data_2I83
# 
_entry.id   2I83 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I83         
RCSB  RCSB039255   
WWPDB D_1000039255 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I83 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Takeda, M.'     1  
'Ogino, S.'      2  
'Umemoto, R.'    3  
'Sakakura, M.'   4  
'Kajiwara, M.'   5  
'Sugahara, K.N.' 6  
'Hayasaka, H.'   7  
'Miyasaka, M.'   8  
'Terasawa, H.'   9  
'Shimada, I.'    10 
# 
_citation.id                        primary 
_citation.title                     'Ligand-induced Structural Changes of the CD44 Hyaluronan-binding Domain Revealed by NMR' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                40089 
_citation.page_last                 40095 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17085435 
_citation.pdbx_database_id_DOI      10.1074/jbc.M608425200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Takeda, M.'     1  
primary 'Ogino, S.'      2  
primary 'Umemoto, R.'    3  
primary 'Sakakura, M.'   4  
primary 'Kajiwara, M.'   5  
primary 'Sugahara, K.N.' 6  
primary 'Hayasaka, H.'   7  
primary 'Miyasaka, M.'   8  
primary 'Terasawa, H.'   9  
primary 'Shimada, I.'    10 
# 
_cell.entry_id           2I83 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2I83 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'CD44 antigen' 
_entity.formula_weight             17732.686 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Hyaluronan binding domain residue 21-178' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Phagocytic glycoprotein I, PGP-1, HUTCH-I, Extracellular matrix receptor-III, ECMR-III, GP90 lymphocyte homing/adhesion receptor, Hermes antigen, Hyaluronate receptor, Heparan sulfate proteoglycan, Epican, CDw44
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICA
ANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICA
ANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLN n 
1 4   ILE n 
1 5   ASP n 
1 6   LEU n 
1 7   ASN n 
1 8   ILE n 
1 9   THR n 
1 10  CYS n 
1 11  ARG n 
1 12  PHE n 
1 13  ALA n 
1 14  GLY n 
1 15  VAL n 
1 16  PHE n 
1 17  HIS n 
1 18  VAL n 
1 19  GLU n 
1 20  LYS n 
1 21  ASN n 
1 22  GLY n 
1 23  ARG n 
1 24  TYR n 
1 25  SER n 
1 26  ILE n 
1 27  SER n 
1 28  ARG n 
1 29  THR n 
1 30  GLU n 
1 31  ALA n 
1 32  ALA n 
1 33  ASP n 
1 34  LEU n 
1 35  CYS n 
1 36  LYS n 
1 37  ALA n 
1 38  PHE n 
1 39  ASN n 
1 40  SER n 
1 41  THR n 
1 42  LEU n 
1 43  PRO n 
1 44  THR n 
1 45  MET n 
1 46  ALA n 
1 47  GLN n 
1 48  MET n 
1 49  GLU n 
1 50  LYS n 
1 51  ALA n 
1 52  LEU n 
1 53  SER n 
1 54  ILE n 
1 55  GLY n 
1 56  PHE n 
1 57  GLU n 
1 58  THR n 
1 59  CYS n 
1 60  ARG n 
1 61  TYR n 
1 62  GLY n 
1 63  PHE n 
1 64  ILE n 
1 65  GLU n 
1 66  GLY n 
1 67  HIS n 
1 68  VAL n 
1 69  VAL n 
1 70  ILE n 
1 71  PRO n 
1 72  ARG n 
1 73  ILE n 
1 74  HIS n 
1 75  PRO n 
1 76  ASN n 
1 77  SER n 
1 78  ILE n 
1 79  CYS n 
1 80  ALA n 
1 81  ALA n 
1 82  ASN n 
1 83  ASN n 
1 84  THR n 
1 85  GLY n 
1 86  VAL n 
1 87  TYR n 
1 88  ILE n 
1 89  LEU n 
1 90  THR n 
1 91  SER n 
1 92  ASN n 
1 93  THR n 
1 94  SER n 
1 95  GLN n 
1 96  TYR n 
1 97  ASP n 
1 98  THR n 
1 99  TYR n 
1 100 CYS n 
1 101 PHE n 
1 102 ASN n 
1 103 ALA n 
1 104 SER n 
1 105 ALA n 
1 106 PRO n 
1 107 PRO n 
1 108 GLU n 
1 109 GLU n 
1 110 ASP n 
1 111 CYS n 
1 112 THR n 
1 113 SER n 
1 114 VAL n 
1 115 THR n 
1 116 ASP n 
1 117 LEU n 
1 118 PRO n 
1 119 ASN n 
1 120 ALA n 
1 121 PHE n 
1 122 ASP n 
1 123 GLY n 
1 124 PRO n 
1 125 ILE n 
1 126 THR n 
1 127 ILE n 
1 128 THR n 
1 129 ILE n 
1 130 VAL n 
1 131 ASN n 
1 132 ARG n 
1 133 ASP n 
1 134 GLY n 
1 135 THR n 
1 136 ARG n 
1 137 TYR n 
1 138 VAL n 
1 139 GLN n 
1 140 LYS n 
1 141 GLY n 
1 142 GLU n 
1 143 TYR n 
1 144 ARG n 
1 145 THR n 
1 146 ASN n 
1 147 PRO n 
1 148 GLU n 
1 149 ASP n 
1 150 ILE n 
1 151 TYR n 
1 152 PRO n 
1 153 SER n 
1 154 ASN n 
1 155 PRO n 
1 156 THR n 
1 157 ASP n 
1 158 ASP n 
1 159 ASP n 
1 160 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD44_HUMAN 
_struct_ref.pdbx_db_accession          P16070 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAAN
NTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2I83 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 160 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16070 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  178 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       21 
_struct_ref_seq.pdbx_auth_seq_align_end       178 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2I83 MET A 1 ? UNP P16070 ? ? 'INITIATING METHIONINE' 19 1 
1 2I83 ALA A 2 ? UNP P16070 ? ? 'CLONING ARTIFACT'      20 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY                  1 
2 1 3D_13C-separated_NOESY 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '150mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2.0mM CD44HABD U-15N,13C; 6.0mM hyaluronan; 50mM phosphate buffer; 150mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '2.0mM CD44HABD U-15N,13C; 6.0mM hyaluronan; 50mM phosphate buffer; 150mM NaCl; 100% D2O'         '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 Avance Bruker 600 ? 
2 Avance Bruker 800 ? 
# 
_pdbx_nmr_refine.entry_id           2I83 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2I83 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2I83 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CYANA 2.1 'P.GUNTERT ET AL.' 1 
'structure solution' CYANA 2.0 ?                  2 
# 
_exptl.entry_id          2I83 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2I83 
_struct.title                     'hyaluronan-binding domain of CD44 in its ligand-bound form' 
_struct.pdbx_descriptor           'CD44 antigen' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I83 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'Link module, CELL ADHESION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 27 ? ALA A 37 ? SER A 45 ALA A 55  1 ? 11 
HELX_P HELX_P2 2 THR A 44 ? LEU A 52 ? THR A 62 LEU A 70  1 ? 9  
HELX_P HELX_P3 3 CYS A 79 ? ASN A 83 ? CYS A 97 ASN A 101 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 28 A CYS 129 1_555 ? ? ? ? ? ? ? 1.980 ? 
disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 53 A CYS 118 1_555 ? ? ? ? ? ? ? 2.002 ? 
disulf3 disulf ? ? A CYS 59 SG ? ? ? 1_555 A CYS 79  SG ? ? A CYS 77 A CYS 97  1_555 ? ? ? ? ? ? ? 1.978 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 98  ? PHE A 101 ? THR A 116 PHE A 119 
A 2 VAL A 15  ? LYS A 20  ? VAL A 33  LYS A 38  
A 3 ILE A 4   ? ILE A 8   ? ILE A 22  ILE A 26  
A 4 ILE A 125 ? ILE A 129 ? ILE A 143 ILE A 147 
B 1 VAL A 69  ? ARG A 72  ? VAL A 87  ARG A 90  
B 2 GLY A 85  ? ILE A 88  ? GLY A 103 ILE A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 100 ? O CYS A 118 N PHE A 16  ? N PHE A 34  
A 2 3 O GLU A 19  ? O GLU A 37  N ASN A 7   ? N ASN A 25  
A 3 4 N ILE A 8   ? N ILE A 26  O THR A 128 ? O THR A 146 
B 1 2 N ILE A 70  ? N ILE A 88  O TYR A 87  ? O TYR A 105 
# 
_database_PDB_matrix.entry_id          2I83 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I83 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLN A 1 3   ? 7.235   -12.512 4.999   1.00 0.00 ? 21  GLN A N    1  
ATOM 2     C CA   . GLN A 1 3   ? 7.327   -13.068 3.655   1.00 0.00 ? 21  GLN A CA   1  
ATOM 3     C C    . GLN A 1 3   ? 6.445   -12.291 2.683   1.00 0.00 ? 21  GLN A C    1  
ATOM 4     O O    . GLN A 1 3   ? 5.987   -12.833 1.677   1.00 0.00 ? 21  GLN A O    1  
ATOM 5     C CB   . GLN A 1 3   ? 6.925   -14.543 3.660   1.00 0.00 ? 21  GLN A CB   1  
ATOM 6     C CG   . GLN A 1 3   ? 5.613   -14.813 4.378   1.00 0.00 ? 21  GLN A CG   1  
ATOM 7     C CD   . GLN A 1 3   ? 5.338   -16.293 4.554   1.00 0.00 ? 21  GLN A CD   1  
ATOM 8     O OE1  . GLN A 1 3   ? 6.017   -17.137 3.969   1.00 0.00 ? 21  GLN A OE1  1  
ATOM 9     N NE2  . GLN A 1 3   ? 4.336   -16.618 5.363   1.00 0.00 ? 21  GLN A NE2  1  
ATOM 10    H H    . GLN A 1 3   ? 7.981   -12.636 5.621   1.00 0.00 ? 21  GLN A H    1  
ATOM 11    H HA   . GLN A 1 3   ? 8.355   -12.985 3.332   1.00 0.00 ? 21  GLN A HA   1  
ATOM 12    H HB3  . GLN A 1 3   ? 7.701   -15.114 4.149   1.00 0.00 ? 21  GLN A HB3  1  
ATOM 13    H HG3  . GLN A 1 3   ? 4.807   -14.377 3.805   1.00 0.00 ? 21  GLN A HG3  1  
ATOM 14    H HE21 . GLN A 1 3   ? 3.837   -15.892 5.794   1.00 0.00 ? 21  GLN A HE21 1  
ATOM 15    H HE22 . GLN A 1 3   ? 4.136   -17.566 5.495   1.00 0.00 ? 21  GLN A HE22 1  
ATOM 16    N N    . ILE A 1 4   ? 6.210   -11.020 2.991   1.00 0.00 ? 22  ILE A N    1  
ATOM 17    C CA   . ILE A 1 4   ? 5.383   -10.169 2.144   1.00 0.00 ? 22  ILE A CA   1  
ATOM 18    C C    . ILE A 1 4   ? 6.117   -8.886  1.771   1.00 0.00 ? 22  ILE A C    1  
ATOM 19    O O    . ILE A 1 4   ? 6.866   -8.330  2.574   1.00 0.00 ? 22  ILE A O    1  
ATOM 20    C CB   . ILE A 1 4   ? 4.056   -9.806  2.836   1.00 0.00 ? 22  ILE A CB   1  
ATOM 21    C CG1  . ILE A 1 4   ? 3.279   -11.074 3.194   1.00 0.00 ? 22  ILE A CG1  1  
ATOM 22    C CG2  . ILE A 1 4   ? 3.222   -8.901  1.941   1.00 0.00 ? 22  ILE A CG2  1  
ATOM 23    C CD1  . ILE A 1 4   ? 2.867   -11.892 1.990   1.00 0.00 ? 22  ILE A CD1  1  
ATOM 24    H H    . ILE A 1 4   ? 6.603   -10.645 3.806   1.00 0.00 ? 22  ILE A H    1  
ATOM 25    H HA   . ILE A 1 4   ? 5.156   -10.718 1.241   1.00 0.00 ? 22  ILE A HA   1  
ATOM 26    H HB   . ILE A 1 4   ? 4.285   -9.264  3.742   1.00 0.00 ? 22  ILE A HB   1  
ATOM 27    H HG13 . ILE A 1 4   ? 2.382   -10.798 3.731   1.00 0.00 ? 22  ILE A HG13 1  
ATOM 28    H HG21 . ILE A 1 4   ? 3.043   -9.395  0.998   1.00 0.00 ? 22  ILE A HG21 1  
ATOM 29    H HG22 . ILE A 1 4   ? 2.279   -8.692  2.421   1.00 0.00 ? 22  ILE A HG22 1  
ATOM 30    H HG23 . ILE A 1 4   ? 3.752   -7.977  1.769   1.00 0.00 ? 22  ILE A HG23 1  
ATOM 31    H HD11 . ILE A 1 4   ? 2.224   -12.700 2.305   1.00 0.00 ? 22  ILE A HD11 1  
ATOM 32    H HD12 . ILE A 1 4   ? 2.338   -11.261 1.290   1.00 0.00 ? 22  ILE A HD12 1  
ATOM 33    H HD13 . ILE A 1 4   ? 3.748   -12.298 1.512   1.00 0.00 ? 22  ILE A HD13 1  
ATOM 34    N N    . ASP A 1 5   ? 5.896   -8.420  0.546   1.00 0.00 ? 23  ASP A N    1  
ATOM 35    C CA   . ASP A 1 5   ? 6.534   -7.200  0.065   1.00 0.00 ? 23  ASP A CA   1  
ATOM 36    C C    . ASP A 1 5   ? 5.493   -6.205  -0.439  1.00 0.00 ? 23  ASP A C    1  
ATOM 37    O O    . ASP A 1 5   ? 4.410   -6.593  -0.879  1.00 0.00 ? 23  ASP A O    1  
ATOM 38    C CB   . ASP A 1 5   ? 7.529   -7.524  -1.049  1.00 0.00 ? 23  ASP A CB   1  
ATOM 39    C CG   . ASP A 1 5   ? 8.697   -6.558  -1.081  1.00 0.00 ? 23  ASP A CG   1  
ATOM 40    O OD1  . ASP A 1 5   ? 8.462   -5.348  -1.287  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 41    O OD2  . ASP A 1 5   ? 9.846   -7.011  -0.900  1.00 0.00 ? 23  ASP A OD2  1  
ATOM 42    H H    . ASP A 1 5   ? 5.288   -8.908  -0.049  1.00 0.00 ? 23  ASP A H    1  
ATOM 43    H HA   . ASP A 1 5   ? 7.066   -6.756  0.893   1.00 0.00 ? 23  ASP A HA   1  
ATOM 44    H HB3  . ASP A 1 5   ? 7.021   -7.479  -2.001  1.00 0.00 ? 23  ASP A HB3  1  
ATOM 45    N N    . LEU A 1 6   ? 5.826   -4.921  -0.370  1.00 0.00 ? 24  LEU A N    1  
ATOM 46    C CA   . LEU A 1 6   ? 4.921   -3.870  -0.819  1.00 0.00 ? 24  LEU A CA   1  
ATOM 47    C C    . LEU A 1 6   ? 5.604   -2.959  -1.835  1.00 0.00 ? 24  LEU A C    1  
ATOM 48    O O    . LEU A 1 6   ? 6.830   -2.895  -1.899  1.00 0.00 ? 24  LEU A O    1  
ATOM 49    C CB   . LEU A 1 6   ? 4.433   -3.046  0.374   1.00 0.00 ? 24  LEU A CB   1  
ATOM 50    C CG   . LEU A 1 6   ? 3.085   -3.456  0.968   1.00 0.00 ? 24  LEU A CG   1  
ATOM 51    C CD1  . LEU A 1 6   ? 3.134   -4.894  1.461   1.00 0.00 ? 24  LEU A CD1  1  
ATOM 52    C CD2  . LEU A 1 6   ? 2.690   -2.516  2.097   1.00 0.00 ? 24  LEU A CD2  1  
ATOM 53    H H    . LEU A 1 6   ? 6.703   -4.673  -0.010  1.00 0.00 ? 24  LEU A H    1  
ATOM 54    H HA   . LEU A 1 6   ? 4.072   -4.343  -1.290  1.00 0.00 ? 24  LEU A HA   1  
ATOM 55    H HB3  . LEU A 1 6   ? 4.356   -2.016  0.055   1.00 0.00 ? 24  LEU A HB3  1  
ATOM 56    H HG   . LEU A 1 6   ? 2.327   -3.393  0.199   1.00 0.00 ? 24  LEU A HG   1  
ATOM 57    H HD11 . LEU A 1 6   ? 4.117   -5.105  1.856   1.00 0.00 ? 24  LEU A HD11 1  
ATOM 58    H HD12 . LEU A 1 6   ? 2.925   -5.564  0.641   1.00 0.00 ? 24  LEU A HD12 1  
ATOM 59    H HD13 . LEU A 1 6   ? 2.395   -5.033  2.237   1.00 0.00 ? 24  LEU A HD13 1  
ATOM 60    H HD21 . LEU A 1 6   ? 1.620   -2.377  2.092   1.00 0.00 ? 24  LEU A HD21 1  
ATOM 61    H HD22 . LEU A 1 6   ? 3.178   -1.562  1.958   1.00 0.00 ? 24  LEU A HD22 1  
ATOM 62    H HD23 . LEU A 1 6   ? 2.995   -2.941  3.042   1.00 0.00 ? 24  LEU A HD23 1  
ATOM 63    N N    . ASN A 1 7   ? 4.800   -2.256  -2.626  1.00 0.00 ? 25  ASN A N    1  
ATOM 64    C CA   . ASN A 1 7   ? 5.326   -1.348  -3.638  1.00 0.00 ? 25  ASN A CA   1  
ATOM 65    C C    . ASN A 1 7   ? 4.508   -0.061  -3.692  1.00 0.00 ? 25  ASN A C    1  
ATOM 66    O O    . ASN A 1 7   ? 3.280   -0.098  -3.772  1.00 0.00 ? 25  ASN A O    1  
ATOM 67    C CB   . ASN A 1 7   ? 5.325   -2.024  -5.010  1.00 0.00 ? 25  ASN A CB   1  
ATOM 68    C CG   . ASN A 1 7   ? 5.624   -3.509  -4.923  1.00 0.00 ? 25  ASN A CG   1  
ATOM 69    O OD1  . ASN A 1 7   ? 6.581   -3.924  -4.269  1.00 0.00 ? 25  ASN A OD1  1  
ATOM 70    N ND2  . ASN A 1 7   ? 4.803   -4.317  -5.584  1.00 0.00 ? 25  ASN A ND2  1  
ATOM 71    H H    . ASN A 1 7   ? 3.829   -2.351  -2.528  1.00 0.00 ? 25  ASN A H    1  
ATOM 72    H HA   . ASN A 1 7   ? 6.342   -1.104  -3.367  1.00 0.00 ? 25  ASN A HA   1  
ATOM 73    H HB3  . ASN A 1 7   ? 6.074   -1.561  -5.635  1.00 0.00 ? 25  ASN A HB3  1  
ATOM 74    H HD21 . ASN A 1 7   ? 4.061   -3.916  -6.085  1.00 0.00 ? 25  ASN A HD21 1  
ATOM 75    H HD22 . ASN A 1 7   ? 4.973   -5.282  -5.545  1.00 0.00 ? 25  ASN A HD22 1  
ATOM 76    N N    . ILE A 1 8   ? 5.197   1.074   -3.651  1.00 0.00 ? 26  ILE A N    1  
ATOM 77    C CA   . ILE A 1 8   ? 4.535   2.371   -3.697  1.00 0.00 ? 26  ILE A CA   1  
ATOM 78    C C    . ILE A 1 8   ? 4.683   3.015   -5.072  1.00 0.00 ? 26  ILE A C    1  
ATOM 79    O O    . ILE A 1 8   ? 5.788   3.347   -5.499  1.00 0.00 ? 26  ILE A O    1  
ATOM 80    C CB   . ILE A 1 8   ? 5.099   3.329   -2.630  1.00 0.00 ? 26  ILE A CB   1  
ATOM 81    C CG1  . ILE A 1 8   ? 5.518   2.549   -1.383  1.00 0.00 ? 26  ILE A CG1  1  
ATOM 82    C CG2  . ILE A 1 8   ? 4.070   4.393   -2.277  1.00 0.00 ? 26  ILE A CG2  1  
ATOM 83    C CD1  . ILE A 1 8   ? 4.396   1.737   -0.774  1.00 0.00 ? 26  ILE A CD1  1  
ATOM 84    H H    . ILE A 1 8   ? 6.175   1.038   -3.587  1.00 0.00 ? 26  ILE A H    1  
ATOM 85    H HA   . ILE A 1 8   ? 3.485   2.217   -3.494  1.00 0.00 ? 26  ILE A HA   1  
ATOM 86    H HB   . ILE A 1 8   ? 5.964   3.824   -3.045  1.00 0.00 ? 26  ILE A HB   1  
ATOM 87    H HG13 . ILE A 1 8   ? 5.869   3.245   -0.635  1.00 0.00 ? 26  ILE A HG13 1  
ATOM 88    H HG21 . ILE A 1 8   ? 4.273   4.775   -1.287  1.00 0.00 ? 26  ILE A HG21 1  
ATOM 89    H HG22 . ILE A 1 8   ? 4.126   5.200   -2.992  1.00 0.00 ? 26  ILE A HG22 1  
ATOM 90    H HG23 . ILE A 1 8   ? 3.082   3.959   -2.300  1.00 0.00 ? 26  ILE A HG23 1  
ATOM 91    H HD11 . ILE A 1 8   ? 3.598   2.398   -0.470  1.00 0.00 ? 26  ILE A HD11 1  
ATOM 92    H HD12 . ILE A 1 8   ? 4.026   1.032   -1.501  1.00 0.00 ? 26  ILE A HD12 1  
ATOM 93    H HD13 . ILE A 1 8   ? 4.767   1.202   0.089   1.00 0.00 ? 26  ILE A HD13 1  
ATOM 94    N N    . THR A 1 9   ? 3.558   3.190   -5.760  1.00 0.00 ? 27  THR A N    1  
ATOM 95    C CA   . THR A 1 9   ? 3.561   3.795   -7.086  1.00 0.00 ? 27  THR A CA   1  
ATOM 96    C C    . THR A 1 9   ? 3.552   5.316   -6.997  1.00 0.00 ? 27  THR A C    1  
ATOM 97    O O    . THR A 1 9   ? 3.679   5.886   -5.913  1.00 0.00 ? 27  THR A O    1  
ATOM 98    C CB   . THR A 1 9   ? 2.350   3.333   -7.917  1.00 0.00 ? 27  THR A CB   1  
ATOM 99    O OG1  . THR A 1 9   ? 2.550   3.655   -9.298  1.00 0.00 ? 27  THR A OG1  1  
ATOM 100   C CG2  . THR A 1 9   ? 1.071   3.989   -7.419  1.00 0.00 ? 27  THR A CG2  1  
ATOM 101   H H    . THR A 1 9   ? 2.708   2.905   -5.365  1.00 0.00 ? 27  THR A H    1  
ATOM 102   H HA   . THR A 1 9   ? 4.461   3.479   -7.595  1.00 0.00 ? 27  THR A HA   1  
ATOM 103   H HB   . THR A 1 9   ? 2.250   2.261   -7.815  1.00 0.00 ? 27  THR A HB   1  
ATOM 104   H HG1  . THR A 1 9   ? 2.437   2.864   -9.831  1.00 0.00 ? 27  THR A HG1  1  
ATOM 105   H HG21 . THR A 1 9   ? 0.934   3.763   -6.372  1.00 0.00 ? 27  THR A HG21 1  
ATOM 106   H HG22 . THR A 1 9   ? 0.230   3.611   -7.981  1.00 0.00 ? 27  THR A HG22 1  
ATOM 107   H HG23 . THR A 1 9   ? 1.140   5.058   -7.550  1.00 0.00 ? 27  THR A HG23 1  
ATOM 108   N N    . CYS A 1 10  ? 3.399   5.971   -8.144  1.00 0.00 ? 28  CYS A N    1  
ATOM 109   C CA   . CYS A 1 10  ? 3.371   7.428   -8.196  1.00 0.00 ? 28  CYS A CA   1  
ATOM 110   C C    . CYS A 1 10  ? 2.350   7.988   -7.210  1.00 0.00 ? 28  CYS A C    1  
ATOM 111   O O    . CYS A 1 10  ? 1.399   7.304   -6.831  1.00 0.00 ? 28  CYS A O    1  
ATOM 112   C CB   . CYS A 1 10  ? 3.044   7.902   -9.613  1.00 0.00 ? 28  CYS A CB   1  
ATOM 113   S SG   . CYS A 1 10  ? 4.475   7.912   -10.742 1.00 0.00 ? 28  CYS A SG   1  
ATOM 114   H H    . CYS A 1 10  ? 3.303   5.461   -8.976  1.00 0.00 ? 28  CYS A H    1  
ATOM 115   H HA   . CYS A 1 10  ? 4.352   7.788   -7.922  1.00 0.00 ? 28  CYS A HA   1  
ATOM 116   H HB3  . CYS A 1 10  ? 2.655   8.908   -9.566  1.00 0.00 ? 28  CYS A HB3  1  
ATOM 117   N N    . ARG A 1 11  ? 2.552   9.237   -6.803  1.00 0.00 ? 29  ARG A N    1  
ATOM 118   C CA   . ARG A 1 11  ? 1.649   9.889   -5.862  1.00 0.00 ? 29  ARG A CA   1  
ATOM 119   C C    . ARG A 1 11  ? 0.910   11.044  -6.530  1.00 0.00 ? 29  ARG A C    1  
ATOM 120   O O    . ARG A 1 11  ? 1.457   12.136  -6.689  1.00 0.00 ? 29  ARG A O    1  
ATOM 121   C CB   . ARG A 1 11  ? 2.427   10.400  -4.648  1.00 0.00 ? 29  ARG A CB   1  
ATOM 122   C CG   . ARG A 1 11  ? 3.247   9.327   -3.953  1.00 0.00 ? 29  ARG A CG   1  
ATOM 123   C CD   . ARG A 1 11  ? 4.596   9.863   -3.499  1.00 0.00 ? 29  ARG A CD   1  
ATOM 124   N NE   . ARG A 1 11  ? 5.297   8.918   -2.633  1.00 0.00 ? 29  ARG A NE   1  
ATOM 125   C CZ   . ARG A 1 11  ? 5.995   7.884   -3.087  1.00 0.00 ? 29  ARG A CZ   1  
ATOM 126   N NH1  . ARG A 1 11  ? 6.085   7.661   -4.390  1.00 0.00 ? 29  ARG A NH1  1  
ATOM 127   N NH2  . ARG A 1 11  ? 6.605   7.068   -2.235  1.00 0.00 ? 29  ARG A NH2  1  
ATOM 128   H H    . ARG A 1 11  ? 3.328   9.731   -7.141  1.00 0.00 ? 29  ARG A H    1  
ATOM 129   H HA   . ARG A 1 11  ? 0.927   9.156   -5.533  1.00 0.00 ? 29  ARG A HA   1  
ATOM 130   H HB3  . ARG A 1 11  ? 1.727   10.807  -3.934  1.00 0.00 ? 29  ARG A HB3  1  
ATOM 131   H HG3  . ARG A 1 11  ? 3.408   8.509   -4.640  1.00 0.00 ? 29  ARG A HG3  1  
ATOM 132   H HD3  . ARG A 1 11  ? 4.438   10.784  -2.959  1.00 0.00 ? 29  ARG A HD3  1  
ATOM 133   H HE   . ARG A 1 11  ? 5.244   9.064   -1.665  1.00 0.00 ? 29  ARG A HE   1  
ATOM 134   H HH11 . ARG A 1 11  ? 5.627   8.274   -5.034  1.00 0.00 ? 29  ARG A HH11 1  
ATOM 135   H HH12 . ARG A 1 11  ? 6.613   6.881   -4.730  1.00 0.00 ? 29  ARG A HH12 1  
ATOM 136   H HH21 . ARG A 1 11  ? 6.539   7.234   -1.251  1.00 0.00 ? 29  ARG A HH21 1  
ATOM 137   H HH22 . ARG A 1 11  ? 7.130   6.290   -2.577  1.00 0.00 ? 29  ARG A HH22 1  
ATOM 138   N N    . PHE A 1 12  ? -0.335  10.796  -6.920  1.00 0.00 ? 30  PHE A N    1  
ATOM 139   C CA   . PHE A 1 12  ? -1.150  11.815  -7.572  1.00 0.00 ? 30  PHE A CA   1  
ATOM 140   C C    . PHE A 1 12  ? -1.767  12.758  -6.545  1.00 0.00 ? 30  PHE A C    1  
ATOM 141   O O    . PHE A 1 12  ? -2.694  12.388  -5.824  1.00 0.00 ? 30  PHE A O    1  
ATOM 142   C CB   . PHE A 1 12  ? -2.252  11.160  -8.408  1.00 0.00 ? 30  PHE A CB   1  
ATOM 143   C CG   . PHE A 1 12  ? -1.736  10.431  -9.616  1.00 0.00 ? 30  PHE A CG   1  
ATOM 144   C CD1  . PHE A 1 12  ? -1.533  11.104  -10.810 1.00 0.00 ? 30  PHE A CD1  1  
ATOM 145   C CD2  . PHE A 1 12  ? -1.455  9.076   -9.557  1.00 0.00 ? 30  PHE A CD2  1  
ATOM 146   C CE1  . PHE A 1 12  ? -1.059  10.435  -11.924 1.00 0.00 ? 30  PHE A CE1  1  
ATOM 147   C CE2  . PHE A 1 12  ? -0.981  8.403   -10.667 1.00 0.00 ? 30  PHE A CE2  1  
ATOM 148   C CZ   . PHE A 1 12  ? -0.782  9.084   -11.852 1.00 0.00 ? 30  PHE A CZ   1  
ATOM 149   H H    . PHE A 1 12  ? -0.717  9.906   -6.765  1.00 0.00 ? 30  PHE A H    1  
ATOM 150   H HA   . PHE A 1 12  ? -0.506  12.384  -8.225  1.00 0.00 ? 30  PHE A HA   1  
ATOM 151   H HB3  . PHE A 1 12  ? -2.938  11.921  -8.745  1.00 0.00 ? 30  PHE A HB3  1  
ATOM 152   H HD1  . PHE A 1 12  ? -1.748  12.160  -10.869 1.00 0.00 ? 30  PHE A HD1  1  
ATOM 153   H HD2  . PHE A 1 12  ? -1.611  8.543   -8.630  1.00 0.00 ? 30  PHE A HD2  1  
ATOM 154   H HE1  . PHE A 1 12  ? -0.904  10.970  -12.849 1.00 0.00 ? 30  PHE A HE1  1  
ATOM 155   H HE2  . PHE A 1 12  ? -0.765  7.347   -10.607 1.00 0.00 ? 30  PHE A HE2  1  
ATOM 156   H HZ   . PHE A 1 12  ? -0.413  8.560   -12.720 1.00 0.00 ? 30  PHE A HZ   1  
ATOM 157   N N    . ALA A 1 13  ? -1.246  13.979  -6.483  1.00 0.00 ? 31  ALA A N    1  
ATOM 158   C CA   . ALA A 1 13  ? -1.747  14.977  -5.545  1.00 0.00 ? 31  ALA A CA   1  
ATOM 159   C C    . ALA A 1 13  ? -1.682  14.462  -4.111  1.00 0.00 ? 31  ALA A C    1  
ATOM 160   O O    . ALA A 1 13  ? -2.425  14.920  -3.244  1.00 0.00 ? 31  ALA A O    1  
ATOM 161   C CB   . ALA A 1 13  ? -3.171  15.370  -5.903  1.00 0.00 ? 31  ALA A CB   1  
ATOM 162   H H    . ALA A 1 13  ? -0.508  14.215  -7.083  1.00 0.00 ? 31  ALA A H    1  
ATOM 163   H HA   . ALA A 1 13  ? -1.124  15.856  -5.629  1.00 0.00 ? 31  ALA A HA   1  
ATOM 164   H HB1  . ALA A 1 13  ? -3.700  14.506  -6.277  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 165   H HB2  . ALA A 1 13  ? -3.672  15.748  -5.024  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 166   H HB3  . ALA A 1 13  ? -3.152  16.137  -6.664  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 167   N N    . GLY A 1 14  ? -0.790  13.506  -3.868  1.00 0.00 ? 32  GLY A N    1  
ATOM 168   C CA   . GLY A 1 14  ? -0.647  12.945  -2.537  1.00 0.00 ? 32  GLY A CA   1  
ATOM 169   C C    . GLY A 1 14  ? -1.335  11.602  -2.398  1.00 0.00 ? 32  GLY A C    1  
ATOM 170   O O    . GLY A 1 14  ? -1.051  10.844  -1.470  1.00 0.00 ? 32  GLY A O    1  
ATOM 171   H H    . GLY A 1 14  ? -0.225  13.179  -4.599  1.00 0.00 ? 32  GLY A H    1  
ATOM 172   H HA2  . GLY A 1 14  ? 0.404   12.825  -2.321  1.00 0.00 ? 32  GLY A HA2  1  
ATOM 173   H HA3  . GLY A 1 14  ? -1.076  13.632  -1.822  1.00 0.00 ? 32  GLY A HA3  1  
ATOM 174   N N    . VAL A 1 15  ? -2.243  11.305  -3.321  1.00 0.00 ? 33  VAL A N    1  
ATOM 175   C CA   . VAL A 1 15  ? -2.974  10.043  -3.298  1.00 0.00 ? 33  VAL A CA   1  
ATOM 176   C C    . VAL A 1 15  ? -2.208  8.950   -4.035  1.00 0.00 ? 33  VAL A C    1  
ATOM 177   O O    . VAL A 1 15  ? -1.604  9.196   -5.079  1.00 0.00 ? 33  VAL A O    1  
ATOM 178   C CB   . VAL A 1 15  ? -4.371  10.191  -3.931  1.00 0.00 ? 33  VAL A CB   1  
ATOM 179   C CG1  . VAL A 1 15  ? -5.118  8.867   -3.892  1.00 0.00 ? 33  VAL A CG1  1  
ATOM 180   C CG2  . VAL A 1 15  ? -5.162  11.282  -3.225  1.00 0.00 ? 33  VAL A CG2  1  
ATOM 181   H H    . VAL A 1 15  ? -2.426  11.949  -4.037  1.00 0.00 ? 33  VAL A H    1  
ATOM 182   H HA   . VAL A 1 15  ? -3.099  9.749   -2.266  1.00 0.00 ? 33  VAL A HA   1  
ATOM 183   H HB   . VAL A 1 15  ? -4.246  10.478  -4.965  1.00 0.00 ? 33  VAL A HB   1  
ATOM 184   H HG11 . VAL A 1 15  ? -4.629  8.199   -3.198  1.00 0.00 ? 33  VAL A HG11 1  
ATOM 185   H HG12 . VAL A 1 15  ? -6.136  9.037   -3.573  1.00 0.00 ? 33  VAL A HG12 1  
ATOM 186   H HG13 . VAL A 1 15  ? -5.119  8.425   -4.876  1.00 0.00 ? 33  VAL A HG13 1  
ATOM 187   H HG21 . VAL A 1 15  ? -4.678  12.235  -3.380  1.00 0.00 ? 33  VAL A HG21 1  
ATOM 188   H HG22 . VAL A 1 15  ? -6.164  11.319  -3.628  1.00 0.00 ? 33  VAL A HG22 1  
ATOM 189   H HG23 . VAL A 1 15  ? -5.207  11.067  -2.168  1.00 0.00 ? 33  VAL A HG23 1  
ATOM 190   N N    . PHE A 1 16  ? -2.237  7.741   -3.483  1.00 0.00 ? 34  PHE A N    1  
ATOM 191   C CA   . PHE A 1 16  ? -1.544  6.609   -4.086  1.00 0.00 ? 34  PHE A CA   1  
ATOM 192   C C    . PHE A 1 16  ? -2.055  5.290   -3.514  1.00 0.00 ? 34  PHE A C    1  
ATOM 193   O O    . PHE A 1 16  ? -2.649  5.258   -2.436  1.00 0.00 ? 34  PHE A O    1  
ATOM 194   C CB   . PHE A 1 16  ? -0.035  6.726   -3.860  1.00 0.00 ? 34  PHE A CB   1  
ATOM 195   C CG   . PHE A 1 16  ? 0.357   6.686   -2.410  1.00 0.00 ? 34  PHE A CG   1  
ATOM 196   C CD1  . PHE A 1 16  ? 0.149   7.785   -1.592  1.00 0.00 ? 34  PHE A CD1  1  
ATOM 197   C CD2  . PHE A 1 16  ? 0.935   5.550   -1.866  1.00 0.00 ? 34  PHE A CD2  1  
ATOM 198   C CE1  . PHE A 1 16  ? 0.510   7.751   -0.258  1.00 0.00 ? 34  PHE A CE1  1  
ATOM 199   C CE2  . PHE A 1 16  ? 1.297   5.510   -0.533  1.00 0.00 ? 34  PHE A CE2  1  
ATOM 200   C CZ   . PHE A 1 16  ? 1.084   6.612   0.272   1.00 0.00 ? 34  PHE A CZ   1  
ATOM 201   H H    . PHE A 1 16  ? -2.736  7.608   -2.650  1.00 0.00 ? 34  PHE A H    1  
ATOM 202   H HA   . PHE A 1 16  ? -1.742  6.627   -5.148  1.00 0.00 ? 34  PHE A HA   1  
ATOM 203   H HB3  . PHE A 1 16  ? 0.312   7.661   -4.273  1.00 0.00 ? 34  PHE A HB3  1  
ATOM 204   H HD1  . PHE A 1 16  ? -0.301  8.675   -2.005  1.00 0.00 ? 34  PHE A HD1  1  
ATOM 205   H HD2  . PHE A 1 16  ? 1.101   4.688   -2.496  1.00 0.00 ? 34  PHE A HD2  1  
ATOM 206   H HE1  . PHE A 1 16  ? 0.341   8.613   0.370   1.00 0.00 ? 34  PHE A HE1  1  
ATOM 207   H HE2  . PHE A 1 16  ? 1.745   4.618   -0.122  1.00 0.00 ? 34  PHE A HE2  1  
ATOM 208   H HZ   . PHE A 1 16  ? 1.367   6.583   1.313   1.00 0.00 ? 34  PHE A HZ   1  
ATOM 209   N N    . HIS A 1 17  ? -1.820  4.204   -4.244  1.00 0.00 ? 35  HIS A N    1  
ATOM 210   C CA   . HIS A 1 17  ? -2.256  2.882   -3.809  1.00 0.00 ? 35  HIS A CA   1  
ATOM 211   C C    . HIS A 1 17  ? -1.059  2.002   -3.460  1.00 0.00 ? 35  HIS A C    1  
ATOM 212   O O    . HIS A 1 17  ? -0.052  1.997   -4.169  1.00 0.00 ? 35  HIS A O    1  
ATOM 213   C CB   . HIS A 1 17  ? -3.094  2.214   -4.899  1.00 0.00 ? 35  HIS A CB   1  
ATOM 214   C CG   . HIS A 1 17  ? -2.277  1.647   -6.019  1.00 0.00 ? 35  HIS A CG   1  
ATOM 215   N ND1  . HIS A 1 17  ? -2.105  2.292   -7.226  1.00 0.00 ? 35  HIS A ND1  1  
ATOM 216   C CD2  . HIS A 1 17  ? -1.583  0.489   -6.111  1.00 0.00 ? 35  HIS A CD2  1  
ATOM 217   C CE1  . HIS A 1 17  ? -1.341  1.554   -8.011  1.00 0.00 ? 35  HIS A CE1  1  
ATOM 218   N NE2  . HIS A 1 17  ? -1.010  0.456   -7.358  1.00 0.00 ? 35  HIS A NE2  1  
ATOM 219   H H    . HIS A 1 17  ? -1.342  4.295   -5.094  1.00 0.00 ? 35  HIS A H    1  
ATOM 220   H HA   . HIS A 1 17  ? -2.864  3.007   -2.926  1.00 0.00 ? 35  HIS A HA   1  
ATOM 221   H HB3  . HIS A 1 17  ? -3.775  2.941   -5.318  1.00 0.00 ? 35  HIS A HB3  1  
ATOM 222   H HD1  . HIS A 1 17  ? -2.488  3.160   -7.471  1.00 0.00 ? 35  HIS A HD1  1  
ATOM 223   H HD2  . HIS A 1 17  ? -1.494  -0.268  -5.344  1.00 0.00 ? 35  HIS A HD2  1  
ATOM 224   H HE1  . HIS A 1 17  ? -1.038  1.807   -9.016  1.00 0.00 ? 35  HIS A HE1  1  
ATOM 225   N N    . VAL A 1 18  ? -1.175  1.260   -2.363  1.00 0.00 ? 36  VAL A N    1  
ATOM 226   C CA   . VAL A 1 18  ? -0.103  0.377   -1.921  1.00 0.00 ? 36  VAL A CA   1  
ATOM 227   C C    . VAL A 1 18  ? -0.258  -1.018  -2.519  1.00 0.00 ? 36  VAL A C    1  
ATOM 228   O O    . VAL A 1 18  ? -1.178  -1.755  -2.166  1.00 0.00 ? 36  VAL A O    1  
ATOM 229   C CB   . VAL A 1 18  ? -0.067  0.263   -0.385  1.00 0.00 ? 36  VAL A CB   1  
ATOM 230   C CG1  . VAL A 1 18  ? 1.031   -0.692  0.054   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 231   C CG2  . VAL A 1 18  ? 0.123   1.635   0.246   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 232   H H    . VAL A 1 18  ? -2.003  1.308   -1.840  1.00 0.00 ? 36  VAL A H    1  
ATOM 233   H HA   . VAL A 1 18  ? 0.834   0.798   -2.252  1.00 0.00 ? 36  VAL A HA   1  
ATOM 234   H HB   . VAL A 1 18  ? -1.015  -0.134  -0.052  1.00 0.00 ? 36  VAL A HB   1  
ATOM 235   H HG11 . VAL A 1 18  ? 1.151   -0.632  1.126   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 236   H HG12 . VAL A 1 18  ? 0.763   -1.701  -0.223  1.00 0.00 ? 36  VAL A HG12 1  
ATOM 237   H HG13 . VAL A 1 18  ? 1.959   -0.420  -0.427  1.00 0.00 ? 36  VAL A HG13 1  
ATOM 238   H HG21 . VAL A 1 18  ? 0.264   2.372   -0.532  1.00 0.00 ? 36  VAL A HG21 1  
ATOM 239   H HG22 . VAL A 1 18  ? -0.751  1.889   0.828   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 240   H HG23 . VAL A 1 18  ? 0.991   1.619   0.888   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 241   N N    . GLU A 1 19  ? 0.649   -1.370  -3.425  1.00 0.00 ? 37  GLU A N    1  
ATOM 242   C CA   . GLU A 1 19  ? 0.612   -2.677  -4.071  1.00 0.00 ? 37  GLU A CA   1  
ATOM 243   C C    . GLU A 1 19  ? 1.423   -3.699  -3.280  1.00 0.00 ? 37  GLU A C    1  
ATOM 244   O O    . GLU A 1 19  ? 2.288   -3.338  -2.480  1.00 0.00 ? 37  GLU A O    1  
ATOM 245   C CB   . GLU A 1 19  ? 1.151   -2.578  -5.500  1.00 0.00 ? 37  GLU A CB   1  
ATOM 246   C CG   . GLU A 1 19  ? 0.693   -3.712  -6.402  1.00 0.00 ? 37  GLU A CG   1  
ATOM 247   C CD   . GLU A 1 19  ? 0.897   -3.404  -7.874  1.00 0.00 ? 37  GLU A CD   1  
ATOM 248   O OE1  . GLU A 1 19  ? 0.400   -2.355  -8.335  1.00 0.00 ? 37  GLU A OE1  1  
ATOM 249   O OE2  . GLU A 1 19  ? 1.553   -4.213  -8.563  1.00 0.00 ? 37  GLU A OE2  1  
ATOM 250   H H    . GLU A 1 19  ? 1.358   -0.738  -3.663  1.00 0.00 ? 37  GLU A H    1  
ATOM 251   H HA   . GLU A 1 19  ? -0.417  -3.000  -4.106  1.00 0.00 ? 37  GLU A HA   1  
ATOM 252   H HB3  . GLU A 1 19  ? 2.230   -2.586  -5.466  1.00 0.00 ? 37  GLU A HB3  1  
ATOM 253   H HG3  . GLU A 1 19  ? -0.358  -3.890  -6.230  1.00 0.00 ? 37  GLU A HG3  1  
ATOM 254   N N    . LYS A 1 20  ? 1.138   -4.976  -3.509  1.00 0.00 ? 38  LYS A N    1  
ATOM 255   C CA   . LYS A 1 20  ? 1.840   -6.052  -2.819  1.00 0.00 ? 38  LYS A CA   1  
ATOM 256   C C    . LYS A 1 20  ? 2.742   -6.818  -3.781  1.00 0.00 ? 38  LYS A C    1  
ATOM 257   O O    . LYS A 1 20  ? 2.689   -6.611  -4.993  1.00 0.00 ? 38  LYS A O    1  
ATOM 258   C CB   . LYS A 1 20  ? 0.837   -7.010  -2.172  1.00 0.00 ? 38  LYS A CB   1  
ATOM 259   C CG   . LYS A 1 20  ? 1.383   -7.730  -0.951  1.00 0.00 ? 38  LYS A CG   1  
ATOM 260   C CD   . LYS A 1 20  ? 0.266   -8.289  -0.086  1.00 0.00 ? 38  LYS A CD   1  
ATOM 261   C CE   . LYS A 1 20  ? -0.170  -9.667  -0.561  1.00 0.00 ? 38  LYS A CE   1  
ATOM 262   N NZ   . LYS A 1 20  ? -0.667  -10.508 0.563   1.00 0.00 ? 38  LYS A NZ   1  
ATOM 263   H H    . LYS A 1 20  ? 0.439   -5.200  -4.158  1.00 0.00 ? 38  LYS A H    1  
ATOM 264   H HA   . LYS A 1 20  ? 2.450   -5.609  -2.047  1.00 0.00 ? 38  LYS A HA   1  
ATOM 265   H HB3  . LYS A 1 20  ? 0.545   -7.754  -2.901  1.00 0.00 ? 38  LYS A HB3  1  
ATOM 266   H HG3  . LYS A 1 20  ? 1.966   -7.033  -0.365  1.00 0.00 ? 38  LYS A HG3  1  
ATOM 267   H HD3  . LYS A 1 20  ? -0.580  -7.618  -0.130  1.00 0.00 ? 38  LYS A HD3  1  
ATOM 268   H HE3  . LYS A 1 20  ? 0.674   -10.158 -1.021  1.00 0.00 ? 38  LYS A HE3  1  
ATOM 269   H HZ1  . LYS A 1 20  ? 0.130   -10.992 1.026   1.00 0.00 ? 38  LYS A HZ1  1  
ATOM 270   H HZ2  . LYS A 1 20  ? -1.332  -11.224 0.207   1.00 0.00 ? 38  LYS A HZ2  1  
ATOM 271   H HZ3  . LYS A 1 20  ? -1.153  -9.916  1.266   1.00 0.00 ? 38  LYS A HZ3  1  
ATOM 272   N N    . ASN A 1 21  ? 3.569   -7.703  -3.233  1.00 0.00 ? 39  ASN A N    1  
ATOM 273   C CA   . ASN A 1 21  ? 4.483   -8.500  -4.044  1.00 0.00 ? 39  ASN A CA   1  
ATOM 274   C C    . ASN A 1 21  ? 3.739   -9.182  -5.189  1.00 0.00 ? 39  ASN A C    1  
ATOM 275   O O    . ASN A 1 21  ? 4.206   -9.193  -6.327  1.00 0.00 ? 39  ASN A O    1  
ATOM 276   C CB   . ASN A 1 21  ? 5.183   -9.549  -3.178  1.00 0.00 ? 39  ASN A CB   1  
ATOM 277   C CG   . ASN A 1 21  ? 4.228   -10.244 -2.226  1.00 0.00 ? 39  ASN A CG   1  
ATOM 278   O OD1  . ASN A 1 21  ? 4.001   -9.781  -1.109  1.00 0.00 ? 39  ASN A OD1  1  
ATOM 279   N ND2  . ASN A 1 21  ? 3.665   -11.364 -2.667  1.00 0.00 ? 39  ASN A ND2  1  
ATOM 280   H H    . ASN A 1 21  ? 3.565   -7.822  -2.260  1.00 0.00 ? 39  ASN A H    1  
ATOM 281   H HA   . ASN A 1 21  ? 5.224   -7.834  -4.458  1.00 0.00 ? 39  ASN A HA   1  
ATOM 282   H HB3  . ASN A 1 21  ? 5.957   -9.070  -2.597  1.00 0.00 ? 39  ASN A HB3  1  
ATOM 283   H HD21 . ASN A 1 21  ? 3.893   -11.674 -3.569  1.00 0.00 ? 39  ASN A HD21 1  
ATOM 284   H HD22 . ASN A 1 21  ? 3.042   -11.833 -2.073  1.00 0.00 ? 39  ASN A HD22 1  
ATOM 285   N N    . GLY A 1 22  ? 2.578   -9.751  -4.878  1.00 0.00 ? 40  GLY A N    1  
ATOM 286   C CA   . GLY A 1 22  ? 1.789   -10.428 -5.890  1.00 0.00 ? 40  GLY A CA   1  
ATOM 287   C C    . GLY A 1 22  ? 0.570   -9.628  -6.305  1.00 0.00 ? 40  GLY A C    1  
ATOM 288   O O    . GLY A 1 22  ? 0.670   -8.707  -7.115  1.00 0.00 ? 40  GLY A O    1  
ATOM 289   H H    . GLY A 1 22  ? 2.255   -9.711  -3.953  1.00 0.00 ? 40  GLY A H    1  
ATOM 290   H HA2  . GLY A 1 22  ? 2.407   -10.599 -6.758  1.00 0.00 ? 40  GLY A HA2  1  
ATOM 291   H HA3  . GLY A 1 22  ? 1.463   -11.381 -5.499  1.00 0.00 ? 40  GLY A HA3  1  
ATOM 292   N N    . ARG A 1 23  ? -0.585  -9.980  -5.750  1.00 0.00 ? 41  ARG A N    1  
ATOM 293   C CA   . ARG A 1 23  ? -1.829  -9.291  -6.069  1.00 0.00 ? 41  ARG A CA   1  
ATOM 294   C C    . ARG A 1 23  ? -2.338  -8.502  -4.867  1.00 0.00 ? 41  ARG A C    1  
ATOM 295   O O    . ARG A 1 23  ? -1.747  -8.546  -3.787  1.00 0.00 ? 41  ARG A O    1  
ATOM 296   C CB   . ARG A 1 23  ? -2.892  -10.294 -6.522  1.00 0.00 ? 41  ARG A CB   1  
ATOM 297   C CG   . ARG A 1 23  ? -2.618  -10.895 -7.891  1.00 0.00 ? 41  ARG A CG   1  
ATOM 298   C CD   . ARG A 1 23  ? -1.826  -12.188 -7.784  1.00 0.00 ? 41  ARG A CD   1  
ATOM 299   N NE   . ARG A 1 23  ? -2.648  -13.296 -7.307  1.00 0.00 ? 41  ARG A NE   1  
ATOM 300   C CZ   . ARG A 1 23  ? -2.200  -14.540 -7.174  1.00 0.00 ? 41  ARG A CZ   1  
ATOM 301   N NH1  . ARG A 1 23  ? -0.943  -14.831 -7.480  1.00 0.00 ? 41  ARG A NH1  1  
ATOM 302   N NH2  . ARG A 1 23  ? -3.009  -15.494 -6.734  1.00 0.00 ? 41  ARG A NH2  1  
ATOM 303   H H    . ARG A 1 23  ? -0.601  -10.723 -5.111  1.00 0.00 ? 41  ARG A H    1  
ATOM 304   H HA   . ARG A 1 23  ? -1.629  -8.604  -6.878  1.00 0.00 ? 41  ARG A HA   1  
ATOM 305   H HB3  . ARG A 1 23  ? -3.848  -9.795  -6.555  1.00 0.00 ? 41  ARG A HB3  1  
ATOM 306   H HG3  . ARG A 1 23  ? -2.056  -10.185 -8.479  1.00 0.00 ? 41  ARG A HG3  1  
ATOM 307   H HD3  . ARG A 1 23  ? -1.007  -12.036 -7.097  1.00 0.00 ? 41  ARG A HD3  1  
ATOM 308   H HE   . ARG A 1 23  ? -3.580  -13.103 -7.075  1.00 0.00 ? 41  ARG A HE   1  
ATOM 309   H HH11 . ARG A 1 23  ? -0.330  -14.113 -7.812  1.00 0.00 ? 41  ARG A HH11 1  
ATOM 310   H HH12 . ARG A 1 23  ? -0.608  -15.768 -7.378  1.00 0.00 ? 41  ARG A HH12 1  
ATOM 311   H HH21 . ARG A 1 23  ? -3.957  -15.278 -6.501  1.00 0.00 ? 41  ARG A HH21 1  
ATOM 312   H HH22 . ARG A 1 23  ? -2.671  -16.430 -6.633  1.00 0.00 ? 41  ARG A HH22 1  
ATOM 313   N N    . TYR A 1 24  ? -3.435  -7.781  -5.060  1.00 0.00 ? 42  TYR A N    1  
ATOM 314   C CA   . TYR A 1 24  ? -4.023  -6.979  -3.993  1.00 0.00 ? 42  TYR A CA   1  
ATOM 315   C C    . TYR A 1 24  ? -4.538  -7.869  -2.866  1.00 0.00 ? 42  TYR A C    1  
ATOM 316   O O    . TYR A 1 24  ? -5.239  -8.851  -3.106  1.00 0.00 ? 42  TYR A O    1  
ATOM 317   C CB   . TYR A 1 24  ? -5.162  -6.118  -4.540  1.00 0.00 ? 42  TYR A CB   1  
ATOM 318   C CG   . TYR A 1 24  ? -4.832  -5.439  -5.851  1.00 0.00 ? 42  TYR A CG   1  
ATOM 319   C CD1  . TYR A 1 24  ? -3.572  -4.900  -6.079  1.00 0.00 ? 42  TYR A CD1  1  
ATOM 320   C CD2  . TYR A 1 24  ? -5.781  -5.337  -6.861  1.00 0.00 ? 42  TYR A CD2  1  
ATOM 321   C CE1  . TYR A 1 24  ? -3.266  -4.279  -7.274  1.00 0.00 ? 42  TYR A CE1  1  
ATOM 322   C CE2  . TYR A 1 24  ? -5.483  -4.719  -8.060  1.00 0.00 ? 42  TYR A CE2  1  
ATOM 323   C CZ   . TYR A 1 24  ? -4.225  -4.192  -8.262  1.00 0.00 ? 42  TYR A CZ   1  
ATOM 324   O OH   . TYR A 1 24  ? -3.925  -3.574  -9.455  1.00 0.00 ? 42  TYR A OH   1  
ATOM 325   H H    . TYR A 1 24  ? -3.862  -7.785  -5.943  1.00 0.00 ? 42  TYR A H    1  
ATOM 326   H HA   . TYR A 1 24  ? -3.251  -6.333  -3.601  1.00 0.00 ? 42  TYR A HA   1  
ATOM 327   H HB3  . TYR A 1 24  ? -5.401  -5.350  -3.819  1.00 0.00 ? 42  TYR A HB3  1  
ATOM 328   H HD1  . TYR A 1 24  ? -2.823  -4.971  -5.303  1.00 0.00 ? 42  TYR A HD1  1  
ATOM 329   H HD2  . TYR A 1 24  ? -6.765  -5.751  -6.699  1.00 0.00 ? 42  TYR A HD2  1  
ATOM 330   H HE1  . TYR A 1 24  ? -2.281  -3.867  -7.433  1.00 0.00 ? 42  TYR A HE1  1  
ATOM 331   H HE2  . TYR A 1 24  ? -6.234  -4.650  -8.833  1.00 0.00 ? 42  TYR A HE2  1  
ATOM 332   H HH   . TYR A 1 24  ? -3.357  -4.145  -9.976  1.00 0.00 ? 42  TYR A HH   1  
ATOM 333   N N    . SER A 1 25  ? -4.188  -7.514  -1.634  1.00 0.00 ? 43  SER A N    1  
ATOM 334   C CA   . SER A 1 25  ? -4.613  -8.280  -0.468  1.00 0.00 ? 43  SER A CA   1  
ATOM 335   C C    . SER A 1 25  ? -4.448  -7.461  0.810   1.00 0.00 ? 43  SER A C    1  
ATOM 336   O O    . SER A 1 25  ? -3.736  -7.863  1.730   1.00 0.00 ? 43  SER A O    1  
ATOM 337   C CB   . SER A 1 25  ? -3.807  -9.577  -0.362  1.00 0.00 ? 43  SER A CB   1  
ATOM 338   O OG   . SER A 1 25  ? -4.150  -10.475 -1.403  1.00 0.00 ? 43  SER A OG   1  
ATOM 339   H H    . SER A 1 25  ? -3.628  -6.719  -1.506  1.00 0.00 ? 43  SER A H    1  
ATOM 340   H HA   . SER A 1 25  ? -5.657  -8.524  -0.593  1.00 0.00 ? 43  SER A HA   1  
ATOM 341   H HB3  . SER A 1 25  ? -4.013  -10.048 0.588   1.00 0.00 ? 43  SER A HB3  1  
ATOM 342   H HG   . SER A 1 25  ? -4.631  -11.221 -1.036  1.00 0.00 ? 43  SER A HG   1  
ATOM 343   N N    . ILE A 1 26  ? -5.113  -6.311  0.857   1.00 0.00 ? 44  ILE A N    1  
ATOM 344   C CA   . ILE A 1 26  ? -5.042  -5.436  2.021   1.00 0.00 ? 44  ILE A CA   1  
ATOM 345   C C    . ILE A 1 26  ? -6.410  -5.277  2.673   1.00 0.00 ? 44  ILE A C    1  
ATOM 346   O O    . ILE A 1 26  ? -7.404  -5.009  1.998   1.00 0.00 ? 44  ILE A O    1  
ATOM 347   C CB   . ILE A 1 26  ? -4.499  -4.044  1.646   1.00 0.00 ? 44  ILE A CB   1  
ATOM 348   C CG1  . ILE A 1 26  ? -3.178  -4.175  0.885   1.00 0.00 ? 44  ILE A CG1  1  
ATOM 349   C CG2  . ILE A 1 26  ? -4.315  -3.193  2.894   1.00 0.00 ? 44  ILE A CG2  1  
ATOM 350   C CD1  . ILE A 1 26  ? -3.347  -4.199  -0.618  1.00 0.00 ? 44  ILE A CD1  1  
ATOM 351   H H    . ILE A 1 26  ? -5.664  -6.045  0.092   1.00 0.00 ? 44  ILE A H    1  
ATOM 352   H HA   . ILE A 1 26  ? -4.364  -5.884  2.734   1.00 0.00 ? 44  ILE A HA   1  
ATOM 353   H HB   . ILE A 1 26  ? -5.225  -3.558  1.012   1.00 0.00 ? 44  ILE A HB   1  
ATOM 354   H HG13 . ILE A 1 26  ? -2.692  -5.094  1.179   1.00 0.00 ? 44  ILE A HG13 1  
ATOM 355   H HG21 . ILE A 1 26  ? -4.322  -3.830  3.767   1.00 0.00 ? 44  ILE A HG21 1  
ATOM 356   H HG22 . ILE A 1 26  ? -3.373  -2.671  2.837   1.00 0.00 ? 44  ILE A HG22 1  
ATOM 357   H HG23 . ILE A 1 26  ? -5.121  -2.478  2.964   1.00 0.00 ? 44  ILE A HG23 1  
ATOM 358   H HD11 . ILE A 1 26  ? -2.428  -4.531  -1.078  1.00 0.00 ? 44  ILE A HD11 1  
ATOM 359   H HD12 . ILE A 1 26  ? -4.146  -4.874  -0.880  1.00 0.00 ? 44  ILE A HD12 1  
ATOM 360   H HD13 . ILE A 1 26  ? -3.586  -3.204  -0.969  1.00 0.00 ? 44  ILE A HD13 1  
ATOM 361   N N    . SER A 1 27  ? -6.454  -5.443  3.991   1.00 0.00 ? 45  SER A N    1  
ATOM 362   C CA   . SER A 1 27  ? -7.702  -5.320  4.736   1.00 0.00 ? 45  SER A CA   1  
ATOM 363   C C    . SER A 1 27  ? -7.939  -3.875  5.165   1.00 0.00 ? 45  SER A C    1  
ATOM 364   O O    . SER A 1 27  ? -7.015  -3.061  5.178   1.00 0.00 ? 45  SER A O    1  
ATOM 365   C CB   . SER A 1 27  ? -7.680  -6.232  5.964   1.00 0.00 ? 45  SER A CB   1  
ATOM 366   O OG   . SER A 1 27  ? -7.065  -5.587  7.067   1.00 0.00 ? 45  SER A OG   1  
ATOM 367   H H    . SER A 1 27  ? -5.628  -5.656  4.474   1.00 0.00 ? 45  SER A H    1  
ATOM 368   H HA   . SER A 1 27  ? -8.508  -5.626  4.085   1.00 0.00 ? 45  SER A HA   1  
ATOM 369   H HB3  . SER A 1 27  ? -7.125  -7.130  5.732   1.00 0.00 ? 45  SER A HB3  1  
ATOM 370   H HG   . SER A 1 27  ? -7.045  -6.186  7.817   1.00 0.00 ? 45  SER A HG   1  
ATOM 371   N N    . ARG A 1 28  ? -9.181  -3.564  5.517   1.00 0.00 ? 46  ARG A N    1  
ATOM 372   C CA   . ARG A 1 28  ? -9.541  -2.218  5.946   1.00 0.00 ? 46  ARG A CA   1  
ATOM 373   C C    . ARG A 1 28  ? -8.796  -1.837  7.221   1.00 0.00 ? 46  ARG A C    1  
ATOM 374   O O    . ARG A 1 28  ? -8.087  -0.829  7.263   1.00 0.00 ? 46  ARG A O    1  
ATOM 375   C CB   . ARG A 1 28  ? -11.050 -2.118  6.175   1.00 0.00 ? 46  ARG A CB   1  
ATOM 376   C CG   . ARG A 1 28  ? -11.878 -2.648  5.016   1.00 0.00 ? 46  ARG A CG   1  
ATOM 377   C CD   . ARG A 1 28  ? -13.366 -2.440  5.254   1.00 0.00 ? 46  ARG A CD   1  
ATOM 378   N NE   . ARG A 1 28  ? -14.180 -3.362  4.467   1.00 0.00 ? 46  ARG A NE   1  
ATOM 379   C CZ   . ARG A 1 28  ? -15.508 -3.354  4.468   1.00 0.00 ? 46  ARG A CZ   1  
ATOM 380   N NH1  . ARG A 1 28  ? -16.169 -2.477  5.211   1.00 0.00 ? 46  ARG A NH1  1  
ATOM 381   N NH2  . ARG A 1 28  ? -16.179 -4.225  3.725   1.00 0.00 ? 46  ARG A NH2  1  
ATOM 382   H H    . ARG A 1 28  ? -9.875  -4.257  5.486   1.00 0.00 ? 46  ARG A H    1  
ATOM 383   H HA   . ARG A 1 28  ? -9.259  -1.533  5.160   1.00 0.00 ? 46  ARG A HA   1  
ATOM 384   H HB3  . ARG A 1 28  ? -11.310 -1.082  6.332   1.00 0.00 ? 46  ARG A HB3  1  
ATOM 385   H HG3  . ARG A 1 28  ? -11.685 -3.704  4.900   1.00 0.00 ? 46  ARG A HG3  1  
ATOM 386   H HD3  . ARG A 1 28  ? -13.621 -1.427  4.983   1.00 0.00 ? 46  ARG A HD3  1  
ATOM 387   H HE   . ARG A 1 28  ? -13.713 -4.018  3.910   1.00 0.00 ? 46  ARG A HE   1  
ATOM 388   H HH11 . ARG A 1 28  ? -15.667 -1.818  5.771   1.00 0.00 ? 46  ARG A HH11 1  
ATOM 389   H HH12 . ARG A 1 28  ? -17.169 -2.472  5.209   1.00 0.00 ? 46  ARG A HH12 1  
ATOM 390   H HH21 . ARG A 1 28  ? -15.685 -4.888  3.163   1.00 0.00 ? 46  ARG A HH21 1  
ATOM 391   H HH22 . ARG A 1 28  ? -17.179 -4.219  3.727   1.00 0.00 ? 46  ARG A HH22 1  
ATOM 392   N N    . THR A 1 29  ? -8.959  -2.648  8.261   1.00 0.00 ? 47  THR A N    1  
ATOM 393   C CA   . THR A 1 29  ? -8.304  -2.397  9.538   1.00 0.00 ? 47  THR A CA   1  
ATOM 394   C C    . THR A 1 29  ? -6.797  -2.240  9.362   1.00 0.00 ? 47  THR A C    1  
ATOM 395   O O    . THR A 1 29  ? -6.136  -1.573  10.157  1.00 0.00 ? 47  THR A O    1  
ATOM 396   C CB   . THR A 1 29  ? -8.577  -3.530  10.544  1.00 0.00 ? 47  THR A CB   1  
ATOM 397   O OG1  . THR A 1 29  ? -8.506  -4.799  9.883   1.00 0.00 ? 47  THR A OG1  1  
ATOM 398   C CG2  . THR A 1 29  ? -9.945  -3.364  11.189  1.00 0.00 ? 47  THR A CG2  1  
ATOM 399   H H    . THR A 1 29  ? -9.535  -3.436  8.166   1.00 0.00 ? 47  THR A H    1  
ATOM 400   H HA   . THR A 1 29  ? -8.706  -1.479  9.944   1.00 0.00 ? 47  THR A HA   1  
ATOM 401   H HB   . THR A 1 29  ? -7.824  -3.494  11.318  1.00 0.00 ? 47  THR A HB   1  
ATOM 402   H HG1  . THR A 1 29  ? -8.900  -5.473  10.442  1.00 0.00 ? 47  THR A HG1  1  
ATOM 403   H HG21 . THR A 1 29  ? -10.568 -4.208  10.933  1.00 0.00 ? 47  THR A HG21 1  
ATOM 404   H HG22 . THR A 1 29  ? -10.404 -2.455  10.830  1.00 0.00 ? 47  THR A HG22 1  
ATOM 405   H HG23 . THR A 1 29  ? -9.833  -3.312  12.261  1.00 0.00 ? 47  THR A HG23 1  
ATOM 406   N N    . GLU A 1 30  ? -6.261  -2.860  8.315   1.00 0.00 ? 48  GLU A N    1  
ATOM 407   C CA   . GLU A 1 30  ? -4.832  -2.789  8.036   1.00 0.00 ? 48  GLU A CA   1  
ATOM 408   C C    . GLU A 1 30  ? -4.503  -1.563  7.189   1.00 0.00 ? 48  GLU A C    1  
ATOM 409   O O    . GLU A 1 30  ? -3.399  -1.025  7.261   1.00 0.00 ? 48  GLU A O    1  
ATOM 410   C CB   . GLU A 1 30  ? -4.366  -4.059  7.319   1.00 0.00 ? 48  GLU A CB   1  
ATOM 411   C CG   . GLU A 1 30  ? -2.886  -4.352  7.500   1.00 0.00 ? 48  GLU A CG   1  
ATOM 412   C CD   . GLU A 1 30  ? -2.596  -5.117  8.776   1.00 0.00 ? 48  GLU A CD   1  
ATOM 413   O OE1  . GLU A 1 30  ? -3.272  -6.138  9.022   1.00 0.00 ? 48  GLU A OE1  1  
ATOM 414   O OE2  . GLU A 1 30  ? -1.693  -4.695  9.529   1.00 0.00 ? 48  GLU A OE2  1  
ATOM 415   H H    . GLU A 1 30  ? -6.840  -3.378  7.717   1.00 0.00 ? 48  GLU A H    1  
ATOM 416   H HA   . GLU A 1 30  ? -4.314  -2.711  8.980   1.00 0.00 ? 48  GLU A HA   1  
ATOM 417   H HB3  . GLU A 1 30  ? -4.564  -3.952  6.262   1.00 0.00 ? 48  GLU A HB3  1  
ATOM 418   H HG3  . GLU A 1 30  ? -2.348  -3.417  7.527   1.00 0.00 ? 48  GLU A HG3  1  
ATOM 419   N N    . ALA A 1 31  ? -5.469  -1.129  6.388   1.00 0.00 ? 49  ALA A N    1  
ATOM 420   C CA   . ALA A 1 31  ? -5.284  0.034   5.529   1.00 0.00 ? 49  ALA A CA   1  
ATOM 421   C C    . ALA A 1 31  ? -4.759  1.226   6.322   1.00 0.00 ? 49  ALA A C    1  
ATOM 422   O O    . ALA A 1 31  ? -3.728  1.804   5.984   1.00 0.00 ? 49  ALA A O    1  
ATOM 423   C CB   . ALA A 1 31  ? -6.591  0.392   4.836   1.00 0.00 ? 49  ALA A CB   1  
ATOM 424   H H    . ALA A 1 31  ? -6.329  -1.600  6.376   1.00 0.00 ? 49  ALA A H    1  
ATOM 425   H HA   . ALA A 1 31  ? -4.562  -0.225  4.768   1.00 0.00 ? 49  ALA A HA   1  
ATOM 426   H HB1  . ALA A 1 31  ? -6.910  -0.436  4.221   1.00 0.00 ? 49  ALA A HB1  1  
ATOM 427   H HB2  . ALA A 1 31  ? -7.346  0.602   5.579   1.00 0.00 ? 49  ALA A HB2  1  
ATOM 428   H HB3  . ALA A 1 31  ? -6.442  1.265   4.218   1.00 0.00 ? 49  ALA A HB3  1  
ATOM 429   N N    . ALA A 1 32  ? -5.477  1.588   7.381   1.00 0.00 ? 50  ALA A N    1  
ATOM 430   C CA   . ALA A 1 32  ? -5.083  2.710   8.224   1.00 0.00 ? 50  ALA A CA   1  
ATOM 431   C C    . ALA A 1 32  ? -3.631  2.576   8.671   1.00 0.00 ? 50  ALA A C    1  
ATOM 432   O O    . ALA A 1 32  ? -2.825  3.484   8.471   1.00 0.00 ? 50  ALA A O    1  
ATOM 433   C CB   . ALA A 1 32  ? -6.003  2.812   9.432   1.00 0.00 ? 50  ALA A CB   1  
ATOM 434   H H    . ALA A 1 32  ? -6.291  1.088   7.601   1.00 0.00 ? 50  ALA A H    1  
ATOM 435   H HA   . ALA A 1 32  ? -5.189  3.616   7.645   1.00 0.00 ? 50  ALA A HA   1  
ATOM 436   H HB1  . ALA A 1 32  ? -5.755  3.697   9.998   1.00 0.00 ? 50  ALA A HB1  1  
ATOM 437   H HB2  . ALA A 1 32  ? -7.028  2.871   9.099   1.00 0.00 ? 50  ALA A HB2  1  
ATOM 438   H HB3  . ALA A 1 32  ? -5.877  1.938   10.055  1.00 0.00 ? 50  ALA A HB3  1  
ATOM 439   N N    . ASP A 1 33  ? -3.306  1.441   9.278   1.00 0.00 ? 51  ASP A N    1  
ATOM 440   C CA   . ASP A 1 33  ? -1.951  1.189   9.754   1.00 0.00 ? 51  ASP A CA   1  
ATOM 441   C C    . ASP A 1 33  ? -0.942  1.326   8.618   1.00 0.00 ? 51  ASP A C    1  
ATOM 442   O O    . ASP A 1 33  ? 0.157   1.850   8.810   1.00 0.00 ? 51  ASP A O    1  
ATOM 443   C CB   . ASP A 1 33  ? -1.856  -0.208  10.371  1.00 0.00 ? 51  ASP A CB   1  
ATOM 444   C CG   . ASP A 1 33  ? -0.628  -0.371  11.245  1.00 0.00 ? 51  ASP A CG   1  
ATOM 445   O OD1  . ASP A 1 33  ? 0.471   -0.580  10.692  1.00 0.00 ? 51  ASP A OD1  1  
ATOM 446   O OD2  . ASP A 1 33  ? -0.768  -0.290  12.484  1.00 0.00 ? 51  ASP A OD2  1  
ATOM 447   H H    . ASP A 1 33  ? -3.994  0.755   9.408   1.00 0.00 ? 51  ASP A H    1  
ATOM 448   H HA   . ASP A 1 33  ? -1.724  1.923   10.512  1.00 0.00 ? 51  ASP A HA   1  
ATOM 449   H HB3  . ASP A 1 33  ? -1.813  -0.941  9.580   1.00 0.00 ? 51  ASP A HB3  1  
ATOM 450   N N    . LEU A 1 34  ? -1.321  0.853   7.437   1.00 0.00 ? 52  LEU A N    1  
ATOM 451   C CA   . LEU A 1 34  ? -0.449  0.922   6.269   1.00 0.00 ? 52  LEU A CA   1  
ATOM 452   C C    . LEU A 1 34  ? -0.089  2.367   5.943   1.00 0.00 ? 52  LEU A C    1  
ATOM 453   O O    . LEU A 1 34  ? 1.087   2.722   5.856   1.00 0.00 ? 52  LEU A O    1  
ATOM 454   C CB   . LEU A 1 34  ? -1.125  0.268   5.063   1.00 0.00 ? 52  LEU A CB   1  
ATOM 455   C CG   . LEU A 1 34  ? -0.194  -0.400  4.051   1.00 0.00 ? 52  LEU A CG   1  
ATOM 456   C CD1  . LEU A 1 34  ? 0.903   0.560   3.619   1.00 0.00 ? 52  LEU A CD1  1  
ATOM 457   C CD2  . LEU A 1 34  ? 0.407   -1.670  4.638   1.00 0.00 ? 52  LEU A CD2  1  
ATOM 458   H H    . LEU A 1 34  ? -2.207  0.446   7.346   1.00 0.00 ? 52  LEU A H    1  
ATOM 459   H HA   . LEU A 1 34  ? 0.457   0.381   6.500   1.00 0.00 ? 52  LEU A HA   1  
ATOM 460   H HB3  . LEU A 1 34  ? -1.685  1.033   4.544   1.00 0.00 ? 52  LEU A HB3  1  
ATOM 461   H HG   . LEU A 1 34  ? -0.763  -0.674  3.173   1.00 0.00 ? 52  LEU A HG   1  
ATOM 462   H HD11 . LEU A 1 34  ? 0.462   1.403   3.110   1.00 0.00 ? 52  LEU A HD11 1  
ATOM 463   H HD12 . LEU A 1 34  ? 1.583   0.053   2.952   1.00 0.00 ? 52  LEU A HD12 1  
ATOM 464   H HD13 . LEU A 1 34  ? 1.442   0.906   4.490   1.00 0.00 ? 52  LEU A HD13 1  
ATOM 465   H HD21 . LEU A 1 34  ? 1.458   -1.717  4.392   1.00 0.00 ? 52  LEU A HD21 1  
ATOM 466   H HD22 . LEU A 1 34  ? -0.097  -2.532  4.225   1.00 0.00 ? 52  LEU A HD22 1  
ATOM 467   H HD23 . LEU A 1 34  ? 0.289   -1.662  5.711   1.00 0.00 ? 52  LEU A HD23 1  
ATOM 468   N N    . CYS A 1 35  ? -1.110  3.200   5.766   1.00 0.00 ? 53  CYS A N    1  
ATOM 469   C CA   . CYS A 1 35  ? -0.903  4.608   5.451   1.00 0.00 ? 53  CYS A CA   1  
ATOM 470   C C    . CYS A 1 35  ? -0.046  5.284   6.517   1.00 0.00 ? 53  CYS A C    1  
ATOM 471   O O    . CYS A 1 35  ? 0.986   5.883   6.213   1.00 0.00 ? 53  CYS A O    1  
ATOM 472   C CB   . CYS A 1 35  ? -2.248  5.329   5.331   1.00 0.00 ? 53  CYS A CB   1  
ATOM 473   S SG   . CYS A 1 35  ? -3.365  4.613   4.083   1.00 0.00 ? 53  CYS A SG   1  
ATOM 474   H H    . CYS A 1 35  ? -2.025  2.858   5.848   1.00 0.00 ? 53  CYS A H    1  
ATOM 475   H HA   . CYS A 1 35  ? -0.388  4.665   4.504   1.00 0.00 ? 53  CYS A HA   1  
ATOM 476   H HB3  . CYS A 1 35  ? -2.072  6.360   5.062   1.00 0.00 ? 53  CYS A HB3  1  
ATOM 477   N N    . LYS A 1 36  ? -0.480  5.182   7.770   1.00 0.00 ? 54  LYS A N    1  
ATOM 478   C CA   . LYS A 1 36  ? 0.247   5.780   8.883   1.00 0.00 ? 54  LYS A CA   1  
ATOM 479   C C    . LYS A 1 36  ? 1.677   5.254   8.944   1.00 0.00 ? 54  LYS A C    1  
ATOM 480   O O    . LYS A 1 36  ? 2.590   5.959   9.376   1.00 0.00 ? 54  LYS A O    1  
ATOM 481   C CB   . LYS A 1 36  ? -0.472  5.490   10.202  1.00 0.00 ? 54  LYS A CB   1  
ATOM 482   C CG   . LYS A 1 36  ? -0.067  6.421   11.333  1.00 0.00 ? 54  LYS A CG   1  
ATOM 483   C CD   . LYS A 1 36  ? -0.766  6.056   12.632  1.00 0.00 ? 54  LYS A CD   1  
ATOM 484   C CE   . LYS A 1 36  ? -0.056  6.660   13.834  1.00 0.00 ? 54  LYS A CE   1  
ATOM 485   N NZ   . LYS A 1 36  ? -0.495  8.060   14.093  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 486   H H    . LYS A 1 36  ? -1.309  4.691   7.948   1.00 0.00 ? 54  LYS A H    1  
ATOM 487   H HA   . LYS A 1 36  ? 0.275   6.848   8.725   1.00 0.00 ? 54  LYS A HA   1  
ATOM 488   H HB3  . LYS A 1 36  ? -0.250  4.476   10.503  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 489   H HG3  . LYS A 1 36  ? -0.331  7.434   11.064  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 490   H HD3  . LYS A 1 36  ? -0.778  4.981   12.734  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 491   H HE3  . LYS A 1 36  ? 1.008   6.654   13.648  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 492   H HZ1  . LYS A 1 36  ? -0.484  8.606   13.208  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 493   H HZ2  . LYS A 1 36  ? 0.144   8.513   14.776  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 494   H HZ3  . LYS A 1 36  ? -1.461  8.066   14.480  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 495   N N    . ALA A 1 37  ? 1.866   4.012   8.509   1.00 0.00 ? 55  ALA A N    1  
ATOM 496   C CA   . ALA A 1 37  ? 3.185   3.395   8.511   1.00 0.00 ? 55  ALA A CA   1  
ATOM 497   C C    . ALA A 1 37  ? 4.089   4.024   7.456   1.00 0.00 ? 55  ALA A C    1  
ATOM 498   O O    . ALA A 1 37  ? 5.290   3.755   7.412   1.00 0.00 ? 55  ALA A O    1  
ATOM 499   C CB   . ALA A 1 37  ? 3.067   1.895   8.280   1.00 0.00 ? 55  ALA A CB   1  
ATOM 500   H H    . ALA A 1 37  ? 1.100   3.501   8.176   1.00 0.00 ? 55  ALA A H    1  
ATOM 501   H HA   . ALA A 1 37  ? 3.625   3.549   9.486   1.00 0.00 ? 55  ALA A HA   1  
ATOM 502   H HB1  . ALA A 1 37  ? 2.599   1.436   9.138   1.00 0.00 ? 55  ALA A HB1  1  
ATOM 503   H HB2  . ALA A 1 37  ? 2.466   1.713   7.401   1.00 0.00 ? 55  ALA A HB2  1  
ATOM 504   H HB3  . ALA A 1 37  ? 4.050   1.475   8.137   1.00 0.00 ? 55  ALA A HB3  1  
ATOM 505   N N    . PHE A 1 38  ? 3.504   4.863   6.607   1.00 0.00 ? 56  PHE A N    1  
ATOM 506   C CA   . PHE A 1 38  ? 4.257   5.530   5.552   1.00 0.00 ? 56  PHE A CA   1  
ATOM 507   C C    . PHE A 1 38  ? 4.105   7.045   5.649   1.00 0.00 ? 56  PHE A C    1  
ATOM 508   O O    . PHE A 1 38  ? 4.163   7.752   4.644   1.00 0.00 ? 56  PHE A O    1  
ATOM 509   C CB   . PHE A 1 38  ? 3.786   5.047   4.177   1.00 0.00 ? 56  PHE A CB   1  
ATOM 510   C CG   . PHE A 1 38  ? 4.826   5.188   3.104   1.00 0.00 ? 56  PHE A CG   1  
ATOM 511   C CD1  . PHE A 1 38  ? 6.090   4.643   3.270   1.00 0.00 ? 56  PHE A CD1  1  
ATOM 512   C CD2  . PHE A 1 38  ? 4.542   5.863   1.928   1.00 0.00 ? 56  PHE A CD2  1  
ATOM 513   C CE1  . PHE A 1 38  ? 7.050   4.772   2.283   1.00 0.00 ? 56  PHE A CE1  1  
ATOM 514   C CE2  . PHE A 1 38  ? 5.497   5.994   0.938   1.00 0.00 ? 56  PHE A CE2  1  
ATOM 515   C CZ   . PHE A 1 38  ? 6.752   5.448   1.116   1.00 0.00 ? 56  PHE A CZ   1  
ATOM 516   H H    . PHE A 1 38  ? 2.544   5.037   6.693   1.00 0.00 ? 56  PHE A H    1  
ATOM 517   H HA   . PHE A 1 38  ? 5.298   5.275   5.675   1.00 0.00 ? 56  PHE A HA   1  
ATOM 518   H HB3  . PHE A 1 38  ? 2.920   5.620   3.880   1.00 0.00 ? 56  PHE A HB3  1  
ATOM 519   H HD1  . PHE A 1 38  ? 6.323   4.114   4.182   1.00 0.00 ? 56  PHE A HD1  1  
ATOM 520   H HD2  . PHE A 1 38  ? 3.559   6.292   1.788   1.00 0.00 ? 56  PHE A HD2  1  
ATOM 521   H HE1  . PHE A 1 38  ? 8.031   4.343   2.424   1.00 0.00 ? 56  PHE A HE1  1  
ATOM 522   H HE2  . PHE A 1 38  ? 5.261   6.524   0.027   1.00 0.00 ? 56  PHE A HE2  1  
ATOM 523   H HZ   . PHE A 1 38  ? 7.501   5.549   0.344   1.00 0.00 ? 56  PHE A HZ   1  
ATOM 524   N N    . ASN A 1 39  ? 3.910   7.537   6.869   1.00 0.00 ? 57  ASN A N    1  
ATOM 525   C CA   . ASN A 1 39  ? 3.749   8.968   7.100   1.00 0.00 ? 57  ASN A CA   1  
ATOM 526   C C    . ASN A 1 39  ? 2.545   9.510   6.334   1.00 0.00 ? 57  ASN A C    1  
ATOM 527   O O    . ASN A 1 39  ? 2.433   10.714  6.105   1.00 0.00 ? 57  ASN A O    1  
ATOM 528   C CB   . ASN A 1 39  ? 5.014   9.718   6.679   1.00 0.00 ? 57  ASN A CB   1  
ATOM 529   C CG   . ASN A 1 39  ? 5.148   11.059  7.375   1.00 0.00 ? 57  ASN A CG   1  
ATOM 530   O OD1  . ASN A 1 39  ? 4.237   11.502  8.075   1.00 0.00 ? 57  ASN A OD1  1  
ATOM 531   N ND2  . ASN A 1 39  ? 6.289   11.713  7.186   1.00 0.00 ? 57  ASN A ND2  1  
ATOM 532   H H    . ASN A 1 39  ? 3.873   6.923   7.632   1.00 0.00 ? 57  ASN A H    1  
ATOM 533   H HA   . ASN A 1 39  ? 3.586   9.117   8.156   1.00 0.00 ? 57  ASN A HA   1  
ATOM 534   H HB3  . ASN A 1 39  ? 4.988   9.888   5.614   1.00 0.00 ? 57  ASN A HB3  1  
ATOM 535   H HD21 . ASN A 1 39  ? 6.971   11.299  6.616   1.00 0.00 ? 57  ASN A HD21 1  
ATOM 536   H HD22 . ASN A 1 39  ? 6.403   12.581  7.626   1.00 0.00 ? 57  ASN A HD22 1  
ATOM 537   N N    . SER A 1 40  ? 1.646   8.612   5.943   1.00 0.00 ? 58  SER A N    1  
ATOM 538   C CA   . SER A 1 40  ? 0.452   8.999   5.202   1.00 0.00 ? 58  SER A CA   1  
ATOM 539   C C    . SER A 1 40  ? -0.811  8.639   5.979   1.00 0.00 ? 58  SER A C    1  
ATOM 540   O O    . SER A 1 40  ? -0.753  7.942   6.992   1.00 0.00 ? 58  SER A O    1  
ATOM 541   C CB   . SER A 1 40  ? 0.432   8.318   3.832   1.00 0.00 ? 58  SER A CB   1  
ATOM 542   O OG   . SER A 1 40  ? 1.187   7.118   3.849   1.00 0.00 ? 58  SER A OG   1  
ATOM 543   H H    . SER A 1 40  ? 1.791   7.666   6.157   1.00 0.00 ? 58  SER A H    1  
ATOM 544   H HA   . SER A 1 40  ? 0.481   10.069  5.061   1.00 0.00 ? 58  SER A HA   1  
ATOM 545   H HB3  . SER A 1 40  ? 0.855   8.985   3.095   1.00 0.00 ? 58  SER A HB3  1  
ATOM 546   H HG   . SER A 1 40  ? 1.865   7.157   3.169   1.00 0.00 ? 58  SER A HG   1  
ATOM 547   N N    . THR A 1 41  ? -1.953  9.120   5.497   1.00 0.00 ? 59  THR A N    1  
ATOM 548   C CA   . THR A 1 41  ? -3.230  8.850   6.145   1.00 0.00 ? 59  THR A CA   1  
ATOM 549   C C    . THR A 1 41  ? -4.285  8.428   5.129   1.00 0.00 ? 59  THR A C    1  
ATOM 550   O O    . THR A 1 41  ? -4.199  8.775   3.949   1.00 0.00 ? 59  THR A O    1  
ATOM 551   C CB   . THR A 1 41  ? -3.740  10.083  6.916   1.00 0.00 ? 59  THR A CB   1  
ATOM 552   O OG1  . THR A 1 41  ? -3.816  11.213  6.038   1.00 0.00 ? 59  THR A OG1  1  
ATOM 553   C CG2  . THR A 1 41  ? -2.824  10.406  8.087   1.00 0.00 ? 59  THR A CG2  1  
ATOM 554   H H    . THR A 1 41  ? -1.934  9.669   4.685   1.00 0.00 ? 59  THR A H    1  
ATOM 555   H HA   . THR A 1 41  ? -3.083  8.046   6.851   1.00 0.00 ? 59  THR A HA   1  
ATOM 556   H HB   . THR A 1 41  ? -4.727  9.867   7.299   1.00 0.00 ? 59  THR A HB   1  
ATOM 557   H HG1  . THR A 1 41  ? -3.858  12.019  6.557   1.00 0.00 ? 59  THR A HG1  1  
ATOM 558   H HG21 . THR A 1 41  ? -2.836  11.470  8.271   1.00 0.00 ? 59  THR A HG21 1  
ATOM 559   H HG22 . THR A 1 41  ? -1.818  10.092  7.854   1.00 0.00 ? 59  THR A HG22 1  
ATOM 560   H HG23 . THR A 1 41  ? -3.169  9.885   8.967   1.00 0.00 ? 59  THR A HG23 1  
ATOM 561   N N    . LEU A 1 42  ? -5.279  7.679   5.591   1.00 0.00 ? 60  LEU A N    1  
ATOM 562   C CA   . LEU A 1 42  ? -6.352  7.211   4.721   1.00 0.00 ? 60  LEU A CA   1  
ATOM 563   C C    . LEU A 1 42  ? -6.957  8.366   3.930   1.00 0.00 ? 60  LEU A C    1  
ATOM 564   O O    . LEU A 1 42  ? -7.103  9.483   4.430   1.00 0.00 ? 60  LEU A O    1  
ATOM 565   C CB   . LEU A 1 42  ? -7.440  6.520   5.547   1.00 0.00 ? 60  LEU A CB   1  
ATOM 566   C CG   . LEU A 1 42  ? -7.134  5.091   5.998   1.00 0.00 ? 60  LEU A CG   1  
ATOM 567   C CD1  . LEU A 1 42  ? -8.150  4.628   7.031   1.00 0.00 ? 60  LEU A CD1  1  
ATOM 568   C CD2  . LEU A 1 42  ? -7.115  4.147   4.804   1.00 0.00 ? 60  LEU A CD2  1  
ATOM 569   H H    . LEU A 1 42  ? -5.293  7.435   6.540   1.00 0.00 ? 60  LEU A H    1  
ATOM 570   H HA   . LEU A 1 42  ? -5.931  6.498   4.029   1.00 0.00 ? 60  LEU A HA   1  
ATOM 571   H HB3  . LEU A 1 42  ? -8.341  6.494   4.951   1.00 0.00 ? 60  LEU A HB3  1  
ATOM 572   H HG   . LEU A 1 42  ? -6.155  5.068   6.459   1.00 0.00 ? 60  LEU A HG   1  
ATOM 573   H HD11 . LEU A 1 42  ? -8.891  5.399   7.176   1.00 0.00 ? 60  LEU A HD11 1  
ATOM 574   H HD12 . LEU A 1 42  ? -7.647  4.430   7.966   1.00 0.00 ? 60  LEU A HD12 1  
ATOM 575   H HD13 . LEU A 1 42  ? -8.631  3.726   6.682   1.00 0.00 ? 60  LEU A HD13 1  
ATOM 576   H HD21 . LEU A 1 42  ? -7.820  4.493   4.062   1.00 0.00 ? 60  LEU A HD21 1  
ATOM 577   H HD22 . LEU A 1 42  ? -7.392  3.154   5.126   1.00 0.00 ? 60  LEU A HD22 1  
ATOM 578   H HD23 . LEU A 1 42  ? -6.124  4.125   4.378   1.00 0.00 ? 60  LEU A HD23 1  
ATOM 579   N N    . PRO A 1 43  ? -7.318  8.095   2.668   1.00 0.00 ? 61  PRO A N    1  
ATOM 580   C CA   . PRO A 1 43  ? -7.916  9.099   1.782   1.00 0.00 ? 61  PRO A CA   1  
ATOM 581   C C    . PRO A 1 43  ? -9.328  9.481   2.208   1.00 0.00 ? 61  PRO A C    1  
ATOM 582   O O    . PRO A 1 43  ? -9.805  9.064   3.265   1.00 0.00 ? 61  PRO A O    1  
ATOM 583   C CB   . PRO A 1 43  ? -7.938  8.400   0.420   1.00 0.00 ? 61  PRO A CB   1  
ATOM 584   C CG   . PRO A 1 43  ? -7.966  6.946   0.740   1.00 0.00 ? 61  PRO A CG   1  
ATOM 585   C CD   . PRO A 1 43  ? -7.174  6.786   2.008   1.00 0.00 ? 61  PRO A CD   1  
ATOM 586   H HA   . PRO A 1 43  ? -7.305  9.988   1.722   1.00 0.00 ? 61  PRO A HA   1  
ATOM 587   H HB3  . PRO A 1 43  ? -7.054  8.665   -0.140  1.00 0.00 ? 61  PRO A HB3  1  
ATOM 588   H HG3  . PRO A 1 43  ? -7.507  6.385   -0.061  1.00 0.00 ? 61  PRO A HG3  1  
ATOM 589   H HD3  . PRO A 1 43  ? -6.138  6.581   1.783   1.00 0.00 ? 61  PRO A HD3  1  
ATOM 590   N N    . THR A 1 44  ? -9.997  10.278  1.380   1.00 0.00 ? 62  THR A N    1  
ATOM 591   C CA   . THR A 1 44  ? -11.356 10.717  1.672   1.00 0.00 ? 62  THR A CA   1  
ATOM 592   C C    . THR A 1 44  ? -12.304 10.363  0.533   1.00 0.00 ? 62  THR A C    1  
ATOM 593   O O    . THR A 1 44  ? -11.919 9.686   -0.420  1.00 0.00 ? 62  THR A O    1  
ATOM 594   C CB   . THR A 1 44  ? -11.413 12.237  1.918   1.00 0.00 ? 62  THR A CB   1  
ATOM 595   O OG1  . THR A 1 44  ? -11.057 12.941  0.723   1.00 0.00 ? 62  THR A OG1  1  
ATOM 596   C CG2  . THR A 1 44  ? -10.478 12.639  3.048   1.00 0.00 ? 62  THR A CG2  1  
ATOM 597   H H    . THR A 1 44  ? -9.564  10.577  0.553   1.00 0.00 ? 62  THR A H    1  
ATOM 598   H HA   . THR A 1 44  ? -11.682 10.215  2.570   1.00 0.00 ? 62  THR A HA   1  
ATOM 599   H HB   . THR A 1 44  ? -12.423 12.503  2.195   1.00 0.00 ? 62  THR A HB   1  
ATOM 600   H HG1  . THR A 1 44  ? -10.872 13.859  0.936   1.00 0.00 ? 62  THR A HG1  1  
ATOM 601   H HG21 . THR A 1 44  ? -10.196 11.760  3.611   1.00 0.00 ? 62  THR A HG21 1  
ATOM 602   H HG22 . THR A 1 44  ? -10.978 13.338  3.699   1.00 0.00 ? 62  THR A HG22 1  
ATOM 603   H HG23 . THR A 1 44  ? -9.593  13.100  2.635   1.00 0.00 ? 62  THR A HG23 1  
ATOM 604   N N    . MET A 1 45  ? -13.547 10.823  0.638   1.00 0.00 ? 63  MET A N    1  
ATOM 605   C CA   . MET A 1 45  ? -14.551 10.555  -0.385  1.00 0.00 ? 63  MET A CA   1  
ATOM 606   C C    . MET A 1 45  ? -14.392 11.508  -1.566  1.00 0.00 ? 63  MET A C    1  
ATOM 607   O O    . MET A 1 45  ? -14.692 11.154  -2.705  1.00 0.00 ? 63  MET A O    1  
ATOM 608   C CB   . MET A 1 45  ? -15.957 10.683  0.204   1.00 0.00 ? 63  MET A CB   1  
ATOM 609   C CG   . MET A 1 45  ? -16.390 12.121  0.434   1.00 0.00 ? 63  MET A CG   1  
ATOM 610   S SD   . MET A 1 45  ? -18.073 12.247  1.071   1.00 0.00 ? 63  MET A SD   1  
ATOM 611   C CE   . MET A 1 45  ? -18.980 11.364  -0.196  1.00 0.00 ? 63  MET A CE   1  
ATOM 612   H H    . MET A 1 45  ? -13.794 11.358  1.422   1.00 0.00 ? 63  MET A H    1  
ATOM 613   H HA   . MET A 1 45  ? -14.407 9.543   -0.733  1.00 0.00 ? 63  MET A HA   1  
ATOM 614   H HB3  . MET A 1 45  ? -15.987 10.165  1.151   1.00 0.00 ? 63  MET A HB3  1  
ATOM 615   H HG3  . MET A 1 45  ? -16.334 12.654  -0.503  1.00 0.00 ? 63  MET A HG3  1  
ATOM 616   H HE1  . MET A 1 45  ? -18.689 10.324  -0.189  1.00 0.00 ? 63  MET A HE1  1  
ATOM 617   H HE2  . MET A 1 45  ? -20.040 11.443  -0.002  1.00 0.00 ? 63  MET A HE2  1  
ATOM 618   H HE3  . MET A 1 45  ? -18.758 11.793  -1.163  1.00 0.00 ? 63  MET A HE3  1  
ATOM 619   N N    . ALA A 1 46  ? -13.920 12.718  -1.284  1.00 0.00 ? 64  ALA A N    1  
ATOM 620   C CA   . ALA A 1 46  ? -13.720 13.721  -2.323  1.00 0.00 ? 64  ALA A CA   1  
ATOM 621   C C    . ALA A 1 46  ? -12.341 13.585  -2.959  1.00 0.00 ? 64  ALA A C    1  
ATOM 622   O O    . ALA A 1 46  ? -12.187 13.751  -4.169  1.00 0.00 ? 64  ALA A O    1  
ATOM 623   C CB   . ALA A 1 46  ? -13.904 15.119  -1.750  1.00 0.00 ? 64  ALA A CB   1  
ATOM 624   H H    . ALA A 1 46  ? -13.699 12.941  -0.357  1.00 0.00 ? 64  ALA A H    1  
ATOM 625   H HA   . ALA A 1 46  ? -14.473 13.568  -3.084  1.00 0.00 ? 64  ALA A HA   1  
ATOM 626   H HB1  . ALA A 1 46  ? -14.630 15.656  -2.342  1.00 0.00 ? 64  ALA A HB1  1  
ATOM 627   H HB2  . ALA A 1 46  ? -14.253 15.046  -0.731  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 628   H HB3  . ALA A 1 46  ? -12.961 15.642  -1.772  1.00 0.00 ? 64  ALA A HB3  1  
ATOM 629   N N    . GLN A 1 47  ? -11.342 13.283  -2.136  1.00 0.00 ? 65  GLN A N    1  
ATOM 630   C CA   . GLN A 1 47  ? -9.976  13.127  -2.620  1.00 0.00 ? 65  GLN A CA   1  
ATOM 631   C C    . GLN A 1 47  ? -9.916  12.131  -3.773  1.00 0.00 ? 65  GLN A C    1  
ATOM 632   O O    . GLN A 1 47  ? -9.266  12.379  -4.788  1.00 0.00 ? 65  GLN A O    1  
ATOM 633   C CB   . GLN A 1 47  ? -9.059  12.666  -1.485  1.00 0.00 ? 65  GLN A CB   1  
ATOM 634   C CG   . GLN A 1 47  ? -8.502  13.808  -0.651  1.00 0.00 ? 65  GLN A CG   1  
ATOM 635   C CD   . GLN A 1 47  ? -7.701  13.323  0.542   1.00 0.00 ? 65  GLN A CD   1  
ATOM 636   O OE1  . GLN A 1 47  ? -7.150  12.222  0.528   1.00 0.00 ? 65  GLN A OE1  1  
ATOM 637   N NE2  . GLN A 1 47  ? -7.635  14.144  1.583   1.00 0.00 ? 65  GLN A NE2  1  
ATOM 638   H H    . GLN A 1 47  ? -11.528 13.164  -1.183  1.00 0.00 ? 65  GLN A H    1  
ATOM 639   H HA   . GLN A 1 47  ? -9.637  14.089  -2.975  1.00 0.00 ? 65  GLN A HA   1  
ATOM 640   H HB3  . GLN A 1 47  ? -8.229  12.120  -1.908  1.00 0.00 ? 65  GLN A HB3  1  
ATOM 641   H HG3  . GLN A 1 47  ? -9.324  14.410  -0.294  1.00 0.00 ? 65  GLN A HG3  1  
ATOM 642   H HE21 . GLN A 1 47  ? -8.100  15.005  1.524   1.00 0.00 ? 65  GLN A HE21 1  
ATOM 643   H HE22 . GLN A 1 47  ? -7.125  13.856  2.368   1.00 0.00 ? 65  GLN A HE22 1  
ATOM 644   N N    . MET A 1 48  ? -10.601 11.003  -3.611  1.00 0.00 ? 66  MET A N    1  
ATOM 645   C CA   . MET A 1 48  ? -10.626 9.970   -4.639  1.00 0.00 ? 66  MET A CA   1  
ATOM 646   C C    . MET A 1 48  ? -11.163 10.525  -5.954  1.00 0.00 ? 66  MET A C    1  
ATOM 647   O O    . MET A 1 48  ? -10.479 10.494  -6.977  1.00 0.00 ? 66  MET A O    1  
ATOM 648   C CB   . MET A 1 48  ? -11.484 8.788   -4.183  1.00 0.00 ? 66  MET A CB   1  
ATOM 649   C CG   . MET A 1 48  ? -10.909 8.046   -2.988  1.00 0.00 ? 66  MET A CG   1  
ATOM 650   S SD   . MET A 1 48  ? -9.332  7.253   -3.355  1.00 0.00 ? 66  MET A SD   1  
ATOM 651   C CE   . MET A 1 48  ? -9.783  6.233   -4.756  1.00 0.00 ? 66  MET A CE   1  
ATOM 652   H H    . MET A 1 48  ? -11.101 10.862  -2.779  1.00 0.00 ? 66  MET A H    1  
ATOM 653   H HA   . MET A 1 48  ? -9.614  9.630   -4.792  1.00 0.00 ? 66  MET A HA   1  
ATOM 654   H HB3  . MET A 1 48  ? -11.579 8.090   -5.001  1.00 0.00 ? 66  MET A HB3  1  
ATOM 655   H HG3  . MET A 1 48  ? -11.614 7.288   -2.679  1.00 0.00 ? 66  MET A HG3  1  
ATOM 656   H HE1  . MET A 1 48  ? -10.105 6.862   -5.572  1.00 0.00 ? 66  MET A HE1  1  
ATOM 657   H HE2  . MET A 1 48  ? -8.929  5.650   -5.066  1.00 0.00 ? 66  MET A HE2  1  
ATOM 658   H HE3  . MET A 1 48  ? -10.589 5.571   -4.474  1.00 0.00 ? 66  MET A HE3  1  
ATOM 659   N N    . GLU A 1 49  ? -12.391 11.033  -5.919  1.00 0.00 ? 67  GLU A N    1  
ATOM 660   C CA   . GLU A 1 49  ? -13.019 11.594  -7.111  1.00 0.00 ? 67  GLU A CA   1  
ATOM 661   C C    . GLU A 1 49  ? -12.197 12.755  -7.663  1.00 0.00 ? 67  GLU A C    1  
ATOM 662   O O    . GLU A 1 49  ? -12.287 13.088  -8.845  1.00 0.00 ? 67  GLU A O    1  
ATOM 663   C CB   . GLU A 1 49  ? -14.439 12.067  -6.791  1.00 0.00 ? 67  GLU A CB   1  
ATOM 664   C CG   . GLU A 1 49  ? -15.258 11.052  -6.013  1.00 0.00 ? 67  GLU A CG   1  
ATOM 665   C CD   . GLU A 1 49  ? -16.684 10.943  -6.517  1.00 0.00 ? 67  GLU A CD   1  
ATOM 666   O OE1  . GLU A 1 49  ? -16.888 11.034  -7.745  1.00 0.00 ? 67  GLU A OE1  1  
ATOM 667   O OE2  . GLU A 1 49  ? -17.596 10.767  -5.682  1.00 0.00 ? 67  GLU A OE2  1  
ATOM 668   H H    . GLU A 1 49  ? -12.887 11.029  -5.074  1.00 0.00 ? 67  GLU A H    1  
ATOM 669   H HA   . GLU A 1 49  ? -13.068 10.816  -7.857  1.00 0.00 ? 67  GLU A HA   1  
ATOM 670   H HB3  . GLU A 1 49  ? -14.952 12.277  -7.718  1.00 0.00 ? 67  GLU A HB3  1  
ATOM 671   H HG3  . GLU A 1 49  ? -15.280 11.346  -4.974  1.00 0.00 ? 67  GLU A HG3  1  
ATOM 672   N N    . LYS A 1 50  ? -11.395 13.368  -6.799  1.00 0.00 ? 68  LYS A N    1  
ATOM 673   C CA   . LYS A 1 50  ? -10.555 14.491  -7.199  1.00 0.00 ? 68  LYS A CA   1  
ATOM 674   C C    . LYS A 1 50  ? -9.373  14.016  -8.038  1.00 0.00 ? 68  LYS A C    1  
ATOM 675   O O    . LYS A 1 50  ? -9.045  14.615  -9.061  1.00 0.00 ? 68  LYS A O    1  
ATOM 676   C CB   . LYS A 1 50  ? -10.049 15.240  -5.964  1.00 0.00 ? 68  LYS A CB   1  
ATOM 677   C CG   . LYS A 1 50  ? -9.587  16.657  -6.259  1.00 0.00 ? 68  LYS A CG   1  
ATOM 678   C CD   . LYS A 1 50  ? -9.351  17.444  -4.982  1.00 0.00 ? 68  LYS A CD   1  
ATOM 679   C CE   . LYS A 1 50  ? -10.624 18.127  -4.504  1.00 0.00 ? 68  LYS A CE   1  
ATOM 680   N NZ   . LYS A 1 50  ? -10.513 18.579  -3.089  1.00 0.00 ? 68  LYS A NZ   1  
ATOM 681   H H    . LYS A 1 50  ? -11.366 13.056  -5.870  1.00 0.00 ? 68  LYS A H    1  
ATOM 682   H HA   . LYS A 1 50  ? -11.158 15.161  -7.794  1.00 0.00 ? 68  LYS A HA   1  
ATOM 683   H HB3  . LYS A 1 50  ? -9.219  14.694  -5.542  1.00 0.00 ? 68  LYS A HB3  1  
ATOM 684   H HG3  . LYS A 1 50  ? -10.346 17.158  -6.845  1.00 0.00 ? 68  LYS A HG3  1  
ATOM 685   H HD3  . LYS A 1 50  ? -8.598  18.197  -5.167  1.00 0.00 ? 68  LYS A HD3  1  
ATOM 686   H HE3  . LYS A 1 50  ? -11.444 17.429  -4.587  1.00 0.00 ? 68  LYS A HE3  1  
ATOM 687   H HZ1  . LYS A 1 50  ? -11.384 18.345  -2.571  1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 688   H HZ2  . LYS A 1 50  ? -10.369 19.609  -3.053  1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 689   H HZ3  . LYS A 1 50  ? -9.709  18.111  -2.625  1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 690   N N    . ALA A 1 51  ? -8.739  12.934  -7.597  1.00 0.00 ? 69  ALA A N    1  
ATOM 691   C CA   . ALA A 1 51  ? -7.596  12.376  -8.310  1.00 0.00 ? 69  ALA A CA   1  
ATOM 692   C C    . ALA A 1 51  ? -8.016  11.804  -9.660  1.00 0.00 ? 69  ALA A C    1  
ATOM 693   O O    . ALA A 1 51  ? -7.184  11.599  -10.546 1.00 0.00 ? 69  ALA A O    1  
ATOM 694   C CB   . ALA A 1 51  ? -6.920  11.304  -7.468  1.00 0.00 ? 69  ALA A CB   1  
ATOM 695   H H    . ALA A 1 51  ? -9.047  12.500  -6.775  1.00 0.00 ? 69  ALA A H    1  
ATOM 696   H HA   . ALA A 1 51  ? -6.883  13.172  -8.474  1.00 0.00 ? 69  ALA A HA   1  
ATOM 697   H HB1  . ALA A 1 51  ? -6.706  10.444  -8.085  1.00 0.00 ? 69  ALA A HB1  1  
ATOM 698   H HB2  . ALA A 1 51  ? -5.999  11.694  -7.061  1.00 0.00 ? 69  ALA A HB2  1  
ATOM 699   H HB3  . ALA A 1 51  ? -7.576  11.015  -6.661  1.00 0.00 ? 69  ALA A HB3  1  
ATOM 700   N N    . LEU A 1 52  ? -9.311  11.548  -9.810  1.00 0.00 ? 70  LEU A N    1  
ATOM 701   C CA   . LEU A 1 52  ? -9.841  10.998  -11.053 1.00 0.00 ? 70  LEU A CA   1  
ATOM 702   C C    . LEU A 1 52  ? -9.426  11.850  -12.247 1.00 0.00 ? 70  LEU A C    1  
ATOM 703   O O    . LEU A 1 52  ? -9.159  11.331  -13.331 1.00 0.00 ? 70  LEU A O    1  
ATOM 704   C CB   . LEU A 1 52  ? -11.367 10.907  -10.983 1.00 0.00 ? 70  LEU A CB   1  
ATOM 705   C CG   . LEU A 1 52  ? -12.073 10.467  -12.266 1.00 0.00 ? 70  LEU A CG   1  
ATOM 706   C CD1  . LEU A 1 52  ? -12.312 8.965   -12.255 1.00 0.00 ? 70  LEU A CD1  1  
ATOM 707   C CD2  . LEU A 1 52  ? -13.386 11.217  -12.436 1.00 0.00 ? 70  LEU A CD2  1  
ATOM 708   H H    . LEU A 1 52  ? -9.924  11.731  -9.070  1.00 0.00 ? 70  LEU A H    1  
ATOM 709   H HA   . LEU A 1 52  ? -9.435  10.004  -11.177 1.00 0.00 ? 70  LEU A HA   1  
ATOM 710   H HB3  . LEU A 1 52  ? -11.743 11.883  -10.715 1.00 0.00 ? 70  LEU A HB3  1  
ATOM 711   H HG   . LEU A 1 52  ? -11.442 10.699  -13.114 1.00 0.00 ? 70  LEU A HG   1  
ATOM 712   H HD11 . LEU A 1 52  ? -12.869 8.683   -13.136 1.00 0.00 ? 70  LEU A HD11 1  
ATOM 713   H HD12 . LEU A 1 52  ? -12.874 8.696   -11.372 1.00 0.00 ? 70  LEU A HD12 1  
ATOM 714   H HD13 . LEU A 1 52  ? -11.363 8.450   -12.249 1.00 0.00 ? 70  LEU A HD13 1  
ATOM 715   H HD21 . LEU A 1 52  ? -13.566 11.829  -11.564 1.00 0.00 ? 70  LEU A HD21 1  
ATOM 716   H HD22 . LEU A 1 52  ? -14.193 10.507  -12.549 1.00 0.00 ? 70  LEU A HD22 1  
ATOM 717   H HD23 . LEU A 1 52  ? -13.331 11.844  -13.312 1.00 0.00 ? 70  LEU A HD23 1  
ATOM 718   N N    . SER A 1 53  ? -9.371  13.162  -12.041 1.00 0.00 ? 71  SER A N    1  
ATOM 719   C CA   . SER A 1 53  ? -8.990  14.088  -13.101 1.00 0.00 ? 71  SER A CA   1  
ATOM 720   C C    . SER A 1 53  ? -7.479  14.295  -13.123 1.00 0.00 ? 71  SER A C    1  
ATOM 721   O O    . SER A 1 53  ? -6.929  14.832  -14.085 1.00 0.00 ? 71  SER A O    1  
ATOM 722   C CB   . SER A 1 53  ? -9.698  15.431  -12.913 1.00 0.00 ? 71  SER A CB   1  
ATOM 723   O OG   . SER A 1 53  ? -9.503  16.272  -14.037 1.00 0.00 ? 71  SER A OG   1  
ATOM 724   H H    . SER A 1 53  ? -9.596  13.517  -11.155 1.00 0.00 ? 71  SER A H    1  
ATOM 725   H HA   . SER A 1 53  ? -9.296  13.657  -14.042 1.00 0.00 ? 71  SER A HA   1  
ATOM 726   H HB3  . SER A 1 53  ? -9.302  15.924  -12.037 1.00 0.00 ? 71  SER A HB3  1  
ATOM 727   H HG   . SER A 1 53  ? -8.611  16.626  -14.021 1.00 0.00 ? 71  SER A HG   1  
ATOM 728   N N    . ILE A 1 54  ? -6.813  13.867  -12.056 1.00 0.00 ? 72  ILE A N    1  
ATOM 729   C CA   . ILE A 1 54  ? -5.366  14.004  -11.951 1.00 0.00 ? 72  ILE A CA   1  
ATOM 730   C C    . ILE A 1 54  ? -4.654  12.848  -12.645 1.00 0.00 ? 72  ILE A C    1  
ATOM 731   O O    . ILE A 1 54  ? -3.496  12.969  -13.046 1.00 0.00 ? 72  ILE A O    1  
ATOM 732   C CB   . ILE A 1 54  ? -4.911  14.067  -10.482 1.00 0.00 ? 72  ILE A CB   1  
ATOM 733   C CG1  . ILE A 1 54  ? -5.711  15.126  -9.722  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 734   C CG2  . ILE A 1 54  ? -3.420  14.364  -10.402 1.00 0.00 ? 72  ILE A CG2  1  
ATOM 735   C CD1  . ILE A 1 54  ? -5.327  15.242  -8.264  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 736   H H    . ILE A 1 54  ? -7.307  13.448  -11.320 1.00 0.00 ? 72  ILE A H    1  
ATOM 737   H HA   . ILE A 1 54  ? -5.083  14.928  -12.435 1.00 0.00 ? 72  ILE A HA   1  
ATOM 738   H HB   . ILE A 1 54  ? -5.085  13.102  -10.032 1.00 0.00 ? 72  ILE A HB   1  
ATOM 739   H HG13 . ILE A 1 54  ? -6.762  14.874  -9.769  1.00 0.00 ? 72  ILE A HG13 1  
ATOM 740   H HG21 . ILE A 1 54  ? -3.264  15.264  -9.825  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 741   H HG22 . ILE A 1 54  ? -2.914  13.540  -9.923  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 742   H HG23 . ILE A 1 54  ? -3.026  14.500  -11.398 1.00 0.00 ? 72  ILE A HG23 1  
ATOM 743   H HD11 . ILE A 1 54  ? -5.162  14.257  -7.854  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 744   H HD12 . ILE A 1 54  ? -4.423  15.827  -8.174  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 745   H HD13 . ILE A 1 54  ? -6.124  15.729  -7.718  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 746   N N    . GLY A 1 55  ? -5.352  11.727  -12.783 1.00 0.00 ? 73  GLY A N    1  
ATOM 747   C CA   . GLY A 1 55  ? -4.772  10.564  -13.429 1.00 0.00 ? 73  GLY A CA   1  
ATOM 748   C C    . GLY A 1 55  ? -4.710  9.360   -12.511 1.00 0.00 ? 73  GLY A C    1  
ATOM 749   O O    . GLY A 1 55  ? -3.635  8.812   -12.264 1.00 0.00 ? 73  GLY A O    1  
ATOM 750   H H    . GLY A 1 55  ? -6.272  11.687  -12.443 1.00 0.00 ? 73  GLY A H    1  
ATOM 751   H HA2  . GLY A 1 55  ? -5.365  10.313  -14.296 1.00 0.00 ? 73  GLY A HA2  1  
ATOM 752   H HA3  . GLY A 1 55  ? -3.769  10.809  -13.750 1.00 0.00 ? 73  GLY A HA3  1  
ATOM 753   N N    . PHE A 1 56  ? -5.866  8.946   -12.002 1.00 0.00 ? 74  PHE A N    1  
ATOM 754   C CA   . PHE A 1 56  ? -5.939  7.801   -11.103 1.00 0.00 ? 74  PHE A CA   1  
ATOM 755   C C    . PHE A 1 56  ? -6.925  6.760   -11.627 1.00 0.00 ? 74  PHE A C    1  
ATOM 756   O O    . PHE A 1 56  ? -7.926  6.457   -10.977 1.00 0.00 ? 74  PHE A O    1  
ATOM 757   C CB   . PHE A 1 56  ? -6.353  8.251   -9.701  1.00 0.00 ? 74  PHE A CB   1  
ATOM 758   C CG   . PHE A 1 56  ? -5.911  7.312   -8.615  1.00 0.00 ? 74  PHE A CG   1  
ATOM 759   C CD1  . PHE A 1 56  ? -4.672  7.460   -8.013  1.00 0.00 ? 74  PHE A CD1  1  
ATOM 760   C CD2  . PHE A 1 56  ? -6.736  6.280   -8.196  1.00 0.00 ? 74  PHE A CD2  1  
ATOM 761   C CE1  . PHE A 1 56  ? -4.262  6.598   -7.013  1.00 0.00 ? 74  PHE A CE1  1  
ATOM 762   C CE2  . PHE A 1 56  ? -6.332  5.415   -7.196  1.00 0.00 ? 74  PHE A CE2  1  
ATOM 763   C CZ   . PHE A 1 56  ? -5.094  5.574   -6.605  1.00 0.00 ? 74  PHE A CZ   1  
ATOM 764   H H    . PHE A 1 56  ? -6.689  9.423   -12.236 1.00 0.00 ? 74  PHE A H    1  
ATOM 765   H HA   . PHE A 1 56  ? -4.958  7.355   -11.054 1.00 0.00 ? 74  PHE A HA   1  
ATOM 766   H HB3  . PHE A 1 56  ? -7.429  8.328   -9.658  1.00 0.00 ? 74  PHE A HB3  1  
ATOM 767   H HD1  . PHE A 1 56  ? -4.021  8.263   -8.333  1.00 0.00 ? 74  PHE A HD1  1  
ATOM 768   H HD2  . PHE A 1 56  ? -7.703  6.154   -8.658  1.00 0.00 ? 74  PHE A HD2  1  
ATOM 769   H HE1  . PHE A 1 56  ? -3.294  6.726   -6.554  1.00 0.00 ? 74  PHE A HE1  1  
ATOM 770   H HE2  . PHE A 1 56  ? -6.983  4.614   -6.879  1.00 0.00 ? 74  PHE A HE2  1  
ATOM 771   H HZ   . PHE A 1 56  ? -4.776  4.900   -5.824  1.00 0.00 ? 74  PHE A HZ   1  
ATOM 772   N N    . GLU A 1 57  ? -6.635  6.219   -12.805 1.00 0.00 ? 75  GLU A N    1  
ATOM 773   C CA   . GLU A 1 57  ? -7.496  5.214   -13.418 1.00 0.00 ? 75  GLU A CA   1  
ATOM 774   C C    . GLU A 1 57  ? -7.242  3.837   -12.810 1.00 0.00 ? 75  GLU A C    1  
ATOM 775   O O    . GLU A 1 57  ? -6.121  3.328   -12.842 1.00 0.00 ? 75  GLU A O    1  
ATOM 776   C CB   . GLU A 1 57  ? -7.269  5.167   -14.929 1.00 0.00 ? 75  GLU A CB   1  
ATOM 777   C CG   . GLU A 1 57  ? -5.849  4.794   -15.320 1.00 0.00 ? 75  GLU A CG   1  
ATOM 778   C CD   . GLU A 1 57  ? -5.534  5.128   -16.765 1.00 0.00 ? 75  GLU A CD   1  
ATOM 779   O OE1  . GLU A 1 57  ? -5.242  6.308   -17.051 1.00 0.00 ? 75  GLU A OE1  1  
ATOM 780   O OE2  . GLU A 1 57  ? -5.578  4.209   -17.609 1.00 0.00 ? 75  GLU A OE2  1  
ATOM 781   H H    . GLU A 1 57  ? -5.822  6.502   -13.275 1.00 0.00 ? 75  GLU A H    1  
ATOM 782   H HA   . GLU A 1 57  ? -8.521  5.495   -13.226 1.00 0.00 ? 75  GLU A HA   1  
ATOM 783   H HB3  . GLU A 1 57  ? -7.490  6.138   -15.344 1.00 0.00 ? 75  GLU A HB3  1  
ATOM 784   H HG3  . GLU A 1 57  ? -5.715  3.732   -15.173 1.00 0.00 ? 75  GLU A HG3  1  
ATOM 785   N N    . THR A 1 58  ? -8.293  3.239   -12.256 1.00 0.00 ? 76  THR A N    1  
ATOM 786   C CA   . THR A 1 58  ? -8.184  1.922   -11.640 1.00 0.00 ? 76  THR A CA   1  
ATOM 787   C C    . THR A 1 58  ? -9.502  1.162   -11.732 1.00 0.00 ? 76  THR A C    1  
ATOM 788   O O    . THR A 1 58  ? -10.568 1.711   -11.454 1.00 0.00 ? 76  THR A O    1  
ATOM 789   C CB   . THR A 1 58  ? -7.769  2.027   -10.160 1.00 0.00 ? 76  THR A CB   1  
ATOM 790   O OG1  . THR A 1 58  ? -8.781  2.712   -9.414  1.00 0.00 ? 76  THR A OG1  1  
ATOM 791   C CG2  . THR A 1 58  ? -6.444  2.762   -10.021 1.00 0.00 ? 76  THR A CG2  1  
ATOM 792   H H    . THR A 1 58  ? -9.159  3.695   -12.261 1.00 0.00 ? 76  THR A H    1  
ATOM 793   H HA   . THR A 1 58  ? -7.422  1.368   -12.167 1.00 0.00 ? 76  THR A HA   1  
ATOM 794   H HB   . THR A 1 58  ? -7.653  1.029   -9.763  1.00 0.00 ? 76  THR A HB   1  
ATOM 795   H HG1  . THR A 1 58  ? -8.899  3.595   -9.770  1.00 0.00 ? 76  THR A HG1  1  
ATOM 796   H HG21 . THR A 1 58  ? -6.034  2.583   -9.037  1.00 0.00 ? 76  THR A HG21 1  
ATOM 797   H HG22 . THR A 1 58  ? -6.605  3.821   -10.157 1.00 0.00 ? 76  THR A HG22 1  
ATOM 798   H HG23 . THR A 1 58  ? -5.753  2.404   -10.769 1.00 0.00 ? 76  THR A HG23 1  
ATOM 799   N N    . CYS A 1 59  ? -9.422  -0.106  -12.125 1.00 0.00 ? 77  CYS A N    1  
ATOM 800   C CA   . CYS A 1 59  ? -10.608 -0.943  -12.254 1.00 0.00 ? 77  CYS A CA   1  
ATOM 801   C C    . CYS A 1 59  ? -10.828 -1.774  -10.993 1.00 0.00 ? 77  CYS A C    1  
ATOM 802   O O    . CYS A 1 59  ? -11.408 -2.859  -11.045 1.00 0.00 ? 77  CYS A O    1  
ATOM 803   C CB   . CYS A 1 59  ? -10.477 -1.864  -13.468 1.00 0.00 ? 77  CYS A CB   1  
ATOM 804   S SG   . CYS A 1 59  ? -12.067 -2.309  -14.238 1.00 0.00 ? 77  CYS A SG   1  
ATOM 805   H H    . CYS A 1 59  ? -8.543  -0.488  -12.332 1.00 0.00 ? 77  CYS A H    1  
ATOM 806   H HA   . CYS A 1 59  ? -11.459 -0.294  -12.395 1.00 0.00 ? 77  CYS A HA   1  
ATOM 807   H HB3  . CYS A 1 59  ? -9.990  -2.779  -13.167 1.00 0.00 ? 77  CYS A HB3  1  
ATOM 808   N N    . ARG A 1 60  ? -10.360 -1.257  -9.862  1.00 0.00 ? 78  ARG A N    1  
ATOM 809   C CA   . ARG A 1 60  ? -10.505 -1.951  -8.588  1.00 0.00 ? 78  ARG A CA   1  
ATOM 810   C C    . ARG A 1 60  ? -10.697 -0.957  -7.446  1.00 0.00 ? 78  ARG A C    1  
ATOM 811   O O    . ARG A 1 60  ? -9.777  -0.218  -7.092  1.00 0.00 ? 78  ARG A O    1  
ATOM 812   C CB   . ARG A 1 60  ? -9.279  -2.825  -8.317  1.00 0.00 ? 78  ARG A CB   1  
ATOM 813   C CG   . ARG A 1 60  ? -9.319  -4.168  -9.031  1.00 0.00 ? 78  ARG A CG   1  
ATOM 814   C CD   . ARG A 1 60  ? -8.586  -4.113  -10.361 1.00 0.00 ? 78  ARG A CD   1  
ATOM 815   N NE   . ARG A 1 60  ? -7.983  -5.398  -10.708 1.00 0.00 ? 78  ARG A NE   1  
ATOM 816   C CZ   . ARG A 1 60  ? -7.053  -5.544  -11.645 1.00 0.00 ? 78  ARG A CZ   1  
ATOM 817   N NH1  . ARG A 1 60  ? -6.621  -4.492  -12.325 1.00 0.00 ? 78  ARG A NH1  1  
ATOM 818   N NH2  . ARG A 1 60  ? -6.552  -6.746  -11.902 1.00 0.00 ? 78  ARG A NH2  1  
ATOM 819   H H    . ARG A 1 60  ? -9.907  -0.389  -9.884  1.00 0.00 ? 78  ARG A H    1  
ATOM 820   H HA   . ARG A 1 60  ? -11.379 -2.582  -8.651  1.00 0.00 ? 78  ARG A HA   1  
ATOM 821   H HB3  . ARG A 1 60  ? -9.210  -3.008  -7.256  1.00 0.00 ? 78  ARG A HB3  1  
ATOM 822   H HG3  . ARG A 1 60  ? -10.348 -4.440  -9.207  1.00 0.00 ? 78  ARG A HG3  1  
ATOM 823   H HD3  . ARG A 1 60  ? -7.808  -3.366  -10.298 1.00 0.00 ? 78  ARG A HD3  1  
ATOM 824   H HE   . ARG A 1 60  ? -8.288  -6.188  -10.216 1.00 0.00 ? 78  ARG A HE   1  
ATOM 825   H HH11 . ARG A 1 60  ? -6.995  -3.585  -12.132 1.00 0.00 ? 78  ARG A HH11 1  
ATOM 826   H HH12 . ARG A 1 60  ? -5.920  -4.605  -13.030 1.00 0.00 ? 78  ARG A HH12 1  
ATOM 827   H HH21 . ARG A 1 60  ? -6.876  -7.542  -11.391 1.00 0.00 ? 78  ARG A HH21 1  
ATOM 828   H HH22 . ARG A 1 60  ? -5.854  -6.856  -12.607 1.00 0.00 ? 78  ARG A HH22 1  
ATOM 829   N N    . TYR A 1 61  ? -11.895 -0.945  -6.874  1.00 0.00 ? 79  TYR A N    1  
ATOM 830   C CA   . TYR A 1 61  ? -12.208 -0.040  -5.774  1.00 0.00 ? 79  TYR A CA   1  
ATOM 831   C C    . TYR A 1 61  ? -11.185 -0.175  -4.650  1.00 0.00 ? 79  TYR A C    1  
ATOM 832   O O    . TYR A 1 61  ? -10.337 -1.066  -4.671  1.00 0.00 ? 79  TYR A O    1  
ATOM 833   C CB   . TYR A 1 61  ? -13.612 -0.323  -5.237  1.00 0.00 ? 79  TYR A CB   1  
ATOM 834   C CG   . TYR A 1 61  ? -13.881 -1.790  -4.990  1.00 0.00 ? 79  TYR A CG   1  
ATOM 835   C CD1  . TYR A 1 61  ? -13.208 -2.482  -3.992  1.00 0.00 ? 79  TYR A CD1  1  
ATOM 836   C CD2  . TYR A 1 61  ? -14.812 -2.485  -5.753  1.00 0.00 ? 79  TYR A CD2  1  
ATOM 837   C CE1  . TYR A 1 61  ? -13.450 -3.822  -3.762  1.00 0.00 ? 79  TYR A CE1  1  
ATOM 838   C CE2  . TYR A 1 61  ? -15.063 -3.824  -5.531  1.00 0.00 ? 79  TYR A CE2  1  
ATOM 839   C CZ   . TYR A 1 61  ? -14.379 -4.489  -4.534  1.00 0.00 ? 79  TYR A CZ   1  
ATOM 840   O OH   . TYR A 1 61  ? -14.625 -5.824  -4.308  1.00 0.00 ? 79  TYR A OH   1  
ATOM 841   H H    . TYR A 1 61  ? -12.587 -1.559  -7.200  1.00 0.00 ? 79  TYR A H    1  
ATOM 842   H HA   . TYR A 1 61  ? -12.175 0.969   -6.156  1.00 0.00 ? 79  TYR A HA   1  
ATOM 843   H HB3  . TYR A 1 61  ? -14.341 0.032   -5.951  1.00 0.00 ? 79  TYR A HB3  1  
ATOM 844   H HD1  . TYR A 1 61  ? -12.482 -1.956  -3.388  1.00 0.00 ? 79  TYR A HD1  1  
ATOM 845   H HD2  . TYR A 1 61  ? -15.346 -1.961  -6.533  1.00 0.00 ? 79  TYR A HD2  1  
ATOM 846   H HE1  . TYR A 1 61  ? -12.915 -4.343  -2.982  1.00 0.00 ? 79  TYR A HE1  1  
ATOM 847   H HE2  . TYR A 1 61  ? -15.789 -4.347  -6.135  1.00 0.00 ? 79  TYR A HE2  1  
ATOM 848   H HH   . TYR A 1 61  ? -15.245 -5.917  -3.581  1.00 0.00 ? 79  TYR A HH   1  
ATOM 849   N N    . GLY A 1 62  ? -11.273 0.718   -3.668  1.00 0.00 ? 80  GLY A N    1  
ATOM 850   C CA   . GLY A 1 62  ? -10.351 0.682   -2.548  1.00 0.00 ? 80  GLY A CA   1  
ATOM 851   C C    . GLY A 1 62  ? -10.985 1.165   -1.259  1.00 0.00 ? 80  GLY A C    1  
ATOM 852   O O    . GLY A 1 62  ? -12.166 1.512   -1.232  1.00 0.00 ? 80  GLY A O    1  
ATOM 853   H H    . GLY A 1 62  ? -11.971 1.406   -3.705  1.00 0.00 ? 80  GLY A H    1  
ATOM 854   H HA2  . GLY A 1 62  ? -10.008 -0.333  -2.411  1.00 0.00 ? 80  GLY A HA2  1  
ATOM 855   H HA3  . GLY A 1 62  ? -9.503  1.309   -2.776  1.00 0.00 ? 80  GLY A HA3  1  
ATOM 856   N N    . PHE A 1 63  ? -10.200 1.187   -0.188  1.00 0.00 ? 81  PHE A N    1  
ATOM 857   C CA   . PHE A 1 63  ? -10.693 1.629   1.112   1.00 0.00 ? 81  PHE A CA   1  
ATOM 858   C C    . PHE A 1 63  ? -10.281 3.073   1.388   1.00 0.00 ? 81  PHE A C    1  
ATOM 859   O O    . PHE A 1 63  ? -9.182  3.494   1.028   1.00 0.00 ? 81  PHE A O    1  
ATOM 860   C CB   . PHE A 1 63  ? -10.163 0.716   2.219   1.00 0.00 ? 81  PHE A CB   1  
ATOM 861   C CG   . PHE A 1 63  ? -10.609 -0.712  2.083   1.00 0.00 ? 81  PHE A CG   1  
ATOM 862   C CD1  . PHE A 1 63  ? -11.922 -1.015  1.761   1.00 0.00 ? 81  PHE A CD1  1  
ATOM 863   C CD2  . PHE A 1 63  ? -9.714  -1.752  2.276   1.00 0.00 ? 81  PHE A CD2  1  
ATOM 864   C CE1  . PHE A 1 63  ? -12.335 -2.328  1.634   1.00 0.00 ? 81  PHE A CE1  1  
ATOM 865   C CE2  . PHE A 1 63  ? -10.120 -3.067  2.149   1.00 0.00 ? 81  PHE A CE2  1  
ATOM 866   C CZ   . PHE A 1 63  ? -11.433 -3.355  1.829   1.00 0.00 ? 81  PHE A CZ   1  
ATOM 867   H H    . PHE A 1 63  ? -9.267  0.899   -0.272  1.00 0.00 ? 81  PHE A H    1  
ATOM 868   H HA   . PHE A 1 63  ? -11.771 1.572   1.094   1.00 0.00 ? 81  PHE A HA   1  
ATOM 869   H HB3  . PHE A 1 63  ? -10.509 1.083   3.174   1.00 0.00 ? 81  PHE A HB3  1  
ATOM 870   H HD1  . PHE A 1 63  ? -12.629 -0.212  1.608   1.00 0.00 ? 81  PHE A HD1  1  
ATOM 871   H HD2  . PHE A 1 63  ? -8.687  -1.529  2.527   1.00 0.00 ? 81  PHE A HD2  1  
ATOM 872   H HE1  . PHE A 1 63  ? -13.361 -2.549  1.384   1.00 0.00 ? 81  PHE A HE1  1  
ATOM 873   H HE2  . PHE A 1 63  ? -9.414  -3.869  2.303   1.00 0.00 ? 81  PHE A HE2  1  
ATOM 874   H HZ   . PHE A 1 63  ? -11.753 -4.381  1.729   1.00 0.00 ? 81  PHE A HZ   1  
ATOM 875   N N    . ILE A 1 64  ? -11.171 3.823   2.027   1.00 0.00 ? 82  ILE A N    1  
ATOM 876   C CA   . ILE A 1 64  ? -10.900 5.218   2.351   1.00 0.00 ? 82  ILE A CA   1  
ATOM 877   C C    . ILE A 1 64  ? -11.254 5.524   3.803   1.00 0.00 ? 82  ILE A C    1  
ATOM 878   O O    . ILE A 1 64  ? -11.531 4.618   4.588   1.00 0.00 ? 82  ILE A O    1  
ATOM 879   C CB   . ILE A 1 64  ? -11.684 6.172   1.432   1.00 0.00 ? 82  ILE A CB   1  
ATOM 880   C CG1  . ILE A 1 64  ? -13.190 5.992   1.638   1.00 0.00 ? 82  ILE A CG1  1  
ATOM 881   C CG2  . ILE A 1 64  ? -11.311 5.932   -0.024  1.00 0.00 ? 82  ILE A CG2  1  
ATOM 882   C CD1  . ILE A 1 64  ? -13.981 7.269   1.459   1.00 0.00 ? 82  ILE A CD1  1  
ATOM 883   H H    . ILE A 1 64  ? -12.030 3.430   2.288   1.00 0.00 ? 82  ILE A H    1  
ATOM 884   H HA   . ILE A 1 64  ? -9.844  5.396   2.205   1.00 0.00 ? 82  ILE A HA   1  
ATOM 885   H HB   . ILE A 1 64  ? -11.413 7.186   1.685   1.00 0.00 ? 82  ILE A HB   1  
ATOM 886   H HG13 . ILE A 1 64  ? -13.368 5.628   2.639   1.00 0.00 ? 82  ILE A HG13 1  
ATOM 887   H HG21 . ILE A 1 64  ? -10.447 5.284   -0.071  1.00 0.00 ? 82  ILE A HG21 1  
ATOM 888   H HG22 . ILE A 1 64  ? -12.139 5.463   -0.534  1.00 0.00 ? 82  ILE A HG22 1  
ATOM 889   H HG23 . ILE A 1 64  ? -11.081 6.874   -0.497  1.00 0.00 ? 82  ILE A HG23 1  
ATOM 890   H HD11 . ILE A 1 64  ? -13.317 8.065   1.158   1.00 0.00 ? 82  ILE A HD11 1  
ATOM 891   H HD12 . ILE A 1 64  ? -14.736 7.122   0.700   1.00 0.00 ? 82  ILE A HD12 1  
ATOM 892   H HD13 . ILE A 1 64  ? -14.457 7.532   2.393   1.00 0.00 ? 82  ILE A HD13 1  
ATOM 893   N N    . GLU A 1 65  ? -11.246 6.808   4.151   1.00 0.00 ? 83  GLU A N    1  
ATOM 894   C CA   . GLU A 1 65  ? -11.567 7.232   5.508   1.00 0.00 ? 83  GLU A CA   1  
ATOM 895   C C    . GLU A 1 65  ? -12.791 6.488   6.035   1.00 0.00 ? 83  GLU A C    1  
ATOM 896   O O    . GLU A 1 65  ? -12.830 6.076   7.193   1.00 0.00 ? 83  GLU A O    1  
ATOM 897   C CB   . GLU A 1 65  ? -11.818 8.741   5.549   1.00 0.00 ? 83  GLU A CB   1  
ATOM 898   C CG   . GLU A 1 65  ? -12.927 9.199   4.617   1.00 0.00 ? 83  GLU A CG   1  
ATOM 899   C CD   . GLU A 1 65  ? -13.080 10.707  4.589   1.00 0.00 ? 83  GLU A CD   1  
ATOM 900   O OE1  . GLU A 1 65  ? -12.327 11.394  5.313   1.00 0.00 ? 83  GLU A OE1  1  
ATOM 901   O OE2  . GLU A 1 65  ? -13.951 11.203  3.844   1.00 0.00 ? 83  GLU A OE2  1  
ATOM 902   H H    . GLU A 1 65  ? -11.018 7.483   3.479   1.00 0.00 ? 83  GLU A H    1  
ATOM 903   H HA   . GLU A 1 65  ? -10.723 7.000   6.138   1.00 0.00 ? 83  GLU A HA   1  
ATOM 904   H HB3  . GLU A 1 65  ? -10.908 9.252   5.268   1.00 0.00 ? 83  GLU A HB3  1  
ATOM 905   H HG3  . GLU A 1 65  ? -13.860 8.764   4.947   1.00 0.00 ? 83  GLU A HG3  1  
ATOM 906   N N    . GLY A 1 66  ? -13.792 6.322   5.175   1.00 0.00 ? 84  GLY A N    1  
ATOM 907   C CA   . GLY A 1 66  ? -15.005 5.629   5.571   1.00 0.00 ? 84  GLY A CA   1  
ATOM 908   C C    . GLY A 1 66  ? -15.951 5.407   4.409   1.00 0.00 ? 84  GLY A C    1  
ATOM 909   O O    . GLY A 1 66  ? -17.088 5.881   4.425   1.00 0.00 ? 84  GLY A O    1  
ATOM 910   H H    . GLY A 1 66  ? -13.706 6.672   4.263   1.00 0.00 ? 84  GLY A H    1  
ATOM 911   H HA2  . GLY A 1 66  ? -14.737 4.672   5.993   1.00 0.00 ? 84  GLY A HA2  1  
ATOM 912   H HA3  . GLY A 1 66  ? -15.509 6.215   6.325   1.00 0.00 ? 84  GLY A HA3  1  
ATOM 913   N N    . HIS A 1 67  ? -15.483 4.685   3.395   1.00 0.00 ? 85  HIS A N    1  
ATOM 914   C CA   . HIS A 1 67  ? -16.297 4.402   2.218   1.00 0.00 ? 85  HIS A CA   1  
ATOM 915   C C    . HIS A 1 67  ? -15.507 3.591   1.194   1.00 0.00 ? 85  HIS A C    1  
ATOM 916   O O    . HIS A 1 67  ? -14.372 3.189   1.447   1.00 0.00 ? 85  HIS A O    1  
ATOM 917   C CB   . HIS A 1 67  ? -16.788 5.704   1.586   1.00 0.00 ? 85  HIS A CB   1  
ATOM 918   C CG   . HIS A 1 67  ? -18.278 5.851   1.594   1.00 0.00 ? 85  HIS A CG   1  
ATOM 919   N ND1  . HIS A 1 67  ? -19.139 4.796   1.374   1.00 0.00 ? 85  HIS A ND1  1  
ATOM 920   C CD2  . HIS A 1 67  ? -19.060 6.936   1.801   1.00 0.00 ? 85  HIS A CD2  1  
ATOM 921   C CE1  . HIS A 1 67  ? -20.386 5.227   1.443   1.00 0.00 ? 85  HIS A CE1  1  
ATOM 922   N NE2  . HIS A 1 67  ? -20.366 6.522   1.702   1.00 0.00 ? 85  HIS A NE2  1  
ATOM 923   H H    . HIS A 1 67  ? -14.569 4.335   3.441   1.00 0.00 ? 85  HIS A H    1  
ATOM 924   H HA   . HIS A 1 67  ? -17.150 3.823   2.537   1.00 0.00 ? 85  HIS A HA   1  
ATOM 925   H HB3  . HIS A 1 67  ? -16.455 5.746   0.558   1.00 0.00 ? 85  HIS A HB3  1  
ATOM 926   H HD1  . HIS A 1 67  ? -18.875 3.871   1.193   1.00 0.00 ? 85  HIS A HD1  1  
ATOM 927   H HD2  . HIS A 1 67  ? -18.721 7.942   2.006   1.00 0.00 ? 85  HIS A HD2  1  
ATOM 928   H HE1  . HIS A 1 67  ? -21.271 4.624   1.311   1.00 0.00 ? 85  HIS A HE1  1  
ATOM 929   N N    . VAL A 1 68  ? -16.117 3.354   0.038   1.00 0.00 ? 86  VAL A N    1  
ATOM 930   C CA   . VAL A 1 68  ? -15.472 2.592   -1.024  1.00 0.00 ? 86  VAL A CA   1  
ATOM 931   C C    . VAL A 1 68  ? -15.849 3.134   -2.398  1.00 0.00 ? 86  VAL A C    1  
ATOM 932   O O    . VAL A 1 68  ? -16.995 3.012   -2.833  1.00 0.00 ? 86  VAL A O    1  
ATOM 933   C CB   . VAL A 1 68  ? -15.849 1.099   -0.953  1.00 0.00 ? 86  VAL A CB   1  
ATOM 934   C CG1  . VAL A 1 68  ? -15.036 0.294   -1.955  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 935   C CG2  . VAL A 1 68  ? -15.649 0.567   0.458   1.00 0.00 ? 86  VAL A CG2  1  
ATOM 936   H H    . VAL A 1 68  ? -17.023 3.701   -0.105  1.00 0.00 ? 86  VAL A H    1  
ATOM 937   H HA   . VAL A 1 68  ? -14.402 2.677   -0.895  1.00 0.00 ? 86  VAL A HA   1  
ATOM 938   H HB   . VAL A 1 68  ? -16.894 1.000   -1.208  1.00 0.00 ? 86  VAL A HB   1  
ATOM 939   H HG11 . VAL A 1 68  ? -15.028 0.807   -2.907  1.00 0.00 ? 86  VAL A HG11 1  
ATOM 940   H HG12 . VAL A 1 68  ? -14.024 0.186   -1.595  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 941   H HG13 . VAL A 1 68  ? -15.482 -0.682  -2.079  1.00 0.00 ? 86  VAL A HG13 1  
ATOM 942   H HG21 . VAL A 1 68  ? -15.732 -0.510  0.450   1.00 0.00 ? 86  VAL A HG21 1  
ATOM 943   H HG22 . VAL A 1 68  ? -14.669 0.850   0.815   1.00 0.00 ? 86  VAL A HG22 1  
ATOM 944   H HG23 . VAL A 1 68  ? -16.403 0.982   1.110   1.00 0.00 ? 86  VAL A HG23 1  
ATOM 945   N N    . VAL A 1 69  ? -14.878 3.735   -3.079  1.00 0.00 ? 87  VAL A N    1  
ATOM 946   C CA   . VAL A 1 69  ? -15.107 4.295   -4.404  1.00 0.00 ? 87  VAL A CA   1  
ATOM 947   C C    . VAL A 1 69  ? -14.126 3.721   -5.421  1.00 0.00 ? 87  VAL A C    1  
ATOM 948   O O    . VAL A 1 69  ? -13.118 3.119   -5.053  1.00 0.00 ? 87  VAL A O    1  
ATOM 949   C CB   . VAL A 1 69  ? -14.979 5.830   -4.394  1.00 0.00 ? 87  VAL A CB   1  
ATOM 950   C CG1  . VAL A 1 69  ? -15.974 6.443   -3.420  1.00 0.00 ? 87  VAL A CG1  1  
ATOM 951   C CG2  . VAL A 1 69  ? -13.557 6.244   -4.047  1.00 0.00 ? 87  VAL A CG2  1  
ATOM 952   H H    . VAL A 1 69  ? -13.986 3.801   -2.679  1.00 0.00 ? 87  VAL A H    1  
ATOM 953   H HA   . VAL A 1 69  ? -16.113 4.041   -4.705  1.00 0.00 ? 87  VAL A HA   1  
ATOM 954   H HB   . VAL A 1 69  ? -15.207 6.197   -5.384  1.00 0.00 ? 87  VAL A HB   1  
ATOM 955   H HG11 . VAL A 1 69  ? -15.874 5.965   -2.457  1.00 0.00 ? 87  VAL A HG11 1  
ATOM 956   H HG12 . VAL A 1 69  ? -15.777 7.500   -3.321  1.00 0.00 ? 87  VAL A HG12 1  
ATOM 957   H HG13 . VAL A 1 69  ? -16.978 6.296   -3.791  1.00 0.00 ? 87  VAL A HG13 1  
ATOM 958   H HG21 . VAL A 1 69  ? -12.928 5.367   -4.004  1.00 0.00 ? 87  VAL A HG21 1  
ATOM 959   H HG22 . VAL A 1 69  ? -13.183 6.919   -4.803  1.00 0.00 ? 87  VAL A HG22 1  
ATOM 960   H HG23 . VAL A 1 69  ? -13.550 6.740   -3.088  1.00 0.00 ? 87  VAL A HG23 1  
ATOM 961   N N    . ILE A 1 70  ? -14.429 3.913   -6.700  1.00 0.00 ? 88  ILE A N    1  
ATOM 962   C CA   . ILE A 1 70  ? -13.573 3.416   -7.770  1.00 0.00 ? 88  ILE A CA   1  
ATOM 963   C C    . ILE A 1 70  ? -13.620 4.337   -8.984  1.00 0.00 ? 88  ILE A C    1  
ATOM 964   O O    . ILE A 1 70  ? -14.456 4.191   -9.875  1.00 0.00 ? 88  ILE A O    1  
ATOM 965   C CB   . ILE A 1 70  ? -13.980 1.995   -8.203  1.00 0.00 ? 88  ILE A CB   1  
ATOM 966   C CG1  . ILE A 1 70  ? -13.192 1.570   -9.443  1.00 0.00 ? 88  ILE A CG1  1  
ATOM 967   C CG2  . ILE A 1 70  ? -15.477 1.932   -8.471  1.00 0.00 ? 88  ILE A CG2  1  
ATOM 968   C CD1  . ILE A 1 70  ? -13.359 0.108   -9.794  1.00 0.00 ? 88  ILE A CD1  1  
ATOM 969   H H    . ILE A 1 70  ? -15.248 4.400   -6.930  1.00 0.00 ? 88  ILE A H    1  
ATOM 970   H HA   . ILE A 1 70  ? -12.560 3.380   -7.396  1.00 0.00 ? 88  ILE A HA   1  
ATOM 971   H HB   . ILE A 1 70  ? -13.755 1.318   -7.393  1.00 0.00 ? 88  ILE A HB   1  
ATOM 972   H HG13 . ILE A 1 70  ? -12.141 1.754   -9.273  1.00 0.00 ? 88  ILE A HG13 1  
ATOM 973   H HG21 . ILE A 1 70  ? -15.867 2.934   -8.574  1.00 0.00 ? 88  ILE A HG21 1  
ATOM 974   H HG22 . ILE A 1 70  ? -15.655 1.383   -9.384  1.00 0.00 ? 88  ILE A HG22 1  
ATOM 975   H HG23 . ILE A 1 70  ? -15.969 1.435   -7.649  1.00 0.00 ? 88  ILE A HG23 1  
ATOM 976   H HD11 . ILE A 1 70  ? -12.677 -0.151  -10.591 1.00 0.00 ? 88  ILE A HD11 1  
ATOM 977   H HD12 . ILE A 1 70  ? -13.147 -0.497  -8.926  1.00 0.00 ? 88  ILE A HD12 1  
ATOM 978   H HD13 . ILE A 1 70  ? -14.375 -0.070  -10.119 1.00 0.00 ? 88  ILE A HD13 1  
ATOM 979   N N    . PRO A 1 71  ? -12.696 5.310   -9.024  1.00 0.00 ? 89  PRO A N    1  
ATOM 980   C CA   . PRO A 1 71  ? -12.609 6.274   -10.125 1.00 0.00 ? 89  PRO A CA   1  
ATOM 981   C C    . PRO A 1 71  ? -12.128 5.630   -11.421 1.00 0.00 ? 89  PRO A C    1  
ATOM 982   O O    . PRO A 1 71  ? -11.188 4.836   -11.421 1.00 0.00 ? 89  PRO A O    1  
ATOM 983   C CB   . PRO A 1 71  ? -11.585 7.294   -9.623  1.00 0.00 ? 89  PRO A CB   1  
ATOM 984   C CG   . PRO A 1 71  ? -10.749 6.542   -8.646  1.00 0.00 ? 89  PRO A CG   1  
ATOM 985   C CD   . PRO A 1 71  ? -11.667 5.544   -7.997  1.00 0.00 ? 89  PRO A CD   1  
ATOM 986   H HA   . PRO A 1 71  ? -13.555 6.766   -10.297 1.00 0.00 ? 89  PRO A HA   1  
ATOM 987   H HB3  . PRO A 1 71  ? -12.096 8.121   -9.152  1.00 0.00 ? 89  PRO A HB3  1  
ATOM 988   H HG3  . PRO A 1 71  ? -10.351 7.221   -7.905  1.00 0.00 ? 89  PRO A HG3  1  
ATOM 989   H HD3  . PRO A 1 71  ? -12.105 5.960   -7.102  1.00 0.00 ? 89  PRO A HD3  1  
ATOM 990   N N    . ARG A 1 72  ? -12.780 5.979   -12.526 1.00 0.00 ? 90  ARG A N    1  
ATOM 991   C CA   . ARG A 1 72  ? -12.419 5.435   -13.829 1.00 0.00 ? 90  ARG A CA   1  
ATOM 992   C C    . ARG A 1 72  ? -12.285 6.547   -14.865 1.00 0.00 ? 90  ARG A C    1  
ATOM 993   O O    . ARG A 1 72  ? -13.171 7.390   -15.004 1.00 0.00 ? 90  ARG A O    1  
ATOM 994   C CB   . ARG A 1 72  ? -13.467 4.419   -14.290 1.00 0.00 ? 90  ARG A CB   1  
ATOM 995   C CG   . ARG A 1 72  ? -12.871 3.111   -14.784 1.00 0.00 ? 90  ARG A CG   1  
ATOM 996   C CD   . ARG A 1 72  ? -13.231 1.954   -13.864 1.00 0.00 ? 90  ARG A CD   1  
ATOM 997   N NE   . ARG A 1 72  ? -14.474 1.301   -14.264 1.00 0.00 ? 90  ARG A NE   1  
ATOM 998   C CZ   . ARG A 1 72  ? -14.940 0.195   -13.696 1.00 0.00 ? 90  ARG A CZ   1  
ATOM 999   N NH1  . ARG A 1 72  ? -14.268 -0.380  -12.708 1.00 0.00 ? 90  ARG A NH1  1  
ATOM 1000  N NH2  . ARG A 1 72  ? -16.080 -0.339  -14.115 1.00 0.00 ? 90  ARG A NH2  1  
ATOM 1001  H H    . ARG A 1 72  ? -13.522 6.616   -12.463 1.00 0.00 ? 90  ARG A H    1  
ATOM 1002  H HA   . ARG A 1 72  ? -11.467 4.936   -13.729 1.00 0.00 ? 90  ARG A HA   1  
ATOM 1003  H HB3  . ARG A 1 72  ? -14.043 4.854   -15.093 1.00 0.00 ? 90  ARG A HB3  1  
ATOM 1004  H HG3  . ARG A 1 72  ? -11.797 3.208   -14.824 1.00 0.00 ? 90  ARG A HG3  1  
ATOM 1005  H HD3  . ARG A 1 72  ? -13.339 2.331   -12.859 1.00 0.00 ? 90  ARG A HD3  1  
ATOM 1006  H HE   . ARG A 1 72  ? -14.986 1.710   -14.992 1.00 0.00 ? 90  ARG A HE   1  
ATOM 1007  H HH11 . ARG A 1 72  ? -13.409 0.021   -12.389 1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1008  H HH12 . ARG A 1 72  ? -14.621 -1.212  -12.281 1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1009  H HH21 . ARG A 1 72  ? -16.589 0.092   -14.859 1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1010  H HH22 . ARG A 1 72  ? -16.429 -1.172  -13.686 1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1011  N N    . ILE A 1 73  ? -11.171 6.543   -15.590 1.00 0.00 ? 91  ILE A N    1  
ATOM 1012  C CA   . ILE A 1 73  ? -10.921 7.552   -16.611 1.00 0.00 ? 91  ILE A CA   1  
ATOM 1013  C C    . ILE A 1 73  ? -10.917 6.931   -18.005 1.00 0.00 ? 91  ILE A C    1  
ATOM 1014  O O    . ILE A 1 73  ? -11.839 7.146   -18.794 1.00 0.00 ? 91  ILE A O    1  
ATOM 1015  C CB   . ILE A 1 73  ? -9.577  8.269   -16.378 1.00 0.00 ? 91  ILE A CB   1  
ATOM 1016  C CG1  . ILE A 1 73  ? -9.554  8.913   -14.990 1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1017  C CG2  . ILE A 1 73  ? -9.342  9.315   -17.458 1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1018  C CD1  . ILE A 1 73  ? -8.232  8.751   -14.273 1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1019  H H    . ILE A 1 73  ? -10.501 5.845   -15.432 1.00 0.00 ? 91  ILE A H    1  
ATOM 1020  H HA   . ILE A 1 73  ? -11.712 8.285   -16.557 1.00 0.00 ? 91  ILE A HA   1  
ATOM 1021  H HB   . ILE A 1 73  ? -8.788  7.537   -16.441 1.00 0.00 ? 91  ILE A HB   1  
ATOM 1022  H HG13 . ILE A 1 73  ? -10.321 8.461   -14.379 1.00 0.00 ? 91  ILE A HG13 1  
ATOM 1023  H HG21 . ILE A 1 73  ? -9.200  8.825   -18.409 1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1024  H HG22 . ILE A 1 73  ? -10.197 9.970   -17.516 1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1025  H HG23 . ILE A 1 73  ? -8.462  9.892   -17.214 1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1026  H HD11 . ILE A 1 73  ? -8.309  9.167   -13.279 1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1027  H HD12 . ILE A 1 73  ? -7.983  7.703   -14.207 1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1028  H HD13 . ILE A 1 73  ? -7.458  9.270   -14.820 1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1029  N N    . HIS A 1 74  ? -9.876  6.162   -18.302 1.00 0.00 ? 92  HIS A N    1  
ATOM 1030  C CA   . HIS A 1 74  ? -9.753  5.507   -19.600 1.00 0.00 ? 92  HIS A CA   1  
ATOM 1031  C C    . HIS A 1 74  ? -9.715  3.990   -19.444 1.00 0.00 ? 92  HIS A C    1  
ATOM 1032  O O    . HIS A 1 74  ? -8.710  3.338   -19.727 1.00 0.00 ? 92  HIS A O    1  
ATOM 1033  C CB   . HIS A 1 74  ? -8.494  5.989   -20.320 1.00 0.00 ? 92  HIS A CB   1  
ATOM 1034  C CG   . HIS A 1 74  ? -8.601  5.940   -21.814 1.00 0.00 ? 92  HIS A CG   1  
ATOM 1035  N ND1  . HIS A 1 74  ? -7.647  5.354   -22.618 1.00 0.00 ? 92  HIS A ND1  1  
ATOM 1036  C CD2  . HIS A 1 74  ? -9.560  6.406   -22.648 1.00 0.00 ? 92  HIS A CD2  1  
ATOM 1037  C CE1  . HIS A 1 74  ? -8.013  5.465   -23.883 1.00 0.00 ? 92  HIS A CE1  1  
ATOM 1038  N NE2  . HIS A 1 74  ? -9.170  6.098   -23.928 1.00 0.00 ? 92  HIS A NE2  1  
ATOM 1039  H H    . HIS A 1 74  ? -9.173  6.028   -17.632 1.00 0.00 ? 92  HIS A H    1  
ATOM 1040  H HA   . HIS A 1 74  ? -10.618 5.774   -20.188 1.00 0.00 ? 92  HIS A HA   1  
ATOM 1041  H HB3  . HIS A 1 74  ? -7.659  5.369   -20.027 1.00 0.00 ? 92  HIS A HB3  1  
ATOM 1042  H HD1  . HIS A 1 74  ? -6.824  4.924   -22.309 1.00 0.00 ? 92  HIS A HD1  1  
ATOM 1043  H HD2  . HIS A 1 74  ? -10.464 6.925   -22.360 1.00 0.00 ? 92  HIS A HD2  1  
ATOM 1044  H HE1  . HIS A 1 74  ? -7.461  5.098   -24.735 1.00 0.00 ? 92  HIS A HE1  1  
ATOM 1045  N N    . PRO A 1 75  ? -10.835 3.415   -18.980 1.00 0.00 ? 93  PRO A N    1  
ATOM 1046  C CA   . PRO A 1 75  ? -10.955 1.968   -18.775 1.00 0.00 ? 93  PRO A CA   1  
ATOM 1047  C C    . PRO A 1 75  ? -10.984 1.196   -20.090 1.00 0.00 ? 93  PRO A C    1  
ATOM 1048  O O    . PRO A 1 75  ? -10.732 1.758   -21.156 1.00 0.00 ? 93  PRO A O    1  
ATOM 1049  C CB   . PRO A 1 75  ? -12.289 1.823   -18.040 1.00 0.00 ? 93  PRO A CB   1  
ATOM 1050  C CG   . PRO A 1 75  ? -13.072 3.026   -18.438 1.00 0.00 ? 93  PRO A CG   1  
ATOM 1051  C CD   . PRO A 1 75  ? -12.070 4.131   -18.622 1.00 0.00 ? 93  PRO A CD   1  
ATOM 1052  H HA   . PRO A 1 75  ? -10.156 1.588   -18.155 1.00 0.00 ? 93  PRO A HA   1  
ATOM 1053  H HB3  . PRO A 1 75  ? -12.117 1.800   -16.975 1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1054  H HG3  . PRO A 1 75  ? -13.773 3.282   -17.656 1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1055  H HD3  . PRO A 1 75  ? -11.942 4.683   -17.703 1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1056  N N    . ASN A 1 76  ? -11.294 -0.093  -20.008 1.00 0.00 ? 94  ASN A N    1  
ATOM 1057  C CA   . ASN A 1 76  ? -11.356 -0.942  -21.192 1.00 0.00 ? 94  ASN A CA   1  
ATOM 1058  C C    . ASN A 1 76  ? -12.539 -1.902  -21.111 1.00 0.00 ? 94  ASN A C    1  
ATOM 1059  O O    . ASN A 1 76  ? -13.391 -1.782  -20.230 1.00 0.00 ? 94  ASN A O    1  
ATOM 1060  C CB   . ASN A 1 76  ? -10.055 -1.730  -21.349 1.00 0.00 ? 94  ASN A CB   1  
ATOM 1061  C CG   . ASN A 1 76  ? -8.830  -0.836  -21.313 1.00 0.00 ? 94  ASN A CG   1  
ATOM 1062  O OD1  . ASN A 1 76  ? -8.592  -0.054  -22.234 1.00 0.00 ? 94  ASN A OD1  1  
ATOM 1063  N ND2  . ASN A 1 76  ? -8.047  -0.949  -20.247 1.00 0.00 ? 94  ASN A ND2  1  
ATOM 1064  H H    . ASN A 1 76  ? -11.485 -0.484  -19.129 1.00 0.00 ? 94  ASN A H    1  
ATOM 1065  H HA   . ASN A 1 76  ? -11.486 -0.302  -22.052 1.00 0.00 ? 94  ASN A HA   1  
ATOM 1066  H HB3  . ASN A 1 76  ? -10.069 -2.253  -22.294 1.00 0.00 ? 94  ASN A HB3  1  
ATOM 1067  H HD21 . ASN A 1 76  ? -8.298  -1.594  -19.553 1.00 0.00 ? 94  ASN A HD21 1  
ATOM 1068  H HD22 . ASN A 1 76  ? -7.247  -0.383  -20.198 1.00 0.00 ? 94  ASN A HD22 1  
ATOM 1069  N N    . SER A 1 77  ? -12.584 -2.856  -22.035 1.00 0.00 ? 95  SER A N    1  
ATOM 1070  C CA   . SER A 1 77  ? -13.663 -3.837  -22.071 1.00 0.00 ? 95  SER A CA   1  
ATOM 1071  C C    . SER A 1 77  ? -13.574 -4.786  -20.879 1.00 0.00 ? 95  SER A C    1  
ATOM 1072  O O    . SER A 1 77  ? -14.531 -5.493  -20.563 1.00 0.00 ? 95  SER A O    1  
ATOM 1073  C CB   . SER A 1 77  ? -13.614 -4.633  -23.377 1.00 0.00 ? 95  SER A CB   1  
ATOM 1074  O OG   . SER A 1 77  ? -12.536 -5.552  -23.373 1.00 0.00 ? 95  SER A OG   1  
ATOM 1075  H H    . SER A 1 77  ? -11.875 -2.900  -22.711 1.00 0.00 ? 95  SER A H    1  
ATOM 1076  H HA   . SER A 1 77  ? -14.599 -3.301  -22.020 1.00 0.00 ? 95  SER A HA   1  
ATOM 1077  H HB3  . SER A 1 77  ? -13.489 -3.951  -24.206 1.00 0.00 ? 95  SER A HB3  1  
ATOM 1078  H HG   . SER A 1 77  ? -12.800 -6.355  -22.919 1.00 0.00 ? 95  SER A HG   1  
ATOM 1079  N N    . ILE A 1 78  ? -12.419 -4.795  -20.223 1.00 0.00 ? 96  ILE A N    1  
ATOM 1080  C CA   . ILE A 1 78  ? -12.205 -5.656  -19.067 1.00 0.00 ? 96  ILE A CA   1  
ATOM 1081  C C    . ILE A 1 78  ? -12.992 -5.160  -17.859 1.00 0.00 ? 96  ILE A C    1  
ATOM 1082  O O    . ILE A 1 78  ? -13.248 -5.912  -16.919 1.00 0.00 ? 96  ILE A O    1  
ATOM 1083  C CB   . ILE A 1 78  ? -10.713 -5.737  -18.694 1.00 0.00 ? 96  ILE A CB   1  
ATOM 1084  C CG1  . ILE A 1 78  ? -9.875  -6.081  -19.928 1.00 0.00 ? 96  ILE A CG1  1  
ATOM 1085  C CG2  . ILE A 1 78  ? -10.496 -6.769  -17.597 1.00 0.00 ? 96  ILE A CG2  1  
ATOM 1086  C CD1  . ILE A 1 78  ? -8.387  -6.109  -19.659 1.00 0.00 ? 96  ILE A CD1  1  
ATOM 1087  H H    . ILE A 1 78  ? -11.694 -4.209  -20.524 1.00 0.00 ? 96  ILE A H    1  
ATOM 1088  H HA   . ILE A 1 78  ? -12.546 -6.649  -19.323 1.00 0.00 ? 96  ILE A HA   1  
ATOM 1089  H HB   . ILE A 1 78  ? -10.405 -4.774  -18.317 1.00 0.00 ? 96  ILE A HB   1  
ATOM 1090  H HG13 . ILE A 1 78  ? -10.061 -5.345  -20.696 1.00 0.00 ? 96  ILE A HG13 1  
ATOM 1091  H HG21 . ILE A 1 78  ? -10.981 -6.436  -16.691 1.00 0.00 ? 96  ILE A HG21 1  
ATOM 1092  H HG22 . ILE A 1 78  ? -10.918 -7.713  -17.903 1.00 0.00 ? 96  ILE A HG22 1  
ATOM 1093  H HG23 . ILE A 1 78  ? -9.439  -6.886  -17.417 1.00 0.00 ? 96  ILE A HG23 1  
ATOM 1094  H HD11 . ILE A 1 78  ? -7.858  -5.724  -20.519 1.00 0.00 ? 96  ILE A HD11 1  
ATOM 1095  H HD12 . ILE A 1 78  ? -8.165  -5.497  -18.796 1.00 0.00 ? 96  ILE A HD12 1  
ATOM 1096  H HD13 . ILE A 1 78  ? -8.073  -7.125  -19.469 1.00 0.00 ? 96  ILE A HD13 1  
ATOM 1097  N N    . CYS A 1 79  ? -13.376 -3.888  -17.892 1.00 0.00 ? 97  CYS A N    1  
ATOM 1098  C CA   . CYS A 1 79  ? -14.136 -3.290  -16.802 1.00 0.00 ? 97  CYS A CA   1  
ATOM 1099  C C    . CYS A 1 79  ? -15.630 -3.552  -16.971 1.00 0.00 ? 97  CYS A C    1  
ATOM 1100  O O    . CYS A 1 79  ? -16.049 -4.233  -17.908 1.00 0.00 ? 97  CYS A O    1  
ATOM 1101  C CB   . CYS A 1 79  ? -13.877 -1.784  -16.737 1.00 0.00 ? 97  CYS A CB   1  
ATOM 1102  S SG   . CYS A 1 79  ? -12.299 -1.335  -15.944 1.00 0.00 ? 97  CYS A SG   1  
ATOM 1103  H H    . CYS A 1 79  ? -13.142 -3.337  -18.669 1.00 0.00 ? 97  CYS A H    1  
ATOM 1104  H HA   . CYS A 1 79  ? -13.807 -3.743  -15.879 1.00 0.00 ? 97  CYS A HA   1  
ATOM 1105  H HB3  . CYS A 1 79  ? -14.672 -1.312  -16.178 1.00 0.00 ? 97  CYS A HB3  1  
ATOM 1106  N N    . ALA A 1 80  ? -16.429 -3.008  -16.059 1.00 0.00 ? 98  ALA A N    1  
ATOM 1107  C CA   . ALA A 1 80  ? -17.875 -3.181  -16.109 1.00 0.00 ? 98  ALA A CA   1  
ATOM 1108  C C    . ALA A 1 80  ? -18.475 -2.447  -17.303 1.00 0.00 ? 98  ALA A C    1  
ATOM 1109  O O    . ALA A 1 80  ? -18.801 -1.263  -17.217 1.00 0.00 ? 98  ALA A O    1  
ATOM 1110  C CB   . ALA A 1 80  ? -18.509 -2.694  -14.815 1.00 0.00 ? 98  ALA A CB   1  
ATOM 1111  H H    . ALA A 1 80  ? -16.035 -2.475  -15.337 1.00 0.00 ? 98  ALA A H    1  
ATOM 1112  H HA   . ALA A 1 80  ? -18.082 -4.237  -16.207 1.00 0.00 ? 98  ALA A HA   1  
ATOM 1113  H HB1  . ALA A 1 80  ? -17.792 -2.776  -14.010 1.00 0.00 ? 98  ALA A HB1  1  
ATOM 1114  H HB2  . ALA A 1 80  ? -18.810 -1.663  -14.927 1.00 0.00 ? 98  ALA A HB2  1  
ATOM 1115  H HB3  . ALA A 1 80  ? -19.375 -3.299  -14.588 1.00 0.00 ? 98  ALA A HB3  1  
ATOM 1116  N N    . ALA A 1 81  ? -18.617 -3.156  -18.418 1.00 0.00 ? 99  ALA A N    1  
ATOM 1117  C CA   . ALA A 1 81  ? -19.179 -2.572  -19.629 1.00 0.00 ? 99  ALA A CA   1  
ATOM 1118  C C    . ALA A 1 81  ? -18.486 -1.259  -19.978 1.00 0.00 ? 99  ALA A C    1  
ATOM 1119  O O    . ALA A 1 81  ? -19.125 -0.312  -20.435 1.00 0.00 ? 99  ALA A O    1  
ATOM 1120  C CB   . ALA A 1 81  ? -20.675 -2.354  -19.464 1.00 0.00 ? 99  ALA A CB   1  
ATOM 1121  H H    . ALA A 1 81  ? -18.338 -4.095  -18.425 1.00 0.00 ? 99  ALA A H    1  
ATOM 1122  H HA   . ALA A 1 81  ? -19.028 -3.273  -20.438 1.00 0.00 ? 99  ALA A HA   1  
ATOM 1123  H HB1  . ALA A 1 81  ? -21.098 -2.038  -20.407 1.00 0.00 ? 99  ALA A HB1  1  
ATOM 1124  H HB2  . ALA A 1 81  ? -21.141 -3.277  -19.152 1.00 0.00 ? 99  ALA A HB2  1  
ATOM 1125  H HB3  . ALA A 1 81  ? -20.848 -1.593  -18.719 1.00 0.00 ? 99  ALA A HB3  1  
ATOM 1126  N N    . ASN A 1 82  ? -17.176 -1.211  -19.759 1.00 0.00 ? 100 ASN A N    1  
ATOM 1127  C CA   . ASN A 1 82  ? -16.397 -0.012  -20.050 1.00 0.00 ? 100 ASN A CA   1  
ATOM 1128  C C    . ASN A 1 82  ? -17.022 1.215   -19.394 1.00 0.00 ? 100 ASN A C    1  
ATOM 1129  O O    . ASN A 1 82  ? -17.235 2.237   -20.045 1.00 0.00 ? 100 ASN A O    1  
ATOM 1130  C CB   . ASN A 1 82  ? -16.293 0.199   -21.561 1.00 0.00 ? 100 ASN A CB   1  
ATOM 1131  C CG   . ASN A 1 82  ? -15.850 -1.053  -22.292 1.00 0.00 ? 100 ASN A CG   1  
ATOM 1132  O OD1  . ASN A 1 82  ? -16.551 -2.066  -22.292 1.00 0.00 ? 100 ASN A OD1  1  
ATOM 1133  N ND2  . ASN A 1 82  ? -14.682 -0.991  -22.919 1.00 0.00 ? 100 ASN A ND2  1  
ATOM 1134  H H    . ASN A 1 82  ? -16.722 -1.999  -19.394 1.00 0.00 ? 100 ASN A H    1  
ATOM 1135  H HA   . ASN A 1 82  ? -15.406 -0.156  -19.646 1.00 0.00 ? 100 ASN A HA   1  
ATOM 1136  H HB3  . ASN A 1 82  ? -15.576 0.983   -21.761 1.00 0.00 ? 100 ASN A HB3  1  
ATOM 1137  H HD21 . ASN A 1 82  ? -14.177 -0.152  -22.876 1.00 0.00 ? 100 ASN A HD21 1  
ATOM 1138  H HD22 . ASN A 1 82  ? -14.372 -1.786  -23.400 1.00 0.00 ? 100 ASN A HD22 1  
ATOM 1139  N N    . ASN A 1 83  ? -17.314 1.106   -18.102 1.00 0.00 ? 101 ASN A N    1  
ATOM 1140  C CA   . ASN A 1 83  ? -17.915 2.208   -17.358 1.00 0.00 ? 101 ASN A CA   1  
ATOM 1141  C C    . ASN A 1 83  ? -17.021 3.443   -17.399 1.00 0.00 ? 101 ASN A C    1  
ATOM 1142  O O    . ASN A 1 83  ? -16.002 3.464   -18.090 1.00 0.00 ? 101 ASN A O    1  
ATOM 1143  C CB   . ASN A 1 83  ? -18.165 1.793   -15.906 1.00 0.00 ? 101 ASN A CB   1  
ATOM 1144  C CG   . ASN A 1 83  ? -19.469 2.346   -15.365 1.00 0.00 ? 101 ASN A CG   1  
ATOM 1145  O OD1  . ASN A 1 83  ? -19.473 3.235   -14.514 1.00 0.00 ? 101 ASN A OD1  1  
ATOM 1146  N ND2  . ASN A 1 83  ? -20.585 1.820   -15.856 1.00 0.00 ? 101 ASN A ND2  1  
ATOM 1147  H H    . ASN A 1 83  ? -17.120 0.265   -17.638 1.00 0.00 ? 101 ASN A H    1  
ATOM 1148  H HA   . ASN A 1 83  ? -18.859 2.444   -17.824 1.00 0.00 ? 101 ASN A HA   1  
ATOM 1149  H HB3  . ASN A 1 83  ? -17.357 2.156   -15.290 1.00 0.00 ? 101 ASN A HB3  1  
ATOM 1150  H HD21 . ASN A 1 83  ? -20.505 1.114   -16.532 1.00 0.00 ? 101 ASN A HD21 1  
ATOM 1151  H HD22 . ASN A 1 83  ? -21.442 2.159   -15.524 1.00 0.00 ? 101 ASN A HD22 1  
ATOM 1152  N N    . THR A 1 84  ? -17.410 4.472   -16.653 1.00 0.00 ? 102 THR A N    1  
ATOM 1153  C CA   . THR A 1 84  ? -16.645 5.713   -16.604 1.00 0.00 ? 102 THR A CA   1  
ATOM 1154  C C    . THR A 1 84  ? -16.913 6.472   -15.310 1.00 0.00 ? 102 THR A C    1  
ATOM 1155  O O    . THR A 1 84  ? -17.732 6.056   -14.492 1.00 0.00 ? 102 THR A O    1  
ATOM 1156  C CB   . THR A 1 84  ? -16.977 6.624   -17.800 1.00 0.00 ? 102 THR A CB   1  
ATOM 1157  O OG1  . THR A 1 84  ? -18.302 6.354   -18.270 1.00 0.00 ? 102 THR A OG1  1  
ATOM 1158  C CG2  . THR A 1 84  ? -15.980 6.419   -18.930 1.00 0.00 ? 102 THR A CG2  1  
ATOM 1159  H H    . THR A 1 84  ? -18.232 4.395   -16.124 1.00 0.00 ? 102 THR A H    1  
ATOM 1160  H HA   . THR A 1 84  ? -15.596 5.459   -16.651 1.00 0.00 ? 102 THR A HA   1  
ATOM 1161  H HB   . THR A 1 84  ? -16.921 7.654   -17.475 1.00 0.00 ? 102 THR A HB   1  
ATOM 1162  H HG1  . THR A 1 84  ? -18.523 6.967   -18.976 1.00 0.00 ? 102 THR A HG1  1  
ATOM 1163  H HG21 . THR A 1 84  ? -15.996 7.277   -19.585 1.00 0.00 ? 102 THR A HG21 1  
ATOM 1164  H HG22 . THR A 1 84  ? -16.248 5.534   -19.489 1.00 0.00 ? 102 THR A HG22 1  
ATOM 1165  H HG23 . THR A 1 84  ? -14.990 6.298   -18.519 1.00 0.00 ? 102 THR A HG23 1  
ATOM 1166  N N    . GLY A 1 85  ? -16.219 7.592   -15.132 1.00 0.00 ? 103 GLY A N    1  
ATOM 1167  C CA   . GLY A 1 85  ? -16.396 8.393   -13.935 1.00 0.00 ? 103 GLY A CA   1  
ATOM 1168  C C    . GLY A 1 85  ? -16.129 7.607   -12.666 1.00 0.00 ? 103 GLY A C    1  
ATOM 1169  O O    . GLY A 1 85  ? -15.519 6.538   -12.706 1.00 0.00 ? 103 GLY A O    1  
ATOM 1170  H H    . GLY A 1 85  ? -15.579 7.876   -15.818 1.00 0.00 ? 103 GLY A H    1  
ATOM 1171  H HA2  . GLY A 1 85  ? -15.720 9.234   -13.974 1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1172  H HA3  . GLY A 1 85  ? -17.412 8.761   -13.909 1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1173  N N    . VAL A 1 86  ? -16.586 8.137   -11.535 1.00 0.00 ? 104 VAL A N    1  
ATOM 1174  C CA   . VAL A 1 86  ? -16.393 7.478   -10.250 1.00 0.00 ? 104 VAL A CA   1  
ATOM 1175  C C    . VAL A 1 86  ? -17.613 6.645   -9.870  1.00 0.00 ? 104 VAL A C    1  
ATOM 1176  O O    . VAL A 1 86  ? -18.746 7.001   -10.193 1.00 0.00 ? 104 VAL A O    1  
ATOM 1177  C CB   . VAL A 1 86  ? -16.116 8.500   -9.132  1.00 0.00 ? 104 VAL A CB   1  
ATOM 1178  C CG1  . VAL A 1 86  ? -15.846 7.791   -7.814  1.00 0.00 ? 104 VAL A CG1  1  
ATOM 1179  C CG2  . VAL A 1 86  ? -14.950 9.400   -9.511  1.00 0.00 ? 104 VAL A CG2  1  
ATOM 1180  H H    . VAL A 1 86  ? -17.066 8.990   -11.569 1.00 0.00 ? 104 VAL A H    1  
ATOM 1181  H HA   . VAL A 1 86  ? -15.536 6.826   -10.334 1.00 0.00 ? 104 VAL A HA   1  
ATOM 1182  H HB   . VAL A 1 86  ? -16.994 9.117   -9.009  1.00 0.00 ? 104 VAL A HB   1  
ATOM 1183  H HG11 . VAL A 1 86  ? -16.718 7.223   -7.526  1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1184  H HG12 . VAL A 1 86  ? -15.002 7.125   -7.929  1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1185  H HG13 . VAL A 1 86  ? -15.625 8.522   -7.050  1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1186  H HG21 . VAL A 1 86  ? -14.142 9.256   -8.809  1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1187  H HG22 . VAL A 1 86  ? -14.611 9.151   -10.506 1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1188  H HG23 . VAL A 1 86  ? -15.268 10.432  -9.487  1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1189  N N    . TYR A 1 87  ? -17.372 5.534   -9.183  1.00 0.00 ? 105 TYR A N    1  
ATOM 1190  C CA   . TYR A 1 87  ? -18.451 4.648   -8.760  1.00 0.00 ? 105 TYR A CA   1  
ATOM 1191  C C    . TYR A 1 87  ? -18.267 4.220   -7.309  1.00 0.00 ? 105 TYR A C    1  
ATOM 1192  O O    . TYR A 1 87  ? -17.187 3.782   -6.911  1.00 0.00 ? 105 TYR A O    1  
ATOM 1193  C CB   . TYR A 1 87  ? -18.510 3.415   -9.665  1.00 0.00 ? 105 TYR A CB   1  
ATOM 1194  C CG   . TYR A 1 87  ? -19.881 2.783   -9.736  1.00 0.00 ? 105 TYR A CG   1  
ATOM 1195  C CD1  . TYR A 1 87  ? -20.426 2.132   -8.636  1.00 0.00 ? 105 TYR A CD1  1  
ATOM 1196  C CD2  . TYR A 1 87  ? -20.631 2.835   -10.904 1.00 0.00 ? 105 TYR A CD2  1  
ATOM 1197  C CE1  . TYR A 1 87  ? -21.678 1.552   -8.697  1.00 0.00 ? 105 TYR A CE1  1  
ATOM 1198  C CE2  . TYR A 1 87  ? -21.885 2.258   -10.974 1.00 0.00 ? 105 TYR A CE2  1  
ATOM 1199  C CZ   . TYR A 1 87  ? -22.404 1.618   -9.868  1.00 0.00 ? 105 TYR A CZ   1  
ATOM 1200  O OH   . TYR A 1 87  ? -23.652 1.042   -9.933  1.00 0.00 ? 105 TYR A OH   1  
ATOM 1201  H H    . TYR A 1 87  ? -16.448 5.302   -8.956  1.00 0.00 ? 105 TYR A H    1  
ATOM 1202  H HA   . TYR A 1 87  ? -19.381 5.192   -8.849  1.00 0.00 ? 105 TYR A HA   1  
ATOM 1203  H HB3  . TYR A 1 87  ? -17.820 2.672   -9.293  1.00 0.00 ? 105 TYR A HB3  1  
ATOM 1204  H HD1  . TYR A 1 87  ? -19.856 2.084   -7.720  1.00 0.00 ? 105 TYR A HD1  1  
ATOM 1205  H HD2  . TYR A 1 87  ? -20.223 3.337   -11.769 1.00 0.00 ? 105 TYR A HD2  1  
ATOM 1206  H HE1  . TYR A 1 87  ? -22.085 1.051   -7.832  1.00 0.00 ? 105 TYR A HE1  1  
ATOM 1207  H HE2  . TYR A 1 87  ? -22.454 2.309   -11.892 1.00 0.00 ? 105 TYR A HE2  1  
ATOM 1208  H HH   . TYR A 1 87  ? -24.078 1.103   -9.075  1.00 0.00 ? 105 TYR A HH   1  
ATOM 1209  N N    . ILE A 1 88  ? -19.330 4.349   -6.521  1.00 0.00 ? 106 ILE A N    1  
ATOM 1210  C CA   . ILE A 1 88  ? -19.287 3.974   -5.113  1.00 0.00 ? 106 ILE A CA   1  
ATOM 1211  C C    . ILE A 1 88  ? -19.929 2.609   -4.888  1.00 0.00 ? 106 ILE A C    1  
ATOM 1212  O O    . ILE A 1 88  ? -21.011 2.327   -5.405  1.00 0.00 ? 106 ILE A O    1  
ATOM 1213  C CB   . ILE A 1 88  ? -19.999 5.016   -4.231  1.00 0.00 ? 106 ILE A CB   1  
ATOM 1214  C CG1  . ILE A 1 88  ? -19.981 4.574   -2.766  1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1215  C CG2  . ILE A 1 88  ? -21.428 5.226   -4.709  1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1216  C CD1  . ILE A 1 88  ? -20.659 5.551   -1.832  1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1217  H H    . ILE A 1 88  ? -20.162 4.705   -6.896  1.00 0.00 ? 106 ILE A H    1  
ATOM 1218  H HA   . ILE A 1 88  ? -18.249 3.925   -4.813  1.00 0.00 ? 106 ILE A HA   1  
ATOM 1219  H HB   . ILE A 1 88  ? -19.472 5.954   -4.324  1.00 0.00 ? 106 ILE A HB   1  
ATOM 1220  H HG13 . ILE A 1 88  ? -18.956 4.463   -2.445  1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1221  H HG21 . ILE A 1 88  ? -21.960 4.286   -4.682  1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1222  H HG22 . ILE A 1 88  ? -21.922 5.937   -4.063  1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1223  H HG23 . ILE A 1 88  ? -21.418 5.604   -5.720  1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1224  H HD11 . ILE A 1 88  ? -21.529 5.085   -1.392  1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1225  H HD12 . ILE A 1 88  ? -19.971 5.842   -1.052  1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1226  H HD13 . ILE A 1 88  ? -20.965 6.426   -2.387  1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1227  N N    . LEU A 1 89  ? -19.257 1.766   -4.112  1.00 0.00 ? 107 LEU A N    1  
ATOM 1228  C CA   . LEU A 1 89  ? -19.763 0.430   -3.816  1.00 0.00 ? 107 LEU A CA   1  
ATOM 1229  C C    . LEU A 1 89  ? -18.919 -0.245  -2.739  1.00 0.00 ? 107 LEU A C    1  
ATOM 1230  O O    . LEU A 1 89  ? -17.701 -0.362  -2.873  1.00 0.00 ? 107 LEU A O    1  
ATOM 1231  C CB   . LEU A 1 89  ? -19.774 -0.425  -5.084  1.00 0.00 ? 107 LEU A CB   1  
ATOM 1232  C CG   . LEU A 1 89  ? -20.903 -1.450  -5.193  1.00 0.00 ? 107 LEU A CG   1  
ATOM 1233  C CD1  . LEU A 1 89  ? -22.203 -0.771  -5.593  1.00 0.00 ? 107 LEU A CD1  1  
ATOM 1234  C CD2  . LEU A 1 89  ? -20.539 -2.541  -6.191  1.00 0.00 ? 107 LEU A CD2  1  
ATOM 1235  H H    . LEU A 1 89  ? -18.401 2.048   -3.729  1.00 0.00 ? 107 LEU A H    1  
ATOM 1236  H HA   . LEU A 1 89  ? -20.775 0.532   -3.452  1.00 0.00 ? 107 LEU A HA   1  
ATOM 1237  H HB3  . LEU A 1 89  ? -18.835 -0.960  -5.129  1.00 0.00 ? 107 LEU A HB3  1  
ATOM 1238  H HG   . LEU A 1 89  ? -21.053 -1.915  -4.228  1.00 0.00 ? 107 LEU A HG   1  
ATOM 1239  H HD11 . LEU A 1 89  ? -22.452 -1.041  -6.608  1.00 0.00 ? 107 LEU A HD11 1  
ATOM 1240  H HD12 . LEU A 1 89  ? -22.087 0.299   -5.523  1.00 0.00 ? 107 LEU A HD12 1  
ATOM 1241  H HD13 . LEU A 1 89  ? -22.995 -1.091  -4.931  1.00 0.00 ? 107 LEU A HD13 1  
ATOM 1242  H HD21 . LEU A 1 89  ? -20.247 -2.089  -7.127  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 1243  H HD22 . LEU A 1 89  ? -21.394 -3.181  -6.351  1.00 0.00 ? 107 LEU A HD22 1  
ATOM 1244  H HD23 . LEU A 1 89  ? -19.719 -3.126  -5.801  1.00 0.00 ? 107 LEU A HD23 1  
ATOM 1245  N N    . THR A 1 90  ? -19.576 -0.691  -1.673  1.00 0.00 ? 108 THR A N    1  
ATOM 1246  C CA   . THR A 1 90  ? -18.887 -1.357  -0.574  1.00 0.00 ? 108 THR A CA   1  
ATOM 1247  C C    . THR A 1 90  ? -18.065 -2.538  -1.076  1.00 0.00 ? 108 THR A C    1  
ATOM 1248  O O    . THR A 1 90  ? -18.094 -2.868  -2.261  1.00 0.00 ? 108 THR A O    1  
ATOM 1249  C CB   . THR A 1 90  ? -19.880 -1.853  0.492   1.00 0.00 ? 108 THR A CB   1  
ATOM 1250  O OG1  . THR A 1 90  ? -21.115 -1.137  0.383   1.00 0.00 ? 108 THR A OG1  1  
ATOM 1251  C CG2  . THR A 1 90  ? -19.307 -1.676  1.890   1.00 0.00 ? 108 THR A CG2  1  
ATOM 1252  H H    . THR A 1 90  ? -20.546 -0.569  -1.625  1.00 0.00 ? 108 THR A H    1  
ATOM 1253  H HA   . THR A 1 90  ? -18.224 -0.639  -0.113  1.00 0.00 ? 108 THR A HA   1  
ATOM 1254  H HB   . THR A 1 90  ? -20.067 -2.905  0.327   1.00 0.00 ? 108 THR A HB   1  
ATOM 1255  H HG1  . THR A 1 90  ? -21.739 -1.652  -0.136  1.00 0.00 ? 108 THR A HG1  1  
ATOM 1256  H HG21 . THR A 1 90  ? -18.495 -0.964  1.858   1.00 0.00 ? 108 THR A HG21 1  
ATOM 1257  H HG22 . THR A 1 90  ? -18.942 -2.624  2.253   1.00 0.00 ? 108 THR A HG22 1  
ATOM 1258  H HG23 . THR A 1 90  ? -20.079 -1.310  2.551   1.00 0.00 ? 108 THR A HG23 1  
ATOM 1259  N N    . SER A 1 91  ? -17.331 -3.171  -0.167  1.00 0.00 ? 109 SER A N    1  
ATOM 1260  C CA   . SER A 1 91  ? -16.498 -4.316  -0.518  1.00 0.00 ? 109 SER A CA   1  
ATOM 1261  C C    . SER A 1 91  ? -16.836 -5.521  0.354   1.00 0.00 ? 109 SER A C    1  
ATOM 1262  O O    . SER A 1 91  ? -16.145 -5.806  1.332   1.00 0.00 ? 109 SER A O    1  
ATOM 1263  C CB   . SER A 1 91  ? -15.017 -3.959  -0.365  1.00 0.00 ? 109 SER A CB   1  
ATOM 1264  O OG   . SER A 1 91  ? -14.191 -4.979  -0.901  1.00 0.00 ? 109 SER A OG   1  
ATOM 1265  H H    . SER A 1 91  ? -17.350 -2.860  0.763   1.00 0.00 ? 109 SER A H    1  
ATOM 1266  H HA   . SER A 1 91  ? -16.695 -4.565  -1.549  1.00 0.00 ? 109 SER A HA   1  
ATOM 1267  H HB3  . SER A 1 91  ? -14.785 -3.837  0.682   1.00 0.00 ? 109 SER A HB3  1  
ATOM 1268  H HG   . SER A 1 91  ? -14.260 -5.766  -0.356  1.00 0.00 ? 109 SER A HG   1  
ATOM 1269  N N    . ASN A 1 92  ? -17.902 -6.226  -0.010  1.00 0.00 ? 110 ASN A N    1  
ATOM 1270  C CA   . ASN A 1 92  ? -18.332 -7.401  0.739   1.00 0.00 ? 110 ASN A CA   1  
ATOM 1271  C C    . ASN A 1 92  ? -17.351 -8.554  0.551   1.00 0.00 ? 110 ASN A C    1  
ATOM 1272  O O    . ASN A 1 92  ? -17.132 -9.354  1.463   1.00 0.00 ? 110 ASN A O    1  
ATOM 1273  C CB   . ASN A 1 92  ? -19.733 -7.830  0.295   1.00 0.00 ? 110 ASN A CB   1  
ATOM 1274  C CG   . ASN A 1 92  ? -19.766 -8.281  -1.153  1.00 0.00 ? 110 ASN A CG   1  
ATOM 1275  O OD1  . ASN A 1 92  ? -19.651 -9.472  -1.447  1.00 0.00 ? 110 ASN A OD1  1  
ATOM 1276  N ND2  . ASN A 1 92  ? -19.926 -7.330  -2.066  1.00 0.00 ? 110 ASN A ND2  1  
ATOM 1277  H H    . ASN A 1 92  ? -18.412 -5.949  -0.799  1.00 0.00 ? 110 ASN A H    1  
ATOM 1278  H HA   . ASN A 1 92  ? -18.362 -7.135  1.785   1.00 0.00 ? 110 ASN A HA   1  
ATOM 1279  H HB3  . ASN A 1 92  ? -20.411 -6.998  0.410   1.00 0.00 ? 110 ASN A HB3  1  
ATOM 1280  H HD21 . ASN A 1 92  ? -20.011 -6.402  -1.759  1.00 0.00 ? 110 ASN A HD21 1  
ATOM 1281  H HD22 . ASN A 1 92  ? -19.952 -7.594  -3.009  1.00 0.00 ? 110 ASN A HD22 1  
ATOM 1282  N N    . THR A 1 93  ? -16.762 -8.636  -0.637  1.00 0.00 ? 111 THR A N    1  
ATOM 1283  C CA   . THR A 1 93  ? -15.805 -9.692  -0.946  1.00 0.00 ? 111 THR A CA   1  
ATOM 1284  C C    . THR A 1 93  ? -14.599 -9.628  -0.017  1.00 0.00 ? 111 THR A C    1  
ATOM 1285  O O    . THR A 1 93  ? -14.558 -8.817  0.908   1.00 0.00 ? 111 THR A O    1  
ATOM 1286  C CB   . THR A 1 93  ? -15.321 -9.602  -2.405  1.00 0.00 ? 111 THR A CB   1  
ATOM 1287  O OG1  . THR A 1 93  ? -16.177 -8.730  -3.153  1.00 0.00 ? 111 THR A OG1  1  
ATOM 1288  C CG2  . THR A 1 93  ? -15.296 -10.977 -3.054  1.00 0.00 ? 111 THR A CG2  1  
ATOM 1289  H H    . THR A 1 93  ? -16.978 -7.970  -1.324  1.00 0.00 ? 111 THR A H    1  
ATOM 1290  H HA   . THR A 1 93  ? -16.302 -10.642 -0.812  1.00 0.00 ? 111 THR A HA   1  
ATOM 1291  H HB   . THR A 1 93  ? -14.317 -9.200  -2.411  1.00 0.00 ? 111 THR A HB   1  
ATOM 1292  H HG1  . THR A 1 93  ? -15.975 -8.809  -4.089  1.00 0.00 ? 111 THR A HG1  1  
ATOM 1293  H HG21 . THR A 1 93  ? -15.577 -10.891 -4.094  1.00 0.00 ? 111 THR A HG21 1  
ATOM 1294  H HG22 . THR A 1 93  ? -15.993 -11.627 -2.546  1.00 0.00 ? 111 THR A HG22 1  
ATOM 1295  H HG23 . THR A 1 93  ? -14.302 -11.390 -2.984  1.00 0.00 ? 111 THR A HG23 1  
ATOM 1296  N N    . SER A 1 94  ? -13.618 -10.489 -0.269  1.00 0.00 ? 112 SER A N    1  
ATOM 1297  C CA   . SER A 1 94  ? -12.411 -10.533 0.548   1.00 0.00 ? 112 SER A CA   1  
ATOM 1298  C C    . SER A 1 94  ? -11.680 -9.194  0.509   1.00 0.00 ? 112 SER A C    1  
ATOM 1299  O O    . SER A 1 94  ? -12.189 -8.213  -0.031  1.00 0.00 ? 112 SER A O    1  
ATOM 1300  C CB   . SER A 1 94  ? -11.482 -11.649 0.064   1.00 0.00 ? 112 SER A CB   1  
ATOM 1301  O OG   . SER A 1 94  ? -12.130 -12.908 0.113   1.00 0.00 ? 112 SER A OG   1  
ATOM 1302  H H    . SER A 1 94  ? -13.709 -11.111 -1.022  1.00 0.00 ? 112 SER A H    1  
ATOM 1303  H HA   . SER A 1 94  ? -12.707 -10.739 1.566   1.00 0.00 ? 112 SER A HA   1  
ATOM 1304  H HB3  . SER A 1 94  ? -10.606 -11.683 0.695   1.00 0.00 ? 112 SER A HB3  1  
ATOM 1305  H HG   . SER A 1 94  ? -11.516 -13.594 -0.159  1.00 0.00 ? 112 SER A HG   1  
ATOM 1306  N N    . GLN A 1 95  ? -10.483 -9.165  1.086   1.00 0.00 ? 113 GLN A N    1  
ATOM 1307  C CA   . GLN A 1 95  ? -9.681  -7.947  1.118   1.00 0.00 ? 113 GLN A CA   1  
ATOM 1308  C C    . GLN A 1 95  ? -9.423  -7.427  -0.293  1.00 0.00 ? 113 GLN A C    1  
ATOM 1309  O O    . GLN A 1 95  ? -9.891  -8.006  -1.273  1.00 0.00 ? 113 GLN A O    1  
ATOM 1310  C CB   . GLN A 1 95  ? -8.352  -8.204  1.831   1.00 0.00 ? 113 GLN A CB   1  
ATOM 1311  C CG   . GLN A 1 95  ? -7.471  -9.222  1.124   1.00 0.00 ? 113 GLN A CG   1  
ATOM 1312  C CD   . GLN A 1 95  ? -7.705  -10.637 1.615   1.00 0.00 ? 113 GLN A CD   1  
ATOM 1313  O OE1  . GLN A 1 95  ? -8.041  -11.529 0.835   1.00 0.00 ? 113 GLN A OE1  1  
ATOM 1314  N NE2  . GLN A 1 95  ? -7.529  -10.850 2.914   1.00 0.00 ? 113 GLN A NE2  1  
ATOM 1315  H H    . GLN A 1 95  ? -10.130 -9.979  1.500   1.00 0.00 ? 113 GLN A H    1  
ATOM 1316  H HA   . GLN A 1 95  ? -10.235 -7.200  1.667   1.00 0.00 ? 113 GLN A HA   1  
ATOM 1317  H HB3  . GLN A 1 95  ? -8.556  -8.568  2.828   1.00 0.00 ? 113 GLN A HB3  1  
ATOM 1318  H HG3  . GLN A 1 95  ? -6.437  -8.963  1.297   1.00 0.00 ? 113 GLN A HG3  1  
ATOM 1319  H HE21 . GLN A 1 95  ? -7.263  -10.092 3.475   1.00 0.00 ? 113 GLN A HE21 1  
ATOM 1320  H HE22 . GLN A 1 95  ? -7.675  -11.756 3.258   1.00 0.00 ? 113 GLN A HE22 1  
ATOM 1321  N N    . TYR A 1 96  ? -8.676  -6.332  -0.387  1.00 0.00 ? 114 TYR A N    1  
ATOM 1322  C CA   . TYR A 1 96  ? -8.359  -5.734  -1.677  1.00 0.00 ? 114 TYR A CA   1  
ATOM 1323  C C    . TYR A 1 96  ? -7.303  -4.643  -1.527  1.00 0.00 ? 114 TYR A C    1  
ATOM 1324  O O    . TYR A 1 96  ? -6.776  -4.420  -0.436  1.00 0.00 ? 114 TYR A O    1  
ATOM 1325  C CB   . TYR A 1 96  ? -9.620  -5.152  -2.318  1.00 0.00 ? 114 TYR A CB   1  
ATOM 1326  C CG   . TYR A 1 96  ? -10.222 -6.041  -3.383  1.00 0.00 ? 114 TYR A CG   1  
ATOM 1327  C CD1  . TYR A 1 96  ? -9.496  -6.395  -4.513  1.00 0.00 ? 114 TYR A CD1  1  
ATOM 1328  C CD2  . TYR A 1 96  ? -11.518 -6.526  -3.260  1.00 0.00 ? 114 TYR A CD2  1  
ATOM 1329  C CE1  . TYR A 1 96  ? -10.043 -7.206  -5.489  1.00 0.00 ? 114 TYR A CE1  1  
ATOM 1330  C CE2  . TYR A 1 96  ? -12.073 -7.338  -4.229  1.00 0.00 ? 114 TYR A CE2  1  
ATOM 1331  C CZ   . TYR A 1 96  ? -11.331 -7.675  -5.342  1.00 0.00 ? 114 TYR A CZ   1  
ATOM 1332  O OH   . TYR A 1 96  ? -11.880 -8.484  -6.311  1.00 0.00 ? 114 TYR A OH   1  
ATOM 1333  H H    . TYR A 1 96  ? -8.332  -5.917  0.431   1.00 0.00 ? 114 TYR A H    1  
ATOM 1334  H HA   . TYR A 1 96  ? -7.967  -6.511  -2.317  1.00 0.00 ? 114 TYR A HA   1  
ATOM 1335  H HB3  . TYR A 1 96  ? -9.379  -4.203  -2.775  1.00 0.00 ? 114 TYR A HB3  1  
ATOM 1336  H HD1  . TYR A 1 96  ? -8.486  -6.026  -4.624  1.00 0.00 ? 114 TYR A HD1  1  
ATOM 1337  H HD2  . TYR A 1 96  ? -12.097 -6.261  -2.386  1.00 0.00 ? 114 TYR A HD2  1  
ATOM 1338  H HE1  . TYR A 1 96  ? -9.462  -7.470  -6.360  1.00 0.00 ? 114 TYR A HE1  1  
ATOM 1339  H HE2  . TYR A 1 96  ? -13.083 -7.706  -4.115  1.00 0.00 ? 114 TYR A HE2  1  
ATOM 1340  H HH   . TYR A 1 96  ? -11.702 -9.404  -6.098  1.00 0.00 ? 114 TYR A HH   1  
ATOM 1341  N N    . ASP A 1 97  ? -7.000  -3.966  -2.629  1.00 0.00 ? 115 ASP A N    1  
ATOM 1342  C CA   . ASP A 1 97  ? -6.008  -2.896  -2.621  1.00 0.00 ? 115 ASP A CA   1  
ATOM 1343  C C    . ASP A 1 97  ? -6.347  -1.849  -1.564  1.00 0.00 ? 115 ASP A C    1  
ATOM 1344  O O    . ASP A 1 97  ? -7.429  -1.871  -0.977  1.00 0.00 ? 115 ASP A O    1  
ATOM 1345  C CB   . ASP A 1 97  ? -5.924  -2.239  -3.998  1.00 0.00 ? 115 ASP A CB   1  
ATOM 1346  C CG   . ASP A 1 97  ? -7.273  -1.750  -4.490  1.00 0.00 ? 115 ASP A CG   1  
ATOM 1347  O OD1  . ASP A 1 97  ? -7.659  -0.617  -4.136  1.00 0.00 ? 115 ASP A OD1  1  
ATOM 1348  O OD2  . ASP A 1 97  ? -7.942  -2.502  -5.230  1.00 0.00 ? 115 ASP A OD2  1  
ATOM 1349  H H    . ASP A 1 97  ? -7.454  -4.190  -3.468  1.00 0.00 ? 115 ASP A H    1  
ATOM 1350  H HA   . ASP A 1 97  ? -5.050  -3.334  -2.382  1.00 0.00 ? 115 ASP A HA   1  
ATOM 1351  H HB3  . ASP A 1 97  ? -5.540  -2.956  -4.709  1.00 0.00 ? 115 ASP A HB3  1  
ATOM 1352  N N    . THR A 1 98  ? -5.413  -0.933  -1.324  1.00 0.00 ? 116 THR A N    1  
ATOM 1353  C CA   . THR A 1 98  ? -5.611  0.120   -0.337  1.00 0.00 ? 116 THR A CA   1  
ATOM 1354  C C    . THR A 1 98  ? -5.041  1.447   -0.827  1.00 0.00 ? 116 THR A C    1  
ATOM 1355  O O    . THR A 1 98  ? -3.963  1.488   -1.420  1.00 0.00 ? 116 THR A O    1  
ATOM 1356  C CB   . THR A 1 98  ? -4.957  -0.242  1.009   1.00 0.00 ? 116 THR A CB   1  
ATOM 1357  O OG1  . THR A 1 98  ? -5.313  0.727   2.003   1.00 0.00 ? 116 THR A OG1  1  
ATOM 1358  C CG2  . THR A 1 98  ? -3.443  -0.305  0.876   1.00 0.00 ? 116 THR A CG2  1  
ATOM 1359  H H    . THR A 1 98  ? -4.572  -0.969  -1.825  1.00 0.00 ? 116 THR A H    1  
ATOM 1360  H HA   . THR A 1 98  ? -6.674  0.233   -0.179  1.00 0.00 ? 116 THR A HA   1  
ATOM 1361  H HB   . THR A 1 98  ? -5.319  -1.212  1.318   1.00 0.00 ? 116 THR A HB   1  
ATOM 1362  H HG1  . THR A 1 98  ? -4.890  1.564   1.800   1.00 0.00 ? 116 THR A HG1  1  
ATOM 1363  H HG21 . THR A 1 98  ? -3.022  -0.740  1.769   1.00 0.00 ? 116 THR A HG21 1  
ATOM 1364  H HG22 . THR A 1 98  ? -3.052  0.692   0.741   1.00 0.00 ? 116 THR A HG22 1  
ATOM 1365  H HG23 . THR A 1 98  ? -3.183  -0.913  0.023   1.00 0.00 ? 116 THR A HG23 1  
ATOM 1366  N N    . TYR A 1 99  ? -5.770  2.528   -0.574  1.00 0.00 ? 117 TYR A N    1  
ATOM 1367  C CA   . TYR A 1 99  ? -5.336  3.857   -0.990  1.00 0.00 ? 117 TYR A CA   1  
ATOM 1368  C C    . TYR A 1 99  ? -4.860  4.675   0.207   1.00 0.00 ? 117 TYR A C    1  
ATOM 1369  O O    . TYR A 1 99  ? -5.315  4.472   1.333   1.00 0.00 ? 117 TYR A O    1  
ATOM 1370  C CB   . TYR A 1 99  ? -6.475  4.588   -1.702  1.00 0.00 ? 117 TYR A CB   1  
ATOM 1371  C CG   . TYR A 1 99  ? -6.924  3.914   -2.978  1.00 0.00 ? 117 TYR A CG   1  
ATOM 1372  C CD1  . TYR A 1 99  ? -5.998  3.441   -3.900  1.00 0.00 ? 117 TYR A CD1  1  
ATOM 1373  C CD2  . TYR A 1 99  ? -8.273  3.749   -3.262  1.00 0.00 ? 117 TYR A CD2  1  
ATOM 1374  C CE1  . TYR A 1 99  ? -6.403  2.826   -5.068  1.00 0.00 ? 117 TYR A CE1  1  
ATOM 1375  C CE2  . TYR A 1 99  ? -8.688  3.133   -4.428  1.00 0.00 ? 117 TYR A CE2  1  
ATOM 1376  C CZ   . TYR A 1 99  ? -7.749  2.674   -5.327  1.00 0.00 ? 117 TYR A CZ   1  
ATOM 1377  O OH   . TYR A 1 99  ? -8.156  2.059   -6.489  1.00 0.00 ? 117 TYR A OH   1  
ATOM 1378  H H    . TYR A 1 99  ? -6.619  2.431   -0.096  1.00 0.00 ? 117 TYR A H    1  
ATOM 1379  H HA   . TYR A 1 99  ? -4.512  3.736   -1.679  1.00 0.00 ? 117 TYR A HA   1  
ATOM 1380  H HB3  . TYR A 1 99  ? -6.152  5.589   -1.950  1.00 0.00 ? 117 TYR A HB3  1  
ATOM 1381  H HD1  . TYR A 1 99  ? -4.944  3.562   -3.693  1.00 0.00 ? 117 TYR A HD1  1  
ATOM 1382  H HD2  . TYR A 1 99  ? -9.007  4.110   -2.556  1.00 0.00 ? 117 TYR A HD2  1  
ATOM 1383  H HE1  . TYR A 1 99  ? -5.668  2.466   -5.773  1.00 0.00 ? 117 TYR A HE1  1  
ATOM 1384  H HE2  . TYR A 1 99  ? -9.742  3.013   -4.632  1.00 0.00 ? 117 TYR A HE2  1  
ATOM 1385  H HH   . TYR A 1 99  ? -9.100  2.195   -6.609  1.00 0.00 ? 117 TYR A HH   1  
ATOM 1386  N N    . CYS A 1 100 ? -3.941  5.601   -0.046  1.00 0.00 ? 118 CYS A N    1  
ATOM 1387  C CA   . CYS A 1 100 ? -3.402  6.451   1.009   1.00 0.00 ? 118 CYS A CA   1  
ATOM 1388  C C    . CYS A 1 100 ? -3.133  7.860   0.488   1.00 0.00 ? 118 CYS A C    1  
ATOM 1389  O O    . CYS A 1 100 ? -2.808  8.049   -0.685  1.00 0.00 ? 118 CYS A O    1  
ATOM 1390  C CB   . CYS A 1 100 ? -2.112  5.849   1.569   1.00 0.00 ? 118 CYS A CB   1  
ATOM 1391  S SG   . CYS A 1 100 ? -2.341  4.245   2.402   1.00 0.00 ? 118 CYS A SG   1  
ATOM 1392  H H    . CYS A 1 100 ? -3.616  5.715   -0.964  1.00 0.00 ? 118 CYS A H    1  
ATOM 1393  H HA   . CYS A 1 100 ? -4.136  6.507   1.798   1.00 0.00 ? 118 CYS A HA   1  
ATOM 1394  H HB3  . CYS A 1 100 ? -1.685  6.534   2.286   1.00 0.00 ? 118 CYS A HB3  1  
ATOM 1395  N N    . PHE A 1 101 ? -3.273  8.846   1.366   1.00 0.00 ? 119 PHE A N    1  
ATOM 1396  C CA   . PHE A 1 101 ? -3.048  10.239  0.995   1.00 0.00 ? 119 PHE A CA   1  
ATOM 1397  C C    . PHE A 1 101 ? -1.954  10.861  1.859   1.00 0.00 ? 119 PHE A C    1  
ATOM 1398  O O    . PHE A 1 101 ? -2.022  10.824  3.087   1.00 0.00 ? 119 PHE A O    1  
ATOM 1399  C CB   . PHE A 1 101 ? -4.342  11.042  1.135   1.00 0.00 ? 119 PHE A CB   1  
ATOM 1400  C CG   . PHE A 1 101 ? -4.147  12.524  0.988   1.00 0.00 ? 119 PHE A CG   1  
ATOM 1401  C CD1  . PHE A 1 101 ? -4.083  13.107  -0.268  1.00 0.00 ? 119 PHE A CD1  1  
ATOM 1402  C CD2  . PHE A 1 101 ? -4.028  13.334  2.106   1.00 0.00 ? 119 PHE A CD2  1  
ATOM 1403  C CE1  . PHE A 1 101 ? -3.902  14.471  -0.404  1.00 0.00 ? 119 PHE A CE1  1  
ATOM 1404  C CE2  . PHE A 1 101 ? -3.848  14.699  1.975   1.00 0.00 ? 119 PHE A CE2  1  
ATOM 1405  C CZ   . PHE A 1 101 ? -3.786  15.267  0.718   1.00 0.00 ? 119 PHE A CZ   1  
ATOM 1406  H H    . PHE A 1 101 ? -3.536  8.633   2.287   1.00 0.00 ? 119 PHE A H    1  
ATOM 1407  H HA   . PHE A 1 101 ? -2.731  10.258  -0.036  1.00 0.00 ? 119 PHE A HA   1  
ATOM 1408  H HB3  . PHE A 1 101 ? -4.769  10.858  2.108   1.00 0.00 ? 119 PHE A HB3  1  
ATOM 1409  H HD1  . PHE A 1 101 ? -4.175  12.485  -1.145  1.00 0.00 ? 119 PHE A HD1  1  
ATOM 1410  H HD2  . PHE A 1 101 ? -4.077  12.890  3.090   1.00 0.00 ? 119 PHE A HD2  1  
ATOM 1411  H HE1  . PHE A 1 101 ? -3.854  14.912  -1.389  1.00 0.00 ? 119 PHE A HE1  1  
ATOM 1412  H HE2  . PHE A 1 101 ? -3.757  15.318  2.855   1.00 0.00 ? 119 PHE A HE2  1  
ATOM 1413  H HZ   . PHE A 1 101 ? -3.644  16.332  0.613   1.00 0.00 ? 119 PHE A HZ   1  
ATOM 1414  N N    . ASN A 1 102 ? -0.948  11.433  1.207   1.00 0.00 ? 120 ASN A N    1  
ATOM 1415  C CA   . ASN A 1 102 ? 0.162   12.063  1.914   1.00 0.00 ? 120 ASN A CA   1  
ATOM 1416  C C    . ASN A 1 102 ? 0.114   13.580  1.760   1.00 0.00 ? 120 ASN A C    1  
ATOM 1417  O O    . ASN A 1 102 ? -0.350  14.097  0.743   1.00 0.00 ? 120 ASN A O    1  
ATOM 1418  C CB   . ASN A 1 102 ? 1.496   11.528  1.391   1.00 0.00 ? 120 ASN A CB   1  
ATOM 1419  C CG   . ASN A 1 102 ? 2.655   11.873  2.306   1.00 0.00 ? 120 ASN A CG   1  
ATOM 1420  O OD1  . ASN A 1 102 ? 3.410   12.809  2.045   1.00 0.00 ? 120 ASN A OD1  1  
ATOM 1421  N ND2  . ASN A 1 102 ? 2.801   11.115  3.388   1.00 0.00 ? 120 ASN A ND2  1  
ATOM 1422  H H    . ASN A 1 102 ? -0.950  11.432  0.227   1.00 0.00 ? 120 ASN A H    1  
ATOM 1423  H HA   . ASN A 1 102 ? 0.070   11.816  2.961   1.00 0.00 ? 120 ASN A HA   1  
ATOM 1424  H HB3  . ASN A 1 102 ? 1.691   11.952  0.418   1.00 0.00 ? 120 ASN A HB3  1  
ATOM 1425  H HD21 . ASN A 1 102 ? 2.162   10.387  3.532   1.00 0.00 ? 120 ASN A HD21 1  
ATOM 1426  H HD22 . ASN A 1 102 ? 3.542   11.316  3.996   1.00 0.00 ? 120 ASN A HD22 1  
ATOM 1427  N N    . ALA A 1 103 ? 0.596   14.288  2.776   1.00 0.00 ? 121 ALA A N    1  
ATOM 1428  C CA   . ALA A 1 103 ? 0.610   15.746  2.753   1.00 0.00 ? 121 ALA A CA   1  
ATOM 1429  C C    . ALA A 1 103 ? 1.994   16.275  2.391   1.00 0.00 ? 121 ALA A C    1  
ATOM 1430  O O    . ALA A 1 103 ? 2.129   17.388  1.884   1.00 0.00 ? 121 ALA A O    1  
ATOM 1431  C CB   . ALA A 1 103 ? 0.167   16.299  4.099   1.00 0.00 ? 121 ALA A CB   1  
ATOM 1432  H H    . ALA A 1 103 ? 0.951   13.819  3.560   1.00 0.00 ? 121 ALA A H    1  
ATOM 1433  H HA   . ALA A 1 103 ? -0.098  16.074  2.005   1.00 0.00 ? 121 ALA A HA   1  
ATOM 1434  H HB1  . ALA A 1 103 ? -0.726  15.784  4.423   1.00 0.00 ? 121 ALA A HB1  1  
ATOM 1435  H HB2  . ALA A 1 103 ? 0.952   16.151  4.825   1.00 0.00 ? 121 ALA A HB2  1  
ATOM 1436  H HB3  . ALA A 1 103 ? -0.041  17.355  4.002   1.00 0.00 ? 121 ALA A HB3  1  
ATOM 1437  N N    . SER A 1 104 ? 3.018   15.469  2.654   1.00 0.00 ? 122 SER A N    1  
ATOM 1438  C CA   . SER A 1 104 ? 4.393   15.859  2.360   1.00 0.00 ? 122 SER A CA   1  
ATOM 1439  C C    . SER A 1 104 ? 4.592   16.053  0.860   1.00 0.00 ? 122 SER A C    1  
ATOM 1440  O O    . SER A 1 104 ? 5.129   17.070  0.421   1.00 0.00 ? 122 SER A O    1  
ATOM 1441  C CB   . SER A 1 104 ? 5.367   14.803  2.884   1.00 0.00 ? 122 SER A CB   1  
ATOM 1442  O OG   . SER A 1 104 ? 6.623   15.381  3.197   1.00 0.00 ? 122 SER A OG   1  
ATOM 1443  H H    . SER A 1 104 ? 2.845   14.594  3.059   1.00 0.00 ? 122 SER A H    1  
ATOM 1444  H HA   . SER A 1 104 ? 4.585   16.796  2.861   1.00 0.00 ? 122 SER A HA   1  
ATOM 1445  H HB3  . SER A 1 104 ? 5.512   14.044  2.128   1.00 0.00 ? 122 SER A HB3  1  
ATOM 1446  H HG   . SER A 1 104 ? 6.492   16.271  3.533   1.00 0.00 ? 122 SER A HG   1  
ATOM 1447  N N    . ALA A 1 105 ? 4.157   15.070  0.079   1.00 0.00 ? 123 ALA A N    1  
ATOM 1448  C CA   . ALA A 1 105 ? 4.285   15.132  -1.372  1.00 0.00 ? 123 ALA A CA   1  
ATOM 1449  C C    . ALA A 1 105 ? 3.598   16.372  -1.931  1.00 0.00 ? 123 ALA A C    1  
ATOM 1450  O O    . ALA A 1 105 ? 2.740   16.978  -1.289  1.00 0.00 ? 123 ALA A O    1  
ATOM 1451  C CB   . ALA A 1 105 ? 3.710   13.875  -2.006  1.00 0.00 ? 123 ALA A CB   1  
ATOM 1452  H H    . ALA A 1 105 ? 3.739   14.285  0.489   1.00 0.00 ? 123 ALA A H    1  
ATOM 1453  H HA   . ALA A 1 105 ? 5.339   15.177  -1.611  1.00 0.00 ? 123 ALA A HA   1  
ATOM 1454  H HB1  . ALA A 1 105 ? 2.979   13.438  -1.341  1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1455  H HB2  . ALA A 1 105 ? 3.238   14.129  -2.944  1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1456  H HB3  . ALA A 1 105 ? 4.504   13.166  -2.184  1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1457  N N    . PRO A 1 106 ? 3.982   16.761  -3.156  1.00 0.00 ? 124 PRO A N    1  
ATOM 1458  C CA   . PRO A 1 106 ? 3.415   17.932  -3.829  1.00 0.00 ? 124 PRO A CA   1  
ATOM 1459  C C    . PRO A 1 106 ? 1.964   17.717  -4.246  1.00 0.00 ? 124 PRO A C    1  
ATOM 1460  O O    . PRO A 1 106 ? 1.448   16.599  -4.227  1.00 0.00 ? 124 PRO A O    1  
ATOM 1461  C CB   . PRO A 1 106 ? 4.307   18.100  -5.062  1.00 0.00 ? 124 PRO A CB   1  
ATOM 1462  C CG   . PRO A 1 106 ? 4.849   16.738  -5.326  1.00 0.00 ? 124 PRO A CG   1  
ATOM 1463  C CD   . PRO A 1 106 ? 5.000   16.086  -3.979  1.00 0.00 ? 124 PRO A CD   1  
ATOM 1464  H HA   . PRO A 1 106 ? 3.483   18.817  -3.211  1.00 0.00 ? 124 PRO A HA   1  
ATOM 1465  H HB3  . PRO A 1 106 ? 5.096   18.804  -4.847  1.00 0.00 ? 124 PRO A HB3  1  
ATOM 1466  H HG3  . PRO A 1 106 ? 5.808   16.814  -5.814  1.00 0.00 ? 124 PRO A HG3  1  
ATOM 1467  H HD3  . PRO A 1 106 ? 5.991   16.259  -3.585  1.00 0.00 ? 124 PRO A HD3  1  
ATOM 1468  N N    . PRO A 1 107 ? 1.289   18.810  -4.632  1.00 0.00 ? 125 PRO A N    1  
ATOM 1469  C CA   . PRO A 1 107 ? -0.112  18.763  -5.061  1.00 0.00 ? 125 PRO A CA   1  
ATOM 1470  C C    . PRO A 1 107 ? -0.283  18.063  -6.405  1.00 0.00 ? 125 PRO A C    1  
ATOM 1471  O O    . PRO A 1 107 ? -1.404  17.796  -6.838  1.00 0.00 ? 125 PRO A O    1  
ATOM 1472  C CB   . PRO A 1 107 ? -0.496  20.241  -5.177  1.00 0.00 ? 125 PRO A CB   1  
ATOM 1473  C CG   . PRO A 1 107 ? 0.791   20.949  -5.426  1.00 0.00 ? 125 PRO A CG   1  
ATOM 1474  C CD   . PRO A 1 107 ? 1.842   20.174  -4.680  1.00 0.00 ? 125 PRO A CD   1  
ATOM 1475  H HA   . PRO A 1 107 ? -0.738  18.284  -4.324  1.00 0.00 ? 125 PRO A HA   1  
ATOM 1476  H HB3  . PRO A 1 107 ? -0.956  20.570  -4.257  1.00 0.00 ? 125 PRO A HB3  1  
ATOM 1477  H HG3  . PRO A 1 107 ? 0.733   21.959  -5.048  1.00 0.00 ? 125 PRO A HG3  1  
ATOM 1478  H HD3  . PRO A 1 107 ? 1.969   20.572  -3.684  1.00 0.00 ? 125 PRO A HD3  1  
ATOM 1479  N N    . GLU A 1 108 ? 0.835   17.767  -7.061  1.00 0.00 ? 126 GLU A N    1  
ATOM 1480  C CA   . GLU A 1 108 ? 0.807   17.097  -8.355  1.00 0.00 ? 126 GLU A CA   1  
ATOM 1481  C C    . GLU A 1 108 ? 1.422   15.704  -8.261  1.00 0.00 ? 126 GLU A C    1  
ATOM 1482  O O    . GLU A 1 108 ? 1.803   15.255  -7.180  1.00 0.00 ? 126 GLU A O    1  
ATOM 1483  C CB   . GLU A 1 108 ? 1.555   17.927  -9.400  1.00 0.00 ? 126 GLU A CB   1  
ATOM 1484  C CG   . GLU A 1 108 ? 0.790   19.156  -9.863  1.00 0.00 ? 126 GLU A CG   1  
ATOM 1485  C CD   . GLU A 1 108 ? 1.046   20.366  -8.985  1.00 0.00 ? 126 GLU A CD   1  
ATOM 1486  O OE1  . GLU A 1 108 ? 2.227   20.656  -8.702  1.00 0.00 ? 126 GLU A OE1  1  
ATOM 1487  O OE2  . GLU A 1 108 ? 0.063   21.023  -8.583  1.00 0.00 ? 126 GLU A OE2  1  
ATOM 1488  H H    . GLU A 1 108 ? 1.699   18.005  -6.664  1.00 0.00 ? 126 GLU A H    1  
ATOM 1489  H HA   . GLU A 1 108 ? -0.226  17.001  -8.657  1.00 0.00 ? 126 GLU A HA   1  
ATOM 1490  H HB3  . GLU A 1 108 ? 1.751   17.306  -10.262 1.00 0.00 ? 126 GLU A HB3  1  
ATOM 1491  H HG3  . GLU A 1 108 ? -0.266  18.934  -9.847  1.00 0.00 ? 126 GLU A HG3  1  
ATOM 1492  N N    . GLU A 1 109 ? 1.514   15.026  -9.400  1.00 0.00 ? 127 GLU A N    1  
ATOM 1493  C CA   . GLU A 1 109 ? 2.081   13.682  -9.446  1.00 0.00 ? 127 GLU A CA   1  
ATOM 1494  C C    . GLU A 1 109 ? 3.525   13.686  -8.953  1.00 0.00 ? 127 GLU A C    1  
ATOM 1495  O O    . GLU A 1 109 ? 4.376   14.390  -9.496  1.00 0.00 ? 127 GLU A O    1  
ATOM 1496  C CB   . GLU A 1 109 ? 2.017   13.126  -10.869 1.00 0.00 ? 127 GLU A CB   1  
ATOM 1497  C CG   . GLU A 1 109 ? 2.671   14.025  -11.904 1.00 0.00 ? 127 GLU A CG   1  
ATOM 1498  C CD   . GLU A 1 109 ? 2.514   13.499  -13.318 1.00 0.00 ? 127 GLU A CD   1  
ATOM 1499  O OE1  . GLU A 1 109 ? 3.336   12.655  -13.732 1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1500  O OE2  . GLU A 1 109 ? 1.568   13.931  -14.009 1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1501  H H    . GLU A 1 109 ? 1.193   15.437  -10.229 1.00 0.00 ? 127 GLU A H    1  
ATOM 1502  H HA   . GLU A 1 109 ? 1.493   13.052  -8.796  1.00 0.00 ? 127 GLU A HA   1  
ATOM 1503  H HB3  . GLU A 1 109 ? 0.981   12.991  -11.144 1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1504  H HG3  . GLU A 1 109 ? 3.725   14.104  -11.681 1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1505  N N    . ASP A 1 110 ? 3.794   12.892  -7.922  1.00 0.00 ? 128 ASP A N    1  
ATOM 1506  C CA   . ASP A 1 110 ? 5.134   12.801  -7.356  1.00 0.00 ? 128 ASP A CA   1  
ATOM 1507  C C    . ASP A 1 110 ? 5.689   11.387  -7.493  1.00 0.00 ? 128 ASP A C    1  
ATOM 1508  O O    . ASP A 1 110 ? 5.155   10.440  -6.912  1.00 0.00 ? 128 ASP A O    1  
ATOM 1509  C CB   . ASP A 1 110 ? 5.118   13.215  -5.883  1.00 0.00 ? 128 ASP A CB   1  
ATOM 1510  C CG   . ASP A 1 110 ? 6.471   13.705  -5.404  1.00 0.00 ? 128 ASP A CG   1  
ATOM 1511  O OD1  . ASP A 1 110 ? 7.065   14.568  -6.084  1.00 0.00 ? 128 ASP A OD1  1  
ATOM 1512  O OD2  . ASP A 1 110 ? 6.935   13.226  -4.349  1.00 0.00 ? 128 ASP A OD2  1  
ATOM 1513  H H    . ASP A 1 110 ? 3.073   12.355  -7.533  1.00 0.00 ? 128 ASP A H    1  
ATOM 1514  H HA   . ASP A 1 110 ? 5.772   13.479  -7.903  1.00 0.00 ? 128 ASP A HA   1  
ATOM 1515  H HB3  . ASP A 1 110 ? 4.828   12.367  -5.281  1.00 0.00 ? 128 ASP A HB3  1  
ATOM 1516  N N    . CYS A 1 111 ? 6.761   11.249  -8.266  1.00 0.00 ? 129 CYS A N    1  
ATOM 1517  C CA   . CYS A 1 111 ? 7.386   9.951   -8.482  1.00 0.00 ? 129 CYS A CA   1  
ATOM 1518  C C    . CYS A 1 111 ? 8.898   10.038  -8.299  1.00 0.00 ? 129 CYS A C    1  
ATOM 1519  O O    . CYS A 1 111 ? 9.666   9.679   -9.193  1.00 0.00 ? 129 CYS A O    1  
ATOM 1520  C CB   . CYS A 1 111 ? 7.061   9.431   -9.884  1.00 0.00 ? 129 CYS A CB   1  
ATOM 1521  S SG   . CYS A 1 111 ? 5.323   9.664   -10.378 1.00 0.00 ? 129 CYS A SG   1  
ATOM 1522  H H    . CYS A 1 111 ? 7.140   12.041  -8.702  1.00 0.00 ? 129 CYS A H    1  
ATOM 1523  H HA   . CYS A 1 111 ? 6.986   9.264   -7.752  1.00 0.00 ? 129 CYS A HA   1  
ATOM 1524  H HB3  . CYS A 1 111 ? 7.276   8.373   -9.927  1.00 0.00 ? 129 CYS A HB3  1  
ATOM 1525  N N    . THR A 1 112 ? 9.321   10.519  -7.133  1.00 0.00 ? 130 THR A N    1  
ATOM 1526  C CA   . THR A 1 112 ? 10.740  10.654  -6.832  1.00 0.00 ? 130 THR A CA   1  
ATOM 1527  C C    . THR A 1 112 ? 11.008  10.457  -5.345  1.00 0.00 ? 130 THR A C    1  
ATOM 1528  O O    . THR A 1 112 ? 10.113  10.081  -4.589  1.00 0.00 ? 130 THR A O    1  
ATOM 1529  C CB   . THR A 1 112 ? 11.276  12.034  -7.259  1.00 0.00 ? 130 THR A CB   1  
ATOM 1530  O OG1  . THR A 1 112 ? 10.694  13.059  -6.446  1.00 0.00 ? 130 THR A OG1  1  
ATOM 1531  C CG2  . THR A 1 112 ? 10.965  12.306  -8.724  1.00 0.00 ? 130 THR A CG2  1  
ATOM 1532  H H    . THR A 1 112 ? 8.661   10.788  -6.461  1.00 0.00 ? 130 THR A H    1  
ATOM 1533  H HA   . THR A 1 112 ? 11.273  9.897   -7.388  1.00 0.00 ? 130 THR A HA   1  
ATOM 1534  H HB   . THR A 1 112 ? 12.348  12.044  -7.126  1.00 0.00 ? 130 THR A HB   1  
ATOM 1535  H HG1  . THR A 1 112 ? 11.389  13.613  -6.084  1.00 0.00 ? 130 THR A HG1  1  
ATOM 1536  H HG21 . THR A 1 112 ? 11.584  13.116  -9.079  1.00 0.00 ? 130 THR A HG21 1  
ATOM 1537  H HG22 . THR A 1 112 ? 9.925   12.576  -8.828  1.00 0.00 ? 130 THR A HG22 1  
ATOM 1538  H HG23 . THR A 1 112 ? 11.167  11.418  -9.305  1.00 0.00 ? 130 THR A HG23 1  
ATOM 1539  N N    . SER A 1 113 ? 12.245  10.713  -4.932  1.00 0.00 ? 131 SER A N    1  
ATOM 1540  C CA   . SER A 1 113 ? 12.631  10.559  -3.534  1.00 0.00 ? 131 SER A CA   1  
ATOM 1541  C C    . SER A 1 113 ? 11.813  11.487  -2.639  1.00 0.00 ? 131 SER A C    1  
ATOM 1542  O O    . SER A 1 113 ? 10.822  12.073  -3.075  1.00 0.00 ? 131 SER A O    1  
ATOM 1543  C CB   . SER A 1 113 ? 14.123  10.851  -3.360  1.00 0.00 ? 131 SER A CB   1  
ATOM 1544  O OG   . SER A 1 113 ? 14.631  10.233  -2.190  1.00 0.00 ? 131 SER A OG   1  
ATOM 1545  H H    . SER A 1 113 ? 12.915  11.010  -5.584  1.00 0.00 ? 131 SER A H    1  
ATOM 1546  H HA   . SER A 1 113 ? 12.438  9.538   -3.247  1.00 0.00 ? 131 SER A HA   1  
ATOM 1547  H HB3  . SER A 1 113 ? 14.272  11.919  -3.283  1.00 0.00 ? 131 SER A HB3  1  
ATOM 1548  H HG   . SER A 1 113 ? 15.370  10.745  -1.853  1.00 0.00 ? 131 SER A HG   1  
ATOM 1549  N N    . VAL A 1 114 ? 12.236  11.613  -1.386  1.00 0.00 ? 132 VAL A N    1  
ATOM 1550  C CA   . VAL A 1 114 ? 11.544  12.468  -0.429  1.00 0.00 ? 132 VAL A CA   1  
ATOM 1551  C C    . VAL A 1 114 ? 10.150  11.934  -0.121  1.00 0.00 ? 132 VAL A C    1  
ATOM 1552  O O    . VAL A 1 114 ? 9.215   12.702  0.110   1.00 0.00 ? 132 VAL A O    1  
ATOM 1553  C CB   . VAL A 1 114 ? 11.425  13.913  -0.950  1.00 0.00 ? 132 VAL A CB   1  
ATOM 1554  C CG1  . VAL A 1 114 ? 11.094  14.866  0.188   1.00 0.00 ? 132 VAL A CG1  1  
ATOM 1555  C CG2  . VAL A 1 114 ? 12.708  14.332  -1.652  1.00 0.00 ? 132 VAL A CG2  1  
ATOM 1556  H H    . VAL A 1 114 ? 13.032  11.120  -1.098  1.00 0.00 ? 132 VAL A H    1  
ATOM 1557  H HA   . VAL A 1 114 ? 12.122  12.484  0.484   1.00 0.00 ? 132 VAL A HA   1  
ATOM 1558  H HB   . VAL A 1 114 ? 10.619  13.950  -1.668  1.00 0.00 ? 132 VAL A HB   1  
ATOM 1559  H HG11 . VAL A 1 114 ? 11.486  14.472  1.114   1.00 0.00 ? 132 VAL A HG11 1  
ATOM 1560  H HG12 . VAL A 1 114 ? 11.537  15.831  -0.010  1.00 0.00 ? 132 VAL A HG12 1  
ATOM 1561  H HG13 . VAL A 1 114 ? 10.022  14.972  0.268   1.00 0.00 ? 132 VAL A HG13 1  
ATOM 1562  H HG21 . VAL A 1 114 ? 13.529  13.731  -1.290  1.00 0.00 ? 132 VAL A HG21 1  
ATOM 1563  H HG22 . VAL A 1 114 ? 12.600  14.188  -2.717  1.00 0.00 ? 132 VAL A HG22 1  
ATOM 1564  H HG23 . VAL A 1 114 ? 12.907  15.374  -1.449  1.00 0.00 ? 132 VAL A HG23 1  
ATOM 1565  N N    . THR A 1 115 ? 10.015  10.611  -0.121  1.00 0.00 ? 133 THR A N    1  
ATOM 1566  C CA   . THR A 1 115 ? 8.735   9.974   0.156   1.00 0.00 ? 133 THR A CA   1  
ATOM 1567  C C    . THR A 1 115 ? 8.930   8.559   0.690   1.00 0.00 ? 133 THR A C    1  
ATOM 1568  O O    . THR A 1 115 ? 8.811   7.584   -0.053  1.00 0.00 ? 133 THR A O    1  
ATOM 1569  C CB   . THR A 1 115 ? 7.850   9.918   -1.103  1.00 0.00 ? 133 THR A CB   1  
ATOM 1570  O OG1  . THR A 1 115 ? 8.647   9.591   -2.248  1.00 0.00 ? 133 THR A OG1  1  
ATOM 1571  C CG2  . THR A 1 115 ? 7.148   11.248  -1.331  1.00 0.00 ? 133 THR A CG2  1  
ATOM 1572  H H    . THR A 1 115 ? 10.797  10.053  -0.313  1.00 0.00 ? 133 THR A H    1  
ATOM 1573  H HA   . THR A 1 115 ? 8.224   10.563  0.904   1.00 0.00 ? 133 THR A HA   1  
ATOM 1574  H HB   . THR A 1 115 ? 7.100   9.152   -0.965  1.00 0.00 ? 133 THR A HB   1  
ATOM 1575  H HG1  . THR A 1 115 ? 8.501   8.672   -2.487  1.00 0.00 ? 133 THR A HG1  1  
ATOM 1576  H HG21 . THR A 1 115 ? 6.346   11.115  -2.042  1.00 0.00 ? 133 THR A HG21 1  
ATOM 1577  H HG22 . THR A 1 115 ? 7.856   11.967  -1.717  1.00 0.00 ? 133 THR A HG22 1  
ATOM 1578  H HG23 . THR A 1 115 ? 6.744   11.606  -0.396  1.00 0.00 ? 133 THR A HG23 1  
ATOM 1579  N N    . ASP A 1 116 ? 9.228   8.454   1.979   1.00 0.00 ? 134 ASP A N    1  
ATOM 1580  C CA   . ASP A 1 116 ? 9.438   7.157   2.613   1.00 0.00 ? 134 ASP A CA   1  
ATOM 1581  C C    . ASP A 1 116 ? 8.702   7.079   3.947   1.00 0.00 ? 134 ASP A C    1  
ATOM 1582  O O    . ASP A 1 116 ? 7.930   7.973   4.296   1.00 0.00 ? 134 ASP A O    1  
ATOM 1583  C CB   . ASP A 1 116 ? 10.931  6.904   2.824   1.00 0.00 ? 134 ASP A CB   1  
ATOM 1584  C CG   . ASP A 1 116 ? 11.349  5.513   2.389   1.00 0.00 ? 134 ASP A CG   1  
ATOM 1585  O OD1  . ASP A 1 116 ? 10.473  4.627   2.316   1.00 0.00 ? 134 ASP A OD1  1  
ATOM 1586  O OD2  . ASP A 1 116 ? 12.553  5.312   2.122   1.00 0.00 ? 134 ASP A OD2  1  
ATOM 1587  H H    . ASP A 1 116 ? 9.308   9.269   2.520   1.00 0.00 ? 134 ASP A H    1  
ATOM 1588  H HA   . ASP A 1 116 ? 9.042   6.399   1.954   1.00 0.00 ? 134 ASP A HA   1  
ATOM 1589  H HB3  . ASP A 1 116 ? 11.165  7.020   3.873   1.00 0.00 ? 134 ASP A HB3  1  
ATOM 1590  N N    . LEU A 1 117 ? 8.946   6.005   4.690   1.00 0.00 ? 135 LEU A N    1  
ATOM 1591  C CA   . LEU A 1 117 ? 8.307   5.809   5.986   1.00 0.00 ? 135 LEU A CA   1  
ATOM 1592  C C    . LEU A 1 117 ? 8.485   7.038   6.872   1.00 0.00 ? 135 LEU A C    1  
ATOM 1593  O O    . LEU A 1 117 ? 9.361   7.873   6.648   1.00 0.00 ? 135 LEU A O    1  
ATOM 1594  C CB   . LEU A 1 117 ? 8.887   4.576   6.682   1.00 0.00 ? 135 LEU A CB   1  
ATOM 1595  C CG   . LEU A 1 117 ? 8.203   3.245   6.368   1.00 0.00 ? 135 LEU A CG   1  
ATOM 1596  C CD1  . LEU A 1 117 ? 8.867   2.572   5.176   1.00 0.00 ? 135 LEU A CD1  1  
ATOM 1597  C CD2  . LEU A 1 117 ? 8.234   2.330   7.584   1.00 0.00 ? 135 LEU A CD2  1  
ATOM 1598  H H    . LEU A 1 117 ? 9.571   5.326   4.358   1.00 0.00 ? 135 LEU A H    1  
ATOM 1599  H HA   . LEU A 1 117 ? 7.252   5.652   5.815   1.00 0.00 ? 135 LEU A HA   1  
ATOM 1600  H HB3  . LEU A 1 117 ? 8.823   4.739   7.748   1.00 0.00 ? 135 LEU A HB3  1  
ATOM 1601  H HG   . LEU A 1 117 ? 7.169   3.429   6.113   1.00 0.00 ? 135 LEU A HG   1  
ATOM 1602  H HD11 . LEU A 1 117 ? 9.935   2.534   5.332   1.00 0.00 ? 135 LEU A HD11 1  
ATOM 1603  H HD12 . LEU A 1 117 ? 8.654   3.135   4.280   1.00 0.00 ? 135 LEU A HD12 1  
ATOM 1604  H HD13 . LEU A 1 117 ? 8.483   1.568   5.070   1.00 0.00 ? 135 LEU A HD13 1  
ATOM 1605  H HD21 . LEU A 1 117 ? 7.231   1.997   7.807   1.00 0.00 ? 135 LEU A HD21 1  
ATOM 1606  H HD22 . LEU A 1 117 ? 8.631   2.871   8.431   1.00 0.00 ? 135 LEU A HD22 1  
ATOM 1607  H HD23 . LEU A 1 117 ? 8.860   1.476   7.376   1.00 0.00 ? 135 LEU A HD23 1  
ATOM 1608  N N    . PRO A 1 118 ? 7.635   7.152   7.903   1.00 0.00 ? 136 PRO A N    1  
ATOM 1609  C CA   . PRO A 1 118 ? 7.680   8.273   8.846   1.00 0.00 ? 136 PRO A CA   1  
ATOM 1610  C C    . PRO A 1 118 ? 8.913   8.230   9.741   1.00 0.00 ? 136 PRO A C    1  
ATOM 1611  O O    . PRO A 1 118 ? 9.447   9.269   10.128  1.00 0.00 ? 136 PRO A O    1  
ATOM 1612  C CB   . PRO A 1 118 ? 6.408   8.088   9.679   1.00 0.00 ? 136 PRO A CB   1  
ATOM 1613  C CG   . PRO A 1 118 ? 6.109   6.632   9.594   1.00 0.00 ? 136 PRO A CG   1  
ATOM 1614  C CD   . PRO A 1 118 ? 6.565   6.194   8.229   1.00 0.00 ? 136 PRO A CD   1  
ATOM 1615  H HA   . PRO A 1 118 ? 7.641   9.224   8.334   1.00 0.00 ? 136 PRO A HA   1  
ATOM 1616  H HB3  . PRO A 1 118 ? 5.609   8.680   9.259   1.00 0.00 ? 136 PRO A HB3  1  
ATOM 1617  H HG3  . PRO A 1 118 ? 5.048   6.468   9.704   1.00 0.00 ? 136 PRO A HG3  1  
ATOM 1618  H HD3  . PRO A 1 118 ? 5.754   6.265   7.520   1.00 0.00 ? 136 PRO A HD3  1  
ATOM 1619  N N    . ASN A 1 119 ? 9.362   7.022   10.064  1.00 0.00 ? 137 ASN A N    1  
ATOM 1620  C CA   . ASN A 1 119 ? 10.534  6.843   10.914  1.00 0.00 ? 137 ASN A CA   1  
ATOM 1621  C C    . ASN A 1 119 ? 11.603  6.021   10.201  1.00 0.00 ? 137 ASN A C    1  
ATOM 1622  O O    . ASN A 1 119 ? 12.705  5.837   10.716  1.00 0.00 ? 137 ASN A O    1  
ATOM 1623  C CB   . ASN A 1 119 ? 10.140  6.162   12.225  1.00 0.00 ? 137 ASN A CB   1  
ATOM 1624  C CG   . ASN A 1 119 ? 11.152  6.402   13.329  1.00 0.00 ? 137 ASN A CG   1  
ATOM 1625  O OD1  . ASN A 1 119 ? 11.788  7.454   13.386  1.00 0.00 ? 137 ASN A OD1  1  
ATOM 1626  N ND2  . ASN A 1 119 ? 11.308  5.422   14.212  1.00 0.00 ? 137 ASN A ND2  1  
ATOM 1627  H H    . ASN A 1 119 ? 8.894   6.231   9.724   1.00 0.00 ? 137 ASN A H    1  
ATOM 1628  H HA   . ASN A 1 119 ? 10.936  7.822   11.133  1.00 0.00 ? 137 ASN A HA   1  
ATOM 1629  H HB3  . ASN A 1 119 ? 10.057  5.098   12.061  1.00 0.00 ? 137 ASN A HB3  1  
ATOM 1630  H HD21 . ASN A 1 119 ? 10.768  4.610   14.104  1.00 0.00 ? 137 ASN A HD21 1  
ATOM 1631  H HD22 . ASN A 1 119 ? 11.955  5.550   14.936  1.00 0.00 ? 137 ASN A HD22 1  
ATOM 1632  N N    . ALA A 1 120 ? 11.268  5.528   9.012   1.00 0.00 ? 138 ALA A N    1  
ATOM 1633  C CA   . ALA A 1 120 ? 12.199  4.727   8.228   1.00 0.00 ? 138 ALA A CA   1  
ATOM 1634  C C    . ALA A 1 120 ? 12.633  3.483   8.994   1.00 0.00 ? 138 ALA A C    1  
ATOM 1635  O O    . ALA A 1 120 ? 13.820  3.284   9.254   1.00 0.00 ? 138 ALA A O    1  
ATOM 1636  C CB   . ALA A 1 120 ? 13.412  5.559   7.838   1.00 0.00 ? 138 ALA A CB   1  
ATOM 1637  H H    . ALA A 1 120 ? 10.374  5.710   8.655   1.00 0.00 ? 138 ALA A H    1  
ATOM 1638  H HA   . ALA A 1 120 ? 11.695  4.423   7.322   1.00 0.00 ? 138 ALA A HA   1  
ATOM 1639  H HB1  . ALA A 1 120 ? 13.138  6.243   7.047   1.00 0.00 ? 138 ALA A HB1  1  
ATOM 1640  H HB2  . ALA A 1 120 ? 13.755  6.119   8.695   1.00 0.00 ? 138 ALA A HB2  1  
ATOM 1641  H HB3  . ALA A 1 120 ? 14.199  4.907   7.493   1.00 0.00 ? 138 ALA A HB3  1  
ATOM 1642  N N    . PHE A 1 121 ? 11.664  2.647   9.354   1.00 0.00 ? 139 PHE A N    1  
ATOM 1643  C CA   . PHE A 1 121 ? 11.947  1.422   10.092  1.00 0.00 ? 139 PHE A CA   1  
ATOM 1644  C C    . PHE A 1 121 ? 11.775  0.196   9.199   1.00 0.00 ? 139 PHE A C    1  
ATOM 1645  O O    . PHE A 1 121 ? 11.105  0.257   8.168   1.00 0.00 ? 139 PHE A O    1  
ATOM 1646  C CB   . PHE A 1 121 ? 11.028  1.311   11.311  1.00 0.00 ? 139 PHE A CB   1  
ATOM 1647  C CG   . PHE A 1 121 ? 9.568   1.269   10.959  1.00 0.00 ? 139 PHE A CG   1  
ATOM 1648  C CD1  . PHE A 1 121 ? 8.976   0.085   10.551  1.00 0.00 ? 139 PHE A CD1  1  
ATOM 1649  C CD2  . PHE A 1 121 ? 8.790   2.411   11.037  1.00 0.00 ? 139 PHE A CD2  1  
ATOM 1650  C CE1  . PHE A 1 121 ? 7.633   0.043   10.226  1.00 0.00 ? 139 PHE A CE1  1  
ATOM 1651  C CE2  . PHE A 1 121 ? 7.446   2.375   10.713  1.00 0.00 ? 139 PHE A CE2  1  
ATOM 1652  C CZ   . PHE A 1 121 ? 6.868   1.189   10.309  1.00 0.00 ? 139 PHE A CZ   1  
ATOM 1653  H H    . PHE A 1 121 ? 10.737  2.860   9.118   1.00 0.00 ? 139 PHE A H    1  
ATOM 1654  H HA   . PHE A 1 121 ? 12.972  1.467   10.428  1.00 0.00 ? 139 PHE A HA   1  
ATOM 1655  H HB3  . PHE A 1 121 ? 11.192  2.164   11.953  1.00 0.00 ? 139 PHE A HB3  1  
ATOM 1656  H HD1  . PHE A 1 121 ? 9.573   -0.813  10.487  1.00 0.00 ? 139 PHE A HD1  1  
ATOM 1657  H HD2  . PHE A 1 121 ? 9.242   3.341   11.354  1.00 0.00 ? 139 PHE A HD2  1  
ATOM 1658  H HE1  . PHE A 1 121 ? 7.182   -0.887  9.910   1.00 0.00 ? 139 PHE A HE1  1  
ATOM 1659  H HE2  . PHE A 1 121 ? 6.850   3.274   10.779  1.00 0.00 ? 139 PHE A HE2  1  
ATOM 1660  H HZ   . PHE A 1 121 ? 5.818   1.158   10.054  1.00 0.00 ? 139 PHE A HZ   1  
ATOM 1661  N N    . ASP A 1 122 ? 12.383  -0.913  9.603   1.00 0.00 ? 140 ASP A N    1  
ATOM 1662  C CA   . ASP A 1 122 ? 12.298  -2.153  8.840   1.00 0.00 ? 140 ASP A CA   1  
ATOM 1663  C C    . ASP A 1 122 ? 11.650  -3.257  9.670   1.00 0.00 ? 140 ASP A C    1  
ATOM 1664  O O    . ASP A 1 122 ? 12.268  -3.809  10.578  1.00 0.00 ? 140 ASP A O    1  
ATOM 1665  C CB   . ASP A 1 122 ? 13.690  -2.592  8.383   1.00 0.00 ? 140 ASP A CB   1  
ATOM 1666  C CG   . ASP A 1 122 ? 14.762  -2.277  9.406   1.00 0.00 ? 140 ASP A CG   1  
ATOM 1667  O OD1  . ASP A 1 122 ? 14.510  -2.483  10.613  1.00 0.00 ? 140 ASP A OD1  1  
ATOM 1668  O OD2  . ASP A 1 122 ? 15.854  -1.826  9.002   1.00 0.00 ? 140 ASP A OD2  1  
ATOM 1669  H H    . ASP A 1 122 ? 12.904  -0.897  10.434  1.00 0.00 ? 140 ASP A H    1  
ATOM 1670  H HA   . ASP A 1 122 ? 11.685  -1.966  7.971   1.00 0.00 ? 140 ASP A HA   1  
ATOM 1671  H HB3  . ASP A 1 122 ? 13.936  -2.084  7.461   1.00 0.00 ? 140 ASP A HB3  1  
ATOM 1672  N N    . GLY A 1 123 ? 10.399  -3.573  9.350   1.00 0.00 ? 141 GLY A N    1  
ATOM 1673  C CA   . GLY A 1 123 ? 9.687   -4.608  10.076  1.00 0.00 ? 141 GLY A CA   1  
ATOM 1674  C C    . GLY A 1 123 ? 9.646   -5.923  9.321   1.00 0.00 ? 141 GLY A C    1  
ATOM 1675  O O    . GLY A 1 123 ? 10.381  -6.131  8.356   1.00 0.00 ? 141 GLY A O    1  
ATOM 1676  H H    . GLY A 1 123 ? 9.955   -3.098  8.616   1.00 0.00 ? 141 GLY A H    1  
ATOM 1677  H HA2  . GLY A 1 123 ? 10.174  -4.767  11.027  1.00 0.00 ? 141 GLY A HA2  1  
ATOM 1678  H HA3  . GLY A 1 123 ? 8.673   -4.277  10.253  1.00 0.00 ? 141 GLY A HA3  1  
ATOM 1679  N N    . PRO A 1 124 ? 8.771   -6.837  9.764   1.00 0.00 ? 142 PRO A N    1  
ATOM 1680  C CA   . PRO A 1 124 ? 8.617   -8.154  9.139   1.00 0.00 ? 142 PRO A CA   1  
ATOM 1681  C C    . PRO A 1 124 ? 7.977   -8.068  7.757   1.00 0.00 ? 142 PRO A C    1  
ATOM 1682  O O    . PRO A 1 124 ? 7.502   -9.069  7.220   1.00 0.00 ? 142 PRO A O    1  
ATOM 1683  C CB   . PRO A 1 124 ? 7.698   -8.903  10.108  1.00 0.00 ? 142 PRO A CB   1  
ATOM 1684  C CG   . PRO A 1 124 ? 6.932   -7.832  10.806  1.00 0.00 ? 142 PRO A CG   1  
ATOM 1685  C CD   . PRO A 1 124 ? 7.864   -6.656  10.910  1.00 0.00 ? 142 PRO A CD   1  
ATOM 1686  H HA   . PRO A 1 124 ? 9.563   -8.670  9.065   1.00 0.00 ? 142 PRO A HA   1  
ATOM 1687  H HB3  . PRO A 1 124 ? 8.293   -9.477  10.801  1.00 0.00 ? 142 PRO A HB3  1  
ATOM 1688  H HG3  . PRO A 1 124 ? 6.644   -8.170  11.789  1.00 0.00 ? 142 PRO A HG3  1  
ATOM 1689  H HD3  . PRO A 1 124 ? 8.409   -6.689  11.842  1.00 0.00 ? 142 PRO A HD3  1  
ATOM 1690  N N    . ILE A 1 125 ? 7.970   -6.868  7.187   1.00 0.00 ? 143 ILE A N    1  
ATOM 1691  C CA   . ILE A 1 125 ? 7.391   -6.653  5.867   1.00 0.00 ? 143 ILE A CA   1  
ATOM 1692  C C    . ILE A 1 125 ? 8.222   -5.665  5.055   1.00 0.00 ? 143 ILE A C    1  
ATOM 1693  O O    . ILE A 1 125 ? 8.445   -4.530  5.478   1.00 0.00 ? 143 ILE A O    1  
ATOM 1694  C CB   . ILE A 1 125 ? 5.945   -6.132  5.964   1.00 0.00 ? 143 ILE A CB   1  
ATOM 1695  C CG1  . ILE A 1 125 ? 5.127   -7.006  6.918   1.00 0.00 ? 143 ILE A CG1  1  
ATOM 1696  C CG2  . ILE A 1 125 ? 5.300   -6.094  4.588   1.00 0.00 ? 143 ILE A CG2  1  
ATOM 1697  C CD1  . ILE A 1 125 ? 3.721   -6.501  7.146   1.00 0.00 ? 143 ILE A CD1  1  
ATOM 1698  H H    . ILE A 1 125 ? 8.365   -6.109  7.665   1.00 0.00 ? 143 ILE A H    1  
ATOM 1699  H HA   . ILE A 1 125 ? 7.375   -7.603  5.351   1.00 0.00 ? 143 ILE A HA   1  
ATOM 1700  H HB   . ILE A 1 125 ? 5.975   -5.124  6.349   1.00 0.00 ? 143 ILE A HB   1  
ATOM 1701  H HG13 . ILE A 1 125 ? 5.627   -7.045  7.876   1.00 0.00 ? 143 ILE A HG13 1  
ATOM 1702  H HG21 . ILE A 1 125 ? 6.050   -6.286  3.834   1.00 0.00 ? 143 ILE A HG21 1  
ATOM 1703  H HG22 . ILE A 1 125 ? 4.533   -6.851  4.529   1.00 0.00 ? 143 ILE A HG22 1  
ATOM 1704  H HG23 . ILE A 1 125 ? 4.862   -5.122  4.421   1.00 0.00 ? 143 ILE A HG23 1  
ATOM 1705  H HD11 . ILE A 1 125 ? 3.697   -5.428  7.016   1.00 0.00 ? 143 ILE A HD11 1  
ATOM 1706  H HD12 . ILE A 1 125 ? 3.051   -6.964  6.437   1.00 0.00 ? 143 ILE A HD12 1  
ATOM 1707  H HD13 . ILE A 1 125 ? 3.407   -6.747  8.150   1.00 0.00 ? 143 ILE A HD13 1  
ATOM 1708  N N    . THR A 1 126 ? 8.677   -6.103  3.886   1.00 0.00 ? 144 THR A N    1  
ATOM 1709  C CA   . THR A 1 126 ? 9.483   -5.257  3.014   1.00 0.00 ? 144 THR A CA   1  
ATOM 1710  C C    . THR A 1 126 ? 8.602   -4.377  2.135   1.00 0.00 ? 144 THR A C    1  
ATOM 1711  O O    . THR A 1 126 ? 7.457   -4.723  1.843   1.00 0.00 ? 144 THR A O    1  
ATOM 1712  C CB   . THR A 1 126 ? 10.408  -6.099  2.114   1.00 0.00 ? 144 THR A CB   1  
ATOM 1713  O OG1  . THR A 1 126 ? 11.045  -7.122  2.887   1.00 0.00 ? 144 THR A OG1  1  
ATOM 1714  C CG2  . THR A 1 126 ? 11.464  -5.224  1.455   1.00 0.00 ? 144 THR A CG2  1  
ATOM 1715  H H    . THR A 1 126 ? 8.465   -7.018  3.604   1.00 0.00 ? 144 THR A H    1  
ATOM 1716  H HA   . THR A 1 126 ? 10.099  -4.627  3.638   1.00 0.00 ? 144 THR A HA   1  
ATOM 1717  H HB   . THR A 1 126 ? 9.810   -6.561  1.341   1.00 0.00 ? 144 THR A HB   1  
ATOM 1718  H HG1  . THR A 1 126 ? 11.629  -6.720  3.533   1.00 0.00 ? 144 THR A HG1  1  
ATOM 1719  H HG21 . THR A 1 126 ? 11.848  -4.519  2.177   1.00 0.00 ? 144 THR A HG21 1  
ATOM 1720  H HG22 . THR A 1 126 ? 11.022  -4.689  0.628   1.00 0.00 ? 144 THR A HG22 1  
ATOM 1721  H HG23 . THR A 1 126 ? 12.269  -5.844  1.094   1.00 0.00 ? 144 THR A HG23 1  
ATOM 1722  N N    . ILE A 1 127 ? 9.143   -3.238  1.717   1.00 0.00 ? 145 ILE A N    1  
ATOM 1723  C CA   . ILE A 1 127 ? 8.406   -2.308  0.870   1.00 0.00 ? 145 ILE A CA   1  
ATOM 1724  C C    . ILE A 1 127 ? 9.354   -1.383  0.114   1.00 0.00 ? 145 ILE A C    1  
ATOM 1725  O O    . ILE A 1 127 ? 10.361  -0.928  0.658   1.00 0.00 ? 145 ILE A O    1  
ATOM 1726  C CB   . ILE A 1 127 ? 7.422   -1.456  1.692   1.00 0.00 ? 145 ILE A CB   1  
ATOM 1727  C CG1  . ILE A 1 127 ? 6.820   -0.350  0.823   1.00 0.00 ? 145 ILE A CG1  1  
ATOM 1728  C CG2  . ILE A 1 127 ? 8.122   -0.862  2.906   1.00 0.00 ? 145 ILE A CG2  1  
ATOM 1729  C CD1  . ILE A 1 127 ? 7.573   0.959   0.903   1.00 0.00 ? 145 ILE A CD1  1  
ATOM 1730  H H    . ILE A 1 127 ? 10.060  -3.018  1.983   1.00 0.00 ? 145 ILE A H    1  
ATOM 1731  H HA   . ILE A 1 127 ? 7.839   -2.888  0.155   1.00 0.00 ? 145 ILE A HA   1  
ATOM 1732  H HB   . ILE A 1 127 ? 6.629   -2.100  2.044   1.00 0.00 ? 145 ILE A HB   1  
ATOM 1733  H HG13 . ILE A 1 127 ? 5.803   -0.169  1.137   1.00 0.00 ? 145 ILE A HG13 1  
ATOM 1734  H HG21 . ILE A 1 127 ? 8.228   -1.620  3.667   1.00 0.00 ? 145 ILE A HG21 1  
ATOM 1735  H HG22 . ILE A 1 127 ? 9.099   -0.503  2.617   1.00 0.00 ? 145 ILE A HG22 1  
ATOM 1736  H HG23 . ILE A 1 127 ? 7.537   -0.042  3.293   1.00 0.00 ? 145 ILE A HG23 1  
ATOM 1737  H HD11 . ILE A 1 127 ? 7.215   1.529   1.749   1.00 0.00 ? 145 ILE A HD11 1  
ATOM 1738  H HD12 . ILE A 1 127 ? 8.627   0.762   1.022   1.00 0.00 ? 145 ILE A HD12 1  
ATOM 1739  H HD13 . ILE A 1 127 ? 7.412   1.523   -0.004  1.00 0.00 ? 145 ILE A HD13 1  
ATOM 1740  N N    . THR A 1 128 ? 9.024   -1.106  -1.143  1.00 0.00 ? 146 THR A N    1  
ATOM 1741  C CA   . THR A 1 128 ? 9.845   -0.235  -1.974  1.00 0.00 ? 146 THR A CA   1  
ATOM 1742  C C    . THR A 1 128 ? 8.989   0.795   -2.704  1.00 0.00 ? 146 THR A C    1  
ATOM 1743  O O    . THR A 1 128 ? 7.788   0.599   -2.887  1.00 0.00 ? 146 THR A O    1  
ATOM 1744  C CB   . THR A 1 128 ? 10.651  -1.041  -3.010  1.00 0.00 ? 146 THR A CB   1  
ATOM 1745  O OG1  . THR A 1 128 ? 10.001  -2.289  -3.273  1.00 0.00 ? 146 THR A OG1  1  
ATOM 1746  C CG2  . THR A 1 128 ? 12.067  -1.296  -2.514  1.00 0.00 ? 146 THR A CG2  1  
ATOM 1747  H H    . THR A 1 128 ? 8.210   -1.499  -1.521  1.00 0.00 ? 146 THR A H    1  
ATOM 1748  H HA   . THR A 1 128 ? 10.541  0.282   -1.329  1.00 0.00 ? 146 THR A HA   1  
ATOM 1749  H HB   . THR A 1 128 ? 10.705  -0.471  -3.926  1.00 0.00 ? 146 THR A HB   1  
ATOM 1750  H HG1  . THR A 1 128 ? 9.050   -2.178  -3.195  1.00 0.00 ? 146 THR A HG1  1  
ATOM 1751  H HG21 . THR A 1 128 ? 12.532  -2.055  -3.126  1.00 0.00 ? 146 THR A HG21 1  
ATOM 1752  H HG22 . THR A 1 128 ? 12.034  -1.631  -1.488  1.00 0.00 ? 146 THR A HG22 1  
ATOM 1753  H HG23 . THR A 1 128 ? 12.640  -0.384  -2.576  1.00 0.00 ? 146 THR A HG23 1  
ATOM 1754  N N    . ILE A 1 129 ? 9.616   1.890   -3.119  1.00 0.00 ? 147 ILE A N    1  
ATOM 1755  C CA   . ILE A 1 129 ? 8.912   2.950   -3.831  1.00 0.00 ? 147 ILE A CA   1  
ATOM 1756  C C    . ILE A 1 129 ? 9.431   3.094   -5.257  1.00 0.00 ? 147 ILE A C    1  
ATOM 1757  O O    . ILE A 1 129 ? 10.416  2.460   -5.638  1.00 0.00 ? 147 ILE A O    1  
ATOM 1758  C CB   . ILE A 1 129 ? 9.050   4.303   -3.107  1.00 0.00 ? 147 ILE A CB   1  
ATOM 1759  C CG1  . ILE A 1 129 ? 10.522  4.714   -3.026  1.00 0.00 ? 147 ILE A CG1  1  
ATOM 1760  C CG2  . ILE A 1 129 ? 8.440   4.224   -1.715  1.00 0.00 ? 147 ILE A CG2  1  
ATOM 1761  C CD1  . ILE A 1 129 ? 10.769  6.153   -3.423  1.00 0.00 ? 147 ILE A CD1  1  
ATOM 1762  H H    . ILE A 1 129 ? 10.576  1.989   -2.943  1.00 0.00 ? 147 ILE A H    1  
ATOM 1763  H HA   . ILE A 1 129 ? 7.863   2.689   -3.864  1.00 0.00 ? 147 ILE A HA   1  
ATOM 1764  H HB   . ILE A 1 129 ? 8.506   5.045   -3.671  1.00 0.00 ? 147 ILE A HB   1  
ATOM 1765  H HG13 . ILE A 1 129 ? 11.100  4.083   -3.686  1.00 0.00 ? 147 ILE A HG13 1  
ATOM 1766  H HG21 . ILE A 1 129 ? 8.984   4.874   -1.046  1.00 0.00 ? 147 ILE A HG21 1  
ATOM 1767  H HG22 . ILE A 1 129 ? 7.407   4.535   -1.758  1.00 0.00 ? 147 ILE A HG22 1  
ATOM 1768  H HG23 . ILE A 1 129 ? 8.495   3.208   -1.354  1.00 0.00 ? 147 ILE A HG23 1  
ATOM 1769  H HD11 . ILE A 1 129 ? 9.895   6.544   -3.922  1.00 0.00 ? 147 ILE A HD11 1  
ATOM 1770  H HD12 . ILE A 1 129 ? 10.973  6.740   -2.540  1.00 0.00 ? 147 ILE A HD12 1  
ATOM 1771  H HD13 . ILE A 1 129 ? 11.616  6.202   -4.092  1.00 0.00 ? 147 ILE A HD13 1  
ATOM 1772  N N    . VAL A 1 130 ? 8.762   3.933   -6.042  1.00 0.00 ? 148 VAL A N    1  
ATOM 1773  C CA   . VAL A 1 130 ? 9.158   4.163   -7.427  1.00 0.00 ? 148 VAL A CA   1  
ATOM 1774  C C    . VAL A 1 130 ? 10.336  5.126   -7.509  1.00 0.00 ? 148 VAL A C    1  
ATOM 1775  O O    . VAL A 1 130 ? 10.385  6.125   -6.792  1.00 0.00 ? 148 VAL A O    1  
ATOM 1776  C CB   . VAL A 1 130 ? 7.989   4.726   -8.258  1.00 0.00 ? 148 VAL A CB   1  
ATOM 1777  C CG1  . VAL A 1 130 ? 6.919   3.664   -8.462  1.00 0.00 ? 148 VAL A CG1  1  
ATOM 1778  C CG2  . VAL A 1 130 ? 7.406   5.961   -7.588  1.00 0.00 ? 148 VAL A CG2  1  
ATOM 1779  H H    . VAL A 1 130 ? 7.985   4.409   -5.682  1.00 0.00 ? 148 VAL A H    1  
ATOM 1780  H HA   . VAL A 1 130 ? 9.451   3.213   -7.852  1.00 0.00 ? 148 VAL A HA   1  
ATOM 1781  H HB   . VAL A 1 130 ? 8.369   5.012   -9.227  1.00 0.00 ? 148 VAL A HB   1  
ATOM 1782  H HG11 . VAL A 1 130 ? 7.214   3.006   -9.265  1.00 0.00 ? 148 VAL A HG11 1  
ATOM 1783  H HG12 . VAL A 1 130 ? 6.800   3.093   -7.552  1.00 0.00 ? 148 VAL A HG12 1  
ATOM 1784  H HG13 . VAL A 1 130 ? 5.983   4.141   -8.712  1.00 0.00 ? 148 VAL A HG13 1  
ATOM 1785  H HG21 . VAL A 1 130 ? 6.853   5.665   -6.709  1.00 0.00 ? 148 VAL A HG21 1  
ATOM 1786  H HG22 . VAL A 1 130 ? 8.208   6.627   -7.302  1.00 0.00 ? 148 VAL A HG22 1  
ATOM 1787  H HG23 . VAL A 1 130 ? 6.747   6.467   -8.277  1.00 0.00 ? 148 VAL A HG23 1  
ATOM 1788  N N    . ASN A 1 131 ? 11.284  4.819   -8.389  1.00 0.00 ? 149 ASN A N    1  
ATOM 1789  C CA   . ASN A 1 131 ? 12.463  5.659   -8.565  1.00 0.00 ? 149 ASN A CA   1  
ATOM 1790  C C    . ASN A 1 131 ? 12.072  7.051   -9.052  1.00 0.00 ? 149 ASN A C    1  
ATOM 1791  O O    . ASN A 1 131 ? 10.889  7.384   -9.129  1.00 0.00 ? 149 ASN A O    1  
ATOM 1792  C CB   . ASN A 1 131 ? 13.430  5.013   -9.559  1.00 0.00 ? 149 ASN A CB   1  
ATOM 1793  C CG   . ASN A 1 131 ? 13.871  3.629   -9.121  1.00 0.00 ? 149 ASN A CG   1  
ATOM 1794  O OD1  . ASN A 1 131 ? 13.747  3.268   -7.951  1.00 0.00 ? 149 ASN A OD1  1  
ATOM 1795  N ND2  . ASN A 1 131 ? 14.387  2.848   -10.062 1.00 0.00 ? 149 ASN A ND2  1  
ATOM 1796  H H    . ASN A 1 131 ? 11.188  4.010   -8.933  1.00 0.00 ? 149 ASN A H    1  
ATOM 1797  H HA   . ASN A 1 131 ? 12.952  5.749   -7.608  1.00 0.00 ? 149 ASN A HA   1  
ATOM 1798  H HB3  . ASN A 1 131 ? 14.307  5.635   -9.657  1.00 0.00 ? 149 ASN A HB3  1  
ATOM 1799  H HD21 . ASN A 1 131 ? 14.455  3.202   -10.974 1.00 0.00 ? 149 ASN A HD21 1  
ATOM 1800  H HD22 . ASN A 1 131 ? 14.679  1.948   -9.806  1.00 0.00 ? 149 ASN A HD22 1  
ATOM 1801  N N    . ARG A 1 132 ? 13.074  7.861   -9.379  1.00 0.00 ? 150 ARG A N    1  
ATOM 1802  C CA   . ARG A 1 132 ? 12.835  9.217   -9.858  1.00 0.00 ? 150 ARG A CA   1  
ATOM 1803  C C    . ARG A 1 132 ? 12.158  9.201   -11.224 1.00 0.00 ? 150 ARG A C    1  
ATOM 1804  O O    . ARG A 1 132 ? 11.359  10.081  -11.543 1.00 0.00 ? 150 ARG A O    1  
ATOM 1805  C CB   . ARG A 1 132 ? 14.152  9.991   -9.938  1.00 0.00 ? 150 ARG A CB   1  
ATOM 1806  C CG   . ARG A 1 132 ? 15.195  9.330   -10.824 1.00 0.00 ? 150 ARG A CG   1  
ATOM 1807  C CD   . ARG A 1 132 ? 16.436  10.197  -10.965 1.00 0.00 ? 150 ARG A CD   1  
ATOM 1808  N NE   . ARG A 1 132 ? 17.224  10.229  -9.735  1.00 0.00 ? 150 ARG A NE   1  
ATOM 1809  C CZ   . ARG A 1 132 ? 18.260  11.039  -9.549  1.00 0.00 ? 150 ARG A CZ   1  
ATOM 1810  N NH1  . ARG A 1 132 ? 18.631  11.879  -10.504 1.00 0.00 ? 150 ARG A NH1  1  
ATOM 1811  N NH2  . ARG A 1 132 ? 18.928  11.009  -8.402  1.00 0.00 ? 150 ARG A NH2  1  
ATOM 1812  H H    . ARG A 1 132 ? 13.996  7.539   -9.296  1.00 0.00 ? 150 ARG A H    1  
ATOM 1813  H HA   . ARG A 1 132 ? 12.181  9.707   -9.151  1.00 0.00 ? 150 ARG A HA   1  
ATOM 1814  H HB3  . ARG A 1 132 ? 14.562  10.085  -8.943  1.00 0.00 ? 150 ARG A HB3  1  
ATOM 1815  H HG3  . ARG A 1 132 ? 14.768  9.164   -11.802 1.00 0.00 ? 150 ARG A HG3  1  
ATOM 1816  H HD3  . ARG A 1 132 ? 16.130  11.202  -11.212 1.00 0.00 ? 150 ARG A HD3  1  
ATOM 1817  H HE   . ARG A 1 132 ? 16.967  9.616   -9.015  1.00 0.00 ? 150 ARG A HE   1  
ATOM 1818  H HH11 . ARG A 1 132 ? 18.130  11.904  -11.369 1.00 0.00 ? 150 ARG A HH11 1  
ATOM 1819  H HH12 . ARG A 1 132 ? 19.411  12.488  -10.360 1.00 0.00 ? 150 ARG A HH12 1  
ATOM 1820  H HH21 . ARG A 1 132 ? 18.650  10.378  -7.678  1.00 0.00 ? 150 ARG A HH21 1  
ATOM 1821  H HH22 . ARG A 1 132 ? 19.708  11.619  -8.261  1.00 0.00 ? 150 ARG A HH22 1  
ATOM 1822  N N    . ASP A 1 133 ? 12.484  8.194   -12.027 1.00 0.00 ? 151 ASP A N    1  
ATOM 1823  C CA   . ASP A 1 133 ? 11.908  8.062   -13.360 1.00 0.00 ? 151 ASP A CA   1  
ATOM 1824  C C    . ASP A 1 133 ? 10.400  7.838   -13.281 1.00 0.00 ? 151 ASP A C    1  
ATOM 1825  O O    . ASP A 1 133 ? 9.687   7.988   -14.272 1.00 0.00 ? 151 ASP A O    1  
ATOM 1826  C CB   . ASP A 1 133 ? 12.569  6.906   -14.113 1.00 0.00 ? 151 ASP A CB   1  
ATOM 1827  C CG   . ASP A 1 133 ? 12.486  7.071   -15.618 1.00 0.00 ? 151 ASP A CG   1  
ATOM 1828  O OD1  . ASP A 1 133 ? 12.545  8.225   -16.092 1.00 0.00 ? 151 ASP A OD1  1  
ATOM 1829  O OD2  . ASP A 1 133 ? 12.360  6.047   -16.322 1.00 0.00 ? 151 ASP A OD2  1  
ATOM 1830  H H    . ASP A 1 133 ? 13.128  7.523   -11.716 1.00 0.00 ? 151 ASP A H    1  
ATOM 1831  H HA   . ASP A 1 133 ? 12.095  8.981   -13.896 1.00 0.00 ? 151 ASP A HA   1  
ATOM 1832  H HB3  . ASP A 1 133 ? 12.079  5.982   -13.842 1.00 0.00 ? 151 ASP A HB3  1  
ATOM 1833  N N    . GLY A 1 134 ? 9.923   7.475   -12.095 1.00 0.00 ? 152 GLY A N    1  
ATOM 1834  C CA   . GLY A 1 134 ? 8.504   7.235   -11.909 1.00 0.00 ? 152 GLY A CA   1  
ATOM 1835  C C    . GLY A 1 134 ? 7.941   6.268   -12.931 1.00 0.00 ? 152 GLY A C    1  
ATOM 1836  O O    . GLY A 1 134 ? 6.914   6.540   -13.554 1.00 0.00 ? 152 GLY A O    1  
ATOM 1837  H H    . GLY A 1 134 ? 10.540  7.370   -11.340 1.00 0.00 ? 152 GLY A H    1  
ATOM 1838  H HA2  . GLY A 1 134 ? 8.346   6.830   -10.919 1.00 0.00 ? 152 GLY A HA2  1  
ATOM 1839  H HA3  . GLY A 1 134 ? 7.978   8.174   -11.990 1.00 0.00 ? 152 GLY A HA3  1  
ATOM 1840  N N    . THR A 1 135 ? 8.614   5.135   -13.106 1.00 0.00 ? 153 THR A N    1  
ATOM 1841  C CA   . THR A 1 135 ? 8.176   4.126   -14.062 1.00 0.00 ? 153 THR A CA   1  
ATOM 1842  C C    . THR A 1 135 ? 8.072   2.754   -13.404 1.00 0.00 ? 153 THR A C    1  
ATOM 1843  O O    . THR A 1 135 ? 6.975   2.266   -13.137 1.00 0.00 ? 153 THR A O    1  
ATOM 1844  C CB   . THR A 1 135 ? 9.137   4.036   -15.263 1.00 0.00 ? 153 THR A CB   1  
ATOM 1845  O OG1  . THR A 1 135 ? 10.490  3.943   -14.802 1.00 0.00 ? 153 THR A OG1  1  
ATOM 1846  C CG2  . THR A 1 135 ? 8.985   5.248   -16.169 1.00 0.00 ? 153 THR A CG2  1  
ATOM 1847  H H    . THR A 1 135 ? 9.425   4.976   -12.579 1.00 0.00 ? 153 THR A H    1  
ATOM 1848  H HA   . THR A 1 135 ? 7.202   4.414   -14.428 1.00 0.00 ? 153 THR A HA   1  
ATOM 1849  H HB   . THR A 1 135 ? 8.897   3.148   -15.830 1.00 0.00 ? 153 THR A HB   1  
ATOM 1850  H HG1  . THR A 1 135 ? 10.646  4.615   -14.133 1.00 0.00 ? 153 THR A HG1  1  
ATOM 1851  H HG21 . THR A 1 135 ? 9.391   6.119   -15.676 1.00 0.00 ? 153 THR A HG21 1  
ATOM 1852  H HG22 . THR A 1 135 ? 7.939   5.409   -16.383 1.00 0.00 ? 153 THR A HG22 1  
ATOM 1853  H HG23 . THR A 1 135 ? 9.519   5.076   -17.092 1.00 0.00 ? 153 THR A HG23 1  
ATOM 1854  N N    . ARG A 1 136 ? 9.222   2.138   -13.146 1.00 0.00 ? 154 ARG A N    1  
ATOM 1855  C CA   . ARG A 1 136 ? 9.259   0.822   -12.521 1.00 0.00 ? 154 ARG A CA   1  
ATOM 1856  C C    . ARG A 1 136 ? 10.065  0.859   -11.225 1.00 0.00 ? 154 ARG A C    1  
ATOM 1857  O O    . ARG A 1 136 ? 11.280  1.058   -11.244 1.00 0.00 ? 154 ARG A O    1  
ATOM 1858  C CB   . ARG A 1 136 ? 9.862   -0.205  -13.480 1.00 0.00 ? 154 ARG A CB   1  
ATOM 1859  C CG   . ARG A 1 136 ? 8.857   -0.786  -14.461 1.00 0.00 ? 154 ARG A CG   1  
ATOM 1860  C CD   . ARG A 1 136 ? 9.540   -1.634  -15.522 1.00 0.00 ? 154 ARG A CD   1  
ATOM 1861  N NE   . ARG A 1 136 ? 10.160  -0.817  -16.561 1.00 0.00 ? 154 ARG A NE   1  
ATOM 1862  C CZ   . ARG A 1 136 ? 11.078  -1.274  -17.406 1.00 0.00 ? 154 ARG A CZ   1  
ATOM 1863  N NH1  . ARG A 1 136 ? 11.478  -2.536  -17.336 1.00 0.00 ? 154 ARG A NH1  1  
ATOM 1864  N NH2  . ARG A 1 136 ? 11.596  -0.468  -18.324 1.00 0.00 ? 154 ARG A NH2  1  
ATOM 1865  H H    . ARG A 1 136 ? 10.064  2.579   -13.384 1.00 0.00 ? 154 ARG A H    1  
ATOM 1866  H HA   . ARG A 1 136 ? 8.244   0.535   -12.291 1.00 0.00 ? 154 ARG A HA   1  
ATOM 1867  H HB3  . ARG A 1 136 ? 10.279  -1.017  -12.903 1.00 0.00 ? 154 ARG A HB3  1  
ATOM 1868  H HG3  . ARG A 1 136 ? 8.330   0.023   -14.944 1.00 0.00 ? 154 ARG A HG3  1  
ATOM 1869  H HD3  . ARG A 1 136 ? 8.803   -2.280  -15.977 1.00 0.00 ? 154 ARG A HD3  1  
ATOM 1870  H HE   . ARG A 1 136 ? 9.879   0.119   -16.630 1.00 0.00 ? 154 ARG A HE   1  
ATOM 1871  H HH11 . ARG A 1 136 ? 11.089  -3.145  -16.646 1.00 0.00 ? 154 ARG A HH11 1  
ATOM 1872  H HH12 . ARG A 1 136 ? 12.169  -2.878  -17.974 1.00 0.00 ? 154 ARG A HH12 1  
ATOM 1873  H HH21 . ARG A 1 136 ? 11.296  0.483   -18.380 1.00 0.00 ? 154 ARG A HH21 1  
ATOM 1874  H HH22 . ARG A 1 136 ? 12.287  -0.813  -18.959 1.00 0.00 ? 154 ARG A HH22 1  
ATOM 1875  N N    . TYR A 1 137 ? 9.381   0.667   -10.104 1.00 0.00 ? 155 TYR A N    1  
ATOM 1876  C CA   . TYR A 1 137 ? 10.032  0.680   -8.799  1.00 0.00 ? 155 TYR A CA   1  
ATOM 1877  C C    . TYR A 1 137 ? 11.168  -0.335  -8.747  1.00 0.00 ? 155 TYR A C    1  
ATOM 1878  O O    . TYR A 1 137 ? 11.204  -1.286  -9.528  1.00 0.00 ? 155 TYR A O    1  
ATOM 1879  C CB   . TYR A 1 137 ? 9.016   0.382   -7.695  1.00 0.00 ? 155 TYR A CB   1  
ATOM 1880  C CG   . TYR A 1 137 ? 8.683   -1.086  -7.558  1.00 0.00 ? 155 TYR A CG   1  
ATOM 1881  C CD1  . TYR A 1 137 ? 8.188   -1.810  -8.635  1.00 0.00 ? 155 TYR A CD1  1  
ATOM 1882  C CD2  . TYR A 1 137 ? 8.865   -1.750  -6.351  1.00 0.00 ? 155 TYR A CD2  1  
ATOM 1883  C CE1  . TYR A 1 137 ? 7.883   -3.152  -8.514  1.00 0.00 ? 155 TYR A CE1  1  
ATOM 1884  C CE2  . TYR A 1 137 ? 8.564   -3.091  -6.221  1.00 0.00 ? 155 TYR A CE2  1  
ATOM 1885  C CZ   . TYR A 1 137 ? 8.073   -3.788  -7.306  1.00 0.00 ? 155 TYR A CZ   1  
ATOM 1886  O OH   . TYR A 1 137 ? 7.771   -5.125  -7.182  1.00 0.00 ? 155 TYR A OH   1  
ATOM 1887  H H    . TYR A 1 137 ? 8.414   0.513   -10.153 1.00 0.00 ? 155 TYR A H    1  
ATOM 1888  H HA   . TYR A 1 137 ? 10.440  1.669   -8.643  1.00 0.00 ? 155 TYR A HA   1  
ATOM 1889  H HB3  . TYR A 1 137 ? 8.098   0.913   -7.908  1.00 0.00 ? 155 TYR A HB3  1  
ATOM 1890  H HD1  . TYR A 1 137 ? 8.042   -1.309  -9.582  1.00 0.00 ? 155 TYR A HD1  1  
ATOM 1891  H HD2  . TYR A 1 137 ? 9.251   -1.201  -5.503  1.00 0.00 ? 155 TYR A HD2  1  
ATOM 1892  H HE1  . TYR A 1 137 ? 7.499   -3.698  -9.364  1.00 0.00 ? 155 TYR A HE1  1  
ATOM 1893  H HE2  . TYR A 1 137 ? 8.712   -3.590  -5.275  1.00 0.00 ? 155 TYR A HE2  1  
ATOM 1894  H HH   . TYR A 1 137 ? 6.886   -5.285  -7.517  1.00 0.00 ? 155 TYR A HH   1  
ATOM 1895  N N    . VAL A 1 138 ? 12.098  -0.127  -7.820  1.00 0.00 ? 156 VAL A N    1  
ATOM 1896  C CA   . VAL A 1 138 ? 13.236  -1.024  -7.662  1.00 0.00 ? 156 VAL A CA   1  
ATOM 1897  C C    . VAL A 1 138 ? 13.033  -1.969  -6.483  1.00 0.00 ? 156 VAL A C    1  
ATOM 1898  O O    . VAL A 1 138 ? 12.355  -1.629  -5.513  1.00 0.00 ? 156 VAL A O    1  
ATOM 1899  C CB   . VAL A 1 138 ? 14.545  -0.239  -7.458  1.00 0.00 ? 156 VAL A CB   1  
ATOM 1900  C CG1  . VAL A 1 138 ? 14.514  0.517   -6.138  1.00 0.00 ? 156 VAL A CG1  1  
ATOM 1901  C CG2  . VAL A 1 138 ? 15.743  -1.176  -7.516  1.00 0.00 ? 156 VAL A CG2  1  
ATOM 1902  H H    . VAL A 1 138 ? 12.016  0.649   -7.226  1.00 0.00 ? 156 VAL A H    1  
ATOM 1903  H HA   . VAL A 1 138 ? 13.328  -1.608  -8.567  1.00 0.00 ? 156 VAL A HA   1  
ATOM 1904  H HB   . VAL A 1 138 ? 14.639  0.480   -8.258  1.00 0.00 ? 156 VAL A HB   1  
ATOM 1905  H HG11 . VAL A 1 138 ? 15.070  -0.034  -5.395  1.00 0.00 ? 156 VAL A HG11 1  
ATOM 1906  H HG12 . VAL A 1 138 ? 14.957  1.493   -6.272  1.00 0.00 ? 156 VAL A HG12 1  
ATOM 1907  H HG13 . VAL A 1 138 ? 13.490  0.629   -5.812  1.00 0.00 ? 156 VAL A HG13 1  
ATOM 1908  H HG21 . VAL A 1 138 ? 15.782  -1.764  -6.611  1.00 0.00 ? 156 VAL A HG21 1  
ATOM 1909  H HG22 . VAL A 1 138 ? 15.645  -1.834  -8.368  1.00 0.00 ? 156 VAL A HG22 1  
ATOM 1910  H HG23 . VAL A 1 138 ? 16.649  -0.598  -7.610  1.00 0.00 ? 156 VAL A HG23 1  
ATOM 1911  N N    . GLN A 1 139 ? 13.624  -3.155  -6.573  1.00 0.00 ? 157 GLN A N    1  
ATOM 1912  C CA   . GLN A 1 139 ? 13.508  -4.149  -5.512  1.00 0.00 ? 157 GLN A CA   1  
ATOM 1913  C C    . GLN A 1 139 ? 14.704  -5.095  -5.520  1.00 0.00 ? 157 GLN A C    1  
ATOM 1914  O O    . GLN A 1 139 ? 15.150  -5.542  -6.576  1.00 0.00 ? 157 GLN A O    1  
ATOM 1915  C CB   . GLN A 1 139 ? 12.212  -4.945  -5.671  1.00 0.00 ? 157 GLN A CB   1  
ATOM 1916  C CG   . GLN A 1 139 ? 11.663  -5.483  -4.359  1.00 0.00 ? 157 GLN A CG   1  
ATOM 1917  C CD   . GLN A 1 139 ? 10.673  -6.612  -4.560  1.00 0.00 ? 157 GLN A CD   1  
ATOM 1918  O OE1  . GLN A 1 139 ? 9.461   -6.416  -4.461  1.00 0.00 ? 157 GLN A OE1  1  
ATOM 1919  N NE2  . GLN A 1 139 ? 11.183  -7.805  -4.843  1.00 0.00 ? 157 GLN A NE2  1  
ATOM 1920  H H    . GLN A 1 139 ? 14.151  -3.368  -7.371  1.00 0.00 ? 157 GLN A H    1  
ATOM 1921  H HA   . GLN A 1 139 ? 13.485  -3.625  -4.569  1.00 0.00 ? 157 GLN A HA   1  
ATOM 1922  H HB3  . GLN A 1 139 ? 12.396  -5.782  -6.328  1.00 0.00 ? 157 GLN A HB3  1  
ATOM 1923  H HG3  . GLN A 1 139 ? 11.169  -4.678  -3.835  1.00 0.00 ? 157 GLN A HG3  1  
ATOM 1924  H HE21 . GLN A 1 139 ? 12.159  -7.887  -4.905  1.00 0.00 ? 157 GLN A HE21 1  
ATOM 1925  H HE22 . GLN A 1 139 ? 10.566  -8.553  -4.977  1.00 0.00 ? 157 GLN A HE22 1  
ATOM 1926  N N    . LYS A 1 140 ? 15.220  -5.397  -4.332  1.00 0.00 ? 158 LYS A N    1  
ATOM 1927  C CA   . LYS A 1 140 ? 16.365  -6.292  -4.200  1.00 0.00 ? 158 LYS A CA   1  
ATOM 1928  C C    . LYS A 1 140 ? 17.547  -5.787  -5.020  1.00 0.00 ? 158 LYS A C    1  
ATOM 1929  O O    . LYS A 1 140 ? 18.250  -6.568  -5.659  1.00 0.00 ? 158 LYS A O    1  
ATOM 1930  C CB   . LYS A 1 140 ? 15.987  -7.706  -4.647  1.00 0.00 ? 158 LYS A CB   1  
ATOM 1931  C CG   . LYS A 1 140 ? 15.056  -8.420  -3.682  1.00 0.00 ? 158 LYS A CG   1  
ATOM 1932  C CD   . LYS A 1 140 ? 14.378  -9.611  -4.339  1.00 0.00 ? 158 LYS A CD   1  
ATOM 1933  C CE   . LYS A 1 140 ? 15.365  -10.738 -4.603  1.00 0.00 ? 158 LYS A CE   1  
ATOM 1934  N NZ   . LYS A 1 140 ? 16.032  -10.592 -5.927  1.00 0.00 ? 158 LYS A NZ   1  
ATOM 1935  H H    . LYS A 1 140 ? 14.820  -5.010  -3.525  1.00 0.00 ? 158 LYS A H    1  
ATOM 1936  H HA   . LYS A 1 140 ? 16.648  -6.315  -3.159  1.00 0.00 ? 158 LYS A HA   1  
ATOM 1937  H HB3  . LYS A 1 140 ? 16.889  -8.292  -4.744  1.00 0.00 ? 158 LYS A HB3  1  
ATOM 1938  H HG3  . LYS A 1 140 ? 14.299  -7.725  -3.347  1.00 0.00 ? 158 LYS A HG3  1  
ATOM 1939  H HD3  . LYS A 1 140 ? 13.946  -9.294  -5.278  1.00 0.00 ? 158 LYS A HD3  1  
ATOM 1940  H HE3  . LYS A 1 140 ? 14.833  -11.677 -4.579  1.00 0.00 ? 158 LYS A HE3  1  
ATOM 1941  H HZ1  . LYS A 1 140 ? 16.211  -11.529 -6.341  1.00 0.00 ? 158 LYS A HZ1  1  
ATOM 1942  H HZ2  . LYS A 1 140 ? 16.939  -10.095 -5.817  1.00 0.00 ? 158 LYS A HZ2  1  
ATOM 1943  H HZ3  . LYS A 1 140 ? 15.426  -10.048 -6.574  1.00 0.00 ? 158 LYS A HZ3  1  
ATOM 1944  N N    . GLY A 1 141 ? 17.761  -4.474  -4.997  1.00 0.00 ? 159 GLY A N    1  
ATOM 1945  C CA   . GLY A 1 141 ? 18.860  -3.889  -5.742  1.00 0.00 ? 159 GLY A CA   1  
ATOM 1946  C C    . GLY A 1 141 ? 20.166  -3.926  -4.974  1.00 0.00 ? 159 GLY A C    1  
ATOM 1947  O O    . GLY A 1 141 ? 20.207  -4.376  -3.828  1.00 0.00 ? 159 GLY A O    1  
ATOM 1948  H H    . GLY A 1 141 ? 17.167  -3.899  -4.470  1.00 0.00 ? 159 GLY A H    1  
ATOM 1949  H HA2  . GLY A 1 141 ? 18.984  -4.432  -6.667  1.00 0.00 ? 159 GLY A HA2  1  
ATOM 1950  H HA3  . GLY A 1 141 ? 18.619  -2.861  -5.969  1.00 0.00 ? 159 GLY A HA3  1  
ATOM 1951  N N    . GLU A 1 142 ? 21.236  -3.452  -5.604  1.00 0.00 ? 160 GLU A N    1  
ATOM 1952  C CA   . GLU A 1 142 ? 22.550  -3.436  -4.971  1.00 0.00 ? 160 GLU A CA   1  
ATOM 1953  C C    . GLU A 1 142 ? 22.808  -2.096  -4.289  1.00 0.00 ? 160 GLU A C    1  
ATOM 1954  O O    . GLU A 1 142 ? 22.053  -1.140  -4.467  1.00 0.00 ? 160 GLU A O    1  
ATOM 1955  C CB   . GLU A 1 142 ? 23.642  -3.714  -6.006  1.00 0.00 ? 160 GLU A CB   1  
ATOM 1956  C CG   . GLU A 1 142 ? 24.886  -4.359  -5.420  1.00 0.00 ? 160 GLU A CG   1  
ATOM 1957  C CD   . GLU A 1 142 ? 25.640  -5.199  -6.432  1.00 0.00 ? 160 GLU A CD   1  
ATOM 1958  O OE1  . GLU A 1 142 ? 25.666  -4.815  -7.620  1.00 0.00 ? 160 GLU A OE1  1  
ATOM 1959  O OE2  . GLU A 1 142 ? 26.205  -6.240  -6.037  1.00 0.00 ? 160 GLU A OE2  1  
ATOM 1960  H H    . GLU A 1 142 ? 21.139  -3.107  -6.516  1.00 0.00 ? 160 GLU A H    1  
ATOM 1961  H HA   . GLU A 1 142 ? 22.568  -4.215  -4.225  1.00 0.00 ? 160 GLU A HA   1  
ATOM 1962  H HB3  . GLU A 1 142 ? 23.930  -2.780  -6.467  1.00 0.00 ? 160 GLU A HB3  1  
ATOM 1963  H HG3  . GLU A 1 142 ? 24.593  -4.991  -4.595  1.00 0.00 ? 160 GLU A HG3  1  
ATOM 1964  N N    . TYR A 1 143 ? 23.881  -2.033  -3.508  1.00 0.00 ? 161 TYR A N    1  
ATOM 1965  C CA   . TYR A 1 143 ? 24.239  -0.812  -2.797  1.00 0.00 ? 161 TYR A CA   1  
ATOM 1966  C C    . TYR A 1 143 ? 23.114  -0.377  -1.863  1.00 0.00 ? 161 TYR A C    1  
ATOM 1967  O O    . TYR A 1 143 ? 22.746  0.798   -1.822  1.00 0.00 ? 161 TYR A O    1  
ATOM 1968  C CB   . TYR A 1 143 ? 24.554  0.307   -3.790  1.00 0.00 ? 161 TYR A CB   1  
ATOM 1969  C CG   . TYR A 1 143 ? 25.580  -0.077  -4.832  1.00 0.00 ? 161 TYR A CG   1  
ATOM 1970  C CD1  . TYR A 1 143 ? 26.730  -0.774  -4.478  1.00 0.00 ? 161 TYR A CD1  1  
ATOM 1971  C CD2  . TYR A 1 143 ? 25.400  0.255   -6.169  1.00 0.00 ? 161 TYR A CD2  1  
ATOM 1972  C CE1  . TYR A 1 143 ? 27.670  -1.128  -5.427  1.00 0.00 ? 161 TYR A CE1  1  
ATOM 1973  C CE2  . TYR A 1 143 ? 26.335  -0.096  -7.124  1.00 0.00 ? 161 TYR A CE2  1  
ATOM 1974  C CZ   . TYR A 1 143 ? 27.468  -0.787  -6.749  1.00 0.00 ? 161 TYR A CZ   1  
ATOM 1975  O OH   . TYR A 1 143 ? 28.402  -1.137  -7.696  1.00 0.00 ? 161 TYR A OH   1  
ATOM 1976  H H    . TYR A 1 143 ? 24.445  -2.828  -3.407  1.00 0.00 ? 161 TYR A H    1  
ATOM 1977  H HA   . TYR A 1 143 ? 25.122  -1.017  -2.209  1.00 0.00 ? 161 TYR A HA   1  
ATOM 1978  H HB3  . TYR A 1 143 ? 24.934  1.163   -3.250  1.00 0.00 ? 161 TYR A HB3  1  
ATOM 1979  H HD1  . TYR A 1 143 ? 26.886  -1.038  -3.443  1.00 0.00 ? 161 TYR A HD1  1  
ATOM 1980  H HD2  . TYR A 1 143 ? 24.511  0.796   -6.460  1.00 0.00 ? 161 TYR A HD2  1  
ATOM 1981  H HE1  . TYR A 1 143 ? 28.558  -1.668  -5.133  1.00 0.00 ? 161 TYR A HE1  1  
ATOM 1982  H HE2  . TYR A 1 143 ? 26.176  0.170   -8.159  1.00 0.00 ? 161 TYR A HE2  1  
ATOM 1983  H HH   . TYR A 1 143 ? 28.183  -1.999  -8.058  1.00 0.00 ? 161 TYR A HH   1  
ATOM 1984  N N    . ARG A 1 144 ? 22.573  -1.332  -1.114  1.00 0.00 ? 162 ARG A N    1  
ATOM 1985  C CA   . ARG A 1 144 ? 21.490  -1.049  -0.179  1.00 0.00 ? 162 ARG A CA   1  
ATOM 1986  C C    . ARG A 1 144 ? 21.863  -1.487  1.234   1.00 0.00 ? 162 ARG A C    1  
ATOM 1987  O O    . ARG A 1 144 ? 21.052  -2.079  1.947   1.00 0.00 ? 162 ARG A O    1  
ATOM 1988  C CB   . ARG A 1 144 ? 20.208  -1.756  -0.623  1.00 0.00 ? 162 ARG A CB   1  
ATOM 1989  C CG   . ARG A 1 144 ? 18.951  -0.928  -0.410  1.00 0.00 ? 162 ARG A CG   1  
ATOM 1990  C CD   . ARG A 1 144 ? 18.293  -1.247  0.923   1.00 0.00 ? 162 ARG A CD   1  
ATOM 1991  N NE   . ARG A 1 144 ? 16.894  -0.827  0.956   1.00 0.00 ? 162 ARG A NE   1  
ATOM 1992  C CZ   . ARG A 1 144 ? 15.917  -1.474  0.331   1.00 0.00 ? 162 ARG A CZ   1  
ATOM 1993  N NH1  . ARG A 1 144 ? 16.185  -2.565  -0.373  1.00 0.00 ? 162 ARG A NH1  1  
ATOM 1994  N NH2  . ARG A 1 144 ? 14.669  -1.030  0.410   1.00 0.00 ? 162 ARG A NH2  1  
ATOM 1995  H H    . ARG A 1 144 ? 22.909  -2.249  -1.192  1.00 0.00 ? 162 ARG A H    1  
ATOM 1996  H HA   . ARG A 1 144 ? 21.321  0.018   -0.181  1.00 0.00 ? 162 ARG A HA   1  
ATOM 1997  H HB3  . ARG A 1 144 ? 20.107  -2.675  -0.064  1.00 0.00 ? 162 ARG A HB3  1  
ATOM 1998  H HG3  . ARG A 1 144 ? 18.253  -1.139  -1.207  1.00 0.00 ? 162 ARG A HG3  1  
ATOM 1999  H HD3  . ARG A 1 144 ? 18.832  -0.736  1.707   1.00 0.00 ? 162 ARG A HD3  1  
ATOM 2000  H HE   . ARG A 1 144 ? 16.674  -0.023  1.472   1.00 0.00 ? 162 ARG A HE   1  
ATOM 2001  H HH11 . ARG A 1 144 ? 17.124  -2.903  -0.433  1.00 0.00 ? 162 ARG A HH11 1  
ATOM 2002  H HH12 . ARG A 1 144 ? 15.447  -3.051  -0.842  1.00 0.00 ? 162 ARG A HH12 1  
ATOM 2003  H HH21 . ARG A 1 144 ? 14.464  -0.208  0.939   1.00 0.00 ? 162 ARG A HH21 1  
ATOM 2004  H HH22 . ARG A 1 144 ? 13.935  -1.517  -0.062  1.00 0.00 ? 162 ARG A HH22 1  
ATOM 2005  N N    . THR A 1 145 ? 23.096  -1.192  1.633   1.00 0.00 ? 163 THR A N    1  
ATOM 2006  C CA   . THR A 1 145 ? 23.578  -1.556  2.960   1.00 0.00 ? 163 THR A CA   1  
ATOM 2007  C C    . THR A 1 145 ? 23.400  -0.405  3.944   1.00 0.00 ? 163 THR A C    1  
ATOM 2008  O O    . THR A 1 145 ? 23.823  0.719   3.681   1.00 0.00 ? 163 THR A O    1  
ATOM 2009  C CB   . THR A 1 145 ? 25.063  -1.963  2.927   1.00 0.00 ? 163 THR A CB   1  
ATOM 2010  O OG1  . THR A 1 145 ? 25.252  -3.051  2.014   1.00 0.00 ? 163 THR A OG1  1  
ATOM 2011  C CG2  . THR A 1 145 ? 25.544  -2.367  4.312   1.00 0.00 ? 163 THR A CG2  1  
ATOM 2012  H H    . THR A 1 145 ? 23.696  -0.718  1.019   1.00 0.00 ? 163 THR A H    1  
ATOM 2013  H HA   . THR A 1 145 ? 23.002  -2.403  3.303   1.00 0.00 ? 163 THR A HA   1  
ATOM 2014  H HB   . THR A 1 145 ? 25.645  -1.117  2.591   1.00 0.00 ? 163 THR A HB   1  
ATOM 2015  H HG1  . THR A 1 145 ? 24.957  -2.789  1.138   1.00 0.00 ? 163 THR A HG1  1  
ATOM 2016  H HG21 . THR A 1 145 ? 26.168  -3.245  4.235   1.00 0.00 ? 163 THR A HG21 1  
ATOM 2017  H HG22 . THR A 1 145 ? 24.693  -2.583  4.940   1.00 0.00 ? 163 THR A HG22 1  
ATOM 2018  H HG23 . THR A 1 145 ? 26.114  -1.558  4.743   1.00 0.00 ? 163 THR A HG23 1  
ATOM 2019  N N    . ASN A 1 146 ? 22.771  -0.696  5.080   1.00 0.00 ? 164 ASN A N    1  
ATOM 2020  C CA   . ASN A 1 146 ? 22.538  0.316   6.103   1.00 0.00 ? 164 ASN A CA   1  
ATOM 2021  C C    . ASN A 1 146 ? 23.856  0.790   6.710   1.00 0.00 ? 164 ASN A C    1  
ATOM 2022  O O    . ASN A 1 146 ? 24.793  0.016   6.901   1.00 0.00 ? 164 ASN A O    1  
ATOM 2023  C CB   . ASN A 1 146 ? 21.629  -0.241  7.201   1.00 0.00 ? 164 ASN A CB   1  
ATOM 2024  C CG   . ASN A 1 146 ? 21.703  0.572   8.479   1.00 0.00 ? 164 ASN A CG   1  
ATOM 2025  O OD1  . ASN A 1 146 ? 22.698  0.524   9.203   1.00 0.00 ? 164 ASN A OD1  1  
ATOM 2026  N ND2  . ASN A 1 146 ? 20.645  1.324   8.763   1.00 0.00 ? 164 ASN A ND2  1  
ATOM 2027  H H    . ASN A 1 146 ? 22.457  -1.612  5.231   1.00 0.00 ? 164 ASN A H    1  
ATOM 2028  H HA   . ASN A 1 146 ? 22.048  1.155   5.634   1.00 0.00 ? 164 ASN A HA   1  
ATOM 2029  H HB3  . ASN A 1 146 ? 21.924  -1.256  7.424   1.00 0.00 ? 164 ASN A HB3  1  
ATOM 2030  H HD21 . ASN A 1 146 ? 19.888  1.312   8.141   1.00 0.00 ? 164 ASN A HD21 1  
ATOM 2031  H HD22 . ASN A 1 146 ? 20.666  1.860   9.584   1.00 0.00 ? 164 ASN A HD22 1  
ATOM 2032  N N    . PRO A 1 147 ? 23.928  2.092   7.021   1.00 0.00 ? 165 PRO A N    1  
ATOM 2033  C CA   . PRO A 1 147 ? 25.125  2.700   7.611   1.00 0.00 ? 165 PRO A CA   1  
ATOM 2034  C C    . PRO A 1 147 ? 25.358  2.243   9.047   1.00 0.00 ? 165 PRO A C    1  
ATOM 2035  O O    . PRO A 1 147 ? 24.466  2.334   9.890   1.00 0.00 ? 165 PRO A O    1  
ATOM 2036  C CB   . PRO A 1 147 ? 24.820  4.199   7.569   1.00 0.00 ? 165 PRO A CB   1  
ATOM 2037  C CG   . PRO A 1 147 ? 23.332  4.282   7.571   1.00 0.00 ? 165 PRO A CG   1  
ATOM 2038  C CD   . PRO A 1 147 ? 22.848  3.073   6.821   1.00 0.00 ? 165 PRO A CD   1  
ATOM 2039  H HA   . PRO A 1 147 ? 26.007  2.493   7.022   1.00 0.00 ? 165 PRO A HA   1  
ATOM 2040  H HB3  . PRO A 1 147 ? 25.238  4.630   6.672   1.00 0.00 ? 165 PRO A HB3  1  
ATOM 2041  H HG3  . PRO A 1 147 ? 23.016  5.185   7.071   1.00 0.00 ? 165 PRO A HG3  1  
ATOM 2042  H HD3  . PRO A 1 147 ? 22.728  3.303   5.772   1.00 0.00 ? 165 PRO A HD3  1  
ATOM 2043  N N    . GLU A 1 148 ? 26.563  1.751   9.319   1.00 0.00 ? 166 GLU A N    1  
ATOM 2044  C CA   . GLU A 1 148 ? 26.912  1.281   10.655  1.00 0.00 ? 166 GLU A CA   1  
ATOM 2045  C C    . GLU A 1 148 ? 28.418  1.071   10.782  1.00 0.00 ? 166 GLU A C    1  
ATOM 2046  O O    . GLU A 1 148 ? 28.968  0.104   10.255  1.00 0.00 ? 166 GLU A O    1  
ATOM 2047  C CB   . GLU A 1 148 ? 26.177  -0.024  10.968  1.00 0.00 ? 166 GLU A CB   1  
ATOM 2048  C CG   . GLU A 1 148 ? 26.217  -1.033  9.833   1.00 0.00 ? 166 GLU A CG   1  
ATOM 2049  C CD   . GLU A 1 148 ? 25.381  -2.266  10.118  1.00 0.00 ? 166 GLU A CD   1  
ATOM 2050  O OE1  . GLU A 1 148 ? 24.330  -2.129  10.777  1.00 0.00 ? 166 GLU A OE1  1  
ATOM 2051  O OE2  . GLU A 1 148 ? 25.779  -3.367  9.682   1.00 0.00 ? 166 GLU A OE2  1  
ATOM 2052  H H    . GLU A 1 148 ? 27.232  1.704   8.605   1.00 0.00 ? 166 GLU A H    1  
ATOM 2053  H HA   . GLU A 1 148 ? 26.605  2.035   11.363  1.00 0.00 ? 166 GLU A HA   1  
ATOM 2054  H HB3  . GLU A 1 148 ? 25.143  0.203   11.183  1.00 0.00 ? 166 GLU A HB3  1  
ATOM 2055  H HG3  . GLU A 1 148 ? 27.241  -1.338  9.675   1.00 0.00 ? 166 GLU A HG3  1  
ATOM 2056  N N    . ASP A 1 149 ? 29.079  1.986   11.484  1.00 0.00 ? 167 ASP A N    1  
ATOM 2057  C CA   . ASP A 1 149 ? 30.522  1.902   11.681  1.00 0.00 ? 167 ASP A CA   1  
ATOM 2058  C C    . ASP A 1 149 ? 30.858  1.727   13.158  1.00 0.00 ? 167 ASP A C    1  
ATOM 2059  O O    . ASP A 1 149 ? 30.013  1.942   14.028  1.00 0.00 ? 167 ASP A O    1  
ATOM 2060  C CB   . ASP A 1 149 ? 31.206  3.155   11.133  1.00 0.00 ? 167 ASP A CB   1  
ATOM 2061  C CG   . ASP A 1 149 ? 31.419  3.090   9.634   1.00 0.00 ? 167 ASP A CG   1  
ATOM 2062  O OD1  . ASP A 1 149 ? 32.263  2.283   9.191   1.00 0.00 ? 167 ASP A OD1  1  
ATOM 2063  O OD2  . ASP A 1 149 ? 30.744  3.845   8.904   1.00 0.00 ? 167 ASP A OD2  1  
ATOM 2064  H H    . ASP A 1 149 ? 28.585  2.734   11.879  1.00 0.00 ? 167 ASP A H    1  
ATOM 2065  H HA   . ASP A 1 149 ? 30.881  1.040   11.138  1.00 0.00 ? 167 ASP A HA   1  
ATOM 2066  H HB3  . ASP A 1 149 ? 32.168  3.270   11.612  1.00 0.00 ? 167 ASP A HB3  1  
ATOM 2067  N N    . ILE A 1 150 ? 32.098  1.337   13.435  1.00 0.00 ? 168 ILE A N    1  
ATOM 2068  C CA   . ILE A 1 150 ? 32.547  1.134   14.807  1.00 0.00 ? 168 ILE A CA   1  
ATOM 2069  C C    . ILE A 1 150 ? 33.843  1.888   15.079  1.00 0.00 ? 168 ILE A C    1  
ATOM 2070  O O    . ILE A 1 150 ? 34.753  1.897   14.249  1.00 0.00 ? 168 ILE A O    1  
ATOM 2071  C CB   . ILE A 1 150 ? 32.759  -0.360  15.115  1.00 0.00 ? 168 ILE A CB   1  
ATOM 2072  C CG1  . ILE A 1 150 ? 33.025  -0.563  16.608  1.00 0.00 ? 168 ILE A CG1  1  
ATOM 2073  C CG2  . ILE A 1 150 ? 33.911  -0.912  14.287  1.00 0.00 ? 168 ILE A CG2  1  
ATOM 2074  C CD1  . ILE A 1 150 ? 33.225  -2.011  16.994  1.00 0.00 ? 168 ILE A CD1  1  
ATOM 2075  H H    . ILE A 1 150 ? 32.726  1.183   12.700  1.00 0.00 ? 168 ILE A H    1  
ATOM 2076  H HA   . ILE A 1 150 ? 31.778  1.511   15.468  1.00 0.00 ? 168 ILE A HA   1  
ATOM 2077  H HB   . ILE A 1 150 ? 31.862  -0.893  14.840  1.00 0.00 ? 168 ILE A HB   1  
ATOM 2078  H HG13 . ILE A 1 150 ? 32.184  -0.182  17.170  1.00 0.00 ? 168 ILE A HG13 1  
ATOM 2079  H HG21 . ILE A 1 150 ? 34.765  -1.081  14.926  1.00 0.00 ? 168 ILE A HG21 1  
ATOM 2080  H HG22 . ILE A 1 150 ? 33.612  -1.845  13.834  1.00 0.00 ? 168 ILE A HG22 1  
ATOM 2081  H HG23 . ILE A 1 150 ? 34.172  -0.203  13.516  1.00 0.00 ? 168 ILE A HG23 1  
ATOM 2082  H HD11 . ILE A 1 150 ? 33.004  -2.139  18.043  1.00 0.00 ? 168 ILE A HD11 1  
ATOM 2083  H HD12 . ILE A 1 150 ? 32.568  -2.636  16.408  1.00 0.00 ? 168 ILE A HD12 1  
ATOM 2084  H HD13 . ILE A 1 150 ? 34.252  -2.295  16.807  1.00 0.00 ? 168 ILE A HD13 1  
ATOM 2085  N N    . TYR A 1 151 ? 33.922  2.517   16.246  1.00 0.00 ? 169 TYR A N    1  
ATOM 2086  C CA   . TYR A 1 151 ? 35.109  3.274   16.628  1.00 0.00 ? 169 TYR A CA   1  
ATOM 2087  C C    . TYR A 1 151 ? 35.810  2.625   17.818  1.00 0.00 ? 169 TYR A C    1  
ATOM 2088  O O    . TYR A 1 151 ? 35.761  3.118   18.945  1.00 0.00 ? 169 TYR A O    1  
ATOM 2089  C CB   . TYR A 1 151 ? 34.731  4.716   16.969  1.00 0.00 ? 169 TYR A CB   1  
ATOM 2090  C CG   . TYR A 1 151 ? 34.625  5.616   15.760  1.00 0.00 ? 169 TYR A CG   1  
ATOM 2091  C CD1  . TYR A 1 151 ? 33.422  5.765   15.081  1.00 0.00 ? 169 TYR A CD1  1  
ATOM 2092  C CD2  . TYR A 1 151 ? 35.729  6.322   15.296  1.00 0.00 ? 169 TYR A CD2  1  
ATOM 2093  C CE1  . TYR A 1 151 ? 33.322  6.586   13.976  1.00 0.00 ? 169 TYR A CE1  1  
ATOM 2094  C CE2  . TYR A 1 151 ? 35.638  7.146   14.191  1.00 0.00 ? 169 TYR A CE2  1  
ATOM 2095  C CZ   . TYR A 1 151 ? 34.433  7.275   13.534  1.00 0.00 ? 169 TYR A CZ   1  
ATOM 2096  O OH   . TYR A 1 151 ? 34.337  8.095   12.433  1.00 0.00 ? 169 TYR A OH   1  
ATOM 2097  H H    . TYR A 1 151 ? 33.165  2.472   16.866  1.00 0.00 ? 169 TYR A H    1  
ATOM 2098  H HA   . TYR A 1 151 ? 35.784  3.279   15.786  1.00 0.00 ? 169 TYR A HA   1  
ATOM 2099  H HB3  . TYR A 1 151 ? 35.479  5.131   17.628  1.00 0.00 ? 169 TYR A HB3  1  
ATOM 2100  H HD1  . TYR A 1 151 ? 32.554  5.225   15.430  1.00 0.00 ? 169 TYR A HD1  1  
ATOM 2101  H HD2  . TYR A 1 151 ? 36.673  6.219   15.813  1.00 0.00 ? 169 TYR A HD2  1  
ATOM 2102  H HE1  . TYR A 1 151 ? 32.377  6.687   13.460  1.00 0.00 ? 169 TYR A HE1  1  
ATOM 2103  H HE2  . TYR A 1 151 ? 36.508  7.685   13.845  1.00 0.00 ? 169 TYR A HE2  1  
ATOM 2104  H HH   . TYR A 1 151 ? 34.237  7.559   11.643  1.00 0.00 ? 169 TYR A HH   1  
ATOM 2105  N N    . PRO A 1 152 ? 36.479  1.491   17.562  1.00 0.00 ? 170 PRO A N    1  
ATOM 2106  C CA   . PRO A 1 152 ? 37.205  0.749   18.598  1.00 0.00 ? 170 PRO A CA   1  
ATOM 2107  C C    . PRO A 1 152 ? 38.448  1.491   19.078  1.00 0.00 ? 170 PRO A C    1  
ATOM 2108  O O    . PRO A 1 152 ? 39.416  1.645   18.333  1.00 0.00 ? 170 PRO A O    1  
ATOM 2109  C CB   . PRO A 1 152 ? 37.597  -0.552  17.894  1.00 0.00 ? 170 PRO A CB   1  
ATOM 2110  C CG   . PRO A 1 152 ? 37.639  -0.201  16.446  1.00 0.00 ? 170 PRO A CG   1  
ATOM 2111  C CD   . PRO A 1 152 ? 36.580  0.846   16.242  1.00 0.00 ? 170 PRO A CD   1  
ATOM 2112  H HA   . PRO A 1 152 ? 36.571  0.527   19.443  1.00 0.00 ? 170 PRO A HA   1  
ATOM 2113  H HB3  . PRO A 1 152 ? 36.856  -1.311  18.094  1.00 0.00 ? 170 PRO A HB3  1  
ATOM 2114  H HG3  . PRO A 1 152 ? 37.422  -1.075  15.850  1.00 0.00 ? 170 PRO A HG3  1  
ATOM 2115  H HD3  . PRO A 1 152 ? 35.642  0.385   15.966  1.00 0.00 ? 170 PRO A HD3  1  
ATOM 2116  N N    . SER A 1 153 ? 38.415  1.948   20.326  1.00 0.00 ? 171 SER A N    1  
ATOM 2117  C CA   . SER A 1 153 ? 39.537  2.676   20.903  1.00 0.00 ? 171 SER A CA   1  
ATOM 2118  C C    . SER A 1 153 ? 40.552  1.714   21.515  1.00 0.00 ? 171 SER A C    1  
ATOM 2119  O O    . SER A 1 153 ? 40.336  1.175   22.600  1.00 0.00 ? 171 SER A O    1  
ATOM 2120  C CB   . SER A 1 153 ? 39.043  3.658   21.968  1.00 0.00 ? 171 SER A CB   1  
ATOM 2121  O OG   . SER A 1 153 ? 37.920  4.388   21.505  1.00 0.00 ? 171 SER A OG   1  
ATOM 2122  H H    . SER A 1 153 ? 37.613  1.793   20.869  1.00 0.00 ? 171 SER A H    1  
ATOM 2123  H HA   . SER A 1 153 ? 40.016  3.230   20.110  1.00 0.00 ? 171 SER A HA   1  
ATOM 2124  H HB3  . SER A 1 153 ? 39.834  4.352   22.209  1.00 0.00 ? 171 SER A HB3  1  
ATOM 2125  H HG   . SER A 1 153 ? 38.136  5.322   21.473  1.00 0.00 ? 171 SER A HG   1  
ATOM 2126  N N    . ASN A 1 154 ? 41.658  1.504   20.810  1.00 0.00 ? 172 ASN A N    1  
ATOM 2127  C CA   . ASN A 1 154 ? 42.707  0.607   21.281  1.00 0.00 ? 172 ASN A CA   1  
ATOM 2128  C C    . ASN A 1 154 ? 44.087  1.218   21.058  1.00 0.00 ? 172 ASN A C    1  
ATOM 2129  O O    . ASN A 1 154 ? 44.842  0.803   20.179  1.00 0.00 ? 172 ASN A O    1  
ATOM 2130  C CB   . ASN A 1 154 ? 42.612  -0.742  20.566  1.00 0.00 ? 172 ASN A CB   1  
ATOM 2131  C CG   . ASN A 1 154 ? 41.448  -1.579  21.062  1.00 0.00 ? 172 ASN A CG   1  
ATOM 2132  O OD1  . ASN A 1 154 ? 40.551  -1.930  20.296  1.00 0.00 ? 172 ASN A OD1  1  
ATOM 2133  N ND2  . ASN A 1 154 ? 41.461  -1.903  22.350  1.00 0.00 ? 172 ASN A ND2  1  
ATOM 2134  H H    . ASN A 1 154 ? 41.772  1.963   19.951  1.00 0.00 ? 172 ASN A H    1  
ATOM 2135  H HA   . ASN A 1 154 ? 42.561  0.454   22.340  1.00 0.00 ? 172 ASN A HA   1  
ATOM 2136  H HB3  . ASN A 1 154 ? 43.525  -1.294  20.729  1.00 0.00 ? 172 ASN A HB3  1  
ATOM 2137  H HD21 . ASN A 1 154 ? 42.207  -1.589  22.900  1.00 0.00 ? 172 ASN A HD21 1  
ATOM 2138  H HD22 . ASN A 1 154 ? 40.721  -2.444  22.697  1.00 0.00 ? 172 ASN A HD22 1  
ATOM 2139  N N    . PRO A 1 155 ? 44.425  2.229   21.872  1.00 0.00 ? 173 PRO A N    1  
ATOM 2140  C CA   . PRO A 1 155 ? 45.716  2.918   21.784  1.00 0.00 ? 173 PRO A CA   1  
ATOM 2141  C C    . PRO A 1 155 ? 46.876  2.037   22.235  1.00 0.00 ? 173 PRO A C    1  
ATOM 2142  O O    . PRO A 1 155 ? 46.675  0.906   22.678  1.00 0.00 ? 173 PRO A O    1  
ATOM 2143  C CB   . PRO A 1 155 ? 45.549  4.108   22.732  1.00 0.00 ? 173 PRO A CB   1  
ATOM 2144  C CG   . PRO A 1 155 ? 44.509  3.672   23.707  1.00 0.00 ? 173 PRO A CG   1  
ATOM 2145  C CD   . PRO A 1 155 ? 43.574  2.776   22.942  1.00 0.00 ? 173 PRO A CD   1  
ATOM 2146  H HA   . PRO A 1 155 ? 45.906  3.277   20.783  1.00 0.00 ? 173 PRO A HA   1  
ATOM 2147  H HB3  . PRO A 1 155 ? 45.227  4.975   22.175  1.00 0.00 ? 173 PRO A HB3  1  
ATOM 2148  H HG3  . PRO A 1 155 ? 43.977  4.533   24.085  1.00 0.00 ? 173 PRO A HG3  1  
ATOM 2149  H HD3  . PRO A 1 155 ? 42.756  3.349   22.528  1.00 0.00 ? 173 PRO A HD3  1  
ATOM 2150  N N    . THR A 1 156 ? 48.092  2.562   22.120  1.00 0.00 ? 174 THR A N    1  
ATOM 2151  C CA   . THR A 1 156 ? 49.284  1.824   22.515  1.00 0.00 ? 174 THR A CA   1  
ATOM 2152  C C    . THR A 1 156 ? 50.404  2.770   22.932  1.00 0.00 ? 174 THR A C    1  
ATOM 2153  O O    . THR A 1 156 ? 50.470  3.909   22.472  1.00 0.00 ? 174 THR A O    1  
ATOM 2154  C CB   . THR A 1 156 ? 49.789  0.919   21.374  1.00 0.00 ? 174 THR A CB   1  
ATOM 2155  O OG1  . THR A 1 156 ? 50.888  0.123   21.830  1.00 0.00 ? 174 THR A OG1  1  
ATOM 2156  C CG2  . THR A 1 156 ? 50.221  1.751   20.175  1.00 0.00 ? 174 THR A CG2  1  
ATOM 2157  H H    . THR A 1 156 ? 48.187  3.468   21.759  1.00 0.00 ? 174 THR A H    1  
ATOM 2158  H HA   . THR A 1 156 ? 49.024  1.196   23.355  1.00 0.00 ? 174 THR A HA   1  
ATOM 2159  H HB   . THR A 1 156 ? 48.983  0.267   21.069  1.00 0.00 ? 174 THR A HB   1  
ATOM 2160  H HG1  . THR A 1 156 ? 50.568  -0.746  22.087  1.00 0.00 ? 174 THR A HG1  1  
ATOM 2161  H HG21 . THR A 1 156 ? 50.142  1.157   19.277  1.00 0.00 ? 174 THR A HG21 1  
ATOM 2162  H HG22 . THR A 1 156 ? 51.245  2.069   20.309  1.00 0.00 ? 174 THR A HG22 1  
ATOM 2163  H HG23 . THR A 1 156 ? 49.584  2.619   20.091  1.00 0.00 ? 174 THR A HG23 1  
ATOM 2164  N N    . ASP A 1 157 ? 51.283  2.289   23.804  1.00 0.00 ? 175 ASP A N    1  
ATOM 2165  C CA   . ASP A 1 157 ? 52.403  3.092   24.282  1.00 0.00 ? 175 ASP A CA   1  
ATOM 2166  C C    . ASP A 1 157 ? 53.553  2.201   24.743  1.00 0.00 ? 175 ASP A C    1  
ATOM 2167  O O    . ASP A 1 157 ? 53.407  0.983   24.839  1.00 0.00 ? 175 ASP A O    1  
ATOM 2168  C CB   . ASP A 1 157 ? 51.954  4.001   25.428  1.00 0.00 ? 175 ASP A CB   1  
ATOM 2169  C CG   . ASP A 1 157 ? 51.375  5.311   24.935  1.00 0.00 ? 175 ASP A CG   1  
ATOM 2170  O OD1  . ASP A 1 157 ? 52.053  5.998   24.142  1.00 0.00 ? 175 ASP A OD1  1  
ATOM 2171  O OD2  . ASP A 1 157 ? 50.244  5.651   25.342  1.00 0.00 ? 175 ASP A OD2  1  
ATOM 2172  H H    . ASP A 1 157 ? 51.177  1.372   24.135  1.00 0.00 ? 175 ASP A H    1  
ATOM 2173  H HA   . ASP A 1 157 ? 52.745  3.705   23.463  1.00 0.00 ? 175 ASP A HA   1  
ATOM 2174  H HB3  . ASP A 1 157 ? 52.803  4.218   26.060  1.00 0.00 ? 175 ASP A HB3  1  
ATOM 2175  N N    . ASP A 1 158 ? 54.695  2.819   25.026  1.00 0.00 ? 176 ASP A N    1  
ATOM 2176  C CA   . ASP A 1 158 ? 55.870  2.082   25.478  1.00 0.00 ? 176 ASP A CA   1  
ATOM 2177  C C    . ASP A 1 158 ? 56.891  3.023   26.108  1.00 0.00 ? 176 ASP A C    1  
ATOM 2178  O O    . ASP A 1 158 ? 57.187  4.089   25.567  1.00 0.00 ? 176 ASP A O    1  
ATOM 2179  C CB   . ASP A 1 158 ? 56.506  1.329   24.308  1.00 0.00 ? 176 ASP A CB   1  
ATOM 2180  C CG   . ASP A 1 158 ? 56.820  2.238   23.136  1.00 0.00 ? 176 ASP A CG   1  
ATOM 2181  O OD1  . ASP A 1 158 ? 55.877  2.623   22.415  1.00 0.00 ? 176 ASP A OD1  1  
ATOM 2182  O OD2  . ASP A 1 158 ? 58.010  2.563   22.940  1.00 0.00 ? 176 ASP A OD2  1  
ATOM 2183  H H    . ASP A 1 158 ? 54.749  3.792   24.930  1.00 0.00 ? 176 ASP A H    1  
ATOM 2184  H HA   . ASP A 1 158 ? 55.549  1.368   26.221  1.00 0.00 ? 176 ASP A HA   1  
ATOM 2185  H HB3  . ASP A 1 158 ? 55.826  0.559   23.971  1.00 0.00 ? 176 ASP A HB3  1  
ATOM 2186  N N    . ASP A 1 159 ? 57.428  2.622   27.255  1.00 0.00 ? 177 ASP A N    1  
ATOM 2187  C CA   . ASP A 1 159 ? 58.417  3.429   27.961  1.00 0.00 ? 177 ASP A CA   1  
ATOM 2188  C C    . ASP A 1 159 ? 59.671  2.613   28.258  1.00 0.00 ? 177 ASP A C    1  
ATOM 2189  O O    . ASP A 1 159 ? 59.610  1.394   28.412  1.00 0.00 ? 177 ASP A O    1  
ATOM 2190  C CB   . ASP A 1 159 ? 57.827  3.974   29.262  1.00 0.00 ? 177 ASP A CB   1  
ATOM 2191  C CG   . ASP A 1 159 ? 56.925  5.170   29.034  1.00 0.00 ? 177 ASP A CG   1  
ATOM 2192  O OD1  . ASP A 1 159 ? 57.140  5.894   28.040  1.00 0.00 ? 177 ASP A OD1  1  
ATOM 2193  O OD2  . ASP A 1 159 ? 56.003  5.382   29.849  1.00 0.00 ? 177 ASP A OD2  1  
ATOM 2194  H H    . ASP A 1 159 ? 57.152  1.761   27.638  1.00 0.00 ? 177 ASP A H    1  
ATOM 2195  H HA   . ASP A 1 159 ? 58.685  4.258   27.323  1.00 0.00 ? 177 ASP A HA   1  
ATOM 2196  H HB3  . ASP A 1 159 ? 58.632  4.272   29.918  1.00 0.00 ? 177 ASP A HB3  1  
ATOM 2197  N N    . VAL A 1 160 ? 60.809  3.295   28.336  1.00 0.00 ? 178 VAL A N    1  
ATOM 2198  C CA   . VAL A 1 160 ? 62.079  2.635   28.614  1.00 0.00 ? 178 VAL A CA   1  
ATOM 2199  C C    . VAL A 1 160 ? 62.241  2.361   30.105  1.00 0.00 ? 178 VAL A C    1  
ATOM 2200  O O    . VAL A 1 160 ? 62.200  1.212   30.543  1.00 0.00 ? 178 VAL A O    1  
ATOM 2201  C CB   . VAL A 1 160 ? 63.271  3.481   28.126  1.00 0.00 ? 178 VAL A CB   1  
ATOM 2202  C CG1  . VAL A 1 160 ? 63.325  4.807   28.870  1.00 0.00 ? 178 VAL A CG1  1  
ATOM 2203  C CG2  . VAL A 1 160 ? 64.573  2.713   28.294  1.00 0.00 ? 178 VAL A CG2  1  
ATOM 2204  H H    . VAL A 1 160 ? 60.795  4.266   28.204  1.00 0.00 ? 178 VAL A H    1  
ATOM 2205  H HA   . VAL A 1 160 ? 62.090  1.696   28.082  1.00 0.00 ? 178 VAL A HA   1  
ATOM 2206  H HB   . VAL A 1 160 ? 63.132  3.689   27.076  1.00 0.00 ? 178 VAL A HB   1  
ATOM 2207  H HG11 . VAL A 1 160 ? 62.320  5.132   29.100  1.00 0.00 ? 178 VAL A HG11 1  
ATOM 2208  H HG12 . VAL A 1 160 ? 63.882  4.682   29.788  1.00 0.00 ? 178 VAL A HG12 1  
ATOM 2209  H HG13 . VAL A 1 160 ? 63.810  5.547   28.252  1.00 0.00 ? 178 VAL A HG13 1  
ATOM 2210  H HG21 . VAL A 1 160 ? 64.760  2.547   29.344  1.00 0.00 ? 178 VAL A HG21 1  
ATOM 2211  H HG22 . VAL A 1 160 ? 64.498  1.761   27.788  1.00 0.00 ? 178 VAL A HG22 1  
ATOM 2212  H HG23 . VAL A 1 160 ? 65.386  3.283   27.869  1.00 0.00 ? 178 VAL A HG23 1  
ATOM 2213  N N    . GLN A 1 3   ? 6.377   -13.106 3.703   1.00 0.00 ? 21  GLN A N    2  
ATOM 2214  C CA   . GLN A 1 3   ? 7.144   -12.206 2.851   1.00 0.00 ? 21  GLN A CA   2  
ATOM 2215  C C    . GLN A 1 3   ? 6.221   -11.256 2.093   1.00 0.00 ? 21  GLN A C    2  
ATOM 2216  O O    . GLN A 1 3   ? 5.625   -11.630 1.082   1.00 0.00 ? 21  GLN A O    2  
ATOM 2217  C CB   . GLN A 1 3   ? 7.994   -13.006 1.862   1.00 0.00 ? 21  GLN A CB   2  
ATOM 2218  C CG   . GLN A 1 3   ? 8.886   -12.140 0.988   1.00 0.00 ? 21  GLN A CG   2  
ATOM 2219  C CD   . GLN A 1 3   ? 9.850   -11.293 1.797   1.00 0.00 ? 21  GLN A CD   2  
ATOM 2220  O OE1  . GLN A 1 3   ? 10.237  -11.659 2.907   1.00 0.00 ? 21  GLN A OE1  2  
ATOM 2221  N NE2  . GLN A 1 3   ? 10.242  -10.152 1.242   1.00 0.00 ? 21  GLN A NE2  2  
ATOM 2222  H H    . GLN A 1 3   ? 5.928   -13.878 3.303   1.00 0.00 ? 21  GLN A H    2  
ATOM 2223  H HA   . GLN A 1 3   ? 7.796   -11.623 3.483   1.00 0.00 ? 21  GLN A HA   2  
ATOM 2224  H HB3  . GLN A 1 3   ? 7.338   -13.573 1.219   1.00 0.00 ? 21  GLN A HB3  2  
ATOM 2225  H HG3  . GLN A 1 3   ? 8.264   -11.487 0.396   1.00 0.00 ? 21  GLN A HG3  2  
ATOM 2226  H HE21 . GLN A 1 3   ? 9.892   -9.924  0.355   1.00 0.00 ? 21  GLN A HE21 2  
ATOM 2227  H HE22 . GLN A 1 3   ? 10.864  -9.584  1.743   1.00 0.00 ? 21  GLN A HE22 2  
ATOM 2228  N N    . ILE A 1 4   ? 6.108   -10.028 2.587   1.00 0.00 ? 22  ILE A N    2  
ATOM 2229  C CA   . ILE A 1 4   ? 5.257   -9.026  1.958   1.00 0.00 ? 22  ILE A CA   2  
ATOM 2230  C C    . ILE A 1 4   ? 5.961   -7.674  1.887   1.00 0.00 ? 22  ILE A C    2  
ATOM 2231  O O    . ILE A 1 4   ? 6.364   -7.120  2.910   1.00 0.00 ? 22  ILE A O    2  
ATOM 2232  C CB   . ILE A 1 4   ? 3.926   -8.861  2.713   1.00 0.00 ? 22  ILE A CB   2  
ATOM 2233  C CG1  . ILE A 1 4   ? 3.082   -10.132 2.587   1.00 0.00 ? 22  ILE A CG1  2  
ATOM 2234  C CG2  . ILE A 1 4   ? 3.161   -7.657  2.182   1.00 0.00 ? 22  ILE A CG2  2  
ATOM 2235  C CD1  . ILE A 1 4   ? 2.637   -10.423 1.172   1.00 0.00 ? 22  ILE A CD1  2  
ATOM 2236  H H    . ILE A 1 4   ? 6.608   -9.791  3.397   1.00 0.00 ? 22  ILE A H    2  
ATOM 2237  H HA   . ILE A 1 4   ? 5.040   -9.359  0.952   1.00 0.00 ? 22  ILE A HA   2  
ATOM 2238  H HB   . ILE A 1 4   ? 4.148   -8.686  3.754   1.00 0.00 ? 22  ILE A HB   2  
ATOM 2239  H HG13 . ILE A 1 4   ? 2.198   -10.030 3.201   1.00 0.00 ? 22  ILE A HG13 2  
ATOM 2240  H HG21 . ILE A 1 4   ? 3.707   -6.754  2.413   1.00 0.00 ? 22  ILE A HG21 2  
ATOM 2241  H HG22 . ILE A 1 4   ? 3.050   -7.746  1.111   1.00 0.00 ? 22  ILE A HG22 2  
ATOM 2242  H HG23 . ILE A 1 4   ? 2.186   -7.618  2.643   1.00 0.00 ? 22  ILE A HG23 2  
ATOM 2243  H HD11 . ILE A 1 4   ? 3.500   -10.636 0.560   1.00 0.00 ? 22  ILE A HD11 2  
ATOM 2244  H HD12 . ILE A 1 4   ? 1.975   -11.277 1.171   1.00 0.00 ? 22  ILE A HD12 2  
ATOM 2245  H HD13 . ILE A 1 4   ? 2.116   -9.565  0.774   1.00 0.00 ? 22  ILE A HD13 2  
ATOM 2246  N N    . ASP A 1 5   ? 6.103   -7.150  0.675   1.00 0.00 ? 23  ASP A N    2  
ATOM 2247  C CA   . ASP A 1 5   ? 6.754   -5.861  0.472   1.00 0.00 ? 23  ASP A CA   2  
ATOM 2248  C C    . ASP A 1 5   ? 5.754   -4.818  -0.016  1.00 0.00 ? 23  ASP A C    2  
ATOM 2249  O O    . ASP A 1 5   ? 5.023   -5.046  -0.981  1.00 0.00 ? 23  ASP A O    2  
ATOM 2250  C CB   . ASP A 1 5   ? 7.899   -5.998  -0.532  1.00 0.00 ? 23  ASP A CB   2  
ATOM 2251  C CG   . ASP A 1 5   ? 9.030   -5.026  -0.257  1.00 0.00 ? 23  ASP A CG   2  
ATOM 2252  O OD1  . ASP A 1 5   ? 8.748   -3.908  0.221   1.00 0.00 ? 23  ASP A OD1  2  
ATOM 2253  O OD2  . ASP A 1 5   ? 10.197  -5.383  -0.523  1.00 0.00 ? 23  ASP A OD2  2  
ATOM 2254  H H    . ASP A 1 5   ? 5.759   -7.640  -0.101  1.00 0.00 ? 23  ASP A H    2  
ATOM 2255  H HA   . ASP A 1 5   ? 7.156   -5.539  1.420   1.00 0.00 ? 23  ASP A HA   2  
ATOM 2256  H HB3  . ASP A 1 5   ? 7.521   -5.810  -1.528  1.00 0.00 ? 23  ASP A HB3  2  
ATOM 2257  N N    . LEU A 1 6   ? 5.726   -3.673  0.656   1.00 0.00 ? 24  LEU A N    2  
ATOM 2258  C CA   . LEU A 1 6   ? 4.814   -2.593  0.293   1.00 0.00 ? 24  LEU A CA   2  
ATOM 2259  C C    . LEU A 1 6   ? 5.406   -1.733  -0.820  1.00 0.00 ? 24  LEU A C    2  
ATOM 2260  O O    . LEU A 1 6   ? 6.266   -0.889  -0.573  1.00 0.00 ? 24  LEU A O    2  
ATOM 2261  C CB   . LEU A 1 6   ? 4.505   -1.726  1.514   1.00 0.00 ? 24  LEU A CB   2  
ATOM 2262  C CG   . LEU A 1 6   ? 4.089   -2.475  2.781   1.00 0.00 ? 24  LEU A CG   2  
ATOM 2263  C CD1  . LEU A 1 6   ? 4.104   -1.542  3.982   1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2264  C CD2  . LEU A 1 6   ? 2.709   -3.095  2.604   1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2265  H H    . LEU A 1 6   ? 6.331   -3.549  1.416   1.00 0.00 ? 24  LEU A H    2  
ATOM 2266  H HA   . LEU A 1 6   ? 3.897   -3.039  -0.063  1.00 0.00 ? 24  LEU A HA   2  
ATOM 2267  H HB3  . LEU A 1 6   ? 3.702   -1.053  1.247   1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2268  H HG   . LEU A 1 6   ? 4.793   -3.272  2.968   1.00 0.00 ? 24  LEU A HG   2  
ATOM 2269  H HD11 . LEU A 1 6   ? 5.099   -1.143  4.115   1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2270  H HD12 . LEU A 1 6   ? 3.815   -2.090  4.866   1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2271  H HD13 . LEU A 1 6   ? 3.410   -0.731  3.818   1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2272  H HD21 . LEU A 1 6   ? 2.783   -3.953  1.954   1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2273  H HD22 . LEU A 1 6   ? 2.042   -2.367  2.166   1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2274  H HD23 . LEU A 1 6   ? 2.328   -3.403  3.565   1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2275  N N    . ASN A 1 7   ? 4.936   -1.953  -2.044  1.00 0.00 ? 25  ASN A N    2  
ATOM 2276  C CA   . ASN A 1 7   ? 5.418   -1.195  -3.193  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2277  C C    . ASN A 1 7   ? 4.512   -0.001  -3.477  1.00 0.00 ? 25  ASN A C    2  
ATOM 2278  O O    . ASN A 1 7   ? 3.317   -0.161  -3.728  1.00 0.00 ? 25  ASN A O    2  
ATOM 2279  C CB   . ASN A 1 7   ? 5.492   -2.097  -4.429  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2280  C CG   . ASN A 1 7   ? 5.934   -1.344  -5.668  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2281  O OD1  . ASN A 1 7   ? 6.944   -0.640  -5.653  1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2282  N ND2  . ASN A 1 7   ? 5.177   -1.489  -6.750  1.00 0.00 ? 25  ASN A ND2  2  
ATOM 2283  H H    . ASN A 1 7   ? 4.250   -2.639  -2.177  1.00 0.00 ? 25  ASN A H    2  
ATOM 2284  H HA   . ASN A 1 7   ? 6.408   -0.836  -2.962  1.00 0.00 ? 25  ASN A HA   2  
ATOM 2285  H HB3  . ASN A 1 7   ? 4.518   -2.523  -4.616  1.00 0.00 ? 25  ASN A HB3  2  
ATOM 2286  H HD21 . ASN A 1 7   ? 4.386   -2.066  -6.687  1.00 0.00 ? 25  ASN A HD21 2  
ATOM 2287  H HD22 . ASN A 1 7   ? 5.440   -1.014  -7.565  1.00 0.00 ? 25  ASN A HD22 2  
ATOM 2288  N N    . ILE A 1 8   ? 5.090   1.195   -3.434  1.00 0.00 ? 26  ILE A N    2  
ATOM 2289  C CA   . ILE A 1 8   ? 4.335   2.416   -3.688  1.00 0.00 ? 26  ILE A CA   2  
ATOM 2290  C C    . ILE A 1 8   ? 4.726   3.036   -5.026  1.00 0.00 ? 26  ILE A C    2  
ATOM 2291  O O    . ILE A 1 8   ? 5.889   3.365   -5.254  1.00 0.00 ? 26  ILE A O    2  
ATOM 2292  C CB   . ILE A 1 8   ? 4.553   3.454   -2.571  1.00 0.00 ? 26  ILE A CB   2  
ATOM 2293  C CG1  . ILE A 1 8   ? 4.373   2.804   -1.199  1.00 0.00 ? 26  ILE A CG1  2  
ATOM 2294  C CG2  . ILE A 1 8   ? 3.594   4.623   -2.740  1.00 0.00 ? 26  ILE A CG2  2  
ATOM 2295  C CD1  . ILE A 1 8   ? 5.676   2.413   -0.538  1.00 0.00 ? 26  ILE A CD1  2  
ATOM 2296  H H    . ILE A 1 8   ? 6.046   1.258   -3.229  1.00 0.00 ? 26  ILE A H    2  
ATOM 2297  H HA   . ILE A 1 8   ? 3.286   2.160   -3.714  1.00 0.00 ? 26  ILE A HA   2  
ATOM 2298  H HB   . ILE A 1 8   ? 5.561   3.832   -2.652  1.00 0.00 ? 26  ILE A HB   2  
ATOM 2299  H HG13 . ILE A 1 8   ? 3.775   1.911   -1.306  1.00 0.00 ? 26  ILE A HG13 2  
ATOM 2300  H HG21 . ILE A 1 8   ? 2.597   4.247   -2.916  1.00 0.00 ? 26  ILE A HG21 2  
ATOM 2301  H HG22 . ILE A 1 8   ? 3.599   5.223   -1.842  1.00 0.00 ? 26  ILE A HG22 2  
ATOM 2302  H HG23 . ILE A 1 8   ? 3.905   5.226   -3.579  1.00 0.00 ? 26  ILE A HG23 2  
ATOM 2303  H HD11 . ILE A 1 8   ? 5.742   1.337   -0.478  1.00 0.00 ? 26  ILE A HD11 2  
ATOM 2304  H HD12 . ILE A 1 8   ? 6.502   2.793   -1.119  1.00 0.00 ? 26  ILE A HD12 2  
ATOM 2305  H HD13 . ILE A 1 8   ? 5.715   2.832   0.458   1.00 0.00 ? 26  ILE A HD13 2  
ATOM 2306  N N    . THR A 1 9   ? 3.744   3.193   -5.907  1.00 0.00 ? 27  THR A N    2  
ATOM 2307  C CA   . THR A 1 9   ? 3.983   3.773   -7.222  1.00 0.00 ? 27  THR A CA   2  
ATOM 2308  C C    . THR A 1 9   ? 4.031   5.296   -7.151  1.00 0.00 ? 27  THR A C    2  
ATOM 2309  O O    . THR A 1 9   ? 4.033   5.876   -6.066  1.00 0.00 ? 27  THR A O    2  
ATOM 2310  C CB   . THR A 1 9   ? 2.895   3.352   -8.229  1.00 0.00 ? 27  THR A CB   2  
ATOM 2311  O OG1  . THR A 1 9   ? 3.328   3.637   -9.564  1.00 0.00 ? 27  THR A OG1  2  
ATOM 2312  C CG2  . THR A 1 9   ? 1.588   4.077   -7.948  1.00 0.00 ? 27  THR A CG2  2  
ATOM 2313  H H    . THR A 1 9   ? 2.836   2.910   -5.666  1.00 0.00 ? 27  THR A H    2  
ATOM 2314  H HA   . THR A 1 9   ? 4.935   3.409   -7.580  1.00 0.00 ? 27  THR A HA   2  
ATOM 2315  H HB   . THR A 1 9   ? 2.730   2.289   -8.132  1.00 0.00 ? 27  THR A HB   2  
ATOM 2316  H HG1  . THR A 1 9   ? 2.873   3.055   -10.179 1.00 0.00 ? 27  THR A HG1  2  
ATOM 2317  H HG21 . THR A 1 9   ? 1.291   3.900   -6.925  1.00 0.00 ? 27  THR A HG21 2  
ATOM 2318  H HG22 . THR A 1 9   ? 0.822   3.709   -8.615  1.00 0.00 ? 27  THR A HG22 2  
ATOM 2319  H HG23 . THR A 1 9   ? 1.722   5.135   -8.105  1.00 0.00 ? 27  THR A HG23 2  
ATOM 2320  N N    . CYS A 1 10  ? 4.069   5.937   -8.315  1.00 0.00 ? 28  CYS A N    2  
ATOM 2321  C CA   . CYS A 1 10  ? 4.117   7.392   -8.385  1.00 0.00 ? 28  CYS A CA   2  
ATOM 2322  C C    . CYS A 1 10  ? 3.010   8.014   -7.539  1.00 0.00 ? 28  CYS A C    2  
ATOM 2323  O O    . CYS A 1 10  ? 1.998   7.374   -7.252  1.00 0.00 ? 28  CYS A O    2  
ATOM 2324  C CB   . CYS A 1 10  ? 3.986   7.858   -9.837  1.00 0.00 ? 28  CYS A CB   2  
ATOM 2325  S SG   . CYS A 1 10  ? 5.214   7.125   -10.965 1.00 0.00 ? 28  CYS A SG   2  
ATOM 2326  H H    . CYS A 1 10  ? 4.065   5.418   -9.148  1.00 0.00 ? 28  CYS A H    2  
ATOM 2327  H HA   . CYS A 1 10  ? 5.072   7.712   -7.997  1.00 0.00 ? 28  CYS A HA   2  
ATOM 2328  H HB3  . CYS A 1 10  ? 4.103   8.931   -9.875  1.00 0.00 ? 28  CYS A HB3  2  
ATOM 2329  N N    . ARG A 1 11  ? 3.209   9.266   -7.139  1.00 0.00 ? 29  ARG A N    2  
ATOM 2330  C CA   . ARG A 1 11  ? 2.231   9.974   -6.326  1.00 0.00 ? 29  ARG A CA   2  
ATOM 2331  C C    . ARG A 1 11  ? 1.302   10.814  -7.199  1.00 0.00 ? 29  ARG A C    2  
ATOM 2332  O O    . ARG A 1 11  ? 1.727   11.386  -8.203  1.00 0.00 ? 29  ARG A O    2  
ATOM 2333  C CB   . ARG A 1 11  ? 2.936   10.871  -5.305  1.00 0.00 ? 29  ARG A CB   2  
ATOM 2334  C CG   . ARG A 1 11  ? 3.530   10.107  -4.133  1.00 0.00 ? 29  ARG A CG   2  
ATOM 2335  C CD   . ARG A 1 11  ? 5.015   9.844   -4.335  1.00 0.00 ? 29  ARG A CD   2  
ATOM 2336  N NE   . ARG A 1 11  ? 5.809   10.284  -3.191  1.00 0.00 ? 29  ARG A NE   2  
ATOM 2337  C CZ   . ARG A 1 11  ? 5.769   9.698   -1.999  1.00 0.00 ? 29  ARG A CZ   2  
ATOM 2338  N NH1  . ARG A 1 11  ? 4.977   8.654   -1.797  1.00 0.00 ? 29  ARG A NH1  2  
ATOM 2339  N NH2  . ARG A 1 11  ? 6.521   10.157  -1.006  1.00 0.00 ? 29  ARG A NH2  2  
ATOM 2340  H H    . ARG A 1 11  ? 4.038   9.724   -7.400  1.00 0.00 ? 29  ARG A H    2  
ATOM 2341  H HA   . ARG A 1 11  ? 1.642   9.238   -5.799  1.00 0.00 ? 29  ARG A HA   2  
ATOM 2342  H HB3  . ARG A 1 11  ? 2.224   11.584  -4.917  1.00 0.00 ? 29  ARG A HB3  2  
ATOM 2343  H HG3  . ARG A 1 11  ? 3.017   9.162   -4.033  1.00 0.00 ? 29  ARG A HG3  2  
ATOM 2344  H HD3  . ARG A 1 11  ? 5.344   10.374  -5.215  1.00 0.00 ? 29  ARG A HD3  2  
ATOM 2345  H HE   . ARG A 1 11  ? 6.400   11.054  -3.318  1.00 0.00 ? 29  ARG A HE   2  
ATOM 2346  H HH11 . ARG A 1 11  ? 4.409   8.305   -2.543  1.00 0.00 ? 29  ARG A HH11 2  
ATOM 2347  H HH12 . ARG A 1 11  ? 4.949   8.214   -0.899  1.00 0.00 ? 29  ARG A HH12 2  
ATOM 2348  H HH21 . ARG A 1 11  ? 7.119   10.943  -1.156  1.00 0.00 ? 29  ARG A HH21 2  
ATOM 2349  H HH22 . ARG A 1 11  ? 6.490   9.715   -0.111  1.00 0.00 ? 29  ARG A HH22 2  
ATOM 2350  N N    . PHE A 1 12  ? 0.033   10.882  -6.810  1.00 0.00 ? 30  PHE A N    2  
ATOM 2351  C CA   . PHE A 1 12  ? -0.955  11.651  -7.558  1.00 0.00 ? 30  PHE A CA   2  
ATOM 2352  C C    . PHE A 1 12  ? -1.652  12.665  -6.655  1.00 0.00 ? 30  PHE A C    2  
ATOM 2353  O O    . PHE A 1 12  ? -2.628  12.342  -5.979  1.00 0.00 ? 30  PHE A O    2  
ATOM 2354  C CB   . PHE A 1 12  ? -1.990  10.715  -8.186  1.00 0.00 ? 30  PHE A CB   2  
ATOM 2355  C CG   . PHE A 1 12  ? -1.450  9.908   -9.333  1.00 0.00 ? 30  PHE A CG   2  
ATOM 2356  C CD1  . PHE A 1 12  ? -1.065  10.528  -10.511 1.00 0.00 ? 30  PHE A CD1  2  
ATOM 2357  C CD2  . PHE A 1 12  ? -1.329  8.533   -9.234  1.00 0.00 ? 30  PHE A CD2  2  
ATOM 2358  C CE1  . PHE A 1 12  ? -0.569  9.789   -11.570 1.00 0.00 ? 30  PHE A CE1  2  
ATOM 2359  C CE2  . PHE A 1 12  ? -0.833  7.789   -10.288 1.00 0.00 ? 30  PHE A CE2  2  
ATOM 2360  C CZ   . PHE A 1 12  ? -0.454  8.418   -11.457 1.00 0.00 ? 30  PHE A CZ   2  
ATOM 2361  H H    . PHE A 1 12  ? -0.245  10.405  -5.999  1.00 0.00 ? 30  PHE A H    2  
ATOM 2362  H HA   . PHE A 1 12  ? -0.438  12.179  -8.342  1.00 0.00 ? 30  PHE A HA   2  
ATOM 2363  H HB3  . PHE A 1 12  ? -2.820  11.301  -8.552  1.00 0.00 ? 30  PHE A HB3  2  
ATOM 2364  H HD1  . PHE A 1 12  ? -1.156  11.602  -10.599 1.00 0.00 ? 30  PHE A HD1  2  
ATOM 2365  H HD2  . PHE A 1 12  ? -1.626  8.038   -8.320  1.00 0.00 ? 30  PHE A HD2  2  
ATOM 2366  H HE1  . PHE A 1 12  ? -0.272  10.286  -12.482 1.00 0.00 ? 30  PHE A HE1  2  
ATOM 2367  H HE2  . PHE A 1 12  ? -0.745  6.716   -10.198 1.00 0.00 ? 30  PHE A HE2  2  
ATOM 2368  H HZ   . PHE A 1 12  ? -0.064  7.840   -12.282 1.00 0.00 ? 30  PHE A HZ   2  
ATOM 2369  N N    . ALA A 1 13  ? -1.142  13.892  -6.650  1.00 0.00 ? 31  ALA A N    2  
ATOM 2370  C CA   . ALA A 1 13  ? -1.714  14.954  -5.833  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2371  C C    . ALA A 1 13  ? -1.705  14.576  -4.355  1.00 0.00 ? 31  ALA A C    2  
ATOM 2372  O O    . ALA A 1 13  ? -2.468  15.122  -3.561  1.00 0.00 ? 31  ALA A O    2  
ATOM 2373  C CB   . ALA A 1 13  ? -3.132  15.267  -6.291  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2374  H H    . ALA A 1 13  ? -0.362  14.088  -7.210  1.00 0.00 ? 31  ALA A H    2  
ATOM 2375  H HA   . ALA A 1 13  ? -1.114  15.842  -5.971  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2376  H HB1  . ALA A 1 13  ? -3.095  15.933  -7.141  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2377  H HB2  . ALA A 1 13  ? -3.629  14.351  -6.572  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2378  H HB3  . ALA A 1 13  ? -3.673  15.738  -5.485  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2379  N N    . GLY A 1 14  ? -0.835  13.638  -3.996  1.00 0.00 ? 32  GLY A N    2  
ATOM 2380  C CA   . GLY A 1 14  ? -0.744  13.202  -2.614  1.00 0.00 ? 32  GLY A CA   2  
ATOM 2381  C C    . GLY A 1 14  ? -1.369  11.838  -2.394  1.00 0.00 ? 32  GLY A C    2  
ATOM 2382  O O    . GLY A 1 14  ? -1.034  11.142  -1.435  1.00 0.00 ? 32  GLY A O    2  
ATOM 2383  H H    . GLY A 1 14  ? -0.251  13.236  -4.672  1.00 0.00 ? 32  GLY A H    2  
ATOM 2384  H HA2  . GLY A 1 14  ? 0.297   13.159  -2.330  1.00 0.00 ? 32  GLY A HA2  2  
ATOM 2385  H HA3  . GLY A 1 14  ? -1.249  13.922  -1.988  1.00 0.00 ? 32  GLY A HA3  2  
ATOM 2386  N N    . VAL A 1 15  ? -2.282  11.457  -3.280  1.00 0.00 ? 33  VAL A N    2  
ATOM 2387  C CA   . VAL A 1 15  ? -2.958  10.168  -3.178  1.00 0.00 ? 33  VAL A CA   2  
ATOM 2388  C C    . VAL A 1 15  ? -2.235  9.104   -3.994  1.00 0.00 ? 33  VAL A C    2  
ATOM 2389  O O    . VAL A 1 15  ? -1.607  9.405   -5.010  1.00 0.00 ? 33  VAL A O    2  
ATOM 2390  C CB   . VAL A 1 15  ? -4.419  10.262  -3.653  1.00 0.00 ? 33  VAL A CB   2  
ATOM 2391  C CG1  . VAL A 1 15  ? -5.162  8.967   -3.355  1.00 0.00 ? 33  VAL A CG1  2  
ATOM 2392  C CG2  . VAL A 1 15  ? -5.116  11.448  -3.005  1.00 0.00 ? 33  VAL A CG2  2  
ATOM 2393  H H    . VAL A 1 15  ? -2.508  12.056  -4.023  1.00 0.00 ? 33  VAL A H    2  
ATOM 2394  H HA   . VAL A 1 15  ? -2.958  9.873   -2.139  1.00 0.00 ? 33  VAL A HA   2  
ATOM 2395  H HB   . VAL A 1 15  ? -4.420  10.412  -4.723  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2396  H HG11 . VAL A 1 15  ? -6.205  9.086   -3.607  1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2397  H HG12 . VAL A 1 15  ? -4.736  8.165   -3.939  1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2398  H HG13 . VAL A 1 15  ? -5.070  8.736   -2.304  1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2399  H HG21 . VAL A 1 15  ? -4.601  12.357  -3.273  1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2400  H HG22 . VAL A 1 15  ? -6.139  11.498  -3.350  1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2401  H HG23 . VAL A 1 15  ? -5.105  11.330  -1.931  1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2402  N N    . PHE A 1 16  ? -2.328  7.857   -3.545  1.00 0.00 ? 34  PHE A N    2  
ATOM 2403  C CA   . PHE A 1 16  ? -1.683  6.745   -4.234  1.00 0.00 ? 34  PHE A CA   2  
ATOM 2404  C C    . PHE A 1 16  ? -2.167  5.407   -3.683  1.00 0.00 ? 34  PHE A C    2  
ATOM 2405  O O    . PHE A 1 16  ? -2.952  5.362   -2.732  1.00 0.00 ? 34  PHE A O    2  
ATOM 2406  C CB   . PHE A 1 16  ? -0.161  6.845   -4.094  1.00 0.00 ? 34  PHE A CB   2  
ATOM 2407  C CG   . PHE A 1 16  ? 0.303   6.973   -2.671  1.00 0.00 ? 34  PHE A CG   2  
ATOM 2408  C CD1  . PHE A 1 16  ? 0.302   8.206   -2.038  1.00 0.00 ? 34  PHE A CD1  2  
ATOM 2409  C CD2  . PHE A 1 16  ? 0.740   5.863   -1.968  1.00 0.00 ? 34  PHE A CD2  2  
ATOM 2410  C CE1  . PHE A 1 16  ? 0.728   8.327   -0.729  1.00 0.00 ? 34  PHE A CE1  2  
ATOM 2411  C CE2  . PHE A 1 16  ? 1.167   5.978   -0.659  1.00 0.00 ? 34  PHE A CE2  2  
ATOM 2412  C CZ   . PHE A 1 16  ? 1.163   7.212   -0.039  1.00 0.00 ? 34  PHE A CZ   2  
ATOM 2413  H H    . PHE A 1 16  ? -2.842  7.680   -2.729  1.00 0.00 ? 34  PHE A H    2  
ATOM 2414  H HA   . PHE A 1 16  ? -1.944  6.808   -5.279  1.00 0.00 ? 34  PHE A HA   2  
ATOM 2415  H HB3  . PHE A 1 16  ? 0.186   7.710   -4.638  1.00 0.00 ? 34  PHE A HB3  2  
ATOM 2416  H HD1  . PHE A 1 16  ? -0.037  9.079   -2.577  1.00 0.00 ? 34  PHE A HD1  2  
ATOM 2417  H HD2  . PHE A 1 16  ? 0.745   4.897   -2.452  1.00 0.00 ? 34  PHE A HD2  2  
ATOM 2418  H HE1  . PHE A 1 16  ? 0.723   9.294   -0.246  1.00 0.00 ? 34  PHE A HE1  2  
ATOM 2419  H HE2  . PHE A 1 16  ? 1.506   5.106   -0.123  1.00 0.00 ? 34  PHE A HE2  2  
ATOM 2420  H HZ   . PHE A 1 16  ? 1.496   7.305   0.984   1.00 0.00 ? 34  PHE A HZ   2  
ATOM 2421  N N    . HIS A 1 17  ? -1.698  4.321   -4.285  1.00 0.00 ? 35  HIS A N    2  
ATOM 2422  C CA   . HIS A 1 17  ? -2.085  2.981   -3.856  1.00 0.00 ? 35  HIS A CA   2  
ATOM 2423  C C    . HIS A 1 17  ? -0.874  2.203   -3.350  1.00 0.00 ? 35  HIS A C    2  
ATOM 2424  O O    . HIS A 1 17  ? 0.244   2.392   -3.830  1.00 0.00 ? 35  HIS A O    2  
ATOM 2425  C CB   . HIS A 1 17  ? -2.747  2.225   -5.007  1.00 0.00 ? 35  HIS A CB   2  
ATOM 2426  C CG   . HIS A 1 17  ? -1.770  1.585   -5.945  1.00 0.00 ? 35  HIS A CG   2  
ATOM 2427  N ND1  . HIS A 1 17  ? -0.991  2.306   -6.825  1.00 0.00 ? 35  HIS A ND1  2  
ATOM 2428  C CD2  . HIS A 1 17  ? -1.446  0.284   -6.135  1.00 0.00 ? 35  HIS A CD2  2  
ATOM 2429  C CE1  . HIS A 1 17  ? -0.231  1.475   -7.518  1.00 0.00 ? 35  HIS A CE1  2  
ATOM 2430  N NE2  . HIS A 1 17  ? -0.489  0.243   -7.118  1.00 0.00 ? 35  HIS A NE2  2  
ATOM 2431  H H    . HIS A 1 17  ? -1.078  4.421   -5.036  1.00 0.00 ? 35  HIS A H    2  
ATOM 2432  H HA   . HIS A 1 17  ? -2.794  3.083   -3.048  1.00 0.00 ? 35  HIS A HA   2  
ATOM 2433  H HB3  . HIS A 1 17  ? -3.355  2.911   -5.578  1.00 0.00 ? 35  HIS A HB3  2  
ATOM 2434  H HD1  . HIS A 1 17  ? -0.996  3.280   -6.929  1.00 0.00 ? 35  HIS A HD1  2  
ATOM 2435  H HD2  . HIS A 1 17  ? -1.863  -0.564  -5.612  1.00 0.00 ? 35  HIS A HD2  2  
ATOM 2436  H HE1  . HIS A 1 17  ? 0.479   1.756   -8.282  1.00 0.00 ? 35  HIS A HE1  2  
ATOM 2437  N N    . VAL A 1 18  ? -1.103  1.327   -2.377  1.00 0.00 ? 36  VAL A N    2  
ATOM 2438  C CA   . VAL A 1 18  ? -0.031  0.519   -1.806  1.00 0.00 ? 36  VAL A CA   2  
ATOM 2439  C C    . VAL A 1 18  ? -0.178  -0.946  -2.201  1.00 0.00 ? 36  VAL A C    2  
ATOM 2440  O O    . VAL A 1 18  ? -1.164  -1.596  -1.857  1.00 0.00 ? 36  VAL A O    2  
ATOM 2441  C CB   . VAL A 1 18  ? -0.007  0.626   -0.269  1.00 0.00 ? 36  VAL A CB   2  
ATOM 2442  C CG1  . VAL A 1 18  ? 1.140   -0.192  0.304   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2443  C CG2  . VAL A 1 18  ? 0.096   2.080   0.162   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2444  H H    . VAL A 1 18  ? -2.017  1.220   -2.034  1.00 0.00 ? 36  VAL A H    2  
ATOM 2445  H HA   . VAL A 1 18  ? 0.907   0.894   -2.188  1.00 0.00 ? 36  VAL A HA   2  
ATOM 2446  H HB   . VAL A 1 18  ? -0.933  0.223   0.115   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2447  H HG11 . VAL A 1 18  ? 0.752   -0.909  1.013   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2448  H HG12 . VAL A 1 18  ? 1.647   -0.713  -0.496  1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2449  H HG13 . VAL A 1 18  ? 1.837   0.466   0.803   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2450  H HG21 . VAL A 1 18  ? -0.895  2.483   0.310   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2451  H HG22 . VAL A 1 18  ? 0.651   2.144   1.087   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2452  H HG23 . VAL A 1 18  ? 0.605   2.648   -0.602  1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2453  N N    . GLU A 1 19  ? 0.812   -1.460  -2.924  1.00 0.00 ? 37  GLU A N    2  
ATOM 2454  C CA   . GLU A 1 19  ? 0.794   -2.850  -3.366  1.00 0.00 ? 37  GLU A CA   2  
ATOM 2455  C C    . GLU A 1 19  ? 1.369   -3.770  -2.293  1.00 0.00 ? 37  GLU A C    2  
ATOM 2456  O O    . GLU A 1 19  ? 2.472   -3.545  -1.793  1.00 0.00 ? 37  GLU A O    2  
ATOM 2457  C CB   . GLU A 1 19  ? 1.585   -3.005  -4.666  1.00 0.00 ? 37  GLU A CB   2  
ATOM 2458  C CG   . GLU A 1 19  ? 1.137   -4.182  -5.514  1.00 0.00 ? 37  GLU A CG   2  
ATOM 2459  C CD   . GLU A 1 19  ? 1.837   -4.233  -6.858  1.00 0.00 ? 37  GLU A CD   2  
ATOM 2460  O OE1  . GLU A 1 19  ? 2.971   -3.722  -6.955  1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2461  O OE2  . GLU A 1 19  ? 1.251   -4.787  -7.811  1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2462  H H    . GLU A 1 19  ? 1.573   -0.891  -3.166  1.00 0.00 ? 37  GLU A H    2  
ATOM 2463  H HA   . GLU A 1 19  ? -0.235  -3.126  -3.547  1.00 0.00 ? 37  GLU A HA   2  
ATOM 2464  H HB3  . GLU A 1 19  ? 2.629   -3.140  -4.423  1.00 0.00 ? 37  GLU A HB3  2  
ATOM 2465  H HG3  . GLU A 1 19  ? 0.073   -4.104  -5.683  1.00 0.00 ? 37  GLU A HG3  2  
ATOM 2466  N N    . LYS A 1 20  ? 0.615   -4.806  -1.946  1.00 0.00 ? 38  LYS A N    2  
ATOM 2467  C CA   . LYS A 1 20  ? 1.050   -5.763  -0.933  1.00 0.00 ? 38  LYS A CA   2  
ATOM 2468  C C    . LYS A 1 20  ? 1.775   -6.942  -1.573  1.00 0.00 ? 38  LYS A C    2  
ATOM 2469  O O    . LYS A 1 20  ? 1.167   -7.967  -1.875  1.00 0.00 ? 38  LYS A O    2  
ATOM 2470  C CB   . LYS A 1 20  ? -0.151  -6.264  -0.129  1.00 0.00 ? 38  LYS A CB   2  
ATOM 2471  C CG   . LYS A 1 20  ? 0.194   -6.656  1.298   1.00 0.00 ? 38  LYS A CG   2  
ATOM 2472  C CD   . LYS A 1 20  ? -1.053  -6.789  2.157   1.00 0.00 ? 38  LYS A CD   2  
ATOM 2473  C CE   . LYS A 1 20  ? -1.945  -7.922  1.673   1.00 0.00 ? 38  LYS A CE   2  
ATOM 2474  N NZ   . LYS A 1 20  ? -1.320  -9.254  1.898   1.00 0.00 ? 38  LYS A NZ   2  
ATOM 2475  H H    . LYS A 1 20  ? -0.254  -4.933  -2.380  1.00 0.00 ? 38  LYS A H    2  
ATOM 2476  H HA   . LYS A 1 20  ? 1.731   -5.255  -0.267  1.00 0.00 ? 38  LYS A HA   2  
ATOM 2477  H HB3  . LYS A 1 20  ? -0.567  -7.129  -0.626  1.00 0.00 ? 38  LYS A HB3  2  
ATOM 2478  H HG3  . LYS A 1 20  ? 0.835   -5.898  1.725   1.00 0.00 ? 38  LYS A HG3  2  
ATOM 2479  H HD3  . LYS A 1 20  ? -1.607  -5.862  2.116   1.00 0.00 ? 38  LYS A HD3  2  
ATOM 2480  H HE3  . LYS A 1 20  ? -2.127  -7.792  0.617   1.00 0.00 ? 38  LYS A HE3  2  
ATOM 2481  H HZ1  . LYS A 1 20  ? -0.530  -9.170  2.567   1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 2482  H HZ2  . LYS A 1 20  ? -0.960  -9.637  0.999   1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 2483  H HZ3  . LYS A 1 20  ? -2.021  -9.916  2.288   1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 2484  N N    . ASN A 1 21  ? 3.080   -6.789  -1.778  1.00 0.00 ? 39  ASN A N    2  
ATOM 2485  C CA   . ASN A 1 21  ? 3.887   -7.842  -2.382  1.00 0.00 ? 39  ASN A CA   2  
ATOM 2486  C C    . ASN A 1 21  ? 3.347   -8.221  -3.757  1.00 0.00 ? 39  ASN A C    2  
ATOM 2487  O O    . ASN A 1 21  ? 3.625   -9.304  -4.268  1.00 0.00 ? 39  ASN A O    2  
ATOM 2488  C CB   . ASN A 1 21  ? 3.916   -9.074  -1.476  1.00 0.00 ? 39  ASN A CB   2  
ATOM 2489  C CG   . ASN A 1 21  ? 5.237   -9.814  -1.550  1.00 0.00 ? 39  ASN A CG   2  
ATOM 2490  O OD1  . ASN A 1 21  ? 6.251   -9.354  -1.024  1.00 0.00 ? 39  ASN A OD1  2  
ATOM 2491  N ND2  . ASN A 1 21  ? 5.231   -10.971 -2.203  1.00 0.00 ? 39  ASN A ND2  2  
ATOM 2492  H H    . ASN A 1 21  ? 3.509   -5.948  -1.517  1.00 0.00 ? 39  ASN A H    2  
ATOM 2493  H HA   . ASN A 1 21  ? 4.892   -7.465  -2.494  1.00 0.00 ? 39  ASN A HA   2  
ATOM 2494  H HB3  . ASN A 1 21  ? 3.128   -9.749  -1.771  1.00 0.00 ? 39  ASN A HB3  2  
ATOM 2495  H HD21 . ASN A 1 21  ? 4.388   -11.276 -2.598  1.00 0.00 ? 39  ASN A HD21 2  
ATOM 2496  H HD22 . ASN A 1 21  ? 6.072   -11.471 -2.267  1.00 0.00 ? 39  ASN A HD22 2  
ATOM 2497  N N    . GLY A 1 22  ? 2.573   -7.318  -4.352  1.00 0.00 ? 40  GLY A N    2  
ATOM 2498  C CA   . GLY A 1 22  ? 2.005   -7.576  -5.663  1.00 0.00 ? 40  GLY A CA   2  
ATOM 2499  C C    . GLY A 1 22  ? 0.699   -8.341  -5.589  1.00 0.00 ? 40  GLY A C    2  
ATOM 2500  O O    . GLY A 1 22  ? 0.651   -9.530  -5.907  1.00 0.00 ? 40  GLY A O    2  
ATOM 2501  H H    . GLY A 1 22  ? 2.384   -6.471  -3.897  1.00 0.00 ? 40  GLY A H    2  
ATOM 2502  H HA2  . GLY A 1 22  ? 1.829   -6.633  -6.159  1.00 0.00 ? 40  GLY A HA2  2  
ATOM 2503  H HA3  . GLY A 1 22  ? 2.714   -8.149  -6.242  1.00 0.00 ? 40  GLY A HA3  2  
ATOM 2504  N N    . ARG A 1 23  ? -0.362  -7.662  -5.169  1.00 0.00 ? 41  ARG A N    2  
ATOM 2505  C CA   . ARG A 1 23  ? -1.674  -8.286  -5.052  1.00 0.00 ? 41  ARG A CA   2  
ATOM 2506  C C    . ARG A 1 23  ? -2.723  -7.271  -4.610  1.00 0.00 ? 41  ARG A C    2  
ATOM 2507  O O    . ARG A 1 23  ? -2.390  -6.213  -4.074  1.00 0.00 ? 41  ARG A O    2  
ATOM 2508  C CB   . ARG A 1 23  ? -1.622  -9.448  -4.057  1.00 0.00 ? 41  ARG A CB   2  
ATOM 2509  C CG   . ARG A 1 23  ? -2.531  -10.608 -4.428  1.00 0.00 ? 41  ARG A CG   2  
ATOM 2510  C CD   . ARG A 1 23  ? -1.876  -11.527 -5.447  1.00 0.00 ? 41  ARG A CD   2  
ATOM 2511  N NE   . ARG A 1 23  ? -2.087  -11.064 -6.816  1.00 0.00 ? 41  ARG A NE   2  
ATOM 2512  C CZ   . ARG A 1 23  ? -1.520  -11.627 -7.878  1.00 0.00 ? 41  ARG A CZ   2  
ATOM 2513  N NH1  . ARG A 1 23  ? -0.713  -12.669 -7.728  1.00 0.00 ? 41  ARG A NH1  2  
ATOM 2514  N NH2  . ARG A 1 23  ? -1.761  -11.150 -9.091  1.00 0.00 ? 41  ARG A NH2  2  
ATOM 2515  H H    . ARG A 1 23  ? -0.260  -6.716  -4.931  1.00 0.00 ? 41  ARG A H    2  
ATOM 2516  H HA   . ARG A 1 23  ? -1.947  -8.669  -6.024  1.00 0.00 ? 41  ARG A HA   2  
ATOM 2517  H HB3  . ARG A 1 23  ? -1.915  -9.085  -3.084  1.00 0.00 ? 41  ARG A HB3  2  
ATOM 2518  H HG3  . ARG A 1 23  ? -3.447  -10.215 -4.845  1.00 0.00 ? 41  ARG A HG3  2  
ATOM 2519  H HD3  . ARG A 1 23  ? -2.295  -12.516 -5.341  1.00 0.00 ? 41  ARG A HD3  2  
ATOM 2520  H HE   . ARG A 1 23  ? -2.680  -10.295 -6.949  1.00 0.00 ? 41  ARG A HE   2  
ATOM 2521  H HH11 . ARG A 1 23  ? -0.530  -13.031 -6.814  1.00 0.00 ? 41  ARG A HH11 2  
ATOM 2522  H HH12 . ARG A 1 23  ? -0.289  -13.092 -8.528  1.00 0.00 ? 41  ARG A HH12 2  
ATOM 2523  H HH21 . ARG A 1 23  ? -2.369  -10.365 -9.208  1.00 0.00 ? 41  ARG A HH21 2  
ATOM 2524  H HH22 . ARG A 1 23  ? -1.335  -11.574 -9.890  1.00 0.00 ? 41  ARG A HH22 2  
ATOM 2525  N N    . TYR A 1 24  ? -3.989  -7.599  -4.839  1.00 0.00 ? 42  TYR A N    2  
ATOM 2526  C CA   . TYR A 1 24  ? -5.086  -6.714  -4.467  1.00 0.00 ? 42  TYR A CA   2  
ATOM 2527  C C    . TYR A 1 24  ? -5.976  -7.361  -3.409  1.00 0.00 ? 42  TYR A C    2  
ATOM 2528  O O    . TYR A 1 24  ? -7.195  -7.417  -3.557  1.00 0.00 ? 42  TYR A O    2  
ATOM 2529  C CB   . TYR A 1 24  ? -5.920  -6.356  -5.700  1.00 0.00 ? 42  TYR A CB   2  
ATOM 2530  C CG   . TYR A 1 24  ? -5.332  -5.230  -6.522  1.00 0.00 ? 42  TYR A CG   2  
ATOM 2531  C CD1  . TYR A 1 24  ? -4.021  -5.289  -6.976  1.00 0.00 ? 42  TYR A CD1  2  
ATOM 2532  C CD2  . TYR A 1 24  ? -6.089  -4.113  -6.846  1.00 0.00 ? 42  TYR A CD2  2  
ATOM 2533  C CE1  . TYR A 1 24  ? -3.479  -4.265  -7.728  1.00 0.00 ? 42  TYR A CE1  2  
ATOM 2534  C CE2  . TYR A 1 24  ? -5.556  -3.083  -7.599  1.00 0.00 ? 42  TYR A CE2  2  
ATOM 2535  C CZ   . TYR A 1 24  ? -4.251  -3.163  -8.037  1.00 0.00 ? 42  TYR A CZ   2  
ATOM 2536  O OH   . TYR A 1 24  ? -3.716  -2.141  -8.785  1.00 0.00 ? 42  TYR A OH   2  
ATOM 2537  H H    . TYR A 1 24  ? -4.191  -8.455  -5.269  1.00 0.00 ? 42  TYR A H    2  
ATOM 2538  H HA   . TYR A 1 24  ? -4.660  -5.809  -4.058  1.00 0.00 ? 42  TYR A HA   2  
ATOM 2539  H HB3  . TYR A 1 24  ? -6.908  -6.053  -5.382  1.00 0.00 ? 42  TYR A HB3  2  
ATOM 2540  H HD1  . TYR A 1 24  ? -3.419  -6.153  -6.733  1.00 0.00 ? 42  TYR A HD1  2  
ATOM 2541  H HD2  . TYR A 1 24  ? -7.111  -4.052  -6.502  1.00 0.00 ? 42  TYR A HD2  2  
ATOM 2542  H HE1  . TYR A 1 24  ? -2.457  -4.327  -8.071  1.00 0.00 ? 42  TYR A HE1  2  
ATOM 2543  H HE2  . TYR A 1 24  ? -6.160  -2.220  -7.840  1.00 0.00 ? 42  TYR A HE2  2  
ATOM 2544  H HH   . TYR A 1 24  ? -4.021  -1.298  -8.443  1.00 0.00 ? 42  TYR A HH   2  
ATOM 2545  N N    . SER A 1 25  ? -5.353  -7.850  -2.343  1.00 0.00 ? 43  SER A N    2  
ATOM 2546  C CA   . SER A 1 25  ? -6.084  -8.497  -1.260  1.00 0.00 ? 43  SER A CA   2  
ATOM 2547  C C    . SER A 1 25  ? -5.705  -7.893  0.090   1.00 0.00 ? 43  SER A C    2  
ATOM 2548  O O    . SER A 1 25  ? -5.020  -8.525  0.894   1.00 0.00 ? 43  SER A O    2  
ATOM 2549  C CB   . SER A 1 25  ? -5.805  -10.001 -1.255  1.00 0.00 ? 43  SER A CB   2  
ATOM 2550  O OG   . SER A 1 25  ? -4.424  -10.262 -1.073  1.00 0.00 ? 43  SER A OG   2  
ATOM 2551  H H    . SER A 1 25  ? -4.377  -7.775  -2.281  1.00 0.00 ? 43  SER A H    2  
ATOM 2552  H HA   . SER A 1 25  ? -7.139  -8.336  -1.430  1.00 0.00 ? 43  SER A HA   2  
ATOM 2553  H HB3  . SER A 1 25  ? -6.118  -10.425 -2.197  1.00 0.00 ? 43  SER A HB3  2  
ATOM 2554  H HG   . SER A 1 25  ? -3.909  -9.646  -1.600  1.00 0.00 ? 43  SER A HG   2  
ATOM 2555  N N    . ILE A 1 26  ? -6.155  -6.666  0.328   1.00 0.00 ? 44  ILE A N    2  
ATOM 2556  C CA   . ILE A 1 26  ? -5.865  -5.977  1.580   1.00 0.00 ? 44  ILE A CA   2  
ATOM 2557  C C    . ILE A 1 26  ? -7.149  -5.617  2.320   1.00 0.00 ? 44  ILE A C    2  
ATOM 2558  O O    . ILE A 1 26  ? -8.182  -5.359  1.703   1.00 0.00 ? 44  ILE A O    2  
ATOM 2559  C CB   . ILE A 1 26  ? -5.049  -4.694  1.339   1.00 0.00 ? 44  ILE A CB   2  
ATOM 2560  C CG1  . ILE A 1 26  ? -3.856  -4.986  0.427   1.00 0.00 ? 44  ILE A CG1  2  
ATOM 2561  C CG2  . ILE A 1 26  ? -4.578  -4.109  2.664   1.00 0.00 ? 44  ILE A CG2  2  
ATOM 2562  C CD1  . ILE A 1 26  ? -3.047  -3.757  0.076   1.00 0.00 ? 44  ILE A CD1  2  
ATOM 2563  H H    . ILE A 1 26  ? -6.697  -6.213  -0.352  1.00 0.00 ? 44  ILE A H    2  
ATOM 2564  H HA   . ILE A 1 26  ? -5.280  -6.641  2.199   1.00 0.00 ? 44  ILE A HA   2  
ATOM 2565  H HB   . ILE A 1 26  ? -5.689  -3.970  0.861   1.00 0.00 ? 44  ILE A HB   2  
ATOM 2566  H HG13 . ILE A 1 26  ? -4.217  -5.422  -0.495  1.00 0.00 ? 44  ILE A HG13 2  
ATOM 2567  H HG21 . ILE A 1 26  ? -5.432  -3.779  3.235   1.00 0.00 ? 44  ILE A HG21 2  
ATOM 2568  H HG22 . ILE A 1 26  ? -4.044  -4.864  3.221   1.00 0.00 ? 44  ILE A HG22 2  
ATOM 2569  H HG23 . ILE A 1 26  ? -3.925  -3.271  2.475   1.00 0.00 ? 44  ILE A HG23 2  
ATOM 2570  H HD11 . ILE A 1 26  ? -2.285  -4.020  -0.642  1.00 0.00 ? 44  ILE A HD11 2  
ATOM 2571  H HD12 . ILE A 1 26  ? -3.697  -3.006  -0.349  1.00 0.00 ? 44  ILE A HD12 2  
ATOM 2572  H HD13 . ILE A 1 26  ? -2.582  -3.366  0.969   1.00 0.00 ? 44  ILE A HD13 2  
ATOM 2573  N N    . SER A 1 27  ? -7.076  -5.600  3.647   1.00 0.00 ? 45  SER A N    2  
ATOM 2574  C CA   . SER A 1 27  ? -8.233  -5.273  4.472   1.00 0.00 ? 45  SER A CA   2  
ATOM 2575  C C    . SER A 1 27  ? -8.112  -3.865  5.044   1.00 0.00 ? 45  SER A C    2  
ATOM 2576  O O    . SER A 1 27  ? -7.025  -3.288  5.081   1.00 0.00 ? 45  SER A O    2  
ATOM 2577  C CB   . SER A 1 27  ? -8.376  -6.286  5.609   1.00 0.00 ? 45  SER A CB   2  
ATOM 2578  O OG   . SER A 1 27  ? -9.716  -6.348  6.070   1.00 0.00 ? 45  SER A OG   2  
ATOM 2579  H H    . SER A 1 27  ? -6.224  -5.815  4.081   1.00 0.00 ? 45  SER A H    2  
ATOM 2580  H HA   . SER A 1 27  ? -9.112  -5.321  3.846   1.00 0.00 ? 45  SER A HA   2  
ATOM 2581  H HB3  . SER A 1 27  ? -7.740  -5.995  6.431   1.00 0.00 ? 45  SER A HB3  2  
ATOM 2582  H HG   . SER A 1 27  ? -9.793  -7.035  6.737   1.00 0.00 ? 45  SER A HG   2  
ATOM 2583  N N    . ARG A 1 28  ? -9.237  -3.315  5.489   1.00 0.00 ? 46  ARG A N    2  
ATOM 2584  C CA   . ARG A 1 28  ? -9.259  -1.972  6.058   1.00 0.00 ? 46  ARG A CA   2  
ATOM 2585  C C    . ARG A 1 28  ? -8.411  -1.904  7.326   1.00 0.00 ? 46  ARG A C    2  
ATOM 2586  O O    . ARG A 1 28  ? -7.678  -0.941  7.544   1.00 0.00 ? 46  ARG A O    2  
ATOM 2587  C CB   . ARG A 1 28  ? -10.696 -1.551  6.369   1.00 0.00 ? 46  ARG A CB   2  
ATOM 2588  C CG   . ARG A 1 28  ? -11.427 -2.515  7.290   1.00 0.00 ? 46  ARG A CG   2  
ATOM 2589  C CD   . ARG A 1 28  ? -12.936 -2.389  7.142   1.00 0.00 ? 46  ARG A CD   2  
ATOM 2590  N NE   . ARG A 1 28  ? -13.439 -1.139  7.703   1.00 0.00 ? 46  ARG A NE   2  
ATOM 2591  C CZ   . ARG A 1 28  ? -14.677 -0.693  7.512   1.00 0.00 ? 46  ARG A CZ   2  
ATOM 2592  N NH1  . ARG A 1 28  ? -15.531 -1.394  6.780   1.00 0.00 ? 46  ARG A NH1  2  
ATOM 2593  N NH2  . ARG A 1 28  ? -15.061 0.455   8.056   1.00 0.00 ? 46  ARG A NH2  2  
ATOM 2594  H H    . ARG A 1 28  ? -10.073 -3.824  5.433   1.00 0.00 ? 46  ARG A H    2  
ATOM 2595  H HA   . ARG A 1 28  ? -8.844  -1.295  5.327   1.00 0.00 ? 46  ARG A HA   2  
ATOM 2596  H HB3  . ARG A 1 28  ? -11.248 -1.483  5.444   1.00 0.00 ? 46  ARG A HB3  2  
ATOM 2597  H HG3  . ARG A 1 28  ? -11.156 -2.297  8.312   1.00 0.00 ? 46  ARG A HG3  2  
ATOM 2598  H HD3  . ARG A 1 28  ? -13.404 -3.217  7.653   1.00 0.00 ? 46  ARG A HD3  2  
ATOM 2599  H HE   . ARG A 1 28  ? -12.824 -0.606  8.249   1.00 0.00 ? 46  ARG A HE   2  
ATOM 2600  H HH11 . ARG A 1 28  ? -15.245 -2.259  6.370   1.00 0.00 ? 46  ARG A HH11 2  
ATOM 2601  H HH12 . ARG A 1 28  ? -16.463 -1.056  6.639   1.00 0.00 ? 46  ARG A HH12 2  
ATOM 2602  H HH21 . ARG A 1 28  ? -14.419 0.984   8.610   1.00 0.00 ? 46  ARG A HH21 2  
ATOM 2603  H HH22 . ARG A 1 28  ? -15.991 0.788   7.912   1.00 0.00 ? 46  ARG A HH22 2  
ATOM 2604  N N    . THR A 1 29  ? -8.519  -2.935  8.159   1.00 0.00 ? 47  THR A N    2  
ATOM 2605  C CA   . THR A 1 29  ? -7.764  -2.993  9.404   1.00 0.00 ? 47  THR A CA   2  
ATOM 2606  C C    . THR A 1 29  ? -6.271  -2.813  9.151   1.00 0.00 ? 47  THR A C    2  
ATOM 2607  O O    . THR A 1 29  ? -5.547  -2.302  10.005  1.00 0.00 ? 47  THR A O    2  
ATOM 2608  C CB   . THR A 1 29  ? -7.993  -4.329  10.137  1.00 0.00 ? 47  THR A CB   2  
ATOM 2609  O OG1  . THR A 1 29  ? -7.773  -5.424  9.240   1.00 0.00 ? 47  THR A OG1  2  
ATOM 2610  C CG2  . THR A 1 29  ? -9.404  -4.403  10.702  1.00 0.00 ? 47  THR A CG2  2  
ATOM 2611  H H    . THR A 1 29  ? -9.120  -3.674  7.928   1.00 0.00 ? 47  THR A H    2  
ATOM 2612  H HA   . THR A 1 29  ? -8.111  -2.192  10.041  1.00 0.00 ? 47  THR A HA   2  
ATOM 2613  H HB   . THR A 1 29  ? -7.290  -4.398  10.955  1.00 0.00 ? 47  THR A HB   2  
ATOM 2614  H HG1  . THR A 1 29  ? -8.556  -5.555  8.699   1.00 0.00 ? 47  THR A HG1  2  
ATOM 2615  H HG21 . THR A 1 29  ? -9.846  -5.352  10.441  1.00 0.00 ? 47  THR A HG21 2  
ATOM 2616  H HG22 . THR A 1 29  ? -10.000 -3.603  10.287  1.00 0.00 ? 47  THR A HG22 2  
ATOM 2617  H HG23 . THR A 1 29  ? -9.367  -4.305  11.776  1.00 0.00 ? 47  THR A HG23 2  
ATOM 2618  N N    . GLU A 1 30  ? -5.820  -3.237  7.977   1.00 0.00 ? 48  GLU A N    2  
ATOM 2619  C CA   . GLU A 1 30  ? -4.413  -3.121  7.613   1.00 0.00 ? 48  GLU A CA   2  
ATOM 2620  C C    . GLU A 1 30  ? -4.153  -1.831  6.841   1.00 0.00 ? 48  GLU A C    2  
ATOM 2621  O O    . GLU A 1 30  ? -3.074  -1.245  6.934   1.00 0.00 ? 48  GLU A O    2  
ATOM 2622  C CB   . GLU A 1 30  ? -3.979  -4.327  6.774   1.00 0.00 ? 48  GLU A CB   2  
ATOM 2623  C CG   . GLU A 1 30  ? -3.595  -5.539  7.606   1.00 0.00 ? 48  GLU A CG   2  
ATOM 2624  C CD   . GLU A 1 30  ? -2.599  -6.438  6.901   1.00 0.00 ? 48  GLU A CD   2  
ATOM 2625  O OE1  . GLU A 1 30  ? -3.031  -7.303  6.112   1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2626  O OE2  . GLU A 1 30  ? -1.382  -6.274  7.139   1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2627  H H    . GLU A 1 30  ? -6.447  -3.637  7.337   1.00 0.00 ? 48  GLU A H    2  
ATOM 2628  H HA   . GLU A 1 30  ? -3.835  -3.104  8.526   1.00 0.00 ? 48  GLU A HA   2  
ATOM 2629  H HB3  . GLU A 1 30  ? -3.125  -4.043  6.175   1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2630  H HG3  . GLU A 1 30  ? -4.488  -6.112  7.816   1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2631  N N    . ALA A 1 31  ? -5.150  -1.394  6.079   1.00 0.00 ? 49  ALA A N    2  
ATOM 2632  C CA   . ALA A 1 31  ? -5.032  -0.173  5.293   1.00 0.00 ? 49  ALA A CA   2  
ATOM 2633  C C    . ALA A 1 31  ? -4.573  0.996   6.158   1.00 0.00 ? 49  ALA A C    2  
ATOM 2634  O O    . ALA A 1 31  ? -3.575  1.649   5.855   1.00 0.00 ? 49  ALA A O    2  
ATOM 2635  C CB   . ALA A 1 31  ? -6.358  0.154   4.622   1.00 0.00 ? 49  ALA A CB   2  
ATOM 2636  H H    . ALA A 1 31  ? -5.987  -1.905  6.047   1.00 0.00 ? 49  ALA A H    2  
ATOM 2637  H HA   . ALA A 1 31  ? -4.298  -0.344  4.519   1.00 0.00 ? 49  ALA A HA   2  
ATOM 2638  H HB1  . ALA A 1 31  ? -6.566  -0.583  3.860   1.00 0.00 ? 49  ALA A HB1  2  
ATOM 2639  H HB2  . ALA A 1 31  ? -7.147  0.142   5.359   1.00 0.00 ? 49  ALA A HB2  2  
ATOM 2640  H HB3  . ALA A 1 31  ? -6.302  1.132   4.171   1.00 0.00 ? 49  ALA A HB3  2  
ATOM 2641  N N    . ALA A 1 32  ? -5.307  1.252   7.236   1.00 0.00 ? 50  ALA A N    2  
ATOM 2642  C CA   . ALA A 1 32  ? -4.974  2.340   8.145   1.00 0.00 ? 50  ALA A CA   2  
ATOM 2643  C C    . ALA A 1 32  ? -3.519  2.254   8.594   1.00 0.00 ? 50  ALA A C    2  
ATOM 2644  O O    . ALA A 1 32  ? -2.755  3.209   8.442   1.00 0.00 ? 50  ALA A O    2  
ATOM 2645  C CB   . ALA A 1 32  ? -5.901  2.325   9.352   1.00 0.00 ? 50  ALA A CB   2  
ATOM 2646  H H    . ALA A 1 32  ? -6.090  0.695   7.424   1.00 0.00 ? 50  ALA A H    2  
ATOM 2647  H HA   . ALA A 1 32  ? -5.123  3.273   7.620   1.00 0.00 ? 50  ALA A HA   2  
ATOM 2648  H HB1  . ALA A 1 32  ? -5.751  3.222   9.932   1.00 0.00 ? 50  ALA A HB1  2  
ATOM 2649  H HB2  . ALA A 1 32  ? -6.927  2.279   9.015   1.00 0.00 ? 50  ALA A HB2  2  
ATOM 2650  H HB3  . ALA A 1 32  ? -5.684  1.460   9.961   1.00 0.00 ? 50  ALA A HB3  2  
ATOM 2651  N N    . ASP A 1 33  ? -3.142  1.108   9.150   1.00 0.00 ? 51  ASP A N    2  
ATOM 2652  C CA   . ASP A 1 33  ? -1.778  0.897   9.621   1.00 0.00 ? 51  ASP A CA   2  
ATOM 2653  C C    . ASP A 1 33  ? -0.776  1.097   8.489   1.00 0.00 ? 51  ASP A C    2  
ATOM 2654  O O    . ASP A 1 33  ? 0.330   1.597   8.705   1.00 0.00 ? 51  ASP A O    2  
ATOM 2655  C CB   . ASP A 1 33  ? -1.630  -0.507  10.209  1.00 0.00 ? 51  ASP A CB   2  
ATOM 2656  C CG   . ASP A 1 33  ? -0.191  -0.845  10.542  1.00 0.00 ? 51  ASP A CG   2  
ATOM 2657  O OD1  . ASP A 1 33  ? 0.302   -0.378  11.590  1.00 0.00 ? 51  ASP A OD1  2  
ATOM 2658  O OD2  . ASP A 1 33  ? 0.444   -1.578  9.754   1.00 0.00 ? 51  ASP A OD2  2  
ATOM 2659  H H    . ASP A 1 33  ? -3.798  0.385   9.244   1.00 0.00 ? 51  ASP A H    2  
ATOM 2660  H HA   . ASP A 1 33  ? -1.579  1.624   10.394  1.00 0.00 ? 51  ASP A HA   2  
ATOM 2661  H HB3  . ASP A 1 33  ? -1.995  -1.229  9.494   1.00 0.00 ? 51  ASP A HB3  2  
ATOM 2662  N N    . LEU A 1 34  ? -1.168  0.703   7.283   1.00 0.00 ? 52  LEU A N    2  
ATOM 2663  C CA   . LEU A 1 34  ? -0.302  0.838   6.115   1.00 0.00 ? 52  LEU A CA   2  
ATOM 2664  C C    . LEU A 1 34  ? 0.034   2.302   5.852   1.00 0.00 ? 52  LEU A C    2  
ATOM 2665  O O    . LEU A 1 34  ? 1.199   2.698   5.882   1.00 0.00 ? 52  LEU A O    2  
ATOM 2666  C CB   . LEU A 1 34  ? -0.974  0.227   4.884   1.00 0.00 ? 52  LEU A CB   2  
ATOM 2667  C CG   . LEU A 1 34  ? -0.047  -0.476  3.892   1.00 0.00 ? 52  LEU A CG   2  
ATOM 2668  C CD1  . LEU A 1 34  ? 1.104   0.436   3.499   1.00 0.00 ? 52  LEU A CD1  2  
ATOM 2669  C CD2  . LEU A 1 34  ? 0.478   -1.776  4.484   1.00 0.00 ? 52  LEU A CD2  2  
ATOM 2670  H H    . LEU A 1 34  ? -2.058  0.313   7.171   1.00 0.00 ? 52  LEU A H    2  
ATOM 2671  H HA   . LEU A 1 34  ? 0.614   0.301   6.319   1.00 0.00 ? 52  LEU A HA   2  
ATOM 2672  H HB3  . LEU A 1 34  ? -1.481  1.023   4.358   1.00 0.00 ? 52  LEU A HB3  2  
ATOM 2673  H HG   . LEU A 1 34  ? -0.604  -0.717  2.998   1.00 0.00 ? 52  LEU A HG   2  
ATOM 2674  H HD11 . LEU A 1 34  ? 0.717   1.306   2.990   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 2675  H HD12 . LEU A 1 34  ? 1.776   -0.095  2.841   1.00 0.00 ? 52  LEU A HD12 2  
ATOM 2676  H HD13 . LEU A 1 34  ? 1.639   0.744   4.386   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 2677  H HD21 . LEU A 1 34  ? -0.082  -2.018  5.375   1.00 0.00 ? 52  LEU A HD21 2  
ATOM 2678  H HD22 . LEU A 1 34  ? 1.523   -1.661  4.736   1.00 0.00 ? 52  LEU A HD22 2  
ATOM 2679  H HD23 . LEU A 1 34  ? 0.366   -2.571  3.762   1.00 0.00 ? 52  LEU A HD23 2  
ATOM 2680  N N    . CYS A 1 35  ? -0.995  3.103   5.597   1.00 0.00 ? 53  CYS A N    2  
ATOM 2681  C CA   . CYS A 1 35  ? -0.811  4.524   5.330   1.00 0.00 ? 53  CYS A CA   2  
ATOM 2682  C C    . CYS A 1 35  ? -0.036  5.194   6.461   1.00 0.00 ? 53  CYS A C    2  
ATOM 2683  O O    . CYS A 1 35  ? 0.928   5.922   6.221   1.00 0.00 ? 53  CYS A O    2  
ATOM 2684  C CB   . CYS A 1 35  ? -2.168  5.210   5.151   1.00 0.00 ? 53  CYS A CB   2  
ATOM 2685  S SG   . CYS A 1 35  ? -3.232  4.435   3.894   1.00 0.00 ? 53  CYS A SG   2  
ATOM 2686  H H    . CYS A 1 35  ? -1.902  2.728   5.587   1.00 0.00 ? 53  CYS A H    2  
ATOM 2687  H HA   . CYS A 1 35  ? -0.246  4.620   4.416   1.00 0.00 ? 53  CYS A HA   2  
ATOM 2688  H HB3  . CYS A 1 35  ? -2.006  6.238   4.858   1.00 0.00 ? 53  CYS A HB3  2  
ATOM 2689  N N    . LYS A 1 36  ? -0.463  4.942   7.694   1.00 0.00 ? 54  LYS A N    2  
ATOM 2690  C CA   . LYS A 1 36  ? 0.191   5.518   8.862   1.00 0.00 ? 54  LYS A CA   2  
ATOM 2691  C C    . LYS A 1 36  ? 1.662   5.120   8.915   1.00 0.00 ? 54  LYS A C    2  
ATOM 2692  O O    . LYS A 1 36  ? 2.516   5.909   9.320   1.00 0.00 ? 54  LYS A O    2  
ATOM 2693  C CB   . LYS A 1 36  ? -0.517  5.067   10.142  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2694  C CG   . LYS A 1 36  ? -0.193  5.927   11.352  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2695  C CD   . LYS A 1 36  ? -0.690  5.288   12.638  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2696  C CE   . LYS A 1 36  ? 0.039   5.842   13.853  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2697  N NZ   . LYS A 1 36  ? -0.514  7.157   14.281  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2698  H H    . LYS A 1 36  ? -1.236  4.353   7.820   1.00 0.00 ? 54  LYS A H    2  
ATOM 2699  H HA   . LYS A 1 36  ? 0.125   6.592   8.784   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2700  H HB3  . LYS A 1 36  ? -0.224  4.050   10.361  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2701  H HG3  . LYS A 1 36  ? -0.666  6.891   11.233  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2702  H HD3  . LYS A 1 36  ? -0.527  4.220   12.587  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2703  H HE3  . LYS A 1 36  ? 1.084   5.963   13.605  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2704  H HZ1  . LYS A 1 36  ? -1.285  7.444   13.644  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2705  H HZ2  . LYS A 1 36  ? 0.230   7.883   14.255  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2706  H HZ3  . LYS A 1 36  ? -0.885  7.090   15.249  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2707  N N    . ALA A 1 37  ? 1.952   3.890   8.502   1.00 0.00 ? 55  ALA A N    2  
ATOM 2708  C CA   . ALA A 1 37  ? 3.322   3.389   8.498   1.00 0.00 ? 55  ALA A CA   2  
ATOM 2709  C C    . ALA A 1 37  ? 4.156   4.081   7.427   1.00 0.00 ? 55  ALA A C    2  
ATOM 2710  O O    . ALA A 1 37  ? 5.369   4.232   7.572   1.00 0.00 ? 55  ALA A O    2  
ATOM 2711  C CB   . ALA A 1 37  ? 3.331   1.882   8.286   1.00 0.00 ? 55  ALA A CB   2  
ATOM 2712  H H    . ALA A 1 37  ? 1.229   3.308   8.189   1.00 0.00 ? 55  ALA A H    2  
ATOM 2713  H HA   . ALA A 1 37  ? 3.755   3.594   9.466   1.00 0.00 ? 55  ALA A HA   2  
ATOM 2714  H HB1  . ALA A 1 37  ? 4.335   1.507   8.425   1.00 0.00 ? 55  ALA A HB1  2  
ATOM 2715  H HB2  . ALA A 1 37  ? 2.669   1.415   9.000   1.00 0.00 ? 55  ALA A HB2  2  
ATOM 2716  H HB3  . ALA A 1 37  ? 2.997   1.658   7.284   1.00 0.00 ? 55  ALA A HB3  2  
ATOM 2717  N N    . PHE A 1 38  ? 3.501   4.499   6.349   1.00 0.00 ? 56  PHE A N    2  
ATOM 2718  C CA   . PHE A 1 38  ? 4.183   5.173   5.251   1.00 0.00 ? 56  PHE A CA   2  
ATOM 2719  C C    . PHE A 1 38  ? 4.101   6.688   5.407   1.00 0.00 ? 56  PHE A C    2  
ATOM 2720  O O    . PHE A 1 38  ? 4.079   7.425   4.422   1.00 0.00 ? 56  PHE A O    2  
ATOM 2721  C CB   . PHE A 1 38  ? 3.578   4.753   3.910   1.00 0.00 ? 56  PHE A CB   2  
ATOM 2722  C CG   . PHE A 1 38  ? 4.459   5.057   2.732   1.00 0.00 ? 56  PHE A CG   2  
ATOM 2723  C CD1  . PHE A 1 38  ? 5.803   4.720   2.751   1.00 0.00 ? 56  PHE A CD1  2  
ATOM 2724  C CD2  . PHE A 1 38  ? 3.943   5.679   1.607   1.00 0.00 ? 56  PHE A CD2  2  
ATOM 2725  C CE1  . PHE A 1 38  ? 6.617   4.999   1.669   1.00 0.00 ? 56  PHE A CE1  2  
ATOM 2726  C CE2  . PHE A 1 38  ? 4.752   5.960   0.521   1.00 0.00 ? 56  PHE A CE2  2  
ATOM 2727  C CZ   . PHE A 1 38  ? 6.090   5.620   0.553   1.00 0.00 ? 56  PHE A CZ   2  
ATOM 2728  H H    . PHE A 1 38  ? 2.533   4.348   6.290   1.00 0.00 ? 56  PHE A H    2  
ATOM 2729  H HA   . PHE A 1 38  ? 5.222   4.877   5.275   1.00 0.00 ? 56  PHE A HA   2  
ATOM 2730  H HB3  . PHE A 1 38  ? 2.641   5.271   3.769   1.00 0.00 ? 56  PHE A HB3  2  
ATOM 2731  H HD1  . PHE A 1 38  ? 6.215   4.235   3.623   1.00 0.00 ? 56  PHE A HD1  2  
ATOM 2732  H HD2  . PHE A 1 38  ? 2.897   5.946   1.582   1.00 0.00 ? 56  PHE A HD2  2  
ATOM 2733  H HE1  . PHE A 1 38  ? 7.663   4.732   1.696   1.00 0.00 ? 56  PHE A HE1  2  
ATOM 2734  H HE2  . PHE A 1 38  ? 4.338   6.446   -0.349  1.00 0.00 ? 56  PHE A HE2  2  
ATOM 2735  H HZ   . PHE A 1 38  ? 6.724   5.839   -0.294  1.00 0.00 ? 56  PHE A HZ   2  
ATOM 2736  N N    . ASN A 1 39  ? 4.049   7.147   6.654   1.00 0.00 ? 57  ASN A N    2  
ATOM 2737  C CA   . ASN A 1 39  ? 3.967   8.574   6.941   1.00 0.00 ? 57  ASN A CA   2  
ATOM 2738  C C    . ASN A 1 39  ? 2.831   9.221   6.153   1.00 0.00 ? 57  ASN A C    2  
ATOM 2739  O O    . ASN A 1 39  ? 3.012   10.267  5.529   1.00 0.00 ? 57  ASN A O    2  
ATOM 2740  C CB   . ASN A 1 39  ? 5.291   9.261   6.604   1.00 0.00 ? 57  ASN A CB   2  
ATOM 2741  C CG   . ASN A 1 39  ? 5.318   10.712  7.042   1.00 0.00 ? 57  ASN A CG   2  
ATOM 2742  O OD1  . ASN A 1 39  ? 5.317   11.012  8.238   1.00 0.00 ? 57  ASN A OD1  2  
ATOM 2743  N ND2  . ASN A 1 39  ? 5.341   11.623  6.075   1.00 0.00 ? 57  ASN A ND2  2  
ATOM 2744  H H    . ASN A 1 39  ? 4.069   6.509   7.398   1.00 0.00 ? 57  ASN A H    2  
ATOM 2745  H HA   . ASN A 1 39  ? 3.769   8.689   7.996   1.00 0.00 ? 57  ASN A HA   2  
ATOM 2746  H HB3  . ASN A 1 39  ? 5.450   9.223   5.538   1.00 0.00 ? 57  ASN A HB3  2  
ATOM 2747  H HD21 . ASN A 1 39  ? 5.339   11.310  5.147   1.00 0.00 ? 57  ASN A HD21 2  
ATOM 2748  H HD22 . ASN A 1 39  ? 5.358   12.568  6.331   1.00 0.00 ? 57  ASN A HD22 2  
ATOM 2749  N N    . SER A 1 40  ? 1.660   8.594   6.188   1.00 0.00 ? 58  SER A N    2  
ATOM 2750  C CA   . SER A 1 40  ? 0.496   9.105   5.476   1.00 0.00 ? 58  SER A CA   2  
ATOM 2751  C C    . SER A 1 40  ? -0.796  8.616   6.123   1.00 0.00 ? 58  SER A C    2  
ATOM 2752  O O    . SER A 1 40  ? -0.772  7.822   7.064   1.00 0.00 ? 58  SER A O    2  
ATOM 2753  C CB   . SER A 1 40  ? 0.539   8.676   4.008   1.00 0.00 ? 58  SER A CB   2  
ATOM 2754  O OG   . SER A 1 40  ? 1.804   8.956   3.432   1.00 0.00 ? 58  SER A OG   2  
ATOM 2755  H H    . SER A 1 40  ? 1.579   7.763   6.705   1.00 0.00 ? 58  SER A H    2  
ATOM 2756  H HA   . SER A 1 40  ? 0.523   10.184  5.528   1.00 0.00 ? 58  SER A HA   2  
ATOM 2757  H HB3  . SER A 1 40  ? -0.221  9.211   3.458   1.00 0.00 ? 58  SER A HB3  2  
ATOM 2758  H HG   . SER A 1 40  ? 2.171   8.152   3.059   1.00 0.00 ? 58  SER A HG   2  
ATOM 2759  N N    . THR A 1 41  ? -1.926  9.095   5.611   1.00 0.00 ? 59  THR A N    2  
ATOM 2760  C CA   . THR A 1 41  ? -3.228  8.708   6.138   1.00 0.00 ? 59  THR A CA   2  
ATOM 2761  C C    . THR A 1 41  ? -4.199  8.373   5.012   1.00 0.00 ? 59  THR A C    2  
ATOM 2762  O O    . THR A 1 41  ? -4.067  8.872   3.894   1.00 0.00 ? 59  THR A O    2  
ATOM 2763  C CB   . THR A 1 41  ? -3.836  9.822   7.010   1.00 0.00 ? 59  THR A CB   2  
ATOM 2764  O OG1  . THR A 1 41  ? -3.713  11.085  6.346   1.00 0.00 ? 59  THR A OG1  2  
ATOM 2765  C CG2  . THR A 1 41  ? -3.146  9.887   8.365   1.00 0.00 ? 59  THR A CG2  2  
ATOM 2766  H H    . THR A 1 41  ? -1.880  9.724   4.861   1.00 0.00 ? 59  THR A H    2  
ATOM 2767  H HA   . THR A 1 41  ? -3.091  7.831   6.755   1.00 0.00 ? 59  THR A HA   2  
ATOM 2768  H HB   . THR A 1 41  ? -4.884  9.607   7.166   1.00 0.00 ? 59  THR A HB   2  
ATOM 2769  H HG1  . THR A 1 41  ? -2.785  11.325  6.285   1.00 0.00 ? 59  THR A HG1  2  
ATOM 2770  H HG21 . THR A 1 41  ? -2.507  9.025   8.484   1.00 0.00 ? 59  THR A HG21 2  
ATOM 2771  H HG22 . THR A 1 41  ? -3.890  9.897   9.147   1.00 0.00 ? 59  THR A HG22 2  
ATOM 2772  H HG23 . THR A 1 41  ? -2.551  10.787  8.424   1.00 0.00 ? 59  THR A HG23 2  
ATOM 2773  N N    . LEU A 1 42  ? -5.177  7.524   5.313   1.00 0.00 ? 60  LEU A N    2  
ATOM 2774  C CA   . LEU A 1 42  ? -6.172  7.122   4.326   1.00 0.00 ? 60  LEU A CA   2  
ATOM 2775  C C    . LEU A 1 42  ? -6.779  8.340   3.637   1.00 0.00 ? 60  LEU A C    2  
ATOM 2776  O O    . LEU A 1 42  ? -6.838  9.435   4.196   1.00 0.00 ? 60  LEU A O    2  
ATOM 2777  C CB   . LEU A 1 42  ? -7.274  6.295   4.991   1.00 0.00 ? 60  LEU A CB   2  
ATOM 2778  C CG   . LEU A 1 42  ? -6.828  4.991   5.652   1.00 0.00 ? 60  LEU A CG   2  
ATOM 2779  C CD1  . LEU A 1 42  ? -7.775  4.615   6.781   1.00 0.00 ? 60  LEU A CD1  2  
ATOM 2780  C CD2  . LEU A 1 42  ? -6.750  3.871   4.625   1.00 0.00 ? 60  LEU A CD2  2  
ATOM 2781  H H    . LEU A 1 42  ? -5.231  7.159   6.221   1.00 0.00 ? 60  LEU A H    2  
ATOM 2782  H HA   . LEU A 1 42  ? -5.675  6.514   3.584   1.00 0.00 ? 60  LEU A HA   2  
ATOM 2783  H HB3  . LEU A 1 42  ? -8.004  6.050   4.233   1.00 0.00 ? 60  LEU A HB3  2  
ATOM 2784  H HG   . LEU A 1 42  ? -5.842  5.128   6.076   1.00 0.00 ? 60  LEU A HG   2  
ATOM 2785  H HD11 . LEU A 1 42  ? -8.759  5.003   6.571   1.00 0.00 ? 60  LEU A HD11 2  
ATOM 2786  H HD12 . LEU A 1 42  ? -7.413  5.033   7.709   1.00 0.00 ? 60  LEU A HD12 2  
ATOM 2787  H HD13 . LEU A 1 42  ? -7.822  3.538   6.867   1.00 0.00 ? 60  LEU A HD13 2  
ATOM 2788  H HD21 . LEU A 1 42  ? -6.232  4.226   3.745   1.00 0.00 ? 60  LEU A HD21 2  
ATOM 2789  H HD22 . LEU A 1 42  ? -7.748  3.561   4.354   1.00 0.00 ? 60  LEU A HD22 2  
ATOM 2790  H HD23 . LEU A 1 42  ? -6.212  3.034   5.045   1.00 0.00 ? 60  LEU A HD23 2  
ATOM 2791  N N    . PRO A 1 43  ? -7.244  8.148   2.394   1.00 0.00 ? 61  PRO A N    2  
ATOM 2792  C CA   . PRO A 1 43  ? -7.858  9.218   1.603   1.00 0.00 ? 61  PRO A CA   2  
ATOM 2793  C C    . PRO A 1 43  ? -9.217  9.637   2.152   1.00 0.00 ? 61  PRO A C    2  
ATOM 2794  O O    . PRO A 1 43  ? -9.620  9.210   3.234   1.00 0.00 ? 61  PRO A O    2  
ATOM 2795  C CB   . PRO A 1 43  ? -8.013  8.590   0.216   1.00 0.00 ? 61  PRO A CB   2  
ATOM 2796  C CG   . PRO A 1 43  ? -8.081  7.123   0.468   1.00 0.00 ? 61  PRO A CG   2  
ATOM 2797  C CD   . PRO A 1 43  ? -7.207  6.868   1.665   1.00 0.00 ? 61  PRO A CD   2  
ATOM 2798  H HA   . PRO A 1 43  ? -7.214  10.083  1.539   1.00 0.00 ? 61  PRO A HA   2  
ATOM 2799  H HB3  . PRO A 1 43  ? -7.159  8.845   -0.395  1.00 0.00 ? 61  PRO A HB3  2  
ATOM 2800  H HG3  . PRO A 1 43  ? -7.707  6.586   -0.390  1.00 0.00 ? 61  PRO A HG3  2  
ATOM 2801  H HD3  . PRO A 1 43  ? -6.200  6.632   1.353   1.00 0.00 ? 61  PRO A HD3  2  
ATOM 2802  N N    . THR A 1 44  ? -9.921  10.475  1.399   1.00 0.00 ? 62  THR A N    2  
ATOM 2803  C CA   . THR A 1 44  ? -11.235 10.954  1.810   1.00 0.00 ? 62  THR A CA   2  
ATOM 2804  C C    . THR A 1 44  ? -12.277 10.698  0.727   1.00 0.00 ? 62  THR A C    2  
ATOM 2805  O O    . THR A 1 44  ? -12.006 10.012  -0.258  1.00 0.00 ? 62  THR A O    2  
ATOM 2806  C CB   . THR A 1 44  ? -11.209 12.460  2.136   1.00 0.00 ? 62  THR A CB   2  
ATOM 2807  O OG1  . THR A 1 44  ? -11.129 13.221  0.925   1.00 0.00 ? 62  THR A OG1  2  
ATOM 2808  C CG2  . THR A 1 44  ? -10.029 12.799  3.033   1.00 0.00 ? 62  THR A CG2  2  
ATOM 2809  H H    . THR A 1 44  ? -9.546  10.781  0.546   1.00 0.00 ? 62  THR A H    2  
ATOM 2810  H HA   . THR A 1 44  ? -11.520 10.418  2.705   1.00 0.00 ? 62  THR A HA   2  
ATOM 2811  H HB   . THR A 1 44  ? -12.121 12.716  2.654   1.00 0.00 ? 62  THR A HB   2  
ATOM 2812  H HG1  . THR A 1 44  ? -11.161 14.158  1.134   1.00 0.00 ? 62  THR A HG1  2  
ATOM 2813  H HG21 . THR A 1 44  ? -9.964  12.075  3.833   1.00 0.00 ? 62  THR A HG21 2  
ATOM 2814  H HG22 . THR A 1 44  ? -10.165 13.785  3.451   1.00 0.00 ? 62  THR A HG22 2  
ATOM 2815  H HG23 . THR A 1 44  ? -9.118  12.776  2.454   1.00 0.00 ? 62  THR A HG23 2  
ATOM 2816  N N    . MET A 1 45  ? -13.470 11.254  0.918   1.00 0.00 ? 63  MET A N    2  
ATOM 2817  C CA   . MET A 1 45  ? -14.553 11.086  -0.046  1.00 0.00 ? 63  MET A CA   2  
ATOM 2818  C C    . MET A 1 45  ? -14.373 12.025  -1.234  1.00 0.00 ? 63  MET A C    2  
ATOM 2819  O O    . MET A 1 45  ? -14.807 11.723  -2.346  1.00 0.00 ? 63  MET A O    2  
ATOM 2820  C CB   . MET A 1 45  ? -15.903 11.345  0.623   1.00 0.00 ? 63  MET A CB   2  
ATOM 2821  C CG   . MET A 1 45  ? -15.980 12.685  1.338   1.00 0.00 ? 63  MET A CG   2  
ATOM 2822  S SD   . MET A 1 45  ? -17.644 13.065  1.921   1.00 0.00 ? 63  MET A SD   2  
ATOM 2823  C CE   . MET A 1 45  ? -17.934 11.695  3.036   1.00 0.00 ? 63  MET A CE   2  
ATOM 2824  H H    . MET A 1 45  ? -13.626 11.790  1.723   1.00 0.00 ? 63  MET A H    2  
ATOM 2825  H HA   . MET A 1 45  ? -14.524 10.067  -0.399  1.00 0.00 ? 63  MET A HA   2  
ATOM 2826  H HB3  . MET A 1 45  ? -16.089 10.565  1.347   1.00 0.00 ? 63  MET A HB3  2  
ATOM 2827  H HG3  . MET A 1 45  ? -15.667 13.460  0.653   1.00 0.00 ? 63  MET A HG3  2  
ATOM 2828  H HE1  . MET A 1 45  ? -18.129 12.073  4.029   1.00 0.00 ? 63  MET A HE1  2  
ATOM 2829  H HE2  . MET A 1 45  ? -18.785 11.126  2.694   1.00 0.00 ? 63  MET A HE2  2  
ATOM 2830  H HE3  . MET A 1 45  ? -17.061 11.059  3.059   1.00 0.00 ? 63  MET A HE3  2  
ATOM 2831  N N    . ALA A 1 46  ? -13.729 13.163  -0.993  1.00 0.00 ? 64  ALA A N    2  
ATOM 2832  C CA   . ALA A 1 46  ? -13.492 14.143  -2.044  1.00 0.00 ? 64  ALA A CA   2  
ATOM 2833  C C    . ALA A 1 46  ? -12.166 13.879  -2.752  1.00 0.00 ? 64  ALA A C    2  
ATOM 2834  O O    . ALA A 1 46  ? -12.088 13.926  -3.979  1.00 0.00 ? 64  ALA A O    2  
ATOM 2835  C CB   . ALA A 1 46  ? -13.512 15.551  -1.468  1.00 0.00 ? 64  ALA A CB   2  
ATOM 2836  H H    . ALA A 1 46  ? -13.407 13.345  -0.086  1.00 0.00 ? 64  ALA A H    2  
ATOM 2837  H HA   . ALA A 1 46  ? -14.294 14.064  -2.763  1.00 0.00 ? 64  ALA A HA   2  
ATOM 2838  H HB1  . ALA A 1 46  ? -12.945 15.570  -0.547  1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2839  H HB2  . ALA A 1 46  ? -13.072 16.237  -2.176  1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2840  H HB3  . ALA A 1 46  ? -14.533 15.843  -1.269  1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2841  N N    . GLN A 1 47  ? -11.128 13.602  -1.970  1.00 0.00 ? 65  GLN A N    2  
ATOM 2842  C CA   . GLN A 1 47  ? -9.806  13.332  -2.523  1.00 0.00 ? 65  GLN A CA   2  
ATOM 2843  C C    . GLN A 1 47  ? -9.879  12.267  -3.612  1.00 0.00 ? 65  GLN A C    2  
ATOM 2844  O O    . GLN A 1 47  ? -9.166  12.340  -4.612  1.00 0.00 ? 65  GLN A O    2  
ATOM 2845  C CB   . GLN A 1 47  ? -8.849  12.884  -1.416  1.00 0.00 ? 65  GLN A CB   2  
ATOM 2846  C CG   . GLN A 1 47  ? -8.147  14.034  -0.715  1.00 0.00 ? 65  GLN A CG   2  
ATOM 2847  C CD   . GLN A 1 47  ? -9.032  15.257  -0.569  1.00 0.00 ? 65  GLN A CD   2  
ATOM 2848  O OE1  . GLN A 1 47  ? -9.792  15.376  0.393   1.00 0.00 ? 65  GLN A OE1  2  
ATOM 2849  N NE2  . GLN A 1 47  ? -8.939  16.172  -1.527  1.00 0.00 ? 65  GLN A NE2  2  
ATOM 2850  H H    . GLN A 1 47  ? -11.253 13.580  -0.999  1.00 0.00 ? 65  GLN A H    2  
ATOM 2851  H HA   . GLN A 1 47  ? -9.435  14.248  -2.956  1.00 0.00 ? 65  GLN A HA   2  
ATOM 2852  H HB3  . GLN A 1 47  ? -8.097  12.239  -1.848  1.00 0.00 ? 65  GLN A HB3  2  
ATOM 2853  H HG3  . GLN A 1 47  ? -7.272  14.307  -1.287  1.00 0.00 ? 65  GLN A HG3  2  
ATOM 2854  H HE21 . GLN A 1 47  ? -8.313  16.010  -2.264  1.00 0.00 ? 65  GLN A HE21 2  
ATOM 2855  H HE22 . GLN A 1 47  ? -9.500  16.972  -1.458  1.00 0.00 ? 65  GLN A HE22 2  
ATOM 2856  N N    . MET A 1 48  ? -10.744 11.279  -3.409  1.00 0.00 ? 66  MET A N    2  
ATOM 2857  C CA   . MET A 1 48  ? -10.911 10.199  -4.375  1.00 0.00 ? 66  MET A CA   2  
ATOM 2858  C C    . MET A 1 48  ? -11.447 10.732  -5.700  1.00 0.00 ? 66  MET A C    2  
ATOM 2859  O O    . MET A 1 48  ? -10.783 10.635  -6.731  1.00 0.00 ? 66  MET A O    2  
ATOM 2860  C CB   . MET A 1 48  ? -11.855 9.130   -3.820  1.00 0.00 ? 66  MET A CB   2  
ATOM 2861  C CG   . MET A 1 48  ? -11.239 8.291   -2.713  1.00 0.00 ? 66  MET A CG   2  
ATOM 2862  S SD   . MET A 1 48  ? -9.885  7.254   -3.299  1.00 0.00 ? 66  MET A SD   2  
ATOM 2863  C CE   . MET A 1 48  ? -10.777 6.066   -4.301  1.00 0.00 ? 66  MET A CE   2  
ATOM 2864  H H    . MET A 1 48  ? -11.284 11.275  -2.592  1.00 0.00 ? 66  MET A H    2  
ATOM 2865  H HA   . MET A 1 48  ? -9.941  9.755   -4.546  1.00 0.00 ? 66  MET A HA   2  
ATOM 2866  H HB3  . MET A 1 48  ? -12.145 8.472   -4.624  1.00 0.00 ? 66  MET A HB3  2  
ATOM 2867  H HG3  . MET A 1 48  ? -12.007 7.656   -2.294  1.00 0.00 ? 66  MET A HG3  2  
ATOM 2868  H HE1  . MET A 1 48  ? -10.088 5.566   -4.965  1.00 0.00 ? 66  MET A HE1  2  
ATOM 2869  H HE2  . MET A 1 48  ? -11.251 5.339   -3.659  1.00 0.00 ? 66  MET A HE2  2  
ATOM 2870  H HE3  . MET A 1 48  ? -11.530 6.579   -4.881  1.00 0.00 ? 66  MET A HE3  2  
ATOM 2871  N N    . GLU A 1 49  ? -12.651 11.293  -5.662  1.00 0.00 ? 67  GLU A N    2  
ATOM 2872  C CA   . GLU A 1 49  ? -13.276 11.839  -6.861  1.00 0.00 ? 67  GLU A CA   2  
ATOM 2873  C C    . GLU A 1 49  ? -12.369 12.871  -7.524  1.00 0.00 ? 67  GLU A C    2  
ATOM 2874  O O    . GLU A 1 49  ? -12.451 13.101  -8.732  1.00 0.00 ? 67  GLU A O    2  
ATOM 2875  C CB   . GLU A 1 49  ? -14.623 12.477  -6.514  1.00 0.00 ? 67  GLU A CB   2  
ATOM 2876  C CG   . GLU A 1 49  ? -15.520 11.586  -5.670  1.00 0.00 ? 67  GLU A CG   2  
ATOM 2877  C CD   . GLU A 1 49  ? -16.989 11.752  -6.004  1.00 0.00 ? 67  GLU A CD   2  
ATOM 2878  O OE1  . GLU A 1 49  ? -17.311 11.907  -7.202  1.00 0.00 ? 67  GLU A OE1  2  
ATOM 2879  O OE2  . GLU A 1 49  ? -17.817 11.727  -5.070  1.00 0.00 ? 67  GLU A OE2  2  
ATOM 2880  H H    . GLU A 1 49  ? -13.131 11.340  -4.809  1.00 0.00 ? 67  GLU A H    2  
ATOM 2881  H HA   . GLU A 1 49  ? -13.440 11.025  -7.550  1.00 0.00 ? 67  GLU A HA   2  
ATOM 2882  H HB3  . GLU A 1 49  ? -15.145 12.707  -7.432  1.00 0.00 ? 67  GLU A HB3  2  
ATOM 2883  H HG3  . GLU A 1 49  ? -15.373 11.832  -4.629  1.00 0.00 ? 67  GLU A HG3  2  
ATOM 2884  N N    . LYS A 1 50  ? -11.504 13.488  -6.729  1.00 0.00 ? 68  LYS A N    2  
ATOM 2885  C CA   . LYS A 1 50  ? -10.579 14.495  -7.237  1.00 0.00 ? 68  LYS A CA   2  
ATOM 2886  C C    . LYS A 1 50  ? -9.455  13.847  -8.037  1.00 0.00 ? 68  LYS A C    2  
ATOM 2887  O O    . LYS A 1 50  ? -9.117  14.300  -9.131  1.00 0.00 ? 68  LYS A O    2  
ATOM 2888  C CB   . LYS A 1 50  ? -9.994  15.310  -6.082  1.00 0.00 ? 68  LYS A CB   2  
ATOM 2889  C CG   . LYS A 1 50  ? -9.492  16.682  -6.497  1.00 0.00 ? 68  LYS A CG   2  
ATOM 2890  C CD   . LYS A 1 50  ? -9.268  17.582  -5.293  1.00 0.00 ? 68  LYS A CD   2  
ATOM 2891  C CE   . LYS A 1 50  ? -7.919  17.317  -4.643  1.00 0.00 ? 68  LYS A CE   2  
ATOM 2892  N NZ   . LYS A 1 50  ? -7.688  18.197  -3.465  1.00 0.00 ? 68  LYS A NZ   2  
ATOM 2893  H H    . LYS A 1 50  ? -11.486 13.261  -5.775  1.00 0.00 ? 68  LYS A H    2  
ATOM 2894  H HA   . LYS A 1 50  ? -11.133 15.156  -7.887  1.00 0.00 ? 68  LYS A HA   2  
ATOM 2895  H HB3  . LYS A 1 50  ? -9.166  14.762  -5.655  1.00 0.00 ? 68  LYS A HB3  2  
ATOM 2896  H HG3  . LYS A 1 50  ? -10.225 17.141  -7.147  1.00 0.00 ? 68  LYS A HG3  2  
ATOM 2897  H HD3  . LYS A 1 50  ? -10.049 17.400  -4.569  1.00 0.00 ? 68  LYS A HD3  2  
ATOM 2898  H HE3  . LYS A 1 50  ? -7.141  17.494  -5.373  1.00 0.00 ? 68  LYS A HE3  2  
ATOM 2899  H HZ1  . LYS A 1 50  ? -8.581  18.644  -3.174  1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 2900  H HZ2  . LYS A 1 50  ? -7.003  18.943  -3.705  1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 2901  H HZ3  . LYS A 1 50  ? -7.315  17.641  -2.670  1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 2902  N N    . ALA A 1 51  ? -8.879  12.783  -7.486  1.00 0.00 ? 69  ALA A N    2  
ATOM 2903  C CA   . ALA A 1 51  ? -7.795  12.070  -8.151  1.00 0.00 ? 69  ALA A CA   2  
ATOM 2904  C C    . ALA A 1 51  ? -8.291  11.368  -9.410  1.00 0.00 ? 69  ALA A C    2  
ATOM 2905  O O    . ALA A 1 51  ? -7.496  10.920  -10.237 1.00 0.00 ? 69  ALA A O    2  
ATOM 2906  C CB   . ALA A 1 51  ? -7.163  11.065  -7.198  1.00 0.00 ? 69  ALA A CB   2  
ATOM 2907  H H    . ALA A 1 51  ? -9.194  12.469  -6.613  1.00 0.00 ? 69  ALA A H    2  
ATOM 2908  H HA   . ALA A 1 51  ? -7.041  12.792  -8.425  1.00 0.00 ? 69  ALA A HA   2  
ATOM 2909  H HB1  . ALA A 1 51  ? -6.977  11.540  -6.246  1.00 0.00 ? 69  ALA A HB1  2  
ATOM 2910  H HB2  . ALA A 1 51  ? -7.834  10.231  -7.059  1.00 0.00 ? 69  ALA A HB2  2  
ATOM 2911  H HB3  . ALA A 1 51  ? -6.231  10.713  -7.614  1.00 0.00 ? 69  ALA A HB3  2  
ATOM 2912  N N    . LEU A 1 52  ? -9.609  11.276  -9.552  1.00 0.00 ? 70  LEU A N    2  
ATOM 2913  C CA   . LEU A 1 52  ? -10.211 10.629  -10.711 1.00 0.00 ? 70  LEU A CA   2  
ATOM 2914  C C    . LEU A 1 52  ? -9.635  11.188  -12.008 1.00 0.00 ? 70  LEU A C    2  
ATOM 2915  O O    . LEU A 1 52  ? -9.201  10.437  -12.882 1.00 0.00 ? 70  LEU A O    2  
ATOM 2916  C CB   . LEU A 1 52  ? -11.729 10.813  -10.693 1.00 0.00 ? 70  LEU A CB   2  
ATOM 2917  C CG   . LEU A 1 52  ? -12.483 10.301  -11.921 1.00 0.00 ? 70  LEU A CG   2  
ATOM 2918  C CD1  . LEU A 1 52  ? -12.771 8.813   -11.788 1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2919  C CD2  . LEU A 1 52  ? -13.774 11.081  -12.119 1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2920  H H    . LEU A 1 52  ? -10.192 11.652  -8.861  1.00 0.00 ? 70  LEU A H    2  
ATOM 2921  H HA   . LEU A 1 52  ? -9.984  9.574   -10.656 1.00 0.00 ? 70  LEU A HA   2  
ATOM 2922  H HB3  . LEU A 1 52  ? -11.931 11.871  -10.597 1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2923  H HG   . LEU A 1 52  ? -11.867 10.444  -12.799 1.00 0.00 ? 70  LEU A HG   2  
ATOM 2924  H HD11 . LEU A 1 52  ? -13.301 8.630   -10.865 1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2925  H HD12 . LEU A 1 52  ? -11.840 8.265   -11.783 1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2926  H HD13 . LEU A 1 52  ? -13.376 8.489   -12.622 1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2927  H HD21 . LEU A 1 52  ? -14.614 10.403  -12.073 1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2928  H HD22 . LEU A 1 52  ? -13.756 11.569  -13.081 1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2929  H HD23 . LEU A 1 52  ? -13.869 11.823  -11.339 1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2930  N N    . SER A 1 53  ? -9.630  12.512  -12.125 1.00 0.00 ? 71  SER A N    2  
ATOM 2931  C CA   . SER A 1 53  ? -9.108  13.174  -13.315 1.00 0.00 ? 71  SER A CA   2  
ATOM 2932  C C    . SER A 1 53  ? -7.583  13.176  -13.309 1.00 0.00 ? 71  SER A C    2  
ATOM 2933  O O    . SER A 1 53  ? -6.948  13.501  -14.313 1.00 0.00 ? 71  SER A O    2  
ATOM 2934  C CB   . SER A 1 53  ? -9.632  14.607  -13.399 1.00 0.00 ? 71  SER A CB   2  
ATOM 2935  O OG   . SER A 1 53  ? -9.443  15.144  -14.696 1.00 0.00 ? 71  SER A OG   2  
ATOM 2936  H H    . SER A 1 53  ? -9.989  13.056  -11.394 1.00 0.00 ? 71  SER A H    2  
ATOM 2937  H HA   . SER A 1 53  ? -9.452  12.621  -14.178 1.00 0.00 ? 71  SER A HA   2  
ATOM 2938  H HB3  . SER A 1 53  ? -9.103  15.224  -12.686 1.00 0.00 ? 71  SER A HB3  2  
ATOM 2939  H HG   . SER A 1 53  ? -10.227 14.984  -15.227 1.00 0.00 ? 71  SER A HG   2  
ATOM 2940  N N    . ILE A 1 54  ? -7.000  12.811  -12.172 1.00 0.00 ? 72  ILE A N    2  
ATOM 2941  C CA   . ILE A 1 54  ? -5.550  12.771  -12.036 1.00 0.00 ? 72  ILE A CA   2  
ATOM 2942  C C    . ILE A 1 54  ? -4.987  11.447  -12.539 1.00 0.00 ? 72  ILE A C    2  
ATOM 2943  O O    . ILE A 1 54  ? -3.826  11.365  -12.938 1.00 0.00 ? 72  ILE A O    2  
ATOM 2944  C CB   . ILE A 1 54  ? -5.116  12.979  -10.573 1.00 0.00 ? 72  ILE A CB   2  
ATOM 2945  C CG1  . ILE A 1 54  ? -5.615  14.330  -10.056 1.00 0.00 ? 72  ILE A CG1  2  
ATOM 2946  C CG2  . ILE A 1 54  ? -3.603  12.883  -10.450 1.00 0.00 ? 72  ILE A CG2  2  
ATOM 2947  C CD1  . ILE A 1 54  ? -5.210  14.617  -8.627  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 2948  H H    . ILE A 1 54  ? -7.559  12.563  -11.407 1.00 0.00 ? 72  ILE A H    2  
ATOM 2949  H HA   . ILE A 1 54  ? -5.137  13.574  -12.629 1.00 0.00 ? 72  ILE A HA   2  
ATOM 2950  H HB   . ILE A 1 54  ? -5.551  12.191  -9.977  1.00 0.00 ? 72  ILE A HB   2  
ATOM 2951  H HG13 . ILE A 1 54  ? -6.693  14.351  -10.108 1.00 0.00 ? 72  ILE A HG13 2  
ATOM 2952  H HG21 . ILE A 1 54  ? -3.144  13.643  -11.067 1.00 0.00 ? 72  ILE A HG21 2  
ATOM 2953  H HG22 . ILE A 1 54  ? -3.315  13.036  -9.421  1.00 0.00 ? 72  ILE A HG22 2  
ATOM 2954  H HG23 . ILE A 1 54  ? -3.275  11.908  -10.776 1.00 0.00 ? 72  ILE A HG23 2  
ATOM 2955  H HD11 . ILE A 1 54  ? -5.069  13.686  -8.099  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 2956  H HD12 . ILE A 1 54  ? -4.290  15.181  -8.619  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 2957  H HD13 . ILE A 1 54  ? -5.988  15.191  -8.141  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 2958  N N    . GLY A 1 55  ? -5.819  10.410  -12.516 1.00 0.00 ? 73  GLY A N    2  
ATOM 2959  C CA   . GLY A 1 55  ? -5.387  9.102   -12.975 1.00 0.00 ? 73  GLY A CA   2  
ATOM 2960  C C    . GLY A 1 55  ? -5.530  8.036   -11.905 1.00 0.00 ? 73  GLY A C    2  
ATOM 2961  O O    . GLY A 1 55  ? -4.786  7.056   -11.894 1.00 0.00 ? 73  GLY A O    2  
ATOM 2962  H H    . GLY A 1 55  ? -6.733  10.534  -12.187 1.00 0.00 ? 73  GLY A H    2  
ATOM 2963  H HA2  . GLY A 1 55  ? -5.979  8.819   -13.831 1.00 0.00 ? 73  GLY A HA2  2  
ATOM 2964  H HA3  . GLY A 1 55  ? -4.350  9.162   -13.271 1.00 0.00 ? 73  GLY A HA3  2  
ATOM 2965  N N    . PHE A 1 56  ? -6.487  8.231   -11.004 1.00 0.00 ? 74  PHE A N    2  
ATOM 2966  C CA   . PHE A 1 56  ? -6.723  7.281   -9.923  1.00 0.00 ? 74  PHE A CA   2  
ATOM 2967  C C    . PHE A 1 56  ? -7.871  6.337   -10.270 1.00 0.00 ? 74  PHE A C    2  
ATOM 2968  O O    . PHE A 1 56  ? -8.583  5.860   -9.388  1.00 0.00 ? 74  PHE A O    2  
ATOM 2969  C CB   . PHE A 1 56  ? -7.032  8.022   -8.622  1.00 0.00 ? 74  PHE A CB   2  
ATOM 2970  C CG   . PHE A 1 56  ? -6.538  7.311   -7.395  1.00 0.00 ? 74  PHE A CG   2  
ATOM 2971  C CD1  . PHE A 1 56  ? -5.195  7.003   -7.251  1.00 0.00 ? 74  PHE A CD1  2  
ATOM 2972  C CD2  . PHE A 1 56  ? -7.415  6.952   -6.385  1.00 0.00 ? 74  PHE A CD2  2  
ATOM 2973  C CE1  . PHE A 1 56  ? -4.737  6.348   -6.123  1.00 0.00 ? 74  PHE A CE1  2  
ATOM 2974  C CE2  . PHE A 1 56  ? -6.964  6.298   -5.254  1.00 0.00 ? 74  PHE A CE2  2  
ATOM 2975  C CZ   . PHE A 1 56  ? -5.622  5.996   -5.123  1.00 0.00 ? 74  PHE A CZ   2  
ATOM 2976  H H    . PHE A 1 56  ? -7.048  9.033   -11.065 1.00 0.00 ? 74  PHE A H    2  
ATOM 2977  H HA   . PHE A 1 56  ? -5.824  6.700   -9.791  1.00 0.00 ? 74  PHE A HA   2  
ATOM 2978  H HB3  . PHE A 1 56  ? -8.102  8.141   -8.529  1.00 0.00 ? 74  PHE A HB3  2  
ATOM 2979  H HD1  . PHE A 1 56  ? -4.501  7.277   -8.031  1.00 0.00 ? 74  PHE A HD1  2  
ATOM 2980  H HD2  . PHE A 1 56  ? -8.465  7.188   -6.486  1.00 0.00 ? 74  PHE A HD2  2  
ATOM 2981  H HE1  . PHE A 1 56  ? -3.688  6.114   -6.022  1.00 0.00 ? 74  PHE A HE1  2  
ATOM 2982  H HE2  . PHE A 1 56  ? -7.659  6.024   -4.474  1.00 0.00 ? 74  PHE A HE2  2  
ATOM 2983  H HZ   . PHE A 1 56  ? -5.268  5.485   -4.241  1.00 0.00 ? 74  PHE A HZ   2  
ATOM 2984  N N    . GLU A 1 57  ? -8.044  6.075   -11.562 1.00 0.00 ? 75  GLU A N    2  
ATOM 2985  C CA   . GLU A 1 57  ? -9.107  5.190   -12.025 1.00 0.00 ? 75  GLU A CA   2  
ATOM 2986  C C    . GLU A 1 57  ? -8.709  3.727   -11.854 1.00 0.00 ? 75  GLU A C    2  
ATOM 2987  O O    . GLU A 1 57  ? -7.546  3.362   -12.027 1.00 0.00 ? 75  GLU A O    2  
ATOM 2988  C CB   . GLU A 1 57  ? -9.433  5.473   -13.493 1.00 0.00 ? 75  GLU A CB   2  
ATOM 2989  C CG   . GLU A 1 57  ? -8.478  4.804   -14.469 1.00 0.00 ? 75  GLU A CG   2  
ATOM 2990  C CD   . GLU A 1 57  ? -7.037  5.224   -14.254 1.00 0.00 ? 75  GLU A CD   2  
ATOM 2991  O OE1  . GLU A 1 57  ? -6.787  6.439   -14.113 1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2992  O OE2  . GLU A 1 57  ? -6.158  4.336   -14.228 1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2993  H H    . GLU A 1 57  ? -7.444  6.487   -12.218 1.00 0.00 ? 75  GLU A H    2  
ATOM 2994  H HA   . GLU A 1 57  ? -9.984  5.385   -11.428 1.00 0.00 ? 75  GLU A HA   2  
ATOM 2995  H HB3  . GLU A 1 57  ? -9.393  6.540   -13.659 1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2996  H HG3  . GLU A 1 57  ? -8.768  5.068   -15.474 1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2997  N N    . THR A 1 58  ? -9.685  2.891   -11.512 1.00 0.00 ? 76  THR A N    2  
ATOM 2998  C CA   . THR A 1 58  ? -9.440  1.468   -11.315 1.00 0.00 ? 76  THR A CA   2  
ATOM 2999  C C    . THR A 1 58  ? -10.731 0.726   -10.989 1.00 0.00 ? 76  THR A C    2  
ATOM 3000  O O    . THR A 1 58  ? -11.656 1.296   -10.409 1.00 0.00 ? 76  THR A O    2  
ATOM 3001  C CB   . THR A 1 58  ? -8.422  1.225   -10.185 1.00 0.00 ? 76  THR A CB   2  
ATOM 3002  O OG1  . THR A 1 58  ? -8.386  -0.166  -9.849  1.00 0.00 ? 76  THR A OG1  2  
ATOM 3003  C CG2  . THR A 1 58  ? -8.778  2.041   -8.952  1.00 0.00 ? 76  THR A CG2  2  
ATOM 3004  H H    . THR A 1 58  ? -10.593 3.242   -11.389 1.00 0.00 ? 76  THR A H    2  
ATOM 3005  H HA   . THR A 1 58  ? -9.030  1.071   -12.232 1.00 0.00 ? 76  THR A HA   2  
ATOM 3006  H HB   . THR A 1 58  ? -7.444  1.531   -10.530 1.00 0.00 ? 76  THR A HB   2  
ATOM 3007  H HG1  . THR A 1 58  ? -8.385  -0.690  -10.654 1.00 0.00 ? 76  THR A HG1  2  
ATOM 3008  H HG21 . THR A 1 58  ? -8.005  1.922   -8.206  1.00 0.00 ? 76  THR A HG21 2  
ATOM 3009  H HG22 . THR A 1 58  ? -9.720  1.695   -8.551  1.00 0.00 ? 76  THR A HG22 2  
ATOM 3010  H HG23 . THR A 1 58  ? -8.862  3.082   -9.221  1.00 0.00 ? 76  THR A HG23 2  
ATOM 3011  N N    . CYS A 1 59  ? -10.788 -0.547  -11.363 1.00 0.00 ? 77  CYS A N    2  
ATOM 3012  C CA   . CYS A 1 59  ? -11.965 -1.367  -11.110 1.00 0.00 ? 77  CYS A CA   2  
ATOM 3013  C C    . CYS A 1 59  ? -11.808 -2.162  -9.817  1.00 0.00 ? 77  CYS A C    2  
ATOM 3014  O O    . CYS A 1 59  ? -12.301 -3.284  -9.701  1.00 0.00 ? 77  CYS A O    2  
ATOM 3015  C CB   . CYS A 1 59  ? -12.210 -2.321  -12.281 1.00 0.00 ? 77  CYS A CB   2  
ATOM 3016  S SG   . CYS A 1 59  ? -12.836 -1.505  -13.785 1.00 0.00 ? 77  CYS A SG   2  
ATOM 3017  H H    . CYS A 1 59  ? -10.017 -0.945  -11.822 1.00 0.00 ? 77  CYS A H    2  
ATOM 3018  H HA   . CYS A 1 59  ? -12.815 -0.708  -11.010 1.00 0.00 ? 77  CYS A HA   2  
ATOM 3019  H HB3  . CYS A 1 59  ? -12.935 -3.065  -11.984 1.00 0.00 ? 77  CYS A HB3  2  
ATOM 3020  N N    . ARG A 1 60  ? -11.116 -1.572  -8.847  1.00 0.00 ? 78  ARG A N    2  
ATOM 3021  C CA   . ARG A 1 60  ? -10.891 -2.225  -7.563  1.00 0.00 ? 78  ARG A CA   2  
ATOM 3022  C C    . ARG A 1 60  ? -11.211 -1.279  -6.409  1.00 0.00 ? 78  ARG A C    2  
ATOM 3023  O O    . ARG A 1 60  ? -10.481 -0.320  -6.159  1.00 0.00 ? 78  ARG A O    2  
ATOM 3024  C CB   . ARG A 1 60  ? -9.443  -2.704  -7.457  1.00 0.00 ? 78  ARG A CB   2  
ATOM 3025  C CG   . ARG A 1 60  ? -8.989  -3.540  -8.643  1.00 0.00 ? 78  ARG A CG   2  
ATOM 3026  C CD   . ARG A 1 60  ? -9.597  -4.934  -8.608  1.00 0.00 ? 78  ARG A CD   2  
ATOM 3027  N NE   . ARG A 1 60  ? -8.957  -5.834  -9.564  1.00 0.00 ? 78  ARG A NE   2  
ATOM 3028  C CZ   . ARG A 1 60  ? -9.114  -5.741  -10.880 1.00 0.00 ? 78  ARG A CZ   2  
ATOM 3029  N NH1  . ARG A 1 60  ? -9.886  -4.793  -11.394 1.00 0.00 ? 78  ARG A NH1  2  
ATOM 3030  N NH2  . ARG A 1 60  ? -8.500  -6.598  -11.684 1.00 0.00 ? 78  ARG A NH2  2  
ATOM 3031  H H    . ARG A 1 60  ? -10.747 -0.677  -8.999  1.00 0.00 ? 78  ARG A H    2  
ATOM 3032  H HA   . ARG A 1 60  ? -11.549 -3.079  -7.506  1.00 0.00 ? 78  ARG A HA   2  
ATOM 3033  H HB3  . ARG A 1 60  ? -9.338  -3.301  -6.564  1.00 0.00 ? 78  ARG A HB3  2  
ATOM 3034  H HG3  . ARG A 1 60  ? -7.912  -3.625  -8.621  1.00 0.00 ? 78  ARG A HG3  2  
ATOM 3035  H HD3  . ARG A 1 60  ? -10.648 -4.858  -8.845  1.00 0.00 ? 78  ARG A HD3  2  
ATOM 3036  H HE   . ARG A 1 60  ? -8.382  -6.541  -9.205  1.00 0.00 ? 78  ARG A HE   2  
ATOM 3037  H HH11 . ARG A 1 60  ? -10.351 -4.146  -10.789 1.00 0.00 ? 78  ARG A HH11 2  
ATOM 3038  H HH12 . ARG A 1 60  ? -10.003 -4.726  -12.385 1.00 0.00 ? 78  ARG A HH12 2  
ATOM 3039  H HH21 . ARG A 1 60  ? -7.915  -7.314  -11.301 1.00 0.00 ? 78  ARG A HH21 2  
ATOM 3040  H HH22 . ARG A 1 60  ? -8.618  -6.527  -12.674 1.00 0.00 ? 78  ARG A HH22 2  
ATOM 3041  N N    . TYR A 1 61  ? -12.306 -1.555  -5.711  1.00 0.00 ? 79  TYR A N    2  
ATOM 3042  C CA   . TYR A 1 61  ? -12.725 -0.729  -4.585  1.00 0.00 ? 79  TYR A CA   2  
ATOM 3043  C C    . TYR A 1 61  ? -11.578 -0.529  -3.599  1.00 0.00 ? 79  TYR A C    2  
ATOM 3044  O O    . TYR A 1 61  ? -10.703 -1.385  -3.466  1.00 0.00 ? 79  TYR A O    2  
ATOM 3045  C CB   . TYR A 1 61  ? -13.920 -1.364  -3.873  1.00 0.00 ? 79  TYR A CB   2  
ATOM 3046  C CG   . TYR A 1 61  ? -15.072 -1.689  -4.797  1.00 0.00 ? 79  TYR A CG   2  
ATOM 3047  C CD1  . TYR A 1 61  ? -15.995 -0.713  -5.157  1.00 0.00 ? 79  TYR A CD1  2  
ATOM 3048  C CD2  . TYR A 1 61  ? -15.239 -2.969  -5.308  1.00 0.00 ? 79  TYR A CD2  2  
ATOM 3049  C CE1  . TYR A 1 61  ? -17.049 -1.004  -6.000  1.00 0.00 ? 79  TYR A CE1  2  
ATOM 3050  C CE2  . TYR A 1 61  ? -16.290 -3.269  -6.154  1.00 0.00 ? 79  TYR A CE2  2  
ATOM 3051  C CZ   . TYR A 1 61  ? -17.193 -2.284  -6.496  1.00 0.00 ? 79  TYR A CZ   2  
ATOM 3052  O OH   . TYR A 1 61  ? -18.241 -2.578  -7.337  1.00 0.00 ? 79  TYR A OH   2  
ATOM 3053  H H    . TYR A 1 61  ? -12.848 -2.334  -5.958  1.00 0.00 ? 79  TYR A H    2  
ATOM 3054  H HA   . TYR A 1 61  ? -13.021 0.235   -4.974  1.00 0.00 ? 79  TYR A HA   2  
ATOM 3055  H HB3  . TYR A 1 61  ? -14.282 -0.686  -3.115  1.00 0.00 ? 79  TYR A HB3  2  
ATOM 3056  H HD1  . TYR A 1 61  ? -15.879 0.287   -4.768  1.00 0.00 ? 79  TYR A HD1  2  
ATOM 3057  H HD2  . TYR A 1 61  ? -14.530 -3.739  -5.039  1.00 0.00 ? 79  TYR A HD2  2  
ATOM 3058  H HE1  . TYR A 1 61  ? -17.756 -0.234  -6.269  1.00 0.00 ? 79  TYR A HE1  2  
ATOM 3059  H HE2  . TYR A 1 61  ? -16.403 -4.271  -6.542  1.00 0.00 ? 79  TYR A HE2  2  
ATOM 3060  H HH   . TYR A 1 61  ? -18.140 -3.470  -7.675  1.00 0.00 ? 79  TYR A HH   2  
ATOM 3061  N N    . GLY A 1 62  ? -11.591 0.606   -2.908  1.00 0.00 ? 80  GLY A N    2  
ATOM 3062  C CA   . GLY A 1 62  ? -10.547 0.898   -1.941  1.00 0.00 ? 80  GLY A CA   2  
ATOM 3063  C C    . GLY A 1 62  ? -11.104 1.307   -0.593  1.00 0.00 ? 80  GLY A C    2  
ATOM 3064  O O    . GLY A 1 62  ? -12.293 1.604   -0.468  1.00 0.00 ? 80  GLY A O    2  
ATOM 3065  H H    . GLY A 1 62  ? -12.312 1.251   -3.055  1.00 0.00 ? 80  GLY A H    2  
ATOM 3066  H HA2  . GLY A 1 62  ? -9.933  0.018   -1.814  1.00 0.00 ? 80  GLY A HA2  2  
ATOM 3067  H HA3  . GLY A 1 62  ? -9.933  1.700   -2.323  1.00 0.00 ? 80  GLY A HA3  2  
ATOM 3068  N N    . PHE A 1 63  ? -10.245 1.320   0.421   1.00 0.00 ? 81  PHE A N    2  
ATOM 3069  C CA   . PHE A 1 63  ? -10.658 1.694   1.768   1.00 0.00 ? 81  PHE A CA   2  
ATOM 3070  C C    . PHE A 1 63  ? -10.221 3.118   2.098   1.00 0.00 ? 81  PHE A C    2  
ATOM 3071  O O    . PHE A 1 63  ? -9.045  3.370   2.366   1.00 0.00 ? 81  PHE A O    2  
ATOM 3072  C CB   . PHE A 1 63  ? -10.073 0.719   2.793   1.00 0.00 ? 81  PHE A CB   2  
ATOM 3073  C CG   . PHE A 1 63  ? -10.669 -0.658  2.719   1.00 0.00 ? 81  PHE A CG   2  
ATOM 3074  C CD1  . PHE A 1 63  ? -12.044 -0.832  2.687   1.00 0.00 ? 81  PHE A CD1  2  
ATOM 3075  C CD2  . PHE A 1 63  ? -9.855  -1.779  2.680   1.00 0.00 ? 81  PHE A CD2  2  
ATOM 3076  C CE1  . PHE A 1 63  ? -12.596 -2.097  2.618   1.00 0.00 ? 81  PHE A CE1  2  
ATOM 3077  C CE2  . PHE A 1 63  ? -10.401 -3.047  2.609   1.00 0.00 ? 81  PHE A CE2  2  
ATOM 3078  C CZ   . PHE A 1 63  ? -11.773 -3.206  2.581   1.00 0.00 ? 81  PHE A CZ   2  
ATOM 3079  H H    . PHE A 1 63  ? -9.309  1.073   0.259   1.00 0.00 ? 81  PHE A H    2  
ATOM 3080  H HA   . PHE A 1 63  ? -11.736 1.643   1.810   1.00 0.00 ? 81  PHE A HA   2  
ATOM 3081  H HB3  . PHE A 1 63  ? -10.248 1.104   3.786   1.00 0.00 ? 81  PHE A HB3  2  
ATOM 3082  H HD1  . PHE A 1 63  ? -12.689 0.036   2.717   1.00 0.00 ? 81  PHE A HD1  2  
ATOM 3083  H HD2  . PHE A 1 63  ? -8.782  -1.655  2.704   1.00 0.00 ? 81  PHE A HD2  2  
ATOM 3084  H HE1  . PHE A 1 63  ? -13.668 -2.219  2.596   1.00 0.00 ? 81  PHE A HE1  2  
ATOM 3085  H HE2  . PHE A 1 63  ? -9.756  -3.912  2.582   1.00 0.00 ? 81  PHE A HE2  2  
ATOM 3086  H HZ   . PHE A 1 63  ? -12.202 -4.196  2.526   1.00 0.00 ? 81  PHE A HZ   2  
ATOM 3087  N N    . ILE A 1 64  ? -11.173 4.043   2.074   1.00 0.00 ? 82  ILE A N    2  
ATOM 3088  C CA   . ILE A 1 64  ? -10.885 5.442   2.369   1.00 0.00 ? 82  ILE A CA   2  
ATOM 3089  C C    . ILE A 1 64  ? -11.045 5.732   3.858   1.00 0.00 ? 82  ILE A C    2  
ATOM 3090  O O    . ILE A 1 64  ? -11.194 4.817   4.666   1.00 0.00 ? 82  ILE A O    2  
ATOM 3091  C CB   . ILE A 1 64  ? -11.806 6.386   1.573   1.00 0.00 ? 82  ILE A CB   2  
ATOM 3092  C CG1  . ILE A 1 64  ? -13.265 6.175   1.980   1.00 0.00 ? 82  ILE A CG1  2  
ATOM 3093  C CG2  . ILE A 1 64  ? -11.629 6.160   0.079   1.00 0.00 ? 82  ILE A CG2  2  
ATOM 3094  C CD1  . ILE A 1 64  ? -14.029 7.466   2.180   1.00 0.00 ? 82  ILE A CD1  2  
ATOM 3095  H H    . ILE A 1 64  ? -12.090 3.780   1.852   1.00 0.00 ? 82  ILE A H    2  
ATOM 3096  H HA   . ILE A 1 64  ? -9.863  5.640   2.082   1.00 0.00 ? 82  ILE A HA   2  
ATOM 3097  H HB   . ILE A 1 64  ? -11.520 7.403   1.796   1.00 0.00 ? 82  ILE A HB   2  
ATOM 3098  H HG13 . ILE A 1 64  ? -13.295 5.624   2.908   1.00 0.00 ? 82  ILE A HG13 2  
ATOM 3099  H HG21 . ILE A 1 64  ? -12.473 5.605   -0.304  1.00 0.00 ? 82  ILE A HG21 2  
ATOM 3100  H HG22 . ILE A 1 64  ? -11.569 7.114   -0.424  1.00 0.00 ? 82  ILE A HG22 2  
ATOM 3101  H HG23 . ILE A 1 64  ? -10.721 5.602   -0.097  1.00 0.00 ? 82  ILE A HG23 2  
ATOM 3102  H HD11 . ILE A 1 64  ? -14.745 7.589   1.379   1.00 0.00 ? 82  ILE A HD11 2  
ATOM 3103  H HD12 . ILE A 1 64  ? -14.546 7.435   3.126   1.00 0.00 ? 82  ILE A HD12 2  
ATOM 3104  H HD13 . ILE A 1 64  ? -13.337 8.297   2.173   1.00 0.00 ? 82  ILE A HD13 2  
ATOM 3105  N N    . GLU A 1 65  ? -11.013 7.014   4.212   1.00 0.00 ? 83  GLU A N    2  
ATOM 3106  C CA   . GLU A 1 65  ? -11.155 7.425   5.603   1.00 0.00 ? 83  GLU A CA   2  
ATOM 3107  C C    . GLU A 1 65  ? -12.295 6.670   6.281   1.00 0.00 ? 83  GLU A C    2  
ATOM 3108  O O    . GLU A 1 65  ? -12.213 6.323   7.459   1.00 0.00 ? 83  GLU A O    2  
ATOM 3109  C CB   . GLU A 1 65  ? -11.403 8.932   5.691   1.00 0.00 ? 83  GLU A CB   2  
ATOM 3110  C CG   . GLU A 1 65  ? -12.602 9.399   4.883   1.00 0.00 ? 83  GLU A CG   2  
ATOM 3111  C CD   . GLU A 1 65  ? -13.899 9.316   5.665   1.00 0.00 ? 83  GLU A CD   2  
ATOM 3112  O OE1  . GLU A 1 65  ? -13.916 9.751   6.835   1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3113  O OE2  . GLU A 1 65  ? -14.897 8.814   5.107   1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3114  H H    . GLU A 1 65  ? -10.891 7.698   3.521   1.00 0.00 ? 83  GLU A H    2  
ATOM 3115  H HA   . GLU A 1 65  ? -10.232 7.190   6.114   1.00 0.00 ? 83  GLU A HA   2  
ATOM 3116  H HB3  . GLU A 1 65  ? -10.528 9.449   5.328   1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3117  H HG3  . GLU A 1 65  ? -12.690 8.781   4.003   1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3118  N N    . GLY A 1 66  ? -13.362 6.421   5.526   1.00 0.00 ? 84  GLY A N    2  
ATOM 3119  C CA   . GLY A 1 66  ? -14.505 5.710   6.069   1.00 0.00 ? 84  GLY A CA   2  
ATOM 3120  C C    . GLY A 1 66  ? -15.593 5.487   5.037   1.00 0.00 ? 84  GLY A C    2  
ATOM 3121  O O    . GLY A 1 66  ? -16.708 5.989   5.182   1.00 0.00 ? 84  GLY A O    2  
ATOM 3122  H H    . GLY A 1 66  ? -13.373 6.721   4.593   1.00 0.00 ? 84  GLY A H    2  
ATOM 3123  H HA2  . GLY A 1 66  ? -14.175 4.753   6.442   1.00 0.00 ? 84  GLY A HA2  2  
ATOM 3124  H HA3  . GLY A 1 66  ? -14.914 6.283   6.888   1.00 0.00 ? 84  GLY A HA3  2  
ATOM 3125  N N    . HIS A 1 67  ? -15.269 4.734   3.991   1.00 0.00 ? 85  HIS A N    2  
ATOM 3126  C CA   . HIS A 1 67  ? -16.227 4.446   2.931   1.00 0.00 ? 85  HIS A CA   2  
ATOM 3127  C C    . HIS A 1 67  ? -15.582 3.611   1.828   1.00 0.00 ? 85  HIS A C    2  
ATOM 3128  O O    . HIS A 1 67  ? -14.362 3.446   1.793   1.00 0.00 ? 85  HIS A O    2  
ATOM 3129  C CB   . HIS A 1 67  ? -16.777 5.747   2.345   1.00 0.00 ? 85  HIS A CB   2  
ATOM 3130  C CG   . HIS A 1 67  ? -18.270 5.842   2.394   1.00 0.00 ? 85  HIS A CG   2  
ATOM 3131  N ND1  . HIS A 1 67  ? -18.942 7.000   2.729   1.00 0.00 ? 85  HIS A ND1  2  
ATOM 3132  C CD2  . HIS A 1 67  ? -19.225 4.914   2.148   1.00 0.00 ? 85  HIS A CD2  2  
ATOM 3133  C CE1  . HIS A 1 67  ? -20.243 6.780   2.688   1.00 0.00 ? 85  HIS A CE1  2  
ATOM 3134  N NE2  . HIS A 1 67  ? -20.443 5.521   2.336   1.00 0.00 ? 85  HIS A NE2  2  
ATOM 3135  H H    . HIS A 1 67  ? -14.364 4.362   3.932   1.00 0.00 ? 85  HIS A H    2  
ATOM 3136  H HA   . HIS A 1 67  ? -17.040 3.884   3.362   1.00 0.00 ? 85  HIS A HA   2  
ATOM 3137  H HB3  . HIS A 1 67  ? -16.473 5.827   1.311   1.00 0.00 ? 85  HIS A HB3  2  
ATOM 3138  H HD1  . HIS A 1 67  ? -18.525 7.854   2.963   1.00 0.00 ? 85  HIS A HD1  2  
ATOM 3139  H HD2  . HIS A 1 67  ? -19.061 3.885   1.856   1.00 0.00 ? 85  HIS A HD2  2  
ATOM 3140  H HE1  . HIS A 1 67  ? -21.014 7.504   2.903   1.00 0.00 ? 85  HIS A HE1  2  
ATOM 3141  N N    . VAL A 1 68  ? -16.408 3.087   0.929   1.00 0.00 ? 86  VAL A N    2  
ATOM 3142  C CA   . VAL A 1 68  ? -15.920 2.269   -0.175  1.00 0.00 ? 86  VAL A CA   2  
ATOM 3143  C C    . VAL A 1 68  ? -16.316 2.869   -1.520  1.00 0.00 ? 86  VAL A C    2  
ATOM 3144  O O    . VAL A 1 68  ? -17.448 2.705   -1.976  1.00 0.00 ? 86  VAL A O    2  
ATOM 3145  C CB   . VAL A 1 68  ? -16.459 0.828   -0.088  1.00 0.00 ? 86  VAL A CB   2  
ATOM 3146  C CG1  . VAL A 1 68  ? -15.970 0.004   -1.269  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 3147  C CG2  . VAL A 1 68  ? -16.050 0.186   1.228   1.00 0.00 ? 86  VAL A CG2  2  
ATOM 3148  H H    . VAL A 1 68  ? -17.371 3.254   1.010   1.00 0.00 ? 86  VAL A H    2  
ATOM 3149  H HA   . VAL A 1 68  ? -14.842 2.232   -0.112  1.00 0.00 ? 86  VAL A HA   2  
ATOM 3150  H HB   . VAL A 1 68  ? -17.538 0.867   -0.125  1.00 0.00 ? 86  VAL A HB   2  
ATOM 3151  H HG11 . VAL A 1 68  ? -16.402 0.391   -2.181  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 3152  H HG12 . VAL A 1 68  ? -14.893 0.060   -1.326  1.00 0.00 ? 86  VAL A HG12 2  
ATOM 3153  H HG13 . VAL A 1 68  ? -16.271 -1.025  -1.138  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 3154  H HG21 . VAL A 1 68  ? -16.543 0.692   2.044   1.00 0.00 ? 86  VAL A HG21 2  
ATOM 3155  H HG22 . VAL A 1 68  ? -16.337 -0.856  1.225   1.00 0.00 ? 86  VAL A HG22 2  
ATOM 3156  H HG23 . VAL A 1 68  ? -14.979 0.263   1.349   1.00 0.00 ? 86  VAL A HG23 2  
ATOM 3157  N N    . VAL A 1 69  ? -15.374 3.563   -2.151  1.00 0.00 ? 87  VAL A N    2  
ATOM 3158  C CA   . VAL A 1 69  ? -15.624 4.186   -3.446  1.00 0.00 ? 87  VAL A CA   2  
ATOM 3159  C C    . VAL A 1 69  ? -14.781 3.537   -4.540  1.00 0.00 ? 87  VAL A C    2  
ATOM 3160  O O    . VAL A 1 69  ? -13.871 2.758   -4.256  1.00 0.00 ? 87  VAL A O    2  
ATOM 3161  C CB   . VAL A 1 69  ? -15.322 5.695   -3.409  1.00 0.00 ? 87  VAL A CB   2  
ATOM 3162  C CG1  . VAL A 1 69  ? -16.105 6.370   -2.293  1.00 0.00 ? 87  VAL A CG1  2  
ATOM 3163  C CG2  . VAL A 1 69  ? -13.830 5.937   -3.246  1.00 0.00 ? 87  VAL A CG2  2  
ATOM 3164  H H    . VAL A 1 69  ? -14.491 3.658   -1.737  1.00 0.00 ? 87  VAL A H    2  
ATOM 3165  H HA   . VAL A 1 69  ? -16.669 4.054   -3.685  1.00 0.00 ? 87  VAL A HA   2  
ATOM 3166  H HB   . VAL A 1 69  ? -15.634 6.128   -4.349  1.00 0.00 ? 87  VAL A HB   2  
ATOM 3167  H HG11 . VAL A 1 69  ? -16.172 7.431   -2.490  1.00 0.00 ? 87  VAL A HG11 2  
ATOM 3168  H HG12 . VAL A 1 69  ? -17.099 5.949   -2.244  1.00 0.00 ? 87  VAL A HG12 2  
ATOM 3169  H HG13 . VAL A 1 69  ? -15.600 6.209   -1.352  1.00 0.00 ? 87  VAL A HG13 2  
ATOM 3170  H HG21 . VAL A 1 69  ? -13.637 7.000   -3.237  1.00 0.00 ? 87  VAL A HG21 2  
ATOM 3171  H HG22 . VAL A 1 69  ? -13.494 5.502   -2.316  1.00 0.00 ? 87  VAL A HG22 2  
ATOM 3172  H HG23 . VAL A 1 69  ? -13.298 5.482   -4.068  1.00 0.00 ? 87  VAL A HG23 2  
ATOM 3173  N N    . ILE A 1 70  ? -15.090 3.865   -5.789  1.00 0.00 ? 88  ILE A N    2  
ATOM 3174  C CA   . ILE A 1 70  ? -14.361 3.316   -6.926  1.00 0.00 ? 88  ILE A CA   2  
ATOM 3175  C C    . ILE A 1 70  ? -14.454 4.237   -8.137  1.00 0.00 ? 88  ILE A C    2  
ATOM 3176  O O    . ILE A 1 70  ? -15.295 4.060   -9.019  1.00 0.00 ? 88  ILE A O    2  
ATOM 3177  C CB   . ILE A 1 70  ? -14.889 1.921   -7.313  1.00 0.00 ? 88  ILE A CB   2  
ATOM 3178  C CG1  . ILE A 1 70  ? -14.224 1.440   -8.603  1.00 0.00 ? 88  ILE A CG1  2  
ATOM 3179  C CG2  . ILE A 1 70  ? -16.402 1.953   -7.470  1.00 0.00 ? 88  ILE A CG2  2  
ATOM 3180  C CD1  . ILE A 1 70  ? -14.239 -0.063  -8.767  1.00 0.00 ? 88  ILE A CD1  2  
ATOM 3181  H H    . ILE A 1 70  ? -15.827 4.492   -5.952  1.00 0.00 ? 88  ILE A H    2  
ATOM 3182  H HA   . ILE A 1 70  ? -13.324 3.218   -6.639  1.00 0.00 ? 88  ILE A HA   2  
ATOM 3183  H HB   . ILE A 1 70  ? -14.649 1.236   -6.515  1.00 0.00 ? 88  ILE A HB   2  
ATOM 3184  H HG13 . ILE A 1 70  ? -13.193 1.765   -8.611  1.00 0.00 ? 88  ILE A HG13 2  
ATOM 3185  H HG21 . ILE A 1 70  ? -16.686 1.380   -8.340  1.00 0.00 ? 88  ILE A HG21 2  
ATOM 3186  H HG22 . ILE A 1 70  ? -16.864 1.527   -6.593  1.00 0.00 ? 88  ILE A HG22 2  
ATOM 3187  H HG23 . ILE A 1 70  ? -16.730 2.975   -7.590  1.00 0.00 ? 88  ILE A HG23 2  
ATOM 3188  H HD11 . ILE A 1 70  ? -15.056 -0.479  -8.198  1.00 0.00 ? 88  ILE A HD11 2  
ATOM 3189  H HD12 . ILE A 1 70  ? -14.363 -0.310  -9.811  1.00 0.00 ? 88  ILE A HD12 2  
ATOM 3190  H HD13 . ILE A 1 70  ? -13.307 -0.474  -8.409  1.00 0.00 ? 88  ILE A HD13 2  
ATOM 3191  N N    . PRO A 1 71  ? -13.571 5.245   -8.183  1.00 0.00 ? 89  PRO A N    2  
ATOM 3192  C CA   . PRO A 1 71  ? -13.532 6.214   -9.283  1.00 0.00 ? 89  PRO A CA   2  
ATOM 3193  C C    . PRO A 1 71  ? -13.039 5.591   -10.585 1.00 0.00 ? 89  PRO A C    2  
ATOM 3194  O O    . PRO A 1 71  ? -12.073 4.831   -10.594 1.00 0.00 ? 89  PRO A O    2  
ATOM 3195  C CB   . PRO A 1 71  ? -12.544 7.272   -8.787  1.00 0.00 ? 89  PRO A CB   2  
ATOM 3196  C CG   . PRO A 1 71  ? -11.669 6.551   -7.820  1.00 0.00 ? 89  PRO A CG   2  
ATOM 3197  C CD   . PRO A 1 71  ? -12.541 5.517   -7.165  1.00 0.00 ? 89  PRO A CD   2  
ATOM 3198  H HA   . PRO A 1 71  ? -14.498 6.668   -9.444  1.00 0.00 ? 89  PRO A HA   2  
ATOM 3199  H HB3  . PRO A 1 71  ? -13.081 8.076   -8.310  1.00 0.00 ? 89  PRO A HB3  2  
ATOM 3200  H HG3  . PRO A 1 71  ? -11.291 7.244   -7.082  1.00 0.00 ? 89  PRO A HG3  2  
ATOM 3201  H HD3  . PRO A 1 71  ? -12.986 5.912   -6.264  1.00 0.00 ? 89  PRO A HD3  2  
ATOM 3202  N N    . ARG A 1 72  ? -13.710 5.922   -11.683 1.00 0.00 ? 90  ARG A N    2  
ATOM 3203  C CA   . ARG A 1 72  ? -13.341 5.395   -12.992 1.00 0.00 ? 90  ARG A CA   2  
ATOM 3204  C C    . ARG A 1 72  ? -13.550 6.446   -14.080 1.00 0.00 ? 90  ARG A C    2  
ATOM 3205  O O    . ARG A 1 72  ? -14.619 7.051   -14.174 1.00 0.00 ? 90  ARG A O    2  
ATOM 3206  C CB   . ARG A 1 72  ? -14.160 4.144   -13.311 1.00 0.00 ? 90  ARG A CB   2  
ATOM 3207  C CG   . ARG A 1 72  ? -13.518 2.856   -12.826 1.00 0.00 ? 90  ARG A CG   2  
ATOM 3208  C CD   . ARG A 1 72  ? -12.239 2.549   -13.591 1.00 0.00 ? 90  ARG A CD   2  
ATOM 3209  N NE   . ARG A 1 72  ? -12.474 1.639   -14.709 1.00 0.00 ? 90  ARG A NE   2  
ATOM 3210  C CZ   . ARG A 1 72  ? -11.503 1.134   -15.462 1.00 0.00 ? 90  ARG A CZ   2  
ATOM 3211  N NH1  . ARG A 1 72  ? -10.240 1.448   -15.219 1.00 0.00 ? 90  ARG A NH1  2  
ATOM 3212  N NH2  . ARG A 1 72  ? -11.797 0.313   -16.462 1.00 0.00 ? 90  ARG A NH2  2  
ATOM 3213  H H    . ARG A 1 72  ? -14.473 6.534   -11.613 1.00 0.00 ? 90  ARG A H    2  
ATOM 3214  H HA   . ARG A 1 72  ? -12.294 5.131   -12.960 1.00 0.00 ? 90  ARG A HA   2  
ATOM 3215  H HB3  . ARG A 1 72  ? -14.290 4.076   -14.380 1.00 0.00 ? 90  ARG A HB3  2  
ATOM 3216  H HG3  . ARG A 1 72  ? -14.214 2.042   -12.966 1.00 0.00 ? 90  ARG A HG3  2  
ATOM 3217  H HD3  . ARG A 1 72  ? -11.530 2.096   -12.913 1.00 0.00 ? 90  ARG A HD3  2  
ATOM 3218  H HE   . ARG A 1 72  ? -13.401 1.393   -14.907 1.00 0.00 ? 90  ARG A HE   2  
ATOM 3219  H HH11 . ARG A 1 72  ? -10.015 2.066   -14.466 1.00 0.00 ? 90  ARG A HH11 2  
ATOM 3220  H HH12 . ARG A 1 72  ? -9.510  1.065   -15.786 1.00 0.00 ? 90  ARG A HH12 2  
ATOM 3221  H HH21 . ARG A 1 72  ? -12.750 0.074   -16.649 1.00 0.00 ? 90  ARG A HH21 2  
ATOM 3222  H HH22 . ARG A 1 72  ? -11.067 -0.067  -17.028 1.00 0.00 ? 90  ARG A HH22 2  
ATOM 3223  N N    . ILE A 1 73  ? -12.525 6.654   -14.898 1.00 0.00 ? 91  ILE A N    2  
ATOM 3224  C CA   . ILE A 1 73  ? -12.598 7.630   -15.978 1.00 0.00 ? 91  ILE A CA   2  
ATOM 3225  C C    . ILE A 1 73  ? -13.269 7.035   -17.211 1.00 0.00 ? 91  ILE A C    2  
ATOM 3226  O O    . ILE A 1 73  ? -14.366 7.445   -17.593 1.00 0.00 ? 91  ILE A O    2  
ATOM 3227  C CB   . ILE A 1 73  ? -11.199 8.144   -16.367 1.00 0.00 ? 91  ILE A CB   2  
ATOM 3228  C CG1  . ILE A 1 73  ? -10.516 8.791   -15.161 1.00 0.00 ? 91  ILE A CG1  2  
ATOM 3229  C CG2  . ILE A 1 73  ? -11.300 9.133   -17.520 1.00 0.00 ? 91  ILE A CG2  2  
ATOM 3230  C CD1  . ILE A 1 73  ? -9.005  8.735   -15.220 1.00 0.00 ? 91  ILE A CD1  2  
ATOM 3231  H H    . ILE A 1 73  ? -11.701 6.140   -14.771 1.00 0.00 ? 91  ILE A H    2  
ATOM 3232  H HA   . ILE A 1 73  ? -13.183 8.468   -15.631 1.00 0.00 ? 91  ILE A HA   2  
ATOM 3233  H HB   . ILE A 1 73  ? -10.610 7.303   -16.696 1.00 0.00 ? 91  ILE A HB   2  
ATOM 3234  H HG13 . ILE A 1 73  ? -10.833 8.284   -14.261 1.00 0.00 ? 91  ILE A HG13 2  
ATOM 3235  H HG21 . ILE A 1 73  ? -11.373 8.592   -18.451 1.00 0.00 ? 91  ILE A HG21 2  
ATOM 3236  H HG22 . ILE A 1 73  ? -12.178 9.747   -17.390 1.00 0.00 ? 91  ILE A HG22 2  
ATOM 3237  H HG23 . ILE A 1 73  ? -10.421 9.759   -17.534 1.00 0.00 ? 91  ILE A HG23 2  
ATOM 3238  H HD11 . ILE A 1 73  ? -8.626  8.265   -14.324 1.00 0.00 ? 91  ILE A HD11 2  
ATOM 3239  H HD12 . ILE A 1 73  ? -8.699  8.164   -16.083 1.00 0.00 ? 91  ILE A HD12 2  
ATOM 3240  H HD13 . ILE A 1 73  ? -8.610  9.738   -15.293 1.00 0.00 ? 91  ILE A HD13 2  
ATOM 3241  N N    . HIS A 1 74  ? -12.606 6.064   -17.831 1.00 0.00 ? 92  HIS A N    2  
ATOM 3242  C CA   . HIS A 1 74  ? -13.140 5.410   -19.019 1.00 0.00 ? 92  HIS A CA   2  
ATOM 3243  C C    . HIS A 1 74  ? -13.351 3.920   -18.772 1.00 0.00 ? 92  HIS A C    2  
ATOM 3244  O O    . HIS A 1 74  ? -12.675 3.067   -19.348 1.00 0.00 ? 92  HIS A O    2  
ATOM 3245  C CB   . HIS A 1 74  ? -12.197 5.615   -20.206 1.00 0.00 ? 92  HIS A CB   2  
ATOM 3246  C CG   . HIS A 1 74  ? -12.712 5.034   -21.487 1.00 0.00 ? 92  HIS A CG   2  
ATOM 3247  N ND1  . HIS A 1 74  ? -14.052 4.820   -21.730 1.00 0.00 ? 92  HIS A ND1  2  
ATOM 3248  C CD2  . HIS A 1 74  ? -12.059 4.622   -22.599 1.00 0.00 ? 92  HIS A CD2  2  
ATOM 3249  C CE1  . HIS A 1 74  ? -14.201 4.301   -22.937 1.00 0.00 ? 92  HIS A CE1  2  
ATOM 3250  N NE2  . HIS A 1 74  ? -13.006 4.173   -23.486 1.00 0.00 ? 92  HIS A NE2  2  
ATOM 3251  H H    . HIS A 1 74  ? -11.735 5.781   -17.479 1.00 0.00 ? 92  HIS A H    2  
ATOM 3252  H HA   . HIS A 1 74  ? -14.092 5.863   -19.247 1.00 0.00 ? 92  HIS A HA   2  
ATOM 3253  H HB3  . HIS A 1 74  ? -11.246 5.146   -19.988 1.00 0.00 ? 92  HIS A HB3  2  
ATOM 3254  H HD1  . HIS A 1 74  ? -14.785 5.017   -21.111 1.00 0.00 ? 92  HIS A HD1  2  
ATOM 3255  H HD2  . HIS A 1 74  ? -10.991 4.645   -22.761 1.00 0.00 ? 92  HIS A HD2  2  
ATOM 3256  H HE1  . HIS A 1 74  ? -15.139 4.029   -23.398 1.00 0.00 ? 92  HIS A HE1  2  
ATOM 3257  N N    . PRO A 1 75  ? -14.310 3.596   -17.892 1.00 0.00 ? 93  PRO A N    2  
ATOM 3258  C CA   . PRO A 1 75  ? -14.632 2.208   -17.548 1.00 0.00 ? 93  PRO A CA   2  
ATOM 3259  C C    . PRO A 1 75  ? -15.300 1.464   -18.701 1.00 0.00 ? 93  PRO A C    2  
ATOM 3260  O O    . PRO A 1 75  ? -15.383 1.977   -19.816 1.00 0.00 ? 93  PRO A O    2  
ATOM 3261  C CB   . PRO A 1 75  ? -15.600 2.350   -16.371 1.00 0.00 ? 93  PRO A CB   2  
ATOM 3262  C CG   . PRO A 1 75  ? -16.217 3.694   -16.548 1.00 0.00 ? 93  PRO A CG   2  
ATOM 3263  C CD   . PRO A 1 75  ? -15.155 4.560   -17.167 1.00 0.00 ? 93  PRO A CD   2  
ATOM 3264  H HA   . PRO A 1 75  ? -13.755 1.664   -17.231 1.00 0.00 ? 93  PRO A HA   2  
ATOM 3265  H HB3  . PRO A 1 75  ? -15.055 2.286   -15.442 1.00 0.00 ? 93  PRO A HB3  2  
ATOM 3266  H HG3  . PRO A 1 75  ? -16.513 4.092   -15.589 1.00 0.00 ? 93  PRO A HG3  2  
ATOM 3267  H HD3  . PRO A 1 75  ? -14.589 5.067   -16.402 1.00 0.00 ? 93  PRO A HD3  2  
ATOM 3268  N N    . ASN A 1 76  ? -15.776 0.256   -18.421 1.00 0.00 ? 94  ASN A N    2  
ATOM 3269  C CA   . ASN A 1 76  ? -16.437 -0.558  -19.436 1.00 0.00 ? 94  ASN A CA   2  
ATOM 3270  C C    . ASN A 1 76  ? -17.545 -1.405  -18.816 1.00 0.00 ? 94  ASN A C    2  
ATOM 3271  O O    . ASN A 1 76  ? -17.815 -1.313  -17.620 1.00 0.00 ? 94  ASN A O    2  
ATOM 3272  C CB   . ASN A 1 76  ? -15.420 -1.463  -20.136 1.00 0.00 ? 94  ASN A CB   2  
ATOM 3273  C CG   . ASN A 1 76  ? -15.707 -1.615  -21.616 1.00 0.00 ? 94  ASN A CG   2  
ATOM 3274  O OD1  . ASN A 1 76  ? -16.705 -1.102  -22.124 1.00 0.00 ? 94  ASN A OD1  2  
ATOM 3275  N ND2  . ASN A 1 76  ? -14.830 -2.323  -22.319 1.00 0.00 ? 94  ASN A ND2  2  
ATOM 3276  H H    . ASN A 1 76  ? -15.680 -0.099  -17.512 1.00 0.00 ? 94  ASN A H    2  
ATOM 3277  H HA   . ASN A 1 76  ? -16.873 0.109   -20.163 1.00 0.00 ? 94  ASN A HA   2  
ATOM 3278  H HB3  . ASN A 1 76  ? -15.443 -2.440  -19.680 1.00 0.00 ? 94  ASN A HB3  2  
ATOM 3279  H HD21 . ASN A 1 76  ? -14.058 -2.702  -21.849 1.00 0.00 ? 94  ASN A HD21 2  
ATOM 3280  H HD22 . ASN A 1 76  ? -14.991 -2.438  -23.279 1.00 0.00 ? 94  ASN A HD22 2  
ATOM 3281  N N    . SER A 1 77  ? -18.182 -2.229  -19.641 1.00 0.00 ? 95  SER A N    2  
ATOM 3282  C CA   . SER A 1 77  ? -19.265 -3.091  -19.176 1.00 0.00 ? 95  SER A CA   2  
ATOM 3283  C C    . SER A 1 77  ? -18.755 -4.091  -18.142 1.00 0.00 ? 95  SER A C    2  
ATOM 3284  O O    . SER A 1 77  ? -19.539 -4.694  -17.408 1.00 0.00 ? 95  SER A O    2  
ATOM 3285  C CB   . SER A 1 77  ? -19.895 -3.833  -20.354 1.00 0.00 ? 95  SER A CB   2  
ATOM 3286  O OG   . SER A 1 77  ? -19.194 -5.031  -20.637 1.00 0.00 ? 95  SER A OG   2  
ATOM 3287  H H    . SER A 1 77  ? -17.922 -2.257  -20.585 1.00 0.00 ? 95  SER A H    2  
ATOM 3288  H HA   . SER A 1 77  ? -20.012 -2.463  -18.714 1.00 0.00 ? 95  SER A HA   2  
ATOM 3289  H HB3  . SER A 1 77  ? -19.871 -3.200  -21.230 1.00 0.00 ? 95  SER A HB3  2  
ATOM 3290  H HG   . SER A 1 77  ? -18.357 -4.821  -21.058 1.00 0.00 ? 95  SER A HG   2  
ATOM 3291  N N    . ILE A 1 78  ? -17.439 -4.262  -18.093 1.00 0.00 ? 96  ILE A N    2  
ATOM 3292  C CA   . ILE A 1 78  ? -16.825 -5.189  -17.150 1.00 0.00 ? 96  ILE A CA   2  
ATOM 3293  C C    . ILE A 1 78  ? -16.388 -4.470  -15.877 1.00 0.00 ? 96  ILE A C    2  
ATOM 3294  O O    . ILE A 1 78  ? -15.509 -4.940  -15.156 1.00 0.00 ? 96  ILE A O    2  
ATOM 3295  C CB   . ILE A 1 78  ? -15.605 -5.898  -17.770 1.00 0.00 ? 96  ILE A CB   2  
ATOM 3296  C CG1  . ILE A 1 78  ? -15.887 -6.260  -19.229 1.00 0.00 ? 96  ILE A CG1  2  
ATOM 3297  C CG2  . ILE A 1 78  ? -15.253 -7.141  -16.969 1.00 0.00 ? 96  ILE A CG2  2  
ATOM 3298  C CD1  . ILE A 1 78  ? -14.745 -6.991  -19.901 1.00 0.00 ? 96  ILE A CD1  2  
ATOM 3299  H H    . ILE A 1 78  ? -16.866 -3.753  -18.704 1.00 0.00 ? 96  ILE A H    2  
ATOM 3300  H HA   . ILE A 1 78  ? -17.559 -5.939  -16.893 1.00 0.00 ? 96  ILE A HA   2  
ATOM 3301  H HB   . ILE A 1 78  ? -14.765 -5.222  -17.728 1.00 0.00 ? 96  ILE A HB   2  
ATOM 3302  H HG13 . ILE A 1 78  ? -16.076 -5.354  -19.787 1.00 0.00 ? 96  ILE A HG13 2  
ATOM 3303  H HG21 . ILE A 1 78  ? -14.190 -7.155  -16.775 1.00 0.00 ? 96  ILE A HG21 2  
ATOM 3304  H HG22 . ILE A 1 78  ? -15.787 -7.129  -16.030 1.00 0.00 ? 96  ILE A HG22 2  
ATOM 3305  H HG23 . ILE A 1 78  ? -15.528 -8.023  -17.529 1.00 0.00 ? 96  ILE A HG23 2  
ATOM 3306  H HD11 . ILE A 1 78  ? -14.981 -7.147  -20.944 1.00 0.00 ? 96  ILE A HD11 2  
ATOM 3307  H HD12 . ILE A 1 78  ? -13.844 -6.403  -19.820 1.00 0.00 ? 96  ILE A HD12 2  
ATOM 3308  H HD13 . ILE A 1 78  ? -14.596 -7.947  -19.420 1.00 0.00 ? 96  ILE A HD13 2  
ATOM 3309  N N    . CYS A 1 79  ? -17.009 -3.327  -15.608 1.00 0.00 ? 97  CYS A N    2  
ATOM 3310  C CA   . CYS A 1 79  ? -16.687 -2.542  -14.423 1.00 0.00 ? 97  CYS A CA   2  
ATOM 3311  C C    . CYS A 1 79  ? -17.955 -2.020  -13.755 1.00 0.00 ? 97  CYS A C    2  
ATOM 3312  O O    . CYS A 1 79  ? -18.607 -1.109  -14.265 1.00 0.00 ? 97  CYS A O    2  
ATOM 3313  C CB   . CYS A 1 79  ? -15.773 -1.371  -14.794 1.00 0.00 ? 97  CYS A CB   2  
ATOM 3314  S SG   . CYS A 1 79  ? -14.680 -0.826  -13.442 1.00 0.00 ? 97  CYS A SG   2  
ATOM 3315  H H    . CYS A 1 79  ? -17.701 -3.002  -16.222 1.00 0.00 ? 97  CYS A H    2  
ATOM 3316  H HA   . CYS A 1 79  ? -16.169 -3.186  -13.730 1.00 0.00 ? 97  CYS A HA   2  
ATOM 3317  H HB3  . CYS A 1 79  ? -16.381 -0.528  -15.085 1.00 0.00 ? 97  CYS A HB3  2  
ATOM 3318  N N    . ALA A 1 80  ? -18.298 -2.602  -12.611 1.00 0.00 ? 98  ALA A N    2  
ATOM 3319  C CA   . ALA A 1 80  ? -19.487 -2.194  -11.871 1.00 0.00 ? 98  ALA A CA   2  
ATOM 3320  C C    . ALA A 1 80  ? -20.719 -2.194  -12.770 1.00 0.00 ? 98  ALA A C    2  
ATOM 3321  O O    . ALA A 1 80  ? -21.626 -1.381  -12.594 1.00 0.00 ? 98  ALA A O    2  
ATOM 3322  C CB   . ALA A 1 80  ? -19.279 -0.819  -11.256 1.00 0.00 ? 98  ALA A CB   2  
ATOM 3323  H H    . ALA A 1 80  ? -17.737 -3.322  -12.255 1.00 0.00 ? 98  ALA A H    2  
ATOM 3324  H HA   . ALA A 1 80  ? -19.638 -2.901  -11.069 1.00 0.00 ? 98  ALA A HA   2  
ATOM 3325  H HB1  . ALA A 1 80  ? -18.885 -0.146  -12.005 1.00 0.00 ? 98  ALA A HB1  2  
ATOM 3326  H HB2  . ALA A 1 80  ? -20.223 -0.440  -10.893 1.00 0.00 ? 98  ALA A HB2  2  
ATOM 3327  H HB3  . ALA A 1 80  ? -18.581 -0.893  -10.437 1.00 0.00 ? 98  ALA A HB3  2  
ATOM 3328  N N    . ALA A 1 81  ? -20.743 -3.108  -13.734 1.00 0.00 ? 99  ALA A N    2  
ATOM 3329  C CA   . ALA A 1 81  ? -21.864 -3.214  -14.659 1.00 0.00 ? 99  ALA A CA   2  
ATOM 3330  C C    . ALA A 1 81  ? -21.983 -1.963  -15.522 1.00 0.00 ? 99  ALA A C    2  
ATOM 3331  O O    . ALA A 1 81  ? -23.058 -1.377  -15.637 1.00 0.00 ? 99  ALA A O    2  
ATOM 3332  C CB   . ALA A 1 81  ? -23.158 -3.456  -13.895 1.00 0.00 ? 99  ALA A CB   2  
ATOM 3333  H H    . ALA A 1 81  ? -19.989 -3.729  -13.822 1.00 0.00 ? 99  ALA A H    2  
ATOM 3334  H HA   . ALA A 1 81  ? -21.690 -4.067  -15.299 1.00 0.00 ? 99  ALA A HA   2  
ATOM 3335  H HB1  . ALA A 1 81  ? -23.568 -2.508  -13.575 1.00 0.00 ? 99  ALA A HB1  2  
ATOM 3336  H HB2  . ALA A 1 81  ? -23.867 -3.957  -14.536 1.00 0.00 ? 99  ALA A HB2  2  
ATOM 3337  H HB3  . ALA A 1 81  ? -22.955 -4.070  -13.030 1.00 0.00 ? 99  ALA A HB3  2  
ATOM 3338  N N    . ASN A 1 82  ? -20.870 -1.560  -16.127 1.00 0.00 ? 100 ASN A N    2  
ATOM 3339  C CA   . ASN A 1 82  ? -20.849 -0.377  -16.980 1.00 0.00 ? 100 ASN A CA   2  
ATOM 3340  C C    . ASN A 1 82  ? -21.181 0.879   -16.177 1.00 0.00 ? 100 ASN A C    2  
ATOM 3341  O O    . ASN A 1 82  ? -22.047 1.662   -16.562 1.00 0.00 ? 100 ASN A O    2  
ATOM 3342  C CB   . ASN A 1 82  ? -21.845 -0.536  -18.131 1.00 0.00 ? 100 ASN A CB   2  
ATOM 3343  C CG   . ASN A 1 82  ? -21.432 0.245   -19.364 1.00 0.00 ? 100 ASN A CG   2  
ATOM 3344  O OD1  . ASN A 1 82  ? -20.902 1.353   -19.262 1.00 0.00 ? 100 ASN A OD1  2  
ATOM 3345  N ND2  . ASN A 1 82  ? -21.674 -0.328  -20.537 1.00 0.00 ? 100 ASN A ND2  2  
ATOM 3346  H H    . ASN A 1 82  ? -20.043 -2.069  -15.997 1.00 0.00 ? 100 ASN A H    2  
ATOM 3347  H HA   . ASN A 1 82  ? -19.855 -0.278  -17.387 1.00 0.00 ? 100 ASN A HA   2  
ATOM 3348  H HB3  . ASN A 1 82  ? -22.815 -0.185  -17.813 1.00 0.00 ? 100 ASN A HB3  2  
ATOM 3349  H HD21 . ASN A 1 82  ? -22.099 -1.211  -20.542 1.00 0.00 ? 100 ASN A HD21 2  
ATOM 3350  H HD22 . ASN A 1 82  ? -21.417 0.154   -21.349 1.00 0.00 ? 100 ASN A HD22 2  
ATOM 3351  N N    . ASN A 1 83  ? -20.483 1.061   -15.061 1.00 0.00 ? 101 ASN A N    2  
ATOM 3352  C CA   . ASN A 1 83  ? -20.702 2.219   -14.203 1.00 0.00 ? 101 ASN A CA   2  
ATOM 3353  C C    . ASN A 1 83  ? -19.691 3.321   -14.509 1.00 0.00 ? 101 ASN A C    2  
ATOM 3354  O O    . ASN A 1 83  ? -18.640 3.068   -15.101 1.00 0.00 ? 101 ASN A O    2  
ATOM 3355  C CB   . ASN A 1 83  ? -20.604 1.817   -12.731 1.00 0.00 ? 101 ASN A CB   2  
ATOM 3356  C CG   . ASN A 1 83  ? -21.585 2.576   -11.857 1.00 0.00 ? 101 ASN A CG   2  
ATOM 3357  O OD1  . ASN A 1 83  ? -21.189 3.367   -11.002 1.00 0.00 ? 101 ASN A OD1  2  
ATOM 3358  N ND2  . ASN A 1 83  ? -22.874 2.336   -12.071 1.00 0.00 ? 101 ASN A ND2  2  
ATOM 3359  H H    . ASN A 1 83  ? -19.806 0.400   -14.807 1.00 0.00 ? 101 ASN A H    2  
ATOM 3360  H HA   . ASN A 1 83  ? -21.695 2.595   -14.401 1.00 0.00 ? 101 ASN A HA   2  
ATOM 3361  H HB3  . ASN A 1 83  ? -19.605 2.016   -12.374 1.00 0.00 ? 101 ASN A HB3  2  
ATOM 3362  H HD21 . ASN A 1 83  ? -23.116 1.693   -12.769 1.00 0.00 ? 101 ASN A HD21 2  
ATOM 3363  H HD22 . ASN A 1 83  ? -23.530 2.813   -11.521 1.00 0.00 ? 101 ASN A HD22 2  
ATOM 3364  N N    . THR A 1 84  ? -20.014 4.544   -14.101 1.00 0.00 ? 102 THR A N    2  
ATOM 3365  C CA   . THR A 1 84  ? -19.136 5.684   -14.332 1.00 0.00 ? 102 THR A CA   2  
ATOM 3366  C C    . THR A 1 84  ? -19.064 6.580   -13.100 1.00 0.00 ? 102 THR A C    2  
ATOM 3367  O O    . THR A 1 84  ? -19.816 6.399   -12.143 1.00 0.00 ? 102 THR A O    2  
ATOM 3368  C CB   . THR A 1 84  ? -19.606 6.522   -15.534 1.00 0.00 ? 102 THR A CB   2  
ATOM 3369  O OG1  . THR A 1 84  ? -20.853 7.157   -15.232 1.00 0.00 ? 102 THR A OG1  2  
ATOM 3370  C CG2  . THR A 1 84  ? -19.761 5.651   -16.772 1.00 0.00 ? 102 THR A CG2  2  
ATOM 3371  H H    . THR A 1 84  ? -20.865 4.682   -13.634 1.00 0.00 ? 102 THR A H    2  
ATOM 3372  H HA   . THR A 1 84  ? -18.147 5.305   -14.546 1.00 0.00 ? 102 THR A HA   2  
ATOM 3373  H HB   . THR A 1 84  ? -18.864 7.282   -15.737 1.00 0.00 ? 102 THR A HB   2  
ATOM 3374  H HG1  . THR A 1 84  ? -20.763 8.106   -15.338 1.00 0.00 ? 102 THR A HG1  2  
ATOM 3375  H HG21 . THR A 1 84  ? -20.270 6.210   -17.544 1.00 0.00 ? 102 THR A HG21 2  
ATOM 3376  H HG22 . THR A 1 84  ? -20.337 4.772   -16.524 1.00 0.00 ? 102 THR A HG22 2  
ATOM 3377  H HG23 . THR A 1 84  ? -18.786 5.355   -17.128 1.00 0.00 ? 102 THR A HG23 2  
ATOM 3378  N N    . GLY A 1 85  ? -18.152 7.547   -13.130 1.00 0.00 ? 103 GLY A N    2  
ATOM 3379  C CA   . GLY A 1 85  ? -18.000 8.458   -12.010 1.00 0.00 ? 103 GLY A CA   2  
ATOM 3380  C C    . GLY A 1 85  ? -17.280 7.821   -10.839 1.00 0.00 ? 103 GLY A C    2  
ATOM 3381  O O    . GLY A 1 85  ? -16.315 7.077   -11.024 1.00 0.00 ? 103 GLY A O    2  
ATOM 3382  H H    . GLY A 1 85  ? -17.579 7.645   -13.919 1.00 0.00 ? 103 GLY A H    2  
ATOM 3383  H HA2  . GLY A 1 85  ? -17.441 9.322   -12.336 1.00 0.00 ? 103 GLY A HA2  2  
ATOM 3384  H HA3  . GLY A 1 85  ? -18.979 8.777   -11.684 1.00 0.00 ? 103 GLY A HA3  2  
ATOM 3385  N N    . VAL A 1 86  ? -17.745 8.113   -9.629  1.00 0.00 ? 104 VAL A N    2  
ATOM 3386  C CA   . VAL A 1 86  ? -17.138 7.563   -8.422  1.00 0.00 ? 104 VAL A CA   2  
ATOM 3387  C C    . VAL A 1 86  ? -18.158 6.783   -7.600  1.00 0.00 ? 104 VAL A C    2  
ATOM 3388  O O    . VAL A 1 86  ? -18.633 7.259   -6.568  1.00 0.00 ? 104 VAL A O    2  
ATOM 3389  C CB   . VAL A 1 86  ? -16.529 8.674   -7.546  1.00 0.00 ? 104 VAL A CB   2  
ATOM 3390  C CG1  . VAL A 1 86  ? -15.865 8.077   -6.314  1.00 0.00 ? 104 VAL A CG1  2  
ATOM 3391  C CG2  . VAL A 1 86  ? -15.538 9.502   -8.348  1.00 0.00 ? 104 VAL A CG2  2  
ATOM 3392  H H    . VAL A 1 86  ? -18.516 8.712   -9.546  1.00 0.00 ? 104 VAL A H    2  
ATOM 3393  H HA   . VAL A 1 86  ? -16.346 6.895   -8.723  1.00 0.00 ? 104 VAL A HA   2  
ATOM 3394  H HB   . VAL A 1 86  ? -17.326 9.324   -7.218  1.00 0.00 ? 104 VAL A HB   2  
ATOM 3395  H HG11 . VAL A 1 86  ? -16.522 8.184   -5.464  1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3396  H HG12 . VAL A 1 86  ? -15.663 7.030   -6.485  1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3397  H HG13 . VAL A 1 86  ? -14.937 8.596   -6.119  1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3398  H HG21 . VAL A 1 86  ? -15.835 10.540  -8.326  1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3399  H HG22 . VAL A 1 86  ? -14.552 9.401   -7.916  1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3400  H HG23 . VAL A 1 86  ? -15.520 9.153   -9.370  1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3401  N N    . TYR A 1 87  ? -18.491 5.585   -8.063  1.00 0.00 ? 105 TYR A N    2  
ATOM 3402  C CA   . TYR A 1 87  ? -19.457 4.739   -7.373  1.00 0.00 ? 105 TYR A CA   2  
ATOM 3403  C C    . TYR A 1 87  ? -19.025 4.483   -5.932  1.00 0.00 ? 105 TYR A C    2  
ATOM 3404  O O    . TYR A 1 87  ? -17.832 4.401   -5.636  1.00 0.00 ? 105 TYR A O    2  
ATOM 3405  C CB   . TYR A 1 87  ? -19.623 3.410   -8.111  1.00 0.00 ? 105 TYR A CB   2  
ATOM 3406  C CG   . TYR A 1 87  ? -20.974 2.764   -7.901  1.00 0.00 ? 105 TYR A CG   2  
ATOM 3407  C CD1  . TYR A 1 87  ? -22.144 3.421   -8.265  1.00 0.00 ? 105 TYR A CD1  2  
ATOM 3408  C CD2  . TYR A 1 87  ? -21.082 1.500   -7.335  1.00 0.00 ? 105 TYR A CD2  2  
ATOM 3409  C CE1  . TYR A 1 87  ? -23.381 2.835   -8.075  1.00 0.00 ? 105 TYR A CE1  2  
ATOM 3410  C CE2  . TYR A 1 87  ? -22.314 0.907   -7.141  1.00 0.00 ? 105 TYR A CE2  2  
ATOM 3411  C CZ   . TYR A 1 87  ? -23.460 1.578   -7.512  1.00 0.00 ? 105 TYR A CZ   2  
ATOM 3412  O OH   . TYR A 1 87  ? -24.689 0.991   -7.320  1.00 0.00 ? 105 TYR A OH   2  
ATOM 3413  H H    . TYR A 1 87  ? -18.078 5.261   -8.892  1.00 0.00 ? 105 TYR A H    2  
ATOM 3414  H HA   . TYR A 1 87  ? -20.405 5.257   -7.365  1.00 0.00 ? 105 TYR A HA   2  
ATOM 3415  H HB3  . TYR A 1 87  ? -18.868 2.718   -7.766  1.00 0.00 ? 105 TYR A HB3  2  
ATOM 3416  H HD1  . TYR A 1 87  ? -22.077 4.404   -8.705  1.00 0.00 ? 105 TYR A HD1  2  
ATOM 3417  H HD2  . TYR A 1 87  ? -20.182 0.977   -7.044  1.00 0.00 ? 105 TYR A HD2  2  
ATOM 3418  H HE1  . TYR A 1 87  ? -24.278 3.361   -8.365  1.00 0.00 ? 105 TYR A HE1  2  
ATOM 3419  H HE2  . TYR A 1 87  ? -22.376 -0.077  -6.700  1.00 0.00 ? 105 TYR A HE2  2  
ATOM 3420  H HH   . TYR A 1 87  ? -25.209 1.527   -6.717  1.00 0.00 ? 105 TYR A HH   2  
ATOM 3421  N N    . ILE A 1 88  ? -20.002 4.358   -5.041  1.00 0.00 ? 106 ILE A N    2  
ATOM 3422  C CA   . ILE A 1 88  ? -19.723 4.109   -3.632  1.00 0.00 ? 106 ILE A CA   2  
ATOM 3423  C C    . ILE A 1 88  ? -20.390 2.822   -3.158  1.00 0.00 ? 106 ILE A C    2  
ATOM 3424  O O    . ILE A 1 88  ? -21.537 2.834   -2.709  1.00 0.00 ? 106 ILE A O    2  
ATOM 3425  C CB   . ILE A 1 88  ? -20.200 5.278   -2.749  1.00 0.00 ? 106 ILE A CB   2  
ATOM 3426  C CG1  . ILE A 1 88  ? -19.719 6.610   -3.324  1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3427  C CG2  . ILE A 1 88  ? -19.706 5.099   -1.322  1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3428  C CD1  . ILE A 1 88  ? -20.205 7.815   -2.548  1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3429  H H    . ILE A 1 88  ? -20.932 4.433   -5.339  1.00 0.00 ? 106 ILE A H    2  
ATOM 3430  H HA   . ILE A 1 88  ? -18.653 4.011   -3.517  1.00 0.00 ? 106 ILE A HA   2  
ATOM 3431  H HB   . ILE A 1 88  ? -21.280 5.269   -2.734  1.00 0.00 ? 106 ILE A HB   2  
ATOM 3432  H HG13 . ILE A 1 88  ? -20.074 6.705   -4.341  1.00 0.00 ? 106 ILE A HG13 2  
ATOM 3433  H HG21 . ILE A 1 88  ? -18.630 5.015   -1.322  1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3434  H HG22 . ILE A 1 88  ? -19.999 5.954   -0.731  1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3435  H HG23 . ILE A 1 88  ? -20.138 4.205   -0.899  1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3436  H HD11 . ILE A 1 88  ? -20.730 8.484   -3.212  1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3437  H HD12 . ILE A 1 88  ? -20.868 7.492   -1.760  1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3438  H HD13 . ILE A 1 88  ? -19.358 8.329   -2.116  1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3439  N N    . LEU A 1 89  ? -19.664 1.714   -3.259  1.00 0.00 ? 107 LEU A N    2  
ATOM 3440  C CA   . LEU A 1 89  ? -20.184 0.418   -2.840  1.00 0.00 ? 107 LEU A CA   2  
ATOM 3441  C C    . LEU A 1 89  ? -20.717 0.482   -1.412  1.00 0.00 ? 107 LEU A C    2  
ATOM 3442  O O    . LEU A 1 89  ? -19.959 0.686   -0.463  1.00 0.00 ? 107 LEU A O    2  
ATOM 3443  C CB   . LEU A 1 89  ? -19.094 -0.649  -2.943  1.00 0.00 ? 107 LEU A CB   2  
ATOM 3444  C CG   . LEU A 1 89  ? -19.572 -2.071  -3.234  1.00 0.00 ? 107 LEU A CG   2  
ATOM 3445  C CD1  . LEU A 1 89  ? -20.540 -2.541  -2.160  1.00 0.00 ? 107 LEU A CD1  2  
ATOM 3446  C CD2  . LEU A 1 89  ? -20.220 -2.145  -4.610  1.00 0.00 ? 107 LEU A CD2  2  
ATOM 3447  H H    . LEU A 1 89  ? -18.757 1.768   -3.626  1.00 0.00 ? 107 LEU A H    2  
ATOM 3448  H HA   . LEU A 1 89  ? -20.996 0.156   -3.503  1.00 0.00 ? 107 LEU A HA   2  
ATOM 3449  H HB3  . LEU A 1 89  ? -18.557 -0.665  -2.003  1.00 0.00 ? 107 LEU A HB3  2  
ATOM 3450  H HG   . LEU A 1 89  ? -18.719 -2.740  -3.229  1.00 0.00 ? 107 LEU A HG   2  
ATOM 3451  H HD11 . LEU A 1 89  ? -20.503 -3.617  -2.088  1.00 0.00 ? 107 LEU A HD11 2  
ATOM 3452  H HD12 . LEU A 1 89  ? -21.541 -2.231  -2.419  1.00 0.00 ? 107 LEU A HD12 2  
ATOM 3453  H HD13 . LEU A 1 89  ? -20.263 -2.105  -1.211  1.00 0.00 ? 107 LEU A HD13 2  
ATOM 3454  H HD21 . LEU A 1 89  ? -19.932 -3.067  -5.094  1.00 0.00 ? 107 LEU A HD21 2  
ATOM 3455  H HD22 . LEU A 1 89  ? -19.893 -1.307  -5.206  1.00 0.00 ? 107 LEU A HD22 2  
ATOM 3456  H HD23 . LEU A 1 89  ? -21.293 -2.115  -4.502  1.00 0.00 ? 107 LEU A HD23 2  
ATOM 3457  N N    . THR A 1 90  ? -22.026 0.302   -1.266  1.00 0.00 ? 108 THR A N    2  
ATOM 3458  C CA   . THR A 1 90  ? -22.660 0.338   0.046   1.00 0.00 ? 108 THR A CA   2  
ATOM 3459  C C    . THR A 1 90  ? -21.967 -0.610  1.018   1.00 0.00 ? 108 THR A C    2  
ATOM 3460  O O    . THR A 1 90  ? -21.266 -0.174  1.931   1.00 0.00 ? 108 THR A O    2  
ATOM 3461  C CB   . THR A 1 90  ? -24.153 -0.035  -0.041  1.00 0.00 ? 108 THR A CB   2  
ATOM 3462  O OG1  . THR A 1 90  ? -24.352 -1.029  -1.053  1.00 0.00 ? 108 THR A OG1  2  
ATOM 3463  C CG2  . THR A 1 90  ? -24.999 1.191   -0.353  1.00 0.00 ? 108 THR A CG2  2  
ATOM 3464  H H    . THR A 1 90  ? -22.578 0.143   -2.060  1.00 0.00 ? 108 THR A H    2  
ATOM 3465  H HA   . THR A 1 90  ? -22.585 1.346   0.426   1.00 0.00 ? 108 THR A HA   2  
ATOM 3466  H HB   . THR A 1 90  ? -24.464 -0.436  0.913   1.00 0.00 ? 108 THR A HB   2  
ATOM 3467  H HG1  . THR A 1 90  ? -25.072 -1.607  -0.795  1.00 0.00 ? 108 THR A HG1  2  
ATOM 3468  H HG21 . THR A 1 90  ? -26.044 0.917   -0.350  1.00 0.00 ? 108 THR A HG21 2  
ATOM 3469  H HG22 . THR A 1 90  ? -24.730 1.575   -1.326  1.00 0.00 ? 108 THR A HG22 2  
ATOM 3470  H HG23 . THR A 1 90  ? -24.824 1.948   0.395   1.00 0.00 ? 108 THR A HG23 2  
ATOM 3471  N N    . SER A 1 91  ? -22.167 -1.909  0.815   1.00 0.00 ? 109 SER A N    2  
ATOM 3472  C CA   . SER A 1 91  ? -21.563 -2.918  1.676   1.00 0.00 ? 109 SER A CA   2  
ATOM 3473  C C    . SER A 1 91  ? -20.613 -3.811  0.882   1.00 0.00 ? 109 SER A C    2  
ATOM 3474  O O    . SER A 1 91  ? -21.043 -4.607  0.048   1.00 0.00 ? 109 SER A O    2  
ATOM 3475  C CB   . SER A 1 91  ? -22.649 -3.770  2.337   1.00 0.00 ? 109 SER A CB   2  
ATOM 3476  O OG   . SER A 1 91  ? -23.586 -2.959  3.024   1.00 0.00 ? 109 SER A OG   2  
ATOM 3477  H H    . SER A 1 91  ? -22.737 -2.194  0.070   1.00 0.00 ? 109 SER A H    2  
ATOM 3478  H HA   . SER A 1 91  ? -21.002 -2.407  2.442   1.00 0.00 ? 109 SER A HA   2  
ATOM 3479  H HB3  . SER A 1 91  ? -22.190 -4.448  3.044   1.00 0.00 ? 109 SER A HB3  2  
ATOM 3480  H HG   . SER A 1 91  ? -24.471 -3.309  2.892   1.00 0.00 ? 109 SER A HG   2  
ATOM 3481  N N    . ASN A 1 92  ? -19.319 -3.672  1.151   1.00 0.00 ? 110 ASN A N    2  
ATOM 3482  C CA   . ASN A 1 92  ? -18.307 -4.466  0.462   1.00 0.00 ? 110 ASN A CA   2  
ATOM 3483  C C    . ASN A 1 92  ? -17.694 -5.499  1.401   1.00 0.00 ? 110 ASN A C    2  
ATOM 3484  O O    . ASN A 1 92  ? -17.898 -6.703  1.236   1.00 0.00 ? 110 ASN A O    2  
ATOM 3485  C CB   . ASN A 1 92  ? -17.212 -3.556  -0.099  1.00 0.00 ? 110 ASN A CB   2  
ATOM 3486  C CG   . ASN A 1 92  ? -16.413 -4.224  -1.201  1.00 0.00 ? 110 ASN A CG   2  
ATOM 3487  O OD1  . ASN A 1 92  ? -16.978 -4.838  -2.107  1.00 0.00 ? 110 ASN A OD1  2  
ATOM 3488  N ND2  . ASN A 1 92  ? -15.093 -4.107  -1.130  1.00 0.00 ? 110 ASN A ND2  2  
ATOM 3489  H H    . ASN A 1 92  ? -19.037 -3.020  1.826   1.00 0.00 ? 110 ASN A H    2  
ATOM 3490  H HA   . ASN A 1 92  ? -18.789 -4.979  -0.356  1.00 0.00 ? 110 ASN A HA   2  
ATOM 3491  H HB3  . ASN A 1 92  ? -16.534 -3.285  0.697   1.00 0.00 ? 110 ASN A HB3  2  
ATOM 3492  H HD21 . ASN A 1 92  ? -14.712 -3.604  -0.380  1.00 0.00 ? 110 ASN A HD21 2  
ATOM 3493  H HD22 . ASN A 1 92  ? -14.552 -4.528  -1.830  1.00 0.00 ? 110 ASN A HD22 2  
ATOM 3494  N N    . THR A 1 93  ? -16.943 -5.021  2.389   1.00 0.00 ? 111 THR A N    2  
ATOM 3495  C CA   . THR A 1 93  ? -16.299 -5.905  3.354   1.00 0.00 ? 111 THR A CA   2  
ATOM 3496  C C    . THR A 1 93  ? -15.540 -7.025  2.653   1.00 0.00 ? 111 THR A C    2  
ATOM 3497  O O    . THR A 1 93  ? -15.515 -8.161  3.128   1.00 0.00 ? 111 THR A O    2  
ATOM 3498  C CB   . THR A 1 93  ? -17.327 -6.522  4.322   1.00 0.00 ? 111 THR A CB   2  
ATOM 3499  O OG1  . THR A 1 93  ? -18.055 -7.566  3.662   1.00 0.00 ? 111 THR A OG1  2  
ATOM 3500  C CG2  . THR A 1 93  ? -18.296 -5.465  4.831   1.00 0.00 ? 111 THR A CG2  2  
ATOM 3501  H H    . THR A 1 93  ? -16.818 -4.054  2.468   1.00 0.00 ? 111 THR A H    2  
ATOM 3502  H HA   . THR A 1 93  ? -15.602 -5.316  3.931   1.00 0.00 ? 111 THR A HA   2  
ATOM 3503  H HB   . THR A 1 93  ? -16.798 -6.941  5.166   1.00 0.00 ? 111 THR A HB   2  
ATOM 3504  H HG1  . THR A 1 93  ? -18.799 -7.186  3.190   1.00 0.00 ? 111 THR A HG1  2  
ATOM 3505  H HG21 . THR A 1 93  ? -17.740 -4.623  5.215   1.00 0.00 ? 111 THR A HG21 2  
ATOM 3506  H HG22 . THR A 1 93  ? -18.905 -5.884  5.618   1.00 0.00 ? 111 THR A HG22 2  
ATOM 3507  H HG23 . THR A 1 93  ? -18.928 -5.137  4.021   1.00 0.00 ? 111 THR A HG23 2  
ATOM 3508  N N    . SER A 1 94  ? -14.921 -6.698  1.525   1.00 0.00 ? 112 SER A N    2  
ATOM 3509  C CA   . SER A 1 94  ? -14.161 -7.679  0.757   1.00 0.00 ? 112 SER A CA   2  
ATOM 3510  C C    . SER A 1 94  ? -12.702 -7.257  0.629   1.00 0.00 ? 112 SER A C    2  
ATOM 3511  O O    . SER A 1 94  ? -12.383 -6.069  0.662   1.00 0.00 ? 112 SER A O    2  
ATOM 3512  C CB   . SER A 1 94  ? -14.776 -7.856  -0.633  1.00 0.00 ? 112 SER A CB   2  
ATOM 3513  O OG   . SER A 1 94  ? -16.187 -7.961  -0.557  1.00 0.00 ? 112 SER A OG   2  
ATOM 3514  H H    . SER A 1 94  ? -14.978 -5.776  1.198   1.00 0.00 ? 112 SER A H    2  
ATOM 3515  H HA   . SER A 1 94  ? -14.208 -8.620  1.284   1.00 0.00 ? 112 SER A HA   2  
ATOM 3516  H HB3  . SER A 1 94  ? -14.384 -8.757  -1.085  1.00 0.00 ? 112 SER A HB3  2  
ATOM 3517  H HG   . SER A 1 94  ? -16.425 -8.597  0.122   1.00 0.00 ? 112 SER A HG   2  
ATOM 3518  N N    . GLN A 1 95  ? -11.818 -8.240  0.486   1.00 0.00 ? 113 GLN A N    2  
ATOM 3519  C CA   . GLN A 1 95  ? -10.392 -7.972  0.355   1.00 0.00 ? 113 GLN A CA   2  
ATOM 3520  C C    . GLN A 1 95  ? -10.091 -7.255  -0.957  1.00 0.00 ? 113 GLN A C    2  
ATOM 3521  O O    . GLN A 1 95  ? -10.440 -7.737  -2.035  1.00 0.00 ? 113 GLN A O    2  
ATOM 3522  C CB   . GLN A 1 95  ? -9.596  -9.276  0.430   1.00 0.00 ? 113 GLN A CB   2  
ATOM 3523  C CG   . GLN A 1 95  ? -9.285  -9.716  1.852   1.00 0.00 ? 113 GLN A CG   2  
ATOM 3524  C CD   . GLN A 1 95  ? -10.481 -10.335 2.546   1.00 0.00 ? 113 GLN A CD   2  
ATOM 3525  O OE1  . GLN A 1 95  ? -11.002 -9.786  3.518   1.00 0.00 ? 113 GLN A OE1  2  
ATOM 3526  N NE2  . GLN A 1 95  ? -10.926 -11.483 2.050   1.00 0.00 ? 113 GLN A NE2  2  
ATOM 3527  H H    . GLN A 1 95  ? -12.134 -9.166  0.467   1.00 0.00 ? 113 GLN A H    2  
ATOM 3528  H HA   . GLN A 1 95  ? -10.098 -7.333  1.174   1.00 0.00 ? 113 GLN A HA   2  
ATOM 3529  H HB3  . GLN A 1 95  ? -8.661  -9.145  -0.096  1.00 0.00 ? 113 GLN A HB3  2  
ATOM 3530  H HG3  . GLN A 1 95  ? -8.962  -8.856  2.419   1.00 0.00 ? 113 GLN A HG3  2  
ATOM 3531  H HE21 . GLN A 1 95  ? -10.462 -11.863 1.274   1.00 0.00 ? 113 GLN A HE21 2  
ATOM 3532  H HE22 . GLN A 1 95  ? -11.698 -11.905 2.480   1.00 0.00 ? 113 GLN A HE22 2  
ATOM 3533  N N    . TYR A 1 96  ? -9.443  -6.100  -0.859  1.00 0.00 ? 114 TYR A N    2  
ATOM 3534  C CA   . TYR A 1 96  ? -9.097  -5.314  -2.038  1.00 0.00 ? 114 TYR A CA   2  
ATOM 3535  C C    . TYR A 1 96  ? -7.890  -4.424  -1.767  1.00 0.00 ? 114 TYR A C    2  
ATOM 3536  O O    . TYR A 1 96  ? -7.386  -4.368  -0.644  1.00 0.00 ? 114 TYR A O    2  
ATOM 3537  C CB   . TYR A 1 96  ? -10.289 -4.459  -2.475  1.00 0.00 ? 114 TYR A CB   2  
ATOM 3538  C CG   . TYR A 1 96  ? -11.257 -5.187  -3.380  1.00 0.00 ? 114 TYR A CG   2  
ATOM 3539  C CD1  . TYR A 1 96  ? -10.973 -5.371  -4.728  1.00 0.00 ? 114 TYR A CD1  2  
ATOM 3540  C CD2  . TYR A 1 96  ? -12.454 -5.691  -2.887  1.00 0.00 ? 114 TYR A CD2  2  
ATOM 3541  C CE1  . TYR A 1 96  ? -11.856 -6.034  -5.558  1.00 0.00 ? 114 TYR A CE1  2  
ATOM 3542  C CE2  . TYR A 1 96  ? -13.342 -6.355  -3.711  1.00 0.00 ? 114 TYR A CE2  2  
ATOM 3543  C CZ   . TYR A 1 96  ? -13.039 -6.524  -5.045  1.00 0.00 ? 114 TYR A CZ   2  
ATOM 3544  O OH   . TYR A 1 96  ? -13.920 -7.187  -5.869  1.00 0.00 ? 114 TYR A OH   2  
ATOM 3545  H H    . TYR A 1 96  ? -9.191  -5.766  0.026   1.00 0.00 ? 114 TYR A H    2  
ATOM 3546  H HA   . TYR A 1 96  ? -8.851  -6.001  -2.834  1.00 0.00 ? 114 TYR A HA   2  
ATOM 3547  H HB3  . TYR A 1 96  ? -9.925  -3.592  -3.006  1.00 0.00 ? 114 TYR A HB3  2  
ATOM 3548  H HD1  . TYR A 1 96  ? -10.046 -4.986  -5.126  1.00 0.00 ? 114 TYR A HD1  2  
ATOM 3549  H HD2  . TYR A 1 96  ? -12.691 -5.555  -1.841  1.00 0.00 ? 114 TYR A HD2  2  
ATOM 3550  H HE1  . TYR A 1 96  ? -11.618 -6.169  -6.603  1.00 0.00 ? 114 TYR A HE1  2  
ATOM 3551  H HE2  . TYR A 1 96  ? -14.269 -6.740  -3.310  1.00 0.00 ? 114 TYR A HE2  2  
ATOM 3552  H HH   . TYR A 1 96  ? -13.881 -6.807  -6.751  1.00 0.00 ? 114 TYR A HH   2  
ATOM 3553  N N    . ASP A 1 97  ? -7.432  -3.725  -2.799  1.00 0.00 ? 115 ASP A N    2  
ATOM 3554  C CA   . ASP A 1 97  ? -6.284  -2.834  -2.672  1.00 0.00 ? 115 ASP A CA   2  
ATOM 3555  C C    . ASP A 1 97  ? -6.535  -1.776  -1.603  1.00 0.00 ? 115 ASP A C    2  
ATOM 3556  O O    . ASP A 1 97  ? -7.612  -1.721  -1.006  1.00 0.00 ? 115 ASP A O    2  
ATOM 3557  C CB   . ASP A 1 97  ? -5.984  -2.160  -4.013  1.00 0.00 ? 115 ASP A CB   2  
ATOM 3558  C CG   . ASP A 1 97  ? -4.527  -2.284  -4.408  1.00 0.00 ? 115 ASP A CG   2  
ATOM 3559  O OD1  . ASP A 1 97  ? -4.058  -3.425  -4.600  1.00 0.00 ? 115 ASP A OD1  2  
ATOM 3560  O OD2  . ASP A 1 97  ? -3.855  -1.238  -4.527  1.00 0.00 ? 115 ASP A OD2  2  
ATOM 3561  H H    . ASP A 1 97  ? -7.876  -3.811  -3.669  1.00 0.00 ? 115 ASP A H    2  
ATOM 3562  H HA   . ASP A 1 97  ? -5.434  -3.429  -2.380  1.00 0.00 ? 115 ASP A HA   2  
ATOM 3563  H HB3  . ASP A 1 97  ? -6.234  -1.112  -3.944  1.00 0.00 ? 115 ASP A HB3  2  
ATOM 3564  N N    . THR A 1 98  ? -5.532  -0.936  -1.361  1.00 0.00 ? 116 THR A N    2  
ATOM 3565  C CA   . THR A 1 98  ? -5.642  0.119   -0.362  1.00 0.00 ? 116 THR A CA   2  
ATOM 3566  C C    . THR A 1 98  ? -5.010  1.415   -0.858  1.00 0.00 ? 116 THR A C    2  
ATOM 3567  O O    . THR A 1 98  ? -3.909  1.408   -1.409  1.00 0.00 ? 116 THR A O    2  
ATOM 3568  C CB   . THR A 1 98  ? -4.973  -0.291  0.963   1.00 0.00 ? 116 THR A CB   2  
ATOM 3569  O OG1  . THR A 1 98  ? -5.257  0.679   1.976   1.00 0.00 ? 116 THR A OG1  2  
ATOM 3570  C CG2  . THR A 1 98  ? -3.467  -0.425  0.789   1.00 0.00 ? 116 THR A CG2  2  
ATOM 3571  H H    . THR A 1 98  ? -4.700  -1.030  -1.869  1.00 0.00 ? 116 THR A H    2  
ATOM 3572  H HA   . THR A 1 98  ? -6.692  0.291   -0.173  1.00 0.00 ? 116 THR A HA   2  
ATOM 3573  H HB   . THR A 1 98  ? -5.371  -1.248  1.269   1.00 0.00 ? 116 THR A HB   2  
ATOM 3574  H HG1  . THR A 1 98  ? -6.177  0.948   1.913   1.00 0.00 ? 116 THR A HG1  2  
ATOM 3575  H HG21 . THR A 1 98  ? -3.036  -0.840  1.688   1.00 0.00 ? 116 THR A HG21 2  
ATOM 3576  H HG22 . THR A 1 98  ? -3.038  0.549   0.602   1.00 0.00 ? 116 THR A HG22 2  
ATOM 3577  H HG23 . THR A 1 98  ? -3.258  -1.076  -0.044  1.00 0.00 ? 116 THR A HG23 2  
ATOM 3578  N N    . TYR A 1 99  ? -5.713  2.524   -0.660  1.00 0.00 ? 117 TYR A N    2  
ATOM 3579  C CA   . TYR A 1 99  ? -5.222  3.828   -1.090  1.00 0.00 ? 117 TYR A CA   2  
ATOM 3580  C C    . TYR A 1 99  ? -4.773  4.662   0.106   1.00 0.00 ? 117 TYR A C    2  
ATOM 3581  O O    . TYR A 1 99  ? -5.298  4.518   1.211   1.00 0.00 ? 117 TYR A O    2  
ATOM 3582  C CB   . TYR A 1 99  ? -6.307  4.574   -1.868  1.00 0.00 ? 117 TYR A CB   2  
ATOM 3583  C CG   . TYR A 1 99  ? -6.925  3.758   -2.980  1.00 0.00 ? 117 TYR A CG   2  
ATOM 3584  C CD1  . TYR A 1 99  ? -6.144  2.929   -3.777  1.00 0.00 ? 117 TYR A CD1  2  
ATOM 3585  C CD2  . TYR A 1 99  ? -8.289  3.815   -3.235  1.00 0.00 ? 117 TYR A CD2  2  
ATOM 3586  C CE1  . TYR A 1 99  ? -6.705  2.182   -4.794  1.00 0.00 ? 117 TYR A CE1  2  
ATOM 3587  C CE2  . TYR A 1 99  ? -8.859  3.070   -4.249  1.00 0.00 ? 117 TYR A CE2  2  
ATOM 3588  C CZ   . TYR A 1 99  ? -8.063  2.254   -5.026  1.00 0.00 ? 117 TYR A CZ   2  
ATOM 3589  O OH   . TYR A 1 99  ? -8.625  1.512   -6.038  1.00 0.00 ? 117 TYR A OH   2  
ATOM 3590  H H    . TYR A 1 99  ? -6.585  2.464   -0.216  1.00 0.00 ? 117 TYR A H    2  
ATOM 3591  H HA   . TYR A 1 99  ? -4.374  3.665   -1.740  1.00 0.00 ? 117 TYR A HA   2  
ATOM 3592  H HB3  . TYR A 1 99  ? -5.877  5.462   -2.308  1.00 0.00 ? 117 TYR A HB3  2  
ATOM 3593  H HD1  . TYR A 1 99  ? -5.081  2.874   -3.594  1.00 0.00 ? 117 TYR A HD1  2  
ATOM 3594  H HD2  . TYR A 1 99  ? -8.911  4.455   -2.624  1.00 0.00 ? 117 TYR A HD2  2  
ATOM 3595  H HE1  . TYR A 1 99  ? -6.082  1.543   -5.404  1.00 0.00 ? 117 TYR A HE1  2  
ATOM 3596  H HE2  . TYR A 1 99  ? -9.923  3.127   -4.431  1.00 0.00 ? 117 TYR A HE2  2  
ATOM 3597  H HH   . TYR A 1 99  ? -9.582  1.586   -5.996  1.00 0.00 ? 117 TYR A HH   2  
ATOM 3598  N N    . CYS A 1 100 ? -3.798  5.535   -0.122  1.00 0.00 ? 118 CYS A N    2  
ATOM 3599  C CA   . CYS A 1 100 ? -3.276  6.392   0.934   1.00 0.00 ? 118 CYS A CA   2  
ATOM 3600  C C    . CYS A 1 100 ? -3.039  7.808   0.418   1.00 0.00 ? 118 CYS A C    2  
ATOM 3601  O O    . CYS A 1 100 ? -2.727  8.009   -0.757  1.00 0.00 ? 118 CYS A O    2  
ATOM 3602  C CB   . CYS A 1 100 ? -1.974  5.816   1.492   1.00 0.00 ? 118 CYS A CB   2  
ATOM 3603  S SG   . CYS A 1 100 ? -2.149  4.159   2.227   1.00 0.00 ? 118 CYS A SG   2  
ATOM 3604  H H    . CYS A 1 100 ? -3.419  5.603   -1.025  1.00 0.00 ? 118 CYS A H    2  
ATOM 3605  H HA   . CYS A 1 100 ? -4.011  6.431   1.724   1.00 0.00 ? 118 CYS A HA   2  
ATOM 3606  H HB3  . CYS A 1 100 ? -1.595  6.477   2.258   1.00 0.00 ? 118 CYS A HB3  2  
ATOM 3607  N N    . PHE A 1 101 ? -3.188  8.789   1.302   1.00 0.00 ? 119 PHE A N    2  
ATOM 3608  C CA   . PHE A 1 101 ? -2.989  10.187  0.936   1.00 0.00 ? 119 PHE A CA   2  
ATOM 3609  C C    . PHE A 1 101 ? -1.964  10.848  1.851   1.00 0.00 ? 119 PHE A C    2  
ATOM 3610  O O    . PHE A 1 101 ? -1.974  10.643  3.064   1.00 0.00 ? 119 PHE A O    2  
ATOM 3611  C CB   . PHE A 1 101 ? -4.317  10.947  1.005   1.00 0.00 ? 119 PHE A CB   2  
ATOM 3612  C CG   . PHE A 1 101 ? -4.164  12.433  0.846   1.00 0.00 ? 119 PHE A CG   2  
ATOM 3613  C CD1  . PHE A 1 101 ? -3.726  12.975  -0.350  1.00 0.00 ? 119 PHE A CD1  2  
ATOM 3614  C CD2  . PHE A 1 101 ? -4.460  13.287  1.896   1.00 0.00 ? 119 PHE A CD2  2  
ATOM 3615  C CE1  . PHE A 1 101 ? -3.585  14.341  -0.499  1.00 0.00 ? 119 PHE A CE1  2  
ATOM 3616  C CE2  . PHE A 1 101 ? -4.323  14.655  1.754   1.00 0.00 ? 119 PHE A CE2  2  
ATOM 3617  C CZ   . PHE A 1 101 ? -3.883  15.182  0.555   1.00 0.00 ? 119 PHE A CZ   2  
ATOM 3618  H H    . PHE A 1 101 ? -3.437  8.567   2.223   1.00 0.00 ? 119 PHE A H    2  
ATOM 3619  H HA   . PHE A 1 101 ? -2.622  10.213  -0.077  1.00 0.00 ? 119 PHE A HA   2  
ATOM 3620  H HB3  . PHE A 1 101 ? -4.781  10.759  1.961   1.00 0.00 ? 119 PHE A HB3  2  
ATOM 3621  H HD1  . PHE A 1 101 ? -3.491  12.316  -1.176  1.00 0.00 ? 119 PHE A HD1  2  
ATOM 3622  H HD2  . PHE A 1 101 ? -4.804  12.877  2.835   1.00 0.00 ? 119 PHE A HD2  2  
ATOM 3623  H HE1  . PHE A 1 101 ? -3.241  14.750  -1.438  1.00 0.00 ? 119 PHE A HE1  2  
ATOM 3624  H HE2  . PHE A 1 101 ? -4.556  15.310  2.578   1.00 0.00 ? 119 PHE A HE2  2  
ATOM 3625  H HZ   . PHE A 1 101 ? -3.775  16.250  0.441   1.00 0.00 ? 119 PHE A HZ   2  
ATOM 3626  N N    . ASN A 1 102 ? -1.078  11.644  1.259   1.00 0.00 ? 120 ASN A N    2  
ATOM 3627  C CA   . ASN A 1 102 ? -0.044  12.336  2.019   1.00 0.00 ? 120 ASN A CA   2  
ATOM 3628  C C    . ASN A 1 102 ? 0.139   13.763  1.514   1.00 0.00 ? 120 ASN A C    2  
ATOM 3629  O O    . ASN A 1 102 ? 0.366   13.988  0.326   1.00 0.00 ? 120 ASN A O    2  
ATOM 3630  C CB   . ASN A 1 102 ? 1.281   11.575  1.927   1.00 0.00 ? 120 ASN A CB   2  
ATOM 3631  C CG   . ASN A 1 102 ? 2.155   11.787  3.148   1.00 0.00 ? 120 ASN A CG   2  
ATOM 3632  O OD1  . ASN A 1 102 ? 1.660   12.073  4.237   1.00 0.00 ? 120 ASN A OD1  2  
ATOM 3633  N ND2  . ASN A 1 102 ? 3.464   11.647  2.970   1.00 0.00 ? 120 ASN A ND2  2  
ATOM 3634  H H    . ASN A 1 102 ? -1.121  11.768  0.289   1.00 0.00 ? 120 ASN A H    2  
ATOM 3635  H HA   . ASN A 1 102 ? -0.359  12.368  3.052   1.00 0.00 ? 120 ASN A HA   2  
ATOM 3636  H HB3  . ASN A 1 102 ? 1.823   11.912  1.056   1.00 0.00 ? 120 ASN A HB3  2  
ATOM 3637  H HD21 . ASN A 1 102 ? 3.787   11.417  2.074   1.00 0.00 ? 120 ASN A HD21 2  
ATOM 3638  H HD22 . ASN A 1 102 ? 4.053   11.777  3.742   1.00 0.00 ? 120 ASN A HD22 2  
ATOM 3639  N N    . ALA A 1 103 ? 0.040   14.725  2.426   1.00 0.00 ? 121 ALA A N    2  
ATOM 3640  C CA   . ALA A 1 103 ? 0.197   16.130  2.074   1.00 0.00 ? 121 ALA A CA   2  
ATOM 3641  C C    . ALA A 1 103 ? 1.635   16.438  1.667   1.00 0.00 ? 121 ALA A C    2  
ATOM 3642  O O    . ALA A 1 103 ? 1.901   17.438  1.003   1.00 0.00 ? 121 ALA A O    2  
ATOM 3643  C CB   . ALA A 1 103 ? -0.224  17.016  3.237   1.00 0.00 ? 121 ALA A CB   2  
ATOM 3644  H H    . ALA A 1 103 ? -0.143  14.484  3.358   1.00 0.00 ? 121 ALA A H    2  
ATOM 3645  H HA   . ALA A 1 103 ? -0.455  16.341  1.239   1.00 0.00 ? 121 ALA A HA   2  
ATOM 3646  H HB1  . ALA A 1 103 ? -1.118  17.561  2.968   1.00 0.00 ? 121 ALA A HB1  2  
ATOM 3647  H HB2  . ALA A 1 103 ? -0.421  16.403  4.103   1.00 0.00 ? 121 ALA A HB2  2  
ATOM 3648  H HB3  . ALA A 1 103 ? 0.568   17.714  3.464   1.00 0.00 ? 121 ALA A HB3  2  
ATOM 3649  N N    . SER A 1 104 ? 2.557   15.568  2.071   1.00 0.00 ? 122 SER A N    2  
ATOM 3650  C CA   . SER A 1 104 ? 3.969   15.750  1.752   1.00 0.00 ? 122 SER A CA   2  
ATOM 3651  C C    . SER A 1 104 ? 4.163   15.973  0.256   1.00 0.00 ? 122 SER A C    2  
ATOM 3652  O O    . SER A 1 104 ? 4.595   17.042  -0.174  1.00 0.00 ? 122 SER A O    2  
ATOM 3653  C CB   . SER A 1 104 ? 4.775   14.532  2.208   1.00 0.00 ? 122 SER A CB   2  
ATOM 3654  O OG   . SER A 1 104 ? 4.690   14.359  3.611   1.00 0.00 ? 122 SER A OG   2  
ATOM 3655  H H    . SER A 1 104 ? 2.282   14.790  2.598   1.00 0.00 ? 122 SER A H    2  
ATOM 3656  H HA   . SER A 1 104 ? 4.319   16.622  2.282   1.00 0.00 ? 122 SER A HA   2  
ATOM 3657  H HB3  . SER A 1 104 ? 5.813   14.670  1.935   1.00 0.00 ? 122 SER A HB3  2  
ATOM 3658  H HG   . SER A 1 104 ? 5.449   14.769  4.031   1.00 0.00 ? 122 SER A HG   2  
ATOM 3659  N N    . ALA A 1 105 ? 3.840   14.954  -0.536  1.00 0.00 ? 123 ALA A N    2  
ATOM 3660  C CA   . ALA A 1 105 ? 3.978   15.038  -1.983  1.00 0.00 ? 123 ALA A CA   2  
ATOM 3661  C C    . ALA A 1 105 ? 3.295   16.288  -2.528  1.00 0.00 ? 123 ALA A C    2  
ATOM 3662  O O    . ALA A 1 105 ? 2.436   16.889  -1.881  1.00 0.00 ? 123 ALA A O    2  
ATOM 3663  C CB   . ALA A 1 105 ? 3.403   13.793  -2.642  1.00 0.00 ? 123 ALA A CB   2  
ATOM 3664  H H    . ALA A 1 105 ? 3.502   14.127  -0.135  1.00 0.00 ? 123 ALA A H    2  
ATOM 3665  H HA   . ALA A 1 105 ? 5.031   15.086  -2.218  1.00 0.00 ? 123 ALA A HA   2  
ATOM 3666  H HB1  . ALA A 1 105 ? 2.608   13.395  -2.026  1.00 0.00 ? 123 ALA A HB1  2  
ATOM 3667  H HB2  . ALA A 1 105 ? 3.011   14.048  -3.615  1.00 0.00 ? 123 ALA A HB2  2  
ATOM 3668  H HB3  . ALA A 1 105 ? 4.181   13.051  -2.749  1.00 0.00 ? 123 ALA A HB3  2  
ATOM 3669  N N    . PRO A 1 106 ? 3.684   16.693  -3.747  1.00 0.00 ? 124 PRO A N    2  
ATOM 3670  C CA   . PRO A 1 106 ? 3.122   17.877  -4.405  1.00 0.00 ? 124 PRO A CA   2  
ATOM 3671  C C    . PRO A 1 106 ? 1.671   17.670  -4.828  1.00 0.00 ? 124 PRO A C    2  
ATOM 3672  O O    . PRO A 1 106 ? 1.155   16.554  -4.834  1.00 0.00 ? 124 PRO A O    2  
ATOM 3673  C CB   . PRO A 1 106 ? 4.018   18.059  -5.632  1.00 0.00 ? 124 PRO A CB   2  
ATOM 3674  C CG   . PRO A 1 106 ? 4.557   16.699  -5.912  1.00 0.00 ? 124 PRO A CG   2  
ATOM 3675  C CD   . PRO A 1 106 ? 4.702   16.028  -4.575  1.00 0.00 ? 124 PRO A CD   2  
ATOM 3676  H HA   . PRO A 1 106 ? 3.190   18.752  -3.774  1.00 0.00 ? 124 PRO A HA   2  
ATOM 3677  H HB3  . PRO A 1 106 ? 4.809   18.758  -5.405  1.00 0.00 ? 124 PRO A HB3  2  
ATOM 3678  H HG3  . PRO A 1 106 ? 5.518   16.779  -6.398  1.00 0.00 ? 124 PRO A HG3  2  
ATOM 3679  H HD3  . PRO A 1 106 ? 5.691   16.192  -4.177  1.00 0.00 ? 124 PRO A HD3  2  
ATOM 3680  N N    . PRO A 1 107 ? 0.998   18.772  -5.192  1.00 0.00 ? 125 PRO A N    2  
ATOM 3681  C CA   . PRO A 1 107 ? -0.401  18.737  -5.626  1.00 0.00 ? 125 PRO A CA   2  
ATOM 3682  C C    . PRO A 1 107 ? -0.571  18.065  -6.984  1.00 0.00 ? 125 PRO A C    2  
ATOM 3683  O O    . PRO A 1 107 ? -1.688  17.748  -7.394  1.00 0.00 ? 125 PRO A O    2  
ATOM 3684  C CB   . PRO A 1 107 ? -0.785  20.217  -5.710  1.00 0.00 ? 125 PRO A CB   2  
ATOM 3685  C CG   . PRO A 1 107 ? 0.504   20.928  -5.941  1.00 0.00 ? 125 PRO A CG   2  
ATOM 3686  C CD   . PRO A 1 107 ? 1.552   20.136  -5.210  1.00 0.00 ? 125 PRO A CD   2  
ATOM 3687  H HA   . PRO A 1 107 ? -1.030  18.241  -4.900  1.00 0.00 ? 125 PRO A HA   2  
ATOM 3688  H HB3  . PRO A 1 107 ? -1.245  20.526  -4.783  1.00 0.00 ? 125 PRO A HB3  2  
ATOM 3689  H HG3  . PRO A 1 107 ? 0.446   21.931  -5.542  1.00 0.00 ? 125 PRO A HG3  2  
ATOM 3690  H HD3  . PRO A 1 107 ? 1.678   20.513  -4.206  1.00 0.00 ? 125 PRO A HD3  2  
ATOM 3691  N N    . GLU A 1 108 ? 0.543   17.852  -7.677  1.00 0.00 ? 126 GLU A N    2  
ATOM 3692  C CA   . GLU A 1 108 ? 0.517   17.218  -8.990  1.00 0.00 ? 126 GLU A CA   2  
ATOM 3693  C C    . GLU A 1 108 ? 1.161   15.835  -8.941  1.00 0.00 ? 126 GLU A C    2  
ATOM 3694  O O    . GLU A 1 108 ? 1.476   15.325  -7.865  1.00 0.00 ? 126 GLU A O    2  
ATOM 3695  C CB   . GLU A 1 108 ? 1.236   18.092  -10.018 1.00 0.00 ? 126 GLU A CB   2  
ATOM 3696  C CG   . GLU A 1 108 ? 2.719   18.268  -9.734  1.00 0.00 ? 126 GLU A CG   2  
ATOM 3697  C CD   . GLU A 1 108 ? 3.423   19.087  -10.799 1.00 0.00 ? 126 GLU A CD   2  
ATOM 3698  O OE1  . GLU A 1 108 ? 3.280   20.328  -10.784 1.00 0.00 ? 126 GLU A OE1  2  
ATOM 3699  O OE2  . GLU A 1 108 ? 4.118   18.488  -11.645 1.00 0.00 ? 126 GLU A OE2  2  
ATOM 3700  H H    . GLU A 1 108 ? 1.403   18.127  -7.296  1.00 0.00 ? 126 GLU A H    2  
ATOM 3701  H HA   . GLU A 1 108 ? -0.517  17.109  -9.284  1.00 0.00 ? 126 GLU A HA   2  
ATOM 3702  H HB3  . GLU A 1 108 ? 0.775   19.068  -10.029 1.00 0.00 ? 126 GLU A HB3  2  
ATOM 3703  H HG3  . GLU A 1 108 ? 3.182   17.294  -9.685  1.00 0.00 ? 126 GLU A HG3  2  
ATOM 3704  N N    . GLU A 1 109 ? 1.351   15.235  -10.110 1.00 0.00 ? 127 GLU A N    2  
ATOM 3705  C CA   . GLU A 1 109 ? 1.958   13.912  -10.200 1.00 0.00 ? 127 GLU A CA   2  
ATOM 3706  C C    . GLU A 1 109 ? 3.445   13.971  -9.868  1.00 0.00 ? 127 GLU A C    2  
ATOM 3707  O O    . GLU A 1 109 ? 4.168   14.841  -10.354 1.00 0.00 ? 127 GLU A O    2  
ATOM 3708  C CB   . GLU A 1 109 ? 1.758   13.329  -11.602 1.00 0.00 ? 127 GLU A CB   2  
ATOM 3709  C CG   . GLU A 1 109 ? 2.489   14.098  -12.689 1.00 0.00 ? 127 GLU A CG   2  
ATOM 3710  C CD   . GLU A 1 109 ? 2.076   13.670  -14.084 1.00 0.00 ? 127 GLU A CD   2  
ATOM 3711  O OE1  . GLU A 1 109 ? 0.971   14.052  -14.519 1.00 0.00 ? 127 GLU A OE1  2  
ATOM 3712  O OE2  . GLU A 1 109 ? 2.861   12.953  -14.740 1.00 0.00 ? 127 GLU A OE2  2  
ATOM 3713  H H    . GLU A 1 109 ? 1.079   15.693  -10.933 1.00 0.00 ? 127 GLU A H    2  
ATOM 3714  H HA   . GLU A 1 109 ? 1.465   13.273  -9.482  1.00 0.00 ? 127 GLU A HA   2  
ATOM 3715  H HB3  . GLU A 1 109 ? 0.704   13.334  -11.833 1.00 0.00 ? 127 GLU A HB3  2  
ATOM 3716  H HG3  . GLU A 1 109 ? 3.551   13.933  -12.577 1.00 0.00 ? 127 GLU A HG3  2  
ATOM 3717  N N    . ASP A 1 110 ? 3.897   13.038  -9.035  1.00 0.00 ? 128 ASP A N    2  
ATOM 3718  C CA   . ASP A 1 110 ? 5.299   12.982  -8.637  1.00 0.00 ? 128 ASP A CA   2  
ATOM 3719  C C    . ASP A 1 110 ? 5.799   11.542  -8.612  1.00 0.00 ? 128 ASP A C    2  
ATOM 3720  O O    . ASP A 1 110 ? 5.549   10.803  -7.659  1.00 0.00 ? 128 ASP A O    2  
ATOM 3721  C CB   . ASP A 1 110 ? 5.486   13.626  -7.263  1.00 0.00 ? 128 ASP A CB   2  
ATOM 3722  C CG   . ASP A 1 110 ? 6.869   14.223  -7.087  1.00 0.00 ? 128 ASP A CG   2  
ATOM 3723  O OD1  . ASP A 1 110 ? 7.142   15.276  -7.700  1.00 0.00 ? 128 ASP A OD1  2  
ATOM 3724  O OD2  . ASP A 1 110 ? 7.678   13.638  -6.339  1.00 0.00 ? 128 ASP A OD2  2  
ATOM 3725  H H    . ASP A 1 110 ? 3.271   12.372  -8.681  1.00 0.00 ? 128 ASP A H    2  
ATOM 3726  H HA   . ASP A 1 110 ? 5.871   13.536  -9.365  1.00 0.00 ? 128 ASP A HA   2  
ATOM 3727  H HB3  . ASP A 1 110 ? 5.338   12.877  -6.499  1.00 0.00 ? 128 ASP A HB3  2  
ATOM 3728  N N    . CYS A 1 111 ? 6.507   11.148  -9.665  1.00 0.00 ? 129 CYS A N    2  
ATOM 3729  C CA   . CYS A 1 111 ? 7.042   9.796   -9.766  1.00 0.00 ? 129 CYS A CA   2  
ATOM 3730  C C    . CYS A 1 111 ? 8.339   9.664   -8.974  1.00 0.00 ? 129 CYS A C    2  
ATOM 3731  O O    . CYS A 1 111 ? 9.382   9.303   -9.521  1.00 0.00 ? 129 CYS A O    2  
ATOM 3732  C CB   . CYS A 1 111 ? 7.286   9.429   -11.230 1.00 0.00 ? 129 CYS A CB   2  
ATOM 3733  S SG   . CYS A 1 111 ? 5.813   8.794   -12.093 1.00 0.00 ? 129 CYS A SG   2  
ATOM 3734  H H    . CYS A 1 111 ? 6.674   11.784  -10.394 1.00 0.00 ? 129 CYS A H    2  
ATOM 3735  H HA   . CYS A 1 111 ? 6.312   9.118   -9.351  1.00 0.00 ? 129 CYS A HA   2  
ATOM 3736  H HB3  . CYS A 1 111 ? 8.050   8.668   -11.280 1.00 0.00 ? 129 CYS A HB3  2  
ATOM 3737  N N    . THR A 1 112 ? 8.269   9.959   -7.679  1.00 0.00 ? 130 THR A N    2  
ATOM 3738  C CA   . THR A 1 112 ? 9.438   9.875   -6.811  1.00 0.00 ? 130 THR A CA   2  
ATOM 3739  C C    . THR A 1 112 ? 9.039   9.970   -5.343  1.00 0.00 ? 130 THR A C    2  
ATOM 3740  O O    . THR A 1 112 ? 7.895   10.286  -5.020  1.00 0.00 ? 130 THR A O    2  
ATOM 3741  C CB   . THR A 1 112 ? 10.455  10.987  -7.128  1.00 0.00 ? 130 THR A CB   2  
ATOM 3742  O OG1  . THR A 1 112 ? 9.796   12.083  -7.772  1.00 0.00 ? 130 THR A OG1  2  
ATOM 3743  C CG2  . THR A 1 112 ? 11.569  10.464  -8.021  1.00 0.00 ? 130 THR A CG2  2  
ATOM 3744  H H    . THR A 1 112 ? 7.410   10.240  -7.300  1.00 0.00 ? 130 THR A H    2  
ATOM 3745  H HA   . THR A 1 112 ? 9.913   8.920   -6.984  1.00 0.00 ? 130 THR A HA   2  
ATOM 3746  H HB   . THR A 1 112 ? 10.887  11.334  -6.200  1.00 0.00 ? 130 THR A HB   2  
ATOM 3747  H HG1  . THR A 1 112 ? 10.076  12.908  -7.368  1.00 0.00 ? 130 THR A HG1  2  
ATOM 3748  H HG21 . THR A 1 112 ? 11.658  11.093  -8.893  1.00 0.00 ? 130 THR A HG21 2  
ATOM 3749  H HG22 . THR A 1 112 ? 11.340  9.453   -8.326  1.00 0.00 ? 130 THR A HG22 2  
ATOM 3750  H HG23 . THR A 1 112 ? 12.501  10.472  -7.474  1.00 0.00 ? 130 THR A HG23 2  
ATOM 3751  N N    . SER A 1 113 ? 9.991   9.693   -4.457  1.00 0.00 ? 131 SER A N    2  
ATOM 3752  C CA   . SER A 1 113 ? 9.738   9.744   -3.022  1.00 0.00 ? 131 SER A CA   2  
ATOM 3753  C C    . SER A 1 113 ? 9.936   11.158  -2.485  1.00 0.00 ? 131 SER A C    2  
ATOM 3754  O O    . SER A 1 113 ? 10.527  12.011  -3.150  1.00 0.00 ? 131 SER A O    2  
ATOM 3755  C CB   . SER A 1 113 ? 10.662  8.774   -2.284  1.00 0.00 ? 131 SER A CB   2  
ATOM 3756  O OG   . SER A 1 113 ? 11.895  9.391   -1.959  1.00 0.00 ? 131 SER A OG   2  
ATOM 3757  H H    . SER A 1 113 ? 10.884  9.446   -4.777  1.00 0.00 ? 131 SER A H    2  
ATOM 3758  H HA   . SER A 1 113 ? 8.712   9.449   -2.856  1.00 0.00 ? 131 SER A HA   2  
ATOM 3759  H HB3  . SER A 1 113 ? 10.856  7.918   -2.915  1.00 0.00 ? 131 SER A HB3  2  
ATOM 3760  H HG   . SER A 1 113 ? 12.091  9.246   -1.030  1.00 0.00 ? 131 SER A HG   2  
ATOM 3761  N N    . VAL A 1 114 ? 9.436   11.402  -1.278  1.00 0.00 ? 132 VAL A N    2  
ATOM 3762  C CA   . VAL A 1 114 ? 9.558   12.713  -0.650  1.00 0.00 ? 132 VAL A CA   2  
ATOM 3763  C C    . VAL A 1 114 ? 9.792   12.583  0.850   1.00 0.00 ? 132 VAL A C    2  
ATOM 3764  O O    . VAL A 1 114 ? 10.612  13.300  1.427   1.00 0.00 ? 132 VAL A O    2  
ATOM 3765  C CB   . VAL A 1 114 ? 8.300   13.569  -0.890  1.00 0.00 ? 132 VAL A CB   2  
ATOM 3766  C CG1  . VAL A 1 114 ? 8.474   14.955  -0.287  1.00 0.00 ? 132 VAL A CG1  2  
ATOM 3767  C CG2  . VAL A 1 114 ? 7.993   13.660  -2.377  1.00 0.00 ? 132 VAL A CG2  2  
ATOM 3768  H H    . VAL A 1 114 ? 8.974   10.684  -0.798  1.00 0.00 ? 132 VAL A H    2  
ATOM 3769  H HA   . VAL A 1 114 ? 10.403  13.219  -1.094  1.00 0.00 ? 132 VAL A HA   2  
ATOM 3770  H HB   . VAL A 1 114 ? 7.465   13.090  -0.400  1.00 0.00 ? 132 VAL A HB   2  
ATOM 3771  H HG11 . VAL A 1 114 ? 8.301   14.907  0.779   1.00 0.00 ? 132 VAL A HG11 2  
ATOM 3772  H HG12 . VAL A 1 114 ? 9.479   15.306  -0.475  1.00 0.00 ? 132 VAL A HG12 2  
ATOM 3773  H HG13 . VAL A 1 114 ? 7.765   15.635  -0.735  1.00 0.00 ? 132 VAL A HG13 2  
ATOM 3774  H HG21 . VAL A 1 114 ? 7.475   14.587  -2.580  1.00 0.00 ? 132 VAL A HG21 2  
ATOM 3775  H HG22 . VAL A 1 114 ? 8.917   13.635  -2.937  1.00 0.00 ? 132 VAL A HG22 2  
ATOM 3776  H HG23 . VAL A 1 114 ? 7.372   12.828  -2.669  1.00 0.00 ? 132 VAL A HG23 2  
ATOM 3777  N N    . THR A 1 115 ? 9.069   11.663  1.480   1.00 0.00 ? 133 THR A N    2  
ATOM 3778  C CA   . THR A 1 115 ? 9.198   11.439  2.915   1.00 0.00 ? 133 THR A CA   2  
ATOM 3779  C C    . THR A 1 115 ? 9.091   9.956   3.252   1.00 0.00 ? 133 THR A C    2  
ATOM 3780  O O    . THR A 1 115 ? 8.348   9.215   2.606   1.00 0.00 ? 133 THR A O    2  
ATOM 3781  C CB   . THR A 1 115 ? 8.123   12.213  3.703   1.00 0.00 ? 133 THR A CB   2  
ATOM 3782  O OG1  . THR A 1 115 ? 8.110   11.779  5.067   1.00 0.00 ? 133 THR A OG1  2  
ATOM 3783  C CG2  . THR A 1 115 ? 6.747   12.005  3.087   1.00 0.00 ? 133 THR A CG2  2  
ATOM 3784  H H    . THR A 1 115 ? 8.432   11.123  0.967   1.00 0.00 ? 133 THR A H    2  
ATOM 3785  H HA   . THR A 1 115 ? 10.168  11.799  3.223   1.00 0.00 ? 133 THR A HA   2  
ATOM 3786  H HB   . THR A 1 115 ? 8.361   13.265  3.669   1.00 0.00 ? 133 THR A HB   2  
ATOM 3787  H HG1  . THR A 1 115 ? 7.557   10.999  5.150   1.00 0.00 ? 133 THR A HG1  2  
ATOM 3788  H HG21 . THR A 1 115 ? 6.722   12.448  2.102   1.00 0.00 ? 133 THR A HG21 2  
ATOM 3789  H HG22 . THR A 1 115 ? 6.000   12.471  3.712   1.00 0.00 ? 133 THR A HG22 2  
ATOM 3790  H HG23 . THR A 1 115 ? 6.543   10.947  3.010   1.00 0.00 ? 133 THR A HG23 2  
ATOM 3791  N N    . ASP A 1 116 ? 9.836   9.530   4.265   1.00 0.00 ? 134 ASP A N    2  
ATOM 3792  C CA   . ASP A 1 116 ? 9.824   8.134   4.689   1.00 0.00 ? 134 ASP A CA   2  
ATOM 3793  C C    . ASP A 1 116 ? 8.917   7.942   5.900   1.00 0.00 ? 134 ASP A C    2  
ATOM 3794  O O    . ASP A 1 116 ? 8.250   8.878   6.346   1.00 0.00 ? 134 ASP A O    2  
ATOM 3795  C CB   . ASP A 1 116 ? 11.242  7.667   5.019   1.00 0.00 ? 134 ASP A CB   2  
ATOM 3796  C CG   . ASP A 1 116 ? 11.901  8.523   6.082   1.00 0.00 ? 134 ASP A CG   2  
ATOM 3797  O OD1  . ASP A 1 116 ? 11.586  8.334   7.276   1.00 0.00 ? 134 ASP A OD1  2  
ATOM 3798  O OD2  . ASP A 1 116 ? 12.733  9.383   5.720   1.00 0.00 ? 134 ASP A OD2  2  
ATOM 3799  H H    . ASP A 1 116 ? 10.408  10.168  4.740   1.00 0.00 ? 134 ASP A H    2  
ATOM 3800  H HA   . ASP A 1 116 ? 9.441   7.544   3.871   1.00 0.00 ? 134 ASP A HA   2  
ATOM 3801  H HB3  . ASP A 1 116 ? 11.845  7.708   4.124   1.00 0.00 ? 134 ASP A HB3  2  
ATOM 3802  N N    . LEU A 1 117 ? 8.895   6.725   6.429   1.00 0.00 ? 135 LEU A N    2  
ATOM 3803  C CA   . LEU A 1 117 ? 8.068   6.408   7.590   1.00 0.00 ? 135 LEU A CA   2  
ATOM 3804  C C    . LEU A 1 117 ? 8.284   7.426   8.704   1.00 0.00 ? 135 LEU A C    2  
ATOM 3805  O O    . LEU A 1 117 ? 9.342   8.048   8.816   1.00 0.00 ? 135 LEU A O    2  
ATOM 3806  C CB   . LEU A 1 117 ? 8.388   5.002   8.100   1.00 0.00 ? 135 LEU A CB   2  
ATOM 3807  C CG   . LEU A 1 117 ? 8.484   3.908   7.036   1.00 0.00 ? 135 LEU A CG   2  
ATOM 3808  C CD1  . LEU A 1 117 ? 9.939   3.622   6.697   1.00 0.00 ? 135 LEU A CD1  2  
ATOM 3809  C CD2  . LEU A 1 117 ? 7.787   2.641   7.508   1.00 0.00 ? 135 LEU A CD2  2  
ATOM 3810  H H    . LEU A 1 117 ? 9.448   6.020   6.033   1.00 0.00 ? 135 LEU A H    2  
ATOM 3811  H HA   . LEU A 1 117 ? 7.035   6.444   7.280   1.00 0.00 ? 135 LEU A HA   2  
ATOM 3812  H HB3  . LEU A 1 117 ? 7.611   4.720   8.797   1.00 0.00 ? 135 LEU A HB3  2  
ATOM 3813  H HG   . LEU A 1 117 ? 7.992   4.247   6.134   1.00 0.00 ? 135 LEU A HG   2  
ATOM 3814  H HD11 . LEU A 1 117 ? 10.297  2.805   7.304   1.00 0.00 ? 135 LEU A HD11 2  
ATOM 3815  H HD12 . LEU A 1 117 ? 10.534  4.503   6.888   1.00 0.00 ? 135 LEU A HD12 2  
ATOM 3816  H HD13 . LEU A 1 117 ? 10.019  3.355   5.652   1.00 0.00 ? 135 LEU A HD13 2  
ATOM 3817  H HD21 . LEU A 1 117 ? 6.855   2.524   6.975   1.00 0.00 ? 135 LEU A HD21 2  
ATOM 3818  H HD22 . LEU A 1 117 ? 7.587   2.714   8.567   1.00 0.00 ? 135 LEU A HD22 2  
ATOM 3819  H HD23 . LEU A 1 117 ? 8.421   1.789   7.318   1.00 0.00 ? 135 LEU A HD23 2  
ATOM 3820  N N    . PRO A 1 118 ? 7.259   7.602   9.552   1.00 0.00 ? 136 PRO A N    2  
ATOM 3821  C CA   . PRO A 1 118 ? 7.312   8.542   10.675  1.00 0.00 ? 136 PRO A CA   2  
ATOM 3822  C C    . PRO A 1 118 ? 8.268   8.082   11.771  1.00 0.00 ? 136 PRO A C    2  
ATOM 3823  O O    . PRO A 1 118 ? 8.877   8.899   12.459  1.00 0.00 ? 136 PRO A O    2  
ATOM 3824  C CB   . PRO A 1 118 ? 5.872   8.558   11.194  1.00 0.00 ? 136 PRO A CB   2  
ATOM 3825  C CG   . PRO A 1 118 ? 5.307   7.241   10.784  1.00 0.00 ? 136 PRO A CG   2  
ATOM 3826  C CD   . PRO A 1 118 ? 5.969   6.895   9.479   1.00 0.00 ? 136 PRO A CD   2  
ATOM 3827  H HA   . PRO A 1 118 ? 7.590   9.534   10.350  1.00 0.00 ? 136 PRO A HA   2  
ATOM 3828  H HB3  . PRO A 1 118 ? 5.332   9.377   10.741  1.00 0.00 ? 136 PRO A HB3  2  
ATOM 3829  H HG3  . PRO A 1 118 ? 4.239   7.325   10.652  1.00 0.00 ? 136 PRO A HG3  2  
ATOM 3830  H HD3  . PRO A 1 118 ? 5.380   7.255   8.650   1.00 0.00 ? 136 PRO A HD3  2  
ATOM 3831  N N    . ASN A 1 119 ? 8.393   6.768   11.928  1.00 0.00 ? 137 ASN A N    2  
ATOM 3832  C CA   . ASN A 1 119 ? 9.275   6.201   12.941  1.00 0.00 ? 137 ASN A CA   2  
ATOM 3833  C C    . ASN A 1 119 ? 10.471  5.506   12.294  1.00 0.00 ? 137 ASN A C    2  
ATOM 3834  O O    . ASN A 1 119 ? 11.529  5.375   12.906  1.00 0.00 ? 137 ASN A O    2  
ATOM 3835  C CB   . ASN A 1 119 ? 8.508   5.208   13.816  1.00 0.00 ? 137 ASN A CB   2  
ATOM 3836  C CG   . ASN A 1 119 ? 7.089   5.663   14.100  1.00 0.00 ? 137 ASN A CG   2  
ATOM 3837  O OD1  . ASN A 1 119 ? 6.124   5.003   13.716  1.00 0.00 ? 137 ASN A OD1  2  
ATOM 3838  N ND2  . ASN A 1 119 ? 6.957   6.799   14.776  1.00 0.00 ? 137 ASN A ND2  2  
ATOM 3839  H H    . ASN A 1 119 ? 7.880   6.166   11.349  1.00 0.00 ? 137 ASN A H    2  
ATOM 3840  H HA   . ASN A 1 119 ? 9.634   7.009   13.559  1.00 0.00 ? 137 ASN A HA   2  
ATOM 3841  H HB3  . ASN A 1 119 ? 9.024   5.092   14.757  1.00 0.00 ? 137 ASN A HB3  2  
ATOM 3842  H HD21 . ASN A 1 119 ? 7.770   7.272   15.050  1.00 0.00 ? 137 ASN A HD21 2  
ATOM 3843  H HD22 . ASN A 1 119 ? 6.051   7.116   14.973  1.00 0.00 ? 137 ASN A HD22 2  
ATOM 3844  N N    . ALA A 1 120 ? 10.290  5.065   11.055  1.00 0.00 ? 138 ALA A N    2  
ATOM 3845  C CA   . ALA A 1 120 ? 11.355  4.387   10.323  1.00 0.00 ? 138 ALA A CA   2  
ATOM 3846  C C    . ALA A 1 120 ? 11.737  3.075   11.000  1.00 0.00 ? 138 ALA A C    2  
ATOM 3847  O O    . ALA A 1 120 ? 12.877  2.896   11.429  1.00 0.00 ? 138 ALA A O    2  
ATOM 3848  C CB   . ALA A 1 120 ? 12.571  5.293   10.200  1.00 0.00 ? 138 ALA A CB   2  
ATOM 3849  H H    . ALA A 1 120 ? 9.424   5.200   10.619  1.00 0.00 ? 138 ALA A H    2  
ATOM 3850  H HA   . ALA A 1 120 ? 10.992  4.175   9.327   1.00 0.00 ? 138 ALA A HA   2  
ATOM 3851  H HB1  . ALA A 1 120 ? 12.248  6.299   9.967   1.00 0.00 ? 138 ALA A HB1  2  
ATOM 3852  H HB2  . ALA A 1 120 ? 13.113  5.297   11.134  1.00 0.00 ? 138 ALA A HB2  2  
ATOM 3853  H HB3  . ALA A 1 120 ? 13.213  4.930   9.411   1.00 0.00 ? 138 ALA A HB3  2  
ATOM 3854  N N    . PHE A 1 121 ? 10.777  2.162   11.096  1.00 0.00 ? 139 PHE A N    2  
ATOM 3855  C CA   . PHE A 1 121 ? 11.012  0.868   11.723  1.00 0.00 ? 139 PHE A CA   2  
ATOM 3856  C C    . PHE A 1 121 ? 11.045  -0.245  10.679  1.00 0.00 ? 139 PHE A C    2  
ATOM 3857  O O    . PHE A 1 121 ? 10.675  -0.037  9.522   1.00 0.00 ? 139 PHE A O    2  
ATOM 3858  C CB   . PHE A 1 121 ? 9.928   0.575   12.761  1.00 0.00 ? 139 PHE A CB   2  
ATOM 3859  C CG   . PHE A 1 121 ? 10.235  1.133   14.122  1.00 0.00 ? 139 PHE A CG   2  
ATOM 3860  C CD1  . PHE A 1 121 ? 10.540  2.475   14.282  1.00 0.00 ? 139 PHE A CD1  2  
ATOM 3861  C CD2  . PHE A 1 121 ? 10.216  0.315   15.240  1.00 0.00 ? 139 PHE A CD2  2  
ATOM 3862  C CE1  . PHE A 1 121 ? 10.824  2.989   15.533  1.00 0.00 ? 139 PHE A CE1  2  
ATOM 3863  C CE2  . PHE A 1 121 ? 10.498  0.825   16.495  1.00 0.00 ? 139 PHE A CE2  2  
ATOM 3864  C CZ   . PHE A 1 121 ? 10.802  2.165   16.640  1.00 0.00 ? 139 PHE A CZ   2  
ATOM 3865  H H    . PHE A 1 121 ? 9.887   2.364   10.735  1.00 0.00 ? 139 PHE A H    2  
ATOM 3866  H HA   . PHE A 1 121 ? 11.970  0.909   12.217  1.00 0.00 ? 139 PHE A HA   2  
ATOM 3867  H HB3  . PHE A 1 121 ? 9.810   -0.493  12.858  1.00 0.00 ? 139 PHE A HB3  2  
ATOM 3868  H HD1  . PHE A 1 121 ? 10.557  3.121   13.418  1.00 0.00 ? 139 PHE A HD1  2  
ATOM 3869  H HD2  . PHE A 1 121 ? 9.978   -0.733  15.127  1.00 0.00 ? 139 PHE A HD2  2  
ATOM 3870  H HE1  . PHE A 1 121 ? 11.061  4.037   15.644  1.00 0.00 ? 139 PHE A HE1  2  
ATOM 3871  H HE2  . PHE A 1 121 ? 10.480  0.177   17.357  1.00 0.00 ? 139 PHE A HE2  2  
ATOM 3872  H HZ   . PHE A 1 121 ? 11.024  2.565   17.618  1.00 0.00 ? 139 PHE A HZ   2  
ATOM 3873  N N    . ASP A 1 122 ? 11.491  -1.424  11.095  1.00 0.00 ? 140 ASP A N    2  
ATOM 3874  C CA   . ASP A 1 122 ? 11.573  -2.571  10.196  1.00 0.00 ? 140 ASP A CA   2  
ATOM 3875  C C    . ASP A 1 122 ? 10.775  -3.749  10.746  1.00 0.00 ? 140 ASP A C    2  
ATOM 3876  O O    . ASP A 1 122 ? 11.339  -4.676  11.328  1.00 0.00 ? 140 ASP A O    2  
ATOM 3877  C CB   . ASP A 1 122 ? 13.031  -2.979  9.987   1.00 0.00 ? 140 ASP A CB   2  
ATOM 3878  C CG   . ASP A 1 122 ? 13.714  -2.160  8.910   1.00 0.00 ? 140 ASP A CG   2  
ATOM 3879  O OD1  . ASP A 1 122 ? 13.796  -0.923  9.066   1.00 0.00 ? 140 ASP A OD1  2  
ATOM 3880  O OD2  . ASP A 1 122 ? 14.167  -2.755  7.908   1.00 0.00 ? 140 ASP A OD2  2  
ATOM 3881  H H    . ASP A 1 122 ? 11.772  -1.528  12.028  1.00 0.00 ? 140 ASP A H    2  
ATOM 3882  H HA   . ASP A 1 122 ? 11.151  -2.279  9.247   1.00 0.00 ? 140 ASP A HA   2  
ATOM 3883  H HB3  . ASP A 1 122 ? 13.069  -4.020  9.702   1.00 0.00 ? 140 ASP A HB3  2  
ATOM 3884  N N    . GLY A 1 123 ? 9.459   -3.708  10.557  1.00 0.00 ? 141 GLY A N    2  
ATOM 3885  C CA   . GLY A 1 123 ? 8.607   -4.777  11.040  1.00 0.00 ? 141 GLY A CA   2  
ATOM 3886  C C    . GLY A 1 123 ? 8.554   -5.953  10.087  1.00 0.00 ? 141 GLY A C    2  
ATOM 3887  O O    . GLY A 1 123 ? 9.369   -6.075  9.171   1.00 0.00 ? 141 GLY A O    2  
ATOM 3888  H H    . GLY A 1 123 ? 9.066   -2.944  10.085  1.00 0.00 ? 141 GLY A H    2  
ATOM 3889  H HA2  . GLY A 1 123 ? 8.979   -5.116  11.994  1.00 0.00 ? 141 GLY A HA2  2  
ATOM 3890  H HA3  . GLY A 1 123 ? 7.606   -4.391  11.173  1.00 0.00 ? 141 GLY A HA3  2  
ATOM 3891  N N    . PRO A 1 124 ? 7.577   -6.848  10.297  1.00 0.00 ? 142 PRO A N    2  
ATOM 3892  C CA   . PRO A 1 124 ? 7.400   -8.039  9.458   1.00 0.00 ? 142 PRO A CA   2  
ATOM 3893  C C    . PRO A 1 124 ? 6.914   -7.692  8.055   1.00 0.00 ? 142 PRO A C    2  
ATOM 3894  O O    . PRO A 1 124 ? 6.429   -8.557  7.325   1.00 0.00 ? 142 PRO A O    2  
ATOM 3895  C CB   . PRO A 1 124 ? 6.337   -8.844  10.209  1.00 0.00 ? 142 PRO A CB   2  
ATOM 3896  C CG   . PRO A 1 124 ? 5.577   -7.831  10.994  1.00 0.00 ? 142 PRO A CG   2  
ATOM 3897  C CD   . PRO A 1 124 ? 6.571   -6.767  11.368  1.00 0.00 ? 142 PRO A CD   2  
ATOM 3898  H HA   . PRO A 1 124 ? 8.310   -8.616  9.391   1.00 0.00 ? 142 PRO A HA   2  
ATOM 3899  H HB3  . PRO A 1 124 ? 6.816   -9.566  10.854  1.00 0.00 ? 142 PRO A HB3  2  
ATOM 3900  H HG3  . PRO A 1 124 ? 5.165   -8.289  11.882  1.00 0.00 ? 142 PRO A HG3  2  
ATOM 3901  H HD3  . PRO A 1 124 ? 7.014   -6.985  12.330  1.00 0.00 ? 142 PRO A HD3  2  
ATOM 3902  N N    . ILE A 1 125 ? 7.048   -6.423  7.684   1.00 0.00 ? 143 ILE A N    2  
ATOM 3903  C CA   . ILE A 1 125 ? 6.624   -5.964  6.368   1.00 0.00 ? 143 ILE A CA   2  
ATOM 3904  C C    . ILE A 1 125 ? 7.564   -4.889  5.832   1.00 0.00 ? 143 ILE A C    2  
ATOM 3905  O O    . ILE A 1 125 ? 7.751   -3.844  6.456   1.00 0.00 ? 143 ILE A O    2  
ATOM 3906  C CB   . ILE A 1 125 ? 5.190   -5.406  6.402   1.00 0.00 ? 143 ILE A CB   2  
ATOM 3907  C CG1  . ILE A 1 125 ? 4.249   -6.399  7.087   1.00 0.00 ? 143 ILE A CG1  2  
ATOM 3908  C CG2  . ILE A 1 125 ? 4.707   -5.100  4.992   1.00 0.00 ? 143 ILE A CG2  2  
ATOM 3909  C CD1  . ILE A 1 125 ? 2.827   -5.897  7.211   1.00 0.00 ? 143 ILE A CD1  2  
ATOM 3910  H H    . ILE A 1 125 ? 7.443   -5.781  8.310   1.00 0.00 ? 143 ILE A H    2  
ATOM 3911  H HA   . ILE A 1 125 ? 6.645   -6.811  5.697   1.00 0.00 ? 143 ILE A HA   2  
ATOM 3912  H HB   . ILE A 1 125 ? 5.198   -4.483  6.961   1.00 0.00 ? 143 ILE A HB   2  
ATOM 3913  H HG13 . ILE A 1 125 ? 4.618   -6.604  8.082   1.00 0.00 ? 143 ILE A HG13 2  
ATOM 3914  H HG21 . ILE A 1 125 ? 5.445   -4.496  4.481   1.00 0.00 ? 143 ILE A HG21 2  
ATOM 3915  H HG22 . ILE A 1 125 ? 4.564   -6.023  4.451   1.00 0.00 ? 143 ILE A HG22 2  
ATOM 3916  H HG23 . ILE A 1 125 ? 3.774   -4.561  5.038   1.00 0.00 ? 143 ILE A HG23 2  
ATOM 3917  H HD11 . ILE A 1 125 ? 2.289   -6.513  7.917   1.00 0.00 ? 143 ILE A HD11 2  
ATOM 3918  H HD12 . ILE A 1 125 ? 2.835   -4.874  7.558   1.00 0.00 ? 143 ILE A HD12 2  
ATOM 3919  H HD13 . ILE A 1 125 ? 2.342   -5.946  6.248   1.00 0.00 ? 143 ILE A HD13 2  
ATOM 3920  N N    . THR A 1 126 ? 8.151   -5.150  4.667   1.00 0.00 ? 144 THR A N    2  
ATOM 3921  C CA   . THR A 1 126 ? 9.071   -4.206  4.046   1.00 0.00 ? 144 THR A CA   2  
ATOM 3922  C C    . THR A 1 126 ? 8.319   -3.178  3.208   1.00 0.00 ? 144 THR A C    2  
ATOM 3923  O O    . THR A 1 126 ? 7.107   -3.285  3.018   1.00 0.00 ? 144 THR A O    2  
ATOM 3924  C CB   . THR A 1 126 ? 10.099  -4.927  3.155   1.00 0.00 ? 144 THR A CB   2  
ATOM 3925  O OG1  . THR A 1 126 ? 10.239  -6.290  3.571   1.00 0.00 ? 144 THR A OG1  2  
ATOM 3926  C CG2  . THR A 1 126 ? 11.451  -4.231  3.216   1.00 0.00 ? 144 THR A CG2  2  
ATOM 3927  H H    . THR A 1 126 ? 7.962   -6.001  4.219   1.00 0.00 ? 144 THR A H    2  
ATOM 3928  H HA   . THR A 1 126 ? 9.605   -3.693  4.834   1.00 0.00 ? 144 THR A HA   2  
ATOM 3929  H HB   . THR A 1 126 ? 9.745   -4.905  2.134   1.00 0.00 ? 144 THR A HB   2  
ATOM 3930  H HG1  . THR A 1 126 ? 10.943  -6.355  4.220   1.00 0.00 ? 144 THR A HG1  2  
ATOM 3931  H HG21 . THR A 1 126 ? 11.652  -3.752  2.270   1.00 0.00 ? 144 THR A HG21 2  
ATOM 3932  H HG22 . THR A 1 126 ? 12.221  -4.959  3.423   1.00 0.00 ? 144 THR A HG22 2  
ATOM 3933  H HG23 . THR A 1 126 ? 11.438  -3.489  4.001   1.00 0.00 ? 144 THR A HG23 2  
ATOM 3934  N N    . ILE A 1 127 ? 9.046   -2.186  2.707   1.00 0.00 ? 145 ILE A N    2  
ATOM 3935  C CA   . ILE A 1 127 ? 8.448   -1.139  1.888   1.00 0.00 ? 145 ILE A CA   2  
ATOM 3936  C C    . ILE A 1 127 ? 9.446   -0.600  0.868   1.00 0.00 ? 145 ILE A C    2  
ATOM 3937  O O    . ILE A 1 127 ? 10.638  -0.482  1.153   1.00 0.00 ? 145 ILE A O    2  
ATOM 3938  C CB   . ILE A 1 127 ? 7.931   0.027   2.750   1.00 0.00 ? 145 ILE A CB   2  
ATOM 3939  C CG1  . ILE A 1 127 ? 7.333   1.122   1.863   1.00 0.00 ? 145 ILE A CG1  2  
ATOM 3940  C CG2  . ILE A 1 127 ? 9.056   0.589   3.608   1.00 0.00 ? 145 ILE A CG2  2  
ATOM 3941  C CD1  . ILE A 1 127 ? 8.313   2.221   1.517   1.00 0.00 ? 145 ILE A CD1  2  
ATOM 3942  H H    . ILE A 1 127 ? 10.007  -2.155  2.894   1.00 0.00 ? 145 ILE A H    2  
ATOM 3943  H HA   . ILE A 1 127 ? 7.608   -1.569  1.359   1.00 0.00 ? 145 ILE A HA   2  
ATOM 3944  H HB   . ILE A 1 127 ? 7.166   -0.352  3.408   1.00 0.00 ? 145 ILE A HB   2  
ATOM 3945  H HG13 . ILE A 1 127 ? 6.496   1.571   2.376   1.00 0.00 ? 145 ILE A HG13 2  
ATOM 3946  H HG21 . ILE A 1 127 ? 9.247   -0.079  4.435   1.00 0.00 ? 145 ILE A HG21 2  
ATOM 3947  H HG22 . ILE A 1 127 ? 9.951   0.685   3.010   1.00 0.00 ? 145 ILE A HG22 2  
ATOM 3948  H HG23 . ILE A 1 127 ? 8.770   1.558   3.988   1.00 0.00 ? 145 ILE A HG23 2  
ATOM 3949  H HD11 . ILE A 1 127 ? 7.978   2.733   0.626   1.00 0.00 ? 145 ILE A HD11 2  
ATOM 3950  H HD12 . ILE A 1 127 ? 8.374   2.921   2.336   1.00 0.00 ? 145 ILE A HD12 2  
ATOM 3951  H HD13 . ILE A 1 127 ? 9.289   1.791   1.338   1.00 0.00 ? 145 ILE A HD13 2  
ATOM 3952  N N    . THR A 1 128 ? 8.952   -0.272  -0.321  1.00 0.00 ? 146 THR A N    2  
ATOM 3953  C CA   . THR A 1 128 ? 9.798   0.255   -1.383  1.00 0.00 ? 146 THR A CA   2  
ATOM 3954  C C    . THR A 1 128 ? 9.022   1.208   -2.284  1.00 0.00 ? 146 THR A C    2  
ATOM 3955  O O    . THR A 1 128 ? 7.975   0.851   -2.825  1.00 0.00 ? 146 THR A O    2  
ATOM 3956  C CB   . THR A 1 128 ? 10.393  -0.877  -2.241  1.00 0.00 ? 146 THR A CB   2  
ATOM 3957  O OG1  . THR A 1 128 ? 10.724  -1.998  -1.415  1.00 0.00 ? 146 THR A OG1  2  
ATOM 3958  C CG2  . THR A 1 128 ? 11.634  -0.401  -2.981  1.00 0.00 ? 146 THR A CG2  2  
ATOM 3959  H H    . THR A 1 128 ? 7.992   -0.388  -0.488  1.00 0.00 ? 146 THR A H    2  
ATOM 3960  H HA   . THR A 1 128 ? 10.613  0.795   -0.922  1.00 0.00 ? 146 THR A HA   2  
ATOM 3961  H HB   . THR A 1 128 ? 9.655   -1.181  -2.970  1.00 0.00 ? 146 THR A HB   2  
ATOM 3962  H HG1  . THR A 1 128 ? 11.499  -1.789  -0.888  1.00 0.00 ? 146 THR A HG1  2  
ATOM 3963  H HG21 . THR A 1 128 ? 12.370  -1.192  -2.995  1.00 0.00 ? 146 THR A HG21 2  
ATOM 3964  H HG22 . THR A 1 128 ? 12.044  0.462   -2.477  1.00 0.00 ? 146 THR A HG22 2  
ATOM 3965  H HG23 . THR A 1 128 ? 11.371  -0.136  -3.993  1.00 0.00 ? 146 THR A HG23 2  
ATOM 3966  N N    . ILE A 1 129 ? 9.541   2.421   -2.443  1.00 0.00 ? 147 ILE A N    2  
ATOM 3967  C CA   . ILE A 1 129 ? 8.897   3.424   -3.281  1.00 0.00 ? 147 ILE A CA   2  
ATOM 3968  C C    . ILE A 1 129 ? 9.565   3.508   -4.649  1.00 0.00 ? 147 ILE A C    2  
ATOM 3969  O O    . ILE A 1 129 ? 10.718  3.112   -4.815  1.00 0.00 ? 147 ILE A O    2  
ATOM 3970  C CB   . ILE A 1 129 ? 8.930   4.815   -2.619  1.00 0.00 ? 147 ILE A CB   2  
ATOM 3971  C CG1  . ILE A 1 129 ? 7.955   5.762   -3.324  1.00 0.00 ? 147 ILE A CG1  2  
ATOM 3972  C CG2  . ILE A 1 129 ? 10.341  5.382   -2.647  1.00 0.00 ? 147 ILE A CG2  2  
ATOM 3973  C CD1  . ILE A 1 129 ? 7.698   7.041   -2.562  1.00 0.00 ? 147 ILE A CD1  2  
ATOM 3974  H H    . ILE A 1 129 ? 10.379  2.646   -1.985  1.00 0.00 ? 147 ILE A H    2  
ATOM 3975  H HA   . ILE A 1 129 ? 7.864   3.134   -3.413  1.00 0.00 ? 147 ILE A HA   2  
ATOM 3976  H HB   . ILE A 1 129 ? 8.632   4.706   -1.588  1.00 0.00 ? 147 ILE A HB   2  
ATOM 3977  H HG13 . ILE A 1 129 ? 7.008   5.257   -3.456  1.00 0.00 ? 147 ILE A HG13 2  
ATOM 3978  H HG21 . ILE A 1 129 ? 10.490  5.931   -3.566  1.00 0.00 ? 147 ILE A HG21 2  
ATOM 3979  H HG22 . ILE A 1 129 ? 10.478  6.046   -1.806  1.00 0.00 ? 147 ILE A HG22 2  
ATOM 3980  H HG23 . ILE A 1 129 ? 11.054  4.574   -2.589  1.00 0.00 ? 147 ILE A HG23 2  
ATOM 3981  H HD11 . ILE A 1 129 ? 8.533   7.245   -1.907  1.00 0.00 ? 147 ILE A HD11 2  
ATOM 3982  H HD12 . ILE A 1 129 ? 7.578   7.858   -3.256  1.00 0.00 ? 147 ILE A HD12 2  
ATOM 3983  H HD13 . ILE A 1 129 ? 6.799   6.935   -1.972  1.00 0.00 ? 147 ILE A HD13 2  
ATOM 3984  N N    . VAL A 1 130 ? 8.832   4.031   -5.628  1.00 0.00 ? 148 VAL A N    2  
ATOM 3985  C CA   . VAL A 1 130 ? 9.353   4.170   -6.982  1.00 0.00 ? 148 VAL A CA   2  
ATOM 3986  C C    . VAL A 1 130 ? 10.263  5.388   -7.097  1.00 0.00 ? 148 VAL A C    2  
ATOM 3987  O O    . VAL A 1 130 ? 10.009  6.426   -6.486  1.00 0.00 ? 148 VAL A O    2  
ATOM 3988  C CB   . VAL A 1 130 ? 8.215   4.294   -8.011  1.00 0.00 ? 148 VAL A CB   2  
ATOM 3989  C CG1  . VAL A 1 130 ? 7.458   2.981   -8.131  1.00 0.00 ? 148 VAL A CG1  2  
ATOM 3990  C CG2  . VAL A 1 130 ? 7.275   5.430   -7.632  1.00 0.00 ? 148 VAL A CG2  2  
ATOM 3991  H H    . VAL A 1 130 ? 7.919   4.330   -5.433  1.00 0.00 ? 148 VAL A H    2  
ATOM 3992  H HA   . VAL A 1 130 ? 9.925   3.283   -7.213  1.00 0.00 ? 148 VAL A HA   2  
ATOM 3993  H HB   . VAL A 1 130 ? 8.651   4.523   -8.973  1.00 0.00 ? 148 VAL A HB   2  
ATOM 3994  H HG11 . VAL A 1 130 ? 8.096   2.238   -8.585  1.00 0.00 ? 148 VAL A HG11 2  
ATOM 3995  H HG12 . VAL A 1 130 ? 7.157   2.647   -7.149  1.00 0.00 ? 148 VAL A HG12 2  
ATOM 3996  H HG13 . VAL A 1 130 ? 6.581   3.126   -8.746  1.00 0.00 ? 148 VAL A HG13 2  
ATOM 3997  H HG21 . VAL A 1 130 ? 6.741   5.761   -8.510  1.00 0.00 ? 148 VAL A HG21 2  
ATOM 3998  H HG22 . VAL A 1 130 ? 6.571   5.080   -6.892  1.00 0.00 ? 148 VAL A HG22 2  
ATOM 3999  H HG23 . VAL A 1 130 ? 7.847   6.250   -7.226  1.00 0.00 ? 148 VAL A HG23 2  
ATOM 4000  N N    . ASN A 1 131 ? 11.324  5.254   -7.886  1.00 0.00 ? 149 ASN A N    2  
ATOM 4001  C CA   . ASN A 1 131 ? 12.273  6.345   -8.082  1.00 0.00 ? 149 ASN A CA   2  
ATOM 4002  C C    . ASN A 1 131 ? 11.903  7.175   -9.307  1.00 0.00 ? 149 ASN A C    2  
ATOM 4003  O O    . ASN A 1 131 ? 10.824  7.010   -9.879  1.00 0.00 ? 149 ASN A O    2  
ATOM 4004  C CB   . ASN A 1 131 ? 13.692  5.792   -8.237  1.00 0.00 ? 149 ASN A CB   2  
ATOM 4005  C CG   . ASN A 1 131 ? 14.717  6.614   -7.479  1.00 0.00 ? 149 ASN A CG   2  
ATOM 4006  O OD1  . ASN A 1 131 ? 14.426  7.717   -7.016  1.00 0.00 ? 149 ASN A OD1  2  
ATOM 4007  N ND2  . ASN A 1 131 ? 15.927  6.079   -7.353  1.00 0.00 ? 149 ASN A ND2  2  
ATOM 4008  H H    . ASN A 1 131 ? 11.473  4.402   -8.348  1.00 0.00 ? 149 ASN A H    2  
ATOM 4009  H HA   . ASN A 1 131 ? 12.236  6.978   -7.208  1.00 0.00 ? 149 ASN A HA   2  
ATOM 4010  H HB3  . ASN A 1 131 ? 13.959  5.790   -9.283  1.00 0.00 ? 149 ASN A HB3  2  
ATOM 4011  H HD21 . ASN A 1 131 ? 16.087  5.198   -7.748  1.00 0.00 ? 149 ASN A HD21 2  
ATOM 4012  H HD22 . ASN A 1 131 ? 16.608  6.590   -6.867  1.00 0.00 ? 149 ASN A HD22 2  
ATOM 4013  N N    . ARG A 1 132 ? 12.803  8.066   -9.706  1.00 0.00 ? 150 ARG A N    2  
ATOM 4014  C CA   . ARG A 1 132 ? 12.572  8.923   -10.863 1.00 0.00 ? 150 ARG A CA   2  
ATOM 4015  C C    . ARG A 1 132 ? 12.267  8.089   -12.104 1.00 0.00 ? 150 ARG A C    2  
ATOM 4016  O O    . ARG A 1 132 ? 11.490  8.500   -12.966 1.00 0.00 ? 150 ARG A O    2  
ATOM 4017  C CB   . ARG A 1 132 ? 13.791  9.811   -11.120 1.00 0.00 ? 150 ARG A CB   2  
ATOM 4018  C CG   . ARG A 1 132 ? 15.009  9.048   -11.610 1.00 0.00 ? 150 ARG A CG   2  
ATOM 4019  C CD   . ARG A 1 132 ? 16.222  9.954   -11.736 1.00 0.00 ? 150 ARG A CD   2  
ATOM 4020  N NE   . ARG A 1 132 ? 16.230  10.687  -13.000 1.00 0.00 ? 150 ARG A NE   2  
ATOM 4021  C CZ   . ARG A 1 132 ? 17.234  11.463  -13.394 1.00 0.00 ? 150 ARG A CZ   2  
ATOM 4022  N NH1  . ARG A 1 132 ? 18.306  11.608  -12.627 1.00 0.00 ? 150 ARG A NH1  2  
ATOM 4023  N NH2  . ARG A 1 132 ? 17.167  12.097  -14.557 1.00 0.00 ? 150 ARG A NH2  2  
ATOM 4024  H H    . ARG A 1 132 ? 13.645  8.152   -9.210  1.00 0.00 ? 150 ARG A H    2  
ATOM 4025  H HA   . ARG A 1 132 ? 11.719  9.549   -10.647 1.00 0.00 ? 150 ARG A HA   2  
ATOM 4026  H HB3  . ARG A 1 132 ? 14.054  10.314  -10.201 1.00 0.00 ? 150 ARG A HB3  2  
ATOM 4027  H HG3  . ARG A 1 132 ? 14.788  8.619   -12.578 1.00 0.00 ? 150 ARG A HG3  2  
ATOM 4028  H HD3  . ARG A 1 132 ? 17.116  9.350   -11.676 1.00 0.00 ? 150 ARG A HD3  2  
ATOM 4029  H HE   . ARG A 1 132 ? 15.447  10.595  -13.582 1.00 0.00 ? 150 ARG A HE   2  
ATOM 4030  H HH11 . ARG A 1 132 ? 18.358  11.131  -11.748 1.00 0.00 ? 150 ARG A HH11 2  
ATOM 4031  H HH12 . ARG A 1 132 ? 19.059  12.192  -12.925 1.00 0.00 ? 150 ARG A HH12 2  
ATOM 4032  H HH21 . ARG A 1 132 ? 16.360  11.991  -15.138 1.00 0.00 ? 150 ARG A HH21 2  
ATOM 4033  H HH22 . ARG A 1 132 ? 17.921  12.682  -14.852 1.00 0.00 ? 150 ARG A HH22 2  
ATOM 4034  N N    . ASP A 1 133 ? 12.884  6.915   -12.189 1.00 0.00 ? 151 ASP A N    2  
ATOM 4035  C CA   . ASP A 1 133 ? 12.679  6.023   -13.324 1.00 0.00 ? 151 ASP A CA   2  
ATOM 4036  C C    . ASP A 1 133 ? 11.219  5.592   -13.419 1.00 0.00 ? 151 ASP A C    2  
ATOM 4037  O O    . ASP A 1 133 ? 10.766  5.120   -14.461 1.00 0.00 ? 151 ASP A O    2  
ATOM 4038  C CB   . ASP A 1 133 ? 13.579  4.794   -13.203 1.00 0.00 ? 151 ASP A CB   2  
ATOM 4039  C CG   . ASP A 1 133 ? 15.048  5.133   -13.368 1.00 0.00 ? 151 ASP A CG   2  
ATOM 4040  O OD1  . ASP A 1 133 ? 15.437  5.563   -14.473 1.00 0.00 ? 151 ASP A OD1  2  
ATOM 4041  O OD2  . ASP A 1 133 ? 15.807  4.970   -12.390 1.00 0.00 ? 151 ASP A OD2  2  
ATOM 4042  H H    . ASP A 1 133 ? 13.492  6.643   -11.469 1.00 0.00 ? 151 ASP A H    2  
ATOM 4043  H HA   . ASP A 1 133 ? 12.939  6.563   -14.221 1.00 0.00 ? 151 ASP A HA   2  
ATOM 4044  H HB3  . ASP A 1 133 ? 13.306  4.077   -13.964 1.00 0.00 ? 151 ASP A HB3  2  
ATOM 4045  N N    . GLY A 1 134 ? 10.486  5.757   -12.322 1.00 0.00 ? 152 GLY A N    2  
ATOM 4046  C CA   . GLY A 1 134 ? 9.084   5.379   -12.301 1.00 0.00 ? 152 GLY A CA   2  
ATOM 4047  C C    . GLY A 1 134 ? 8.867   3.987   -11.742 1.00 0.00 ? 152 GLY A C    2  
ATOM 4048  O O    . GLY A 1 134 ? 9.580   3.554   -10.836 1.00 0.00 ? 152 GLY A O    2  
ATOM 4049  H H    . GLY A 1 134 ? 10.899  6.138   -11.518 1.00 0.00 ? 152 GLY A H    2  
ATOM 4050  H HA2  . GLY A 1 134 ? 8.539   6.087   -11.696 1.00 0.00 ? 152 GLY A HA2  2  
ATOM 4051  H HA3  . GLY A 1 134 ? 8.699   5.412   -13.310 1.00 0.00 ? 152 GLY A HA3  2  
ATOM 4052  N N    . THR A 1 135 ? 7.879   3.281   -12.282 1.00 0.00 ? 153 THR A N    2  
ATOM 4053  C CA   . THR A 1 135 ? 7.568   1.931   -11.831 1.00 0.00 ? 153 THR A CA   2  
ATOM 4054  C C    . THR A 1 135 ? 8.621   0.936   -12.305 1.00 0.00 ? 153 THR A C    2  
ATOM 4055  O O    . THR A 1 135 ? 8.393   0.182   -13.252 1.00 0.00 ? 153 THR A O    2  
ATOM 4056  C CB   . THR A 1 135 ? 6.184   1.475   -12.332 1.00 0.00 ? 153 THR A CB   2  
ATOM 4057  O OG1  . THR A 1 135 ? 6.046   1.769   -13.727 1.00 0.00 ? 153 THR A OG1  2  
ATOM 4058  C CG2  . THR A 1 135 ? 5.074   2.162   -11.553 1.00 0.00 ? 153 THR A CG2  2  
ATOM 4059  H H    . THR A 1 135 ? 7.347   3.679   -13.002 1.00 0.00 ? 153 THR A H    2  
ATOM 4060  H HA   . THR A 1 135 ? 7.552   1.935   -10.750 1.00 0.00 ? 153 THR A HA   2  
ATOM 4061  H HB   . THR A 1 135 ? 6.099   0.408   -12.187 1.00 0.00 ? 153 THR A HB   2  
ATOM 4062  H HG1  . THR A 1 135 ? 6.832   1.473   -14.194 1.00 0.00 ? 153 THR A HG1  2  
ATOM 4063  H HG21 . THR A 1 135 ? 4.381   2.624   -12.242 1.00 0.00 ? 153 THR A HG21 2  
ATOM 4064  H HG22 . THR A 1 135 ? 5.499   2.917   -10.909 1.00 0.00 ? 153 THR A HG22 2  
ATOM 4065  H HG23 . THR A 1 135 ? 4.550   1.432   -10.953 1.00 0.00 ? 153 THR A HG23 2  
ATOM 4066  N N    . ARG A 1 136 ? 9.772   0.939   -11.643 1.00 0.00 ? 154 ARG A N    2  
ATOM 4067  C CA   . ARG A 1 136 ? 10.861  0.036   -11.997 1.00 0.00 ? 154 ARG A CA   2  
ATOM 4068  C C    . ARG A 1 136 ? 11.623  -0.413  -10.754 1.00 0.00 ? 154 ARG A C    2  
ATOM 4069  O O    . ARG A 1 136 ? 12.768  -0.856  -10.841 1.00 0.00 ? 154 ARG A O    2  
ATOM 4070  C CB   . ARG A 1 136 ? 11.818  0.718   -12.977 1.00 0.00 ? 154 ARG A CB   2  
ATOM 4071  C CG   . ARG A 1 136 ? 12.627  -0.258  -13.815 1.00 0.00 ? 154 ARG A CG   2  
ATOM 4072  C CD   . ARG A 1 136 ? 13.480  0.467   -14.845 1.00 0.00 ? 154 ARG A CD   2  
ATOM 4073  N NE   . ARG A 1 136 ? 14.330  -0.453  -15.597 1.00 0.00 ? 154 ARG A NE   2  
ATOM 4074  C CZ   . ARG A 1 136 ? 15.191  -0.061  -16.530 1.00 0.00 ? 154 ARG A CZ   2  
ATOM 4075  N NH1  . ARG A 1 136 ? 15.317  1.226   -16.822 1.00 0.00 ? 154 ARG A NH1  2  
ATOM 4076  N NH2  . ARG A 1 136 ? 15.930  -0.957  -17.171 1.00 0.00 ? 154 ARG A NH2  2  
ATOM 4077  H H    . ARG A 1 136 ? 9.894   1.562   -10.897 1.00 0.00 ? 154 ARG A H    2  
ATOM 4078  H HA   . ARG A 1 136 ? 10.430  -0.832  -12.474 1.00 0.00 ? 154 ARG A HA   2  
ATOM 4079  H HB3  . ARG A 1 136 ? 12.505  1.335   -12.419 1.00 0.00 ? 154 ARG A HB3  2  
ATOM 4080  H HG3  . ARG A 1 136 ? 11.950  -0.925  -14.329 1.00 0.00 ? 154 ARG A HG3  2  
ATOM 4081  H HD3  . ARG A 1 136 ? 14.106  1.184   -14.334 1.00 0.00 ? 154 ARG A HD3  2  
ATOM 4082  H HE   . ARG A 1 136 ? 14.253  -1.407  -15.398 1.00 0.00 ? 154 ARG A HE   2  
ATOM 4083  H HH11 . ARG A 1 136 ? 14.762  1.905   -16.341 1.00 0.00 ? 154 ARG A HH11 2  
ATOM 4084  H HH12 . ARG A 1 136 ? 15.966  1.519   -17.525 1.00 0.00 ? 154 ARG A HH12 2  
ATOM 4085  H HH21 . ARG A 1 136 ? 15.837  -1.929  -16.954 1.00 0.00 ? 154 ARG A HH21 2  
ATOM 4086  H HH22 . ARG A 1 136 ? 16.576  -0.663  -17.873 1.00 0.00 ? 154 ARG A HH22 2  
ATOM 4087  N N    . TYR A 1 137 ? 10.979  -0.294  -9.597  1.00 0.00 ? 155 TYR A N    2  
ATOM 4088  C CA   . TYR A 1 137 ? 11.597  -0.685  -8.336  1.00 0.00 ? 155 TYR A CA   2  
ATOM 4089  C C    . TYR A 1 137 ? 10.898  -1.904  -7.741  1.00 0.00 ? 155 TYR A C    2  
ATOM 4090  O O    . TYR A 1 137 ? 10.528  -1.910  -6.567  1.00 0.00 ? 155 TYR A O    2  
ATOM 4091  C CB   . TYR A 1 137 ? 11.555  0.477   -7.343  1.00 0.00 ? 155 TYR A CB   2  
ATOM 4092  C CG   . TYR A 1 137 ? 12.733  0.506   -6.395  1.00 0.00 ? 155 TYR A CG   2  
ATOM 4093  C CD1  . TYR A 1 137 ? 13.219  -0.663  -5.824  1.00 0.00 ? 155 TYR A CD1  2  
ATOM 4094  C CD2  . TYR A 1 137 ? 13.358  1.703   -6.069  1.00 0.00 ? 155 TYR A CD2  2  
ATOM 4095  C CE1  . TYR A 1 137 ? 14.295  -0.641  -4.957  1.00 0.00 ? 155 TYR A CE1  2  
ATOM 4096  C CE2  . TYR A 1 137 ? 14.435  1.735   -5.204  1.00 0.00 ? 155 TYR A CE2  2  
ATOM 4097  C CZ   . TYR A 1 137 ? 14.900  0.560   -4.651  1.00 0.00 ? 155 TYR A CZ   2  
ATOM 4098  O OH   . TYR A 1 137 ? 15.971  0.587   -3.788  1.00 0.00 ? 155 TYR A OH   2  
ATOM 4099  H H    . TYR A 1 137 ? 10.068  0.066   -9.592  1.00 0.00 ? 155 TYR A H    2  
ATOM 4100  H HA   . TYR A 1 137 ? 12.629  -0.937  -8.536  1.00 0.00 ? 155 TYR A HA   2  
ATOM 4101  H HB3  . TYR A 1 137 ? 10.654  0.403   -6.751  1.00 0.00 ? 155 TYR A HB3  2  
ATOM 4102  H HD1  . TYR A 1 137 ? 12.744  -1.603  -6.066  1.00 0.00 ? 155 TYR A HD1  2  
ATOM 4103  H HD2  . TYR A 1 137 ? 12.991  2.622   -6.504  1.00 0.00 ? 155 TYR A HD2  2  
ATOM 4104  H HE1  . TYR A 1 137 ? 14.659  -1.561  -4.524  1.00 0.00 ? 155 TYR A HE1  2  
ATOM 4105  H HE2  . TYR A 1 137 ? 14.909  2.674   -4.963  1.00 0.00 ? 155 TYR A HE2  2  
ATOM 4106  H HH   . TYR A 1 137 ? 16.578  -0.124  -4.010  1.00 0.00 ? 155 TYR A HH   2  
ATOM 4107  N N    . VAL A 1 138 ? 10.719  -2.934  -8.561  1.00 0.00 ? 156 VAL A N    2  
ATOM 4108  C CA   . VAL A 1 138 ? 10.066  -4.160  -8.118  1.00 0.00 ? 156 VAL A CA   2  
ATOM 4109  C C    . VAL A 1 138 ? 10.542  -5.360  -8.930  1.00 0.00 ? 156 VAL A C    2  
ATOM 4110  O O    . VAL A 1 138 ? 11.061  -5.208  -10.034 1.00 0.00 ? 156 VAL A O    2  
ATOM 4111  C CB   . VAL A 1 138 ? 8.535   -4.051  -8.229  1.00 0.00 ? 156 VAL A CB   2  
ATOM 4112  C CG1  . VAL A 1 138 ? 7.973   -3.208  -7.095  1.00 0.00 ? 156 VAL A CG1  2  
ATOM 4113  C CG2  . VAL A 1 138 ? 8.138   -3.475  -9.581  1.00 0.00 ? 156 VAL A CG2  2  
ATOM 4114  H H    . VAL A 1 138 ? 11.035  -2.870  -9.486  1.00 0.00 ? 156 VAL A H    2  
ATOM 4115  H HA   . VAL A 1 138 ? 10.321  -4.317  -7.079  1.00 0.00 ? 156 VAL A HA   2  
ATOM 4116  H HB   . VAL A 1 138 ? 8.118   -5.045  -8.150  1.00 0.00 ? 156 VAL A HB   2  
ATOM 4117  H HG11 . VAL A 1 138 ? 7.023   -3.612  -6.782  1.00 0.00 ? 156 VAL A HG11 2  
ATOM 4118  H HG12 . VAL A 1 138 ? 8.663   -3.219  -6.263  1.00 0.00 ? 156 VAL A HG12 2  
ATOM 4119  H HG13 . VAL A 1 138 ? 7.836   -2.192  -7.437  1.00 0.00 ? 156 VAL A HG13 2  
ATOM 4120  H HG21 . VAL A 1 138 ? 7.127   -3.768  -9.814  1.00 0.00 ? 156 VAL A HG21 2  
ATOM 4121  H HG22 . VAL A 1 138 ? 8.202   -2.396  -9.545  1.00 0.00 ? 156 VAL A HG22 2  
ATOM 4122  H HG23 . VAL A 1 138 ? 8.807   -3.849  -10.342 1.00 0.00 ? 156 VAL A HG23 2  
ATOM 4123  N N    . GLN A 1 139 ? 10.358  -6.554  -8.373  1.00 0.00 ? 157 GLN A N    2  
ATOM 4124  C CA   . GLN A 1 139 ? 10.768  -7.781  -9.046  1.00 0.00 ? 157 GLN A CA   2  
ATOM 4125  C C    . GLN A 1 139 ? 9.620   -8.361  -9.866  1.00 0.00 ? 157 GLN A C    2  
ATOM 4126  O O    . GLN A 1 139 ? 9.154   -9.471  -9.604  1.00 0.00 ? 157 GLN A O    2  
ATOM 4127  C CB   . GLN A 1 139 ? 11.251  -8.810  -8.024  1.00 0.00 ? 157 GLN A CB   2  
ATOM 4128  C CG   . GLN A 1 139 ? 12.306  -8.272  -7.069  1.00 0.00 ? 157 GLN A CG   2  
ATOM 4129  C CD   . GLN A 1 139 ? 13.200  -9.363  -6.513  1.00 0.00 ? 157 GLN A CD   2  
ATOM 4130  O OE1  . GLN A 1 139 ? 13.244  -9.589  -5.304  1.00 0.00 ? 157 GLN A OE1  2  
ATOM 4131  N NE2  . GLN A 1 139 ? 13.922  -10.044 -7.395  1.00 0.00 ? 157 GLN A NE2  2  
ATOM 4132  H H    . GLN A 1 139 ? 9.937   -6.610  -7.490  1.00 0.00 ? 157 GLN A H    2  
ATOM 4133  H HA   . GLN A 1 139 ? 11.582  -7.538  -9.711  1.00 0.00 ? 157 GLN A HA   2  
ATOM 4134  H HB3  . GLN A 1 139 ? 11.673  -9.653  -8.550  1.00 0.00 ? 157 GLN A HB3  2  
ATOM 4135  H HG3  . GLN A 1 139 ? 11.809  -7.779  -6.246  1.00 0.00 ? 157 GLN A HG3  2  
ATOM 4136  H HE21 . GLN A 1 139 ? 13.838  -9.807  -8.343  1.00 0.00 ? 157 GLN A HE21 2  
ATOM 4137  H HE22 . GLN A 1 139 ? 14.510  -10.753 -7.064  1.00 0.00 ? 157 GLN A HE22 2  
ATOM 4138  N N    . LYS A 1 140 ? 9.168   -7.604  -10.859 1.00 0.00 ? 158 LYS A N    2  
ATOM 4139  C CA   . LYS A 1 140 ? 8.075   -8.042  -11.720 1.00 0.00 ? 158 LYS A CA   2  
ATOM 4140  C C    . LYS A 1 140 ? 7.886   -7.083  -12.890 1.00 0.00 ? 158 LYS A C    2  
ATOM 4141  O O    . LYS A 1 140 ? 8.053   -5.872  -12.746 1.00 0.00 ? 158 LYS A O    2  
ATOM 4142  C CB   . LYS A 1 140 ? 6.778   -8.147  -10.917 1.00 0.00 ? 158 LYS A CB   2  
ATOM 4143  C CG   . LYS A 1 140 ? 6.179   -6.800  -10.549 1.00 0.00 ? 158 LYS A CG   2  
ATOM 4144  C CD   . LYS A 1 140 ? 5.012   -6.952  -9.588  1.00 0.00 ? 158 LYS A CD   2  
ATOM 4145  C CE   . LYS A 1 140 ? 4.352   -5.612  -9.297  1.00 0.00 ? 158 LYS A CE   2  
ATOM 4146  N NZ   . LYS A 1 140 ? 3.324   -5.268  -10.318 1.00 0.00 ? 158 LYS A NZ   2  
ATOM 4147  H H    . LYS A 1 140 ? 9.580   -6.729  -11.018 1.00 0.00 ? 158 LYS A H    2  
ATOM 4148  H HA   . LYS A 1 140 ? 8.328   -9.017  -12.106 1.00 0.00 ? 158 LYS A HA   2  
ATOM 4149  H HB3  . LYS A 1 140 ? 6.976   -8.690  -10.004 1.00 0.00 ? 158 LYS A HB3  2  
ATOM 4150  H HG3  . LYS A 1 140 ? 5.832   -6.312  -11.450 1.00 0.00 ? 158 LYS A HG3  2  
ATOM 4151  H HD3  . LYS A 1 140 ? 5.372   -7.375  -8.661  1.00 0.00 ? 158 LYS A HD3  2  
ATOM 4152  H HE3  . LYS A 1 140 ? 5.112   -4.845  -9.290  1.00 0.00 ? 158 LYS A HE3  2  
ATOM 4153  H HZ1  . LYS A 1 140 ? 3.458   -4.288  -10.641 1.00 0.00 ? 158 LYS A HZ1  2  
ATOM 4154  H HZ2  . LYS A 1 140 ? 2.372   -5.358  -9.910  1.00 0.00 ? 158 LYS A HZ2  2  
ATOM 4155  H HZ3  . LYS A 1 140 ? 3.402   -5.905  -11.134 1.00 0.00 ? 158 LYS A HZ3  2  
ATOM 4156  N N    . GLY A 1 141 ? 7.535   -7.631  -14.049 1.00 0.00 ? 159 GLY A N    2  
ATOM 4157  C CA   . GLY A 1 141 ? 7.327   -6.809  -15.227 1.00 0.00 ? 159 GLY A CA   2  
ATOM 4158  C C    . GLY A 1 141 ? 5.920   -6.253  -15.304 1.00 0.00 ? 159 GLY A C    2  
ATOM 4159  O O    . GLY A 1 141 ? 5.137   -6.397  -14.366 1.00 0.00 ? 159 GLY A O    2  
ATOM 4160  H H    . GLY A 1 141 ? 7.417   -8.603  -14.106 1.00 0.00 ? 159 GLY A H    2  
ATOM 4161  H HA2  . GLY A 1 141 ? 8.028   -5.987  -15.207 1.00 0.00 ? 159 GLY A HA2  2  
ATOM 4162  H HA3  . GLY A 1 141 ? 7.513   -7.407  -16.106 1.00 0.00 ? 159 GLY A HA3  2  
ATOM 4163  N N    . GLU A 1 142 ? 5.597   -5.614  -16.424 1.00 0.00 ? 160 GLU A N    2  
ATOM 4164  C CA   . GLU A 1 142 ? 4.275   -5.030  -16.619 1.00 0.00 ? 160 GLU A CA   2  
ATOM 4165  C C    . GLU A 1 142 ? 4.002   -4.779  -18.098 1.00 0.00 ? 160 GLU A C    2  
ATOM 4166  O O    . GLU A 1 142 ? 4.902   -4.401  -18.850 1.00 0.00 ? 160 GLU A O    2  
ATOM 4167  C CB   . GLU A 1 142 ? 4.150   -3.721  -15.835 1.00 0.00 ? 160 GLU A CB   2  
ATOM 4168  C CG   . GLU A 1 142 ? 2.713   -3.273  -15.625 1.00 0.00 ? 160 GLU A CG   2  
ATOM 4169  C CD   . GLU A 1 142 ? 2.599   -2.123  -14.644 1.00 0.00 ? 160 GLU A CD   2  
ATOM 4170  O OE1  . GLU A 1 142 ? 3.607   -1.414  -14.439 1.00 0.00 ? 160 GLU A OE1  2  
ATOM 4171  O OE2  . GLU A 1 142 ? 1.501   -1.931  -14.081 1.00 0.00 ? 160 GLU A OE2  2  
ATOM 4172  H H    . GLU A 1 142 ? 6.266   -5.530  -17.136 1.00 0.00 ? 160 GLU A H    2  
ATOM 4173  H HA   . GLU A 1 142 ? 3.545   -5.733  -16.244 1.00 0.00 ? 160 GLU A HA   2  
ATOM 4174  H HB3  . GLU A 1 142 ? 4.671   -2.944  -16.373 1.00 0.00 ? 160 GLU A HB3  2  
ATOM 4175  H HG3  . GLU A 1 142 ? 2.141   -4.107  -15.248 1.00 0.00 ? 160 GLU A HG3  2  
ATOM 4176  N N    . TYR A 1 143 ? 2.758   -4.992  -18.510 1.00 0.00 ? 161 TYR A N    2  
ATOM 4177  C CA   . TYR A 1 143 ? 2.367   -4.792  -19.900 1.00 0.00 ? 161 TYR A CA   2  
ATOM 4178  C C    . TYR A 1 143 ? 1.406   -3.615  -20.032 1.00 0.00 ? 161 TYR A C    2  
ATOM 4179  O O    . TYR A 1 143 ? 0.220   -3.729  -19.724 1.00 0.00 ? 161 TYR A O    2  
ATOM 4180  C CB   . TYR A 1 143 ? 1.715   -6.060  -20.456 1.00 0.00 ? 161 TYR A CB   2  
ATOM 4181  C CG   . TYR A 1 143 ? 1.190   -5.902  -21.864 1.00 0.00 ? 161 TYR A CG   2  
ATOM 4182  C CD1  . TYR A 1 143 ? 2.051   -5.935  -22.955 1.00 0.00 ? 161 TYR A CD1  2  
ATOM 4183  C CD2  . TYR A 1 143 ? -0.166  -5.720  -22.105 1.00 0.00 ? 161 TYR A CD2  2  
ATOM 4184  C CE1  . TYR A 1 143 ? 1.574   -5.791  -24.245 1.00 0.00 ? 161 TYR A CE1  2  
ATOM 4185  C CE2  . TYR A 1 143 ? -0.651  -5.577  -23.391 1.00 0.00 ? 161 TYR A CE2  2  
ATOM 4186  C CZ   . TYR A 1 143 ? 0.223   -5.613  -24.457 1.00 0.00 ? 161 TYR A CZ   2  
ATOM 4187  O OH   . TYR A 1 143 ? -0.255  -5.469  -25.739 1.00 0.00 ? 161 TYR A OH   2  
ATOM 4188  H H    . TYR A 1 143 ? 2.085   -5.294  -17.862 1.00 0.00 ? 161 TYR A H    2  
ATOM 4189  H HA   . TYR A 1 143 ? 3.261   -4.579  -20.468 1.00 0.00 ? 161 TYR A HA   2  
ATOM 4190  H HB3  . TYR A 1 143 ? 0.887   -6.339  -19.822 1.00 0.00 ? 161 TYR A HB3  2  
ATOM 4191  H HD1  . TYR A 1 143 ? 3.108   -6.075  -22.787 1.00 0.00 ? 161 TYR A HD1  2  
ATOM 4192  H HD2  . TYR A 1 143 ? -0.848  -5.693  -21.267 1.00 0.00 ? 161 TYR A HD2  2  
ATOM 4193  H HE1  . TYR A 1 143 ? 2.258   -5.820  -25.080 1.00 0.00 ? 161 TYR A HE1  2  
ATOM 4194  H HE2  . TYR A 1 143 ? -1.709  -5.436  -23.557 1.00 0.00 ? 161 TYR A HE2  2  
ATOM 4195  H HH   . TYR A 1 143 ? -1.052  -5.994  -25.844 1.00 0.00 ? 161 TYR A HH   2  
ATOM 4196  N N    . ARG A 1 144 ? 1.929   -2.483  -20.493 1.00 0.00 ? 162 ARG A N    2  
ATOM 4197  C CA   . ARG A 1 144 ? 1.119   -1.283  -20.665 1.00 0.00 ? 162 ARG A CA   2  
ATOM 4198  C C    . ARG A 1 144 ? 1.031   -0.894  -22.137 1.00 0.00 ? 162 ARG A C    2  
ATOM 4199  O O    . ARG A 1 144 ? 1.830   -1.344  -22.960 1.00 0.00 ? 162 ARG A O    2  
ATOM 4200  C CB   . ARG A 1 144 ? 1.706   -0.124  -19.855 1.00 0.00 ? 162 ARG A CB   2  
ATOM 4201  C CG   . ARG A 1 144 ? 3.190   0.098   -20.098 1.00 0.00 ? 162 ARG A CG   2  
ATOM 4202  C CD   . ARG A 1 144 ? 3.616   1.501   -19.700 1.00 0.00 ? 162 ARG A CD   2  
ATOM 4203  N NE   . ARG A 1 144 ? 5.060   1.689   -19.814 1.00 0.00 ? 162 ARG A NE   2  
ATOM 4204  C CZ   . ARG A 1 144 ? 5.679   1.948   -20.959 1.00 0.00 ? 162 ARG A CZ   2  
ATOM 4205  N NH1  . ARG A 1 144 ? 4.984   2.050   -22.084 1.00 0.00 ? 162 ARG A NH1  2  
ATOM 4206  N NH2  . ARG A 1 144 ? 6.996   2.105   -20.982 1.00 0.00 ? 162 ARG A NH2  2  
ATOM 4207  H H    . ARG A 1 144 ? 2.881   -2.454  -20.721 1.00 0.00 ? 162 ARG A H    2  
ATOM 4208  H HA   . ARG A 1 144 ? 0.125   -1.497  -20.301 1.00 0.00 ? 162 ARG A HA   2  
ATOM 4209  H HB3  . ARG A 1 144 ? 1.561   -0.326  -18.805 1.00 0.00 ? 162 ARG A HB3  2  
ATOM 4210  H HG3  . ARG A 1 144 ? 3.400   -0.050  -21.146 1.00 0.00 ? 162 ARG A HG3  2  
ATOM 4211  H HD3  . ARG A 1 144 ? 3.319   1.676   -18.676 1.00 0.00 ? 162 ARG A HD3  2  
ATOM 4212  H HE   . ARG A 1 144 ? 5.593   1.617   -18.994 1.00 0.00 ? 162 ARG A HE   2  
ATOM 4213  H HH11 . ARG A 1 144 ? 3.991   1.933   -22.069 1.00 0.00 ? 162 ARG A HH11 2  
ATOM 4214  H HH12 . ARG A 1 144 ? 5.453   2.246   -22.946 1.00 0.00 ? 162 ARG A HH12 2  
ATOM 4215  H HH21 . ARG A 1 144 ? 7.524   2.030   -20.136 1.00 0.00 ? 162 ARG A HH21 2  
ATOM 4216  H HH22 . ARG A 1 144 ? 7.462   2.299   -21.845 1.00 0.00 ? 162 ARG A HH22 2  
ATOM 4217  N N    . THR A 1 145 ? 0.053   -0.054  -22.465 1.00 0.00 ? 163 THR A N    2  
ATOM 4218  C CA   . THR A 1 145 ? -0.141  0.395   -23.840 1.00 0.00 ? 163 THR A CA   2  
ATOM 4219  C C    . THR A 1 145 ? -0.767  1.783   -23.880 1.00 0.00 ? 163 THR A C    2  
ATOM 4220  O O    . THR A 1 145 ? -1.751  2.052   -23.191 1.00 0.00 ? 163 THR A O    2  
ATOM 4221  C CB   . THR A 1 145 ? -1.034  -0.583  -24.627 1.00 0.00 ? 163 THR A CB   2  
ATOM 4222  O OG1  . THR A 1 145 ? -0.662  -1.934  -24.331 1.00 0.00 ? 163 THR A OG1  2  
ATOM 4223  C CG2  . THR A 1 145 ? -0.916  -0.335  -26.123 1.00 0.00 ? 163 THR A CG2  2  
ATOM 4224  H H    . THR A 1 145 ? -0.551  0.270   -21.766 1.00 0.00 ? 163 THR A H    2  
ATOM 4225  H HA   . THR A 1 145 ? 0.826   0.430   -24.317 1.00 0.00 ? 163 THR A HA   2  
ATOM 4226  H HB   . THR A 1 145 ? -2.061  -0.426  -24.331 1.00 0.00 ? 163 THR A HB   2  
ATOM 4227  H HG1  . THR A 1 145 ? -1.229  -2.536  -24.821 1.00 0.00 ? 163 THR A HG1  2  
ATOM 4228  H HG21 . THR A 1 145 ? -0.088  0.331   -26.314 1.00 0.00 ? 163 THR A HG21 2  
ATOM 4229  H HG22 . THR A 1 145 ? -1.831  0.111   -26.488 1.00 0.00 ? 163 THR A HG22 2  
ATOM 4230  H HG23 . THR A 1 145 ? -0.748  -1.274  -26.631 1.00 0.00 ? 163 THR A HG23 2  
ATOM 4231  N N    . ASN A 1 146 ? -0.191  2.663   -24.693 1.00 0.00 ? 164 ASN A N    2  
ATOM 4232  C CA   . ASN A 1 146 ? -0.692  4.026   -24.823 1.00 0.00 ? 164 ASN A CA   2  
ATOM 4233  C C    . ASN A 1 146 ? -0.079  4.717   -26.037 1.00 0.00 ? 164 ASN A C    2  
ATOM 4234  O O    . ASN A 1 146 ? 0.776   5.595   -25.917 1.00 0.00 ? 164 ASN A O    2  
ATOM 4235  C CB   . ASN A 1 146 ? -0.388  4.828   -23.558 1.00 0.00 ? 164 ASN A CB   2  
ATOM 4236  C CG   . ASN A 1 146 ? -1.339  5.994   -23.368 1.00 0.00 ? 164 ASN A CG   2  
ATOM 4237  O OD1  . ASN A 1 146 ? -2.542  5.806   -23.189 1.00 0.00 ? 164 ASN A OD1  2  
ATOM 4238  N ND2  . ASN A 1 146 ? -0.802  7.208   -23.407 1.00 0.00 ? 164 ASN A ND2  2  
ATOM 4239  H H    . ASN A 1 146 ? 0.592   2.389   -25.216 1.00 0.00 ? 164 ASN A H    2  
ATOM 4240  H HA   . ASN A 1 146 ? -1.763  3.974   -24.957 1.00 0.00 ? 164 ASN A HA   2  
ATOM 4241  H HB3  . ASN A 1 146 ? 0.619   5.214   -23.616 1.00 0.00 ? 164 ASN A HB3  2  
ATOM 4242  H HD21 . ASN A 1 146 ? 0.163   7.283   -23.554 1.00 0.00 ? 164 ASN A HD21 2  
ATOM 4243  H HD22 . ASN A 1 146 ? -1.395  7.979   -23.287 1.00 0.00 ? 164 ASN A HD22 2  
ATOM 4244  N N    . PRO A 1 147 ? -0.525  4.315   -27.236 1.00 0.00 ? 165 PRO A N    2  
ATOM 4245  C CA   . PRO A 1 147 ? -0.035  4.882   -28.496 1.00 0.00 ? 165 PRO A CA   2  
ATOM 4246  C C    . PRO A 1 147 ? -0.494  6.322   -28.700 1.00 0.00 ? 165 PRO A C    2  
ATOM 4247  O O    . PRO A 1 147 ? -1.098  6.922   -27.812 1.00 0.00 ? 165 PRO A O    2  
ATOM 4248  C CB   . PRO A 1 147 ? -0.647  3.970   -29.559 1.00 0.00 ? 165 PRO A CB   2  
ATOM 4249  C CG   . PRO A 1 147 ? -1.869  3.406   -28.917 1.00 0.00 ? 165 PRO A CG   2  
ATOM 4250  C CD   . PRO A 1 147 ? -1.542  3.273   -27.455 1.00 0.00 ? 165 PRO A CD   2  
ATOM 4251  H HA   . PRO A 1 147 ? 1.043   4.837   -28.558 1.00 0.00 ? 165 PRO A HA   2  
ATOM 4252  H HB3  . PRO A 1 147 ? 0.055   3.193   -29.821 1.00 0.00 ? 165 PRO A HB3  2  
ATOM 4253  H HG3  . PRO A 1 147 ? -2.091  2.437   -29.340 1.00 0.00 ? 165 PRO A HG3  2  
ATOM 4254  H HD3  . PRO A 1 147 ? -1.141  2.293   -27.246 1.00 0.00 ? 165 PRO A HD3  2  
ATOM 4255  N N    . GLU A 1 148 ? -0.204  6.870   -29.876 1.00 0.00 ? 166 GLU A N    2  
ATOM 4256  C CA   . GLU A 1 148 ? -0.588  8.239   -30.195 1.00 0.00 ? 166 GLU A CA   2  
ATOM 4257  C C    . GLU A 1 148 ? -0.298  8.559   -31.659 1.00 0.00 ? 166 GLU A C    2  
ATOM 4258  O O    . GLU A 1 148 ? 0.860   8.672   -32.064 1.00 0.00 ? 166 GLU A O    2  
ATOM 4259  C CB   . GLU A 1 148 ? 0.154   9.225   -29.290 1.00 0.00 ? 166 GLU A CB   2  
ATOM 4260  C CG   . GLU A 1 148 ? -0.108  10.683  -29.632 1.00 0.00 ? 166 GLU A CG   2  
ATOM 4261  C CD   . GLU A 1 148 ? 0.168   11.614  -28.468 1.00 0.00 ? 166 GLU A CD   2  
ATOM 4262  O OE1  . GLU A 1 148 ? 1.357   11.887  -28.197 1.00 0.00 ? 166 GLU A OE1  2  
ATOM 4263  O OE2  . GLU A 1 148 ? -0.802  12.068  -27.828 1.00 0.00 ? 166 GLU A OE2  2  
ATOM 4264  H H    . GLU A 1 148 ? 0.280   6.341   -30.544 1.00 0.00 ? 166 GLU A H    2  
ATOM 4265  H HA   . GLU A 1 148 ? -1.649  8.336   -30.021 1.00 0.00 ? 166 GLU A HA   2  
ATOM 4266  H HB3  . GLU A 1 148 ? 1.217   9.043   -29.375 1.00 0.00 ? 166 GLU A HB3  2  
ATOM 4267  H HG3  . GLU A 1 148 ? -1.142  10.789  -29.923 1.00 0.00 ? 166 GLU A HG3  2  
ATOM 4268  N N    . ASP A 1 149 ? -1.358  8.704   -32.448 1.00 0.00 ? 167 ASP A N    2  
ATOM 4269  C CA   . ASP A 1 149 ? -1.218  9.010   -33.867 1.00 0.00 ? 167 ASP A CA   2  
ATOM 4270  C C    . ASP A 1 149 ? -1.817  10.375  -34.188 1.00 0.00 ? 167 ASP A C    2  
ATOM 4271  O O    . ASP A 1 149 ? -2.817  10.472  -34.900 1.00 0.00 ? 167 ASP A O    2  
ATOM 4272  C CB   . ASP A 1 149 ? -1.894  7.930   -34.713 1.00 0.00 ? 167 ASP A CB   2  
ATOM 4273  C CG   . ASP A 1 149 ? -1.404  7.927   -36.147 1.00 0.00 ? 167 ASP A CG   2  
ATOM 4274  O OD1  . ASP A 1 149 ? -0.400  8.613   -36.432 1.00 0.00 ? 167 ASP A OD1  2  
ATOM 4275  O OD2  . ASP A 1 149 ? -2.025  7.239   -36.986 1.00 0.00 ? 167 ASP A OD2  2  
ATOM 4276  H H    . ASP A 1 149 ? -2.255  8.602   -32.066 1.00 0.00 ? 167 ASP A H    2  
ATOM 4277  H HA   . ASP A 1 149 ? -0.163  9.030   -34.099 1.00 0.00 ? 167 ASP A HA   2  
ATOM 4278  H HB3  . ASP A 1 149 ? -2.960  8.099   -34.716 1.00 0.00 ? 167 ASP A HB3  2  
ATOM 4279  N N    . ILE A 1 150 ? -1.199  11.427  -33.660 1.00 0.00 ? 168 ILE A N    2  
ATOM 4280  C CA   . ILE A 1 150 ? -1.672  12.787  -33.892 1.00 0.00 ? 168 ILE A CA   2  
ATOM 4281  C C    . ILE A 1 150 ? -0.741  13.538  -34.836 1.00 0.00 ? 168 ILE A C    2  
ATOM 4282  O O    . ILE A 1 150 ? 0.482   13.471  -34.704 1.00 0.00 ? 168 ILE A O    2  
ATOM 4283  C CB   . ILE A 1 150 ? -1.791  13.573  -32.573 1.00 0.00 ? 168 ILE A CB   2  
ATOM 4284  C CG1  . ILE A 1 150 ? -2.486  14.914  -32.815 1.00 0.00 ? 168 ILE A CG1  2  
ATOM 4285  C CG2  . ILE A 1 150 ? -0.418  13.786  -31.956 1.00 0.00 ? 168 ILE A CG2  2  
ATOM 4286  C CD1  . ILE A 1 150 ? -3.990  14.802  -32.945 1.00 0.00 ? 168 ILE A CD1  2  
ATOM 4287  H H    . ILE A 1 150 ? -0.407  11.285  -33.102 1.00 0.00 ? 168 ILE A H    2  
ATOM 4288  H HA   . ILE A 1 150 ? -2.652  12.725  -34.342 1.00 0.00 ? 168 ILE A HA   2  
ATOM 4289  H HB   . ILE A 1 150 ? -2.382  12.988  -31.884 1.00 0.00 ? 168 ILE A HB   2  
ATOM 4290  H HG13 . ILE A 1 150 ? -2.105  15.348  -33.729 1.00 0.00 ? 168 ILE A HG13 2  
ATOM 4291  H HG21 . ILE A 1 150 ? -0.524  14.284  -31.004 1.00 0.00 ? 168 ILE A HG21 2  
ATOM 4292  H HG22 . ILE A 1 150 ? 0.062   12.829  -31.808 1.00 0.00 ? 168 ILE A HG22 2  
ATOM 4293  H HG23 . ILE A 1 150 ? 0.183   14.391  -32.616 1.00 0.00 ? 168 ILE A HG23 2  
ATOM 4294  H HD11 . ILE A 1 150 ? -4.321  15.377  -33.796 1.00 0.00 ? 168 ILE A HD11 2  
ATOM 4295  H HD12 . ILE A 1 150 ? -4.263  13.768  -33.077 1.00 0.00 ? 168 ILE A HD12 2  
ATOM 4296  H HD13 . ILE A 1 150 ? -4.457  15.186  -32.049 1.00 0.00 ? 168 ILE A HD13 2  
ATOM 4297  N N    . TYR A 1 151 ? -1.327  14.257  -35.788 1.00 0.00 ? 169 TYR A N    2  
ATOM 4298  C CA   . TYR A 1 151 ? -0.551  15.022  -36.756 1.00 0.00 ? 169 TYR A CA   2  
ATOM 4299  C C    . TYR A 1 151 ? -0.871  16.510  -36.657 1.00 0.00 ? 169 TYR A C    2  
ATOM 4300  O O    . TYR A 1 151 ? -1.540  17.085  -37.516 1.00 0.00 ? 169 TYR A O    2  
ATOM 4301  C CB   . TYR A 1 151 ? -0.828  14.521  -38.174 1.00 0.00 ? 169 TYR A CB   2  
ATOM 4302  C CG   . TYR A 1 151 ? -0.057  15.266  -39.241 1.00 0.00 ? 169 TYR A CG   2  
ATOM 4303  C CD1  . TYR A 1 151 ? 1.332   15.300  -39.226 1.00 0.00 ? 169 TYR A CD1  2  
ATOM 4304  C CD2  . TYR A 1 151 ? -0.717  15.937  -40.262 1.00 0.00 ? 169 TYR A CD2  2  
ATOM 4305  C CE1  . TYR A 1 151 ? 2.040   15.980  -40.198 1.00 0.00 ? 169 TYR A CE1  2  
ATOM 4306  C CE2  . TYR A 1 151 ? -0.018  16.617  -41.239 1.00 0.00 ? 169 TYR A CE2  2  
ATOM 4307  C CZ   . TYR A 1 151 ? 1.361   16.637  -41.202 1.00 0.00 ? 169 TYR A CZ   2  
ATOM 4308  O OH   . TYR A 1 151 ? 2.063   17.314  -42.173 1.00 0.00 ? 169 TYR A OH   2  
ATOM 4309  H H    . TYR A 1 151 ? -2.305  14.271  -35.842 1.00 0.00 ? 169 TYR A H    2  
ATOM 4310  H HA   . TYR A 1 151 ? 0.497   14.875  -36.531 1.00 0.00 ? 169 TYR A HA   2  
ATOM 4311  H HB3  . TYR A 1 151 ? -1.880  14.631  -38.387 1.00 0.00 ? 169 TYR A HB3  2  
ATOM 4312  H HD1  . TYR A 1 151 ? 1.861   14.785  -38.438 1.00 0.00 ? 169 TYR A HD1  2  
ATOM 4313  H HD2  . TYR A 1 151 ? -1.798  15.921  -40.288 1.00 0.00 ? 169 TYR A HD2  2  
ATOM 4314  H HE1  . TYR A 1 151 ? 3.120   15.993  -40.169 1.00 0.00 ? 169 TYR A HE1  2  
ATOM 4315  H HE2  . TYR A 1 151 ? -0.549  17.133  -42.026 1.00 0.00 ? 169 TYR A HE2  2  
ATOM 4316  H HH   . TYR A 1 151 ? 2.617   16.698  -42.659 1.00 0.00 ? 169 TYR A HH   2  
ATOM 4317  N N    . PRO A 1 152 ? -0.382  17.149  -35.584 1.00 0.00 ? 170 PRO A N    2  
ATOM 4318  C CA   . PRO A 1 152 ? -0.602  18.579  -35.347 1.00 0.00 ? 170 PRO A CA   2  
ATOM 4319  C C    . PRO A 1 152 ? 0.157   19.455  -36.337 1.00 0.00 ? 170 PRO A C    2  
ATOM 4320  O O    . PRO A 1 152 ? 0.846   18.952  -37.226 1.00 0.00 ? 170 PRO A O    2  
ATOM 4321  C CB   . PRO A 1 152 ? -0.068  18.789  -33.928 1.00 0.00 ? 170 PRO A CB   2  
ATOM 4322  C CG   . PRO A 1 152 ? 0.933   17.704  -33.735 1.00 0.00 ? 170 PRO A CG   2  
ATOM 4323  C CD   . PRO A 1 152 ? 0.424   16.527  -34.521 1.00 0.00 ? 170 PRO A CD   2  
ATOM 4324  H HA   . PRO A 1 152 ? -1.653  18.830  -35.379 1.00 0.00 ? 170 PRO A HA   2  
ATOM 4325  H HB3  . PRO A 1 152 ? -0.878  18.711  -33.219 1.00 0.00 ? 170 PRO A HB3  2  
ATOM 4326  H HG3  . PRO A 1 152 ? 1.004   17.452  -32.688 1.00 0.00 ? 170 PRO A HG3  2  
ATOM 4327  H HD3  . PRO A 1 152 ? -0.188  15.893  -33.896 1.00 0.00 ? 170 PRO A HD3  2  
ATOM 4328  N N    . SER A 1 153 ? 0.028   20.769  -36.180 1.00 0.00 ? 171 SER A N    2  
ATOM 4329  C CA   . SER A 1 153 ? 0.699   21.715  -37.063 1.00 0.00 ? 171 SER A CA   2  
ATOM 4330  C C    . SER A 1 153 ? 1.552   22.695  -36.262 1.00 0.00 ? 171 SER A C    2  
ATOM 4331  O O    . SER A 1 153 ? 1.291   23.896  -36.253 1.00 0.00 ? 171 SER A O    2  
ATOM 4332  C CB   . SER A 1 153 ? -0.327  22.480  -37.901 1.00 0.00 ? 171 SER A CB   2  
ATOM 4333  O OG   . SER A 1 153 ? 0.308   23.411  -38.760 1.00 0.00 ? 171 SER A OG   2  
ATOM 4334  H H    . SER A 1 153 ? -0.536  21.109  -35.454 1.00 0.00 ? 171 SER A H    2  
ATOM 4335  H HA   . SER A 1 153 ? 1.343   21.152  -37.723 1.00 0.00 ? 171 SER A HA   2  
ATOM 4336  H HB3  . SER A 1 153 ? -0.997  23.014  -37.243 1.00 0.00 ? 171 SER A HB3  2  
ATOM 4337  H HG   . SER A 1 153 ? 0.299   24.281  -38.352 1.00 0.00 ? 171 SER A HG   2  
ATOM 4338  N N    . ASN A 1 154 ? 2.571   22.169  -35.591 1.00 0.00 ? 172 ASN A N    2  
ATOM 4339  C CA   . ASN A 1 154 ? 3.463   22.998  -34.785 1.00 0.00 ? 172 ASN A CA   2  
ATOM 4340  C C    . ASN A 1 154 ? 4.919   22.776  -35.185 1.00 0.00 ? 172 ASN A C    2  
ATOM 4341  O O    . ASN A 1 154 ? 5.276   21.768  -35.794 1.00 0.00 ? 172 ASN A O    2  
ATOM 4342  C CB   . ASN A 1 154 ? 3.277   22.686  -33.299 1.00 0.00 ? 172 ASN A CB   2  
ATOM 4343  C CG   . ASN A 1 154 ? 2.942   21.228  -33.051 1.00 0.00 ? 172 ASN A CG   2  
ATOM 4344  O OD1  . ASN A 1 154 ? 3.597   20.330  -33.580 1.00 0.00 ? 172 ASN A OD1  2  
ATOM 4345  N ND2  . ASN A 1 154 ? 1.916   20.986  -32.243 1.00 0.00 ? 172 ASN A ND2  2  
ATOM 4346  H H    . ASN A 1 154 ? 2.728   21.204  -35.637 1.00 0.00 ? 172 ASN A H    2  
ATOM 4347  H HA   . ASN A 1 154 ? 3.206   24.030  -34.963 1.00 0.00 ? 172 ASN A HA   2  
ATOM 4348  H HB3  . ASN A 1 154 ? 2.475   23.293  -32.908 1.00 0.00 ? 172 ASN A HB3  2  
ATOM 4349  H HD21 . ASN A 1 154 ? 1.439   21.752  -31.858 1.00 0.00 ? 172 ASN A HD21 2  
ATOM 4350  H HD22 . ASN A 1 154 ? 1.677   20.052  -32.065 1.00 0.00 ? 172 ASN A HD22 2  
ATOM 4351  N N    . PRO A 1 155 ? 5.782   23.741  -34.834 1.00 0.00 ? 173 PRO A N    2  
ATOM 4352  C CA   . PRO A 1 155 ? 7.213   23.675  -35.144 1.00 0.00 ? 173 PRO A CA   2  
ATOM 4353  C C    . PRO A 1 155 ? 7.932   22.602  -34.336 1.00 0.00 ? 173 PRO A C    2  
ATOM 4354  O O    . PRO A 1 155 ? 7.462   22.191  -33.274 1.00 0.00 ? 173 PRO A O    2  
ATOM 4355  C CB   . PRO A 1 155 ? 7.723   25.066  -34.761 1.00 0.00 ? 173 PRO A CB   2  
ATOM 4356  C CG   . PRO A 1 155 ? 6.762   25.553  -33.733 1.00 0.00 ? 173 PRO A CG   2  
ATOM 4357  C CD   . PRO A 1 155 ? 5.427   24.971  -34.106 1.00 0.00 ? 173 PRO A CD   2  
ATOM 4358  H HA   . PRO A 1 155 ? 7.383   23.505  -36.197 1.00 0.00 ? 173 PRO A HA   2  
ATOM 4359  H HB3  . PRO A 1 155 ? 7.726   25.705  -35.631 1.00 0.00 ? 173 PRO A HB3  2  
ATOM 4360  H HG3  . PRO A 1 155 ? 6.719   26.631  -33.753 1.00 0.00 ? 173 PRO A HG3  2  
ATOM 4361  H HD3  . PRO A 1 155 ? 4.883   25.653  -34.745 1.00 0.00 ? 173 PRO A HD3  2  
ATOM 4362  N N    . THR A 1 156 ? 9.076   22.151  -34.842 1.00 0.00 ? 174 THR A N    2  
ATOM 4363  C CA   . THR A 1 156 ? 9.860   21.125  -34.167 1.00 0.00 ? 174 THR A CA   2  
ATOM 4364  C C    . THR A 1 156 ? 11.244  21.647  -33.794 1.00 0.00 ? 174 THR A C    2  
ATOM 4365  O O    . THR A 1 156 ? 11.711  22.643  -34.346 1.00 0.00 ? 174 THR A O    2  
ATOM 4366  C CB   . THR A 1 156 ? 10.016  19.868  -35.043 1.00 0.00 ? 174 THR A CB   2  
ATOM 4367  O OG1  . THR A 1 156 ? 10.794  18.884  -34.355 1.00 0.00 ? 174 THR A OG1  2  
ATOM 4368  C CG2  . THR A 1 156 ? 10.681  20.213  -36.368 1.00 0.00 ? 174 THR A CG2  2  
ATOM 4369  H H    . THR A 1 156 ? 9.398   22.518  -35.691 1.00 0.00 ? 174 THR A H    2  
ATOM 4370  H HA   . THR A 1 156 ? 9.336   20.846  -33.263 1.00 0.00 ? 174 THR A HA   2  
ATOM 4371  H HB   . THR A 1 156 ? 9.034   19.465  -35.245 1.00 0.00 ? 174 THR A HB   2  
ATOM 4372  H HG1  . THR A 1 156 ? 11.702  19.190  -34.278 1.00 0.00 ? 174 THR A HG1  2  
ATOM 4373  H HG21 . THR A 1 156 ? 10.113  19.782  -37.178 1.00 0.00 ? 174 THR A HG21 2  
ATOM 4374  H HG22 . THR A 1 156 ? 11.685  19.815  -36.381 1.00 0.00 ? 174 THR A HG22 2  
ATOM 4375  H HG23 . THR A 1 156 ? 10.717  21.286  -36.485 1.00 0.00 ? 174 THR A HG23 2  
ATOM 4376  N N    . ASP A 1 157 ? 11.893  20.967  -32.857 1.00 0.00 ? 175 ASP A N    2  
ATOM 4377  C CA   . ASP A 1 157 ? 13.225  21.362  -32.411 1.00 0.00 ? 175 ASP A CA   2  
ATOM 4378  C C    . ASP A 1 157 ? 13.994  20.161  -31.866 1.00 0.00 ? 175 ASP A C    2  
ATOM 4379  O O    . ASP A 1 157 ? 13.543  19.495  -30.934 1.00 0.00 ? 175 ASP A O    2  
ATOM 4380  C CB   . ASP A 1 157 ? 13.128  22.450  -31.341 1.00 0.00 ? 175 ASP A CB   2  
ATOM 4381  C CG   . ASP A 1 157 ? 14.489  22.955  -30.903 1.00 0.00 ? 175 ASP A CG   2  
ATOM 4382  O OD1  . ASP A 1 157 ? 15.060  23.809  -31.612 1.00 0.00 ? 175 ASP A OD1  2  
ATOM 4383  O OD2  . ASP A 1 157 ? 14.982  22.496  -29.852 1.00 0.00 ? 175 ASP A OD2  2  
ATOM 4384  H H    . ASP A 1 157 ? 11.468  20.181  -32.454 1.00 0.00 ? 175 ASP A H    2  
ATOM 4385  H HA   . ASP A 1 157 ? 13.756  21.755  -33.264 1.00 0.00 ? 175 ASP A HA   2  
ATOM 4386  H HB3  . ASP A 1 157 ? 12.616  22.050  -30.477 1.00 0.00 ? 175 ASP A HB3  2  
ATOM 4387  N N    . ASP A 1 158 ? 15.154  19.891  -32.455 1.00 0.00 ? 176 ASP A N    2  
ATOM 4388  C CA   . ASP A 1 158 ? 15.985  18.771  -32.028 1.00 0.00 ? 176 ASP A CA   2  
ATOM 4389  C C    . ASP A 1 158 ? 17.227  19.265  -31.294 1.00 0.00 ? 176 ASP A C    2  
ATOM 4390  O O    . ASP A 1 158 ? 17.607  20.429  -31.412 1.00 0.00 ? 176 ASP A O    2  
ATOM 4391  C CB   . ASP A 1 158 ? 16.392  17.923  -33.233 1.00 0.00 ? 176 ASP A CB   2  
ATOM 4392  C CG   . ASP A 1 158 ? 15.206  17.242  -33.890 1.00 0.00 ? 176 ASP A CG   2  
ATOM 4393  O OD1  . ASP A 1 158 ? 14.726  16.226  -33.342 1.00 0.00 ? 176 ASP A OD1  2  
ATOM 4394  O OD2  . ASP A 1 158 ? 14.758  17.725  -34.950 1.00 0.00 ? 176 ASP A OD2  2  
ATOM 4395  H H    . ASP A 1 158 ? 15.458  20.458  -33.193 1.00 0.00 ? 176 ASP A H    2  
ATOM 4396  H HA   . ASP A 1 158 ? 15.401  18.164  -31.352 1.00 0.00 ? 176 ASP A HA   2  
ATOM 4397  H HB3  . ASP A 1 158 ? 17.087  17.161  -32.911 1.00 0.00 ? 176 ASP A HB3  2  
ATOM 4398  N N    . ASP A 1 159 ? 17.856  18.372  -30.538 1.00 0.00 ? 177 ASP A N    2  
ATOM 4399  C CA   . ASP A 1 159 ? 19.056  18.716  -29.785 1.00 0.00 ? 177 ASP A CA   2  
ATOM 4400  C C    . ASP A 1 159 ? 20.140  17.661  -29.978 1.00 0.00 ? 177 ASP A C    2  
ATOM 4401  O O    . ASP A 1 159 ? 19.846  16.472  -30.119 1.00 0.00 ? 177 ASP A O    2  
ATOM 4402  C CB   . ASP A 1 159 ? 18.727  18.863  -28.299 1.00 0.00 ? 177 ASP A CB   2  
ATOM 4403  C CG   . ASP A 1 159 ? 18.263  20.262  -27.944 1.00 0.00 ? 177 ASP A CG   2  
ATOM 4404  O OD1  . ASP A 1 159 ? 19.102  21.187  -27.959 1.00 0.00 ? 177 ASP A OD1  2  
ATOM 4405  O OD2  . ASP A 1 159 ? 17.061  20.431  -27.652 1.00 0.00 ? 177 ASP A OD2  2  
ATOM 4406  H H    . ASP A 1 159 ? 17.504  17.458  -30.486 1.00 0.00 ? 177 ASP A H    2  
ATOM 4407  H HA   . ASP A 1 159 ? 19.422  19.661  -30.159 1.00 0.00 ? 177 ASP A HA   2  
ATOM 4408  H HB3  . ASP A 1 159 ? 19.609  18.637  -27.719 1.00 0.00 ? 177 ASP A HB3  2  
ATOM 4409  N N    . VAL A 1 160 ? 21.395  18.101  -29.984 1.00 0.00 ? 178 VAL A N    2  
ATOM 4410  C CA   . VAL A 1 160 ? 22.522  17.193  -30.158 1.00 0.00 ? 178 VAL A CA   2  
ATOM 4411  C C    . VAL A 1 160 ? 22.883  16.506  -28.847 1.00 0.00 ? 178 VAL A C    2  
ATOM 4412  O O    . VAL A 1 160 ? 22.897  17.134  -27.788 1.00 0.00 ? 178 VAL A O    2  
ATOM 4413  C CB   . VAL A 1 160 ? 23.762  17.937  -30.694 1.00 0.00 ? 178 VAL A CB   2  
ATOM 4414  C CG1  . VAL A 1 160 ? 24.912  16.966  -30.914 1.00 0.00 ? 178 VAL A CG1  2  
ATOM 4415  C CG2  . VAL A 1 160 ? 23.425  18.678  -31.979 1.00 0.00 ? 178 VAL A CG2  2  
ATOM 4416  H H    . VAL A 1 160 ? 21.565  19.059  -29.867 1.00 0.00 ? 178 VAL A H    2  
ATOM 4417  H HA   . VAL A 1 160 ? 22.239  16.444  -30.882 1.00 0.00 ? 178 VAL A HA   2  
ATOM 4418  H HB   . VAL A 1 160 ? 24.068  18.662  -29.954 1.00 0.00 ? 178 VAL A HB   2  
ATOM 4419  H HG11 . VAL A 1 160 ? 25.660  17.431  -31.540 1.00 0.00 ? 178 VAL A HG11 2  
ATOM 4420  H HG12 . VAL A 1 160 ? 25.349  16.703  -29.963 1.00 0.00 ? 178 VAL A HG12 2  
ATOM 4421  H HG13 . VAL A 1 160 ? 24.543  16.075  -31.401 1.00 0.00 ? 178 VAL A HG13 2  
ATOM 4422  H HG21 . VAL A 1 160 ? 23.669  19.723  -31.865 1.00 0.00 ? 178 VAL A HG21 2  
ATOM 4423  H HG22 . VAL A 1 160 ? 23.996  18.261  -32.796 1.00 0.00 ? 178 VAL A HG22 2  
ATOM 4424  H HG23 . VAL A 1 160 ? 22.370  18.574  -32.189 1.00 0.00 ? 178 VAL A HG23 2  
ATOM 4425  N N    . GLN A 1 3   ? 8.476   -11.671 6.356   1.00 0.00 ? 21  GLN A N    3  
ATOM 4426  C CA   . GLN A 1 3   ? 8.450   -12.422 5.106   1.00 0.00 ? 21  GLN A CA   3  
ATOM 4427  C C    . GLN A 1 3   ? 7.411   -11.851 4.147   1.00 0.00 ? 21  GLN A C    3  
ATOM 4428  O O    . GLN A 1 3   ? 6.731   -12.595 3.439   1.00 0.00 ? 21  GLN A O    3  
ATOM 4429  C CB   . GLN A 1 3   ? 8.154   -13.898 5.379   1.00 0.00 ? 21  GLN A CB   3  
ATOM 4430  C CG   . GLN A 1 3   ? 6.794   -14.137 6.014   1.00 0.00 ? 21  GLN A CG   3  
ATOM 4431  C CD   . GLN A 1 3   ? 6.661   -15.529 6.601   1.00 0.00 ? 21  GLN A CD   3  
ATOM 4432  O OE1  . GLN A 1 3   ? 5.858   -16.337 6.134   1.00 0.00 ? 21  GLN A OE1  3  
ATOM 4433  N NE2  . GLN A 1 3   ? 7.450   -15.816 7.629   1.00 0.00 ? 21  GLN A NE2  3  
ATOM 4434  H H    . GLN A 1 3   ? 7.718   -11.744 6.971   1.00 0.00 ? 21  GLN A H    3  
ATOM 4435  H HA   . GLN A 1 3   ? 9.425   -12.339 4.650   1.00 0.00 ? 21  GLN A HA   3  
ATOM 4436  H HB3  . GLN A 1 3   ? 8.910   -14.288 6.043   1.00 0.00 ? 21  GLN A HB3  3  
ATOM 4437  H HG3  . GLN A 1 3   ? 6.031   -14.006 5.261   1.00 0.00 ? 21  GLN A HG3  3  
ATOM 4438  H HE21 . GLN A 1 3   ? 8.063   -15.121 7.949   1.00 0.00 ? 21  GLN A HE21 3  
ATOM 4439  H HE22 . GLN A 1 3   ? 7.384   -16.707 8.029   1.00 0.00 ? 21  GLN A HE22 3  
ATOM 4440  N N    . ILE A 1 4   ? 7.291   -10.527 4.133   1.00 0.00 ? 22  ILE A N    3  
ATOM 4441  C CA   . ILE A 1 4   ? 6.334   -9.857  3.261   1.00 0.00 ? 22  ILE A CA   3  
ATOM 4442  C C    . ILE A 1 4   ? 6.923   -8.576  2.681   1.00 0.00 ? 22  ILE A C    3  
ATOM 4443  O O    . ILE A 1 4   ? 7.643   -7.847  3.362   1.00 0.00 ? 22  ILE A O    3  
ATOM 4444  C CB   . ILE A 1 4   ? 5.033   -9.517  4.011   1.00 0.00 ? 22  ILE A CB   3  
ATOM 4445  C CG1  . ILE A 1 4   ? 4.402   -10.788 4.584   1.00 0.00 ? 22  ILE A CG1  3  
ATOM 4446  C CG2  . ILE A 1 4   ? 4.057   -8.808  3.083   1.00 0.00 ? 22  ILE A CG2  3  
ATOM 4447  C CD1  . ILE A 1 4   ? 3.951   -11.771 3.525   1.00 0.00 ? 22  ILE A CD1  3  
ATOM 4448  H H    . ILE A 1 4   ? 7.861   -9.989  4.720   1.00 0.00 ? 22  ILE A H    3  
ATOM 4449  H HA   . ILE A 1 4   ? 6.094   -10.530 2.450   1.00 0.00 ? 22  ILE A HA   3  
ATOM 4450  H HB   . ILE A 1 4   ? 5.274   -8.846  4.821   1.00 0.00 ? 22  ILE A HB   3  
ATOM 4451  H HG13 . ILE A 1 4   ? 3.539   -10.517 5.176   1.00 0.00 ? 22  ILE A HG13 3  
ATOM 4452  H HG21 . ILE A 1 4   ? 3.164   -8.545  3.631   1.00 0.00 ? 22  ILE A HG21 3  
ATOM 4453  H HG22 . ILE A 1 4   ? 4.516   -7.912  2.695   1.00 0.00 ? 22  ILE A HG22 3  
ATOM 4454  H HG23 . ILE A 1 4   ? 3.797   -9.462  2.264   1.00 0.00 ? 22  ILE A HG23 3  
ATOM 4455  H HD11 . ILE A 1 4   ? 4.218   -11.394 2.549   1.00 0.00 ? 22  ILE A HD11 3  
ATOM 4456  H HD12 . ILE A 1 4   ? 4.432   -12.722 3.691   1.00 0.00 ? 22  ILE A HD12 3  
ATOM 4457  H HD13 . ILE A 1 4   ? 2.879   -11.894 3.583   1.00 0.00 ? 22  ILE A HD13 3  
ATOM 4458  N N    . ASP A 1 5   ? 6.610   -8.307  1.418   1.00 0.00 ? 23  ASP A N    3  
ATOM 4459  C CA   . ASP A 1 5   ? 7.105   -7.111  0.745   1.00 0.00 ? 23  ASP A CA   3  
ATOM 4460  C C    . ASP A 1 5   ? 5.951   -6.271  0.211   1.00 0.00 ? 23  ASP A C    3  
ATOM 4461  O O    . ASP A 1 5   ? 4.849   -6.777  -0.011  1.00 0.00 ? 23  ASP A O    3  
ATOM 4462  C CB   . ASP A 1 5   ? 8.044   -7.497  -0.400  1.00 0.00 ? 23  ASP A CB   3  
ATOM 4463  C CG   . ASP A 1 5   ? 9.308   -6.660  -0.419  1.00 0.00 ? 23  ASP A CG   3  
ATOM 4464  O OD1  . ASP A 1 5   ? 9.219   -5.444  -0.150  1.00 0.00 ? 23  ASP A OD1  3  
ATOM 4465  O OD2  . ASP A 1 5   ? 10.387  -7.222  -0.702  1.00 0.00 ? 23  ASP A OD2  3  
ATOM 4466  H H    . ASP A 1 5   ? 6.031   -8.927  0.926   1.00 0.00 ? 23  ASP A H    3  
ATOM 4467  H HA   . ASP A 1 5   ? 7.655   -6.529  1.468   1.00 0.00 ? 23  ASP A HA   3  
ATOM 4468  H HB3  . ASP A 1 5   ? 7.529   -7.361  -1.339  1.00 0.00 ? 23  ASP A HB3  3  
ATOM 4469  N N    . LEU A 1 6   ? 6.207   -4.984  0.007   1.00 0.00 ? 24  LEU A N    3  
ATOM 4470  C CA   . LEU A 1 6   ? 5.190   -4.071  -0.499  1.00 0.00 ? 24  LEU A CA   3  
ATOM 4471  C C    . LEU A 1 6   ? 5.727   -3.248  -1.666  1.00 0.00 ? 24  LEU A C    3  
ATOM 4472  O O    . LEU A 1 6   ? 6.918   -3.290  -1.972  1.00 0.00 ? 24  LEU A O    3  
ATOM 4473  C CB   . LEU A 1 6   ? 4.709   -3.140  0.617   1.00 0.00 ? 24  LEU A CB   3  
ATOM 4474  C CG   . LEU A 1 6   ? 3.744   -3.753  1.631   1.00 0.00 ? 24  LEU A CG   3  
ATOM 4475  C CD1  . LEU A 1 6   ? 4.458   -4.781  2.495   1.00 0.00 ? 24  LEU A CD1  3  
ATOM 4476  C CD2  . LEU A 1 6   ? 3.121   -2.667  2.497   1.00 0.00 ? 24  LEU A CD2  3  
ATOM 4477  H H    . LEU A 1 6   ? 7.104   -4.638  0.202   1.00 0.00 ? 24  LEU A H    3  
ATOM 4478  H HA   . LEU A 1 6   ? 4.356   -4.663  -0.846  1.00 0.00 ? 24  LEU A HA   3  
ATOM 4479  H HB3  . LEU A 1 6   ? 4.214   -2.298  0.154   1.00 0.00 ? 24  LEU A HB3  3  
ATOM 4480  H HG   . LEU A 1 6   ? 2.947   -4.257  1.102   1.00 0.00 ? 24  LEU A HG   3  
ATOM 4481  H HD11 . LEU A 1 6   ? 5.517   -4.569  2.504   1.00 0.00 ? 24  LEU A HD11 3  
ATOM 4482  H HD12 . LEU A 1 6   ? 4.292   -5.768  2.090   1.00 0.00 ? 24  LEU A HD12 3  
ATOM 4483  H HD13 . LEU A 1 6   ? 4.071   -4.736  3.502   1.00 0.00 ? 24  LEU A HD13 3  
ATOM 4484  H HD21 . LEU A 1 6   ? 2.321   -2.188  1.951   1.00 0.00 ? 24  LEU A HD21 3  
ATOM 4485  H HD22 . LEU A 1 6   ? 3.872   -1.935  2.752   1.00 0.00 ? 24  LEU A HD22 3  
ATOM 4486  H HD23 . LEU A 1 6   ? 2.727   -3.110  3.400   1.00 0.00 ? 24  LEU A HD23 3  
ATOM 4487  N N    . ASN A 1 7   ? 4.841   -2.499  -2.313  1.00 0.00 ? 25  ASN A N    3  
ATOM 4488  C CA   . ASN A 1 7   ? 5.227   -1.664  -3.445  1.00 0.00 ? 25  ASN A CA   3  
ATOM 4489  C C    . ASN A 1 7   ? 4.446   -0.354  -3.447  1.00 0.00 ? 25  ASN A C    3  
ATOM 4490  O O    . ASN A 1 7   ? 3.252   -0.331  -3.148  1.00 0.00 ? 25  ASN A O    3  
ATOM 4491  C CB   . ASN A 1 7   ? 4.993   -2.412  -4.759  1.00 0.00 ? 25  ASN A CB   3  
ATOM 4492  C CG   . ASN A 1 7   ? 5.288   -3.895  -4.641  1.00 0.00 ? 25  ASN A CG   3  
ATOM 4493  O OD1  . ASN A 1 7   ? 6.384   -4.349  -4.969  1.00 0.00 ? 25  ASN A OD1  3  
ATOM 4494  N ND2  . ASN A 1 7   ? 4.308   -4.658  -4.171  1.00 0.00 ? 25  ASN A ND2  3  
ATOM 4495  H H    . ASN A 1 7   ? 3.904   -2.506  -2.023  1.00 0.00 ? 25  ASN A H    3  
ATOM 4496  H HA   . ASN A 1 7   ? 6.279   -1.443  -3.350  1.00 0.00 ? 25  ASN A HA   3  
ATOM 4497  H HB3  . ASN A 1 7   ? 5.632   -1.996  -5.523  1.00 0.00 ? 25  ASN A HB3  3  
ATOM 4498  H HD21 . ASN A 1 7   ? 3.460   -4.227  -3.929  1.00 0.00 ? 25  ASN A HD21 3  
ATOM 4499  H HD22 . ASN A 1 7   ? 4.472   -5.620  -4.084  1.00 0.00 ? 25  ASN A HD22 3  
ATOM 4500  N N    . ILE A 1 8   ? 5.128   0.734   -3.787  1.00 0.00 ? 26  ILE A N    3  
ATOM 4501  C CA   . ILE A 1 8   ? 4.498   2.048   -3.829  1.00 0.00 ? 26  ILE A CA   3  
ATOM 4502  C C    . ILE A 1 8   ? 4.716   2.719   -5.182  1.00 0.00 ? 26  ILE A C    3  
ATOM 4503  O O    . ILE A 1 8   ? 5.848   3.018   -5.564  1.00 0.00 ? 26  ILE A O    3  
ATOM 4504  C CB   . ILE A 1 8   ? 5.039   2.968   -2.719  1.00 0.00 ? 26  ILE A CB   3  
ATOM 4505  C CG1  . ILE A 1 8   ? 5.108   2.213   -1.390  1.00 0.00 ? 26  ILE A CG1  3  
ATOM 4506  C CG2  . ILE A 1 8   ? 4.166   4.206   -2.586  1.00 0.00 ? 26  ILE A CG2  3  
ATOM 4507  C CD1  . ILE A 1 8   ? 3.764   1.715   -0.907  1.00 0.00 ? 26  ILE A CD1  3  
ATOM 4508  H H    . ILE A 1 8   ? 6.076   0.652   -4.015  1.00 0.00 ? 26  ILE A H    3  
ATOM 4509  H HA   . ILE A 1 8   ? 3.438   1.913   -3.673  1.00 0.00 ? 26  ILE A HA   3  
ATOM 4510  H HB   . ILE A 1 8   ? 6.032   3.285   -2.997  1.00 0.00 ? 26  ILE A HB   3  
ATOM 4511  H HG13 . ILE A 1 8   ? 5.512   2.869   -0.633  1.00 0.00 ? 26  ILE A HG13 3  
ATOM 4512  H HG21 . ILE A 1 8   ? 4.075   4.473   -1.542  1.00 0.00 ? 26  ILE A HG21 3  
ATOM 4513  H HG22 . ILE A 1 8   ? 4.618   5.025   -3.126  1.00 0.00 ? 26  ILE A HG22 3  
ATOM 4514  H HG23 . ILE A 1 8   ? 3.187   4.004   -2.992  1.00 0.00 ? 26  ILE A HG23 3  
ATOM 4515  H HD11 . ILE A 1 8   ? 3.842   0.673   -0.638  1.00 0.00 ? 26  ILE A HD11 3  
ATOM 4516  H HD12 . ILE A 1 8   ? 3.454   2.287   -0.045  1.00 0.00 ? 26  ILE A HD12 3  
ATOM 4517  H HD13 . ILE A 1 8   ? 3.034   1.829   -1.696  1.00 0.00 ? 26  ILE A HD13 3  
ATOM 4518  N N    . THR A 1 9   ? 3.625   2.955   -5.903  1.00 0.00 ? 27  THR A N    3  
ATOM 4519  C CA   . THR A 1 9   ? 3.696   3.591   -7.212  1.00 0.00 ? 27  THR A CA   3  
ATOM 4520  C C    . THR A 1 9   ? 3.770   5.108   -7.082  1.00 0.00 ? 27  THR A C    3  
ATOM 4521  O O    . THR A 1 9   ? 3.890   5.642   -5.978  1.00 0.00 ? 27  THR A O    3  
ATOM 4522  C CB   . THR A 1 9   ? 2.480   3.221   -8.083  1.00 0.00 ? 27  THR A CB   3  
ATOM 4523  O OG1  . THR A 1 9   ? 2.729   3.576   -9.447  1.00 0.00 ? 27  THR A OG1  3  
ATOM 4524  C CG2  . THR A 1 9   ? 1.226   3.928   -7.590  1.00 0.00 ? 27  THR A CG2  3  
ATOM 4525  H H    . THR A 1 9   ? 2.751   2.693   -5.543  1.00 0.00 ? 27  THR A H    3  
ATOM 4526  H HA   . THR A 1 9   ? 4.588   3.237   -7.706  1.00 0.00 ? 27  THR A HA   3  
ATOM 4527  H HB   . THR A 1 9   ? 2.322   2.154   -8.020  1.00 0.00 ? 27  THR A HB   3  
ATOM 4528  H HG1  . THR A 1 9   ? 2.244   2.983   -10.026 1.00 0.00 ? 27  THR A HG1  3  
ATOM 4529  H HG21 . THR A 1 9   ? 1.355   4.995   -7.682  1.00 0.00 ? 27  THR A HG21 3  
ATOM 4530  H HG22 . THR A 1 9   ? 1.053   3.673   -6.554  1.00 0.00 ? 27  THR A HG22 3  
ATOM 4531  H HG23 . THR A 1 9   ? 0.381   3.613   -8.184  1.00 0.00 ? 27  THR A HG23 3  
ATOM 4532  N N    . CYS A 1 10  ? 3.698   5.799   -8.215  1.00 0.00 ? 28  CYS A N    3  
ATOM 4533  C CA   . CYS A 1 10  ? 3.758   7.255   -8.229  1.00 0.00 ? 28  CYS A CA   3  
ATOM 4534  C C    . CYS A 1 10  ? 2.686   7.852   -7.322  1.00 0.00 ? 28  CYS A C    3  
ATOM 4535  O O    . CYS A 1 10  ? 1.858   7.130   -6.764  1.00 0.00 ? 28  CYS A O    3  
ATOM 4536  C CB   . CYS A 1 10  ? 3.584   7.780   -9.655  1.00 0.00 ? 28  CYS A CB   3  
ATOM 4537  S SG   . CYS A 1 10  ? 4.810   7.134   -10.839 1.00 0.00 ? 28  CYS A SG   3  
ATOM 4538  H H    . CYS A 1 10  ? 3.603   5.316   -9.064  1.00 0.00 ? 28  CYS A H    3  
ATOM 4539  H HA   . CYS A 1 10  ? 4.728   7.551   -7.862  1.00 0.00 ? 28  CYS A HA   3  
ATOM 4540  H HB3  . CYS A 1 10  ? 3.669   8.857   -9.648  1.00 0.00 ? 28  CYS A HB3  3  
ATOM 4541  N N    . ARG A 1 11  ? 2.707   9.173   -7.180  1.00 0.00 ? 29  ARG A N    3  
ATOM 4542  C CA   . ARG A 1 11  ? 1.738   9.867   -6.340  1.00 0.00 ? 29  ARG A CA   3  
ATOM 4543  C C    . ARG A 1 11  ? 0.872   10.807  -7.173  1.00 0.00 ? 29  ARG A C    3  
ATOM 4544  O O    . ARG A 1 11  ? 1.381   11.703  -7.848  1.00 0.00 ? 29  ARG A O    3  
ATOM 4545  C CB   . ARG A 1 11  ? 2.455   10.653  -5.242  1.00 0.00 ? 29  ARG A CB   3  
ATOM 4546  C CG   . ARG A 1 11  ? 2.097   10.202  -3.836  1.00 0.00 ? 29  ARG A CG   3  
ATOM 4547  C CD   . ARG A 1 11  ? 2.511   11.230  -2.796  1.00 0.00 ? 29  ARG A CD   3  
ATOM 4548  N NE   . ARG A 1 11  ? 3.602   10.750  -1.954  1.00 0.00 ? 29  ARG A NE   3  
ATOM 4549  C CZ   . ARG A 1 11  ? 4.881   10.796  -2.311  1.00 0.00 ? 29  ARG A CZ   3  
ATOM 4550  N NH1  . ARG A 1 11  ? 5.227   11.301  -3.486  1.00 0.00 ? 29  ARG A NH1  3  
ATOM 4551  N NH2  . ARG A 1 11  ? 5.818   10.340  -1.488  1.00 0.00 ? 29  ARG A NH2  3  
ATOM 4552  H H    . ARG A 1 11  ? 3.391   9.693   -7.651  1.00 0.00 ? 29  ARG A H    3  
ATOM 4553  H HA   . ARG A 1 11  ? 1.103   9.124   -5.882  1.00 0.00 ? 29  ARG A HA   3  
ATOM 4554  H HB3  . ARG A 1 11  ? 2.196   11.698  -5.337  1.00 0.00 ? 29  ARG A HB3  3  
ATOM 4555  H HG3  . ARG A 1 11  ? 2.603   9.269   -3.629  1.00 0.00 ? 29  ARG A HG3  3  
ATOM 4556  H HD3  . ARG A 1 11  ? 1.658   11.456  -2.173  1.00 0.00 ? 29  ARG A HD3  3  
ATOM 4557  H HE   . ARG A 1 11  ? 3.370   10.374  -1.079  1.00 0.00 ? 29  ARG A HE   3  
ATOM 4558  H HH11 . ARG A 1 11  ? 4.524   11.647  -4.108  1.00 0.00 ? 29  ARG A HH11 3  
ATOM 4559  H HH12 . ARG A 1 11  ? 6.191   11.336  -3.752  1.00 0.00 ? 29  ARG A HH12 3  
ATOM 4560  H HH21 . ARG A 1 11  ? 5.561   9.959   -0.600  1.00 0.00 ? 29  ARG A HH21 3  
ATOM 4561  H HH22 . ARG A 1 11  ? 6.779   10.375  -1.758  1.00 0.00 ? 29  ARG A HH22 3  
ATOM 4562  N N    . PHE A 1 12  ? -0.439  10.599  -7.121  1.00 0.00 ? 30  PHE A N    3  
ATOM 4563  C CA   . PHE A 1 12  ? -1.375  11.426  -7.872  1.00 0.00 ? 30  PHE A CA   3  
ATOM 4564  C C    . PHE A 1 12  ? -1.977  12.510  -6.981  1.00 0.00 ? 30  PHE A C    3  
ATOM 4565  O O    . PHE A 1 12  ? -2.878  12.245  -6.185  1.00 0.00 ? 30  PHE A O    3  
ATOM 4566  C CB   . PHE A 1 12  ? -2.489  10.563  -8.467  1.00 0.00 ? 30  PHE A CB   3  
ATOM 4567  C CG   . PHE A 1 12  ? -2.009  9.612   -9.525  1.00 0.00 ? 30  PHE A CG   3  
ATOM 4568  C CD1  . PHE A 1 12  ? -1.867  10.031  -10.839 1.00 0.00 ? 30  PHE A CD1  3  
ATOM 4569  C CD2  . PHE A 1 12  ? -1.698  8.300   -9.208  1.00 0.00 ? 30  PHE A CD2  3  
ATOM 4570  C CE1  . PHE A 1 12  ? -1.426  9.158   -11.815 1.00 0.00 ? 30  PHE A CE1  3  
ATOM 4571  C CE2  . PHE A 1 12  ? -1.257  7.422   -10.180 1.00 0.00 ? 30  PHE A CE2  3  
ATOM 4572  C CZ   . PHE A 1 12  ? -1.120  7.852   -11.484 1.00 0.00 ? 30  PHE A CZ   3  
ATOM 4573  H H    . PHE A 1 12  ? -0.785  9.870   -6.565  1.00 0.00 ? 30  PHE A H    3  
ATOM 4574  H HA   . PHE A 1 12  ? -0.830  11.899  -8.674  1.00 0.00 ? 30  PHE A HA   3  
ATOM 4575  H HB3  . PHE A 1 12  ? -3.235  11.206  -8.909  1.00 0.00 ? 30  PHE A HB3  3  
ATOM 4576  H HD1  . PHE A 1 12  ? -2.105  11.052  -11.099 1.00 0.00 ? 30  PHE A HD1  3  
ATOM 4577  H HD2  . PHE A 1 12  ? -1.807  7.963   -8.186  1.00 0.00 ? 30  PHE A HD2  3  
ATOM 4578  H HE1  . PHE A 1 12  ? -1.320  9.496   -12.834 1.00 0.00 ? 30  PHE A HE1  3  
ATOM 4579  H HE2  . PHE A 1 12  ? -1.019  6.402   -9.918  1.00 0.00 ? 30  PHE A HE2  3  
ATOM 4580  H HZ   . PHE A 1 12  ? -0.776  7.169   -12.245 1.00 0.00 ? 30  PHE A HZ   3  
ATOM 4581  N N    . ALA A 1 13  ? -1.472  13.732  -7.122  1.00 0.00 ? 31  ALA A N    3  
ATOM 4582  C CA   . ALA A 1 13  ? -1.960  14.855  -6.331  1.00 0.00 ? 31  ALA A CA   3  
ATOM 4583  C C    . ALA A 1 13  ? -1.848  14.568  -4.838  1.00 0.00 ? 31  ALA A C    3  
ATOM 4584  O O    . ALA A 1 13  ? -2.585  15.129  -4.030  1.00 0.00 ? 31  ALA A O    3  
ATOM 4585  C CB   . ALA A 1 13  ? -3.401  15.175  -6.702  1.00 0.00 ? 31  ALA A CB   3  
ATOM 4586  H H    . ALA A 1 13  ? -0.756  13.880  -7.773  1.00 0.00 ? 31  ALA A H    3  
ATOM 4587  H HA   . ALA A 1 13  ? -1.354  15.718  -6.568  1.00 0.00 ? 31  ALA A HA   3  
ATOM 4588  H HB1  . ALA A 1 13  ? -3.984  14.265  -6.695  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 4589  H HB2  . ALA A 1 13  ? -3.811  15.872  -5.985  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 4590  H HB3  . ALA A 1 13  ? -3.429  15.613  -7.688  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 4591  N N    . GLY A 1 14  ? -0.919  13.685  -4.479  1.00 0.00 ? 32  GLY A N    3  
ATOM 4592  C CA   . GLY A 1 14  ? -0.729  13.336  -3.083  1.00 0.00 ? 32  GLY A CA   3  
ATOM 4593  C C    . GLY A 1 14  ? -1.404  12.031  -2.713  1.00 0.00 ? 32  GLY A C    3  
ATOM 4594  O O    . GLY A 1 14  ? -1.159  11.478  -1.641  1.00 0.00 ? 32  GLY A O    3  
ATOM 4595  H H    . GLY A 1 14  ? -0.361  13.268  -5.167  1.00 0.00 ? 32  GLY A H    3  
ATOM 4596  H HA2  . GLY A 1 14  ? 0.330   13.251  -2.887  1.00 0.00 ? 32  GLY A HA2  3  
ATOM 4597  H HA3  . GLY A 1 14  ? -1.137  14.126  -2.468  1.00 0.00 ? 32  GLY A HA3  3  
ATOM 4598  N N    . VAL A 1 15  ? -2.259  11.536  -3.602  1.00 0.00 ? 33  VAL A N    3  
ATOM 4599  C CA   . VAL A 1 15  ? -2.973  10.287  -3.365  1.00 0.00 ? 33  VAL A CA   3  
ATOM 4600  C C    . VAL A 1 15  ? -2.370  9.146   -4.177  1.00 0.00 ? 33  VAL A C    3  
ATOM 4601  O O    . VAL A 1 15  ? -2.161  9.272   -5.384  1.00 0.00 ? 33  VAL A O    3  
ATOM 4602  C CB   . VAL A 1 15  ? -4.466  10.420  -3.714  1.00 0.00 ? 33  VAL A CB   3  
ATOM 4603  C CG1  . VAL A 1 15  ? -5.213  9.143   -3.359  1.00 0.00 ? 33  VAL A CG1  3  
ATOM 4604  C CG2  . VAL A 1 15  ? -5.076  11.619  -3.006  1.00 0.00 ? 33  VAL A CG2  3  
ATOM 4605  H H    . VAL A 1 15  ? -2.412  12.022  -4.440  1.00 0.00 ? 33  VAL A H    3  
ATOM 4606  H HA   . VAL A 1 15  ? -2.890  10.051  -2.314  1.00 0.00 ? 33  VAL A HA   3  
ATOM 4607  H HB   . VAL A 1 15  ? -4.553  10.575  -4.780  1.00 0.00 ? 33  VAL A HB   3  
ATOM 4608  H HG11 . VAL A 1 15  ? -5.287  9.058   -2.283  1.00 0.00 ? 33  VAL A HG11 3  
ATOM 4609  H HG12 . VAL A 1 15  ? -6.204  9.174   -3.787  1.00 0.00 ? 33  VAL A HG12 3  
ATOM 4610  H HG13 . VAL A 1 15  ? -4.678  8.291   -3.749  1.00 0.00 ? 33  VAL A HG13 3  
ATOM 4611  H HG21 . VAL A 1 15  ? -4.980  11.493  -1.938  1.00 0.00 ? 33  VAL A HG21 3  
ATOM 4612  H HG22 . VAL A 1 15  ? -4.558  12.518  -3.310  1.00 0.00 ? 33  VAL A HG22 3  
ATOM 4613  H HG23 . VAL A 1 15  ? -6.120  11.700  -3.268  1.00 0.00 ? 33  VAL A HG23 3  
ATOM 4614  N N    . PHE A 1 16  ? -2.092  8.034   -3.508  1.00 0.00 ? 34  PHE A N    3  
ATOM 4615  C CA   . PHE A 1 16  ? -1.514  6.869   -4.166  1.00 0.00 ? 34  PHE A CA   3  
ATOM 4616  C C    . PHE A 1 16  ? -2.114  5.578   -3.619  1.00 0.00 ? 34  PHE A C    3  
ATOM 4617  O O    . PHE A 1 16  ? -2.906  5.600   -2.675  1.00 0.00 ? 34  PHE A O    3  
ATOM 4618  C CB   . PHE A 1 16  ? 0.006   6.855   -3.982  1.00 0.00 ? 34  PHE A CB   3  
ATOM 4619  C CG   . PHE A 1 16  ? 0.436   6.579   -2.570  1.00 0.00 ? 34  PHE A CG   3  
ATOM 4620  C CD1  . PHE A 1 16  ? 0.201   7.505   -1.567  1.00 0.00 ? 34  PHE A CD1  3  
ATOM 4621  C CD2  . PHE A 1 16  ? 1.075   5.393   -2.246  1.00 0.00 ? 34  PHE A CD2  3  
ATOM 4622  C CE1  . PHE A 1 16  ? 0.596   7.254   -0.266  1.00 0.00 ? 34  PHE A CE1  3  
ATOM 4623  C CE2  . PHE A 1 16  ? 1.472   5.137   -0.947  1.00 0.00 ? 34  PHE A CE2  3  
ATOM 4624  C CZ   . PHE A 1 16  ? 1.231   6.068   0.044   1.00 0.00 ? 34  PHE A CZ   3  
ATOM 4625  H H    . PHE A 1 16  ? -2.282  7.994   -2.546  1.00 0.00 ? 34  PHE A H    3  
ATOM 4626  H HA   . PHE A 1 16  ? -1.739  6.938   -5.219  1.00 0.00 ? 34  PHE A HA   3  
ATOM 4627  H HB3  . PHE A 1 16  ? 0.404   7.815   -4.271  1.00 0.00 ? 34  PHE A HB3  3  
ATOM 4628  H HD1  . PHE A 1 16  ? -0.297  8.432   -1.807  1.00 0.00 ? 34  PHE A HD1  3  
ATOM 4629  H HD2  . PHE A 1 16  ? 1.263   4.664   -3.020  1.00 0.00 ? 34  PHE A HD2  3  
ATOM 4630  H HE1  . PHE A 1 16  ? 0.406   7.984   0.507   1.00 0.00 ? 34  PHE A HE1  3  
ATOM 4631  H HE2  . PHE A 1 16  ? 1.969   4.207   -0.707  1.00 0.00 ? 34  PHE A HE2  3  
ATOM 4632  H HZ   . PHE A 1 16  ? 1.542   5.868   1.059   1.00 0.00 ? 34  PHE A HZ   3  
ATOM 4633  N N    . HIS A 1 17  ? -1.734  4.453   -4.217  1.00 0.00 ? 35  HIS A N    3  
ATOM 4634  C CA   . HIS A 1 17  ? -2.235  3.152   -3.789  1.00 0.00 ? 35  HIS A CA   3  
ATOM 4635  C C    . HIS A 1 17  ? -1.090  2.251   -3.339  1.00 0.00 ? 35  HIS A C    3  
ATOM 4636  O O    . HIS A 1 17  ? -0.012  2.256   -3.932  1.00 0.00 ? 35  HIS A O    3  
ATOM 4637  C CB   . HIS A 1 17  ? -3.011  2.482   -4.925  1.00 0.00 ? 35  HIS A CB   3  
ATOM 4638  C CG   . HIS A 1 17  ? -2.137  1.758   -5.902  1.00 0.00 ? 35  HIS A CG   3  
ATOM 4639  N ND1  . HIS A 1 17  ? -1.727  2.309   -7.097  1.00 0.00 ? 35  HIS A ND1  3  
ATOM 4640  C CD2  . HIS A 1 17  ? -1.593  0.520   -5.853  1.00 0.00 ? 35  HIS A CD2  3  
ATOM 4641  C CE1  . HIS A 1 17  ? -0.970  1.440   -7.744  1.00 0.00 ? 35  HIS A CE1  3  
ATOM 4642  N NE2  . HIS A 1 17  ? -0.872  0.346   -7.010  1.00 0.00 ? 35  HIS A NE2  3  
ATOM 4643  H H    . HIS A 1 17  ? -1.100  4.501   -4.964  1.00 0.00 ? 35  HIS A H    3  
ATOM 4644  H HA   . HIS A 1 17  ? -2.901  3.311   -2.955  1.00 0.00 ? 35  HIS A HA   3  
ATOM 4645  H HB3  . HIS A 1 17  ? -3.563  3.236   -5.467  1.00 0.00 ? 35  HIS A HB3  3  
ATOM 4646  H HD1  . HIS A 1 17  ? -1.958  3.203   -7.425  1.00 0.00 ? 35  HIS A HD1  3  
ATOM 4647  H HD2  . HIS A 1 17  ? -1.703  -0.199  -5.054  1.00 0.00 ? 35  HIS A HD2  3  
ATOM 4648  H HE1  . HIS A 1 17  ? -0.509  1.597   -8.707  1.00 0.00 ? 35  HIS A HE1  3  
ATOM 4649  N N    . VAL A 1 18  ? -1.332  1.476   -2.286  1.00 0.00 ? 36  VAL A N    3  
ATOM 4650  C CA   . VAL A 1 18  ? -0.322  0.569   -1.756  1.00 0.00 ? 36  VAL A CA   3  
ATOM 4651  C C    . VAL A 1 18  ? -0.536  -0.851  -2.268  1.00 0.00 ? 36  VAL A C    3  
ATOM 4652  O O    . VAL A 1 18  ? -1.630  -1.401  -2.162  1.00 0.00 ? 36  VAL A O    3  
ATOM 4653  C CB   . VAL A 1 18  ? -0.333  0.555   -0.215  1.00 0.00 ? 36  VAL A CB   3  
ATOM 4654  C CG1  . VAL A 1 18  ? 0.710   -0.417  0.316   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4655  C CG2  . VAL A 1 18  ? -0.098  1.954   0.332   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4656  H H    . VAL A 1 18  ? -2.212  1.515   -1.856  1.00 0.00 ? 36  VAL A H    3  
ATOM 4657  H HA   . VAL A 1 18  ? 0.647   0.918   -2.084  1.00 0.00 ? 36  VAL A HA   3  
ATOM 4658  H HB   . VAL A 1 18  ? -1.305  0.220   0.114   1.00 0.00 ? 36  VAL A HB   3  
ATOM 4659  H HG11 . VAL A 1 18  ? 0.476   -1.417  -0.021  1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4660  H HG12 . VAL A 1 18  ? 1.687   -0.132  -0.045  1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4661  H HG13 . VAL A 1 18  ? 0.706   -0.394  1.396   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4662  H HG21 . VAL A 1 18  ? 0.880   2.298   0.032   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4663  H HG22 . VAL A 1 18  ? -0.850  2.624   -0.059  1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4664  H HG23 . VAL A 1 18  ? -0.158  1.934   1.410   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4665  N N    . GLU A 1 19  ? 0.519   -1.440  -2.824  1.00 0.00 ? 37  GLU A N    3  
ATOM 4666  C CA   . GLU A 1 19  ? 0.447   -2.796  -3.354  1.00 0.00 ? 37  GLU A CA   3  
ATOM 4667  C C    . GLU A 1 19  ? 1.317   -3.746  -2.536  1.00 0.00 ? 37  GLU A C    3  
ATOM 4668  O O    . GLU A 1 19  ? 2.244   -3.321  -1.845  1.00 0.00 ? 37  GLU A O    3  
ATOM 4669  C CB   . GLU A 1 19  ? 0.885   -2.820  -4.819  1.00 0.00 ? 37  GLU A CB   3  
ATOM 4670  C CG   . GLU A 1 19  ? 0.385   -4.033  -5.584  1.00 0.00 ? 37  GLU A CG   3  
ATOM 4671  C CD   . GLU A 1 19  ? 0.496   -3.863  -7.086  1.00 0.00 ? 37  GLU A CD   3  
ATOM 4672  O OE1  . GLU A 1 19  ? 0.444   -2.707  -7.557  1.00 0.00 ? 37  GLU A OE1  3  
ATOM 4673  O OE2  . GLU A 1 19  ? 0.636   -4.884  -7.792  1.00 0.00 ? 37  GLU A OE2  3  
ATOM 4674  H H    . GLU A 1 19  ? 1.367   -0.949  -2.879  1.00 0.00 ? 37  GLU A H    3  
ATOM 4675  H HA   . GLU A 1 19  ? -0.580  -3.123  -3.289  1.00 0.00 ? 37  GLU A HA   3  
ATOM 4676  H HB3  . GLU A 1 19  ? 1.964   -2.814  -4.860  1.00 0.00 ? 37  GLU A HB3  3  
ATOM 4677  H HG3  . GLU A 1 19  ? -0.652  -4.200  -5.331  1.00 0.00 ? 37  GLU A HG3  3  
ATOM 4678  N N    . LYS A 1 20  ? 1.011   -5.037  -2.617  1.00 0.00 ? 38  LYS A N    3  
ATOM 4679  C CA   . LYS A 1 20  ? 1.765   -6.049  -1.888  1.00 0.00 ? 38  LYS A CA   3  
ATOM 4680  C C    . LYS A 1 20  ? 2.652   -6.853  -2.832  1.00 0.00 ? 38  LYS A C    3  
ATOM 4681  O O    . LYS A 1 20  ? 2.531   -6.750  -4.052  1.00 0.00 ? 38  LYS A O    3  
ATOM 4682  C CB   . LYS A 1 20  ? 0.810   -6.988  -1.145  1.00 0.00 ? 38  LYS A CB   3  
ATOM 4683  C CG   . LYS A 1 20  ? 0.635   -6.640  0.322   1.00 0.00 ? 38  LYS A CG   3  
ATOM 4684  C CD   . LYS A 1 20  ? 1.917   -6.864  1.107   1.00 0.00 ? 38  LYS A CD   3  
ATOM 4685  C CE   . LYS A 1 20  ? 1.726   -6.562  2.585   1.00 0.00 ? 38  LYS A CE   3  
ATOM 4686  N NZ   . LYS A 1 20  ? 1.125   -5.217  2.803   1.00 0.00 ? 38  LYS A NZ   3  
ATOM 4687  H H    . LYS A 1 20  ? 0.261   -5.315  -3.185  1.00 0.00 ? 38  LYS A H    3  
ATOM 4688  H HA   . LYS A 1 20  ? 2.391   -5.543  -1.168  1.00 0.00 ? 38  LYS A HA   3  
ATOM 4689  H HB3  . LYS A 1 20  ? 1.192   -7.997  -1.211  1.00 0.00 ? 38  LYS A HB3  3  
ATOM 4690  H HG3  . LYS A 1 20  ? -0.145  -7.261  0.739   1.00 0.00 ? 38  LYS A HG3  3  
ATOM 4691  H HD3  . LYS A 1 20  ? 2.687   -6.218  0.711   1.00 0.00 ? 38  LYS A HD3  3  
ATOM 4692  H HE3  . LYS A 1 20  ? 2.690   -6.599  3.073   1.00 0.00 ? 38  LYS A HE3  3  
ATOM 4693  H HZ1  . LYS A 1 20  ? 1.625   -4.723  3.568   1.00 0.00 ? 38  LYS A HZ1  3  
ATOM 4694  H HZ2  . LYS A 1 20  ? 0.123   -5.314  3.064   1.00 0.00 ? 38  LYS A HZ2  3  
ATOM 4695  H HZ3  . LYS A 1 20  ? 1.192   -4.650  1.935   1.00 0.00 ? 38  LYS A HZ3  3  
ATOM 4696  N N    . ASN A 1 21  ? 3.544   -7.656  -2.260  1.00 0.00 ? 39  ASN A N    3  
ATOM 4697  C CA   . ASN A 1 21  ? 4.451   -8.479  -3.050  1.00 0.00 ? 39  ASN A CA   3  
ATOM 4698  C C    . ASN A 1 21  ? 3.675   -9.379  -4.008  1.00 0.00 ? 39  ASN A C    3  
ATOM 4699  O O    . ASN A 1 21  ? 3.903   -9.360  -5.216  1.00 0.00 ? 39  ASN A O    3  
ATOM 4700  C CB   . ASN A 1 21  ? 5.332   -9.331  -2.134  1.00 0.00 ? 39  ASN A CB   3  
ATOM 4701  C CG   . ASN A 1 21  ? 4.549   -9.953  -0.994  1.00 0.00 ? 39  ASN A CG   3  
ATOM 4702  O OD1  . ASN A 1 21  ? 4.286   -9.305  0.020   1.00 0.00 ? 39  ASN A OD1  3  
ATOM 4703  N ND2  . ASN A 1 21  ? 4.172   -11.216 -1.155  1.00 0.00 ? 39  ASN A ND2  3  
ATOM 4704  H H    . ASN A 1 21  ? 3.594   -7.696  -1.282  1.00 0.00 ? 39  ASN A H    3  
ATOM 4705  H HA   . ASN A 1 21  ? 5.081   -7.818  -3.627  1.00 0.00 ? 39  ASN A HA   3  
ATOM 4706  H HB3  . ASN A 1 21  ? 6.111   -8.712  -1.715  1.00 0.00 ? 39  ASN A HB3  3  
ATOM 4707  H HD21 . ASN A 1 21  ? 4.417   -11.670 -1.990  1.00 0.00 ? 39  ASN A HD21 3  
ATOM 4708  H HD22 . ASN A 1 21  ? 3.664   -11.643 -0.435  1.00 0.00 ? 39  ASN A HD22 3  
ATOM 4709  N N    . GLY A 1 22  ? 2.755   -10.166 -3.458  1.00 0.00 ? 40  GLY A N    3  
ATOM 4710  C CA   . GLY A 1 22  ? 1.959   -11.060 -4.276  1.00 0.00 ? 40  GLY A CA   3  
ATOM 4711  C C    . GLY A 1 22  ? 0.863   -10.335 -5.032  1.00 0.00 ? 40  GLY A C    3  
ATOM 4712  O O    . GLY A 1 22  ? 1.039   -9.967  -6.193  1.00 0.00 ? 40  GLY A O    3  
ATOM 4713  H H    . GLY A 1 22  ? 2.616   -10.137 -2.488  1.00 0.00 ? 40  GLY A H    3  
ATOM 4714  H HA2  . GLY A 1 22  ? 2.606   -11.552 -4.987  1.00 0.00 ? 40  GLY A HA2  3  
ATOM 4715  H HA3  . GLY A 1 22  ? 1.507   -11.807 -3.639  1.00 0.00 ? 40  GLY A HA3  3  
ATOM 4716  N N    . ARG A 1 23  ? -0.273  -10.129 -4.372  1.00 0.00 ? 41  ARG A N    3  
ATOM 4717  C CA   . ARG A 1 23  ? -1.403  -9.445  -4.989  1.00 0.00 ? 41  ARG A CA   3  
ATOM 4718  C C    . ARG A 1 23  ? -2.148  -8.595  -3.966  1.00 0.00 ? 41  ARG A C    3  
ATOM 4719  O O    . ARG A 1 23  ? -1.763  -8.529  -2.798  1.00 0.00 ? 41  ARG A O    3  
ATOM 4720  C CB   . ARG A 1 23  ? -2.358  -10.460 -5.618  1.00 0.00 ? 41  ARG A CB   3  
ATOM 4721  C CG   . ARG A 1 23  ? -2.936  -11.451 -4.622  1.00 0.00 ? 41  ARG A CG   3  
ATOM 4722  C CD   . ARG A 1 23  ? -3.532  -12.663 -5.322  1.00 0.00 ? 41  ARG A CD   3  
ATOM 4723  N NE   . ARG A 1 23  ? -3.833  -13.743 -4.387  1.00 0.00 ? 41  ARG A NE   3  
ATOM 4724  C CZ   . ARG A 1 23  ? -4.661  -14.744 -4.662  1.00 0.00 ? 41  ARG A CZ   3  
ATOM 4725  N NH1  . ARG A 1 23  ? -5.268  -14.803 -5.837  1.00 0.00 ? 41  ARG A NH1  3  
ATOM 4726  N NH2  . ARG A 1 23  ? -4.882  -15.691 -3.758  1.00 0.00 ? 41  ARG A NH2  3  
ATOM 4727  H H    . ARG A 1 23  ? -0.352  -10.445 -3.448  1.00 0.00 ? 41  ARG A H    3  
ATOM 4728  H HA   . ARG A 1 23  ? -1.016  -8.800  -5.764  1.00 0.00 ? 41  ARG A HA   3  
ATOM 4729  H HB3  . ARG A 1 23  ? -1.826  -11.015 -6.377  1.00 0.00 ? 41  ARG A HB3  3  
ATOM 4730  H HG3  . ARG A 1 23  ? -3.709  -10.961 -4.049  1.00 0.00 ? 41  ARG A HG3  3  
ATOM 4731  H HD3  . ARG A 1 23  ? -2.826  -13.020 -6.056  1.00 0.00 ? 41  ARG A HD3  3  
ATOM 4732  H HE   . ARG A 1 23  ? -3.394  -13.720 -3.510  1.00 0.00 ? 41  ARG A HE   3  
ATOM 4733  H HH11 . ARG A 1 23  ? -5.103  -14.091 -6.521  1.00 0.00 ? 41  ARG A HH11 3  
ATOM 4734  H HH12 . ARG A 1 23  ? -5.892  -15.558 -6.043  1.00 0.00 ? 41  ARG A HH12 3  
ATOM 4735  H HH21 . ARG A 1 23  ? -4.426  -15.650 -2.870  1.00 0.00 ? 41  ARG A HH21 3  
ATOM 4736  H HH22 . ARG A 1 23  ? -5.507  -16.443 -3.965  1.00 0.00 ? 41  ARG A HH22 3  
ATOM 4737  N N    . TYR A 1 24  ? -3.218  -7.944  -4.412  1.00 0.00 ? 42  TYR A N    3  
ATOM 4738  C CA   . TYR A 1 24  ? -4.016  -7.095  -3.536  1.00 0.00 ? 42  TYR A CA   3  
ATOM 4739  C C    . TYR A 1 24  ? -4.674  -7.917  -2.432  1.00 0.00 ? 42  TYR A C    3  
ATOM 4740  O O    . TYR A 1 24  ? -5.760  -8.467  -2.618  1.00 0.00 ? 42  TYR A O    3  
ATOM 4741  C CB   . TYR A 1 24  ? -5.084  -6.355  -4.342  1.00 0.00 ? 42  TYR A CB   3  
ATOM 4742  C CG   . TYR A 1 24  ? -4.561  -5.749  -5.626  1.00 0.00 ? 42  TYR A CG   3  
ATOM 4743  C CD1  . TYR A 1 24  ? -3.437  -4.933  -5.625  1.00 0.00 ? 42  TYR A CD1  3  
ATOM 4744  C CD2  . TYR A 1 24  ? -5.193  -5.993  -6.839  1.00 0.00 ? 42  TYR A CD2  3  
ATOM 4745  C CE1  . TYR A 1 24  ? -2.956  -4.376  -6.794  1.00 0.00 ? 42  TYR A CE1  3  
ATOM 4746  C CE2  . TYR A 1 24  ? -4.718  -5.442  -8.014  1.00 0.00 ? 42  TYR A CE2  3  
ATOM 4747  C CZ   . TYR A 1 24  ? -3.601  -4.635  -7.987  1.00 0.00 ? 42  TYR A CZ   3  
ATOM 4748  O OH   . TYR A 1 24  ? -3.125  -4.083  -9.155  1.00 0.00 ? 42  TYR A OH   3  
ATOM 4749  H H    . TYR A 1 24  ? -3.475  -8.035  -5.353  1.00 0.00 ? 42  TYR A H    3  
ATOM 4750  H HA   . TYR A 1 24  ? -3.355  -6.371  -3.083  1.00 0.00 ? 42  TYR A HA   3  
ATOM 4751  H HB3  . TYR A 1 24  ? -5.491  -5.556  -3.740  1.00 0.00 ? 42  TYR A HB3  3  
ATOM 4752  H HD1  . TYR A 1 24  ? -2.934  -4.733  -4.689  1.00 0.00 ? 42  TYR A HD1  3  
ATOM 4753  H HD2  . TYR A 1 24  ? -6.068  -6.625  -6.857  1.00 0.00 ? 42  TYR A HD2  3  
ATOM 4754  H HE1  . TYR A 1 24  ? -2.081  -3.746  -6.774  1.00 0.00 ? 42  TYR A HE1  3  
ATOM 4755  H HE2  . TYR A 1 24  ? -5.223  -5.643  -8.948  1.00 0.00 ? 42  TYR A HE2  3  
ATOM 4756  H HH   . TYR A 1 24  ? -2.354  -3.544  -8.963  1.00 0.00 ? 42  TYR A HH   3  
ATOM 4757  N N    . SER A 1 25  ? -4.011  -7.995  -1.284  1.00 0.00 ? 43  SER A N    3  
ATOM 4758  C CA   . SER A 1 25  ? -4.529  -8.752  -0.150  1.00 0.00 ? 43  SER A CA   3  
ATOM 4759  C C    . SER A 1 25  ? -4.440  -7.935  1.134   1.00 0.00 ? 43  SER A C    3  
ATOM 4760  O O    . SER A 1 25  ? -3.783  -8.340  2.096   1.00 0.00 ? 43  SER A O    3  
ATOM 4761  C CB   . SER A 1 25  ? -3.756  -10.063 0.009   1.00 0.00 ? 43  SER A CB   3  
ATOM 4762  O OG   . SER A 1 25  ? -4.525  -11.025 0.712   1.00 0.00 ? 43  SER A OG   3  
ATOM 4763  H H    . SER A 1 25  ? -3.149  -7.534  -1.198  1.00 0.00 ? 43  SER A H    3  
ATOM 4764  H HA   . SER A 1 25  ? -5.566  -8.977  -0.349  1.00 0.00 ? 43  SER A HA   3  
ATOM 4765  H HB3  . SER A 1 25  ? -2.846  -9.877  0.560   1.00 0.00 ? 43  SER A HB3  3  
ATOM 4766  H HG   . SER A 1 25  ? -4.534  -11.850 0.220   1.00 0.00 ? 43  SER A HG   3  
ATOM 4767  N N    . ILE A 1 26  ? -5.103  -6.784  1.145   1.00 0.00 ? 44  ILE A N    3  
ATOM 4768  C CA   . ILE A 1 26  ? -5.099  -5.911  2.311   1.00 0.00 ? 44  ILE A CA   3  
ATOM 4769  C C    . ILE A 1 26  ? -6.518  -5.641  2.800   1.00 0.00 ? 44  ILE A C    3  
ATOM 4770  O O    . ILE A 1 26  ? -7.448  -5.523  2.002   1.00 0.00 ? 44  ILE A O    3  
ATOM 4771  C CB   . ILE A 1 26  ? -4.409  -4.568  2.006   1.00 0.00 ? 44  ILE A CB   3  
ATOM 4772  C CG1  . ILE A 1 26  ? -2.968  -4.803  1.548   1.00 0.00 ? 44  ILE A CG1  3  
ATOM 4773  C CG2  . ILE A 1 26  ? -4.441  -3.667  3.232   1.00 0.00 ? 44  ILE A CG2  3  
ATOM 4774  C CD1  . ILE A 1 26  ? -2.368  -3.623  0.816   1.00 0.00 ? 44  ILE A CD1  3  
ATOM 4775  H H    . ILE A 1 26  ? -5.605  -6.517  0.348   1.00 0.00 ? 44  ILE A H    3  
ATOM 4776  H HA   . ILE A 1 26  ? -4.547  -6.406  3.096   1.00 0.00 ? 44  ILE A HA   3  
ATOM 4777  H HB   . ILE A 1 26  ? -4.957  -4.079  1.216   1.00 0.00 ? 44  ILE A HB   3  
ATOM 4778  H HG13 . ILE A 1 26  ? -2.944  -5.654  0.883   1.00 0.00 ? 44  ILE A HG13 3  
ATOM 4779  H HG21 . ILE A 1 26  ? -3.558  -3.045  3.245   1.00 0.00 ? 44  ILE A HG21 3  
ATOM 4780  H HG22 . ILE A 1 26  ? -5.321  -3.042  3.198   1.00 0.00 ? 44  ILE A HG22 3  
ATOM 4781  H HG23 . ILE A 1 26  ? -4.465  -4.273  4.125   1.00 0.00 ? 44  ILE A HG23 3  
ATOM 4782  H HD11 . ILE A 1 26  ? -2.863  -3.500  -0.137  1.00 0.00 ? 44  ILE A HD11 3  
ATOM 4783  H HD12 . ILE A 1 26  ? -2.495  -2.728  1.407   1.00 0.00 ? 44  ILE A HD12 3  
ATOM 4784  H HD13 . ILE A 1 26  ? -1.314  -3.799  0.653   1.00 0.00 ? 44  ILE A HD13 3  
ATOM 4785  N N    . SER A 1 27  ? -6.677  -5.543  4.116   1.00 0.00 ? 45  SER A N    3  
ATOM 4786  C CA   . SER A 1 27  ? -7.984  -5.290  4.712   1.00 0.00 ? 45  SER A CA   3  
ATOM 4787  C C    . SER A 1 27  ? -8.107  -3.832  5.148   1.00 0.00 ? 45  SER A C    3  
ATOM 4788  O O    . SER A 1 27  ? -7.143  -3.069  5.081   1.00 0.00 ? 45  SER A O    3  
ATOM 4789  C CB   . SER A 1 27  ? -8.208  -6.213  5.910   1.00 0.00 ? 45  SER A CB   3  
ATOM 4790  O OG   . SER A 1 27  ? -7.114  -6.159  6.809   1.00 0.00 ? 45  SER A OG   3  
ATOM 4791  H H    . SER A 1 27  ? -5.896  -5.647  4.700   1.00 0.00 ? 45  SER A H    3  
ATOM 4792  H HA   . SER A 1 27  ? -8.734  -5.495  3.964   1.00 0.00 ? 45  SER A HA   3  
ATOM 4793  H HB3  . SER A 1 27  ? -8.323  -7.229  5.562   1.00 0.00 ? 45  SER A HB3  3  
ATOM 4794  H HG   . SER A 1 27  ? -6.895  -5.243  6.992   1.00 0.00 ? 45  SER A HG   3  
ATOM 4795  N N    . ARG A 1 28  ? -9.300  -3.455  5.594   1.00 0.00 ? 46  ARG A N    3  
ATOM 4796  C CA   . ARG A 1 28  ? -9.552  -2.090  6.041   1.00 0.00 ? 46  ARG A CA   3  
ATOM 4797  C C    . ARG A 1 28  ? -8.806  -1.795  7.337   1.00 0.00 ? 46  ARG A C    3  
ATOM 4798  O O    . ARG A 1 28  ? -8.141  -0.766  7.465   1.00 0.00 ? 46  ARG A O    3  
ATOM 4799  C CB   . ARG A 1 28  ? -11.053 -1.865  6.240   1.00 0.00 ? 46  ARG A CB   3  
ATOM 4800  C CG   . ARG A 1 28  ? -11.899 -2.323  5.064   1.00 0.00 ? 46  ARG A CG   3  
ATOM 4801  C CD   . ARG A 1 28  ? -13.383 -2.130  5.337   1.00 0.00 ? 46  ARG A CD   3  
ATOM 4802  N NE   . ARG A 1 28  ? -13.820 -2.863  6.522   1.00 0.00 ? 46  ARG A NE   3  
ATOM 4803  C CZ   . ARG A 1 28  ? -13.919 -4.187  6.574   1.00 0.00 ? 46  ARG A CZ   3  
ATOM 4804  N NH1  . ARG A 1 28  ? -13.611 -4.919  5.511   1.00 0.00 ? 46  ARG A NH1  3  
ATOM 4805  N NH2  . ARG A 1 28  ? -14.324 -4.781  7.688   1.00 0.00 ? 46  ARG A NH2  3  
ATOM 4806  H H    . ARG A 1 28  ? -10.029 -4.110  5.624   1.00 0.00 ? 46  ARG A H    3  
ATOM 4807  H HA   . ARG A 1 28  ? -9.196  -1.419  5.272   1.00 0.00 ? 46  ARG A HA   3  
ATOM 4808  H HB3  . ARG A 1 28  ? -11.228 -0.812  6.393   1.00 0.00 ? 46  ARG A HB3  3  
ATOM 4809  H HG3  . ARG A 1 28  ? -11.709 -3.370  4.881   1.00 0.00 ? 46  ARG A HG3  3  
ATOM 4810  H HD3  . ARG A 1 28  ? -13.941 -2.480  4.482   1.00 0.00 ? 46  ARG A HD3  3  
ATOM 4811  H HE   . ARG A 1 28  ? -14.053 -2.342  7.319   1.00 0.00 ? 46  ARG A HE   3  
ATOM 4812  H HH11 . ARG A 1 28  ? -13.305 -4.474  4.670   1.00 0.00 ? 46  ARG A HH11 3  
ATOM 4813  H HH12 . ARG A 1 28  ? -13.685 -5.915  5.553   1.00 0.00 ? 46  ARG A HH12 3  
ATOM 4814  H HH21 . ARG A 1 28  ? -14.557 -4.232  8.491   1.00 0.00 ? 46  ARG A HH21 3  
ATOM 4815  H HH22 . ARG A 1 28  ? -14.399 -5.777  7.725   1.00 0.00 ? 46  ARG A HH22 3  
ATOM 4816  N N    . THR A 1 29  ? -8.919  -2.705  8.300   1.00 0.00 ? 47  THR A N    3  
ATOM 4817  C CA   . THR A 1 29  ? -8.257  -2.543  9.587   1.00 0.00 ? 47  THR A CA   3  
ATOM 4818  C C    . THR A 1 29  ? -6.751  -2.378  9.414   1.00 0.00 ? 47  THR A C    3  
ATOM 4819  O O    . THR A 1 29  ? -6.084  -1.774  10.254  1.00 0.00 ? 47  THR A O    3  
ATOM 4820  C CB   . THR A 1 29  ? -8.527  -3.743  10.514  1.00 0.00 ? 47  THR A CB   3  
ATOM 4821  O OG1  . THR A 1 29  ? -7.936  -3.514  11.798  1.00 0.00 ? 47  THR A OG1  3  
ATOM 4822  C CG2  . THR A 1 29  ? -7.969  -5.025  9.915   1.00 0.00 ? 47  THR A CG2  3  
ATOM 4823  H H    . THR A 1 29  ? -9.463  -3.505  8.138   1.00 0.00 ? 47  THR A H    3  
ATOM 4824  H HA   . THR A 1 29  ? -8.654  -1.655  10.058  1.00 0.00 ? 47  THR A HA   3  
ATOM 4825  H HB   . THR A 1 29  ? -9.596  -3.853  10.633  1.00 0.00 ? 47  THR A HB   3  
ATOM 4826  H HG1  . THR A 1 29  ? -6.980  -3.556  11.722  1.00 0.00 ? 47  THR A HG1  3  
ATOM 4827  H HG21 . THR A 1 29  ? -8.058  -5.827  10.633  1.00 0.00 ? 47  THR A HG21 3  
ATOM 4828  H HG22 . THR A 1 29  ? -6.928  -4.882  9.663   1.00 0.00 ? 47  THR A HG22 3  
ATOM 4829  H HG23 . THR A 1 29  ? -8.524  -5.277  9.024   1.00 0.00 ? 47  THR A HG23 3  
ATOM 4830  N N    . GLU A 1 30  ? -6.223  -2.915  8.320   1.00 0.00 ? 48  GLU A N    3  
ATOM 4831  C CA   . GLU A 1 30  ? -4.795  -2.827  8.038   1.00 0.00 ? 48  GLU A CA   3  
ATOM 4832  C C    . GLU A 1 30  ? -4.493  -1.642  7.126   1.00 0.00 ? 48  GLU A C    3  
ATOM 4833  O O    . GLU A 1 30  ? -3.396  -1.086  7.157   1.00 0.00 ? 48  GLU A O    3  
ATOM 4834  C CB   . GLU A 1 30  ? -4.299  -4.122  7.390   1.00 0.00 ? 48  GLU A CB   3  
ATOM 4835  C CG   . GLU A 1 30  ? -3.999  -5.226  8.390   1.00 0.00 ? 48  GLU A CG   3  
ATOM 4836  C CD   . GLU A 1 30  ? -3.223  -6.375  7.774   1.00 0.00 ? 48  GLU A CD   3  
ATOM 4837  O OE1  . GLU A 1 30  ? -2.163  -6.118  7.166   1.00 0.00 ? 48  GLU A OE1  3  
ATOM 4838  O OE2  . GLU A 1 30  ? -3.678  -7.532  7.901   1.00 0.00 ? 48  GLU A OE2  3  
ATOM 4839  H H    . GLU A 1 30  ? -6.808  -3.385  7.687   1.00 0.00 ? 48  GLU A H    3  
ATOM 4840  H HA   . GLU A 1 30  ? -4.280  -2.685  8.976   1.00 0.00 ? 48  GLU A HA   3  
ATOM 4841  H HB3  . GLU A 1 30  ? -3.397  -3.911  6.837   1.00 0.00 ? 48  GLU A HB3  3  
ATOM 4842  H HG3  . GLU A 1 30  ? -4.932  -5.608  8.777   1.00 0.00 ? 48  GLU A HG3  3  
ATOM 4843  N N    . ALA A 1 31  ? -5.475  -1.261  6.314   1.00 0.00 ? 49  ALA A N    3  
ATOM 4844  C CA   . ALA A 1 31  ? -5.315  -0.142  5.396   1.00 0.00 ? 49  ALA A CA   3  
ATOM 4845  C C    . ALA A 1 31  ? -4.814  1.100   6.124   1.00 0.00 ? 49  ALA A C    3  
ATOM 4846  O O    . ALA A 1 31  ? -3.808  1.694   5.739   1.00 0.00 ? 49  ALA A O    3  
ATOM 4847  C CB   . ALA A 1 31  ? -6.631  0.153   4.690   1.00 0.00 ? 49  ALA A CB   3  
ATOM 4848  H H    . ALA A 1 31  ? -6.327  -1.744  6.336   1.00 0.00 ? 49  ALA A H    3  
ATOM 4849  H HA   . ALA A 1 31  ? -4.588  -0.426  4.647   1.00 0.00 ? 49  ALA A HA   3  
ATOM 4850  H HB1  . ALA A 1 31  ? -6.581  1.129   4.229   1.00 0.00 ? 49  ALA A HB1  3  
ATOM 4851  H HB2  . ALA A 1 31  ? -6.807  -0.595  3.931   1.00 0.00 ? 49  ALA A HB2  3  
ATOM 4852  H HB3  . ALA A 1 31  ? -7.436  0.135   5.409   1.00 0.00 ? 49  ALA A HB3  3  
ATOM 4853  N N    . ALA A 1 32  ? -5.524  1.488   7.180   1.00 0.00 ? 50  ALA A N    3  
ATOM 4854  C CA   . ALA A 1 32  ? -5.150  2.658   7.964   1.00 0.00 ? 50  ALA A CA   3  
ATOM 4855  C C    . ALA A 1 32  ? -3.705  2.561   8.442   1.00 0.00 ? 50  ALA A C    3  
ATOM 4856  O O    . ALA A 1 32  ? -2.917  3.489   8.259   1.00 0.00 ? 50  ALA A O    3  
ATOM 4857  C CB   . ALA A 1 32  ? -6.090  2.822   9.149   1.00 0.00 ? 50  ALA A CB   3  
ATOM 4858  H H    . ALA A 1 32  ? -6.317  0.972   7.438   1.00 0.00 ? 50  ALA A H    3  
ATOM 4859  H HA   . ALA A 1 32  ? -5.251  3.529   7.332   1.00 0.00 ? 50  ALA A HA   3  
ATOM 4860  H HB1  . ALA A 1 32  ? -5.806  2.133   9.930   1.00 0.00 ? 50  ALA A HB1  3  
ATOM 4861  H HB2  . ALA A 1 32  ? -6.028  3.835   9.521   1.00 0.00 ? 50  ALA A HB2  3  
ATOM 4862  H HB3  . ALA A 1 32  ? -7.102  2.615   8.837   1.00 0.00 ? 50  ALA A HB3  3  
ATOM 4863  N N    . ASP A 1 33  ? -3.365  1.432   9.055   1.00 0.00 ? 51  ASP A N    3  
ATOM 4864  C CA   . ASP A 1 33  ? -2.015  1.214   9.559   1.00 0.00 ? 51  ASP A CA   3  
ATOM 4865  C C    . ASP A 1 33  ? -0.992  1.305   8.430   1.00 0.00 ? 51  ASP A C    3  
ATOM 4866  O O    . ASP A 1 33  ? 0.079   1.892   8.593   1.00 0.00 ? 51  ASP A O    3  
ATOM 4867  C CB   . ASP A 1 33  ? -1.916  -0.151  10.243  1.00 0.00 ? 51  ASP A CB   3  
ATOM 4868  C CG   . ASP A 1 33  ? -0.747  -0.235  11.203  1.00 0.00 ? 51  ASP A CG   3  
ATOM 4869  O OD1  . ASP A 1 33  ? -0.283  0.828   11.668  1.00 0.00 ? 51  ASP A OD1  3  
ATOM 4870  O OD2  . ASP A 1 33  ? -0.295  -1.364  11.490  1.00 0.00 ? 51  ASP A OD2  3  
ATOM 4871  H H    . ASP A 1 33  ? -4.038  0.729   9.169   1.00 0.00 ? 51  ASP A H    3  
ATOM 4872  H HA   . ASP A 1 33  ? -1.802  1.984   10.283  1.00 0.00 ? 51  ASP A HA   3  
ATOM 4873  H HB3  . ASP A 1 33  ? -1.796  -0.917  9.488   1.00 0.00 ? 51  ASP A HB3  3  
ATOM 4874  N N    . LEU A 1 34  ? -1.327  0.721   7.285   1.00 0.00 ? 52  LEU A N    3  
ATOM 4875  C CA   . LEU A 1 34  ? -0.438  0.736   6.129   1.00 0.00 ? 52  LEU A CA   3  
ATOM 4876  C C    . LEU A 1 34  ? -0.162  2.164   5.671   1.00 0.00 ? 52  LEU A C    3  
ATOM 4877  O O    . LEU A 1 34  ? 0.988   2.548   5.456   1.00 0.00 ? 52  LEU A O    3  
ATOM 4878  C CB   . LEU A 1 34  ? -1.048  -0.071  4.982   1.00 0.00 ? 52  LEU A CB   3  
ATOM 4879  C CG   . LEU A 1 34  ? -0.559  -1.513  4.840   1.00 0.00 ? 52  LEU A CG   3  
ATOM 4880  C CD1  . LEU A 1 34  ? -1.053  -2.360  6.004   1.00 0.00 ? 52  LEU A CD1  3  
ATOM 4881  C CD2  . LEU A 1 34  ? -1.018  -2.105  3.515   1.00 0.00 ? 52  LEU A CD2  3  
ATOM 4882  H H    . LEU A 1 34  ? -2.193  0.269   7.214   1.00 0.00 ? 52  LEU A H    3  
ATOM 4883  H HA   . LEU A 1 34  ? 0.495   0.279   6.423   1.00 0.00 ? 52  LEU A HA   3  
ATOM 4884  H HB3  . LEU A 1 34  ? -0.825  0.447   4.059   1.00 0.00 ? 52  LEU A HB3  3  
ATOM 4885  H HG   . LEU A 1 34  ? 0.522   -1.524  4.856   1.00 0.00 ? 52  LEU A HG   3  
ATOM 4886  H HD11 . LEU A 1 34  ? -2.110  -2.544  5.892   1.00 0.00 ? 52  LEU A HD11 3  
ATOM 4887  H HD12 . LEU A 1 34  ? -0.874  -1.837  6.931   1.00 0.00 ? 52  LEU A HD12 3  
ATOM 4888  H HD13 . LEU A 1 34  ? -0.523  -3.301  6.013   1.00 0.00 ? 52  LEU A HD13 3  
ATOM 4889  H HD21 . LEU A 1 34  ? -1.641  -1.390  3.000   1.00 0.00 ? 52  LEU A HD21 3  
ATOM 4890  H HD22 . LEU A 1 34  ? -1.582  -3.007  3.700   1.00 0.00 ? 52  LEU A HD22 3  
ATOM 4891  H HD23 . LEU A 1 34  ? -0.156  -2.337  2.908   1.00 0.00 ? 52  LEU A HD23 3  
ATOM 4892  N N    . CYS A 1 35  ? -1.225  2.949   5.527   1.00 0.00 ? 53  CYS A N    3  
ATOM 4893  C CA   . CYS A 1 35  ? -1.099  4.336   5.098   1.00 0.00 ? 53  CYS A CA   3  
ATOM 4894  C C    . CYS A 1 35  ? -0.255  5.137   6.085   1.00 0.00 ? 53  CYS A C    3  
ATOM 4895  O O    . CYS A 1 35  ? 0.748   5.745   5.711   1.00 0.00 ? 53  CYS A O    3  
ATOM 4896  C CB   . CYS A 1 35  ? -2.483  4.975   4.955   1.00 0.00 ? 53  CYS A CB   3  
ATOM 4897  S SG   . CYS A 1 35  ? -3.519  4.225   3.659   1.00 0.00 ? 53  CYS A SG   3  
ATOM 4898  H H    . CYS A 1 35  ? -2.117  2.586   5.715   1.00 0.00 ? 53  CYS A H    3  
ATOM 4899  H HA   . CYS A 1 35  ? -0.610  4.343   4.137   1.00 0.00 ? 53  CYS A HA   3  
ATOM 4900  H HB3  . CYS A 1 35  ? -2.364  6.022   4.718   1.00 0.00 ? 53  CYS A HB3  3  
ATOM 4901  N N    . LYS A 1 36  ? -0.670  5.133   7.347   1.00 0.00 ? 54  LYS A N    3  
ATOM 4902  C CA   . LYS A 1 36  ? 0.047   5.857   8.390   1.00 0.00 ? 54  LYS A CA   3  
ATOM 4903  C C    . LYS A 1 36  ? 1.507   5.421   8.450   1.00 0.00 ? 54  LYS A C    3  
ATOM 4904  O O    . LYS A 1 36  ? 2.406   6.248   8.602   1.00 0.00 ? 54  LYS A O    3  
ATOM 4905  C CB   . LYS A 1 36  ? -0.620  5.628   9.749   1.00 0.00 ? 54  LYS A CB   3  
ATOM 4906  C CG   . LYS A 1 36  ? 0.045   6.384   10.887  1.00 0.00 ? 54  LYS A CG   3  
ATOM 4907  C CD   . LYS A 1 36  ? -0.393  5.849   12.241  1.00 0.00 ? 54  LYS A CD   3  
ATOM 4908  C CE   . LYS A 1 36  ? 0.667   6.089   13.304  1.00 0.00 ? 54  LYS A CE   3  
ATOM 4909  N NZ   . LYS A 1 36  ? 0.729   7.520   13.713  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 4910  H H    . LYS A 1 36  ? -1.477  4.629   7.584   1.00 0.00 ? 54  LYS A H    3  
ATOM 4911  H HA   . LYS A 1 36  ? 0.007   6.908   8.152   1.00 0.00 ? 54  LYS A HA   3  
ATOM 4912  H HB3  . LYS A 1 36  ? -0.591  4.573   9.978   1.00 0.00 ? 54  LYS A HB3  3  
ATOM 4913  H HG3  . LYS A 1 36  ? -0.222  7.429   10.820  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 4914  H HD3  . LYS A 1 36  ? -0.573  4.786   12.157  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 4915  H HE3  . LYS A 1 36  ? 1.628   5.793   12.909  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 4916  H HZ1  . LYS A 1 36  ? 1.681   7.899   13.536  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 4917  H HZ2  . LYS A 1 36  ? 0.515   7.612   14.726  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 4918  H HZ3  . LYS A 1 36  ? 0.040   8.077   13.170  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 4919  N N    . ALA A 1 37  ? 1.737   4.117   8.328   1.00 0.00 ? 55  ALA A N    3  
ATOM 4920  C CA   . ALA A 1 37  ? 3.088   3.573   8.365   1.00 0.00 ? 55  ALA A CA   3  
ATOM 4921  C C    . ALA A 1 37  ? 3.867   3.951   7.109   1.00 0.00 ? 55  ALA A C    3  
ATOM 4922  O O    . ALA A 1 37  ? 5.078   3.750   7.035   1.00 0.00 ? 55  ALA A O    3  
ATOM 4923  C CB   . ALA A 1 37  ? 3.043   2.060   8.524   1.00 0.00 ? 55  ALA A CB   3  
ATOM 4924  H H    . ALA A 1 37  ? 0.978   3.508   8.209   1.00 0.00 ? 55  ALA A H    3  
ATOM 4925  H HA   . ALA A 1 37  ? 3.591   3.986   9.227   1.00 0.00 ? 55  ALA A HA   3  
ATOM 4926  H HB1  . ALA A 1 37  ? 2.518   1.626   7.685   1.00 0.00 ? 55  ALA A HB1  3  
ATOM 4927  H HB2  . ALA A 1 37  ? 4.049   1.673   8.560   1.00 0.00 ? 55  ALA A HB2  3  
ATOM 4928  H HB3  . ALA A 1 37  ? 2.528   1.811   9.439   1.00 0.00 ? 55  ALA A HB3  3  
ATOM 4929  N N    . PHE A 1 38  ? 3.162   4.500   6.125   1.00 0.00 ? 56  PHE A N    3  
ATOM 4930  C CA   . PHE A 1 38  ? 3.788   4.905   4.872   1.00 0.00 ? 56  PHE A CA   3  
ATOM 4931  C C    . PHE A 1 38  ? 3.871   6.426   4.772   1.00 0.00 ? 56  PHE A C    3  
ATOM 4932  O O    . PHE A 1 38  ? 3.963   6.984   3.680   1.00 0.00 ? 56  PHE A O    3  
ATOM 4933  C CB   . PHE A 1 38  ? 3.004   4.348   3.682   1.00 0.00 ? 56  PHE A CB   3  
ATOM 4934  C CG   . PHE A 1 38  ? 3.573   3.072   3.133   1.00 0.00 ? 56  PHE A CG   3  
ATOM 4935  C CD1  . PHE A 1 38  ? 4.900   3.004   2.738   1.00 0.00 ? 56  PHE A CD1  3  
ATOM 4936  C CD2  . PHE A 1 38  ? 2.784   1.939   3.012   1.00 0.00 ? 56  PHE A CD2  3  
ATOM 4937  C CE1  . PHE A 1 38  ? 5.428   1.830   2.233   1.00 0.00 ? 56  PHE A CE1  3  
ATOM 4938  C CE2  . PHE A 1 38  ? 3.306   0.764   2.509   1.00 0.00 ? 56  PHE A CE2  3  
ATOM 4939  C CZ   . PHE A 1 38  ? 4.629   0.709   2.118   1.00 0.00 ? 56  PHE A CZ   3  
ATOM 4940  H H    . PHE A 1 38  ? 2.199   4.635   6.244   1.00 0.00 ? 56  PHE A H    3  
ATOM 4941  H HA   . PHE A 1 38  ? 4.787   4.500   4.854   1.00 0.00 ? 56  PHE A HA   3  
ATOM 4942  H HB3  . PHE A 1 38  ? 3.000   5.081   2.889   1.00 0.00 ? 56  PHE A HB3  3  
ATOM 4943  H HD1  . PHE A 1 38  ? 5.526   3.880   2.828   1.00 0.00 ? 56  PHE A HD1  3  
ATOM 4944  H HD2  . PHE A 1 38  ? 1.748   1.981   3.317   1.00 0.00 ? 56  PHE A HD2  3  
ATOM 4945  H HE1  . PHE A 1 38  ? 6.463   1.791   1.927   1.00 0.00 ? 56  PHE A HE1  3  
ATOM 4946  H HE2  . PHE A 1 38  ? 2.680   -0.110  2.419   1.00 0.00 ? 56  PHE A HE2  3  
ATOM 4947  H HZ   . PHE A 1 38  ? 5.040   -0.208  1.723   1.00 0.00 ? 56  PHE A HZ   3  
ATOM 4948  N N    . ASN A 1 39  ? 3.840   7.091   5.923   1.00 0.00 ? 57  ASN A N    3  
ATOM 4949  C CA   . ASN A 1 39  ? 3.912   8.547   5.968   1.00 0.00 ? 57  ASN A CA   3  
ATOM 4950  C C    . ASN A 1 39  ? 2.727   9.171   5.238   1.00 0.00 ? 57  ASN A C    3  
ATOM 4951  O O    . ASN A 1 39  ? 2.805   10.305  4.763   1.00 0.00 ? 57  ASN A O    3  
ATOM 4952  C CB   . ASN A 1 39  ? 5.223   9.032   5.344   1.00 0.00 ? 57  ASN A CB   3  
ATOM 4953  C CG   . ASN A 1 39  ? 5.709   10.330  5.962   1.00 0.00 ? 57  ASN A CG   3  
ATOM 4954  O OD1  . ASN A 1 39  ? 6.159   10.355  7.107   1.00 0.00 ? 57  ASN A OD1  3  
ATOM 4955  N ND2  . ASN A 1 39  ? 5.622   11.416  5.202   1.00 0.00 ? 57  ASN A ND2  3  
ATOM 4956  H H    . ASN A 1 39  ? 3.767   6.590   6.763   1.00 0.00 ? 57  ASN A H    3  
ATOM 4957  H HA   . ASN A 1 39  ? 3.882   8.848   7.003   1.00 0.00 ? 57  ASN A HA   3  
ATOM 4958  H HB3  . ASN A 1 39  ? 5.075   9.191   4.287   1.00 0.00 ? 57  ASN A HB3  3  
ATOM 4959  H HD21 . ASN A 1 39  ? 5.253   11.320  4.299   1.00 0.00 ? 57  ASN A HD21 3  
ATOM 4960  H HD22 . ASN A 1 39  ? 5.931   12.267  5.576   1.00 0.00 ? 57  ASN A HD22 3  
ATOM 4961  N N    . SER A 1 40  ? 1.631   8.424   5.152   1.00 0.00 ? 58  SER A N    3  
ATOM 4962  C CA   . SER A 1 40  ? 0.430   8.904   4.478   1.00 0.00 ? 58  SER A CA   3  
ATOM 4963  C C    . SER A 1 40  ? -0.724  9.055   5.465   1.00 0.00 ? 58  SER A C    3  
ATOM 4964  O O    . SER A 1 40  ? -0.552  8.881   6.672   1.00 0.00 ? 58  SER A O    3  
ATOM 4965  C CB   . SER A 1 40  ? 0.032   7.943   3.355   1.00 0.00 ? 58  SER A CB   3  
ATOM 4966  O OG   . SER A 1 40  ? 1.168   7.513   2.625   1.00 0.00 ? 58  SER A OG   3  
ATOM 4967  H H    . SER A 1 40  ? 1.631   7.528   5.550   1.00 0.00 ? 58  SER A H    3  
ATOM 4968  H HA   . SER A 1 40  ? 0.652   9.870   4.050   1.00 0.00 ? 58  SER A HA   3  
ATOM 4969  H HB3  . SER A 1 40  ? -0.646  8.445   2.679   1.00 0.00 ? 58  SER A HB3  3  
ATOM 4970  H HG   . SER A 1 40  ? 1.849   8.188   2.664   1.00 0.00 ? 58  SER A HG   3  
ATOM 4971  N N    . THR A 1 41  ? -1.903  9.380   4.943   1.00 0.00 ? 59  THR A N    3  
ATOM 4972  C CA   . THR A 1 41  ? -3.085  9.556   5.776   1.00 0.00 ? 59  THR A CA   3  
ATOM 4973  C C    . THR A 1 41  ? -4.299  8.868   5.162   1.00 0.00 ? 59  THR A C    3  
ATOM 4974  O O    . THR A 1 41  ? -4.193  8.209   4.126   1.00 0.00 ? 59  THR A O    3  
ATOM 4975  C CB   . THR A 1 41  ? -3.407  11.048  5.987   1.00 0.00 ? 59  THR A CB   3  
ATOM 4976  O OG1  . THR A 1 41  ? -3.740  11.659  4.735   1.00 0.00 ? 59  THR A OG1  3  
ATOM 4977  C CG2  . THR A 1 41  ? -2.225  11.774  6.611   1.00 0.00 ? 59  THR A CG2  3  
ATOM 4978  H H    . THR A 1 41  ? -1.977  9.505   3.973   1.00 0.00 ? 59  THR A H    3  
ATOM 4979  H HA   . THR A 1 41  ? -2.882  9.114   6.740   1.00 0.00 ? 59  THR A HA   3  
ATOM 4980  H HB   . THR A 1 41  ? -4.253  11.127  6.654   1.00 0.00 ? 59  THR A HB   3  
ATOM 4981  H HG1  . THR A 1 41  ? -3.637  12.611  4.806   1.00 0.00 ? 59  THR A HG1  3  
ATOM 4982  H HG21 . THR A 1 41  ? -2.585  12.588  7.223   1.00 0.00 ? 59  THR A HG21 3  
ATOM 4983  H HG22 . THR A 1 41  ? -1.587  12.162  5.831   1.00 0.00 ? 59  THR A HG22 3  
ATOM 4984  H HG23 . THR A 1 41  ? -1.663  11.085  7.225   1.00 0.00 ? 59  THR A HG23 3  
ATOM 4985  N N    . LEU A 1 42  ? -5.451  9.025   5.804   1.00 0.00 ? 60  LEU A N    3  
ATOM 4986  C CA   . LEU A 1 42  ? -6.686  8.419   5.319   1.00 0.00 ? 60  LEU A CA   3  
ATOM 4987  C C    . LEU A 1 42  ? -7.611  9.473   4.719   1.00 0.00 ? 60  LEU A C    3  
ATOM 4988  O O    . LEU A 1 42  ? -8.383  10.127  5.418   1.00 0.00 ? 60  LEU A O    3  
ATOM 4989  C CB   . LEU A 1 42  ? -7.399  7.688   6.459   1.00 0.00 ? 60  LEU A CB   3  
ATOM 4990  C CG   . LEU A 1 42  ? -7.044  6.212   6.635   1.00 0.00 ? 60  LEU A CG   3  
ATOM 4991  C CD1  . LEU A 1 42  ? -7.615  5.678   7.940   1.00 0.00 ? 60  LEU A CD1  3  
ATOM 4992  C CD2  . LEU A 1 42  ? -7.553  5.396   5.456   1.00 0.00 ? 60  LEU A CD2  3  
ATOM 4993  H H    . LEU A 1 42  ? -5.471  9.561   6.624   1.00 0.00 ? 60  LEU A H    3  
ATOM 4994  H HA   . LEU A 1 42  ? -6.425  7.705   4.552   1.00 0.00 ? 60  LEU A HA   3  
ATOM 4995  H HB3  . LEU A 1 42  ? -8.463  7.755   6.277   1.00 0.00 ? 60  LEU A HB3  3  
ATOM 4996  H HG   . LEU A 1 42  ? -5.968  6.108   6.675   1.00 0.00 ? 60  LEU A HG   3  
ATOM 4997  H HD11 . LEU A 1 42  ? -6.912  5.856   8.740   1.00 0.00 ? 60  LEU A HD11 3  
ATOM 4998  H HD12 . LEU A 1 42  ? -7.792  4.615   7.848   1.00 0.00 ? 60  LEU A HD12 3  
ATOM 4999  H HD13 . LEU A 1 42  ? -8.545  6.180   8.158   1.00 0.00 ? 60  LEU A HD13 3  
ATOM 5000  H HD21 . LEU A 1 42  ? -7.635  6.032   4.588   1.00 0.00 ? 60  LEU A HD21 3  
ATOM 5001  H HD22 . LEU A 1 42  ? -8.524  4.984   5.694   1.00 0.00 ? 60  LEU A HD22 3  
ATOM 5002  H HD23 . LEU A 1 42  ? -6.862  4.592   5.249   1.00 0.00 ? 60  LEU A HD23 3  
ATOM 5003  N N    . PRO A 1 43  ? -7.530  9.641   3.390   1.00 0.00 ? 61  PRO A N    3  
ATOM 5004  C CA   . PRO A 1 43  ? -8.355  10.613  2.665   1.00 0.00 ? 61  PRO A CA   3  
ATOM 5005  C C    . PRO A 1 43  ? -9.826  10.209  2.624   1.00 0.00 ? 61  PRO A C    3  
ATOM 5006  O O    . PRO A 1 43  ? -10.192 9.114   3.053   1.00 0.00 ? 61  PRO A O    3  
ATOM 5007  C CB   . PRO A 1 43  ? -7.759  10.601  1.255   1.00 0.00 ? 61  PRO A CB   3  
ATOM 5008  C CG   . PRO A 1 43  ? -7.127  9.258   1.121   1.00 0.00 ? 61  PRO A CG   3  
ATOM 5009  C CD   . PRO A 1 43  ? -6.631  8.896   2.494   1.00 0.00 ? 61  PRO A CD   3  
ATOM 5010  H HA   . PRO A 1 43  ? -8.266  11.602  3.087   1.00 0.00 ? 61  PRO A HA   3  
ATOM 5011  H HB3  . PRO A 1 43  ? -7.029  11.391  1.163   1.00 0.00 ? 61  PRO A HB3  3  
ATOM 5012  H HG3  . PRO A 1 43  ? -6.303  9.308   0.426   1.00 0.00 ? 61  PRO A HG3  3  
ATOM 5013  H HD3  . PRO A 1 43  ? -5.608  9.218   2.621   1.00 0.00 ? 61  PRO A HD3  3  
ATOM 5014  N N    . THR A 1 44  ? -10.665 11.100  2.107   1.00 0.00 ? 62  THR A N    3  
ATOM 5015  C CA   . THR A 1 44  ? -12.096 10.838  2.012   1.00 0.00 ? 62  THR A CA   3  
ATOM 5016  C C    . THR A 1 44  ? -12.534 10.701  0.559   1.00 0.00 ? 62  THR A C    3  
ATOM 5017  O O    . THR A 1 44  ? -11.710 10.743  -0.354  1.00 0.00 ? 62  THR A O    3  
ATOM 5018  C CB   . THR A 1 44  ? -12.918 11.956  2.682   1.00 0.00 ? 62  THR A CB   3  
ATOM 5019  O OG1  . THR A 1 44  ? -12.680 13.203  2.018   1.00 0.00 ? 62  THR A OG1  3  
ATOM 5020  C CG2  . THR A 1 44  ? -12.559 12.083  4.154   1.00 0.00 ? 62  THR A CG2  3  
ATOM 5021  H H    . THR A 1 44  ? -10.312 11.955  1.782   1.00 0.00 ? 62  THR A H    3  
ATOM 5022  H HA   . THR A 1 44  ? -12.299 9.912   2.528   1.00 0.00 ? 62  THR A HA   3  
ATOM 5023  H HB   . THR A 1 44  ? -13.966 11.707  2.601   1.00 0.00 ? 62  THR A HB   3  
ATOM 5024  H HG1  . THR A 1 44  ? -11.874 13.598  2.359   1.00 0.00 ? 62  THR A HG1  3  
ATOM 5025  H HG21 . THR A 1 44  ? -11.966 12.973  4.304   1.00 0.00 ? 62  THR A HG21 3  
ATOM 5026  H HG22 . THR A 1 44  ? -11.994 11.216  4.463   1.00 0.00 ? 62  THR A HG22 3  
ATOM 5027  H HG23 . THR A 1 44  ? -13.464 12.151  4.740   1.00 0.00 ? 62  THR A HG23 3  
ATOM 5028  N N    . MET A 1 45  ? -13.837 10.540  0.351   1.00 0.00 ? 63  MET A N    3  
ATOM 5029  C CA   . MET A 1 45  ? -14.383 10.398  -0.994  1.00 0.00 ? 63  MET A CA   3  
ATOM 5030  C C    . MET A 1 45  ? -13.924 11.543  -1.890  1.00 0.00 ? 63  MET A C    3  
ATOM 5031  O O    . MET A 1 45  ? -13.603 11.337  -3.062  1.00 0.00 ? 63  MET A O    3  
ATOM 5032  C CB   . MET A 1 45  ? -15.912 10.358  -0.944  1.00 0.00 ? 63  MET A CB   3  
ATOM 5033  C CG   . MET A 1 45  ? -16.475 8.967   -0.702  1.00 0.00 ? 63  MET A CG   3  
ATOM 5034  S SD   . MET A 1 45  ? -16.508 8.524   1.045   1.00 0.00 ? 63  MET A SD   3  
ATOM 5035  C CE   . MET A 1 45  ? -17.876 7.369   1.076   1.00 0.00 ? 63  MET A CE   3  
ATOM 5036  H H    . MET A 1 45  ? -14.445 10.514  1.119   1.00 0.00 ? 63  MET A H    3  
ATOM 5037  H HA   . MET A 1 45  ? -14.021 9.468   -1.404  1.00 0.00 ? 63  MET A HA   3  
ATOM 5038  H HB3  . MET A 1 45  ? -16.301 10.723  -1.882  1.00 0.00 ? 63  MET A HB3  3  
ATOM 5039  H HG3  . MET A 1 45  ? -15.865 8.250   -1.231  1.00 0.00 ? 63  MET A HG3  3  
ATOM 5040  H HE1  . MET A 1 45  ? -18.723 7.799   0.561   1.00 0.00 ? 63  MET A HE1  3  
ATOM 5041  H HE2  . MET A 1 45  ? -17.584 6.451   0.586   1.00 0.00 ? 63  MET A HE2  3  
ATOM 5042  H HE3  . MET A 1 45  ? -18.147 7.160   2.100   1.00 0.00 ? 63  MET A HE3  3  
ATOM 5043  N N    . ALA A 1 46  ? -13.892 12.749  -1.334  1.00 0.00 ? 64  ALA A N    3  
ATOM 5044  C CA   . ALA A 1 46  ? -13.469 13.926  -2.083  1.00 0.00 ? 64  ALA A CA   3  
ATOM 5045  C C    . ALA A 1 46  ? -12.124 13.690  -2.763  1.00 0.00 ? 64  ALA A C    3  
ATOM 5046  O O    . ALA A 1 46  ? -11.989 13.874  -3.973  1.00 0.00 ? 64  ALA A O    3  
ATOM 5047  C CB   . ALA A 1 46  ? -13.393 15.138  -1.166  1.00 0.00 ? 64  ALA A CB   3  
ATOM 5048  H H    . ALA A 1 46  ? -14.160 12.851  -0.396  1.00 0.00 ? 64  ALA A H    3  
ATOM 5049  H HA   . ALA A 1 46  ? -14.214 14.124  -2.841  1.00 0.00 ? 64  ALA A HA   3  
ATOM 5050  H HB1  . ALA A 1 46  ? -14.304 15.207  -0.588  1.00 0.00 ? 64  ALA A HB1  3  
ATOM 5051  H HB2  . ALA A 1 46  ? -12.550 15.032  -0.499  1.00 0.00 ? 64  ALA A HB2  3  
ATOM 5052  H HB3  . ALA A 1 46  ? -13.274 16.031  -1.760  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 5053  N N    . GLN A 1 47  ? -11.134 13.281  -1.977  1.00 0.00 ? 65  GLN A N    3  
ATOM 5054  C CA   . GLN A 1 47  ? -9.799  13.022  -2.504  1.00 0.00 ? 65  GLN A CA   3  
ATOM 5055  C C    . GLN A 1 47  ? -9.857  12.052  -3.680  1.00 0.00 ? 65  GLN A C    3  
ATOM 5056  O O    . GLN A 1 47  ? -9.273  12.304  -4.734  1.00 0.00 ? 65  GLN A O    3  
ATOM 5057  C CB   . GLN A 1 47  ? -8.895  12.457  -1.407  1.00 0.00 ? 65  GLN A CB   3  
ATOM 5058  C CG   . GLN A 1 47  ? -7.960  13.490  -0.799  1.00 0.00 ? 65  GLN A CG   3  
ATOM 5059  C CD   . GLN A 1 47  ? -7.118  14.200  -1.841  1.00 0.00 ? 65  GLN A CD   3  
ATOM 5060  O OE1  . GLN A 1 47  ? -7.053  13.777  -2.996  1.00 0.00 ? 65  GLN A OE1  3  
ATOM 5061  N NE2  . GLN A 1 47  ? -6.468  15.285  -1.437  1.00 0.00 ? 65  GLN A NE2  3  
ATOM 5062  H H    . GLN A 1 47  ? -11.304 13.152  -1.022  1.00 0.00 ? 65  GLN A H    3  
ATOM 5063  H HA   . GLN A 1 47  ? -9.390  13.961  -2.847  1.00 0.00 ? 65  GLN A HA   3  
ATOM 5064  H HB3  . GLN A 1 47  ? -8.296  11.662  -1.824  1.00 0.00 ? 65  GLN A HB3  3  
ATOM 5065  H HG3  . GLN A 1 47  ? -7.300  12.992  -0.102  1.00 0.00 ? 65  GLN A HG3  3  
ATOM 5066  H HE21 . GLN A 1 47  ? -6.566  15.561  -0.502  1.00 0.00 ? 65  GLN A HE21 3  
ATOM 5067  H HE22 . GLN A 1 47  ? -5.917  15.763  -2.090  1.00 0.00 ? 65  GLN A HE22 3  
ATOM 5068  N N    . MET A 1 48  ? -10.565 10.943  -3.493  1.00 0.00 ? 66  MET A N    3  
ATOM 5069  C CA   . MET A 1 48  ? -10.701 9.937   -4.538  1.00 0.00 ? 66  MET A CA   3  
ATOM 5070  C C    . MET A 1 48  ? -11.191 10.567  -5.838  1.00 0.00 ? 66  MET A C    3  
ATOM 5071  O O    . MET A 1 48  ? -10.581 10.392  -6.892  1.00 0.00 ? 66  MET A O    3  
ATOM 5072  C CB   . MET A 1 48  ? -11.665 8.836   -4.095  1.00 0.00 ? 66  MET A CB   3  
ATOM 5073  C CG   . MET A 1 48  ? -11.245 8.143   -2.809  1.00 0.00 ? 66  MET A CG   3  
ATOM 5074  S SD   . MET A 1 48  ? -10.012 6.858   -3.083  1.00 0.00 ? 66  MET A SD   3  
ATOM 5075  C CE   . MET A 1 48  ? -10.953 5.687   -4.058  1.00 0.00 ? 66  MET A CE   3  
ATOM 5076  H H    . MET A 1 48  ? -11.010 10.800  -2.630  1.00 0.00 ? 66  MET A H    3  
ATOM 5077  H HA   . MET A 1 48  ? -9.727  9.503   -4.708  1.00 0.00 ? 66  MET A HA   3  
ATOM 5078  H HB3  . MET A 1 48  ? -11.727 8.091   -4.875  1.00 0.00 ? 66  MET A HB3  3  
ATOM 5079  H HG3  . MET A 1 48  ? -12.119 7.695   -2.357  1.00 0.00 ? 66  MET A HG3  3  
ATOM 5080  H HE1  . MET A 1 48  ? -11.190 4.822   -3.455  1.00 0.00 ? 66  MET A HE1  3  
ATOM 5081  H HE2  . MET A 1 48  ? -11.867 6.152   -4.396  1.00 0.00 ? 66  MET A HE2  3  
ATOM 5082  H HE3  . MET A 1 48  ? -10.368 5.379   -4.913  1.00 0.00 ? 66  MET A HE3  3  
ATOM 5083  N N    . GLU A 1 49  ? -12.299 11.297  -5.755  1.00 0.00 ? 67  GLU A N    3  
ATOM 5084  C CA   . GLU A 1 49  ? -12.871 11.951  -6.927  1.00 0.00 ? 67  GLU A CA   3  
ATOM 5085  C C    . GLU A 1 49  ? -11.941 13.041  -7.451  1.00 0.00 ? 67  GLU A C    3  
ATOM 5086  O O    . GLU A 1 49  ? -11.981 13.392  -8.630  1.00 0.00 ? 67  GLU A O    3  
ATOM 5087  C CB   . GLU A 1 49  ? -14.237 12.552  -6.587  1.00 0.00 ? 67  GLU A CB   3  
ATOM 5088  C CG   . GLU A 1 49  ? -15.125 11.624  -5.774  1.00 0.00 ? 67  GLU A CG   3  
ATOM 5089  C CD   . GLU A 1 49  ? -16.572 11.658  -6.227  1.00 0.00 ? 67  GLU A CD   3  
ATOM 5090  O OE1  . GLU A 1 49  ? -17.016 12.716  -6.719  1.00 0.00 ? 67  GLU A OE1  3  
ATOM 5091  O OE2  . GLU A 1 49  ? -17.260 10.625  -6.089  1.00 0.00 ? 67  GLU A OE2  3  
ATOM 5092  H H    . GLU A 1 49  ? -12.741 11.400  -4.887  1.00 0.00 ? 67  GLU A H    3  
ATOM 5093  H HA   . GLU A 1 49  ? -12.999 11.203  -7.694  1.00 0.00 ? 67  GLU A HA   3  
ATOM 5094  H HB3  . GLU A 1 49  ? -14.750 12.792  -7.507  1.00 0.00 ? 67  GLU A HB3  3  
ATOM 5095  H HG3  . GLU A 1 49  ? -15.080 11.920  -4.737  1.00 0.00 ? 67  GLU A HG3  3  
ATOM 5096  N N    . LYS A 1 50  ? -11.103 13.571  -6.567  1.00 0.00 ? 68  LYS A N    3  
ATOM 5097  C CA   . LYS A 1 50  ? -10.161 14.620  -6.938  1.00 0.00 ? 68  LYS A CA   3  
ATOM 5098  C C    . LYS A 1 50  ? -9.119  14.093  -7.920  1.00 0.00 ? 68  LYS A C    3  
ATOM 5099  O O    . LYS A 1 50  ? -8.905  14.674  -8.984  1.00 0.00 ? 68  LYS A O    3  
ATOM 5100  C CB   . LYS A 1 50  ? -9.468  15.176  -5.692  1.00 0.00 ? 68  LYS A CB   3  
ATOM 5101  C CG   . LYS A 1 50  ? -8.964  16.599  -5.861  1.00 0.00 ? 68  LYS A CG   3  
ATOM 5102  C CD   . LYS A 1 50  ? -8.028  16.995  -4.731  1.00 0.00 ? 68  LYS A CD   3  
ATOM 5103  C CE   . LYS A 1 50  ? -8.793  17.277  -3.447  1.00 0.00 ? 68  LYS A CE   3  
ATOM 5104  N NZ   . LYS A 1 50  ? -7.930  17.926  -2.419  1.00 0.00 ? 68  LYS A NZ   3  
ATOM 5105  H H    . LYS A 1 50  ? -11.118 13.249  -5.640  1.00 0.00 ? 68  LYS A H    3  
ATOM 5106  H HA   . LYS A 1 50  ? -10.718 15.414  -7.414  1.00 0.00 ? 68  LYS A HA   3  
ATOM 5107  H HB3  . LYS A 1 50  ? -8.625  14.544  -5.452  1.00 0.00 ? 68  LYS A HB3  3  
ATOM 5108  H HG3  . LYS A 1 50  ? -9.810  17.272  -5.868  1.00 0.00 ? 68  LYS A HG3  3  
ATOM 5109  H HD3  . LYS A 1 50  ? -7.486  17.885  -5.020  1.00 0.00 ? 68  LYS A HD3  3  
ATOM 5110  H HE3  . LYS A 1 50  ? -9.166  16.345  -3.053  1.00 0.00 ? 68  LYS A HE3  3  
ATOM 5111  H HZ1  . LYS A 1 50  ? -8.156  17.551  -1.475  1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 5112  H HZ2  . LYS A 1 50  ? -8.087  18.954  -2.418  1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 5113  H HZ3  . LYS A 1 50  ? -6.927  17.739  -2.624  1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 5114  N N    . ALA A 1 51  ? -8.476  12.989  -7.558  1.00 0.00 ? 69  ALA A N    3  
ATOM 5115  C CA   . ALA A 1 51  ? -7.460  12.382  -8.408  1.00 0.00 ? 69  ALA A CA   3  
ATOM 5116  C C    . ALA A 1 51  ? -8.033  12.016  -9.772  1.00 0.00 ? 69  ALA A C    3  
ATOM 5117  O O    . ALA A 1 51  ? -7.349  12.114  -10.792 1.00 0.00 ? 69  ALA A O    3  
ATOM 5118  C CB   . ALA A 1 51  ? -6.872  11.152  -7.733  1.00 0.00 ? 69  ALA A CB   3  
ATOM 5119  H H    . ALA A 1 51  ? -8.691  12.571  -6.698  1.00 0.00 ? 69  ALA A H    3  
ATOM 5120  H HA   . ALA A 1 51  ? -6.666  13.102  -8.545  1.00 0.00 ? 69  ALA A HA   3  
ATOM 5121  H HB1  . ALA A 1 51  ? -6.548  11.410  -6.735  1.00 0.00 ? 69  ALA A HB1  3  
ATOM 5122  H HB2  . ALA A 1 51  ? -7.623  10.379  -7.679  1.00 0.00 ? 69  ALA A HB2  3  
ATOM 5123  H HB3  . ALA A 1 51  ? -6.028  10.797  -8.304  1.00 0.00 ? 69  ALA A HB3  3  
ATOM 5124  N N    . LEU A 1 52  ? -9.292  11.592  -9.786  1.00 0.00 ? 70  LEU A N    3  
ATOM 5125  C CA   . LEU A 1 52  ? -9.958  11.210  -11.025 1.00 0.00 ? 70  LEU A CA   3  
ATOM 5126  C C    . LEU A 1 52  ? -9.830  12.310  -12.074 1.00 0.00 ? 70  LEU A C    3  
ATOM 5127  O O    . LEU A 1 52  ? -9.829  12.039  -13.275 1.00 0.00 ? 70  LEU A O    3  
ATOM 5128  C CB   . LEU A 1 52  ? -11.435 10.910  -10.763 1.00 0.00 ? 70  LEU A CB   3  
ATOM 5129  C CG   . LEU A 1 52  ? -12.301 10.666  -12.000 1.00 0.00 ? 70  LEU A CG   3  
ATOM 5130  C CD1  . LEU A 1 52  ? -12.740 9.211   -12.064 1.00 0.00 ? 70  LEU A CD1  3  
ATOM 5131  C CD2  . LEU A 1 52  ? -13.510 11.589  -11.994 1.00 0.00 ? 70  LEU A CD2  3  
ATOM 5132  H H    . LEU A 1 52  ? -9.787  11.535  -8.941  1.00 0.00 ? 70  LEU A H    3  
ATOM 5133  H HA   . LEU A 1 52  ? -9.479  10.317  -11.398 1.00 0.00 ? 70  LEU A HA   3  
ATOM 5134  H HB3  . LEU A 1 52  ? -11.852 11.750  -10.226 1.00 0.00 ? 70  LEU A HB3  3  
ATOM 5135  H HG   . LEU A 1 52  ? -11.719 10.879  -12.886 1.00 0.00 ? 70  LEU A HG   3  
ATOM 5136  H HD11 . LEU A 1 52  ? -11.880 8.583   -12.242 1.00 0.00 ? 70  LEU A HD11 3  
ATOM 5137  H HD12 . LEU A 1 52  ? -13.450 9.085   -12.869 1.00 0.00 ? 70  LEU A HD12 3  
ATOM 5138  H HD13 . LEU A 1 52  ? -13.203 8.932   -11.130 1.00 0.00 ? 70  LEU A HD13 3  
ATOM 5139  H HD21 . LEU A 1 52  ? -14.361 11.067  -11.582 1.00 0.00 ? 70  LEU A HD21 3  
ATOM 5140  H HD22 . LEU A 1 52  ? -13.733 11.897  -13.007 1.00 0.00 ? 70  LEU A HD22 3  
ATOM 5141  H HD23 . LEU A 1 52  ? -13.296 12.460  -11.391 1.00 0.00 ? 70  LEU A HD23 3  
ATOM 5142  N N    . SER A 1 53  ? -9.720  13.552  -11.612 1.00 0.00 ? 71  SER A N    3  
ATOM 5143  C CA   . SER A 1 53  ? -9.593  14.693  -12.510 1.00 0.00 ? 71  SER A CA   3  
ATOM 5144  C C    . SER A 1 53  ? -8.149  14.864  -12.970 1.00 0.00 ? 71  SER A C    3  
ATOM 5145  O O    . SER A 1 53  ? -7.889  15.320  -14.083 1.00 0.00 ? 71  SER A O    3  
ATOM 5146  C CB   . SER A 1 53  ? -10.074 15.970  -11.818 1.00 0.00 ? 71  SER A CB   3  
ATOM 5147  O OG   . SER A 1 53  ? -10.116 17.057  -12.726 1.00 0.00 ? 71  SER A OG   3  
ATOM 5148  H H    . SER A 1 53  ? -9.729  13.703  -10.644 1.00 0.00 ? 71  SER A H    3  
ATOM 5149  H HA   . SER A 1 53  ? -10.214 14.507  -13.374 1.00 0.00 ? 71  SER A HA   3  
ATOM 5150  H HB3  . SER A 1 53  ? -9.398  16.215  -11.012 1.00 0.00 ? 71  SER A HB3  3  
ATOM 5151  H HG   . SER A 1 53  ? -11.018 17.382  -12.793 1.00 0.00 ? 71  SER A HG   3  
ATOM 5152  N N    . ILE A 1 54  ? -7.211  14.494  -12.103 1.00 0.00 ? 72  ILE A N    3  
ATOM 5153  C CA   . ILE A 1 54  ? -5.793  14.605  -12.420 1.00 0.00 ? 72  ILE A CA   3  
ATOM 5154  C C    . ILE A 1 54  ? -5.200  13.244  -12.769 1.00 0.00 ? 72  ILE A C    3  
ATOM 5155  O O    . ILE A 1 54  ? -4.021  12.989  -12.529 1.00 0.00 ? 72  ILE A O    3  
ATOM 5156  C CB   . ILE A 1 54  ? -5.000  15.211  -11.247 1.00 0.00 ? 72  ILE A CB   3  
ATOM 5157  C CG1  . ILE A 1 54  ? -4.936  14.223  -10.081 1.00 0.00 ? 72  ILE A CG1  3  
ATOM 5158  C CG2  . ILE A 1 54  ? -5.630  16.522  -10.803 1.00 0.00 ? 72  ILE A CG2  3  
ATOM 5159  C CD1  . ILE A 1 54  ? -3.533  13.755  -9.762  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 5160  H H    . ILE A 1 54  ? -7.480  14.138  -11.231 1.00 0.00 ? 72  ILE A H    3  
ATOM 5161  H HA   . ILE A 1 54  ? -5.693  15.260  -13.273 1.00 0.00 ? 72  ILE A HA   3  
ATOM 5162  H HB   . ILE A 1 54  ? -3.997  15.419  -11.588 1.00 0.00 ? 72  ILE A HB   3  
ATOM 5163  H HG13 . ILE A 1 54  ? -5.530  13.354  -10.323 1.00 0.00 ? 72  ILE A HG13 3  
ATOM 5164  H HG21 . ILE A 1 54  ? -5.015  16.979  -10.041 1.00 0.00 ? 72  ILE A HG21 3  
ATOM 5165  H HG22 . ILE A 1 54  ? -5.706  17.190  -11.649 1.00 0.00 ? 72  ILE A HG22 3  
ATOM 5166  H HG23 . ILE A 1 54  ? -6.615  16.332  -10.405 1.00 0.00 ? 72  ILE A HG23 3  
ATOM 5167  H HD11 . ILE A 1 54  ? -2.827  14.531  -10.018 1.00 0.00 ? 72  ILE A HD11 3  
ATOM 5168  H HD12 . ILE A 1 54  ? -3.458  13.534  -8.707  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 5169  H HD13 . ILE A 1 54  ? -3.311  12.865  -10.333 1.00 0.00 ? 72  ILE A HD13 3  
ATOM 5170  N N    . GLY A 1 55  ? -6.026  12.374  -13.341 1.00 0.00 ? 73  GLY A N    3  
ATOM 5171  C CA   . GLY A 1 55  ? -5.565  11.050  -13.719 1.00 0.00 ? 73  GLY A CA   3  
ATOM 5172  C C    . GLY A 1 55  ? -5.548  10.088  -12.547 1.00 0.00 ? 73  GLY A C    3  
ATOM 5173  O O    . GLY A 1 55  ? -4.637  10.121  -11.720 1.00 0.00 ? 73  GLY A O    3  
ATOM 5174  H H    . GLY A 1 55  ? -6.956  12.632  -13.510 1.00 0.00 ? 73  GLY A H    3  
ATOM 5175  H HA2  . GLY A 1 55  ? -6.218  10.658  -14.484 1.00 0.00 ? 73  GLY A HA2  3  
ATOM 5176  H HA3  . GLY A 1 55  ? -4.565  11.131  -14.119 1.00 0.00 ? 73  GLY A HA3  3  
ATOM 5177  N N    . PHE A 1 56  ? -6.558  9.228   -12.475 1.00 0.00 ? 74  PHE A N    3  
ATOM 5178  C CA   . PHE A 1 56  ? -6.658  8.254   -11.394 1.00 0.00 ? 74  PHE A CA   3  
ATOM 5179  C C    . PHE A 1 56  ? -7.844  7.320   -11.612 1.00 0.00 ? 74  PHE A C    3  
ATOM 5180  O O    . PHE A 1 56  ? -8.804  7.331   -10.841 1.00 0.00 ? 74  PHE A O    3  
ATOM 5181  C CB   . PHE A 1 56  ? -6.795  8.967   -10.047 1.00 0.00 ? 74  PHE A CB   3  
ATOM 5182  C CG   . PHE A 1 56  ? -6.301  8.152   -8.886  1.00 0.00 ? 74  PHE A CG   3  
ATOM 5183  C CD1  . PHE A 1 56  ? -4.989  7.709   -8.840  1.00 0.00 ? 74  PHE A CD1  3  
ATOM 5184  C CD2  . PHE A 1 56  ? -7.150  7.829   -7.840  1.00 0.00 ? 74  PHE A CD2  3  
ATOM 5185  C CE1  . PHE A 1 56  ? -4.532  6.960   -7.773  1.00 0.00 ? 74  PHE A CE1  3  
ATOM 5186  C CE2  . PHE A 1 56  ? -6.699  7.079   -6.769  1.00 0.00 ? 74  PHE A CE2  3  
ATOM 5187  C CZ   . PHE A 1 56  ? -5.388  6.644   -6.737  1.00 0.00 ? 74  PHE A CZ   3  
ATOM 5188  H H    . PHE A 1 56  ? -7.256  9.251   -13.164 1.00 0.00 ? 74  PHE A H    3  
ATOM 5189  H HA   . PHE A 1 56  ? -5.751  7.669   -11.393 1.00 0.00 ? 74  PHE A HA   3  
ATOM 5190  H HB3  . PHE A 1 56  ? -7.835  9.196   -9.875  1.00 0.00 ? 74  PHE A HB3  3  
ATOM 5191  H HD1  . PHE A 1 56  ? -4.319  7.955   -9.651  1.00 0.00 ? 74  PHE A HD1  3  
ATOM 5192  H HD2  . PHE A 1 56  ? -8.175  8.168   -7.864  1.00 0.00 ? 74  PHE A HD2  3  
ATOM 5193  H HE1  . PHE A 1 56  ? -3.507  6.621   -7.751  1.00 0.00 ? 74  PHE A HE1  3  
ATOM 5194  H HE2  . PHE A 1 56  ? -7.370  6.834   -5.960  1.00 0.00 ? 74  PHE A HE2  3  
ATOM 5195  H HZ   . PHE A 1 56  ? -5.033  6.060   -5.901  1.00 0.00 ? 74  PHE A HZ   3  
ATOM 5196  N N    . GLU A 1 57  ? -7.771  6.514   -12.667 1.00 0.00 ? 75  GLU A N    3  
ATOM 5197  C CA   . GLU A 1 57  ? -8.841  5.575   -12.986 1.00 0.00 ? 75  GLU A CA   3  
ATOM 5198  C C    . GLU A 1 57  ? -8.333  4.137   -12.938 1.00 0.00 ? 75  GLU A C    3  
ATOM 5199  O O    . GLU A 1 57  ? -7.257  3.828   -13.451 1.00 0.00 ? 75  GLU A O    3  
ATOM 5200  C CB   . GLU A 1 57  ? -9.419  5.879   -14.371 1.00 0.00 ? 75  GLU A CB   3  
ATOM 5201  C CG   . GLU A 1 57  ? -8.396  5.785   -15.491 1.00 0.00 ? 75  GLU A CG   3  
ATOM 5202  C CD   . GLU A 1 57  ? -8.374  4.420   -16.149 1.00 0.00 ? 75  GLU A CD   3  
ATOM 5203  O OE1  . GLU A 1 57  ? -9.464  3.868   -16.409 1.00 0.00 ? 75  GLU A OE1  3  
ATOM 5204  O OE2  . GLU A 1 57  ? -7.266  3.903   -16.403 1.00 0.00 ? 75  GLU A OE2  3  
ATOM 5205  H H    . GLU A 1 57  ? -6.980  6.554   -13.244 1.00 0.00 ? 75  GLU A H    3  
ATOM 5206  H HA   . GLU A 1 57  ? -9.618  5.695   -12.248 1.00 0.00 ? 75  GLU A HA   3  
ATOM 5207  H HB3  . GLU A 1 57  ? -9.826  6.879   -14.365 1.00 0.00 ? 75  GLU A HB3  3  
ATOM 5208  H HG3  . GLU A 1 57  ? -7.417  5.990   -15.084 1.00 0.00 ? 75  GLU A HG3  3  
ATOM 5209  N N    . THR A 1 58  ? -9.116  3.260   -12.317 1.00 0.00 ? 76  THR A N    3  
ATOM 5210  C CA   . THR A 1 58  ? -8.747  1.854   -12.200 1.00 0.00 ? 76  THR A CA   3  
ATOM 5211  C C    . THR A 1 58  ? -9.951  1.000   -11.821 1.00 0.00 ? 76  THR A C    3  
ATOM 5212  O O    . THR A 1 58  ? -11.022 1.521   -11.508 1.00 0.00 ? 76  THR A O    3  
ATOM 5213  C CB   . THR A 1 58  ? -7.637  1.652   -11.152 1.00 0.00 ? 76  THR A CB   3  
ATOM 5214  O OG1  . THR A 1 58  ? -7.178  0.295   -11.181 1.00 0.00 ? 76  THR A OG1  3  
ATOM 5215  C CG2  . THR A 1 58  ? -8.139  1.993   -9.759  1.00 0.00 ? 76  THR A CG2  3  
ATOM 5216  H H    . THR A 1 58  ? -9.962  3.568   -11.929 1.00 0.00 ? 76  THR A H    3  
ATOM 5217  H HA   . THR A 1 58  ? -8.372  1.527   -13.160 1.00 0.00 ? 76  THR A HA   3  
ATOM 5218  H HB   . THR A 1 58  ? -6.811  2.306   -11.393 1.00 0.00 ? 76  THR A HB   3  
ATOM 5219  H HG1  . THR A 1 58  ? -6.641  0.122   -10.405 1.00 0.00 ? 76  THR A HG1  3  
ATOM 5220  H HG21 . THR A 1 58  ? -9.118  2.444   -9.829  1.00 0.00 ? 76  THR A HG21 3  
ATOM 5221  H HG22 . THR A 1 58  ? -7.456  2.687   -9.289  1.00 0.00 ? 76  THR A HG22 3  
ATOM 5222  H HG23 . THR A 1 58  ? -8.201  1.092   -9.167  1.00 0.00 ? 76  THR A HG23 3  
ATOM 5223  N N    . CYS A 1 59  ? -9.769  -0.316  -11.851 1.00 0.00 ? 77  CYS A N    3  
ATOM 5224  C CA   . CYS A 1 59  ? -10.840 -1.245  -11.511 1.00 0.00 ? 77  CYS A CA   3  
ATOM 5225  C C    . CYS A 1 59  ? -10.532 -1.976  -10.207 1.00 0.00 ? 77  CYS A C    3  
ATOM 5226  O O    . CYS A 1 59  ? -11.062 -3.057  -9.950  1.00 0.00 ? 77  CYS A O    3  
ATOM 5227  C CB   . CYS A 1 59  ? -11.046 -2.256  -12.640 1.00 0.00 ? 77  CYS A CB   3  
ATOM 5228  S SG   . CYS A 1 59  ? -11.146 -1.509  -14.298 1.00 0.00 ? 77  CYS A SG   3  
ATOM 5229  H H    . CYS A 1 59  ? -8.892  -0.672  -12.110 1.00 0.00 ? 77  CYS A H    3  
ATOM 5230  H HA   . CYS A 1 59  ? -11.747 -0.673  -11.384 1.00 0.00 ? 77  CYS A HA   3  
ATOM 5231  H HB3  . CYS A 1 59  ? -11.964 -2.798  -12.466 1.00 0.00 ? 77  CYS A HB3  3  
ATOM 5232  N N    . ARG A 1 60  ? -9.672  -1.378  -9.389  1.00 0.00 ? 78  ARG A N    3  
ATOM 5233  C CA   . ARG A 1 60  ? -9.292  -1.972  -8.113  1.00 0.00 ? 78  ARG A CA   3  
ATOM 5234  C C    . ARG A 1 60  ? -9.856  -1.163  -6.948  1.00 0.00 ? 78  ARG A C    3  
ATOM 5235  O O    . ARG A 1 60  ? -9.382  -0.065  -6.654  1.00 0.00 ? 78  ARG A O    3  
ATOM 5236  C CB   . ARG A 1 60  ? -7.770  -2.058  -8.000  1.00 0.00 ? 78  ARG A CB   3  
ATOM 5237  C CG   . ARG A 1 60  ? -7.181  -3.306  -8.635  1.00 0.00 ? 78  ARG A CG   3  
ATOM 5238  C CD   . ARG A 1 60  ? -7.472  -3.362  -10.127 1.00 0.00 ? 78  ARG A CD   3  
ATOM 5239  N NE   . ARG A 1 60  ? -6.459  -4.121  -10.855 1.00 0.00 ? 78  ARG A NE   3  
ATOM 5240  C CZ   . ARG A 1 60  ? -6.631  -4.581  -12.089 1.00 0.00 ? 78  ARG A CZ   3  
ATOM 5241  N NH1  . ARG A 1 60  ? -7.770  -4.361  -12.730 1.00 0.00 ? 78  ARG A NH1  3  
ATOM 5242  N NH2  . ARG A 1 60  ? -5.663  -5.265  -12.684 1.00 0.00 ? 78  ARG A NH2  3  
ATOM 5243  H H    . ARG A 1 60  ? -9.283  -0.516  -9.649  1.00 0.00 ? 78  ARG A H    3  
ATOM 5244  H HA   . ARG A 1 60  ? -9.704  -2.970  -8.076  1.00 0.00 ? 78  ARG A HA   3  
ATOM 5245  H HB3  . ARG A 1 60  ? -7.499  -2.051  -6.954  1.00 0.00 ? 78  ARG A HB3  3  
ATOM 5246  H HG3  . ARG A 1 60  ? -7.610  -4.177  -8.162  1.00 0.00 ? 78  ARG A HG3  3  
ATOM 5247  H HD3  . ARG A 1 60  ? -7.498  -2.353  -10.512 1.00 0.00 ? 78  ARG A HD3  3  
ATOM 5248  H HE   . ARG A 1 60  ? -5.610  -4.297  -10.400 1.00 0.00 ? 78  ARG A HE   3  
ATOM 5249  H HH11 . ARG A 1 60  ? -8.501  -3.845  -12.284 1.00 0.00 ? 78  ARG A HH11 3  
ATOM 5250  H HH12 . ARG A 1 60  ? -7.897  -4.708  -13.659 1.00 0.00 ? 78  ARG A HH12 3  
ATOM 5251  H HH21 . ARG A 1 60  ? -4.802  -5.435  -12.205 1.00 0.00 ? 78  ARG A HH21 3  
ATOM 5252  H HH22 . ARG A 1 60  ? -5.792  -5.612  -13.613 1.00 0.00 ? 78  ARG A HH22 3  
ATOM 5253  N N    . TYR A 1 61  ? -10.869 -1.714  -6.287  1.00 0.00 ? 79  TYR A N    3  
ATOM 5254  C CA   . TYR A 1 61  ? -11.498 -1.043  -5.156  1.00 0.00 ? 79  TYR A CA   3  
ATOM 5255  C C    . TYR A 1 61  ? -10.455 -0.606  -4.133  1.00 0.00 ? 79  TYR A C    3  
ATOM 5256  O O    . TYR A 1 61  ? -9.330  -1.105  -4.123  1.00 0.00 ? 79  TYR A O    3  
ATOM 5257  C CB   . TYR A 1 61  ? -12.522 -1.966  -4.494  1.00 0.00 ? 79  TYR A CB   3  
ATOM 5258  C CG   . TYR A 1 61  ? -13.497 -2.586  -5.468  1.00 0.00 ? 79  TYR A CG   3  
ATOM 5259  C CD1  . TYR A 1 61  ? -14.427 -1.806  -6.144  1.00 0.00 ? 79  TYR A CD1  3  
ATOM 5260  C CD2  . TYR A 1 61  ? -13.489 -3.954  -5.715  1.00 0.00 ? 79  TYR A CD2  3  
ATOM 5261  C CE1  . TYR A 1 61  ? -15.320 -2.367  -7.035  1.00 0.00 ? 79  TYR A CE1  3  
ATOM 5262  C CE2  . TYR A 1 61  ? -14.377 -4.526  -6.605  1.00 0.00 ? 79  TYR A CE2  3  
ATOM 5263  C CZ   . TYR A 1 61  ? -15.291 -3.729  -7.262  1.00 0.00 ? 79  TYR A CZ   3  
ATOM 5264  O OH   . TYR A 1 61  ? -16.179 -4.292  -8.150  1.00 0.00 ? 79  TYR A OH   3  
ATOM 5265  H H    . TYR A 1 61  ? -11.202 -2.592  -6.568  1.00 0.00 ? 79  TYR A H    3  
ATOM 5266  H HA   . TYR A 1 61  ? -12.006 -0.167  -5.532  1.00 0.00 ? 79  TYR A HA   3  
ATOM 5267  H HB3  . TYR A 1 61  ? -13.090 -1.401  -3.770  1.00 0.00 ? 79  TYR A HB3  3  
ATOM 5268  H HD1  . TYR A 1 61  ? -14.446 -0.740  -5.965  1.00 0.00 ? 79  TYR A HD1  3  
ATOM 5269  H HD2  . TYR A 1 61  ? -12.772 -4.575  -5.198  1.00 0.00 ? 79  TYR A HD2  3  
ATOM 5270  H HE1  . TYR A 1 61  ? -16.035 -1.744  -7.549  1.00 0.00 ? 79  TYR A HE1  3  
ATOM 5271  H HE2  . TYR A 1 61  ? -14.356 -5.590  -6.783  1.00 0.00 ? 79  TYR A HE2  3  
ATOM 5272  H HH   . TYR A 1 61  ? -15.729 -4.475  -8.978  1.00 0.00 ? 79  TYR A HH   3  
ATOM 5273  N N    . GLY A 1 62  ? -10.836 0.333   -3.271  1.00 0.00 ? 80  GLY A N    3  
ATOM 5274  C CA   . GLY A 1 62  ? -9.923  0.823   -2.254  1.00 0.00 ? 80  GLY A CA   3  
ATOM 5275  C C    . GLY A 1 62  ? -10.646 1.319   -1.018  1.00 0.00 ? 80  GLY A C    3  
ATOM 5276  O O    . GLY A 1 62  ? -11.802 1.736   -1.090  1.00 0.00 ? 80  GLY A O    3  
ATOM 5277  H H    . GLY A 1 62  ? -11.746 0.695   -3.326  1.00 0.00 ? 80  GLY A H    3  
ATOM 5278  H HA2  . GLY A 1 62  ? -9.255  0.024   -1.973  1.00 0.00 ? 80  GLY A HA2  3  
ATOM 5279  H HA3  . GLY A 1 62  ? -9.344  1.634   -2.669  1.00 0.00 ? 80  GLY A HA3  3  
ATOM 5280  N N    . PHE A 1 63  ? -9.964  1.273   0.122   1.00 0.00 ? 81  PHE A N    3  
ATOM 5281  C CA   . PHE A 1 63  ? -10.549 1.718   1.381   1.00 0.00 ? 81  PHE A CA   3  
ATOM 5282  C C    . PHE A 1 63  ? -10.127 3.149   1.700   1.00 0.00 ? 81  PHE A C    3  
ATOM 5283  O O    . PHE A 1 63  ? -9.042  3.588   1.316   1.00 0.00 ? 81  PHE A O    3  
ATOM 5284  C CB   . PHE A 1 63  ? -10.131 0.786   2.521   1.00 0.00 ? 81  PHE A CB   3  
ATOM 5285  C CG   . PHE A 1 63  ? -10.327 -0.669  2.205   1.00 0.00 ? 81  PHE A CG   3  
ATOM 5286  C CD1  . PHE A 1 63  ? -11.505 -1.115  1.627   1.00 0.00 ? 81  PHE A CD1  3  
ATOM 5287  C CD2  . PHE A 1 63  ? -9.334  -1.594  2.488   1.00 0.00 ? 81  PHE A CD2  3  
ATOM 5288  C CE1  . PHE A 1 63  ? -11.688 -2.453  1.338   1.00 0.00 ? 81  PHE A CE1  3  
ATOM 5289  C CE2  . PHE A 1 63  ? -9.512  -2.934  2.201   1.00 0.00 ? 81  PHE A CE2  3  
ATOM 5290  C CZ   . PHE A 1 63  ? -10.690 -3.364  1.624   1.00 0.00 ? 81  PHE A CZ   3  
ATOM 5291  H H    . PHE A 1 63  ? -9.046  0.930   0.116   1.00 0.00 ? 81  PHE A H    3  
ATOM 5292  H HA   . PHE A 1 63  ? -11.622 1.686   1.277   1.00 0.00 ? 81  PHE A HA   3  
ATOM 5293  H HB3  . PHE A 1 63  ? -10.715 1.019   3.398   1.00 0.00 ? 81  PHE A HB3  3  
ATOM 5294  H HD1  . PHE A 1 63  ? -12.287 -0.404  1.401   1.00 0.00 ? 81  PHE A HD1  3  
ATOM 5295  H HD2  . PHE A 1 63  ? -8.411  -1.257  2.940   1.00 0.00 ? 81  PHE A HD2  3  
ATOM 5296  H HE1  . PHE A 1 63  ? -12.611 -2.787  0.886   1.00 0.00 ? 81  PHE A HE1  3  
ATOM 5297  H HE2  . PHE A 1 63  ? -8.728  -3.642  2.425   1.00 0.00 ? 81  PHE A HE2  3  
ATOM 5298  H HZ   . PHE A 1 63  ? -10.831 -4.411  1.399   1.00 0.00 ? 81  PHE A HZ   3  
ATOM 5299  N N    . ILE A 1 64  ? -10.992 3.873   2.402   1.00 0.00 ? 82  ILE A N    3  
ATOM 5300  C CA   . ILE A 1 64  ? -10.709 5.254   2.774   1.00 0.00 ? 82  ILE A CA   3  
ATOM 5301  C C    . ILE A 1 64  ? -11.418 5.631   4.070   1.00 0.00 ? 82  ILE A C    3  
ATOM 5302  O O    . ILE A 1 64  ? -12.092 4.804   4.683   1.00 0.00 ? 82  ILE A O    3  
ATOM 5303  C CB   . ILE A 1 64  ? -11.135 6.233   1.664   1.00 0.00 ? 82  ILE A CB   3  
ATOM 5304  C CG1  . ILE A 1 64  ? -12.598 5.996   1.278   1.00 0.00 ? 82  ILE A CG1  3  
ATOM 5305  C CG2  . ILE A 1 64  ? -10.230 6.085   0.449   1.00 0.00 ? 82  ILE A CG2  3  
ATOM 5306  C CD1  . ILE A 1 64  ? -13.313 7.250   0.826   1.00 0.00 ? 82  ILE A CD1  3  
ATOM 5307  H H    . ILE A 1 64  ? -11.840 3.468   2.679   1.00 0.00 ? 82  ILE A H    3  
ATOM 5308  H HA   . ILE A 1 64  ? -9.643  5.348   2.919   1.00 0.00 ? 82  ILE A HA   3  
ATOM 5309  H HB   . ILE A 1 64  ? -11.029 7.238   2.042   1.00 0.00 ? 82  ILE A HB   3  
ATOM 5310  H HG13 . ILE A 1 64  ? -13.127 5.599   2.132   1.00 0.00 ? 82  ILE A HG13 3  
ATOM 5311  H HG21 . ILE A 1 64  ? -10.491 6.829   -0.287  1.00 0.00 ? 82  ILE A HG21 3  
ATOM 5312  H HG22 . ILE A 1 64  ? -9.203  6.219   0.750   1.00 0.00 ? 82  ILE A HG22 3  
ATOM 5313  H HG23 . ILE A 1 64  ? -10.356 5.099   0.026   1.00 0.00 ? 82  ILE A HG23 3  
ATOM 5314  H HD11 . ILE A 1 64  ? -12.698 7.780   0.116   1.00 0.00 ? 82  ILE A HD11 3  
ATOM 5315  H HD12 . ILE A 1 64  ? -14.251 6.981   0.363   1.00 0.00 ? 82  ILE A HD12 3  
ATOM 5316  H HD13 . ILE A 1 64  ? -13.504 7.883   1.681   1.00 0.00 ? 82  ILE A HD13 3  
ATOM 5317  N N    . GLU A 1 65  ? -11.263 6.887   4.479   1.00 0.00 ? 83  GLU A N    3  
ATOM 5318  C CA   . GLU A 1 65  ? -11.891 7.374   5.702   1.00 0.00 ? 83  GLU A CA   3  
ATOM 5319  C C    . GLU A 1 65  ? -13.385 7.063   5.708   1.00 0.00 ? 83  GLU A C    3  
ATOM 5320  O O    . GLU A 1 65  ? -13.979 6.835   6.761   1.00 0.00 ? 83  GLU A O    3  
ATOM 5321  C CB   . GLU A 1 65  ? -11.671 8.881   5.848   1.00 0.00 ? 83  GLU A CB   3  
ATOM 5322  C CG   . GLU A 1 65  ? -11.842 9.385   7.272   1.00 0.00 ? 83  GLU A CG   3  
ATOM 5323  C CD   . GLU A 1 65  ? -11.407 10.829  7.435   1.00 0.00 ? 83  GLU A CD   3  
ATOM 5324  O OE1  . GLU A 1 65  ? -10.191 11.096  7.351   1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5325  O OE2  . GLU A 1 65  ? -12.284 11.691  7.650   1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5326  H H    . GLU A 1 65  ? -10.714 7.499   3.946   1.00 0.00 ? 83  GLU A H    3  
ATOM 5327  H HA   . GLU A 1 65  ? -11.428 6.869   6.536   1.00 0.00 ? 83  GLU A HA   3  
ATOM 5328  H HB3  . GLU A 1 65  ? -12.380 9.398   5.219   1.00 0.00 ? 83  GLU A HB3  3  
ATOM 5329  H HG3  . GLU A 1 65  ? -11.248 8.768   7.933   1.00 0.00 ? 83  GLU A HG3  3  
ATOM 5330  N N    . GLY A 1 66  ? -13.987 7.059   4.522   1.00 0.00 ? 84  GLY A N    3  
ATOM 5331  C CA   . GLY A 1 66  ? -15.406 6.777   4.412   1.00 0.00 ? 84  GLY A CA   3  
ATOM 5332  C C    . GLY A 1 66  ? -15.692 5.300   4.233   1.00 0.00 ? 84  GLY A C    3  
ATOM 5333  O O    . GLY A 1 66  ? -15.753 4.548   5.207   1.00 0.00 ? 84  GLY A O    3  
ATOM 5334  H H    . GLY A 1 66  ? -13.463 7.249   3.716   1.00 0.00 ? 84  GLY A H    3  
ATOM 5335  H HA2  . GLY A 1 66  ? -15.901 7.123   5.307   1.00 0.00 ? 84  GLY A HA2  3  
ATOM 5336  H HA3  . GLY A 1 66  ? -15.804 7.313   3.562   1.00 0.00 ? 84  GLY A HA3  3  
ATOM 5337  N N    . HIS A 1 67  ? -15.870 4.879   2.984   1.00 0.00 ? 85  HIS A N    3  
ATOM 5338  C CA   . HIS A 1 67  ? -16.152 3.481   2.680   1.00 0.00 ? 85  HIS A CA   3  
ATOM 5339  C C    . HIS A 1 67  ? -15.445 3.050   1.397   1.00 0.00 ? 85  HIS A C    3  
ATOM 5340  O O    . HIS A 1 67  ? -14.696 3.822   0.801   1.00 0.00 ? 85  HIS A O    3  
ATOM 5341  C CB   . HIS A 1 67  ? -17.659 3.261   2.544   1.00 0.00 ? 85  HIS A CB   3  
ATOM 5342  C CG   . HIS A 1 67  ? -18.421 3.547   3.802   1.00 0.00 ? 85  HIS A CG   3  
ATOM 5343  N ND1  . HIS A 1 67  ? -18.808 2.566   4.688   1.00 0.00 ? 85  HIS A ND1  3  
ATOM 5344  C CD2  . HIS A 1 67  ? -18.868 4.717   4.319   1.00 0.00 ? 85  HIS A CD2  3  
ATOM 5345  C CE1  . HIS A 1 67  ? -19.460 3.117   5.695   1.00 0.00 ? 85  HIS A CE1  3  
ATOM 5346  N NE2  . HIS A 1 67  ? -19.511 4.421   5.495   1.00 0.00 ? 85  HIS A NE2  3  
ATOM 5347  H H    . HIS A 1 67  ? -15.810 5.525   2.250   1.00 0.00 ? 85  HIS A H    3  
ATOM 5348  H HA   . HIS A 1 67  ? -15.782 2.882   3.499   1.00 0.00 ? 85  HIS A HA   3  
ATOM 5349  H HB3  . HIS A 1 67  ? -17.843 2.231   2.272   1.00 0.00 ? 85  HIS A HB3  3  
ATOM 5350  H HD1  . HIS A 1 67  ? -18.632 1.606   4.593   1.00 0.00 ? 85  HIS A HD1  3  
ATOM 5351  H HD2  . HIS A 1 67  ? -18.743 5.699   3.885   1.00 0.00 ? 85  HIS A HD2  3  
ATOM 5352  H HE1  . HIS A 1 67  ? -19.882 2.591   6.539   1.00 0.00 ? 85  HIS A HE1  3  
ATOM 5353  N N    . VAL A 1 68  ? -15.688 1.811   0.982   1.00 0.00 ? 86  VAL A N    3  
ATOM 5354  C CA   . VAL A 1 68  ? -15.075 1.278   -0.229  1.00 0.00 ? 86  VAL A CA   3  
ATOM 5355  C C    . VAL A 1 68  ? -15.510 2.067   -1.458  1.00 0.00 ? 86  VAL A C    3  
ATOM 5356  O O    . VAL A 1 68  ? -16.680 2.049   -1.840  1.00 0.00 ? 86  VAL A O    3  
ATOM 5357  C CB   . VAL A 1 68  ? -15.435 -0.206  -0.432  1.00 0.00 ? 86  VAL A CB   3  
ATOM 5358  C CG1  . VAL A 1 68  ? -14.647 -0.792  -1.595  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 5359  C CG2  . VAL A 1 68  ? -15.184 -0.996  0.844   1.00 0.00 ? 86  VAL A CG2  3  
ATOM 5360  H H    . VAL A 1 68  ? -16.294 1.243   1.501   1.00 0.00 ? 86  VAL A H    3  
ATOM 5361  H HA   . VAL A 1 68  ? -14.003 1.356   -0.122  1.00 0.00 ? 86  VAL A HA   3  
ATOM 5362  H HB   . VAL A 1 68  ? -16.486 -0.272  -0.670  1.00 0.00 ? 86  VAL A HB   3  
ATOM 5363  H HG11 . VAL A 1 68  ? -14.840 -1.853  -1.660  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 5364  H HG12 . VAL A 1 68  ? -14.948 -0.312  -2.513  1.00 0.00 ? 86  VAL A HG12 3  
ATOM 5365  H HG13 . VAL A 1 68  ? -13.591 -0.629  -1.431  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 5366  H HG21 . VAL A 1 68  ? -14.802 -1.973  0.593   1.00 0.00 ? 86  VAL A HG21 3  
ATOM 5367  H HG22 . VAL A 1 68  ? -14.462 -0.472  1.455   1.00 0.00 ? 86  VAL A HG22 3  
ATOM 5368  H HG23 . VAL A 1 68  ? -16.110 -1.099  1.391   1.00 0.00 ? 86  VAL A HG23 3  
ATOM 5369  N N    . VAL A 1 69  ? -14.559 2.761   -2.075  1.00 0.00 ? 87  VAL A N    3  
ATOM 5370  C CA   . VAL A 1 69  ? -14.841 3.557   -3.263  1.00 0.00 ? 87  VAL A CA   3  
ATOM 5371  C C    . VAL A 1 69  ? -13.717 3.437   -4.286  1.00 0.00 ? 87  VAL A C    3  
ATOM 5372  O O    . VAL A 1 69  ? -12.644 2.915   -3.985  1.00 0.00 ? 87  VAL A O    3  
ATOM 5373  C CB   . VAL A 1 69  ? -15.042 5.043   -2.910  1.00 0.00 ? 87  VAL A CB   3  
ATOM 5374  C CG1  . VAL A 1 69  ? -16.118 5.198   -1.845  1.00 0.00 ? 87  VAL A CG1  3  
ATOM 5375  C CG2  . VAL A 1 69  ? -13.731 5.661   -2.448  1.00 0.00 ? 87  VAL A CG2  3  
ATOM 5376  H H    . VAL A 1 69  ? -13.645 2.737   -1.724  1.00 0.00 ? 87  VAL A H    3  
ATOM 5377  H HA   . VAL A 1 69  ? -15.757 3.188   -3.704  1.00 0.00 ? 87  VAL A HA   3  
ATOM 5378  H HB   . VAL A 1 69  ? -15.368 5.562   -3.798  1.00 0.00 ? 87  VAL A HB   3  
ATOM 5379  H HG11 . VAL A 1 69  ? -16.117 6.214   -1.479  1.00 0.00 ? 87  VAL A HG11 3  
ATOM 5380  H HG12 . VAL A 1 69  ? -17.084 4.970   -2.274  1.00 0.00 ? 87  VAL A HG12 3  
ATOM 5381  H HG13 . VAL A 1 69  ? -15.917 4.520   -1.029  1.00 0.00 ? 87  VAL A HG13 3  
ATOM 5382  H HG21 . VAL A 1 69  ? -13.419 6.414   -3.157  1.00 0.00 ? 87  VAL A HG21 3  
ATOM 5383  H HG22 . VAL A 1 69  ? -13.869 6.117   -1.477  1.00 0.00 ? 87  VAL A HG22 3  
ATOM 5384  H HG23 . VAL A 1 69  ? -12.974 4.894   -2.380  1.00 0.00 ? 87  VAL A HG23 3  
ATOM 5385  N N    . ILE A 1 70  ? -13.971 3.923   -5.497  1.00 0.00 ? 88  ILE A N    3  
ATOM 5386  C CA   . ILE A 1 70  ? -12.980 3.871   -6.563  1.00 0.00 ? 88  ILE A CA   3  
ATOM 5387  C C    . ILE A 1 70  ? -13.428 4.690   -7.771  1.00 0.00 ? 88  ILE A C    3  
ATOM 5388  O O    . ILE A 1 70  ? -14.481 4.451   -8.357  1.00 0.00 ? 88  ILE A O    3  
ATOM 5389  C CB   . ILE A 1 70  ? -12.710 2.423   -7.012  1.00 0.00 ? 88  ILE A CB   3  
ATOM 5390  C CG1  . ILE A 1 70  ? -11.710 2.402   -8.170  1.00 0.00 ? 88  ILE A CG1  3  
ATOM 5391  C CG2  . ILE A 1 70  ? -14.010 1.743   -7.416  1.00 0.00 ? 88  ILE A CG2  3  
ATOM 5392  C CD1  . ILE A 1 70  ? -11.407 1.011   -8.682  1.00 0.00 ? 88  ILE A CD1  3  
ATOM 5393  H H    . ILE A 1 70  ? -14.846 4.327   -5.675  1.00 0.00 ? 88  ILE A H    3  
ATOM 5394  H HA   . ILE A 1 70  ? -12.058 4.287   -6.182  1.00 0.00 ? 88  ILE A HA   3  
ATOM 5395  H HB   . ILE A 1 70  ? -12.294 1.883   -6.176  1.00 0.00 ? 88  ILE A HB   3  
ATOM 5396  H HG13 . ILE A 1 70  ? -10.781 2.845   -7.841  1.00 0.00 ? 88  ILE A HG13 3  
ATOM 5397  H HG21 . ILE A 1 70  ? -13.843 0.681   -7.523  1.00 0.00 ? 88  ILE A HG21 3  
ATOM 5398  H HG22 . ILE A 1 70  ? -14.756 1.914   -6.654  1.00 0.00 ? 88  ILE A HG22 3  
ATOM 5399  H HG23 . ILE A 1 70  ? -14.354 2.150   -8.355  1.00 0.00 ? 88  ILE A HG23 3  
ATOM 5400  H HD11 . ILE A 1 70  ? -12.005 0.813   -9.560  1.00 0.00 ? 88  ILE A HD11 3  
ATOM 5401  H HD12 . ILE A 1 70  ? -10.361 0.940   -8.935  1.00 0.00 ? 88  ILE A HD12 3  
ATOM 5402  H HD13 . ILE A 1 70  ? -11.644 0.287   -7.916  1.00 0.00 ? 88  ILE A HD13 3  
ATOM 5403  N N    . PRO A 1 71  ? -12.606 5.681   -8.151  1.00 0.00 ? 89  PRO A N    3  
ATOM 5404  C CA   . PRO A 1 71  ? -12.894 6.554   -9.291  1.00 0.00 ? 89  PRO A CA   3  
ATOM 5405  C C    . PRO A 1 71  ? -12.787 5.821   -10.623 1.00 0.00 ? 89  PRO A C    3  
ATOM 5406  O O    . PRO A 1 71  ? -12.066 4.829   -10.742 1.00 0.00 ? 89  PRO A O    3  
ATOM 5407  C CB   . PRO A 1 71  ? -11.818 7.639   -9.189  1.00 0.00 ? 89  PRO A CB   3  
ATOM 5408  C CG   . PRO A 1 71  ? -10.696 6.990   -8.454  1.00 0.00 ? 89  PRO A CG   3  
ATOM 5409  C CD   . PRO A 1 71  ? -11.332 6.023   -7.495  1.00 0.00 ? 89  PRO A CD   3  
ATOM 5410  H HA   . PRO A 1 71  ? -13.872 7.006   -9.208  1.00 0.00 ? 89  PRO A HA   3  
ATOM 5411  H HB3  . PRO A 1 71  ? -12.208 8.486   -8.646  1.00 0.00 ? 89  PRO A HB3  3  
ATOM 5412  H HG3  . PRO A 1 71  ? -10.130 7.736   -7.915  1.00 0.00 ? 89  PRO A HG3  3  
ATOM 5413  H HD3  . PRO A 1 71  ? -11.506 6.498   -6.541  1.00 0.00 ? 89  PRO A HD3  3  
ATOM 5414  N N    . ARG A 1 72  ? -13.506 6.316   -11.626 1.00 0.00 ? 90  ARG A N    3  
ATOM 5415  C CA   . ARG A 1 72  ? -13.492 5.707   -12.950 1.00 0.00 ? 90  ARG A CA   3  
ATOM 5416  C C    . ARG A 1 72  ? -13.811 6.740   -14.027 1.00 0.00 ? 90  ARG A C    3  
ATOM 5417  O O    . ARG A 1 72  ? -14.930 7.250   -14.100 1.00 0.00 ? 90  ARG A O    3  
ATOM 5418  C CB   . ARG A 1 72  ? -14.499 4.558   -13.017 1.00 0.00 ? 90  ARG A CB   3  
ATOM 5419  C CG   . ARG A 1 72  ? -13.873 3.187   -12.817 1.00 0.00 ? 90  ARG A CG   3  
ATOM 5420  C CD   . ARG A 1 72  ? -14.788 2.266   -12.025 1.00 0.00 ? 90  ARG A CD   3  
ATOM 5421  N NE   . ARG A 1 72  ? -14.398 0.865   -12.154 1.00 0.00 ? 90  ARG A NE   3  
ATOM 5422  C CZ   . ARG A 1 72  ? -14.750 -0.078  -11.286 1.00 0.00 ? 90  ARG A CZ   3  
ATOM 5423  N NH1  . ARG A 1 72  ? -15.496 0.229   -10.234 1.00 0.00 ? 90  ARG A NH1  3  
ATOM 5424  N NH2  . ARG A 1 72  ? -14.356 -1.331  -11.470 1.00 0.00 ? 90  ARG A NH2  3  
ATOM 5425  H H    . ARG A 1 72  ? -14.061 7.109   -11.471 1.00 0.00 ? 90  ARG A H    3  
ATOM 5426  H HA   . ARG A 1 72  ? -12.501 5.317   -13.125 1.00 0.00 ? 90  ARG A HA   3  
ATOM 5427  H HB3  . ARG A 1 72  ? -14.980 4.572   -13.984 1.00 0.00 ? 90  ARG A HB3  3  
ATOM 5428  H HG3  . ARG A 1 72  ? -12.941 3.302   -12.282 1.00 0.00 ? 90  ARG A HG3  3  
ATOM 5429  H HD3  . ARG A 1 72  ? -15.798 2.384   -12.390 1.00 0.00 ? 90  ARG A HD3  3  
ATOM 5430  H HE   . ARG A 1 72  ? -13.846 0.615   -12.923 1.00 0.00 ? 90  ARG A HE   3  
ATOM 5431  H HH11 . ARG A 1 72  ? -15.795 1.173   -10.094 1.00 0.00 ? 90  ARG A HH11 3  
ATOM 5432  H HH12 . ARG A 1 72  ? -15.761 -0.482  -9.583  1.00 0.00 ? 90  ARG A HH12 3  
ATOM 5433  H HH21 . ARG A 1 72  ? -13.794 -1.567  -12.262 1.00 0.00 ? 90  ARG A HH21 3  
ATOM 5434  H HH22 . ARG A 1 72  ? -14.621 -2.040  -10.817 1.00 0.00 ? 90  ARG A HH22 3  
ATOM 5435  N N    . ILE A 1 73  ? -12.821 7.042   -14.861 1.00 0.00 ? 91  ILE A N    3  
ATOM 5436  C CA   . ILE A 1 73  ? -12.996 8.013   -15.933 1.00 0.00 ? 91  ILE A CA   3  
ATOM 5437  C C    . ILE A 1 73  ? -13.523 7.347   -17.197 1.00 0.00 ? 91  ILE A C    3  
ATOM 5438  O O    . ILE A 1 73  ? -14.681 7.534   -17.576 1.00 0.00 ? 91  ILE A O    3  
ATOM 5439  C CB   . ILE A 1 73  ? -11.676 8.737   -16.260 1.00 0.00 ? 91  ILE A CB   3  
ATOM 5440  C CG1  . ILE A 1 73  ? -11.127 9.432   -15.012 1.00 0.00 ? 91  ILE A CG1  3  
ATOM 5441  C CG2  . ILE A 1 73  ? -11.886 9.742   -17.382 1.00 0.00 ? 91  ILE A CG2  3  
ATOM 5442  C CD1  . ILE A 1 73  ? -9.655  9.769   -15.106 1.00 0.00 ? 91  ILE A CD1  3  
ATOM 5443  H H    . ILE A 1 73  ? -11.952 6.603   -14.752 1.00 0.00 ? 91  ILE A H    3  
ATOM 5444  H HA   . ILE A 1 73  ? -13.714 8.751   -15.601 1.00 0.00 ? 91  ILE A HA   3  
ATOM 5445  H HB   . ILE A 1 73  ? -10.963 8.000   -16.597 1.00 0.00 ? 91  ILE A HB   3  
ATOM 5446  H HG13 . ILE A 1 73  ? -11.266 8.783   -14.159 1.00 0.00 ? 91  ILE A HG13 3  
ATOM 5447  H HG21 . ILE A 1 73  ? -12.642 10.455  -17.090 1.00 0.00 ? 91  ILE A HG21 3  
ATOM 5448  H HG22 . ILE A 1 73  ? -10.960 10.259  -17.579 1.00 0.00 ? 91  ILE A HG22 3  
ATOM 5449  H HG23 . ILE A 1 73  ? -12.206 9.224   -18.275 1.00 0.00 ? 91  ILE A HG23 3  
ATOM 5450  H HD11 . ILE A 1 73  ? -9.526  10.645  -15.724 1.00 0.00 ? 91  ILE A HD11 3  
ATOM 5451  H HD12 . ILE A 1 73  ? -9.266  9.964   -14.119 1.00 0.00 ? 91  ILE A HD12 3  
ATOM 5452  H HD13 . ILE A 1 73  ? -9.123  8.936   -15.545 1.00 0.00 ? 91  ILE A HD13 3  
ATOM 5453  N N    . HIS A 1 74  ? -12.668 6.564   -17.848 1.00 0.00 ? 92  HIS A N    3  
ATOM 5454  C CA   . HIS A 1 74  ? -13.049 5.866   -19.072 1.00 0.00 ? 92  HIS A CA   3  
ATOM 5455  C C    . HIS A 1 74  ? -12.943 4.354   -18.889 1.00 0.00 ? 92  HIS A C    3  
ATOM 5456  O O    . HIS A 1 74  ? -12.108 3.689   -19.503 1.00 0.00 ? 92  HIS A O    3  
ATOM 5457  C CB   . HIS A 1 74  ? -12.166 6.315   -20.236 1.00 0.00 ? 92  HIS A CB   3  
ATOM 5458  C CG   . HIS A 1 74  ? -10.701 6.267   -19.930 1.00 0.00 ? 92  HIS A CG   3  
ATOM 5459  N ND1  . HIS A 1 74  ? -9.886  5.220   -20.304 1.00 0.00 ? 92  HIS A ND1  3  
ATOM 5460  C CD2  . HIS A 1 74  ? -9.904  7.150   -19.282 1.00 0.00 ? 92  HIS A CD2  3  
ATOM 5461  C CE1  . HIS A 1 74  ? -8.653  5.458   -19.898 1.00 0.00 ? 92  HIS A CE1  3  
ATOM 5462  N NE2  . HIS A 1 74  ? -8.635  6.623   -19.276 1.00 0.00 ? 92  HIS A NE2  3  
ATOM 5463  H H    . HIS A 1 74  ? -11.761 6.454   -17.499 1.00 0.00 ? 92  HIS A H    3  
ATOM 5464  H HA   . HIS A 1 74  ? -14.075 6.118   -19.291 1.00 0.00 ? 92  HIS A HA   3  
ATOM 5465  H HB3  . HIS A 1 74  ? -12.419 7.331   -20.501 1.00 0.00 ? 92  HIS A HB3  3  
ATOM 5466  H HD1  . HIS A 1 74  ? -10.172 4.420   -20.792 1.00 0.00 ? 92  HIS A HD1  3  
ATOM 5467  H HD2  . HIS A 1 74  ? -10.208 8.092   -18.851 1.00 0.00 ? 92  HIS A HD2  3  
ATOM 5468  H HE1  . HIS A 1 74  ? -7.802  4.811   -20.049 1.00 0.00 ? 92  HIS A HE1  3  
ATOM 5469  N N    . PRO A 1 75  ? -13.807 3.799   -18.026 1.00 0.00 ? 93  PRO A N    3  
ATOM 5470  C CA   . PRO A 1 75  ? -13.829 2.361   -17.743 1.00 0.00 ? 93  PRO A CA   3  
ATOM 5471  C C    . PRO A 1 75  ? -14.336 1.545   -18.928 1.00 0.00 ? 93  PRO A C    3  
ATOM 5472  O O    . PRO A 1 75  ? -14.527 2.074   -20.021 1.00 0.00 ? 93  PRO A O    3  
ATOM 5473  C CB   . PRO A 1 75  ? -14.796 2.248   -16.562 1.00 0.00 ? 93  PRO A CB   3  
ATOM 5474  C CG   . PRO A 1 75  ? -15.681 3.438   -16.681 1.00 0.00 ? 93  PRO A CG   3  
ATOM 5475  C CD   . PRO A 1 75  ? -14.828 4.533   -17.261 1.00 0.00 ? 93  PRO A CD   3  
ATOM 5476  H HA   . PRO A 1 75  ? -12.854 2.000   -17.450 1.00 0.00 ? 93  PRO A HA   3  
ATOM 5477  H HB3  . PRO A 1 75  ? -14.241 2.260   -15.636 1.00 0.00 ? 93  PRO A HB3  3  
ATOM 5478  H HG3  . PRO A 1 75  ? -16.045 3.726   -15.705 1.00 0.00 ? 93  PRO A HG3  3  
ATOM 5479  H HD3  . PRO A 1 75  ? -14.374 5.115   -16.471 1.00 0.00 ? 93  PRO A HD3  3  
ATOM 5480  N N    . ASN A 1 76  ? -14.553 0.254   -18.701 1.00 0.00 ? 94  ASN A N    3  
ATOM 5481  C CA   . ASN A 1 76  ? -15.038 -0.635  -19.751 1.00 0.00 ? 94  ASN A CA   3  
ATOM 5482  C C    . ASN A 1 76  ? -16.244 -1.438  -19.269 1.00 0.00 ? 94  ASN A C    3  
ATOM 5483  O O    . ASN A 1 76  ? -16.618 -1.373  -18.097 1.00 0.00 ? 94  ASN A O    3  
ATOM 5484  C CB   . ASN A 1 76  ? -13.926 -1.585  -20.198 1.00 0.00 ? 94  ASN A CB   3  
ATOM 5485  C CG   . ASN A 1 76  ? -14.072 -2.003  -21.649 1.00 0.00 ? 94  ASN A CG   3  
ATOM 5486  O OD1  . ASN A 1 76  ? -14.561 -1.237  -22.481 1.00 0.00 ? 94  ASN A OD1  3  
ATOM 5487  N ND2  . ASN A 1 76  ? -13.649 -3.223  -21.958 1.00 0.00 ? 94  ASN A ND2  3  
ATOM 5488  H H    . ASN A 1 76  ? -14.383 -0.110  -17.807 1.00 0.00 ? 94  ASN A H    3  
ATOM 5489  H HA   . ASN A 1 76  ? -15.339 -0.026  -20.589 1.00 0.00 ? 94  ASN A HA   3  
ATOM 5490  H HB3  . ASN A 1 76  ? -13.947 -2.470  -19.583 1.00 0.00 ? 94  ASN A HB3  3  
ATOM 5491  H HD21 . ASN A 1 76  ? -13.271 -3.777  -21.243 1.00 0.00 ? 94  ASN A HD21 3  
ATOM 5492  H HD22 . ASN A 1 76  ? -13.732 -3.518  -22.888 1.00 0.00 ? 94  ASN A HD22 3  
ATOM 5493  N N    . SER A 1 77  ? -16.848 -2.193  -20.180 1.00 0.00 ? 95  SER A N    3  
ATOM 5494  C CA   . SER A 1 77  ? -18.011 -3.005  -19.851 1.00 0.00 ? 95  SER A CA   3  
ATOM 5495  C C    . SER A 1 77  ? -17.625 -4.161  -18.931 1.00 0.00 ? 95  SER A C    3  
ATOM 5496  O O    . SER A 1 77  ? -18.488 -4.832  -18.363 1.00 0.00 ? 95  SER A O    3  
ATOM 5497  C CB   . SER A 1 77  ? -18.660 -3.549  -21.126 1.00 0.00 ? 95  SER A CB   3  
ATOM 5498  O OG   . SER A 1 77  ? -17.871 -3.250  -22.264 1.00 0.00 ? 95  SER A OG   3  
ATOM 5499  H H    . SER A 1 77  ? -16.502 -2.201  -21.099 1.00 0.00 ? 95  SER A H    3  
ATOM 5500  H HA   . SER A 1 77  ? -18.722 -2.375  -19.336 1.00 0.00 ? 95  SER A HA   3  
ATOM 5501  H HB3  . SER A 1 77  ? -19.635 -3.100  -21.250 1.00 0.00 ? 95  SER A HB3  3  
ATOM 5502  H HG   . SER A 1 77  ? -18.444 -3.079  -23.016 1.00 0.00 ? 95  SER A HG   3  
ATOM 5503  N N    . ILE A 1 78  ? -16.324 -4.386  -18.790 1.00 0.00 ? 96  ILE A N    3  
ATOM 5504  C CA   . ILE A 1 78  ? -15.822 -5.459  -17.939 1.00 0.00 ? 96  ILE A CA   3  
ATOM 5505  C C    . ILE A 1 78  ? -15.586 -4.966  -16.516 1.00 0.00 ? 96  ILE A C    3  
ATOM 5506  O O    . ILE A 1 78  ? -15.535 -5.757  -15.574 1.00 0.00 ? 96  ILE A O    3  
ATOM 5507  C CB   . ILE A 1 78  ? -14.510 -6.048  -18.491 1.00 0.00 ? 96  ILE A CB   3  
ATOM 5508  C CG1  . ILE A 1 78  ? -14.680 -6.438  -19.960 1.00 0.00 ? 96  ILE A CG1  3  
ATOM 5509  C CG2  . ILE A 1 78  ? -14.081 -7.250  -17.664 1.00 0.00 ? 96  ILE A CG2  3  
ATOM 5510  C CD1  . ILE A 1 78  ? -13.414 -6.967  -20.596 1.00 0.00 ? 96  ILE A CD1  3  
ATOM 5511  H H    . ILE A 1 78  ? -15.685 -3.817  -19.268 1.00 0.00 ? 96  ILE A H    3  
ATOM 5512  H HA   . ILE A 1 78  ? -16.565 -6.242  -17.920 1.00 0.00 ? 96  ILE A HA   3  
ATOM 5513  H HB   . ILE A 1 78  ? -13.742 -5.294  -18.413 1.00 0.00 ? 96  ILE A HB   3  
ATOM 5514  H HG13 . ILE A 1 78  ? -14.998 -5.571  -20.522 1.00 0.00 ? 96  ILE A HG13 3  
ATOM 5515  H HG21 . ILE A 1 78  ? -14.870 -7.987  -17.664 1.00 0.00 ? 96  ILE A HG21 3  
ATOM 5516  H HG22 . ILE A 1 78  ? -13.188 -7.680  -18.092 1.00 0.00 ? 96  ILE A HG22 3  
ATOM 5517  H HG23 . ILE A 1 78  ? -13.879 -6.937  -16.651 1.00 0.00 ? 96  ILE A HG23 3  
ATOM 5518  H HD11 . ILE A 1 78  ? -13.266 -6.492  -21.554 1.00 0.00 ? 96  ILE A HD11 3  
ATOM 5519  H HD12 . ILE A 1 78  ? -12.572 -6.753  -19.955 1.00 0.00 ? 96  ILE A HD12 3  
ATOM 5520  H HD13 . ILE A 1 78  ? -13.498 -8.035  -20.735 1.00 0.00 ? 96  ILE A HD13 3  
ATOM 5521  N N    . CYS A 1 79  ? -15.443 -3.654  -16.366 1.00 0.00 ? 97  CYS A N    3  
ATOM 5522  C CA   . CYS A 1 79  ? -15.214 -3.053  -15.057 1.00 0.00 ? 97  CYS A CA   3  
ATOM 5523  C C    . CYS A 1 79  ? -16.478 -2.371  -14.542 1.00 0.00 ? 97  CYS A C    3  
ATOM 5524  O O    . CYS A 1 79  ? -16.970 -1.417  -15.144 1.00 0.00 ? 97  CYS A O    3  
ATOM 5525  C CB   . CYS A 1 79  ? -14.069 -2.042  -15.131 1.00 0.00 ? 97  CYS A CB   3  
ATOM 5526  S SG   . CYS A 1 79  ? -12.427 -2.794  -15.365 1.00 0.00 ? 97  CYS A SG   3  
ATOM 5527  H H    . CYS A 1 79  ? -15.494 -3.074  -17.156 1.00 0.00 ? 97  CYS A H    3  
ATOM 5528  H HA   . CYS A 1 79  ? -14.943 -3.842  -14.373 1.00 0.00 ? 97  CYS A HA   3  
ATOM 5529  H HB3  . CYS A 1 79  ? -14.042 -1.473  -14.213 1.00 0.00 ? 97  CYS A HB3  3  
ATOM 5530  N N    . ALA A 1 80  ? -16.998 -2.866  -13.424 1.00 0.00 ? 98  ALA A N    3  
ATOM 5531  C CA   . ALA A 1 80  ? -18.203 -2.304  -12.827 1.00 0.00 ? 98  ALA A CA   3  
ATOM 5532  C C    . ALA A 1 80  ? -19.322 -2.186  -13.856 1.00 0.00 ? 98  ALA A C    3  
ATOM 5533  O O    . ALA A 1 80  ? -20.175 -1.303  -13.762 1.00 0.00 ? 98  ALA A O    3  
ATOM 5534  C CB   . ALA A 1 80  ? -17.902 -0.944  -12.214 1.00 0.00 ? 98  ALA A CB   3  
ATOM 5535  H H    . ALA A 1 80  ? -16.560 -3.628  -12.991 1.00 0.00 ? 98  ALA A H    3  
ATOM 5536  H HA   . ALA A 1 80  ? -18.524 -2.965  -12.035 1.00 0.00 ? 98  ALA A HA   3  
ATOM 5537  H HB1  . ALA A 1 80  ? -17.298 -0.367  -12.899 1.00 0.00 ? 98  ALA A HB1  3  
ATOM 5538  H HB2  . ALA A 1 80  ? -18.827 -0.422  -12.022 1.00 0.00 ? 98  ALA A HB2  3  
ATOM 5539  H HB3  . ALA A 1 80  ? -17.366 -1.079  -11.287 1.00 0.00 ? 98  ALA A HB3  3  
ATOM 5540  N N    . ALA A 1 81  ? -19.313 -3.080  -14.839 1.00 0.00 ? 99  ALA A N    3  
ATOM 5541  C CA   . ALA A 1 81  ? -20.328 -3.077  -15.884 1.00 0.00 ? 99  ALA A CA   3  
ATOM 5542  C C    . ALA A 1 81  ? -20.420 -1.712  -16.557 1.00 0.00 ? 99  ALA A C    3  
ATOM 5543  O O    . ALA A 1 81  ? -21.440 -1.031  -16.463 1.00 0.00 ? 99  ALA A O    3  
ATOM 5544  C CB   . ALA A 1 81  ? -21.680 -3.476  -15.308 1.00 0.00 ? 99  ALA A CB   3  
ATOM 5545  H H    . ALA A 1 81  ? -18.608 -3.760  -14.860 1.00 0.00 ? 99  ALA A H    3  
ATOM 5546  H HA   . ALA A 1 81  ? -20.049 -3.813  -16.624 1.00 0.00 ? 99  ALA A HA   3  
ATOM 5547  H HB1  . ALA A 1 81  ? -22.082 -2.655  -14.734 1.00 0.00 ? 99  ALA A HB1  3  
ATOM 5548  H HB2  . ALA A 1 81  ? -22.357 -3.719  -16.115 1.00 0.00 ? 99  ALA A HB2  3  
ATOM 5549  H HB3  . ALA A 1 81  ? -21.558 -4.338  -14.669 1.00 0.00 ? 99  ALA A HB3  3  
ATOM 5550  N N    . ASN A 1 82  ? -19.346 -1.319  -17.234 1.00 0.00 ? 100 ASN A N    3  
ATOM 5551  C CA   . ASN A 1 82  ? -19.306 -0.032  -17.921 1.00 0.00 ? 100 ASN A CA   3  
ATOM 5552  C C    . ASN A 1 82  ? -19.958 1.057   -17.076 1.00 0.00 ? 100 ASN A C    3  
ATOM 5553  O O    . ASN A 1 82  ? -20.921 1.694   -17.500 1.00 0.00 ? 100 ASN A O    3  
ATOM 5554  C CB   . ASN A 1 82  ? -20.010 -0.133  -19.277 1.00 0.00 ? 100 ASN A CB   3  
ATOM 5555  C CG   . ASN A 1 82  ? -21.188 -1.086  -19.247 1.00 0.00 ? 100 ASN A CG   3  
ATOM 5556  O OD1  . ASN A 1 82  ? -21.014 -2.304  -19.216 1.00 0.00 ? 100 ASN A OD1  3  
ATOM 5557  N ND2  . ASN A 1 82  ? -22.397 -0.534  -19.255 1.00 0.00 ? 100 ASN A ND2  3  
ATOM 5558  H H    . ASN A 1 82  ? -18.563 -1.906  -17.272 1.00 0.00 ? 100 ASN A H    3  
ATOM 5559  H HA   . ASN A 1 82  ? -18.271 0.224   -18.082 1.00 0.00 ? 100 ASN A HA   3  
ATOM 5560  H HB3  . ASN A 1 82  ? -19.306 -0.481  -20.016 1.00 0.00 ? 100 ASN A HB3  3  
ATOM 5561  H HD21 . ASN A 1 82  ? -22.459 0.442   -19.280 1.00 0.00 ? 100 ASN A HD21 3  
ATOM 5562  H HD22 . ASN A 1 82  ? -23.176 -1.129  -19.236 1.00 0.00 ? 100 ASN A HD22 3  
ATOM 5563  N N    . ASN A 1 83  ? -19.426 1.267   -15.877 1.00 0.00 ? 101 ASN A N    3  
ATOM 5564  C CA   . ASN A 1 83  ? -19.956 2.280   -14.970 1.00 0.00 ? 101 ASN A CA   3  
ATOM 5565  C C    . ASN A 1 83  ? -19.245 3.615   -15.171 1.00 0.00 ? 101 ASN A C    3  
ATOM 5566  O O    . ASN A 1 83  ? -18.490 3.790   -16.128 1.00 0.00 ? 101 ASN A O    3  
ATOM 5567  C CB   . ASN A 1 83  ? -19.805 1.823   -13.518 1.00 0.00 ? 101 ASN A CB   3  
ATOM 5568  C CG   . ASN A 1 83  ? -21.133 1.777   -12.787 1.00 0.00 ? 101 ASN A CG   3  
ATOM 5569  O OD1  . ASN A 1 83  ? -21.313 2.437   -11.761 1.00 0.00 ? 101 ASN A OD1  3  
ATOM 5570  N ND2  . ASN A 1 83  ? -22.071 0.996   -13.310 1.00 0.00 ? 101 ASN A ND2  3  
ATOM 5571  H H    . ASN A 1 83  ? -18.658 0.727   -15.593 1.00 0.00 ? 101 ASN A H    3  
ATOM 5572  H HA   . ASN A 1 83  ? -21.004 2.406   -15.192 1.00 0.00 ? 101 ASN A HA   3  
ATOM 5573  H HB3  . ASN A 1 83  ? -19.151 2.507   -12.998 1.00 0.00 ? 101 ASN A HB3  3  
ATOM 5574  H HD21 . ASN A 1 83  ? -21.857 0.500   -14.127 1.00 0.00 ? 101 ASN A HD21 3  
ATOM 5575  H HD22 . ASN A 1 83  ? -22.938 0.949   -12.857 1.00 0.00 ? 101 ASN A HD22 3  
ATOM 5576  N N    . THR A 1 84  ? -19.492 4.553   -14.263 1.00 0.00 ? 102 THR A N    3  
ATOM 5577  C CA   . THR A 1 84  ? -18.878 5.872   -14.340 1.00 0.00 ? 102 THR A CA   3  
ATOM 5578  C C    . THR A 1 84  ? -18.771 6.510   -12.960 1.00 0.00 ? 102 THR A C    3  
ATOM 5579  O O    . THR A 1 84  ? -19.244 5.955   -11.970 1.00 0.00 ? 102 THR A O    3  
ATOM 5580  C CB   . THR A 1 84  ? -19.676 6.810   -15.266 1.00 0.00 ? 102 THR A CB   3  
ATOM 5581  O OG1  . THR A 1 84  ? -21.074 6.715   -14.973 1.00 0.00 ? 102 THR A OG1  3  
ATOM 5582  C CG2  . THR A 1 84  ? -19.434 6.463   -16.727 1.00 0.00 ? 102 THR A CG2  3  
ATOM 5583  H H    . THR A 1 84  ? -20.104 4.352   -13.524 1.00 0.00 ? 102 THR A H    3  
ATOM 5584  H HA   . THR A 1 84  ? -17.885 5.754   -14.750 1.00 0.00 ? 102 THR A HA   3  
ATOM 5585  H HB   . THR A 1 84  ? -19.347 7.826   -15.093 1.00 0.00 ? 102 THR A HB   3  
ATOM 5586  H HG1  . THR A 1 84  ? -21.580 7.060   -15.713 1.00 0.00 ? 102 THR A HG1  3  
ATOM 5587  H HG21 . THR A 1 84  ? -19.890 5.510   -16.951 1.00 0.00 ? 102 THR A HG21 3  
ATOM 5588  H HG22 . THR A 1 84  ? -18.371 6.405   -16.912 1.00 0.00 ? 102 THR A HG22 3  
ATOM 5589  H HG23 . THR A 1 84  ? -19.867 7.227   -17.355 1.00 0.00 ? 102 THR A HG23 3  
ATOM 5590  N N    . GLY A 1 85  ? -18.143 7.682   -12.902 1.00 0.00 ? 103 GLY A N    3  
ATOM 5591  C CA   . GLY A 1 85  ? -17.985 8.377   -11.637 1.00 0.00 ? 103 GLY A CA   3  
ATOM 5592  C C    . GLY A 1 85  ? -17.080 7.632   -10.675 1.00 0.00 ? 103 GLY A C    3  
ATOM 5593  O O    . GLY A 1 85  ? -16.062 7.068   -11.080 1.00 0.00 ? 103 GLY A O    3  
ATOM 5594  H H    . GLY A 1 85  ? -17.785 8.077   -13.723 1.00 0.00 ? 103 GLY A H    3  
ATOM 5595  H HA2  . GLY A 1 85  ? -17.568 9.354   -11.826 1.00 0.00 ? 103 GLY A HA2  3  
ATOM 5596  H HA3  . GLY A 1 85  ? -18.957 8.493   -11.180 1.00 0.00 ? 103 GLY A HA3  3  
ATOM 5597  N N    . VAL A 1 86  ? -17.448 7.630   -9.400  1.00 0.00 ? 104 VAL A N    3  
ATOM 5598  C CA   . VAL A 1 86  ? -16.662 6.950   -8.376  1.00 0.00 ? 104 VAL A CA   3  
ATOM 5599  C C    . VAL A 1 86  ? -17.456 5.821   -7.733  1.00 0.00 ? 104 VAL A C    3  
ATOM 5600  O O    . VAL A 1 86  ? -18.204 6.038   -6.777  1.00 0.00 ? 104 VAL A O    3  
ATOM 5601  C CB   . VAL A 1 86  ? -16.201 7.929   -7.279  1.00 0.00 ? 104 VAL A CB   3  
ATOM 5602  C CG1  . VAL A 1 86  ? -15.426 7.192   -6.198  1.00 0.00 ? 104 VAL A CG1  3  
ATOM 5603  C CG2  . VAL A 1 86  ? -15.361 9.044   -7.882  1.00 0.00 ? 104 VAL A CG2  3  
ATOM 5604  H H    . VAL A 1 86  ? -18.270 8.096   -9.138  1.00 0.00 ? 104 VAL A H    3  
ATOM 5605  H HA   . VAL A 1 86  ? -15.784 6.536   -8.851  1.00 0.00 ? 104 VAL A HA   3  
ATOM 5606  H HB   . VAL A 1 86  ? -17.077 8.370   -6.828  1.00 0.00 ? 104 VAL A HB   3  
ATOM 5607  H HG11 . VAL A 1 86  ? -14.683 7.851   -5.775  1.00 0.00 ? 104 VAL A HG11 3  
ATOM 5608  H HG12 . VAL A 1 86  ? -16.107 6.871   -5.423  1.00 0.00 ? 104 VAL A HG12 3  
ATOM 5609  H HG13 . VAL A 1 86  ? -14.938 6.329   -6.628  1.00 0.00 ? 104 VAL A HG13 3  
ATOM 5610  H HG21 . VAL A 1 86  ? -15.047 8.763   -8.876  1.00 0.00 ? 104 VAL A HG21 3  
ATOM 5611  H HG22 . VAL A 1 86  ? -15.948 9.951   -7.933  1.00 0.00 ? 104 VAL A HG22 3  
ATOM 5612  H HG23 . VAL A 1 86  ? -14.491 9.215   -7.265  1.00 0.00 ? 104 VAL A HG23 3  
ATOM 5613  N N    . TYR A 1 87  ? -17.291 4.612   -8.261  1.00 0.00 ? 105 TYR A N    3  
ATOM 5614  C CA   . TYR A 1 87  ? -17.995 3.447   -7.739  1.00 0.00 ? 105 TYR A CA   3  
ATOM 5615  C C    . TYR A 1 87  ? -17.805 3.325   -6.230  1.00 0.00 ? 105 TYR A C    3  
ATOM 5616  O O    . TYR A 1 87  ? -16.771 3.721   -5.690  1.00 0.00 ? 105 TYR A O    3  
ATOM 5617  C CB   . TYR A 1 87  ? -17.502 2.175   -8.430  1.00 0.00 ? 105 TYR A CB   3  
ATOM 5618  C CG   . TYR A 1 87  ? -18.579 1.129   -8.614  1.00 0.00 ? 105 TYR A CG   3  
ATOM 5619  C CD1  . TYR A 1 87  ? -19.753 1.424   -9.297  1.00 0.00 ? 105 TYR A CD1  3  
ATOM 5620  C CD2  . TYR A 1 87  ? -18.423 -0.154  -8.104  1.00 0.00 ? 105 TYR A CD2  3  
ATOM 5621  C CE1  . TYR A 1 87  ? -20.739 0.473   -9.466  1.00 0.00 ? 105 TYR A CE1  3  
ATOM 5622  C CE2  . TYR A 1 87  ? -19.403 -1.112  -8.270  1.00 0.00 ? 105 TYR A CE2  3  
ATOM 5623  C CZ   . TYR A 1 87  ? -20.560 -0.794  -8.952  1.00 0.00 ? 105 TYR A CZ   3  
ATOM 5624  O OH   . TYR A 1 87  ? -21.539 -1.746  -9.119  1.00 0.00 ? 105 TYR A OH   3  
ATOM 5625  H H    . TYR A 1 87  ? -16.684 4.502   -9.021  1.00 0.00 ? 105 TYR A H    3  
ATOM 5626  H HA   . TYR A 1 87  ? -19.047 3.574   -7.948  1.00 0.00 ? 105 TYR A HA   3  
ATOM 5627  H HB3  . TYR A 1 87  ? -16.710 1.737   -7.840  1.00 0.00 ? 105 TYR A HB3  3  
ATOM 5628  H HD1  . TYR A 1 87  ? -19.889 2.418   -9.699  1.00 0.00 ? 105 TYR A HD1  3  
ATOM 5629  H HD2  . TYR A 1 87  ? -17.516 -0.399  -7.570  1.00 0.00 ? 105 TYR A HD2  3  
ATOM 5630  H HE1  . TYR A 1 87  ? -21.644 0.721   -10.000 1.00 0.00 ? 105 TYR A HE1  3  
ATOM 5631  H HE2  . TYR A 1 87  ? -19.263 -2.105  -7.868  1.00 0.00 ? 105 TYR A HE2  3  
ATOM 5632  H HH   . TYR A 1 87  ? -22.344 -1.325  -9.430  1.00 0.00 ? 105 TYR A HH   3  
ATOM 5633  N N    . ILE A 1 88  ? -18.809 2.778   -5.555  1.00 0.00 ? 106 ILE A N    3  
ATOM 5634  C CA   . ILE A 1 88  ? -18.753 2.602   -4.109  1.00 0.00 ? 106 ILE A CA   3  
ATOM 5635  C C    . ILE A 1 88  ? -19.148 1.184   -3.711  1.00 0.00 ? 106 ILE A C    3  
ATOM 5636  O O    . ILE A 1 88  ? -20.145 0.977   -3.018  1.00 0.00 ? 106 ILE A O    3  
ATOM 5637  C CB   . ILE A 1 88  ? -19.673 3.601   -3.385  1.00 0.00 ? 106 ILE A CB   3  
ATOM 5638  C CG1  . ILE A 1 88  ? -19.439 5.019   -3.911  1.00 0.00 ? 106 ILE A CG1  3  
ATOM 5639  C CG2  . ILE A 1 88  ? -19.440 3.545   -1.882  1.00 0.00 ? 106 ILE A CG2  3  
ATOM 5640  C CD1  . ILE A 1 88  ? -20.327 6.059   -3.264  1.00 0.00 ? 106 ILE A CD1  3  
ATOM 5641  H H    . ILE A 1 88  ? -19.608 2.483   -6.042  1.00 0.00 ? 106 ILE A H    3  
ATOM 5642  H HA   . ILE A 1 88  ? -17.736 2.785   -3.792  1.00 0.00 ? 106 ILE A HA   3  
ATOM 5643  H HB   . ILE A 1 88  ? -20.698 3.319   -3.577  1.00 0.00 ? 106 ILE A HB   3  
ATOM 5644  H HG13 . ILE A 1 88  ? -19.630 5.035   -4.975  1.00 0.00 ? 106 ILE A HG13 3  
ATOM 5645  H HG21 . ILE A 1 88  ? -18.865 4.406   -1.575  1.00 0.00 ? 106 ILE A HG21 3  
ATOM 5646  H HG22 . ILE A 1 88  ? -20.390 3.545   -1.370  1.00 0.00 ? 106 ILE A HG22 3  
ATOM 5647  H HG23 . ILE A 1 88  ? -18.897 2.644   -1.636  1.00 0.00 ? 106 ILE A HG23 3  
ATOM 5648  H HD11 . ILE A 1 88  ? -20.805 6.654   -4.030  1.00 0.00 ? 106 ILE A HD11 3  
ATOM 5649  H HD12 . ILE A 1 88  ? -21.080 5.568   -2.666  1.00 0.00 ? 106 ILE A HD12 3  
ATOM 5650  H HD13 . ILE A 1 88  ? -19.728 6.700   -2.634  1.00 0.00 ? 106 ILE A HD13 3  
ATOM 5651  N N    . LEU A 1 89  ? -18.358 0.211   -4.152  1.00 0.00 ? 107 LEU A N    3  
ATOM 5652  C CA   . LEU A 1 89  ? -18.623 -1.189  -3.841  1.00 0.00 ? 107 LEU A CA   3  
ATOM 5653  C C    . LEU A 1 89  ? -18.346 -1.483  -2.369  1.00 0.00 ? 107 LEU A C    3  
ATOM 5654  O O    . LEU A 1 89  ? -17.276 -1.976  -2.014  1.00 0.00 ? 107 LEU A O    3  
ATOM 5655  C CB   . LEU A 1 89  ? -17.768 -2.099  -4.724  1.00 0.00 ? 107 LEU A CB   3  
ATOM 5656  C CG   . LEU A 1 89  ? -18.324 -3.501  -4.981  1.00 0.00 ? 107 LEU A CG   3  
ATOM 5657  C CD1  . LEU A 1 89  ? -18.425 -4.282  -3.681  1.00 0.00 ? 107 LEU A CD1  3  
ATOM 5658  C CD2  . LEU A 1 89  ? -19.681 -3.419  -5.664  1.00 0.00 ? 107 LEU A CD2  3  
ATOM 5659  H H    . LEU A 1 89  ? -17.579 0.437   -4.700  1.00 0.00 ? 107 LEU A H    3  
ATOM 5660  H HA   . LEU A 1 89  ? -19.667 -1.383  -4.044  1.00 0.00 ? 107 LEU A HA   3  
ATOM 5661  H HB3  . LEU A 1 89  ? -16.802 -2.207  -4.249  1.00 0.00 ? 107 LEU A HB3  3  
ATOM 5662  H HG   . LEU A 1 89  ? -17.649 -4.034  -5.638  1.00 0.00 ? 107 LEU A HG   3  
ATOM 5663  H HD11 . LEU A 1 89  ? -19.119 -3.788  -3.017  1.00 0.00 ? 107 LEU A HD11 3  
ATOM 5664  H HD12 . LEU A 1 89  ? -17.453 -4.329  -3.212  1.00 0.00 ? 107 LEU A HD12 3  
ATOM 5665  H HD13 . LEU A 1 89  ? -18.774 -5.282  -3.888  1.00 0.00 ? 107 LEU A HD13 3  
ATOM 5666  H HD21 . LEU A 1 89  ? -19.652 -3.973  -6.591  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 5667  H HD22 . LEU A 1 89  ? -19.918 -2.385  -5.870  1.00 0.00 ? 107 LEU A HD22 3  
ATOM 5668  H HD23 . LEU A 1 89  ? -20.436 -3.840  -5.016  1.00 0.00 ? 107 LEU A HD23 3  
ATOM 5669  N N    . THR A 1 90  ? -19.318 -1.174  -1.516  1.00 0.00 ? 108 THR A N    3  
ATOM 5670  C CA   . THR A 1 90  ? -19.180 -1.405  -0.085  1.00 0.00 ? 108 THR A CA   3  
ATOM 5671  C C    . THR A 1 90  ? -19.395 -2.875  0.259   1.00 0.00 ? 108 THR A C    3  
ATOM 5672  O O    . THR A 1 90  ? -20.359 -3.493  -0.191  1.00 0.00 ? 108 THR A O    3  
ATOM 5673  C CB   . THR A 1 90  ? -20.177 -0.550  0.721   1.00 0.00 ? 108 THR A CB   3  
ATOM 5674  O OG1  . THR A 1 90  ? -20.003 -0.785  2.123   1.00 0.00 ? 108 THR A OG1  3  
ATOM 5675  C CG2  . THR A 1 90  ? -21.610 -0.872  0.322   1.00 0.00 ? 108 THR A CG2  3  
ATOM 5676  H H    . THR A 1 90  ? -20.148 -0.783  -1.862  1.00 0.00 ? 108 THR A H    3  
ATOM 5677  H HA   . THR A 1 90  ? -18.179 -1.121  0.204   1.00 0.00 ? 108 THR A HA   3  
ATOM 5678  H HB   . THR A 1 90  ? -19.986 0.492   0.511   1.00 0.00 ? 108 THR A HB   3  
ATOM 5679  H HG1  . THR A 1 90  ? -19.423 -0.113  2.489   1.00 0.00 ? 108 THR A HG1  3  
ATOM 5680  H HG21 . THR A 1 90  ? -22.079 -1.451  1.104   1.00 0.00 ? 108 THR A HG21 3  
ATOM 5681  H HG22 . THR A 1 90  ? -21.609 -1.439  -0.596  1.00 0.00 ? 108 THR A HG22 3  
ATOM 5682  H HG23 . THR A 1 90  ? -22.157 0.047   0.178   1.00 0.00 ? 108 THR A HG23 3  
ATOM 5683  N N    . SER A 1 91  ? -18.488 -3.428  1.059   1.00 0.00 ? 109 SER A N    3  
ATOM 5684  C CA   . SER A 1 91  ? -18.576 -4.828  1.459   1.00 0.00 ? 109 SER A CA   3  
ATOM 5685  C C    . SER A 1 91  ? -18.295 -4.984  2.950   1.00 0.00 ? 109 SER A C    3  
ATOM 5686  O O    . SER A 1 91  ? -17.899 -4.032  3.622   1.00 0.00 ? 109 SER A O    3  
ATOM 5687  C CB   . SER A 1 91  ? -17.593 -5.676  0.651   1.00 0.00 ? 109 SER A CB   3  
ATOM 5688  O OG   . SER A 1 91  ? -17.766 -7.055  0.924   1.00 0.00 ? 109 SER A OG   3  
ATOM 5689  H H    . SER A 1 91  ? -17.741 -2.885  1.383   1.00 0.00 ? 109 SER A H    3  
ATOM 5690  H HA   . SER A 1 91  ? -19.582 -5.168  1.257   1.00 0.00 ? 109 SER A HA   3  
ATOM 5691  H HB3  . SER A 1 91  ? -16.582 -5.393  0.910   1.00 0.00 ? 109 SER A HB3  3  
ATOM 5692  H HG   . SER A 1 91  ? -17.004 -7.384  1.409   1.00 0.00 ? 109 SER A HG   3  
ATOM 5693  N N    . ASN A 1 92  ? -18.504 -6.193  3.463   1.00 0.00 ? 110 ASN A N    3  
ATOM 5694  C CA   . ASN A 1 92  ? -18.274 -6.476  4.874   1.00 0.00 ? 110 ASN A CA   3  
ATOM 5695  C C    . ASN A 1 92  ? -16.819 -6.862  5.122   1.00 0.00 ? 110 ASN A C    3  
ATOM 5696  O O    . ASN A 1 92  ? -16.090 -6.165  5.829   1.00 0.00 ? 110 ASN A O    3  
ATOM 5697  C CB   . ASN A 1 92  ? -19.198 -7.598  5.349   1.00 0.00 ? 110 ASN A CB   3  
ATOM 5698  C CG   . ASN A 1 92  ? -20.543 -7.079  5.822   1.00 0.00 ? 110 ASN A CG   3  
ATOM 5699  O OD1  . ASN A 1 92  ? -21.261 -6.414  5.075   1.00 0.00 ? 110 ASN A OD1  3  
ATOM 5700  N ND2  . ASN A 1 92  ? -20.889 -7.381  7.067   1.00 0.00 ? 110 ASN A ND2  3  
ATOM 5701  H H    . ASN A 1 92  ? -18.820 -6.913  2.877   1.00 0.00 ? 110 ASN A H    3  
ATOM 5702  H HA   . ASN A 1 92  ? -18.496 -5.579  5.432   1.00 0.00 ? 110 ASN A HA   3  
ATOM 5703  H HB3  . ASN A 1 92  ? -18.728 -8.123  6.167   1.00 0.00 ? 110 ASN A HB3  3  
ATOM 5704  H HD21 . ASN A 1 92  ? -20.266 -7.916  7.604   1.00 0.00 ? 110 ASN A HD21 3  
ATOM 5705  H HD22 . ASN A 1 92  ? -21.753 -7.059  7.398   1.00 0.00 ? 110 ASN A HD22 3  
ATOM 5706  N N    . THR A 1 93  ? -16.399 -7.978  4.533   1.00 0.00 ? 111 THR A N    3  
ATOM 5707  C CA   . THR A 1 93  ? -15.032 -8.458  4.689   1.00 0.00 ? 111 THR A CA   3  
ATOM 5708  C C    . THR A 1 93  ? -14.483 -8.992  3.371   1.00 0.00 ? 111 THR A C    3  
ATOM 5709  O O    . THR A 1 93  ? -15.018 -9.946  2.806   1.00 0.00 ? 111 THR A O    3  
ATOM 5710  C CB   . THR A 1 93  ? -14.944 -9.565  5.756   1.00 0.00 ? 111 THR A CB   3  
ATOM 5711  O OG1  . THR A 1 93  ? -15.973 -10.537 5.539   1.00 0.00 ? 111 THR A OG1  3  
ATOM 5712  C CG2  . THR A 1 93  ? -15.076 -8.982  7.154   1.00 0.00 ? 111 THR A CG2  3  
ATOM 5713  H H    . THR A 1 93  ? -17.027 -8.490  3.981   1.00 0.00 ? 111 THR A H    3  
ATOM 5714  H HA   . THR A 1 93  ? -14.422 -7.626  5.011   1.00 0.00 ? 111 THR A HA   3  
ATOM 5715  H HB   . THR A 1 93  ? -13.980 -10.048 5.672   1.00 0.00 ? 111 THR A HB   3  
ATOM 5716  H HG1  . THR A 1 93  ? -15.734 -11.099 4.799   1.00 0.00 ? 111 THR A HG1  3  
ATOM 5717  H HG21 . THR A 1 93  ? -15.426 -9.746  7.831   1.00 0.00 ? 111 THR A HG21 3  
ATOM 5718  H HG22 . THR A 1 93  ? -15.781 -8.165  7.138   1.00 0.00 ? 111 THR A HG22 3  
ATOM 5719  H HG23 . THR A 1 93  ? -14.114 -8.622  7.485   1.00 0.00 ? 111 THR A HG23 3  
ATOM 5720  N N    . SER A 1 94  ? -13.413 -8.371  2.886   1.00 0.00 ? 112 SER A N    3  
ATOM 5721  C CA   . SER A 1 94  ? -12.792 -8.783  1.632   1.00 0.00 ? 112 SER A CA   3  
ATOM 5722  C C    . SER A 1 94  ? -11.342 -8.316  1.564   1.00 0.00 ? 112 SER A C    3  
ATOM 5723  O O    . SER A 1 94  ? -10.970 -7.319  2.184   1.00 0.00 ? 112 SER A O    3  
ATOM 5724  C CB   . SER A 1 94  ? -13.576 -8.224  0.444   1.00 0.00 ? 112 SER A CB   3  
ATOM 5725  O OG   . SER A 1 94  ? -14.700 -9.035  0.145   1.00 0.00 ? 112 SER A OG   3  
ATOM 5726  H H    . SER A 1 94  ? -13.032 -7.617  3.383   1.00 0.00 ? 112 SER A H    3  
ATOM 5727  H HA   . SER A 1 94  ? -12.814 -9.861  1.591   1.00 0.00 ? 112 SER A HA   3  
ATOM 5728  H HB3  . SER A 1 94  ? -12.933 -8.187  -0.423  1.00 0.00 ? 112 SER A HB3  3  
ATOM 5729  H HG   . SER A 1 94  ? -14.909 -8.961  -0.788  1.00 0.00 ? 112 SER A HG   3  
ATOM 5730  N N    . GLN A 1 95  ? -10.527 -9.043  0.808   1.00 0.00 ? 113 GLN A N    3  
ATOM 5731  C CA   . GLN A 1 95  ? -9.116  -8.706  0.659   1.00 0.00 ? 113 GLN A CA   3  
ATOM 5732  C C    . GLN A 1 95  ? -8.871  -7.955  -0.646  1.00 0.00 ? 113 GLN A C    3  
ATOM 5733  O O    . GLN A 1 95  ? -9.106  -8.486  -1.732  1.00 0.00 ? 113 GLN A O    3  
ATOM 5734  C CB   . GLN A 1 95  ? -8.259  -9.970  0.702   1.00 0.00 ? 113 GLN A CB   3  
ATOM 5735  C CG   . GLN A 1 95  ? -8.018  -10.495 2.108   1.00 0.00 ? 113 GLN A CG   3  
ATOM 5736  C CD   . GLN A 1 95  ? -9.293  -10.965 2.783   1.00 0.00 ? 113 GLN A CD   3  
ATOM 5737  O OE1  . GLN A 1 95  ? -9.960  -11.881 2.304   1.00 0.00 ? 113 GLN A OE1  3  
ATOM 5738  N NE2  . GLN A 1 95  ? -9.637  -10.337 3.901   1.00 0.00 ? 113 GLN A NE2  3  
ATOM 5739  H H    . GLN A 1 95  ? -10.883 -9.827  0.338   1.00 0.00 ? 113 GLN A H    3  
ATOM 5740  H HA   . GLN A 1 95  ? -8.841  -8.067  1.484   1.00 0.00 ? 113 GLN A HA   3  
ATOM 5741  H HB3  . GLN A 1 95  ? -7.301  -9.757  0.252   1.00 0.00 ? 113 GLN A HB3  3  
ATOM 5742  H HG3  . GLN A 1 95  ? -7.583  -9.705  2.703   1.00 0.00 ? 113 GLN A HG3  3  
ATOM 5743  H HE21 . GLN A 1 95  ? -9.058  -9.615  4.224   1.00 0.00 ? 113 GLN A HE21 3  
ATOM 5744  H HE22 . GLN A 1 95  ? -10.456 -10.620 4.357   1.00 0.00 ? 113 GLN A HE22 3  
ATOM 5745  N N    . TYR A 1 96  ? -8.400  -6.719  -0.532  1.00 0.00 ? 114 TYR A N    3  
ATOM 5746  C CA   . TYR A 1 96  ? -8.126  -5.894  -1.704  1.00 0.00 ? 114 TYR A CA   3  
ATOM 5747  C C    . TYR A 1 96  ? -7.054  -4.852  -1.397  1.00 0.00 ? 114 TYR A C    3  
ATOM 5748  O O    . TYR A 1 96  ? -6.486  -4.831  -0.305  1.00 0.00 ? 114 TYR A O    3  
ATOM 5749  C CB   . TYR A 1 96  ? -9.405  -5.202  -2.177  1.00 0.00 ? 114 TYR A CB   3  
ATOM 5750  C CG   . TYR A 1 96  ? -10.384 -6.136  -2.850  1.00 0.00 ? 114 TYR A CG   3  
ATOM 5751  C CD1  . TYR A 1 96  ? -10.015 -6.873  -3.970  1.00 0.00 ? 114 TYR A CD1  3  
ATOM 5752  C CD2  . TYR A 1 96  ? -11.680 -6.282  -2.369  1.00 0.00 ? 114 TYR A CD2  3  
ATOM 5753  C CE1  . TYR A 1 96  ? -10.907 -7.727  -4.588  1.00 0.00 ? 114 TYR A CE1  3  
ATOM 5754  C CE2  . TYR A 1 96  ? -12.577 -7.135  -2.981  1.00 0.00 ? 114 TYR A CE2  3  
ATOM 5755  C CZ   . TYR A 1 96  ? -12.186 -7.854  -4.091  1.00 0.00 ? 114 TYR A CZ   3  
ATOM 5756  O OH   . TYR A 1 96  ? -13.078 -8.705  -4.704  1.00 0.00 ? 114 TYR A OH   3  
ATOM 5757  H H    . TYR A 1 96  ? -8.233  -6.351  0.361   1.00 0.00 ? 114 TYR A H    3  
ATOM 5758  H HA   . TYR A 1 96  ? -7.768  -6.543  -2.490  1.00 0.00 ? 114 TYR A HA   3  
ATOM 5759  H HB3  . TYR A 1 96  ? -9.147  -4.426  -2.882  1.00 0.00 ? 114 TYR A HB3  3  
ATOM 5760  H HD1  . TYR A 1 96  ? -9.011  -6.772  -4.356  1.00 0.00 ? 114 TYR A HD1  3  
ATOM 5761  H HD2  . TYR A 1 96  ? -11.982 -5.717  -1.499  1.00 0.00 ? 114 TYR A HD2  3  
ATOM 5762  H HE1  . TYR A 1 96  ? -10.600 -8.291  -5.456  1.00 0.00 ? 114 TYR A HE1  3  
ATOM 5763  H HE2  . TYR A 1 96  ? -13.580 -7.235  -2.592  1.00 0.00 ? 114 TYR A HE2  3  
ATOM 5764  H HH   . TYR A 1 96  ? -13.660 -9.090  -4.044  1.00 0.00 ? 114 TYR A HH   3  
ATOM 5765  N N    . ASP A 1 97  ? -6.784  -3.989  -2.369  1.00 0.00 ? 115 ASP A N    3  
ATOM 5766  C CA   . ASP A 1 97  ? -5.782  -2.942  -2.205  1.00 0.00 ? 115 ASP A CA   3  
ATOM 5767  C C    . ASP A 1 97  ? -6.285  -1.851  -1.265  1.00 0.00 ? 115 ASP A C    3  
ATOM 5768  O O    . ASP A 1 97  ? -7.368  -1.961  -0.692  1.00 0.00 ? 115 ASP A O    3  
ATOM 5769  C CB   . ASP A 1 97  ? -5.418  -2.337  -3.563  1.00 0.00 ? 115 ASP A CB   3  
ATOM 5770  C CG   . ASP A 1 97  ? -6.640  -1.895  -4.344  1.00 0.00 ? 115 ASP A CG   3  
ATOM 5771  O OD1  . ASP A 1 97  ? -7.437  -2.770  -4.745  1.00 0.00 ? 115 ASP A OD1  3  
ATOM 5772  O OD2  . ASP A 1 97  ? -6.800  -0.674  -4.554  1.00 0.00 ? 115 ASP A OD2  3  
ATOM 5773  H H    . ASP A 1 97  ? -7.269  -4.056  -3.218  1.00 0.00 ? 115 ASP A H    3  
ATOM 5774  H HA   . ASP A 1 97  ? -4.900  -3.391  -1.776  1.00 0.00 ? 115 ASP A HA   3  
ATOM 5775  H HB3  . ASP A 1 97  ? -4.886  -3.070  -4.146  1.00 0.00 ? 115 ASP A HB3  3  
ATOM 5776  N N    . THR A 1 98  ? -5.489  -0.797  -1.110  1.00 0.00 ? 116 THR A N    3  
ATOM 5777  C CA   . THR A 1 98  ? -5.852  0.313   -0.238  1.00 0.00 ? 116 THR A CA   3  
ATOM 5778  C C    . THR A 1 98  ? -5.245  1.621   -0.732  1.00 0.00 ? 116 THR A C    3  
ATOM 5779  O O    . THR A 1 98  ? -4.125  1.643   -1.245  1.00 0.00 ? 116 THR A O    3  
ATOM 5780  C CB   . THR A 1 98  ? -5.394  0.062   1.211   1.00 0.00 ? 116 THR A CB   3  
ATOM 5781  O OG1  . THR A 1 98  ? -5.834  1.131   2.056   1.00 0.00 ? 116 THR A OG1  3  
ATOM 5782  C CG2  . THR A 1 98  ? -3.879  -0.062  1.286   1.00 0.00 ? 116 THR A CG2  3  
ATOM 5783  H H    . THR A 1 98  ? -4.638  -0.767  -1.595  1.00 0.00 ? 116 THR A H    3  
ATOM 5784  H HA   . THR A 1 98  ? -6.929  0.403   -0.244  1.00 0.00 ? 116 THR A HA   3  
ATOM 5785  H HB   . THR A 1 98  ? -5.833  -0.863  1.555   1.00 0.00 ? 116 THR A HB   3  
ATOM 5786  H HG1  . THR A 1 98  ? -6.789  1.102   2.138   1.00 0.00 ? 116 THR A HG1  3  
ATOM 5787  H HG21 . THR A 1 98  ? -3.429  0.891   1.051   1.00 0.00 ? 116 THR A HG21 3  
ATOM 5788  H HG22 . THR A 1 98  ? -3.543  -0.806  0.578   1.00 0.00 ? 116 THR A HG22 3  
ATOM 5789  H HG23 . THR A 1 98  ? -3.593  -0.358  2.284   1.00 0.00 ? 116 THR A HG23 3  
ATOM 5790  N N    . TYR A 1 99  ? -5.987  2.710   -0.571  1.00 0.00 ? 117 TYR A N    3  
ATOM 5791  C CA   . TYR A 1 99  ? -5.521  4.023   -1.003  1.00 0.00 ? 117 TYR A CA   3  
ATOM 5792  C C    . TYR A 1 99  ? -5.057  4.855   0.189   1.00 0.00 ? 117 TYR A C    3  
ATOM 5793  O O    . TYR A 1 99  ? -5.576  4.719   1.297   1.00 0.00 ? 117 TYR A O    3  
ATOM 5794  C CB   . TYR A 1 99  ? -6.634  4.762   -1.751  1.00 0.00 ? 117 TYR A CB   3  
ATOM 5795  C CG   . TYR A 1 99  ? -6.982  4.140   -3.085  1.00 0.00 ? 117 TYR A CG   3  
ATOM 5796  C CD1  . TYR A 1 99  ? -5.988  3.800   -3.995  1.00 0.00 ? 117 TYR A CD1  3  
ATOM 5797  C CD2  . TYR A 1 99  ? -8.303  3.895   -3.436  1.00 0.00 ? 117 TYR A CD2  3  
ATOM 5798  C CE1  . TYR A 1 99  ? -6.300  3.233   -5.214  1.00 0.00 ? 117 TYR A CE1  3  
ATOM 5799  C CE2  . TYR A 1 99  ? -8.624  3.328   -4.654  1.00 0.00 ? 117 TYR A CE2  3  
ATOM 5800  C CZ   . TYR A 1 99  ? -7.620  2.999   -5.540  1.00 0.00 ? 117 TYR A CZ   3  
ATOM 5801  O OH   . TYR A 1 99  ? -7.936  2.435   -6.754  1.00 0.00 ? 117 TYR A OH   3  
ATOM 5802  H H    . TYR A 1 99  ? -6.872  2.631   -0.155  1.00 0.00 ? 117 TYR A H    3  
ATOM 5803  H HA   . TYR A 1 99  ? -4.687  3.876   -1.671  1.00 0.00 ? 117 TYR A HA   3  
ATOM 5804  H HB3  . TYR A 1 99  ? -6.322  5.781   -1.930  1.00 0.00 ? 117 TYR A HB3  3  
ATOM 5805  H HD1  . TYR A 1 99  ? -4.954  3.985   -3.738  1.00 0.00 ? 117 TYR A HD1  3  
ATOM 5806  H HD2  . TYR A 1 99  ? -9.088  4.155   -2.741  1.00 0.00 ? 117 TYR A HD2  3  
ATOM 5807  H HE1  . TYR A 1 99  ? -5.513  2.975   -5.909  1.00 0.00 ? 117 TYR A HE1  3  
ATOM 5808  H HE2  . TYR A 1 99  ? -9.658  3.144   -4.909  1.00 0.00 ? 117 TYR A HE2  3  
ATOM 5809  H HH   . TYR A 1 99  ? -7.536  1.564   -6.817  1.00 0.00 ? 117 TYR A HH   3  
ATOM 5810  N N    . CYS A 1 100 ? -4.074  5.718   -0.047  1.00 0.00 ? 118 CYS A N    3  
ATOM 5811  C CA   . CYS A 1 100 ? -3.537  6.572   1.004   1.00 0.00 ? 118 CYS A CA   3  
ATOM 5812  C C    . CYS A 1 100 ? -3.276  7.981   0.479   1.00 0.00 ? 118 CYS A C    3  
ATOM 5813  O O    . CYS A 1 100 ? -3.061  8.179   -0.716  1.00 0.00 ? 118 CYS A O    3  
ATOM 5814  C CB   . CYS A 1 100 ? -2.243  5.976   1.564   1.00 0.00 ? 118 CYS A CB   3  
ATOM 5815  S SG   . CYS A 1 100 ? -2.351  4.202   1.956   1.00 0.00 ? 118 CYS A SG   3  
ATOM 5816  H H    . CYS A 1 100 ? -3.700  5.781   -0.951  1.00 0.00 ? 118 CYS A H    3  
ATOM 5817  H HA   . CYS A 1 100 ? -4.270  6.626   1.795   1.00 0.00 ? 118 CYS A HA   3  
ATOM 5818  H HB3  . CYS A 1 100 ? -1.978  6.499   2.470   1.00 0.00 ? 118 CYS A HB3  3  
ATOM 5819  N N    . PHE A 1 101 ? -3.298  8.956   1.382   1.00 0.00 ? 119 PHE A N    3  
ATOM 5820  C CA   . PHE A 1 101 ? -3.064  10.347  1.010   1.00 0.00 ? 119 PHE A CA   3  
ATOM 5821  C C    . PHE A 1 101 ? -1.852  10.910  1.745   1.00 0.00 ? 119 PHE A C    3  
ATOM 5822  O O    . PHE A 1 101 ? -1.925  11.235  2.929   1.00 0.00 ? 119 PHE A O    3  
ATOM 5823  C CB   . PHE A 1 101 ? -4.300  11.194  1.321   1.00 0.00 ? 119 PHE A CB   3  
ATOM 5824  C CG   . PHE A 1 101 ? -4.078  12.668  1.138   1.00 0.00 ? 119 PHE A CG   3  
ATOM 5825  C CD1  . PHE A 1 101 ? -3.660  13.172  -0.083  1.00 0.00 ? 119 PHE A CD1  3  
ATOM 5826  C CD2  . PHE A 1 101 ? -4.288  13.549  2.186   1.00 0.00 ? 119 PHE A CD2  3  
ATOM 5827  C CE1  . PHE A 1 101 ? -3.455  14.528  -0.253  1.00 0.00 ? 119 PHE A CE1  3  
ATOM 5828  C CE2  . PHE A 1 101 ? -4.083  14.906  2.022   1.00 0.00 ? 119 PHE A CE2  3  
ATOM 5829  C CZ   . PHE A 1 101 ? -3.668  15.397  0.799   1.00 0.00 ? 119 PHE A CZ   3  
ATOM 5830  H H    . PHE A 1 101 ? -3.475  8.734   2.320   1.00 0.00 ? 119 PHE A H    3  
ATOM 5831  H HA   . PHE A 1 101 ? -2.873  10.378  -0.051  1.00 0.00 ? 119 PHE A HA   3  
ATOM 5832  H HB3  . PHE A 1 101 ? -4.594  11.026  2.346   1.00 0.00 ? 119 PHE A HB3  3  
ATOM 5833  H HD1  . PHE A 1 101 ? -3.494  12.496  -0.907  1.00 0.00 ? 119 PHE A HD1  3  
ATOM 5834  H HD2  . PHE A 1 101 ? -4.614  13.166  3.143   1.00 0.00 ? 119 PHE A HD2  3  
ATOM 5835  H HE1  . PHE A 1 101 ? -3.129  14.910  -1.210  1.00 0.00 ? 119 PHE A HE1  3  
ATOM 5836  H HE2  . PHE A 1 101 ? -4.252  15.582  2.848   1.00 0.00 ? 119 PHE A HE2  3  
ATOM 5837  H HZ   . PHE A 1 101 ? -3.507  16.456  0.669   1.00 0.00 ? 119 PHE A HZ   3  
ATOM 5838  N N    . ASN A 1 102 ? -0.734  11.021  1.033   1.00 0.00 ? 120 ASN A N    3  
ATOM 5839  C CA   . ASN A 1 102 ? 0.496   11.543  1.616   1.00 0.00 ? 120 ASN A CA   3  
ATOM 5840  C C    . ASN A 1 102 ? 0.591   13.053  1.425   1.00 0.00 ? 120 ASN A C    3  
ATOM 5841  O O    . ASN A 1 102 ? 1.065   13.530  0.395   1.00 0.00 ? 120 ASN A O    3  
ATOM 5842  C CB   . ASN A 1 102 ? 1.713   10.860  0.988   1.00 0.00 ? 120 ASN A CB   3  
ATOM 5843  C CG   . ASN A 1 102 ? 2.905   10.827  1.924   1.00 0.00 ? 120 ASN A CG   3  
ATOM 5844  O OD1  . ASN A 1 102 ? 3.163   11.787  2.652   1.00 0.00 ? 120 ASN A OD1  3  
ATOM 5845  N ND2  . ASN A 1 102 ? 3.640   9.721   1.908   1.00 0.00 ? 120 ASN A ND2  3  
ATOM 5846  H H    . ASN A 1 102 ? -0.737  10.744  0.093   1.00 0.00 ? 120 ASN A H    3  
ATOM 5847  H HA   . ASN A 1 102 ? 0.479   11.325  2.674   1.00 0.00 ? 120 ASN A HA   3  
ATOM 5848  H HB3  . ASN A 1 102 ? 1.995   11.394  0.093   1.00 0.00 ? 120 ASN A HB3  3  
ATOM 5849  H HD21 . ASN A 1 102 ? 3.374   8.998   1.301   1.00 0.00 ? 120 ASN A HD21 3  
ATOM 5850  H HD22 . ASN A 1 102 ? 4.415   9.673   2.504   1.00 0.00 ? 120 ASN A HD22 3  
ATOM 5851  N N    . ALA A 1 103 ? 0.135   13.800  2.426   1.00 0.00 ? 121 ALA A N    3  
ATOM 5852  C CA   . ALA A 1 103 ? 0.172   15.256  2.370   1.00 0.00 ? 121 ALA A CA   3  
ATOM 5853  C C    . ALA A 1 103 ? 1.603   15.774  2.464   1.00 0.00 ? 121 ALA A C    3  
ATOM 5854  O O    . ALA A 1 103 ? 2.070   16.140  3.541   1.00 0.00 ? 121 ALA A O    3  
ATOM 5855  C CB   . ALA A 1 103 ? -0.681  15.848  3.482   1.00 0.00 ? 121 ALA A CB   3  
ATOM 5856  H H    . ALA A 1 103 ? -0.232  13.361  3.222   1.00 0.00 ? 121 ALA A H    3  
ATOM 5857  H HA   . ALA A 1 103 ? -0.251  15.564  1.424   1.00 0.00 ? 121 ALA A HA   3  
ATOM 5858  H HB1  . ALA A 1 103 ? -0.199  15.676  4.434   1.00 0.00 ? 121 ALA A HB1  3  
ATOM 5859  H HB2  . ALA A 1 103 ? -0.794  16.910  3.323   1.00 0.00 ? 121 ALA A HB2  3  
ATOM 5860  H HB3  . ALA A 1 103 ? -1.652  15.378  3.481   1.00 0.00 ? 121 ALA A HB3  3  
ATOM 5861  N N    . SER A 1 104 ? 2.292   15.802  1.327   1.00 0.00 ? 122 SER A N    3  
ATOM 5862  C CA   . SER A 1 104 ? 3.672   16.270  1.282   1.00 0.00 ? 122 SER A CA   3  
ATOM 5863  C C    . SER A 1 104 ? 4.026   16.784  -0.111  1.00 0.00 ? 122 SER A C    3  
ATOM 5864  O O    . SER A 1 104 ? 4.533   17.896  -0.264  1.00 0.00 ? 122 SER A O    3  
ATOM 5865  C CB   . SER A 1 104 ? 4.629   15.147  1.683   1.00 0.00 ? 122 SER A CB   3  
ATOM 5866  O OG   . SER A 1 104 ? 5.963   15.458  1.318   1.00 0.00 ? 122 SER A OG   3  
ATOM 5867  H H    . SER A 1 104 ? 1.864   15.496  0.500   1.00 0.00 ? 122 SER A H    3  
ATOM 5868  H HA   . SER A 1 104 ? 3.769   17.083  1.989   1.00 0.00 ? 122 SER A HA   3  
ATOM 5869  H HB3  . SER A 1 104 ? 4.336   14.233  1.184   1.00 0.00 ? 122 SER A HB3  3  
ATOM 5870  H HG   . SER A 1 104 ? 6.164   16.359  1.581   1.00 0.00 ? 122 SER A HG   3  
ATOM 5871  N N    . ALA A 1 105 ? 3.757   15.966  -1.121  1.00 0.00 ? 123 ALA A N    3  
ATOM 5872  C CA   . ALA A 1 105 ? 4.045   16.336  -2.502  1.00 0.00 ? 123 ALA A CA   3  
ATOM 5873  C C    . ALA A 1 105 ? 3.040   17.361  -3.016  1.00 0.00 ? 123 ALA A C    3  
ATOM 5874  O O    . ALA A 1 105 ? 1.940   17.511  -2.483  1.00 0.00 ? 123 ALA A O    3  
ATOM 5875  C CB   . ALA A 1 105 ? 4.043   15.101  -3.391  1.00 0.00 ? 123 ALA A CB   3  
ATOM 5876  H H    . ALA A 1 105 ? 3.352   15.092  -0.935  1.00 0.00 ? 123 ALA A H    3  
ATOM 5877  H HA   . ALA A 1 105 ? 5.034   16.770  -2.532  1.00 0.00 ? 123 ALA A HA   3  
ATOM 5878  H HB1  . ALA A 1 105 ? 5.062   14.805  -3.593  1.00 0.00 ? 123 ALA A HB1  3  
ATOM 5879  H HB2  . ALA A 1 105 ? 3.526   14.297  -2.889  1.00 0.00 ? 123 ALA A HB2  3  
ATOM 5880  H HB3  . ALA A 1 105 ? 3.543   15.328  -4.320  1.00 0.00 ? 123 ALA A HB3  3  
ATOM 5881  N N    . PRO A 1 106 ? 3.424   18.087  -4.077  1.00 0.00 ? 124 PRO A N    3  
ATOM 5882  C CA   . PRO A 1 106 ? 2.569   19.111  -4.686  1.00 0.00 ? 124 PRO A CA   3  
ATOM 5883  C C    . PRO A 1 106 ? 1.368   18.511  -5.408  1.00 0.00 ? 124 PRO A C    3  
ATOM 5884  O O    . PRO A 1 106 ? 1.311   17.310  -5.675  1.00 0.00 ? 124 PRO A O    3  
ATOM 5885  C CB   . PRO A 1 106 ? 3.501   19.802  -5.683  1.00 0.00 ? 124 PRO A CB   3  
ATOM 5886  C CG   . PRO A 1 106 ? 4.530   18.776  -6.014  1.00 0.00 ? 124 PRO A CG   3  
ATOM 5887  C CD   . PRO A 1 106 ? 4.719   17.963  -4.764  1.00 0.00 ? 124 PRO A CD   3  
ATOM 5888  H HA   . PRO A 1 106 ? 2.228   19.828  -3.954  1.00 0.00 ? 124 PRO A HA   3  
ATOM 5889  H HB3  . PRO A 1 106 ? 3.945   20.673  -5.224  1.00 0.00 ? 124 PRO A HB3  3  
ATOM 5890  H HG3  . PRO A 1 106 ? 5.456   19.261  -6.288  1.00 0.00 ? 124 PRO A HG3  3  
ATOM 5891  H HD3  . PRO A 1 106 ? 5.516   18.374  -4.161  1.00 0.00 ? 124 PRO A HD3  3  
ATOM 5892  N N    . PRO A 1 107 ? 0.385   19.362  -5.733  1.00 0.00 ? 125 PRO A N    3  
ATOM 5893  C CA   . PRO A 1 107 ? -0.832  18.938  -6.429  1.00 0.00 ? 125 PRO A CA   3  
ATOM 5894  C C    . PRO A 1 107 ? -0.565  18.542  -7.878  1.00 0.00 ? 125 PRO A C    3  
ATOM 5895  O O    . PRO A 1 107 ? -0.827  19.313  -8.800  1.00 0.00 ? 125 PRO A O    3  
ATOM 5896  C CB   . PRO A 1 107 ? -1.725  20.180  -6.372  1.00 0.00 ? 125 PRO A CB   3  
ATOM 5897  C CG   . PRO A 1 107 ? -0.779  21.322  -6.244  1.00 0.00 ? 125 PRO A CG   3  
ATOM 5898  C CD   . PRO A 1 107 ? 0.386   20.806  -5.446  1.00 0.00 ? 125 PRO A CD   3  
ATOM 5899  H HA   . PRO A 1 107 ? -1.317  18.120  -5.918  1.00 0.00 ? 125 PRO A HA   3  
ATOM 5900  H HB3  . PRO A 1 107 ? -2.383  20.116  -5.517  1.00 0.00 ? 125 PRO A HB3  3  
ATOM 5901  H HG3  . PRO A 1 107 ? -1.257  22.140  -5.725  1.00 0.00 ? 125 PRO A HG3  3  
ATOM 5902  H HD3  . PRO A 1 107 ? 0.233   20.990  -4.392  1.00 0.00 ? 125 PRO A HD3  3  
ATOM 5903  N N    . GLU A 1 108 ? -0.040  17.335  -8.069  1.00 0.00 ? 126 GLU A N    3  
ATOM 5904  C CA   . GLU A 1 108 ? 0.265   16.838  -9.404  1.00 0.00 ? 126 GLU A CA   3  
ATOM 5905  C C    . GLU A 1 108 ? 0.654   15.364  -9.362  1.00 0.00 ? 126 GLU A C    3  
ATOM 5906  O O    . GLU A 1 108 ? 0.934   14.817  -8.296  1.00 0.00 ? 126 GLU A O    3  
ATOM 5907  C CB   . GLU A 1 108 ? 1.393   17.657  -10.033 1.00 0.00 ? 126 GLU A CB   3  
ATOM 5908  C CG   . GLU A 1 108 ? 1.515   17.475  -11.537 1.00 0.00 ? 126 GLU A CG   3  
ATOM 5909  C CD   . GLU A 1 108 ? 0.192   17.657  -12.255 1.00 0.00 ? 126 GLU A CD   3  
ATOM 5910  O OE1  . GLU A 1 108 ? -0.274  18.812  -12.355 1.00 0.00 ? 126 GLU A OE1  3  
ATOM 5911  O OE2  . GLU A 1 108 ? -0.378  16.647  -12.716 1.00 0.00 ? 126 GLU A OE2  3  
ATOM 5912  H H    . GLU A 1 108 ? 0.148   16.768  -7.293  1.00 0.00 ? 126 GLU A H    3  
ATOM 5913  H HA   . GLU A 1 108 ? -0.624  16.946  -10.008 1.00 0.00 ? 126 GLU A HA   3  
ATOM 5914  H HB3  . GLU A 1 108 ? 2.329   17.365  -9.580  1.00 0.00 ? 126 GLU A HB3  3  
ATOM 5915  H HG3  . GLU A 1 108 ? 1.882   16.478  -11.737 1.00 0.00 ? 126 GLU A HG3  3  
ATOM 5916  N N    . GLU A 1 109 ? 0.670   14.727  -10.528 1.00 0.00 ? 127 GLU A N    3  
ATOM 5917  C CA   . GLU A 1 109 ? 1.024   13.315  -10.623 1.00 0.00 ? 127 GLU A CA   3  
ATOM 5918  C C    . GLU A 1 109 ? 2.538   13.130  -10.579 1.00 0.00 ? 127 GLU A C    3  
ATOM 5919  O O    . GLU A 1 109 ? 3.156   12.741  -11.573 1.00 0.00 ? 127 GLU A O    3  
ATOM 5920  C CB   . GLU A 1 109 ? 0.462   12.711  -11.911 1.00 0.00 ? 127 GLU A CB   3  
ATOM 5921  C CG   . GLU A 1 109 ? 0.848   13.482  -13.163 1.00 0.00 ? 127 GLU A CG   3  
ATOM 5922  C CD   . GLU A 1 109 ? 0.958   12.591  -14.386 1.00 0.00 ? 127 GLU A CD   3  
ATOM 5923  O OE1  . GLU A 1 109 ? -0.079  12.038  -14.812 1.00 0.00 ? 127 GLU A OE1  3  
ATOM 5924  O OE2  . GLU A 1 109 ? 2.079   12.444  -14.917 1.00 0.00 ? 127 GLU A OE2  3  
ATOM 5925  H H    . GLU A 1 109 ? 0.438   15.218  -11.345 1.00 0.00 ? 127 GLU A H    3  
ATOM 5926  H HA   . GLU A 1 109 ? 0.588   12.807  -9.778  1.00 0.00 ? 127 GLU A HA   3  
ATOM 5927  H HB3  . GLU A 1 109 ? -0.616  12.691  -11.844 1.00 0.00 ? 127 GLU A HB3  3  
ATOM 5928  H HG3  . GLU A 1 109 ? 1.803   13.958  -12.997 1.00 0.00 ? 127 GLU A HG3  3  
ATOM 5929  N N    . ASP A 1 110 ? 3.131   13.413  -9.425  1.00 0.00 ? 128 ASP A N    3  
ATOM 5930  C CA   . ASP A 1 110 ? 4.573   13.278  -9.251  1.00 0.00 ? 128 ASP A CA   3  
ATOM 5931  C C    . ASP A 1 110 ? 4.968   11.811  -9.108  1.00 0.00 ? 128 ASP A C    3  
ATOM 5932  O O    . ASP A 1 110 ? 4.386   11.075  -8.309  1.00 0.00 ? 128 ASP A O    3  
ATOM 5933  C CB   . ASP A 1 110 ? 5.035   14.065  -8.024  1.00 0.00 ? 128 ASP A CB   3  
ATOM 5934  C CG   . ASP A 1 110 ? 6.393   13.611  -7.524  1.00 0.00 ? 128 ASP A CG   3  
ATOM 5935  O OD1  . ASP A 1 110 ? 6.437   12.683  -6.689  1.00 0.00 ? 128 ASP A OD1  3  
ATOM 5936  O OD2  . ASP A 1 110 ? 7.410   14.186  -7.965  1.00 0.00 ? 128 ASP A OD2  3  
ATOM 5937  H H    . ASP A 1 110 ? 2.584   13.719  -8.671  1.00 0.00 ? 128 ASP A H    3  
ATOM 5938  H HA   . ASP A 1 110 ? 5.052   13.683  -10.128 1.00 0.00 ? 128 ASP A HA   3  
ATOM 5939  H HB3  . ASP A 1 110 ? 4.316   13.936  -7.229  1.00 0.00 ? 128 ASP A HB3  3  
ATOM 5940  N N    . CYS A 1 111 ? 5.957   11.393  -9.889  1.00 0.00 ? 129 CYS A N    3  
ATOM 5941  C CA   . CYS A 1 111 ? 6.429   10.013  -9.851  1.00 0.00 ? 129 CYS A CA   3  
ATOM 5942  C C    . CYS A 1 111 ? 7.737   9.908   -9.072  1.00 0.00 ? 129 CYS A C    3  
ATOM 5943  O O    . CYS A 1 111 ? 8.739   9.404   -9.582  1.00 0.00 ? 129 CYS A O    3  
ATOM 5944  C CB   . CYS A 1 111 ? 6.627   9.482   -11.272 1.00 0.00 ? 129 CYS A CB   3  
ATOM 5945  S SG   . CYS A 1 111 ? 5.104   8.845   -12.045 1.00 0.00 ? 129 CYS A SG   3  
ATOM 5946  H H    . CYS A 1 111 ? 6.382   12.026  -10.505 1.00 0.00 ? 129 CYS A H    3  
ATOM 5947  H HA   . CYS A 1 111 ? 5.679   9.419   -9.354  1.00 0.00 ? 129 CYS A HA   3  
ATOM 5948  H HB3  . CYS A 1 111 ? 7.345   8.676   -11.251 1.00 0.00 ? 129 CYS A HB3  3  
ATOM 5949  N N    . THR A 1 112 ? 7.720   10.384  -7.831  1.00 0.00 ? 130 THR A N    3  
ATOM 5950  C CA   . THR A 1 112 ? 8.903   10.344  -6.980  1.00 0.00 ? 130 THR A CA   3  
ATOM 5951  C C    . THR A 1 112 ? 8.526   10.074  -5.527  1.00 0.00 ? 130 THR A C    3  
ATOM 5952  O O    . THR A 1 112 ? 7.350   9.915   -5.200  1.00 0.00 ? 130 THR A O    3  
ATOM 5953  C CB   . THR A 1 112 ? 9.696   11.662  -7.058  1.00 0.00 ? 130 THR A CB   3  
ATOM 5954  O OG1  . THR A 1 112 ? 9.006   12.691  -6.337  1.00 0.00 ? 130 THR A OG1  3  
ATOM 5955  C CG2  . THR A 1 112 ? 9.891   12.092  -8.504  1.00 0.00 ? 130 THR A CG2  3  
ATOM 5956  H H    . THR A 1 112 ? 6.891   10.772  -7.481  1.00 0.00 ? 130 THR A H    3  
ATOM 5957  H HA   . THR A 1 112 ? 9.540   9.545   -7.331  1.00 0.00 ? 130 THR A HA   3  
ATOM 5958  H HB   . THR A 1 112 ? 10.666  11.507  -6.610  1.00 0.00 ? 130 THR A HB   3  
ATOM 5959  H HG1  . THR A 1 112 ? 9.639   13.345  -6.032  1.00 0.00 ? 130 THR A HG1  3  
ATOM 5960  H HG21 . THR A 1 112 ? 10.738  12.756  -8.570  1.00 0.00 ? 130 THR A HG21 3  
ATOM 5961  H HG22 . THR A 1 112 ? 9.004   12.602  -8.850  1.00 0.00 ? 130 THR A HG22 3  
ATOM 5962  H HG23 . THR A 1 112 ? 10.067  11.221  -9.117  1.00 0.00 ? 130 THR A HG23 3  
ATOM 5963  N N    . SER A 1 113 ? 9.532   10.026  -4.660  1.00 0.00 ? 131 SER A N    3  
ATOM 5964  C CA   . SER A 1 113 ? 9.307   9.773   -3.242  1.00 0.00 ? 131 SER A CA   3  
ATOM 5965  C C    . SER A 1 113 ? 9.928   10.874  -2.388  1.00 0.00 ? 131 SER A C    3  
ATOM 5966  O O    . SER A 1 113 ? 11.077  10.768  -1.956  1.00 0.00 ? 131 SER A O    3  
ATOM 5967  C CB   . SER A 1 113 ? 9.889   8.415   -2.845  1.00 0.00 ? 131 SER A CB   3  
ATOM 5968  O OG   . SER A 1 113 ? 11.260  8.326   -3.194  1.00 0.00 ? 131 SER A OG   3  
ATOM 5969  H H    . SER A 1 113 ? 10.448  10.161  -4.983  1.00 0.00 ? 131 SER A H    3  
ATOM 5970  H HA   . SER A 1 113 ? 8.241   9.760   -3.073  1.00 0.00 ? 131 SER A HA   3  
ATOM 5971  H HB3  . SER A 1 113 ? 9.348   7.631   -3.356  1.00 0.00 ? 131 SER A HB3  3  
ATOM 5972  H HG   . SER A 1 113 ? 11.683  7.648   -2.662  1.00 0.00 ? 131 SER A HG   3  
ATOM 5973  N N    . VAL A 1 114 ? 9.161   11.932  -2.148  1.00 0.00 ? 132 VAL A N    3  
ATOM 5974  C CA   . VAL A 1 114 ? 9.634   13.054  -1.346  1.00 0.00 ? 132 VAL A CA   3  
ATOM 5975  C C    . VAL A 1 114 ? 9.213   12.903  0.112   1.00 0.00 ? 132 VAL A C    3  
ATOM 5976  O O    . VAL A 1 114 ? 9.153   13.881  0.858   1.00 0.00 ? 132 VAL A O    3  
ATOM 5977  C CB   . VAL A 1 114 ? 9.102   14.395  -1.885  1.00 0.00 ? 132 VAL A CB   3  
ATOM 5978  C CG1  . VAL A 1 114 ? 9.721   14.710  -3.238  1.00 0.00 ? 132 VAL A CG1  3  
ATOM 5979  C CG2  . VAL A 1 114 ? 7.584   14.366  -1.979  1.00 0.00 ? 132 VAL A CG2  3  
ATOM 5980  H H    . VAL A 1 114 ? 8.254   11.959  -2.520  1.00 0.00 ? 132 VAL A H    3  
ATOM 5981  H HA   . VAL A 1 114 ? 10.713  13.072  -1.399  1.00 0.00 ? 132 VAL A HA   3  
ATOM 5982  H HB   . VAL A 1 114 ? 9.384   15.175  -1.195  1.00 0.00 ? 132 VAL A HB   3  
ATOM 5983  H HG11 . VAL A 1 114 ? 10.797  14.732  -3.145  1.00 0.00 ? 132 VAL A HG11 3  
ATOM 5984  H HG12 . VAL A 1 114 ? 9.437   13.949  -3.951  1.00 0.00 ? 132 VAL A HG12 3  
ATOM 5985  H HG13 . VAL A 1 114 ? 9.371   15.673  -3.581  1.00 0.00 ? 132 VAL A HG13 3  
ATOM 5986  H HG21 . VAL A 1 114 ? 7.190   13.701  -1.226  1.00 0.00 ? 132 VAL A HG21 3  
ATOM 5987  H HG22 . VAL A 1 114 ? 7.193   15.361  -1.819  1.00 0.00 ? 132 VAL A HG22 3  
ATOM 5988  H HG23 . VAL A 1 114 ? 7.289   14.019  -2.957  1.00 0.00 ? 132 VAL A HG23 3  
ATOM 5989  N N    . THR A 1 115 ? 8.923   11.669  0.513   1.00 0.00 ? 133 THR A N    3  
ATOM 5990  C CA   . THR A 1 115 ? 8.507   11.389  1.881   1.00 0.00 ? 133 THR A CA   3  
ATOM 5991  C C    . THR A 1 115 ? 9.219   10.158  2.432   1.00 0.00 ? 133 THR A C    3  
ATOM 5992  O O    . THR A 1 115 ? 10.020  9.531   1.738   1.00 0.00 ? 133 THR A O    3  
ATOM 5993  C CB   . THR A 1 115 ? 6.985   11.171  1.973   1.00 0.00 ? 133 THR A CB   3  
ATOM 5994  O OG1  . THR A 1 115 ? 6.623   9.959   1.302   1.00 0.00 ? 133 THR A OG1  3  
ATOM 5995  C CG2  . THR A 1 115 ? 6.232   12.342  1.359   1.00 0.00 ? 133 THR A CG2  3  
ATOM 5996  H H    . THR A 1 115 ? 8.990   10.931  -0.127  1.00 0.00 ? 133 THR A H    3  
ATOM 5997  H HA   . THR A 1 115 ? 8.765   12.243  2.490   1.00 0.00 ? 133 THR A HA   3  
ATOM 5998  H HB   . THR A 1 115 ? 6.710   11.093  3.016   1.00 0.00 ? 133 THR A HB   3  
ATOM 5999  H HG1  . THR A 1 115 ? 6.246   9.344   1.935   1.00 0.00 ? 133 THR A HG1  3  
ATOM 6000  H HG21 . THR A 1 115 ? 5.437   12.647  2.021   1.00 0.00 ? 133 THR A HG21 3  
ATOM 6001  H HG22 . THR A 1 115 ? 5.816   12.043  0.409   1.00 0.00 ? 133 THR A HG22 3  
ATOM 6002  H HG23 . THR A 1 115 ? 6.913   13.167  1.210   1.00 0.00 ? 133 THR A HG23 3  
ATOM 6003  N N    . ASP A 1 116 ? 8.921   9.817   3.680   1.00 0.00 ? 134 ASP A N    3  
ATOM 6004  C CA   . ASP A 1 116 ? 9.532   8.658   4.323   1.00 0.00 ? 134 ASP A CA   3  
ATOM 6005  C C    . ASP A 1 116 ? 8.658   8.147   5.464   1.00 0.00 ? 134 ASP A C    3  
ATOM 6006  O O    . ASP A 1 116 ? 8.168   8.926   6.282   1.00 0.00 ? 134 ASP A O    3  
ATOM 6007  C CB   . ASP A 1 116 ? 10.923  9.015   4.849   1.00 0.00 ? 134 ASP A CB   3  
ATOM 6008  C CG   . ASP A 1 116 ? 10.948  10.355  5.560   1.00 0.00 ? 134 ASP A CG   3  
ATOM 6009  O OD1  . ASP A 1 116 ? 11.018  11.392  4.867   1.00 0.00 ? 134 ASP A OD1  3  
ATOM 6010  O OD2  . ASP A 1 116 ? 10.893  10.365  6.807   1.00 0.00 ? 134 ASP A OD2  3  
ATOM 6011  H H    . ASP A 1 116 ? 8.275   10.357  4.183   1.00 0.00 ? 134 ASP A H    3  
ATOM 6012  H HA   . ASP A 1 116 ? 9.627   7.880   3.582   1.00 0.00 ? 134 ASP A HA   3  
ATOM 6013  H HB3  . ASP A 1 116 ? 11.615  9.055   4.021   1.00 0.00 ? 134 ASP A HB3  3  
ATOM 6014  N N    . LEU A 1 117 ? 8.466   6.833   5.511   1.00 0.00 ? 135 LEU A N    3  
ATOM 6015  C CA   . LEU A 1 117 ? 7.650   6.216   6.551   1.00 0.00 ? 135 LEU A CA   3  
ATOM 6016  C C    . LEU A 1 117 ? 8.075   6.699   7.934   1.00 0.00 ? 135 LEU A C    3  
ATOM 6017  O O    . LEU A 1 117 ? 9.260   6.878   8.221   1.00 0.00 ? 135 LEU A O    3  
ATOM 6018  C CB   . LEU A 1 117 ? 7.759   4.693   6.475   1.00 0.00 ? 135 LEU A CB   3  
ATOM 6019  C CG   . LEU A 1 117 ? 9.168   4.127   6.295   1.00 0.00 ? 135 LEU A CG   3  
ATOM 6020  C CD1  . LEU A 1 117 ? 9.850   3.954   7.643   1.00 0.00 ? 135 LEU A CD1  3  
ATOM 6021  C CD2  . LEU A 1 117 ? 9.119   2.805   5.544   1.00 0.00 ? 135 LEU A CD2  3  
ATOM 6022  H H    . LEU A 1 117 ? 8.882   6.264   4.832   1.00 0.00 ? 135 LEU A H    3  
ATOM 6023  H HA   . LEU A 1 117 ? 6.624   6.505   6.382   1.00 0.00 ? 135 LEU A HA   3  
ATOM 6024  H HB3  . LEU A 1 117 ? 7.158   4.361   5.639   1.00 0.00 ? 135 LEU A HB3  3  
ATOM 6025  H HG   . LEU A 1 117 ? 9.756   4.822   5.711   1.00 0.00 ? 135 LEU A HG   3  
ATOM 6026  H HD11 . LEU A 1 117 ? 9.781   2.921   7.950   1.00 0.00 ? 135 LEU A HD11 3  
ATOM 6027  H HD12 . LEU A 1 117 ? 9.364   4.580   8.376   1.00 0.00 ? 135 LEU A HD12 3  
ATOM 6028  H HD13 . LEU A 1 117 ? 10.888  4.237   7.559   1.00 0.00 ? 135 LEU A HD13 3  
ATOM 6029  H HD21 . LEU A 1 117 ? 8.091   2.544   5.340   1.00 0.00 ? 135 LEU A HD21 3  
ATOM 6030  H HD22 . LEU A 1 117 ? 9.572   2.031   6.149   1.00 0.00 ? 135 LEU A HD22 3  
ATOM 6031  H HD23 . LEU A 1 117 ? 9.660   2.898   4.615   1.00 0.00 ? 135 LEU A HD23 3  
ATOM 6032  N N    . PRO A 1 118 ? 7.088   6.913   8.817   1.00 0.00 ? 136 PRO A N    3  
ATOM 6033  C CA   . PRO A 1 118 ? 7.335   7.374   10.185  1.00 0.00 ? 136 PRO A CA   3  
ATOM 6034  C C    . PRO A 1 118 ? 8.004   6.307   11.046  1.00 0.00 ? 136 PRO A C    3  
ATOM 6035  O O    . PRO A 1 118 ? 8.996   6.574   11.722  1.00 0.00 ? 136 PRO A O    3  
ATOM 6036  C CB   . PRO A 1 118 ? 5.932   7.685   10.714  1.00 0.00 ? 136 PRO A CB   3  
ATOM 6037  C CG   . PRO A 1 118 ? 5.023   6.823   9.907   1.00 0.00 ? 136 PRO A CG   3  
ATOM 6038  C CD   . PRO A 1 118 ? 5.653   6.720   8.545   1.00 0.00 ? 136 PRO A CD   3  
ATOM 6039  H HA   . PRO A 1 118 ? 7.934   8.274   10.199  1.00 0.00 ? 136 PRO A HA   3  
ATOM 6040  H HB3  . PRO A 1 118 ? 5.713   8.733   10.571  1.00 0.00 ? 136 PRO A HB3  3  
ATOM 6041  H HG3  . PRO A 1 118 ? 4.050   7.284   9.835   1.00 0.00 ? 136 PRO A HG3  3  
ATOM 6042  H HD3  . PRO A 1 118 ? 5.277   7.496   7.896   1.00 0.00 ? 136 PRO A HD3  3  
ATOM 6043  N N    . ASN A 1 119 ? 7.454   5.098   11.013  1.00 0.00 ? 137 ASN A N    3  
ATOM 6044  C CA   . ASN A 1 119 ? 7.998   3.990   11.790  1.00 0.00 ? 137 ASN A CA   3  
ATOM 6045  C C    . ASN A 1 119 ? 7.691   2.653   11.121  1.00 0.00 ? 137 ASN A C    3  
ATOM 6046  O O    . ASN A 1 119 ? 6.756   1.953   11.510  1.00 0.00 ? 137 ASN A O    3  
ATOM 6047  C CB   . ASN A 1 119 ? 7.428   4.006   13.209  1.00 0.00 ? 137 ASN A CB   3  
ATOM 6048  C CG   . ASN A 1 119 ? 7.635   5.339   13.900  1.00 0.00 ? 137 ASN A CG   3  
ATOM 6049  O OD1  . ASN A 1 119 ? 6.747   6.193   13.906  1.00 0.00 ? 137 ASN A OD1  3  
ATOM 6050  N ND2  . ASN A 1 119 ? 8.812   5.526   14.487  1.00 0.00 ? 137 ASN A ND2  3  
ATOM 6051  H H    . ASN A 1 119 ? 6.664   4.946   10.454  1.00 0.00 ? 137 ASN A H    3  
ATOM 6052  H HA   . ASN A 1 119 ? 9.071   4.115   11.841  1.00 0.00 ? 137 ASN A HA   3  
ATOM 6053  H HB3  . ASN A 1 119 ? 7.912   3.239   13.794  1.00 0.00 ? 137 ASN A HB3  3  
ATOM 6054  H HD21 . ASN A 1 119 ? 9.472   4.803   14.441  1.00 0.00 ? 137 ASN A HD21 3  
ATOM 6055  H HD22 . ASN A 1 119 ? 8.973   6.379   14.941  1.00 0.00 ? 137 ASN A HD22 3  
ATOM 6056  N N    . ALA A 1 120 ? 8.484   2.306   10.113  1.00 0.00 ? 138 ALA A N    3  
ATOM 6057  C CA   . ALA A 1 120 ? 8.299   1.053   9.392   1.00 0.00 ? 138 ALA A CA   3  
ATOM 6058  C C    . ALA A 1 120 ? 9.605   0.269   9.308   1.00 0.00 ? 138 ALA A C    3  
ATOM 6059  O O    . ALA A 1 120 ? 9.772   -0.586  8.438   1.00 0.00 ? 138 ALA A O    3  
ATOM 6060  C CB   . ALA A 1 120 ? 7.752   1.322   7.997   1.00 0.00 ? 138 ALA A CB   3  
ATOM 6061  H H    . ALA A 1 120 ? 9.212   2.905   9.850   1.00 0.00 ? 138 ALA A H    3  
ATOM 6062  H HA   . ALA A 1 120 ? 7.571   0.463   9.930   1.00 0.00 ? 138 ALA A HA   3  
ATOM 6063  H HB1  . ALA A 1 120 ? 6.736   0.961   7.935   1.00 0.00 ? 138 ALA A HB1  3  
ATOM 6064  H HB2  . ALA A 1 120 ? 7.771   2.383   7.803   1.00 0.00 ? 138 ALA A HB2  3  
ATOM 6065  H HB3  . ALA A 1 120 ? 8.362   0.811   7.267   1.00 0.00 ? 138 ALA A HB3  3  
ATOM 6066  N N    . PHE A 1 121 ? 10.526  0.565   10.218  1.00 0.00 ? 139 PHE A N    3  
ATOM 6067  C CA   . PHE A 1 121 ? 11.818  -0.111  10.246  1.00 0.00 ? 139 PHE A CA   3  
ATOM 6068  C C    . PHE A 1 121 ? 11.981  -0.918  11.530  1.00 0.00 ? 139 PHE A C    3  
ATOM 6069  O O    . PHE A 1 121 ? 13.086  -1.049  12.058  1.00 0.00 ? 139 PHE A O    3  
ATOM 6070  C CB   . PHE A 1 121 ? 12.953  0.908   10.122  1.00 0.00 ? 139 PHE A CB   3  
ATOM 6071  C CG   . PHE A 1 121 ? 14.242  0.311   9.631   1.00 0.00 ? 139 PHE A CG   3  
ATOM 6072  C CD1  . PHE A 1 121 ? 14.269  -0.463  8.483   1.00 0.00 ? 139 PHE A CD1  3  
ATOM 6073  C CD2  . PHE A 1 121 ? 15.426  0.527   10.317  1.00 0.00 ? 139 PHE A CD2  3  
ATOM 6074  C CE1  . PHE A 1 121 ? 15.454  -1.012  8.030   1.00 0.00 ? 139 PHE A CE1  3  
ATOM 6075  C CE2  . PHE A 1 121 ? 16.613  -0.019  9.870   1.00 0.00 ? 139 PHE A CE2  3  
ATOM 6076  C CZ   . PHE A 1 121 ? 16.627  -0.789  8.723   1.00 0.00 ? 139 PHE A CZ   3  
ATOM 6077  H H    . PHE A 1 121 ? 10.333  1.257   10.886  1.00 0.00 ? 139 PHE A H    3  
ATOM 6078  H HA   . PHE A 1 121 ? 11.856  -0.785  9.404   1.00 0.00 ? 139 PHE A HA   3  
ATOM 6079  H HB3  . PHE A 1 121 ? 13.137  1.349   11.089  1.00 0.00 ? 139 PHE A HB3  3  
ATOM 6080  H HD1  . PHE A 1 121 ? 13.353  -0.637  7.939   1.00 0.00 ? 139 PHE A HD1  3  
ATOM 6081  H HD2  . PHE A 1 121 ? 15.416  1.130   11.215  1.00 0.00 ? 139 PHE A HD2  3  
ATOM 6082  H HE1  . PHE A 1 121 ? 15.462  -1.614  7.132   1.00 0.00 ? 139 PHE A HE1  3  
ATOM 6083  H HE2  . PHE A 1 121 ? 17.530  0.157   10.414  1.00 0.00 ? 139 PHE A HE2  3  
ATOM 6084  H HZ   . PHE A 1 121 ? 17.554  -1.219  8.371   1.00 0.00 ? 139 PHE A HZ   3  
ATOM 6085  N N    . ASP A 1 122 ? 10.875  -1.456  12.029  1.00 0.00 ? 140 ASP A N    3  
ATOM 6086  C CA   . ASP A 1 122 ? 10.894  -2.251  13.252  1.00 0.00 ? 140 ASP A CA   3  
ATOM 6087  C C    . ASP A 1 122 ? 10.600  -3.717  12.951  1.00 0.00 ? 140 ASP A C    3  
ATOM 6088  O O    . ASP A 1 122 ? 11.409  -4.596  13.248  1.00 0.00 ? 140 ASP A O    3  
ATOM 6089  C CB   . ASP A 1 122 ? 9.872   -1.709  14.253  1.00 0.00 ? 140 ASP A CB   3  
ATOM 6090  C CG   . ASP A 1 122 ? 10.453  -0.629  15.145  1.00 0.00 ? 140 ASP A CG   3  
ATOM 6091  O OD1  . ASP A 1 122 ? 11.651  -0.724  15.489  1.00 0.00 ? 140 ASP A OD1  3  
ATOM 6092  O OD2  . ASP A 1 122 ? 9.712   0.310   15.501  1.00 0.00 ? 140 ASP A OD2  3  
ATOM 6093  H H    . ASP A 1 122 ? 10.023  -1.315  11.563  1.00 0.00 ? 140 ASP A H    3  
ATOM 6094  H HA   . ASP A 1 122 ? 11.881  -2.175  13.681  1.00 0.00 ? 140 ASP A HA   3  
ATOM 6095  H HB3  . ASP A 1 122 ? 9.526   -2.519  14.878  1.00 0.00 ? 140 ASP A HB3  3  
ATOM 6096  N N    . GLY A 1 123 ? 9.438   -3.975  12.359  1.00 0.00 ? 141 GLY A N    3  
ATOM 6097  C CA   . GLY A 1 123 ? 9.059   -5.336  12.030  1.00 0.00 ? 141 GLY A CA   3  
ATOM 6098  C C    . GLY A 1 123 ? 9.540   -5.754  10.654  1.00 0.00 ? 141 GLY A C    3  
ATOM 6099  O O    . GLY A 1 123 ? 9.944   -4.927  9.836   1.00 0.00 ? 141 GLY A O    3  
ATOM 6100  H H    . GLY A 1 123 ? 8.833   -3.234  12.145  1.00 0.00 ? 141 GLY A H    3  
ATOM 6101  H HA2  . GLY A 1 123 ? 9.479   -6.004  12.765  1.00 0.00 ? 141 GLY A HA2  3  
ATOM 6102  H HA3  . GLY A 1 123 ? 7.981   -5.415  12.061  1.00 0.00 ? 141 GLY A HA3  3  
ATOM 6103  N N    . PRO A 1 124 ? 9.501   -7.068  10.385  1.00 0.00 ? 142 PRO A N    3  
ATOM 6104  C CA   . PRO A 1 124 ? 9.934   -7.625  9.099   1.00 0.00 ? 142 PRO A CA   3  
ATOM 6105  C C    . PRO A 1 124 ? 8.985   -7.263  7.962   1.00 0.00 ? 142 PRO A C    3  
ATOM 6106  O O    . PRO A 1 124 ? 8.133   -8.063  7.574   1.00 0.00 ? 142 PRO A O    3  
ATOM 6107  C CB   . PRO A 1 124 ? 9.923   -9.135  9.346   1.00 0.00 ? 142 PRO A CB   3  
ATOM 6108  C CG   . PRO A 1 124 ? 8.935   -9.334  10.443  1.00 0.00 ? 142 PRO A CG   3  
ATOM 6109  C CD   . PRO A 1 124 ? 9.032   -8.110  11.313  1.00 0.00 ? 142 PRO A CD   3  
ATOM 6110  H HA   . PRO A 1 124 ? 10.935  -7.308  8.846   1.00 0.00 ? 142 PRO A HA   3  
ATOM 6111  H HB3  . PRO A 1 124 ? 10.908  -9.464  9.639   1.00 0.00 ? 142 PRO A HB3  3  
ATOM 6112  H HG3  . PRO A 1 124 ? 9.189   -10.216 11.009  1.00 0.00 ? 142 PRO A HG3  3  
ATOM 6113  H HD3  . PRO A 1 124 ? 9.746   -8.267  12.108  1.00 0.00 ? 142 PRO A HD3  3  
ATOM 6114  N N    . ILE A 1 125 ? 9.139   -6.055  7.431   1.00 0.00 ? 143 ILE A N    3  
ATOM 6115  C CA   . ILE A 1 125 ? 8.296   -5.590  6.337   1.00 0.00 ? 143 ILE A CA   3  
ATOM 6116  C C    . ILE A 1 125 ? 9.082   -4.703  5.377   1.00 0.00 ? 143 ILE A C    3  
ATOM 6117  O O    . ILE A 1 125 ? 9.435   -3.571  5.708   1.00 0.00 ? 143 ILE A O    3  
ATOM 6118  C CB   . ILE A 1 125 ? 7.076   -4.807  6.859   1.00 0.00 ? 143 ILE A CB   3  
ATOM 6119  C CG1  . ILE A 1 125 ? 6.370   -5.598  7.962   1.00 0.00 ? 143 ILE A CG1  3  
ATOM 6120  C CG2  . ILE A 1 125 ? 6.114   -4.504  5.720   1.00 0.00 ? 143 ILE A CG2  3  
ATOM 6121  C CD1  . ILE A 1 125 ? 5.199   -4.865  8.577   1.00 0.00 ? 143 ILE A CD1  3  
ATOM 6122  H H    . ILE A 1 125 ? 9.835   -5.463  7.783   1.00 0.00 ? 143 ILE A H    3  
ATOM 6123  H HA   . ILE A 1 125 ? 7.940   -6.456  5.799   1.00 0.00 ? 143 ILE A HA   3  
ATOM 6124  H HB   . ILE A 1 125 ? 7.425   -3.870  7.264   1.00 0.00 ? 143 ILE A HB   3  
ATOM 6125  H HG13 . ILE A 1 125 ? 7.078   -5.813  8.750   1.00 0.00 ? 143 ILE A HG13 3  
ATOM 6126  H HG21 . ILE A 1 125 ? 5.259   -3.966  6.104   1.00 0.00 ? 143 ILE A HG21 3  
ATOM 6127  H HG22 . ILE A 1 125 ? 6.614   -3.900  4.978   1.00 0.00 ? 143 ILE A HG22 3  
ATOM 6128  H HG23 . ILE A 1 125 ? 5.785   -5.428  5.269   1.00 0.00 ? 143 ILE A HG23 3  
ATOM 6129  H HD11 . ILE A 1 125 ? 5.159   -5.071  9.636   1.00 0.00 ? 143 ILE A HD11 3  
ATOM 6130  H HD12 . ILE A 1 125 ? 5.317   -3.803  8.420   1.00 0.00 ? 143 ILE A HD12 3  
ATOM 6131  H HD13 . ILE A 1 125 ? 4.282   -5.196  8.112   1.00 0.00 ? 143 ILE A HD13 3  
ATOM 6132  N N    . THR A 1 126 ? 9.350   -5.224  4.184   1.00 0.00 ? 144 THR A N    3  
ATOM 6133  C CA   . THR A 1 126 ? 10.093  -4.480  3.174   1.00 0.00 ? 144 THR A CA   3  
ATOM 6134  C C    . THR A 1 126 ? 9.150   -3.772  2.208   1.00 0.00 ? 144 THR A C    3  
ATOM 6135  O O    . THR A 1 126 ? 8.062   -4.268  1.914   1.00 0.00 ? 144 THR A O    3  
ATOM 6136  C CB   . THR A 1 126 ? 11.033  -5.402  2.375   1.00 0.00 ? 144 THR A CB   3  
ATOM 6137  O OG1  . THR A 1 126 ? 11.773  -6.240  3.268   1.00 0.00 ? 144 THR A OG1  3  
ATOM 6138  C CG2  . THR A 1 126 ? 11.993  -4.588  1.522   1.00 0.00 ? 144 THR A CG2  3  
ATOM 6139  H H    . THR A 1 126 ? 9.042   -6.131  3.979   1.00 0.00 ? 144 THR A H    3  
ATOM 6140  H HA   . THR A 1 126 ? 10.695  -3.740  3.682   1.00 0.00 ? 144 THR A HA   3  
ATOM 6141  H HB   . THR A 1 126 ? 10.433  -6.023  1.723   1.00 0.00 ? 144 THR A HB   3  
ATOM 6142  H HG1  . THR A 1 126 ? 12.376  -5.702  3.786   1.00 0.00 ? 144 THR A HG1  3  
ATOM 6143  H HG21 . THR A 1 126 ? 11.533  -4.372  0.567   1.00 0.00 ? 144 THR A HG21 3  
ATOM 6144  H HG22 . THR A 1 126 ? 12.901  -5.151  1.365   1.00 0.00 ? 144 THR A HG22 3  
ATOM 6145  H HG23 . THR A 1 126 ? 12.227  -3.662  2.025   1.00 0.00 ? 144 THR A HG23 3  
ATOM 6146  N N    . ILE A 1 127 ? 9.576   -2.612  1.718   1.00 0.00 ? 145 ILE A N    3  
ATOM 6147  C CA   . ILE A 1 127 ? 8.769   -1.838  0.782   1.00 0.00 ? 145 ILE A CA   3  
ATOM 6148  C C    . ILE A 1 127 ? 9.571   -1.471  -0.462  1.00 0.00 ? 145 ILE A C    3  
ATOM 6149  O O    . ILE A 1 127 ? 10.780  -1.252  -0.394  1.00 0.00 ? 145 ILE A O    3  
ATOM 6150  C CB   . ILE A 1 127 ? 8.234   -0.549  1.433   1.00 0.00 ? 145 ILE A CB   3  
ATOM 6151  C CG1  . ILE A 1 127 ? 9.395   0.365   1.834   1.00 0.00 ? 145 ILE A CG1  3  
ATOM 6152  C CG2  . ILE A 1 127 ? 7.375   -0.884  2.644   1.00 0.00 ? 145 ILE A CG2  3  
ATOM 6153  C CD1  . ILE A 1 127 ? 9.445   1.658   1.048   1.00 0.00 ? 145 ILE A CD1  3  
ATOM 6154  H H    . ILE A 1 127 ? 10.451  -2.270  1.989   1.00 0.00 ? 145 ILE A H    3  
ATOM 6155  H HA   . ILE A 1 127 ? 7.924   -2.445  0.488   1.00 0.00 ? 145 ILE A HA   3  
ATOM 6156  H HB   . ILE A 1 127 ? 7.615   -0.037  0.713   1.00 0.00 ? 145 ILE A HB   3  
ATOM 6157  H HG13 . ILE A 1 127 ? 10.327  -0.158  1.673   1.00 0.00 ? 145 ILE A HG13 3  
ATOM 6158  H HG21 . ILE A 1 127 ? 6.501   -1.429  2.324   1.00 0.00 ? 145 ILE A HG21 3  
ATOM 6159  H HG22 . ILE A 1 127 ? 7.944   -1.489  3.332   1.00 0.00 ? 145 ILE A HG22 3  
ATOM 6160  H HG23 . ILE A 1 127 ? 7.071   0.030   3.133   1.00 0.00 ? 145 ILE A HG23 3  
ATOM 6161  H HD11 . ILE A 1 127 ? 9.297   2.492   1.718   1.00 0.00 ? 145 ILE A HD11 3  
ATOM 6162  H HD12 . ILE A 1 127 ? 10.404  1.748   0.563   1.00 0.00 ? 145 ILE A HD12 3  
ATOM 6163  H HD13 . ILE A 1 127 ? 8.663   1.655   0.301   1.00 0.00 ? 145 ILE A HD13 3  
ATOM 6164  N N    . THR A 1 128 ? 8.886   -1.404  -1.601  1.00 0.00 ? 146 THR A N    3  
ATOM 6165  C CA   . THR A 1 128 ? 9.534   -1.062  -2.862  1.00 0.00 ? 146 THR A CA   3  
ATOM 6166  C C    . THR A 1 128 ? 8.879   0.156   -3.504  1.00 0.00 ? 146 THR A C    3  
ATOM 6167  O O    . THR A 1 128 ? 7.942   0.024   -4.291  1.00 0.00 ? 146 THR A O    3  
ATOM 6168  C CB   . THR A 1 128 ? 9.488   -2.240  -3.853  1.00 0.00 ? 146 THR A CB   3  
ATOM 6169  O OG1  . THR A 1 128 ? 8.127   -2.565  -4.164  1.00 0.00 ? 146 THR A OG1  3  
ATOM 6170  C CG2  . THR A 1 128 ? 10.188  -3.461  -3.277  1.00 0.00 ? 146 THR A CG2  3  
ATOM 6171  H H    . THR A 1 128 ? 7.925   -1.588  -1.591  1.00 0.00 ? 146 THR A H    3  
ATOM 6172  H HA   . THR A 1 128 ? 10.569  -0.834  -2.653  1.00 0.00 ? 146 THR A HA   3  
ATOM 6173  H HB   . THR A 1 128 ? 9.996   -1.947  -4.761  1.00 0.00 ? 146 THR A HB   3  
ATOM 6174  H HG1  . THR A 1 128 ? 8.108   -3.238  -4.848  1.00 0.00 ? 146 THR A HG1  3  
ATOM 6175  H HG21 . THR A 1 128 ? 9.462   -4.242  -3.101  1.00 0.00 ? 146 THR A HG21 3  
ATOM 6176  H HG22 . THR A 1 128 ? 10.664  -3.196  -2.345  1.00 0.00 ? 146 THR A HG22 3  
ATOM 6177  H HG23 . THR A 1 128 ? 10.931  -3.812  -3.976  1.00 0.00 ? 146 THR A HG23 3  
ATOM 6178  N N    . ILE A 1 129 ? 9.378   1.339   -3.163  1.00 0.00 ? 147 ILE A N    3  
ATOM 6179  C CA   . ILE A 1 129 ? 8.842   2.580   -3.708  1.00 0.00 ? 147 ILE A CA   3  
ATOM 6180  C C    . ILE A 1 129 ? 9.500   2.924   -5.039  1.00 0.00 ? 147 ILE A C    3  
ATOM 6181  O O    . ILE A 1 129 ? 10.634  2.526   -5.305  1.00 0.00 ? 147 ILE A O    3  
ATOM 6182  C CB   . ILE A 1 129 ? 9.035   3.754   -2.731  1.00 0.00 ? 147 ILE A CB   3  
ATOM 6183  C CG1  . ILE A 1 129 ? 8.219   4.966   -3.188  1.00 0.00 ? 147 ILE A CG1  3  
ATOM 6184  C CG2  . ILE A 1 129 ? 10.509  4.113   -2.621  1.00 0.00 ? 147 ILE A CG2  3  
ATOM 6185  C CD1  . ILE A 1 129 ? 7.722   5.824   -2.046  1.00 0.00 ? 147 ILE A CD1  3  
ATOM 6186  H H    . ILE A 1 129 ? 10.124  1.378   -2.530  1.00 0.00 ? 147 ILE A H    3  
ATOM 6187  H HA   . ILE A 1 129 ? 7.781   2.441   -3.868  1.00 0.00 ? 147 ILE A HA   3  
ATOM 6188  H HB   . ILE A 1 129 ? 8.690   3.444   -1.757  1.00 0.00 ? 147 ILE A HB   3  
ATOM 6189  H HG13 . ILE A 1 129 ? 7.359   4.621   -3.744  1.00 0.00 ? 147 ILE A HG13 3  
ATOM 6190  H HG21 . ILE A 1 129 ? 11.106  3.308   -3.023  1.00 0.00 ? 147 ILE A HG21 3  
ATOM 6191  H HG22 . ILE A 1 129 ? 10.702  5.016   -3.180  1.00 0.00 ? 147 ILE A HG22 3  
ATOM 6192  H HG23 . ILE A 1 129 ? 10.766  4.269   -1.583  1.00 0.00 ? 147 ILE A HG23 3  
ATOM 6193  H HD11 . ILE A 1 129 ? 8.541   6.406   -1.649  1.00 0.00 ? 147 ILE A HD11 3  
ATOM 6194  H HD12 . ILE A 1 129 ? 6.948   6.486   -2.404  1.00 0.00 ? 147 ILE A HD12 3  
ATOM 6195  H HD13 . ILE A 1 129 ? 7.321   5.191   -1.268  1.00 0.00 ? 147 ILE A HD13 3  
ATOM 6196  N N    . VAL A 1 130 ? 8.783   3.672   -5.872  1.00 0.00 ? 148 VAL A N    3  
ATOM 6197  C CA   . VAL A 1 130 ? 9.298   4.075   -7.174  1.00 0.00 ? 148 VAL A CA   3  
ATOM 6198  C C    . VAL A 1 130 ? 10.252  5.258   -7.047  1.00 0.00 ? 148 VAL A C    3  
ATOM 6199  O O    . VAL A 1 130 ? 9.908   6.284   -6.463  1.00 0.00 ? 148 VAL A O    3  
ATOM 6200  C CB   . VAL A 1 130 ? 8.158   4.450   -8.139  1.00 0.00 ? 148 VAL A CB   3  
ATOM 6201  C CG1  . VAL A 1 130 ? 7.345   3.219   -8.509  1.00 0.00 ? 148 VAL A CG1  3  
ATOM 6202  C CG2  . VAL A 1 130 ? 7.269   5.520   -7.520  1.00 0.00 ? 148 VAL A CG2  3  
ATOM 6203  H H    . VAL A 1 130 ? 7.885   3.959   -5.604  1.00 0.00 ? 148 VAL A H    3  
ATOM 6204  H HA   . VAL A 1 130 ? 9.835   3.236   -7.595  1.00 0.00 ? 148 VAL A HA   3  
ATOM 6205  H HB   . VAL A 1 130 ? 8.594   4.852   -9.041  1.00 0.00 ? 148 VAL A HB   3  
ATOM 6206  H HG11 . VAL A 1 130 ? 6.967   2.754   -7.612  1.00 0.00 ? 148 VAL A HG11 3  
ATOM 6207  H HG12 . VAL A 1 130 ? 6.518   3.511   -9.141  1.00 0.00 ? 148 VAL A HG12 3  
ATOM 6208  H HG13 . VAL A 1 130 ? 7.973   2.519   -9.040  1.00 0.00 ? 148 VAL A HG13 3  
ATOM 6209  H HG21 . VAL A 1 130 ? 6.252   5.160   -7.474  1.00 0.00 ? 148 VAL A HG21 3  
ATOM 6210  H HG22 . VAL A 1 130 ? 7.617   5.745   -6.522  1.00 0.00 ? 148 VAL A HG22 3  
ATOM 6211  H HG23 . VAL A 1 130 ? 7.308   6.414   -8.126  1.00 0.00 ? 148 VAL A HG23 3  
ATOM 6212  N N    . ASN A 1 131 ? 11.452  5.106   -7.597  1.00 0.00 ? 149 ASN A N    3  
ATOM 6213  C CA   . ASN A 1 131 ? 12.455  6.162   -7.546  1.00 0.00 ? 149 ASN A CA   3  
ATOM 6214  C C    . ASN A 1 131 ? 11.935  7.440   -8.195  1.00 0.00 ? 149 ASN A C    3  
ATOM 6215  O O    . ASN A 1 131 ? 10.782  7.507   -8.621  1.00 0.00 ? 149 ASN A O    3  
ATOM 6216  C CB   . ASN A 1 131 ? 13.740  5.709   -8.243  1.00 0.00 ? 149 ASN A CB   3  
ATOM 6217  C CG   . ASN A 1 131 ? 14.535  4.725   -7.407  1.00 0.00 ? 149 ASN A CG   3  
ATOM 6218  O OD1  . ASN A 1 131 ? 14.801  3.601   -7.837  1.00 0.00 ? 149 ASN A OD1  3  
ATOM 6219  N ND2  . ASN A 1 131 ? 14.918  5.143   -6.206  1.00 0.00 ? 149 ASN A ND2  3  
ATOM 6220  H H    . ASN A 1 131 ? 11.668  4.264   -8.049  1.00 0.00 ? 149 ASN A H    3  
ATOM 6221  H HA   . ASN A 1 131 ? 12.672  6.362   -6.507  1.00 0.00 ? 149 ASN A HA   3  
ATOM 6222  H HB3  . ASN A 1 131 ? 14.360  6.571   -8.439  1.00 0.00 ? 149 ASN A HB3  3  
ATOM 6223  H HD21 . ASN A 1 131 ? 14.671  6.050   -5.931  1.00 0.00 ? 149 ASN A HD21 3  
ATOM 6224  H HD22 . ASN A 1 131 ? 15.435  4.527   -5.646  1.00 0.00 ? 149 ASN A HD22 3  
ATOM 6225  N N    . ARG A 1 132 ? 12.793  8.453   -8.269  1.00 0.00 ? 150 ARG A N    3  
ATOM 6226  C CA   . ARG A 1 132 ? 12.420  9.729   -8.866  1.00 0.00 ? 150 ARG A CA   3  
ATOM 6227  C C    . ARG A 1 132 ? 12.079  9.559   -10.344 1.00 0.00 ? 150 ARG A C    3  
ATOM 6228  O O    . ARG A 1 132 ? 11.004  9.960   -10.793 1.00 0.00 ? 150 ARG A O    3  
ATOM 6229  C CB   . ARG A 1 132 ? 13.554  10.743  -8.708  1.00 0.00 ? 150 ARG A CB   3  
ATOM 6230  C CG   . ARG A 1 132 ? 13.222  12.120  -9.255  1.00 0.00 ? 150 ARG A CG   3  
ATOM 6231  C CD   . ARG A 1 132 ? 14.471  12.850  -9.727  1.00 0.00 ? 150 ARG A CD   3  
ATOM 6232  N NE   . ARG A 1 132 ? 14.260  14.292  -9.822  1.00 0.00 ? 150 ARG A NE   3  
ATOM 6233  C CZ   . ARG A 1 132 ? 15.247  15.179  -9.829  1.00 0.00 ? 150 ARG A CZ   3  
ATOM 6234  N NH1  . ARG A 1 132 ? 16.507  14.775  -9.746  1.00 0.00 ? 150 ARG A NH1  3  
ATOM 6235  N NH2  . ARG A 1 132 ? 14.975  16.475  -9.920  1.00 0.00 ? 150 ARG A NH2  3  
ATOM 6236  H H    . ARG A 1 132 ? 13.698  8.339   -7.912  1.00 0.00 ? 150 ARG A H    3  
ATOM 6237  H HA   . ARG A 1 132 ? 11.546  10.096  -8.347  1.00 0.00 ? 150 ARG A HA   3  
ATOM 6238  H HB3  . ARG A 1 132 ? 14.425  10.373  -9.227  1.00 0.00 ? 150 ARG A HB3  3  
ATOM 6239  H HG3  . ARG A 1 132 ? 12.748  12.702  -8.478  1.00 0.00 ? 150 ARG A HG3  3  
ATOM 6240  H HD3  . ARG A 1 132 ? 14.747  12.469  -10.699 1.00 0.00 ? 150 ARG A HD3  3  
ATOM 6241  H HE   . ARG A 1 132 ? 13.337  14.611  -9.885  1.00 0.00 ? 150 ARG A HE   3  
ATOM 6242  H HH11 . ARG A 1 132 ? 16.716  13.800  -9.678  1.00 0.00 ? 150 ARG A HH11 3  
ATOM 6243  H HH12 . ARG A 1 132 ? 17.249  15.446  -9.752  1.00 0.00 ? 150 ARG A HH12 3  
ATOM 6244  H HH21 . ARG A 1 132 ? 14.027  16.784  -9.982  1.00 0.00 ? 150 ARG A HH21 3  
ATOM 6245  H HH22 . ARG A 1 132 ? 15.720  17.143  -9.923  1.00 0.00 ? 150 ARG A HH22 3  
ATOM 6246  N N    . ASP A 1 133 ? 12.999  8.962   -11.093 1.00 0.00 ? 151 ASP A N    3  
ATOM 6247  C CA   . ASP A 1 133 ? 12.796  8.739   -12.519 1.00 0.00 ? 151 ASP A CA   3  
ATOM 6248  C C    . ASP A 1 133 ? 12.253  7.336   -12.778 1.00 0.00 ? 151 ASP A C    3  
ATOM 6249  O O    . ASP A 1 133 ? 12.459  6.768   -13.850 1.00 0.00 ? 151 ASP A O    3  
ATOM 6250  C CB   . ASP A 1 133 ? 14.106  8.940   -13.280 1.00 0.00 ? 151 ASP A CB   3  
ATOM 6251  C CG   . ASP A 1 133 ? 13.884  9.430   -14.698 1.00 0.00 ? 151 ASP A CG   3  
ATOM 6252  O OD1  . ASP A 1 133 ? 13.141  10.418  -14.874 1.00 0.00 ? 151 ASP A OD1  3  
ATOM 6253  O OD2  . ASP A 1 133 ? 14.453  8.826   -15.632 1.00 0.00 ? 151 ASP A OD2  3  
ATOM 6254  H H    . ASP A 1 133 ? 13.835  8.666   -10.677 1.00 0.00 ? 151 ASP A H    3  
ATOM 6255  H HA   . ASP A 1 133 ? 12.073  9.461   -12.870 1.00 0.00 ? 151 ASP A HA   3  
ATOM 6256  H HB3  . ASP A 1 133 ? 14.639  8.001   -13.323 1.00 0.00 ? 151 ASP A HB3  3  
ATOM 6257  N N    . GLY A 1 134 ? 11.560  6.784   -11.787 1.00 0.00 ? 152 GLY A N    3  
ATOM 6258  C CA   . GLY A 1 134 ? 11.001  5.453   -11.926 1.00 0.00 ? 152 GLY A CA   3  
ATOM 6259  C C    . GLY A 1 134 ? 12.032  4.433   -12.368 1.00 0.00 ? 152 GLY A C    3  
ATOM 6260  O O    . GLY A 1 134 ? 12.217  4.204   -13.564 1.00 0.00 ? 152 GLY A O    3  
ATOM 6261  H H    . GLY A 1 134 ? 11.428  7.284   -10.955 1.00 0.00 ? 152 GLY A H    3  
ATOM 6262  H HA2  . GLY A 1 134 ? 10.590  5.146   -10.975 1.00 0.00 ? 152 GLY A HA2  3  
ATOM 6263  H HA3  . GLY A 1 134 ? 10.206  5.483   -12.657 1.00 0.00 ? 152 GLY A HA3  3  
ATOM 6264  N N    . THR A 1 135 ? 12.707  3.820   -11.402 1.00 0.00 ? 153 THR A N    3  
ATOM 6265  C CA   . THR A 1 135 ? 13.727  2.822   -11.696 1.00 0.00 ? 153 THR A CA   3  
ATOM 6266  C C    . THR A 1 135 ? 13.128  1.421   -11.742 1.00 0.00 ? 153 THR A C    3  
ATOM 6267  O O    . THR A 1 135 ? 13.684  0.480   -11.177 1.00 0.00 ? 153 THR A O    3  
ATOM 6268  C CB   . THR A 1 135 ? 14.860  2.850   -10.652 1.00 0.00 ? 153 THR A CB   3  
ATOM 6269  O OG1  . THR A 1 135 ? 15.208  4.204   -10.344 1.00 0.00 ? 153 THR A OG1  3  
ATOM 6270  C CG2  . THR A 1 135 ? 16.086  2.109   -11.165 1.00 0.00 ? 153 THR A CG2  3  
ATOM 6271  H H    . THR A 1 135 ? 12.514  4.045   -10.467 1.00 0.00 ? 153 THR A H    3  
ATOM 6272  H HA   . THR A 1 135 ? 14.151  3.054   -12.663 1.00 0.00 ? 153 THR A HA   3  
ATOM 6273  H HB   . THR A 1 135 ? 14.512  2.362   -9.754  1.00 0.00 ? 153 THR A HB   3  
ATOM 6274  H HG1  . THR A 1 135 ? 15.746  4.223   -9.549  1.00 0.00 ? 153 THR A HG1  3  
ATOM 6275  H HG21 . THR A 1 135 ? 16.906  2.804   -11.276 1.00 0.00 ? 153 THR A HG21 3  
ATOM 6276  H HG22 . THR A 1 135 ? 15.862  1.661   -12.121 1.00 0.00 ? 153 THR A HG22 3  
ATOM 6277  H HG23 . THR A 1 135 ? 16.361  1.339   -10.460 1.00 0.00 ? 153 THR A HG23 3  
ATOM 6278  N N    . ARG A 1 136 ? 11.993  1.289   -12.420 1.00 0.00 ? 154 ARG A N    3  
ATOM 6279  C CA   . ARG A 1 136 ? 11.318  0.002   -12.539 1.00 0.00 ? 154 ARG A CA   3  
ATOM 6280  C C    . ARG A 1 136 ? 11.403  -0.779  -11.231 1.00 0.00 ? 154 ARG A C    3  
ATOM 6281  O O    . ARG A 1 136 ? 11.688  -1.977  -11.229 1.00 0.00 ? 154 ARG A O    3  
ATOM 6282  C CB   . ARG A 1 136 ? 11.935  -0.818  -13.675 1.00 0.00 ? 154 ARG A CB   3  
ATOM 6283  C CG   . ARG A 1 136 ? 13.406  -1.140  -13.465 1.00 0.00 ? 154 ARG A CG   3  
ATOM 6284  C CD   . ARG A 1 136 ? 13.865  -2.266  -14.378 1.00 0.00 ? 154 ARG A CD   3  
ATOM 6285  N NE   . ARG A 1 136 ? 13.782  -1.896  -15.788 1.00 0.00 ? 154 ARG A NE   3  
ATOM 6286  C CZ   . ARG A 1 136 ? 13.844  -2.774  -16.783 1.00 0.00 ? 154 ARG A CZ   3  
ATOM 6287  N NH1  . ARG A 1 136 ? 13.989  -4.066  -16.524 1.00 0.00 ? 154 ARG A NH1  3  
ATOM 6288  N NH2  . ARG A 1 136 ? 13.762  -2.359  -18.042 1.00 0.00 ? 154 ARG A NH2  3  
ATOM 6289  H H    . ARG A 1 136 ? 11.599  2.077   -12.850 1.00 0.00 ? 154 ARG A H    3  
ATOM 6290  H HA   . ARG A 1 136 ? 10.280  0.191   -12.767 1.00 0.00 ? 154 ARG A HA   3  
ATOM 6291  H HB3  . ARG A 1 136 ? 11.839  -0.263  -14.596 1.00 0.00 ? 154 ARG A HB3  3  
ATOM 6292  H HG3  . ARG A 1 136 ? 13.555  -1.437  -12.438 1.00 0.00 ? 154 ARG A HG3  3  
ATOM 6293  H HD3  . ARG A 1 136 ? 13.239  -3.130  -14.205 1.00 0.00 ? 154 ARG A HD3  3  
ATOM 6294  H HE   . ARG A 1 136 ? 13.675  -0.947  -16.002 1.00 0.00 ? 154 ARG A HE   3  
ATOM 6295  H HH11 . ARG A 1 136 ? 14.051  -4.381  -15.577 1.00 0.00 ? 154 ARG A HH11 3  
ATOM 6296  H HH12 . ARG A 1 136 ? 14.034  -4.725  -17.275 1.00 0.00 ? 154 ARG A HH12 3  
ATOM 6297  H HH21 . ARG A 1 136 ? 13.653  -1.386  -18.241 1.00 0.00 ? 154 ARG A HH21 3  
ATOM 6298  H HH22 . ARG A 1 136 ? 13.810  -3.020  -18.789 1.00 0.00 ? 154 ARG A HH22 3  
ATOM 6299  N N    . TYR A 1 137 ? 11.153  -0.094  -10.122 1.00 0.00 ? 155 TYR A N    3  
ATOM 6300  C CA   . TYR A 1 137 ? 11.203  -0.720  -8.807  1.00 0.00 ? 155 TYR A CA   3  
ATOM 6301  C C    . TYR A 1 137 ? 9.812   -1.165  -8.362  1.00 0.00 ? 155 TYR A C    3  
ATOM 6302  O O    . TYR A 1 137 ? 9.507   -1.185  -7.170  1.00 0.00 ? 155 TYR A O    3  
ATOM 6303  C CB   . TYR A 1 137 ? 11.795  0.246   -7.779  1.00 0.00 ? 155 TYR A CB   3  
ATOM 6304  C CG   . TYR A 1 137 ? 12.536  -0.445  -6.656  1.00 0.00 ? 155 TYR A CG   3  
ATOM 6305  C CD1  . TYR A 1 137 ? 13.646  -1.241  -6.914  1.00 0.00 ? 155 TYR A CD1  3  
ATOM 6306  C CD2  . TYR A 1 137 ? 12.126  -0.301  -5.336  1.00 0.00 ? 155 TYR A CD2  3  
ATOM 6307  C CE1  . TYR A 1 137 ? 14.323  -1.873  -5.890  1.00 0.00 ? 155 TYR A CE1  3  
ATOM 6308  C CE2  . TYR A 1 137 ? 12.800  -0.929  -4.307  1.00 0.00 ? 155 TYR A CE2  3  
ATOM 6309  C CZ   . TYR A 1 137 ? 13.897  -1.714  -4.588  1.00 0.00 ? 155 TYR A CZ   3  
ATOM 6310  O OH   . TYR A 1 137 ? 14.572  -2.342  -3.566  1.00 0.00 ? 155 TYR A OH   3  
ATOM 6311  H H    . TYR A 1 137 ? 10.931  0.860   -10.188 1.00 0.00 ? 155 TYR A H    3  
ATOM 6312  H HA   . TYR A 1 137 ? 11.841  -1.590  -8.878  1.00 0.00 ? 155 TYR A HA   3  
ATOM 6313  H HB3  . TYR A 1 137 ? 10.997  0.829   -7.343  1.00 0.00 ? 155 TYR A HB3  3  
ATOM 6314  H HD1  . TYR A 1 137 ? 13.976  -1.362  -7.936  1.00 0.00 ? 155 TYR A HD1  3  
ATOM 6315  H HD2  . TYR A 1 137 ? 11.265  0.316   -5.118  1.00 0.00 ? 155 TYR A HD2  3  
ATOM 6316  H HE1  . TYR A 1 137 ? 15.184  -2.488  -6.112  1.00 0.00 ? 155 TYR A HE1  3  
ATOM 6317  H HE2  . TYR A 1 137 ? 12.466  -0.804  -3.287  1.00 0.00 ? 155 TYR A HE2  3  
ATOM 6318  H HH   . TYR A 1 137 ? 15.461  -2.559  -3.856  1.00 0.00 ? 155 TYR A HH   3  
ATOM 6319  N N    . VAL A 1 138 ? 8.974   -1.520  -9.330  1.00 0.00 ? 156 VAL A N    3  
ATOM 6320  C CA   . VAL A 1 138 ? 7.617   -1.967  -9.041  1.00 0.00 ? 156 VAL A CA   3  
ATOM 6321  C C    . VAL A 1 138 ? 7.174   -3.049  -10.018 1.00 0.00 ? 156 VAL A C    3  
ATOM 6322  O O    . VAL A 1 138 ? 7.935   -3.455  -10.896 1.00 0.00 ? 156 VAL A O    3  
ATOM 6323  C CB   . VAL A 1 138 ? 6.616   -0.796  -9.099  1.00 0.00 ? 156 VAL A CB   3  
ATOM 6324  C CG1  . VAL A 1 138 ? 6.755   0.086   -7.868  1.00 0.00 ? 156 VAL A CG1  3  
ATOM 6325  C CG2  . VAL A 1 138 ? 6.819   0.012   -10.371 1.00 0.00 ? 156 VAL A CG2  3  
ATOM 6326  H H    . VAL A 1 138 ? 9.277   -1.483  -10.261 1.00 0.00 ? 156 VAL A H    3  
ATOM 6327  H HA   . VAL A 1 138 ? 7.606   -2.373  -8.039  1.00 0.00 ? 156 VAL A HA   3  
ATOM 6328  H HB   . VAL A 1 138 ? 5.617   -1.204  -9.112  1.00 0.00 ? 156 VAL A HB   3  
ATOM 6329  H HG11 . VAL A 1 138 ? 7.642   0.697   -7.961  1.00 0.00 ? 156 VAL A HG11 3  
ATOM 6330  H HG12 . VAL A 1 138 ? 5.887   0.721   -7.781  1.00 0.00 ? 156 VAL A HG12 3  
ATOM 6331  H HG13 . VAL A 1 138 ? 6.838   -0.535  -6.987  1.00 0.00 ? 156 VAL A HG13 3  
ATOM 6332  H HG21 . VAL A 1 138 ? 5.986   0.687   -10.503 1.00 0.00 ? 156 VAL A HG21 3  
ATOM 6333  H HG22 . VAL A 1 138 ? 7.735   0.582   -10.294 1.00 0.00 ? 156 VAL A HG22 3  
ATOM 6334  H HG23 . VAL A 1 138 ? 6.881   -0.655  -11.217 1.00 0.00 ? 156 VAL A HG23 3  
ATOM 6335  N N    . GLN A 1 139 ? 5.938   -3.512  -9.860  1.00 0.00 ? 157 GLN A N    3  
ATOM 6336  C CA   . GLN A 1 139 ? 5.393   -4.548  -10.729 1.00 0.00 ? 157 GLN A CA   3  
ATOM 6337  C C    . GLN A 1 139 ? 4.580   -3.933  -11.863 1.00 0.00 ? 157 GLN A C    3  
ATOM 6338  O O    . GLN A 1 139 ? 3.596   -4.516  -12.322 1.00 0.00 ? 157 GLN A O    3  
ATOM 6339  C CB   . GLN A 1 139 ? 4.521   -5.512  -9.923  1.00 0.00 ? 157 GLN A CB   3  
ATOM 6340  C CG   . GLN A 1 139 ? 3.292   -4.858  -9.314  1.00 0.00 ? 157 GLN A CG   3  
ATOM 6341  C CD   . GLN A 1 139 ? 3.563   -4.270  -7.944  1.00 0.00 ? 157 GLN A CD   3  
ATOM 6342  O OE1  . GLN A 1 139 ? 3.932   -4.984  -7.011  1.00 0.00 ? 157 GLN A OE1  3  
ATOM 6343  N NE2  . GLN A 1 139 ? 3.380   -2.961  -7.814  1.00 0.00 ? 157 GLN A NE2  3  
ATOM 6344  H H    . GLN A 1 139 ? 5.380   -3.148  -9.141  1.00 0.00 ? 157 GLN A H    3  
ATOM 6345  H HA   . GLN A 1 139 ? 6.223   -5.095  -11.152 1.00 0.00 ? 157 GLN A HA   3  
ATOM 6346  H HB3  . GLN A 1 139 ? 5.113   -5.931  -9.123  1.00 0.00 ? 157 GLN A HB3  3  
ATOM 6347  H HG3  . GLN A 1 139 ? 2.512   -5.600  -9.224  1.00 0.00 ? 157 GLN A HG3  3  
ATOM 6348  H HE21 . GLN A 1 139 ? 3.084   -2.455  -8.600  1.00 0.00 ? 157 GLN A HE21 3  
ATOM 6349  H HE22 . GLN A 1 139 ? 3.547   -2.555  -6.939  1.00 0.00 ? 157 GLN A HE22 3  
ATOM 6350  N N    . LYS A 1 140 ? 4.995   -2.755  -12.312 1.00 0.00 ? 158 LYS A N    3  
ATOM 6351  C CA   . LYS A 1 140 ? 4.305   -2.061  -13.394 1.00 0.00 ? 158 LYS A CA   3  
ATOM 6352  C C    . LYS A 1 140 ? 5.241   -1.083  -14.097 1.00 0.00 ? 158 LYS A C    3  
ATOM 6353  O O    . LYS A 1 140 ? 5.951   -0.315  -13.450 1.00 0.00 ? 158 LYS A O    3  
ATOM 6354  C CB   . LYS A 1 140 ? 3.084   -1.314  -12.852 1.00 0.00 ? 158 LYS A CB   3  
ATOM 6355  C CG   . LYS A 1 140 ? 1.860   -2.196  -12.678 1.00 0.00 ? 158 LYS A CG   3  
ATOM 6356  C CD   . LYS A 1 140 ? 0.609   -1.370  -12.425 1.00 0.00 ? 158 LYS A CD   3  
ATOM 6357  C CE   . LYS A 1 140 ? 0.474   -0.998  -10.956 1.00 0.00 ? 158 LYS A CE   3  
ATOM 6358  N NZ   . LYS A 1 140 ? -0.868  -0.434  -10.649 1.00 0.00 ? 158 LYS A NZ   3  
ATOM 6359  H H    . LYS A 1 140 ? 5.785   -2.340  -11.907 1.00 0.00 ? 158 LYS A H    3  
ATOM 6360  H HA   . LYS A 1 140 ? 3.976   -2.802  -14.106 1.00 0.00 ? 158 LYS A HA   3  
ATOM 6361  H HB3  . LYS A 1 140 ? 2.834   -0.516  -13.535 1.00 0.00 ? 158 LYS A HB3  3  
ATOM 6362  H HG3  . LYS A 1 140 ? 2.020   -2.858  -11.839 1.00 0.00 ? 158 LYS A HG3  3  
ATOM 6363  H HD3  . LYS A 1 140 ? -0.257  -1.943  -12.725 1.00 0.00 ? 158 LYS A HD3  3  
ATOM 6364  H HE3  . LYS A 1 140 ? 1.229   -0.266  -10.713 1.00 0.00 ? 158 LYS A HE3  3  
ATOM 6365  H HZ1  . LYS A 1 140 ? -0.791  0.588   -10.463 1.00 0.00 ? 158 LYS A HZ1  3  
ATOM 6366  H HZ2  . LYS A 1 140 ? -1.266  -0.897  -9.807  1.00 0.00 ? 158 LYS A HZ2  3  
ATOM 6367  H HZ3  . LYS A 1 140 ? -1.511  -0.583  -11.452 1.00 0.00 ? 158 LYS A HZ3  3  
ATOM 6368  N N    . GLY A 1 141 ? 5.237   -1.117  -15.425 1.00 0.00 ? 159 GLY A N    3  
ATOM 6369  C CA   . GLY A 1 141 ? 6.088   -0.229  -16.194 1.00 0.00 ? 159 GLY A CA   3  
ATOM 6370  C C    . GLY A 1 141 ? 5.501   0.109   -17.550 1.00 0.00 ? 159 GLY A C    3  
ATOM 6371  O O    . GLY A 1 141 ? 5.984   -0.364  -18.578 1.00 0.00 ? 159 GLY A O    3  
ATOM 6372  H H    . GLY A 1 141 ? 4.649   -1.751  -15.888 1.00 0.00 ? 159 GLY A H    3  
ATOM 6373  H HA2  . GLY A 1 141 ? 6.230   0.685   -15.638 1.00 0.00 ? 159 GLY A HA2  3  
ATOM 6374  H HA3  . GLY A 1 141 ? 7.047   -0.704  -16.339 1.00 0.00 ? 159 GLY A HA3  3  
ATOM 6375  N N    . GLU A 1 142 ? 4.453   0.928   -17.552 1.00 0.00 ? 160 GLU A N    3  
ATOM 6376  C CA   . GLU A 1 142 ? 3.797   1.326   -18.793 1.00 0.00 ? 160 GLU A CA   3  
ATOM 6377  C C    . GLU A 1 142 ? 3.808   2.843   -18.953 1.00 0.00 ? 160 GLU A C    3  
ATOM 6378  O O    . GLU A 1 142 ? 3.647   3.580   -17.980 1.00 0.00 ? 160 GLU A O    3  
ATOM 6379  C CB   . GLU A 1 142 ? 2.359   0.808   -18.824 1.00 0.00 ? 160 GLU A CB   3  
ATOM 6380  C CG   . GLU A 1 142 ? 1.694   0.934   -20.185 1.00 0.00 ? 160 GLU A CG   3  
ATOM 6381  C CD   . GLU A 1 142 ? 1.977   -0.255  -21.083 1.00 0.00 ? 160 GLU A CD   3  
ATOM 6382  O OE1  . GLU A 1 142 ? 1.340   -1.311  -20.887 1.00 0.00 ? 160 GLU A OE1  3  
ATOM 6383  O OE2  . GLU A 1 142 ? 2.834   -0.129  -21.982 1.00 0.00 ? 160 GLU A OE2  3  
ATOM 6384  H H    . GLU A 1 142 ? 4.112   1.272   -16.700 1.00 0.00 ? 160 GLU A H    3  
ATOM 6385  H HA   . GLU A 1 142 ? 4.346   0.886   -19.613 1.00 0.00 ? 160 GLU A HA   3  
ATOM 6386  H HB3  . GLU A 1 142 ? 1.773   1.367   -18.110 1.00 0.00 ? 160 GLU A HB3  3  
ATOM 6387  H HG3  . GLU A 1 142 ? 2.062   1.827   -20.670 1.00 0.00 ? 160 GLU A HG3  3  
ATOM 6388  N N    . TYR A 1 143 ? 4.000   3.300   -20.184 1.00 0.00 ? 161 TYR A N    3  
ATOM 6389  C CA   . TYR A 1 143 ? 4.034   4.730   -20.471 1.00 0.00 ? 161 TYR A CA   3  
ATOM 6390  C C    . TYR A 1 143 ? 3.044   5.089   -21.574 1.00 0.00 ? 161 TYR A C    3  
ATOM 6391  O O    . TYR A 1 143 ? 2.851   4.328   -22.522 1.00 0.00 ? 161 TYR A O    3  
ATOM 6392  C CB   . TYR A 1 143 ? 5.446   5.155   -20.879 1.00 0.00 ? 161 TYR A CB   3  
ATOM 6393  C CG   . TYR A 1 143 ? 6.031   4.320   -21.996 1.00 0.00 ? 161 TYR A CG   3  
ATOM 6394  C CD1  . TYR A 1 143 ? 6.721   3.146   -21.723 1.00 0.00 ? 161 TYR A CD1  3  
ATOM 6395  C CD2  . TYR A 1 143 ? 5.891   4.704   -23.325 1.00 0.00 ? 161 TYR A CD2  3  
ATOM 6396  C CE1  . TYR A 1 143 ? 7.258   2.380   -22.740 1.00 0.00 ? 161 TYR A CE1  3  
ATOM 6397  C CE2  . TYR A 1 143 ? 6.423   3.943   -24.348 1.00 0.00 ? 161 TYR A CE2  3  
ATOM 6398  C CZ   . TYR A 1 143 ? 7.106   2.783   -24.050 1.00 0.00 ? 161 TYR A CZ   3  
ATOM 6399  O OH   . TYR A 1 143 ? 7.638   2.022   -25.065 1.00 0.00 ? 161 TYR A OH   3  
ATOM 6400  H H    . TYR A 1 143 ? 4.122   2.663   -20.918 1.00 0.00 ? 161 TYR A H    3  
ATOM 6401  H HA   . TYR A 1 143 ? 3.758   5.257   -19.568 1.00 0.00 ? 161 TYR A HA   3  
ATOM 6402  H HB3  . TYR A 1 143 ? 6.101   5.073   -20.025 1.00 0.00 ? 161 TYR A HB3  3  
ATOM 6403  H HD1  . TYR A 1 143 ? 6.838   2.833   -20.695 1.00 0.00 ? 161 TYR A HD1  3  
ATOM 6404  H HD2  . TYR A 1 143 ? 5.354   5.614   -23.553 1.00 0.00 ? 161 TYR A HD2  3  
ATOM 6405  H HE1  . TYR A 1 143 ? 7.793   1.471   -22.507 1.00 0.00 ? 161 TYR A HE1  3  
ATOM 6406  H HE2  . TYR A 1 143 ? 6.304   4.258   -25.374 1.00 0.00 ? 161 TYR A HE2  3  
ATOM 6407  H HH   . TYR A 1 143 ? 6.982   1.388   -25.368 1.00 0.00 ? 161 TYR A HH   3  
ATOM 6408  N N    . ARG A 1 144 ? 2.419   6.255   -21.443 1.00 0.00 ? 162 ARG A N    3  
ATOM 6409  C CA   . ARG A 1 144 ? 1.447   6.714   -22.427 1.00 0.00 ? 162 ARG A CA   3  
ATOM 6410  C C    . ARG A 1 144 ? 1.602   8.211   -22.684 1.00 0.00 ? 162 ARG A C    3  
ATOM 6411  O O    . ARG A 1 144 ? 1.642   9.013   -21.750 1.00 0.00 ? 162 ARG A O    3  
ATOM 6412  C CB   . ARG A 1 144 ? 0.025   6.412   -21.952 1.00 0.00 ? 162 ARG A CB   3  
ATOM 6413  C CG   . ARG A 1 144 ? -0.427  4.991   -22.245 1.00 0.00 ? 162 ARG A CG   3  
ATOM 6414  C CD   . ARG A 1 144 ? -1.885  4.780   -21.870 1.00 0.00 ? 162 ARG A CD   3  
ATOM 6415  N NE   . ARG A 1 144 ? -2.447  3.592   -22.505 1.00 0.00 ? 162 ARG A NE   3  
ATOM 6416  C CZ   . ARG A 1 144 ? -2.743  3.519   -23.798 1.00 0.00 ? 162 ARG A CZ   3  
ATOM 6417  N NH1  . ARG A 1 144 ? -2.531  4.560   -24.590 1.00 0.00 ? 162 ARG A NH1  3  
ATOM 6418  N NH2  . ARG A 1 144 ? -3.252  2.401   -24.301 1.00 0.00 ? 162 ARG A NH2  3  
ATOM 6419  H H    . ARG A 1 144 ? 2.614   6.817   -20.665 1.00 0.00 ? 162 ARG A H    3  
ATOM 6420  H HA   . ARG A 1 144 ? 1.630   6.182   -23.349 1.00 0.00 ? 162 ARG A HA   3  
ATOM 6421  H HB3  . ARG A 1 144 ? -0.658  7.091   -22.441 1.00 0.00 ? 162 ARG A HB3  3  
ATOM 6422  H HG3  . ARG A 1 144 ? 0.184   4.306   -21.678 1.00 0.00 ? 162 ARG A HG3  3  
ATOM 6423  H HD3  . ARG A 1 144 ? -2.451  5.646   -22.182 1.00 0.00 ? 162 ARG A HD3  3  
ATOM 6424  H HE   . ARG A 1 144 ? -2.611  2.809   -21.939 1.00 0.00 ? 162 ARG A HE   3  
ATOM 6425  H HH11 . ARG A 1 144 ? -2.148  5.403   -24.212 1.00 0.00 ? 162 ARG A HH11 3  
ATOM 6426  H HH12 . ARG A 1 144 ? -2.755  4.502   -25.562 1.00 0.00 ? 162 ARG A HH12 3  
ATOM 6427  H HH21 . ARG A 1 144 ? -3.413  1.613   -23.707 1.00 0.00 ? 162 ARG A HH21 3  
ATOM 6428  H HH22 . ARG A 1 144 ? -3.474  2.347   -25.274 1.00 0.00 ? 162 ARG A HH22 3  
ATOM 6429  N N    . THR A 1 145 ? 1.686   8.583   -23.958 1.00 0.00 ? 163 THR A N    3  
ATOM 6430  C CA   . THR A 1 145 ? 1.838   9.980   -24.338 1.00 0.00 ? 163 THR A CA   3  
ATOM 6431  C C    . THR A 1 145 ? 0.804   10.381  -25.384 1.00 0.00 ? 163 THR A C    3  
ATOM 6432  O O    . THR A 1 145 ? 0.476   9.600   -26.276 1.00 0.00 ? 163 THR A O    3  
ATOM 6433  C CB   . THR A 1 145 ? 3.248   10.263  -24.892 1.00 0.00 ? 163 THR A CB   3  
ATOM 6434  O OG1  . THR A 1 145 ? 3.394   11.659  -25.171 1.00 0.00 ? 163 THR A OG1  3  
ATOM 6435  C CG2  . THR A 1 145 ? 3.502   9.458   -26.158 1.00 0.00 ? 163 THR A CG2  3  
ATOM 6436  H H    . THR A 1 145 ? 1.648   7.896   -24.658 1.00 0.00 ? 163 THR A H    3  
ATOM 6437  H HA   . THR A 1 145 ? 1.694   10.584  -23.454 1.00 0.00 ? 163 THR A HA   3  
ATOM 6438  H HB   . THR A 1 145 ? 3.976   9.974   -24.147 1.00 0.00 ? 163 THR A HB   3  
ATOM 6439  H HG1  . THR A 1 145 ? 4.324   11.897  -25.133 1.00 0.00 ? 163 THR A HG1  3  
ATOM 6440  H HG21 . THR A 1 145 ? 2.811   8.631   -26.205 1.00 0.00 ? 163 THR A HG21 3  
ATOM 6441  H HG22 . THR A 1 145 ? 4.515   9.081   -26.147 1.00 0.00 ? 163 THR A HG22 3  
ATOM 6442  H HG23 . THR A 1 145 ? 3.364   10.092  -27.021 1.00 0.00 ? 163 THR A HG23 3  
ATOM 6443  N N    . ASN A 1 146 ? 0.295   11.603  -25.268 1.00 0.00 ? 164 ASN A N    3  
ATOM 6444  C CA   . ASN A 1 146 ? -0.703  12.107  -26.204 1.00 0.00 ? 164 ASN A CA   3  
ATOM 6445  C C    . ASN A 1 146 ? -0.689  13.632  -26.246 1.00 0.00 ? 164 ASN A C    3  
ATOM 6446  O O    . ASN A 1 146 ? -1.627  14.299  -25.809 1.00 0.00 ? 164 ASN A O    3  
ATOM 6447  C CB   . ASN A 1 146 ? -2.096  11.609  -25.816 1.00 0.00 ? 164 ASN A CB   3  
ATOM 6448  C CG   . ASN A 1 146 ? -2.285  11.539  -24.313 1.00 0.00 ? 164 ASN A CG   3  
ATOM 6449  O OD1  . ASN A 1 146 ? -2.429  10.457  -23.745 1.00 0.00 ? 164 ASN A OD1  3  
ATOM 6450  N ND2  . ASN A 1 146 ? -2.288  12.696  -23.662 1.00 0.00 ? 164 ASN A ND2  3  
ATOM 6451  H H    . ASN A 1 146 ? 0.597   12.180  -24.535 1.00 0.00 ? 164 ASN A H    3  
ATOM 6452  H HA   . ASN A 1 146 ? -0.456  11.730  -27.186 1.00 0.00 ? 164 ASN A HA   3  
ATOM 6453  H HB3  . ASN A 1 146 ? -2.247  10.622  -26.226 1.00 0.00 ? 164 ASN A HB3  3  
ATOM 6454  H HD21 . ASN A 1 146 ? -2.168  13.519  -24.181 1.00 0.00 ? 164 ASN A HD21 3  
ATOM 6455  H HD22 . ASN A 1 146 ? -2.407  12.680  -22.690 1.00 0.00 ? 164 ASN A HD22 3  
ATOM 6456  N N    . PRO A 1 147 ? 0.401   14.199  -26.785 1.00 0.00 ? 165 PRO A N    3  
ATOM 6457  C CA   . PRO A 1 147 ? 0.563   15.651  -26.897 1.00 0.00 ? 165 PRO A CA   3  
ATOM 6458  C C    . PRO A 1 147 ? -0.383  16.263  -27.925 1.00 0.00 ? 165 PRO A C    3  
ATOM 6459  O O    . PRO A 1 147 ? -1.099  15.549  -28.624 1.00 0.00 ? 165 PRO A O    3  
ATOM 6460  C CB   . PRO A 1 147 ? 2.017   15.813  -27.347 1.00 0.00 ? 165 PRO A CB   3  
ATOM 6461  C CG   . PRO A 1 147 ? 2.344   14.534  -28.038 1.00 0.00 ? 165 PRO A CG   3  
ATOM 6462  C CD   . PRO A 1 147 ? 1.557   13.468  -27.327 1.00 0.00 ? 165 PRO A CD   3  
ATOM 6463  H HA   . PRO A 1 147 ? 0.423   16.142  -25.944 1.00 0.00 ? 165 PRO A HA   3  
ATOM 6464  H HB3  . PRO A 1 147 ? 2.650   15.970  -26.487 1.00 0.00 ? 165 PRO A HB3  3  
ATOM 6465  H HG3  . PRO A 1 147 ? 3.401   14.334  -27.959 1.00 0.00 ? 165 PRO A HG3  3  
ATOM 6466  H HD3  . PRO A 1 147 ? 2.145   13.033  -26.531 1.00 0.00 ? 165 PRO A HD3  3  
ATOM 6467  N N    . GLU A 1 148 ? -0.381  17.590  -28.009 1.00 0.00 ? 166 GLU A N    3  
ATOM 6468  C CA   . GLU A 1 148 ? -1.239  18.296  -28.951 1.00 0.00 ? 166 GLU A CA   3  
ATOM 6469  C C    . GLU A 1 148 ? -0.445  19.330  -29.745 1.00 0.00 ? 166 GLU A C    3  
ATOM 6470  O O    . GLU A 1 148 ? -0.760  20.519  -29.729 1.00 0.00 ? 166 GLU A O    3  
ATOM 6471  C CB   . GLU A 1 148 ? -2.391  18.982  -28.212 1.00 0.00 ? 166 GLU A CB   3  
ATOM 6472  C CG   . GLU A 1 148 ? -3.264  18.021  -27.423 1.00 0.00 ? 166 GLU A CG   3  
ATOM 6473  C CD   . GLU A 1 148 ? -4.310  17.343  -28.284 1.00 0.00 ? 166 GLU A CD   3  
ATOM 6474  O OE1  . GLU A 1 148 ? -4.842  18.001  -29.203 1.00 0.00 ? 166 GLU A OE1  3  
ATOM 6475  O OE2  . GLU A 1 148 ? -4.598  16.152  -28.041 1.00 0.00 ? 166 GLU A OE2  3  
ATOM 6476  H H    . GLU A 1 148 ? 0.214   18.106  -27.425 1.00 0.00 ? 166 GLU A H    3  
ATOM 6477  H HA   . GLU A 1 148 ? -1.647  17.570  -29.638 1.00 0.00 ? 166 GLU A HA   3  
ATOM 6478  H HB3  . GLU A 1 148 ? -3.012  19.492  -28.933 1.00 0.00 ? 166 GLU A HB3  3  
ATOM 6479  H HG3  . GLU A 1 148 ? -3.765  18.572  -26.641 1.00 0.00 ? 166 GLU A HG3  3  
ATOM 6480  N N    . ASP A 1 149 ? 0.591   18.865  -30.438 1.00 0.00 ? 167 ASP A N    3  
ATOM 6481  C CA   . ASP A 1 149 ? 1.431   19.747  -31.240 1.00 0.00 ? 167 ASP A CA   3  
ATOM 6482  C C    . ASP A 1 149 ? 1.097   19.618  -32.722 1.00 0.00 ? 167 ASP A C    3  
ATOM 6483  O O    . ASP A 1 149 ? 0.961   18.512  -33.243 1.00 0.00 ? 167 ASP A O    3  
ATOM 6484  C CB   . ASP A 1 149 ? 2.909   19.428  -31.007 1.00 0.00 ? 167 ASP A CB   3  
ATOM 6485  C CG   . ASP A 1 149 ? 3.805   20.022  -32.074 1.00 0.00 ? 167 ASP A CG   3  
ATOM 6486  O OD1  . ASP A 1 149 ? 3.871   19.449  -33.181 1.00 0.00 ? 167 ASP A OD1  3  
ATOM 6487  O OD2  . ASP A 1 149 ? 4.441   21.062  -31.802 1.00 0.00 ? 167 ASP A OD2  3  
ATOM 6488  H H    . ASP A 1 149 ? 0.792   17.907  -30.412 1.00 0.00 ? 167 ASP A H    3  
ATOM 6489  H HA   . ASP A 1 149 ? 1.238   20.763  -30.927 1.00 0.00 ? 167 ASP A HA   3  
ATOM 6490  H HB3  . ASP A 1 149 ? 3.043   18.356  -31.005 1.00 0.00 ? 167 ASP A HB3  3  
ATOM 6491  N N    . ILE A 1 150 ? 0.969   20.756  -33.396 1.00 0.00 ? 168 ILE A N    3  
ATOM 6492  C CA   . ILE A 1 150 ? 0.651   20.770  -34.818 1.00 0.00 ? 168 ILE A CA   3  
ATOM 6493  C C    . ILE A 1 150 ? 1.791   21.376  -35.630 1.00 0.00 ? 168 ILE A C    3  
ATOM 6494  O O    . ILE A 1 150 ? 2.458   22.308  -35.182 1.00 0.00 ? 168 ILE A O    3  
ATOM 6495  C CB   . ILE A 1 150 ? -0.641  21.560  -35.099 1.00 0.00 ? 168 ILE A CB   3  
ATOM 6496  C CG1  . ILE A 1 150 ? -0.951  21.555  -36.597 1.00 0.00 ? 168 ILE A CG1  3  
ATOM 6497  C CG2  . ILE A 1 150 ? -0.513  22.985  -34.584 1.00 0.00 ? 168 ILE A CG2  3  
ATOM 6498  C CD1  . ILE A 1 150 ? -2.389  21.901  -36.918 1.00 0.00 ? 168 ILE A CD1  3  
ATOM 6499  H H    . ILE A 1 150 ? 1.090   21.607  -32.924 1.00 0.00 ? 168 ILE A H    3  
ATOM 6500  H HA   . ILE A 1 150 ? 0.501   19.747  -35.135 1.00 0.00 ? 168 ILE A HA   3  
ATOM 6501  H HB   . ILE A 1 150 ? -1.451  21.082  -34.570 1.00 0.00 ? 168 ILE A HB   3  
ATOM 6502  H HG13 . ILE A 1 150 ? -0.748  20.572  -36.997 1.00 0.00 ? 168 ILE A HG13 3  
ATOM 6503  H HG21 . ILE A 1 150 ? 0.315   23.473  -35.076 1.00 0.00 ? 168 ILE A HG21 3  
ATOM 6504  H HG22 . ILE A 1 150 ? -1.424  23.526  -34.792 1.00 0.00 ? 168 ILE A HG22 3  
ATOM 6505  H HG23 . ILE A 1 150 ? -0.338  22.969  -33.518 1.00 0.00 ? 168 ILE A HG23 3  
ATOM 6506  H HD11 . ILE A 1 150 ? -2.509  22.973  -36.924 1.00 0.00 ? 168 ILE A HD11 3  
ATOM 6507  H HD12 . ILE A 1 150 ? -2.647  21.503  -37.888 1.00 0.00 ? 168 ILE A HD12 3  
ATOM 6508  H HD13 . ILE A 1 150 ? -3.038  21.470  -36.167 1.00 0.00 ? 168 ILE A HD13 3  
ATOM 6509  N N    . TYR A 1 151 ? 2.007   20.840  -36.826 1.00 0.00 ? 169 TYR A N    3  
ATOM 6510  C CA   . TYR A 1 151 ? 3.067   21.328  -37.702 1.00 0.00 ? 169 TYR A CA   3  
ATOM 6511  C C    . TYR A 1 151 ? 2.486   22.065  -38.904 1.00 0.00 ? 169 TYR A C    3  
ATOM 6512  O O    . TYR A 1 151 ? 1.316   21.905  -39.256 1.00 0.00 ? 169 TYR A O    3  
ATOM 6513  C CB   . TYR A 1 151 ? 3.940   20.165  -38.175 1.00 0.00 ? 169 TYR A CB   3  
ATOM 6514  C CG   . TYR A 1 151 ? 5.095   19.858  -37.249 1.00 0.00 ? 169 TYR A CG   3  
ATOM 6515  C CD1  . TYR A 1 151 ? 4.886   19.218  -36.033 1.00 0.00 ? 169 TYR A CD1  3  
ATOM 6516  C CD2  . TYR A 1 151 ? 6.396   20.211  -37.587 1.00 0.00 ? 169 TYR A CD2  3  
ATOM 6517  C CE1  . TYR A 1 151 ? 5.937   18.936  -35.184 1.00 0.00 ? 169 TYR A CE1  3  
ATOM 6518  C CE2  . TYR A 1 151 ? 7.453   19.931  -36.744 1.00 0.00 ? 169 TYR A CE2  3  
ATOM 6519  C CZ   . TYR A 1 151 ? 7.220   19.294  -35.543 1.00 0.00 ? 169 TYR A CZ   3  
ATOM 6520  O OH   . TYR A 1 151 ? 8.271   19.017  -34.699 1.00 0.00 ? 169 TYR A OH   3  
ATOM 6521  H H    . TYR A 1 151 ? 1.442   20.099  -37.128 1.00 0.00 ? 169 TYR A H    3  
ATOM 6522  H HA   . TYR A 1 151 ? 3.676   22.015  -37.132 1.00 0.00 ? 169 TYR A HA   3  
ATOM 6523  H HB3  . TYR A 1 151 ? 4.349   20.403  -39.147 1.00 0.00 ? 169 TYR A HB3  3  
ATOM 6524  H HD1  . TYR A 1 151 ? 3.880   18.938  -35.754 1.00 0.00 ? 169 TYR A HD1  3  
ATOM 6525  H HD2  . TYR A 1 151 ? 6.576   20.710  -38.528 1.00 0.00 ? 169 TYR A HD2  3  
ATOM 6526  H HE1  . TYR A 1 151 ? 5.755   18.437  -34.243 1.00 0.00 ? 169 TYR A HE1  3  
ATOM 6527  H HE2  . TYR A 1 151 ? 8.459   20.213  -37.025 1.00 0.00 ? 169 TYR A HE2  3  
ATOM 6528  H HH   . TYR A 1 151 ? 8.749   19.826  -34.507 1.00 0.00 ? 169 TYR A HH   3  
ATOM 6529  N N    . PRO A 1 152 ? 3.320   22.890  -39.551 1.00 0.00 ? 170 PRO A N    3  
ATOM 6530  C CA   . PRO A 1 152 ? 2.912   23.666  -40.726 1.00 0.00 ? 170 PRO A CA   3  
ATOM 6531  C C    . PRO A 1 152 ? 2.676   22.789  -41.949 1.00 0.00 ? 170 PRO A C    3  
ATOM 6532  O O    . PRO A 1 152 ? 3.486   21.917  -42.265 1.00 0.00 ? 170 PRO A O    3  
ATOM 6533  C CB   . PRO A 1 152 ? 4.101   24.604  -40.961 1.00 0.00 ? 170 PRO A CB   3  
ATOM 6534  C CG   . PRO A 1 152 ? 5.266   23.894  -40.364 1.00 0.00 ? 170 PRO A CG   3  
ATOM 6535  C CD   . PRO A 1 152 ? 4.727   23.128  -39.188 1.00 0.00 ? 170 PRO A CD   3  
ATOM 6536  H HA   . PRO A 1 152 ? 2.025   24.251  -40.527 1.00 0.00 ? 170 PRO A HA   3  
ATOM 6537  H HB3  . PRO A 1 152 ? 3.921   25.548  -40.470 1.00 0.00 ? 170 PRO A HB3  3  
ATOM 6538  H HG3  . PRO A 1 152 ? 6.004   24.611  -40.038 1.00 0.00 ? 170 PRO A HG3  3  
ATOM 6539  H HD3  . PRO A 1 152 ? 4.797   23.721  -38.287 1.00 0.00 ? 170 PRO A HD3  3  
ATOM 6540  N N    . SER A 1 153 ? 1.562   23.023  -42.634 1.00 0.00 ? 171 SER A N    3  
ATOM 6541  C CA   . SER A 1 153 ? 1.217   22.250  -43.821 1.00 0.00 ? 171 SER A CA   3  
ATOM 6542  C C    . SER A 1 153 ? 2.349   22.291  -44.844 1.00 0.00 ? 171 SER A C    3  
ATOM 6543  O O    . SER A 1 153 ? 3.065   21.309  -45.030 1.00 0.00 ? 171 SER A O    3  
ATOM 6544  C CB   . SER A 1 153 ? -0.071  22.786  -44.449 1.00 0.00 ? 171 SER A CB   3  
ATOM 6545  O OG   . SER A 1 153 ? -0.291  22.217  -45.728 1.00 0.00 ? 171 SER A OG   3  
ATOM 6546  H H    . SER A 1 153 ? 0.954   23.732  -42.331 1.00 0.00 ? 171 SER A H    3  
ATOM 6547  H HA   . SER A 1 153 ? 1.060   21.226  -43.517 1.00 0.00 ? 171 SER A HA   3  
ATOM 6548  H HB3  . SER A 1 153 ? 0.003   23.859  -44.554 1.00 0.00 ? 171 SER A HB3  3  
ATOM 6549  H HG   . SER A 1 153 ? -0.809  21.414  -45.636 1.00 0.00 ? 171 SER A HG   3  
ATOM 6550  N N    . ASN A 1 154 ? 2.504   23.435  -45.501 1.00 0.00 ? 172 ASN A N    3  
ATOM 6551  C CA   . ASN A 1 154 ? 3.549   23.604  -46.504 1.00 0.00 ? 172 ASN A CA   3  
ATOM 6552  C C    . ASN A 1 154 ? 4.225   24.965  -46.361 1.00 0.00 ? 172 ASN A C    3  
ATOM 6553  O O    . ASN A 1 154 ? 3.685   25.894  -45.762 1.00 0.00 ? 172 ASN A O    3  
ATOM 6554  C CB   . ASN A 1 154 ? 2.962   23.461  -47.911 1.00 0.00 ? 172 ASN A CB   3  
ATOM 6555  C CG   . ASN A 1 154 ? 1.540   23.983  -48.001 1.00 0.00 ? 172 ASN A CG   3  
ATOM 6556  O OD1  . ASN A 1 154 ? 1.292   25.174  -47.808 1.00 0.00 ? 172 ASN A OD1  3  
ATOM 6557  N ND2  . ASN A 1 154 ? 0.601   23.092  -48.293 1.00 0.00 ? 172 ASN A ND2  3  
ATOM 6558  H H    . ASN A 1 154 ? 1.900   24.184  -45.306 1.00 0.00 ? 172 ASN A H    3  
ATOM 6559  H HA   . ASN A 1 154 ? 4.284   22.831  -46.350 1.00 0.00 ? 172 ASN A HA   3  
ATOM 6560  H HB3  . ASN A 1 154 ? 2.961   22.419  -48.190 1.00 0.00 ? 172 ASN A HB3  3  
ATOM 6561  H HD21 . ASN A 1 154 ? 0.873   22.161  -48.432 1.00 0.00 ? 172 ASN A HD21 3  
ATOM 6562  H HD22 . ASN A 1 154 ? -0.327  23.403  -48.357 1.00 0.00 ? 172 ASN A HD22 3  
ATOM 6563  N N    . PRO A 1 155 ? 5.436   25.084  -46.923 1.00 0.00 ? 173 PRO A N    3  
ATOM 6564  C CA   . PRO A 1 155 ? 6.214   26.328  -46.871 1.00 0.00 ? 173 PRO A CA   3  
ATOM 6565  C C    . PRO A 1 155 ? 5.600   27.429  -47.726 1.00 0.00 ? 173 PRO A C    3  
ATOM 6566  O O    . PRO A 1 155 ? 5.622   28.604  -47.354 1.00 0.00 ? 173 PRO A O    3  
ATOM 6567  C CB   . PRO A 1 155 ? 7.578   25.915  -47.428 1.00 0.00 ? 173 PRO A CB   3  
ATOM 6568  C CG   . PRO A 1 155 ? 7.294   24.738  -48.295 1.00 0.00 ? 173 PRO A CG   3  
ATOM 6569  C CD   . PRO A 1 155 ? 6.142   24.018  -47.651 1.00 0.00 ? 173 PRO A CD   3  
ATOM 6570  H HA   . PRO A 1 155 ? 6.330   26.682  -45.856 1.00 0.00 ? 173 PRO A HA   3  
ATOM 6571  H HB3  . PRO A 1 155 ? 8.240   25.656  -46.615 1.00 0.00 ? 173 PRO A HB3  3  
ATOM 6572  H HG3  . PRO A 1 155 ? 8.161   24.095  -48.337 1.00 0.00 ? 173 PRO A HG3  3  
ATOM 6573  H HD3  . PRO A 1 155 ? 6.504   23.260  -46.971 1.00 0.00 ? 173 PRO A HD3  3  
ATOM 6574  N N    . THR A 1 156 ? 5.052   27.047  -48.874 1.00 0.00 ? 174 THR A N    3  
ATOM 6575  C CA   . THR A 1 156 ? 4.432   28.003  -49.784 1.00 0.00 ? 174 THR A CA   3  
ATOM 6576  C C    . THR A 1 156 ? 2.913   27.897  -49.740 1.00 0.00 ? 174 THR A C    3  
ATOM 6577  O O    . THR A 1 156 ? 2.362   26.808  -49.585 1.00 0.00 ? 174 THR A O    3  
ATOM 6578  C CB   . THR A 1 156 ? 4.911   27.792  -51.232 1.00 0.00 ? 174 THR A CB   3  
ATOM 6579  O OG1  . THR A 1 156 ? 4.182   28.649  -52.118 1.00 0.00 ? 174 THR A OG1  3  
ATOM 6580  C CG2  . THR A 1 156 ? 4.727   26.343  -51.656 1.00 0.00 ? 174 THR A CG2  3  
ATOM 6581  H H    . THR A 1 156 ? 5.065   26.097  -49.116 1.00 0.00 ? 174 THR A H    3  
ATOM 6582  H HA   . THR A 1 156 ? 4.725   28.995  -49.471 1.00 0.00 ? 174 THR A HA   3  
ATOM 6583  H HB   . THR A 1 156 ? 5.961   28.038  -51.287 1.00 0.00 ? 174 THR A HB   3  
ATOM 6584  H HG1  . THR A 1 156 ? 4.624   29.500  -52.176 1.00 0.00 ? 174 THR A HG1  3  
ATOM 6585  H HG21 . THR A 1 156 ? 5.526   25.743  -51.246 1.00 0.00 ? 174 THR A HG21 3  
ATOM 6586  H HG22 . THR A 1 156 ? 4.746   26.278  -52.735 1.00 0.00 ? 174 THR A HG22 3  
ATOM 6587  H HG23 . THR A 1 156 ? 3.780   25.978  -51.291 1.00 0.00 ? 174 THR A HG23 3  
ATOM 6588  N N    . ASP A 1 157 ? 2.241   29.034  -49.881 1.00 0.00 ? 175 ASP A N    3  
ATOM 6589  C CA   . ASP A 1 157 ? 0.783   29.069  -49.860 1.00 0.00 ? 175 ASP A CA   3  
ATOM 6590  C C    . ASP A 1 157 ? 0.206   28.332  -51.064 1.00 0.00 ? 175 ASP A C    3  
ATOM 6591  O O    . ASP A 1 157 ? 0.860   28.203  -52.099 1.00 0.00 ? 175 ASP A O    3  
ATOM 6592  C CB   . ASP A 1 157 ? 0.286   30.515  -49.846 1.00 0.00 ? 175 ASP A CB   3  
ATOM 6593  C CG   . ASP A 1 157 ? 0.438   31.194  -51.193 1.00 0.00 ? 175 ASP A CG   3  
ATOM 6594  O OD1  . ASP A 1 157 ? 1.581   31.282  -51.687 1.00 0.00 ? 175 ASP A OD1  3  
ATOM 6595  O OD2  . ASP A 1 157 ? -0.588  31.637  -51.753 1.00 0.00 ? 175 ASP A OD2  3  
ATOM 6596  H H    . ASP A 1 157 ? 2.737   29.872  -50.001 1.00 0.00 ? 175 ASP A H    3  
ATOM 6597  H HA   . ASP A 1 157 ? 0.453   28.576  -48.959 1.00 0.00 ? 175 ASP A HA   3  
ATOM 6598  H HB3  . ASP A 1 157 ? 0.852   31.076  -49.114 1.00 0.00 ? 175 ASP A HB3  3  
ATOM 6599  N N    . ASP A 1 158 ? -1.025  27.851  -50.922 1.00 0.00 ? 176 ASP A N    3  
ATOM 6600  C CA   . ASP A 1 158 ? -1.691  27.125  -51.998 1.00 0.00 ? 176 ASP A CA   3  
ATOM 6601  C C    . ASP A 1 158 ? -2.716  28.014  -52.696 1.00 0.00 ? 176 ASP A C    3  
ATOM 6602  O O    . ASP A 1 158 ? -3.571  28.619  -52.050 1.00 0.00 ? 176 ASP A O    3  
ATOM 6603  C CB   . ASP A 1 158 ? -2.373  25.871  -51.451 1.00 0.00 ? 176 ASP A CB   3  
ATOM 6604  C CG   . ASP A 1 158 ? -3.601  26.194  -50.622 1.00 0.00 ? 176 ASP A CG   3  
ATOM 6605  O OD1  . ASP A 1 158 ? -3.444  26.483  -49.418 1.00 0.00 ? 176 ASP A OD1  3  
ATOM 6606  O OD2  . ASP A 1 158 ? -4.719  26.158  -51.178 1.00 0.00 ? 176 ASP A OD2  3  
ATOM 6607  H H    . ASP A 1 158 ? -1.495  27.986  -50.073 1.00 0.00 ? 176 ASP A H    3  
ATOM 6608  H HA   . ASP A 1 158 ? -0.939  26.832  -52.715 1.00 0.00 ? 176 ASP A HA   3  
ATOM 6609  H HB3  . ASP A 1 158 ? -1.674  25.331  -50.829 1.00 0.00 ? 176 ASP A HB3  3  
ATOM 6610  N N    . ASP A 1 159 ? -2.625  28.087  -54.019 1.00 0.00 ? 177 ASP A N    3  
ATOM 6611  C CA   . ASP A 1 159 ? -3.544  28.900  -54.806 1.00 0.00 ? 177 ASP A CA   3  
ATOM 6612  C C    . ASP A 1 159 ? -3.930  28.188  -56.100 1.00 0.00 ? 177 ASP A C    3  
ATOM 6613  O O    . ASP A 1 159 ? -3.364  27.149  -56.440 1.00 0.00 ? 177 ASP A O    3  
ATOM 6614  C CB   . ASP A 1 159 ? -2.914  30.256  -55.125 1.00 0.00 ? 177 ASP A CB   3  
ATOM 6615  C CG   . ASP A 1 159 ? -1.489  30.129  -55.626 1.00 0.00 ? 177 ASP A CG   3  
ATOM 6616  O OD1  . ASP A 1 159 ? -1.304  29.902  -56.841 1.00 0.00 ? 177 ASP A OD1  3  
ATOM 6617  O OD2  . ASP A 1 159 ? -0.557  30.257  -54.804 1.00 0.00 ? 177 ASP A OD2  3  
ATOM 6618  H H    . ASP A 1 159 ? -1.921  27.580  -54.479 1.00 0.00 ? 177 ASP A H    3  
ATOM 6619  H HA   . ASP A 1 159 ? -4.435  29.057  -54.218 1.00 0.00 ? 177 ASP A HA   3  
ATOM 6620  H HB3  . ASP A 1 159 ? -2.910  30.864  -54.232 1.00 0.00 ? 177 ASP A HB3  3  
ATOM 6621  N N    . VAL A 1 160 ? -4.898  28.752  -56.815 1.00 0.00 ? 178 VAL A N    3  
ATOM 6622  C CA   . VAL A 1 160 ? -5.359  28.173  -58.070 1.00 0.00 ? 178 VAL A CA   3  
ATOM 6623  C C    . VAL A 1 160 ? -4.360  28.426  -59.193 1.00 0.00 ? 178 VAL A C    3  
ATOM 6624  O O    . VAL A 1 160 ? -3.846  27.490  -59.804 1.00 0.00 ? 178 VAL A O    3  
ATOM 6625  C CB   . VAL A 1 160 ? -6.731  28.740  -58.480 1.00 0.00 ? 178 VAL A CB   3  
ATOM 6626  C CG1  . VAL A 1 160 ? -6.623  30.225  -58.792 1.00 0.00 ? 178 VAL A CG1  3  
ATOM 6627  C CG2  . VAL A 1 160 ? -7.289  27.976  -59.670 1.00 0.00 ? 178 VAL A CG2  3  
ATOM 6628  H H    . VAL A 1 160 ? -5.310  29.580  -56.490 1.00 0.00 ? 178 VAL A H    3  
ATOM 6629  H HA   . VAL A 1 160 ? -5.463  27.108  -57.926 1.00 0.00 ? 178 VAL A HA   3  
ATOM 6630  H HB   . VAL A 1 160 ? -7.411  28.619  -57.649 1.00 0.00 ? 178 VAL A HB   3  
ATOM 6631  H HG11 . VAL A 1 160 ? -7.588  30.599  -59.101 1.00 0.00 ? 178 VAL A HG11 3  
ATOM 6632  H HG12 . VAL A 1 160 ? -6.294  30.756  -57.910 1.00 0.00 ? 178 VAL A HG12 3  
ATOM 6633  H HG13 . VAL A 1 160 ? -5.908  30.373  -59.589 1.00 0.00 ? 178 VAL A HG13 3  
ATOM 6634  H HG21 . VAL A 1 160 ? -6.481  27.700  -60.331 1.00 0.00 ? 178 VAL A HG21 3  
ATOM 6635  H HG22 . VAL A 1 160 ? -7.790  27.083  -59.323 1.00 0.00 ? 178 VAL A HG22 3  
ATOM 6636  H HG23 . VAL A 1 160 ? -7.993  28.600  -60.201 1.00 0.00 ? 178 VAL A HG23 3  
ATOM 6637  N N    . GLN A 1 3   ? 7.340   -12.267 6.332   1.00 0.00 ? 21  GLN A N    4  
ATOM 6638  C CA   . GLN A 1 3   ? 8.042   -11.394 5.398   1.00 0.00 ? 21  GLN A CA   4  
ATOM 6639  C C    . GLN A 1 3   ? 7.115   -10.943 4.273   1.00 0.00 ? 21  GLN A C    4  
ATOM 6640  O O    . GLN A 1 3   ? 6.786   -11.722 3.379   1.00 0.00 ? 21  GLN A O    4  
ATOM 6641  C CB   . GLN A 1 3   ? 9.261   -12.110 4.817   1.00 0.00 ? 21  GLN A CB   4  
ATOM 6642  C CG   . GLN A 1 3   ? 10.361  -11.165 4.362   1.00 0.00 ? 21  GLN A CG   4  
ATOM 6643  C CD   . GLN A 1 3   ? 11.243  -10.702 5.506   1.00 0.00 ? 21  GLN A CD   4  
ATOM 6644  O OE1  . GLN A 1 3   ? 11.095  -9.587  6.006   1.00 0.00 ? 21  GLN A OE1  4  
ATOM 6645  N NE2  . GLN A 1 3   ? 12.166  -11.558 5.927   1.00 0.00 ? 21  GLN A NE2  4  
ATOM 6646  H H    . GLN A 1 3   ? 7.038   -13.147 6.028   1.00 0.00 ? 21  GLN A H    4  
ATOM 6647  H HA   . GLN A 1 3   ? 8.373   -10.523 5.944   1.00 0.00 ? 21  GLN A HA   4  
ATOM 6648  H HB3  . GLN A 1 3   ? 8.946   -12.697 3.966   1.00 0.00 ? 21  GLN A HB3  4  
ATOM 6649  H HG3  . GLN A 1 3   ? 9.908   -10.299 3.903   1.00 0.00 ? 21  GLN A HG3  4  
ATOM 6650  H HE21 . GLN A 1 3   ? 12.227  -12.428 5.480   1.00 0.00 ? 21  GLN A HE21 4  
ATOM 6651  H HE22 . GLN A 1 3   ? 12.749  -11.285 6.664   1.00 0.00 ? 21  GLN A HE22 4  
ATOM 6652  N N    . ILE A 1 4   ? 6.700   -9.683  4.325   1.00 0.00 ? 22  ILE A N    4  
ATOM 6653  C CA   . ILE A 1 4   ? 5.812   -9.129  3.310   1.00 0.00 ? 22  ILE A CA   4  
ATOM 6654  C C    . ILE A 1 4   ? 6.464   -7.954  2.590   1.00 0.00 ? 22  ILE A C    4  
ATOM 6655  O O    . ILE A 1 4   ? 7.147   -7.136  3.208   1.00 0.00 ? 22  ILE A O    4  
ATOM 6656  C CB   . ILE A 1 4   ? 4.477   -8.664  3.922   1.00 0.00 ? 22  ILE A CB   4  
ATOM 6657  C CG1  . ILE A 1 4   ? 3.675   -9.866  4.425   1.00 0.00 ? 22  ILE A CG1  4  
ATOM 6658  C CG2  . ILE A 1 4   ? 3.672   -7.874  2.900   1.00 0.00 ? 22  ILE A CG2  4  
ATOM 6659  C CD1  . ILE A 1 4   ? 3.239   -10.806 3.322   1.00 0.00 ? 22  ILE A CD1  4  
ATOM 6660  H H    . ILE A 1 4   ? 6.996   -9.111  5.064   1.00 0.00 ? 22  ILE A H    4  
ATOM 6661  H HA   . ILE A 1 4   ? 5.603   -9.907  2.590   1.00 0.00 ? 22  ILE A HA   4  
ATOM 6662  H HB   . ILE A 1 4   ? 4.694   -8.011  4.754   1.00 0.00 ? 22  ILE A HB   4  
ATOM 6663  H HG13 . ILE A 1 4   ? 2.788   -9.511  4.930   1.00 0.00 ? 22  ILE A HG13 4  
ATOM 6664  H HG21 . ILE A 1 4   ? 4.170   -6.937  2.697   1.00 0.00 ? 22  ILE A HG21 4  
ATOM 6665  H HG22 . ILE A 1 4   ? 3.595   -8.444  1.986   1.00 0.00 ? 22  ILE A HG22 4  
ATOM 6666  H HG23 . ILE A 1 4   ? 2.685   -7.681  3.290   1.00 0.00 ? 22  ILE A HG23 4  
ATOM 6667  H HD11 . ILE A 1 4   ? 2.163   -10.901 3.336   1.00 0.00 ? 22  ILE A HD11 4  
ATOM 6668  H HD12 . ILE A 1 4   ? 3.555   -10.413 2.368   1.00 0.00 ? 22  ILE A HD12 4  
ATOM 6669  H HD13 . ILE A 1 4   ? 3.688   -11.777 3.479   1.00 0.00 ? 22  ILE A HD13 4  
ATOM 6670  N N    . ASP A 1 5   ? 6.250   -7.876  1.282   1.00 0.00 ? 23  ASP A N    4  
ATOM 6671  C CA   . ASP A 1 5   ? 6.815   -6.799  0.477   1.00 0.00 ? 23  ASP A CA   4  
ATOM 6672  C C    . ASP A 1 5   ? 5.718   -6.028  -0.249  1.00 0.00 ? 23  ASP A C    4  
ATOM 6673  O O    . ASP A 1 5   ? 4.665   -6.581  -0.569  1.00 0.00 ? 23  ASP A O    4  
ATOM 6674  C CB   . ASP A 1 5   ? 7.815   -7.361  -0.535  1.00 0.00 ? 23  ASP A CB   4  
ATOM 6675  C CG   . ASP A 1 5   ? 9.028   -6.467  -0.710  1.00 0.00 ? 23  ASP A CG   4  
ATOM 6676  O OD1  . ASP A 1 5   ? 9.962   -6.567  0.111   1.00 0.00 ? 23  ASP A OD1  4  
ATOM 6677  O OD2  . ASP A 1 5   ? 9.040   -5.666  -1.669  1.00 0.00 ? 23  ASP A OD2  4  
ATOM 6678  H H    . ASP A 1 5   ? 5.698   -8.559  0.846   1.00 0.00 ? 23  ASP A H    4  
ATOM 6679  H HA   . ASP A 1 5   ? 7.333   -6.124  1.142   1.00 0.00 ? 23  ASP A HA   4  
ATOM 6680  H HB3  . ASP A 1 5   ? 7.327   -7.468  -1.492  1.00 0.00 ? 23  ASP A HB3  4  
ATOM 6681  N N    . LEU A 1 6   ? 5.969   -4.749  -0.502  1.00 0.00 ? 24  LEU A N    4  
ATOM 6682  C CA   . LEU A 1 6   ? 5.000   -3.900  -1.189  1.00 0.00 ? 24  LEU A CA   4  
ATOM 6683  C C    . LEU A 1 6   ? 5.706   -2.850  -2.042  1.00 0.00 ? 24  LEU A C    4  
ATOM 6684  O O    . LEU A 1 6   ? 6.932   -2.759  -2.043  1.00 0.00 ? 24  LEU A O    4  
ATOM 6685  C CB   . LEU A 1 6   ? 4.082   -3.217  -0.175  1.00 0.00 ? 24  LEU A CB   4  
ATOM 6686  C CG   . LEU A 1 6   ? 3.173   -4.141  0.636   1.00 0.00 ? 24  LEU A CG   4  
ATOM 6687  C CD1  . LEU A 1 6   ? 3.777   -4.420  2.003   1.00 0.00 ? 24  LEU A CD1  4  
ATOM 6688  C CD2  . LEU A 1 6   ? 1.785   -3.534  0.778   1.00 0.00 ? 24  LEU A CD2  4  
ATOM 6689  H H    . LEU A 1 6   ? 6.826   -4.364  -0.222  1.00 0.00 ? 24  LEU A H    4  
ATOM 6690  H HA   . LEU A 1 6   ? 4.407   -4.531  -1.834  1.00 0.00 ? 24  LEU A HA   4  
ATOM 6691  H HB3  . LEU A 1 6   ? 3.454   -2.522  -0.714  1.00 0.00 ? 24  LEU A HB3  4  
ATOM 6692  H HG   . LEU A 1 6   ? 3.075   -5.085  0.118   1.00 0.00 ? 24  LEU A HG   4  
ATOM 6693  H HD11 . LEU A 1 6   ? 4.763   -4.841  1.882   1.00 0.00 ? 24  LEU A HD11 4  
ATOM 6694  H HD12 . LEU A 1 6   ? 3.151   -5.119  2.538   1.00 0.00 ? 24  LEU A HD12 4  
ATOM 6695  H HD13 . LEU A 1 6   ? 3.845   -3.498  2.561   1.00 0.00 ? 24  LEU A HD13 4  
ATOM 6696  H HD21 . LEU A 1 6   ? 1.225   -4.085  1.520   1.00 0.00 ? 24  LEU A HD21 4  
ATOM 6697  H HD22 . LEU A 1 6   ? 1.271   -3.583  -0.171  1.00 0.00 ? 24  LEU A HD22 4  
ATOM 6698  H HD23 . LEU A 1 6   ? 1.873   -2.503  1.088   1.00 0.00 ? 24  LEU A HD23 4  
ATOM 6699  N N    . ASN A 1 7   ? 4.920   -2.058  -2.763  1.00 0.00 ? 25  ASN A N    4  
ATOM 6700  C CA   . ASN A 1 7   ? 5.469   -1.012  -3.620  1.00 0.00 ? 25  ASN A CA   4  
ATOM 6701  C C    . ASN A 1 7   ? 4.514   0.175   -3.709  1.00 0.00 ? 25  ASN A C    4  
ATOM 6702  O O    . ASN A 1 7   ? 3.295   0.008   -3.662  1.00 0.00 ? 25  ASN A O    4  
ATOM 6703  C CB   . ASN A 1 7   ? 5.748   -1.564  -5.019  1.00 0.00 ? 25  ASN A CB   4  
ATOM 6704  C CG   . ASN A 1 7   ? 6.335   -2.961  -4.984  1.00 0.00 ? 25  ASN A CG   4  
ATOM 6705  O OD1  . ASN A 1 7   ? 7.553   -3.136  -5.011  1.00 0.00 ? 25  ASN A OD1  4  
ATOM 6706  N ND2  . ASN A 1 7   ? 5.468   -3.965  -4.923  1.00 0.00 ? 25  ASN A ND2  4  
ATOM 6707  H H    . ASN A 1 7   ? 3.948   -2.180  -2.721  1.00 0.00 ? 25  ASN A H    4  
ATOM 6708  H HA   . ASN A 1 7   ? 6.399   -0.680  -3.182  1.00 0.00 ? 25  ASN A HA   4  
ATOM 6709  H HB3  . ASN A 1 7   ? 6.444   -0.912  -5.526  1.00 0.00 ? 25  ASN A HB3  4  
ATOM 6710  H HD21 . ASN A 1 7   ? 4.512   -3.752  -4.905  1.00 0.00 ? 25  ASN A HD21 4  
ATOM 6711  H HD22 . ASN A 1 7   ? 5.821   -4.881  -4.898  1.00 0.00 ? 25  ASN A HD22 4  
ATOM 6712  N N    . ILE A 1 8   ? 5.078   1.371   -3.838  1.00 0.00 ? 26  ILE A N    4  
ATOM 6713  C CA   . ILE A 1 8   ? 4.276   2.585   -3.937  1.00 0.00 ? 26  ILE A CA   4  
ATOM 6714  C C    . ILE A 1 8   ? 4.568   3.333   -5.233  1.00 0.00 ? 26  ILE A C    4  
ATOM 6715  O O    . ILE A 1 8   ? 5.711   3.704   -5.505  1.00 0.00 ? 26  ILE A O    4  
ATOM 6716  C CB   . ILE A 1 8   ? 4.532   3.526   -2.744  1.00 0.00 ? 26  ILE A CB   4  
ATOM 6717  C CG1  . ILE A 1 8   ? 4.589   2.728   -1.441  1.00 0.00 ? 26  ILE A CG1  4  
ATOM 6718  C CG2  . ILE A 1 8   ? 3.451   4.594   -2.672  1.00 0.00 ? 26  ILE A CG2  4  
ATOM 6719  C CD1  . ILE A 1 8   ? 3.347   1.904   -1.179  1.00 0.00 ? 26  ILE A CD1  4  
ATOM 6720  H H    . ILE A 1 8   ? 6.055   1.439   -3.870  1.00 0.00 ? 26  ILE A H    4  
ATOM 6721  H HA   . ILE A 1 8   ? 3.234   2.297   -3.926  1.00 0.00 ? 26  ILE A HA   4  
ATOM 6722  H HB   . ILE A 1 8   ? 5.480   4.017   -2.899  1.00 0.00 ? 26  ILE A HB   4  
ATOM 6723  H HG13 . ILE A 1 8   ? 4.714   3.412   -0.614  1.00 0.00 ? 26  ILE A HG13 4  
ATOM 6724  H HG21 . ILE A 1 8   ? 3.575   5.288   -3.488  1.00 0.00 ? 26  ILE A HG21 4  
ATOM 6725  H HG22 . ILE A 1 8   ? 2.480   4.128   -2.742  1.00 0.00 ? 26  ILE A HG22 4  
ATOM 6726  H HG23 . ILE A 1 8   ? 3.529   5.123   -1.734  1.00 0.00 ? 26  ILE A HG23 4  
ATOM 6727  H HD11 . ILE A 1 8   ? 2.995   2.091   -0.177  1.00 0.00 ? 26  ILE A HD11 4  
ATOM 6728  H HD12 . ILE A 1 8   ? 2.580   2.176   -1.889  1.00 0.00 ? 26  ILE A HD12 4  
ATOM 6729  H HD13 . ILE A 1 8   ? 3.583   0.855   -1.288  1.00 0.00 ? 26  ILE A HD13 4  
ATOM 6730  N N    . THR A 1 9   ? 3.528   3.555   -6.030  1.00 0.00 ? 27  THR A N    4  
ATOM 6731  C CA   . THR A 1 9   ? 3.671   4.260   -7.297  1.00 0.00 ? 27  THR A CA   4  
ATOM 6732  C C    . THR A 1 9   ? 3.732   5.768   -7.083  1.00 0.00 ? 27  THR A C    4  
ATOM 6733  O O    . THR A 1 9   ? 3.787   6.243   -5.949  1.00 0.00 ? 27  THR A O    4  
ATOM 6734  C CB   . THR A 1 9   ? 2.511   3.935   -8.256  1.00 0.00 ? 27  THR A CB   4  
ATOM 6735  O OG1  . THR A 1 9   ? 2.836   4.366   -9.582  1.00 0.00 ? 27  THR A OG1  4  
ATOM 6736  C CG2  . THR A 1 9   ? 1.226   4.610   -7.799  1.00 0.00 ? 27  THR A CG2  4  
ATOM 6737  H H    . THR A 1 9   ? 2.642   3.235   -5.758  1.00 0.00 ? 27  THR A H    4  
ATOM 6738  H HA   . THR A 1 9   ? 4.593   3.934   -7.758  1.00 0.00 ? 27  THR A HA   4  
ATOM 6739  H HB   . THR A 1 9   ? 2.356   2.866   -8.260  1.00 0.00 ? 27  THR A HB   4  
ATOM 6740  H HG1  . THR A 1 9   ? 2.999   3.600   -10.137 1.00 0.00 ? 27  THR A HG1  4  
ATOM 6741  H HG21 . THR A 1 9   ? 1.006   4.311   -6.784  1.00 0.00 ? 27  THR A HG21 4  
ATOM 6742  H HG22 . THR A 1 9   ? 0.414   4.312   -8.445  1.00 0.00 ? 27  THR A HG22 4  
ATOM 6743  H HG23 . THR A 1 9   ? 1.348   5.681   -7.841  1.00 0.00 ? 27  THR A HG23 4  
ATOM 6744  N N    . CYS A 1 10  ? 3.719   6.518   -8.180  1.00 0.00 ? 28  CYS A N    4  
ATOM 6745  C CA   . CYS A 1 10  ? 3.773   7.973   -8.113  1.00 0.00 ? 28  CYS A CA   4  
ATOM 6746  C C    . CYS A 1 10  ? 2.624   8.521   -7.271  1.00 0.00 ? 28  CYS A C    4  
ATOM 6747  O O    . CYS A 1 10  ? 1.503   8.015   -7.326  1.00 0.00 ? 28  CYS A O    4  
ATOM 6748  C CB   . CYS A 1 10  ? 3.718   8.572   -9.521  1.00 0.00 ? 28  CYS A CB   4  
ATOM 6749  S SG   . CYS A 1 10  ? 4.967   7.900   -10.663 1.00 0.00 ? 28  CYS A SG   4  
ATOM 6750  H H    . CYS A 1 10  ? 3.674   6.081   -9.058  1.00 0.00 ? 28  CYS A H    4  
ATOM 6751  H HA   . CYS A 1 10  ? 4.706   8.251   -7.650  1.00 0.00 ? 28  CYS A HA   4  
ATOM 6752  H HB3  . CYS A 1 10  ? 3.871   9.639   -9.456  1.00 0.00 ? 28  CYS A HB3  4  
ATOM 6753  N N    . ARG A 1 11  ? 2.912   9.559   -6.491  1.00 0.00 ? 29  ARG A N    4  
ATOM 6754  C CA   . ARG A 1 11  ? 1.904   10.175  -5.637  1.00 0.00 ? 29  ARG A CA   4  
ATOM 6755  C C    . ARG A 1 11  ? 1.077   11.191  -6.419  1.00 0.00 ? 29  ARG A C    4  
ATOM 6756  O O    . ARG A 1 11  ? 1.573   12.252  -6.798  1.00 0.00 ? 29  ARG A O    4  
ATOM 6757  C CB   . ARG A 1 11  ? 2.569   10.856  -4.439  1.00 0.00 ? 29  ARG A CB   4  
ATOM 6758  C CG   . ARG A 1 11  ? 3.238   9.884   -3.481  1.00 0.00 ? 29  ARG A CG   4  
ATOM 6759  C CD   . ARG A 1 11  ? 3.995   10.616  -2.383  1.00 0.00 ? 29  ARG A CD   4  
ATOM 6760  N NE   . ARG A 1 11  ? 4.599   9.693   -1.426  1.00 0.00 ? 29  ARG A NE   4  
ATOM 6761  C CZ   . ARG A 1 11  ? 5.595   10.027  -0.613  1.00 0.00 ? 29  ARG A CZ   4  
ATOM 6762  N NH1  . ARG A 1 11  ? 6.097   11.254  -0.641  1.00 0.00 ? 29  ARG A NH1  4  
ATOM 6763  N NH2  . ARG A 1 11  ? 6.092   9.132   0.231   1.00 0.00 ? 29  ARG A NH2  4  
ATOM 6764  H H    . ARG A 1 11  ? 3.824   9.917   -6.491  1.00 0.00 ? 29  ARG A H    4  
ATOM 6765  H HA   . ARG A 1 11  ? 1.250   9.395   -5.280  1.00 0.00 ? 29  ARG A HA   4  
ATOM 6766  H HB3  . ARG A 1 11  ? 1.819   11.407  -3.892  1.00 0.00 ? 29  ARG A HB3  4  
ATOM 6767  H HG3  . ARG A 1 11  ? 3.932   9.268   -4.035  1.00 0.00 ? 29  ARG A HG3  4  
ATOM 6768  H HD3  . ARG A 1 11  ? 3.306   11.264  -1.861  1.00 0.00 ? 29  ARG A HD3  4  
ATOM 6769  H HE   . ARG A 1 11  ? 4.244   8.782   -1.388  1.00 0.00 ? 29  ARG A HE   4  
ATOM 6770  H HH11 . ARG A 1 11  ? 5.724   11.930  -1.275  1.00 0.00 ? 29  ARG A HH11 4  
ATOM 6771  H HH12 . ARG A 1 11  ? 6.846   11.503  -0.028  1.00 0.00 ? 29  ARG A HH12 4  
ATOM 6772  H HH21 . ARG A 1 11  ? 5.716   8.206   0.256   1.00 0.00 ? 29  ARG A HH21 4  
ATOM 6773  H HH22 . ARG A 1 11  ? 6.842   9.383   0.842   1.00 0.00 ? 29  ARG A HH22 4  
ATOM 6774  N N    . PHE A 1 12  ? -0.188  10.858  -6.657  1.00 0.00 ? 30  PHE A N    4  
ATOM 6775  C CA   . PHE A 1 12  ? -1.085  11.741  -7.393  1.00 0.00 ? 30  PHE A CA   4  
ATOM 6776  C C    . PHE A 1 12  ? -1.810  12.693  -6.447  1.00 0.00 ? 30  PHE A C    4  
ATOM 6777  O O    . PHE A 1 12  ? -2.715  12.290  -5.717  1.00 0.00 ? 30  PHE A O    4  
ATOM 6778  C CB   . PHE A 1 12  ? -2.103  10.921  -8.189  1.00 0.00 ? 30  PHE A CB   4  
ATOM 6779  C CG   . PHE A 1 12  ? -1.531  10.295  -9.428  1.00 0.00 ? 30  PHE A CG   4  
ATOM 6780  C CD1  . PHE A 1 12  ? -1.026  11.084  -10.448 1.00 0.00 ? 30  PHE A CD1  4  
ATOM 6781  C CD2  . PHE A 1 12  ? -1.499  8.917   -9.573  1.00 0.00 ? 30  PHE A CD2  4  
ATOM 6782  C CE1  . PHE A 1 12  ? -0.500  10.511  -11.591 1.00 0.00 ? 30  PHE A CE1  4  
ATOM 6783  C CE2  . PHE A 1 12  ? -0.974  8.339   -10.714 1.00 0.00 ? 30  PHE A CE2  4  
ATOM 6784  C CZ   . PHE A 1 12  ? -0.472  9.137   -11.724 1.00 0.00 ? 30  PHE A CZ   4  
ATOM 6785  H H    . PHE A 1 12  ? -0.526  9.999   -6.329  1.00 0.00 ? 30  PHE A H    4  
ATOM 6786  H HA   . PHE A 1 12  ? -0.486  12.320  -8.080  1.00 0.00 ? 30  PHE A HA   4  
ATOM 6787  H HB3  . PHE A 1 12  ? -2.918  11.563  -8.485  1.00 0.00 ? 30  PHE A HB3  4  
ATOM 6788  H HD1  . PHE A 1 12  ? -1.045  12.160  -10.347 1.00 0.00 ? 30  PHE A HD1  4  
ATOM 6789  H HD2  . PHE A 1 12  ? -1.890  8.291   -8.784  1.00 0.00 ? 30  PHE A HD2  4  
ATOM 6790  H HE1  . PHE A 1 12  ? -0.109  11.137  -12.379 1.00 0.00 ? 30  PHE A HE1  4  
ATOM 6791  H HE2  . PHE A 1 12  ? -0.954  7.263   -10.813 1.00 0.00 ? 30  PHE A HE2  4  
ATOM 6792  H HZ   . PHE A 1 12  ? -0.063  8.686   -12.616 1.00 0.00 ? 30  PHE A HZ   4  
ATOM 6793  N N    . ALA A 1 13  ? -1.404  13.959  -6.466  1.00 0.00 ? 31  ALA A N    4  
ATOM 6794  C CA   . ALA A 1 13  ? -2.016  14.969  -5.612  1.00 0.00 ? 31  ALA A CA   4  
ATOM 6795  C C    . ALA A 1 13  ? -1.993  14.539  -4.149  1.00 0.00 ? 31  ALA A C    4  
ATOM 6796  O O    . ALA A 1 13  ? -2.836  14.954  -3.356  1.00 0.00 ? 31  ALA A O    4  
ATOM 6797  C CB   . ALA A 1 13  ? -3.443  15.246  -6.060  1.00 0.00 ? 31  ALA A CB   4  
ATOM 6798  H H    . ALA A 1 13  ? -0.678  14.220  -7.070  1.00 0.00 ? 31  ALA A H    4  
ATOM 6799  H HA   . ALA A 1 13  ? -1.448  15.884  -5.717  1.00 0.00 ? 31  ALA A HA   4  
ATOM 6800  H HB1  . ALA A 1 13  ? -4.034  14.349  -5.948  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 6801  H HB2  . ALA A 1 13  ? -3.864  16.034  -5.453  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 6802  H HB3  . ALA A 1 13  ? -3.442  15.550  -7.096  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 6803  N N    . GLY A 1 14  ? -1.020  13.703  -3.798  1.00 0.00 ? 32  GLY A N    4  
ATOM 6804  C CA   . GLY A 1 14  ? -0.906  13.229  -2.431  1.00 0.00 ? 32  GLY A CA   4  
ATOM 6805  C C    . GLY A 1 14  ? -1.490  11.842  -2.247  1.00 0.00 ? 32  GLY A C    4  
ATOM 6806  O O    . GLY A 1 14  ? -1.093  11.108  -1.343  1.00 0.00 ? 32  GLY A O    4  
ATOM 6807  H H    . GLY A 1 14  ? -0.375  13.405  -4.473  1.00 0.00 ? 32  GLY A H    4  
ATOM 6808  H HA2  . GLY A 1 14  ? 0.138   13.209  -2.155  1.00 0.00 ? 32  GLY A HA2  4  
ATOM 6809  H HA3  . GLY A 1 14  ? -1.427  13.916  -1.780  1.00 0.00 ? 32  GLY A HA3  4  
ATOM 6810  N N    . VAL A 1 15  ? -2.438  11.483  -3.107  1.00 0.00 ? 33  VAL A N    4  
ATOM 6811  C CA   . VAL A 1 15  ? -3.079  10.175  -3.036  1.00 0.00 ? 33  VAL A CA   4  
ATOM 6812  C C    . VAL A 1 15  ? -2.328  9.149   -3.877  1.00 0.00 ? 33  VAL A C    4  
ATOM 6813  O O    . VAL A 1 15  ? -1.853  9.455   -4.970  1.00 0.00 ? 33  VAL A O    4  
ATOM 6814  C CB   . VAL A 1 15  ? -4.542  10.241  -3.510  1.00 0.00 ? 33  VAL A CB   4  
ATOM 6815  C CG1  . VAL A 1 15  ? -5.183  8.861   -3.458  1.00 0.00 ? 33  VAL A CG1  4  
ATOM 6816  C CG2  . VAL A 1 15  ? -5.330  11.234  -2.670  1.00 0.00 ? 33  VAL A CG2  4  
ATOM 6817  H H    . VAL A 1 15  ? -2.712  12.111  -3.807  1.00 0.00 ? 33  VAL A H    4  
ATOM 6818  H HA   . VAL A 1 15  ? -3.070  9.855   -2.004  1.00 0.00 ? 33  VAL A HA   4  
ATOM 6819  H HB   . VAL A 1 15  ? -4.553  10.580  -4.536  1.00 0.00 ? 33  VAL A HB   4  
ATOM 6820  H HG11 . VAL A 1 15  ? -4.991  8.341   -4.385  1.00 0.00 ? 33  VAL A HG11 4  
ATOM 6821  H HG12 . VAL A 1 15  ? -4.765  8.301   -2.635  1.00 0.00 ? 33  VAL A HG12 4  
ATOM 6822  H HG13 . VAL A 1 15  ? -6.249  8.965   -3.319  1.00 0.00 ? 33  VAL A HG13 4  
ATOM 6823  H HG21 . VAL A 1 15  ? -5.209  10.997  -1.624  1.00 0.00 ? 33  VAL A HG21 4  
ATOM 6824  H HG22 . VAL A 1 15  ? -4.963  12.234  -2.855  1.00 0.00 ? 33  VAL A HG22 4  
ATOM 6825  H HG23 . VAL A 1 15  ? -6.376  11.181  -2.934  1.00 0.00 ? 33  VAL A HG23 4  
ATOM 6826  N N    . PHE A 1 16  ? -2.228  7.927   -3.361  1.00 0.00 ? 34  PHE A N    4  
ATOM 6827  C CA   . PHE A 1 16  ? -1.534  6.856   -4.065  1.00 0.00 ? 34  PHE A CA   4  
ATOM 6828  C C    . PHE A 1 16  ? -2.035  5.489   -3.602  1.00 0.00 ? 34  PHE A C    4  
ATOM 6829  O O    . PHE A 1 16  ? -2.619  5.363   -2.525  1.00 0.00 ? 34  PHE A O    4  
ATOM 6830  C CB   . PHE A 1 16  ? -0.025  6.961   -3.842  1.00 0.00 ? 34  PHE A CB   4  
ATOM 6831  C CG   . PHE A 1 16  ? 0.360   7.099   -2.397  1.00 0.00 ? 34  PHE A CG   4  
ATOM 6832  C CD1  . PHE A 1 16  ? 0.352   8.339   -1.779  1.00 0.00 ? 34  PHE A CD1  4  
ATOM 6833  C CD2  . PHE A 1 16  ? 0.728   5.987   -1.656  1.00 0.00 ? 34  PHE A CD2  4  
ATOM 6834  C CE1  . PHE A 1 16  ? 0.705   8.468   -0.448  1.00 0.00 ? 34  PHE A CE1  4  
ATOM 6835  C CE2  . PHE A 1 16  ? 1.081   6.111   -0.325  1.00 0.00 ? 34  PHE A CE2  4  
ATOM 6836  C CZ   . PHE A 1 16  ? 1.070   7.353   0.278   1.00 0.00 ? 34  PHE A CZ   4  
ATOM 6837  H H    . PHE A 1 16  ? -2.627  7.745   -2.485  1.00 0.00 ? 34  PHE A H    4  
ATOM 6838  H HA   . PHE A 1 16  ? -1.743  6.963   -5.118  1.00 0.00 ? 34  PHE A HA   4  
ATOM 6839  H HB3  . PHE A 1 16  ? 0.350   7.826   -4.369  1.00 0.00 ? 34  PHE A HB3  4  
ATOM 6840  H HD1  . PHE A 1 16  ? 0.067   9.213   -2.347  1.00 0.00 ? 34  PHE A HD1  4  
ATOM 6841  H HD2  . PHE A 1 16  ? 0.738   5.016   -2.126  1.00 0.00 ? 34  PHE A HD2  4  
ATOM 6842  H HE1  . PHE A 1 16  ? 0.696   9.441   0.020   1.00 0.00 ? 34  PHE A HE1  4  
ATOM 6843  H HE2  . PHE A 1 16  ? 1.367   5.237   0.242   1.00 0.00 ? 34  PHE A HE2  4  
ATOM 6844  H HZ   . PHE A 1 16  ? 1.345   7.452   1.319   1.00 0.00 ? 34  PHE A HZ   4  
ATOM 6845  N N    . HIS A 1 17  ? -1.797  4.470   -4.422  1.00 0.00 ? 35  HIS A N    4  
ATOM 6846  C CA   . HIS A 1 17  ? -2.222  3.114   -4.096  1.00 0.00 ? 35  HIS A CA   4  
ATOM 6847  C C    . HIS A 1 17  ? -1.022  2.237   -3.750  1.00 0.00 ? 35  HIS A C    4  
ATOM 6848  O O    . HIS A 1 17  ? 0.017   2.299   -4.407  1.00 0.00 ? 35  HIS A O    4  
ATOM 6849  C CB   . HIS A 1 17  ? -2.992  2.503   -5.267  1.00 0.00 ? 35  HIS A CB   4  
ATOM 6850  C CG   . HIS A 1 17  ? -2.109  1.952   -6.344  1.00 0.00 ? 35  HIS A CG   4  
ATOM 6851  N ND1  . HIS A 1 17  ? -1.202  2.723   -7.041  1.00 0.00 ? 35  HIS A ND1  4  
ATOM 6852  C CD2  . HIS A 1 17  ? -1.996  0.698   -6.840  1.00 0.00 ? 35  HIS A CD2  4  
ATOM 6853  C CE1  . HIS A 1 17  ? -0.570  1.967   -7.920  1.00 0.00 ? 35  HIS A CE1  4  
ATOM 6854  N NE2  . HIS A 1 17  ? -1.032  0.734   -7.819  1.00 0.00 ? 35  HIS A NE2  4  
ATOM 6855  H H    . HIS A 1 17  ? -1.326  4.635   -5.264  1.00 0.00 ? 35  HIS A H    4  
ATOM 6856  H HA   . HIS A 1 17  ? -2.873  3.167   -3.237  1.00 0.00 ? 35  HIS A HA   4  
ATOM 6857  H HB3  . HIS A 1 17  ? -3.623  3.261   -5.709  1.00 0.00 ? 35  HIS A HB3  4  
ATOM 6858  H HD1  . HIS A 1 17  ? -1.047  3.681   -6.911  1.00 0.00 ? 35  HIS A HD1  4  
ATOM 6859  H HD2  . HIS A 1 17  ? -2.557  -0.170  -6.526  1.00 0.00 ? 35  HIS A HD2  4  
ATOM 6860  H HE1  . HIS A 1 17  ? 0.195   2.299   -8.606  1.00 0.00 ? 35  HIS A HE1  4  
ATOM 6861  N N    . VAL A 1 18  ? -1.173  1.420   -2.711  1.00 0.00 ? 36  VAL A N    4  
ATOM 6862  C CA   . VAL A 1 18  ? -0.103  0.531   -2.277  1.00 0.00 ? 36  VAL A CA   4  
ATOM 6863  C C    . VAL A 1 18  ? -0.334  -0.892  -2.773  1.00 0.00 ? 36  VAL A C    4  
ATOM 6864  O O    . VAL A 1 18  ? -1.402  -1.466  -2.563  1.00 0.00 ? 36  VAL A O    4  
ATOM 6865  C CB   . VAL A 1 18  ? 0.024   0.513   -0.742  1.00 0.00 ? 36  VAL A CB   4  
ATOM 6866  C CG1  . VAL A 1 18  ? 1.120   -0.447  -0.308  1.00 0.00 ? 36  VAL A CG1  4  
ATOM 6867  C CG2  . VAL A 1 18  ? 0.290   1.913   -0.213  1.00 0.00 ? 36  VAL A CG2  4  
ATOM 6868  H H    . VAL A 1 18  ? -2.024  1.415   -2.226  1.00 0.00 ? 36  VAL A H    4  
ATOM 6869  H HA   . VAL A 1 18  ? 0.826   0.899   -2.689  1.00 0.00 ? 36  VAL A HA   4  
ATOM 6870  H HB   . VAL A 1 18  ? -0.913  0.166   -0.328  1.00 0.00 ? 36  VAL A HB   4  
ATOM 6871  H HG11 . VAL A 1 18  ? 1.375   -0.261  0.725   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 6872  H HG12 . VAL A 1 18  ? 0.774   -1.464  -0.415  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 6873  H HG13 . VAL A 1 18  ? 1.995   -0.298  -0.925  1.00 0.00 ? 36  VAL A HG13 4  
ATOM 6874  H HG21 . VAL A 1 18  ? 0.943   1.856   0.645   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 6875  H HG22 . VAL A 1 18  ? 0.761   2.507   -0.983  1.00 0.00 ? 36  VAL A HG22 4  
ATOM 6876  H HG23 . VAL A 1 18  ? -0.644  2.373   0.075   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 6877  N N    . GLU A 1 19  ? 0.673   -1.453  -3.435  1.00 0.00 ? 37  GLU A N    4  
ATOM 6878  C CA   . GLU A 1 19  ? 0.578   -2.809  -3.962  1.00 0.00 ? 37  GLU A CA   4  
ATOM 6879  C C    . GLU A 1 19  ? 1.483   -3.761  -3.183  1.00 0.00 ? 37  GLU A C    4  
ATOM 6880  O O    . GLU A 1 19  ? 2.511   -3.355  -2.643  1.00 0.00 ? 37  GLU A O    4  
ATOM 6881  C CB   . GLU A 1 19  ? 0.953   -2.831  -5.446  1.00 0.00 ? 37  GLU A CB   4  
ATOM 6882  C CG   . GLU A 1 19  ? 0.214   -3.892  -6.244  1.00 0.00 ? 37  GLU A CG   4  
ATOM 6883  C CD   . GLU A 1 19  ? -0.278  -3.377  -7.582  1.00 0.00 ? 37  GLU A CD   4  
ATOM 6884  O OE1  . GLU A 1 19  ? -0.784  -2.235  -7.628  1.00 0.00 ? 37  GLU A OE1  4  
ATOM 6885  O OE2  . GLU A 1 19  ? -0.160  -4.114  -8.583  1.00 0.00 ? 37  GLU A OE2  4  
ATOM 6886  H H    . GLU A 1 19  ? 1.499   -0.944  -3.572  1.00 0.00 ? 37  GLU A H    4  
ATOM 6887  H HA   . GLU A 1 19  ? -0.445  -3.137  -3.854  1.00 0.00 ? 37  GLU A HA   4  
ATOM 6888  H HB3  . GLU A 1 19  ? 2.013   -3.018  -5.533  1.00 0.00 ? 37  GLU A HB3  4  
ATOM 6889  H HG3  . GLU A 1 19  ? -0.636  -4.231  -5.670  1.00 0.00 ? 37  GLU A HG3  4  
ATOM 6890  N N    . LYS A 1 20  ? 1.091   -5.029  -3.129  1.00 0.00 ? 38  LYS A N    4  
ATOM 6891  C CA   . LYS A 1 20  ? 1.864   -6.040  -2.418  1.00 0.00 ? 38  LYS A CA   4  
ATOM 6892  C C    . LYS A 1 20  ? 2.668   -6.895  -3.394  1.00 0.00 ? 38  LYS A C    4  
ATOM 6893  O O    . LYS A 1 20  ? 2.428   -6.869  -4.599  1.00 0.00 ? 38  LYS A O    4  
ATOM 6894  C CB   . LYS A 1 20  ? 0.937   -6.930  -1.587  1.00 0.00 ? 38  LYS A CB   4  
ATOM 6895  C CG   . LYS A 1 20  ? 1.630   -7.597  -0.411  1.00 0.00 ? 38  LYS A CG   4  
ATOM 6896  C CD   . LYS A 1 20  ? 0.671   -7.825  0.744   1.00 0.00 ? 38  LYS A CD   4  
ATOM 6897  C CE   . LYS A 1 20  ? 0.345   -6.525  1.463   1.00 0.00 ? 38  LYS A CE   4  
ATOM 6898  N NZ   . LYS A 1 20  ? -0.769  -6.693  2.437   1.00 0.00 ? 38  LYS A NZ   4  
ATOM 6899  H H    . LYS A 1 20  ? 0.260   -5.292  -3.581  1.00 0.00 ? 38  LYS A H    4  
ATOM 6900  H HA   . LYS A 1 20  ? 2.549   -5.530  -1.758  1.00 0.00 ? 38  LYS A HA   4  
ATOM 6901  H HB3  . LYS A 1 20  ? 0.531   -7.701  -2.224  1.00 0.00 ? 38  LYS A HB3  4  
ATOM 6902  H HG3  . LYS A 1 20  ? 2.440   -6.966  -0.076  1.00 0.00 ? 38  LYS A HG3  4  
ATOM 6903  H HD3  . LYS A 1 20  ? 1.124   -8.511  1.447   1.00 0.00 ? 38  LYS A HD3  4  
ATOM 6904  H HE3  . LYS A 1 20  ? 0.060   -5.786  0.729   1.00 0.00 ? 38  LYS A HE3  4  
ATOM 6905  H HZ1  . LYS A 1 20  ? -1.070  -5.766  2.799   1.00 0.00 ? 38  LYS A HZ1  4  
ATOM 6906  H HZ2  . LYS A 1 20  ? -0.458  -7.281  3.238   1.00 0.00 ? 38  LYS A HZ2  4  
ATOM 6907  H HZ3  . LYS A 1 20  ? -1.580  -7.154  1.978   1.00 0.00 ? 38  LYS A HZ3  4  
ATOM 6908  N N    . ASN A 1 21  ? 3.619   -7.655  -2.861  1.00 0.00 ? 39  ASN A N    4  
ATOM 6909  C CA   . ASN A 1 21  ? 4.457   -8.520  -3.684  1.00 0.00 ? 39  ASN A CA   4  
ATOM 6910  C C    . ASN A 1 21  ? 3.603   -9.408  -4.583  1.00 0.00 ? 39  ASN A C    4  
ATOM 6911  O O    . ASN A 1 21  ? 3.784   -9.434  -5.800  1.00 0.00 ? 39  ASN A O    4  
ATOM 6912  C CB   . ASN A 1 21  ? 5.357   -9.385  -2.800  1.00 0.00 ? 39  ASN A CB   4  
ATOM 6913  C CG   . ASN A 1 21  ? 4.636   -9.897  -1.567  1.00 0.00 ? 39  ASN A CG   4  
ATOM 6914  O OD1  . ASN A 1 21  ? 4.444   -9.163  -0.597  1.00 0.00 ? 39  ASN A OD1  4  
ATOM 6915  N ND2  . ASN A 1 21  ? 4.234   -11.162 -1.600  1.00 0.00 ? 39  ASN A ND2  4  
ATOM 6916  H H    . ASN A 1 21  ? 3.763   -7.633  -1.892  1.00 0.00 ? 39  ASN A H    4  
ATOM 6917  H HA   . ASN A 1 21  ? 5.076   -7.888  -4.305  1.00 0.00 ? 39  ASN A HA   4  
ATOM 6918  H HB3  . ASN A 1 21  ? 6.208   -8.802  -2.481  1.00 0.00 ? 39  ASN A HB3  4  
ATOM 6919  H HD21 . ASN A 1 21  ? 4.421   -11.687 -2.405  1.00 0.00 ? 39  ASN A HD21 4  
ATOM 6920  H HD22 . ASN A 1 21  ? 3.765   -11.518 -0.817  1.00 0.00 ? 39  ASN A HD22 4  
ATOM 6921  N N    . GLY A 1 22  ? 2.670   -10.135 -3.976  1.00 0.00 ? 40  GLY A N    4  
ATOM 6922  C CA   . GLY A 1 22  ? 1.801   -11.014 -4.737  1.00 0.00 ? 40  GLY A CA   4  
ATOM 6923  C C    . GLY A 1 22  ? 0.622   -10.280 -5.343  1.00 0.00 ? 40  GLY A C    4  
ATOM 6924  O O    . GLY A 1 22  ? 0.725   -9.713  -6.430  1.00 0.00 ? 40  GLY A O    4  
ATOM 6925  H H    . GLY A 1 22  ? 2.572   -10.073 -3.003  1.00 0.00 ? 40  GLY A H    4  
ATOM 6926  H HA2  . GLY A 1 22  ? 2.374   -11.469 -5.529  1.00 0.00 ? 40  GLY A HA2  4  
ATOM 6927  H HA3  . GLY A 1 22  ? 1.432   -11.790 -4.081  1.00 0.00 ? 40  GLY A HA3  4  
ATOM 6928  N N    . ARG A 1 23  ? -0.506  -10.293 -4.637  1.00 0.00 ? 41  ARG A N    4  
ATOM 6929  C CA   . ARG A 1 23  ? -1.711  -9.625  -5.113  1.00 0.00 ? 41  ARG A CA   4  
ATOM 6930  C C    . ARG A 1 23  ? -2.193  -8.587  -4.104  1.00 0.00 ? 41  ARG A C    4  
ATOM 6931  O O    . ARG A 1 23  ? -1.488  -8.260  -3.150  1.00 0.00 ? 41  ARG A O    4  
ATOM 6932  C CB   . ARG A 1 23  ? -2.817  -10.650 -5.374  1.00 0.00 ? 41  ARG A CB   4  
ATOM 6933  C CG   . ARG A 1 23  ? -3.288  -11.371 -4.121  1.00 0.00 ? 41  ARG A CG   4  
ATOM 6934  C CD   . ARG A 1 23  ? -2.561  -12.692 -3.932  1.00 0.00 ? 41  ARG A CD   4  
ATOM 6935  N NE   . ARG A 1 23  ? -3.249  -13.796 -4.598  1.00 0.00 ? 41  ARG A NE   4  
ATOM 6936  C CZ   . ARG A 1 23  ? -2.806  -15.048 -4.593  1.00 0.00 ? 41  ARG A CZ   4  
ATOM 6937  N NH1  . ARG A 1 23  ? -1.681  -15.354 -3.961  1.00 0.00 ? 41  ARG A NH1  4  
ATOM 6938  N NH2  . ARG A 1 23  ? -3.488  -15.996 -5.221  1.00 0.00 ? 41  ARG A NH2  4  
ATOM 6939  H H    . ARG A 1 23  ? -0.527  -10.761 -3.776  1.00 0.00 ? 41  ARG A H    4  
ATOM 6940  H HA   . ARG A 1 23  ? -1.470  -9.125  -6.039  1.00 0.00 ? 41  ARG A HA   4  
ATOM 6941  H HB3  . ARG A 1 23  ? -2.449  -11.389 -6.071  1.00 0.00 ? 41  ARG A HB3  4  
ATOM 6942  H HG3  . ARG A 1 23  ? -4.348  -11.560 -4.204  1.00 0.00 ? 41  ARG A HG3  4  
ATOM 6943  H HD3  . ARG A 1 23  ? -2.498  -12.905 -2.875  1.00 0.00 ? 41  ARG A HD3  4  
ATOM 6944  H HE   . ARG A 1 23  ? -4.082  -13.592 -5.070  1.00 0.00 ? 41  ARG A HE   4  
ATOM 6945  H HH11 . ARG A 1 23  ? -1.166  -14.641 -3.487  1.00 0.00 ? 41  ARG A HH11 4  
ATOM 6946  H HH12 . ARG A 1 23  ? -1.351  -16.298 -3.959  1.00 0.00 ? 41  ARG A HH12 4  
ATOM 6947  H HH21 . ARG A 1 23  ? -4.336  -15.769 -5.699  1.00 0.00 ? 41  ARG A HH21 4  
ATOM 6948  H HH22 . ARG A 1 23  ? -3.153  -16.939 -5.218  1.00 0.00 ? 41  ARG A HH22 4  
ATOM 6949  N N    . TYR A 1 24  ? -3.399  -8.074  -4.322  1.00 0.00 ? 42  TYR A N    4  
ATOM 6950  C CA   . TYR A 1 24  ? -3.973  -7.070  -3.434  1.00 0.00 ? 42  TYR A CA   4  
ATOM 6951  C C    . TYR A 1 24  ? -5.106  -7.665  -2.601  1.00 0.00 ? 42  TYR A C    4  
ATOM 6952  O O    . TYR A 1 24  ? -6.248  -7.744  -3.053  1.00 0.00 ? 42  TYR A O    4  
ATOM 6953  C CB   . TYR A 1 24  ? -4.490  -5.879  -4.242  1.00 0.00 ? 42  TYR A CB   4  
ATOM 6954  C CG   . TYR A 1 24  ? -5.179  -6.274  -5.528  1.00 0.00 ? 42  TYR A CG   4  
ATOM 6955  C CD1  . TYR A 1 24  ? -4.451  -6.489  -6.692  1.00 0.00 ? 42  TYR A CD1  4  
ATOM 6956  C CD2  . TYR A 1 24  ? -6.559  -6.433  -5.581  1.00 0.00 ? 42  TYR A CD2  4  
ATOM 6957  C CE1  . TYR A 1 24  ? -5.076  -6.850  -7.870  1.00 0.00 ? 42  TYR A CE1  4  
ATOM 6958  C CE2  . TYR A 1 24  ? -7.193  -6.795  -6.754  1.00 0.00 ? 42  TYR A CE2  4  
ATOM 6959  C CZ   . TYR A 1 24  ? -6.447  -7.001  -7.896  1.00 0.00 ? 42  TYR A CZ   4  
ATOM 6960  O OH   . TYR A 1 24  ? -7.073  -7.362  -9.067  1.00 0.00 ? 42  TYR A OH   4  
ATOM 6961  H H    . TYR A 1 24  ? -3.913  -8.374  -5.100  1.00 0.00 ? 42  TYR A H    4  
ATOM 6962  H HA   . TYR A 1 24  ? -3.193  -6.731  -2.769  1.00 0.00 ? 42  TYR A HA   4  
ATOM 6963  H HB3  . TYR A 1 24  ? -3.661  -5.237  -4.493  1.00 0.00 ? 42  TYR A HB3  4  
ATOM 6964  H HD1  . TYR A 1 24  ? -3.378  -6.371  -6.668  1.00 0.00 ? 42  TYR A HD1  4  
ATOM 6965  H HD2  . TYR A 1 24  ? -7.140  -6.270  -4.685  1.00 0.00 ? 42  TYR A HD2  4  
ATOM 6966  H HE1  . TYR A 1 24  ? -4.493  -7.012  -8.764  1.00 0.00 ? 42  TYR A HE1  4  
ATOM 6967  H HE2  . TYR A 1 24  ? -8.266  -6.912  -6.775  1.00 0.00 ? 42  TYR A HE2  4  
ATOM 6968  H HH   . TYR A 1 24  ? -7.763  -8.001  -8.877  1.00 0.00 ? 42  TYR A HH   4  
ATOM 6969  N N    . SER A 1 25  ? -4.779  -8.081  -1.382  1.00 0.00 ? 43  SER A N    4  
ATOM 6970  C CA   . SER A 1 25  ? -5.766  -8.672  -0.486  1.00 0.00 ? 43  SER A CA   4  
ATOM 6971  C C    . SER A 1 25  ? -5.637  -8.096  0.921   1.00 0.00 ? 43  SER A C    4  
ATOM 6972  O O    . SER A 1 25  ? -5.472  -8.834  1.893   1.00 0.00 ? 43  SER A O    4  
ATOM 6973  C CB   . SER A 1 25  ? -5.602  -10.193 -0.444  1.00 0.00 ? 43  SER A CB   4  
ATOM 6974  O OG   . SER A 1 25  ? -5.308  -10.710 -1.730  1.00 0.00 ? 43  SER A OG   4  
ATOM 6975  H H    . SER A 1 25  ? -3.851  -7.991  -1.079  1.00 0.00 ? 43  SER A H    4  
ATOM 6976  H HA   . SER A 1 25  ? -6.747  -8.435  -0.871  1.00 0.00 ? 43  SER A HA   4  
ATOM 6977  H HB3  . SER A 1 25  ? -6.521  -10.641 -0.090  1.00 0.00 ? 43  SER A HB3  4  
ATOM 6978  H HG   . SER A 1 25  ? -4.616  -11.371 -1.658  1.00 0.00 ? 43  SER A HG   4  
ATOM 6979  N N    . ILE A 1 26  ? -5.712  -6.773  1.021   1.00 0.00 ? 44  ILE A N    4  
ATOM 6980  C CA   . ILE A 1 26  ? -5.605  -6.097  2.308   1.00 0.00 ? 44  ILE A CA   4  
ATOM 6981  C C    . ILE A 1 26  ? -6.980  -5.742  2.860   1.00 0.00 ? 44  ILE A C    4  
ATOM 6982  O O    . ILE A 1 26  ? -7.937  -5.565  2.105   1.00 0.00 ? 44  ILE A O    4  
ATOM 6983  C CB   . ILE A 1 26  ? -4.761  -4.813  2.201   1.00 0.00 ? 44  ILE A CB   4  
ATOM 6984  C CG1  . ILE A 1 26  ? -3.479  -5.084  1.411   1.00 0.00 ? 44  ILE A CG1  4  
ATOM 6985  C CG2  . ILE A 1 26  ? -4.432  -4.278  3.586   1.00 0.00 ? 44  ILE A CG2  4  
ATOM 6986  C CD1  . ILE A 1 26  ? -3.601  -4.779  -0.066  1.00 0.00 ? 44  ILE A CD1  4  
ATOM 6987  H H    . ILE A 1 26  ? -5.844  -6.239  0.209   1.00 0.00 ? 44  ILE A H    4  
ATOM 6988  H HA   . ILE A 1 26  ? -5.114  -6.770  2.997   1.00 0.00 ? 44  ILE A HA   4  
ATOM 6989  H HB   . ILE A 1 26  ? -5.344  -4.069  1.681   1.00 0.00 ? 44  ILE A HB   4  
ATOM 6990  H HG13 . ILE A 1 26  ? -3.215  -6.127  1.514   1.00 0.00 ? 44  ILE A HG13 4  
ATOM 6991  H HG21 . ILE A 1 26  ? -3.691  -3.497  3.504   1.00 0.00 ? 44  ILE A HG21 4  
ATOM 6992  H HG22 . ILE A 1 26  ? -5.327  -3.877  4.037   1.00 0.00 ? 44  ILE A HG22 4  
ATOM 6993  H HG23 . ILE A 1 26  ? -4.046  -5.078  4.199   1.00 0.00 ? 44  ILE A HG23 4  
ATOM 6994  H HD11 . ILE A 1 26  ? -4.152  -5.571  -0.553  1.00 0.00 ? 44  ILE A HD11 4  
ATOM 6995  H HD12 . ILE A 1 26  ? -4.123  -3.843  -0.198  1.00 0.00 ? 44  ILE A HD12 4  
ATOM 6996  H HD13 . ILE A 1 26  ? -2.616  -4.708  -0.502  1.00 0.00 ? 44  ILE A HD13 4  
ATOM 6997  N N    . SER A 1 27  ? -7.074  -5.639  4.181   1.00 0.00 ? 45  SER A N    4  
ATOM 6998  C CA   . SER A 1 27  ? -8.334  -5.307  4.835   1.00 0.00 ? 45  SER A CA   4  
ATOM 6999  C C    . SER A 1 27  ? -8.349  -3.846  5.276   1.00 0.00 ? 45  SER A C    4  
ATOM 7000  O O    . SER A 1 27  ? -7.380  -3.116  5.073   1.00 0.00 ? 45  SER A O    4  
ATOM 7001  C CB   . SER A 1 27  ? -8.561  -6.218  6.043   1.00 0.00 ? 45  SER A CB   4  
ATOM 7002  O OG   . SER A 1 27  ? -7.645  -5.924  7.084   1.00 0.00 ? 45  SER A OG   4  
ATOM 7003  H H    . SER A 1 27  ? -6.275  -5.792  4.730   1.00 0.00 ? 45  SER A H    4  
ATOM 7004  H HA   . SER A 1 27  ? -9.130  -5.465  4.122   1.00 0.00 ? 45  SER A HA   4  
ATOM 7005  H HB3  . SER A 1 27  ? -8.429  -7.248  5.744   1.00 0.00 ? 45  SER A HB3  4  
ATOM 7006  H HG   . SER A 1 27  ? -7.305  -6.743  7.451   1.00 0.00 ? 45  SER A HG   4  
ATOM 7007  N N    . ARG A 1 28  ? -9.458  -3.429  5.879   1.00 0.00 ? 46  ARG A N    4  
ATOM 7008  C CA   . ARG A 1 28  ? -9.601  -2.055  6.348   1.00 0.00 ? 46  ARG A CA   4  
ATOM 7009  C C    . ARG A 1 28  ? -8.644  -1.771  7.500   1.00 0.00 ? 46  ARG A C    4  
ATOM 7010  O O    . ARG A 1 28  ? -7.825  -0.853  7.432   1.00 0.00 ? 46  ARG A O    4  
ATOM 7011  C CB   . ARG A 1 28  ? -11.042 -1.792  6.790   1.00 0.00 ? 46  ARG A CB   4  
ATOM 7012  C CG   . ARG A 1 28  ? -12.035 -1.760  5.641   1.00 0.00 ? 46  ARG A CG   4  
ATOM 7013  C CD   . ARG A 1 28  ? -13.465 -1.904  6.137   1.00 0.00 ? 46  ARG A CD   4  
ATOM 7014  N NE   . ARG A 1 28  ? -14.033 -0.624  6.552   1.00 0.00 ? 46  ARG A NE   4  
ATOM 7015  C CZ   . ARG A 1 28  ? -14.454 0.305   5.702   1.00 0.00 ? 46  ARG A CZ   4  
ATOM 7016  N NH1  . ARG A 1 28  ? -14.372 0.097   4.395   1.00 0.00 ? 46  ARG A NH1  4  
ATOM 7017  N NH2  . ARG A 1 28  ? -14.958 1.444   6.158   1.00 0.00 ? 46  ARG A NH2  4  
ATOM 7018  H H    . ARG A 1 28  ? -10.198 -4.058  6.012   1.00 0.00 ? 46  ARG A H    4  
ATOM 7019  H HA   . ARG A 1 28  ? -9.361  -1.397  5.525   1.00 0.00 ? 46  ARG A HA   4  
ATOM 7020  H HB3  . ARG A 1 28  ? -11.081 -0.842  7.299   1.00 0.00 ? 46  ARG A HB3  4  
ATOM 7021  H HG3  . ARG A 1 28  ? -11.815 -2.570  4.962   1.00 0.00 ? 46  ARG A HG3  4  
ATOM 7022  H HD3  . ARG A 1 28  ? -13.474 -2.582  6.977   1.00 0.00 ? 46  ARG A HD3  4  
ATOM 7023  H HE   . ARG A 1 28  ? -14.102 -0.450  7.514   1.00 0.00 ? 46  ARG A HE   4  
ATOM 7024  H HH11 . ARG A 1 28  ? -13.994 -0.762  4.049   1.00 0.00 ? 46  ARG A HH11 4  
ATOM 7025  H HH12 . ARG A 1 28  ? -14.691 0.798   3.756   1.00 0.00 ? 46  ARG A HH12 4  
ATOM 7026  H HH21 . ARG A 1 28  ? -15.021 1.606   7.142   1.00 0.00 ? 46  ARG A HH21 4  
ATOM 7027  H HH22 . ARG A 1 28  ? -15.274 2.143   5.516   1.00 0.00 ? 46  ARG A HH22 4  
ATOM 7028  N N    . THR A 1 29  ? -8.751  -2.565  8.561   1.00 0.00 ? 47  THR A N    4  
ATOM 7029  C CA   . THR A 1 29  ? -7.896  -2.398  9.730   1.00 0.00 ? 47  THR A CA   4  
ATOM 7030  C C    . THR A 1 29  ? -6.423  -2.376  9.337   1.00 0.00 ? 47  THR A C    4  
ATOM 7031  O O    . THR A 1 29  ? -5.607  -1.732  9.992   1.00 0.00 ? 47  THR A O    4  
ATOM 7032  C CB   . THR A 1 29  ? -8.125  -3.522  10.759  1.00 0.00 ? 47  THR A CB   4  
ATOM 7033  O OG1  . THR A 1 29  ? -7.999  -4.800  10.124  1.00 0.00 ? 47  THR A OG1  4  
ATOM 7034  C CG2  . THR A 1 29  ? -9.501  -3.401  11.396  1.00 0.00 ? 47  THR A CG2  4  
ATOM 7035  H H    . THR A 1 29  ? -9.422  -3.280  8.557   1.00 0.00 ? 47  THR A H    4  
ATOM 7036  H HA   . THR A 1 29  ? -8.149  -1.457  10.196  1.00 0.00 ? 47  THR A HA   4  
ATOM 7037  H HB   . THR A 1 29  ? -7.376  -3.438  11.534  1.00 0.00 ? 47  THR A HB   4  
ATOM 7038  H HG1  . THR A 1 29  ? -8.459  -5.463  10.643  1.00 0.00 ? 47  THR A HG1  4  
ATOM 7039  H HG21 . THR A 1 29  ? -9.475  -3.824  12.390  1.00 0.00 ? 47  THR A HG21 4  
ATOM 7040  H HG22 . THR A 1 29  ? -10.224 -3.931  10.796  1.00 0.00 ? 47  THR A HG22 4  
ATOM 7041  H HG23 . THR A 1 29  ? -9.777  -2.359  11.457  1.00 0.00 ? 47  THR A HG23 4  
ATOM 7042  N N    . GLU A 1 30  ? -6.092  -3.085  8.262   1.00 0.00 ? 48  GLU A N    4  
ATOM 7043  C CA   . GLU A 1 30  ? -4.717  -3.146  7.781   1.00 0.00 ? 48  GLU A CA   4  
ATOM 7044  C C    . GLU A 1 30  ? -4.378  -1.916  6.946   1.00 0.00 ? 48  GLU A C    4  
ATOM 7045  O O    . GLU A 1 30  ? -3.261  -1.403  7.002   1.00 0.00 ? 48  GLU A O    4  
ATOM 7046  C CB   . GLU A 1 30  ? -4.498  -4.415  6.955   1.00 0.00 ? 48  GLU A CB   4  
ATOM 7047  C CG   . GLU A 1 30  ? -4.183  -5.641  7.794   1.00 0.00 ? 48  GLU A CG   4  
ATOM 7048  C CD   . GLU A 1 30  ? -4.266  -6.930  6.999   1.00 0.00 ? 48  GLU A CD   4  
ATOM 7049  O OE1  . GLU A 1 30  ? -4.679  -6.874  5.822   1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7050  O OE2  . GLU A 1 30  ? -3.916  -7.994  7.553   1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7051  H H    . GLU A 1 30  ? -6.790  -3.578  7.780   1.00 0.00 ? 48  GLU A H    4  
ATOM 7052  H HA   . GLU A 1 30  ? -4.067  -3.173  8.643   1.00 0.00 ? 48  GLU A HA   4  
ATOM 7053  H HB3  . GLU A 1 30  ? -3.676  -4.249  6.274   1.00 0.00 ? 48  GLU A HB3  4  
ATOM 7054  H HG3  . GLU A 1 30  ? -4.888  -5.694  8.611   1.00 0.00 ? 48  GLU A HG3  4  
ATOM 7055  N N    . ALA A 1 31  ? -5.350  -1.449  6.169   1.00 0.00 ? 49  ALA A N    4  
ATOM 7056  C CA   . ALA A 1 31  ? -5.156  -0.279  5.322   1.00 0.00 ? 49  ALA A CA   4  
ATOM 7057  C C    . ALA A 1 31  ? -4.634  0.904   6.130   1.00 0.00 ? 49  ALA A C    4  
ATOM 7058  O O    . ALA A 1 31  ? -3.564  1.441   5.845   1.00 0.00 ? 49  ALA A O    4  
ATOM 7059  C CB   . ALA A 1 31  ? -6.457  0.091   4.624   1.00 0.00 ? 49  ALA A CB   4  
ATOM 7060  H H    . ALA A 1 31  ? -6.219  -1.900  6.167   1.00 0.00 ? 49  ALA A H    4  
ATOM 7061  H HA   . ALA A 1 31  ? -4.429  -0.532  4.564   1.00 0.00 ? 49  ALA A HA   4  
ATOM 7062  H HB1  . ALA A 1 31  ? -6.510  -0.418  3.672   1.00 0.00 ? 49  ALA A HB1  4  
ATOM 7063  H HB2  . ALA A 1 31  ? -7.291  -0.208  5.239   1.00 0.00 ? 49  ALA A HB2  4  
ATOM 7064  H HB3  . ALA A 1 31  ? -6.490  1.158   4.465   1.00 0.00 ? 49  ALA A HB3  4  
ATOM 7065  N N    . ALA A 1 32  ? -5.398  1.307   7.141   1.00 0.00 ? 50  ALA A N    4  
ATOM 7066  C CA   . ALA A 1 32  ? -5.011  2.426   7.992   1.00 0.00 ? 50  ALA A CA   4  
ATOM 7067  C C    . ALA A 1 32  ? -3.587  2.255   8.511   1.00 0.00 ? 50  ALA A C    4  
ATOM 7068  O O    . ALA A 1 32  ? -2.746  3.139   8.348   1.00 0.00 ? 50  ALA A O    4  
ATOM 7069  C CB   . ALA A 1 32  ? -5.985  2.567   9.153   1.00 0.00 ? 50  ALA A CB   4  
ATOM 7070  H H    . ALA A 1 32  ? -6.239  0.839   7.319   1.00 0.00 ? 50  ALA A H    4  
ATOM 7071  H HA   . ALA A 1 32  ? -5.061  3.328   7.401   1.00 0.00 ? 50  ALA A HA   4  
ATOM 7072  H HB1  . ALA A 1 32  ? -5.893  1.711   9.805   1.00 0.00 ? 50  ALA A HB1  4  
ATOM 7073  H HB2  . ALA A 1 32  ? -5.758  3.466   9.705   1.00 0.00 ? 50  ALA A HB2  4  
ATOM 7074  H HB3  . ALA A 1 32  ? -6.993  2.623   8.772   1.00 0.00 ? 50  ALA A HB3  4  
ATOM 7075  N N    . ASP A 1 33  ? -3.324  1.113   9.137   1.00 0.00 ? 51  ASP A N    4  
ATOM 7076  C CA   . ASP A 1 33  ? -2.001  0.825   9.680   1.00 0.00 ? 51  ASP A CA   4  
ATOM 7077  C C    . ASP A 1 33  ? -0.927  0.996   8.611   1.00 0.00 ? 51  ASP A C    4  
ATOM 7078  O O    . ASP A 1 33  ? 0.170   1.482   8.890   1.00 0.00 ? 51  ASP A O    4  
ATOM 7079  C CB   . ASP A 1 33  ? -1.957  -0.595  10.245  1.00 0.00 ? 51  ASP A CB   4  
ATOM 7080  C CG   . ASP A 1 33  ? -0.629  -0.913  10.904  1.00 0.00 ? 51  ASP A CG   4  
ATOM 7081  O OD1  . ASP A 1 33  ? -0.473  -0.603  12.103  1.00 0.00 ? 51  ASP A OD1  4  
ATOM 7082  O OD2  . ASP A 1 33  ? 0.255   -1.473  10.221  1.00 0.00 ? 51  ASP A OD2  4  
ATOM 7083  H H    . ASP A 1 33  ? -4.037  0.447   9.235   1.00 0.00 ? 51  ASP A H    4  
ATOM 7084  H HA   . ASP A 1 33  ? -1.811  1.527   10.478  1.00 0.00 ? 51  ASP A HA   4  
ATOM 7085  H HB3  . ASP A 1 33  ? -2.117  -1.300  9.443   1.00 0.00 ? 51  ASP A HB3  4  
ATOM 7086  N N    . LEU A 1 34  ? -1.248  0.590   7.387   1.00 0.00 ? 52  LEU A N    4  
ATOM 7087  C CA   . LEU A 1 34  ? -0.309  0.696   6.275   1.00 0.00 ? 52  LEU A CA   4  
ATOM 7088  C C    . LEU A 1 34  ? 0.025   2.156   5.981   1.00 0.00 ? 52  LEU A C    4  
ATOM 7089  O O    . LEU A 1 34  ? 1.195   2.534   5.914   1.00 0.00 ? 52  LEU A O    4  
ATOM 7090  C CB   . LEU A 1 34  ? -0.892  0.033   5.026   1.00 0.00 ? 52  LEU A CB   4  
ATOM 7091  C CG   . LEU A 1 34  ? 0.097   -0.257  3.896   1.00 0.00 ? 52  LEU A CG   4  
ATOM 7092  C CD1  . LEU A 1 34  ? 1.160   -1.241  4.359   1.00 0.00 ? 52  LEU A CD1  4  
ATOM 7093  C CD2  . LEU A 1 34  ? -0.632  -0.792  2.673   1.00 0.00 ? 52  LEU A CD2  4  
ATOM 7094  H H    . LEU A 1 34  ? -2.136  0.211   7.227   1.00 0.00 ? 52  LEU A H    4  
ATOM 7095  H HA   . LEU A 1 34  ? 0.597   0.181   6.556   1.00 0.00 ? 52  LEU A HA   4  
ATOM 7096  H HB3  . LEU A 1 34  ? -1.660  0.686   4.634   1.00 0.00 ? 52  LEU A HB3  4  
ATOM 7097  H HG   . LEU A 1 34  ? 0.594   0.662   3.615   1.00 0.00 ? 52  LEU A HG   4  
ATOM 7098  H HD11 . LEU A 1 34  ? 0.690   -2.168  4.652   1.00 0.00 ? 52  LEU A HD11 4  
ATOM 7099  H HD12 . LEU A 1 34  ? 1.694   -0.826  5.201   1.00 0.00 ? 52  LEU A HD12 4  
ATOM 7100  H HD13 . LEU A 1 34  ? 1.854   -1.428  3.551   1.00 0.00 ? 52  LEU A HD13 4  
ATOM 7101  H HD21 . LEU A 1 34  ? -1.523  -1.317  2.986   1.00 0.00 ? 52  LEU A HD21 4  
ATOM 7102  H HD22 . LEU A 1 34  ? 0.015   -1.472  2.136   1.00 0.00 ? 52  LEU A HD22 4  
ATOM 7103  H HD23 . LEU A 1 34  ? -0.905  0.029   2.028   1.00 0.00 ? 52  LEU A HD23 4  
ATOM 7104  N N    . CYS A 1 35  ? -1.010  2.970   5.810   1.00 0.00 ? 53  CYS A N    4  
ATOM 7105  C CA   . CYS A 1 35  ? -0.828  4.389   5.525   1.00 0.00 ? 53  CYS A CA   4  
ATOM 7106  C C    . CYS A 1 35  ? -0.058  5.075   6.652   1.00 0.00 ? 53  CYS A C    4  
ATOM 7107  O O    . CYS A 1 35  ? 0.931   5.767   6.411   1.00 0.00 ? 53  CYS A O    4  
ATOM 7108  C CB   . CYS A 1 35  ? -2.184  5.071   5.331   1.00 0.00 ? 53  CYS A CB   4  
ATOM 7109  S SG   . CYS A 1 35  ? -3.266  4.240   4.125   1.00 0.00 ? 53  CYS A SG   4  
ATOM 7110  H H    . CYS A 1 35  ? -1.920  2.610   5.875   1.00 0.00 ? 53  CYS A H    4  
ATOM 7111  H HA   . CYS A 1 35  ? -0.258  4.474   4.613   1.00 0.00 ? 53  CYS A HA   4  
ATOM 7112  H HB3  . CYS A 1 35  ? -2.023  6.082   4.989   1.00 0.00 ? 53  CYS A HB3  4  
ATOM 7113  N N    . LYS A 1 36  ? -0.520  4.877   7.882   1.00 0.00 ? 54  LYS A N    4  
ATOM 7114  C CA   . LYS A 1 36  ? 0.124   5.473   9.046   1.00 0.00 ? 54  LYS A CA   4  
ATOM 7115  C C    . LYS A 1 36  ? 1.584   5.041   9.140   1.00 0.00 ? 54  LYS A C    4  
ATOM 7116  O O    . LYS A 1 36  ? 2.463   5.852   9.432   1.00 0.00 ? 54  LYS A O    4  
ATOM 7117  C CB   . LYS A 1 36  ? -0.619  5.079   10.323  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7118  C CG   . LYS A 1 36  ? -0.077  5.748   11.575  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7119  C CD   . LYS A 1 36  ? -0.368  4.925   12.818  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7120  C CE   . LYS A 1 36  ? 0.726   3.902   13.079  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7121  N NZ   . LYS A 1 36  ? 0.264   2.814   13.986  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7122  H H    . LYS A 1 36  ? -1.313  4.315   8.010   1.00 0.00 ? 54  LYS A H    4  
ATOM 7123  H HA   . LYS A 1 36  ? 0.086   6.546   8.933   1.00 0.00 ? 54  LYS A HA   4  
ATOM 7124  H HB3  . LYS A 1 36  ? -0.546  4.009   10.453  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7125  H HG3  . LYS A 1 36  ? -0.537  6.720   11.680  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7126  H HD3  . LYS A 1 36  ? -1.308  4.408   12.685  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7127  H HE3  . LYS A 1 36  ? 1.569   4.403   13.533  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7128  H HZ1  . LYS A 1 36  ? 1.073   2.233   14.287  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7129  H HZ2  . LYS A 1 36  ? -0.422  2.206   13.494  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7130  H HZ3  . LYS A 1 36  ? -0.190  3.220   14.828  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7131  N N    . ALA A 1 37  ? 1.835   3.760   8.891   1.00 0.00 ? 55  ALA A N    4  
ATOM 7132  C CA   . ALA A 1 37  ? 3.189   3.223   8.946   1.00 0.00 ? 55  ALA A CA   4  
ATOM 7133  C C    . ALA A 1 37  ? 4.078   3.866   7.887   1.00 0.00 ? 55  ALA A C    4  
ATOM 7134  O O    . ALA A 1 37  ? 5.303   3.866   8.006   1.00 0.00 ? 55  ALA A O    4  
ATOM 7135  C CB   . ALA A 1 37  ? 3.164   1.712   8.770   1.00 0.00 ? 55  ALA A CB   4  
ATOM 7136  H H    . ALA A 1 37  ? 1.092   3.164   8.664   1.00 0.00 ? 55  ALA A H    4  
ATOM 7137  H HA   . ALA A 1 37  ? 3.596   3.440   9.923   1.00 0.00 ? 55  ALA A HA   4  
ATOM 7138  H HB1  . ALA A 1 37  ? 2.846   1.472   7.766   1.00 0.00 ? 55  ALA A HB1  4  
ATOM 7139  H HB2  . ALA A 1 37  ? 4.153   1.313   8.938   1.00 0.00 ? 55  ALA A HB2  4  
ATOM 7140  H HB3  . ALA A 1 37  ? 2.474   1.278   9.479   1.00 0.00 ? 55  ALA A HB3  4  
ATOM 7141  N N    . PHE A 1 38  ? 3.454   4.413   6.849   1.00 0.00 ? 56  PHE A N    4  
ATOM 7142  C CA   . PHE A 1 38  ? 4.189   5.058   5.768   1.00 0.00 ? 56  PHE A CA   4  
ATOM 7143  C C    . PHE A 1 38  ? 4.051   6.576   5.846   1.00 0.00 ? 56  PHE A C    4  
ATOM 7144  O O    . PHE A 1 38  ? 4.080   7.266   4.829   1.00 0.00 ? 56  PHE A O    4  
ATOM 7145  C CB   . PHE A 1 38  ? 3.685   4.559   4.413   1.00 0.00 ? 56  PHE A CB   4  
ATOM 7146  C CG   . PHE A 1 38  ? 4.597   4.906   3.270   1.00 0.00 ? 56  PHE A CG   4  
ATOM 7147  C CD1  . PHE A 1 38  ? 5.968   4.741   3.385   1.00 0.00 ? 56  PHE A CD1  4  
ATOM 7148  C CD2  . PHE A 1 38  ? 4.082   5.399   2.081   1.00 0.00 ? 56  PHE A CD2  4  
ATOM 7149  C CE1  . PHE A 1 38  ? 6.808   5.060   2.335   1.00 0.00 ? 56  PHE A CE1  4  
ATOM 7150  C CE2  . PHE A 1 38  ? 4.918   5.718   1.028   1.00 0.00 ? 56  PHE A CE2  4  
ATOM 7151  C CZ   . PHE A 1 38  ? 6.283   5.550   1.155   1.00 0.00 ? 56  PHE A CZ   4  
ATOM 7152  H H    . PHE A 1 38  ? 2.474   4.383   6.811   1.00 0.00 ? 56  PHE A H    4  
ATOM 7153  H HA   . PHE A 1 38  ? 5.230   4.797   5.874   1.00 0.00 ? 56  PHE A HA   4  
ATOM 7154  H HB3  . PHE A 1 38  ? 2.719   4.997   4.212   1.00 0.00 ? 56  PHE A HB3  4  
ATOM 7155  H HD1  . PHE A 1 38  ? 6.379   4.358   4.307   1.00 0.00 ? 56  PHE A HD1  4  
ATOM 7156  H HD2  . PHE A 1 38  ? 3.015   5.533   1.980   1.00 0.00 ? 56  PHE A HD2  4  
ATOM 7157  H HE1  . PHE A 1 38  ? 7.875   4.927   2.438   1.00 0.00 ? 56  PHE A HE1  4  
ATOM 7158  H HE2  . PHE A 1 38  ? 4.505   6.102   0.107   1.00 0.00 ? 56  PHE A HE2  4  
ATOM 7159  H HZ   . PHE A 1 38  ? 6.939   5.799   0.335   1.00 0.00 ? 56  PHE A HZ   4  
ATOM 7160  N N    . ASN A 1 39  ? 3.901   7.088   7.064   1.00 0.00 ? 57  ASN A N    4  
ATOM 7161  C CA   . ASN A 1 39  ? 3.758   8.524   7.276   1.00 0.00 ? 57  ASN A CA   4  
ATOM 7162  C C    . ASN A 1 39  ? 2.652   9.097   6.396   1.00 0.00 ? 57  ASN A C    4  
ATOM 7163  O O    . ASN A 1 39  ? 2.845   10.104  5.715   1.00 0.00 ? 57  ASN A O    4  
ATOM 7164  C CB   . ASN A 1 39  ? 5.079   9.238   6.984   1.00 0.00 ? 57  ASN A CB   4  
ATOM 7165  C CG   . ASN A 1 39  ? 5.311   10.424  7.900   1.00 0.00 ? 57  ASN A CG   4  
ATOM 7166  O OD1  . ASN A 1 39  ? 5.978   10.308  8.927   1.00 0.00 ? 57  ASN A OD1  4  
ATOM 7167  N ND2  . ASN A 1 39  ? 4.758   11.574  7.531   1.00 0.00 ? 57  ASN A ND2  4  
ATOM 7168  H H    . ASN A 1 39  ? 3.887   6.487   7.837   1.00 0.00 ? 57  ASN A H    4  
ATOM 7169  H HA   . ASN A 1 39  ? 3.496   8.682   8.312   1.00 0.00 ? 57  ASN A HA   4  
ATOM 7170  H HB3  . ASN A 1 39  ? 5.073   9.590   5.963   1.00 0.00 ? 57  ASN A HB3  4  
ATOM 7171  H HD21 . ASN A 1 39  ? 4.238   11.592  6.701   1.00 0.00 ? 57  ASN A HD21 4  
ATOM 7172  H HD22 . ASN A 1 39  ? 4.892   12.356  8.105   1.00 0.00 ? 57  ASN A HD22 4  
ATOM 7173  N N    . SER A 1 40  ? 1.492   8.448   6.416   1.00 0.00 ? 58  SER A N    4  
ATOM 7174  C CA   . SER A 1 40  ? 0.354   8.890   5.618   1.00 0.00 ? 58  SER A CA   4  
ATOM 7175  C C    . SER A 1 40  ? -0.961  8.482   6.273   1.00 0.00 ? 58  SER A C    4  
ATOM 7176  O O    . SER A 1 40  ? -0.984  7.657   7.187   1.00 0.00 ? 58  SER A O    4  
ATOM 7177  C CB   . SER A 1 40  ? 0.438   8.306   4.206   1.00 0.00 ? 58  SER A CB   4  
ATOM 7178  O OG   . SER A 1 40  ? 1.772   7.968   3.871   1.00 0.00 ? 58  SER A OG   4  
ATOM 7179  H H    . SER A 1 40  ? 1.399   7.651   6.979   1.00 0.00 ? 58  SER A H    4  
ATOM 7180  H HA   . SER A 1 40  ? 0.392   9.968   5.554   1.00 0.00 ? 58  SER A HA   4  
ATOM 7181  H HB3  . SER A 1 40  ? 0.074   9.035   3.495   1.00 0.00 ? 58  SER A HB3  4  
ATOM 7182  H HG   . SER A 1 40  ? 2.314   8.761   3.878   1.00 0.00 ? 58  SER A HG   4  
ATOM 7183  N N    . THR A 1 41  ? -2.058  9.066   5.799   1.00 0.00 ? 59  THR A N    4  
ATOM 7184  C CA   . THR A 1 41  ? -3.378  8.765   6.339   1.00 0.00 ? 59  THR A CA   4  
ATOM 7185  C C    . THR A 1 41  ? -4.364  8.431   5.224   1.00 0.00 ? 59  THR A C    4  
ATOM 7186  O O    . THR A 1 41  ? -4.176  8.831   4.075   1.00 0.00 ? 59  THR A O    4  
ATOM 7187  C CB   . THR A 1 41  ? -3.931  9.945   7.161   1.00 0.00 ? 59  THR A CB   4  
ATOM 7188  O OG1  . THR A 1 41  ? -3.537  11.186  6.564   1.00 0.00 ? 59  THR A OG1  4  
ATOM 7189  C CG2  . THR A 1 41  ? -3.429  9.885   8.596   1.00 0.00 ? 59  THR A CG2  4  
ATOM 7190  H H    . THR A 1 41  ? -1.975  9.715   5.070   1.00 0.00 ? 59  THR A H    4  
ATOM 7191  H HA   . THR A 1 41  ? -3.285  7.911   6.992   1.00 0.00 ? 59  THR A HA   4  
ATOM 7192  H HB   . THR A 1 41  ? -5.010  9.884   7.168   1.00 0.00 ? 59  THR A HB   4  
ATOM 7193  H HG1  . THR A 1 41  ? -3.562  11.880  7.226   1.00 0.00 ? 59  THR A HG1  4  
ATOM 7194  H HG21 . THR A 1 41  ? -2.863  8.977   8.743   1.00 0.00 ? 59  THR A HG21 4  
ATOM 7195  H HG22 . THR A 1 41  ? -4.272  9.897   9.272   1.00 0.00 ? 59  THR A HG22 4  
ATOM 7196  H HG23 . THR A 1 41  ? -2.797  10.738  8.792   1.00 0.00 ? 59  THR A HG23 4  
ATOM 7197  N N    . LEU A 1 42  ? -5.414  7.697   5.572   1.00 0.00 ? 60  LEU A N    4  
ATOM 7198  C CA   . LEU A 1 42  ? -6.432  7.309   4.600   1.00 0.00 ? 60  LEU A CA   4  
ATOM 7199  C C    . LEU A 1 42  ? -6.937  8.523   3.827   1.00 0.00 ? 60  LEU A C    4  
ATOM 7200  O O    . LEU A 1 42  ? -7.014  9.636   4.351   1.00 0.00 ? 60  LEU A O    4  
ATOM 7201  C CB   . LEU A 1 42  ? -7.600  6.616   5.306   1.00 0.00 ? 60  LEU A CB   4  
ATOM 7202  C CG   . LEU A 1 42  ? -7.250  5.363   6.110   1.00 0.00 ? 60  LEU A CG   4  
ATOM 7203  C CD1  . LEU A 1 42  ? -8.373  5.021   7.077   1.00 0.00 ? 60  LEU A CD1  4  
ATOM 7204  C CD2  . LEU A 1 42  ? -6.971  4.193   5.179   1.00 0.00 ? 60  LEU A CD2  4  
ATOM 7205  H H    . LEU A 1 42  ? -5.509  7.408   6.503   1.00 0.00 ? 60  LEU A H    4  
ATOM 7206  H HA   . LEU A 1 42  ? -5.980  6.618   3.905   1.00 0.00 ? 60  LEU A HA   4  
ATOM 7207  H HB3  . LEU A 1 42  ? -8.320  6.336   4.550   1.00 0.00 ? 60  LEU A HB3  4  
ATOM 7208  H HG   . LEU A 1 42  ? -6.358  5.553   6.688   1.00 0.00 ? 60  LEU A HG   4  
ATOM 7209  H HD11 . LEU A 1 42  ? -9.277  4.816   6.524   1.00 0.00 ? 60  LEU A HD11 4  
ATOM 7210  H HD12 . LEU A 1 42  ? -8.540  5.855   7.744   1.00 0.00 ? 60  LEU A HD12 4  
ATOM 7211  H HD13 . LEU A 1 42  ? -8.097  4.150   7.654   1.00 0.00 ? 60  LEU A HD13 4  
ATOM 7212  H HD21 . LEU A 1 42  ? -7.725  4.158   4.407   1.00 0.00 ? 60  LEU A HD21 4  
ATOM 7213  H HD22 . LEU A 1 42  ? -6.991  3.272   5.743   1.00 0.00 ? 60  LEU A HD22 4  
ATOM 7214  H HD23 . LEU A 1 42  ? -5.998  4.318   4.726   1.00 0.00 ? 60  LEU A HD23 4  
ATOM 7215  N N    . PRO A 1 43  ? -7.292  8.306   2.552   1.00 0.00 ? 61  PRO A N    4  
ATOM 7216  C CA   . PRO A 1 43  ? -7.801  9.370   1.681   1.00 0.00 ? 61  PRO A CA   4  
ATOM 7217  C C    . PRO A 1 43  ? -9.192  9.843   2.092   1.00 0.00 ? 61  PRO A C    4  
ATOM 7218  O O    . PRO A 1 43  ? -9.878  9.182   2.871   1.00 0.00 ? 61  PRO A O    4  
ATOM 7219  C CB   . PRO A 1 43  ? -7.847  8.707   0.302   1.00 0.00 ? 61  PRO A CB   4  
ATOM 7220  C CG   . PRO A 1 43  ? -7.983  7.252   0.586   1.00 0.00 ? 61  PRO A CG   4  
ATOM 7221  C CD   . PRO A 1 43  ? -7.229  7.007   1.864   1.00 0.00 ? 61  PRO A CD   4  
ATOM 7222  H HA   . PRO A 1 43  ? -7.128  10.215  1.653   1.00 0.00 ? 61  PRO A HA   4  
ATOM 7223  H HB3  . PRO A 1 43  ? -6.936  8.920   -0.235  1.00 0.00 ? 61  PRO A HB3  4  
ATOM 7224  H HG3  . PRO A 1 43  ? -7.550  6.678   -0.220  1.00 0.00 ? 61  PRO A HG3  4  
ATOM 7225  H HD3  . PRO A 1 43  ? -6.206  6.734   1.651   1.00 0.00 ? 61  PRO A HD3  4  
ATOM 7226  N N    . THR A 1 44  ? -9.602  10.992  1.562   1.00 0.00 ? 62  THR A N    4  
ATOM 7227  C CA   . THR A 1 44  ? -10.909 11.553  1.874   1.00 0.00 ? 62  THR A CA   4  
ATOM 7228  C C    . THR A 1 44  ? -11.931 11.198  0.801   1.00 0.00 ? 62  THR A C    4  
ATOM 7229  O O    . THR A 1 44  ? -11.656 10.394  -0.089  1.00 0.00 ? 62  THR A O    4  
ATOM 7230  C CB   . THR A 1 44  ? -10.844 13.085  2.017   1.00 0.00 ? 62  THR A CB   4  
ATOM 7231  O OG1  . THR A 1 44  ? -10.694 13.691  0.729   1.00 0.00 ? 62  THR A OG1  4  
ATOM 7232  C CG2  . THR A 1 44  ? -9.686  13.496  2.914   1.00 0.00 ? 62  THR A CG2  4  
ATOM 7233  H H    . THR A 1 44  ? -9.009  11.472  0.948   1.00 0.00 ? 62  THR A H    4  
ATOM 7234  H HA   . THR A 1 44  ? -11.234 11.138  2.818   1.00 0.00 ? 62  THR A HA   4  
ATOM 7235  H HB   . THR A 1 44  ? -11.766 13.430  2.464   1.00 0.00 ? 62  THR A HB   4  
ATOM 7236  H HG1  . THR A 1 44  ? -11.287 14.443  0.658   1.00 0.00 ? 62  THR A HG1  4  
ATOM 7237  H HG21 . THR A 1 44  ? -8.769  13.490  2.344   1.00 0.00 ? 62  THR A HG21 4  
ATOM 7238  H HG22 . THR A 1 44  ? -9.603  12.800  3.736   1.00 0.00 ? 62  THR A HG22 4  
ATOM 7239  H HG23 . THR A 1 44  ? -9.864  14.488  3.299   1.00 0.00 ? 62  THR A HG23 4  
ATOM 7240  N N    . MET A 1 45  ? -13.111 11.802  0.889   1.00 0.00 ? 63  MET A N    4  
ATOM 7241  C CA   . MET A 1 45  ? -14.173 11.549  -0.076  1.00 0.00 ? 63  MET A CA   4  
ATOM 7242  C C    . MET A 1 45  ? -13.883 12.252  -1.399  1.00 0.00 ? 63  MET A C    4  
ATOM 7243  O O    . MET A 1 45  ? -13.690 11.604  -2.427  1.00 0.00 ? 63  MET A O    4  
ATOM 7244  C CB   . MET A 1 45  ? -15.520 12.019  0.479   1.00 0.00 ? 63  MET A CB   4  
ATOM 7245  C CG   . MET A 1 45  ? -16.709 11.266  -0.095  1.00 0.00 ? 63  MET A CG   4  
ATOM 7246  S SD   . MET A 1 45  ? -17.131 11.802  -1.765  1.00 0.00 ? 63  MET A SD   4  
ATOM 7247  C CE   . MET A 1 45  ? -18.702 10.975  -1.999  1.00 0.00 ? 63  MET A CE   4  
ATOM 7248  H H    . MET A 1 45  ? -13.272 12.433  1.622   1.00 0.00 ? 63  MET A H    4  
ATOM 7249  H HA   . MET A 1 45  ? -14.217 10.485  -0.250  1.00 0.00 ? 63  MET A HA   4  
ATOM 7250  H HB3  . MET A 1 45  ? -15.643 13.067  0.253   1.00 0.00 ? 63  MET A HB3  4  
ATOM 7251  H HG3  . MET A 1 45  ? -17.562 11.428  0.547   1.00 0.00 ? 63  MET A HG3  4  
ATOM 7252  H HE1  . MET A 1 45  ? -18.536 10.009  -2.455  1.00 0.00 ? 63  MET A HE1  4  
ATOM 7253  H HE2  . MET A 1 45  ? -19.186 10.843  -1.043  1.00 0.00 ? 63  MET A HE2  4  
ATOM 7254  H HE3  . MET A 1 45  ? -19.331 11.573  -2.642  1.00 0.00 ? 63  MET A HE3  4  
ATOM 7255  N N    . ALA A 1 46  ? -13.855 13.581  -1.366  1.00 0.00 ? 64  ALA A N    4  
ATOM 7256  C CA   . ALA A 1 46  ? -13.586 14.369  -2.561  1.00 0.00 ? 64  ALA A CA   4  
ATOM 7257  C C    . ALA A 1 46  ? -12.232 14.010  -3.163  1.00 0.00 ? 64  ALA A C    4  
ATOM 7258  O O    . ALA A 1 46  ? -12.047 14.080  -4.378  1.00 0.00 ? 64  ALA A O    4  
ATOM 7259  C CB   . ALA A 1 46  ? -13.644 15.855  -2.236  1.00 0.00 ? 64  ALA A CB   4  
ATOM 7260  H H    . ALA A 1 46  ? -14.017 14.039  -0.515  1.00 0.00 ? 64  ALA A H    4  
ATOM 7261  H HA   . ALA A 1 46  ? -14.360 14.154  -3.284  1.00 0.00 ? 64  ALA A HA   4  
ATOM 7262  H HB1  . ALA A 1 46  ? -14.024 16.396  -3.092  1.00 0.00 ? 64  ALA A HB1  4  
ATOM 7263  H HB2  . ALA A 1 46  ? -14.297 16.013  -1.391  1.00 0.00 ? 64  ALA A HB2  4  
ATOM 7264  H HB3  . ALA A 1 46  ? -12.653 16.210  -1.998  1.00 0.00 ? 64  ALA A HB3  4  
ATOM 7265  N N    . GLN A 1 47  ? -11.291 13.627  -2.307  1.00 0.00 ? 65  GLN A N    4  
ATOM 7266  C CA   . GLN A 1 47  ? -9.954  13.257  -2.756  1.00 0.00 ? 65  GLN A CA   4  
ATOM 7267  C C    . GLN A 1 47  ? -10.022 12.215  -3.868  1.00 0.00 ? 65  GLN A C    4  
ATOM 7268  O O    . GLN A 1 47  ? -9.223  12.238  -4.803  1.00 0.00 ? 65  GLN A O    4  
ATOM 7269  C CB   . GLN A 1 47  ? -9.130  12.719  -1.586  1.00 0.00 ? 65  GLN A CB   4  
ATOM 7270  C CG   . GLN A 1 47  ? -8.290  13.780  -0.895  1.00 0.00 ? 65  GLN A CG   4  
ATOM 7271  C CD   . GLN A 1 47  ? -7.284  14.426  -1.828  1.00 0.00 ? 65  GLN A CD   4  
ATOM 7272  O OE1  . GLN A 1 47  ? -6.948  13.874  -2.875  1.00 0.00 ? 65  GLN A OE1  4  
ATOM 7273  N NE2  . GLN A 1 47  ? -6.798  15.603  -1.450  1.00 0.00 ? 65  GLN A NE2  4  
ATOM 7274  H H    . GLN A 1 47  ? -11.501 13.591  -1.351  1.00 0.00 ? 65  GLN A H    4  
ATOM 7275  H HA   . GLN A 1 47  ? -9.477  14.146  -3.141  1.00 0.00 ? 65  GLN A HA   4  
ATOM 7276  H HB3  . GLN A 1 47  ? -8.468  11.947  -1.951  1.00 0.00 ? 65  GLN A HB3  4  
ATOM 7277  H HG3  . GLN A 1 47  ? -7.756  13.321  -0.076  1.00 0.00 ? 65  GLN A HG3  4  
ATOM 7278  H HE21 . GLN A 1 47  ? -7.110  15.982  -0.601  1.00 0.00 ? 65  GLN A HE21 4  
ATOM 7279  H HE22 . GLN A 1 47  ? -6.146  16.043  -2.034  1.00 0.00 ? 65  GLN A HE22 4  
ATOM 7280  N N    . MET A 1 48  ? -10.982 11.302  -3.759  1.00 0.00 ? 66  MET A N    4  
ATOM 7281  C CA   . MET A 1 48  ? -11.153 10.252  -4.756  1.00 0.00 ? 66  MET A CA   4  
ATOM 7282  C C    . MET A 1 48  ? -11.589 10.840  -6.095  1.00 0.00 ? 66  MET A C    4  
ATOM 7283  O O    . MET A 1 48  ? -10.873 10.736  -7.090  1.00 0.00 ? 66  MET A O    4  
ATOM 7284  C CB   . MET A 1 48  ? -12.184 9.227   -4.276  1.00 0.00 ? 66  MET A CB   4  
ATOM 7285  C CG   . MET A 1 48  ? -12.006 8.825   -2.821  1.00 0.00 ? 66  MET A CG   4  
ATOM 7286  S SD   . MET A 1 48  ? -10.341 8.238   -2.460  1.00 0.00 ? 66  MET A SD   4  
ATOM 7287  C CE   . MET A 1 48  ? -10.297 6.728   -3.423  1.00 0.00 ? 66  MET A CE   4  
ATOM 7288  H H    . MET A 1 48  ? -11.590 11.336  -2.991  1.00 0.00 ? 66  MET A H    4  
ATOM 7289  H HA   . MET A 1 48  ? -10.202 9.760   -4.885  1.00 0.00 ? 66  MET A HA   4  
ATOM 7290  H HB3  . MET A 1 48  ? -12.102 8.339   -4.885  1.00 0.00 ? 66  MET A HB3  4  
ATOM 7291  H HG3  . MET A 1 48  ? -12.710 8.037   -2.594  1.00 0.00 ? 66  MET A HG3  4  
ATOM 7292  H HE1  . MET A 1 48  ? -9.272  6.474   -3.647  1.00 0.00 ? 66  MET A HE1  4  
ATOM 7293  H HE2  . MET A 1 48  ? -10.752 5.929   -2.859  1.00 0.00 ? 66  MET A HE2  4  
ATOM 7294  H HE3  . MET A 1 48  ? -10.842 6.874   -4.345  1.00 0.00 ? 66  MET A HE3  4  
ATOM 7295  N N    . GLU A 1 49  ? -12.767 11.457  -6.111  1.00 0.00 ? 67  GLU A N    4  
ATOM 7296  C CA   . GLU A 1 49  ? -13.297 12.058  -7.328  1.00 0.00 ? 67  GLU A CA   4  
ATOM 7297  C C    . GLU A 1 49  ? -12.286 13.022  -7.944  1.00 0.00 ? 67  GLU A C    4  
ATOM 7298  O O    . GLU A 1 49  ? -12.275 13.238  -9.155  1.00 0.00 ? 67  GLU A O    4  
ATOM 7299  C CB   . GLU A 1 49  ? -14.604 12.797  -7.031  1.00 0.00 ? 67  GLU A CB   4  
ATOM 7300  C CG   . GLU A 1 49  ? -15.608 11.966  -6.248  1.00 0.00 ? 67  GLU A CG   4  
ATOM 7301  C CD   . GLU A 1 49  ? -17.041 12.244  -6.657  1.00 0.00 ? 67  GLU A CD   4  
ATOM 7302  O OE1  . GLU A 1 49  ? -17.443 13.425  -6.644  1.00 0.00 ? 67  GLU A OE1  4  
ATOM 7303  O OE2  . GLU A 1 49  ? -17.760 11.278  -6.990  1.00 0.00 ? 67  GLU A OE2  4  
ATOM 7304  H H    . GLU A 1 49  ? -13.291 11.508  -5.284  1.00 0.00 ? 67  GLU A H    4  
ATOM 7305  H HA   . GLU A 1 49  ? -13.494 11.265  -8.032  1.00 0.00 ? 67  GLU A HA   4  
ATOM 7306  H HB3  . GLU A 1 49  ? -15.061 13.085  -7.967  1.00 0.00 ? 67  GLU A HB3  4  
ATOM 7307  H HG3  . GLU A 1 49  ? -15.498 12.188  -5.197  1.00 0.00 ? 67  GLU A HG3  4  
ATOM 7308  N N    . LYS A 1 50  ? -11.436 13.598  -7.099  1.00 0.00 ? 68  LYS A N    4  
ATOM 7309  C CA   . LYS A 1 50  ? -10.419 14.537  -7.558  1.00 0.00 ? 68  LYS A CA   4  
ATOM 7310  C C    . LYS A 1 50  ? -9.304  13.811  -8.303  1.00 0.00 ? 68  LYS A C    4  
ATOM 7311  O O    . LYS A 1 50  ? -8.943  14.189  -9.417  1.00 0.00 ? 68  LYS A O    4  
ATOM 7312  C CB   . LYS A 1 50  ? -9.836  15.308  -6.371  1.00 0.00 ? 68  LYS A CB   4  
ATOM 7313  C CG   . LYS A 1 50  ? -8.956  16.476  -6.779  1.00 0.00 ? 68  LYS A CG   4  
ATOM 7314  C CD   . LYS A 1 50  ? -7.711  16.565  -5.910  1.00 0.00 ? 68  LYS A CD   4  
ATOM 7315  C CE   . LYS A 1 50  ? -8.062  16.867  -4.462  1.00 0.00 ? 68  LYS A CE   4  
ATOM 7316  N NZ   . LYS A 1 50  ? -7.524  18.184  -4.024  1.00 0.00 ? 68  LYS A NZ   4  
ATOM 7317  H H    . LYS A 1 50  ? -11.494 13.385  -6.144  1.00 0.00 ? 68  LYS A H    4  
ATOM 7318  H HA   . LYS A 1 50  ? -10.893 15.235  -8.232  1.00 0.00 ? 68  LYS A HA   4  
ATOM 7319  H HB3  . LYS A 1 50  ? -9.246  14.629  -5.772  1.00 0.00 ? 68  LYS A HB3  4  
ATOM 7320  H HG3  . LYS A 1 50  ? -9.519  17.393  -6.679  1.00 0.00 ? 68  LYS A HG3  4  
ATOM 7321  H HD3  . LYS A 1 50  ? -7.074  17.353  -6.289  1.00 0.00 ? 68  LYS A HD3  4  
ATOM 7322  H HE3  . LYS A 1 50  ? -7.647  16.091  -3.836  1.00 0.00 ? 68  LYS A HE3  4  
ATOM 7323  H HZ1  . LYS A 1 50  ? -6.609  18.055  -3.548  1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 7324  H HZ2  . LYS A 1 50  ? -8.184  18.637  -3.361  1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 7325  H HZ3  . LYS A 1 50  ? -7.391  18.807  -4.846  1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 7326  N N    . ALA A 1 51  ? -8.766  12.767  -7.682  1.00 0.00 ? 69  ALA A N    4  
ATOM 7327  C CA   . ALA A 1 51  ? -7.696  11.986  -8.290  1.00 0.00 ? 69  ALA A CA   4  
ATOM 7328  C C    . ALA A 1 51  ? -8.180  11.278  -9.551  1.00 0.00 ? 69  ALA A C    4  
ATOM 7329  O O    . ALA A 1 51  ? -7.383  10.930  -10.424 1.00 0.00 ? 69  ALA A O    4  
ATOM 7330  C CB   . ALA A 1 51  ? -7.147  10.976  -7.292  1.00 0.00 ? 69  ALA A CB   4  
ATOM 7331  H H    . ALA A 1 51  ? -9.099  12.514  -6.796  1.00 0.00 ? 69  ALA A H    4  
ATOM 7332  H HA   . ALA A 1 51  ? -6.896  12.664  -8.555  1.00 0.00 ? 69  ALA A HA   4  
ATOM 7333  H HB1  . ALA A 1 51  ? -6.917  11.478  -6.364  1.00 0.00 ? 69  ALA A HB1  4  
ATOM 7334  H HB2  . ALA A 1 51  ? -7.886  10.210  -7.115  1.00 0.00 ? 69  ALA A HB2  4  
ATOM 7335  H HB3  . ALA A 1 51  ? -6.251  10.526  -7.692  1.00 0.00 ? 69  ALA A HB3  4  
ATOM 7336  N N    . LEU A 1 52  ? -9.488  11.066  -9.640  1.00 0.00 ? 70  LEU A N    4  
ATOM 7337  C CA   . LEU A 1 52  ? -10.078 10.397  -10.793 1.00 0.00 ? 70  LEU A CA   4  
ATOM 7338  C C    . LEU A 1 52  ? -9.618  11.048  -12.094 1.00 0.00 ? 70  LEU A C    4  
ATOM 7339  O O    . LEU A 1 52  ? -9.282  10.362  -13.059 1.00 0.00 ? 70  LEU A O    4  
ATOM 7340  C CB   . LEU A 1 52  ? -11.605 10.434  -10.703 1.00 0.00 ? 70  LEU A CB   4  
ATOM 7341  C CG   . LEU A 1 52  ? -12.362 9.890   -11.915 1.00 0.00 ? 70  LEU A CG   4  
ATOM 7342  C CD1  . LEU A 1 52  ? -12.656 8.408   -11.740 1.00 0.00 ? 70  LEU A CD1  4  
ATOM 7343  C CD2  . LEU A 1 52  ? -13.652 10.670  -12.133 1.00 0.00 ? 70  LEU A CD2  4  
ATOM 7344  H H    . LEU A 1 52  ? -10.072 11.365  -8.911  1.00 0.00 ? 70  LEU A H    4  
ATOM 7345  H HA   . LEU A 1 52  ? -9.750  9.368   -10.785 1.00 0.00 ? 70  LEU A HA   4  
ATOM 7346  H HB3  . LEU A 1 52  ? -11.901 11.464  -10.562 1.00 0.00 ? 70  LEU A HB3  4  
ATOM 7347  H HG   . LEU A 1 52  ? -11.747 10.005  -12.797 1.00 0.00 ? 70  LEU A HG   4  
ATOM 7348  H HD11 . LEU A 1 52  ? -11.730 7.855   -11.741 1.00 0.00 ? 70  LEU A HD11 4  
ATOM 7349  H HD12 . LEU A 1 52  ? -13.281 8.067   -12.551 1.00 0.00 ? 70  LEU A HD12 4  
ATOM 7350  H HD13 . LEU A 1 52  ? -13.169 8.253   -10.801 1.00 0.00 ? 70  LEU A HD13 4  
ATOM 7351  H HD21 . LEU A 1 52  ? -14.485 9.984   -12.160 1.00 0.00 ? 70  LEU A HD21 4  
ATOM 7352  H HD22 . LEU A 1 52  ? -13.595 11.205  -13.070 1.00 0.00 ? 70  LEU A HD22 4  
ATOM 7353  H HD23 . LEU A 1 52  ? -13.789 11.371  -11.324 1.00 0.00 ? 70  LEU A HD23 4  
ATOM 7354  N N    . SER A 1 53  ? -9.604  12.378  -12.112 1.00 0.00 ? 71  SER A N    4  
ATOM 7355  C CA   . SER A 1 53  ? -9.186  13.122  -13.294 1.00 0.00 ? 71  SER A CA   4  
ATOM 7356  C C    . SER A 1 53  ? -7.671  13.303  -13.314 1.00 0.00 ? 71  SER A C    4  
ATOM 7357  O O    . SER A 1 53  ? -7.097  13.700  -14.327 1.00 0.00 ? 71  SER A O    4  
ATOM 7358  C CB   . SER A 1 53  ? -9.876  14.487  -13.333 1.00 0.00 ? 71  SER A CB   4  
ATOM 7359  O OG   . SER A 1 53  ? -9.641  15.141  -14.568 1.00 0.00 ? 71  SER A OG   4  
ATOM 7360  H H    . SER A 1 53  ? -9.885  12.868  -11.311 1.00 0.00 ? 71  SER A H    4  
ATOM 7361  H HA   . SER A 1 53  ? -9.481  12.554  -14.164 1.00 0.00 ? 71  SER A HA   4  
ATOM 7362  H HB3  . SER A 1 53  ? -9.492  15.104  -12.534 1.00 0.00 ? 71  SER A HB3  4  
ATOM 7363  H HG   . SER A 1 53  ? -9.639  16.092  -14.431 1.00 0.00 ? 71  SER A HG   4  
ATOM 7364  N N    . ILE A 1 54  ? -7.032  13.010  -12.188 1.00 0.00 ? 72  ILE A N    4  
ATOM 7365  C CA   . ILE A 1 54  ? -5.585  13.139  -12.076 1.00 0.00 ? 72  ILE A CA   4  
ATOM 7366  C C    . ILE A 1 54  ? -4.879  11.889  -12.592 1.00 0.00 ? 72  ILE A C    4  
ATOM 7367  O O    . ILE A 1 54  ? -3.707  11.933  -12.961 1.00 0.00 ? 72  ILE A O    4  
ATOM 7368  C CB   . ILE A 1 54  ? -5.152  13.394  -10.619 1.00 0.00 ? 72  ILE A CB   4  
ATOM 7369  C CG1  . ILE A 1 54  ? -5.792  14.679  -10.092 1.00 0.00 ? 72  ILE A CG1  4  
ATOM 7370  C CG2  . ILE A 1 54  ? -3.637  13.471  -10.521 1.00 0.00 ? 72  ILE A CG2  4  
ATOM 7371  C CD1  . ILE A 1 54  ? -5.573  14.900  -8.611  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 7372  H H    . ILE A 1 54  ? -7.545  12.698  -11.413 1.00 0.00 ? 72  ILE A H    4  
ATOM 7373  H HA   . ILE A 1 54  ? -5.278  13.985  -12.673 1.00 0.00 ? 72  ILE A HA   4  
ATOM 7374  H HB   . ILE A 1 54  ? -5.486  12.561  -10.017 1.00 0.00 ? 72  ILE A HB   4  
ATOM 7375  H HG13 . ILE A 1 54  ? -6.858  14.641  -10.268 1.00 0.00 ? 72  ILE A HG13 4  
ATOM 7376  H HG21 . ILE A 1 54  ? -3.361  14.223  -9.797  1.00 0.00 ? 72  ILE A HG21 4  
ATOM 7377  H HG22 . ILE A 1 54  ? -3.247  12.513  -10.212 1.00 0.00 ? 72  ILE A HG22 4  
ATOM 7378  H HG23 . ILE A 1 54  ? -3.226  13.733  -11.485 1.00 0.00 ? 72  ILE A HG23 4  
ATOM 7379  H HD11 . ILE A 1 54  ? -6.432  14.542  -8.062  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 7380  H HD12 . ILE A 1 54  ? -4.692  14.364  -8.294  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 7381  H HD13 . ILE A 1 54  ? -5.442  15.957  -8.421  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 7382  N N    . GLY A 1 55  ? -5.604  10.774  -12.617 1.00 0.00 ? 73  GLY A N    4  
ATOM 7383  C CA   . GLY A 1 55  ? -5.032  9.528   -13.092 1.00 0.00 ? 73  GLY A CA   4  
ATOM 7384  C C    . GLY A 1 55  ? -5.188  8.401   -12.090 1.00 0.00 ? 73  GLY A C    4  
ATOM 7385  O O    . GLY A 1 55  ? -4.324  7.529   -11.987 1.00 0.00 ? 73  GLY A O    4  
ATOM 7386  H H    . GLY A 1 55  ? -6.534  10.798  -12.311 1.00 0.00 ? 73  GLY A H    4  
ATOM 7387  H HA2  . GLY A 1 55  ? -5.521  9.249   -14.013 1.00 0.00 ? 73  GLY A HA2  4  
ATOM 7388  H HA3  . GLY A 1 55  ? -3.979  9.680   -13.285 1.00 0.00 ? 73  GLY A HA3  4  
ATOM 7389  N N    . PHE A 1 56  ? -6.291  8.418   -11.351 1.00 0.00 ? 74  PHE A N    4  
ATOM 7390  C CA   . PHE A 1 56  ? -6.555  7.390   -10.350 1.00 0.00 ? 74  PHE A CA   4  
ATOM 7391  C C    . PHE A 1 56  ? -7.498  6.324   -10.902 1.00 0.00 ? 74  PHE A C    4  
ATOM 7392  O O    . PHE A 1 56  ? -8.487  5.965   -10.263 1.00 0.00 ? 74  PHE A O    4  
ATOM 7393  C CB   . PHE A 1 56  ? -7.158  8.017   -9.091  1.00 0.00 ? 74  PHE A CB   4  
ATOM 7394  C CG   . PHE A 1 56  ? -6.705  7.359   -7.819  1.00 0.00 ? 74  PHE A CG   4  
ATOM 7395  C CD1  . PHE A 1 56  ? -5.355  7.219   -7.537  1.00 0.00 ? 74  PHE A CD1  4  
ATOM 7396  C CD2  . PHE A 1 56  ? -7.628  6.881   -6.903  1.00 0.00 ? 74  PHE A CD2  4  
ATOM 7397  C CE1  . PHE A 1 56  ? -4.936  6.615   -6.368  1.00 0.00 ? 74  PHE A CE1  4  
ATOM 7398  C CE2  . PHE A 1 56  ? -7.215  6.274   -5.732  1.00 0.00 ? 74  PHE A CE2  4  
ATOM 7399  C CZ   . PHE A 1 56  ? -5.867  6.142   -5.463  1.00 0.00 ? 74  PHE A CZ   4  
ATOM 7400  H H    . PHE A 1 56  ? -6.942  9.139   -11.479 1.00 0.00 ? 74  PHE A H    4  
ATOM 7401  H HA   . PHE A 1 56  ? -5.615  6.925   -10.096 1.00 0.00 ? 74  PHE A HA   4  
ATOM 7402  H HB3  . PHE A 1 56  ? -8.233  7.941   -9.141  1.00 0.00 ? 74  PHE A HB3  4  
ATOM 7403  H HD1  . PHE A 1 56  ? -4.626  7.590   -8.244  1.00 0.00 ? 74  PHE A HD1  4  
ATOM 7404  H HD2  . PHE A 1 56  ? -8.684  6.984   -7.113  1.00 0.00 ? 74  PHE A HD2  4  
ATOM 7405  H HE1  . PHE A 1 56  ? -3.881  6.512   -6.161  1.00 0.00 ? 74  PHE A HE1  4  
ATOM 7406  H HE2  . PHE A 1 56  ? -7.946  5.907   -5.027  1.00 0.00 ? 74  PHE A HE2  4  
ATOM 7407  H HZ   . PHE A 1 56  ? -5.542  5.670   -4.550  1.00 0.00 ? 74  PHE A HZ   4  
ATOM 7408  N N    . GLU A 1 57  ? -7.184  5.823   -12.093 1.00 0.00 ? 75  GLU A N    4  
ATOM 7409  C CA   . GLU A 1 57  ? -8.003  4.800   -12.731 1.00 0.00 ? 75  GLU A CA   4  
ATOM 7410  C C    . GLU A 1 57  ? -7.702  3.422   -12.149 1.00 0.00 ? 75  GLU A C    4  
ATOM 7411  O O    . GLU A 1 57  ? -6.546  3.003   -12.078 1.00 0.00 ? 75  GLU A O    4  
ATOM 7412  C CB   . GLU A 1 57  ? -7.762  4.793   -14.243 1.00 0.00 ? 75  GLU A CB   4  
ATOM 7413  C CG   . GLU A 1 57  ? -6.297  4.671   -14.625 1.00 0.00 ? 75  GLU A CG   4  
ATOM 7414  C CD   . GLU A 1 57  ? -5.715  5.977   -15.127 1.00 0.00 ? 75  GLU A CD   4  
ATOM 7415  O OE1  . GLU A 1 57  ? -6.084  7.040   -14.586 1.00 0.00 ? 75  GLU A OE1  4  
ATOM 7416  O OE2  . GLU A 1 57  ? -4.888  5.937   -16.063 1.00 0.00 ? 75  GLU A OE2  4  
ATOM 7417  H H    . GLU A 1 57  ? -6.382  6.151   -12.553 1.00 0.00 ? 75  GLU A H    4  
ATOM 7418  H HA   . GLU A 1 57  ? -9.039  5.040   -12.543 1.00 0.00 ? 75  GLU A HA   4  
ATOM 7419  H HB3  . GLU A 1 57  ? -8.146  5.711   -14.661 1.00 0.00 ? 75  GLU A HB3  4  
ATOM 7420  H HG3  . GLU A 1 57  ? -6.201  3.928   -15.404 1.00 0.00 ? 75  GLU A HG3  4  
ATOM 7421  N N    . THR A 1 58  ? -8.751  2.720   -11.734 1.00 0.00 ? 76  THR A N    4  
ATOM 7422  C CA   . THR A 1 58  ? -8.602  1.390   -11.157 1.00 0.00 ? 76  THR A CA   4  
ATOM 7423  C C    . THR A 1 58  ? -9.959  0.767   -10.853 1.00 0.00 ? 76  THR A C    4  
ATOM 7424  O O    . THR A 1 58  ? -10.852 1.427   -10.319 1.00 0.00 ? 76  THR A O    4  
ATOM 7425  C CB   . THR A 1 58  ? -7.766  1.430   -9.864  1.00 0.00 ? 76  THR A CB   4  
ATOM 7426  O OG1  . THR A 1 58  ? -7.847  0.169   -9.189  1.00 0.00 ? 76  THR A OG1  4  
ATOM 7427  C CG2  . THR A 1 58  ? -8.250  2.536   -8.940  1.00 0.00 ? 76  THR A CG2  4  
ATOM 7428  H H    . THR A 1 58  ? -9.648  3.107   -11.817 1.00 0.00 ? 76  THR A H    4  
ATOM 7429  H HA   . THR A 1 58  ? -8.085  0.770   -11.877 1.00 0.00 ? 76  THR A HA   4  
ATOM 7430  H HB   . THR A 1 58  ? -6.736  1.623   -10.126 1.00 0.00 ? 76  THR A HB   4  
ATOM 7431  H HG1  . THR A 1 58  ? -6.972  -0.097  -8.901  1.00 0.00 ? 76  THR A HG1  4  
ATOM 7432  H HG21 . THR A 1 58  ? -9.255  2.319   -8.614  1.00 0.00 ? 76  THR A HG21 4  
ATOM 7433  H HG22 . THR A 1 58  ? -8.239  3.478   -9.471  1.00 0.00 ? 76  THR A HG22 4  
ATOM 7434  H HG23 . THR A 1 58  ? -7.598  2.600   -8.083  1.00 0.00 ? 76  THR A HG23 4  
ATOM 7435  N N    . CYS A 1 59  ? -10.109 -0.509  -11.193 1.00 0.00 ? 77  CYS A N    4  
ATOM 7436  C CA   . CYS A 1 59  ? -11.358 -1.222  -10.955 1.00 0.00 ? 77  CYS A CA   4  
ATOM 7437  C C    . CYS A 1 59  ? -11.266 -2.077  -9.694  1.00 0.00 ? 77  CYS A C    4  
ATOM 7438  O O    . CYS A 1 59  ? -11.888 -3.135  -9.600  1.00 0.00 ? 77  CYS A O    4  
ATOM 7439  C CB   . CYS A 1 59  ? -11.702 -2.106  -12.157 1.00 0.00 ? 77  CYS A CB   4  
ATOM 7440  S SG   . CYS A 1 59  ? -13.480 -2.467  -12.330 1.00 0.00 ? 77  CYS A SG   4  
ATOM 7441  H H    . CYS A 1 59  ? -9.361  -0.983  -11.615 1.00 0.00 ? 77  CYS A H    4  
ATOM 7442  H HA   . CYS A 1 59  ? -12.139 -0.491  -10.823 1.00 0.00 ? 77  CYS A HA   4  
ATOM 7443  H HB3  . CYS A 1 59  ? -11.182 -3.047  -12.063 1.00 0.00 ? 77  CYS A HB3  4  
ATOM 7444  N N    . ARG A 1 60  ? -10.484 -1.609  -8.726  1.00 0.00 ? 78  ARG A N    4  
ATOM 7445  C CA   . ARG A 1 60  ? -10.309 -2.330  -7.470  1.00 0.00 ? 78  ARG A CA   4  
ATOM 7446  C C    . ARG A 1 60  ? -10.759 -1.476  -6.288  1.00 0.00 ? 78  ARG A C    4  
ATOM 7447  O O    . ARG A 1 60  ? -10.283 -0.357  -6.101  1.00 0.00 ? 78  ARG A O    4  
ATOM 7448  C CB   . ARG A 1 60  ? -8.846  -2.737  -7.292  1.00 0.00 ? 78  ARG A CB   4  
ATOM 7449  C CG   . ARG A 1 60  ? -8.446  -3.949  -8.118  1.00 0.00 ? 78  ARG A CG   4  
ATOM 7450  C CD   . ARG A 1 60  ? -8.149  -3.567  -9.559  1.00 0.00 ? 78  ARG A CD   4  
ATOM 7451  N NE   . ARG A 1 60  ? -7.612  -4.690  -10.324 1.00 0.00 ? 78  ARG A NE   4  
ATOM 7452  C CZ   . ARG A 1 60  ? -7.317  -4.626  -11.617 1.00 0.00 ? 78  ARG A CZ   4  
ATOM 7453  N NH1  . ARG A 1 60  ? -7.505  -3.497  -12.286 1.00 0.00 ? 78  ARG A NH1  4  
ATOM 7454  N NH2  . ARG A 1 60  ? -6.833  -5.690  -12.243 1.00 0.00 ? 78  ARG A NH2  4  
ATOM 7455  H H    . ARG A 1 60  ? -10.013 -0.759  -8.859  1.00 0.00 ? 78  ARG A H    4  
ATOM 7456  H HA   . ARG A 1 60  ? -10.919 -3.219  -7.510  1.00 0.00 ? 78  ARG A HA   4  
ATOM 7457  H HB3  . ARG A 1 60  ? -8.673  -2.965  -6.250  1.00 0.00 ? 78  ARG A HB3  4  
ATOM 7458  H HG3  . ARG A 1 60  ? -9.255  -4.665  -8.102  1.00 0.00 ? 78  ARG A HG3  4  
ATOM 7459  H HD3  . ARG A 1 60  ? -7.427  -2.764  -9.563  1.00 0.00 ? 78  ARG A HD3  4  
ATOM 7460  H HE   . ARG A 1 60  ? -7.466  -5.534  -9.848  1.00 0.00 ? 78  ARG A HE   4  
ATOM 7461  H HH11 . ARG A 1 60  ? -7.870  -2.693  -11.818 1.00 0.00 ? 78  ARG A HH11 4  
ATOM 7462  H HH12 . ARG A 1 60  ? -7.281  -3.450  -13.261 1.00 0.00 ? 78  ARG A HH12 4  
ATOM 7463  H HH21 . ARG A 1 60  ? -6.690  -6.542  -11.741 1.00 0.00 ? 78  ARG A HH21 4  
ATOM 7464  H HH22 . ARG A 1 60  ? -6.611  -5.640  -13.216 1.00 0.00 ? 78  ARG A HH22 4  
ATOM 7465  N N    . TYR A 1 61  ? -11.677 -2.014  -5.492  1.00 0.00 ? 79  TYR A N    4  
ATOM 7466  C CA   . TYR A 1 61  ? -12.192 -1.302  -4.329  1.00 0.00 ? 79  TYR A CA   4  
ATOM 7467  C C    . TYR A 1 61  ? -11.052 -0.791  -3.453  1.00 0.00 ? 79  TYR A C    4  
ATOM 7468  O O    . TYR A 1 61  ? -10.077 -1.498  -3.208  1.00 0.00 ? 79  TYR A O    4  
ATOM 7469  C CB   . TYR A 1 61  ? -13.108 -2.216  -3.511  1.00 0.00 ? 79  TYR A CB   4  
ATOM 7470  C CG   . TYR A 1 61  ? -14.202 -2.865  -4.328  1.00 0.00 ? 79  TYR A CG   4  
ATOM 7471  C CD1  . TYR A 1 61  ? -14.933 -2.129  -5.254  1.00 0.00 ? 79  TYR A CD1  4  
ATOM 7472  C CD2  . TYR A 1 61  ? -14.507 -4.210  -4.173  1.00 0.00 ? 79  TYR A CD2  4  
ATOM 7473  C CE1  . TYR A 1 61  ? -15.935 -2.718  -6.002  1.00 0.00 ? 79  TYR A CE1  4  
ATOM 7474  C CE2  . TYR A 1 61  ? -15.507 -4.807  -4.918  1.00 0.00 ? 79  TYR A CE2  4  
ATOM 7475  C CZ   . TYR A 1 61  ? -16.217 -4.057  -5.831  1.00 0.00 ? 79  TYR A CZ   4  
ATOM 7476  O OH   . TYR A 1 61  ? -17.213 -4.647  -6.574  1.00 0.00 ? 79  TYR A OH   4  
ATOM 7477  H H    . TYR A 1 61  ? -12.017 -2.912  -5.693  1.00 0.00 ? 79  TYR A H    4  
ATOM 7478  H HA   . TYR A 1 61  ? -12.765 -0.459  -4.684  1.00 0.00 ? 79  TYR A HA   4  
ATOM 7479  H HB3  . TYR A 1 61  ? -13.575 -1.637  -2.729  1.00 0.00 ? 79  TYR A HB3  4  
ATOM 7480  H HD1  . TYR A 1 61  ? -14.710 -1.081  -5.386  1.00 0.00 ? 79  TYR A HD1  4  
ATOM 7481  H HD2  . TYR A 1 61  ? -13.948 -4.795  -3.456  1.00 0.00 ? 79  TYR A HD2  4  
ATOM 7482  H HE1  . TYR A 1 61  ? -16.492 -2.130  -6.717  1.00 0.00 ? 79  TYR A HE1  4  
ATOM 7483  H HE2  . TYR A 1 61  ? -15.727 -5.856  -4.783  1.00 0.00 ? 79  TYR A HE2  4  
ATOM 7484  H HH   . TYR A 1 61  ? -16.859 -4.925  -7.422  1.00 0.00 ? 79  TYR A HH   4  
ATOM 7485  N N    . GLY A 1 62  ? -11.185 0.446   -2.984  1.00 0.00 ? 80  GLY A N    4  
ATOM 7486  C CA   . GLY A 1 62  ? -10.159 1.034   -2.142  1.00 0.00 ? 80  GLY A CA   4  
ATOM 7487  C C    . GLY A 1 62  ? -10.623 1.218   -0.710  1.00 0.00 ? 80  GLY A C    4  
ATOM 7488  O O    . GLY A 1 62  ? -11.796 1.011   -0.397  1.00 0.00 ? 80  GLY A O    4  
ATOM 7489  H H    . GLY A 1 62  ? -11.985 0.964   -3.214  1.00 0.00 ? 80  GLY A H    4  
ATOM 7490  H HA2  . GLY A 1 62  ? -9.293  0.392   -2.149  1.00 0.00 ? 80  GLY A HA2  4  
ATOM 7491  H HA3  . GLY A 1 62  ? -9.887  1.997   -2.546  1.00 0.00 ? 80  GLY A HA3  4  
ATOM 7492  N N    . PHE A 1 63  ? -9.699  1.604   0.164   1.00 0.00 ? 81  PHE A N    4  
ATOM 7493  C CA   . PHE A 1 63  ? -10.018 1.813   1.572   1.00 0.00 ? 81  PHE A CA   4  
ATOM 7494  C C    . PHE A 1 63  ? -9.729  3.252   1.987   1.00 0.00 ? 81  PHE A C    4  
ATOM 7495  O O    . PHE A 1 63  ? -8.585  3.613   2.260   1.00 0.00 ? 81  PHE A O    4  
ATOM 7496  C CB   . PHE A 1 63  ? -9.216  0.847   2.447   1.00 0.00 ? 81  PHE A CB   4  
ATOM 7497  C CG   . PHE A 1 63  ? -9.595  -0.593  2.253   1.00 0.00 ? 81  PHE A CG   4  
ATOM 7498  C CD1  . PHE A 1 63  ? -10.859 -1.043  2.596   1.00 0.00 ? 81  PHE A CD1  4  
ATOM 7499  C CD2  . PHE A 1 63  ? -8.687  -1.498  1.727   1.00 0.00 ? 81  PHE A CD2  4  
ATOM 7500  C CE1  . PHE A 1 63  ? -11.211 -2.367  2.421   1.00 0.00 ? 81  PHE A CE1  4  
ATOM 7501  C CE2  . PHE A 1 63  ? -9.033  -2.823  1.548   1.00 0.00 ? 81  PHE A CE2  4  
ATOM 7502  C CZ   . PHE A 1 63  ? -10.297 -3.259  1.895   1.00 0.00 ? 81  PHE A CZ   4  
ATOM 7503  H H    . PHE A 1 63  ? -8.782  1.753   -0.146  1.00 0.00 ? 81  PHE A H    4  
ATOM 7504  H HA   . PHE A 1 63  ? -11.070 1.616   1.704   1.00 0.00 ? 81  PHE A HA   4  
ATOM 7505  H HB3  . PHE A 1 63  ? -9.375  1.099   3.485   1.00 0.00 ? 81  PHE A HB3  4  
ATOM 7506  H HD1  . PHE A 1 63  ? -11.576 -0.346  3.007   1.00 0.00 ? 81  PHE A HD1  4  
ATOM 7507  H HD2  . PHE A 1 63  ? -7.697  -1.158  1.455   1.00 0.00 ? 81  PHE A HD2  4  
ATOM 7508  H HE1  . PHE A 1 63  ? -12.200 -2.706  2.692   1.00 0.00 ? 81  PHE A HE1  4  
ATOM 7509  H HE2  . PHE A 1 63  ? -8.315  -3.518  1.136   1.00 0.00 ? 81  PHE A HE2  4  
ATOM 7510  H HZ   . PHE A 1 63  ? -10.569 -4.294  1.756   1.00 0.00 ? 81  PHE A HZ   4  
ATOM 7511  N N    . ILE A 1 64  ? -10.776 4.071   2.032   1.00 0.00 ? 82  ILE A N    4  
ATOM 7512  C CA   . ILE A 1 64  ? -10.637 5.470   2.414   1.00 0.00 ? 82  ILE A CA   4  
ATOM 7513  C C    . ILE A 1 64  ? -10.851 5.655   3.912   1.00 0.00 ? 82  ILE A C    4  
ATOM 7514  O O    . ILE A 1 64  ? -10.908 4.683   4.665   1.00 0.00 ? 82  ILE A O    4  
ATOM 7515  C CB   . ILE A 1 64  ? -11.630 6.364   1.650   1.00 0.00 ? 82  ILE A CB   4  
ATOM 7516  C CG1  . ILE A 1 64  ? -13.061 6.087   2.115   1.00 0.00 ? 82  ILE A CG1  4  
ATOM 7517  C CG2  . ILE A 1 64  ? -11.502 6.139   0.151   1.00 0.00 ? 82  ILE A CG2  4  
ATOM 7518  C CD1  . ILE A 1 64  ? -14.099 6.938   1.417   1.00 0.00 ? 82  ILE A CD1  4  
ATOM 7519  H H    . ILE A 1 64  ? -11.663 3.723   1.803   1.00 0.00 ? 82  ILE A H    4  
ATOM 7520  H HA   . ILE A 1 64  ? -9.633  5.785   2.164   1.00 0.00 ? 82  ILE A HA   4  
ATOM 7521  H HB   . ILE A 1 64  ? -11.386 7.395   1.856   1.00 0.00 ? 82  ILE A HB   4  
ATOM 7522  H HG13 . ILE A 1 64  ? -13.130 6.280   3.175   1.00 0.00 ? 82  ILE A HG13 4  
ATOM 7523  H HG21 . ILE A 1 64  ? -10.481 5.878   -0.087  1.00 0.00 ? 82  ILE A HG21 4  
ATOM 7524  H HG22 . ILE A 1 64  ? -12.157 5.335   -0.150  1.00 0.00 ? 82  ILE A HG22 4  
ATOM 7525  H HG23 . ILE A 1 64  ? -11.775 7.042   -0.375  1.00 0.00 ? 82  ILE A HG23 4  
ATOM 7526  H HD11 . ILE A 1 64  ? -14.728 6.309   0.805   1.00 0.00 ? 82  ILE A HD11 4  
ATOM 7527  H HD12 . ILE A 1 64  ? -14.703 7.445   2.154   1.00 0.00 ? 82  ILE A HD12 4  
ATOM 7528  H HD13 . ILE A 1 64  ? -13.604 7.667   0.793   1.00 0.00 ? 82  ILE A HD13 4  
ATOM 7529  N N    . GLU A 1 65  ? -10.969 6.910   4.336   1.00 0.00 ? 83  GLU A N    4  
ATOM 7530  C CA   . GLU A 1 65  ? -11.179 7.221   5.747   1.00 0.00 ? 83  GLU A CA   4  
ATOM 7531  C C    . GLU A 1 65  ? -12.225 6.293   6.358   1.00 0.00 ? 83  GLU A C    4  
ATOM 7532  O O    . GLU A 1 65  ? -11.960 5.609   7.346   1.00 0.00 ? 83  GLU A O    4  
ATOM 7533  C CB   . GLU A 1 65  ? -11.617 8.678   5.910   1.00 0.00 ? 83  GLU A CB   4  
ATOM 7534  C CG   . GLU A 1 65  ? -11.788 9.103   7.358   1.00 0.00 ? 83  GLU A CG   4  
ATOM 7535  C CD   . GLU A 1 65  ? -10.535 9.737   7.932   1.00 0.00 ? 83  GLU A CD   4  
ATOM 7536  O OE1  . GLU A 1 65  ? -10.223 10.883  7.548   1.00 0.00 ? 83  GLU A OE1  4  
ATOM 7537  O OE2  . GLU A 1 65  ? -9.870  9.087   8.764   1.00 0.00 ? 83  GLU A OE2  4  
ATOM 7538  H H    . GLU A 1 65  ? -10.915 7.641   3.688   1.00 0.00 ? 83  GLU A H    4  
ATOM 7539  H HA   . GLU A 1 65  ? -10.242 7.076   6.261   1.00 0.00 ? 83  GLU A HA   4  
ATOM 7540  H HB3  . GLU A 1 65  ? -12.559 8.816   5.402   1.00 0.00 ? 83  GLU A HB3  4  
ATOM 7541  H HG3  . GLU A 1 65  ? -12.037 8.233   7.948   1.00 0.00 ? 83  GLU A HG3  4  
ATOM 7542  N N    . GLY A 1 66  ? -13.414 6.277   5.764   1.00 0.00 ? 84  GLY A N    4  
ATOM 7543  C CA   . GLY A 1 66  ? -14.483 5.432   6.266   1.00 0.00 ? 84  GLY A CA   4  
ATOM 7544  C C    . GLY A 1 66  ? -15.512 5.106   5.201   1.00 0.00 ? 84  GLY A C    4  
ATOM 7545  O O    . GLY A 1 66  ? -16.675 5.494   5.313   1.00 0.00 ? 84  GLY A O    4  
ATOM 7546  H H    . GLY A 1 66  ? -13.568 6.845   4.980   1.00 0.00 ? 84  GLY A H    4  
ATOM 7547  H HA2  . GLY A 1 66  ? -14.055 4.511   6.633   1.00 0.00 ? 84  GLY A HA2  4  
ATOM 7548  H HA3  . GLY A 1 66  ? -14.975 5.939   7.082   1.00 0.00 ? 84  GLY A HA3  4  
ATOM 7549  N N    . HIS A 1 67  ? -15.083 4.393   4.164   1.00 0.00 ? 85  HIS A N    4  
ATOM 7550  C CA   . HIS A 1 67  ? -15.977 4.017   3.075   1.00 0.00 ? 85  HIS A CA   4  
ATOM 7551  C C    . HIS A 1 67  ? -15.229 3.219   2.011   1.00 0.00 ? 85  HIS A C    4  
ATOM 7552  O O    . HIS A 1 67  ? -14.051 2.901   2.171   1.00 0.00 ? 85  HIS A O    4  
ATOM 7553  C CB   . HIS A 1 67  ? -16.604 5.261   2.447   1.00 0.00 ? 85  HIS A CB   4  
ATOM 7554  C CG   . HIS A 1 67  ? -18.073 5.390   2.709   1.00 0.00 ? 85  HIS A CG   4  
ATOM 7555  N ND1  . HIS A 1 67  ? -18.941 4.319   2.669   1.00 0.00 ? 85  HIS A ND1  4  
ATOM 7556  C CD2  . HIS A 1 67  ? -18.826 6.471   3.018   1.00 0.00 ? 85  HIS A CD2  4  
ATOM 7557  C CE1  . HIS A 1 67  ? -20.165 4.735   2.940   1.00 0.00 ? 85  HIS A CE1  4  
ATOM 7558  N NE2  . HIS A 1 67  ? -20.124 6.037   3.156   1.00 0.00 ? 85  HIS A NE2  4  
ATOM 7559  H H    . HIS A 1 67  ? -14.146 4.114   4.132   1.00 0.00 ? 85  HIS A H    4  
ATOM 7560  H HA   . HIS A 1 67  ? -16.760 3.397   3.486   1.00 0.00 ? 85  HIS A HA   4  
ATOM 7561  H HB3  . HIS A 1 67  ? -16.458 5.231   1.377   1.00 0.00 ? 85  HIS A HB3  4  
ATOM 7562  H HD1  . HIS A 1 67  ? -18.695 3.391   2.470   1.00 0.00 ? 85  HIS A HD1  4  
ATOM 7563  H HD2  . HIS A 1 67  ? -18.475 7.486   3.135   1.00 0.00 ? 85  HIS A HD2  4  
ATOM 7564  H HE1  . HIS A 1 67  ? -21.049 4.116   2.980   1.00 0.00 ? 85  HIS A HE1  4  
ATOM 7565  N N    . VAL A 1 68  ? -15.922 2.898   0.922   1.00 0.00 ? 86  VAL A N    4  
ATOM 7566  C CA   . VAL A 1 68  ? -15.324 2.138   -0.168  1.00 0.00 ? 86  VAL A CA   4  
ATOM 7567  C C    . VAL A 1 68  ? -15.753 2.689   -1.523  1.00 0.00 ? 86  VAL A C    4  
ATOM 7568  O O    . VAL A 1 68  ? -16.914 2.568   -1.916  1.00 0.00 ? 86  VAL A O    4  
ATOM 7569  C CB   . VAL A 1 68  ? -15.706 0.648   -0.089  1.00 0.00 ? 86  VAL A CB   4  
ATOM 7570  C CG1  . VAL A 1 68  ? -15.071 -0.128  -1.232  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 7571  C CG2  . VAL A 1 68  ? -15.296 0.063   1.255   1.00 0.00 ? 86  VAL A CG2  4  
ATOM 7572  H H    . VAL A 1 68  ? -16.858 3.180   0.852   1.00 0.00 ? 86  VAL A H    4  
ATOM 7573  H HA   . VAL A 1 68  ? -14.250 2.218   -0.082  1.00 0.00 ? 86  VAL A HA   4  
ATOM 7574  H HB   . VAL A 1 68  ? -16.779 0.566   -0.180  1.00 0.00 ? 86  VAL A HB   4  
ATOM 7575  H HG11 . VAL A 1 68  ? -14.001 0.019   -1.218  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 7576  H HG12 . VAL A 1 68  ? -15.292 -1.180  -1.121  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 7577  H HG13 . VAL A 1 68  ? -15.469 0.226   -2.172  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 7578  H HG21 . VAL A 1 68  ? -14.219 0.064   1.332   1.00 0.00 ? 86  VAL A HG21 4  
ATOM 7579  H HG22 . VAL A 1 68  ? -15.713 0.662   2.051   1.00 0.00 ? 86  VAL A HG22 4  
ATOM 7580  H HG23 . VAL A 1 68  ? -15.662 -0.949  1.336   1.00 0.00 ? 86  VAL A HG23 4  
ATOM 7581  N N    . VAL A 1 69  ? -14.809 3.297   -2.234  1.00 0.00 ? 87  VAL A N    4  
ATOM 7582  C CA   . VAL A 1 69  ? -15.088 3.867   -3.547  1.00 0.00 ? 87  VAL A CA   4  
ATOM 7583  C C    . VAL A 1 69  ? -14.288 3.160   -4.634  1.00 0.00 ? 87  VAL A C    4  
ATOM 7584  O O    . VAL A 1 69  ? -13.458 2.297   -4.347  1.00 0.00 ? 87  VAL A O    4  
ATOM 7585  C CB   . VAL A 1 69  ? -14.767 5.373   -3.586  1.00 0.00 ? 87  VAL A CB   4  
ATOM 7586  C CG1  . VAL A 1 69  ? -15.643 6.132   -2.600  1.00 0.00 ? 87  VAL A CG1  4  
ATOM 7587  C CG2  . VAL A 1 69  ? -13.293 5.610   -3.293  1.00 0.00 ? 87  VAL A CG2  4  
ATOM 7588  H H    . VAL A 1 69  ? -13.903 3.364   -1.867  1.00 0.00 ? 87  VAL A H    4  
ATOM 7589  H HA   . VAL A 1 69  ? -16.142 3.740   -3.748  1.00 0.00 ? 87  VAL A HA   4  
ATOM 7590  H HB   . VAL A 1 69  ? -14.979 5.741   -4.578  1.00 0.00 ? 87  VAL A HB   4  
ATOM 7591  H HG11 . VAL A 1 69  ? -16.000 7.040   -3.061  1.00 0.00 ? 87  VAL A HG11 4  
ATOM 7592  H HG12 . VAL A 1 69  ? -16.484 5.516   -2.317  1.00 0.00 ? 87  VAL A HG12 4  
ATOM 7593  H HG13 . VAL A 1 69  ? -15.065 6.379   -1.721  1.00 0.00 ? 87  VAL A HG13 4  
ATOM 7594  H HG21 . VAL A 1 69  ? -12.760 4.673   -3.354  1.00 0.00 ? 87  VAL A HG21 4  
ATOM 7595  H HG22 . VAL A 1 69  ? -12.888 6.302   -4.018  1.00 0.00 ? 87  VAL A HG22 4  
ATOM 7596  H HG23 . VAL A 1 69  ? -13.184 6.024   -2.302  1.00 0.00 ? 87  VAL A HG23 4  
ATOM 7597  N N    . ILE A 1 70  ? -14.543 3.532   -5.885  1.00 0.00 ? 88  ILE A N    4  
ATOM 7598  C CA   . ILE A 1 70  ? -13.843 2.933   -7.016  1.00 0.00 ? 88  ILE A CA   4  
ATOM 7599  C C    . ILE A 1 70  ? -13.942 3.819   -8.253  1.00 0.00 ? 88  ILE A C    4  
ATOM 7600  O O    . ILE A 1 70  ? -14.814 3.644   -9.105  1.00 0.00 ? 88  ILE A O    4  
ATOM 7601  C CB   . ILE A 1 70  ? -14.405 1.539   -7.351  1.00 0.00 ? 88  ILE A CB   4  
ATOM 7602  C CG1  . ILE A 1 70  ? -13.777 1.008   -8.641  1.00 0.00 ? 88  ILE A CG1  4  
ATOM 7603  C CG2  . ILE A 1 70  ? -15.921 1.594   -7.477  1.00 0.00 ? 88  ILE A CG2  4  
ATOM 7604  C CD1  . ILE A 1 70  ? -13.849 -0.497  -8.775  1.00 0.00 ? 88  ILE A CD1  4  
ATOM 7605  H H    . ILE A 1 70  ? -15.215 4.223   -6.051  1.00 0.00 ? 88  ILE A H    4  
ATOM 7606  H HA   . ILE A 1 70  ? -12.804 2.825   -6.746  1.00 0.00 ? 88  ILE A HA   4  
ATOM 7607  H HB   . ILE A 1 70  ? -14.159 0.872   -6.538  1.00 0.00 ? 88  ILE A HB   4  
ATOM 7608  H HG13 . ILE A 1 70  ? -12.736 1.297   -8.670  1.00 0.00 ? 88  ILE A HG13 4  
ATOM 7609  H HG21 . ILE A 1 70  ? -16.369 1.049   -6.659  1.00 0.00 ? 88  ILE A HG21 4  
ATOM 7610  H HG22 . ILE A 1 70  ? -16.247 2.623   -7.445  1.00 0.00 ? 88  ILE A HG22 4  
ATOM 7611  H HG23 . ILE A 1 70  ? -16.220 1.149   -8.413  1.00 0.00 ? 88  ILE A HG23 4  
ATOM 7612  H HD11 . ILE A 1 70  ? -13.845 -0.766  -9.820  1.00 0.00 ? 88  ILE A HD11 4  
ATOM 7613  H HD12 . ILE A 1 70  ? -12.999 -0.943  -8.283  1.00 0.00 ? 88  ILE A HD12 4  
ATOM 7614  H HD13 . ILE A 1 70  ? -14.759 -0.855  -8.316  1.00 0.00 ? 88  ILE A HD13 4  
ATOM 7615  N N    . PRO A 1 71  ? -13.027 4.794   -8.358  1.00 0.00 ? 89  PRO A N    4  
ATOM 7616  C CA   . PRO A 1 71  ? -12.989 5.726   -9.489  1.00 0.00 ? 89  PRO A CA   4  
ATOM 7617  C C    . PRO A 1 71  ? -12.556 5.047   -10.784 1.00 0.00 ? 89  PRO A C    4  
ATOM 7618  O O    . PRO A 1 71  ? -11.657 4.206   -10.785 1.00 0.00 ? 89  PRO A O    4  
ATOM 7619  C CB   . PRO A 1 71  ? -11.951 6.765   -9.057  1.00 0.00 ? 89  PRO A CB   4  
ATOM 7620  C CG   . PRO A 1 71  ? -11.073 6.045   -8.091  1.00 0.00 ? 89  PRO A CG   4  
ATOM 7621  C CD   . PRO A 1 71  ? -11.959 5.061   -7.380  1.00 0.00 ? 89  PRO A CD   4  
ATOM 7622  H HA   . PRO A 1 71  ? -13.943 6.208   -9.638  1.00 0.00 ? 89  PRO A HA   4  
ATOM 7623  H HB3  . PRO A 1 71  ? -12.447 7.602   -8.590  1.00 0.00 ? 89  PRO A HB3  4  
ATOM 7624  H HG3  . PRO A 1 71  ? -10.650 6.746   -7.387  1.00 0.00 ? 89  PRO A HG3  4  
ATOM 7625  H HD3  . PRO A 1 71  ? -12.365 5.501   -6.479  1.00 0.00 ? 89  PRO A HD3  4  
ATOM 7626  N N    . ARG A 1 72  ? -13.200 5.419   -11.884 1.00 0.00 ? 90  ARG A N    4  
ATOM 7627  C CA   . ARG A 1 72  ? -12.882 4.845   -13.187 1.00 0.00 ? 90  ARG A CA   4  
ATOM 7628  C C    . ARG A 1 72  ? -13.137 5.855   -14.303 1.00 0.00 ? 90  ARG A C    4  
ATOM 7629  O O    . ARG A 1 72  ? -14.287 6.165   -14.620 1.00 0.00 ? 90  ARG A O    4  
ATOM 7630  C CB   . ARG A 1 72  ? -13.710 3.581   -13.427 1.00 0.00 ? 90  ARG A CB   4  
ATOM 7631  C CG   . ARG A 1 72  ? -13.063 2.317   -12.884 1.00 0.00 ? 90  ARG A CG   4  
ATOM 7632  C CD   . ARG A 1 72  ? -11.808 1.955   -13.662 1.00 0.00 ? 90  ARG A CD   4  
ATOM 7633  N NE   . ARG A 1 72  ? -12.088 1.026   -14.753 1.00 0.00 ? 90  ARG A NE   4  
ATOM 7634  C CZ   . ARG A 1 72  ? -11.145 0.429   -15.471 1.00 0.00 ? 90  ARG A CZ   4  
ATOM 7635  N NH1  . ARG A 1 72  ? -9.865  0.662   -15.216 1.00 0.00 ? 90  ARG A NH1  4  
ATOM 7636  N NH2  . ARG A 1 72  ? -11.481 -0.407  -16.447 1.00 0.00 ? 90  ARG A NH2  4  
ATOM 7637  H H    . ARG A 1 72  ? -13.906 6.095   -11.820 1.00 0.00 ? 90  ARG A H    4  
ATOM 7638  H HA   . ARG A 1 72  ? -11.834 4.584   -13.187 1.00 0.00 ? 90  ARG A HA   4  
ATOM 7639  H HB3  . ARG A 1 72  ? -13.854 3.457   -14.489 1.00 0.00 ? 90  ARG A HB3  4  
ATOM 7640  H HG3  . ARG A 1 72  ? -13.768 1.504   -12.956 1.00 0.00 ? 90  ARG A HG3  4  
ATOM 7641  H HD3  . ARG A 1 72  ? -11.101 1.500   -12.986 1.00 0.00 ? 90  ARG A HD3  4  
ATOM 7642  H HE   . ARG A 1 72  ? -13.029 0.838   -14.959 1.00 0.00 ? 90  ARG A HE   4  
ATOM 7643  H HH11 . ARG A 1 72  ? -9.610  1.289   -14.481 1.00 0.00 ? 90  ARG A HH11 4  
ATOM 7644  H HH12 . ARG A 1 72  ? -9.157  0.209   -15.758 1.00 0.00 ? 90  ARG A HH12 4  
ATOM 7645  H HH21 . ARG A 1 72  ? -12.444 -0.585  -16.643 1.00 0.00 ? 90  ARG A HH21 4  
ATOM 7646  H HH22 . ARG A 1 72  ? -10.769 -0.856  -16.988 1.00 0.00 ? 90  ARG A HH22 4  
ATOM 7647  N N    . ILE A 1 73  ? -12.061 6.361   -14.894 1.00 0.00 ? 91  ILE A N    4  
ATOM 7648  C CA   . ILE A 1 73  ? -12.170 7.334   -15.975 1.00 0.00 ? 91  ILE A CA   4  
ATOM 7649  C C    . ILE A 1 73  ? -12.828 6.717   -17.205 1.00 0.00 ? 91  ILE A C    4  
ATOM 7650  O O    . ILE A 1 73  ? -13.967 7.039   -17.541 1.00 0.00 ? 91  ILE A O    4  
ATOM 7651  C CB   . ILE A 1 73  ? -10.791 7.894   -16.370 1.00 0.00 ? 91  ILE A CB   4  
ATOM 7652  C CG1  . ILE A 1 73  ? -10.125 8.562   -15.165 1.00 0.00 ? 91  ILE A CG1  4  
ATOM 7653  C CG2  . ILE A 1 73  ? -10.929 8.880   -17.521 1.00 0.00 ? 91  ILE A CG2  4  
ATOM 7654  C CD1  . ILE A 1 73  ? -8.616  8.454   -15.172 1.00 0.00 ? 91  ILE A CD1  4  
ATOM 7655  H H    . ILE A 1 73  ? -11.173 6.075   -14.597 1.00 0.00 ? 91  ILE A H    4  
ATOM 7656  H HA   . ILE A 1 73  ? -12.784 8.152   -15.624 1.00 0.00 ? 91  ILE A HA   4  
ATOM 7657  H HB   . ILE A 1 73  ? -10.176 7.072   -16.702 1.00 0.00 ? 91  ILE A HB   4  
ATOM 7658  H HG13 . ILE A 1 73  ? -10.487 8.098   -14.259 1.00 0.00 ? 91  ILE A HG13 4  
ATOM 7659  H HG21 . ILE A 1 73  ? -10.032 9.475   -17.593 1.00 0.00 ? 91  ILE A HG21 4  
ATOM 7660  H HG22 . ILE A 1 73  ? -11.075 8.336   -18.442 1.00 0.00 ? 91  ILE A HG22 4  
ATOM 7661  H HG23 . ILE A 1 73  ? -11.776 9.524   -17.343 1.00 0.00 ? 91  ILE A HG23 4  
ATOM 7662  H HD11 . ILE A 1 73  ? -8.312  7.698   -15.882 1.00 0.00 ? 91  ILE A HD11 4  
ATOM 7663  H HD12 . ILE A 1 73  ? -8.187  9.405   -15.451 1.00 0.00 ? 91  ILE A HD12 4  
ATOM 7664  H HD13 . ILE A 1 73  ? -8.271  8.180   -14.185 1.00 0.00 ? 91  ILE A HD13 4  
ATOM 7665  N N    . HIS A 1 74  ? -12.102 5.825   -17.872 1.00 0.00 ? 92  HIS A N    4  
ATOM 7666  C CA   . HIS A 1 74  ? -12.614 5.161   -19.065 1.00 0.00 ? 92  HIS A CA   4  
ATOM 7667  C C    . HIS A 1 74  ? -12.774 3.662   -18.825 1.00 0.00 ? 92  HIS A C    4  
ATOM 7668  O O    . HIS A 1 74  ? -12.022 2.842   -19.348 1.00 0.00 ? 92  HIS A O    4  
ATOM 7669  C CB   . HIS A 1 74  ? -11.681 5.402   -20.251 1.00 0.00 ? 92  HIS A CB   4  
ATOM 7670  C CG   . HIS A 1 74  ? -12.375 5.372   -21.576 1.00 0.00 ? 92  HIS A CG   4  
ATOM 7671  N ND1  . HIS A 1 74  ? -11.881 4.694   -22.671 1.00 0.00 ? 92  HIS A ND1  4  
ATOM 7672  C CD2  . HIS A 1 74  ? -13.536 5.940   -21.982 1.00 0.00 ? 92  HIS A CD2  4  
ATOM 7673  C CE1  . HIS A 1 74  ? -12.706 4.848   -23.691 1.00 0.00 ? 92  HIS A CE1  4  
ATOM 7674  N NE2  . HIS A 1 74  ? -13.718 5.600   -23.299 1.00 0.00 ? 92  HIS A NE2  4  
ATOM 7675  H H    . HIS A 1 74  ? -11.201 5.610   -17.555 1.00 0.00 ? 92  HIS A H    4  
ATOM 7676  H HA   . HIS A 1 74  ? -13.582 5.583   -19.289 1.00 0.00 ? 92  HIS A HA   4  
ATOM 7677  H HB3  . HIS A 1 74  ? -10.915 4.640   -20.259 1.00 0.00 ? 92  HIS A HB3  4  
ATOM 7678  H HD1  . HIS A 1 74  ? -11.049 4.178   -22.696 1.00 0.00 ? 92  HIS A HD1  4  
ATOM 7679  H HD2  . HIS A 1 74  ? -14.196 6.551   -21.381 1.00 0.00 ? 92  HIS A HD2  4  
ATOM 7680  H HE1  . HIS A 1 74  ? -12.576 4.430   -24.678 1.00 0.00 ? 92  HIS A HE1  4  
ATOM 7681  N N    . PRO A 1 75  ? -13.780 3.296   -18.016 1.00 0.00 ? 93  PRO A N    4  
ATOM 7682  C CA   . PRO A 1 75  ? -14.062 1.896   -17.688 1.00 0.00 ? 93  PRO A CA   4  
ATOM 7683  C C    . PRO A 1 75  ? -14.611 1.121   -18.881 1.00 0.00 ? 93  PRO A C    4  
ATOM 7684  O O    . PRO A 1 75  ? -14.794 1.677   -19.963 1.00 0.00 ? 93  PRO A O    4  
ATOM 7685  C CB   . PRO A 1 75  ? -15.119 1.996   -16.584 1.00 0.00 ? 93  PRO A CB   4  
ATOM 7686  C CG   . PRO A 1 75  ? -15.782 3.310   -16.812 1.00 0.00 ? 93  PRO A CG   4  
ATOM 7687  C CD   . PRO A 1 75  ? -14.718 4.222   -17.357 1.00 0.00 ? 93  PRO A CD   4  
ATOM 7688  H HA   . PRO A 1 75  ? -13.186 1.392   -17.306 1.00 0.00 ? 93  PRO A HA   4  
ATOM 7689  H HB3  . PRO A 1 75  ? -14.637 1.958   -15.617 1.00 0.00 ? 93  PRO A HB3  4  
ATOM 7690  H HG3  . PRO A 1 75  ? -16.161 3.695   -15.877 1.00 0.00 ? 93  PRO A HG3  4  
ATOM 7691  H HD3  . PRO A 1 75  ? -14.230 4.757   -16.555 1.00 0.00 ? 93  PRO A HD3  4  
ATOM 7692  N N    . ASN A 1 76  ? -14.872 -0.166  -18.676 1.00 0.00 ? 94  ASN A N    4  
ATOM 7693  C CA   . ASN A 1 76  ? -15.400 -1.018  -19.736 1.00 0.00 ? 94  ASN A CA   4  
ATOM 7694  C C    . ASN A 1 76  ? -16.115 -2.232  -19.151 1.00 0.00 ? 94  ASN A C    4  
ATOM 7695  O O    . ASN A 1 76  ? -16.253 -2.358  -17.935 1.00 0.00 ? 94  ASN A O    4  
ATOM 7696  C CB   . ASN A 1 76  ? -14.271 -1.473  -20.662 1.00 0.00 ? 94  ASN A CB   4  
ATOM 7697  C CG   . ASN A 1 76  ? -13.809 -0.371  -21.596 1.00 0.00 ? 94  ASN A CG   4  
ATOM 7698  O OD1  . ASN A 1 76  ? -14.618 0.267   -22.269 1.00 0.00 ? 94  ASN A OD1  4  
ATOM 7699  N ND2  . ASN A 1 76  ? -12.501 -0.143  -21.640 1.00 0.00 ? 94  ASN A ND2  4  
ATOM 7700  H H    . ASN A 1 76  ? -14.705 -0.553  -17.791 1.00 0.00 ? 94  ASN A H    4  
ATOM 7701  H HA   . ASN A 1 76  ? -16.109 -0.436  -20.306 1.00 0.00 ? 94  ASN A HA   4  
ATOM 7702  H HB3  . ASN A 1 76  ? -14.617 -2.304  -21.260 1.00 0.00 ? 94  ASN A HB3  4  
ATOM 7703  H HD21 . ASN A 1 76  ? -11.916 -0.692  -21.077 1.00 0.00 ? 94  ASN A HD21 4  
ATOM 7704  H HD22 . ASN A 1 76  ? -12.175 0.564   -22.236 1.00 0.00 ? 94  ASN A HD22 4  
ATOM 7705  N N    . SER A 1 77  ? -16.568 -3.124  -20.028 1.00 0.00 ? 95  SER A N    4  
ATOM 7706  C CA   . SER A 1 77  ? -17.272 -4.327  -19.600 1.00 0.00 ? 95  SER A CA   4  
ATOM 7707  C C    . SER A 1 77  ? -16.458 -5.091  -18.559 1.00 0.00 ? 95  SER A C    4  
ATOM 7708  O O    . SER A 1 77  ? -17.015 -5.783  -17.707 1.00 0.00 ? 95  SER A O    4  
ATOM 7709  C CB   . SER A 1 77  ? -17.560 -5.229  -20.803 1.00 0.00 ? 95  SER A CB   4  
ATOM 7710  O OG   . SER A 1 77  ? -16.366 -5.798  -21.311 1.00 0.00 ? 95  SER A OG   4  
ATOM 7711  H H    . SER A 1 77  ? -16.426 -2.966  -20.985 1.00 0.00 ? 95  SER A H    4  
ATOM 7712  H HA   . SER A 1 77  ? -18.209 -4.022  -19.157 1.00 0.00 ? 95  SER A HA   4  
ATOM 7713  H HB3  . SER A 1 77  ? -18.028 -4.646  -21.582 1.00 0.00 ? 95  SER A HB3  4  
ATOM 7714  H HG   . SER A 1 77  ? -16.328 -6.727  -21.074 1.00 0.00 ? 95  SER A HG   4  
ATOM 7715  N N    . ILE A 1 78  ? -15.138 -4.960  -18.637 1.00 0.00 ? 96  ILE A N    4  
ATOM 7716  C CA   . ILE A 1 78  ? -14.249 -5.636  -17.702 1.00 0.00 ? 96  ILE A CA   4  
ATOM 7717  C C    . ILE A 1 78  ? -14.637 -5.339  -16.258 1.00 0.00 ? 96  ILE A C    4  
ATOM 7718  O O    . ILE A 1 78  ? -14.425 -6.157  -15.364 1.00 0.00 ? 96  ILE A O    4  
ATOM 7719  C CB   . ILE A 1 78  ? -12.781 -5.224  -17.922 1.00 0.00 ? 96  ILE A CB   4  
ATOM 7720  C CG1  . ILE A 1 78  ? -12.641 -3.703  -17.851 1.00 0.00 ? 96  ILE A CG1  4  
ATOM 7721  C CG2  . ILE A 1 78  ? -12.279 -5.746  -19.260 1.00 0.00 ? 96  ILE A CG2  4  
ATOM 7722  C CD1  . ILE A 1 78  ? -11.206 -3.224  -17.902 1.00 0.00 ? 96  ILE A CD1  4  
ATOM 7723  H H    . ILE A 1 78  ? -14.755 -4.394  -19.339 1.00 0.00 ? 96  ILE A H    4  
ATOM 7724  H HA   . ILE A 1 78  ? -14.331 -6.701  -17.873 1.00 0.00 ? 96  ILE A HA   4  
ATOM 7725  H HB   . ILE A 1 78  ? -12.184 -5.670  -17.141 1.00 0.00 ? 96  ILE A HB   4  
ATOM 7726  H HG13 . ILE A 1 78  ? -13.076 -3.351  -16.926 1.00 0.00 ? 96  ILE A HG13 4  
ATOM 7727  H HG21 . ILE A 1 78  ? -12.883 -5.334  -20.056 1.00 0.00 ? 96  ILE A HG21 4  
ATOM 7728  H HG22 . ILE A 1 78  ? -11.250 -5.449  -19.399 1.00 0.00 ? 96  ILE A HG22 4  
ATOM 7729  H HG23 . ILE A 1 78  ? -12.349 -6.823  -19.275 1.00 0.00 ? 96  ILE A HG23 4  
ATOM 7730  H HD11 . ILE A 1 78  ? -11.107 -2.463  -18.661 1.00 0.00 ? 96  ILE A HD11 4  
ATOM 7731  H HD12 . ILE A 1 78  ? -10.929 -2.816  -16.942 1.00 0.00 ? 96  ILE A HD12 4  
ATOM 7732  H HD13 . ILE A 1 78  ? -10.559 -4.056  -18.141 1.00 0.00 ? 96  ILE A HD13 4  
ATOM 7733  N N    . CYS A 1 79  ? -15.210 -4.160  -16.037 1.00 0.00 ? 97  CYS A N    4  
ATOM 7734  C CA   . CYS A 1 79  ? -15.632 -3.751  -14.703 1.00 0.00 ? 97  CYS A CA   4  
ATOM 7735  C C    . CYS A 1 79  ? -17.031 -4.272  -14.391 1.00 0.00 ? 97  CYS A C    4  
ATOM 7736  O O    . CYS A 1 79  ? -17.702 -4.836  -15.255 1.00 0.00 ? 97  CYS A O    4  
ATOM 7737  C CB   . CYS A 1 79  ? -15.605 -2.226  -14.580 1.00 0.00 ? 97  CYS A CB   4  
ATOM 7738  S SG   . CYS A 1 79  ? -14.005 -1.555  -14.021 1.00 0.00 ? 97  CYS A SG   4  
ATOM 7739  H H    . CYS A 1 79  ? -15.353 -3.548  -16.790 1.00 0.00 ? 97  CYS A H    4  
ATOM 7740  H HA   . CYS A 1 79  ? -14.937 -4.174  -13.992 1.00 0.00 ? 97  CYS A HA   4  
ATOM 7741  H HB3  . CYS A 1 79  ? -16.358 -1.917  -13.872 1.00 0.00 ? 97  CYS A HB3  4  
ATOM 7742  N N    . ALA A 1 80  ? -17.466 -4.079  -13.150 1.00 0.00 ? 98  ALA A N    4  
ATOM 7743  C CA   . ALA A 1 80  ? -18.786 -4.527  -12.725 1.00 0.00 ? 98  ALA A CA   4  
ATOM 7744  C C    . ALA A 1 80  ? -19.883 -3.660  -13.336 1.00 0.00 ? 98  ALA A C    4  
ATOM 7745  O O    . ALA A 1 80  ? -19.970 -2.466  -13.056 1.00 0.00 ? 98  ALA A O    4  
ATOM 7746  C CB   . ALA A 1 80  ? -18.885 -4.512  -11.207 1.00 0.00 ? 98  ALA A CB   4  
ATOM 7747  H H    . ALA A 1 80  ? -16.886 -3.622  -12.506 1.00 0.00 ? 98  ALA A H    4  
ATOM 7748  H HA   . ALA A 1 80  ? -18.918 -5.545  -13.060 1.00 0.00 ? 98  ALA A HA   4  
ATOM 7749  H HB1  . ALA A 1 80  ? -19.454 -5.369  -10.876 1.00 0.00 ? 98  ALA A HB1  4  
ATOM 7750  H HB2  . ALA A 1 80  ? -17.894 -4.553  -10.782 1.00 0.00 ? 98  ALA A HB2  4  
ATOM 7751  H HB3  . ALA A 1 80  ? -19.378 -3.608  -10.886 1.00 0.00 ? 98  ALA A HB3  4  
ATOM 7752  N N    . ALA A 1 81  ? -20.717 -4.270  -14.171 1.00 0.00 ? 99  ALA A N    4  
ATOM 7753  C CA   . ALA A 1 81  ? -21.807 -3.555  -14.819 1.00 0.00 ? 99  ALA A CA   4  
ATOM 7754  C C    . ALA A 1 81  ? -21.304 -2.291  -15.507 1.00 0.00 ? 99  ALA A C    4  
ATOM 7755  O O    . ALA A 1 81  ? -22.029 -1.302  -15.619 1.00 0.00 ? 99  ALA A O    4  
ATOM 7756  C CB   . ALA A 1 81  ? -22.891 -3.212  -13.807 1.00 0.00 ? 99  ALA A CB   4  
ATOM 7757  H H    . ALA A 1 81  ? -20.596 -5.225  -14.354 1.00 0.00 ? 99  ALA A H    4  
ATOM 7758  H HA   . ALA A 1 81  ? -22.240 -4.209  -15.563 1.00 0.00 ? 99  ALA A HA   4  
ATOM 7759  H HB1  . ALA A 1 81  ? -23.859 -3.455  -14.219 1.00 0.00 ? 99  ALA A HB1  4  
ATOM 7760  H HB2  . ALA A 1 81  ? -22.730 -3.780  -12.902 1.00 0.00 ? 99  ALA A HB2  4  
ATOM 7761  H HB3  . ALA A 1 81  ? -22.850 -2.156  -13.581 1.00 0.00 ? 99  ALA A HB3  4  
ATOM 7762  N N    . ASN A 1 82  ? -20.056 -2.327  -15.962 1.00 0.00 ? 100 ASN A N    4  
ATOM 7763  C CA   . ASN A 1 82  ? -19.454 -1.183  -16.637 1.00 0.00 ? 100 ASN A CA   4  
ATOM 7764  C C    . ASN A 1 82  ? -19.605 0.084   -15.800 1.00 0.00 ? 100 ASN A C    4  
ATOM 7765  O O    . ASN A 1 82  ? -19.998 1.132   -16.308 1.00 0.00 ? 100 ASN A O    4  
ATOM 7766  C CB   . ASN A 1 82  ? -20.097 -0.979  -18.011 1.00 0.00 ? 100 ASN A CB   4  
ATOM 7767  C CG   . ASN A 1 82  ? -19.848 -2.147  -18.944 1.00 0.00 ? 100 ASN A CG   4  
ATOM 7768  O OD1  . ASN A 1 82  ? -19.088 -2.036  -19.907 1.00 0.00 ? 100 ASN A OD1  4  
ATOM 7769  N ND2  . ASN A 1 82  ? -20.490 -3.276  -18.665 1.00 0.00 ? 100 ASN A ND2  4  
ATOM 7770  H H    . ASN A 1 82  ? -19.527 -3.143  -15.842 1.00 0.00 ? 100 ASN A H    4  
ATOM 7771  H HA   . ASN A 1 82  ? -18.403 -1.392  -16.768 1.00 0.00 ? 100 ASN A HA   4  
ATOM 7772  H HB3  . ASN A 1 82  ? -19.690 -0.087  -18.463 1.00 0.00 ? 100 ASN A HB3  4  
ATOM 7773  H HD21 . ASN A 1 82  ? -21.079 -3.291  -17.881 1.00 0.00 ? 100 ASN A HD21 4  
ATOM 7774  H HD22 . ASN A 1 82  ? -20.347 -4.047  -19.251 1.00 0.00 ? 100 ASN A HD22 4  
ATOM 7775  N N    . ASN A 1 83  ? -19.288 -0.024  -14.513 1.00 0.00 ? 101 ASN A N    4  
ATOM 7776  C CA   . ASN A 1 83  ? -19.389 1.113   -13.604 1.00 0.00 ? 101 ASN A CA   4  
ATOM 7777  C C    . ASN A 1 83  ? -18.649 2.324   -14.165 1.00 0.00 ? 101 ASN A C    4  
ATOM 7778  O O    . ASN A 1 83  ? -17.783 2.192   -15.030 1.00 0.00 ? 101 ASN A O    4  
ATOM 7779  C CB   . ASN A 1 83  ? -18.823 0.745   -12.232 1.00 0.00 ? 101 ASN A CB   4  
ATOM 7780  C CG   . ASN A 1 83  ? -19.765 -0.135  -11.432 1.00 0.00 ? 101 ASN A CG   4  
ATOM 7781  O OD1  . ASN A 1 83  ? -20.929 -0.304  -11.794 1.00 0.00 ? 101 ASN A OD1  4  
ATOM 7782  N ND2  . ASN A 1 83  ? -19.264 -0.699  -10.341 1.00 0.00 ? 101 ASN A ND2  4  
ATOM 7783  H H    . ASN A 1 83  ? -18.983 -0.887  -14.166 1.00 0.00 ? 101 ASN A H    4  
ATOM 7784  H HA   . ASN A 1 83  ? -20.434 1.361   -13.497 1.00 0.00 ? 101 ASN A HA   4  
ATOM 7785  H HB3  . ASN A 1 83  ? -18.640 1.649   -11.670 1.00 0.00 ? 101 ASN A HB3  4  
ATOM 7786  H HD21 . ASN A 1 83  ? -18.327 -0.520  -10.114 1.00 0.00 ? 101 ASN A HD21 4  
ATOM 7787  H HD22 . ASN A 1 83  ? -19.852 -1.273  -9.807  1.00 0.00 ? 101 ASN A HD22 4  
ATOM 7788  N N    . THR A 1 84  ? -18.999 3.506   -13.666 1.00 0.00 ? 102 THR A N    4  
ATOM 7789  C CA   . THR A 1 84  ? -18.369 4.741   -14.117 1.00 0.00 ? 102 THR A CA   4  
ATOM 7790  C C    . THR A 1 84  ? -18.177 5.714   -12.959 1.00 0.00 ? 102 THR A C    4  
ATOM 7791  O O    . THR A 1 84  ? -18.619 5.458   -11.840 1.00 0.00 ? 102 THR A O    4  
ATOM 7792  C CB   . THR A 1 84  ? -19.203 5.427   -15.216 1.00 0.00 ? 102 THR A CB   4  
ATOM 7793  O OG1  . THR A 1 84  ? -20.578 5.487   -14.822 1.00 0.00 ? 102 THR A OG1  4  
ATOM 7794  C CG2  . THR A 1 84  ? -19.079 4.678   -16.535 1.00 0.00 ? 102 THR A CG2  4  
ATOM 7795  H H    . THR A 1 84  ? -19.696 3.547   -12.979 1.00 0.00 ? 102 THR A H    4  
ATOM 7796  H HA   . THR A 1 84  ? -17.403 4.492   -14.529 1.00 0.00 ? 102 THR A HA   4  
ATOM 7797  H HB   . THR A 1 84  ? -18.830 6.433   -15.352 1.00 0.00 ? 102 THR A HB   4  
ATOM 7798  H HG1  . THR A 1 84  ? -20.945 4.600   -14.804 1.00 0.00 ? 102 THR A HG1  4  
ATOM 7799  H HG21 . THR A 1 84  ? -18.139 4.929   -17.004 1.00 0.00 ? 102 THR A HG21 4  
ATOM 7800  H HG22 . THR A 1 84  ? -19.893 4.960   -17.186 1.00 0.00 ? 102 THR A HG22 4  
ATOM 7801  H HG23 . THR A 1 84  ? -19.117 3.617   -16.349 1.00 0.00 ? 102 THR A HG23 4  
ATOM 7802  N N    . GLY A 1 85  ? -17.514 6.833   -13.235 1.00 0.00 ? 103 GLY A N    4  
ATOM 7803  C CA   . GLY A 1 85  ? -17.274 7.828   -12.206 1.00 0.00 ? 103 GLY A CA   4  
ATOM 7804  C C    . GLY A 1 85  ? -16.633 7.238   -10.967 1.00 0.00 ? 103 GLY A C    4  
ATOM 7805  O O    . GLY A 1 85  ? -15.748 6.387   -11.062 1.00 0.00 ? 103 GLY A O    4  
ATOM 7806  H H    . GLY A 1 85  ? -17.184 6.983   -14.146 1.00 0.00 ? 103 GLY A H    4  
ATOM 7807  H HA2  . GLY A 1 85  ? -16.628 8.594   -12.605 1.00 0.00 ? 103 GLY A HA2  4  
ATOM 7808  H HA3  . GLY A 1 85  ? -18.218 8.276   -11.930 1.00 0.00 ? 103 GLY A HA3  4  
ATOM 7809  N N    . VAL A 1 86  ? -17.076 7.690   -9.799  1.00 0.00 ? 104 VAL A N    4  
ATOM 7810  C CA   . VAL A 1 86  ? -16.538 7.202   -8.535  1.00 0.00 ? 104 VAL A CA   4  
ATOM 7811  C C    . VAL A 1 86  ? -17.584 6.403   -7.765  1.00 0.00 ? 104 VAL A C    4  
ATOM 7812  O O    . VAL A 1 86  ? -18.124 6.871   -6.761  1.00 0.00 ? 104 VAL A O    4  
ATOM 7813  C CB   . VAL A 1 86  ? -16.042 8.361   -7.651  1.00 0.00 ? 104 VAL A CB   4  
ATOM 7814  C CG1  . VAL A 1 86  ? -15.323 7.826   -6.423  1.00 0.00 ? 104 VAL A CG1  4  
ATOM 7815  C CG2  . VAL A 1 86  ? -15.135 9.288   -8.448  1.00 0.00 ? 104 VAL A CG2  4  
ATOM 7816  H H    . VAL A 1 86  ? -17.783 8.368   -9.787  1.00 0.00 ? 104 VAL A H    4  
ATOM 7817  H HA   . VAL A 1 86  ? -15.699 6.559   -8.756  1.00 0.00 ? 104 VAL A HA   4  
ATOM 7818  H HB   . VAL A 1 86  ? -16.900 8.928   -7.320  1.00 0.00 ? 104 VAL A HB   4  
ATOM 7819  H HG11 . VAL A 1 86  ? -15.810 6.924   -6.084  1.00 0.00 ? 104 VAL A HG11 4  
ATOM 7820  H HG12 . VAL A 1 86  ? -14.295 7.610   -6.673  1.00 0.00 ? 104 VAL A HG12 4  
ATOM 7821  H HG13 . VAL A 1 86  ? -15.354 8.567   -5.637  1.00 0.00 ? 104 VAL A HG13 4  
ATOM 7822  H HG21 . VAL A 1 86  ? -15.604 10.256  -8.542  1.00 0.00 ? 104 VAL A HG21 4  
ATOM 7823  H HG22 . VAL A 1 86  ? -14.189 9.395   -7.938  1.00 0.00 ? 104 VAL A HG22 4  
ATOM 7824  H HG23 . VAL A 1 86  ? -14.969 8.872   -9.430  1.00 0.00 ? 104 VAL A HG23 4  
ATOM 7825  N N    . TYR A 1 87  ? -17.865 5.195   -8.240  1.00 0.00 ? 105 TYR A N    4  
ATOM 7826  C CA   . TYR A 1 87  ? -18.847 4.331   -7.597  1.00 0.00 ? 105 TYR A CA   4  
ATOM 7827  C C    . TYR A 1 87  ? -18.403 3.955   -6.187  1.00 0.00 ? 105 TYR A C    4  
ATOM 7828  O O    . TYR A 1 87  ? -17.230 4.087   -5.837  1.00 0.00 ? 105 TYR A O    4  
ATOM 7829  C CB   . TYR A 1 87  ? -19.064 3.065   -8.429  1.00 0.00 ? 105 TYR A CB   4  
ATOM 7830  C CG   . TYR A 1 87  ? -20.427 2.436   -8.231  1.00 0.00 ? 105 TYR A CG   4  
ATOM 7831  C CD1  . TYR A 1 87  ? -21.541 2.923   -8.904  1.00 0.00 ? 105 TYR A CD1  4  
ATOM 7832  C CD2  . TYR A 1 87  ? -20.597 1.358   -7.375  1.00 0.00 ? 105 TYR A CD2  4  
ATOM 7833  C CE1  . TYR A 1 87  ? -22.786 2.355   -8.726  1.00 0.00 ? 105 TYR A CE1  4  
ATOM 7834  C CE2  . TYR A 1 87  ? -21.840 0.781   -7.191  1.00 0.00 ? 105 TYR A CE2  4  
ATOM 7835  C CZ   . TYR A 1 87  ? -22.931 1.283   -7.869  1.00 0.00 ? 105 TYR A CZ   4  
ATOM 7836  O OH   . TYR A 1 87  ? -24.171 0.712   -7.690  1.00 0.00 ? 105 TYR A OH   4  
ATOM 7837  H H    . TYR A 1 87  ? -17.401 4.877   -9.043  1.00 0.00 ? 105 TYR A H    4  
ATOM 7838  H HA   . TYR A 1 87  ? -19.779 4.873   -7.537  1.00 0.00 ? 105 TYR A HA   4  
ATOM 7839  H HB3  . TYR A 1 87  ? -18.319 2.331   -8.157  1.00 0.00 ? 105 TYR A HB3  4  
ATOM 7840  H HD1  . TYR A 1 87  ? -21.423 3.763   -9.574  1.00 0.00 ? 105 TYR A HD1  4  
ATOM 7841  H HD2  . TYR A 1 87  ? -19.741 0.966   -6.845  1.00 0.00 ? 105 TYR A HD2  4  
ATOM 7842  H HE1  . TYR A 1 87  ? -23.641 2.747   -9.257  1.00 0.00 ? 105 TYR A HE1  4  
ATOM 7843  H HE2  . TYR A 1 87  ? -21.953 -0.059  -6.521  1.00 0.00 ? 105 TYR A HE2  4  
ATOM 7844  H HH   . TYR A 1 87  ? -24.167 -0.177  -8.052  1.00 0.00 ? 105 TYR A HH   4  
ATOM 7845  N N    . ILE A 1 88  ? -19.350 3.487   -5.381  1.00 0.00 ? 106 ILE A N    4  
ATOM 7846  C CA   . ILE A 1 88  ? -19.058 3.091   -4.009  1.00 0.00 ? 106 ILE A CA   4  
ATOM 7847  C C    . ILE A 1 88  ? -19.723 1.763   -3.666  1.00 0.00 ? 106 ILE A C    4  
ATOM 7848  O O    . ILE A 1 88  ? -20.439 1.185   -4.484  1.00 0.00 ? 106 ILE A O    4  
ATOM 7849  C CB   . ILE A 1 88  ? -19.522 4.161   -3.003  1.00 0.00 ? 106 ILE A CB   4  
ATOM 7850  C CG1  . ILE A 1 88  ? -21.049 4.268   -3.008  1.00 0.00 ? 106 ILE A CG1  4  
ATOM 7851  C CG2  . ILE A 1 88  ? -18.890 5.505   -3.329  1.00 0.00 ? 106 ILE A CG2  4  
ATOM 7852  C CD1  . ILE A 1 88  ? -21.587 5.288   -2.029  1.00 0.00 ? 106 ILE A CD1  4  
ATOM 7853  H H    . ILE A 1 88  ? -20.266 3.405   -5.716  1.00 0.00 ? 106 ILE A H    4  
ATOM 7854  H HA   . ILE A 1 88  ? -17.987 2.980   -3.916  1.00 0.00 ? 106 ILE A HA   4  
ATOM 7855  H HB   . ILE A 1 88  ? -19.193 3.865   -2.018  1.00 0.00 ? 106 ILE A HB   4  
ATOM 7856  H HG13 . ILE A 1 88  ? -21.471 3.306   -2.752  1.00 0.00 ? 106 ILE A HG13 4  
ATOM 7857  H HG21 . ILE A 1 88  ? -18.763 6.074   -2.420  1.00 0.00 ? 106 ILE A HG21 4  
ATOM 7858  H HG22 . ILE A 1 88  ? -17.928 5.346   -3.791  1.00 0.00 ? 106 ILE A HG22 4  
ATOM 7859  H HG23 . ILE A 1 88  ? -19.531 6.049   -4.008  1.00 0.00 ? 106 ILE A HG23 4  
ATOM 7860  H HD11 . ILE A 1 88  ? -20.776 5.676   -1.430  1.00 0.00 ? 106 ILE A HD11 4  
ATOM 7861  H HD12 . ILE A 1 88  ? -22.052 6.097   -2.572  1.00 0.00 ? 106 ILE A HD12 4  
ATOM 7862  H HD13 . ILE A 1 88  ? -22.316 4.819   -1.385  1.00 0.00 ? 106 ILE A HD13 4  
ATOM 7863  N N    . LEU A 1 89  ? -19.486 1.285   -2.449  1.00 0.00 ? 107 LEU A N    4  
ATOM 7864  C CA   . LEU A 1 89  ? -20.064 0.025   -1.995  1.00 0.00 ? 107 LEU A CA   4  
ATOM 7865  C C    . LEU A 1 89  ? -20.716 0.187   -0.627  1.00 0.00 ? 107 LEU A C    4  
ATOM 7866  O O    . LEU A 1 89  ? -20.065 0.589   0.339   1.00 0.00 ? 107 LEU A O    4  
ATOM 7867  C CB   . LEU A 1 89  ? -18.988 -1.060  -1.937  1.00 0.00 ? 107 LEU A CB   4  
ATOM 7868  C CG   . LEU A 1 89  ? -18.788 -1.878  -3.214  1.00 0.00 ? 107 LEU A CG   4  
ATOM 7869  C CD1  . LEU A 1 89  ? -17.637 -2.857  -3.046  1.00 0.00 ? 107 LEU A CD1  4  
ATOM 7870  C CD2  . LEU A 1 89  ? -20.068 -2.614  -3.582  1.00 0.00 ? 107 LEU A CD2  4  
ATOM 7871  H H    . LEU A 1 89  ? -18.907 1.791   -1.840  1.00 0.00 ? 107 LEU A H    4  
ATOM 7872  H HA   . LEU A 1 89  ? -20.821 -0.268  -2.708  1.00 0.00 ? 107 LEU A HA   4  
ATOM 7873  H HB3  . LEU A 1 89  ? -19.253 -1.746  -1.143  1.00 0.00 ? 107 LEU A HB3  4  
ATOM 7874  H HG   . LEU A 1 89  ? -18.540 -1.209  -4.026  1.00 0.00 ? 107 LEU A HG   4  
ATOM 7875  H HD11 . LEU A 1 89  ? -16.702 -2.349  -3.229  1.00 0.00 ? 107 LEU A HD11 4  
ATOM 7876  H HD12 . LEU A 1 89  ? -17.750 -3.668  -3.750  1.00 0.00 ? 107 LEU A HD12 4  
ATOM 7877  H HD13 . LEU A 1 89  ? -17.642 -3.250  -2.040  1.00 0.00 ? 107 LEU A HD13 4  
ATOM 7878  H HD21 . LEU A 1 89  ? -19.839 -3.648  -3.797  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 7879  H HD22 . LEU A 1 89  ? -20.510 -2.155  -4.454  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 7880  H HD23 . LEU A 1 89  ? -20.762 -2.564  -2.757  1.00 0.00 ? 107 LEU A HD23 4  
ATOM 7881  N N    . THR A 1 90  ? -22.004 -0.132  -0.547  1.00 0.00 ? 108 THR A N    4  
ATOM 7882  C CA   . THR A 1 90  ? -22.744 -0.023  0.704   1.00 0.00 ? 108 THR A CA   4  
ATOM 7883  C C    . THR A 1 90  ? -23.350 -1.363  1.103   1.00 0.00 ? 108 THR A C    4  
ATOM 7884  O O    . THR A 1 90  ? -24.500 -1.431  1.537   1.00 0.00 ? 108 THR A O    4  
ATOM 7885  C CB   . THR A 1 90  ? -23.867 1.026   0.603   1.00 0.00 ? 108 THR A CB   4  
ATOM 7886  O OG1  . THR A 1 90  ? -24.534 1.151   1.863   1.00 0.00 ? 108 THR A OG1  4  
ATOM 7887  C CG2  . THR A 1 90  ? -24.870 0.642   -0.473  1.00 0.00 ? 108 THR A CG2  4  
ATOM 7888  H H    . THR A 1 90  ? -22.467 -0.447  -1.352  1.00 0.00 ? 108 THR A H    4  
ATOM 7889  H HA   . THR A 1 90  ? -22.052 0.291   1.473   1.00 0.00 ? 108 THR A HA   4  
ATOM 7890  H HB   . THR A 1 90  ? -23.426 1.978   0.342   1.00 0.00 ? 108 THR A HB   4  
ATOM 7891  H HG1  . THR A 1 90  ? -23.904 1.013   2.575   1.00 0.00 ? 108 THR A HG1  4  
ATOM 7892  H HG21 . THR A 1 90  ? -24.830 1.363   -1.278  1.00 0.00 ? 108 THR A HG21 4  
ATOM 7893  H HG22 . THR A 1 90  ? -25.865 0.631   -0.050  1.00 0.00 ? 108 THR A HG22 4  
ATOM 7894  H HG23 . THR A 1 90  ? -24.632 -0.339  -0.855  1.00 0.00 ? 108 THR A HG23 4  
ATOM 7895  N N    . SER A 1 91  ? -22.569 -2.430  0.952   1.00 0.00 ? 109 SER A N    4  
ATOM 7896  C CA   . SER A 1 91  ? -23.033 -3.770  1.292   1.00 0.00 ? 109 SER A CA   4  
ATOM 7897  C C    . SER A 1 91  ? -22.056 -4.455  2.243   1.00 0.00 ? 109 SER A C    4  
ATOM 7898  O O    . SER A 1 91  ? -22.349 -4.642  3.424   1.00 0.00 ? 109 SER A O    4  
ATOM 7899  C CB   . SER A 1 91  ? -23.204 -4.611  0.026   1.00 0.00 ? 109 SER A CB   4  
ATOM 7900  O OG   . SER A 1 91  ? -24.494 -4.430  -0.534  1.00 0.00 ? 109 SER A OG   4  
ATOM 7901  H H    . SER A 1 91  ? -21.663 -2.311  0.600   1.00 0.00 ? 109 SER A H    4  
ATOM 7902  H HA   . SER A 1 91  ? -23.989 -3.674  1.785   1.00 0.00 ? 109 SER A HA   4  
ATOM 7903  H HB3  . SER A 1 91  ? -23.074 -5.655  0.271   1.00 0.00 ? 109 SER A HB3  4  
ATOM 7904  H HG   . SER A 1 91  ? -24.442 -4.508  -1.488  1.00 0.00 ? 109 SER A HG   4  
ATOM 7905  N N    . ASN A 1 92  ? -20.891 -4.829  1.718   1.00 0.00 ? 110 ASN A N    4  
ATOM 7906  C CA   . ASN A 1 92  ? -19.872 -5.494  2.519   1.00 0.00 ? 110 ASN A CA   4  
ATOM 7907  C C    . ASN A 1 92  ? -18.479 -5.234  1.953   1.00 0.00 ? 110 ASN A C    4  
ATOM 7908  O O    . ASN A 1 92  ? -18.328 -4.896  0.777   1.00 0.00 ? 110 ASN A O    4  
ATOM 7909  C CB   . ASN A 1 92  ? -20.139 -7.000  2.575   1.00 0.00 ? 110 ASN A CB   4  
ATOM 7910  C CG   . ASN A 1 92  ? -21.504 -7.324  3.151   1.00 0.00 ? 110 ASN A CG   4  
ATOM 7911  O OD1  . ASN A 1 92  ? -21.769 -7.076  4.327   1.00 0.00 ? 110 ASN A OD1  4  
ATOM 7912  N ND2  . ASN A 1 92  ? -22.379 -7.880  2.321   1.00 0.00 ? 110 ASN A ND2  4  
ATOM 7913  H H    . ASN A 1 92  ? -20.717 -4.652  0.770   1.00 0.00 ? 110 ASN A H    4  
ATOM 7914  H HA   . ASN A 1 92  ? -19.920 -5.091  3.520   1.00 0.00 ? 110 ASN A HA   4  
ATOM 7915  H HB3  . ASN A 1 92  ? -19.388 -7.471  3.191   1.00 0.00 ? 110 ASN A HB3  4  
ATOM 7916  H HD21 . ASN A 1 92  ? -22.098 -8.050  1.396   1.00 0.00 ? 110 ASN A HD21 4  
ATOM 7917  H HD22 . ASN A 1 92  ? -23.269 -8.100  2.667   1.00 0.00 ? 110 ASN A HD22 4  
ATOM 7918  N N    . THR A 1 93  ? -17.464 -5.395  2.794   1.00 0.00 ? 111 THR A N    4  
ATOM 7919  C CA   . THR A 1 93  ? -16.084 -5.177  2.376   1.00 0.00 ? 111 THR A CA   4  
ATOM 7920  C C    . THR A 1 93  ? -15.372 -6.500  2.120   1.00 0.00 ? 111 THR A C    4  
ATOM 7921  O O    . THR A 1 93  ? -15.811 -7.553  2.582   1.00 0.00 ? 111 THR A O    4  
ATOM 7922  C CB   . THR A 1 93  ? -15.297 -4.382  3.435   1.00 0.00 ? 111 THR A CB   4  
ATOM 7923  O OG1  . THR A 1 93  ? -15.197 -5.140  4.644   1.00 0.00 ? 111 THR A OG1  4  
ATOM 7924  C CG2  . THR A 1 93  ? -15.969 -3.048  3.720   1.00 0.00 ? 111 THR A CG2  4  
ATOM 7925  H H    . THR A 1 93  ? -17.647 -5.666  3.717   1.00 0.00 ? 111 THR A H    4  
ATOM 7926  H HA   . THR A 1 93  ? -16.098 -4.603  1.462   1.00 0.00 ? 111 THR A HA   4  
ATOM 7927  H HB   . THR A 1 93  ? -14.303 -4.192  3.055   1.00 0.00 ? 111 THR A HB   4  
ATOM 7928  H HG1  . THR A 1 93  ? -14.543 -4.737  5.222   1.00 0.00 ? 111 THR A HG1  4  
ATOM 7929  H HG21 . THR A 1 93  ? -16.791 -2.904  3.032   1.00 0.00 ? 111 THR A HG21 4  
ATOM 7930  H HG22 . THR A 1 93  ? -15.254 -2.249  3.596   1.00 0.00 ? 111 THR A HG22 4  
ATOM 7931  H HG23 . THR A 1 93  ? -16.344 -3.042  4.733   1.00 0.00 ? 111 THR A HG23 4  
ATOM 7932  N N    . SER A 1 94  ? -14.269 -6.441  1.380   1.00 0.00 ? 112 SER A N    4  
ATOM 7933  C CA   . SER A 1 94  ? -13.498 -7.636  1.058   1.00 0.00 ? 112 SER A CA   4  
ATOM 7934  C C    . SER A 1 94  ? -12.014 -7.305  0.927   1.00 0.00 ? 112 SER A C    4  
ATOM 7935  O O    . SER A 1 94  ? -11.628 -6.138  0.903   1.00 0.00 ? 112 SER A O    4  
ATOM 7936  C CB   . SER A 1 94  ? -14.009 -8.264  -0.241  1.00 0.00 ? 112 SER A CB   4  
ATOM 7937  O OG   . SER A 1 94  ? -15.175 -9.033  -0.010  1.00 0.00 ? 112 SER A OG   4  
ATOM 7938  H H    . SER A 1 94  ? -13.971 -5.572  1.039   1.00 0.00 ? 112 SER A H    4  
ATOM 7939  H HA   . SER A 1 94  ? -13.629 -8.341  1.865   1.00 0.00 ? 112 SER A HA   4  
ATOM 7940  H HB3  . SER A 1 94  ? -13.243 -8.906  -0.651  1.00 0.00 ? 112 SER A HB3  4  
ATOM 7941  H HG   . SER A 1 94  ? -15.083 -9.890  -0.433  1.00 0.00 ? 112 SER A HG   4  
ATOM 7942  N N    . GLN A 1 95  ? -11.189 -8.344  0.845   1.00 0.00 ? 113 GLN A N    4  
ATOM 7943  C CA   . GLN A 1 95  ? -9.747  -8.164  0.717   1.00 0.00 ? 113 GLN A CA   4  
ATOM 7944  C C    . GLN A 1 95  ? -9.391  -7.551  -0.633  1.00 0.00 ? 113 GLN A C    4  
ATOM 7945  O O    . GLN A 1 95  ? -9.642  -8.147  -1.682  1.00 0.00 ? 113 GLN A O    4  
ATOM 7946  C CB   . GLN A 1 95  ? -9.029  -9.504  0.888   1.00 0.00 ? 113 GLN A CB   4  
ATOM 7947  C CG   . GLN A 1 95  ? -8.717  -9.848  2.334   1.00 0.00 ? 113 GLN A CG   4  
ATOM 7948  C CD   . GLN A 1 95  ? -9.902  -10.453 3.060   1.00 0.00 ? 113 GLN A CD   4  
ATOM 7949  O OE1  . GLN A 1 95  ? -10.871 -10.886 2.435   1.00 0.00 ? 113 GLN A OE1  4  
ATOM 7950  N NE2  . GLN A 1 95  ? -9.832  -10.487 4.385   1.00 0.00 ? 113 GLN A NE2  4  
ATOM 7951  H H    . GLN A 1 95  ? -11.558 -9.251  0.869   1.00 0.00 ? 113 GLN A H    4  
ATOM 7952  H HA   . GLN A 1 95  ? -9.426  -7.493  1.498   1.00 0.00 ? 113 GLN A HA   4  
ATOM 7953  H HB3  . GLN A 1 95  ? -8.099  -9.472  0.339   1.00 0.00 ? 113 GLN A HB3  4  
ATOM 7954  H HG3  . GLN A 1 95  ? -8.421  -8.945  2.849   1.00 0.00 ? 113 GLN A HG3  4  
ATOM 7955  H HE21 . GLN A 1 95  ? -9.028  -10.122 4.814   1.00 0.00 ? 113 GLN A HE21 4  
ATOM 7956  H HE22 . GLN A 1 95  ? -10.583 -10.874 4.879   1.00 0.00 ? 113 GLN A HE22 4  
ATOM 7957  N N    . TYR A 1 96  ? -8.810  -6.357  -0.600  1.00 0.00 ? 114 TYR A N    4  
ATOM 7958  C CA   . TYR A 1 96  ? -8.422  -5.663  -1.822  1.00 0.00 ? 114 TYR A CA   4  
ATOM 7959  C C    . TYR A 1 96  ? -7.296  -4.669  -1.550  1.00 0.00 ? 114 TYR A C    4  
ATOM 7960  O O    . TYR A 1 96  ? -6.786  -4.583  -0.433  1.00 0.00 ? 114 TYR A O    4  
ATOM 7961  C CB   . TYR A 1 96  ? -9.625  -4.934  -2.422  1.00 0.00 ? 114 TYR A CB   4  
ATOM 7962  C CG   . TYR A 1 96  ? -10.567 -5.841  -3.180  1.00 0.00 ? 114 TYR A CG   4  
ATOM 7963  C CD1  . TYR A 1 96  ? -10.290 -6.228  -4.485  1.00 0.00 ? 114 TYR A CD1  4  
ATOM 7964  C CD2  . TYR A 1 96  ? -11.733 -6.314  -2.590  1.00 0.00 ? 114 TYR A CD2  4  
ATOM 7965  C CE1  . TYR A 1 96  ? -11.148 -7.057  -5.183  1.00 0.00 ? 114 TYR A CE1  4  
ATOM 7966  C CE2  . TYR A 1 96  ? -12.596 -7.144  -3.280  1.00 0.00 ? 114 TYR A CE2  4  
ATOM 7967  C CZ   . TYR A 1 96  ? -12.299 -7.512  -4.575  1.00 0.00 ? 114 TYR A CZ   4  
ATOM 7968  O OH   . TYR A 1 96  ? -13.156 -8.340  -5.266  1.00 0.00 ? 114 TYR A OH   4  
ATOM 7969  H H    . TYR A 1 96  ? -8.636  -5.933  0.266   1.00 0.00 ? 114 TYR A H    4  
ATOM 7970  H HA   . TYR A 1 96  ? -8.072  -6.401  -2.527  1.00 0.00 ? 114 TYR A HA   4  
ATOM 7971  H HB3  . TYR A 1 96  ? -9.274  -4.175  -3.104  1.00 0.00 ? 114 TYR A HB3  4  
ATOM 7972  H HD1  . TYR A 1 96  ? -9.387  -5.869  -4.958  1.00 0.00 ? 114 TYR A HD1  4  
ATOM 7973  H HD2  . TYR A 1 96  ? -11.963 -6.024  -1.575  1.00 0.00 ? 114 TYR A HD2  4  
ATOM 7974  H HE1  . TYR A 1 96  ? -10.915 -7.346  -6.197  1.00 0.00 ? 114 TYR A HE1  4  
ATOM 7975  H HE2  . TYR A 1 96  ? -13.497 -7.502  -2.804  1.00 0.00 ? 114 TYR A HE2  4  
ATOM 7976  H HH   . TYR A 1 96  ? -13.897 -7.826  -5.596  1.00 0.00 ? 114 TYR A HH   4  
ATOM 7977  N N    . ASP A 1 97  ? -6.914  -3.922  -2.579  1.00 0.00 ? 115 ASP A N    4  
ATOM 7978  C CA   . ASP A 1 97  ? -5.850  -2.933  -2.452  1.00 0.00 ? 115 ASP A CA   4  
ATOM 7979  C C    . ASP A 1 97  ? -6.198  -1.890  -1.395  1.00 0.00 ? 115 ASP A C    4  
ATOM 7980  O O    . ASP A 1 97  ? -7.212  -2.005  -0.705  1.00 0.00 ? 115 ASP A O    4  
ATOM 7981  C CB   . ASP A 1 97  ? -5.597  -2.250  -3.797  1.00 0.00 ? 115 ASP A CB   4  
ATOM 7982  C CG   . ASP A 1 97  ? -4.132  -1.917  -4.012  1.00 0.00 ? 115 ASP A CG   4  
ATOM 7983  O OD1  . ASP A 1 97  ? -3.319  -2.858  -4.112  1.00 0.00 ? 115 ASP A OD1  4  
ATOM 7984  O OD2  . ASP A 1 97  ? -3.802  -0.714  -4.077  1.00 0.00 ? 115 ASP A OD2  4  
ATOM 7985  H H    . ASP A 1 97  ? -7.359  -4.037  -3.445  1.00 0.00 ? 115 ASP A H    4  
ATOM 7986  H HA   . ASP A 1 97  ? -4.951  -3.450  -2.147  1.00 0.00 ? 115 ASP A HA   4  
ATOM 7987  H HB3  . ASP A 1 97  ? -6.167  -1.332  -3.840  1.00 0.00 ? 115 ASP A HB3  4  
ATOM 7988  N N    . THR A 1 98  ? -5.352  -0.872  -1.274  1.00 0.00 ? 116 THR A N    4  
ATOM 7989  C CA   . THR A 1 98  ? -5.570  0.190   -0.300  1.00 0.00 ? 116 THR A CA   4  
ATOM 7990  C C    . THR A 1 98  ? -4.904  1.487   -0.742  1.00 0.00 ? 116 THR A C    4  
ATOM 7991  O O    . THR A 1 98  ? -3.749  1.488   -1.169  1.00 0.00 ? 116 THR A O    4  
ATOM 7992  C CB   . THR A 1 98  ? -5.033  -0.203  1.090   1.00 0.00 ? 116 THR A CB   4  
ATOM 7993  O OG1  . THR A 1 98  ? -5.361  0.810   2.047   1.00 0.00 ? 116 THR A OG1  4  
ATOM 7994  C CG2  . THR A 1 98  ? -3.526  -0.401  1.050   1.00 0.00 ? 116 THR A CG2  4  
ATOM 7995  H H    . THR A 1 98  ? -4.564  -0.837  -1.853  1.00 0.00 ? 116 THR A H    4  
ATOM 7996  H HA   . THR A 1 98  ? -6.635  0.354   -0.217  1.00 0.00 ? 116 THR A HA   4  
ATOM 7997  H HB   . THR A 1 98  ? -5.496  -1.131  1.389   1.00 0.00 ? 116 THR A HB   4  
ATOM 7998  H HG1  . THR A 1 98  ? -4.835  1.596   1.874   1.00 0.00 ? 116 THR A HG1  4  
ATOM 7999  H HG21 . THR A 1 98  ? -3.262  -0.993  0.186   1.00 0.00 ? 116 THR A HG21 4  
ATOM 8000  H HG22 . THR A 1 98  ? -3.206  -0.912  1.946   1.00 0.00 ? 116 THR A HG22 4  
ATOM 8001  H HG23 . THR A 1 98  ? -3.037  0.561   0.989   1.00 0.00 ? 116 THR A HG23 4  
ATOM 8002  N N    . TYR A 1 99  ? -5.637  2.590   -0.637  1.00 0.00 ? 117 TYR A N    4  
ATOM 8003  C CA   . TYR A 1 99  ? -5.116  3.895   -1.029  1.00 0.00 ? 117 TYR A CA   4  
ATOM 8004  C C    . TYR A 1 99  ? -4.763  4.731   0.197   1.00 0.00 ? 117 TYR A C    4  
ATOM 8005  O O    . TYR A 1 99  ? -5.415  4.635   1.238   1.00 0.00 ? 117 TYR A O    4  
ATOM 8006  C CB   . TYR A 1 99  ? -6.138  4.638   -1.890  1.00 0.00 ? 117 TYR A CB   4  
ATOM 8007  C CG   . TYR A 1 99  ? -6.692  3.806   -3.025  1.00 0.00 ? 117 TYR A CG   4  
ATOM 8008  C CD1  . TYR A 1 99  ? -5.879  2.926   -3.728  1.00 0.00 ? 117 TYR A CD1  4  
ATOM 8009  C CD2  . TYR A 1 99  ? -8.028  3.901   -3.396  1.00 0.00 ? 117 TYR A CD2  4  
ATOM 8010  C CE1  . TYR A 1 99  ? -6.379  2.165   -4.766  1.00 0.00 ? 117 TYR A CE1  4  
ATOM 8011  C CE2  . TYR A 1 99  ? -8.537  3.144   -4.431  1.00 0.00 ? 117 TYR A CE2  4  
ATOM 8012  C CZ   . TYR A 1 99  ? -7.710  2.277   -5.115  1.00 0.00 ? 117 TYR A CZ   4  
ATOM 8013  O OH   . TYR A 1 99  ? -8.214  1.521   -6.148  1.00 0.00 ? 117 TYR A OH   4  
ATOM 8014  H H    . TYR A 1 99  ? -6.550  2.525   -0.290  1.00 0.00 ? 117 TYR A H    4  
ATOM 8015  H HA   . TYR A 1 99  ? -4.220  3.733   -1.610  1.00 0.00 ? 117 TYR A HA   4  
ATOM 8016  H HB3  . TYR A 1 99  ? -5.671  5.513   -2.316  1.00 0.00 ? 117 TYR A HB3  4  
ATOM 8017  H HD1  . TYR A 1 99  ? -4.838  2.840   -3.454  1.00 0.00 ? 117 TYR A HD1  4  
ATOM 8018  H HD2  . TYR A 1 99  ? -8.673  4.583   -2.859  1.00 0.00 ? 117 TYR A HD2  4  
ATOM 8019  H HE1  . TYR A 1 99  ? -5.733  1.485   -5.301  1.00 0.00 ? 117 TYR A HE1  4  
ATOM 8020  H HE2  . TYR A 1 99  ? -9.578  3.232   -4.704  1.00 0.00 ? 117 TYR A HE2  4  
ATOM 8021  H HH   . TYR A 1 99  ? -7.491  1.094   -6.614  1.00 0.00 ? 117 TYR A HH   4  
ATOM 8022  N N    . CYS A 1 100 ? -3.728  5.552   0.068   1.00 0.00 ? 118 CYS A N    4  
ATOM 8023  C CA   . CYS A 1 100 ? -3.285  6.406   1.164   1.00 0.00 ? 118 CYS A CA   4  
ATOM 8024  C C    . CYS A 1 100 ? -2.977  7.815   0.664   1.00 0.00 ? 118 CYS A C    4  
ATOM 8025  O O    . CYS A 1 100 ? -2.590  8.006   -0.489  1.00 0.00 ? 118 CYS A O    4  
ATOM 8026  C CB   . CYS A 1 100 ? -2.047  5.810   1.837   1.00 0.00 ? 118 CYS A CB   4  
ATOM 8027  S SG   . CYS A 1 100 ? -2.266  4.092   2.405   1.00 0.00 ? 118 CYS A SG   4  
ATOM 8028  H H    . CYS A 1 100 ? -3.245  5.584   -0.788  1.00 0.00 ? 118 CYS A H    4  
ATOM 8029  H HA   . CYS A 1 100 ? -4.087  6.461   1.884   1.00 0.00 ? 118 CYS A HA   4  
ATOM 8030  H HB3  . CYS A 1 100 ? -1.790  6.411   2.697   1.00 0.00 ? 118 CYS A HB3  4  
ATOM 8031  N N    . PHE A 1 101 ? -3.150  8.798   1.540   1.00 0.00 ? 119 PHE A N    4  
ATOM 8032  C CA   . PHE A 1 101 ? -2.891  10.190  1.189   1.00 0.00 ? 119 PHE A CA   4  
ATOM 8033  C C    . PHE A 1 101 ? -1.757  10.762  2.034   1.00 0.00 ? 119 PHE A C    4  
ATOM 8034  O O    . PHE A 1 101 ? -1.686  10.524  3.239   1.00 0.00 ? 119 PHE A O    4  
ATOM 8035  C CB   . PHE A 1 101 ? -4.156  11.029  1.379   1.00 0.00 ? 119 PHE A CB   4  
ATOM 8036  C CG   . PHE A 1 101 ? -3.920  12.507  1.246   1.00 0.00 ? 119 PHE A CG   4  
ATOM 8037  C CD1  . PHE A 1 101 ? -3.756  13.087  -0.001  1.00 0.00 ? 119 PHE A CD1  4  
ATOM 8038  C CD2  . PHE A 1 101 ? -3.863  13.316  2.371   1.00 0.00 ? 119 PHE A CD2  4  
ATOM 8039  C CE1  . PHE A 1 101 ? -3.538  14.447  -0.125  1.00 0.00 ? 119 PHE A CE1  4  
ATOM 8040  C CE2  . PHE A 1 101 ? -3.647  14.675  2.252   1.00 0.00 ? 119 PHE A CE2  4  
ATOM 8041  C CZ   . PHE A 1 101 ? -3.483  15.242  1.003   1.00 0.00 ? 119 PHE A CZ   4  
ATOM 8042  H H    . PHE A 1 101 ? -3.460  8.584   2.445   1.00 0.00 ? 119 PHE A H    4  
ATOM 8043  H HA   . PHE A 1 101 ? -2.602  10.220  0.150   1.00 0.00 ? 119 PHE A HA   4  
ATOM 8044  H HB3  . PHE A 1 101 ? -4.560  10.843  2.363   1.00 0.00 ? 119 PHE A HB3  4  
ATOM 8045  H HD1  . PHE A 1 101 ? -3.798  12.466  -0.884  1.00 0.00 ? 119 PHE A HD1  4  
ATOM 8046  H HD2  . PHE A 1 101 ? -3.990  12.874  3.349   1.00 0.00 ? 119 PHE A HD2  4  
ATOM 8047  H HE1  . PHE A 1 101 ? -3.411  14.886  -1.104  1.00 0.00 ? 119 PHE A HE1  4  
ATOM 8048  H HE2  . PHE A 1 101 ? -3.604  15.295  3.136   1.00 0.00 ? 119 PHE A HE2  4  
ATOM 8049  H HZ   . PHE A 1 101 ? -3.314  16.304  0.908   1.00 0.00 ? 119 PHE A HZ   4  
ATOM 8050  N N    . ASN A 1 102 ? -0.871  11.516  1.392   1.00 0.00 ? 120 ASN A N    4  
ATOM 8051  C CA   . ASN A 1 102 ? 0.261   12.122  2.083   1.00 0.00 ? 120 ASN A CA   4  
ATOM 8052  C C    . ASN A 1 102 ? 0.078   13.632  2.209   1.00 0.00 ? 120 ASN A C    4  
ATOM 8053  O O    . ASN A 1 102 ? -0.793  14.217  1.566   1.00 0.00 ? 120 ASN A O    4  
ATOM 8054  C CB   . ASN A 1 102 ? 1.563   11.816  1.339   1.00 0.00 ? 120 ASN A CB   4  
ATOM 8055  C CG   . ASN A 1 102 ? 2.326   10.662  1.960   1.00 0.00 ? 120 ASN A CG   4  
ATOM 8056  O OD1  . ASN A 1 102 ? 2.268   10.445  3.171   1.00 0.00 ? 120 ASN A OD1  4  
ATOM 8057  N ND2  . ASN A 1 102 ? 3.047   9.916   1.132   1.00 0.00 ? 120 ASN A ND2  4  
ATOM 8058  H H    . ASN A 1 102 ? -0.982  11.669  0.430   1.00 0.00 ? 120 ASN A H    4  
ATOM 8059  H HA   . ASN A 1 102 ? 0.313   11.694  3.072   1.00 0.00 ? 120 ASN A HA   4  
ATOM 8060  H HB3  . ASN A 1 102 ? 2.194   12.691  1.354   1.00 0.00 ? 120 ASN A HB3  4  
ATOM 8061  H HD21 . ASN A 1 102 ? 3.047   10.147  0.180   1.00 0.00 ? 120 ASN A HD21 4  
ATOM 8062  H HD22 . ASN A 1 102 ? 3.549   9.162   1.508   1.00 0.00 ? 120 ASN A HD22 4  
ATOM 8063  N N    . ALA A 1 103 ? 0.906   14.255  3.042   1.00 0.00 ? 121 ALA A N    4  
ATOM 8064  C CA   . ALA A 1 103 ? 0.837   15.696  3.249   1.00 0.00 ? 121 ALA A CA   4  
ATOM 8065  C C    . ALA A 1 103 ? 2.169   16.363  2.922   1.00 0.00 ? 121 ALA A C    4  
ATOM 8066  O O    . ALA A 1 103 ? 2.477   17.440  3.431   1.00 0.00 ? 121 ALA A O    4  
ATOM 8067  C CB   . ALA A 1 103 ? 0.429   16.003  4.682   1.00 0.00 ? 121 ALA A CB   4  
ATOM 8068  H H    . ALA A 1 103 ? 1.580   13.734  3.525   1.00 0.00 ? 121 ALA A H    4  
ATOM 8069  H HA   . ALA A 1 103 ? 0.076   16.093  2.592   1.00 0.00 ? 121 ALA A HA   4  
ATOM 8070  H HB1  . ALA A 1 103 ? 0.051   17.014  4.741   1.00 0.00 ? 121 ALA A HB1  4  
ATOM 8071  H HB2  . ALA A 1 103 ? -0.340  15.313  4.995   1.00 0.00 ? 121 ALA A HB2  4  
ATOM 8072  H HB3  . ALA A 1 103 ? 1.288   15.903  5.331   1.00 0.00 ? 121 ALA A HB3  4  
ATOM 8073  N N    . SER A 1 104 ? 2.956   15.714  2.069   1.00 0.00 ? 122 SER A N    4  
ATOM 8074  C CA   . SER A 1 104 ? 4.257   16.242  1.677   1.00 0.00 ? 122 SER A CA   4  
ATOM 8075  C C    . SER A 1 104 ? 4.299   16.527  0.178   1.00 0.00 ? 122 SER A C    4  
ATOM 8076  O O    . SER A 1 104 ? 4.570   17.651  -0.242  1.00 0.00 ? 122 SER A O    4  
ATOM 8077  C CB   . SER A 1 104 ? 5.366   15.255  2.051   1.00 0.00 ? 122 SER A CB   4  
ATOM 8078  O OG   . SER A 1 104 ? 6.533   15.486  1.284   1.00 0.00 ? 122 SER A OG   4  
ATOM 8079  H H    . SER A 1 104 ? 2.655   14.859  1.698   1.00 0.00 ? 122 SER A H    4  
ATOM 8080  H HA   . SER A 1 104 ? 4.414   17.166  2.212   1.00 0.00 ? 122 SER A HA   4  
ATOM 8081  H HB3  . SER A 1 104 ? 5.022   14.247  1.868   1.00 0.00 ? 122 SER A HB3  4  
ATOM 8082  H HG   . SER A 1 104 ? 7.248   15.762  1.864   1.00 0.00 ? 122 SER A HG   4  
ATOM 8083  N N    . ALA A 1 105 ? 4.028   15.500  -0.620  1.00 0.00 ? 123 ALA A N    4  
ATOM 8084  C CA   . ALA A 1 105 ? 4.032   15.640  -2.071  1.00 0.00 ? 123 ALA A CA   4  
ATOM 8085  C C    . ALA A 1 105 ? 3.166   16.815  -2.512  1.00 0.00 ? 123 ALA A C    4  
ATOM 8086  O O    . ALA A 1 105 ? 2.304   17.292  -1.776  1.00 0.00 ? 123 ALA A O    4  
ATOM 8087  C CB   . ALA A 1 105 ? 3.553   14.354  -2.726  1.00 0.00 ? 123 ALA A CB   4  
ATOM 8088  H H    . ALA A 1 105 ? 3.819   14.628  -0.225  1.00 0.00 ? 123 ALA A H    4  
ATOM 8089  H HA   . ALA A 1 105 ? 5.051   15.818  -2.386  1.00 0.00 ? 123 ALA A HA   4  
ATOM 8090  H HB1  . ALA A 1 105 ? 3.166   13.687  -1.969  1.00 0.00 ? 123 ALA A HB1  4  
ATOM 8091  H HB2  . ALA A 1 105 ? 2.774   14.581  -3.439  1.00 0.00 ? 123 ALA A HB2  4  
ATOM 8092  H HB3  . ALA A 1 105 ? 4.379   13.879  -3.235  1.00 0.00 ? 123 ALA A HB3  4  
ATOM 8093  N N    . PRO A 1 106 ? 3.400   17.295  -3.743  1.00 0.00 ? 124 PRO A N    4  
ATOM 8094  C CA   . PRO A 1 106 ? 2.652   18.420  -4.310  1.00 0.00 ? 124 PRO A CA   4  
ATOM 8095  C C    . PRO A 1 106 ? 1.205   18.056  -4.621  1.00 0.00 ? 124 PRO A C    4  
ATOM 8096  O O    . PRO A 1 106 ? 0.818   16.887  -4.615  1.00 0.00 ? 124 PRO A O    4  
ATOM 8097  C CB   . PRO A 1 106 ? 3.412   18.739  -5.599  1.00 0.00 ? 124 PRO A CB   4  
ATOM 8098  C CG   . PRO A 1 106 ? 4.079   17.459  -5.972  1.00 0.00 ? 124 PRO A CG   4  
ATOM 8099  C CD   . PRO A 1 106 ? 4.414   16.774  -4.676  1.00 0.00 ? 124 PRO A CD   4  
ATOM 8100  H HA   . PRO A 1 106 ? 2.673   19.280  -3.656  1.00 0.00 ? 124 PRO A HA   4  
ATOM 8101  H HB3  . PRO A 1 106 ? 4.134   19.520  -5.412  1.00 0.00 ? 124 PRO A HB3  4  
ATOM 8102  H HG3  . PRO A 1 106 ? 4.979   17.665  -6.531  1.00 0.00 ? 124 PRO A HG3  4  
ATOM 8103  H HD3  . PRO A 1 106 ? 5.409   17.044  -4.353  1.00 0.00 ? 124 PRO A HD3  4  
ATOM 8104  N N    . PRO A 1 107 ? 0.384   19.079  -4.899  1.00 0.00 ? 125 PRO A N    4  
ATOM 8105  C CA   . PRO A 1 107 ? -1.035  18.890  -5.220  1.00 0.00 ? 125 PRO A CA   4  
ATOM 8106  C C    . PRO A 1 107 ? -1.240  18.227  -6.578  1.00 0.00 ? 125 PRO A C    4  
ATOM 8107  O O    . PRO A 1 107 ? -2.357  17.849  -6.931  1.00 0.00 ? 125 PRO A O    4  
ATOM 8108  C CB   . PRO A 1 107 ? -1.589  20.317  -5.233  1.00 0.00 ? 125 PRO A CB   4  
ATOM 8109  C CG   . PRO A 1 107 ? -0.413  21.176  -5.549  1.00 0.00 ? 125 PRO A CG   4  
ATOM 8110  C CD   . PRO A 1 107 ? 0.775   20.497  -4.925  1.00 0.00 ? 125 PRO A CD   4  
ATOM 8111  H HA   . PRO A 1 107 ? -1.541  18.314  -4.459  1.00 0.00 ? 125 PRO A HA   4  
ATOM 8112  H HB3  . PRO A 1 107 ? -2.003  20.555  -4.266  1.00 0.00 ? 125 PRO A HB3  4  
ATOM 8113  H HG3  . PRO A 1 107 ? -0.551  22.158  -5.121  1.00 0.00 ? 125 PRO A HG3  4  
ATOM 8114  H HD3  . PRO A 1 107 ? 0.940   20.870  -3.924  1.00 0.00 ? 125 PRO A HD3  4  
ATOM 8115  N N    . GLU A 1 108 ? -0.156  18.089  -7.334  1.00 0.00 ? 126 GLU A N    4  
ATOM 8116  C CA   . GLU A 1 108 ? -0.217  17.471  -8.652  1.00 0.00 ? 126 GLU A CA   4  
ATOM 8117  C C    . GLU A 1 108 ? 0.617   16.194  -8.696  1.00 0.00 ? 126 GLU A C    4  
ATOM 8118  O O    . GLU A 1 108 ? 1.219   15.801  -7.697  1.00 0.00 ? 126 GLU A O    4  
ATOM 8119  C CB   . GLU A 1 108 ? 0.272   18.449  -9.722  1.00 0.00 ? 126 GLU A CB   4  
ATOM 8120  C CG   . GLU A 1 108 ? -0.592  19.692  -9.851  1.00 0.00 ? 126 GLU A CG   4  
ATOM 8121  C CD   . GLU A 1 108 ? -0.431  20.377  -11.194 1.00 0.00 ? 126 GLU A CD   4  
ATOM 8122  O OE1  . GLU A 1 108 ? 0.495   20.005  -11.944 1.00 0.00 ? 126 GLU A OE1  4  
ATOM 8123  O OE2  . GLU A 1 108 ? -1.234  21.286  -11.495 1.00 0.00 ? 126 GLU A OE2  4  
ATOM 8124  H H    . GLU A 1 108 ? 0.707   18.410  -6.996  1.00 0.00 ? 126 GLU A H    4  
ATOM 8125  H HA   . GLU A 1 108 ? -1.248  17.220  -8.853  1.00 0.00 ? 126 GLU A HA   4  
ATOM 8126  H HB3  . GLU A 1 108 ? 0.283   17.944  -10.677 1.00 0.00 ? 126 GLU A HB3  4  
ATOM 8127  H HG3  . GLU A 1 108 ? -0.316  20.389  -9.073  1.00 0.00 ? 126 GLU A HG3  4  
ATOM 8128  N N    . GLU A 1 109 ? 0.647   15.552  -9.860  1.00 0.00 ? 127 GLU A N    4  
ATOM 8129  C CA   . GLU A 1 109 ? 1.406   14.319  -10.032 1.00 0.00 ? 127 GLU A CA   4  
ATOM 8130  C C    . GLU A 1 109 ? 2.854   14.505  -9.589  1.00 0.00 ? 127 GLU A C    4  
ATOM 8131  O O    . GLU A 1 109 ? 3.439   15.573  -9.776  1.00 0.00 ? 127 GLU A O    4  
ATOM 8132  C CB   . GLU A 1 109 ? 1.362   13.867  -11.493 1.00 0.00 ? 127 GLU A CB   4  
ATOM 8133  C CG   . GLU A 1 109 ? 1.945   14.883  -12.463 1.00 0.00 ? 127 GLU A CG   4  
ATOM 8134  C CD   . GLU A 1 109 ? 0.914   15.882  -12.948 1.00 0.00 ? 127 GLU A CD   4  
ATOM 8135  O OE1  . GLU A 1 109 ? -0.256  15.487  -13.131 1.00 0.00 ? 127 GLU A OE1  4  
ATOM 8136  O OE2  . GLU A 1 109 ? 1.277   17.060  -13.146 1.00 0.00 ? 127 GLU A OE2  4  
ATOM 8137  H H    . GLU A 1 109 ? 0.146   15.916  -10.619 1.00 0.00 ? 127 GLU A H    4  
ATOM 8138  H HA   . GLU A 1 109 ? 0.949   13.559  -9.417  1.00 0.00 ? 127 GLU A HA   4  
ATOM 8139  H HB3  . GLU A 1 109 ? 0.334   13.685  -11.770 1.00 0.00 ? 127 GLU A HB3  4  
ATOM 8140  H HG3  . GLU A 1 109 ? 2.346   14.356  -13.315 1.00 0.00 ? 127 GLU A HG3  4  
ATOM 8141  N N    . ASP A 1 110 ? 3.425   13.460  -9.001  1.00 0.00 ? 128 ASP A N    4  
ATOM 8142  C CA   . ASP A 1 110 ? 4.806   13.507  -8.531  1.00 0.00 ? 128 ASP A CA   4  
ATOM 8143  C C    . ASP A 1 110 ? 5.290   12.119  -8.127  1.00 0.00 ? 128 ASP A C    4  
ATOM 8144  O O    . ASP A 1 110 ? 4.795   11.533  -7.163  1.00 0.00 ? 128 ASP A O    4  
ATOM 8145  C CB   . ASP A 1 110 ? 4.931   14.469  -7.349  1.00 0.00 ? 128 ASP A CB   4  
ATOM 8146  C CG   . ASP A 1 110 ? 6.326   15.050  -7.222  1.00 0.00 ? 128 ASP A CG   4  
ATOM 8147  O OD1  . ASP A 1 110 ? 7.095   14.968  -8.202  1.00 0.00 ? 128 ASP A OD1  4  
ATOM 8148  O OD2  . ASP A 1 110 ? 6.647   15.588  -6.141  1.00 0.00 ? 128 ASP A OD2  4  
ATOM 8149  H H    . ASP A 1 110 ? 2.908   12.636  -8.880  1.00 0.00 ? 128 ASP A H    4  
ATOM 8150  H HA   . ASP A 1 110 ? 5.420   13.867  -9.342  1.00 0.00 ? 128 ASP A HA   4  
ATOM 8151  H HB3  . ASP A 1 110 ? 4.696   13.940  -6.437  1.00 0.00 ? 128 ASP A HB3  4  
ATOM 8152  N N    . CYS A 1 111 ? 6.259   11.595  -8.870  1.00 0.00 ? 129 CYS A N    4  
ATOM 8153  C CA   . CYS A 1 111 ? 6.809   10.274  -8.592  1.00 0.00 ? 129 CYS A CA   4  
ATOM 8154  C C    . CYS A 1 111 ? 7.886   10.351  -7.514  1.00 0.00 ? 129 CYS A C    4  
ATOM 8155  O O    . CYS A 1 111 ? 8.476   9.338   -7.135  1.00 0.00 ? 129 CYS A O    4  
ATOM 8156  C CB   . CYS A 1 111 ? 7.392   9.663   -9.867  1.00 0.00 ? 129 CYS A CB   4  
ATOM 8157  S SG   . CYS A 1 111 ? 6.169   9.402   -11.194 1.00 0.00 ? 129 CYS A SG   4  
ATOM 8158  H H    . CYS A 1 111 ? 6.612   12.111  -9.627  1.00 0.00 ? 129 CYS A H    4  
ATOM 8159  H HA   . CYS A 1 111 ? 6.005   9.648   -8.237  1.00 0.00 ? 129 CYS A HA   4  
ATOM 8160  H HB3  . CYS A 1 111 ? 7.830   8.703   -9.631  1.00 0.00 ? 129 CYS A HB3  4  
ATOM 8161  N N    . THR A 1 112 ? 8.138   11.560  -7.021  1.00 0.00 ? 130 THR A N    4  
ATOM 8162  C CA   . THR A 1 112 ? 9.143   11.770  -5.986  1.00 0.00 ? 130 THR A CA   4  
ATOM 8163  C C    . THR A 1 112 ? 8.570   11.504  -4.600  1.00 0.00 ? 130 THR A C    4  
ATOM 8164  O O    . THR A 1 112 ? 7.352   11.443  -4.422  1.00 0.00 ? 130 THR A O    4  
ATOM 8165  C CB   . THR A 1 112 ? 9.705   13.203  -6.031  1.00 0.00 ? 130 THR A CB   4  
ATOM 8166  O OG1  . THR A 1 112 ? 8.739   14.123  -5.512  1.00 0.00 ? 130 THR A OG1  4  
ATOM 8167  C CG2  . THR A 1 112 ? 10.074  13.594  -7.454  1.00 0.00 ? 130 THR A CG2  4  
ATOM 8168  H H    . THR A 1 112 ? 7.635   12.328  -7.362  1.00 0.00 ? 130 THR A H    4  
ATOM 8169  H HA   . THR A 1 112 ? 9.956   11.080  -6.168  1.00 0.00 ? 130 THR A HA   4  
ATOM 8170  H HB   . THR A 1 112 ? 10.595  13.244  -5.420  1.00 0.00 ? 130 THR A HB   4  
ATOM 8171  H HG1  . THR A 1 112 ? 9.179   14.765  -4.948  1.00 0.00 ? 130 THR A HG1  4  
ATOM 8172  H HG21 . THR A 1 112 ? 11.036  14.088  -7.455  1.00 0.00 ? 130 THR A HG21 4  
ATOM 8173  H HG22 . THR A 1 112 ? 9.325   14.267  -7.848  1.00 0.00 ? 130 THR A HG22 4  
ATOM 8174  H HG23 . THR A 1 112 ? 10.123  12.709  -8.070  1.00 0.00 ? 130 THR A HG23 4  
ATOM 8175  N N    . SER A 1 113 ? 9.453   11.346  -3.619  1.00 0.00 ? 131 SER A N    4  
ATOM 8176  C CA   . SER A 1 113 ? 9.033   11.084  -2.248  1.00 0.00 ? 131 SER A CA   4  
ATOM 8177  C C    . SER A 1 113 ? 10.181  11.329  -1.272  1.00 0.00 ? 131 SER A C    4  
ATOM 8178  O O    . SER A 1 113 ? 11.272  10.784  -1.431  1.00 0.00 ? 131 SER A O    4  
ATOM 8179  C CB   . SER A 1 113 ? 8.532   9.645   -2.111  1.00 0.00 ? 131 SER A CB   4  
ATOM 8180  O OG   . SER A 1 113 ? 8.727   9.158   -0.794  1.00 0.00 ? 131 SER A OG   4  
ATOM 8181  H H    . SER A 1 113 ? 10.409  11.405  -3.824  1.00 0.00 ? 131 SER A H    4  
ATOM 8182  H HA   . SER A 1 113 ? 8.225   11.760  -2.012  1.00 0.00 ? 131 SER A HA   4  
ATOM 8183  H HB3  . SER A 1 113 ? 9.074   9.012   -2.799  1.00 0.00 ? 131 SER A HB3  4  
ATOM 8184  H HG   . SER A 1 113 ? 9.655   8.941   -0.668  1.00 0.00 ? 131 SER A HG   4  
ATOM 8185  N N    . VAL A 1 114 ? 9.923   12.155  -0.262  1.00 0.00 ? 132 VAL A N    4  
ATOM 8186  C CA   . VAL A 1 114 ? 10.932  12.472  0.740   1.00 0.00 ? 132 VAL A CA   4  
ATOM 8187  C C    . VAL A 1 114 ? 10.333  12.481  2.142   1.00 0.00 ? 132 VAL A C    4  
ATOM 8188  O O    . VAL A 1 114 ? 10.504  13.436  2.898   1.00 0.00 ? 132 VAL A O    4  
ATOM 8189  C CB   . VAL A 1 114 ? 11.586  13.840  0.466   1.00 0.00 ? 132 VAL A CB   4  
ATOM 8190  C CG1  . VAL A 1 114 ? 12.837  14.015  1.311   1.00 0.00 ? 132 VAL A CG1  4  
ATOM 8191  C CG2  . VAL A 1 114 ? 11.905  13.991  -1.013  1.00 0.00 ? 132 VAL A CG2  4  
ATOM 8192  H H    . VAL A 1 114 ? 9.034   12.559  -0.189  1.00 0.00 ? 132 VAL A H    4  
ATOM 8193  H HA   . VAL A 1 114 ? 11.701  11.714  0.692   1.00 0.00 ? 132 VAL A HA   4  
ATOM 8194  H HB   . VAL A 1 114 ? 10.883  14.614  0.740   1.00 0.00 ? 132 VAL A HB   4  
ATOM 8195  H HG11 . VAL A 1 114 ? 13.564  14.594  0.762   1.00 0.00 ? 132 VAL A HG11 4  
ATOM 8196  H HG12 . VAL A 1 114 ? 12.585  14.528  2.228   1.00 0.00 ? 132 VAL A HG12 4  
ATOM 8197  H HG13 . VAL A 1 114 ? 13.252  13.046  1.544   1.00 0.00 ? 132 VAL A HG13 4  
ATOM 8198  H HG21 . VAL A 1 114 ? 10.991  13.949  -1.585  1.00 0.00 ? 132 VAL A HG21 4  
ATOM 8199  H HG22 . VAL A 1 114 ? 12.392  14.940  -1.183  1.00 0.00 ? 132 VAL A HG22 4  
ATOM 8200  H HG23 . VAL A 1 114 ? 12.561  13.190  -1.323  1.00 0.00 ? 132 VAL A HG23 4  
ATOM 8201  N N    . THR A 1 115 ? 9.626   11.407  2.483   1.00 0.00 ? 133 THR A N    4  
ATOM 8202  C CA   . THR A 1 115 ? 8.999   11.290  3.792   1.00 0.00 ? 133 THR A CA   4  
ATOM 8203  C C    . THR A 1 115 ? 8.796   9.829   4.177   1.00 0.00 ? 133 THR A C    4  
ATOM 8204  O O    . THR A 1 115 ? 7.819   9.200   3.771   1.00 0.00 ? 133 THR A O    4  
ATOM 8205  C CB   . THR A 1 115 ? 7.638   12.011  3.831   1.00 0.00 ? 133 THR A CB   4  
ATOM 8206  O OG1  . THR A 1 115 ? 6.928   11.657  5.023   1.00 0.00 ? 133 THR A OG1  4  
ATOM 8207  C CG2  . THR A 1 115 ? 6.801   11.655  2.612   1.00 0.00 ? 133 THR A CG2  4  
ATOM 8208  H H    . THR A 1 115 ? 9.524   10.677  1.837   1.00 0.00 ? 133 THR A H    4  
ATOM 8209  H HA   . THR A 1 115 ? 9.649   11.756  4.518   1.00 0.00 ? 133 THR A HA   4  
ATOM 8210  H HB   . THR A 1 115 ? 7.813   13.078  3.829   1.00 0.00 ? 133 THR A HB   4  
ATOM 8211  H HG1  . THR A 1 115 ? 6.641   12.454  5.474   1.00 0.00 ? 133 THR A HG1  4  
ATOM 8212  H HG21 . THR A 1 115 ? 6.717   12.517  1.968   1.00 0.00 ? 133 THR A HG21 4  
ATOM 8213  H HG22 . THR A 1 115 ? 5.816   11.344  2.929   1.00 0.00 ? 133 THR A HG22 4  
ATOM 8214  H HG23 . THR A 1 115 ? 7.277   10.850  2.073   1.00 0.00 ? 133 THR A HG23 4  
ATOM 8215  N N    . ASP A 1 116 ? 9.725   9.293   4.962   1.00 0.00 ? 134 ASP A N    4  
ATOM 8216  C CA   . ASP A 1 116 ? 9.648   7.906   5.402   1.00 0.00 ? 134 ASP A CA   4  
ATOM 8217  C C    . ASP A 1 116 ? 8.728   7.770   6.610   1.00 0.00 ? 134 ASP A C    4  
ATOM 8218  O O    . ASP A 1 116 ? 8.136   8.749   7.068   1.00 0.00 ? 134 ASP A O    4  
ATOM 8219  C CB   . ASP A 1 116 ? 11.042  7.378   5.745   1.00 0.00 ? 134 ASP A CB   4  
ATOM 8220  C CG   . ASP A 1 116 ? 12.039  7.603   4.624   1.00 0.00 ? 134 ASP A CG   4  
ATOM 8221  O OD1  . ASP A 1 116 ? 11.733  7.223   3.473   1.00 0.00 ? 134 ASP A OD1  4  
ATOM 8222  O OD2  . ASP A 1 116 ? 13.122  8.161   4.896   1.00 0.00 ? 134 ASP A OD2  4  
ATOM 8223  H H    . ASP A 1 116 ? 10.482  9.846   5.252   1.00 0.00 ? 134 ASP A H    4  
ATOM 8224  H HA   . ASP A 1 116 ? 9.243   7.321   4.589   1.00 0.00 ? 134 ASP A HA   4  
ATOM 8225  H HB3  . ASP A 1 116 ? 10.981  6.319   5.940   1.00 0.00 ? 134 ASP A HB3  4  
ATOM 8226  N N    . LEU A 1 117 ? 8.611   6.550   7.124   1.00 0.00 ? 135 LEU A N    4  
ATOM 8227  C CA   . LEU A 1 117 ? 7.760   6.285   8.280   1.00 0.00 ? 135 LEU A CA   4  
ATOM 8228  C C    . LEU A 1 117 ? 7.996   7.317   9.377   1.00 0.00 ? 135 LEU A C    4  
ATOM 8229  O O    . LEU A 1 117 ? 9.097   7.849   9.539   1.00 0.00 ? 135 LEU A O    4  
ATOM 8230  C CB   . LEU A 1 117 ? 8.026   4.879   8.821   1.00 0.00 ? 135 LEU A CB   4  
ATOM 8231  C CG   . LEU A 1 117 ? 9.496   4.498   9.009   1.00 0.00 ? 135 LEU A CG   4  
ATOM 8232  C CD1  . LEU A 1 117 ? 10.005  4.984   10.355  1.00 0.00 ? 135 LEU A CD1  4  
ATOM 8233  C CD2  . LEU A 1 117 ? 9.676   2.992   8.879   1.00 0.00 ? 135 LEU A CD2  4  
ATOM 8234  H H    . LEU A 1 117 ? 9.106   5.809   6.717   1.00 0.00 ? 135 LEU A H    4  
ATOM 8235  H HA   . LEU A 1 117 ? 6.733   6.350   7.957   1.00 0.00 ? 135 LEU A HA   4  
ATOM 8236  H HB3  . LEU A 1 117 ? 7.585   4.172   8.132   1.00 0.00 ? 135 LEU A HB3  4  
ATOM 8237  H HG   . LEU A 1 117 ? 10.086  4.974   8.238   1.00 0.00 ? 135 LEU A HG   4  
ATOM 8238  H HD11 . LEU A 1 117 ? 10.934  5.516   10.218  1.00 0.00 ? 135 LEU A HD11 4  
ATOM 8239  H HD12 . LEU A 1 117 ? 10.167  4.138   11.007  1.00 0.00 ? 135 LEU A HD12 4  
ATOM 8240  H HD13 . LEU A 1 117 ? 9.273   5.645   10.800  1.00 0.00 ? 135 LEU A HD13 4  
ATOM 8241  H HD21 . LEU A 1 117 ? 9.981   2.752   7.873   1.00 0.00 ? 135 LEU A HD21 4  
ATOM 8242  H HD22 . LEU A 1 117 ? 8.741   2.498   9.101   1.00 0.00 ? 135 LEU A HD22 4  
ATOM 8243  H HD23 . LEU A 1 117 ? 10.433  2.661   9.574   1.00 0.00 ? 135 LEU A HD23 4  
ATOM 8244  N N    . PRO A 1 118 ? 6.943   7.609   10.155  1.00 0.00 ? 136 PRO A N    4  
ATOM 8245  C CA   . PRO A 1 118 ? 7.011   8.577   11.252  1.00 0.00 ? 136 PRO A CA   4  
ATOM 8246  C C    . PRO A 1 118 ? 7.855   8.072   12.418  1.00 0.00 ? 136 PRO A C    4  
ATOM 8247  O O    . PRO A 1 118 ? 8.704   8.795   12.939  1.00 0.00 ? 136 PRO A O    4  
ATOM 8248  C CB   . PRO A 1 118 ? 5.549   8.733   11.679  1.00 0.00 ? 136 PRO A CB   4  
ATOM 8249  C CG   . PRO A 1 118 ? 4.897   7.457   11.272  1.00 0.00 ? 136 PRO A CG   4  
ATOM 8250  C CD   . PRO A 1 118 ? 5.602   7.012   10.020  1.00 0.00 ? 136 PRO A CD   4  
ATOM 8251  H HA   . PRO A 1 118 ? 7.394   9.530   10.917  1.00 0.00 ? 136 PRO A HA   4  
ATOM 8252  H HB3  . PRO A 1 118 ? 5.112   9.580   11.172  1.00 0.00 ? 136 PRO A HB3  4  
ATOM 8253  H HG3  . PRO A 1 118 ? 3.850   7.629   11.071  1.00 0.00 ? 136 PRO A HG3  4  
ATOM 8254  H HD3  . PRO A 1 118 ? 5.098   7.396   9.146   1.00 0.00 ? 136 PRO A HD3  4  
ATOM 8255  N N    . ASN A 1 119 ? 7.616   6.829   12.821  1.00 0.00 ? 137 ASN A N    4  
ATOM 8256  C CA   . ASN A 1 119 ? 8.354   6.229   13.927  1.00 0.00 ? 137 ASN A CA   4  
ATOM 8257  C C    . ASN A 1 119 ? 8.285   4.705   13.864  1.00 0.00 ? 137 ASN A C    4  
ATOM 8258  O O    . ASN A 1 119 ? 8.443   4.025   14.877  1.00 0.00 ? 137 ASN A O    4  
ATOM 8259  C CB   . ASN A 1 119 ? 7.800   6.720   15.265  1.00 0.00 ? 137 ASN A CB   4  
ATOM 8260  C CG   . ASN A 1 119 ? 8.367   8.068   15.666  1.00 0.00 ? 137 ASN A CG   4  
ATOM 8261  O OD1  . ASN A 1 119 ? 9.569   8.204   15.897  1.00 0.00 ? 137 ASN A OD1  4  
ATOM 8262  N ND2  . ASN A 1 119 ? 7.503   9.073   15.750  1.00 0.00 ? 137 ASN A ND2  4  
ATOM 8263  H H    . ASN A 1 119 ? 6.926   6.302   12.366  1.00 0.00 ? 137 ASN A H    4  
ATOM 8264  H HA   . ASN A 1 119 ? 9.387   6.534   13.841  1.00 0.00 ? 137 ASN A HA   4  
ATOM 8265  H HB3  . ASN A 1 119 ? 8.045   6.004   16.035  1.00 0.00 ? 137 ASN A HB3  4  
ATOM 8266  H HD21 . ASN A 1 119 ? 6.559   8.891   15.552  1.00 0.00 ? 137 ASN A HD21 4  
ATOM 8267  H HD22 . ASN A 1 119 ? 7.842   9.955   16.007  1.00 0.00 ? 137 ASN A HD22 4  
ATOM 8268  N N    . ALA A 1 120 ? 8.049   4.179   12.666  1.00 0.00 ? 138 ALA A N    4  
ATOM 8269  C CA   . ALA A 1 120 ? 7.962   2.737   12.469  1.00 0.00 ? 138 ALA A CA   4  
ATOM 8270  C C    . ALA A 1 120 ? 9.339   2.133   12.218  1.00 0.00 ? 138 ALA A C    4  
ATOM 8271  O O    . ALA A 1 120 ? 9.538   1.392   11.254  1.00 0.00 ? 138 ALA A O    4  
ATOM 8272  C CB   . ALA A 1 120 ? 7.024   2.417   11.315  1.00 0.00 ? 138 ALA A CB   4  
ATOM 8273  H H    . ALA A 1 120 ? 7.933   4.774   11.897  1.00 0.00 ? 138 ALA A H    4  
ATOM 8274  H HA   . ALA A 1 120 ? 7.548   2.303   13.368  1.00 0.00 ? 138 ALA A HA   4  
ATOM 8275  H HB1  . ALA A 1 120 ? 6.020   2.723   11.572  1.00 0.00 ? 138 ALA A HB1  4  
ATOM 8276  H HB2  . ALA A 1 120 ? 7.349   2.948   10.431  1.00 0.00 ? 138 ALA A HB2  4  
ATOM 8277  H HB3  . ALA A 1 120 ? 7.041   1.355   11.122  1.00 0.00 ? 138 ALA A HB3  4  
ATOM 8278  N N    . PHE A 1 121 ? 10.289  2.453   13.090  1.00 0.00 ? 139 PHE A N    4  
ATOM 8279  C CA   . PHE A 1 121 ? 11.650  1.943   12.963  1.00 0.00 ? 139 PHE A CA   4  
ATOM 8280  C C    . PHE A 1 121 ? 11.771  0.555   13.584  1.00 0.00 ? 139 PHE A C    4  
ATOM 8281  O O    . PHE A 1 121 ? 12.759  -0.147  13.374  1.00 0.00 ? 139 PHE A O    4  
ATOM 8282  C CB   . PHE A 1 121 ? 12.641  2.900   13.627  1.00 0.00 ? 139 PHE A CB   4  
ATOM 8283  C CG   . PHE A 1 121 ? 12.699  2.763   15.121  1.00 0.00 ? 139 PHE A CG   4  
ATOM 8284  C CD1  . PHE A 1 121 ? 11.752  3.380   15.923  1.00 0.00 ? 139 PHE A CD1  4  
ATOM 8285  C CD2  . PHE A 1 121 ? 13.697  2.014   15.723  1.00 0.00 ? 139 PHE A CD2  4  
ATOM 8286  C CE1  . PHE A 1 121 ? 11.803  3.255   17.300  1.00 0.00 ? 139 PHE A CE1  4  
ATOM 8287  C CE2  . PHE A 1 121 ? 13.753  1.885   17.099  1.00 0.00 ? 139 PHE A CE2  4  
ATOM 8288  C CZ   . PHE A 1 121 ? 12.803  2.505   17.887  1.00 0.00 ? 139 PHE A CZ   4  
ATOM 8289  H H    . PHE A 1 121 ? 10.070  3.048   13.839  1.00 0.00 ? 139 PHE A H    4  
ATOM 8290  H HA   . PHE A 1 121 ? 11.879  1.875   11.909  1.00 0.00 ? 139 PHE A HA   4  
ATOM 8291  H HB3  . PHE A 1 121 ? 12.358  3.916   13.396  1.00 0.00 ? 139 PHE A HB3  4  
ATOM 8292  H HD1  . PHE A 1 121 ? 10.968  3.964   15.465  1.00 0.00 ? 139 PHE A HD1  4  
ATOM 8293  H HD2  . PHE A 1 121 ? 14.441  1.530   15.107  1.00 0.00 ? 139 PHE A HD2  4  
ATOM 8294  H HE1  . PHE A 1 121 ? 11.059  3.740   17.915  1.00 0.00 ? 139 PHE A HE1  4  
ATOM 8295  H HE2  . PHE A 1 121 ? 14.536  1.300   17.554  1.00 0.00 ? 139 PHE A HE2  4  
ATOM 8296  H HZ   . PHE A 1 121 ? 12.846  2.407   18.962  1.00 0.00 ? 139 PHE A HZ   4  
ATOM 8297  N N    . ASP A 1 122 ? 10.758  0.166   14.351  1.00 0.00 ? 140 ASP A N    4  
ATOM 8298  C CA   . ASP A 1 122 ? 10.750  -1.137  15.005  1.00 0.00 ? 140 ASP A CA   4  
ATOM 8299  C C    . ASP A 1 122 ? 11.026  -2.250  13.999  1.00 0.00 ? 140 ASP A C    4  
ATOM 8300  O O    . ASP A 1 122 ? 12.084  -2.880  14.029  1.00 0.00 ? 140 ASP A O    4  
ATOM 8301  C CB   . ASP A 1 122 ? 9.406   -1.378  15.693  1.00 0.00 ? 140 ASP A CB   4  
ATOM 8302  C CG   . ASP A 1 122 ? 9.269   -0.598  16.986  1.00 0.00 ? 140 ASP A CG   4  
ATOM 8303  O OD1  . ASP A 1 122 ? 9.036   0.628   16.919  1.00 0.00 ? 140 ASP A OD1  4  
ATOM 8304  O OD2  . ASP A 1 122 ? 9.395   -1.211  18.065  1.00 0.00 ? 140 ASP A OD2  4  
ATOM 8305  H H    . ASP A 1 122 ? 9.997   0.771   14.481  1.00 0.00 ? 140 ASP A H    4  
ATOM 8306  H HA   . ASP A 1 122 ? 11.531  -1.139  15.749  1.00 0.00 ? 140 ASP A HA   4  
ATOM 8307  H HB3  . ASP A 1 122 ? 9.305   -2.430  15.916  1.00 0.00 ? 140 ASP A HB3  4  
ATOM 8308  N N    . GLY A 1 123 ? 10.068  -2.488  13.109  1.00 0.00 ? 141 GLY A N    4  
ATOM 8309  C CA   . GLY A 1 123 ? 10.226  -3.527  12.107  1.00 0.00 ? 141 GLY A CA   4  
ATOM 8310  C C    . GLY A 1 123 ? 8.955   -3.774  11.320  1.00 0.00 ? 141 GLY A C    4  
ATOM 8311  O O    . GLY A 1 123 ? 8.409   -4.878  11.312  1.00 0.00 ? 141 GLY A O    4  
ATOM 8312  H H    . GLY A 1 123 ? 9.246   -1.955  13.133  1.00 0.00 ? 141 GLY A H    4  
ATOM 8313  H HA2  . GLY A 1 123 ? 11.010  -3.235  11.422  1.00 0.00 ? 141 GLY A HA2  4  
ATOM 8314  H HA3  . GLY A 1 123 ? 10.516  -4.444  12.599  1.00 0.00 ? 141 GLY A HA3  4  
ATOM 8315  N N    . PRO A 1 124 ? 8.461   -2.728  10.642  1.00 0.00 ? 142 PRO A N    4  
ATOM 8316  C CA   . PRO A 1 124 ? 7.239   -2.811  9.838   1.00 0.00 ? 142 PRO A CA   4  
ATOM 8317  C C    . PRO A 1 124 ? 7.425   -3.661  8.586   1.00 0.00 ? 142 PRO A C    4  
ATOM 8318  O O    . PRO A 1 124 ? 8.406   -4.395  8.463   1.00 0.00 ? 142 PRO A O    4  
ATOM 8319  C CB   . PRO A 1 124 ? 6.962   -1.355  9.459   1.00 0.00 ? 142 PRO A CB   4  
ATOM 8320  C CG   . PRO A 1 124 ? 8.294   -0.690  9.513   1.00 0.00 ? 142 PRO A CG   4  
ATOM 8321  C CD   . PRO A 1 124 ? 9.059   -1.383  10.607  1.00 0.00 ? 142 PRO A CD   4  
ATOM 8322  H HA   . PRO A 1 124 ? 6.410   -3.199  10.414  1.00 0.00 ? 142 PRO A HA   4  
ATOM 8323  H HB3  . PRO A 1 124 ? 6.276   -0.918  10.169  1.00 0.00 ? 142 PRO A HB3  4  
ATOM 8324  H HG3  . PRO A 1 124 ? 8.173   0.357   9.746   1.00 0.00 ? 142 PRO A HG3  4  
ATOM 8325  H HD3  . PRO A 1 124 ? 8.916   -0.873  11.549  1.00 0.00 ? 142 PRO A HD3  4  
ATOM 8326  N N    . ILE A 1 125 ? 6.479   -3.557  7.659   1.00 0.00 ? 143 ILE A N    4  
ATOM 8327  C CA   . ILE A 1 125 ? 6.541   -4.316  6.416   1.00 0.00 ? 143 ILE A CA   4  
ATOM 8328  C C    . ILE A 1 125 ? 7.497   -3.662  5.421   1.00 0.00 ? 143 ILE A C    4  
ATOM 8329  O O    . ILE A 1 125 ? 7.786   -2.469  5.512   1.00 0.00 ? 143 ILE A O    4  
ATOM 8330  C CB   . ILE A 1 125 ? 5.152   -4.444  5.764   1.00 0.00 ? 143 ILE A CB   4  
ATOM 8331  C CG1  . ILE A 1 125 ? 4.102   -4.807  6.818   1.00 0.00 ? 143 ILE A CG1  4  
ATOM 8332  C CG2  . ILE A 1 125 ? 5.181   -5.487  4.657   1.00 0.00 ? 143 ILE A CG2  4  
ATOM 8333  C CD1  . ILE A 1 125 ? 3.235   -3.640  7.234   1.00 0.00 ? 143 ILE A CD1  4  
ATOM 8334  H H    . ILE A 1 125 ? 5.721   -2.956  7.814   1.00 0.00 ? 143 ILE A H    4  
ATOM 8335  H HA   . ILE A 1 125 ? 6.902   -5.307  6.647   1.00 0.00 ? 143 ILE A HA   4  
ATOM 8336  H HB   . ILE A 1 125 ? 4.895   -3.494  5.324   1.00 0.00 ? 143 ILE A HB   4  
ATOM 8337  H HG13 . ILE A 1 125 ? 4.604   -5.180  7.700   1.00 0.00 ? 143 ILE A HG13 4  
ATOM 8338  H HG21 . ILE A 1 125 ? 4.173   -5.822  4.451   1.00 0.00 ? 143 ILE A HG21 4  
ATOM 8339  H HG22 . ILE A 1 125 ? 5.604   -5.053  3.765   1.00 0.00 ? 143 ILE A HG22 4  
ATOM 8340  H HG23 . ILE A 1 125 ? 5.782   -6.329  4.969   1.00 0.00 ? 143 ILE A HG23 4  
ATOM 8341  H HD11 . ILE A 1 125 ? 2.250   -3.754  6.807   1.00 0.00 ? 143 ILE A HD11 4  
ATOM 8342  H HD12 . ILE A 1 125 ? 3.162   -3.611  8.311   1.00 0.00 ? 143 ILE A HD12 4  
ATOM 8343  H HD13 . ILE A 1 125 ? 3.676   -2.719  6.878   1.00 0.00 ? 143 ILE A HD13 4  
ATOM 8344  N N    . THR A 1 126 ? 7.983   -4.453  4.470   1.00 0.00 ? 144 THR A N    4  
ATOM 8345  C CA   . THR A 1 126 ? 8.905   -3.954  3.459   1.00 0.00 ? 144 THR A CA   4  
ATOM 8346  C C    . THR A 1 126 ? 8.154   -3.283  2.313   1.00 0.00 ? 144 THR A C    4  
ATOM 8347  O O    . THR A 1 126 ? 7.249   -3.873  1.722   1.00 0.00 ? 144 THR A O    4  
ATOM 8348  C CB   . THR A 1 126 ? 9.782   -5.085  2.889   1.00 0.00 ? 144 THR A CB   4  
ATOM 8349  O OG1  . THR A 1 126 ? 10.120  -6.012  3.927   1.00 0.00 ? 144 THR A OG1  4  
ATOM 8350  C CG2  . THR A 1 126 ? 11.052  -4.525  2.268   1.00 0.00 ? 144 THR A CG2  4  
ATOM 8351  H H    . THR A 1 126 ? 7.716   -5.395  4.450   1.00 0.00 ? 144 THR A H    4  
ATOM 8352  H HA   . THR A 1 126 ? 9.551   -3.227  3.925   1.00 0.00 ? 144 THR A HA   4  
ATOM 8353  H HB   . THR A 1 126 ? 9.222   -5.602  2.123   1.00 0.00 ? 144 THR A HB   4  
ATOM 8354  H HG1  . THR A 1 126 ? 9.519   -6.761  3.895   1.00 0.00 ? 144 THR A HG1  4  
ATOM 8355  H HG21 . THR A 1 126 ? 11.794  -4.376  3.039   1.00 0.00 ? 144 THR A HG21 4  
ATOM 8356  H HG22 . THR A 1 126 ? 10.835  -3.582  1.789   1.00 0.00 ? 144 THR A HG22 4  
ATOM 8357  H HG23 . THR A 1 126 ? 11.432  -5.222  1.536   1.00 0.00 ? 144 THR A HG23 4  
ATOM 8358  N N    . ILE A 1 127 ? 8.536   -2.048  2.005   1.00 0.00 ? 145 ILE A N    4  
ATOM 8359  C CA   . ILE A 1 127 ? 7.899   -1.300  0.929   1.00 0.00 ? 145 ILE A CA   4  
ATOM 8360  C C    . ILE A 1 127 ? 8.932   -0.777  -0.064  1.00 0.00 ? 145 ILE A C    4  
ATOM 8361  O O    . ILE A 1 127 ? 10.078  -0.511  0.298   1.00 0.00 ? 145 ILE A O    4  
ATOM 8362  C CB   . ILE A 1 127 ? 7.083   -0.113  1.474   1.00 0.00 ? 145 ILE A CB   4  
ATOM 8363  C CG1  . ILE A 1 127 ? 7.942   0.736   2.413   1.00 0.00 ? 145 ILE A CG1  4  
ATOM 8364  C CG2  . ILE A 1 127 ? 5.838   -0.612  2.195   1.00 0.00 ? 145 ILE A CG2  4  
ATOM 8365  C CD1  . ILE A 1 127 ? 8.066   2.180   1.979   1.00 0.00 ? 145 ILE A CD1  4  
ATOM 8366  H H    . ILE A 1 127 ? 9.263   -1.632  2.512   1.00 0.00 ? 145 ILE A H    4  
ATOM 8367  H HA   . ILE A 1 127 ? 7.224   -1.967  0.412   1.00 0.00 ? 145 ILE A HA   4  
ATOM 8368  H HB   . ILE A 1 127 ? 6.767   0.494   0.640   1.00 0.00 ? 145 ILE A HB   4  
ATOM 8369  H HG13 . ILE A 1 127 ? 8.937   0.315   2.457   1.00 0.00 ? 145 ILE A HG13 4  
ATOM 8370  H HG21 . ILE A 1 127 ? 5.568   0.086   2.972   1.00 0.00 ? 145 ILE A HG21 4  
ATOM 8371  H HG22 . ILE A 1 127 ? 5.025   -0.698  1.489   1.00 0.00 ? 145 ILE A HG22 4  
ATOM 8372  H HG23 . ILE A 1 127 ? 6.038   -1.579  2.631   1.00 0.00 ? 145 ILE A HG23 4  
ATOM 8373  H HD11 . ILE A 1 127 ? 8.961   2.303   1.387   1.00 0.00 ? 145 ILE A HD11 4  
ATOM 8374  H HD12 . ILE A 1 127 ? 7.204   2.455   1.391   1.00 0.00 ? 145 ILE A HD12 4  
ATOM 8375  H HD13 . ILE A 1 127 ? 8.123   2.814   2.852   1.00 0.00 ? 145 ILE A HD13 4  
ATOM 8376  N N    . THR A 1 128 ? 8.518   -0.630  -1.319  1.00 0.00 ? 146 THR A N    4  
ATOM 8377  C CA   . THR A 1 128 ? 9.406   -0.139  -2.364  1.00 0.00 ? 146 THR A CA   4  
ATOM 8378  C C    . THR A 1 128 ? 8.761   1.002   -3.142  1.00 0.00 ? 146 THR A C    4  
ATOM 8379  O O    . THR A 1 128 ? 7.954   0.775   -4.042  1.00 0.00 ? 146 THR A O    4  
ATOM 8380  C CB   . THR A 1 128 ? 9.792   -1.261  -3.347  1.00 0.00 ? 146 THR A CB   4  
ATOM 8381  O OG1  . THR A 1 128 ? 10.317  -2.383  -2.628  1.00 0.00 ? 146 THR A OG1  4  
ATOM 8382  C CG2  . THR A 1 128 ? 10.821  -0.769  -4.353  1.00 0.00 ? 146 THR A CG2  4  
ATOM 8383  H H    . THR A 1 128 ? 7.592   -0.860  -1.546  1.00 0.00 ? 146 THR A H    4  
ATOM 8384  H HA   . THR A 1 128 ? 10.308  0.223   -1.893  1.00 0.00 ? 146 THR A HA   4  
ATOM 8385  H HB   . THR A 1 128 ? 8.905   -1.569  -3.883  1.00 0.00 ? 146 THR A HB   4  
ATOM 8386  H HG1  . THR A 1 128 ? 9.673   -2.677  -1.979  1.00 0.00 ? 146 THR A HG1  4  
ATOM 8387  H HG21 . THR A 1 128 ? 10.452  -0.932  -5.355  1.00 0.00 ? 146 THR A HG21 4  
ATOM 8388  H HG22 . THR A 1 128 ? 11.745  -1.311  -4.217  1.00 0.00 ? 146 THR A HG22 4  
ATOM 8389  H HG23 . THR A 1 128 ? 10.997  0.286   -4.202  1.00 0.00 ? 146 THR A HG23 4  
ATOM 8390  N N    . ILE A 1 129 ? 9.125   2.232   -2.789  1.00 0.00 ? 147 ILE A N    4  
ATOM 8391  C CA   . ILE A 1 129 ? 8.583   3.409   -3.455  1.00 0.00 ? 147 ILE A CA   4  
ATOM 8392  C C    . ILE A 1 129 ? 9.335   3.703   -4.750  1.00 0.00 ? 147 ILE A C    4  
ATOM 8393  O O    . ILE A 1 129 ? 10.498  3.331   -4.901  1.00 0.00 ? 147 ILE A O    4  
ATOM 8394  C CB   . ILE A 1 129 ? 8.644   4.650   -2.545  1.00 0.00 ? 147 ILE A CB   4  
ATOM 8395  C CG1  . ILE A 1 129 ? 7.812   5.788   -3.142  1.00 0.00 ? 147 ILE A CG1  4  
ATOM 8396  C CG2  . ILE A 1 129 ? 10.086  5.089   -2.345  1.00 0.00 ? 147 ILE A CG2  4  
ATOM 8397  C CD1  . ILE A 1 129 ? 7.152   6.663   -2.099  1.00 0.00 ? 147 ILE A CD1  4  
ATOM 8398  H H    . ILE A 1 129 ? 9.773   2.349   -2.063  1.00 0.00 ? 147 ILE A H    4  
ATOM 8399  H HA   . ILE A 1 129 ? 7.547   3.210   -3.691  1.00 0.00 ? 147 ILE A HA   4  
ATOM 8400  H HB   . ILE A 1 129 ? 8.238   4.382   -1.581  1.00 0.00 ? 147 ILE A HB   4  
ATOM 8401  H HG13 . ILE A 1 129 ? 7.035   5.369   -3.763  1.00 0.00 ? 147 ILE A HG13 4  
ATOM 8402  H HG21 . ILE A 1 129 ? 10.749  4.364   -2.794  1.00 0.00 ? 147 ILE A HG21 4  
ATOM 8403  H HG22 . ILE A 1 129 ? 10.237  6.051   -2.810  1.00 0.00 ? 147 ILE A HG22 4  
ATOM 8404  H HG23 . ILE A 1 129 ? 10.298  5.163   -1.289  1.00 0.00 ? 147 ILE A HG23 4  
ATOM 8405  H HD11 . ILE A 1 129 ? 6.363   6.110   -1.611  1.00 0.00 ? 147 ILE A HD11 4  
ATOM 8406  H HD12 . ILE A 1 129 ? 7.886   6.969   -1.367  1.00 0.00 ? 147 ILE A HD12 4  
ATOM 8407  H HD13 . ILE A 1 129 ? 6.735   7.538   -2.576  1.00 0.00 ? 147 ILE A HD13 4  
ATOM 8408  N N    . VAL A 1 130 ? 8.663   4.377   -5.677  1.00 0.00 ? 148 VAL A N    4  
ATOM 8409  C CA   . VAL A 1 130 ? 9.270   4.725   -6.958  1.00 0.00 ? 148 VAL A CA   4  
ATOM 8410  C C    . VAL A 1 130 ? 10.169  5.948   -6.824  1.00 0.00 ? 148 VAL A C    4  
ATOM 8411  O O    . VAL A 1 130 ? 9.815   6.923   -6.163  1.00 0.00 ? 148 VAL A O    4  
ATOM 8412  C CB   . VAL A 1 130 ? 8.197   5.004   -8.028  1.00 0.00 ? 148 VAL A CB   4  
ATOM 8413  C CG1  . VAL A 1 130 ? 8.848   5.407   -9.342  1.00 0.00 ? 148 VAL A CG1  4  
ATOM 8414  C CG2  . VAL A 1 130 ? 7.305   3.787   -8.217  1.00 0.00 ? 148 VAL A CG2  4  
ATOM 8415  H H    . VAL A 1 130 ? 7.738   4.647   -5.497  1.00 0.00 ? 148 VAL A H    4  
ATOM 8416  H HA   . VAL A 1 130 ? 9.865   3.886   -7.284  1.00 0.00 ? 148 VAL A HA   4  
ATOM 8417  H HB   . VAL A 1 130 ? 7.584   5.825   -7.689  1.00 0.00 ? 148 VAL A HB   4  
ATOM 8418  H HG11 . VAL A 1 130 ? 8.081   5.624   -10.072 1.00 0.00 ? 148 VAL A HG11 4  
ATOM 8419  H HG12 . VAL A 1 130 ? 9.459   6.284   -9.189  1.00 0.00 ? 148 VAL A HG12 4  
ATOM 8420  H HG13 . VAL A 1 130 ? 9.466   4.597   -9.701  1.00 0.00 ? 148 VAL A HG13 4  
ATOM 8421  H HG21 . VAL A 1 130 ? 6.366   4.095   -8.653  1.00 0.00 ? 148 VAL A HG21 4  
ATOM 8422  H HG22 . VAL A 1 130 ? 7.793   3.080   -8.873  1.00 0.00 ? 148 VAL A HG22 4  
ATOM 8423  H HG23 . VAL A 1 130 ? 7.122   3.322   -7.260  1.00 0.00 ? 148 VAL A HG23 4  
ATOM 8424  N N    . ASN A 1 131 ? 11.336  5.888   -7.460  1.00 0.00 ? 149 ASN A N    4  
ATOM 8425  C CA   . ASN A 1 131 ? 12.289  6.992   -7.411  1.00 0.00 ? 149 ASN A CA   4  
ATOM 8426  C C    . ASN A 1 131 ? 11.654  8.282   -7.925  1.00 0.00 ? 149 ASN A C    4  
ATOM 8427  O O    . ASN A 1 131 ? 10.512  8.283   -8.385  1.00 0.00 ? 149 ASN A O    4  
ATOM 8428  C CB   . ASN A 1 131 ? 13.530  6.658   -8.242  1.00 0.00 ? 149 ASN A CB   4  
ATOM 8429  C CG   . ASN A 1 131 ? 14.772  7.363   -7.733  1.00 0.00 ? 149 ASN A CG   4  
ATOM 8430  O OD1  . ASN A 1 131 ? 15.253  8.315   -8.348  1.00 0.00 ? 149 ASN A OD1  4  
ATOM 8431  N ND2  . ASN A 1 131 ? 15.298  6.897   -6.606  1.00 0.00 ? 149 ASN A ND2  4  
ATOM 8432  H H    . ASN A 1 131 ? 11.563  5.084   -7.971  1.00 0.00 ? 149 ASN A H    4  
ATOM 8433  H HA   . ASN A 1 131 ? 12.581  7.133   -6.382  1.00 0.00 ? 149 ASN A HA   4  
ATOM 8434  H HB3  . ASN A 1 131 ? 13.363  6.955   -9.266  1.00 0.00 ? 149 ASN A HB3  4  
ATOM 8435  H HD21 . ASN A 1 131 ? 14.860  6.136   -6.171  1.00 0.00 ? 149 ASN A HD21 4  
ATOM 8436  H HD22 . ASN A 1 131 ? 16.101  7.336   -6.254  1.00 0.00 ? 149 ASN A HD22 4  
ATOM 8437  N N    . ARG A 1 132 ? 12.401  9.378   -7.840  1.00 0.00 ? 150 ARG A N    4  
ATOM 8438  C CA   . ARG A 1 132 ? 11.911  10.672  -8.294  1.00 0.00 ? 150 ARG A CA   4  
ATOM 8439  C C    . ARG A 1 132 ? 11.953  10.767  -9.817  1.00 0.00 ? 150 ARG A C    4  
ATOM 8440  O O    . ARG A 1 132 ? 11.426  11.712  -10.405 1.00 0.00 ? 150 ARG A O    4  
ATOM 8441  C CB   . ARG A 1 132 ? 12.744  11.800  -7.680  1.00 0.00 ? 150 ARG A CB   4  
ATOM 8442  C CG   . ARG A 1 132 ? 14.238  11.643  -7.901  1.00 0.00 ? 150 ARG A CG   4  
ATOM 8443  C CD   . ARG A 1 132 ? 15.003  12.869  -7.430  1.00 0.00 ? 150 ARG A CD   4  
ATOM 8444  N NE   . ARG A 1 132 ? 15.078  12.941  -5.972  1.00 0.00 ? 150 ARG A NE   4  
ATOM 8445  C CZ   . ARG A 1 132 ? 15.870  13.782  -5.318  1.00 0.00 ? 150 ARG A CZ   4  
ATOM 8446  N NH1  . ARG A 1 132 ? 16.652  14.619  -5.986  1.00 0.00 ? 150 ARG A NH1  4  
ATOM 8447  N NH2  . ARG A 1 132 ? 15.881  13.788  -3.991  1.00 0.00 ? 150 ARG A NH2  4  
ATOM 8448  H H    . ARG A 1 132 ? 13.304  9.312   -7.463  1.00 0.00 ? 150 ARG A H    4  
ATOM 8449  H HA   . ARG A 1 132 ? 10.887  10.774  -7.967  1.00 0.00 ? 150 ARG A HA   4  
ATOM 8450  H HB3  . ARG A 1 132 ? 12.560  11.828  -6.616  1.00 0.00 ? 150 ARG A HB3  4  
ATOM 8451  H HG3  . ARG A 1 132 ? 14.423  11.498  -8.956  1.00 0.00 ? 150 ARG A HG3  4  
ATOM 8452  H HD3  . ARG A 1 132 ? 14.504  13.753  -7.800  1.00 0.00 ? 150 ARG A HD3  4  
ATOM 8453  H HE   . ARG A 1 132 ? 14.509  12.332  -5.459  1.00 0.00 ? 150 ARG A HE   4  
ATOM 8454  H HH11 . ARG A 1 132 ? 16.644  14.617  -6.986  1.00 0.00 ? 150 ARG A HH11 4  
ATOM 8455  H HH12 . ARG A 1 132 ? 17.246  15.252  -5.490  1.00 0.00 ? 150 ARG A HH12 4  
ATOM 8456  H HH21 . ARG A 1 132 ? 15.292  13.160  -3.484  1.00 0.00 ? 150 ARG A HH21 4  
ATOM 8457  H HH22 . ARG A 1 132 ? 16.478  14.421  -3.498  1.00 0.00 ? 150 ARG A HH22 4  
ATOM 8458  N N    . ASP A 1 133 ? 12.580  9.781   -10.447 1.00 0.00 ? 151 ASP A N    4  
ATOM 8459  C CA   . ASP A 1 133 ? 12.690  9.751   -11.902 1.00 0.00 ? 151 ASP A CA   4  
ATOM 8460  C C    . ASP A 1 133 ? 11.561  8.931   -12.516 1.00 0.00 ? 151 ASP A C    4  
ATOM 8461  O O    . ASP A 1 133 ? 11.660  8.472   -13.652 1.00 0.00 ? 151 ASP A O    4  
ATOM 8462  C CB   . ASP A 1 133 ? 14.043  9.173   -12.322 1.00 0.00 ? 151 ASP A CB   4  
ATOM 8463  C CG   . ASP A 1 133 ? 15.182  10.147  -12.096 1.00 0.00 ? 151 ASP A CG   4  
ATOM 8464  O OD1  . ASP A 1 133 ? 15.173  11.227  -12.723 1.00 0.00 ? 151 ASP A OD1  4  
ATOM 8465  O OD2  . ASP A 1 133 ? 16.087  9.830   -11.294 1.00 0.00 ? 151 ASP A OD2  4  
ATOM 8466  H H    . ASP A 1 133 ? 12.978  9.055   -9.923  1.00 0.00 ? 151 ASP A H    4  
ATOM 8467  H HA   . ASP A 1 133 ? 12.615  10.766  -12.260 1.00 0.00 ? 151 ASP A HA   4  
ATOM 8468  H HB3  . ASP A 1 133 ? 14.009  8.922   -13.371 1.00 0.00 ? 151 ASP A HB3  4  
ATOM 8469  N N    . GLY A 1 134 ? 10.486  8.748   -11.753 1.00 0.00 ? 152 GLY A N    4  
ATOM 8470  C CA   . GLY A 1 134 ? 9.353   7.982   -12.239 1.00 0.00 ? 152 GLY A CA   4  
ATOM 8471  C C    . GLY A 1 134 ? 9.758   6.621   -12.769 1.00 0.00 ? 152 GLY A C    4  
ATOM 8472  O O    . GLY A 1 134 ? 9.096   6.064   -13.643 1.00 0.00 ? 152 GLY A O    4  
ATOM 8473  H H    . GLY A 1 134 ? 10.463  9.138   -10.855 1.00 0.00 ? 152 GLY A H    4  
ATOM 8474  H HA2  . GLY A 1 134 ? 8.651   7.847   -11.431 1.00 0.00 ? 152 GLY A HA2  4  
ATOM 8475  H HA3  . GLY A 1 134 ? 8.872   8.535   -13.032 1.00 0.00 ? 152 GLY A HA3  4  
ATOM 8476  N N    . THR A 1 135 ? 10.853  6.083   -12.239 1.00 0.00 ? 153 THR A N    4  
ATOM 8477  C CA   . THR A 1 135 ? 11.347  4.779   -12.665 1.00 0.00 ? 153 THR A CA   4  
ATOM 8478  C C    . THR A 1 135 ? 10.316  3.688   -12.408 1.00 0.00 ? 153 THR A C    4  
ATOM 8479  O O    . THR A 1 135 ? 9.186   3.972   -12.006 1.00 0.00 ? 153 THR A O    4  
ATOM 8480  C CB   . THR A 1 135 ? 12.657  4.412   -11.944 1.00 0.00 ? 153 THR A CB   4  
ATOM 8481  O OG1  . THR A 1 135 ? 13.274  3.290   -12.585 1.00 0.00 ? 153 THR A OG1  4  
ATOM 8482  C CG2  . THR A 1 135 ? 12.397  4.086   -10.481 1.00 0.00 ? 153 THR A CG2  4  
ATOM 8483  H H    . THR A 1 135 ? 11.338  6.576   -11.545 1.00 0.00 ? 153 THR A H    4  
ATOM 8484  H HA   . THR A 1 135 ? 11.548  4.830   -13.725 1.00 0.00 ? 153 THR A HA   4  
ATOM 8485  H HB   . THR A 1 135 ? 13.327  5.259   -11.993 1.00 0.00 ? 153 THR A HB   4  
ATOM 8486  H HG1  . THR A 1 135 ? 14.092  3.568   -13.002 1.00 0.00 ? 153 THR A HG1  4  
ATOM 8487  H HG21 . THR A 1 135 ? 11.365  4.299   -10.242 1.00 0.00 ? 153 THR A HG21 4  
ATOM 8488  H HG22 . THR A 1 135 ? 13.041  4.687   -9.858  1.00 0.00 ? 153 THR A HG22 4  
ATOM 8489  H HG23 . THR A 1 135 ? 12.598  3.040   -10.305 1.00 0.00 ? 153 THR A HG23 4  
ATOM 8490  N N    . ARG A 1 136 ? 10.710  2.441   -12.640 1.00 0.00 ? 154 ARG A N    4  
ATOM 8491  C CA   . ARG A 1 136 ? 9.818   1.307   -12.432 1.00 0.00 ? 154 ARG A CA   4  
ATOM 8492  C C    . ARG A 1 136 ? 10.386  0.351   -11.388 1.00 0.00 ? 154 ARG A C    4  
ATOM 8493  O O    . ARG A 1 136 ? 10.282  -0.869  -11.523 1.00 0.00 ? 154 ARG A O    4  
ATOM 8494  C CB   . ARG A 1 136 ? 9.591   0.562   -13.749 1.00 0.00 ? 154 ARG A CB   4  
ATOM 8495  C CG   . ARG A 1 136 ? 10.846  0.424   -14.596 1.00 0.00 ? 154 ARG A CG   4  
ATOM 8496  C CD   . ARG A 1 136 ? 11.789  -0.625  -14.026 1.00 0.00 ? 154 ARG A CD   4  
ATOM 8497  N NE   . ARG A 1 136 ? 12.743  -0.050  -13.081 1.00 0.00 ? 154 ARG A NE   4  
ATOM 8498  C CZ   . ARG A 1 136 ? 13.382  -0.758  -12.158 1.00 0.00 ? 154 ARG A CZ   4  
ATOM 8499  N NH1  . ARG A 1 136 ? 13.171  -2.063  -12.055 1.00 0.00 ? 154 ARG A NH1  4  
ATOM 8500  N NH2  . ARG A 1 136 ? 14.235  -0.161  -11.334 1.00 0.00 ? 154 ARG A NH2  4  
ATOM 8501  H H    . ARG A 1 136 ? 11.623  2.279   -12.960 1.00 0.00 ? 154 ARG A H    4  
ATOM 8502  H HA   . ARG A 1 136 ? 8.872   1.688   -12.079 1.00 0.00 ? 154 ARG A HA   4  
ATOM 8503  H HB3  . ARG A 1 136 ? 8.851   1.094   -14.328 1.00 0.00 ? 154 ARG A HB3  4  
ATOM 8504  H HG3  . ARG A 1 136 ? 11.356  1.375   -14.624 1.00 0.00 ? 154 ARG A HG3  4  
ATOM 8505  H HD3  . ARG A 1 136 ? 12.335  -1.080  -14.840 1.00 0.00 ? 154 ARG A HD3  4  
ATOM 8506  H HE   . ARG A 1 136 ? 12.914  0.914   -13.139 1.00 0.00 ? 154 ARG A HE   4  
ATOM 8507  H HH11 . ARG A 1 136 ? 12.529  -2.515  -12.675 1.00 0.00 ? 154 ARG A HH11 4  
ATOM 8508  H HH12 . ARG A 1 136 ? 13.653  -2.594  -11.360 1.00 0.00 ? 154 ARG A HH12 4  
ATOM 8509  H HH21 . ARG A 1 136 ? 14.396  0.821   -11.409 1.00 0.00 ? 154 ARG A HH21 4  
ATOM 8510  H HH22 . ARG A 1 136 ? 14.715  -0.696  -10.639 1.00 0.00 ? 154 ARG A HH22 4  
ATOM 8511  N N    . TYR A 1 137 ? 10.988  0.913   -10.346 1.00 0.00 ? 155 TYR A N    4  
ATOM 8512  C CA   . TYR A 1 137 ? 11.576  0.112   -9.278  1.00 0.00 ? 155 TYR A CA   4  
ATOM 8513  C C    . TYR A 1 137 ? 10.493  -0.604  -8.475  1.00 0.00 ? 155 TYR A C    4  
ATOM 8514  O O    . TYR A 1 137 ? 10.028  -0.101  -7.453  1.00 0.00 ? 155 TYR A O    4  
ATOM 8515  C CB   . TYR A 1 137 ? 12.413  0.995   -8.352  1.00 0.00 ? 155 TYR A CB   4  
ATOM 8516  C CG   . TYR A 1 137 ? 13.176  0.219   -7.301  1.00 0.00 ? 155 TYR A CG   4  
ATOM 8517  C CD1  . TYR A 1 137 ? 13.845  -0.954  -7.626  1.00 0.00 ? 155 TYR A CD1  4  
ATOM 8518  C CD2  . TYR A 1 137 ? 13.227  0.660   -5.985  1.00 0.00 ? 155 TYR A CD2  4  
ATOM 8519  C CE1  . TYR A 1 137 ? 14.542  -1.667  -6.669  1.00 0.00 ? 155 TYR A CE1  4  
ATOM 8520  C CE2  . TYR A 1 137 ? 13.922  -0.046  -5.022  1.00 0.00 ? 155 TYR A CE2  4  
ATOM 8521  C CZ   . TYR A 1 137 ? 14.577  -1.208  -5.369  1.00 0.00 ? 155 TYR A CZ   4  
ATOM 8522  O OH   . TYR A 1 137 ? 15.273  -1.915  -4.414  1.00 0.00 ? 155 TYR A OH   4  
ATOM 8523  H H    . TYR A 1 137 ? 11.039  1.890   -10.292 1.00 0.00 ? 155 TYR A H    4  
ATOM 8524  H HA   . TYR A 1 137 ? 12.219  -0.626  -9.733  1.00 0.00 ? 155 TYR A HA   4  
ATOM 8525  H HB3  . TYR A 1 137 ? 11.762  1.691   -7.843  1.00 0.00 ? 155 TYR A HB3  4  
ATOM 8526  H HD1  . TYR A 1 137 ? 13.814  -1.310  -8.645  1.00 0.00 ? 155 TYR A HD1  4  
ATOM 8527  H HD2  . TYR A 1 137 ? 12.713  1.570   -5.716  1.00 0.00 ? 155 TYR A HD2  4  
ATOM 8528  H HE1  . TYR A 1 137 ? 15.056  -2.578  -6.942  1.00 0.00 ? 155 TYR A HE1  4  
ATOM 8529  H HE2  . TYR A 1 137 ? 13.950  0.312   -4.003  1.00 0.00 ? 155 TYR A HE2  4  
ATOM 8530  H HH   . TYR A 1 137 ? 15.733  -2.648  -4.830  1.00 0.00 ? 155 TYR A HH   4  
ATOM 8531  N N    . VAL A 1 138 ? 10.099  -1.783  -8.947  1.00 0.00 ? 156 VAL A N    4  
ATOM 8532  C CA   . VAL A 1 138 ? 9.074   -2.570  -8.273  1.00 0.00 ? 156 VAL A CA   4  
ATOM 8533  C C    . VAL A 1 138 ? 9.285   -4.062  -8.507  1.00 0.00 ? 156 VAL A C    4  
ATOM 8534  O O    . VAL A 1 138 ? 10.234  -4.466  -9.178  1.00 0.00 ? 156 VAL A O    4  
ATOM 8535  C CB   . VAL A 1 138 ? 7.662   -2.182  -8.752  1.00 0.00 ? 156 VAL A CB   4  
ATOM 8536  C CG1  . VAL A 1 138 ? 7.232   -0.862  -8.131  1.00 0.00 ? 156 VAL A CG1  4  
ATOM 8537  C CG2  . VAL A 1 138 ? 7.618   -2.104  -10.271 1.00 0.00 ? 156 VAL A CG2  4  
ATOM 8538  H H    . VAL A 1 138 ? 10.508  -2.131  -9.766  1.00 0.00 ? 156 VAL A H    4  
ATOM 8539  H HA   . VAL A 1 138 ? 9.140   -2.369  -7.214  1.00 0.00 ? 156 VAL A HA   4  
ATOM 8540  H HB   . VAL A 1 138 ? 6.972   -2.948  -8.431  1.00 0.00 ? 156 VAL A HB   4  
ATOM 8541  H HG11 . VAL A 1 138 ? 7.737   -0.728  -7.186  1.00 0.00 ? 156 VAL A HG11 4  
ATOM 8542  H HG12 . VAL A 1 138 ? 7.488   -0.050  -8.796  1.00 0.00 ? 156 VAL A HG12 4  
ATOM 8543  H HG13 . VAL A 1 138 ? 6.164   -0.872  -7.969  1.00 0.00 ? 156 VAL A HG13 4  
ATOM 8544  H HG21 . VAL A 1 138 ? 8.420   -2.699  -10.684 1.00 0.00 ? 156 VAL A HG21 4  
ATOM 8545  H HG22 . VAL A 1 138 ? 6.671   -2.484  -10.623 1.00 0.00 ? 156 VAL A HG22 4  
ATOM 8546  H HG23 . VAL A 1 138 ? 7.733   -1.079  -10.584 1.00 0.00 ? 156 VAL A HG23 4  
ATOM 8547  N N    . GLN A 1 139 ? 8.395   -4.876  -7.948  1.00 0.00 ? 157 GLN A N    4  
ATOM 8548  C CA   . GLN A 1 139 ? 8.485   -6.324  -8.096  1.00 0.00 ? 157 GLN A CA   4  
ATOM 8549  C C    . GLN A 1 139 ? 7.823   -6.780  -9.391  1.00 0.00 ? 157 GLN A C    4  
ATOM 8550  O O    . GLN A 1 139 ? 8.321   -7.676  -10.074 1.00 0.00 ? 157 GLN A O    4  
ATOM 8551  C CB   . GLN A 1 139 ? 7.831   -7.021  -6.902  1.00 0.00 ? 157 GLN A CB   4  
ATOM 8552  C CG   . GLN A 1 139 ? 8.655   -6.947  -5.627  1.00 0.00 ? 157 GLN A CG   4  
ATOM 8553  C CD   . GLN A 1 139 ? 9.978   -7.678  -5.746  1.00 0.00 ? 157 GLN A CD   4  
ATOM 8554  O OE1  . GLN A 1 139 ? 10.078  -8.862  -5.427  1.00 0.00 ? 157 GLN A OE1  4  
ATOM 8555  N NE2  . GLN A 1 139 ? 11.004  -6.974  -6.210  1.00 0.00 ? 157 GLN A NE2  4  
ATOM 8556  H H    . GLN A 1 139 ? 7.659   -4.492  -7.424  1.00 0.00 ? 157 GLN A H    4  
ATOM 8557  H HA   . GLN A 1 139 ? 9.530   -6.589  -8.127  1.00 0.00 ? 157 GLN A HA   4  
ATOM 8558  H HB3  . GLN A 1 139 ? 7.677   -8.060  -7.146  1.00 0.00 ? 157 GLN A HB3  4  
ATOM 8559  H HG3  . GLN A 1 139 ? 8.088   -7.389  -4.820  1.00 0.00 ? 157 GLN A HG3  4  
ATOM 8560  H HE21 . GLN A 1 139 ? 10.851  -6.033  -6.444  1.00 0.00 ? 157 GLN A HE21 4  
ATOM 8561  H HE22 . GLN A 1 139 ? 11.871  -7.420  -6.297  1.00 0.00 ? 157 GLN A HE22 4  
ATOM 8562  N N    . LYS A 1 140 ? 6.696   -6.160  -9.726  1.00 0.00 ? 158 LYS A N    4  
ATOM 8563  C CA   . LYS A 1 140 ? 5.965   -6.501  -10.940 1.00 0.00 ? 158 LYS A CA   4  
ATOM 8564  C C    . LYS A 1 140 ? 6.172   -5.440  -12.016 1.00 0.00 ? 158 LYS A C    4  
ATOM 8565  O O    . LYS A 1 140 ? 6.873   -4.451  -11.800 1.00 0.00 ? 158 LYS A O    4  
ATOM 8566  C CB   . LYS A 1 140 ? 4.473   -6.651  -10.637 1.00 0.00 ? 158 LYS A CB   4  
ATOM 8567  C CG   . LYS A 1 140 ? 4.056   -8.077  -10.324 1.00 0.00 ? 158 LYS A CG   4  
ATOM 8568  C CD   . LYS A 1 140 ? 2.638   -8.358  -10.791 1.00 0.00 ? 158 LYS A CD   4  
ATOM 8569  C CE   . LYS A 1 140 ? 2.463   -9.814  -11.199 1.00 0.00 ? 158 LYS A CE   4  
ATOM 8570  N NZ   . LYS A 1 140 ? 2.929   -10.747 -10.135 1.00 0.00 ? 158 LYS A NZ   4  
ATOM 8571  H H    . LYS A 1 140 ? 6.349   -5.453  -9.141  1.00 0.00 ? 158 LYS A H    4  
ATOM 8572  H HA   . LYS A 1 140 ? 6.347   -7.444  -11.304 1.00 0.00 ? 158 LYS A HA   4  
ATOM 8573  H HB3  . LYS A 1 140 ? 3.908   -6.313  -11.495 1.00 0.00 ? 158 LYS A HB3  4  
ATOM 8574  H HG3  . LYS A 1 140 ? 4.113   -8.234  -9.257  1.00 0.00 ? 158 LYS A HG3  4  
ATOM 8575  H HD3  . LYS A 1 140 ? 2.414   -7.726  -11.638 1.00 0.00 ? 158 LYS A HD3  4  
ATOM 8576  H HE3  . LYS A 1 140 ? 3.032   -9.992  -12.098 1.00 0.00 ? 158 LYS A HE3  4  
ATOM 8577  H HZ1  . LYS A 1 140 ? 2.599   -10.421 -9.204  1.00 0.00 ? 158 LYS A HZ1  4  
ATOM 8578  H HZ2  . LYS A 1 140 ? 3.969   -10.790 -10.127 1.00 0.00 ? 158 LYS A HZ2  4  
ATOM 8579  H HZ3  . LYS A 1 140 ? 2.556   -11.702 -10.309 1.00 0.00 ? 158 LYS A HZ3  4  
ATOM 8580  N N    . GLY A 1 141 ? 5.558   -5.651  -13.176 1.00 0.00 ? 159 GLY A N    4  
ATOM 8581  C CA   . GLY A 1 141 ? 5.687   -4.704  -14.268 1.00 0.00 ? 159 GLY A CA   4  
ATOM 8582  C C    . GLY A 1 141 ? 4.695   -4.966  -15.384 1.00 0.00 ? 159 GLY A C    4  
ATOM 8583  O O    . GLY A 1 141 ? 3.818   -5.821  -15.255 1.00 0.00 ? 159 GLY A O    4  
ATOM 8584  H H    . GLY A 1 141 ? 5.013   -6.458  -13.292 1.00 0.00 ? 159 GLY A H    4  
ATOM 8585  H HA2  . GLY A 1 141 ? 5.526   -3.707  -13.885 1.00 0.00 ? 159 GLY A HA2  4  
ATOM 8586  H HA3  . GLY A 1 141 ? 6.687   -4.769  -14.669 1.00 0.00 ? 159 GLY A HA3  4  
ATOM 8587  N N    . GLU A 1 142 ? 4.832   -4.229  -16.482 1.00 0.00 ? 160 GLU A N    4  
ATOM 8588  C CA   . GLU A 1 142 ? 3.937   -4.385  -17.622 1.00 0.00 ? 160 GLU A CA   4  
ATOM 8589  C C    . GLU A 1 142 ? 4.172   -5.724  -18.317 1.00 0.00 ? 160 GLU A C    4  
ATOM 8590  O O    . GLU A 1 142 ? 4.888   -6.585  -17.805 1.00 0.00 ? 160 GLU A O    4  
ATOM 8591  C CB   . GLU A 1 142 ? 4.139   -3.240  -18.616 1.00 0.00 ? 160 GLU A CB   4  
ATOM 8592  C CG   . GLU A 1 142 ? 5.474   -3.290  -19.340 1.00 0.00 ? 160 GLU A CG   4  
ATOM 8593  C CD   . GLU A 1 142 ? 5.842   -1.964  -19.977 1.00 0.00 ? 160 GLU A CD   4  
ATOM 8594  O OE1  . GLU A 1 142 ? 6.369   -1.087  -19.262 1.00 0.00 ? 160 GLU A OE1  4  
ATOM 8595  O OE2  . GLU A 1 142 ? 5.601   -1.803  -21.192 1.00 0.00 ? 160 GLU A OE2  4  
ATOM 8596  H H    . GLU A 1 142 ? 5.550   -3.564  -16.523 1.00 0.00 ? 160 GLU A H    4  
ATOM 8597  H HA   . GLU A 1 142 ? 2.923   -4.357  -17.255 1.00 0.00 ? 160 GLU A HA   4  
ATOM 8598  H HB3  . GLU A 1 142 ? 4.076   -2.303  -18.085 1.00 0.00 ? 160 GLU A HB3  4  
ATOM 8599  H HG3  . GLU A 1 142 ? 5.423   -4.043  -20.113 1.00 0.00 ? 160 GLU A HG3  4  
ATOM 8600  N N    . TYR A 1 143 ? 3.562   -5.892  -19.485 1.00 0.00 ? 161 TYR A N    4  
ATOM 8601  C CA   . TYR A 1 143 ? 3.701   -7.126  -20.249 1.00 0.00 ? 161 TYR A CA   4  
ATOM 8602  C C    . TYR A 1 143 ? 5.168   -7.420  -20.547 1.00 0.00 ? 161 TYR A C    4  
ATOM 8603  O O    . TYR A 1 143 ? 6.047   -6.613  -20.250 1.00 0.00 ? 161 TYR A O    4  
ATOM 8604  C CB   . TYR A 1 143 ? 2.912   -7.032  -21.557 1.00 0.00 ? 161 TYR A CB   4  
ATOM 8605  C CG   . TYR A 1 143 ? 1.462   -6.647  -21.363 1.00 0.00 ? 161 TYR A CG   4  
ATOM 8606  C CD1  . TYR A 1 143 ? 0.588   -7.480  -20.674 1.00 0.00 ? 161 TYR A CD1  4  
ATOM 8607  C CD2  . TYR A 1 143 ? 0.967   -5.452  -21.869 1.00 0.00 ? 161 TYR A CD2  4  
ATOM 8608  C CE1  . TYR A 1 143 ? -0.736  -7.132  -20.495 1.00 0.00 ? 161 TYR A CE1  4  
ATOM 8609  C CE2  . TYR A 1 143 ? -0.355  -5.096  -21.694 1.00 0.00 ? 161 TYR A CE2  4  
ATOM 8610  C CZ   . TYR A 1 143 ? -1.204  -5.939  -21.006 1.00 0.00 ? 161 TYR A CZ   4  
ATOM 8611  O OH   . TYR A 1 143 ? -2.523  -5.589  -20.831 1.00 0.00 ? 161 TYR A OH   4  
ATOM 8612  H H    . TYR A 1 143 ? 3.004   -5.170  -19.841 1.00 0.00 ? 161 TYR A H    4  
ATOM 8613  H HA   . TYR A 1 143 ? 3.297   -7.931  -19.654 1.00 0.00 ? 161 TYR A HA   4  
ATOM 8614  H HB3  . TYR A 1 143 ? 2.937   -7.991  -22.053 1.00 0.00 ? 161 TYR A HB3  4  
ATOM 8615  H HD1  . TYR A 1 143 ? 0.957   -8.414  -20.275 1.00 0.00 ? 161 TYR A HD1  4  
ATOM 8616  H HD2  . TYR A 1 143 ? 1.633   -4.794  -22.406 1.00 0.00 ? 161 TYR A HD2  4  
ATOM 8617  H HE1  . TYR A 1 143 ? -1.401  -7.793  -19.957 1.00 0.00 ? 161 TYR A HE1  4  
ATOM 8618  H HE2  . TYR A 1 143 ? -0.722  -4.162  -22.095 1.00 0.00 ? 161 TYR A HE2  4  
ATOM 8619  H HH   . TYR A 1 143 ? -2.733  -5.593  -19.894 1.00 0.00 ? 161 TYR A HH   4  
ATOM 8620  N N    . ARG A 1 144 ? 5.422   -8.583  -21.138 1.00 0.00 ? 162 ARG A N    4  
ATOM 8621  C CA   . ARG A 1 144 ? 6.783   -8.986  -21.477 1.00 0.00 ? 162 ARG A CA   4  
ATOM 8622  C C    . ARG A 1 144 ? 7.451   -7.944  -22.369 1.00 0.00 ? 162 ARG A C    4  
ATOM 8623  O O    . ARG A 1 144 ? 7.167   -7.859  -23.564 1.00 0.00 ? 162 ARG A O    4  
ATOM 8624  C CB   . ARG A 1 144 ? 6.775   -10.345 -22.178 1.00 0.00 ? 162 ARG A CB   4  
ATOM 8625  C CG   . ARG A 1 144 ? 6.793   -11.526 -21.221 1.00 0.00 ? 162 ARG A CG   4  
ATOM 8626  C CD   . ARG A 1 144 ? 5.403   -11.826 -20.681 1.00 0.00 ? 162 ARG A CD   4  
ATOM 8627  N NE   . ARG A 1 144 ? 5.449   -12.665 -19.486 1.00 0.00 ? 162 ARG A NE   4  
ATOM 8628  C CZ   . ARG A 1 144 ? 4.391   -12.923 -18.727 1.00 0.00 ? 162 ARG A CZ   4  
ATOM 8629  N NH1  . ARG A 1 144 ? 3.208   -12.410 -19.039 1.00 0.00 ? 162 ARG A NH1  4  
ATOM 8630  N NH2  . ARG A 1 144 ? 4.512   -13.695 -17.656 1.00 0.00 ? 162 ARG A NH2  4  
ATOM 8631  H H    . ARG A 1 144 ? 4.680   -9.185  -21.350 1.00 0.00 ? 162 ARG A H    4  
ATOM 8632  H HA   . ARG A 1 144 ? 7.343   -9.068  -20.557 1.00 0.00 ? 162 ARG A HA   4  
ATOM 8633  H HB3  . ARG A 1 144 ? 7.644   -10.413 -22.816 1.00 0.00 ? 162 ARG A HB3  4  
ATOM 8634  H HG3  . ARG A 1 144 ? 7.448   -11.296 -20.395 1.00 0.00 ? 162 ARG A HG3  4  
ATOM 8635  H HD3  . ARG A 1 144 ? 4.838   -12.336 -21.446 1.00 0.00 ? 162 ARG A HD3  4  
ATOM 8636  H HE   . ARG A 1 144 ? 6.313   -13.053 -19.239 1.00 0.00 ? 162 ARG A HE   4  
ATOM 8637  H HH11 . ARG A 1 144 ? 3.113   -11.829 -19.846 1.00 0.00 ? 162 ARG A HH11 4  
ATOM 8638  H HH12 . ARG A 1 144 ? 2.411   -12.608 -18.466 1.00 0.00 ? 162 ARG A HH12 4  
ATOM 8639  H HH21 . ARG A 1 144 ? 5.403   -14.084 -17.418 1.00 0.00 ? 162 ARG A HH21 4  
ATOM 8640  H HH22 . ARG A 1 144 ? 3.715   -13.888 -17.086 1.00 0.00 ? 162 ARG A HH22 4  
ATOM 8641  N N    . THR A 1 145 ? 8.344   -7.153  -21.780 1.00 0.00 ? 163 THR A N    4  
ATOM 8642  C CA   . THR A 1 145 ? 9.051   -6.117  -22.520 1.00 0.00 ? 163 THR A CA   4  
ATOM 8643  C C    . THR A 1 145 ? 10.105  -5.441  -21.648 1.00 0.00 ? 163 THR A C    4  
ATOM 8644  O O    . THR A 1 145 ? 10.006  -5.448  -20.423 1.00 0.00 ? 163 THR A O    4  
ATOM 8645  C CB   . THR A 1 145 ? 8.081   -5.046  -23.057 1.00 0.00 ? 163 THR A CB   4  
ATOM 8646  O OG1  . THR A 1 145 ? 8.775   -4.151  -23.933 1.00 0.00 ? 163 THR A OG1  4  
ATOM 8647  C CG2  . THR A 1 145 ? 7.457   -4.262  -21.913 1.00 0.00 ? 163 THR A CG2  4  
ATOM 8648  H H    . THR A 1 145 ? 8.526   -7.270  -20.824 1.00 0.00 ? 163 THR A H    4  
ATOM 8649  H HA   . THR A 1 145 ? 9.541   -6.584  -23.363 1.00 0.00 ? 163 THR A HA   4  
ATOM 8650  H HB   . THR A 1 145 ? 7.294   -5.540  -23.607 1.00 0.00 ? 163 THR A HB   4  
ATOM 8651  H HG1  . THR A 1 145 ? 8.522   -4.333  -24.840 1.00 0.00 ? 163 THR A HG1  4  
ATOM 8652  H HG21 . THR A 1 145 ? 8.032   -3.365  -21.733 1.00 0.00 ? 163 THR A HG21 4  
ATOM 8653  H HG22 . THR A 1 145 ? 7.449   -4.870  -21.020 1.00 0.00 ? 163 THR A HG22 4  
ATOM 8654  H HG23 . THR A 1 145 ? 6.444   -3.991  -22.174 1.00 0.00 ? 163 THR A HG23 4  
ATOM 8655  N N    . ASN A 1 146 ? 11.111  -4.857  -22.291 1.00 0.00 ? 164 ASN A N    4  
ATOM 8656  C CA   . ASN A 1 146 ? 12.183  -4.177  -21.574 1.00 0.00 ? 164 ASN A CA   4  
ATOM 8657  C C    . ASN A 1 146 ? 12.920  -5.144  -20.653 1.00 0.00 ? 164 ASN A C    4  
ATOM 8658  O O    . ASN A 1 146 ? 12.775  -5.110  -19.430 1.00 0.00 ? 164 ASN A O    4  
ATOM 8659  C CB   . ASN A 1 146 ? 11.619  -3.010  -20.759 1.00 0.00 ? 164 ASN A CB   4  
ATOM 8660  C CG   . ASN A 1 146 ? 12.639  -1.907  -20.547 1.00 0.00 ? 164 ASN A CG   4  
ATOM 8661  O OD1  . ASN A 1 146 ? 12.697  -0.944  -21.312 1.00 0.00 ? 164 ASN A OD1  4  
ATOM 8662  N ND2  . ASN A 1 146 ? 13.450  -2.045  -19.505 1.00 0.00 ? 164 ASN A ND2  4  
ATOM 8663  H H    . ASN A 1 146 ? 11.134  -4.885  -23.270 1.00 0.00 ? 164 ASN A H    4  
ATOM 8664  H HA   . ASN A 1 146 ? 12.878  -3.791  -22.304 1.00 0.00 ? 164 ASN A HA   4  
ATOM 8665  H HB3  . ASN A 1 146 ? 11.301  -3.373  -19.795 1.00 0.00 ? 164 ASN A HB3  4  
ATOM 8666  H HD21 . ASN A 1 146 ? 13.346  -2.839  -18.938 1.00 0.00 ? 164 ASN A HD21 4  
ATOM 8667  H HD22 . ASN A 1 146 ? 14.118  -1.346  -19.343 1.00 0.00 ? 164 ASN A HD22 4  
ATOM 8668  N N    . PRO A 1 147 ? 13.733  -6.026  -21.251 1.00 0.00 ? 165 PRO A N    4  
ATOM 8669  C CA   . PRO A 1 147 ? 14.512  -7.020  -20.505 1.00 0.00 ? 165 PRO A CA   4  
ATOM 8670  C C    . PRO A 1 147 ? 15.637  -6.384  -19.695 1.00 0.00 ? 165 PRO A C    4  
ATOM 8671  O O    . PRO A 1 147 ? 16.361  -5.523  -20.193 1.00 0.00 ? 165 PRO A O    4  
ATOM 8672  C CB   . PRO A 1 147 ? 15.084  -7.920  -21.601 1.00 0.00 ? 165 PRO A CB   4  
ATOM 8673  C CG   . PRO A 1 147 ? 15.131  -7.056  -22.815 1.00 0.00 ? 165 PRO A CG   4  
ATOM 8674  C CD   . PRO A 1 147 ? 13.955  -6.124  -22.704 1.00 0.00 ? 165 PRO A CD   4  
ATOM 8675  H HA   . PRO A 1 147 ? 13.884  -7.604  -19.848 1.00 0.00 ? 165 PRO A HA   4  
ATOM 8676  H HB3  . PRO A 1 147 ? 14.438  -8.772  -21.748 1.00 0.00 ? 165 PRO A HB3  4  
ATOM 8677  H HG3  . PRO A 1 147 ? 15.041  -7.666  -23.702 1.00 0.00 ? 165 PRO A HG3  4  
ATOM 8678  H HD3  . PRO A 1 147 ? 13.092  -6.544  -23.198 1.00 0.00 ? 165 PRO A HD3  4  
ATOM 8679  N N    . GLU A 1 148 ? 15.778  -6.816  -18.445 1.00 0.00 ? 166 GLU A N    4  
ATOM 8680  C CA   . GLU A 1 148 ? 16.817  -6.288  -17.568 1.00 0.00 ? 166 GLU A CA   4  
ATOM 8681  C C    . GLU A 1 148 ? 16.855  -7.054  -16.250 1.00 0.00 ? 166 GLU A C    4  
ATOM 8682  O O    . GLU A 1 148 ? 15.935  -6.961  -15.437 1.00 0.00 ? 166 GLU A O    4  
ATOM 8683  C CB   . GLU A 1 148 ? 16.580  -4.800  -17.299 1.00 0.00 ? 166 GLU A CB   4  
ATOM 8684  C CG   . GLU A 1 148 ? 17.759  -4.107  -16.639 1.00 0.00 ? 166 GLU A CG   4  
ATOM 8685  C CD   . GLU A 1 148 ? 18.815  -3.672  -17.638 1.00 0.00 ? 166 GLU A CD   4  
ATOM 8686  O OE1  . GLU A 1 148 ? 18.980  -4.365  -18.664 1.00 0.00 ? 166 GLU A OE1  4  
ATOM 8687  O OE2  . GLU A 1 148 ? 19.473  -2.640  -17.394 1.00 0.00 ? 166 GLU A OE2  4  
ATOM 8688  H H    . GLU A 1 148 ? 15.170  -7.505  -18.106 1.00 0.00 ? 166 GLU A H    4  
ATOM 8689  H HA   . GLU A 1 148 ? 17.765  -6.407  -18.068 1.00 0.00 ? 166 GLU A HA   4  
ATOM 8690  H HB3  . GLU A 1 148 ? 15.721  -4.696  -16.655 1.00 0.00 ? 166 GLU A HB3  4  
ATOM 8691  H HG3  . GLU A 1 148 ? 18.211  -4.787  -15.933 1.00 0.00 ? 166 GLU A HG3  4  
ATOM 8692  N N    . ASP A 1 149 ? 17.927  -7.812  -16.045 1.00 0.00 ? 167 ASP A N    4  
ATOM 8693  C CA   . ASP A 1 149 ? 18.087  -8.595  -14.824 1.00 0.00 ? 167 ASP A CA   4  
ATOM 8694  C C    . ASP A 1 149 ? 17.915  -7.717  -13.588 1.00 0.00 ? 167 ASP A C    4  
ATOM 8695  O O    . ASP A 1 149 ? 18.813  -6.959  -13.223 1.00 0.00 ? 167 ASP A O    4  
ATOM 8696  C CB   . ASP A 1 149 ? 19.462  -9.265  -14.800 1.00 0.00 ? 167 ASP A CB   4  
ATOM 8697  C CG   . ASP A 1 149 ? 19.495  -10.487 -13.903 1.00 0.00 ? 167 ASP A CG   4  
ATOM 8698  O OD1  . ASP A 1 149 ? 19.592  -10.316 -12.670 1.00 0.00 ? 167 ASP A OD1  4  
ATOM 8699  O OD2  . ASP A 1 149 ? 19.423  -11.614 -14.434 1.00 0.00 ? 167 ASP A OD2  4  
ATOM 8700  H H    . ASP A 1 149 ? 18.627  -7.846  -16.729 1.00 0.00 ? 167 ASP A H    4  
ATOM 8701  H HA   . ASP A 1 149 ? 17.324  -9.359  -14.816 1.00 0.00 ? 167 ASP A HA   4  
ATOM 8702  H HB3  . ASP A 1 149 ? 20.194  -8.557  -14.441 1.00 0.00 ? 167 ASP A HB3  4  
ATOM 8703  N N    . ILE A 1 150 ? 16.753  -7.825  -12.951 1.00 0.00 ? 168 ILE A N    4  
ATOM 8704  C CA   . ILE A 1 150 ? 16.462  -7.041  -11.757 1.00 0.00 ? 168 ILE A CA   4  
ATOM 8705  C C    . ILE A 1 150 ? 16.149  -7.945  -10.569 1.00 0.00 ? 168 ILE A C    4  
ATOM 8706  O O    . ILE A 1 150 ? 15.564  -9.016  -10.728 1.00 0.00 ? 168 ILE A O    4  
ATOM 8707  C CB   . ILE A 1 150 ? 15.278  -6.084  -11.986 1.00 0.00 ? 168 ILE A CB   4  
ATOM 8708  C CG1  . ILE A 1 150 ? 15.105  -5.153  -10.784 1.00 0.00 ? 168 ILE A CG1  4  
ATOM 8709  C CG2  . ILE A 1 150 ? 14.001  -6.872  -12.239 1.00 0.00 ? 168 ILE A CG2  4  
ATOM 8710  C CD1  . ILE A 1 150 ? 14.131  -5.673  -9.751  1.00 0.00 ? 168 ILE A CD1  4  
ATOM 8711  H H    . ILE A 1 150 ? 16.076  -8.447  -13.291 1.00 0.00 ? 168 ILE A H    4  
ATOM 8712  H HA   . ILE A 1 150 ? 17.338  -6.450  -11.525 1.00 0.00 ? 168 ILE A HA   4  
ATOM 8713  H HB   . ILE A 1 150 ? 15.487  -5.493  -12.864 1.00 0.00 ? 168 ILE A HB   4  
ATOM 8714  H HG13 . ILE A 1 150 ? 14.746  -4.194  -11.130 1.00 0.00 ? 168 ILE A HG13 4  
ATOM 8715  H HG21 . ILE A 1 150 ? 13.158  -6.198  -12.251 1.00 0.00 ? 168 ILE A HG21 4  
ATOM 8716  H HG22 . ILE A 1 150 ? 14.072  -7.376  -13.191 1.00 0.00 ? 168 ILE A HG22 4  
ATOM 8717  H HG23 . ILE A 1 150 ? 13.867  -7.602  -11.454 1.00 0.00 ? 168 ILE A HG23 4  
ATOM 8718  H HD11 . ILE A 1 150 ? 14.229  -6.745  -9.671  1.00 0.00 ? 168 ILE A HD11 4  
ATOM 8719  H HD12 . ILE A 1 150 ? 14.342  -5.219  -8.795  1.00 0.00 ? 168 ILE A HD12 4  
ATOM 8720  H HD13 . ILE A 1 150 ? 13.123  -5.425  -10.053 1.00 0.00 ? 168 ILE A HD13 4  
ATOM 8721  N N    . TYR A 1 151 ? 16.540  -7.504  -9.379  1.00 0.00 ? 169 TYR A N    4  
ATOM 8722  C CA   . TYR A 1 151 ? 16.302  -8.273  -8.163  1.00 0.00 ? 169 TYR A CA   4  
ATOM 8723  C C    . TYR A 1 151 ? 15.602  -7.421  -7.109  1.00 0.00 ? 169 TYR A C    4  
ATOM 8724  O O    . TYR A 1 151 ? 15.662  -6.191  -7.126  1.00 0.00 ? 169 TYR A O    4  
ATOM 8725  C CB   . TYR A 1 151 ? 17.621  -8.810  -7.607  1.00 0.00 ? 169 TYR A CB   4  
ATOM 8726  C CG   . TYR A 1 151 ? 18.749  -7.804  -7.646  1.00 0.00 ? 169 TYR A CG   4  
ATOM 8727  C CD1  . TYR A 1 151 ? 18.975  -6.941  -6.580  1.00 0.00 ? 169 TYR A CD1  4  
ATOM 8728  C CD2  . TYR A 1 151 ? 19.590  -7.716  -8.748  1.00 0.00 ? 169 TYR A CD2  4  
ATOM 8729  C CE1  . TYR A 1 151 ? 20.003  -6.020  -6.612  1.00 0.00 ? 169 TYR A CE1  4  
ATOM 8730  C CE2  . TYR A 1 151 ? 20.624  -6.799  -8.788  1.00 0.00 ? 169 TYR A CE2  4  
ATOM 8731  C CZ   . TYR A 1 151 ? 20.825  -5.952  -7.718  1.00 0.00 ? 169 TYR A CZ   4  
ATOM 8732  O OH   . TYR A 1 151 ? 21.852  -5.037  -7.752  1.00 0.00 ? 169 TYR A OH   4  
ATOM 8733  H H    . TYR A 1 151 ? 17.003  -6.642  -9.316  1.00 0.00 ? 169 TYR A H    4  
ATOM 8734  H HA   . TYR A 1 151 ? 15.663  -9.106  -8.418  1.00 0.00 ? 169 TYR A HA   4  
ATOM 8735  H HB3  . TYR A 1 151 ? 17.924  -9.671  -8.186  1.00 0.00 ? 169 TYR A HB3  4  
ATOM 8736  H HD1  . TYR A 1 151 ? 18.329  -6.997  -5.715  1.00 0.00 ? 169 TYR A HD1  4  
ATOM 8737  H HD2  . TYR A 1 151 ? 19.430  -8.381  -9.585  1.00 0.00 ? 169 TYR A HD2  4  
ATOM 8738  H HE1  . TYR A 1 151 ? 20.162  -5.358  -5.774  1.00 0.00 ? 169 TYR A HE1  4  
ATOM 8739  H HE2  . TYR A 1 151 ? 21.266  -6.746  -9.654  1.00 0.00 ? 169 TYR A HE2  4  
ATOM 8740  H HH   . TYR A 1 151 ? 21.527  -4.206  -8.106  1.00 0.00 ? 169 TYR A HH   4  
ATOM 8741  N N    . PRO A 1 152 ? 14.921  -8.089  -6.165  1.00 0.00 ? 170 PRO A N    4  
ATOM 8742  C CA   . PRO A 1 152 ? 14.198  -7.416  -5.083  1.00 0.00 ? 170 PRO A CA   4  
ATOM 8743  C C    . PRO A 1 152 ? 15.137  -6.759  -4.078  1.00 0.00 ? 170 PRO A C    4  
ATOM 8744  O O    . PRO A 1 152 ? 14.809  -5.729  -3.488  1.00 0.00 ? 170 PRO A O    4  
ATOM 8745  C CB   . PRO A 1 152 ? 13.413  -8.551  -4.420  1.00 0.00 ? 170 PRO A CB   4  
ATOM 8746  C CG   . PRO A 1 152 ? 14.195  -9.781  -4.728  1.00 0.00 ? 170 PRO A CG   4  
ATOM 8747  C CD   . PRO A 1 152 ? 14.807  -9.555  -6.082  1.00 0.00 ? 170 PRO A CD   4  
ATOM 8748  H HA   . PRO A 1 152 ? 13.509  -6.677  -5.467  1.00 0.00 ? 170 PRO A HA   4  
ATOM 8749  H HB3  . PRO A 1 152 ? 12.419  -8.600  -4.840  1.00 0.00 ? 170 PRO A HB3  4  
ATOM 8750  H HG3  . PRO A 1 152 ? 13.536  -10.637 -4.752  1.00 0.00 ? 170 PRO A HG3  4  
ATOM 8751  H HD3  . PRO A 1 152 ? 14.156  -9.934  -6.858  1.00 0.00 ? 170 PRO A HD3  4  
ATOM 8752  N N    . SER A 1 153 ? 16.307  -7.361  -3.888  1.00 0.00 ? 171 SER A N    4  
ATOM 8753  C CA   . SER A 1 153 ? 17.294  -6.835  -2.951  1.00 0.00 ? 171 SER A CA   4  
ATOM 8754  C C    . SER A 1 153 ? 16.750  -6.849  -1.526  1.00 0.00 ? 171 SER A C    4  
ATOM 8755  O O    . SER A 1 153 ? 17.250  -6.143  -0.653  1.00 0.00 ? 171 SER A O    4  
ATOM 8756  C CB   . SER A 1 153 ? 17.694  -5.413  -3.343  1.00 0.00 ? 171 SER A CB   4  
ATOM 8757  O OG   . SER A 1 153 ? 18.883  -5.016  -2.682  1.00 0.00 ? 171 SER A OG   4  
ATOM 8758  H H    . SER A 1 153 ? 16.510  -8.179  -4.388  1.00 0.00 ? 171 SER A H    4  
ATOM 8759  H HA   . SER A 1 153 ? 18.165  -7.470  -2.997  1.00 0.00 ? 171 SER A HA   4  
ATOM 8760  H HB3  . SER A 1 153 ? 16.899  -4.730  -3.071  1.00 0.00 ? 171 SER A HB3  4  
ATOM 8761  H HG   . SER A 1 153 ? 19.449  -4.545  -3.298  1.00 0.00 ? 171 SER A HG   4  
ATOM 8762  N N    . ASN A 1 154 ? 15.721  -7.660  -1.300  1.00 0.00 ? 172 ASN A N    4  
ATOM 8763  C CA   . ASN A 1 154 ? 15.107  -7.766  0.020   1.00 0.00 ? 172 ASN A CA   4  
ATOM 8764  C C    . ASN A 1 154 ? 16.134  -8.192  1.065   1.00 0.00 ? 172 ASN A C    4  
ATOM 8765  O O    . ASN A 1 154 ? 17.169  -8.782  0.751   1.00 0.00 ? 172 ASN A O    4  
ATOM 8766  C CB   . ASN A 1 154 ? 13.950  -8.765  -0.013  1.00 0.00 ? 172 ASN A CB   4  
ATOM 8767  C CG   . ASN A 1 154 ? 14.280  -10.006 -0.818  1.00 0.00 ? 172 ASN A CG   4  
ATOM 8768  O OD1  . ASN A 1 154 ? 15.358  -10.585 -0.675  1.00 0.00 ? 172 ASN A OD1  4  
ATOM 8769  N ND2  . ASN A 1 154 ? 13.351  -10.423 -1.671  1.00 0.00 ? 172 ASN A ND2  4  
ATOM 8770  H H    . ASN A 1 154 ? 15.365  -8.199  -2.035  1.00 0.00 ? 172 ASN A H    4  
ATOM 8771  H HA   . ASN A 1 154 ? 14.723  -6.792  0.286   1.00 0.00 ? 172 ASN A HA   4  
ATOM 8772  H HB3  . ASN A 1 154 ? 13.085  -8.292  -0.452  1.00 0.00 ? 172 ASN A HB3  4  
ATOM 8773  H HD21 . ASN A 1 154 ? 12.517  -9.913  -1.733  1.00 0.00 ? 172 ASN A HD21 4  
ATOM 8774  H HD22 . ASN A 1 154 ? 13.539  -11.223 -2.204  1.00 0.00 ? 172 ASN A HD22 4  
ATOM 8775  N N    . PRO A 1 155 ? 15.843  -7.889  2.338   1.00 0.00 ? 173 PRO A N    4  
ATOM 8776  C CA   . PRO A 1 155 ? 16.727  -8.232  3.456   1.00 0.00 ? 173 PRO A CA   4  
ATOM 8777  C C    . PRO A 1 155 ? 16.770  -9.733  3.721   1.00 0.00 ? 173 PRO A C    4  
ATOM 8778  O O    . PRO A 1 155 ? 16.230  -10.527 2.948   1.00 0.00 ? 173 PRO A O    4  
ATOM 8779  C CB   . PRO A 1 155 ? 16.101  -7.498  4.643   1.00 0.00 ? 173 PRO A CB   4  
ATOM 8780  C CG   . PRO A 1 155 ? 14.664  -7.348  4.280   1.00 0.00 ? 173 PRO A CG   4  
ATOM 8781  C CD   . PRO A 1 155 ? 14.629  -7.187  2.785   1.00 0.00 ? 173 PRO A CD   4  
ATOM 8782  H HA   . PRO A 1 155 ? 17.731  -7.867  3.293   1.00 0.00 ? 173 PRO A HA   4  
ATOM 8783  H HB3  . PRO A 1 155 ? 16.578  -6.537  4.769   1.00 0.00 ? 173 PRO A HB3  4  
ATOM 8784  H HG3  . PRO A 1 155 ? 14.253  -6.472  4.761   1.00 0.00 ? 173 PRO A HG3  4  
ATOM 8785  H HD3  . PRO A 1 155 ? 14.668  -6.142  2.517   1.00 0.00 ? 173 PRO A HD3  4  
ATOM 8786  N N    . THR A 1 156 ? 17.416  -10.117 4.818   1.00 0.00 ? 174 THR A N    4  
ATOM 8787  C CA   . THR A 1 156 ? 17.530  -11.524 5.183   1.00 0.00 ? 174 THR A CA   4  
ATOM 8788  C C    . THR A 1 156 ? 16.384  -11.950 6.095   1.00 0.00 ? 174 THR A C    4  
ATOM 8789  O O    . THR A 1 156 ? 15.763  -11.118 6.756   1.00 0.00 ? 174 THR A O    4  
ATOM 8790  C CB   . THR A 1 156 ? 18.868  -11.814 5.890   1.00 0.00 ? 174 THR A CB   4  
ATOM 8791  O OG1  . THR A 1 156 ? 19.216  -10.721 6.748   1.00 0.00 ? 174 THR A OG1  4  
ATOM 8792  C CG2  . THR A 1 156 ? 19.977  -12.043 4.875   1.00 0.00 ? 174 THR A CG2  4  
ATOM 8793  H H    . THR A 1 156 ? 17.826  -9.439  5.392   1.00 0.00 ? 174 THR A H    4  
ATOM 8794  H HA   . THR A 1 156 ? 17.492  -12.109 4.277   1.00 0.00 ? 174 THR A HA   4  
ATOM 8795  H HB   . THR A 1 156 ? 18.756  -12.708 6.486   1.00 0.00 ? 174 THR A HB   4  
ATOM 8796  H HG1  . THR A 1 156 ? 19.219  -11.018 7.660   1.00 0.00 ? 174 THR A HG1  4  
ATOM 8797  H HG21 . THR A 1 156 ? 20.784  -12.588 5.342   1.00 0.00 ? 174 THR A HG21 4  
ATOM 8798  H HG22 . THR A 1 156 ? 20.343  -11.091 4.521   1.00 0.00 ? 174 THR A HG22 4  
ATOM 8799  H HG23 . THR A 1 156 ? 19.592  -12.613 4.044   1.00 0.00 ? 174 THR A HG23 4  
ATOM 8800  N N    . ASP A 1 157 ? 16.109  -13.249 6.124   1.00 0.00 ? 175 ASP A N    4  
ATOM 8801  C CA   . ASP A 1 157 ? 15.038  -13.785 6.956   1.00 0.00 ? 175 ASP A CA   4  
ATOM 8802  C C    . ASP A 1 157 ? 15.239  -13.395 8.417   1.00 0.00 ? 175 ASP A C    4  
ATOM 8803  O O    . ASP A 1 157 ? 16.368  -13.309 8.898   1.00 0.00 ? 175 ASP A O    4  
ATOM 8804  C CB   . ASP A 1 157 ? 14.976  -15.307 6.825   1.00 0.00 ? 175 ASP A CB   4  
ATOM 8805  C CG   . ASP A 1 157 ? 13.634  -15.871 7.253   1.00 0.00 ? 175 ASP A CG   4  
ATOM 8806  O OD1  . ASP A 1 157 ? 13.385  -15.943 8.475   1.00 0.00 ? 175 ASP A OD1  4  
ATOM 8807  O OD2  . ASP A 1 157 ? 12.836  -16.240 6.368   1.00 0.00 ? 175 ASP A OD2  4  
ATOM 8808  H H    . ASP A 1 157 ? 16.640  -13.862 5.573   1.00 0.00 ? 175 ASP A H    4  
ATOM 8809  H HA   . ASP A 1 157 ? 14.107  -13.365 6.609   1.00 0.00 ? 175 ASP A HA   4  
ATOM 8810  H HB3  . ASP A 1 157 ? 15.745  -15.747 7.444   1.00 0.00 ? 175 ASP A HB3  4  
ATOM 8811  N N    . ASP A 1 158 ? 14.134  -13.159 9.118   1.00 0.00 ? 176 ASP A N    4  
ATOM 8812  C CA   . ASP A 1 158 ? 14.188  -12.778 10.524  1.00 0.00 ? 176 ASP A CA   4  
ATOM 8813  C C    . ASP A 1 158 ? 13.145  -13.542 11.335  1.00 0.00 ? 176 ASP A C    4  
ATOM 8814  O O    . ASP A 1 158 ? 12.237  -14.157 10.774  1.00 0.00 ? 176 ASP A O    4  
ATOM 8815  C CB   . ASP A 1 158 ? 13.967  -11.272 10.675  1.00 0.00 ? 176 ASP A CB   4  
ATOM 8816  C CG   . ASP A 1 158 ? 12.899  -10.746 9.736   1.00 0.00 ? 176 ASP A CG   4  
ATOM 8817  O OD1  . ASP A 1 158 ? 11.742  -11.202 9.840   1.00 0.00 ? 176 ASP A OD1  4  
ATOM 8818  O OD2  . ASP A 1 158 ? 13.221  -9.878  8.899   1.00 0.00 ? 176 ASP A OD2  4  
ATOM 8819  H H    . ASP A 1 158 ? 13.263  -13.244 8.679   1.00 0.00 ? 176 ASP A H    4  
ATOM 8820  H HA   . ASP A 1 158 ? 15.170  -13.028 10.898  1.00 0.00 ? 176 ASP A HA   4  
ATOM 8821  H HB3  . ASP A 1 158 ? 14.893  -10.756 10.465  1.00 0.00 ? 176 ASP A HB3  4  
ATOM 8822  N N    . ASP A 1 159 ? 13.283  -13.500 12.655  1.00 0.00 ? 177 ASP A N    4  
ATOM 8823  C CA   . ASP A 1 159 ? 12.351  -14.187 13.543  1.00 0.00 ? 177 ASP A CA   4  
ATOM 8824  C C    . ASP A 1 159 ? 11.806  -13.234 14.602  1.00 0.00 ? 177 ASP A C    4  
ATOM 8825  O O    . ASP A 1 159 ? 12.458  -12.256 14.967  1.00 0.00 ? 177 ASP A O    4  
ATOM 8826  C CB   . ASP A 1 159 ? 13.039  -15.377 14.214  1.00 0.00 ? 177 ASP A CB   4  
ATOM 8827  C CG   . ASP A 1 159 ? 13.341  -16.498 13.237  1.00 0.00 ? 177 ASP A CG   4  
ATOM 8828  O OD1  . ASP A 1 159 ? 12.446  -17.333 12.998  1.00 0.00 ? 177 ASP A OD1  4  
ATOM 8829  O OD2  . ASP A 1 159 ? 14.474  -16.537 12.712  1.00 0.00 ? 177 ASP A OD2  4  
ATOM 8830  H H    . ASP A 1 159 ? 14.026  -12.992 13.042  1.00 0.00 ? 177 ASP A H    4  
ATOM 8831  H HA   . ASP A 1 159 ? 11.528  -14.549 12.945  1.00 0.00 ? 177 ASP A HA   4  
ATOM 8832  H HB3  . ASP A 1 159 ? 12.396  -15.764 14.991  1.00 0.00 ? 177 ASP A HB3  4  
ATOM 8833  N N    . VAL A 1 160 ? 10.607  -13.527 15.093  1.00 0.00 ? 178 VAL A N    4  
ATOM 8834  C CA   . VAL A 1 160 ? 9.974   -12.697 16.111  1.00 0.00 ? 178 VAL A CA   4  
ATOM 8835  C C    . VAL A 1 160 ? 10.887  -12.513 17.318  1.00 0.00 ? 178 VAL A C    4  
ATOM 8836  O O    . VAL A 1 160 ? 10.744  -11.558 18.079  1.00 0.00 ? 178 VAL A O    4  
ATOM 8837  C CB   . VAL A 1 160 ? 8.639   -13.305 16.580  1.00 0.00 ? 178 VAL A CB   4  
ATOM 8838  C CG1  . VAL A 1 160 ? 7.700   -13.508 15.400  1.00 0.00 ? 178 VAL A CG1  4  
ATOM 8839  C CG2  . VAL A 1 160 ? 8.878   -14.616 17.313  1.00 0.00 ? 178 VAL A CG2  4  
ATOM 8840  H H    . VAL A 1 160 ? 10.136  -14.320 14.764  1.00 0.00 ? 178 VAL A H    4  
ATOM 8841  H HA   . VAL A 1 160 ? 9.771   -11.731 15.675  1.00 0.00 ? 178 VAL A HA   4  
ATOM 8842  H HB   . VAL A 1 160 ? 8.172   -12.614 17.266  1.00 0.00 ? 178 VAL A HB   4  
ATOM 8843  H HG11 . VAL A 1 160 ? 7.485   -14.561 15.288  1.00 0.00 ? 178 VAL A HG11 4  
ATOM 8844  H HG12 . VAL A 1 160 ? 6.781   -12.968 15.574  1.00 0.00 ? 178 VAL A HG12 4  
ATOM 8845  H HG13 . VAL A 1 160 ? 8.170   -13.141 14.500  1.00 0.00 ? 178 VAL A HG13 4  
ATOM 8846  H HG21 . VAL A 1 160 ? 7.986   -15.224 17.265  1.00 0.00 ? 178 VAL A HG21 4  
ATOM 8847  H HG22 . VAL A 1 160 ? 9.700   -15.144 16.848  1.00 0.00 ? 178 VAL A HG22 4  
ATOM 8848  H HG23 . VAL A 1 160 ? 9.121   -14.413 18.345  1.00 0.00 ? 178 VAL A HG23 4  
ATOM 8849  N N    . GLN A 1 3   ? 10.223  -12.710 4.465   1.00 0.00 ? 21  GLN A N    5  
ATOM 8850  C CA   . GLN A 1 3   ? 10.457  -11.385 3.905   1.00 0.00 ? 21  GLN A CA   5  
ATOM 8851  C C    . GLN A 1 3   ? 9.223   -10.883 3.161   1.00 0.00 ? 21  GLN A C    5  
ATOM 8852  O O    . GLN A 1 3   ? 8.473   -11.670 2.579   1.00 0.00 ? 21  GLN A O    5  
ATOM 8853  C CB   . GLN A 1 3   ? 11.659  -11.413 2.959   1.00 0.00 ? 21  GLN A CB   5  
ATOM 8854  C CG   . GLN A 1 3   ? 12.997  -11.477 3.678   1.00 0.00 ? 21  GLN A CG   5  
ATOM 8855  C CD   . GLN A 1 3   ? 13.303  -12.859 4.221   1.00 0.00 ? 21  GLN A CD   5  
ATOM 8856  O OE1  . GLN A 1 3   ? 13.768  -13.735 3.491   1.00 0.00 ? 21  GLN A OE1  5  
ATOM 8857  N NE2  . GLN A 1 3   ? 13.042  -13.063 5.507   1.00 0.00 ? 21  GLN A NE2  5  
ATOM 8858  H H    . GLN A 1 3   ? 10.592  -13.495 4.009   1.00 0.00 ? 21  GLN A H    5  
ATOM 8859  H HA   . GLN A 1 3   ? 10.668  -10.712 4.722   1.00 0.00 ? 21  GLN A HA   5  
ATOM 8860  H HB3  . GLN A 1 3   ? 11.645  -10.521 2.351   1.00 0.00 ? 21  GLN A HB3  5  
ATOM 8861  H HG3  . GLN A 1 3   ? 12.981  -10.778 4.503   1.00 0.00 ? 21  GLN A HG3  5  
ATOM 8862  H HE21 . GLN A 1 3   ? 12.670  -12.319 6.026   1.00 0.00 ? 21  GLN A HE21 5  
ATOM 8863  H HE22 . GLN A 1 3   ? 13.229  -13.946 5.883   1.00 0.00 ? 21  GLN A HE22 5  
ATOM 8864  N N    . ILE A 1 4   ? 9.018   -9.570  3.184   1.00 0.00 ? 22  ILE A N    5  
ATOM 8865  C CA   . ILE A 1 4   ? 7.875   -8.964  2.512   1.00 0.00 ? 22  ILE A CA   5  
ATOM 8866  C C    . ILE A 1 4   ? 8.294   -7.729  1.721   1.00 0.00 ? 22  ILE A C    5  
ATOM 8867  O O    . ILE A 1 4   ? 9.162   -6.969  2.152   1.00 0.00 ? 22  ILE A O    5  
ATOM 8868  C CB   . ILE A 1 4   ? 6.776   -8.569  3.516   1.00 0.00 ? 22  ILE A CB   5  
ATOM 8869  C CG1  . ILE A 1 4   ? 6.260   -9.806  4.255   1.00 0.00 ? 22  ILE A CG1  5  
ATOM 8870  C CG2  . ILE A 1 4   ? 5.637   -7.857  2.801   1.00 0.00 ? 22  ILE A CG2  5  
ATOM 8871  C CD1  . ILE A 1 4   ? 5.564   -10.800 3.352   1.00 0.00 ? 22  ILE A CD1  5  
ATOM 8872  H H    . ILE A 1 4   ? 9.651   -8.996  3.663   1.00 0.00 ? 22  ILE A H    5  
ATOM 8873  H HA   . ILE A 1 4   ? 7.466   -9.695  1.829   1.00 0.00 ? 22  ILE A HA   5  
ATOM 8874  H HB   . ILE A 1 4   ? 7.204   -7.883  4.232   1.00 0.00 ? 22  ILE A HB   5  
ATOM 8875  H HG13 . ILE A 1 4   ? 5.557   -9.495  5.012   1.00 0.00 ? 22  ILE A HG13 5  
ATOM 8876  H HG21 . ILE A 1 4   ? 5.956   -6.867  2.511   1.00 0.00 ? 22  ILE A HG21 5  
ATOM 8877  H HG22 . ILE A 1 4   ? 5.360   -8.418  1.921   1.00 0.00 ? 22  ILE A HG22 5  
ATOM 8878  H HG23 . ILE A 1 4   ? 4.788   -7.783  3.463   1.00 0.00 ? 22  ILE A HG23 5  
ATOM 8879  H HD11 . ILE A 1 4   ? 6.101   -11.738 3.365   1.00 0.00 ? 22  ILE A HD11 5  
ATOM 8880  H HD12 . ILE A 1 4   ? 4.554   -10.958 3.700   1.00 0.00 ? 22  ILE A HD12 5  
ATOM 8881  H HD13 . ILE A 1 4   ? 5.540   -10.416 2.342   1.00 0.00 ? 22  ILE A HD13 5  
ATOM 8882  N N    . ASP A 1 5   ? 7.670   -7.534  0.565   1.00 0.00 ? 23  ASP A N    5  
ATOM 8883  C CA   . ASP A 1 5   ? 7.976   -6.390  -0.285  1.00 0.00 ? 23  ASP A CA   5  
ATOM 8884  C C    . ASP A 1 5   ? 6.721   -5.567  -0.560  1.00 0.00 ? 23  ASP A C    5  
ATOM 8885  O O    . ASP A 1 5   ? 5.659   -6.115  -0.859  1.00 0.00 ? 23  ASP A O    5  
ATOM 8886  C CB   . ASP A 1 5   ? 8.593   -6.858  -1.605  1.00 0.00 ? 23  ASP A CB   5  
ATOM 8887  C CG   . ASP A 1 5   ? 9.508   -5.817  -2.218  1.00 0.00 ? 23  ASP A CG   5  
ATOM 8888  O OD1  . ASP A 1 5   ? 9.135   -4.624  -2.216  1.00 0.00 ? 23  ASP A OD1  5  
ATOM 8889  O OD2  . ASP A 1 5   ? 10.598  -6.192  -2.700  1.00 0.00 ? 23  ASP A OD2  5  
ATOM 8890  H H    . ASP A 1 5   ? 6.987   -8.177  0.276   1.00 0.00 ? 23  ASP A H    5  
ATOM 8891  H HA   . ASP A 1 5   ? 8.690   -5.771  0.236   1.00 0.00 ? 23  ASP A HA   5  
ATOM 8892  H HB3  . ASP A 1 5   ? 7.803   -7.075  -2.308  1.00 0.00 ? 23  ASP A HB3  5  
ATOM 8893  N N    . LEU A 1 6   ? 6.851   -4.249  -0.456  1.00 0.00 ? 24  LEU A N    5  
ATOM 8894  C CA   . LEU A 1 6   ? 5.727   -3.349  -0.693  1.00 0.00 ? 24  LEU A CA   5  
ATOM 8895  C C    . LEU A 1 6   ? 6.049   -2.353  -1.802  1.00 0.00 ? 24  LEU A C    5  
ATOM 8896  O O    . LEU A 1 6   ? 6.933   -1.510  -1.655  1.00 0.00 ? 24  LEU A O    5  
ATOM 8897  C CB   . LEU A 1 6   ? 5.369   -2.599  0.592   1.00 0.00 ? 24  LEU A CB   5  
ATOM 8898  C CG   . LEU A 1 6   ? 4.355   -3.285  1.509   1.00 0.00 ? 24  LEU A CG   5  
ATOM 8899  C CD1  . LEU A 1 6   ? 4.462   -2.740  2.925   1.00 0.00 ? 24  LEU A CD1  5  
ATOM 8900  C CD2  . LEU A 1 6   ? 2.943   -3.103  0.972   1.00 0.00 ? 24  LEU A CD2  5  
ATOM 8901  H H    . LEU A 1 6   ? 7.722   -3.871  -0.215  1.00 0.00 ? 24  LEU A H    5  
ATOM 8902  H HA   . LEU A 1 6   ? 4.881   -3.949  -0.996  1.00 0.00 ? 24  LEU A HA   5  
ATOM 8903  H HB3  . LEU A 1 6   ? 4.966   -1.637  0.311   1.00 0.00 ? 24  LEU A HB3  5  
ATOM 8904  H HG   . LEU A 1 6   ? 4.567   -4.344  1.542   1.00 0.00 ? 24  LEU A HG   5  
ATOM 8905  H HD11 . LEU A 1 6   ? 4.292   -3.539  3.631   1.00 0.00 ? 24  LEU A HD11 5  
ATOM 8906  H HD12 . LEU A 1 6   ? 3.723   -1.967  3.071   1.00 0.00 ? 24  LEU A HD12 5  
ATOM 8907  H HD13 . LEU A 1 6   ? 5.450   -2.328  3.078   1.00 0.00 ? 24  LEU A HD13 5  
ATOM 8908  H HD21 . LEU A 1 6   ? 2.708   -3.915  0.299   1.00 0.00 ? 24  LEU A HD21 5  
ATOM 8909  H HD22 . LEU A 1 6   ? 2.878   -2.165  0.441   1.00 0.00 ? 24  LEU A HD22 5  
ATOM 8910  H HD23 . LEU A 1 6   ? 2.243   -3.102  1.794   1.00 0.00 ? 24  LEU A HD23 5  
ATOM 8911  N N    . ASN A 1 7   ? 5.325   -2.457  -2.912  1.00 0.00 ? 25  ASN A N    5  
ATOM 8912  C CA   . ASN A 1 7   ? 5.534   -1.566  -4.047  1.00 0.00 ? 25  ASN A CA   5  
ATOM 8913  C C    . ASN A 1 7   ? 4.667   -0.316  -3.924  1.00 0.00 ? 25  ASN A C    5  
ATOM 8914  O O    . ASN A 1 7   ? 3.593   -0.351  -3.321  1.00 0.00 ? 25  ASN A O    5  
ATOM 8915  C CB   . ASN A 1 7   ? 5.221   -2.290  -5.357  1.00 0.00 ? 25  ASN A CB   5  
ATOM 8916  C CG   . ASN A 1 7   ? 5.521   -3.775  -5.283  1.00 0.00 ? 25  ASN A CG   5  
ATOM 8917  O OD1  . ASN A 1 7   ? 6.513   -4.189  -4.681  1.00 0.00 ? 25  ASN A OD1  5  
ATOM 8918  N ND2  . ASN A 1 7   ? 4.665   -4.583  -5.896  1.00 0.00 ? 25  ASN A ND2  5  
ATOM 8919  H H    . ASN A 1 7   ? 4.636   -3.150  -2.969  1.00 0.00 ? 25  ASN A H    5  
ATOM 8920  H HA   . ASN A 1 7   ? 6.573   -1.270  -4.049  1.00 0.00 ? 25  ASN A HA   5  
ATOM 8921  H HB3  . ASN A 1 7   ? 5.813   -1.861  -6.151  1.00 0.00 ? 25  ASN A HB3  5  
ATOM 8922  H HD21 . ASN A 1 7   ? 3.898   -4.183  -6.356  1.00 0.00 ? 25  ASN A HD21 5  
ATOM 8923  H HD22 . ASN A 1 7   ? 4.835   -5.548  -5.863  1.00 0.00 ? 25  ASN A HD22 5  
ATOM 8924  N N    . ILE A 1 8   ? 5.140   0.784   -4.498  1.00 0.00 ? 26  ILE A N    5  
ATOM 8925  C CA   . ILE A 1 8   ? 4.406   2.044   -4.454  1.00 0.00 ? 26  ILE A CA   5  
ATOM 8926  C C    . ILE A 1 8   ? 4.408   2.729   -5.816  1.00 0.00 ? 26  ILE A C    5  
ATOM 8927  O O    . ILE A 1 8   ? 5.466   3.033   -6.370  1.00 0.00 ? 26  ILE A O    5  
ATOM 8928  C CB   . ILE A 1 8   ? 5.000   3.005   -3.407  1.00 0.00 ? 26  ILE A CB   5  
ATOM 8929  C CG1  . ILE A 1 8   ? 5.179   2.286   -2.067  1.00 0.00 ? 26  ILE A CG1  5  
ATOM 8930  C CG2  . ILE A 1 8   ? 4.109   4.227   -3.244  1.00 0.00 ? 26  ILE A CG2  5  
ATOM 8931  C CD1  . ILE A 1 8   ? 3.876   1.842   -1.441  1.00 0.00 ? 26  ILE A CD1  5  
ATOM 8932  H H    . ILE A 1 8   ? 6.001   0.749   -4.963  1.00 0.00 ? 26  ILE A H    5  
ATOM 8933  H HA   . ILE A 1 8   ? 3.386   1.825   -4.174  1.00 0.00 ? 26  ILE A HA   5  
ATOM 8934  H HB   . ILE A 1 8   ? 5.963   3.336   -3.760  1.00 0.00 ? 26  ILE A HB   5  
ATOM 8935  H HG13 . ILE A 1 8   ? 5.671   2.952   -1.373  1.00 0.00 ? 26  ILE A HG13 5  
ATOM 8936  H HG21 . ILE A 1 8   ? 4.594   4.942   -2.595  1.00 0.00 ? 26  ILE A HG21 5  
ATOM 8937  H HG22 . ILE A 1 8   ? 3.937   4.677   -4.210  1.00 0.00 ? 26  ILE A HG22 5  
ATOM 8938  H HG23 . ILE A 1 8   ? 3.166   3.930   -2.811  1.00 0.00 ? 26  ILE A HG23 5  
ATOM 8939  H HD11 . ILE A 1 8   ? 3.949   0.804   -1.153  1.00 0.00 ? 26  ILE A HD11 5  
ATOM 8940  H HD12 . ILE A 1 8   ? 3.672   2.445   -0.569  1.00 0.00 ? 26  ILE A HD12 5  
ATOM 8941  H HD13 . ILE A 1 8   ? 3.074   1.961   -2.156  1.00 0.00 ? 26  ILE A HD13 5  
ATOM 8942  N N    . THR A 1 9   ? 3.217   2.973   -6.351  1.00 0.00 ? 27  THR A N    5  
ATOM 8943  C CA   . THR A 1 9   ? 3.081   3.624   -7.648  1.00 0.00 ? 27  THR A CA   5  
ATOM 8944  C C    . THR A 1 9   ? 3.212   5.138   -7.521  1.00 0.00 ? 27  THR A C    5  
ATOM 8945  O O    . THR A 1 9   ? 3.552   5.654   -6.455  1.00 0.00 ? 27  THR A O    5  
ATOM 8946  C CB   . THR A 1 9   ? 1.728   3.291   -8.304  1.00 0.00 ? 27  THR A CB   5  
ATOM 8947  O OG1  . THR A 1 9   ? 1.756   3.646   -9.692  1.00 0.00 ? 27  THR A OG1  5  
ATOM 8948  C CG2  . THR A 1 9   ? 0.594   4.029   -7.610  1.00 0.00 ? 27  THR A CG2  5  
ATOM 8949  H H    . THR A 1 9   ? 2.410   2.709   -5.861  1.00 0.00 ? 27  THR A H    5  
ATOM 8950  H HA   . THR A 1 9   ? 3.869   3.258   -8.290  1.00 0.00 ? 27  THR A HA   5  
ATOM 8951  H HB   . THR A 1 9   ? 1.554   2.229   -8.216  1.00 0.00 ? 27  THR A HB   5  
ATOM 8952  H HG1  . THR A 1 9   ? 1.748   2.848   -10.226 1.00 0.00 ? 27  THR A HG1  5  
ATOM 8953  H HG21 . THR A 1 9   ? 0.732   5.094   -7.725  1.00 0.00 ? 27  THR A HG21 5  
ATOM 8954  H HG22 . THR A 1 9   ? 0.590   3.778   -6.560  1.00 0.00 ? 27  THR A HG22 5  
ATOM 8955  H HG23 . THR A 1 9   ? -0.349  3.740   -8.053  1.00 0.00 ? 27  THR A HG23 5  
ATOM 8956  N N    . CYS A 1 10  ? 2.938   5.845   -8.612  1.00 0.00 ? 28  CYS A N    5  
ATOM 8957  C CA   . CYS A 1 10  ? 3.024   7.301   -8.622  1.00 0.00 ? 28  CYS A CA   5  
ATOM 8958  C C    . CYS A 1 10  ? 2.148   7.905   -7.529  1.00 0.00 ? 28  CYS A C    5  
ATOM 8959  O O    . CYS A 1 10  ? 1.251   7.246   -7.001  1.00 0.00 ? 28  CYS A O    5  
ATOM 8960  C CB   . CYS A 1 10  ? 2.606   7.847   -9.988  1.00 0.00 ? 28  CYS A CB   5  
ATOM 8961  S SG   . CYS A 1 10  ? 3.492   7.097   -11.392 1.00 0.00 ? 28  CYS A SG   5  
ATOM 8962  H H    . CYS A 1 10  ? 2.671   5.376   -9.431  1.00 0.00 ? 28  CYS A H    5  
ATOM 8963  H HA   . CYS A 1 10  ? 4.052   7.573   -8.434  1.00 0.00 ? 28  CYS A HA   5  
ATOM 8964  H HB3  . CYS A 1 10  ? 2.790   8.911   -10.014 1.00 0.00 ? 28  CYS A HB3  5  
ATOM 8965  N N    . ARG A 1 11  ? 2.411   9.164   -7.195  1.00 0.00 ? 29  ARG A N    5  
ATOM 8966  C CA   . ARG A 1 11  ? 1.648   9.858   -6.166  1.00 0.00 ? 29  ARG A CA   5  
ATOM 8967  C C    . ARG A 1 11  ? 0.839   11.003  -6.768  1.00 0.00 ? 29  ARG A C    5  
ATOM 8968  O O    . ARG A 1 11  ? 1.360   12.097  -6.987  1.00 0.00 ? 29  ARG A O    5  
ATOM 8969  C CB   . ARG A 1 11  ? 2.585   10.396  -5.081  1.00 0.00 ? 29  ARG A CB   5  
ATOM 8970  C CG   . ARG A 1 11  ? 3.489   9.335   -4.477  1.00 0.00 ? 29  ARG A CG   5  
ATOM 8971  C CD   . ARG A 1 11  ? 4.360   9.909   -3.370  1.00 0.00 ? 29  ARG A CD   5  
ATOM 8972  N NE   . ARG A 1 11  ? 4.810   8.880   -2.438  1.00 0.00 ? 29  ARG A NE   5  
ATOM 8973  C CZ   . ARG A 1 11  ? 5.235   9.140   -1.207  1.00 0.00 ? 29  ARG A CZ   5  
ATOM 8974  N NH1  . ARG A 1 11  ? 5.270   10.389  -0.762  1.00 0.00 ? 29  ARG A NH1  5  
ATOM 8975  N NH2  . ARG A 1 11  ? 5.628   8.150   -0.416  1.00 0.00 ? 29  ARG A NH2  5  
ATOM 8976  H H    . ARG A 1 11  ? 3.138   9.638   -7.652  1.00 0.00 ? 29  ARG A H    5  
ATOM 8977  H HA   . ARG A 1 11  ? 0.968   9.147   -5.721  1.00 0.00 ? 29  ARG A HA   5  
ATOM 8978  H HB3  . ARG A 1 11  ? 1.989   10.823  -4.289  1.00 0.00 ? 29  ARG A HB3  5  
ATOM 8979  H HG3  . ARG A 1 11  ? 4.125   8.934   -5.252  1.00 0.00 ? 29  ARG A HG3  5  
ATOM 8980  H HD3  . ARG A 1 11  ? 3.788   10.649  -2.830  1.00 0.00 ? 29  ARG A HD3  5  
ATOM 8981  H HE   . ARG A 1 11  ? 4.791   7.950   -2.744  1.00 0.00 ? 29  ARG A HE   5  
ATOM 8982  H HH11 . ARG A 1 11  ? 4.974   11.137  -1.356  1.00 0.00 ? 29  ARG A HH11 5  
ATOM 8983  H HH12 . ARG A 1 11  ? 5.590   10.582  0.165   1.00 0.00 ? 29  ARG A HH12 5  
ATOM 8984  H HH21 . ARG A 1 11  ? 5.603   7.206   -0.746  1.00 0.00 ? 29  ARG A HH21 5  
ATOM 8985  H HH22 . ARG A 1 11  ? 5.948   8.345   0.511   1.00 0.00 ? 29  ARG A HH22 5  
ATOM 8986  N N    . PHE A 1 12  ? -0.437  10.743  -7.032  1.00 0.00 ? 30  PHE A N    5  
ATOM 8987  C CA   . PHE A 1 12  ? -1.318  11.751  -7.610  1.00 0.00 ? 30  PHE A CA   5  
ATOM 8988  C C    . PHE A 1 12  ? -1.811  12.721  -6.541  1.00 0.00 ? 30  PHE A C    5  
ATOM 8989  O O    . PHE A 1 12  ? -2.724  12.409  -5.779  1.00 0.00 ? 30  PHE A O    5  
ATOM 8990  C CB   . PHE A 1 12  ? -2.511  11.084  -8.299  1.00 0.00 ? 30  PHE A CB   5  
ATOM 8991  C CG   . PHE A 1 12  ? -2.122  10.198  -9.446  1.00 0.00 ? 30  PHE A CG   5  
ATOM 8992  C CD1  . PHE A 1 12  ? -1.551  10.733  -10.589 1.00 0.00 ? 30  PHE A CD1  5  
ATOM 8993  C CD2  . PHE A 1 12  ? -2.326  8.829   -9.383  1.00 0.00 ? 30  PHE A CD2  5  
ATOM 8994  C CE1  . PHE A 1 12  ? -1.192  9.921   -11.649 1.00 0.00 ? 30  PHE A CE1  5  
ATOM 8995  C CE2  . PHE A 1 12  ? -1.969  8.011   -10.439 1.00 0.00 ? 30  PHE A CE2  5  
ATOM 8996  C CZ   . PHE A 1 12  ? -1.400  8.557   -11.573 1.00 0.00 ? 30  PHE A CZ   5  
ATOM 8997  H H    . PHE A 1 12  ? -0.794  9.852   -6.835  1.00 0.00 ? 30  PHE A H    5  
ATOM 8998  H HA   . PHE A 1 12  ? -0.753  12.302  -8.346  1.00 0.00 ? 30  PHE A HA   5  
ATOM 8999  H HB3  . PHE A 1 12  ? -3.173  11.847  -8.676  1.00 0.00 ? 30  PHE A HB3  5  
ATOM 9000  H HD1  . PHE A 1 12  ? -1.385  11.799  -10.650 1.00 0.00 ? 30  PHE A HD1  5  
ATOM 9001  H HD2  . PHE A 1 12  ? -2.771  8.399   -8.496  1.00 0.00 ? 30  PHE A HD2  5  
ATOM 9002  H HE1  . PHE A 1 12  ? -0.747  10.351  -12.533 1.00 0.00 ? 30  PHE A HE1  5  
ATOM 9003  H HE2  . PHE A 1 12  ? -2.135  6.945   -10.376 1.00 0.00 ? 30  PHE A HE2  5  
ATOM 9004  H HZ   . PHE A 1 12  ? -1.123  7.921   -12.399 1.00 0.00 ? 30  PHE A HZ   5  
ATOM 9005  N N    . ALA A 1 13  ? -1.198  13.899  -6.490  1.00 0.00 ? 31  ALA A N    5  
ATOM 9006  C CA   . ALA A 1 13  ? -1.574  14.916  -5.515  1.00 0.00 ? 31  ALA A CA   5  
ATOM 9007  C C    . ALA A 1 13  ? -1.490  14.370  -4.094  1.00 0.00 ? 31  ALA A C    5  
ATOM 9008  O O    . ALA A 1 13  ? -2.166  14.859  -3.190  1.00 0.00 ? 31  ALA A O    5  
ATOM 9009  C CB   . ALA A 1 13  ? -2.978  15.430  -5.804  1.00 0.00 ? 31  ALA A CB   5  
ATOM 9010  H H    . ALA A 1 13  ? -0.476  14.090  -7.125  1.00 0.00 ? 31  ALA A H    5  
ATOM 9011  H HA   . ALA A 1 13  ? -0.886  15.744  -5.614  1.00 0.00 ? 31  ALA A HA   5  
ATOM 9012  H HB1  . ALA A 1 13  ? -3.223  16.215  -5.104  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 9013  H HB2  . ALA A 1 13  ? -3.017  15.819  -6.810  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 9014  H HB3  . ALA A 1 13  ? -3.684  14.621  -5.702  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 9015  N N    . GLY A 1 14  ? -0.657  13.352  -3.904  1.00 0.00 ? 32  GLY A N    5  
ATOM 9016  C CA   . GLY A 1 14  ? -0.501  12.757  -2.590  1.00 0.00 ? 32  GLY A CA   5  
ATOM 9017  C C    . GLY A 1 14  ? -1.231  11.434  -2.461  1.00 0.00 ? 32  GLY A C    5  
ATOM 9018  O O    . GLY A 1 14  ? -0.930  10.633  -1.576  1.00 0.00 ? 32  GLY A O    5  
ATOM 9019  H H    . GLY A 1 14  ? -0.144  13.002  -4.662  1.00 0.00 ? 32  GLY A H    5  
ATOM 9020  H HA2  . GLY A 1 14  ? 0.550   12.596  -2.401  1.00 0.00 ? 32  GLY A HA2  5  
ATOM 9021  H HA3  . GLY A 1 14  ? -0.888  13.442  -1.849  1.00 0.00 ? 32  GLY A HA3  5  
ATOM 9022  N N    . VAL A 1 15  ? -2.196  11.205  -3.346  1.00 0.00 ? 33  VAL A N    5  
ATOM 9023  C CA   . VAL A 1 15  ? -2.971  9.971   -3.329  1.00 0.00 ? 33  VAL A CA   5  
ATOM 9024  C C    . VAL A 1 15  ? -2.288  8.879   -4.146  1.00 0.00 ? 33  VAL A C    5  
ATOM 9025  O O    . VAL A 1 15  ? -1.769  9.136   -5.233  1.00 0.00 ? 33  VAL A O    5  
ATOM 9026  C CB   . VAL A 1 15  ? -4.393  10.193  -3.879  1.00 0.00 ? 33  VAL A CB   5  
ATOM 9027  C CG1  . VAL A 1 15  ? -5.245  8.951   -3.674  1.00 0.00 ? 33  VAL A CG1  5  
ATOM 9028  C CG2  . VAL A 1 15  ? -5.035  11.405  -3.220  1.00 0.00 ? 33  VAL A CG2  5  
ATOM 9029  H H    . VAL A 1 15  ? -2.389  11.881  -4.029  1.00 0.00 ? 33  VAL A H    5  
ATOM 9030  H HA   . VAL A 1 15  ? -3.052  9.642   -2.304  1.00 0.00 ? 33  VAL A HA   5  
ATOM 9031  H HB   . VAL A 1 15  ? -4.321  10.382  -4.940  1.00 0.00 ? 33  VAL A HB   5  
ATOM 9032  H HG11 . VAL A 1 15  ? -4.686  8.077   -3.971  1.00 0.00 ? 33  VAL A HG11 5  
ATOM 9033  H HG12 . VAL A 1 15  ? -5.517  8.868   -2.631  1.00 0.00 ? 33  VAL A HG12 5  
ATOM 9034  H HG13 . VAL A 1 15  ? -6.141  9.025   -4.275  1.00 0.00 ? 33  VAL A HG13 5  
ATOM 9035  H HG21 . VAL A 1 15  ? -4.525  12.300  -3.544  1.00 0.00 ? 33  VAL A HG21 5  
ATOM 9036  H HG22 . VAL A 1 15  ? -6.075  11.461  -3.506  1.00 0.00 ? 33  VAL A HG22 5  
ATOM 9037  H HG23 . VAL A 1 15  ? -4.960  11.315  -2.148  1.00 0.00 ? 33  VAL A HG23 5  
ATOM 9038  N N    . PHE A 1 16  ? -2.291  7.662   -3.615  1.00 0.00 ? 34  PHE A N    5  
ATOM 9039  C CA   . PHE A 1 16  ? -1.670  6.530   -4.294  1.00 0.00 ? 34  PHE A CA   5  
ATOM 9040  C C    . PHE A 1 16  ? -2.060  5.214   -3.627  1.00 0.00 ? 34  PHE A C    5  
ATOM 9041  O O    . PHE A 1 16  ? -2.488  5.194   -2.472  1.00 0.00 ? 34  PHE A O    5  
ATOM 9042  C CB   . PHE A 1 16  ? -0.147  6.682   -4.295  1.00 0.00 ? 34  PHE A CB   5  
ATOM 9043  C CG   . PHE A 1 16  ? 0.459   6.654   -2.922  1.00 0.00 ? 34  PHE A CG   5  
ATOM 9044  C CD1  . PHE A 1 16  ? 0.338   7.744   -2.074  1.00 0.00 ? 34  PHE A CD1  5  
ATOM 9045  C CD2  . PHE A 1 16  ? 1.151   5.539   -2.477  1.00 0.00 ? 34  PHE A CD2  5  
ATOM 9046  C CE1  . PHE A 1 16  ? 0.895   7.721   -0.810  1.00 0.00 ? 34  PHE A CE1  5  
ATOM 9047  C CE2  . PHE A 1 16  ? 1.709   5.511   -1.213  1.00 0.00 ? 34  PHE A CE2  5  
ATOM 9048  C CZ   . PHE A 1 16  ? 1.581   6.604   -0.378  1.00 0.00 ? 34  PHE A CZ   5  
ATOM 9049  H H    . PHE A 1 16  ? -2.720  7.520   -2.746  1.00 0.00 ? 34  PHE A H    5  
ATOM 9050  H HA   . PHE A 1 16  ? -2.024  6.522   -5.313  1.00 0.00 ? 34  PHE A HA   5  
ATOM 9051  H HB3  . PHE A 1 16  ? 0.112   7.623   -4.756  1.00 0.00 ? 34  PHE A HB3  5  
ATOM 9052  H HD1  . PHE A 1 16  ? -0.199  8.620   -2.411  1.00 0.00 ? 34  PHE A HD1  5  
ATOM 9053  H HD2  . PHE A 1 16  ? 1.251   4.683   -3.129  1.00 0.00 ? 34  PHE A HD2  5  
ATOM 9054  H HE1  . PHE A 1 16  ? 0.794   8.578   -0.159  1.00 0.00 ? 34  PHE A HE1  5  
ATOM 9055  H HE2  . PHE A 1 16  ? 2.245   4.635   -0.879  1.00 0.00 ? 34  PHE A HE2  5  
ATOM 9056  H HZ   . PHE A 1 16  ? 2.017   6.584   0.609   1.00 0.00 ? 34  PHE A HZ   5  
ATOM 9057  N N    . HIS A 1 17  ? -1.912  4.118   -4.363  1.00 0.00 ? 35  HIS A N    5  
ATOM 9058  C CA   . HIS A 1 17  ? -2.249  2.796   -3.844  1.00 0.00 ? 35  HIS A CA   5  
ATOM 9059  C C    . HIS A 1 17  ? -0.998  2.069   -3.358  1.00 0.00 ? 35  HIS A C    5  
ATOM 9060  O O    . HIS A 1 17  ? 0.099   2.284   -3.876  1.00 0.00 ? 35  HIS A O    5  
ATOM 9061  C CB   . HIS A 1 17  ? -2.952  1.968   -4.918  1.00 0.00 ? 35  HIS A CB   5  
ATOM 9062  C CG   . HIS A 1 17  ? -2.012  1.345   -5.904  1.00 0.00 ? 35  HIS A CG   5  
ATOM 9063  N ND1  . HIS A 1 17  ? -1.752  1.888   -7.145  1.00 0.00 ? 35  HIS A ND1  5  
ATOM 9064  C CD2  . HIS A 1 17  ? -1.267  0.217   -5.826  1.00 0.00 ? 35  HIS A CD2  5  
ATOM 9065  C CE1  . HIS A 1 17  ? -0.890  1.121   -7.787  1.00 0.00 ? 35  HIS A CE1  5  
ATOM 9066  N NE2  . HIS A 1 17  ? -0.578  0.101   -7.008  1.00 0.00 ? 35  HIS A NE2  5  
ATOM 9067  H H    . HIS A 1 17  ? -1.566  4.199   -5.276  1.00 0.00 ? 35  HIS A H    5  
ATOM 9068  H HA   . HIS A 1 17  ? -2.919  2.930   -3.009  1.00 0.00 ? 35  HIS A HA   5  
ATOM 9069  H HB3  . HIS A 1 17  ? -3.634  2.602   -5.465  1.00 0.00 ? 35  HIS A HB3  5  
ATOM 9070  H HD1  . HIS A 1 17  ? -2.143  2.712   -7.501  1.00 0.00 ? 35  HIS A HD1  5  
ATOM 9071  H HD2  . HIS A 1 17  ? -1.220  -0.466  -4.988  1.00 0.00 ? 35  HIS A HD2  5  
ATOM 9072  H HE1  . HIS A 1 17  ? -0.503  1.298   -8.780  1.00 0.00 ? 35  HIS A HE1  5  
ATOM 9073  N N    . VAL A 1 18  ? -1.171  1.206   -2.361  1.00 0.00 ? 36  VAL A N    5  
ATOM 9074  C CA   . VAL A 1 18  ? -0.057  0.446   -1.808  1.00 0.00 ? 36  VAL A CA   5  
ATOM 9075  C C    . VAL A 1 18  ? -0.123  -1.016  -2.234  1.00 0.00 ? 36  VAL A C    5  
ATOM 9076  O O    . VAL A 1 18  ? -1.099  -1.710  -1.956  1.00 0.00 ? 36  VAL A O    5  
ATOM 9077  C CB   . VAL A 1 18  ? -0.038  0.519   -0.269  1.00 0.00 ? 36  VAL A CB   5  
ATOM 9078  C CG1  . VAL A 1 18  ? 1.178   -0.206  0.286   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 9079  C CG2  . VAL A 1 18  ? -0.062  1.968   0.194   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 9080  H H    . VAL A 1 18  ? -2.069  1.077   -1.991  1.00 0.00 ? 36  VAL A H    5  
ATOM 9081  H HA   . VAL A 1 18  ? 0.860   0.878   -2.179  1.00 0.00 ? 36  VAL A HA   5  
ATOM 9082  H HB   . VAL A 1 18  ? -0.925  0.029   0.105   1.00 0.00 ? 36  VAL A HB   5  
ATOM 9083  H HG11 . VAL A 1 18  ? 0.965   -1.263  0.356   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 9084  H HG12 . VAL A 1 18  ? 2.022   -0.052  -0.373  1.00 0.00 ? 36  VAL A HG12 5  
ATOM 9085  H HG13 . VAL A 1 18  ? 1.411   0.180   1.267   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 9086  H HG21 . VAL A 1 18  ? -1.079  2.328   0.199   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 9087  H HG22 . VAL A 1 18  ? 0.348   2.034   1.193   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 9088  H HG23 . VAL A 1 18  ? 0.531   2.572   -0.478  1.00 0.00 ? 36  VAL A HG23 5  
ATOM 9089  N N    . GLU A 1 19  ? 0.923   -1.477  -2.913  1.00 0.00 ? 37  GLU A N    5  
ATOM 9090  C CA   . GLU A 1 19  ? 0.984   -2.858  -3.379  1.00 0.00 ? 37  GLU A CA   5  
ATOM 9091  C C    . GLU A 1 19  ? 1.973   -3.669  -2.548  1.00 0.00 ? 37  GLU A C    5  
ATOM 9092  O O    . GLU A 1 19  ? 2.878   -3.115  -1.923  1.00 0.00 ? 37  GLU A O    5  
ATOM 9093  C CB   . GLU A 1 19  ? 1.382   -2.904  -4.856  1.00 0.00 ? 37  GLU A CB   5  
ATOM 9094  C CG   . GLU A 1 19  ? 0.809   -4.096  -5.603  1.00 0.00 ? 37  GLU A CG   5  
ATOM 9095  C CD   . GLU A 1 19  ? 0.916   -3.947  -7.107  1.00 0.00 ? 37  GLU A CD   5  
ATOM 9096  O OE1  . GLU A 1 19  ? 1.128   -2.811  -7.578  1.00 0.00 ? 37  GLU A OE1  5  
ATOM 9097  O OE2  . GLU A 1 19  ? 0.789   -4.969  -7.815  1.00 0.00 ? 37  GLU A OE2  5  
ATOM 9098  H H    . GLU A 1 19  ? 1.673   -0.874  -3.104  1.00 0.00 ? 37  GLU A H    5  
ATOM 9099  H HA   . GLU A 1 19  ? 0.000   -3.288  -3.266  1.00 0.00 ? 37  GLU A HA   5  
ATOM 9100  H HB3  . GLU A 1 19  ? 2.459   -2.946  -4.924  1.00 0.00 ? 37  GLU A HB3  5  
ATOM 9101  H HG3  . GLU A 1 19  ? -0.232  -4.204  -5.339  1.00 0.00 ? 37  GLU A HG3  5  
ATOM 9102  N N    . LYS A 1 20  ? 1.794   -4.986  -2.546  1.00 0.00 ? 38  LYS A N    5  
ATOM 9103  C CA   . LYS A 1 20  ? 2.670   -5.876  -1.792  1.00 0.00 ? 38  LYS A CA   5  
ATOM 9104  C C    . LYS A 1 20  ? 3.198   -6.999  -2.681  1.00 0.00 ? 38  LYS A C    5  
ATOM 9105  O O    . LYS A 1 20  ? 2.887   -7.060  -3.869  1.00 0.00 ? 38  LYS A O    5  
ATOM 9106  C CB   . LYS A 1 20  ? 1.923   -6.467  -0.594  1.00 0.00 ? 38  LYS A CB   5  
ATOM 9107  C CG   . LYS A 1 20  ? 2.770   -6.560  0.663   1.00 0.00 ? 38  LYS A CG   5  
ATOM 9108  C CD   . LYS A 1 20  ? 2.393   -7.771  1.500   1.00 0.00 ? 38  LYS A CD   5  
ATOM 9109  C CE   . LYS A 1 20  ? 0.979   -7.653  2.046   1.00 0.00 ? 38  LYS A CE   5  
ATOM 9110  N NZ   . LYS A 1 20  ? 0.880   -6.614  3.107   1.00 0.00 ? 38  LYS A NZ   5  
ATOM 9111  H H    . LYS A 1 20  ? 1.055   -5.368  -3.063  1.00 0.00 ? 38  LYS A H    5  
ATOM 9112  H HA   . LYS A 1 20  ? 3.506   -5.294  -1.434  1.00 0.00 ? 38  LYS A HA   5  
ATOM 9113  H HB3  . LYS A 1 20  ? 1.585   -7.461  -0.850  1.00 0.00 ? 38  LYS A HB3  5  
ATOM 9114  H HG3  . LYS A 1 20  ? 2.622   -5.667  1.252   1.00 0.00 ? 38  LYS A HG3  5  
ATOM 9115  H HD3  . LYS A 1 20  ? 3.084   -7.855  2.328   1.00 0.00 ? 38  LYS A HD3  5  
ATOM 9116  H HE3  . LYS A 1 20  ? 0.686   -8.607  2.460   1.00 0.00 ? 38  LYS A HE3  5  
ATOM 9117  H HZ1  . LYS A 1 20  ? 1.741   -6.615  3.691   1.00 0.00 ? 38  LYS A HZ1  5  
ATOM 9118  H HZ2  . LYS A 1 20  ? 0.061   -6.805  3.721   1.00 0.00 ? 38  LYS A HZ2  5  
ATOM 9119  H HZ3  . LYS A 1 20  ? 0.766   -5.674  2.679   1.00 0.00 ? 38  LYS A HZ3  5  
ATOM 9120  N N    . ASN A 1 21  ? 3.995   -7.886  -2.094  1.00 0.00 ? 39  ASN A N    5  
ATOM 9121  C CA   . ASN A 1 21  ? 4.564   -9.007  -2.833  1.00 0.00 ? 39  ASN A CA   5  
ATOM 9122  C C    . ASN A 1 21  ? 3.540   -9.601  -3.795  1.00 0.00 ? 39  ASN A C    5  
ATOM 9123  O O    . ASN A 1 21  ? 3.614   -9.391  -5.005  1.00 0.00 ? 39  ASN A O    5  
ATOM 9124  C CB   . ASN A 1 21  ? 5.056   -10.086 -1.865  1.00 0.00 ? 39  ASN A CB   5  
ATOM 9125  C CG   . ASN A 1 21  ? 6.527   -9.934  -1.530  1.00 0.00 ? 39  ASN A CG   5  
ATOM 9126  O OD1  . ASN A 1 21  ? 6.916   -9.959  -0.362  1.00 0.00 ? 39  ASN A OD1  5  
ATOM 9127  N ND2  . ASN A 1 21  ? 7.354   -9.776  -2.557  1.00 0.00 ? 39  ASN A ND2  5  
ATOM 9128  H H    . ASN A 1 21  ? 4.206   -7.784  -1.142  1.00 0.00 ? 39  ASN A H    5  
ATOM 9129  H HA   . ASN A 1 21  ? 5.403   -8.637  -3.402  1.00 0.00 ? 39  ASN A HA   5  
ATOM 9130  H HB3  . ASN A 1 21  ? 4.904   -11.056 -2.310  1.00 0.00 ? 39  ASN A HB3  5  
ATOM 9131  H HD21 . ASN A 1 21  ? 6.974   -9.765  -3.461  1.00 0.00 ? 39  ASN A HD21 5  
ATOM 9132  H HD22 . ASN A 1 21  ? 8.311   -9.677  -2.370  1.00 0.00 ? 39  ASN A HD22 5  
ATOM 9133  N N    . GLY A 1 22  ? 2.582   -10.344 -3.248  1.00 0.00 ? 40  GLY A N    5  
ATOM 9134  C CA   . GLY A 1 22  ? 1.556   -10.956 -4.070  1.00 0.00 ? 40  GLY A CA   5  
ATOM 9135  C C    . GLY A 1 22  ? 0.477   -9.972  -4.480  1.00 0.00 ? 40  GLY A C    5  
ATOM 9136  O O    . GLY A 1 22  ? 0.690   -8.760  -4.447  1.00 0.00 ? 40  GLY A O    5  
ATOM 9137  H H    . GLY A 1 22  ? 2.573   -10.477 -2.275  1.00 0.00 ? 40  GLY A H    5  
ATOM 9138  H HA2  . GLY A 1 22  ? 2.016   -11.360 -4.959  1.00 0.00 ? 40  GLY A HA2  5  
ATOM 9139  H HA3  . GLY A 1 22  ? 1.098   -11.762 -3.515  1.00 0.00 ? 40  GLY A HA3  5  
ATOM 9140  N N    . ARG A 1 23  ? -0.681  -10.495 -4.868  1.00 0.00 ? 41  ARG A N    5  
ATOM 9141  C CA   . ARG A 1 23  ? -1.795  -9.654  -5.289  1.00 0.00 ? 41  ARG A CA   5  
ATOM 9142  C C    . ARG A 1 23  ? -2.318  -8.819  -4.122  1.00 0.00 ? 41  ARG A C    5  
ATOM 9143  O O    . ARG A 1 23  ? -1.783  -8.878  -3.017  1.00 0.00 ? 41  ARG A O    5  
ATOM 9144  C CB   . ARG A 1 23  ? -2.924  -10.514 -5.859  1.00 0.00 ? 41  ARG A CB   5  
ATOM 9145  C CG   . ARG A 1 23  ? -2.536  -11.273 -7.119  1.00 0.00 ? 41  ARG A CG   5  
ATOM 9146  C CD   . ARG A 1 23  ? -3.603  -12.279 -7.515  1.00 0.00 ? 41  ARG A CD   5  
ATOM 9147  N NE   . ARG A 1 23  ? -3.772  -13.323 -6.508  1.00 0.00 ? 41  ARG A NE   5  
ATOM 9148  C CZ   . ARG A 1 23  ? -2.978  -14.384 -6.408  1.00 0.00 ? 41  ARG A CZ   5  
ATOM 9149  N NH1  . ARG A 1 23  ? -1.966  -14.538 -7.250  1.00 0.00 ? 41  ARG A NH1  5  
ATOM 9150  N NH2  . ARG A 1 23  ? -3.196  -15.292 -5.466  1.00 0.00 ? 41  ARG A NH2  5  
ATOM 9151  H H    . ARG A 1 23  ? -0.790  -11.469 -4.872  1.00 0.00 ? 41  ARG A H    5  
ATOM 9152  H HA   . ARG A 1 23  ? -1.437  -8.989  -6.060  1.00 0.00 ? 41  ARG A HA   5  
ATOM 9153  H HB3  . ARG A 1 23  ? -3.763  -9.876  -6.095  1.00 0.00 ? 41  ARG A HB3  5  
ATOM 9154  H HG3  . ARG A 1 23  ? -1.608  -11.797 -6.940  1.00 0.00 ? 41  ARG A HG3  5  
ATOM 9155  H HD3  . ARG A 1 23  ? -3.319  -12.737 -8.450  1.00 0.00 ? 41  ARG A HD3  5  
ATOM 9156  H HE   . ARG A 1 23  ? -4.515  -13.229 -5.875  1.00 0.00 ? 41  ARG A HE   5  
ATOM 9157  H HH11 . ARG A 1 23  ? -1.799  -13.856 -7.961  1.00 0.00 ? 41  ARG A HH11 5  
ATOM 9158  H HH12 . ARG A 1 23  ? -1.369  -15.338 -7.172  1.00 0.00 ? 41  ARG A HH12 5  
ATOM 9159  H HH21 . ARG A 1 23  ? -3.958  -15.178 -4.828  1.00 0.00 ? 41  ARG A HH21 5  
ATOM 9160  H HH22 . ARG A 1 23  ? -2.598  -16.088 -5.391  1.00 0.00 ? 41  ARG A HH22 5  
ATOM 9161  N N    . TYR A 1 24  ? -3.363  -8.042  -4.380  1.00 0.00 ? 42  TYR A N    5  
ATOM 9162  C CA   . TYR A 1 24  ? -3.956  -7.193  -3.354  1.00 0.00 ? 42  TYR A CA   5  
ATOM 9163  C C    . TYR A 1 24  ? -4.350  -8.014  -2.128  1.00 0.00 ? 42  TYR A C    5  
ATOM 9164  O O    . TYR A 1 24  ? -5.228  -8.872  -2.198  1.00 0.00 ? 42  TYR A O    5  
ATOM 9165  C CB   . TYR A 1 24  ? -5.182  -6.466  -3.908  1.00 0.00 ? 42  TYR A CB   5  
ATOM 9166  C CG   . TYR A 1 24  ? -4.930  -5.781  -5.232  1.00 0.00 ? 42  TYR A CG   5  
ATOM 9167  C CD1  . TYR A 1 24  ? -3.751  -5.086  -5.466  1.00 0.00 ? 42  TYR A CD1  5  
ATOM 9168  C CD2  . TYR A 1 24  ? -5.875  -5.826  -6.250  1.00 0.00 ? 42  TYR A CD2  5  
ATOM 9169  C CE1  . TYR A 1 24  ? -3.516  -4.459  -6.673  1.00 0.00 ? 42  TYR A CE1  5  
ATOM 9170  C CE2  . TYR A 1 24  ? -5.649  -5.202  -7.462  1.00 0.00 ? 42  TYR A CE2  5  
ATOM 9171  C CZ   . TYR A 1 24  ? -4.468  -4.519  -7.669  1.00 0.00 ? 42  TYR A CZ   5  
ATOM 9172  O OH   . TYR A 1 24  ? -4.240  -3.896  -8.873  1.00 0.00 ? 42  TYR A OH   5  
ATOM 9173  H H    . TYR A 1 24  ? -3.746  -8.039  -5.282  1.00 0.00 ? 42  TYR A H    5  
ATOM 9174  H HA   . TYR A 1 24  ? -3.217  -6.461  -3.061  1.00 0.00 ? 42  TYR A HA   5  
ATOM 9175  H HB3  . TYR A 1 24  ? -5.496  -5.713  -3.200  1.00 0.00 ? 42  TYR A HB3  5  
ATOM 9176  H HD1  . TYR A 1 24  ? -3.006  -5.041  -4.683  1.00 0.00 ? 42  TYR A HD1  5  
ATOM 9177  H HD2  . TYR A 1 24  ? -6.798  -6.362  -6.085  1.00 0.00 ? 42  TYR A HD2  5  
ATOM 9178  H HE1  . TYR A 1 24  ? -2.592  -3.925  -6.836  1.00 0.00 ? 42  TYR A HE1  5  
ATOM 9179  H HE2  . TYR A 1 24  ? -6.395  -5.250  -8.242  1.00 0.00 ? 42  TYR A HE2  5  
ATOM 9180  H HH   . TYR A 1 24  ? -4.229  -4.551  -9.576  1.00 0.00 ? 42  TYR A HH   5  
ATOM 9181  N N    . SER A 1 25  ? -3.692  -7.741  -1.007  1.00 0.00 ? 43  SER A N    5  
ATOM 9182  C CA   . SER A 1 25  ? -3.969  -8.455  0.235   1.00 0.00 ? 43  SER A CA   5  
ATOM 9183  C C    . SER A 1 25  ? -4.041  -7.488  1.413   1.00 0.00 ? 43  SER A C    5  
ATOM 9184  O O    . SER A 1 25  ? -3.320  -7.640  2.399   1.00 0.00 ? 43  SER A O    5  
ATOM 9185  C CB   . SER A 1 25  ? -2.893  -9.511  0.492   1.00 0.00 ? 43  SER A CB   5  
ATOM 9186  O OG   . SER A 1 25  ? -3.387  -10.554 1.313   1.00 0.00 ? 43  SER A OG   5  
ATOM 9187  H H    . SER A 1 25  ? -3.002  -7.045  -1.013  1.00 0.00 ? 43  SER A H    5  
ATOM 9188  H HA   . SER A 1 25  ? -4.925  -8.946  0.128   1.00 0.00 ? 43  SER A HA   5  
ATOM 9189  H HB3  . SER A 1 25  ? -2.050  -9.049  0.986   1.00 0.00 ? 43  SER A HB3  5  
ATOM 9190  H HG   . SER A 1 25  ? -3.765  -11.244 0.762   1.00 0.00 ? 43  SER A HG   5  
ATOM 9191  N N    . ILE A 1 26  ? -4.917  -6.495  1.302   1.00 0.00 ? 44  ILE A N    5  
ATOM 9192  C CA   . ILE A 1 26  ? -5.085  -5.504  2.358   1.00 0.00 ? 44  ILE A CA   5  
ATOM 9193  C C    . ILE A 1 26  ? -6.549  -5.373  2.761   1.00 0.00 ? 44  ILE A C    5  
ATOM 9194  O O    . ILE A 1 26  ? -7.447  -5.496  1.928   1.00 0.00 ? 44  ILE A O    5  
ATOM 9195  C CB   . ILE A 1 26  ? -4.559  -4.124  1.923   1.00 0.00 ? 44  ILE A CB   5  
ATOM 9196  C CG1  . ILE A 1 26  ? -3.123  -4.240  1.406   1.00 0.00 ? 44  ILE A CG1  5  
ATOM 9197  C CG2  . ILE A 1 26  ? -4.632  -3.140  3.081   1.00 0.00 ? 44  ILE A CG2  5  
ATOM 9198  C CD1  . ILE A 1 26  ? -3.035  -4.498  -0.082  1.00 0.00 ? 44  ILE A CD1  5  
ATOM 9199  H H    . ILE A 1 26  ? -5.462  -6.426  0.492   1.00 0.00 ? 44  ILE A H    5  
ATOM 9200  H HA   . ILE A 1 26  ? -4.515  -5.831  3.215   1.00 0.00 ? 44  ILE A HA   5  
ATOM 9201  H HB   . ILE A 1 26  ? -5.190  -3.755  1.129   1.00 0.00 ? 44  ILE A HB   5  
ATOM 9202  H HG13 . ILE A 1 26  ? -2.630  -5.057  1.915   1.00 0.00 ? 44  ILE A HG13 5  
ATOM 9203  H HG21 . ILE A 1 26  ? -4.158  -3.571  3.951   1.00 0.00 ? 44  ILE A HG21 5  
ATOM 9204  H HG22 . ILE A 1 26  ? -4.122  -2.228  2.811   1.00 0.00 ? 44  ILE A HG22 5  
ATOM 9205  H HG23 . ILE A 1 26  ? -5.665  -2.921  3.304   1.00 0.00 ? 44  ILE A HG23 5  
ATOM 9206  H HD11 . ILE A 1 26  ? -2.678  -3.609  -0.581  1.00 0.00 ? 44  ILE A HD11 5  
ATOM 9207  H HD12 . ILE A 1 26  ? -2.354  -5.315  -0.267  1.00 0.00 ? 44  ILE A HD12 5  
ATOM 9208  H HD13 . ILE A 1 26  ? -4.016  -4.752  -0.461  1.00 0.00 ? 44  ILE A HD13 5  
ATOM 9209  N N    . SER A 1 27  ? -6.784  -5.120  4.045   1.00 0.00 ? 45  SER A N    5  
ATOM 9210  C CA   . SER A 1 27  ? -8.140  -4.976  4.560   1.00 0.00 ? 45  SER A CA   5  
ATOM 9211  C C    . SER A 1 27  ? -8.429  -3.523  4.926   1.00 0.00 ? 45  SER A C    5  
ATOM 9212  O O    . SER A 1 27  ? -7.513  -2.708  5.052   1.00 0.00 ? 45  SER A O    5  
ATOM 9213  C CB   . SER A 1 27  ? -8.343  -5.872  5.784   1.00 0.00 ? 45  SER A CB   5  
ATOM 9214  O OG   . SER A 1 27  ? -7.707  -7.127  5.606   1.00 0.00 ? 45  SER A OG   5  
ATOM 9215  H H    . SER A 1 27  ? -6.026  -5.034  4.661   1.00 0.00 ? 45  SER A H    5  
ATOM 9216  H HA   . SER A 1 27  ? -8.825  -5.281  3.783   1.00 0.00 ? 45  SER A HA   5  
ATOM 9217  H HB3  . SER A 1 27  ? -9.401  -6.035  5.935   1.00 0.00 ? 45  SER A HB3  5  
ATOM 9218  H HG   . SER A 1 27  ? -8.206  -7.804  6.069   1.00 0.00 ? 45  SER A HG   5  
ATOM 9219  N N    . ARG A 1 28  ? -9.708  -3.206  5.097   1.00 0.00 ? 46  ARG A N    5  
ATOM 9220  C CA   . ARG A 1 28  ? -10.119 -1.851  5.448   1.00 0.00 ? 46  ARG A CA   5  
ATOM 9221  C C    . ARG A 1 28  ? -9.563  -1.450  6.812   1.00 0.00 ? 46  ARG A C    5  
ATOM 9222  O O    . ARG A 1 28  ? -9.151  -0.309  7.017   1.00 0.00 ? 46  ARG A O    5  
ATOM 9223  C CB   . ARG A 1 28  ? -11.644 -1.743  5.454   1.00 0.00 ? 46  ARG A CB   5  
ATOM 9224  C CG   . ARG A 1 28  ? -12.326 -2.788  6.324   1.00 0.00 ? 46  ARG A CG   5  
ATOM 9225  C CD   . ARG A 1 28  ? -13.835 -2.609  6.331   1.00 0.00 ? 46  ARG A CD   5  
ATOM 9226  N NE   . ARG A 1 28  ? -14.232 -1.337  6.930   1.00 0.00 ? 46  ARG A NE   5  
ATOM 9227  C CZ   . ARG A 1 28  ? -15.475 -0.868  6.901   1.00 0.00 ? 46  ARG A CZ   5  
ATOM 9228  N NH1  . ARG A 1 28  ? -16.436 -1.562  6.306   1.00 0.00 ? 46  ARG A NH1  5  
ATOM 9229  N NH2  . ARG A 1 28  ? -15.759 0.298   7.468   1.00 0.00 ? 46  ARG A NH2  5  
ATOM 9230  H H    . ARG A 1 28  ? -10.393 -3.897  4.983   1.00 0.00 ? 46  ARG A H    5  
ATOM 9231  H HA   . ARG A 1 28  ? -9.722  -1.179  4.701   1.00 0.00 ? 46  ARG A HA   5  
ATOM 9232  H HB3  . ARG A 1 28  ? -12.005 -1.857  4.443   1.00 0.00 ? 46  ARG A HB3  5  
ATOM 9233  H HG3  . ARG A 1 28  ? -11.956 -2.697  7.335   1.00 0.00 ? 46  ARG A HG3  5  
ATOM 9234  H HD3  . ARG A 1 28  ? -14.277 -3.416  6.895   1.00 0.00 ? 46  ARG A HD3  5  
ATOM 9235  H HE   . ARG A 1 28  ? -13.539 -0.808  7.374   1.00 0.00 ? 46  ARG A HE   5  
ATOM 9236  H HH11 . ARG A 1 28  ? -16.225 -2.441  5.878   1.00 0.00 ? 46  ARG A HH11 5  
ATOM 9237  H HH12 . ARG A 1 28  ? -17.371 -1.207  6.287   1.00 0.00 ? 46  ARG A HH12 5  
ATOM 9238  H HH21 . ARG A 1 28  ? -15.037 0.824   7.918   1.00 0.00 ? 46  ARG A HH21 5  
ATOM 9239  H HH22 . ARG A 1 28  ? -16.694 0.650   7.446   1.00 0.00 ? 46  ARG A HH22 5  
ATOM 9240  N N    . THR A 1 29  ? -9.558  -2.400  7.745   1.00 0.00 ? 47  THR A N    5  
ATOM 9241  C CA   . THR A 1 29  ? -9.055  -2.147  9.089   1.00 0.00 ? 47  THR A CA   5  
ATOM 9242  C C    . THR A 1 29  ? -7.538  -2.005  9.092   1.00 0.00 ? 47  THR A C    5  
ATOM 9243  O O    . THR A 1 29  ? -6.968  -1.354  9.966   1.00 0.00 ? 47  THR A O    5  
ATOM 9244  C CB   . THR A 1 29  ? -9.457  -3.273  10.059  1.00 0.00 ? 47  THR A CB   5  
ATOM 9245  O OG1  . THR A 1 29  ? -9.233  -4.549  9.449   1.00 0.00 ? 47  THR A OG1  5  
ATOM 9246  C CG2  . THR A 1 29  ? -10.920 -3.146  10.459  1.00 0.00 ? 47  THR A CG2  5  
ATOM 9247  H H    . THR A 1 29  ? -9.899  -3.290  7.521   1.00 0.00 ? 47  THR A H    5  
ATOM 9248  H HA   . THR A 1 29  ? -9.494  -1.223  9.440   1.00 0.00 ? 47  THR A HA   5  
ATOM 9249  H HB   . THR A 1 29  ? -8.848  -3.195  10.950  1.00 0.00 ? 47  THR A HB   5  
ATOM 9250  H HG1  . THR A 1 29  ? -8.615  -5.055  9.982   1.00 0.00 ? 47  THR A HG1  5  
ATOM 9251  H HG21 . THR A 1 29  ? -11.152 -3.886  11.210  1.00 0.00 ? 47  THR A HG21 5  
ATOM 9252  H HG22 . THR A 1 29  ? -11.545 -3.305  9.592   1.00 0.00 ? 47  THR A HG22 5  
ATOM 9253  H HG23 . THR A 1 29  ? -11.099 -2.160  10.858  1.00 0.00 ? 47  THR A HG23 5  
ATOM 9254  N N    . GLU A 1 30  ? -6.889  -2.620  8.108   1.00 0.00 ? 48  GLU A N    5  
ATOM 9255  C CA   . GLU A 1 30  ? -5.436  -2.561  7.998   1.00 0.00 ? 48  GLU A CA   5  
ATOM 9256  C C    . GLU A 1 30  ? -5.000  -1.355  7.173   1.00 0.00 ? 48  GLU A C    5  
ATOM 9257  O O    . GLU A 1 30  ? -3.877  -0.870  7.307   1.00 0.00 ? 48  GLU A O    5  
ATOM 9258  C CB   . GLU A 1 30  ? -4.899  -3.848  7.365   1.00 0.00 ? 48  GLU A CB   5  
ATOM 9259  C CG   . GLU A 1 30  ? -5.068  -5.075  8.244   1.00 0.00 ? 48  GLU A CG   5  
ATOM 9260  C CD   . GLU A 1 30  ? -4.413  -6.309  7.654   1.00 0.00 ? 48  GLU A CD   5  
ATOM 9261  O OE1  . GLU A 1 30  ? -3.249  -6.208  7.213   1.00 0.00 ? 48  GLU A OE1  5  
ATOM 9262  O OE2  . GLU A 1 30  ? -5.064  -7.374  7.633   1.00 0.00 ? 48  GLU A OE2  5  
ATOM 9263  H H    . GLU A 1 30  ? -7.399  -3.124  7.440   1.00 0.00 ? 48  GLU A H    5  
ATOM 9264  H HA   . GLU A 1 30  ? -5.032  -2.466  8.995   1.00 0.00 ? 48  GLU A HA   5  
ATOM 9265  H HB3  . GLU A 1 30  ? -3.845  -3.719  7.160   1.00 0.00 ? 48  GLU A HB3  5  
ATOM 9266  H HG3  . GLU A 1 30  ? -6.122  -5.269  8.369   1.00 0.00 ? 48  GLU A HG3  5  
ATOM 9267  N N    . ALA A 1 31  ? -5.897  -0.874  6.318   1.00 0.00 ? 49  ALA A N    5  
ATOM 9268  C CA   . ALA A 1 31  ? -5.608  0.277   5.471   1.00 0.00 ? 49  ALA A CA   5  
ATOM 9269  C C    . ALA A 1 31  ? -5.081  1.446   6.298   1.00 0.00 ? 49  ALA A C    5  
ATOM 9270  O O    . ALA A 1 31  ? -4.078  2.066   5.944   1.00 0.00 ? 49  ALA A O    5  
ATOM 9271  C CB   . ALA A 1 31  ? -6.850  0.691   4.701   1.00 0.00 ? 49  ALA A CB   5  
ATOM 9272  H H    . ALA A 1 31  ? -6.776  -1.303  6.257   1.00 0.00 ? 49  ALA A H    5  
ATOM 9273  H HA   . ALA A 1 31  ? -4.852  -0.016  4.758   1.00 0.00 ? 49  ALA A HA   5  
ATOM 9274  H HB1  . ALA A 1 31  ? -6.587  1.444   3.971   1.00 0.00 ? 49  ALA A HB1  5  
ATOM 9275  H HB2  . ALA A 1 31  ? -7.265  -0.169  4.195   1.00 0.00 ? 49  ALA A HB2  5  
ATOM 9276  H HB3  . ALA A 1 31  ? -7.583  1.094   5.385   1.00 0.00 ? 49  ALA A HB3  5  
ATOM 9277  N N    . ALA A 1 32  ? -5.764  1.743   7.398   1.00 0.00 ? 50  ALA A N    5  
ATOM 9278  C CA   . ALA A 1 32  ? -5.364  2.837   8.275   1.00 0.00 ? 50  ALA A CA   5  
ATOM 9279  C C    . ALA A 1 32  ? -3.926  2.661   8.750   1.00 0.00 ? 50  ALA A C    5  
ATOM 9280  O O    . ALA A 1 32  ? -3.045  3.445   8.398   1.00 0.00 ? 50  ALA A O    5  
ATOM 9281  C CB   . ALA A 1 32  ? -6.308  2.933   9.463   1.00 0.00 ? 50  ALA A CB   5  
ATOM 9282  H H    . ALA A 1 32  ? -6.555  1.212   7.628   1.00 0.00 ? 50  ALA A H    5  
ATOM 9283  H HA   . ALA A 1 32  ? -5.437  3.757   7.713   1.00 0.00 ? 50  ALA A HA   5  
ATOM 9284  H HB1  . ALA A 1 32  ? -6.425  1.956   9.909   1.00 0.00 ? 50  ALA A HB1  5  
ATOM 9285  H HB2  . ALA A 1 32  ? -5.898  3.615   10.194  1.00 0.00 ? 50  ALA A HB2  5  
ATOM 9286  H HB3  . ALA A 1 32  ? -7.269  3.295   9.132   1.00 0.00 ? 50  ALA A HB3  5  
ATOM 9287  N N    . ASP A 1 33  ? -3.696  1.628   9.553   1.00 0.00 ? 51  ASP A N    5  
ATOM 9288  C CA   . ASP A 1 33  ? -2.364  1.349   10.078  1.00 0.00 ? 51  ASP A CA   5  
ATOM 9289  C C    . ASP A 1 33  ? -1.336  1.301   8.953   1.00 0.00 ? 51  ASP A C    5  
ATOM 9290  O O    . ASP A 1 33  ? -0.173  1.660   9.142   1.00 0.00 ? 51  ASP A O    5  
ATOM 9291  C CB   . ASP A 1 33  ? -2.362  0.025   10.844  1.00 0.00 ? 51  ASP A CB   5  
ATOM 9292  C CG   . ASP A 1 33  ? -1.005  -0.296  11.440  1.00 0.00 ? 51  ASP A CG   5  
ATOM 9293  O OD1  . ASP A 1 33  ? -0.533  0.483   12.295  1.00 0.00 ? 51  ASP A OD1  5  
ATOM 9294  O OD2  . ASP A 1 33  ? -0.414  -1.325  11.051  1.00 0.00 ? 51  ASP A OD2  5  
ATOM 9295  H H    . ASP A 1 33  ? -4.439  1.038   9.798   1.00 0.00 ? 51  ASP A H    5  
ATOM 9296  H HA   . ASP A 1 33  ? -2.100  2.147   10.754  1.00 0.00 ? 51  ASP A HA   5  
ATOM 9297  H HB3  . ASP A 1 33  ? -2.638  -0.773  10.172  1.00 0.00 ? 51  ASP A HB3  5  
ATOM 9298  N N    . LEU A 1 34  ? -1.771  0.853   7.780   1.00 0.00 ? 52  LEU A N    5  
ATOM 9299  C CA   . LEU A 1 34  ? -0.887  0.756   6.622   1.00 0.00 ? 52  LEU A CA   5  
ATOM 9300  C C    . LEU A 1 34  ? -0.393  2.135   6.198   1.00 0.00 ? 52  LEU A C    5  
ATOM 9301  O O    . LEU A 1 34  ? 0.811   2.372   6.098   1.00 0.00 ? 52  LEU A O    5  
ATOM 9302  C CB   . LEU A 1 34  ? -1.613  0.081   5.456   1.00 0.00 ? 52  LEU A CB   5  
ATOM 9303  C CG   . LEU A 1 34  ? -0.747  -0.298  4.256   1.00 0.00 ? 52  LEU A CG   5  
ATOM 9304  C CD1  . LEU A 1 34  ? -1.261  -1.575  3.609   1.00 0.00 ? 52  LEU A CD1  5  
ATOM 9305  C CD2  . LEU A 1 34  ? -0.710  0.838   3.244   1.00 0.00 ? 52  LEU A CD2  5  
ATOM 9306  H H    . LEU A 1 34  ? -2.707  0.580   7.688   1.00 0.00 ? 52  LEU A H    5  
ATOM 9307  H HA   . LEU A 1 34  ? -0.037  0.154   6.903   1.00 0.00 ? 52  LEU A HA   5  
ATOM 9308  H HB3  . LEU A 1 34  ? -2.382  0.758   5.111   1.00 0.00 ? 52  LEU A HB3  5  
ATOM 9309  H HG   . LEU A 1 34  ? 0.265   -0.480  4.592   1.00 0.00 ? 52  LEU A HG   5  
ATOM 9310  H HD11 . LEU A 1 34  ? -2.273  -1.762  3.935   1.00 0.00 ? 52  LEU A HD11 5  
ATOM 9311  H HD12 . LEU A 1 34  ? -0.632  -2.404  3.898   1.00 0.00 ? 52  LEU A HD12 5  
ATOM 9312  H HD13 . LEU A 1 34  ? -1.242  -1.467  2.535   1.00 0.00 ? 52  LEU A HD13 5  
ATOM 9313  H HD21 . LEU A 1 34  ? -0.095  1.639   3.626   1.00 0.00 ? 52  LEU A HD21 5  
ATOM 9314  H HD22 . LEU A 1 34  ? -1.713  1.202   3.076   1.00 0.00 ? 52  LEU A HD22 5  
ATOM 9315  H HD23 . LEU A 1 34  ? -0.298  0.477   2.313   1.00 0.00 ? 52  LEU A HD23 5  
ATOM 9316  N N    . CYS A 1 35  ? -1.331  3.044   5.949   1.00 0.00 ? 53  CYS A N    5  
ATOM 9317  C CA   . CYS A 1 35  ? -0.993  4.401   5.538   1.00 0.00 ? 53  CYS A CA   5  
ATOM 9318  C C    . CYS A 1 35  ? -0.131  5.091   6.592   1.00 0.00 ? 53  CYS A C    5  
ATOM 9319  O O    . CYS A 1 35  ? 0.859   5.747   6.269   1.00 0.00 ? 53  CYS A O    5  
ATOM 9320  C CB   . CYS A 1 35  ? -2.264  5.214   5.291   1.00 0.00 ? 53  CYS A CB   5  
ATOM 9321  S SG   . CYS A 1 35  ? -3.316  4.562   3.954   1.00 0.00 ? 53  CYS A SG   5  
ATOM 9322  H H    . CYS A 1 35  ? -2.275  2.796   6.045   1.00 0.00 ? 53  CYS A H    5  
ATOM 9323  H HA   . CYS A 1 35  ? -0.432  4.338   4.618   1.00 0.00 ? 53  CYS A HA   5  
ATOM 9324  H HB3  . CYS A 1 35  ? -1.991  6.225   5.031   1.00 0.00 ? 53  CYS A HB3  5  
ATOM 9325  N N    . LYS A 1 36  ? -0.515  4.936   7.854   1.00 0.00 ? 54  LYS A N    5  
ATOM 9326  C CA   . LYS A 1 36  ? 0.222   5.542   8.958   1.00 0.00 ? 54  LYS A CA   5  
ATOM 9327  C C    . LYS A 1 36  ? 1.657   5.028   9.000   1.00 0.00 ? 54  LYS A C    5  
ATOM 9328  O O    . LYS A 1 36  ? 2.594   5.796   9.218   1.00 0.00 ? 54  LYS A O    5  
ATOM 9329  C CB   . LYS A 1 36  ? -0.476  5.244   10.286  1.00 0.00 ? 54  LYS A CB   5  
ATOM 9330  C CG   . LYS A 1 36  ? 0.197   5.893   11.486  1.00 0.00 ? 54  LYS A CG   5  
ATOM 9331  C CD   . LYS A 1 36  ? 1.257   4.987   12.087  1.00 0.00 ? 54  LYS A CD   5  
ATOM 9332  C CE   . LYS A 1 36  ? 1.572   5.377   13.524  1.00 0.00 ? 54  LYS A CE   5  
ATOM 9333  N NZ   . LYS A 1 36  ? 2.663   4.543   14.097  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9334  H H    . LYS A 1 36  ? -1.314  4.400   8.049   1.00 0.00 ? 54  LYS A H    5  
ATOM 9335  H HA   . LYS A 1 36  ? 0.237   6.609   8.801   1.00 0.00 ? 54  LYS A HA   5  
ATOM 9336  H HB3  . LYS A 1 36  ? -0.488  4.175   10.443  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9337  H HG3  . LYS A 1 36  ? -0.553  6.104   12.237  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9338  H HD3  . LYS A 1 36  ? 2.159   5.062   11.496  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9339  H HE3  . LYS A 1 36  ? 0.680   5.248   14.121  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9340  H HZ1  . LYS A 1 36  ? 2.484   4.363   15.107  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9341  H HZ2  . LYS A 1 36  ? 3.576   5.033   14.002  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9342  H HZ3  . LYS A 1 36  ? 2.719   3.632   13.599  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9343  N N    . ALA A 1 37  ? 1.823   3.727   8.790   1.00 0.00 ? 55  ALA A N    5  
ATOM 9344  C CA   . ALA A 1 37  ? 3.145   3.113   8.800   1.00 0.00 ? 55  ALA A CA   5  
ATOM 9345  C C    . ALA A 1 37  ? 3.956   3.536   7.580   1.00 0.00 ? 55  ALA A C    5  
ATOM 9346  O O    . ALA A 1 37  ? 5.157   3.279   7.501   1.00 0.00 ? 55  ALA A O    5  
ATOM 9347  C CB   . ALA A 1 37  ? 3.022   1.597   8.855   1.00 0.00 ? 55  ALA A CB   5  
ATOM 9348  H H    . ALA A 1 37  ? 1.036   3.166   8.621   1.00 0.00 ? 55  ALA A H    5  
ATOM 9349  H HA   . ALA A 1 37  ? 3.658   3.441   9.693   1.00 0.00 ? 55  ALA A HA   5  
ATOM 9350  H HB1  . ALA A 1 37  ? 2.618   1.235   7.921   1.00 0.00 ? 55  ALA A HB1  5  
ATOM 9351  H HB2  . ALA A 1 37  ? 3.998   1.164   9.019   1.00 0.00 ? 55  ALA A HB2  5  
ATOM 9352  H HB3  . ALA A 1 37  ? 2.363   1.319   9.665   1.00 0.00 ? 55  ALA A HB3  5  
ATOM 9353  N N    . PHE A 1 38  ? 3.292   4.186   6.629   1.00 0.00 ? 56  PHE A N    5  
ATOM 9354  C CA   . PHE A 1 38  ? 3.951   4.642   5.412   1.00 0.00 ? 56  PHE A CA   5  
ATOM 9355  C C    . PHE A 1 38  ? 4.092   6.161   5.406   1.00 0.00 ? 56  PHE A C    5  
ATOM 9356  O O    . PHE A 1 38  ? 4.253   6.777   4.353   1.00 0.00 ? 56  PHE A O    5  
ATOM 9357  C CB   . PHE A 1 38  ? 3.167   4.186   4.179   1.00 0.00 ? 56  PHE A CB   5  
ATOM 9358  C CG   . PHE A 1 38  ? 3.736   2.958   3.527   1.00 0.00 ? 56  PHE A CG   5  
ATOM 9359  C CD1  . PHE A 1 38  ? 5.048   2.938   3.085   1.00 0.00 ? 56  PHE A CD1  5  
ATOM 9360  C CD2  . PHE A 1 38  ? 2.957   1.825   3.356   1.00 0.00 ? 56  PHE A CD2  5  
ATOM 9361  C CE1  . PHE A 1 38  ? 5.575   1.810   2.484   1.00 0.00 ? 56  PHE A CE1  5  
ATOM 9362  C CE2  . PHE A 1 38  ? 3.478   0.695   2.756   1.00 0.00 ? 56  PHE A CE2  5  
ATOM 9363  C CZ   . PHE A 1 38  ? 4.789   0.687   2.319   1.00 0.00 ? 56  PHE A CZ   5  
ATOM 9364  H H    . PHE A 1 38  ? 2.334   4.360   6.750   1.00 0.00 ? 56  PHE A H    5  
ATOM 9365  H HA   . PHE A 1 38  ? 4.936   4.202   5.384   1.00 0.00 ? 56  PHE A HA   5  
ATOM 9366  H HB3  . PHE A 1 38  ? 3.164   4.981   3.450   1.00 0.00 ? 56  PHE A HB3  5  
ATOM 9367  H HD1  . PHE A 1 38  ? 5.666   3.817   3.214   1.00 0.00 ? 56  PHE A HD1  5  
ATOM 9368  H HD2  . PHE A 1 38  ? 1.931   1.830   3.695   1.00 0.00 ? 56  PHE A HD2  5  
ATOM 9369  H HE1  . PHE A 1 38  ? 6.601   1.808   2.144   1.00 0.00 ? 56  PHE A HE1  5  
ATOM 9370  H HE2  . PHE A 1 38  ? 2.861   -0.183  2.628   1.00 0.00 ? 56  PHE A HE2  5  
ATOM 9371  H HZ   . PHE A 1 38  ? 5.198   -0.195  1.851   1.00 0.00 ? 56  PHE A HZ   5  
ATOM 9372  N N    . ASN A 1 39  ? 4.026   6.760   6.591   1.00 0.00 ? 57  ASN A N    5  
ATOM 9373  C CA   . ASN A 1 39  ? 4.145   8.207   6.724   1.00 0.00 ? 57  ASN A CA   5  
ATOM 9374  C C    . ASN A 1 39  ? 3.029   8.917   5.962   1.00 0.00 ? 57  ASN A C    5  
ATOM 9375  O O    . ASN A 1 39  ? 3.258   9.935   5.309   1.00 0.00 ? 57  ASN A O    5  
ATOM 9376  C CB   . ASN A 1 39  ? 5.507   8.678   6.209   1.00 0.00 ? 57  ASN A CB   5  
ATOM 9377  C CG   . ASN A 1 39  ? 5.766   10.140  6.517   1.00 0.00 ? 57  ASN A CG   5  
ATOM 9378  O OD1  . ASN A 1 39  ? 4.970   10.797  7.188   1.00 0.00 ? 57  ASN A OD1  5  
ATOM 9379  N ND2  . ASN A 1 39  ? 6.887   10.658  6.027   1.00 0.00 ? 57  ASN A ND2  5  
ATOM 9380  H H    . ASN A 1 39  ? 3.895   6.216   7.395   1.00 0.00 ? 57  ASN A H    5  
ATOM 9381  H HA   . ASN A 1 39  ? 4.061   8.452   7.772   1.00 0.00 ? 57  ASN A HA   5  
ATOM 9382  H HB3  . ASN A 1 39  ? 5.549   8.541   5.139   1.00 0.00 ? 57  ASN A HB3  5  
ATOM 9383  H HD21 . ASN A 1 39  ? 7.475   10.075  5.503   1.00 0.00 ? 57  ASN A HD21 5  
ATOM 9384  H HD22 . ASN A 1 39  ? 7.081   11.601  6.211   1.00 0.00 ? 57  ASN A HD22 5  
ATOM 9385  N N    . SER A 1 40  ? 1.820   8.371   6.051   1.00 0.00 ? 58  SER A N    5  
ATOM 9386  C CA   . SER A 1 40  ? 0.668   8.949   5.369   1.00 0.00 ? 58  SER A CA   5  
ATOM 9387  C C    . SER A 1 40  ? -0.630  8.562   6.070   1.00 0.00 ? 58  SER A C    5  
ATOM 9388  O O    . SER A 1 40  ? -0.624  7.802   7.038   1.00 0.00 ? 58  SER A O    5  
ATOM 9389  C CB   . SER A 1 40  ? 0.630   8.489   3.910   1.00 0.00 ? 58  SER A CB   5  
ATOM 9390  O OG   . SER A 1 40  ? 1.765   8.951   3.199   1.00 0.00 ? 58  SER A OG   5  
ATOM 9391  H H    . SER A 1 40  ? 1.700   7.560   6.588   1.00 0.00 ? 58  SER A H    5  
ATOM 9392  H HA   . SER A 1 40  ? 0.773   10.024  5.396   1.00 0.00 ? 58  SER A HA   5  
ATOM 9393  H HB3  . SER A 1 40  ? -0.260  8.878   3.436   1.00 0.00 ? 58  SER A HB3  5  
ATOM 9394  H HG   . SER A 1 40  ? 2.038   8.288   2.562   1.00 0.00 ? 58  SER A HG   5  
ATOM 9395  N N    . THR A 1 41  ? -1.744  9.091   5.573   1.00 0.00 ? 59  THR A N    5  
ATOM 9396  C CA   . THR A 1 41  ? -3.051  8.804   6.151   1.00 0.00 ? 59  THR A CA   5  
ATOM 9397  C C    . THR A 1 41  ? -4.055  8.412   5.073   1.00 0.00 ? 59  THR A C    5  
ATOM 9398  O O    . THR A 1 41  ? -3.928  8.817   3.917   1.00 0.00 ? 59  THR A O    5  
ATOM 9399  C CB   . THR A 1 41  ? -3.598  10.013  6.933   1.00 0.00 ? 59  THR A CB   5  
ATOM 9400  O OG1  . THR A 1 41  ? -3.246  11.229  6.262   1.00 0.00 ? 59  THR A OG1  5  
ATOM 9401  C CG2  . THR A 1 41  ? -3.050  10.033  8.352   1.00 0.00 ? 59  THR A CG2  5  
ATOM 9402  H H    . THR A 1 41  ? -1.684  9.690   4.798   1.00 0.00 ? 59  THR A H    5  
ATOM 9403  H HA   . THR A 1 41  ? -2.937  7.977   6.839   1.00 0.00 ? 59  THR A HA   5  
ATOM 9404  H HB   . THR A 1 41  ? -4.674  9.934   6.980   1.00 0.00 ? 59  THR A HB   5  
ATOM 9405  H HG1  . THR A 1 41  ? -2.290  11.321  6.248   1.00 0.00 ? 59  THR A HG1  5  
ATOM 9406  H HG21 . THR A 1 41  ? -2.055  10.452  8.348   1.00 0.00 ? 59  THR A HG21 5  
ATOM 9407  H HG22 . THR A 1 41  ? -3.013  9.025   8.738   1.00 0.00 ? 59  THR A HG22 5  
ATOM 9408  H HG23 . THR A 1 41  ? -3.692  10.635  8.977   1.00 0.00 ? 59  THR A HG23 5  
ATOM 9409  N N    . LEU A 1 42  ? -5.055  7.627   5.459   1.00 0.00 ? 60  LEU A N    5  
ATOM 9410  C CA   . LEU A 1 42  ? -6.082  7.183   4.524   1.00 0.00 ? 60  LEU A CA   5  
ATOM 9411  C C    . LEU A 1 42  ? -6.661  8.362   3.749   1.00 0.00 ? 60  LEU A C    5  
ATOM 9412  O O    . LEU A 1 42  ? -6.746  9.484   4.250   1.00 0.00 ? 60  LEU A O    5  
ATOM 9413  C CB   . LEU A 1 42  ? -7.199  6.453   5.272   1.00 0.00 ? 60  LEU A CB   5  
ATOM 9414  C CG   . LEU A 1 42  ? -6.844  5.073   5.827   1.00 0.00 ? 60  LEU A CG   5  
ATOM 9415  C CD1  . LEU A 1 42  ? -7.775  4.703   6.973   1.00 0.00 ? 60  LEU A CD1  5  
ATOM 9416  C CD2  . LEU A 1 42  ? -6.906  4.024   4.727   1.00 0.00 ? 60  LEU A CD2  5  
ATOM 9417  H H    . LEU A 1 42  ? -5.103  7.339   6.393   1.00 0.00 ? 60  LEU A H    5  
ATOM 9418  H HA   . LEU A 1 42  ? -5.623  6.499   3.825   1.00 0.00 ? 60  LEU A HA   5  
ATOM 9419  H HB3  . LEU A 1 42  ? -8.030  6.334   4.592   1.00 0.00 ? 60  LEU A HB3  5  
ATOM 9420  H HG   . LEU A 1 42  ? -5.835  5.095   6.213   1.00 0.00 ? 60  LEU A HG   5  
ATOM 9421  H HD11 . LEU A 1 42  ? -7.521  5.284   7.845   1.00 0.00 ? 60  LEU A HD11 5  
ATOM 9422  H HD12 . LEU A 1 42  ? -7.668  3.651   7.196   1.00 0.00 ? 60  LEU A HD12 5  
ATOM 9423  H HD13 . LEU A 1 42  ? -8.796  4.908   6.687   1.00 0.00 ? 60  LEU A HD13 5  
ATOM 9424  H HD21 . LEU A 1 42  ? -7.911  3.634   4.659   1.00 0.00 ? 60  LEU A HD21 5  
ATOM 9425  H HD22 . LEU A 1 42  ? -6.223  3.219   4.957   1.00 0.00 ? 60  LEU A HD22 5  
ATOM 9426  H HD23 . LEU A 1 42  ? -6.630  4.473   3.785   1.00 0.00 ? 60  LEU A HD23 5  
ATOM 9427  N N    . PRO A 1 43  ? -7.071  8.106   2.498   1.00 0.00 ? 61  PRO A N    5  
ATOM 9428  C CA   . PRO A 1 43  ? -7.652  9.132   1.628   1.00 0.00 ? 61  PRO A CA   5  
ATOM 9429  C C    . PRO A 1 43  ? -9.035  9.575   2.096   1.00 0.00 ? 61  PRO A C    5  
ATOM 9430  O O    . PRO A 1 43  ? -9.618  8.973   2.998   1.00 0.00 ? 61  PRO A O    5  
ATOM 9431  C CB   . PRO A 1 43  ? -7.744  8.436   0.269   1.00 0.00 ? 61  PRO A CB   5  
ATOM 9432  C CG   . PRO A 1 43  ? -7.823  6.983   0.591   1.00 0.00 ? 61  PRO A CG   5  
ATOM 9433  C CD   . PRO A 1 43  ? -7.001  6.791   1.836   1.00 0.00 ? 61  PRO A CD   5  
ATOM 9434  H HA   . PRO A 1 43  ? -7.008  9.996   1.550   1.00 0.00 ? 61  PRO A HA   5  
ATOM 9435  H HB3  . PRO A 1 43  ? -6.866  8.664   -0.317  1.00 0.00 ? 61  PRO A HB3  5  
ATOM 9436  H HG3  . PRO A 1 43  ? -7.410  6.405   -0.221  1.00 0.00 ? 61  PRO A HG3  5  
ATOM 9437  H HD3  . PRO A 1 43  ? -5.980  6.544   1.581   1.00 0.00 ? 61  PRO A HD3  5  
ATOM 9438  N N    . THR A 1 44  ? -9.556  10.629  1.477   1.00 0.00 ? 62  THR A N    5  
ATOM 9439  C CA   . THR A 1 44  ? -10.870 11.151  1.829   1.00 0.00 ? 62  THR A CA   5  
ATOM 9440  C C    . THR A 1 44  ? -11.894 10.840  0.745   1.00 0.00 ? 62  THR A C    5  
ATOM 9441  O O    . THR A 1 44  ? -11.561 10.264  -0.292  1.00 0.00 ? 62  THR A O    5  
ATOM 9442  C CB   . THR A 1 44  ? -10.826 12.673  2.057   1.00 0.00 ? 62  THR A CB   5  
ATOM 9443  O OG1  . THR A 1 44  ? -9.705  13.240  1.370   1.00 0.00 ? 62  THR A OG1  5  
ATOM 9444  C CG2  . THR A 1 44  ? -10.733 12.996  3.541   1.00 0.00 ? 62  THR A CG2  5  
ATOM 9445  H H    . THR A 1 44  ? -9.042  11.066  0.765   1.00 0.00 ? 62  THR A H    5  
ATOM 9446  H HA   . THR A 1 44  ? -11.180 10.679  2.750   1.00 0.00 ? 62  THR A HA   5  
ATOM 9447  H HB   . THR A 1 44  ? -11.736 13.107  1.666   1.00 0.00 ? 62  THR A HB   5  
ATOM 9448  H HG1  . THR A 1 44  ? -8.897  13.012  1.835   1.00 0.00 ? 62  THR A HG1  5  
ATOM 9449  H HG21 . THR A 1 44  ? -10.389 14.011  3.669   1.00 0.00 ? 62  THR A HG21 5  
ATOM 9450  H HG22 . THR A 1 44  ? -10.039 12.317  4.014   1.00 0.00 ? 62  THR A HG22 5  
ATOM 9451  H HG23 . THR A 1 44  ? -11.708 12.889  3.994   1.00 0.00 ? 62  THR A HG23 5  
ATOM 9452  N N    . MET A 1 45  ? -13.142 11.225  0.989   1.00 0.00 ? 63  MET A N    5  
ATOM 9453  C CA   . MET A 1 45  ? -14.216 10.989  0.030   1.00 0.00 ? 63  MET A CA   5  
ATOM 9454  C C    . MET A 1 45  ? -14.109 11.945  -1.154  1.00 0.00 ? 63  MET A C    5  
ATOM 9455  O O    . MET A 1 45  ? -14.570 11.642  -2.252  1.00 0.00 ? 63  MET A O    5  
ATOM 9456  C CB   . MET A 1 45  ? -15.578 11.148  0.707   1.00 0.00 ? 63  MET A CB   5  
ATOM 9457  C CG   . MET A 1 45  ? -16.753 10.987  -0.244  1.00 0.00 ? 63  MET A CG   5  
ATOM 9458  S SD   . MET A 1 45  ? -18.344 11.215  0.573   1.00 0.00 ? 63  MET A SD   5  
ATOM 9459  C CE   . MET A 1 45  ? -19.006 9.552   0.495   1.00 0.00 ? 63  MET A CE   5  
ATOM 9460  H H    . MET A 1 45  ? -13.348 11.680  1.832   1.00 0.00 ? 63  MET A H    5  
ATOM 9461  H HA   . MET A 1 45  ? -14.120 9.975   -0.332  1.00 0.00 ? 63  MET A HA   5  
ATOM 9462  H HB3  . MET A 1 45  ? -15.635 12.131  1.151   1.00 0.00 ? 63  MET A HB3  5  
ATOM 9463  H HG3  . MET A 1 45  ? -16.721 9.995   -0.669  1.00 0.00 ? 63  MET A HG3  5  
ATOM 9464  H HE1  . MET A 1 45  ? -19.847 9.467   1.168   1.00 0.00 ? 63  MET A HE1  5  
ATOM 9465  H HE2  . MET A 1 45  ? -19.331 9.342   -0.515  1.00 0.00 ? 63  MET A HE2  5  
ATOM 9466  H HE3  . MET A 1 45  ? -18.241 8.847   0.782   1.00 0.00 ? 63  MET A HE3  5  
ATOM 9467  N N    . ALA A 1 46  ? -13.498 13.103  -0.919  1.00 0.00 ? 64  ALA A N    5  
ATOM 9468  C CA   . ALA A 1 46  ? -13.330 14.103  -1.966  1.00 0.00 ? 64  ALA A CA   5  
ATOM 9469  C C    . ALA A 1 46  ? -12.008 13.911  -2.701  1.00 0.00 ? 64  ALA A C    5  
ATOM 9470  O O    . ALA A 1 46  ? -11.932 14.084  -3.916  1.00 0.00 ? 64  ALA A O    5  
ATOM 9471  C CB   . ALA A 1 46  ? -13.410 15.502  -1.376  1.00 0.00 ? 64  ALA A CB   5  
ATOM 9472  H H    . ALA A 1 46  ? -13.152 13.287  -0.022  1.00 0.00 ? 64  ALA A H    5  
ATOM 9473  H HA   . ALA A 1 46  ? -14.141 13.988  -2.671  1.00 0.00 ? 64  ALA A HA   5  
ATOM 9474  H HB1  . ALA A 1 46  ? -13.226 15.455  -0.313  1.00 0.00 ? 64  ALA A HB1  5  
ATOM 9475  H HB2  . ALA A 1 46  ? -12.667 16.132  -1.841  1.00 0.00 ? 64  ALA A HB2  5  
ATOM 9476  H HB3  . ALA A 1 46  ? -14.393 15.912  -1.555  1.00 0.00 ? 64  ALA A HB3  5  
ATOM 9477  N N    . GLN A 1 47  ? -10.967 13.554  -1.954  1.00 0.00 ? 65  GLN A N    5  
ATOM 9478  C CA   . GLN A 1 47  ? -9.648  13.341  -2.535  1.00 0.00 ? 65  GLN A CA   5  
ATOM 9479  C C    . GLN A 1 47  ? -9.708  12.311  -3.658  1.00 0.00 ? 65  GLN A C    5  
ATOM 9480  O O    . GLN A 1 47  ? -9.120  12.502  -4.723  1.00 0.00 ? 65  GLN A O    5  
ATOM 9481  C CB   . GLN A 1 47  ? -8.661  12.884  -1.460  1.00 0.00 ? 65  GLN A CB   5  
ATOM 9482  C CG   . GLN A 1 47  ? -7.915  14.028  -0.792  1.00 0.00 ? 65  GLN A CG   5  
ATOM 9483  C CD   . GLN A 1 47  ? -7.007  14.772  -1.752  1.00 0.00 ? 65  GLN A CD   5  
ATOM 9484  O OE1  . GLN A 1 47  ? -7.464  15.603  -2.538  1.00 0.00 ? 65  GLN A OE1  5  
ATOM 9485  N NE2  . GLN A 1 47  ? -5.714  14.476  -1.694  1.00 0.00 ? 65  GLN A NE2  5  
ATOM 9486  H H    . GLN A 1 47  ? -11.090 13.432  -0.991  1.00 0.00 ? 65  GLN A H    5  
ATOM 9487  H HA   . GLN A 1 47  ? -9.311  14.281  -2.945  1.00 0.00 ? 65  GLN A HA   5  
ATOM 9488  H HB3  . GLN A 1 47  ? -7.933  12.224  -1.912  1.00 0.00 ? 65  GLN A HB3  5  
ATOM 9489  H HG3  . GLN A 1 47  ? -7.316  13.627  0.012   1.00 0.00 ? 65  GLN A HG3  5  
ATOM 9490  H HE21 . GLN A 1 47  ? -5.423  13.803  -1.043  1.00 0.00 ? 65  GLN A HE21 5  
ATOM 9491  H HE22 . GLN A 1 47  ? -5.104  14.942  -2.302  1.00 0.00 ? 65  GLN A HE22 5  
ATOM 9492  N N    . MET A 1 48  ? -10.421 11.217  -3.413  1.00 0.00 ? 66  MET A N    5  
ATOM 9493  C CA   . MET A 1 48  ? -10.558 10.155  -4.405  1.00 0.00 ? 66  MET A CA   5  
ATOM 9494  C C    . MET A 1 48  ? -11.099 10.708  -5.720  1.00 0.00 ? 66  MET A C    5  
ATOM 9495  O O    . MET A 1 48  ? -10.462 10.583  -6.764  1.00 0.00 ? 66  MET A O    5  
ATOM 9496  C CB   . MET A 1 48  ? -11.483 9.055   -3.882  1.00 0.00 ? 66  MET A CB   5  
ATOM 9497  C CG   . MET A 1 48  ? -10.897 8.270   -2.719  1.00 0.00 ? 66  MET A CG   5  
ATOM 9498  S SD   . MET A 1 48  ? -9.439  7.319   -3.188  1.00 0.00 ? 66  MET A SD   5  
ATOM 9499  C CE   . MET A 1 48  ? -10.164 6.110   -4.292  1.00 0.00 ? 66  MET A CE   5  
ATOM 9500  H H    . MET A 1 48  ? -10.867 11.120  -2.546  1.00 0.00 ? 66  MET A H    5  
ATOM 9501  H HA   . MET A 1 48  ? -9.578  9.737   -4.580  1.00 0.00 ? 66  MET A HA   5  
ATOM 9502  H HB3  . MET A 1 48  ? -11.692 8.364   -4.684  1.00 0.00 ? 66  MET A HB3  5  
ATOM 9503  H HG3  . MET A 1 48  ? -11.648 7.591   -2.346  1.00 0.00 ? 66  MET A HG3  5  
ATOM 9504  H HE1  . MET A 1 48  ? -9.378  5.573   -4.804  1.00 0.00 ? 66  MET A HE1  5  
ATOM 9505  H HE2  . MET A 1 48  ? -10.761 5.415   -3.720  1.00 0.00 ? 66  MET A HE2  5  
ATOM 9506  H HE3  . MET A 1 48  ? -10.788 6.612   -5.016  1.00 0.00 ? 66  MET A HE3  5  
ATOM 9507  N N    . GLU A 1 49  ? -12.279 11.317  -5.660  1.00 0.00 ? 67  GLU A N    5  
ATOM 9508  C CA   . GLU A 1 49  ? -12.906 11.887  -6.847  1.00 0.00 ? 67  GLU A CA   5  
ATOM 9509  C C    . GLU A 1 49  ? -12.060 13.021  -7.418  1.00 0.00 ? 67  GLU A C    5  
ATOM 9510  O O    . GLU A 1 49  ? -12.146 13.340  -8.604  1.00 0.00 ? 67  GLU A O    5  
ATOM 9511  C CB   . GLU A 1 49  ? -14.309 12.401  -6.514  1.00 0.00 ? 67  GLU A CB   5  
ATOM 9512  C CG   . GLU A 1 49  ? -15.128 11.434  -5.677  1.00 0.00 ? 67  GLU A CG   5  
ATOM 9513  C CD   . GLU A 1 49  ? -16.599 11.447  -6.042  1.00 0.00 ? 67  GLU A CD   5  
ATOM 9514  O OE1  . GLU A 1 49  ? -17.081 12.491  -6.528  1.00 0.00 ? 67  GLU A OE1  5  
ATOM 9515  O OE2  . GLU A 1 49  ? -17.269 10.413  -5.840  1.00 0.00 ? 67  GLU A OE2  5  
ATOM 9516  H H    . GLU A 1 49  ? -12.739 11.386  -4.798  1.00 0.00 ? 67  GLU A H    5  
ATOM 9517  H HA   . GLU A 1 49  ? -12.985 11.106  -7.589  1.00 0.00 ? 67  GLU A HA   5  
ATOM 9518  H HB3  . GLU A 1 49  ? -14.839 12.583  -7.438  1.00 0.00 ? 67  GLU A HB3  5  
ATOM 9519  H HG3  . GLU A 1 49  ? -15.027 11.706  -4.635  1.00 0.00 ? 67  GLU A HG3  5  
ATOM 9520  N N    . LYS A 1 50  ? -11.241 13.627  -6.564  1.00 0.00 ? 68  LYS A N    5  
ATOM 9521  C CA   . LYS A 1 50  ? -10.376 14.726  -6.982  1.00 0.00 ? 68  LYS A CA   5  
ATOM 9522  C C    . LYS A 1 50  ? -9.234  14.218  -7.855  1.00 0.00 ? 68  LYS A C    5  
ATOM 9523  O O    . LYS A 1 50  ? -8.842  14.871  -8.822  1.00 0.00 ? 68  LYS A O    5  
ATOM 9524  C CB   . LYS A 1 50  ? -9.814  15.453  -5.757  1.00 0.00 ? 68  LYS A CB   5  
ATOM 9525  C CG   . LYS A 1 50  ? -9.207  16.807  -6.081  1.00 0.00 ? 68  LYS A CG   5  
ATOM 9526  C CD   . LYS A 1 50  ? -8.940  17.612  -4.820  1.00 0.00 ? 68  LYS A CD   5  
ATOM 9527  C CE   . LYS A 1 50  ? -8.789  19.094  -5.128  1.00 0.00 ? 68  LYS A CE   5  
ATOM 9528  N NZ   . LYS A 1 50  ? -8.224  19.846  -3.973  1.00 0.00 ? 68  LYS A NZ   5  
ATOM 9529  H H    . LYS A 1 50  ? -11.217 13.328  -5.631  1.00 0.00 ? 68  LYS A H    5  
ATOM 9530  H HA   . LYS A 1 50  ? -10.973 15.418  -7.558  1.00 0.00 ? 68  LYS A HA   5  
ATOM 9531  H HB3  . LYS A 1 50  ? -9.049  14.836  -5.309  1.00 0.00 ? 68  LYS A HB3  5  
ATOM 9532  H HG3  . LYS A 1 50  ? -9.891  17.357  -6.710  1.00 0.00 ? 68  LYS A HG3  5  
ATOM 9533  H HD3  . LYS A 1 50  ? -8.029  17.254  -4.361  1.00 0.00 ? 68  LYS A HD3  5  
ATOM 9534  H HE3  . LYS A 1 50  ? -9.761  19.500  -5.368  1.00 0.00 ? 68  LYS A HE3  5  
ATOM 9535  H HZ1  . LYS A 1 50  ? -8.963  20.423  -3.526  1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 9536  H HZ2  . LYS A 1 50  ? -7.459  20.473  -4.295  1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 9537  H HZ3  . LYS A 1 50  ? -7.841  19.183  -3.269  1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 9538  N N    . ALA A 1 51  ? -8.705  13.049  -7.508  1.00 0.00 ? 69  ALA A N    5  
ATOM 9539  C CA   . ALA A 1 51  ? -7.609  12.453  -8.262  1.00 0.00 ? 69  ALA A CA   5  
ATOM 9540  C C    . ALA A 1 51  ? -8.118  11.794  -9.539  1.00 0.00 ? 69  ALA A C    5  
ATOM 9541  O O    . ALA A 1 51  ? -7.333  11.427  -10.415 1.00 0.00 ? 69  ALA A O    5  
ATOM 9542  C CB   . ALA A 1 51  ? -6.867  11.441  -7.403  1.00 0.00 ? 69  ALA A CB   5  
ATOM 9543  H H    . ALA A 1 51  ? -9.061  12.577  -6.726  1.00 0.00 ? 69  ALA A H    5  
ATOM 9544  H HA   . ALA A 1 51  ? -6.918  13.240  -8.526  1.00 0.00 ? 69  ALA A HA   5  
ATOM 9545  H HB1  . ALA A 1 51  ? -6.450  11.939  -6.539  1.00 0.00 ? 69  ALA A HB1  5  
ATOM 9546  H HB2  . ALA A 1 51  ? -7.553  10.672  -7.079  1.00 0.00 ? 69  ALA A HB2  5  
ATOM 9547  H HB3  . ALA A 1 51  ? -6.071  10.993  -7.979  1.00 0.00 ? 69  ALA A HB3  5  
ATOM 9548  N N    . LEU A 1 52  ? -9.433  11.645  -9.640  1.00 0.00 ? 70  LEU A N    5  
ATOM 9549  C CA   . LEU A 1 52  ? -10.046 11.029  -10.811 1.00 0.00 ? 70  LEU A CA   5  
ATOM 9550  C C    . LEU A 1 52  ? -9.616  11.742  -12.089 1.00 0.00 ? 70  LEU A C    5  
ATOM 9551  O O    . LEU A 1 52  ? -9.408  11.110  -13.125 1.00 0.00 ? 70  LEU A O    5  
ATOM 9552  C CB   . LEU A 1 52  ? -11.571 11.057  -10.688 1.00 0.00 ? 70  LEU A CB   5  
ATOM 9553  C CG   . LEU A 1 52  ? -12.353 10.558  -11.902 1.00 0.00 ? 70  LEU A CG   5  
ATOM 9554  C CD1  . LEU A 1 52  ? -12.499 9.045   -11.857 1.00 0.00 ? 70  LEU A CD1  5  
ATOM 9555  C CD2  . LEU A 1 52  ? -13.718 11.226  -11.970 1.00 0.00 ? 70  LEU A CD2  5  
ATOM 9556  H H    . LEU A 1 52  ? -10.008 11.957  -8.909  1.00 0.00 ? 70  LEU A H    5  
ATOM 9557  H HA   . LEU A 1 52  ? -9.717  10.003  -10.857 1.00 0.00 ? 70  LEU A HA   5  
ATOM 9558  H HB3  . LEU A 1 52  ? -11.869 12.080  -10.499 1.00 0.00 ? 70  LEU A HB3  5  
ATOM 9559  H HG   . LEU A 1 52  ? -11.809 10.812  -12.802 1.00 0.00 ? 70  LEU A HG   5  
ATOM 9560  H HD11 . LEU A 1 52  ? -13.002 8.705   -12.751 1.00 0.00 ? 70  LEU A HD11 5  
ATOM 9561  H HD12 . LEU A 1 52  ? -13.080 8.765   -10.990 1.00 0.00 ? 70  LEU A HD12 5  
ATOM 9562  H HD13 . LEU A 1 52  ? -11.522 8.590   -11.798 1.00 0.00 ? 70  LEU A HD13 5  
ATOM 9563  H HD21 . LEU A 1 52  ? -13.873 11.818  -11.080 1.00 0.00 ? 70  LEU A HD21 5  
ATOM 9564  H HD22 . LEU A 1 52  ? -14.487 10.470  -12.037 1.00 0.00 ? 70  LEU A HD22 5  
ATOM 9565  H HD23 . LEU A 1 52  ? -13.765 11.864  -12.840 1.00 0.00 ? 70  LEU A HD23 5  
ATOM 9566  N N    . SER A 1 53  ? -9.485  13.063  -12.009 1.00 0.00 ? 71  SER A N    5  
ATOM 9567  C CA   . SER A 1 53  ? -9.080  13.862  -13.160 1.00 0.00 ? 71  SER A CA   5  
ATOM 9568  C C    . SER A 1 53  ? -7.563  14.017  -13.208 1.00 0.00 ? 71  SER A C    5  
ATOM 9569  O O    . SER A 1 53  ? -7.011  14.526  -14.184 1.00 0.00 ? 71  SER A O    5  
ATOM 9570  C CB   . SER A 1 53  ? -9.745  15.239  -13.110 1.00 0.00 ? 71  SER A CB   5  
ATOM 9571  O OG   . SER A 1 53  ? -9.940  15.758  -14.414 1.00 0.00 ? 71  SER A OG   5  
ATOM 9572  H H    . SER A 1 53  ? -9.666  13.510  -11.156 1.00 0.00 ? 71  SER A H    5  
ATOM 9573  H HA   . SER A 1 53  ? -9.405  13.347  -14.052 1.00 0.00 ? 71  SER A HA   5  
ATOM 9574  H HB3  . SER A 1 53  ? -9.114  15.919  -12.556 1.00 0.00 ? 71  SER A HB3  5  
ATOM 9575  H HG   . SER A 1 53  ? -9.602  16.655  -14.456 1.00 0.00 ? 71  SER A HG   5  
ATOM 9576  N N    . ILE A 1 54  ? -6.896  13.576  -12.147 1.00 0.00 ? 72  ILE A N    5  
ATOM 9577  C CA   . ILE A 1 54  ? -5.443  13.664  -12.067 1.00 0.00 ? 72  ILE A CA   5  
ATOM 9578  C C    . ILE A 1 54  ? -4.781  12.474  -12.753 1.00 0.00 ? 72  ILE A C    5  
ATOM 9579  O O    . ILE A 1 54  ? -3.636  12.558  -13.196 1.00 0.00 ? 72  ILE A O    5  
ATOM 9580  C CB   . ILE A 1 54  ? -4.962  13.732  -10.605 1.00 0.00 ? 72  ILE A CB   5  
ATOM 9581  C CG1  . ILE A 1 54  ? -5.551  14.962  -9.910  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 9582  C CG2  . ILE A 1 54  ? -3.444  13.761  -10.548 1.00 0.00 ? 72  ILE A CG2  5  
ATOM 9583  C CD1  . ILE A 1 54  ? -5.114  15.106  -8.468  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 9584  H H    . ILE A 1 54  ? -7.393  13.180  -11.400 1.00 0.00 ? 72  ILE A H    5  
ATOM 9585  H HA   . ILE A 1 54  ? -5.137  14.571  -12.568 1.00 0.00 ? 72  ILE A HA   5  
ATOM 9586  H HB   . ILE A 1 54  ? -5.301  12.843  -10.097 1.00 0.00 ? 72  ILE A HB   5  
ATOM 9587  H HG13 . ILE A 1 54  ? -6.629  14.894  -9.924  1.00 0.00 ? 72  ILE A HG13 5  
ATOM 9588  H HG21 . ILE A 1 54  ? -3.122  13.818  -9.517  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 9589  H HG22 . ILE A 1 54  ? -3.049  12.860  -10.996 1.00 0.00 ? 72  ILE A HG22 5  
ATOM 9590  H HG23 . ILE A 1 54  ? -3.078  14.621  -11.087 1.00 0.00 ? 72  ILE A HG23 5  
ATOM 9591  H HD11 . ILE A 1 54  ? -4.171  15.634  -8.429  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 9592  H HD12 . ILE A 1 54  ? -5.860  15.660  -7.919  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 9593  H HD13 . ILE A 1 54  ? -4.995  14.127  -8.027  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 9594  N N    . GLY A 1 55  ? -5.511  11.366  -12.838 1.00 0.00 ? 73  GLY A N    5  
ATOM 9595  C CA   . GLY A 1 55  ? -4.979  10.174  -13.473 1.00 0.00 ? 73  GLY A CA   5  
ATOM 9596  C C    . GLY A 1 55  ? -5.114  8.943   -12.600 1.00 0.00 ? 73  GLY A C    5  
ATOM 9597  O O    . GLY A 1 55  ? -4.242  8.073   -12.603 1.00 0.00 ? 73  GLY A O    5  
ATOM 9598  H H    . GLY A 1 55  ? -6.418  11.357  -12.467 1.00 0.00 ? 73  GLY A H    5  
ATOM 9599  H HA2  . GLY A 1 55  ? -5.508  10.006  -14.399 1.00 0.00 ? 73  GLY A HA2  5  
ATOM 9600  H HA3  . GLY A 1 55  ? -3.933  10.333  -13.692 1.00 0.00 ? 73  GLY A HA3  5  
ATOM 9601  N N    . PHE A 1 56  ? -6.207  8.869   -11.849 1.00 0.00 ? 74  PHE A N    5  
ATOM 9602  C CA   . PHE A 1 56  ? -6.452  7.735   -10.965 1.00 0.00 ? 74  PHE A CA   5  
ATOM 9603  C C    . PHE A 1 56  ? -7.365  6.711   -11.634 1.00 0.00 ? 74  PHE A C    5  
ATOM 9604  O O    . PHE A 1 56  ? -8.580  6.728   -11.440 1.00 0.00 ? 74  PHE A O    5  
ATOM 9605  C CB   . PHE A 1 56  ? -7.077  8.212   -9.652  1.00 0.00 ? 74  PHE A CB   5  
ATOM 9606  C CG   . PHE A 1 56  ? -6.720  7.353   -8.472  1.00 0.00 ? 74  PHE A CG   5  
ATOM 9607  C CD1  . PHE A 1 56  ? -7.381  6.158   -8.242  1.00 0.00 ? 74  PHE A CD1  5  
ATOM 9608  C CD2  . PHE A 1 56  ? -5.722  7.741   -7.593  1.00 0.00 ? 74  PHE A CD2  5  
ATOM 9609  C CE1  . PHE A 1 56  ? -7.055  5.366   -7.157  1.00 0.00 ? 74  PHE A CE1  5  
ATOM 9610  C CE2  . PHE A 1 56  ? -5.390  6.954   -6.506  1.00 0.00 ? 74  PHE A CE2  5  
ATOM 9611  C CZ   . PHE A 1 56  ? -6.059  5.765   -6.288  1.00 0.00 ? 74  PHE A CZ   5  
ATOM 9612  H H    . PHE A 1 56  ? -6.866  9.594   -11.890 1.00 0.00 ? 74  PHE A H    5  
ATOM 9613  H HA   . PHE A 1 56  ? -5.502  7.269   -10.754 1.00 0.00 ? 74  PHE A HA   5  
ATOM 9614  H HB3  . PHE A 1 56  ? -8.153  8.209   -9.753  1.00 0.00 ? 74  PHE A HB3  5  
ATOM 9615  H HD1  . PHE A 1 56  ? -8.162  5.844   -8.921  1.00 0.00 ? 74  PHE A HD1  5  
ATOM 9616  H HD2  . PHE A 1 56  ? -5.200  8.672   -7.762  1.00 0.00 ? 74  PHE A HD2  5  
ATOM 9617  H HE1  . PHE A 1 56  ? -7.580  4.437   -6.990  1.00 0.00 ? 74  PHE A HE1  5  
ATOM 9618  H HE2  . PHE A 1 56  ? -4.611  7.268   -5.830  1.00 0.00 ? 74  PHE A HE2  5  
ATOM 9619  H HZ   . PHE A 1 56  ? -5.802  5.147   -5.441  1.00 0.00 ? 74  PHE A HZ   5  
ATOM 9620  N N    . GLU A 1 57  ? -6.768  5.820   -12.420 1.00 0.00 ? 75  GLU A N    5  
ATOM 9621  C CA   . GLU A 1 57  ? -7.527  4.789   -13.118 1.00 0.00 ? 75  GLU A CA   5  
ATOM 9622  C C    . GLU A 1 57  ? -7.332  3.428   -12.456 1.00 0.00 ? 75  GLU A C    5  
ATOM 9623  O O    . GLU A 1 57  ? -6.310  2.771   -12.649 1.00 0.00 ? 75  GLU A O    5  
ATOM 9624  C CB   . GLU A 1 57  ? -7.104  4.719   -14.586 1.00 0.00 ? 75  GLU A CB   5  
ATOM 9625  C CG   . GLU A 1 57  ? -5.598  4.697   -14.785 1.00 0.00 ? 75  GLU A CG   5  
ATOM 9626  C CD   . GLU A 1 57  ? -5.176  3.834   -15.960 1.00 0.00 ? 75  GLU A CD   5  
ATOM 9627  O OE1  . GLU A 1 57  ? -5.811  3.938   -17.029 1.00 0.00 ? 75  GLU A OE1  5  
ATOM 9628  O OE2  . GLU A 1 57  ? -4.212  3.055   -15.808 1.00 0.00 ? 75  GLU A OE2  5  
ATOM 9629  H H    . GLU A 1 57  ? -5.796  5.857   -12.534 1.00 0.00 ? 75  GLU A H    5  
ATOM 9630  H HA   . GLU A 1 57  ? -8.572  5.055   -13.067 1.00 0.00 ? 75  GLU A HA   5  
ATOM 9631  H HB3  . GLU A 1 57  ? -7.501  5.580   -15.104 1.00 0.00 ? 75  GLU A HB3  5  
ATOM 9632  H HG3  . GLU A 1 57  ? -5.135  4.311   -13.890 1.00 0.00 ? 75  GLU A HG3  5  
ATOM 9633  N N    . THR A 1 58  ? -8.323  3.010   -11.673 1.00 0.00 ? 76  THR A N    5  
ATOM 9634  C CA   . THR A 1 58  ? -8.261  1.728   -10.981 1.00 0.00 ? 76  THR A CA   5  
ATOM 9635  C C    . THR A 1 58  ? -9.615  1.028   -11.000 1.00 0.00 ? 76  THR A C    5  
ATOM 9636  O O    . THR A 1 58  ? -10.639 1.622   -10.660 1.00 0.00 ? 76  THR A O    5  
ATOM 9637  C CB   . THR A 1 58  ? -7.806  1.901   -9.519  1.00 0.00 ? 76  THR A CB   5  
ATOM 9638  O OG1  . THR A 1 58  ? -8.829  2.557   -8.762  1.00 0.00 ? 76  THR A OG1  5  
ATOM 9639  C CG2  . THR A 1 58  ? -6.518  2.707   -9.446  1.00 0.00 ? 76  THR A CG2  5  
ATOM 9640  H H    . THR A 1 58  ? -9.113  3.578   -11.560 1.00 0.00 ? 76  THR A H    5  
ATOM 9641  H HA   . THR A 1 58  ? -7.537  1.109   -11.491 1.00 0.00 ? 76  THR A HA   5  
ATOM 9642  H HB   . THR A 1 58  ? -7.627  0.922   -9.097  1.00 0.00 ? 76  THR A HB   5  
ATOM 9643  H HG1  . THR A 1 58  ? -8.475  2.823   -7.910  1.00 0.00 ? 76  THR A HG1  5  
ATOM 9644  H HG21 . THR A 1 58  ? -5.954  2.569   -10.357 1.00 0.00 ? 76  THR A HG21 5  
ATOM 9645  H HG22 . THR A 1 58  ? -5.929  2.368   -8.606  1.00 0.00 ? 76  THR A HG22 5  
ATOM 9646  H HG23 . THR A 1 58  ? -6.753  3.753   -9.322  1.00 0.00 ? 76  THR A HG23 5  
ATOM 9647  N N    . CYS A 1 59  ? -9.614  -0.239  -11.401 1.00 0.00 ? 77  CYS A N    5  
ATOM 9648  C CA   . CYS A 1 59  ? -10.841 -1.023  -11.464 1.00 0.00 ? 77  CYS A CA   5  
ATOM 9649  C C    . CYS A 1 59  ? -11.033 -1.837  -10.188 1.00 0.00 ? 77  CYS A C    5  
ATOM 9650  O O    . CYS A 1 59  ? -11.738 -2.848  -10.185 1.00 0.00 ? 77  CYS A O    5  
ATOM 9651  C CB   . CYS A 1 59  ? -10.816 -1.953  -12.678 1.00 0.00 ? 77  CYS A CB   5  
ATOM 9652  S SG   . CYS A 1 59  ? -12.457 -2.293  -13.391 1.00 0.00 ? 77  CYS A SG   5  
ATOM 9653  H H    . CYS A 1 59  ? -8.767  -0.659  -11.660 1.00 0.00 ? 77  CYS A H    5  
ATOM 9654  H HA   . CYS A 1 59  ? -11.669 -0.336  -11.565 1.00 0.00 ? 77  CYS A HA   5  
ATOM 9655  H HB3  . CYS A 1 59  ? -10.381 -2.898  -12.388 1.00 0.00 ? 77  CYS A HB3  5  
ATOM 9656  N N    . ARG A 1 60  ? -10.404 -1.390  -9.106  1.00 0.00 ? 78  ARG A N    5  
ATOM 9657  C CA   . ARG A 1 60  ? -10.504 -2.078  -7.826  1.00 0.00 ? 78  ARG A CA   5  
ATOM 9658  C C    . ARG A 1 60  ? -10.732 -1.084  -6.690  1.00 0.00 ? 78  ARG A C    5  
ATOM 9659  O O    . ARG A 1 60  ? -9.818  -0.365  -6.288  1.00 0.00 ? 78  ARG A O    5  
ATOM 9660  C CB   . ARG A 1 60  ? -9.237  -2.892  -7.558  1.00 0.00 ? 78  ARG A CB   5  
ATOM 9661  C CG   . ARG A 1 60  ? -7.953  -2.135  -7.857  1.00 0.00 ? 78  ARG A CG   5  
ATOM 9662  C CD   . ARG A 1 60  ? -7.507  -2.341  -9.296  1.00 0.00 ? 78  ARG A CD   5  
ATOM 9663  N NE   . ARG A 1 60  ? -6.109  -1.971  -9.495  1.00 0.00 ? 78  ARG A NE   5  
ATOM 9664  C CZ   . ARG A 1 60  ? -5.510  -1.969  -10.680 1.00 0.00 ? 78  ARG A CZ   5  
ATOM 9665  N NH1  . ARG A 1 60  ? -6.185  -2.315  -11.768 1.00 0.00 ? 78  ARG A NH1  5  
ATOM 9666  N NH2  . ARG A 1 60  ? -4.233  -1.620  -10.780 1.00 0.00 ? 78  ARG A NH2  5  
ATOM 9667  H H    . ARG A 1 60  ? -9.857  -0.579  -9.172  1.00 0.00 ? 78  ARG A H    5  
ATOM 9668  H HA   . ARG A 1 60  ? -11.348 -2.750  -7.874  1.00 0.00 ? 78  ARG A HA   5  
ATOM 9669  H HB3  . ARG A 1 60  ? -9.257  -3.779  -8.171  1.00 0.00 ? 78  ARG A HB3  5  
ATOM 9670  H HG3  . ARG A 1 60  ? -7.176  -2.485  -7.195  1.00 0.00 ? 78  ARG A HG3  5  
ATOM 9671  H HD3  . ARG A 1 60  ? -8.125  -1.734  -9.940  1.00 0.00 ? 78  ARG A HD3  5  
ATOM 9672  H HE   . ARG A 1 60  ? -5.591  -1.712  -8.704  1.00 0.00 ? 78  ARG A HE   5  
ATOM 9673  H HH11 . ARG A 1 60  ? -7.146  -2.577  -11.697 1.00 0.00 ? 78  ARG A HH11 5  
ATOM 9674  H HH12 . ARG A 1 60  ? -5.731  -2.312  -12.660 1.00 0.00 ? 78  ARG A HH12 5  
ATOM 9675  H HH21 . ARG A 1 60  ? -3.722  -1.358  -9.962  1.00 0.00 ? 78  ARG A HH21 5  
ATOM 9676  H HH22 . ARG A 1 60  ? -3.785  -1.619  -11.674 1.00 0.00 ? 78  ARG A HH22 5  
ATOM 9677  N N    . TYR A 1 61  ? -11.958 -1.047  -6.181  1.00 0.00 ? 79  TYR A N    5  
ATOM 9678  C CA   . TYR A 1 61  ? -12.308 -0.138  -5.095  1.00 0.00 ? 79  TYR A CA   5  
ATOM 9679  C C    . TYR A 1 61  ? -11.322 -0.268  -3.937  1.00 0.00 ? 79  TYR A C    5  
ATOM 9680  O O    . TYR A 1 61  ? -10.772 -1.341  -3.694  1.00 0.00 ? 79  TYR A O    5  
ATOM 9681  C CB   . TYR A 1 61  ? -13.729 -0.419  -4.604  1.00 0.00 ? 79  TYR A CB   5  
ATOM 9682  C CG   . TYR A 1 61  ? -13.971 -1.868  -4.246  1.00 0.00 ? 79  TYR A CG   5  
ATOM 9683  C CD1  . TYR A 1 61  ? -13.398 -2.430  -3.112  1.00 0.00 ? 79  TYR A CD1  5  
ATOM 9684  C CD2  . TYR A 1 61  ? -14.770 -2.678  -5.045  1.00 0.00 ? 79  TYR A CD2  5  
ATOM 9685  C CE1  . TYR A 1 61  ? -13.614 -3.753  -2.782  1.00 0.00 ? 79  TYR A CE1  5  
ATOM 9686  C CE2  . TYR A 1 61  ? -14.994 -4.002  -4.721  1.00 0.00 ? 79  TYR A CE2  5  
ATOM 9687  C CZ   . TYR A 1 61  ? -14.414 -4.535  -3.589  1.00 0.00 ? 79  TYR A CZ   5  
ATOM 9688  O OH   . TYR A 1 61  ? -14.633 -5.854  -3.265  1.00 0.00 ? 79  TYR A OH   5  
ATOM 9689  H H    . TYR A 1 61  ? -12.646 -1.644  -6.543  1.00 0.00 ? 79  TYR A H    5  
ATOM 9690  H HA   . TYR A 1 61  ? -12.263 0.869   -5.479  1.00 0.00 ? 79  TYR A HA   5  
ATOM 9691  H HB3  . TYR A 1 61  ? -14.430 -0.147  -5.379  1.00 0.00 ? 79  TYR A HB3  5  
ATOM 9692  H HD1  . TYR A 1 61  ? -12.771 -1.814  -2.481  1.00 0.00 ? 79  TYR A HD1  5  
ATOM 9693  H HD2  . TYR A 1 61  ? -15.221 -2.257  -5.931  1.00 0.00 ? 79  TYR A HD2  5  
ATOM 9694  H HE1  . TYR A 1 61  ? -13.161 -4.172  -1.896  1.00 0.00 ? 79  TYR A HE1  5  
ATOM 9695  H HE2  . TYR A 1 61  ? -15.619 -4.614  -5.354  1.00 0.00 ? 79  TYR A HE2  5  
ATOM 9696  H HH   . TYR A 1 61  ? -15.489 -6.129  -3.603  1.00 0.00 ? 79  TYR A HH   5  
ATOM 9697  N N    . GLY A 1 62  ? -11.107 0.834   -3.226  1.00 0.00 ? 80  GLY A N    5  
ATOM 9698  C CA   . GLY A 1 62  ? -10.188 0.823   -2.102  1.00 0.00 ? 80  GLY A CA   5  
ATOM 9699  C C    . GLY A 1 62  ? -10.885 1.094   -0.782  1.00 0.00 ? 80  GLY A C    5  
ATOM 9700  O O    . GLY A 1 62  ? -12.110 1.193   -0.729  1.00 0.00 ? 80  GLY A O    5  
ATOM 9701  H H    . GLY A 1 62  ? -11.574 1.661   -3.467  1.00 0.00 ? 80  GLY A H    5  
ATOM 9702  H HA2  . GLY A 1 62  ? -9.708  -0.142  -2.053  1.00 0.00 ? 80  GLY A HA2  5  
ATOM 9703  H HA3  . GLY A 1 62  ? -9.435  1.581   -2.259  1.00 0.00 ? 80  GLY A HA3  5  
ATOM 9704  N N    . PHE A 1 63  ? -10.101 1.211   0.284   1.00 0.00 ? 81  PHE A N    5  
ATOM 9705  C CA   . PHE A 1 63  ? -10.649 1.469   1.611   1.00 0.00 ? 81  PHE A CA   5  
ATOM 9706  C C    . PHE A 1 63  ? -10.185 2.823   2.138   1.00 0.00 ? 81  PHE A C    5  
ATOM 9707  O O    . PHE A 1 63  ? -9.141  2.925   2.784   1.00 0.00 ? 81  PHE A O    5  
ATOM 9708  C CB   . PHE A 1 63  ? -10.234 0.361   2.581   1.00 0.00 ? 81  PHE A CB   5  
ATOM 9709  C CG   . PHE A 1 63  ? -10.660 -1.012  2.142   1.00 0.00 ? 81  PHE A CG   5  
ATOM 9710  C CD1  . PHE A 1 63  ? -11.938 -1.232  1.655   1.00 0.00 ? 81  PHE A CD1  5  
ATOM 9711  C CD2  . PHE A 1 63  ? -9.781  -2.081  2.218   1.00 0.00 ? 81  PHE A CD2  5  
ATOM 9712  C CE1  . PHE A 1 63  ? -12.333 -2.494  1.250   1.00 0.00 ? 81  PHE A CE1  5  
ATOM 9713  C CE2  . PHE A 1 63  ? -10.171 -3.344  1.813   1.00 0.00 ? 81  PHE A CE2  5  
ATOM 9714  C CZ   . PHE A 1 63  ? -11.447 -3.551  1.330   1.00 0.00 ? 81  PHE A CZ   5  
ATOM 9715  H H    . PHE A 1 63  ? -9.130  1.122   0.177   1.00 0.00 ? 81  PHE A H    5  
ATOM 9716  H HA   . PHE A 1 63  ? -11.724 1.477   1.527   1.00 0.00 ? 81  PHE A HA   5  
ATOM 9717  H HB3  . PHE A 1 63  ? -10.676 0.554   3.547   1.00 0.00 ? 81  PHE A HB3  5  
ATOM 9718  H HD1  . PHE A 1 63  ? -12.631 -0.406  1.592   1.00 0.00 ? 81  PHE A HD1  5  
ATOM 9719  H HD2  . PHE A 1 63  ? -8.783  -1.921  2.597   1.00 0.00 ? 81  PHE A HD2  5  
ATOM 9720  H HE1  . PHE A 1 63  ? -13.332 -2.651  0.873   1.00 0.00 ? 81  PHE A HE1  5  
ATOM 9721  H HE2  . PHE A 1 63  ? -9.477  -4.169  1.878   1.00 0.00 ? 81  PHE A HE2  5  
ATOM 9722  H HZ   . PHE A 1 63  ? -11.753 -4.537  1.014   1.00 0.00 ? 81  PHE A HZ   5  
ATOM 9723  N N    . ILE A 1 64  ? -10.966 3.860   1.858   1.00 0.00 ? 82  ILE A N    5  
ATOM 9724  C CA   . ILE A 1 64  ? -10.636 5.207   2.305   1.00 0.00 ? 82  ILE A CA   5  
ATOM 9725  C C    . ILE A 1 64  ? -10.829 5.351   3.810   1.00 0.00 ? 82  ILE A C    5  
ATOM 9726  O O    . ILE A 1 64  ? -11.048 4.365   4.514   1.00 0.00 ? 82  ILE A O    5  
ATOM 9727  C CB   . ILE A 1 64  ? -11.494 6.265   1.585   1.00 0.00 ? 82  ILE A CB   5  
ATOM 9728  C CG1  . ILE A 1 64  ? -12.970 6.085   1.943   1.00 0.00 ? 82  ILE A CG1  5  
ATOM 9729  C CG2  . ILE A 1 64  ? -11.294 6.174   0.080   1.00 0.00 ? 82  ILE A CG2  5  
ATOM 9730  C CD1  . ILE A 1 64  ? -13.673 7.382   2.278   1.00 0.00 ? 82  ILE A CD1  5  
ATOM 9731  H H    . ILE A 1 64  ? -11.785 3.715   1.340   1.00 0.00 ? 82  ILE A H    5  
ATOM 9732  H HA   . ILE A 1 64  ? -9.598  5.393   2.066   1.00 0.00 ? 82  ILE A HA   5  
ATOM 9733  H HB   . ILE A 1 64  ? -11.168 7.241   1.909   1.00 0.00 ? 82  ILE A HB   5  
ATOM 9734  H HG13 . ILE A 1 64  ? -13.047 5.436   2.804   1.00 0.00 ? 82  ILE A HG13 5  
ATOM 9735  H HG21 . ILE A 1 64  ? -10.716 7.021   -0.259  1.00 0.00 ? 82  ILE A HG21 5  
ATOM 9736  H HG22 . ILE A 1 64  ? -10.769 5.262   -0.159  1.00 0.00 ? 82  ILE A HG22 5  
ATOM 9737  H HG23 . ILE A 1 64  ? -12.257 6.176   -0.412  1.00 0.00 ? 82  ILE A HG23 5  
ATOM 9738  H HD11 . ILE A 1 64  ? -14.270 7.251   3.168   1.00 0.00 ? 82  ILE A HD11 5  
ATOM 9739  H HD12 . ILE A 1 64  ? -12.940 8.157   2.445   1.00 0.00 ? 82  ILE A HD12 5  
ATOM 9740  H HD13 . ILE A 1 64  ? -14.314 7.666   1.453   1.00 0.00 ? 82  ILE A HD13 5  
ATOM 9741  N N    . GLU A 1 65  ? -10.747 6.585   4.297   1.00 0.00 ? 83  GLU A N    5  
ATOM 9742  C CA   . GLU A 1 65  ? -10.913 6.857   5.720   1.00 0.00 ? 83  GLU A CA   5  
ATOM 9743  C C    . GLU A 1 65  ? -12.138 6.131   6.273   1.00 0.00 ? 83  GLU A C    5  
ATOM 9744  O O    . GLU A 1 65  ? -12.140 5.682   7.419   1.00 0.00 ? 83  GLU A O    5  
ATOM 9745  C CB   . GLU A 1 65  ? -11.047 8.362   5.962   1.00 0.00 ? 83  GLU A CB   5  
ATOM 9746  C CG   . GLU A 1 65  ? -11.440 8.717   7.386   1.00 0.00 ? 83  GLU A CG   5  
ATOM 9747  C CD   . GLU A 1 65  ? -11.586 10.211  7.596   1.00 0.00 ? 83  GLU A CD   5  
ATOM 9748  O OE1  . GLU A 1 65  ? -12.640 10.763  7.216   1.00 0.00 ? 83  GLU A OE1  5  
ATOM 9749  O OE2  . GLU A 1 65  ? -10.647 10.830  8.140   1.00 0.00 ? 83  GLU A OE2  5  
ATOM 9750  H H    . GLU A 1 65  ? -10.569 7.329   3.685   1.00 0.00 ? 83  GLU A H    5  
ATOM 9751  H HA   . GLU A 1 65  ? -10.035 6.496   6.232   1.00 0.00 ? 83  GLU A HA   5  
ATOM 9752  H HB3  . GLU A 1 65  ? -11.801 8.756   5.296   1.00 0.00 ? 83  GLU A HB3  5  
ATOM 9753  H HG3  . GLU A 1 65  ? -10.679 8.347   8.059   1.00 0.00 ? 83  GLU A HG3  5  
ATOM 9754  N N    . GLY A 1 66  ? -13.175 6.021   5.449   1.00 0.00 ? 84  GLY A N    5  
ATOM 9755  C CA   . GLY A 1 66  ? -14.389 5.350   5.873   1.00 0.00 ? 84  GLY A CA   5  
ATOM 9756  C C    . GLY A 1 66  ? -15.406 5.231   4.754   1.00 0.00 ? 84  GLY A C    5  
ATOM 9757  O O    . GLY A 1 66  ? -16.477 5.837   4.812   1.00 0.00 ? 84  GLY A O    5  
ATOM 9758  H H    . GLY A 1 66  ? -13.115 6.397   4.546   1.00 0.00 ? 84  GLY A H    5  
ATOM 9759  H HA2  . GLY A 1 66  ? -14.138 4.359   6.223   1.00 0.00 ? 84  GLY A HA2  5  
ATOM 9760  H HA3  . GLY A 1 66  ? -14.829 5.907   6.687   1.00 0.00 ? 84  GLY A HA3  5  
ATOM 9761  N N    . HIS A 1 67  ? -15.072 4.451   3.732   1.00 0.00 ? 85  HIS A N    5  
ATOM 9762  C CA   . HIS A 1 67  ? -15.964 4.257   2.595   1.00 0.00 ? 85  HIS A CA   5  
ATOM 9763  C C    . HIS A 1 67  ? -15.333 3.329   1.561   1.00 0.00 ? 85  HIS A C    5  
ATOM 9764  O O    . HIS A 1 67  ? -14.283 2.733   1.804   1.00 0.00 ? 85  HIS A O    5  
ATOM 9765  C CB   . HIS A 1 67  ? -16.305 5.601   1.952   1.00 0.00 ? 85  HIS A CB   5  
ATOM 9766  C CG   . HIS A 1 67  ? -17.756 5.751   1.608   1.00 0.00 ? 85  HIS A CG   5  
ATOM 9767  N ND1  . HIS A 1 67  ? -18.769 5.535   2.519   1.00 0.00 ? 85  HIS A ND1  5  
ATOM 9768  C CD2  . HIS A 1 67  ? -18.359 6.098   0.448   1.00 0.00 ? 85  HIS A CD2  5  
ATOM 9769  C CE1  . HIS A 1 67  ? -19.935 5.743   1.931   1.00 0.00 ? 85  HIS A CE1  5  
ATOM 9770  N NE2  . HIS A 1 67  ? -19.714 6.085   0.675   1.00 0.00 ? 85  HIS A NE2  5  
ATOM 9771  H H    . HIS A 1 67  ? -14.205 3.996   3.743   1.00 0.00 ? 85  HIS A H    5  
ATOM 9772  H HA   . HIS A 1 67  ? -16.872 3.801   2.960   1.00 0.00 ? 85  HIS A HA   5  
ATOM 9773  H HB3  . HIS A 1 67  ? -15.735 5.711   1.040   1.00 0.00 ? 85  HIS A HB3  5  
ATOM 9774  H HD1  . HIS A 1 67  ? -18.652 5.268   3.453   1.00 0.00 ? 85  HIS A HD1  5  
ATOM 9775  H HD2  . HIS A 1 67  ? -17.869 6.340   -0.483  1.00 0.00 ? 85  HIS A HD2  5  
ATOM 9776  H HE1  . HIS A 1 67  ? -20.903 5.648   2.399   1.00 0.00 ? 85  HIS A HE1  5  
ATOM 9777  N N    . VAL A 1 68  ? -15.979 3.211   0.406   1.00 0.00 ? 86  VAL A N    5  
ATOM 9778  C CA   . VAL A 1 68  ? -15.480 2.357   -0.665  1.00 0.00 ? 86  VAL A CA   5  
ATOM 9779  C C    . VAL A 1 68  ? -15.825 2.935   -2.034  1.00 0.00 ? 86  VAL A C    5  
ATOM 9780  O O    . VAL A 1 68  ? -16.933 2.747   -2.538  1.00 0.00 ? 86  VAL A O    5  
ATOM 9781  C CB   . VAL A 1 68  ? -16.057 0.932   -0.562  1.00 0.00 ? 86  VAL A CB   5  
ATOM 9782  C CG1  . VAL A 1 68  ? -15.446 0.030   -1.624  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 9783  C CG2  . VAL A 1 68  ? -15.824 0.363   0.830   1.00 0.00 ? 86  VAL A CG2  5  
ATOM 9784  H H    . VAL A 1 68  ? -16.811 3.710   0.270   1.00 0.00 ? 86  VAL A H    5  
ATOM 9785  H HA   . VAL A 1 68  ? -14.406 2.295   -0.571  1.00 0.00 ? 86  VAL A HA   5  
ATOM 9786  H HB   . VAL A 1 68  ? -17.123 0.983   -0.734  1.00 0.00 ? 86  VAL A HB   5  
ATOM 9787  H HG11 . VAL A 1 68  ? -15.495 -0.998  -1.294  1.00 0.00 ? 86  VAL A HG11 5  
ATOM 9788  H HG12 . VAL A 1 68  ? -15.996 0.139   -2.548  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 9789  H HG13 . VAL A 1 68  ? -14.416 0.308   -1.782  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 9790  H HG21 . VAL A 1 68  ? -14.805 0.554   1.129   1.00 0.00 ? 86  VAL A HG21 5  
ATOM 9791  H HG22 . VAL A 1 68  ? -16.499 0.835   1.530   1.00 0.00 ? 86  VAL A HG22 5  
ATOM 9792  H HG23 . VAL A 1 68  ? -16.004 -0.701  0.819   1.00 0.00 ? 86  VAL A HG23 5  
ATOM 9793  N N    . VAL A 1 69  ? -14.867 3.636   -2.631  1.00 0.00 ? 87  VAL A N    5  
ATOM 9794  C CA   . VAL A 1 69  ? -15.067 4.240   -3.944  1.00 0.00 ? 87  VAL A CA   5  
ATOM 9795  C C    . VAL A 1 69  ? -14.164 3.594   -4.989  1.00 0.00 ? 87  VAL A C    5  
ATOM 9796  O O    . VAL A 1 69  ? -13.279 2.805   -4.658  1.00 0.00 ? 87  VAL A O    5  
ATOM 9797  C CB   . VAL A 1 69  ? -14.794 5.755   -3.912  1.00 0.00 ? 87  VAL A CB   5  
ATOM 9798  C CG1  . VAL A 1 69  ? -15.732 6.446   -2.932  1.00 0.00 ? 87  VAL A CG1  5  
ATOM 9799  C CG2  . VAL A 1 69  ? -13.341 6.028   -3.552  1.00 0.00 ? 87  VAL A CG2  5  
ATOM 9800  H H    . VAL A 1 69  ? -14.005 3.750   -2.180  1.00 0.00 ? 87  VAL A H    5  
ATOM 9801  H HA   . VAL A 1 69  ? -16.098 4.087   -4.228  1.00 0.00 ? 87  VAL A HA   5  
ATOM 9802  H HB   . VAL A 1 69  ? -14.981 6.156   -4.898  1.00 0.00 ? 87  VAL A HB   5  
ATOM 9803  H HG11 . VAL A 1 69  ? -15.565 7.512   -2.967  1.00 0.00 ? 87  VAL A HG11 5  
ATOM 9804  H HG12 . VAL A 1 69  ? -16.756 6.231   -3.201  1.00 0.00 ? 87  VAL A HG12 5  
ATOM 9805  H HG13 . VAL A 1 69  ? -15.538 6.086   -1.934  1.00 0.00 ? 87  VAL A HG13 5  
ATOM 9806  H HG21 . VAL A 1 69  ? -12.697 5.532   -4.264  1.00 0.00 ? 87  VAL A HG21 5  
ATOM 9807  H HG22 . VAL A 1 69  ? -13.156 7.091   -3.579  1.00 0.00 ? 87  VAL A HG22 5  
ATOM 9808  H HG23 . VAL A 1 69  ? -13.138 5.652   -2.561  1.00 0.00 ? 87  VAL A HG23 5  
ATOM 9809  N N    . ILE A 1 70  ? -14.394 3.935   -6.252  1.00 0.00 ? 88  ILE A N    5  
ATOM 9810  C CA   . ILE A 1 70  ? -13.600 3.390   -7.347  1.00 0.00 ? 88  ILE A CA   5  
ATOM 9811  C C    . ILE A 1 70  ? -13.668 4.290   -8.576  1.00 0.00 ? 88  ILE A C    5  
ATOM 9812  O O    . ILE A 1 70  ? -14.457 4.070   -9.495  1.00 0.00 ? 88  ILE A O    5  
ATOM 9813  C CB   . ILE A 1 70  ? -14.071 1.977   -7.734  1.00 0.00 ? 88  ILE A CB   5  
ATOM 9814  C CG1  . ILE A 1 70  ? -13.331 1.492   -8.982  1.00 0.00 ? 88  ILE A CG1  5  
ATOM 9815  C CG2  . ILE A 1 70  ? -15.575 1.963   -7.966  1.00 0.00 ? 88  ILE A CG2  5  
ATOM 9816  C CD1  . ILE A 1 70  ? -13.311 -0.015  -9.127  1.00 0.00 ? 88  ILE A CD1  5  
ATOM 9817  H H    . ILE A 1 70  ? -15.113 4.570   -6.453  1.00 0.00 ? 88  ILE A H    5  
ATOM 9818  H HA   . ILE A 1 70  ? -12.574 3.328   -7.015  1.00 0.00 ? 88  ILE A HA   5  
ATOM 9819  H HB   . ILE A 1 70  ? -13.853 1.311   -6.913  1.00 0.00 ? 88  ILE A HB   5  
ATOM 9820  H HG13 . ILE A 1 70  ? -12.307 1.835   -8.938  1.00 0.00 ? 88  ILE A HG13 5  
ATOM 9821  H HG21 . ILE A 1 70  ? -15.926 2.975   -8.104  1.00 0.00 ? 88  ILE A HG21 5  
ATOM 9822  H HG22 . ILE A 1 70  ? -15.798 1.382   -8.847  1.00 0.00 ? 88  ILE A HG22 5  
ATOM 9823  H HG23 . ILE A 1 70  ? -16.068 1.525   -7.110  1.00 0.00 ? 88  ILE A HG23 5  
ATOM 9824  H HD11 . ILE A 1 70  ? -14.281 -0.413  -8.866  1.00 0.00 ? 88  ILE A HD11 5  
ATOM 9825  H HD12 . ILE A 1 70  ? -13.076 -0.276  -10.147 1.00 0.00 ? 88  ILE A HD12 5  
ATOM 9826  H HD13 . ILE A 1 70  ? -12.564 -0.430  -8.467  1.00 0.00 ? 88  ILE A HD13 5  
ATOM 9827  N N    . PRO A 1 71  ? -12.819 5.328   -8.596  1.00 0.00 ? 89  PRO A N    5  
ATOM 9828  C CA   . PRO A 1 71  ? -12.760 6.281   -9.709  1.00 0.00 ? 89  PRO A CA   5  
ATOM 9829  C C    . PRO A 1 71  ? -12.184 5.659   -10.977 1.00 0.00 ? 89  PRO A C    5  
ATOM 9830  O O    . PRO A 1 71  ? -11.251 4.859   -10.917 1.00 0.00 ? 89  PRO A O    5  
ATOM 9831  C CB   . PRO A 1 71  ? -11.835 7.383   -9.185  1.00 0.00 ? 89  PRO A CB   5  
ATOM 9832  C CG   . PRO A 1 71  ? -10.983 6.706   -8.165  1.00 0.00 ? 89  PRO A CG   5  
ATOM 9833  C CD   . PRO A 1 71  ? -11.850 5.652   -7.536  1.00 0.00 ? 89  PRO A CD   5  
ATOM 9834  H HA   . PRO A 1 71  ? -13.732 6.700   -9.925  1.00 0.00 ? 89  PRO A HA   5  
ATOM 9835  H HB3  . PRO A 1 71  ? -12.422 8.174   -8.747  1.00 0.00 ? 89  PRO A HB3  5  
ATOM 9836  H HG3  . PRO A 1 71  ? -10.665 7.423   -7.421  1.00 0.00 ? 89  PRO A HG3  5  
ATOM 9837  H HD3  . PRO A 1 71  ? -12.350 6.044   -6.664  1.00 0.00 ? 89  PRO A HD3  5  
ATOM 9838  N N    . ARG A 1 72  ? -12.747 6.031   -12.121 1.00 0.00 ? 90  ARG A N    5  
ATOM 9839  C CA   . ARG A 1 72  ? -12.290 5.508   -13.403 1.00 0.00 ? 90  ARG A CA   5  
ATOM 9840  C C    . ARG A 1 72  ? -12.439 6.555   -14.503 1.00 0.00 ? 90  ARG A C    5  
ATOM 9841  O O    . ARG A 1 72  ? -13.423 7.295   -14.538 1.00 0.00 ? 90  ARG A O    5  
ATOM 9842  C CB   . ARG A 1 72  ? -13.075 4.249   -13.775 1.00 0.00 ? 90  ARG A CB   5  
ATOM 9843  C CG   . ARG A 1 72  ? -12.398 3.398   -14.836 1.00 0.00 ? 90  ARG A CG   5  
ATOM 9844  C CD   . ARG A 1 72  ? -11.191 2.663   -14.275 1.00 0.00 ? 90  ARG A CD   5  
ATOM 9845  N NE   . ARG A 1 72  ? -10.639 1.707   -15.231 1.00 0.00 ? 90  ARG A NE   5  
ATOM 9846  C CZ   . ARG A 1 72  ? -9.850  2.053   -16.244 1.00 0.00 ? 90  ARG A CZ   5  
ATOM 9847  N NH1  . ARG A 1 72  ? -9.523  3.322   -16.431 1.00 0.00 ? 90  ARG A NH1  5  
ATOM 9848  N NH2  . ARG A 1 72  ? -9.388  1.124   -17.071 1.00 0.00 ? 90  ARG A NH2  5  
ATOM 9849  H H    . ARG A 1 72  ? -13.490 6.671   -12.104 1.00 0.00 ? 90  ARG A H    5  
ATOM 9850  H HA   . ARG A 1 72  ? -11.246 5.254   -13.303 1.00 0.00 ? 90  ARG A HA   5  
ATOM 9851  H HB3  . ARG A 1 72  ? -14.047 4.541   -14.144 1.00 0.00 ? 90  ARG A HB3  5  
ATOM 9852  H HG3  . ARG A 1 72  ? -12.075 4.039   -15.643 1.00 0.00 ? 90  ARG A HG3  5  
ATOM 9853  H HD3  . ARG A 1 72  ? -11.490 2.134   -13.384 1.00 0.00 ? 90  ARG A HD3  5  
ATOM 9854  H HE   . ARG A 1 72  ? -10.868 0.762   -15.112 1.00 0.00 ? 90  ARG A HE   5  
ATOM 9855  H HH11 . ARG A 1 72  ? -9.870  4.024   -15.808 1.00 0.00 ? 90  ARG A HH11 5  
ATOM 9856  H HH12 . ARG A 1 72  ? -8.929  3.580   -17.194 1.00 0.00 ? 90  ARG A HH12 5  
ATOM 9857  H HH21 . ARG A 1 72  ? -9.632  0.164   -16.934 1.00 0.00 ? 90  ARG A HH21 5  
ATOM 9858  H HH22 . ARG A 1 72  ? -8.796  1.383   -17.833 1.00 0.00 ? 90  ARG A HH22 5  
ATOM 9859  N N    . ILE A 1 73  ? -11.457 6.613   -15.395 1.00 0.00 ? 91  ILE A N    5  
ATOM 9860  C CA   . ILE A 1 73  ? -11.479 7.569   -16.494 1.00 0.00 ? 91  ILE A CA   5  
ATOM 9861  C C    . ILE A 1 73  ? -11.576 6.859   -17.840 1.00 0.00 ? 91  ILE A C    5  
ATOM 9862  O O    . ILE A 1 73  ? -12.488 7.117   -18.627 1.00 0.00 ? 91  ILE A O    5  
ATOM 9863  C CB   . ILE A 1 73  ? -10.225 8.464   -16.488 1.00 0.00 ? 91  ILE A CB   5  
ATOM 9864  C CG1  . ILE A 1 73  ? -9.981  9.028   -15.088 1.00 0.00 ? 91  ILE A CG1  5  
ATOM 9865  C CG2  . ILE A 1 73  ? -10.373 9.589   -17.500 1.00 0.00 ? 91  ILE A CG2  5  
ATOM 9866  C CD1  . ILE A 1 73  ? -8.664  8.595   -14.482 1.00 0.00 ? 91  ILE A CD1  5  
ATOM 9867  H H    . ILE A 1 73  ? -10.699 5.998   -15.312 1.00 0.00 ? 91  ILE A H    5  
ATOM 9868  H HA   . ILE A 1 73  ? -12.347 8.200   -16.369 1.00 0.00 ? 91  ILE A HA   5  
ATOM 9869  H HB   . ILE A 1 73  ? -9.378  7.860   -16.778 1.00 0.00 ? 91  ILE A HB   5  
ATOM 9870  H HG13 . ILE A 1 73  ? -10.775 8.698   -14.431 1.00 0.00 ? 91  ILE A HG13 5  
ATOM 9871  H HG21 . ILE A 1 73  ? -9.686  10.386  -17.256 1.00 0.00 ? 91  ILE A HG21 5  
ATOM 9872  H HG22 . ILE A 1 73  ? -10.151 9.215   -18.489 1.00 0.00 ? 91  ILE A HG22 5  
ATOM 9873  H HG23 . ILE A 1 73  ? -11.384 9.966   -17.476 1.00 0.00 ? 91  ILE A HG23 5  
ATOM 9874  H HD11 . ILE A 1 73  ? -8.851  7.908   -13.669 1.00 0.00 ? 91  ILE A HD11 5  
ATOM 9875  H HD12 . ILE A 1 73  ? -8.064  8.108   -15.236 1.00 0.00 ? 91  ILE A HD12 5  
ATOM 9876  H HD13 . ILE A 1 73  ? -8.138  9.461   -14.107 1.00 0.00 ? 91  ILE A HD13 5  
ATOM 9877  N N    . HIS A 1 74  ? -10.632 5.960   -18.098 1.00 0.00 ? 92  HIS A N    5  
ATOM 9878  C CA   . HIS A 1 74  ? -10.611 5.208   -19.347 1.00 0.00 ? 92  HIS A CA   5  
ATOM 9879  C C    . HIS A 1 74  ? -10.869 3.725   -19.094 1.00 0.00 ? 92  HIS A C    5  
ATOM 9880  O O    . HIS A 1 74  ? -9.965  2.893   -19.162 1.00 0.00 ? 92  HIS A O    5  
ATOM 9881  C CB   . HIS A 1 74  ? -9.268  5.390   -20.054 1.00 0.00 ? 92  HIS A CB   5  
ATOM 9882  C CG   . HIS A 1 74  ? -9.308  5.045   -21.512 1.00 0.00 ? 92  HIS A CG   5  
ATOM 9883  N ND1  . HIS A 1 74  ? -10.024 5.771   -22.439 1.00 0.00 ? 92  HIS A ND1  5  
ATOM 9884  C CD2  . HIS A 1 74  ? -8.712  4.042   -22.200 1.00 0.00 ? 92  HIS A CD2  5  
ATOM 9885  C CE1  . HIS A 1 74  ? -9.868  5.232   -23.635 1.00 0.00 ? 92  HIS A CE1  5  
ATOM 9886  N NE2  . HIS A 1 74  ? -9.076  4.181   -23.517 1.00 0.00 ? 92  HIS A NE2  5  
ATOM 9887  H H    . HIS A 1 74  ? -9.931  5.799   -17.431 1.00 0.00 ? 92  HIS A H    5  
ATOM 9888  H HA   . HIS A 1 74  ? -11.397 5.594   -19.979 1.00 0.00 ? 92  HIS A HA   5  
ATOM 9889  H HB3  . HIS A 1 74  ? -8.531  4.757   -19.583 1.00 0.00 ? 92  HIS A HB3  5  
ATOM 9890  H HD1  . HIS A 1 74  ? -10.566 6.565   -22.248 1.00 0.00 ? 92  HIS A HD1  5  
ATOM 9891  H HD2  . HIS A 1 74  ? -8.069  3.275   -21.791 1.00 0.00 ? 92  HIS A HD2  5  
ATOM 9892  H HE1  . HIS A 1 74  ? -10.312 5.587   -24.552 1.00 0.00 ? 92  HIS A HE1  5  
ATOM 9893  N N    . PRO A 1 75  ? -12.132 3.387   -18.794 1.00 0.00 ? 93  PRO A N    5  
ATOM 9894  C CA   . PRO A 1 75  ? -12.538 2.005   -18.525 1.00 0.00 ? 93  PRO A CA   5  
ATOM 9895  C C    . PRO A 1 75  ? -12.499 1.135   -19.777 1.00 0.00 ? 93  PRO A C    5  
ATOM 9896  O O    . PRO A 1 75  ? -12.042 1.569   -20.832 1.00 0.00 ? 93  PRO A O    5  
ATOM 9897  C CB   . PRO A 1 75  ? -13.976 2.149   -18.020 1.00 0.00 ? 93  PRO A CB   5  
ATOM 9898  C CG   . PRO A 1 75  ? -14.461 3.425   -18.619 1.00 0.00 ? 93  PRO A CG   5  
ATOM 9899  C CD   . PRO A 1 75  ? -13.261 4.328   -18.696 1.00 0.00 ? 93  PRO A CD   5  
ATOM 9900  H HA   . PRO A 1 75  ? -11.928 1.555   -17.756 1.00 0.00 ? 93  PRO A HA   5  
ATOM 9901  H HB3  . PRO A 1 75  ? -13.981 2.194   -16.942 1.00 0.00 ? 93  PRO A HB3  5  
ATOM 9902  H HG3  . PRO A 1 75  ? -15.218 3.862   -17.984 1.00 0.00 ? 93  PRO A HG3  5  
ATOM 9903  H HD3  . PRO A 1 75  ? -13.182 4.931   -17.803 1.00 0.00 ? 93  PRO A HD3  5  
ATOM 9904  N N    . ASN A 1 76  ? -12.981 -0.097  -19.650 1.00 0.00 ? 94  ASN A N    5  
ATOM 9905  C CA   . ASN A 1 76  ? -13.001 -1.030  -20.772 1.00 0.00 ? 94  ASN A CA   5  
ATOM 9906  C C    . ASN A 1 76  ? -13.937 -2.201  -20.490 1.00 0.00 ? 94  ASN A C    5  
ATOM 9907  O O    . ASN A 1 76  ? -14.497 -2.313  -19.400 1.00 0.00 ? 94  ASN A O    5  
ATOM 9908  C CB   . ASN A 1 76  ? -11.589 -1.548  -21.055 1.00 0.00 ? 94  ASN A CB   5  
ATOM 9909  C CG   . ASN A 1 76  ? -11.370 -1.857  -22.523 1.00 0.00 ? 94  ASN A CG   5  
ATOM 9910  O OD1  . ASN A 1 76  ? -12.317 -1.885  -23.312 1.00 0.00 ? 94  ASN A OD1  5  
ATOM 9911  N ND2  . ASN A 1 76  ? -10.119 -2.092  -22.898 1.00 0.00 ? 94  ASN A ND2  5  
ATOM 9912  H H    . ASN A 1 76  ? -13.333 -0.387  -18.782 1.00 0.00 ? 94  ASN A H    5  
ATOM 9913  H HA   . ASN A 1 76  ? -13.360 -0.496  -21.639 1.00 0.00 ? 94  ASN A HA   5  
ATOM 9914  H HB3  . ASN A 1 76  ? -11.423 -2.451  -20.487 1.00 0.00 ? 94  ASN A HB3  5  
ATOM 9915  H HD21 . ASN A 1 76  ? -9.416  -2.052  -22.217 1.00 0.00 ? 94  ASN A HD21 5  
ATOM 9916  H HD22 . ASN A 1 76  ? -9.949  -2.293  -23.842 1.00 0.00 ? 94  ASN A HD22 5  
ATOM 9917  N N    . SER A 1 77  ? -14.104 -3.070  -21.482 1.00 0.00 ? 95  SER A N    5  
ATOM 9918  C CA   . SER A 1 77  ? -14.974 -4.231  -21.342 1.00 0.00 ? 95  SER A CA   5  
ATOM 9919  C C    . SER A 1 77  ? -14.551 -5.089  -20.155 1.00 0.00 ? 95  SER A C    5  
ATOM 9920  O O    . SER A 1 77  ? -15.358 -5.825  -19.588 1.00 0.00 ? 95  SER A O    5  
ATOM 9921  C CB   . SER A 1 77  ? -14.954 -5.068  -22.624 1.00 0.00 ? 95  SER A CB   5  
ATOM 9922  O OG   . SER A 1 77  ? -13.685 -5.666  -22.822 1.00 0.00 ? 95  SER A OG   5  
ATOM 9923  H H    . SER A 1 77  ? -13.629 -2.927  -22.328 1.00 0.00 ? 95  SER A H    5  
ATOM 9924  H HA   . SER A 1 77  ? -15.979 -3.873  -21.174 1.00 0.00 ? 95  SER A HA   5  
ATOM 9925  H HB3  . SER A 1 77  ? -15.175 -4.431  -23.469 1.00 0.00 ? 95  SER A HB3  5  
ATOM 9926  H HG   . SER A 1 77  ? -13.791 -6.613  -22.928 1.00 0.00 ? 95  SER A HG   5  
ATOM 9927  N N    . ILE A 1 78  ? -13.278 -4.989  -19.785 1.00 0.00 ? 96  ILE A N    5  
ATOM 9928  C CA   . ILE A 1 78  ? -12.747 -5.754  -18.664 1.00 0.00 ? 96  ILE A CA   5  
ATOM 9929  C C    . ILE A 1 78  ? -13.333 -5.274  -17.342 1.00 0.00 ? 96  ILE A C    5  
ATOM 9930  O O    . ILE A 1 78  ? -13.435 -6.036  -16.381 1.00 0.00 ? 96  ILE A O    5  
ATOM 9931  C CB   . ILE A 1 78  ? -11.210 -5.661  -18.598 1.00 0.00 ? 96  ILE A CB   5  
ATOM 9932  C CG1  . ILE A 1 78  ? -10.594 -6.045  -19.944 1.00 0.00 ? 96  ILE A CG1  5  
ATOM 9933  C CG2  . ILE A 1 78  ? -10.674 -6.555  -17.489 1.00 0.00 ? 96  ILE A CG2  5  
ATOM 9934  C CD1  . ILE A 1 78  ? -9.089  -5.903  -19.984 1.00 0.00 ? 96  ILE A CD1  5  
ATOM 9935  H H    . ILE A 1 78  ? -12.684 -4.386  -20.277 1.00 0.00 ? 96  ILE A H    5  
ATOM 9936  H HA   . ILE A 1 78  ? -13.018 -6.791  -18.810 1.00 0.00 ? 96  ILE A HA   5  
ATOM 9937  H HB   . ILE A 1 78  ? -10.945 -4.641  -18.365 1.00 0.00 ? 96  ILE A HB   5  
ATOM 9938  H HG13 . ILE A 1 78  ? -11.009 -5.410  -20.714 1.00 0.00 ? 96  ILE A HG13 5  
ATOM 9939  H HG21 . ILE A 1 78  ? -11.047 -6.210  -16.536 1.00 0.00 ? 96  ILE A HG21 5  
ATOM 9940  H HG22 . ILE A 1 78  ? -10.999 -7.571  -17.656 1.00 0.00 ? 96  ILE A HG22 5  
ATOM 9941  H HG23 . ILE A 1 78  ? -9.595  -6.518  -17.488 1.00 0.00 ? 96  ILE A HG23 5  
ATOM 9942  H HD11 . ILE A 1 78  ? -8.790  -5.504  -20.941 1.00 0.00 ? 96  ILE A HD11 5  
ATOM 9943  H HD12 . ILE A 1 78  ? -8.770  -5.233  -19.198 1.00 0.00 ? 96  ILE A HD12 5  
ATOM 9944  H HD13 . ILE A 1 78  ? -8.633  -6.871  -19.838 1.00 0.00 ? 96  ILE A HD13 5  
ATOM 9945  N N    . CYS A 1 79  ? -13.717 -4.002  -17.300 1.00 0.00 ? 97  CYS A N    5  
ATOM 9946  C CA   . CYS A 1 79  ? -14.294 -3.416  -16.095 1.00 0.00 ? 97  CYS A CA   5  
ATOM 9947  C C    . CYS A 1 79  ? -15.797 -3.672  -16.034 1.00 0.00 ? 97  CYS A C    5  
ATOM 9948  O O    . CYS A 1 79  ? -16.369 -4.297  -16.928 1.00 0.00 ? 97  CYS A O    5  
ATOM 9949  C CB   . CYS A 1 79  ? -14.020 -1.912  -16.051 1.00 0.00 ? 97  CYS A CB   5  
ATOM 9950  S SG   . CYS A 1 79  ? -12.474 -1.462  -15.200 1.00 0.00 ? 97  CYS A SG   5  
ATOM 9951  H H    . CYS A 1 79  ? -13.609 -3.442  -18.098 1.00 0.00 ? 97  CYS A H    5  
ATOM 9952  H HA   . CYS A 1 79  ? -13.827 -3.884  -15.242 1.00 0.00 ? 97  CYS A HA   5  
ATOM 9953  H HB3  . CYS A 1 79  ? -14.834 -1.420  -15.540 1.00 0.00 ? 97  CYS A HB3  5  
ATOM 9954  N N    . ALA A 1 80  ? -16.432 -3.186  -14.973 1.00 0.00 ? 98  ALA A N    5  
ATOM 9955  C CA   . ALA A 1 80  ? -17.869 -3.358  -14.796 1.00 0.00 ? 98  ALA A CA   5  
ATOM 9956  C C    . ALA A 1 80  ? -18.649 -2.578  -15.847 1.00 0.00 ? 98  ALA A C    5  
ATOM 9957  O O    . ALA A 1 80  ? -18.996 -1.416  -15.641 1.00 0.00 ? 98  ALA A O    5  
ATOM 9958  C CB   . ALA A 1 80  ? -18.284 -2.926  -13.397 1.00 0.00 ? 98  ALA A CB   5  
ATOM 9959  H H    . ALA A 1 80  ? -15.923 -2.696  -14.294 1.00 0.00 ? 98  ALA A H    5  
ATOM 9960  H HA   . ALA A 1 80  ? -18.093 -4.410  -14.901 1.00 0.00 ? 98  ALA A HA   5  
ATOM 9961  H HB1  . ALA A 1 80  ? -18.563 -1.882  -13.413 1.00 0.00 ? 98  ALA A HB1  5  
ATOM 9962  H HB2  . ALA A 1 80  ? -19.124 -3.520  -13.071 1.00 0.00 ? 98  ALA A HB2  5  
ATOM 9963  H HB3  . ALA A 1 80  ? -17.457 -3.066  -12.717 1.00 0.00 ? 98  ALA A HB3  5  
ATOM 9964  N N    . ALA A 1 81  ? -18.924 -3.226  -16.975 1.00 0.00 ? 99  ALA A N    5  
ATOM 9965  C CA   . ALA A 1 81  ? -19.666 -2.593  -18.058 1.00 0.00 ? 99  ALA A CA   5  
ATOM 9966  C C    . ALA A 1 81  ? -19.051 -1.249  -18.433 1.00 0.00 ? 99  ALA A C    5  
ATOM 9967  O O    . ALA A 1 81  ? -19.765 -0.284  -18.703 1.00 0.00 ? 99  ALA A O    5  
ATOM 9968  C CB   . ALA A 1 81  ? -21.125 -2.417  -17.666 1.00 0.00 ? 99  ALA A CB   5  
ATOM 9969  H H    . ALA A 1 81  ? -18.621 -4.152  -17.080 1.00 0.00 ? 99  ALA A H    5  
ATOM 9970  H HA   . ALA A 1 81  ? -19.626 -3.248  -18.917 1.00 0.00 ? 99  ALA A HA   5  
ATOM 9971  H HB1  . ALA A 1 81  ? -21.755 -2.643  -18.515 1.00 0.00 ? 99  ALA A HB1  5  
ATOM 9972  H HB2  . ALA A 1 81  ? -21.363 -3.087  -16.853 1.00 0.00 ? 99  ALA A HB2  5  
ATOM 9973  H HB3  . ALA A 1 81  ? -21.294 -1.397  -17.354 1.00 0.00 ? 99  ALA A HB3  5  
ATOM 9974  N N    . ASN A 1 82  ? -17.723 -1.193  -18.444 1.00 0.00 ? 100 ASN A N    5  
ATOM 9975  C CA   . ASN A 1 82  ? -17.012 0.035   -18.783 1.00 0.00 ? 100 ASN A CA   5  
ATOM 9976  C C    . ASN A 1 82  ? -17.520 1.206   -17.948 1.00 0.00 ? 100 ASN A C    5  
ATOM 9977  O O    . ASN A 1 82  ? -17.593 2.336   -18.426 1.00 0.00 ? 100 ASN A O    5  
ATOM 9978  C CB   . ASN A 1 82  ? -17.174 0.346   -20.272 1.00 0.00 ? 100 ASN A CB   5  
ATOM 9979  C CG   . ASN A 1 82  ? -16.710 -0.794  -21.157 1.00 0.00 ? 100 ASN A CG   5  
ATOM 9980  O OD1  . ASN A 1 82  ? -17.186 -1.923  -21.034 1.00 0.00 ? 100 ASN A OD1  5  
ATOM 9981  N ND2  . ASN A 1 82  ? -15.772 -0.504  -22.053 1.00 0.00 ? 100 ASN A ND2  5  
ATOM 9982  H H    . ASN A 1 82  ? -17.209 -1.997  -18.218 1.00 0.00 ? 100 ASN A H    5  
ATOM 9983  H HA   . ASN A 1 82  ? -15.966 -0.120  -18.569 1.00 0.00 ? 100 ASN A HA   5  
ATOM 9984  H HB3  . ASN A 1 82  ? -16.597 1.225   -20.515 1.00 0.00 ? 100 ASN A HB3  5  
ATOM 9985  H HD21 . ASN A 1 82  ? -15.439 0.417   -22.092 1.00 0.00 ? 100 ASN A HD21 5  
ATOM 9986  H HD22 . ASN A 1 82  ? -15.453 -1.222  -22.637 1.00 0.00 ? 100 ASN A HD22 5  
ATOM 9987  N N    . ASN A 1 83  ? -17.868 0.926   -16.697 1.00 0.00 ? 101 ASN A N    5  
ATOM 9988  C CA   . ASN A 1 83  ? -18.369 1.956   -15.794 1.00 0.00 ? 101 ASN A CA   5  
ATOM 9989  C C    . ASN A 1 83  ? -17.423 3.152   -15.756 1.00 0.00 ? 101 ASN A C    5  
ATOM 9990  O O    . ASN A 1 83  ? -16.248 3.041   -16.108 1.00 0.00 ? 101 ASN A O    5  
ATOM 9991  C CB   . ASN A 1 83  ? -18.548 1.387   -14.385 1.00 0.00 ? 101 ASN A CB   5  
ATOM 9992  C CG   . ASN A 1 83  ? -20.005 1.167   -14.030 1.00 0.00 ? 101 ASN A CG   5  
ATOM 9993  O OD1  . ASN A 1 83  ? -20.449 1.519   -12.937 1.00 0.00 ? 101 ASN A OD1  5  
ATOM 9994  N ND2  . ASN A 1 83  ? -20.756 0.580   -14.955 1.00 0.00 ? 101 ASN A ND2  5  
ATOM 9995  H H    . ASN A 1 83  ? -17.788 0.005   -16.372 1.00 0.00 ? 101 ASN A H    5  
ATOM 9996  H HA   . ASN A 1 83  ? -19.330 2.283   -16.163 1.00 0.00 ? 101 ASN A HA   5  
ATOM 9997  H HB3  . ASN A 1 83  ? -18.121 2.074   -13.669 1.00 0.00 ? 101 ASN A HB3  5  
ATOM 9998  H HD21 . ASN A 1 83  ? -20.334 0.326   -15.802 1.00 0.00 ? 101 ASN A HD21 5  
ATOM 9999  H HD22 . ASN A 1 83  ? -21.703 0.427   -14.752 1.00 0.00 ? 101 ASN A HD22 5  
ATOM 10000 N N    . THR A 1 84  ? -17.942 4.297   -15.324 1.00 0.00 ? 102 THR A N    5  
ATOM 10001 C CA   . THR A 1 84  ? -17.146 5.514   -15.240 1.00 0.00 ? 102 THR A CA   5  
ATOM 10002 C C    . THR A 1 84  ? -17.457 6.288   -13.964 1.00 0.00 ? 102 THR A C    5  
ATOM 10003 O O    . THR A 1 84  ? -18.227 5.830   -13.121 1.00 0.00 ? 102 THR A O    5  
ATOM 10004 C CB   . THR A 1 84  ? -17.387 6.430   -16.455 1.00 0.00 ? 102 THR A CB   5  
ATOM 10005 O OG1  . THR A 1 84  ? -18.760 6.832   -16.499 1.00 0.00 ? 102 THR A OG1  5  
ATOM 10006 C CG2  . THR A 1 84  ? -17.019 5.719   -17.749 1.00 0.00 ? 102 THR A CG2  5  
ATOM 10007 H H    . THR A 1 84  ? -18.884 4.323   -15.057 1.00 0.00 ? 102 THR A H    5  
ATOM 10008 H HA   . THR A 1 84  ? -16.103 5.230   -15.231 1.00 0.00 ? 102 THR A HA   5  
ATOM 10009 H HB   . THR A 1 84  ? -16.764 7.307   -16.354 1.00 0.00 ? 102 THR A HB   5  
ATOM 10010 H HG1  . THR A 1 84  ? -18.849 7.707   -16.112 1.00 0.00 ? 102 THR A HG1  5  
ATOM 10011 H HG21 . THR A 1 84  ? -17.376 4.701   -17.714 1.00 0.00 ? 102 THR A HG21 5  
ATOM 10012 H HG22 . THR A 1 84  ? -15.947 5.721   -17.870 1.00 0.00 ? 102 THR A HG22 5  
ATOM 10013 H HG23 . THR A 1 84  ? -17.477 6.232   -18.582 1.00 0.00 ? 102 THR A HG23 5  
ATOM 10014 N N    . GLY A 1 85  ? -16.855 7.467   -13.830 1.00 0.00 ? 103 GLY A N    5  
ATOM 10015 C CA   . GLY A 1 85  ? -17.082 8.287   -12.655 1.00 0.00 ? 103 GLY A CA   5  
ATOM 10016 C C    . GLY A 1 85  ? -16.416 7.722   -11.417 1.00 0.00 ? 103 GLY A C    5  
ATOM 10017 O O    . GLY A 1 85  ? -15.356 7.102   -11.500 1.00 0.00 ? 103 GLY A O    5  
ATOM 10018 H H    . GLY A 1 85  ? -16.251 7.782   -14.537 1.00 0.00 ? 103 GLY A H    5  
ATOM 10019 H HA2  . GLY A 1 85  ? -16.694 9.277   -12.840 1.00 0.00 ? 103 GLY A HA2  5  
ATOM 10020 H HA3  . GLY A 1 85  ? -18.146 8.355   -12.478 1.00 0.00 ? 103 GLY A HA3  5  
ATOM 10021 N N    . VAL A 1 86  ? -17.038 7.936   -10.261 1.00 0.00 ? 104 VAL A N    5  
ATOM 10022 C CA   . VAL A 1 86  ? -16.499 7.444   -9.000  1.00 0.00 ? 104 VAL A CA   5  
ATOM 10023 C C    . VAL A 1 86  ? -17.476 6.495   -8.315  1.00 0.00 ? 104 VAL A C    5  
ATOM 10024 O O    . VAL A 1 86  ? -17.995 6.791   -7.239  1.00 0.00 ? 104 VAL A O    5  
ATOM 10025 C CB   . VAL A 1 86  ? -16.169 8.603   -8.040  1.00 0.00 ? 104 VAL A CB   5  
ATOM 10026 C CG1  . VAL A 1 86  ? -15.430 8.088   -6.815  1.00 0.00 ? 104 VAL A CG1  5  
ATOM 10027 C CG2  . VAL A 1 86  ? -15.355 9.670   -8.754  1.00 0.00 ? 104 VAL A CG2  5  
ATOM 10028 H H    . VAL A 1 86  ? -17.880 8.436   -10.258 1.00 0.00 ? 104 VAL A H    5  
ATOM 10029 H HA   . VAL A 1 86  ? -15.583 6.910   -9.213  1.00 0.00 ? 104 VAL A HA   5  
ATOM 10030 H HB   . VAL A 1 86  ? -17.098 9.048   -7.713  1.00 0.00 ? 104 VAL A HB   5  
ATOM 10031 H HG11 . VAL A 1 86  ? -15.206 7.039   -6.944  1.00 0.00 ? 104 VAL A HG11 5  
ATOM 10032 H HG12 . VAL A 1 86  ? -14.511 8.640   -6.689  1.00 0.00 ? 104 VAL A HG12 5  
ATOM 10033 H HG13 . VAL A 1 86  ? -16.050 8.218   -5.939  1.00 0.00 ? 104 VAL A HG13 5  
ATOM 10034 H HG21 . VAL A 1 86  ? -16.015 10.442  -9.119  1.00 0.00 ? 104 VAL A HG21 5  
ATOM 10035 H HG22 . VAL A 1 86  ? -14.643 10.103  -8.065  1.00 0.00 ? 104 VAL A HG22 5  
ATOM 10036 H HG23 . VAL A 1 86  ? -14.826 9.226   -9.585  1.00 0.00 ? 104 VAL A HG23 5  
ATOM 10037 N N    . TYR A 1 87  ? -17.724 5.354   -8.949  1.00 0.00 ? 105 TYR A N    5  
ATOM 10038 C CA   . TYR A 1 87  ? -18.643 4.362   -8.403  1.00 0.00 ? 105 TYR A CA   5  
ATOM 10039 C C    . TYR A 1 87  ? -18.227 3.952   -6.994  1.00 0.00 ? 105 TYR A C    5  
ATOM 10040 O O    . TYR A 1 87  ? -17.103 4.213   -6.566  1.00 0.00 ? 105 TYR A O    5  
ATOM 10041 C CB   . TYR A 1 87  ? -18.693 3.130   -9.309  1.00 0.00 ? 105 TYR A CB   5  
ATOM 10042 C CG   . TYR A 1 87  ? -19.970 2.331   -9.175  1.00 0.00 ? 105 TYR A CG   5  
ATOM 10043 C CD1  . TYR A 1 87  ? -21.116 2.692   -9.874  1.00 0.00 ? 105 TYR A CD1  5  
ATOM 10044 C CD2  . TYR A 1 87  ? -20.032 1.217   -8.348  1.00 0.00 ? 105 TYR A CD2  5  
ATOM 10045 C CE1  . TYR A 1 87  ? -22.284 1.965   -9.754  1.00 0.00 ? 105 TYR A CE1  5  
ATOM 10046 C CE2  . TYR A 1 87  ? -21.196 0.483   -8.223  1.00 0.00 ? 105 TYR A CE2  5  
ATOM 10047 C CZ   . TYR A 1 87  ? -22.319 0.861   -8.927  1.00 0.00 ? 105 TYR A CZ   5  
ATOM 10048 O OH   . TYR A 1 87  ? -23.480 0.135   -8.805  1.00 0.00 ? 105 TYR A OH   5  
ATOM 10049 H H    . TYR A 1 87  ? -17.282 5.175   -9.804  1.00 0.00 ? 105 TYR A H    5  
ATOM 10050 H HA   . TYR A 1 87  ? -19.626 4.806   -8.362  1.00 0.00 ? 105 TYR A HA   5  
ATOM 10051 H HB3  . TYR A 1 87  ? -17.867 2.479   -9.066  1.00 0.00 ? 105 TYR A HB3  5  
ATOM 10052 H HD1  . TYR A 1 87  ? -21.085 3.558   -10.520 1.00 0.00 ? 105 TYR A HD1  5  
ATOM 10053 H HD2  . TYR A 1 87  ? -19.149 0.923   -7.797  1.00 0.00 ? 105 TYR A HD2  5  
ATOM 10054 H HE1  . TYR A 1 87  ? -23.165 2.262   -10.305 1.00 0.00 ? 105 TYR A HE1  5  
ATOM 10055 H HE2  . TYR A 1 87  ? -21.223 -0.381  -7.576  1.00 0.00 ? 105 TYR A HE2  5  
ATOM 10056 H HH   . TYR A 1 87  ? -24.210 0.728   -8.606  1.00 0.00 ? 105 TYR A HH   5  
ATOM 10057 N N    . ILE A 1 88  ? -19.145 3.311   -6.277  1.00 0.00 ? 106 ILE A N    5  
ATOM 10058 C CA   . ILE A 1 88  ? -18.874 2.864   -4.915  1.00 0.00 ? 106 ILE A CA   5  
ATOM 10059 C C    . ILE A 1 88  ? -19.425 1.462   -4.678  1.00 0.00 ? 106 ILE A C    5  
ATOM 10060 O O    . ILE A 1 88  ? -20.245 0.966   -5.451  1.00 0.00 ? 106 ILE A O    5  
ATOM 10061 C CB   . ILE A 1 88  ? -19.482 3.825   -3.877  1.00 0.00 ? 106 ILE A CB   5  
ATOM 10062 C CG1  . ILE A 1 88  ? -21.010 3.779   -3.940  1.00 0.00 ? 106 ILE A CG1  5  
ATOM 10063 C CG2  . ILE A 1 88  ? -18.979 5.243   -4.109  1.00 0.00 ? 106 ILE A CG2  5  
ATOM 10064 C CD1  . ILE A 1 88  ? -21.684 4.687   -2.935  1.00 0.00 ? 106 ILE A CD1  5  
ATOM 10065 H H    . ILE A 1 88  ? -20.023 3.133   -6.672  1.00 0.00 ? 106 ILE A H    5  
ATOM 10066 H HA   . ILE A 1 88  ? -17.803 2.847   -4.778  1.00 0.00 ? 106 ILE A HA   5  
ATOM 10067 H HB   . ILE A 1 88  ? -19.159 3.509   -2.897  1.00 0.00 ? 106 ILE A HB   5  
ATOM 10068 H HG13 . ILE A 1 88  ? -21.340 2.768   -3.748  1.00 0.00 ? 106 ILE A HG13 5  
ATOM 10069 H HG21 . ILE A 1 88  ? -18.986 5.783   -3.173  1.00 0.00 ? 106 ILE A HG21 5  
ATOM 10070 H HG22 . ILE A 1 88  ? -17.972 5.207   -4.494  1.00 0.00 ? 106 ILE A HG22 5  
ATOM 10071 H HG23 . ILE A 1 88  ? -19.622 5.740   -4.818  1.00 0.00 ? 106 ILE A HG23 5  
ATOM 10072 H HD11 . ILE A 1 88  ? -22.721 4.405   -2.833  1.00 0.00 ? 106 ILE A HD11 5  
ATOM 10073 H HD12 . ILE A 1 88  ? -21.189 4.599   -1.980  1.00 0.00 ? 106 ILE A HD12 5  
ATOM 10074 H HD13 . ILE A 1 88  ? -21.622 5.710   -3.279  1.00 0.00 ? 106 ILE A HD13 5  
ATOM 10075 N N    . LEU A 1 89  ? -18.969 0.828   -3.603  1.00 0.00 ? 107 LEU A N    5  
ATOM 10076 C CA   . LEU A 1 89  ? -19.417 -0.517  -3.261  1.00 0.00 ? 107 LEU A CA   5  
ATOM 10077 C C    . LEU A 1 89  ? -19.812 -0.603  -1.789  1.00 0.00 ? 107 LEU A C    5  
ATOM 10078 O O    . LEU A 1 89  ? -19.210 0.050   -0.936  1.00 0.00 ? 107 LEU A O    5  
ATOM 10079 C CB   . LEU A 1 89  ? -18.317 -1.535  -3.565  1.00 0.00 ? 107 LEU A CB   5  
ATOM 10080 C CG   . LEU A 1 89  ? -18.349 -2.159  -4.961  1.00 0.00 ? 107 LEU A CG   5  
ATOM 10081 C CD1  . LEU A 1 89  ? -19.641 -2.933  -5.171  1.00 0.00 ? 107 LEU A CD1  5  
ATOM 10082 C CD2  . LEU A 1 89  ? -18.187 -1.087  -6.029  1.00 0.00 ? 107 LEU A CD2  5  
ATOM 10083 H H    . LEU A 1 89  ? -18.316 1.275   -3.025  1.00 0.00 ? 107 LEU A H    5  
ATOM 10084 H HA   . LEU A 1 89  ? -20.282 -0.742  -3.866  1.00 0.00 ? 107 LEU A HA   5  
ATOM 10085 H HB3  . LEU A 1 89  ? -18.398 -2.335  -2.842  1.00 0.00 ? 107 LEU A HB3  5  
ATOM 10086 H HG   . LEU A 1 89  ? -17.526 -2.854  -5.057  1.00 0.00 ? 107 LEU A HG   5  
ATOM 10087 H HD11 . LEU A 1 89  ? -20.166 -2.533  -6.025  1.00 0.00 ? 107 LEU A HD11 5  
ATOM 10088 H HD12 . LEU A 1 89  ? -20.261 -2.841  -4.293  1.00 0.00 ? 107 LEU A HD12 5  
ATOM 10089 H HD13 . LEU A 1 89  ? -19.412 -3.975  -5.344  1.00 0.00 ? 107 LEU A HD13 5  
ATOM 10090 H HD21 . LEU A 1 89  ? -19.155 -0.838  -6.437  1.00 0.00 ? 107 LEU A HD21 5  
ATOM 10091 H HD22 . LEU A 1 89  ? -17.548 -1.459  -6.818  1.00 0.00 ? 107 LEU A HD22 5  
ATOM 10092 H HD23 . LEU A 1 89  ? -17.743 -0.206  -5.590  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 10093 N N    . THR A 1 90  ? -20.825 -1.413  -1.499  1.00 0.00 ? 108 THR A N    5  
ATOM 10094 C CA   . THR A 1 90  ? -21.299 -1.585  -0.132  1.00 0.00 ? 108 THR A CA   5  
ATOM 10095 C C    . THR A 1 90  ? -21.127 -3.027  0.332   1.00 0.00 ? 108 THR A C    5  
ATOM 10096 O O    . THR A 1 90  ? -21.900 -3.521  1.154   1.00 0.00 ? 108 THR A O    5  
ATOM 10097 C CB   . THR A 1 90  ? -22.780 -1.187  0.003   1.00 0.00 ? 108 THR A CB   5  
ATOM 10098 O OG1  . THR A 1 90  ? -23.096 -0.150  -0.932  1.00 0.00 ? 108 THR A OG1  5  
ATOM 10099 C CG2  . THR A 1 90  ? -23.086 -0.711  1.416   1.00 0.00 ? 108 THR A CG2  5  
ATOM 10100 H H    . THR A 1 90  ? -21.264 -1.906  -2.224  1.00 0.00 ? 108 THR A H    5  
ATOM 10101 H HA   . THR A 1 90  ? -20.714 -0.939  0.507   1.00 0.00 ? 108 THR A HA   5  
ATOM 10102 H HB   . THR A 1 90  ? -23.391 -2.052  -0.210  1.00 0.00 ? 108 THR A HB   5  
ATOM 10103 H HG1  . THR A 1 90  ? -23.439 -0.542  -1.740  1.00 0.00 ? 108 THR A HG1  5  
ATOM 10104 H HG21 . THR A 1 90  ? -22.357 -1.121  2.099   1.00 0.00 ? 108 THR A HG21 5  
ATOM 10105 H HG22 . THR A 1 90  ? -24.074 -1.044  1.700   1.00 0.00 ? 108 THR A HG22 5  
ATOM 10106 H HG23 . THR A 1 90  ? -23.045 0.367   1.449   1.00 0.00 ? 108 THR A HG23 5  
ATOM 10107 N N    . SER A 1 91  ? -20.111 -3.699  -0.200  1.00 0.00 ? 109 SER A N    5  
ATOM 10108 C CA   . SER A 1 91  ? -19.840 -5.085  0.158   1.00 0.00 ? 109 SER A CA   5  
ATOM 10109 C C    . SER A 1 91  ? -18.368 -5.425  -0.056  1.00 0.00 ? 109 SER A C    5  
ATOM 10110 O O    . SER A 1 91  ? -17.762 -5.009  -1.043  1.00 0.00 ? 109 SER A O    5  
ATOM 10111 C CB   . SER A 1 91  ? -20.718 -6.028  -0.668  1.00 0.00 ? 109 SER A CB   5  
ATOM 10112 O OG   . SER A 1 91  ? -22.000 -5.466  -0.891  1.00 0.00 ? 109 SER A OG   5  
ATOM 10113 H H    . SER A 1 91  ? -19.530 -3.249  -0.851  1.00 0.00 ? 109 SER A H    5  
ATOM 10114 H HA   . SER A 1 91  ? -20.079 -5.211  1.204   1.00 0.00 ? 109 SER A HA   5  
ATOM 10115 H HB3  . SER A 1 91  ? -20.834 -6.963  -0.139  1.00 0.00 ? 109 SER A HB3  5  
ATOM 10116 H HG   . SER A 1 91  ? -22.470 -5.990  -1.544  1.00 0.00 ? 109 SER A HG   5  
ATOM 10117 N N    . ASN A 1 92  ? -17.800 -6.181  0.877   1.00 0.00 ? 110 ASN A N    5  
ATOM 10118 C CA   . ASN A 1 92  ? -16.398 -6.577  0.792   1.00 0.00 ? 110 ASN A CA   5  
ATOM 10119 C C    . ASN A 1 92  ? -16.071 -7.643  1.832   1.00 0.00 ? 110 ASN A C    5  
ATOM 10120 O O    . ASN A 1 92  ? -16.295 -7.451  3.029   1.00 0.00 ? 110 ASN A O    5  
ATOM 10121 C CB   . ASN A 1 92  ? -15.491 -5.360  0.988   1.00 0.00 ? 110 ASN A CB   5  
ATOM 10122 C CG   . ASN A 1 92  ? -15.899 -4.523  2.185   1.00 0.00 ? 110 ASN A CG   5  
ATOM 10123 O OD1  . ASN A 1 92  ? -16.861 -3.757  2.122   1.00 0.00 ? 110 ASN A OD1  5  
ATOM 10124 N ND2  . ASN A 1 92  ? -15.164 -4.663  3.282   1.00 0.00 ? 110 ASN A ND2  5  
ATOM 10125 H H    . ASN A 1 92  ? -18.335 -6.481  1.642   1.00 0.00 ? 110 ASN A H    5  
ATOM 10126 H HA   . ASN A 1 92  ? -16.230 -6.986  -0.192  1.00 0.00 ? 110 ASN A HA   5  
ATOM 10127 H HB3  . ASN A 1 92  ? -15.534 -4.740  0.105   1.00 0.00 ? 110 ASN A HB3  5  
ATOM 10128 H HD21 . ASN A 1 92  ? -14.411 -5.290  3.259   1.00 0.00 ? 110 ASN A HD21 5  
ATOM 10129 H HD22 . ASN A 1 92  ? -15.405 -4.134  4.070   1.00 0.00 ? 110 ASN A HD22 5  
ATOM 10130 N N    . THR A 1 93  ? -15.537 -8.769  1.370   1.00 0.00 ? 111 THR A N    5  
ATOM 10131 C CA   . THR A 1 93  ? -15.177 -9.866  2.258   1.00 0.00 ? 111 THR A CA   5  
ATOM 10132 C C    . THR A 1 93  ? -13.682 -10.156 2.197   1.00 0.00 ? 111 THR A C    5  
ATOM 10133 O O    . THR A 1 93  ? -12.939 -9.843  3.129   1.00 0.00 ? 111 THR A O    5  
ATOM 10134 C CB   . THR A 1 93  ? -15.952 -11.151 1.909   1.00 0.00 ? 111 THR A CB   5  
ATOM 10135 O OG1  . THR A 1 93  ? -17.361 -10.919 2.020   1.00 0.00 ? 111 THR A OG1  5  
ATOM 10136 C CG2  . THR A 1 93  ? -15.547 -12.294 2.826   1.00 0.00 ? 111 THR A CG2  5  
ATOM 10137 H H    . THR A 1 93  ? -15.382 -8.863  0.407   1.00 0.00 ? 111 THR A H    5  
ATOM 10138 H HA   . THR A 1 93  ? -15.437 -9.577  3.268   1.00 0.00 ? 111 THR A HA   5  
ATOM 10139 H HB   . THR A 1 93  ? -15.721 -11.426 0.890   1.00 0.00 ? 111 THR A HB   5  
ATOM 10140 H HG1  . THR A 1 93  ? -17.824 -11.432 1.355   1.00 0.00 ? 111 THR A HG1  5  
ATOM 10141 H HG21 . THR A 1 93  ? -16.433 -12.806 3.175   1.00 0.00 ? 111 THR A HG21 5  
ATOM 10142 H HG22 . THR A 1 93  ? -15.000 -11.902 3.670   1.00 0.00 ? 111 THR A HG22 5  
ATOM 10143 H HG23 . THR A 1 93  ? -14.922 -12.987 2.282   1.00 0.00 ? 111 THR A HG23 5  
ATOM 10144 N N    . SER A 1 94  ? -13.246 -10.758 1.095   1.00 0.00 ? 112 SER A N    5  
ATOM 10145 C CA   . SER A 1 94  ? -11.838 -11.093 0.916   1.00 0.00 ? 112 SER A CA   5  
ATOM 10146 C C    . SER A 1 94  ? -10.974 -9.835  0.919   1.00 0.00 ? 112 SER A C    5  
ATOM 10147 O O    . SER A 1 94  ? -11.488 -8.718  0.882   1.00 0.00 ? 112 SER A O    5  
ATOM 10148 C CB   . SER A 1 94  ? -11.638 -11.858 -0.394  1.00 0.00 ? 112 SER A CB   5  
ATOM 10149 O OG   . SER A 1 94  ? -11.400 -10.970 -1.473  1.00 0.00 ? 112 SER A OG   5  
ATOM 10150 H H    . SER A 1 94  ? -13.885 -10.984 0.389   1.00 0.00 ? 112 SER A H    5  
ATOM 10151 H HA   . SER A 1 94  ? -11.538 -11.723 1.739   1.00 0.00 ? 112 SER A HA   5  
ATOM 10152 H HB3  . SER A 1 94  ? -12.525 -12.437 -0.609  1.00 0.00 ? 112 SER A HB3  5  
ATOM 10153 H HG   . SER A 1 94  ? -12.052 -11.120 -2.162  1.00 0.00 ? 112 SER A HG   5  
ATOM 10154 N N    . GLN A 1 95  ? -9.660  -10.027 0.964   1.00 0.00 ? 113 GLN A N    5  
ATOM 10155 C CA   . GLN A 1 95  ? -8.725  -8.909  0.972   1.00 0.00 ? 113 GLN A CA   5  
ATOM 10156 C C    . GLN A 1 95  ? -8.776  -8.145  -0.347  1.00 0.00 ? 113 GLN A C    5  
ATOM 10157 O O    . GLN A 1 95  ? -9.198  -8.684  -1.370  1.00 0.00 ? 113 GLN A O    5  
ATOM 10158 C CB   . GLN A 1 95  ? -7.303  -9.407  1.234   1.00 0.00 ? 113 GLN A CB   5  
ATOM 10159 C CG   . GLN A 1 95  ? -7.111  -10.003 2.619   1.00 0.00 ? 113 GLN A CG   5  
ATOM 10160 C CD   . GLN A 1 95  ? -7.645  -11.418 2.723   1.00 0.00 ? 113 GLN A CD   5  
ATOM 10161 O OE1  . GLN A 1 95  ? -7.152  -12.329 2.060   1.00 0.00 ? 113 GLN A OE1  5  
ATOM 10162 N NE2  . GLN A 1 95  ? -8.658  -11.609 3.563   1.00 0.00 ? 113 GLN A NE2  5  
ATOM 10163 H H    . GLN A 1 95  ? -9.311  -10.942 0.992   1.00 0.00 ? 113 GLN A H    5  
ATOM 10164 H HA   . GLN A 1 95  ? -9.014  -8.241  1.771   1.00 0.00 ? 113 GLN A HA   5  
ATOM 10165 H HB3  . GLN A 1 95  ? -6.618  -8.579  1.124   1.00 0.00 ? 113 GLN A HB3  5  
ATOM 10166 H HG3  . GLN A 1 95  ? -7.629  -9.384  3.337   1.00 0.00 ? 113 GLN A HG3  5  
ATOM 10167 H HE21 . GLN A 1 95  ? -8.999  -10.835 4.058   1.00 0.00 ? 113 GLN A HE21 5  
ATOM 10168 H HE22 . GLN A 1 95  ? -9.021  -12.513 3.649   1.00 0.00 ? 113 GLN A HE22 5  
ATOM 10169 N N    . TYR A 1 96  ? -8.342  -6.890  -0.316  1.00 0.00 ? 114 TYR A N    5  
ATOM 10170 C CA   . TYR A 1 96  ? -8.340  -6.052  -1.509  1.00 0.00 ? 114 TYR A CA   5  
ATOM 10171 C C    . TYR A 1 96  ? -7.238  -4.999  -1.434  1.00 0.00 ? 114 TYR A C    5  
ATOM 10172 O O    . TYR A 1 96  ? -6.447  -4.979  -0.492  1.00 0.00 ? 114 TYR A O    5  
ATOM 10173 C CB   . TYR A 1 96  ? -9.700  -5.373  -1.682  1.00 0.00 ? 114 TYR A CB   5  
ATOM 10174 C CG   . TYR A 1 96  ? -10.811 -6.328  -2.059  1.00 0.00 ? 114 TYR A CG   5  
ATOM 10175 C CD1  . TYR A 1 96  ? -10.845 -6.924  -3.313  1.00 0.00 ? 114 TYR A CD1  5  
ATOM 10176 C CD2  . TYR A 1 96  ? -11.827 -6.631  -1.161  1.00 0.00 ? 114 TYR A CD2  5  
ATOM 10177 C CE1  . TYR A 1 96  ? -11.858 -7.796  -3.662  1.00 0.00 ? 114 TYR A CE1  5  
ATOM 10178 C CE2  . TYR A 1 96  ? -12.842 -7.503  -1.500  1.00 0.00 ? 114 TYR A CE2  5  
ATOM 10179 C CZ   . TYR A 1 96  ? -12.854 -8.082  -2.751  1.00 0.00 ? 114 TYR A CZ   5  
ATOM 10180 O OH   . TYR A 1 96  ? -13.866 -8.950  -3.094  1.00 0.00 ? 114 TYR A OH   5  
ATOM 10181 H H    . TYR A 1 96  ? -8.017  -6.517  0.530   1.00 0.00 ? 114 TYR A H    5  
ATOM 10182 H HA   . TYR A 1 96  ? -8.156  -6.690  -2.361  1.00 0.00 ? 114 TYR A HA   5  
ATOM 10183 H HB3  . TYR A 1 96  ? -9.624  -4.628  -2.460  1.00 0.00 ? 114 TYR A HB3  5  
ATOM 10184 H HD1  . TYR A 1 96  ? -10.063 -6.697  -4.024  1.00 0.00 ? 114 TYR A HD1  5  
ATOM 10185 H HD2  . TYR A 1 96  ? -11.814 -6.175  -0.182  1.00 0.00 ? 114 TYR A HD2  5  
ATOM 10186 H HE1  . TYR A 1 96  ? -11.868 -8.250  -4.641  1.00 0.00 ? 114 TYR A HE1  5  
ATOM 10187 H HE2  . TYR A 1 96  ? -13.623 -7.727  -0.788  1.00 0.00 ? 114 TYR A HE2  5  
ATOM 10188 H HH   . TYR A 1 96  ? -14.165 -8.757  -3.986  1.00 0.00 ? 114 TYR A HH   5  
ATOM 10189 N N    . ASP A 1 97  ? -7.194  -4.127  -2.436  1.00 0.00 ? 115 ASP A N    5  
ATOM 10190 C CA   . ASP A 1 97  ? -6.191  -3.071  -2.484  1.00 0.00 ? 115 ASP A CA   5  
ATOM 10191 C C    . ASP A 1 97  ? -6.473  -2.004  -1.429  1.00 0.00 ? 115 ASP A C    5  
ATOM 10192 O O    . ASP A 1 97  ? -7.516  -2.024  -0.774  1.00 0.00 ? 115 ASP A O    5  
ATOM 10193 C CB   . ASP A 1 97  ? -6.158  -2.433  -3.874  1.00 0.00 ? 115 ASP A CB   5  
ATOM 10194 C CG   . ASP A 1 97  ? -4.794  -1.869  -4.220  1.00 0.00 ? 115 ASP A CG   5  
ATOM 10195 O OD1  . ASP A 1 97  ? -3.851  -2.064  -3.424  1.00 0.00 ? 115 ASP A OD1  5  
ATOM 10196 O OD2  . ASP A 1 97  ? -4.669  -1.233  -5.286  1.00 0.00 ? 115 ASP A OD2  5  
ATOM 10197 H H    . ASP A 1 97  ? -7.852  -4.196  -3.158  1.00 0.00 ? 115 ASP A H    5  
ATOM 10198 H HA   . ASP A 1 97  ? -5.230  -3.516  -2.279  1.00 0.00 ? 115 ASP A HA   5  
ATOM 10199 H HB3  . ASP A 1 97  ? -6.879  -1.631  -3.913  1.00 0.00 ? 115 ASP A HB3  5  
ATOM 10200 N N    . THR A 1 98  ? -5.537  -1.075  -1.269  1.00 0.00 ? 116 THR A N    5  
ATOM 10201 C CA   . THR A 1 98  ? -5.683  -0.003  -0.293  1.00 0.00 ? 116 THR A CA   5  
ATOM 10202 C C    . THR A 1 98  ? -5.050  1.290   -0.796  1.00 0.00 ? 116 THR A C    5  
ATOM 10203 O O    . THR A 1 98  ? -3.952  1.280   -1.353  1.00 0.00 ? 116 THR A O    5  
ATOM 10204 C CB   . THR A 1 98  ? -5.043  -0.382  1.058   1.00 0.00 ? 116 THR A CB   5  
ATOM 10205 O OG1  . THR A 1 98  ? -5.393  0.586   2.053   1.00 0.00 ? 116 THR A OG1  5  
ATOM 10206 C CG2  . THR A 1 98  ? -3.529  -0.466  0.935   1.00 0.00 ? 116 THR A CG2  5  
ATOM 10207 H H    . THR A 1 98  ? -4.727  -1.113  -1.821  1.00 0.00 ? 116 THR A H    5  
ATOM 10208 H HA   . THR A 1 98  ? -6.738  0.163   -0.134  1.00 0.00 ? 116 THR A HA   5  
ATOM 10209 H HB   . THR A 1 98  ? -5.421  -1.349  1.357   1.00 0.00 ? 116 THR A HB   5  
ATOM 10210 H HG1  . THR A 1 98  ? -6.331  0.783   1.992   1.00 0.00 ? 116 THR A HG1  5  
ATOM 10211 H HG21 . THR A 1 98  ? -3.136  0.502   0.665   1.00 0.00 ? 116 THR A HG21 5  
ATOM 10212 H HG22 . THR A 1 98  ? -3.270  -1.185  0.172   1.00 0.00 ? 116 THR A HG22 5  
ATOM 10213 H HG23 . THR A 1 98  ? -3.109  -0.776  1.880   1.00 0.00 ? 116 THR A HG23 5  
ATOM 10214 N N    . TYR A 1 99  ? -5.750  2.401   -0.597  1.00 0.00 ? 117 TYR A N    5  
ATOM 10215 C CA   . TYR A 1 99  ? -5.258  3.703   -1.034  1.00 0.00 ? 117 TYR A CA   5  
ATOM 10216 C C    . TYR A 1 99  ? -4.771  4.527   0.154   1.00 0.00 ? 117 TYR A C    5  
ATOM 10217 O O    . TYR A 1 99  ? -5.236  4.350   1.280   1.00 0.00 ? 117 TYR A O    5  
ATOM 10218 C CB   . TYR A 1 99  ? -6.355  4.461   -1.781  1.00 0.00 ? 117 TYR A CB   5  
ATOM 10219 C CG   . TYR A 1 99  ? -6.871  3.735   -3.003  1.00 0.00 ? 117 TYR A CG   5  
ATOM 10220 C CD1  . TYR A 1 99  ? -5.999  3.090   -3.871  1.00 0.00 ? 117 TYR A CD1  5  
ATOM 10221 C CD2  . TYR A 1 99  ? -8.230  3.693   -3.287  1.00 0.00 ? 117 TYR A CD2  5  
ATOM 10222 C CE1  . TYR A 1 99  ? -6.466  2.425   -4.988  1.00 0.00 ? 117 TYR A CE1  5  
ATOM 10223 C CE2  . TYR A 1 99  ? -8.706  3.029   -4.402  1.00 0.00 ? 117 TYR A CE2  5  
ATOM 10224 C CZ   . TYR A 1 99  ? -7.820  2.397   -5.249  1.00 0.00 ? 117 TYR A CZ   5  
ATOM 10225 O OH   . TYR A 1 99  ? -8.289  1.735   -6.360  1.00 0.00 ? 117 TYR A OH   5  
ATOM 10226 H H    . TYR A 1 99  ? -6.619  2.346   -0.149  1.00 0.00 ? 117 TYR A H    5  
ATOM 10227 H HA   . TYR A 1 99  ? -4.427  3.535   -1.706  1.00 0.00 ? 117 TYR A HA   5  
ATOM 10228 H HB3  . TYR A 1 99  ? -5.967  5.417   -2.103  1.00 0.00 ? 117 TYR A HB3  5  
ATOM 10229 H HD1  . TYR A 1 99  ? -4.939  3.112   -3.663  1.00 0.00 ? 117 TYR A HD1  5  
ATOM 10230 H HD2  . TYR A 1 99  ? -8.921  4.189   -2.622  1.00 0.00 ? 117 TYR A HD2  5  
ATOM 10231 H HE1  . TYR A 1 99  ? -5.773  1.929   -5.652  1.00 0.00 ? 117 TYR A HE1  5  
ATOM 10232 H HE2  . TYR A 1 99  ? -9.766  3.008   -4.607  1.00 0.00 ? 117 TYR A HE2  5  
ATOM 10233 H HH   . TYR A 1 99  ? -7.892  0.863   -6.404  1.00 0.00 ? 117 TYR A HH   5  
ATOM 10234 N N    . CYS A 1 100 ? -3.832  5.429   -0.106  1.00 0.00 ? 118 CYS A N    5  
ATOM 10235 C CA   . CYS A 1 100 ? -3.281  6.284   0.940   1.00 0.00 ? 118 CYS A CA   5  
ATOM 10236 C C    . CYS A 1 100 ? -3.048  7.698   0.419   1.00 0.00 ? 118 CYS A C    5  
ATOM 10237 O O    . CYS A 1 100 ? -2.862  7.909   -0.780  1.00 0.00 ? 118 CYS A O    5  
ATOM 10238 C CB   . CYS A 1 100 ? -1.968  5.699   1.464   1.00 0.00 ? 118 CYS A CB   5  
ATOM 10239 S SG   . CYS A 1 100 ? -2.161  4.125   2.362   1.00 0.00 ? 118 CYS A SG   5  
ATOM 10240 H H    . CYS A 1 100 ? -3.500  5.524   -1.024  1.00 0.00 ? 118 CYS A H    5  
ATOM 10241 H HA   . CYS A 1 100 ? -3.995  6.324   1.747   1.00 0.00 ? 118 CYS A HA   5  
ATOM 10242 H HB3  . CYS A 1 100 ? -1.510  6.408   2.138   1.00 0.00 ? 118 CYS A HB3  5  
ATOM 10243 N N    . PHE A 1 101 ? -3.057  8.667   1.330   1.00 0.00 ? 119 PHE A N    5  
ATOM 10244 C CA   . PHE A 1 101 ? -2.846  10.063  0.964   1.00 0.00 ? 119 PHE A CA   5  
ATOM 10245 C C    . PHE A 1 101 ? -1.709  10.673  1.776   1.00 0.00 ? 119 PHE A C    5  
ATOM 10246 O O    . PHE A 1 101 ? -1.709  10.613  3.006   1.00 0.00 ? 119 PHE A O    5  
ATOM 10247 C CB   . PHE A 1 101 ? -4.131  10.867  1.178   1.00 0.00 ? 119 PHE A CB   5  
ATOM 10248 C CG   . PHE A 1 101 ? -3.933  12.351  1.073   1.00 0.00 ? 119 PHE A CG   5  
ATOM 10249 C CD1  . PHE A 1 101 ? -3.245  12.899  0.003   1.00 0.00 ? 119 PHE A CD1  5  
ATOM 10250 C CD2  . PHE A 1 101 ? -4.434  13.201  2.048   1.00 0.00 ? 119 PHE A CD2  5  
ATOM 10251 C CE1  . PHE A 1 101 ? -3.061  14.266  -0.096  1.00 0.00 ? 119 PHE A CE1  5  
ATOM 10252 C CE2  . PHE A 1 101 ? -4.253  14.568  1.953   1.00 0.00 ? 119 PHE A CE2  5  
ATOM 10253 C CZ   . PHE A 1 101 ? -3.565  15.100  0.881   1.00 0.00 ? 119 PHE A CZ   5  
ATOM 10254 H H    . PHE A 1 101 ? -3.208  8.436   2.270   1.00 0.00 ? 119 PHE A H    5  
ATOM 10255 H HA   . PHE A 1 101 ? -2.583  10.094  -0.082  1.00 0.00 ? 119 PHE A HA   5  
ATOM 10256 H HB3  . PHE A 1 101 ? -4.522  10.651  2.161   1.00 0.00 ? 119 PHE A HB3  5  
ATOM 10257 H HD1  . PHE A 1 101 ? -2.850  12.246  -0.762  1.00 0.00 ? 119 PHE A HD1  5  
ATOM 10258 H HD2  . PHE A 1 101 ? -4.971  12.786  2.887   1.00 0.00 ? 119 PHE A HD2  5  
ATOM 10259 H HE1  . PHE A 1 101 ? -2.522  14.678  -0.937  1.00 0.00 ? 119 PHE A HE1  5  
ATOM 10260 H HE2  . PHE A 1 101 ? -4.648  15.218  2.719   1.00 0.00 ? 119 PHE A HE2  5  
ATOM 10261 H HZ   . PHE A 1 101 ? -3.423  16.168  0.805   1.00 0.00 ? 119 PHE A HZ   5  
ATOM 10262 N N    . ASN A 1 102 ? -0.741  11.260  1.081   1.00 0.00 ? 120 ASN A N    5  
ATOM 10263 C CA   . ASN A 1 102 ? 0.403   11.881  1.739   1.00 0.00 ? 120 ASN A CA   5  
ATOM 10264 C C    . ASN A 1 102 ? 0.483   13.368  1.402   1.00 0.00 ? 120 ASN A C    5  
ATOM 10265 O O    . ASN A 1 102 ? 0.709   13.743  0.252   1.00 0.00 ? 120 ASN A O    5  
ATOM 10266 C CB   . ASN A 1 102 ? 1.699   11.182  1.321   1.00 0.00 ? 120 ASN A CB   5  
ATOM 10267 C CG   . ASN A 1 102 ? 2.818   11.393  2.322   1.00 0.00 ? 120 ASN A CG   5  
ATOM 10268 O OD1  . ASN A 1 102 ? 2.711   12.222  3.226   1.00 0.00 ? 120 ASN A OD1  5  
ATOM 10269 N ND2  . ASN A 1 102 ? 3.901   10.641  2.165   1.00 0.00 ? 120 ASN A ND2  5  
ATOM 10270 H H    . ASN A 1 102 ? -0.797  11.277  0.104   1.00 0.00 ? 120 ASN A H    5  
ATOM 10271 H HA   . ASN A 1 102 ? 0.274   11.772  2.805   1.00 0.00 ? 120 ASN A HA   5  
ATOM 10272 H HB3  . ASN A 1 102 ? 2.018   11.569  0.365   1.00 0.00 ? 120 ASN A HB3  5  
ATOM 10273 H HD21 . ASN A 1 102 ? 3.919   10.002  1.422   1.00 0.00 ? 120 ASN A HD21 5  
ATOM 10274 H HD22 . ASN A 1 102 ? 4.640   10.757  2.799   1.00 0.00 ? 120 ASN A HD22 5  
ATOM 10275 N N    . ALA A 1 103 ? 0.298   14.208  2.414   1.00 0.00 ? 121 ALA A N    5  
ATOM 10276 C CA   . ALA A 1 103 ? 0.352   15.654  2.228   1.00 0.00 ? 121 ALA A CA   5  
ATOM 10277 C C    . ALA A 1 103 ? 1.759   16.106  1.857   1.00 0.00 ? 121 ALA A C    5  
ATOM 10278 O O    . ALA A 1 103 ? 1.943   17.174  1.273   1.00 0.00 ? 121 ALA A O    5  
ATOM 10279 C CB   . ALA A 1 103 ? -0.120  16.366  3.486   1.00 0.00 ? 121 ALA A CB   5  
ATOM 10280 H H    . ALA A 1 103 ? 0.123   13.849  3.309   1.00 0.00 ? 121 ALA A H    5  
ATOM 10281 H HA   . ALA A 1 103 ? -0.323  15.911  1.423   1.00 0.00 ? 121 ALA A HA   5  
ATOM 10282 H HB1  . ALA A 1 103 ? -0.848  15.751  3.996   1.00 0.00 ? 121 ALA A HB1  5  
ATOM 10283 H HB2  . ALA A 1 103 ? 0.722   16.540  4.138   1.00 0.00 ? 121 ALA A HB2  5  
ATOM 10284 H HB3  . ALA A 1 103 ? -0.570  17.310  3.216   1.00 0.00 ? 121 ALA A HB3  5  
ATOM 10285 N N    . SER A 1 104 ? 2.749   15.289  2.198   1.00 0.00 ? 122 SER A N    5  
ATOM 10286 C CA   . SER A 1 104 ? 4.141   15.607  1.905   1.00 0.00 ? 122 SER A CA   5  
ATOM 10287 C C    . SER A 1 104 ? 4.325   15.926  0.423   1.00 0.00 ? 122 SER A C    5  
ATOM 10288 O O    . SER A 1 104 ? 4.657   17.053  0.056   1.00 0.00 ? 122 SER A O    5  
ATOM 10289 C CB   . SER A 1 104 ? 5.050   14.444  2.305   1.00 0.00 ? 122 SER A CB   5  
ATOM 10290 O OG   . SER A 1 104 ? 6.233   14.911  2.928   1.00 0.00 ? 122 SER A OG   5  
ATOM 10291 H H    . SER A 1 104 ? 2.537   14.450  2.661   1.00 0.00 ? 122 SER A H    5  
ATOM 10292 H HA   . SER A 1 104 ? 4.410   16.479  2.483   1.00 0.00 ? 122 SER A HA   5  
ATOM 10293 H HB3  . SER A 1 104 ? 5.318   13.881  1.423   1.00 0.00 ? 122 SER A HB3  5  
ATOM 10294 H HG   . SER A 1 104 ? 6.028   15.228  3.810   1.00 0.00 ? 122 SER A HG   5  
ATOM 10295 N N    . ALA A 1 105 ? 4.106   14.924  -0.421  1.00 0.00 ? 123 ALA A N    5  
ATOM 10296 C CA   . ALA A 1 105 ? 4.246   15.095  -1.862  1.00 0.00 ? 123 ALA A CA   5  
ATOM 10297 C C    . ALA A 1 105 ? 3.443   16.296  -2.352  1.00 0.00 ? 123 ALA A C    5  
ATOM 10298 O O    . ALA A 1 105 ? 2.518   16.767  -1.690  1.00 0.00 ? 123 ALA A O    5  
ATOM 10299 C CB   . ALA A 1 105 ? 3.806   13.833  -2.589  1.00 0.00 ? 123 ALA A CB   5  
ATOM 10300 H H    . ALA A 1 105 ? 3.844   14.048  -0.067  1.00 0.00 ? 123 ALA A H    5  
ATOM 10301 H HA   . ALA A 1 105 ? 5.292   15.261  -2.080  1.00 0.00 ? 123 ALA A HA   5  
ATOM 10302 H HB1  . ALA A 1 105 ? 3.215   14.102  -3.452  1.00 0.00 ? 123 ALA A HB1  5  
ATOM 10303 H HB2  . ALA A 1 105 ? 4.678   13.280  -2.906  1.00 0.00 ? 123 ALA A HB2  5  
ATOM 10304 H HB3  . ALA A 1 105 ? 3.215   13.222  -1.923  1.00 0.00 ? 123 ALA A HB3  5  
ATOM 10305 N N    . PRO A 1 106 ? 3.804   16.804  -3.540  1.00 0.00 ? 124 PRO A N    5  
ATOM 10306 C CA   . PRO A 1 106 ? 3.131   17.958  -4.144  1.00 0.00 ? 124 PRO A CA   5  
ATOM 10307 C C    . PRO A 1 106 ? 1.715   17.625  -4.606  1.00 0.00 ? 124 PRO A C    5  
ATOM 10308 O O    . PRO A 1 106 ? 1.325   16.461  -4.702  1.00 0.00 ? 124 PRO A O    5  
ATOM 10309 C CB   . PRO A 1 106 ? 4.018   18.299  -5.343  1.00 0.00 ? 124 PRO A CB   5  
ATOM 10310 C CG   . PRO A 1 106 ? 4.701   17.019  -5.686  1.00 0.00 ? 124 PRO A CG   5  
ATOM 10311 C CD   . PRO A 1 106 ? 4.897   16.294  -4.383  1.00 0.00 ? 124 PRO A CD   5  
ATOM 10312 H HA   . PRO A 1 106 ? 3.099   18.798  -3.466  1.00 0.00 ? 124 PRO A HA   5  
ATOM 10313 H HB3  . PRO A 1 106 ? 4.728   19.062  -5.064  1.00 0.00 ? 124 PRO A HB3  5  
ATOM 10314 H HG3  . PRO A 1 106 ? 5.653   17.224  -6.148  1.00 0.00 ? 124 PRO A HG3  5  
ATOM 10315 H HD3  . PRO A 1 106 ? 5.858   16.538  -3.957  1.00 0.00 ? 124 PRO A HD3  5  
ATOM 10316 N N    . PRO A 1 107 ? 0.927   18.670  -4.899  1.00 0.00 ? 125 PRO A N    5  
ATOM 10317 C CA   . PRO A 1 107 ? -0.457  18.514  -5.358  1.00 0.00 ? 125 PRO A CA   5  
ATOM 10318 C C    . PRO A 1 107 ? -0.540  17.931  -6.764  1.00 0.00 ? 125 PRO A C    5  
ATOM 10319 O O    . PRO A 1 107 ? -1.623  17.603  -7.246  1.00 0.00 ? 125 PRO A O    5  
ATOM 10320 C CB   . PRO A 1 107 ? -1.001  19.944  -5.338  1.00 0.00 ? 125 PRO A CB   5  
ATOM 10321 C CG   . PRO A 1 107 ? 0.203   20.809  -5.495  1.00 0.00 ? 125 PRO A CG   5  
ATOM 10322 C CD   . PRO A 1 107 ? 1.325   20.085  -4.806  1.00 0.00 ? 125 PRO A CD   5  
ATOM 10323 H HA   . PRO A 1 107 ? -1.031  17.900  -4.680  1.00 0.00 ? 125 PRO A HA   5  
ATOM 10324 H HB3  . PRO A 1 107 ? -1.500  20.131  -4.400  1.00 0.00 ? 125 PRO A HB3  5  
ATOM 10325 H HG3  . PRO A 1 107 ? 0.030   21.766  -5.025  1.00 0.00 ? 125 PRO A HG3  5  
ATOM 10326 H HD3  . PRO A 1 107 ? 1.400   20.396  -3.775  1.00 0.00 ? 125 PRO A HD3  5  
ATOM 10327 N N    . GLU A 1 108 ? 0.612   17.806  -7.416  1.00 0.00 ? 126 GLU A N    5  
ATOM 10328 C CA   . GLU A 1 108 ? 0.668   17.263  -8.768  1.00 0.00 ? 126 GLU A CA   5  
ATOM 10329 C C    . GLU A 1 108 ? 0.919   15.759  -8.741  1.00 0.00 ? 126 GLU A C    5  
ATOM 10330 O O    . GLU A 1 108 ? 0.956   15.146  -7.674  1.00 0.00 ? 126 GLU A O    5  
ATOM 10331 C CB   . GLU A 1 108 ? 1.765   17.960  -9.577  1.00 0.00 ? 126 GLU A CB   5  
ATOM 10332 C CG   . GLU A 1 108 ? 1.759   19.472  -9.432  1.00 0.00 ? 126 GLU A CG   5  
ATOM 10333 C CD   . GLU A 1 108 ? 2.684   20.156  -10.422 1.00 0.00 ? 126 GLU A CD   5  
ATOM 10334 O OE1  . GLU A 1 108 ? 2.734   19.715  -11.588 1.00 0.00 ? 126 GLU A OE1  5  
ATOM 10335 O OE2  . GLU A 1 108 ? 3.358   21.131  -10.028 1.00 0.00 ? 126 GLU A OE2  5  
ATOM 10336 H H    . GLU A 1 108 ? 1.442   18.085  -6.978  1.00 0.00 ? 126 GLU A H    5  
ATOM 10337 H HA   . GLU A 1 108 ? -0.286  17.447  -9.239  1.00 0.00 ? 126 GLU A HA   5  
ATOM 10338 H HB3  . GLU A 1 108 ? 1.633   17.719  -10.621 1.00 0.00 ? 126 GLU A HB3  5  
ATOM 10339 H HG3  . GLU A 1 108 ? 2.075   19.726  -8.432  1.00 0.00 ? 126 GLU A HG3  5  
ATOM 10340 N N    . GLU A 1 109 ? 1.091   15.171  -9.921  1.00 0.00 ? 127 GLU A N    5  
ATOM 10341 C CA   . GLU A 1 109 ? 1.336   13.738  -10.031 1.00 0.00 ? 127 GLU A CA   5  
ATOM 10342 C C    . GLU A 1 109 ? 2.809   13.418  -9.788  1.00 0.00 ? 127 GLU A C    5  
ATOM 10343 O O    . GLU A 1 109 ? 3.563   13.164  -10.726 1.00 0.00 ? 127 GLU A O    5  
ATOM 10344 C CB   . GLU A 1 109 ? 0.915   13.231  -11.412 1.00 0.00 ? 127 GLU A CB   5  
ATOM 10345 C CG   . GLU A 1 109 ? 1.510   14.027  -12.561 1.00 0.00 ? 127 GLU A CG   5  
ATOM 10346 C CD   . GLU A 1 109 ? 0.505   14.962  -13.205 1.00 0.00 ? 127 GLU A CD   5  
ATOM 10347 O OE1  . GLU A 1 109 ? -0.572  14.481  -13.617 1.00 0.00 ? 127 GLU A OE1  5  
ATOM 10348 O OE2  . GLU A 1 109 ? 0.794   16.173  -13.299 1.00 0.00 ? 127 GLU A OE2  5  
ATOM 10349 H H    . GLU A 1 109 ? 1.050   15.714  -10.735 1.00 0.00 ? 127 GLU A H    5  
ATOM 10350 H HA   . GLU A 1 109 ? 0.744   13.240  -9.280  1.00 0.00 ? 127 GLU A HA   5  
ATOM 10351 H HB3  . GLU A 1 109 ? -0.160  13.280  -11.487 1.00 0.00 ? 127 GLU A HB3  5  
ATOM 10352 H HG3  . GLU A 1 109 ? 1.872   13.339  -13.310 1.00 0.00 ? 127 GLU A HG3  5  
ATOM 10353 N N    . ASP A 1 110 ? 3.209   13.435  -8.522  1.00 0.00 ? 128 ASP A N    5  
ATOM 10354 C CA   . ASP A 1 110 ? 4.591   13.146  -8.153  1.00 0.00 ? 128 ASP A CA   5  
ATOM 10355 C C    . ASP A 1 110 ? 4.877   11.650  -8.244  1.00 0.00 ? 128 ASP A C    5  
ATOM 10356 O O    . ASP A 1 110 ? 4.656   10.906  -7.289  1.00 0.00 ? 128 ASP A O    5  
ATOM 10357 C CB   . ASP A 1 110 ? 4.879   13.648  -6.738  1.00 0.00 ? 128 ASP A CB   5  
ATOM 10358 C CG   . ASP A 1 110 ? 6.295   14.164  -6.583  1.00 0.00 ? 128 ASP A CG   5  
ATOM 10359 O OD1  . ASP A 1 110 ? 6.572   15.285  -7.061  1.00 0.00 ? 128 ASP A OD1  5  
ATOM 10360 O OD2  . ASP A 1 110 ? 7.127   13.450  -5.984  1.00 0.00 ? 128 ASP A OD2  5  
ATOM 10361 H H    . ASP A 1 110 ? 2.561   13.644  -7.818  1.00 0.00 ? 128 ASP A H    5  
ATOM 10362 H HA   . ASP A 1 110 ? 5.234   13.666  -8.846  1.00 0.00 ? 128 ASP A HA   5  
ATOM 10363 H HB3  . ASP A 1 110 ? 4.732   12.836  -6.038  1.00 0.00 ? 128 ASP A HB3  5  
ATOM 10364 N N    . CYS A 1 111 ? 5.368   11.216  -9.400  1.00 0.00 ? 129 CYS A N    5  
ATOM 10365 C CA   . CYS A 1 111 ? 5.683   9.810   -9.618  1.00 0.00 ? 129 CYS A CA   5  
ATOM 10366 C C    . CYS A 1 111 ? 7.137   9.515   -9.258  1.00 0.00 ? 129 CYS A C    5  
ATOM 10367 O O    . CYS A 1 111 ? 7.927   9.102   -10.107 1.00 0.00 ? 129 CYS A O    5  
ATOM 10368 C CB   . CYS A 1 111 ? 5.419   9.426   -11.075 1.00 0.00 ? 129 CYS A CB   5  
ATOM 10369 S SG   . CYS A 1 111 ? 5.400   7.631   -11.379 1.00 0.00 ? 129 CYS A SG   5  
ATOM 10370 H H    . CYS A 1 111 ? 5.524   11.859  -10.125 1.00 0.00 ? 129 CYS A H    5  
ATOM 10371 H HA   . CYS A 1 111 ? 5.042   9.223   -8.979  1.00 0.00 ? 129 CYS A HA   5  
ATOM 10372 H HB3  . CYS A 1 111 ? 6.190   9.857   -11.698 1.00 0.00 ? 129 CYS A HB3  5  
ATOM 10373 N N    . THR A 1 112 ? 7.484   9.733   -7.993  1.00 0.00 ? 130 THR A N    5  
ATOM 10374 C CA   . THR A 1 112 ? 8.841   9.492   -7.520  1.00 0.00 ? 130 THR A CA   5  
ATOM 10375 C C    . THR A 1 112 ? 8.916   9.568   -6.001  1.00 0.00 ? 130 THR A C    5  
ATOM 10376 O O    . THR A 1 112 ? 8.042   10.149  -5.354  1.00 0.00 ? 130 THR A O    5  
ATOM 10377 C CB   . THR A 1 112 ? 9.834   10.505  -8.122  1.00 0.00 ? 130 THR A CB   5  
ATOM 10378 O OG1  . THR A 1 112 ? 9.134   11.676  -8.557  1.00 0.00 ? 130 THR A OG1  5  
ATOM 10379 C CG2  . THR A 1 112 ? 10.586  9.894   -9.295  1.00 0.00 ? 130 THR A CG2  5  
ATOM 10380 H H    . THR A 1 112 ? 6.809   10.063  -7.363  1.00 0.00 ? 130 THR A H    5  
ATOM 10381 H HA   . THR A 1 112 ? 9.134   8.501   -7.836  1.00 0.00 ? 130 THR A HA   5  
ATOM 10382 H HB   . THR A 1 112 ? 10.547  10.783  -7.360  1.00 0.00 ? 130 THR A HB   5  
ATOM 10383 H HG1  . THR A 1 112 ? 9.472   12.443  -8.089  1.00 0.00 ? 130 THR A HG1  5  
ATOM 10384 H HG21 . THR A 1 112 ? 10.150  8.939   -9.544  1.00 0.00 ? 130 THR A HG21 5  
ATOM 10385 H HG22 . THR A 1 112 ? 11.623  9.758   -9.023  1.00 0.00 ? 130 THR A HG22 5  
ATOM 10386 H HG23 . THR A 1 112 ? 10.521  10.552  -10.147 1.00 0.00 ? 130 THR A HG23 5  
ATOM 10387 N N    . SER A 1 113 ? 9.963   8.978   -5.433  1.00 0.00 ? 131 SER A N    5  
ATOM 10388 C CA   . SER A 1 113 ? 10.149  8.975   -3.987  1.00 0.00 ? 131 SER A CA   5  
ATOM 10389 C C    . SER A 1 113 ? 10.096  10.395  -3.430  1.00 0.00 ? 131 SER A C    5  
ATOM 10390 O O    . SER A 1 113 ? 10.528  11.346  -4.082  1.00 0.00 ? 131 SER A O    5  
ATOM 10391 C CB   . SER A 1 113 ? 11.484  8.323   -3.623  1.00 0.00 ? 131 SER A CB   5  
ATOM 10392 O OG   . SER A 1 113 ? 11.837  7.326   -4.568  1.00 0.00 ? 131 SER A OG   5  
ATOM 10393 H H    . SER A 1 113 ? 10.624  8.531   -6.000  1.00 0.00 ? 131 SER A H    5  
ATOM 10394 H HA   . SER A 1 113 ? 9.346   8.399   -3.550  1.00 0.00 ? 131 SER A HA   5  
ATOM 10395 H HB3  . SER A 1 113 ? 11.405  7.868   -2.648  1.00 0.00 ? 131 SER A HB3  5  
ATOM 10396 H HG   . SER A 1 113 ? 12.608  7.613   -5.064  1.00 0.00 ? 131 SER A HG   5  
ATOM 10397 N N    . VAL A 1 114 ? 9.561   10.529  -2.221  1.00 0.00 ? 132 VAL A N    5  
ATOM 10398 C CA   . VAL A 1 114 ? 9.451   11.831  -1.574  1.00 0.00 ? 132 VAL A CA   5  
ATOM 10399 C C    . VAL A 1 114 ? 9.821   11.745  -0.097  1.00 0.00 ? 132 VAL A C    5  
ATOM 10400 O O    . VAL A 1 114 ? 10.693  12.473  0.380   1.00 0.00 ? 132 VAL A O    5  
ATOM 10401 C CB   . VAL A 1 114 ? 8.027   12.404  -1.702  1.00 0.00 ? 132 VAL A CB   5  
ATOM 10402 C CG1  . VAL A 1 114 ? 7.967   13.818  -1.145  1.00 0.00 ? 132 VAL A CG1  5  
ATOM 10403 C CG2  . VAL A 1 114 ? 7.569   12.373  -3.154  1.00 0.00 ? 132 VAL A CG2  5  
ATOM 10404 H H    . VAL A 1 114 ? 9.233   9.735   -1.751  1.00 0.00 ? 132 VAL A H    5  
ATOM 10405 H HA   . VAL A 1 114 ? 10.134  12.510  -2.068  1.00 0.00 ? 132 VAL A HA   5  
ATOM 10406 H HB   . VAL A 1 114 ? 7.358   11.784  -1.123  1.00 0.00 ? 132 VAL A HB   5  
ATOM 10407 H HG11 . VAL A 1 114 ? 7.126   13.903  -0.472  1.00 0.00 ? 132 VAL A HG11 5  
ATOM 10408 H HG12 . VAL A 1 114 ? 8.880   14.034  -0.611  1.00 0.00 ? 132 VAL A HG12 5  
ATOM 10409 H HG13 . VAL A 1 114 ? 7.849   14.520  -1.957  1.00 0.00 ? 132 VAL A HG13 5  
ATOM 10410 H HG21 . VAL A 1 114 ? 8.428   12.262  -3.798  1.00 0.00 ? 132 VAL A HG21 5  
ATOM 10411 H HG22 . VAL A 1 114 ? 6.896   11.542  -3.302  1.00 0.00 ? 132 VAL A HG22 5  
ATOM 10412 H HG23 . VAL A 1 114 ? 7.059   13.295  -3.389  1.00 0.00 ? 132 VAL A HG23 5  
ATOM 10413 N N    . THR A 1 115 ? 9.153   10.850  0.623   1.00 0.00 ? 133 THR A N    5  
ATOM 10414 C CA   . THR A 1 115 ? 9.411   10.670  2.046   1.00 0.00 ? 133 THR A CA   5  
ATOM 10415 C C    . THR A 1 115 ? 9.379   9.193   2.426   1.00 0.00 ? 133 THR A C    5  
ATOM 10416 O O    . THR A 1 115 ? 8.952   8.348   1.639   1.00 0.00 ? 133 THR A O    5  
ATOM 10417 C CB   . THR A 1 115 ? 8.385   11.432  2.905   1.00 0.00 ? 133 THR A CB   5  
ATOM 10418 O OG1  . THR A 1 115 ? 7.125   10.751  2.883   1.00 0.00 ? 133 THR A OG1  5  
ATOM 10419 C CG2  . THR A 1 115 ? 8.205   12.855  2.399   1.00 0.00 ? 133 THR A CG2  5  
ATOM 10420 H H    . THR A 1 115 ? 8.470   10.301  0.187   1.00 0.00 ? 133 THR A H    5  
ATOM 10421 H HA   . THR A 1 115 ? 10.393  11.065  2.260   1.00 0.00 ? 133 THR A HA   5  
ATOM 10422 H HB   . THR A 1 115 ? 8.746   11.469  3.922   1.00 0.00 ? 133 THR A HB   5  
ATOM 10423 H HG1  . THR A 1 115 ? 6.737   10.822  2.007   1.00 0.00 ? 133 THR A HG1  5  
ATOM 10424 H HG21 . THR A 1 115 ? 8.032   13.515  3.235   1.00 0.00 ? 133 THR A HG21 5  
ATOM 10425 H HG22 . THR A 1 115 ? 7.361   12.894  1.726   1.00 0.00 ? 133 THR A HG22 5  
ATOM 10426 H HG23 . THR A 1 115 ? 9.097   13.165  1.875   1.00 0.00 ? 133 THR A HG23 5  
ATOM 10427 N N    . ASP A 1 116 ? 9.831   8.890   3.638   1.00 0.00 ? 134 ASP A N    5  
ATOM 10428 C CA   . ASP A 1 116 ? 9.853   7.515   4.124   1.00 0.00 ? 134 ASP A CA   5  
ATOM 10429 C C    . ASP A 1 116 ? 8.937   7.352   5.333   1.00 0.00 ? 134 ASP A C    5  
ATOM 10430 O O    . ASP A 1 116 ? 8.405   8.330   5.859   1.00 0.00 ? 134 ASP A O    5  
ATOM 10431 C CB   . ASP A 1 116 ? 11.280  7.102   4.489   1.00 0.00 ? 134 ASP A CB   5  
ATOM 10432 C CG   . ASP A 1 116 ? 11.979  8.138   5.349   1.00 0.00 ? 134 ASP A CG   5  
ATOM 10433 O OD1  . ASP A 1 116 ? 11.382  8.577   6.353   1.00 0.00 ? 134 ASP A OD1  5  
ATOM 10434 O OD2  . ASP A 1 116 ? 13.125  8.509   5.016   1.00 0.00 ? 134 ASP A OD2  5  
ATOM 10435 H H    . ASP A 1 116 ? 10.159  9.607   4.220   1.00 0.00 ? 134 ASP A H    5  
ATOM 10436 H HA   . ASP A 1 116 ? 9.496   6.877   3.329   1.00 0.00 ? 134 ASP A HA   5  
ATOM 10437 H HB3  . ASP A 1 116 ? 11.851  6.966   3.584   1.00 0.00 ? 134 ASP A HB3  5  
ATOM 10438 N N    . LEU A 1 117 ? 8.756   6.108   5.768   1.00 0.00 ? 135 LEU A N    5  
ATOM 10439 C CA   . LEU A 1 117 ? 7.903   5.816   6.914   1.00 0.00 ? 135 LEU A CA   5  
ATOM 10440 C C    . LEU A 1 117 ? 8.425   6.506   8.171   1.00 0.00 ? 135 LEU A C    5  
ATOM 10441 O O    . LEU A 1 117 ? 9.599   6.865   8.270   1.00 0.00 ? 135 LEU A O    5  
ATOM 10442 C CB   . LEU A 1 117 ? 7.823   4.306   7.142   1.00 0.00 ? 135 LEU A CB   5  
ATOM 10443 C CG   . LEU A 1 117 ? 9.137   3.536   7.006   1.00 0.00 ? 135 LEU A CG   5  
ATOM 10444 C CD1  . LEU A 1 117 ? 9.247   2.473   8.087   1.00 0.00 ? 135 LEU A CD1  5  
ATOM 10445 C CD2  . LEU A 1 117 ? 9.243   2.906   5.624   1.00 0.00 ? 135 LEU A CD2  5  
ATOM 10446 H H    . LEU A 1 117 ? 9.206   5.371   5.308   1.00 0.00 ? 135 LEU A H    5  
ATOM 10447 H HA   . LEU A 1 117 ? 6.914   6.193   6.696   1.00 0.00 ? 135 LEU A HA   5  
ATOM 10448 H HB3  . LEU A 1 117 ? 7.124   3.901   6.426   1.00 0.00 ? 135 LEU A HB3  5  
ATOM 10449 H HG   . LEU A 1 117 ? 9.963   4.221   7.126   1.00 0.00 ? 135 LEU A HG   5  
ATOM 10450 H HD11 . LEU A 1 117 ? 8.394   1.814   8.035   1.00 0.00 ? 135 LEU A HD11 5  
ATOM 10451 H HD12 . LEU A 1 117 ? 9.277   2.948   9.057   1.00 0.00 ? 135 LEU A HD12 5  
ATOM 10452 H HD13 . LEU A 1 117 ? 10.153  1.902   7.939   1.00 0.00 ? 135 LEU A HD13 5  
ATOM 10453 H HD21 . LEU A 1 117 ? 9.733   1.947   5.703   1.00 0.00 ? 135 LEU A HD21 5  
ATOM 10454 H HD22 . LEU A 1 117 ? 9.819   3.553   4.978   1.00 0.00 ? 135 LEU A HD22 5  
ATOM 10455 H HD23 . LEU A 1 117 ? 8.254   2.772   5.212   1.00 0.00 ? 135 LEU A HD23 5  
ATOM 10456 N N    . PRO A 1 118 ? 7.535   6.692   9.157   1.00 0.00 ? 136 PRO A N    5  
ATOM 10457 C CA   . PRO A 1 118 ? 7.884   7.337   10.426  1.00 0.00 ? 136 PRO A CA   5  
ATOM 10458 C C    . PRO A 1 118 ? 8.799   6.469   11.285  1.00 0.00 ? 136 PRO A C    5  
ATOM 10459 O O    . PRO A 1 118 ? 9.298   6.911   12.318  1.00 0.00 ? 136 PRO A O    5  
ATOM 10460 C CB   . PRO A 1 118 ? 6.528   7.525   11.113  1.00 0.00 ? 136 PRO A CB   5  
ATOM 10461 C CG   . PRO A 1 118 ? 5.658   6.467   10.528  1.00 0.00 ? 136 PRO A CG   5  
ATOM 10462 C CD   . PRO A 1 118 ? 6.121   6.288   9.108   1.00 0.00 ? 136 PRO A CD   5  
ATOM 10463 H HA   . PRO A 1 118 ? 8.347   8.299   10.269  1.00 0.00 ? 136 PRO A HA   5  
ATOM 10464 H HB3  . PRO A 1 118 ? 6.148   8.512   10.900  1.00 0.00 ? 136 PRO A HB3  5  
ATOM 10465 H HG3  . PRO A 1 118 ? 4.627   6.789   10.548  1.00 0.00 ? 136 PRO A HG3  5  
ATOM 10466 H HD3  . PRO A 1 118 ? 5.560   6.930   8.445   1.00 0.00 ? 136 PRO A HD3  5  
ATOM 10467 N N    . ASN A 1 119 ? 9.016   5.232   10.848  1.00 0.00 ? 137 ASN A N    5  
ATOM 10468 C CA   . ASN A 1 119 ? 9.872   4.304   11.576  1.00 0.00 ? 137 ASN A CA   5  
ATOM 10469 C C    . ASN A 1 119 ? 11.240  4.190   10.912  1.00 0.00 ? 137 ASN A C    5  
ATOM 10470 O O    . ASN A 1 119 ? 12.252  3.989   11.583  1.00 0.00 ? 137 ASN A O    5  
ATOM 10471 C CB   . ASN A 1 119 ? 9.214   2.924   11.652  1.00 0.00 ? 137 ASN A CB   5  
ATOM 10472 C CG   . ASN A 1 119 ? 7.711   2.990   11.455  1.00 0.00 ? 137 ASN A CG   5  
ATOM 10473 O OD1  . ASN A 1 119 ? 7.021   3.772   12.109  1.00 0.00 ? 137 ASN A OD1  5  
ATOM 10474 N ND2  . ASN A 1 119 ? 7.197   2.163   10.551  1.00 0.00 ? 137 ASN A ND2  5  
ATOM 10475 H H    . ASN A 1 119 ? 8.589   4.937   10.017  1.00 0.00 ? 137 ASN A H    5  
ATOM 10476 H HA   . ASN A 1 119 ? 10.001  4.687   12.577  1.00 0.00 ? 137 ASN A HA   5  
ATOM 10477 H HB3  . ASN A 1 119 ? 9.413   2.489   12.620  1.00 0.00 ? 137 ASN A HB3  5  
ATOM 10478 H HD21 . ASN A 1 119 ? 7.808   1.567   10.069  1.00 0.00 ? 137 ASN A HD21 5  
ATOM 10479 H HD22 . ASN A 1 119 ? 6.229   2.184   10.403  1.00 0.00 ? 137 ASN A HD22 5  
ATOM 10480 N N    . ALA A 1 120 ? 11.264  4.321   9.590   1.00 0.00 ? 138 ALA A N    5  
ATOM 10481 C CA   . ALA A 1 120 ? 12.508  4.236   8.836   1.00 0.00 ? 138 ALA A CA   5  
ATOM 10482 C C    . ALA A 1 120 ? 13.333  3.032   9.273   1.00 0.00 ? 138 ALA A C    5  
ATOM 10483 O O    . ALA A 1 120 ? 14.506  3.165   9.624   1.00 0.00 ? 138 ALA A O    5  
ATOM 10484 C CB   . ALA A 1 120 ? 13.312  5.518   9.000   1.00 0.00 ? 138 ALA A CB   5  
ATOM 10485 H H    . ALA A 1 120 ? 10.424  4.481   9.112   1.00 0.00 ? 138 ALA A H    5  
ATOM 10486 H HA   . ALA A 1 120 ? 12.258  4.130   7.791   1.00 0.00 ? 138 ALA A HA   5  
ATOM 10487 H HB1  . ALA A 1 120 ? 12.941  6.265   8.314   1.00 0.00 ? 138 ALA A HB1  5  
ATOM 10488 H HB2  . ALA A 1 120 ? 13.214  5.877   10.014  1.00 0.00 ? 138 ALA A HB2  5  
ATOM 10489 H HB3  . ALA A 1 120 ? 14.352  5.318   8.787   1.00 0.00 ? 138 ALA A HB3  5  
ATOM 10490 N N    . PHE A 1 121 ? 12.714  1.856   9.249   1.00 0.00 ? 139 PHE A N    5  
ATOM 10491 C CA   . PHE A 1 121 ? 13.392  0.627   9.644   1.00 0.00 ? 139 PHE A CA   5  
ATOM 10492 C C    . PHE A 1 121 ? 14.177  0.038   8.475   1.00 0.00 ? 139 PHE A C    5  
ATOM 10493 O O    . PHE A 1 121 ? 14.195  0.601   7.379   1.00 0.00 ? 139 PHE A O    5  
ATOM 10494 C CB   . PHE A 1 121 ? 12.378  -0.396  10.159  1.00 0.00 ? 139 PHE A CB   5  
ATOM 10495 C CG   . PHE A 1 121 ? 11.989  -0.185  11.594  1.00 0.00 ? 139 PHE A CG   5  
ATOM 10496 C CD1  . PHE A 1 121 ? 12.958  -0.091  12.582  1.00 0.00 ? 139 PHE A CD1  5  
ATOM 10497 C CD2  . PHE A 1 121 ? 10.657  -0.081  11.957  1.00 0.00 ? 139 PHE A CD2  5  
ATOM 10498 C CE1  . PHE A 1 121 ? 12.603  0.103   13.903  1.00 0.00 ? 139 PHE A CE1  5  
ATOM 10499 C CE2  . PHE A 1 121 ? 10.296  0.112   13.277  1.00 0.00 ? 139 PHE A CE2  5  
ATOM 10500 C CZ   . PHE A 1 121 ? 11.270  0.206   14.250  1.00 0.00 ? 139 PHE A CZ   5  
ATOM 10501 H H    . PHE A 1 121 ? 11.779  1.814   8.958   1.00 0.00 ? 139 PHE A H    5  
ATOM 10502 H HA   . PHE A 1 121 ? 14.081  0.870   10.437  1.00 0.00 ? 139 PHE A HA   5  
ATOM 10503 H HB3  . PHE A 1 121 ? 12.799  -1.387  10.071  1.00 0.00 ? 139 PHE A HB3  5  
ATOM 10504 H HD1  . PHE A 1 121 ? 14.000  -0.169  12.310  1.00 0.00 ? 139 PHE A HD1  5  
ATOM 10505 H HD2  . PHE A 1 121 ? 9.893   -0.155  11.195  1.00 0.00 ? 139 PHE A HD2  5  
ATOM 10506 H HE1  . PHE A 1 121 ? 13.368  0.175   14.662  1.00 0.00 ? 139 PHE A HE1  5  
ATOM 10507 H HE2  . PHE A 1 121 ? 9.252   0.193   13.546  1.00 0.00 ? 139 PHE A HE2  5  
ATOM 10508 H HZ   . PHE A 1 121 ? 10.990  0.356   15.283  1.00 0.00 ? 139 PHE A HZ   5  
ATOM 10509 N N    . ASP A 1 122 ? 14.824  -1.097  8.716   1.00 0.00 ? 140 ASP A N    5  
ATOM 10510 C CA   . ASP A 1 122 ? 15.610  -1.762  7.685   1.00 0.00 ? 140 ASP A CA   5  
ATOM 10511 C C    . ASP A 1 122 ? 15.537  -3.279  7.839   1.00 0.00 ? 140 ASP A C    5  
ATOM 10512 O O    . ASP A 1 122 ? 16.510  -3.987  7.585   1.00 0.00 ? 140 ASP A O    5  
ATOM 10513 C CB   . ASP A 1 122 ? 17.068  -1.301  7.746   1.00 0.00 ? 140 ASP A CB   5  
ATOM 10514 C CG   . ASP A 1 122 ? 17.215  0.186   7.487   1.00 0.00 ? 140 ASP A CG   5  
ATOM 10515 O OD1  . ASP A 1 122 ? 16.812  0.642   6.397   1.00 0.00 ? 140 ASP A OD1  5  
ATOM 10516 O OD2  . ASP A 1 122 ? 17.732  0.892   8.378   1.00 0.00 ? 140 ASP A OD2  5  
ATOM 10517 H H    . ASP A 1 122 ? 14.771  -1.497  9.610   1.00 0.00 ? 140 ASP A H    5  
ATOM 10518 H HA   . ASP A 1 122 ? 15.197  -1.491  6.725   1.00 0.00 ? 140 ASP A HA   5  
ATOM 10519 H HB3  . ASP A 1 122 ? 17.638  -1.836  7.003   1.00 0.00 ? 140 ASP A HB3  5  
ATOM 10520 N N    . GLY A 1 123 ? 14.375  -3.770  8.259   1.00 0.00 ? 141 GLY A N    5  
ATOM 10521 C CA   . GLY A 1 123 ? 14.197  -5.199  8.443   1.00 0.00 ? 141 GLY A CA   5  
ATOM 10522 C C    . GLY A 1 123 ? 13.931  -5.922  7.137   1.00 0.00 ? 141 GLY A C    5  
ATOM 10523 O O    . GLY A 1 123 ? 14.159  -5.390  6.051   1.00 0.00 ? 141 GLY A O    5  
ATOM 10524 H H    . GLY A 1 123 ? 13.634  -3.157  8.448   1.00 0.00 ? 141 GLY A H    5  
ATOM 10525 H HA2  . GLY A 1 123 ? 15.088  -5.607  8.894   1.00 0.00 ? 141 GLY A HA2  5  
ATOM 10526 H HA3  . GLY A 1 123 ? 13.361  -5.363  9.107   1.00 0.00 ? 141 GLY A HA3  5  
ATOM 10527 N N    . PRO A 1 124 ? 13.438  -7.165  7.234   1.00 0.00 ? 142 PRO A N    5  
ATOM 10528 C CA   . PRO A 1 124 ? 13.132  -7.990  6.061   1.00 0.00 ? 142 PRO A CA   5  
ATOM 10529 C C    . PRO A 1 124 ? 11.928  -7.469  5.283   1.00 0.00 ? 142 PRO A C    5  
ATOM 10530 O O    . PRO A 1 124 ? 11.349  -8.183  4.466   1.00 0.00 ? 142 PRO A O    5  
ATOM 10531 C CB   . PRO A 1 124 ? 12.825  -9.363  6.663   1.00 0.00 ? 142 PRO A CB   5  
ATOM 10532 C CG   . PRO A 1 124 ? 12.372  -9.074  8.053   1.00 0.00 ? 142 PRO A CG   5  
ATOM 10533 C CD   . PRO A 1 124 ? 13.142  -7.862  8.497   1.00 0.00 ? 142 PRO A CD   5  
ATOM 10534 H HA   . PRO A 1 124 ? 13.981  -8.067  5.398   1.00 0.00 ? 142 PRO A HA   5  
ATOM 10535 H HB3  . PRO A 1 124 ? 13.719  -9.970  6.658   1.00 0.00 ? 142 PRO A HB3  5  
ATOM 10536 H HG3  . PRO A 1 124 ? 12.595  -9.916  8.692   1.00 0.00 ? 142 PRO A HG3  5  
ATOM 10537 H HD3  . PRO A 1 124 ? 14.052  -8.156  8.998   1.00 0.00 ? 142 PRO A HD3  5  
ATOM 10538 N N    . ILE A 1 125 ? 11.559  -6.219  5.545   1.00 0.00 ? 143 ILE A N    5  
ATOM 10539 C CA   . ILE A 1 125 ? 10.424  -5.602  4.868   1.00 0.00 ? 143 ILE A CA   5  
ATOM 10540 C C    . ILE A 1 125 ? 10.860  -4.382  4.064   1.00 0.00 ? 143 ILE A C    5  
ATOM 10541 O O    . ILE A 1 125 ? 10.915  -3.268  4.586   1.00 0.00 ? 143 ILE A O    5  
ATOM 10542 C CB   . ILE A 1 125 ? 9.333   -5.180  5.870   1.00 0.00 ? 143 ILE A CB   5  
ATOM 10543 C CG1  . ILE A 1 125 ? 8.846   -6.391  6.668   1.00 0.00 ? 143 ILE A CG1  5  
ATOM 10544 C CG2  . ILE A 1 125 ? 8.172   -4.519  5.140   1.00 0.00 ? 143 ILE A CG2  5  
ATOM 10545 C CD1  . ILE A 1 125 ? 7.778   -6.056  7.683   1.00 0.00 ? 143 ILE A CD1  5  
ATOM 10546 H H    . ILE A 1 125 ? 12.060  -5.699  6.207   1.00 0.00 ? 143 ILE A H    5  
ATOM 10547 H HA   . ILE A 1 125 ? 10.002  -6.333  4.193   1.00 0.00 ? 143 ILE A HA   5  
ATOM 10548 H HB   . ILE A 1 125 ? 9.759   -4.458  6.549   1.00 0.00 ? 143 ILE A HB   5  
ATOM 10549 H HG13 . ILE A 1 125 ? 9.683   -6.824  7.195   1.00 0.00 ? 143 ILE A HG13 5  
ATOM 10550 H HG21 . ILE A 1 125 ? 8.530   -3.652  4.606   1.00 0.00 ? 143 ILE A HG21 5  
ATOM 10551 H HG22 . ILE A 1 125 ? 7.741   -5.220  4.441   1.00 0.00 ? 143 ILE A HG22 5  
ATOM 10552 H HG23 . ILE A 1 125 ? 7.422   -4.217  5.856   1.00 0.00 ? 143 ILE A HG23 5  
ATOM 10553 H HD11 . ILE A 1 125 ? 7.532   -6.941  8.254   1.00 0.00 ? 143 ILE A HD11 5  
ATOM 10554 H HD12 . ILE A 1 125 ? 8.141   -5.287  8.349   1.00 0.00 ? 143 ILE A HD12 5  
ATOM 10555 H HD13 . ILE A 1 125 ? 6.894   -5.701  7.174   1.00 0.00 ? 143 ILE A HD13 5  
ATOM 10556 N N    . THR A 1 126 ? 11.171  -4.599  2.791   1.00 0.00 ? 144 THR A N    5  
ATOM 10557 C CA   . THR A 1 126 ? 11.601  -3.517  1.913   1.00 0.00 ? 144 THR A CA   5  
ATOM 10558 C C    . THR A 1 126 ? 10.461  -3.048  1.017   1.00 0.00 ? 144 THR A C    5  
ATOM 10559 O O    . THR A 1 126 ? 9.436   -3.719  0.899   1.00 0.00 ? 144 THR A O    5  
ATOM 10560 C CB   . THR A 1 126 ? 12.789  -3.948  1.033   1.00 0.00 ? 144 THR A CB   5  
ATOM 10561 O OG1  . THR A 1 126 ? 13.546  -4.965  1.696   1.00 0.00 ? 144 THR A OG1  5  
ATOM 10562 C CG2  . THR A 1 126 ? 13.688  -2.761  0.720   1.00 0.00 ? 144 THR A CG2  5  
ATOM 10563 H H    . THR A 1 126 ? 11.108  -5.508  2.432   1.00 0.00 ? 144 THR A H    5  
ATOM 10564 H HA   . THR A 1 126 ? 11.921  -2.692  2.535   1.00 0.00 ? 144 THR A HA   5  
ATOM 10565 H HB   . THR A 1 126 ? 12.403  -4.343  0.104   1.00 0.00 ? 144 THR A HB   5  
ATOM 10566 H HG1  . THR A 1 126 ? 13.263  -5.829  1.385   1.00 0.00 ? 144 THR A HG1  5  
ATOM 10567 H HG21 . THR A 1 126 ? 13.590  -2.500  -0.325  1.00 0.00 ? 144 THR A HG21 5  
ATOM 10568 H HG22 . THR A 1 126 ? 14.714  -3.023  0.930   1.00 0.00 ? 144 THR A HG22 5  
ATOM 10569 H HG23 . THR A 1 126 ? 13.399  -1.920  1.329   1.00 0.00 ? 144 THR A HG23 5  
ATOM 10570 N N    . ILE A 1 127 ? 10.647  -1.892  0.389   1.00 0.00 ? 145 ILE A N    5  
ATOM 10571 C CA   . ILE A 1 127 ? 9.634   -1.335  -0.500  1.00 0.00 ? 145 ILE A CA   5  
ATOM 10572 C C    . ILE A 1 127 ? 10.256  -0.833  -1.797  1.00 0.00 ? 145 ILE A C    5  
ATOM 10573 O O    . ILE A 1 127 ? 11.417  -0.419  -1.824  1.00 0.00 ? 145 ILE A O    5  
ATOM 10574 C CB   . ILE A 1 127 ? 8.871   -0.179  0.173   1.00 0.00 ? 145 ILE A CB   5  
ATOM 10575 C CG1  . ILE A 1 127 ? 9.832   0.955   0.533   1.00 0.00 ? 145 ILE A CG1  5  
ATOM 10576 C CG2  . ILE A 1 127 ? 8.141   -0.676  1.412   1.00 0.00 ? 145 ILE A CG2  5  
ATOM 10577 C CD1  . ILE A 1 127 ? 9.310   2.328   0.172   1.00 0.00 ? 145 ILE A CD1  5  
ATOM 10578 H H    . ILE A 1 127 ? 11.485  -1.404  0.524   1.00 0.00 ? 145 ILE A H    5  
ATOM 10579 H HA   . ILE A 1 127 ? 8.927   -2.120  -0.732  1.00 0.00 ? 145 ILE A HA   5  
ATOM 10580 H HB   . ILE A 1 127 ? 8.135   0.191   -0.525  1.00 0.00 ? 145 ILE A HB   5  
ATOM 10581 H HG13 . ILE A 1 127 ? 10.766  0.805   0.008   1.00 0.00 ? 145 ILE A HG13 5  
ATOM 10582 H HG21 . ILE A 1 127 ? 8.448   -0.093  2.268   1.00 0.00 ? 145 ILE A HG21 5  
ATOM 10583 H HG22 . ILE A 1 127 ? 7.075   -0.569  1.269   1.00 0.00 ? 145 ILE A HG22 5  
ATOM 10584 H HG23 . ILE A 1 127 ? 8.380   -1.716  1.578   1.00 0.00 ? 145 ILE A HG23 5  
ATOM 10585 H HD11 . ILE A 1 127 ? 10.095  2.899   -0.302  1.00 0.00 ? 145 ILE A HD11 5  
ATOM 10586 H HD12 . ILE A 1 127 ? 8.475   2.230   -0.504  1.00 0.00 ? 145 ILE A HD12 5  
ATOM 10587 H HD13 . ILE A 1 127 ? 8.989   2.837   1.071   1.00 0.00 ? 145 ILE A HD13 5  
ATOM 10588 N N    . THR A 1 128 ? 9.478   -0.868  -2.874  1.00 0.00 ? 146 THR A N    5  
ATOM 10589 C CA   . THR A 1 128 ? 9.951   -0.415  -4.176  1.00 0.00 ? 146 THR A CA   5  
ATOM 10590 C C    . THR A 1 128 ? 9.050   0.677   -4.739  1.00 0.00 ? 146 THR A C    5  
ATOM 10591 O O    . THR A 1 128 ? 7.874   0.442   -5.018  1.00 0.00 ? 146 THR A O    5  
ATOM 10592 C CB   . THR A 1 128 ? 10.021  -1.578  -5.183  1.00 0.00 ? 146 THR A CB   5  
ATOM 10593 O OG1  . THR A 1 128 ? 10.219  -1.068  -6.507  1.00 0.00 ? 146 THR A OG1  5  
ATOM 10594 C CG2  . THR A 1 128 ? 8.747   -2.408  -5.141  1.00 0.00 ? 146 THR A CG2  5  
ATOM 10595 H H    . THR A 1 128 ? 8.561   -1.208  -2.790  1.00 0.00 ? 146 THR A H    5  
ATOM 10596 H HA   . THR A 1 128 ? 10.947  -0.016  -4.048  1.00 0.00 ? 146 THR A HA   5  
ATOM 10597 H HB   . THR A 1 128 ? 10.855  -2.212  -4.922  1.00 0.00 ? 146 THR A HB   5  
ATOM 10598 H HG1  . THR A 1 128 ? 10.919  -0.409  -6.495  1.00 0.00 ? 146 THR A HG1  5  
ATOM 10599 H HG21 . THR A 1 128 ? 8.850   -3.259  -5.799  1.00 0.00 ? 146 THR A HG21 5  
ATOM 10600 H HG22 . THR A 1 128 ? 7.912   -1.803  -5.462  1.00 0.00 ? 146 THR A HG22 5  
ATOM 10601 H HG23 . THR A 1 128 ? 8.576   -2.752  -4.132  1.00 0.00 ? 146 THR A HG23 5  
ATOM 10602 N N    . ILE A 1 129 ? 9.609   1.872   -4.906  1.00 0.00 ? 147 ILE A N    5  
ATOM 10603 C CA   . ILE A 1 129 ? 8.856   3.000   -5.437  1.00 0.00 ? 147 ILE A CA   5  
ATOM 10604 C C    . ILE A 1 129 ? 9.098   3.166   -6.934  1.00 0.00 ? 147 ILE A C    5  
ATOM 10605 O O    . ILE A 1 129 ? 10.138  2.764   -7.454  1.00 0.00 ? 147 ILE A O    5  
ATOM 10606 C CB   . ILE A 1 129 ? 9.224   4.312   -4.721  1.00 0.00 ? 147 ILE A CB   5  
ATOM 10607 C CG1  . ILE A 1 129 ? 8.215   5.410   -5.069  1.00 0.00 ? 147 ILE A CG1  5  
ATOM 10608 C CG2  . ILE A 1 129 ? 10.634  4.743   -5.096  1.00 0.00 ? 147 ILE A CG2  5  
ATOM 10609 C CD1  . ILE A 1 129 ? 7.863   6.299   -3.897  1.00 0.00 ? 147 ILE A CD1  5  
ATOM 10610 H H    . ILE A 1 129 ? 10.551  1.996   -4.665  1.00 0.00 ? 147 ILE A H    5  
ATOM 10611 H HA   . ILE A 1 129 ? 7.805   2.806   -5.275  1.00 0.00 ? 147 ILE A HA   5  
ATOM 10612 H HB   . ILE A 1 129 ? 9.199   4.134   -3.657  1.00 0.00 ? 147 ILE A HB   5  
ATOM 10613 H HG13 . ILE A 1 129 ? 7.304   4.950   -5.425  1.00 0.00 ? 147 ILE A HG13 5  
ATOM 10614 H HG21 . ILE A 1 129 ? 10.586  5.538   -5.826  1.00 0.00 ? 147 ILE A HG21 5  
ATOM 10615 H HG22 . ILE A 1 129 ? 11.149  5.095   -4.215  1.00 0.00 ? 147 ILE A HG22 5  
ATOM 10616 H HG23 . ILE A 1 129 ? 11.169  3.903   -5.514  1.00 0.00 ? 147 ILE A HG23 5  
ATOM 10617 H HD11 . ILE A 1 129 ? 8.629   6.218   -3.140  1.00 0.00 ? 147 ILE A HD11 5  
ATOM 10618 H HD12 . ILE A 1 129 ? 7.790   7.322   -4.231  1.00 0.00 ? 147 ILE A HD12 5  
ATOM 10619 H HD13 . ILE A 1 129 ? 6.914   5.987   -3.482  1.00 0.00 ? 147 ILE A HD13 5  
ATOM 10620 N N    . VAL A 1 130 ? 8.130   3.762   -7.623  1.00 0.00 ? 148 VAL A N    5  
ATOM 10621 C CA   . VAL A 1 130 ? 8.239   3.986   -9.060  1.00 0.00 ? 148 VAL A CA   5  
ATOM 10622 C C    . VAL A 1 130 ? 9.109   5.201   -9.363  1.00 0.00 ? 148 VAL A C    5  
ATOM 10623 O O    . VAL A 1 130 ? 8.999   6.235   -8.706  1.00 0.00 ? 148 VAL A O    5  
ATOM 10624 C CB   . VAL A 1 130 ? 6.854   4.186   -9.703  1.00 0.00 ? 148 VAL A CB   5  
ATOM 10625 C CG1  . VAL A 1 130 ? 6.057   2.890   -9.670  1.00 0.00 ? 148 VAL A CG1  5  
ATOM 10626 C CG2  . VAL A 1 130 ? 6.098   5.304   -9.003  1.00 0.00 ? 148 VAL A CG2  5  
ATOM 10627 H H    . VAL A 1 130 ? 7.323   4.061   -7.153  1.00 0.00 ? 148 VAL A H    5  
ATOM 10628 H HA   . VAL A 1 130 ? 8.695   3.110   -9.500  1.00 0.00 ? 148 VAL A HA   5  
ATOM 10629 H HB   . VAL A 1 130 ? 6.996   4.468   -10.736 1.00 0.00 ? 148 VAL A HB   5  
ATOM 10630 H HG11 . VAL A 1 130 ? 6.023   2.515   -8.657  1.00 0.00 ? 148 VAL A HG11 5  
ATOM 10631 H HG12 . VAL A 1 130 ? 5.052   3.076   -10.020 1.00 0.00 ? 148 VAL A HG12 5  
ATOM 10632 H HG13 . VAL A 1 130 ? 6.532   2.159   -10.307 1.00 0.00 ? 148 VAL A HG13 5  
ATOM 10633 H HG21 . VAL A 1 130 ? 5.194   5.525   -9.551  1.00 0.00 ? 148 VAL A HG21 5  
ATOM 10634 H HG22 . VAL A 1 130 ? 5.843   4.995   -7.999  1.00 0.00 ? 148 VAL A HG22 5  
ATOM 10635 H HG23 . VAL A 1 130 ? 6.719   6.186   -8.960  1.00 0.00 ? 148 VAL A HG23 5  
ATOM 10636 N N    . ASN A 1 131 ? 9.973   5.067   -10.364 1.00 0.00 ? 149 ASN A N    5  
ATOM 10637 C CA   . ASN A 1 131 ? 10.862  6.154   -10.754 1.00 0.00 ? 149 ASN A CA   5  
ATOM 10638 C C    . ASN A 1 131 ? 10.087  7.268   -11.452 1.00 0.00 ? 149 ASN A C    5  
ATOM 10639 O O    . ASN A 1 131 ? 8.867   7.188   -11.603 1.00 0.00 ? 149 ASN A O    5  
ATOM 10640 C CB   . ASN A 1 131 ? 11.966  5.633   -11.676 1.00 0.00 ? 149 ASN A CB   5  
ATOM 10641 C CG   . ASN A 1 131 ? 11.463  5.354   -13.080 1.00 0.00 ? 149 ASN A CG   5  
ATOM 10642 O OD1  . ASN A 1 131 ? 10.367  4.829   -13.265 1.00 0.00 ? 149 ASN A OD1  5  
ATOM 10643 N ND2  . ASN A 1 131 ? 12.268  5.705   -14.076 1.00 0.00 ? 149 ASN A ND2  5  
ATOM 10644 H H    . ASN A 1 131 ? 10.015  4.218   -10.850 1.00 0.00 ? 149 ASN A H    5  
ATOM 10645 H HA   . ASN A 1 131 ? 11.312  6.554   -9.858  1.00 0.00 ? 149 ASN A HA   5  
ATOM 10646 H HB3  . ASN A 1 131 ? 12.365  4.717   -11.267 1.00 0.00 ? 149 ASN A HB3  5  
ATOM 10647 H HD21 . ASN A 1 131 ? 13.129  6.118   -13.854 1.00 0.00 ? 149 ASN A HD21 5  
ATOM 10648 H HD22 . ASN A 1 131 ? 11.969  5.538   -14.994 1.00 0.00 ? 149 ASN A HD22 5  
ATOM 10649 N N    . ARG A 1 132 ? 10.801  8.305   -11.877 1.00 0.00 ? 150 ARG A N    5  
ATOM 10650 C CA   . ARG A 1 132 ? 10.180  9.434   -12.559 1.00 0.00 ? 150 ARG A CA   5  
ATOM 10651 C C    . ARG A 1 132 ? 9.451   8.975   -13.818 1.00 0.00 ? 150 ARG A C    5  
ATOM 10652 O O    . ARG A 1 132 ? 8.405   9.517   -14.174 1.00 0.00 ? 150 ARG A O    5  
ATOM 10653 C CB   . ARG A 1 132 ? 11.235  10.481  -12.920 1.00 0.00 ? 150 ARG A CB   5  
ATOM 10654 C CG   . ARG A 1 132 ? 10.670  11.684  -13.658 1.00 0.00 ? 150 ARG A CG   5  
ATOM 10655 C CD   . ARG A 1 132 ? 11.708  12.787  -13.802 1.00 0.00 ? 150 ARG A CD   5  
ATOM 10656 N NE   . ARG A 1 132 ? 11.990  13.443  -12.529 1.00 0.00 ? 150 ARG A NE   5  
ATOM 10657 C CZ   . ARG A 1 132 ? 12.892  14.409  -12.385 1.00 0.00 ? 150 ARG A CZ   5  
ATOM 10658 N NH1  . ARG A 1 132 ? 13.593  14.828  -13.429 1.00 0.00 ? 150 ARG A NH1  5  
ATOM 10659 N NH2  . ARG A 1 132 ? 13.092  14.960  -11.194 1.00 0.00 ? 150 ARG A NH2  5  
ATOM 10660 H H    . ARG A 1 132 ? 11.770  8.310   -11.728 1.00 0.00 ? 150 ARG A H    5  
ATOM 10661 H HA   . ARG A 1 132 ? 9.463   9.876   -11.883 1.00 0.00 ? 150 ARG A HA   5  
ATOM 10662 H HB3  . ARG A 1 132 ? 11.982  10.020  -13.548 1.00 0.00 ? 150 ARG A HB3  5  
ATOM 10663 H HG3  . ARG A 1 132 ? 9.826   12.070  -13.106 1.00 0.00 ? 150 ARG A HG3  5  
ATOM 10664 H HD3  . ARG A 1 132 ? 11.339  13.520  -14.503 1.00 0.00 ? 150 ARG A HD3  5  
ATOM 10665 H HE   . ARG A 1 132 ? 11.485  13.150  -11.744 1.00 0.00 ? 150 ARG A HE   5  
ATOM 10666 H HH11 . ARG A 1 132 ? 13.443  14.417  -14.328 1.00 0.00 ? 150 ARG A HH11 5  
ATOM 10667 H HH12 . ARG A 1 132 ? 14.269  15.557  -13.317 1.00 0.00 ? 150 ARG A HH12 5  
ATOM 10668 H HH21 . ARG A 1 132 ? 12.564  14.647  -10.404 1.00 0.00 ? 150 ARG A HH21 5  
ATOM 10669 H HH22 . ARG A 1 132 ? 13.769  15.686  -11.086 1.00 0.00 ? 150 ARG A HH22 5  
ATOM 10670 N N    . ASP A 1 133 ? 10.012  7.974   -14.487 1.00 0.00 ? 151 ASP A N    5  
ATOM 10671 C CA   . ASP A 1 133 ? 9.416   7.441   -15.708 1.00 0.00 ? 151 ASP A CA   5  
ATOM 10672 C C    . ASP A 1 133 ? 8.370   6.380   -15.382 1.00 0.00 ? 151 ASP A C    5  
ATOM 10673 O O    . ASP A 1 133 ? 7.812   5.748   -16.278 1.00 0.00 ? 151 ASP A O    5  
ATOM 10674 C CB   . ASP A 1 133 ? 10.497  6.850   -16.613 1.00 0.00 ? 151 ASP A CB   5  
ATOM 10675 C CG   . ASP A 1 133 ? 10.151  6.974   -18.084 1.00 0.00 ? 151 ASP A CG   5  
ATOM 10676 O OD1  . ASP A 1 133 ? 9.480   7.958   -18.456 1.00 0.00 ? 151 ASP A OD1  5  
ATOM 10677 O OD2  . ASP A 1 133 ? 10.552  6.085   -18.864 1.00 0.00 ? 151 ASP A OD2  5  
ATOM 10678 H H    . ASP A 1 133 ? 10.847  7.583   -14.155 1.00 0.00 ? 151 ASP A H    5  
ATOM 10679 H HA   . ASP A 1 133 ? 8.932   8.258   -16.224 1.00 0.00 ? 151 ASP A HA   5  
ATOM 10680 H HB3  . ASP A 1 133 ? 10.621  5.803   -16.377 1.00 0.00 ? 151 ASP A HB3  5  
ATOM 10681 N N    . GLY A 1 134 ? 8.108   6.189   -14.093 1.00 0.00 ? 152 GLY A N    5  
ATOM 10682 C CA   . GLY A 1 134 ? 7.132   5.202   -13.671 1.00 0.00 ? 152 GLY A CA   5  
ATOM 10683 C C    . GLY A 1 134 ? 7.467   3.807   -14.160 1.00 0.00 ? 152 GLY A C    5  
ATOM 10684 O O    . GLY A 1 134 ? 8.393   3.170   -13.656 1.00 0.00 ? 152 GLY A O    5  
ATOM 10685 H H    . GLY A 1 134 ? 8.584   6.723   -13.421 1.00 0.00 ? 152 GLY A H    5  
ATOM 10686 H HA2  . GLY A 1 134 ? 7.087   5.193   -12.592 1.00 0.00 ? 152 GLY A HA2  5  
ATOM 10687 H HA3  . GLY A 1 134 ? 6.163   5.483   -14.059 1.00 0.00 ? 152 GLY A HA3  5  
ATOM 10688 N N    . THR A 1 135 ? 6.715   3.329   -15.146 1.00 0.00 ? 153 THR A N    5  
ATOM 10689 C CA   . THR A 1 135 ? 6.936   2.001   -15.701 1.00 0.00 ? 153 THR A CA   5  
ATOM 10690 C C    . THR A 1 135 ? 7.026   0.953   -14.600 1.00 0.00 ? 153 THR A C    5  
ATOM 10691 O O    . THR A 1 135 ? 7.783   -0.014  -14.709 1.00 0.00 ? 153 THR A O    5  
ATOM 10692 C CB   . THR A 1 135 ? 8.222   1.952   -16.548 1.00 0.00 ? 153 THR A CB   5  
ATOM 10693 O OG1  . THR A 1 135 ? 9.369   1.924   -15.692 1.00 0.00 ? 153 THR A OG1  5  
ATOM 10694 C CG2  . THR A 1 135 ? 8.304   3.154   -17.477 1.00 0.00 ? 153 THR A CG2  5  
ATOM 10695 H H    . THR A 1 135 ? 5.993   3.887   -15.506 1.00 0.00 ? 153 THR A H    5  
ATOM 10696 H HA   . THR A 1 135 ? 6.099   1.764   -16.343 1.00 0.00 ? 153 THR A HA   5  
ATOM 10697 H HB   . THR A 1 135 ? 8.208   1.053   -17.147 1.00 0.00 ? 153 THR A HB   5  
ATOM 10698 H HG1  . THR A 1 135 ? 10.081  1.446   -16.127 1.00 0.00 ? 153 THR A HG1  5  
ATOM 10699 H HG21 . THR A 1 135 ? 9.056   3.840   -17.114 1.00 0.00 ? 153 THR A HG21 5  
ATOM 10700 H HG22 . THR A 1 135 ? 7.347   3.653   -17.506 1.00 0.00 ? 153 THR A HG22 5  
ATOM 10701 H HG23 . THR A 1 135 ? 8.569   2.824   -18.470 1.00 0.00 ? 153 THR A HG23 5  
ATOM 10702 N N    . ARG A 1 136 ? 6.251   1.147   -13.538 1.00 0.00 ? 154 ARG A N    5  
ATOM 10703 C CA   . ARG A 1 136 ? 6.245   0.218   -12.415 1.00 0.00 ? 154 ARG A CA   5  
ATOM 10704 C C    . ARG A 1 136 ? 7.656   -0.277  -12.111 1.00 0.00 ? 154 ARG A C    5  
ATOM 10705 O O    . ARG A 1 136 ? 7.865   -1.461  -11.839 1.00 0.00 ? 154 ARG A O    5  
ATOM 10706 C CB   . ARG A 1 136 ? 5.328   -0.971  -12.714 1.00 0.00 ? 154 ARG A CB   5  
ATOM 10707 C CG   . ARG A 1 136 ? 5.792   -1.816  -13.889 1.00 0.00 ? 154 ARG A CG   5  
ATOM 10708 C CD   . ARG A 1 136 ? 5.149   -3.193  -13.874 1.00 0.00 ? 154 ARG A CD   5  
ATOM 10709 N NE   . ARG A 1 136 ? 5.851   -4.116  -12.986 1.00 0.00 ? 154 ARG A NE   5  
ATOM 10710 C CZ   . ARG A 1 136 ? 7.050   -4.622  -13.252 1.00 0.00 ? 154 ARG A CZ   5  
ATOM 10711 N NH1  . ARG A 1 136 ? 7.677   -4.295  -14.374 1.00 0.00 ? 154 ARG A NH1  5  
ATOM 10712 N NH2  . ARG A 1 136 ? 7.625   -5.456  -12.395 1.00 0.00 ? 154 ARG A NH2  5  
ATOM 10713 H H    . ARG A 1 136 ? 5.669   1.936   -13.509 1.00 0.00 ? 154 ARG A H    5  
ATOM 10714 H HA   . ARG A 1 136 ? 5.866   0.743   -11.550 1.00 0.00 ? 154 ARG A HA   5  
ATOM 10715 H HB3  . ARG A 1 136 ? 4.338   -0.600  -12.934 1.00 0.00 ? 154 ARG A HB3  5  
ATOM 10716 H HG3  . ARG A 1 136 ? 6.865   -1.928  -13.838 1.00 0.00 ? 154 ARG A HG3  5  
ATOM 10717 H HD3  . ARG A 1 136 ? 5.161   -3.593  -14.876 1.00 0.00 ? 154 ARG A HD3  5  
ATOM 10718 H HE   . ARG A 1 136 ? 5.406   -4.371  -12.152 1.00 0.00 ? 154 ARG A HE   5  
ATOM 10719 H HH11 . ARG A 1 136 ? 7.247   -3.665  -15.021 1.00 0.00 ? 154 ARG A HH11 5  
ATOM 10720 H HH12 . ARG A 1 136 ? 8.581   -4.675  -14.572 1.00 0.00 ? 154 ARG A HH12 5  
ATOM 10721 H HH21 . ARG A 1 136 ? 7.156   -5.704  -11.549 1.00 0.00 ? 154 ARG A HH21 5  
ATOM 10722 H HH22 . ARG A 1 136 ? 8.528   -5.836  -12.596 1.00 0.00 ? 154 ARG A HH22 5  
ATOM 10723 N N    . TYR A 1 137 ? 8.619   0.635   -12.159 1.00 0.00 ? 155 TYR A N    5  
ATOM 10724 C CA   . TYR A 1 137 ? 10.012  0.290   -11.892 1.00 0.00 ? 155 TYR A CA   5  
ATOM 10725 C C    . TYR A 1 137 ? 10.143  -0.451  -10.565 1.00 0.00 ? 155 TYR A C    5  
ATOM 10726 O O    . TYR A 1 137 ? 9.564   -0.050  -9.555  1.00 0.00 ? 155 TYR A O    5  
ATOM 10727 C CB   . TYR A 1 137 ? 10.876  1.552   -11.873 1.00 0.00 ? 155 TYR A CB   5  
ATOM 10728 C CG   . TYR A 1 137 ? 12.360  1.270   -11.949 1.00 0.00 ? 155 TYR A CG   5  
ATOM 10729 C CD1  . TYR A 1 137 ? 12.942  0.825   -13.129 1.00 0.00 ? 155 TYR A CD1  5  
ATOM 10730 C CD2  . TYR A 1 137 ? 13.178  1.450   -10.841 1.00 0.00 ? 155 TYR A CD2  5  
ATOM 10731 C CE1  . TYR A 1 137 ? 14.298  0.566   -13.203 1.00 0.00 ? 155 TYR A CE1  5  
ATOM 10732 C CE2  . TYR A 1 137 ? 14.534  1.195   -10.906 1.00 0.00 ? 155 TYR A CE2  5  
ATOM 10733 C CZ   . TYR A 1 137 ? 15.090  0.754   -12.089 1.00 0.00 ? 155 TYR A CZ   5  
ATOM 10734 O OH   . TYR A 1 137 ? 16.440  0.497   -12.160 1.00 0.00 ? 155 TYR A OH   5  
ATOM 10735 H H    . TYR A 1 137 ? 8.391   1.561   -12.381 1.00 0.00 ? 155 TYR A H    5  
ATOM 10736 H HA   . TYR A 1 137 ? 10.352  -0.356  -12.687 1.00 0.00 ? 155 TYR A HA   5  
ATOM 10737 H HB3  . TYR A 1 137 ? 10.688  2.095   -10.959 1.00 0.00 ? 155 TYR A HB3  5  
ATOM 10738 H HD1  . TYR A 1 137 ? 12.320  0.681   -14.000 1.00 0.00 ? 155 TYR A HD1  5  
ATOM 10739 H HD2  . TYR A 1 137 ? 12.741  1.797   -9.916  1.00 0.00 ? 155 TYR A HD2  5  
ATOM 10740 H HE1  . TYR A 1 137 ? 14.733  0.221   -14.130 1.00 0.00 ? 155 TYR A HE1  5  
ATOM 10741 H HE2  . TYR A 1 137 ? 15.154  1.341   -10.034 1.00 0.00 ? 155 TYR A HE2  5  
ATOM 10742 H HH   . TYR A 1 137 ? 16.579  -0.398  -12.476 1.00 0.00 ? 155 TYR A HH   5  
ATOM 10743 N N    . VAL A 1 138 ? 10.912  -1.535  -10.574 1.00 0.00 ? 156 VAL A N    5  
ATOM 10744 C CA   . VAL A 1 138 ? 11.125  -2.333  -9.372  1.00 0.00 ? 156 VAL A CA   5  
ATOM 10745 C C    . VAL A 1 138 ? 12.482  -2.033  -8.746  1.00 0.00 ? 156 VAL A C    5  
ATOM 10746 O O    . VAL A 1 138 ? 13.434  -1.689  -9.444  1.00 0.00 ? 156 VAL A O    5  
ATOM 10747 C CB   . VAL A 1 138 ? 11.033  -3.840  -9.676  1.00 0.00 ? 156 VAL A CB   5  
ATOM 10748 C CG1  . VAL A 1 138 ? 11.064  -4.646  -8.387  1.00 0.00 ? 156 VAL A CG1  5  
ATOM 10749 C CG2  . VAL A 1 138 ? 9.774   -4.146  -10.475 1.00 0.00 ? 156 VAL A CG2  5  
ATOM 10750 H H    . VAL A 1 138 ? 11.347  -1.804  -11.410 1.00 0.00 ? 156 VAL A H    5  
ATOM 10751 H HA   . VAL A 1 138 ? 10.349  -2.081  -8.664  1.00 0.00 ? 156 VAL A HA   5  
ATOM 10752 H HB   . VAL A 1 138 ? 11.889  -4.120  -10.271 1.00 0.00 ? 156 VAL A HB   5  
ATOM 10753 H HG11 . VAL A 1 138 ? 10.844  -5.682  -8.604  1.00 0.00 ? 156 VAL A HG11 5  
ATOM 10754 H HG12 . VAL A 1 138 ? 12.044  -4.572  -7.939  1.00 0.00 ? 156 VAL A HG12 5  
ATOM 10755 H HG13 . VAL A 1 138 ? 10.324  -4.260  -7.701  1.00 0.00 ? 156 VAL A HG13 5  
ATOM 10756 H HG21 . VAL A 1 138 ? 9.806   -3.612  -11.413 1.00 0.00 ? 156 VAL A HG21 5  
ATOM 10757 H HG22 . VAL A 1 138 ? 9.719   -5.208  -10.666 1.00 0.00 ? 156 VAL A HG22 5  
ATOM 10758 H HG23 . VAL A 1 138 ? 8.905   -3.836  -9.913  1.00 0.00 ? 156 VAL A HG23 5  
ATOM 10759 N N    . GLN A 1 139 ? 12.562  -2.170  -7.427  1.00 0.00 ? 157 GLN A N    5  
ATOM 10760 C CA   . GLN A 1 139 ? 13.804  -1.914  -6.707  1.00 0.00 ? 157 GLN A CA   5  
ATOM 10761 C C    . GLN A 1 139 ? 14.360  -3.200  -6.105  1.00 0.00 ? 157 GLN A C    5  
ATOM 10762 O O    . GLN A 1 139 ? 13.702  -3.853  -5.294  1.00 0.00 ? 157 GLN A O    5  
ATOM 10763 C CB   . GLN A 1 139 ? 13.575  -0.878  -5.605  1.00 0.00 ? 157 GLN A CB   5  
ATOM 10764 C CG   . GLN A 1 139 ? 14.844  -0.167  -5.164  1.00 0.00 ? 157 GLN A CG   5  
ATOM 10765 C CD   . GLN A 1 139 ? 15.772  -1.069  -4.374  1.00 0.00 ? 157 GLN A CD   5  
ATOM 10766 O OE1  . GLN A 1 139 ? 16.901  -1.336  -4.790  1.00 0.00 ? 157 GLN A OE1  5  
ATOM 10767 N NE2  . GLN A 1 139 ? 15.303  -1.542  -3.225  1.00 0.00 ? 157 GLN A NE2  5  
ATOM 10768 H H    . GLN A 1 139 ? 11.767  -2.448  -6.927  1.00 0.00 ? 157 GLN A H    5  
ATOM 10769 H HA   . GLN A 1 139 ? 14.521  -1.522  -7.412  1.00 0.00 ? 157 GLN A HA   5  
ATOM 10770 H HB3  . GLN A 1 139 ? 13.148  -1.373  -4.745  1.00 0.00 ? 157 GLN A HB3  5  
ATOM 10771 H HG3  . GLN A 1 139 ? 14.574  0.676   -4.548  1.00 0.00 ? 157 GLN A HG3  5  
ATOM 10772 H HE21 . GLN A 1 139 ? 14.395  -1.287  -2.957  1.00 0.00 ? 157 GLN A HE21 5  
ATOM 10773 H HE22 . GLN A 1 139 ? 15.881  -2.127  -2.694  1.00 0.00 ? 157 GLN A HE22 5  
ATOM 10774 N N    . LYS A 1 140 ? 15.573  -3.560  -6.506  1.00 0.00 ? 158 LYS A N    5  
ATOM 10775 C CA   . LYS A 1 140 ? 16.219  -4.768  -6.006  1.00 0.00 ? 158 LYS A CA   5  
ATOM 10776 C C    . LYS A 1 140 ? 17.690  -4.509  -5.692  1.00 0.00 ? 158 LYS A C    5  
ATOM 10777 O O    . LYS A 1 140 ? 18.350  -3.726  -6.374  1.00 0.00 ? 158 LYS A O    5  
ATOM 10778 C CB   . LYS A 1 140 ? 16.095  -5.898  -7.030  1.00 0.00 ? 158 LYS A CB   5  
ATOM 10779 C CG   . LYS A 1 140 ? 16.472  -7.262  -6.479  1.00 0.00 ? 158 LYS A CG   5  
ATOM 10780 C CD   . LYS A 1 140 ? 15.448  -7.756  -5.470  1.00 0.00 ? 158 LYS A CD   5  
ATOM 10781 C CE   . LYS A 1 140 ? 15.941  -8.996  -4.738  1.00 0.00 ? 158 LYS A CE   5  
ATOM 10782 N NZ   . LYS A 1 140 ? 15.312  -9.134  -3.395  1.00 0.00 ? 158 LYS A NZ   5  
ATOM 10783 H H    . LYS A 1 140 ? 16.048  -2.998  -7.154  1.00 0.00 ? 158 LYS A H    5  
ATOM 10784 H HA   . LYS A 1 140 ? 15.716  -5.060  -5.097  1.00 0.00 ? 158 LYS A HA   5  
ATOM 10785 H HB3  . LYS A 1 140 ? 16.743  -5.681  -7.867  1.00 0.00 ? 158 LYS A HB3  5  
ATOM 10786 H HG3  . LYS A 1 140 ? 17.435  -7.192  -5.995  1.00 0.00 ? 158 LYS A HG3  5  
ATOM 10787 H HD3  . LYS A 1 140 ? 14.530  -7.997  -5.988  1.00 0.00 ? 158 LYS A HD3  5  
ATOM 10788 H HE3  . LYS A 1 140 ? 17.011  -8.926  -4.620  1.00 0.00 ? 158 LYS A HE3  5  
ATOM 10789 H HZ1  . LYS A 1 140 ? 14.290  -8.958  -3.460  1.00 0.00 ? 158 LYS A HZ1  5  
ATOM 10790 H HZ2  . LYS A 1 140 ? 15.729  -8.449  -2.734  1.00 0.00 ? 158 LYS A HZ2  5  
ATOM 10791 H HZ3  . LYS A 1 140 ? 15.464  -10.095 -3.026  1.00 0.00 ? 158 LYS A HZ3  5  
ATOM 10792 N N    . GLY A 1 141 ? 18.195  -5.175  -4.659  1.00 0.00 ? 159 GLY A N    5  
ATOM 10793 C CA   . GLY A 1 141 ? 19.585  -5.004  -4.276  1.00 0.00 ? 159 GLY A CA   5  
ATOM 10794 C C    . GLY A 1 141 ? 20.444  -6.190  -4.667  1.00 0.00 ? 159 GLY A C    5  
ATOM 10795 O O    . GLY A 1 141 ? 19.936  -7.195  -5.161  1.00 0.00 ? 159 GLY A O    5  
ATOM 10796 H H    . GLY A 1 141 ? 17.621  -5.787  -4.153  1.00 0.00 ? 159 GLY A H    5  
ATOM 10797 H HA2  . GLY A 1 141 ? 19.973  -4.117  -4.755  1.00 0.00 ? 159 GLY A HA2  5  
ATOM 10798 H HA3  . GLY A 1 141 ? 19.638  -4.874  -3.205  1.00 0.00 ? 159 GLY A HA3  5  
ATOM 10799 N N    . GLU A 1 142 ? 21.750  -6.071  -4.446  1.00 0.00 ? 160 GLU A N    5  
ATOM 10800 C CA   . GLU A 1 142 ? 22.682  -7.143  -4.781  1.00 0.00 ? 160 GLU A CA   5  
ATOM 10801 C C    . GLU A 1 142 ? 24.084  -6.823  -4.273  1.00 0.00 ? 160 GLU A C    5  
ATOM 10802 O O    . GLU A 1 142 ? 24.406  -5.668  -3.989  1.00 0.00 ? 160 GLU A O    5  
ATOM 10803 C CB   . GLU A 1 142 ? 22.714  -7.364  -6.295  1.00 0.00 ? 160 GLU A CB   5  
ATOM 10804 C CG   . GLU A 1 142 ? 23.229  -8.735  -6.697  1.00 0.00 ? 160 GLU A CG   5  
ATOM 10805 C CD   . GLU A 1 142 ? 22.882  -9.091  -8.131  1.00 0.00 ? 160 GLU A CD   5  
ATOM 10806 O OE1  . GLU A 1 142 ? 22.841  -8.173  -8.975  1.00 0.00 ? 160 GLU A OE1  5  
ATOM 10807 O OE2  . GLU A 1 142 ? 22.652  -10.287 -8.406  1.00 0.00 ? 160 GLU A OE2  5  
ATOM 10808 H H    . GLU A 1 142 ? 22.095  -5.245  -4.047  1.00 0.00 ? 160 GLU A H    5  
ATOM 10809 H HA   . GLU A 1 142 ? 22.334  -8.045  -4.302  1.00 0.00 ? 160 GLU A HA   5  
ATOM 10810 H HB3  . GLU A 1 142 ? 23.353  -6.617  -6.741  1.00 0.00 ? 160 GLU A HB3  5  
ATOM 10811 H HG3  . GLU A 1 142 ? 22.794  -9.476  -6.042  1.00 0.00 ? 160 GLU A HG3  5  
ATOM 10812 N N    . TYR A 1 143 ? 24.914  -7.852  -4.158  1.00 0.00 ? 161 TYR A N    5  
ATOM 10813 C CA   . TYR A 1 143 ? 26.281  -7.683  -3.682  1.00 0.00 ? 161 TYR A CA   5  
ATOM 10814 C C    . TYR A 1 143 ? 27.190  -8.780  -4.229  1.00 0.00 ? 161 TYR A C    5  
ATOM 10815 O O    . TYR A 1 143 ? 26.758  -9.623  -5.015  1.00 0.00 ? 161 TYR A O    5  
ATOM 10816 C CB   . TYR A 1 143 ? 26.315  -7.695  -2.153  1.00 0.00 ? 161 TYR A CB   5  
ATOM 10817 C CG   . TYR A 1 143 ? 25.495  -8.805  -1.536  1.00 0.00 ? 161 TYR A CG   5  
ATOM 10818 C CD1  . TYR A 1 143 ? 24.135  -8.641  -1.302  1.00 0.00 ? 161 TYR A CD1  5  
ATOM 10819 C CD2  . TYR A 1 143 ? 26.079  -10.016 -1.189  1.00 0.00 ? 161 TYR A CD2  5  
ATOM 10820 C CE1  . TYR A 1 143 ? 23.381  -9.652  -0.739  1.00 0.00 ? 161 TYR A CE1  5  
ATOM 10821 C CE2  . TYR A 1 143 ? 25.332  -11.033 -0.628  1.00 0.00 ? 161 TYR A CE2  5  
ATOM 10822 C CZ   . TYR A 1 143 ? 23.984  -10.847 -0.403  1.00 0.00 ? 161 TYR A CZ   5  
ATOM 10823 O OH   . TYR A 1 143 ? 23.236  -11.858 0.158   1.00 0.00 ? 161 TYR A OH   5  
ATOM 10824 H H    . TYR A 1 143 ? 24.600  -8.749  -4.399  1.00 0.00 ? 161 TYR A H    5  
ATOM 10825 H HA   . TYR A 1 143 ? 26.639  -6.726  -4.033  1.00 0.00 ? 161 TYR A HA   5  
ATOM 10826 H HB3  . TYR A 1 143 ? 25.932  -6.754  -1.784  1.00 0.00 ? 161 TYR A HB3  5  
ATOM 10827 H HD1  . TYR A 1 143 ? 23.666  -7.704  -1.565  1.00 0.00 ? 161 TYR A HD1  5  
ATOM 10828 H HD2  . TYR A 1 143 ? 27.135  -10.159 -1.366  1.00 0.00 ? 161 TYR A HD2  5  
ATOM 10829 H HE1  . TYR A 1 143 ? 22.325  -9.506  -0.563  1.00 0.00 ? 161 TYR A HE1  5  
ATOM 10830 H HE2  . TYR A 1 143 ? 25.805  -11.969 -0.365  1.00 0.00 ? 161 TYR A HE2  5  
ATOM 10831 H HH   . TYR A 1 143 ? 22.383  -11.512 0.429   1.00 0.00 ? 161 TYR A HH   5  
ATOM 10832 N N    . ARG A 1 144 ? 28.451  -8.760  -3.809  1.00 0.00 ? 162 ARG A N    5  
ATOM 10833 C CA   . ARG A 1 144 ? 29.421  -9.751  -4.256  1.00 0.00 ? 162 ARG A CA   5  
ATOM 10834 C C    . ARG A 1 144 ? 28.892  -11.167 -4.039  1.00 0.00 ? 162 ARG A C    5  
ATOM 10835 O O    . ARG A 1 144 ? 28.505  -11.848 -4.989  1.00 0.00 ? 162 ARG A O    5  
ATOM 10836 C CB   . ARG A 1 144 ? 30.746  -9.571  -3.513  1.00 0.00 ? 162 ARG A CB   5  
ATOM 10837 C CG   . ARG A 1 144 ? 31.770  -10.649 -3.825  1.00 0.00 ? 162 ARG A CG   5  
ATOM 10838 C CD   . ARG A 1 144 ? 32.088  -10.704 -5.312  1.00 0.00 ? 162 ARG A CD   5  
ATOM 10839 N NE   . ARG A 1 144 ? 33.343  -11.403 -5.579  1.00 0.00 ? 162 ARG A NE   5  
ATOM 10840 C CZ   . ARG A 1 144 ? 33.690  -11.856 -6.777  1.00 0.00 ? 162 ARG A CZ   5  
ATOM 10841 N NH1  . ARG A 1 144 ? 32.883  -11.684 -7.814  1.00 0.00 ? 162 ARG A NH1  5  
ATOM 10842 N NH2  . ARG A 1 144 ? 34.849  -12.483 -6.940  1.00 0.00 ? 162 ARG A NH2  5  
ATOM 10843 H H    . ARG A 1 144 ? 28.734  -8.062  -3.182  1.00 0.00 ? 162 ARG A H    5  
ATOM 10844 H HA   . ARG A 1 144 ? 29.588  -9.599  -5.313  1.00 0.00 ? 162 ARG A HA   5  
ATOM 10845 H HB3  . ARG A 1 144 ? 30.554  -9.584  -2.452  1.00 0.00 ? 162 ARG A HB3  5  
ATOM 10846 H HG3  . ARG A 1 144 ? 31.378  -11.606 -3.516  1.00 0.00 ? 162 ARG A HG3  5  
ATOM 10847 H HD3  . ARG A 1 144 ? 32.163  -9.693  -5.687  1.00 0.00 ? 162 ARG A HD3  5  
ATOM 10848 H HE   . ARG A 1 144 ? 33.955  -11.540 -4.826  1.00 0.00 ? 162 ARG A HE   5  
ATOM 10849 H HH11 . ARG A 1 144 ? 32.010  -11.212 -7.695  1.00 0.00 ? 162 ARG A HH11 5  
ATOM 10850 H HH12 . ARG A 1 144 ? 33.149  -12.025 -8.717  1.00 0.00 ? 162 ARG A HH12 5  
ATOM 10851 H HH21 . ARG A 1 144 ? 35.461  -12.614 -6.161  1.00 0.00 ? 162 ARG A HH21 5  
ATOM 10852 H HH22 . ARG A 1 144 ? 35.109  -12.824 -7.843  1.00 0.00 ? 162 ARG A HH22 5  
ATOM 10853 N N    . THR A 1 145 ? 28.880  -11.602 -2.785  1.00 0.00 ? 163 THR A N    5  
ATOM 10854 C CA   . THR A 1 145 ? 28.402  -12.936 -2.442  1.00 0.00 ? 163 THR A CA   5  
ATOM 10855 C C    . THR A 1 145 ? 27.007  -13.181 -3.009  1.00 0.00 ? 163 THR A C    5  
ATOM 10856 O O    . THR A 1 145 ? 26.198  -12.260 -3.110  1.00 0.00 ? 163 THR A O    5  
ATOM 10857 C CB   . THR A 1 145 ? 28.369  -13.147 -0.918  1.00 0.00 ? 163 THR A CB   5  
ATOM 10858 O OG1  . THR A 1 145 ? 28.151  -11.897 -0.253  1.00 0.00 ? 163 THR A OG1  5  
ATOM 10859 C CG2  . THR A 1 145 ? 29.670  -13.766 -0.430  1.00 0.00 ? 163 THR A CG2  5  
ATOM 10860 H H    . THR A 1 145 ? 29.202  -11.012 -2.072  1.00 0.00 ? 163 THR A H    5  
ATOM 10861 H HA   . THR A 1 145 ? 29.084  -13.654 -2.871  1.00 0.00 ? 163 THR A HA   5  
ATOM 10862 H HB   . THR A 1 145 ? 27.557  -13.819 -0.680  1.00 0.00 ? 163 THR A HB   5  
ATOM 10863 H HG1  . THR A 1 145 ? 28.996  -11.475 -0.080  1.00 0.00 ? 163 THR A HG1  5  
ATOM 10864 H HG21 . THR A 1 145 ? 29.529  -14.826 -0.277  1.00 0.00 ? 163 THR A HG21 5  
ATOM 10865 H HG22 . THR A 1 145 ? 29.962  -13.305 0.502   1.00 0.00 ? 163 THR A HG22 5  
ATOM 10866 H HG23 . THR A 1 145 ? 30.442  -13.608 -1.166  1.00 0.00 ? 163 THR A HG23 5  
ATOM 10867 N N    . ASN A 1 146 ? 26.733  -14.429 -3.374  1.00 0.00 ? 164 ASN A N    5  
ATOM 10868 C CA   . ASN A 1 146 ? 25.435  -14.794 -3.929  1.00 0.00 ? 164 ASN A CA   5  
ATOM 10869 C C    . ASN A 1 146 ? 24.302  -14.305 -3.033  1.00 0.00 ? 164 ASN A C    5  
ATOM 10870 O O    . ASN A 1 146 ? 24.487  -14.043 -1.844  1.00 0.00 ? 164 ASN A O    5  
ATOM 10871 C CB   . ASN A 1 146 ? 25.341  -16.311 -4.106  1.00 0.00 ? 164 ASN A CB   5  
ATOM 10872 C CG   . ASN A 1 146 ? 26.001  -17.067 -2.968  1.00 0.00 ? 164 ASN A CG   5  
ATOM 10873 O OD1  . ASN A 1 146 ? 25.406  -17.259 -1.907  1.00 0.00 ? 164 ASN A OD1  5  
ATOM 10874 N ND2  . ASN A 1 146 ? 27.237  -17.501 -3.185  1.00 0.00 ? 164 ASN A ND2  5  
ATOM 10875 H H    . ASN A 1 146 ? 27.419  -15.120 -3.269  1.00 0.00 ? 164 ASN A H    5  
ATOM 10876 H HA   . ASN A 1 146 ? 25.343  -14.323 -4.896  1.00 0.00 ? 164 ASN A HA   5  
ATOM 10877 H HB3  . ASN A 1 146 ? 25.826  -16.592 -5.028  1.00 0.00 ? 164 ASN A HB3  5  
ATOM 10878 H HD21 . ASN A 1 146 ? 27.649  -17.313 -4.053  1.00 0.00 ? 164 ASN A HD21 5  
ATOM 10879 H HD22 . ASN A 1 146 ? 27.687  -17.993 -2.467  1.00 0.00 ? 164 ASN A HD22 5  
ATOM 10880 N N    . PRO A 1 147 ? 23.099  -14.177 -3.615  1.00 0.00 ? 165 PRO A N    5  
ATOM 10881 C CA   . PRO A 1 147 ? 21.914  -13.719 -2.886  1.00 0.00 ? 165 PRO A CA   5  
ATOM 10882 C C    . PRO A 1 147 ? 21.422  -14.747 -1.873  1.00 0.00 ? 165 PRO A C    5  
ATOM 10883 O O    . PRO A 1 147 ? 21.634  -15.948 -2.041  1.00 0.00 ? 165 PRO A O    5  
ATOM 10884 C CB   . PRO A 1 147 ? 20.874  -13.520 -3.992  1.00 0.00 ? 165 PRO A CB   5  
ATOM 10885 C CG   . PRO A 1 147 ? 21.304  -14.433 -5.087  1.00 0.00 ? 165 PRO A CG   5  
ATOM 10886 C CD   . PRO A 1 147 ? 22.808  -14.470 -5.028  1.00 0.00 ? 165 PRO A CD   5  
ATOM 10887 H HA   . PRO A 1 147 ? 22.093  -12.779 -2.385  1.00 0.00 ? 165 PRO A HA   5  
ATOM 10888 H HB3  . PRO A 1 147 ? 20.878  -12.489 -4.314  1.00 0.00 ? 165 PRO A HB3  5  
ATOM 10889 H HG3  . PRO A 1 147 ? 20.978  -14.045 -6.041  1.00 0.00 ? 165 PRO A HG3  5  
ATOM 10890 H HD3  . PRO A 1 147 ? 23.230  -13.713 -5.673  1.00 0.00 ? 165 PRO A HD3  5  
ATOM 10891 N N    . GLU A 1 148 ? 20.765  -14.269 -0.821  1.00 0.00 ? 166 GLU A N    5  
ATOM 10892 C CA   . GLU A 1 148 ? 20.245  -15.148 0.220   1.00 0.00 ? 166 GLU A CA   5  
ATOM 10893 C C    . GLU A 1 148 ? 18.787  -15.508 -0.052  1.00 0.00 ? 166 GLU A C    5  
ATOM 10894 O O    . GLU A 1 148 ? 17.890  -15.111 0.692   1.00 0.00 ? 166 GLU A O    5  
ATOM 10895 C CB   . GLU A 1 148 ? 20.371  -14.482 1.591   1.00 0.00 ? 166 GLU A CB   5  
ATOM 10896 C CG   . GLU A 1 148 ? 21.808  -14.230 2.015   1.00 0.00 ? 166 GLU A CG   5  
ATOM 10897 C CD   . GLU A 1 148 ? 22.459  -15.457 2.625   1.00 0.00 ? 166 GLU A CD   5  
ATOM 10898 O OE1  . GLU A 1 148 ? 22.142  -15.779 3.789   1.00 0.00 ? 166 GLU A OE1  5  
ATOM 10899 O OE2  . GLU A 1 148 ? 23.284  -16.093 1.939   1.00 0.00 ? 166 GLU A OE2  5  
ATOM 10900 H H    . GLU A 1 148 ? 20.627  -13.302 -0.743  1.00 0.00 ? 166 GLU A H    5  
ATOM 10901 H HA   . GLU A 1 148 ? 20.834  -16.053 0.214   1.00 0.00 ? 166 GLU A HA   5  
ATOM 10902 H HB3  . GLU A 1 148 ? 19.905  -15.116 2.330   1.00 0.00 ? 166 GLU A HB3  5  
ATOM 10903 H HG3  . GLU A 1 148 ? 21.820  -13.434 2.746   1.00 0.00 ? 166 GLU A HG3  5  
ATOM 10904 N N    . ASP A 1 149 ? 18.558  -16.261 -1.121  1.00 0.00 ? 167 ASP A N    5  
ATOM 10905 C CA   . ASP A 1 149 ? 17.210  -16.676 -1.491  1.00 0.00 ? 167 ASP A CA   5  
ATOM 10906 C C    . ASP A 1 149 ? 16.921  -18.088 -0.994  1.00 0.00 ? 167 ASP A C    5  
ATOM 10907 O O    . ASP A 1 149 ? 17.040  -19.058 -1.744  1.00 0.00 ? 167 ASP A O    5  
ATOM 10908 C CB   . ASP A 1 149 ? 17.032  -16.610 -3.009  1.00 0.00 ? 167 ASP A CB   5  
ATOM 10909 C CG   . ASP A 1 149 ? 17.311  -15.228 -3.565  1.00 0.00 ? 167 ASP A CG   5  
ATOM 10910 O OD1  . ASP A 1 149 ? 17.011  -14.236 -2.867  1.00 0.00 ? 167 ASP A OD1  5  
ATOM 10911 O OD2  . ASP A 1 149 ? 17.829  -15.137 -4.698  1.00 0.00 ? 167 ASP A OD2  5  
ATOM 10912 H H    . ASP A 1 149 ? 19.316  -16.547 -1.675  1.00 0.00 ? 167 ASP A H    5  
ATOM 10913 H HA   . ASP A 1 149 ? 16.515  -15.994 -1.027  1.00 0.00 ? 167 ASP A HA   5  
ATOM 10914 H HB3  . ASP A 1 149 ? 16.016  -16.881 -3.258  1.00 0.00 ? 167 ASP A HB3  5  
ATOM 10915 N N    . ILE A 1 150 ? 16.540  -18.196 0.275   1.00 0.00 ? 168 ILE A N    5  
ATOM 10916 C CA   . ILE A 1 150 ? 16.234  -19.490 0.872   1.00 0.00 ? 168 ILE A CA   5  
ATOM 10917 C C    . ILE A 1 150 ? 14.786  -19.886 0.611   1.00 0.00 ? 168 ILE A C    5  
ATOM 10918 O O    . ILE A 1 150 ? 13.857  -19.179 1.001   1.00 0.00 ? 168 ILE A O    5  
ATOM 10919 C CB   . ILE A 1 150 ? 16.486  -19.483 2.392   1.00 0.00 ? 168 ILE A CB   5  
ATOM 10920 C CG1  . ILE A 1 150 ? 16.099  -20.832 3.001   1.00 0.00 ? 168 ILE A CG1  5  
ATOM 10921 C CG2  . ILE A 1 150 ? 15.708  -18.354 3.052   1.00 0.00 ? 168 ILE A CG2  5  
ATOM 10922 C CD1  . ILE A 1 150 ? 16.889  -21.996 2.445   1.00 0.00 ? 168 ILE A CD1  5  
ATOM 10923 H H    . ILE A 1 150 ? 16.463  -17.386 0.822   1.00 0.00 ? 168 ILE A H    5  
ATOM 10924 H HA   . ILE A 1 150 ? 16.884  -20.227 0.424   1.00 0.00 ? 168 ILE A HA   5  
ATOM 10925 H HB   . ILE A 1 150 ? 17.538  -19.309 2.559   1.00 0.00 ? 168 ILE A HB   5  
ATOM 10926 H HG13 . ILE A 1 150 ? 15.052  -21.018 2.809   1.00 0.00 ? 168 ILE A HG13 5  
ATOM 10927 H HG21 . ILE A 1 150 ? 15.225  -17.757 2.293   1.00 0.00 ? 168 ILE A HG21 5  
ATOM 10928 H HG22 . ILE A 1 150 ? 14.962  -18.770 3.711   1.00 0.00 ? 168 ILE A HG22 5  
ATOM 10929 H HG23 . ILE A 1 150 ? 16.385  -17.733 3.621   1.00 0.00 ? 168 ILE A HG23 5  
ATOM 10930 H HD11 . ILE A 1 150 ? 17.944  -21.819 2.597   1.00 0.00 ? 168 ILE A HD11 5  
ATOM 10931 H HD12 . ILE A 1 150 ? 16.598  -22.904 2.950   1.00 0.00 ? 168 ILE A HD12 5  
ATOM 10932 H HD13 . ILE A 1 150 ? 16.689  -22.093 1.387   1.00 0.00 ? 168 ILE A HD13 5  
ATOM 10933 N N    . TYR A 1 151 ? 14.598  -21.023 -0.052  1.00 0.00 ? 169 TYR A N    5  
ATOM 10934 C CA   . TYR A 1 151 ? 13.263  -21.515 -0.366  1.00 0.00 ? 169 TYR A CA   5  
ATOM 10935 C C    . TYR A 1 151 ? 13.268  -23.029 -0.552  1.00 0.00 ? 169 TYR A C    5  
ATOM 10936 O O    . TYR A 1 151 ? 13.191  -23.544 -1.668  1.00 0.00 ? 169 TYR A O    5  
ATOM 10937 C CB   . TYR A 1 151 ? 12.732  -20.836 -1.631  1.00 0.00 ? 169 TYR A CB   5  
ATOM 10938 C CG   . TYR A 1 151 ? 11.990  -19.546 -1.360  1.00 0.00 ? 169 TYR A CG   5  
ATOM 10939 C CD1  . TYR A 1 151 ? 10.785  -19.546 -0.668  1.00 0.00 ? 169 TYR A CD1  5  
ATOM 10940 C CD2  . TYR A 1 151 ? 12.495  -18.328 -1.796  1.00 0.00 ? 169 TYR A CD2  5  
ATOM 10941 C CE1  . TYR A 1 151 ? 10.104  -18.371 -0.421  1.00 0.00 ? 169 TYR A CE1  5  
ATOM 10942 C CE2  . TYR A 1 151 ? 11.823  -17.146 -1.550  1.00 0.00 ? 169 TYR A CE2  5  
ATOM 10943 C CZ   . TYR A 1 151 ? 10.626  -17.174 -0.862  1.00 0.00 ? 169 TYR A CZ   5  
ATOM 10944 O OH   . TYR A 1 151 ? 9.952   -15.999 -0.617  1.00 0.00 ? 169 TYR A OH   5  
ATOM 10945 H H    . TYR A 1 151 ? 15.378  -21.544 -0.337  1.00 0.00 ? 169 TYR A H    5  
ATOM 10946 H HA   . TYR A 1 151 ? 12.615  -21.268 0.462   1.00 0.00 ? 169 TYR A HA   5  
ATOM 10947 H HB3  . TYR A 1 151 ? 12.054  -21.510 -2.135  1.00 0.00 ? 169 TYR A HB3  5  
ATOM 10948 H HD1  . TYR A 1 151 ? 10.379  -20.487 -0.323  1.00 0.00 ? 169 TYR A HD1  5  
ATOM 10949 H HD2  . TYR A 1 151 ? 13.432  -18.310 -2.334  1.00 0.00 ? 169 TYR A HD2  5  
ATOM 10950 H HE1  . TYR A 1 151 ? 9.168   -18.391 0.118   1.00 0.00 ? 169 TYR A HE1  5  
ATOM 10951 H HE2  . TYR A 1 151 ? 12.230  -16.209 -1.897  1.00 0.00 ? 169 TYR A HE2  5  
ATOM 10952 H HH   . TYR A 1 151 ? 10.564  -15.346 -0.271  1.00 0.00 ? 169 TYR A HH   5  
ATOM 10953 N N    . PRO A 1 152 ? 13.362  -23.761 0.568   1.00 0.00 ? 170 PRO A N    5  
ATOM 10954 C CA   . PRO A 1 152 ? 13.379  -25.226 0.557   1.00 0.00 ? 170 PRO A CA   5  
ATOM 10955 C C    . PRO A 1 152 ? 12.030  -25.818 0.166   1.00 0.00 ? 170 PRO A C    5  
ATOM 10956 O O    . PRO A 1 152 ? 11.960  -26.768 -0.615  1.00 0.00 ? 170 PRO A O    5  
ATOM 10957 C CB   . PRO A 1 152 ? 13.724  -25.588 2.004   1.00 0.00 ? 170 PRO A CB   5  
ATOM 10958 C CG   . PRO A 1 152 ? 13.262  -24.421 2.806   1.00 0.00 ? 170 PRO A CG   5  
ATOM 10959 C CD   . PRO A 1 152 ? 13.459  -23.213 1.931   1.00 0.00 ? 170 PRO A CD   5  
ATOM 10960 H HA   . PRO A 1 152 ? 14.144  -25.609 -0.103  1.00 0.00 ? 170 PRO A HA   5  
ATOM 10961 H HB3  . PRO A 1 152 ? 14.789  -25.736 2.098   1.00 0.00 ? 170 PRO A HB3  5  
ATOM 10962 H HG3  . PRO A 1 152 ? 13.857  -24.335 3.703   1.00 0.00 ? 170 PRO A HG3  5  
ATOM 10963 H HD3  . PRO A 1 152 ? 14.432  -22.778 2.104   1.00 0.00 ? 170 PRO A HD3  5  
ATOM 10964 N N    . SER A 1 153 ? 10.960  -25.253 0.713   1.00 0.00 ? 171 SER A N    5  
ATOM 10965 C CA   . SER A 1 153 ? 9.611   -25.727 0.423   1.00 0.00 ? 171 SER A CA   5  
ATOM 10966 C C    . SER A 1 153 ? 9.461   -27.198 0.800   1.00 0.00 ? 171 SER A C    5  
ATOM 10967 O O    . SER A 1 153 ? 8.875   -27.983 0.056   1.00 0.00 ? 171 SER A O    5  
ATOM 10968 C CB   . SER A 1 153 ? 9.287   -25.533 -1.059  1.00 0.00 ? 171 SER A CB   5  
ATOM 10969 O OG   . SER A 1 153 ? 7.900   -25.314 -1.252  1.00 0.00 ? 171 SER A OG   5  
ATOM 10970 H H    . SER A 1 153 ? 11.079  -24.499 1.328   1.00 0.00 ? 171 SER A H    5  
ATOM 10971 H HA   . SER A 1 153 ? 8.920   -25.145 1.015   1.00 0.00 ? 171 SER A HA   5  
ATOM 10972 H HB3  . SER A 1 153 ? 9.580   -26.415 -1.608  1.00 0.00 ? 171 SER A HB3  5  
ATOM 10973 H HG   . SER A 1 153 ? 7.717   -24.373 -1.233  1.00 0.00 ? 171 SER A HG   5  
ATOM 10974 N N    . ASN A 1 154 ? 9.996   -27.563 1.960   1.00 0.00 ? 172 ASN A N    5  
ATOM 10975 C CA   . ASN A 1 154 ? 9.922   -28.939 2.437   1.00 0.00 ? 172 ASN A CA   5  
ATOM 10976 C C    . ASN A 1 154 ? 8.716   -29.136 3.349   1.00 0.00 ? 172 ASN A C    5  
ATOM 10977 O O    . ASN A 1 154 ? 8.175   -28.186 3.916   1.00 0.00 ? 172 ASN A O    5  
ATOM 10978 C CB   . ASN A 1 154 ? 11.205  -29.314 3.180   1.00 0.00 ? 172 ASN A CB   5  
ATOM 10979 C CG   . ASN A 1 154 ? 12.245  -29.931 2.265   1.00 0.00 ? 172 ASN A CG   5  
ATOM 10980 O OD1  . ASN A 1 154 ? 12.776  -31.005 2.548   1.00 0.00 ? 172 ASN A OD1  5  
ATOM 10981 N ND2  . ASN A 1 154 ? 12.540  -29.254 1.162   1.00 0.00 ? 172 ASN A ND2  5  
ATOM 10982 H H    . ASN A 1 154 ? 10.450  -26.891 2.511   1.00 0.00 ? 172 ASN A H    5  
ATOM 10983 H HA   . ASN A 1 154 ? 9.816   -29.583 1.576   1.00 0.00 ? 172 ASN A HA   5  
ATOM 10984 H HB3  . ASN A 1 154 ? 10.970  -30.022 3.959   1.00 0.00 ? 172 ASN A HB3  5  
ATOM 10985 H HD21 . ASN A 1 154 ? 12.078  -28.404 1.003   1.00 0.00 ? 172 ASN A HD21 5  
ATOM 10986 H HD22 . ASN A 1 154 ? 13.209  -29.630 0.554   1.00 0.00 ? 172 ASN A HD22 5  
ATOM 10987 N N    . PRO A 1 155 ? 8.284   -30.397 3.499   1.00 0.00 ? 173 PRO A N    5  
ATOM 10988 C CA   . PRO A 1 155 ? 7.139   -30.749 4.343   1.00 0.00 ? 173 PRO A CA   5  
ATOM 10989 C C    . PRO A 1 155 ? 7.439   -30.572 5.828   1.00 0.00 ? 173 PRO A C    5  
ATOM 10990 O O    . PRO A 1 155 ? 8.514   -30.106 6.203   1.00 0.00 ? 173 PRO A O    5  
ATOM 10991 C CB   . PRO A 1 155 ? 6.897   -32.225 4.016   1.00 0.00 ? 173 PRO A CB   5  
ATOM 10992 C CG   . PRO A 1 155 ? 8.219   -32.732 3.553   1.00 0.00 ? 173 PRO A CG   5  
ATOM 10993 C CD   . PRO A 1 155 ? 8.882   -31.579 2.852   1.00 0.00 ? 173 PRO A CD   5  
ATOM 10994 H HA   . PRO A 1 155 ? 6.263   -30.173 4.082   1.00 0.00 ? 173 PRO A HA   5  
ATOM 10995 H HB3  . PRO A 1 155 ? 6.149   -32.308 3.242   1.00 0.00 ? 173 PRO A HB3  5  
ATOM 10996 H HG3  . PRO A 1 155 ? 8.076   -33.553 2.867   1.00 0.00 ? 173 PRO A HG3  5  
ATOM 10997 H HD3  . PRO A 1 155 ? 8.654   -31.596 1.797   1.00 0.00 ? 173 PRO A HD3  5  
ATOM 10998 N N    . THR A 1 156 ? 6.480   -30.951 6.668   1.00 0.00 ? 174 THR A N    5  
ATOM 10999 C CA   . THR A 1 156 ? 6.641   -30.834 8.112   1.00 0.00 ? 174 THR A CA   5  
ATOM 11000 C C    . THR A 1 156 ? 6.818   -32.204 8.757   1.00 0.00 ? 174 THR A C    5  
ATOM 11001 O O    . THR A 1 156 ? 6.551   -33.232 8.136   1.00 0.00 ? 174 THR A O    5  
ATOM 11002 C CB   . THR A 1 156 ? 5.434   -30.128 8.757   1.00 0.00 ? 174 THR A CB   5  
ATOM 11003 O OG1  . THR A 1 156 ? 5.719   -29.821 10.125  1.00 0.00 ? 174 THR A OG1  5  
ATOM 11004 C CG2  . THR A 1 156 ? 4.189   -31.001 8.677   1.00 0.00 ? 174 THR A CG2  5  
ATOM 11005 H H    . THR A 1 156 ? 5.645   -31.316 6.307   1.00 0.00 ? 174 THR A H    5  
ATOM 11006 H HA   . THR A 1 156 ? 7.523   -30.240 8.302   1.00 0.00 ? 174 THR A HA   5  
ATOM 11007 H HB   . THR A 1 156 ? 5.245   -29.209 8.220   1.00 0.00 ? 174 THR A HB   5  
ATOM 11008 H HG1  . THR A 1 156 ? 5.037   -29.240 10.473  1.00 0.00 ? 174 THR A HG1  5  
ATOM 11009 H HG21 . THR A 1 156 ? 4.027   -31.483 9.629   1.00 0.00 ? 174 THR A HG21 5  
ATOM 11010 H HG22 . THR A 1 156 ? 4.325   -31.751 7.911   1.00 0.00 ? 174 THR A HG22 5  
ATOM 11011 H HG23 . THR A 1 156 ? 3.335   -30.388 8.435   1.00 0.00 ? 174 THR A HG23 5  
ATOM 11012 N N    . ASP A 1 157 ? 7.269   -32.210 10.007  1.00 0.00 ? 175 ASP A N    5  
ATOM 11013 C CA   . ASP A 1 157 ? 7.480   -33.454 10.738  1.00 0.00 ? 175 ASP A CA   5  
ATOM 11014 C C    . ASP A 1 157 ? 6.312   -33.738 11.677  1.00 0.00 ? 175 ASP A C    5  
ATOM 11015 O O    . ASP A 1 157 ? 5.854   -34.874 11.787  1.00 0.00 ? 175 ASP A O    5  
ATOM 11016 C CB   . ASP A 1 157 ? 8.785   -33.388 11.532  1.00 0.00 ? 175 ASP A CB   5  
ATOM 11017 C CG   . ASP A 1 157 ? 8.953   -32.071 12.265  1.00 0.00 ? 175 ASP A CG   5  
ATOM 11018 O OD1  . ASP A 1 157 ? 8.356   -31.917 13.351  1.00 0.00 ? 175 ASP A OD1  5  
ATOM 11019 O OD2  . ASP A 1 157 ? 9.680   -31.196 11.751  1.00 0.00 ? 175 ASP A OD2  5  
ATOM 11020 H H    . ASP A 1 157 ? 7.464   -31.356 10.449  1.00 0.00 ? 175 ASP A H    5  
ATOM 11021 H HA   . ASP A 1 157 ? 7.549   -34.254 10.016  1.00 0.00 ? 175 ASP A HA   5  
ATOM 11022 H HB3  . ASP A 1 157 ? 9.618   -33.512 10.855  1.00 0.00 ? 175 ASP A HB3  5  
ATOM 11023 N N    . ASP A 1 158 ? 5.837   -32.697 12.353  1.00 0.00 ? 176 ASP A N    5  
ATOM 11024 C CA   . ASP A 1 158 ? 4.723   -32.834 13.283  1.00 0.00 ? 176 ASP A CA   5  
ATOM 11025 C C    . ASP A 1 158 ? 4.149   -31.468 13.649  1.00 0.00 ? 176 ASP A C    5  
ATOM 11026 O O    . ASP A 1 158 ? 4.799   -30.441 13.458  1.00 0.00 ? 176 ASP A O    5  
ATOM 11027 C CB   . ASP A 1 158 ? 5.174   -33.567 14.547  1.00 0.00 ? 176 ASP A CB   5  
ATOM 11028 C CG   . ASP A 1 158 ? 6.416   -32.953 15.161  1.00 0.00 ? 176 ASP A CG   5  
ATOM 11029 O OD1  . ASP A 1 158 ? 6.396   -31.739 15.454  1.00 0.00 ? 176 ASP A OD1  5  
ATOM 11030 O OD2  . ASP A 1 158 ? 7.408   -33.687 15.350  1.00 0.00 ? 176 ASP A OD2  5  
ATOM 11031 H H    . ASP A 1 158 ? 6.246   -31.816 12.222  1.00 0.00 ? 176 ASP A H    5  
ATOM 11032 H HA   . ASP A 1 158 ? 3.954   -33.414 12.797  1.00 0.00 ? 176 ASP A HA   5  
ATOM 11033 H HB3  . ASP A 1 158 ? 5.386   -34.598 14.301  1.00 0.00 ? 176 ASP A HB3  5  
ATOM 11034 N N    . ASP A 1 159 ? 2.930   -31.466 14.175  1.00 0.00 ? 177 ASP A N    5  
ATOM 11035 C CA   . ASP A 1 159 ? 2.268   -30.227 14.568  1.00 0.00 ? 177 ASP A CA   5  
ATOM 11036 C C    . ASP A 1 159 ? 1.113   -30.507 15.524  1.00 0.00 ? 177 ASP A C    5  
ATOM 11037 O O    . ASP A 1 159 ? 0.355   -31.458 15.336  1.00 0.00 ? 177 ASP A O    5  
ATOM 11038 C CB   . ASP A 1 159 ? 1.758   -29.483 13.333  1.00 0.00 ? 177 ASP A CB   5  
ATOM 11039 C CG   . ASP A 1 159 ? 2.808   -28.574 12.728  1.00 0.00 ? 177 ASP A CG   5  
ATOM 11040 O OD1  . ASP A 1 159 ? 3.353   -27.723 13.464  1.00 0.00 ? 177 ASP A OD1  5  
ATOM 11041 O OD2  . ASP A 1 159 ? 3.086   -28.713 11.519  1.00 0.00 ? 177 ASP A OD2  5  
ATOM 11042 H H    . ASP A 1 159 ? 2.463   -32.318 14.302  1.00 0.00 ? 177 ASP A H    5  
ATOM 11043 H HA   . ASP A 1 159 ? 2.996   -29.608 15.074  1.00 0.00 ? 177 ASP A HA   5  
ATOM 11044 H HB3  . ASP A 1 159 ? 0.904   -28.883 13.612  1.00 0.00 ? 177 ASP A HB3  5  
ATOM 11045 N N    . VAL A 1 160 ? 0.987   -29.672 16.551  1.00 0.00 ? 178 VAL A N    5  
ATOM 11046 C CA   . VAL A 1 160 ? -0.076  -29.830 17.537  1.00 0.00 ? 178 VAL A CA   5  
ATOM 11047 C C    . VAL A 1 160 ? -1.450  -29.689 16.892  1.00 0.00 ? 178 VAL A C    5  
ATOM 11048 O O    . VAL A 1 160 ? -2.288  -30.585 16.987  1.00 0.00 ? 178 VAL A O    5  
ATOM 11049 C CB   . VAL A 1 160 ? 0.054   -28.796 18.671  1.00 0.00 ? 178 VAL A CB   5  
ATOM 11050 C CG1  . VAL A 1 160 ? -0.184  -27.390 18.144  1.00 0.00 ? 178 VAL A CG1  5  
ATOM 11051 C CG2  . VAL A 1 160 ? -0.911  -29.122 19.802  1.00 0.00 ? 178 VAL A CG2  5  
ATOM 11052 H H    . VAL A 1 160 ? 1.622   -28.932 16.646  1.00 0.00 ? 178 VAL A H    5  
ATOM 11053 H HA   . VAL A 1 160 ? 0.010   -30.818 17.966  1.00 0.00 ? 178 VAL A HA   5  
ATOM 11054 H HB   . VAL A 1 160 ? 1.060   -28.845 19.061  1.00 0.00 ? 178 VAL A HB   5  
ATOM 11055 H HG11 . VAL A 1 160 ? -1.193  -27.314 17.764  1.00 0.00 ? 178 VAL A HG11 5  
ATOM 11056 H HG12 . VAL A 1 160 ? -0.045  -26.677 18.943  1.00 0.00 ? 178 VAL A HG12 5  
ATOM 11057 H HG13 . VAL A 1 160 ? 0.515   -27.181 17.348  1.00 0.00 ? 178 VAL A HG13 5  
ATOM 11058 H HG21 . VAL A 1 160 ? -0.514  -28.748 20.733  1.00 0.00 ? 178 VAL A HG21 5  
ATOM 11059 H HG22 . VAL A 1 160 ? -1.866  -28.657 19.605  1.00 0.00 ? 178 VAL A HG22 5  
ATOM 11060 H HG23 . VAL A 1 160 ? -1.040  -30.192 19.868  1.00 0.00 ? 178 VAL A HG23 5  
ATOM 11061 N N    . GLN A 1 3   ? 9.071   -12.609 5.422   1.00 0.00 ? 21  GLN A N    6  
ATOM 11062 C CA   . GLN A 1 3   ? 9.536   -11.524 4.566   1.00 0.00 ? 21  GLN A CA   6  
ATOM 11063 C C    . GLN A 1 3   ? 8.402   -10.993 3.696   1.00 0.00 ? 21  GLN A C    6  
ATOM 11064 O O    . GLN A 1 3   ? 7.893   -11.698 2.823   1.00 0.00 ? 21  GLN A O    6  
ATOM 11065 C CB   . GLN A 1 3   ? 10.690  -12.005 3.682   1.00 0.00 ? 21  GLN A CB   6  
ATOM 11066 C CG   . GLN A 1 3   ? 11.571  -10.877 3.170   1.00 0.00 ? 21  GLN A CG   6  
ATOM 11067 C CD   . GLN A 1 3   ? 12.629  -11.360 2.197   1.00 0.00 ? 21  GLN A CD   6  
ATOM 11068 O OE1  . GLN A 1 3   ? 13.569  -12.059 2.579   1.00 0.00 ? 21  GLN A OE1  6  
ATOM 11069 N NE2  . GLN A 1 3   ? 12.483  -10.992 0.930   1.00 0.00 ? 21  GLN A NE2  6  
ATOM 11070 H H    . GLN A 1 3   ? 8.534   -13.330 5.033   1.00 0.00 ? 21  GLN A H    6  
ATOM 11071 H HA   . GLN A 1 3   ? 9.890   -10.728 5.202   1.00 0.00 ? 21  GLN A HA   6  
ATOM 11072 H HB3  . GLN A 1 3   ? 10.282  -12.528 2.832   1.00 0.00 ? 21  GLN A HB3  6  
ATOM 11073 H HG3  . GLN A 1 3   ? 12.063  -10.410 4.010   1.00 0.00 ? 21  GLN A HG3  6  
ATOM 11074 H HE21 . GLN A 1 3   ? 11.711  -10.432 0.698   1.00 0.00 ? 21  GLN A HE21 6  
ATOM 11075 H HE22 . GLN A 1 3   ? 13.153  -11.288 0.281   1.00 0.00 ? 21  GLN A HE22 6  
ATOM 11076 N N    . ILE A 1 4   ? 8.009   -9.747  3.941   1.00 0.00 ? 22  ILE A N    6  
ATOM 11077 C CA   . ILE A 1 4   ? 6.935   -9.122  3.180   1.00 0.00 ? 22  ILE A CA   6  
ATOM 11078 C C    . ILE A 1 4   ? 7.436   -7.893  2.431   1.00 0.00 ? 22  ILE A C    6  
ATOM 11079 O O    . ILE A 1 4   ? 8.266   -7.137  2.939   1.00 0.00 ? 22  ILE A O    6  
ATOM 11080 C CB   . ILE A 1 4   ? 5.764   -8.712  4.091   1.00 0.00 ? 22  ILE A CB   6  
ATOM 11081 C CG1  . ILE A 1 4   ? 5.130   -9.949  4.732   1.00 0.00 ? 22  ILE A CG1  6  
ATOM 11082 C CG2  . ILE A 1 4   ? 4.727   -7.929  3.301   1.00 0.00 ? 22  ILE A CG2  6  
ATOM 11083 C CD1  . ILE A 1 4   ? 4.472   -10.876 3.734   1.00 0.00 ? 22  ILE A CD1  6  
ATOM 11084 H H    . ILE A 1 4   ? 8.452   -9.237  4.650   1.00 0.00 ? 22  ILE A H    6  
ATOM 11085 H HA   . ILE A 1 4   ? 6.572   -9.843  2.462   1.00 0.00 ? 22  ILE A HA   6  
ATOM 11086 H HB   . ILE A 1 4   ? 6.149   -8.071  4.870   1.00 0.00 ? 22  ILE A HB   6  
ATOM 11087 H HG13 . ILE A 1 4   ? 4.377   -9.633  5.438   1.00 0.00 ? 22  ILE A HG13 6  
ATOM 11088 H HG21 . ILE A 1 4   ? 4.425   -8.500  2.437   1.00 0.00 ? 22  ILE A HG21 6  
ATOM 11089 H HG22 . ILE A 1 4   ? 3.866   -7.739  3.926   1.00 0.00 ? 22  ILE A HG22 6  
ATOM 11090 H HG23 . ILE A 1 4   ? 5.153   -6.989  2.982   1.00 0.00 ? 22  ILE A HG23 6  
ATOM 11091 H HD11 . ILE A 1 4   ? 3.420   -10.963 3.960   1.00 0.00 ? 22  ILE A HD11 6  
ATOM 11092 H HD12 . ILE A 1 4   ? 4.596   -10.480 2.736   1.00 0.00 ? 22  ILE A HD12 6  
ATOM 11093 H HD13 . ILE A 1 4   ? 4.933   -11.853 3.792   1.00 0.00 ? 22  ILE A HD13 6  
ATOM 11094 N N    . ASP A 1 5   ? 6.926   -7.695  1.221   1.00 0.00 ? 23  ASP A N    6  
ATOM 11095 C CA   . ASP A 1 5   ? 7.320   -6.555  0.402   1.00 0.00 ? 23  ASP A CA   6  
ATOM 11096 C C    . ASP A 1 5   ? 6.134   -5.629  0.152   1.00 0.00 ? 23  ASP A C    6  
ATOM 11097 O O    . ASP A 1 5   ? 5.026   -6.084  -0.136  1.00 0.00 ? 23  ASP A O    6  
ATOM 11098 C CB   . ASP A 1 5   ? 7.899   -7.032  -0.932  1.00 0.00 ? 23  ASP A CB   6  
ATOM 11099 C CG   . ASP A 1 5   ? 8.827   -6.011  -1.559  1.00 0.00 ? 23  ASP A CG   6  
ATOM 11100 O OD1  . ASP A 1 5   ? 8.852   -4.858  -1.078  1.00 0.00 ? 23  ASP A OD1  6  
ATOM 11101 O OD2  . ASP A 1 5   ? 9.528   -6.363  -2.531  1.00 0.00 ? 23  ASP A OD2  6  
ATOM 11102 H H    . ASP A 1 5   ? 6.269   -8.333  0.869   1.00 0.00 ? 23  ASP A H    6  
ATOM 11103 H HA   . ASP A 1 5   ? 8.081   -6.008  0.938   1.00 0.00 ? 23  ASP A HA   6  
ATOM 11104 H HB3  . ASP A 1 5   ? 7.088   -7.225  -1.620  1.00 0.00 ? 23  ASP A HB3  6  
ATOM 11105 N N    . LEU A 1 6   ? 6.370   -4.327  0.267   1.00 0.00 ? 24  LEU A N    6  
ATOM 11106 C CA   . LEU A 1 6   ? 5.321   -3.336  0.057   1.00 0.00 ? 24  LEU A CA   6  
ATOM 11107 C C    . LEU A 1 6   ? 5.777   -2.260  -0.922  1.00 0.00 ? 24  LEU A C    6  
ATOM 11108 O O    . LEU A 1 6   ? 6.278   -1.211  -0.519  1.00 0.00 ? 24  LEU A O    6  
ATOM 11109 C CB   . LEU A 1 6   ? 4.922   -2.696  1.387   1.00 0.00 ? 24  LEU A CB   6  
ATOM 11110 C CG   . LEU A 1 6   ? 3.484   -2.181  1.480   1.00 0.00 ? 24  LEU A CG   6  
ATOM 11111 C CD1  . LEU A 1 6   ? 2.497   -3.328  1.330   1.00 0.00 ? 24  LEU A CD1  6  
ATOM 11112 C CD2  . LEU A 1 6   ? 3.263   -1.451  2.798   1.00 0.00 ? 24  LEU A CD2  6  
ATOM 11113 H H    . LEU A 1 6   ? 7.272   -4.023  0.500   1.00 0.00 ? 24  LEU A H    6  
ATOM 11114 H HA   . LEU A 1 6   ? 4.464   -3.845  -0.359  1.00 0.00 ? 24  LEU A HA   6  
ATOM 11115 H HB3  . LEU A 1 6   ? 5.585   -1.861  1.563   1.00 0.00 ? 24  LEU A HB3  6  
ATOM 11116 H HG   . LEU A 1 6   ? 3.307   -1.480  0.676   1.00 0.00 ? 24  LEU A HG   6  
ATOM 11117 H HD11 . LEU A 1 6   ? 1.501   -2.976  1.557   1.00 0.00 ? 24  LEU A HD11 6  
ATOM 11118 H HD12 . LEU A 1 6   ? 2.762   -4.123  2.011   1.00 0.00 ? 24  LEU A HD12 6  
ATOM 11119 H HD13 . LEU A 1 6   ? 2.527   -3.698  0.317   1.00 0.00 ? 24  LEU A HD13 6  
ATOM 11120 H HD21 . LEU A 1 6   ? 4.211   -1.093  3.174   1.00 0.00 ? 24  LEU A HD21 6  
ATOM 11121 H HD22 . LEU A 1 6   ? 2.826   -2.131  3.515   1.00 0.00 ? 24  LEU A HD22 6  
ATOM 11122 H HD23 . LEU A 1 6   ? 2.599   -0.616  2.640   1.00 0.00 ? 24  LEU A HD23 6  
ATOM 11123 N N    . ASN A 1 7   ? 5.598   -2.526  -2.213  1.00 0.00 ? 25  ASN A N    6  
ATOM 11124 C CA   . ASN A 1 7   ? 5.991   -1.579  -3.249  1.00 0.00 ? 25  ASN A CA   6  
ATOM 11125 C C    . ASN A 1 7   ? 4.943   -0.480  -3.407  1.00 0.00 ? 25  ASN A C    6  
ATOM 11126 O O    . ASN A 1 7   ? 3.753   -0.706  -3.185  1.00 0.00 ? 25  ASN A O    6  
ATOM 11127 C CB   . ASN A 1 7   ? 6.189   -2.304  -4.583  1.00 0.00 ? 25  ASN A CB   6  
ATOM 11128 C CG   . ASN A 1 7   ? 7.442   -3.159  -4.593  1.00 0.00 ? 25  ASN A CG   6  
ATOM 11129 O OD1  . ASN A 1 7   ? 8.365   -2.918  -5.370  1.00 0.00 ? 25  ASN A OD1  6  
ATOM 11130 N ND2  . ASN A 1 7   ? 7.478   -4.166  -3.728  1.00 0.00 ? 25  ASN A ND2  6  
ATOM 11131 H H    . ASN A 1 7   ? 5.194   -3.380  -2.473  1.00 0.00 ? 25  ASN A H    6  
ATOM 11132 H HA   . ASN A 1 7   ? 6.925   -1.128  -2.951  1.00 0.00 ? 25  ASN A HA   6  
ATOM 11133 H HB3  . ASN A 1 7   ? 6.267   -1.574  -5.374  1.00 0.00 ? 25  ASN A HB3  6  
ATOM 11134 H HD21 . ASN A 1 7   ? 6.705   -4.299  -3.139  1.00 0.00 ? 25  ASN A HD21 6  
ATOM 11135 H HD22 . ASN A 1 7   ? 8.276   -4.734  -3.713  1.00 0.00 ? 25  ASN A HD22 6  
ATOM 11136 N N    . ILE A 1 8   ? 5.394   0.708   -3.793  1.00 0.00 ? 26  ILE A N    6  
ATOM 11137 C CA   . ILE A 1 8   ? 4.497   1.841   -3.982  1.00 0.00 ? 26  ILE A CA   6  
ATOM 11138 C C    . ILE A 1 8   ? 4.741   2.518   -5.327  1.00 0.00 ? 26  ILE A C    6  
ATOM 11139 O O    . ILE A 1 8   ? 5.878   2.615   -5.789  1.00 0.00 ? 26  ILE A O    6  
ATOM 11140 C CB   . ILE A 1 8   ? 4.660   2.883   -2.860  1.00 0.00 ? 26  ILE A CB   6  
ATOM 11141 C CG1  . ILE A 1 8   ? 4.638   2.196   -1.492  1.00 0.00 ? 26  ILE A CG1  6  
ATOM 11142 C CG2  . ILE A 1 8   ? 3.564   3.934   -2.949  1.00 0.00 ? 26  ILE A CG2  6  
ATOM 11143 C CD1  . ILE A 1 8   ? 4.785   3.157   -0.332  1.00 0.00 ? 26  ILE A CD1  6  
ATOM 11144 H H    . ILE A 1 8   ? 6.354   0.826   -3.956  1.00 0.00 ? 26  ILE A H    6  
ATOM 11145 H HA   . ILE A 1 8   ? 3.482   1.470   -3.958  1.00 0.00 ? 26  ILE A HA   6  
ATOM 11146 H HB   . ILE A 1 8   ? 5.610   3.375   -2.992  1.00 0.00 ? 26  ILE A HB   6  
ATOM 11147 H HG13 . ILE A 1 8   ? 5.450   1.486   -1.441  1.00 0.00 ? 26  ILE A HG13 6  
ATOM 11148 H HG21 . ILE A 1 8   ? 3.701   4.664   -2.165  1.00 0.00 ? 26  ILE A HG21 6  
ATOM 11149 H HG22 . ILE A 1 8   ? 3.614   4.424   -3.910  1.00 0.00 ? 26  ILE A HG22 6  
ATOM 11150 H HG23 . ILE A 1 8   ? 2.600   3.461   -2.836  1.00 0.00 ? 26  ILE A HG23 6  
ATOM 11151 H HD11 . ILE A 1 8   ? 5.521   2.776   0.361   1.00 0.00 ? 26  ILE A HD11 6  
ATOM 11152 H HD12 . ILE A 1 8   ? 5.099   4.122   -0.701  1.00 0.00 ? 26  ILE A HD12 6  
ATOM 11153 H HD13 . ILE A 1 8   ? 3.835   3.258   0.174   1.00 0.00 ? 26  ILE A HD13 6  
ATOM 11154 N N    . THR A 1 9   ? 3.665   2.987   -5.952  1.00 0.00 ? 27  THR A N    6  
ATOM 11155 C CA   . THR A 1 9   ? 3.762   3.655   -7.243  1.00 0.00 ? 27  THR A CA   6  
ATOM 11156 C C    . THR A 1 9   ? 3.824   5.169   -7.075  1.00 0.00 ? 27  THR A C    6  
ATOM 11157 O O    . THR A 1 9   ? 3.954   5.676   -5.960  1.00 0.00 ? 27  THR A O    6  
ATOM 11158 C CB   . THR A 1 9   ? 2.569   3.299   -8.151  1.00 0.00 ? 27  THR A CB   6  
ATOM 11159 O OG1  . THR A 1 9   ? 2.854   3.674   -9.503  1.00 0.00 ? 27  THR A OG1  6  
ATOM 11160 C CG2  . THR A 1 9   ? 1.303   3.999   -7.681  1.00 0.00 ? 27  THR A CG2  6  
ATOM 11161 H H    . THR A 1 9   ? 2.786   2.880   -5.532  1.00 0.00 ? 27  THR A H    6  
ATOM 11162 H HA   . THR A 1 9   ? 4.667   3.319   -7.726  1.00 0.00 ? 27  THR A HA   6  
ATOM 11163 H HB   . THR A 1 9   ? 2.409   2.231   -8.106  1.00 0.00 ? 27  THR A HB   6  
ATOM 11164 H HG1  . THR A 1 9   ? 2.092   3.480   -10.056 1.00 0.00 ? 27  THR A HG1  6  
ATOM 11165 H HG21 . THR A 1 9   ? 1.107   3.737   -6.651  1.00 0.00 ? 27  THR A HG21 6  
ATOM 11166 H HG22 . THR A 1 9   ? 0.471   3.691   -8.296  1.00 0.00 ? 27  THR A HG22 6  
ATOM 11167 H HG23 . THR A 1 9   ? 1.432   5.068   -7.760  1.00 0.00 ? 27  THR A HG23 6  
ATOM 11168 N N    . CYS A 1 10  ? 3.728   5.888   -8.189  1.00 0.00 ? 28  CYS A N    6  
ATOM 11169 C CA   . CYS A 1 10  ? 3.774   7.344   -8.165  1.00 0.00 ? 28  CYS A CA   6  
ATOM 11170 C C    . CYS A 1 10  ? 2.765   7.904   -7.166  1.00 0.00 ? 28  CYS A C    6  
ATOM 11171 O O    . CYS A 1 10  ? 1.915   7.176   -6.653  1.00 0.00 ? 28  CYS A O    6  
ATOM 11172 C CB   . CYS A 1 10  ? 3.491   7.906   -9.560  1.00 0.00 ? 28  CYS A CB   6  
ATOM 11173 S SG   . CYS A 1 10  ? 4.802   7.568   -10.778 1.00 0.00 ? 28  CYS A SG   6  
ATOM 11174 H H    . CYS A 1 10  ? 3.626   5.427   -9.049  1.00 0.00 ? 28  CYS A H    6  
ATOM 11175 H HA   . CYS A 1 10  ? 4.766   7.641   -7.863  1.00 0.00 ? 28  CYS A HA   6  
ATOM 11176 H HB3  . CYS A 1 10  ? 3.374   8.978   -9.492  1.00 0.00 ? 28  CYS A HB3  6  
ATOM 11177 N N    . ARG A 1 11  ? 2.867   9.201   -6.895  1.00 0.00 ? 29  ARG A N    6  
ATOM 11178 C CA   . ARG A 1 11  ? 1.965   9.859   -5.957  1.00 0.00 ? 29  ARG A CA   6  
ATOM 11179 C C    . ARG A 1 11  ? 1.008   10.795  -6.688  1.00 0.00 ? 29  ARG A C    6  
ATOM 11180 O O    . ARG A 1 11  ? 1.398   11.871  -7.137  1.00 0.00 ? 29  ARG A O    6  
ATOM 11181 C CB   . ARG A 1 11  ? 2.764   10.641  -4.912  1.00 0.00 ? 29  ARG A CB   6  
ATOM 11182 C CG   . ARG A 1 11  ? 1.919   11.151  -3.757  1.00 0.00 ? 29  ARG A CG   6  
ATOM 11183 C CD   . ARG A 1 11  ? 1.719   10.079  -2.698  1.00 0.00 ? 29  ARG A CD   6  
ATOM 11184 N NE   . ARG A 1 11  ? 2.990   9.580   -2.175  1.00 0.00 ? 29  ARG A NE   6  
ATOM 11185 C CZ   . ARG A 1 11  ? 3.792   10.292  -1.394  1.00 0.00 ? 29  ARG A CZ   6  
ATOM 11186 N NH1  . ARG A 1 11  ? 3.458   11.527  -1.042  1.00 0.00 ? 29  ARG A NH1  6  
ATOM 11187 N NH2  . ARG A 1 11  ? 4.931   9.769   -0.959  1.00 0.00 ? 29  ARG A NH2  6  
ATOM 11188 H H    . ARG A 1 11  ? 3.566   9.728   -7.336  1.00 0.00 ? 29  ARG A H    6  
ATOM 11189 H HA   . ARG A 1 11  ? 1.392   9.093   -5.457  1.00 0.00 ? 29  ARG A HA   6  
ATOM 11190 H HB3  . ARG A 1 11  ? 3.227   11.492  -5.394  1.00 0.00 ? 29  ARG A HB3  6  
ATOM 11191 H HG3  . ARG A 1 11  ? 0.956   11.457  -4.135  1.00 0.00 ? 29  ARG A HG3  6  
ATOM 11192 H HD3  . ARG A 1 11  ? 1.174   9.257   -3.136  1.00 0.00 ? 29  ARG A HD3  6  
ATOM 11193 H HE   . ARG A 1 11  ? 3.255   8.671   -2.422  1.00 0.00 ? 29  ARG A HE   6  
ATOM 11194 H HH11 . ARG A 1 11  ? 2.600   11.923  -1.369  1.00 0.00 ? 29  ARG A HH11 6  
ATOM 11195 H HH12 . ARG A 1 11  ? 4.064   12.061  -0.453  1.00 0.00 ? 29  ARG A HH12 6  
ATOM 11196 H HH21 . ARG A 1 11  ? 5.186   8.840   -1.220  1.00 0.00 ? 29  ARG A HH21 6  
ATOM 11197 H HH22 . ARG A 1 11  ? 5.534   10.306  -0.369  1.00 0.00 ? 29  ARG A HH22 6  
ATOM 11198 N N    . PHE A 1 12  ? -0.248  10.375  -6.802  1.00 0.00 ? 30  PHE A N    6  
ATOM 11199 C CA   . PHE A 1 12  ? -1.262  11.175  -7.480  1.00 0.00 ? 30  PHE A CA   6  
ATOM 11200 C C    . PHE A 1 12  ? -1.857  12.214  -6.534  1.00 0.00 ? 30  PHE A C    6  
ATOM 11201 O O    . PHE A 1 12  ? -2.796  11.929  -5.792  1.00 0.00 ? 30  PHE A O    6  
ATOM 11202 C CB   . PHE A 1 12  ? -2.370  10.273  -8.028  1.00 0.00 ? 30  PHE A CB   6  
ATOM 11203 C CG   . PHE A 1 12  ? -1.929  9.405   -9.170  1.00 0.00 ? 30  PHE A CG   6  
ATOM 11204 C CD1  . PHE A 1 12  ? -1.017  8.382   -8.969  1.00 0.00 ? 30  PHE A CD1  6  
ATOM 11205 C CD2  . PHE A 1 12  ? -2.424  9.614   -10.448 1.00 0.00 ? 30  PHE A CD2  6  
ATOM 11206 C CE1  . PHE A 1 12  ? -0.607  7.582   -10.019 1.00 0.00 ? 30  PHE A CE1  6  
ATOM 11207 C CE2  . PHE A 1 12  ? -2.020  8.815   -11.502 1.00 0.00 ? 30  PHE A CE2  6  
ATOM 11208 C CZ   . PHE A 1 12  ? -1.109  7.800   -11.287 1.00 0.00 ? 30  PHE A CZ   6  
ATOM 11209 H H    . PHE A 1 12  ? -0.498  9.507   -6.423  1.00 0.00 ? 30  PHE A H    6  
ATOM 11210 H HA   . PHE A 1 12  ? -0.785  11.684  -8.303  1.00 0.00 ? 30  PHE A HA   6  
ATOM 11211 H HB3  . PHE A 1 12  ? -3.187  10.889  -8.373  1.00 0.00 ? 30  PHE A HB3  6  
ATOM 11212 H HD1  . PHE A 1 12  ? -0.623  8.211   -7.977  1.00 0.00 ? 30  PHE A HD1  6  
ATOM 11213 H HD2  . PHE A 1 12  ? -3.136  10.408  -10.617 1.00 0.00 ? 30  PHE A HD2  6  
ATOM 11214 H HE1  . PHE A 1 12  ? 0.106   6.788   -9.847  1.00 0.00 ? 30  PHE A HE1  6  
ATOM 11215 H HE2  . PHE A 1 12  ? -2.413  8.988   -12.492 1.00 0.00 ? 30  PHE A HE2  6  
ATOM 11216 H HZ   . PHE A 1 12  ? -0.791  7.175   -12.108 1.00 0.00 ? 30  PHE A HZ   6  
ATOM 11217 N N    . ALA A 1 13  ? -1.301  13.421  -6.567  1.00 0.00 ? 31  ALA A N    6  
ATOM 11218 C CA   . ALA A 1 13  ? -1.777  14.504  -5.715  1.00 0.00 ? 31  ALA A CA   6  
ATOM 11219 C C    . ALA A 1 13  ? -1.835  14.068  -4.254  1.00 0.00 ? 31  ALA A C    6  
ATOM 11220 O O    . ALA A 1 13  ? -2.762  14.423  -3.528  1.00 0.00 ? 31  ALA A O    6  
ATOM 11221 C CB   . ALA A 1 13  ? -3.143  14.982  -6.181  1.00 0.00 ? 31  ALA A CB   6  
ATOM 11222 H H    . ALA A 1 13  ? -0.556  13.588  -7.179  1.00 0.00 ? 31  ALA A H    6  
ATOM 11223 H HA   . ALA A 1 13  ? -1.083  15.329  -5.806  1.00 0.00 ? 31  ALA A HA   6  
ATOM 11224 H HB1  . ALA A 1 13  ? -3.022  15.661  -7.011  1.00 0.00 ? 31  ALA A HB1  6  
ATOM 11225 H HB2  . ALA A 1 13  ? -3.734  14.133  -6.494  1.00 0.00 ? 31  ALA A HB2  6  
ATOM 11226 H HB3  . ALA A 1 13  ? -3.644  15.489  -5.370  1.00 0.00 ? 31  ALA A HB3  6  
ATOM 11227 N N    . GLY A 1 14  ? -0.841  13.294  -3.831  1.00 0.00 ? 32  GLY A N    6  
ATOM 11228 C CA   . GLY A 1 14  ? -0.799  12.822  -2.459  1.00 0.00 ? 32  GLY A CA   6  
ATOM 11229 C C    . GLY A 1 14  ? -1.441  11.459  -2.297  1.00 0.00 ? 32  GLY A C    6  
ATOM 11230 O O    . GLY A 1 14  ? -1.116  10.717  -1.370  1.00 0.00 ? 32  GLY A O    6  
ATOM 11231 H H    . GLY A 1 14  ? -0.127  13.043  -4.455  1.00 0.00 ? 32  GLY A H    6  
ATOM 11232 H HA2  . GLY A 1 14  ? 0.231   12.763  -2.141  1.00 0.00 ? 32  GLY A HA2  6  
ATOM 11233 H HA3  . GLY A 1 14  ? -1.320  13.530  -1.831  1.00 0.00 ? 32  GLY A HA3  6  
ATOM 11234 N N    . VAL A 1 15  ? -2.360  11.128  -3.200  1.00 0.00 ? 33  VAL A N    6  
ATOM 11235 C CA   . VAL A 1 15  ? -3.052  9.845   -3.152  1.00 0.00 ? 33  VAL A CA   6  
ATOM 11236 C C    . VAL A 1 15  ? -2.271  8.772   -3.901  1.00 0.00 ? 33  VAL A C    6  
ATOM 11237 O O    . VAL A 1 15  ? -1.806  8.992   -5.020  1.00 0.00 ? 33  VAL A O    6  
ATOM 11238 C CB   . VAL A 1 15  ? -4.467  9.947   -3.751  1.00 0.00 ? 33  VAL A CB   6  
ATOM 11239 C CG1  . VAL A 1 15  ? -5.250  8.668   -3.492  1.00 0.00 ? 33  VAL A CG1  6  
ATOM 11240 C CG2  . VAL A 1 15  ? -5.199  11.154  -3.185  1.00 0.00 ? 33  VAL A CG2  6  
ATOM 11241 H H    . VAL A 1 15  ? -2.577  11.761  -3.915  1.00 0.00 ? 33  VAL A H    6  
ATOM 11242 H HA   . VAL A 1 15  ? -3.142  9.553   -2.115  1.00 0.00 ? 33  VAL A HA   6  
ATOM 11243 H HB   . VAL A 1 15  ? -4.374  10.076  -4.819  1.00 0.00 ? 33  VAL A HB   6  
ATOM 11244 H HG11 . VAL A 1 15  ? -6.079  8.609   -4.182  1.00 0.00 ? 33  VAL A HG11 6  
ATOM 11245 H HG12 . VAL A 1 15  ? -4.603  7.815   -3.631  1.00 0.00 ? 33  VAL A HG12 6  
ATOM 11246 H HG13 . VAL A 1 15  ? -5.625  8.676   -2.479  1.00 0.00 ? 33  VAL A HG13 6  
ATOM 11247 H HG21 . VAL A 1 15  ? -4.784  12.057  -3.608  1.00 0.00 ? 33  VAL A HG21 6  
ATOM 11248 H HG22 . VAL A 1 15  ? -6.248  11.089  -3.433  1.00 0.00 ? 33  VAL A HG22 6  
ATOM 11249 H HG23 . VAL A 1 15  ? -5.084  11.174  -2.111  1.00 0.00 ? 33  VAL A HG23 6  
ATOM 11250 N N    . PHE A 1 16  ? -2.129  7.606   -3.278  1.00 0.00 ? 34  PHE A N    6  
ATOM 11251 C CA   . PHE A 1 16  ? -1.403  6.497   -3.886  1.00 0.00 ? 34  PHE A CA   6  
ATOM 11252 C C    . PHE A 1 16  ? -1.947  5.158   -3.398  1.00 0.00 ? 34  PHE A C    6  
ATOM 11253 O O    . PHE A 1 16  ? -2.610  5.086   -2.361  1.00 0.00 ? 34  PHE A O    6  
ATOM 11254 C CB   . PHE A 1 16  ? 0.090   6.600   -3.567  1.00 0.00 ? 34  PHE A CB   6  
ATOM 11255 C CG   . PHE A 1 16  ? 0.393   6.554   -2.096  1.00 0.00 ? 34  PHE A CG   6  
ATOM 11256 C CD1  . PHE A 1 16  ? 0.179   7.664   -1.295  1.00 0.00 ? 34  PHE A CD1  6  
ATOM 11257 C CD2  . PHE A 1 16  ? 0.893   5.399   -1.515  1.00 0.00 ? 34  PHE A CD2  6  
ATOM 11258 C CE1  . PHE A 1 16  ? 0.456   7.625   0.058   1.00 0.00 ? 34  PHE A CE1  6  
ATOM 11259 C CE2  . PHE A 1 16  ? 1.172   5.354   -0.162  1.00 0.00 ? 34  PHE A CE2  6  
ATOM 11260 C CZ   . PHE A 1 16  ? 0.954   6.467   0.625   1.00 0.00 ? 34  PHE A CZ   6  
ATOM 11261 H H    . PHE A 1 16  ? -2.521  7.491   -2.387  1.00 0.00 ? 34  PHE A H    6  
ATOM 11262 H HA   . PHE A 1 16  ? -1.538  6.559   -4.955  1.00 0.00 ? 34  PHE A HA   6  
ATOM 11263 H HB3  . PHE A 1 16  ? 0.470   7.533   -3.955  1.00 0.00 ? 34  PHE A HB3  6  
ATOM 11264 H HD1  . PHE A 1 16  ? -0.211  8.570   -1.738  1.00 0.00 ? 34  PHE A HD1  6  
ATOM 11265 H HD2  . PHE A 1 16  ? 1.065   4.528   -2.129  1.00 0.00 ? 34  PHE A HD2  6  
ATOM 11266 H HE1  . PHE A 1 16  ? 0.285   8.497   0.670   1.00 0.00 ? 34  PHE A HE1  6  
ATOM 11267 H HE2  . PHE A 1 16  ? 1.562   4.448   0.279   1.00 0.00 ? 34  PHE A HE2  6  
ATOM 11268 H HZ   . PHE A 1 16  ? 1.172   6.434   1.683   1.00 0.00 ? 34  PHE A HZ   6  
ATOM 11269 N N    . HIS A 1 17  ? -1.662  4.100   -4.151  1.00 0.00 ? 35  HIS A N    6  
ATOM 11270 C CA   . HIS A 1 17  ? -2.124  2.762   -3.795  1.00 0.00 ? 35  HIS A CA   6  
ATOM 11271 C C    . HIS A 1 17  ? -0.958  1.890   -3.338  1.00 0.00 ? 35  HIS A C    6  
ATOM 11272 O O    . HIS A 1 17  ? 0.117   1.909   -3.937  1.00 0.00 ? 35  HIS A O    6  
ATOM 11273 C CB   . HIS A 1 17  ? -2.828  2.110   -4.984  1.00 0.00 ? 35  HIS A CB   6  
ATOM 11274 C CG   . HIS A 1 17  ? -1.886  1.520   -5.988  1.00 0.00 ? 35  HIS A CG   6  
ATOM 11275 N ND1  . HIS A 1 17  ? -1.518  2.172   -7.148  1.00 0.00 ? 35  HIS A ND1  6  
ATOM 11276 C CD2  . HIS A 1 17  ? -1.234  0.334   -6.002  1.00 0.00 ? 35  HIS A CD2  6  
ATOM 11277 C CE1  . HIS A 1 17  ? -0.682  1.410   -7.831  1.00 0.00 ? 35  HIS A CE1  6  
ATOM 11278 N NE2  . HIS A 1 17  ? -0.493  0.290   -7.158  1.00 0.00 ? 35  HIS A NE2  6  
ATOM 11279 H H    . HIS A 1 17  ? -1.130  4.222   -4.964  1.00 0.00 ? 35  HIS A H    6  
ATOM 11280 H HA   . HIS A 1 17  ? -2.826  2.860   -2.980  1.00 0.00 ? 35  HIS A HA   6  
ATOM 11281 H HB3  . HIS A 1 17  ? -3.431  2.851   -5.490  1.00 0.00 ? 35  HIS A HB3  6  
ATOM 11282 H HD1  . HIS A 1 17  ? -1.824  3.058   -7.429  1.00 0.00 ? 35  HIS A HD1  6  
ATOM 11283 H HD2  . HIS A 1 17  ? -1.288  -0.436  -5.245  1.00 0.00 ? 35  HIS A HD2  6  
ATOM 11284 H HE1  . HIS A 1 17  ? -0.229  1.661   -8.779  1.00 0.00 ? 35  HIS A HE1  6  
ATOM 11285 N N    . VAL A 1 18  ? -1.180  1.128   -2.271  1.00 0.00 ? 36  VAL A N    6  
ATOM 11286 C CA   . VAL A 1 18  ? -0.148  0.249   -1.734  1.00 0.00 ? 36  VAL A CA   6  
ATOM 11287 C C    . VAL A 1 18  ? -0.200  -1.126  -2.391  1.00 0.00 ? 36  VAL A C    6  
ATOM 11288 O O    . VAL A 1 18  ? -1.252  -1.762  -2.437  1.00 0.00 ? 36  VAL A O    6  
ATOM 11289 C CB   . VAL A 1 18  ? -0.291  0.082   -0.208  1.00 0.00 ? 36  VAL A CB   6  
ATOM 11290 C CG1  . VAL A 1 18  ? 0.835   -0.777  0.343   1.00 0.00 ? 36  VAL A CG1  6  
ATOM 11291 C CG2  . VAL A 1 18  ? -0.320  1.441   0.475   1.00 0.00 ? 36  VAL A CG2  6  
ATOM 11292 H H    . VAL A 1 18  ? -2.056  1.157   -1.836  1.00 0.00 ? 36  VAL A H    6  
ATOM 11293 H HA   . VAL A 1 18  ? 0.813   0.698   -1.936  1.00 0.00 ? 36  VAL A HA   6  
ATOM 11294 H HB   . VAL A 1 18  ? -1.227  -0.417  -0.009  1.00 0.00 ? 36  VAL A HB   6  
ATOM 11295 H HG11 . VAL A 1 18  ? 0.633   -1.817  0.127   1.00 0.00 ? 36  VAL A HG11 6  
ATOM 11296 H HG12 . VAL A 1 18  ? 1.769   -0.488  -0.117  1.00 0.00 ? 36  VAL A HG12 6  
ATOM 11297 H HG13 . VAL A 1 18  ? 0.902   -0.640  1.412   1.00 0.00 ? 36  VAL A HG13 6  
ATOM 11298 H HG21 . VAL A 1 18  ? 0.276   2.141   -0.092  1.00 0.00 ? 36  VAL A HG21 6  
ATOM 11299 H HG22 . VAL A 1 18  ? -1.338  1.796   0.529   1.00 0.00 ? 36  VAL A HG22 6  
ATOM 11300 H HG23 . VAL A 1 18  ? 0.084   1.350   1.473   1.00 0.00 ? 36  VAL A HG23 6  
ATOM 11301 N N    . GLU A 1 19  ? 0.943   -1.578  -2.898  1.00 0.00 ? 37  GLU A N    6  
ATOM 11302 C CA   . GLU A 1 19  ? 1.027   -2.878  -3.553  1.00 0.00 ? 37  GLU A CA   6  
ATOM 11303 C C    . GLU A 1 19  ? 2.001   -3.794  -2.819  1.00 0.00 ? 37  GLU A C    6  
ATOM 11304 O O    . GLU A 1 19  ? 3.217   -3.628  -2.910  1.00 0.00 ? 37  GLU A O    6  
ATOM 11305 C CB   . GLU A 1 19  ? 1.465   -2.711  -5.009  1.00 0.00 ? 37  GLU A CB   6  
ATOM 11306 C CG   . GLU A 1 19  ? 1.295   -3.969  -5.844  1.00 0.00 ? 37  GLU A CG   6  
ATOM 11307 C CD   . GLU A 1 19  ? 2.607   -4.688  -6.091  1.00 0.00 ? 37  GLU A CD   6  
ATOM 11308 O OE1  . GLU A 1 19  ? 3.633   -4.002  -6.279  1.00 0.00 ? 37  GLU A OE1  6  
ATOM 11309 O OE2  . GLU A 1 19  ? 2.608   -5.937  -6.096  1.00 0.00 ? 37  GLU A OE2  6  
ATOM 11310 H H    . GLU A 1 19  ? 1.749   -1.023  -2.830  1.00 0.00 ? 37  GLU A H    6  
ATOM 11311 H HA   . GLU A 1 19  ? 0.045   -3.323  -3.531  1.00 0.00 ? 37  GLU A HA   6  
ATOM 11312 H HB3  . GLU A 1 19  ? 2.508   -2.431  -5.030  1.00 0.00 ? 37  GLU A HB3  6  
ATOM 11313 H HG3  . GLU A 1 19  ? 0.865   -3.700  -6.796  1.00 0.00 ? 37  GLU A HG3  6  
ATOM 11314 N N    . LYS A 1 20  ? 1.457   -4.764  -2.091  1.00 0.00 ? 38  LYS A N    6  
ATOM 11315 C CA   . LYS A 1 20  ? 2.273   -5.710  -1.341  1.00 0.00 ? 38  LYS A CA   6  
ATOM 11316 C C    . LYS A 1 20  ? 2.823   -6.800  -2.256  1.00 0.00 ? 38  LYS A C    6  
ATOM 11317 O O    . LYS A 1 20  ? 2.615   -6.768  -3.469  1.00 0.00 ? 38  LYS A O    6  
ATOM 11318 C CB   . LYS A 1 20  ? 1.456   -6.340  -0.211  1.00 0.00 ? 38  LYS A CB   6  
ATOM 11319 C CG   . LYS A 1 20  ? 2.251   -6.568  1.061   1.00 0.00 ? 38  LYS A CG   6  
ATOM 11320 C CD   . LYS A 1 20  ? 1.390   -6.377  2.299   1.00 0.00 ? 38  LYS A CD   6  
ATOM 11321 C CE   . LYS A 1 20  ? 1.231   -7.676  3.074   1.00 0.00 ? 38  LYS A CE   6  
ATOM 11322 N NZ   . LYS A 1 20  ? -0.176  -7.892  3.513   1.00 0.00 ? 38  LYS A NZ   6  
ATOM 11323 H H    . LYS A 1 20  ? 0.480   -4.845  -2.058  1.00 0.00 ? 38  LYS A H    6  
ATOM 11324 H HA   . LYS A 1 20  ? 3.102   -5.166  -0.913  1.00 0.00 ? 38  LYS A HA   6  
ATOM 11325 H HB3  . LYS A 1 20  ? 1.076   -7.294  -0.549  1.00 0.00 ? 38  LYS A HB3  6  
ATOM 11326 H HG3  . LYS A 1 20  ? 3.071   -5.864  1.093   1.00 0.00 ? 38  LYS A HG3  6  
ATOM 11327 H HD3  . LYS A 1 20  ? 0.414   -6.026  1.996   1.00 0.00 ? 38  LYS A HD3  6  
ATOM 11328 H HE3  . LYS A 1 20  ? 1.870   -7.641  3.944   1.00 0.00 ? 38  LYS A HE3  6  
ATOM 11329 H HZ1  . LYS A 1 20  ? -0.191  -8.413  4.413   1.00 0.00 ? 38  LYS A HZ1  6  
ATOM 11330 H HZ2  . LYS A 1 20  ? -0.694  -8.439  2.799   1.00 0.00 ? 38  LYS A HZ2  6  
ATOM 11331 H HZ3  . LYS A 1 20  ? -0.653  -6.976  3.647   1.00 0.00 ? 38  LYS A HZ3  6  
ATOM 11332 N N    . ASN A 1 21  ? 3.522   -7.764  -1.667  1.00 0.00 ? 39  ASN A N    6  
ATOM 11333 C CA   . ASN A 1 21  ? 4.099   -8.865  -2.429  1.00 0.00 ? 39  ASN A CA   6  
ATOM 11334 C C    . ASN A 1 21  ? 3.133   -9.344  -3.510  1.00 0.00 ? 39  ASN A C    6  
ATOM 11335 O O    . ASN A 1 21  ? 3.314   -9.055  -4.691  1.00 0.00 ? 39  ASN A O    6  
ATOM 11336 C CB   . ASN A 1 21  ? 4.456   -10.026 -1.499  1.00 0.00 ? 39  ASN A CB   6  
ATOM 11337 C CG   . ASN A 1 21  ? 5.884   -9.944  -0.996  1.00 0.00 ? 39  ASN A CG   6  
ATOM 11338 O OD1  . ASN A 1 21  ? 6.140   -10.068 0.202   1.00 0.00 ? 39  ASN A OD1  6  
ATOM 11339 N ND2  . ASN A 1 21  ? 6.823   -9.736  -1.911  1.00 0.00 ? 39  ASN A ND2  6  
ATOM 11340 H H    . ASN A 1 21  ? 3.654   -7.735  -0.696  1.00 0.00 ? 39  ASN A H    6  
ATOM 11341 H HA   . ASN A 1 21  ? 4.999   -8.504  -2.903  1.00 0.00 ? 39  ASN A HA   6  
ATOM 11342 H HB3  . ASN A 1 21  ? 4.334   -10.957 -2.031  1.00 0.00 ? 39  ASN A HB3  6  
ATOM 11343 H HD21 . ASN A 1 21  ? 6.546   -9.646  -2.847  1.00 0.00 ? 39  ASN A HD21 6  
ATOM 11344 H HD22 . ASN A 1 21  ? 7.755   -9.679  -1.614  1.00 0.00 ? 39  ASN A HD22 6  
ATOM 11345 N N    . GLY A 1 22  ? 2.105   -10.077 -3.093  1.00 0.00 ? 40  GLY A N    6  
ATOM 11346 C CA   . GLY A 1 22  ? 1.125   -10.584 -4.036  1.00 0.00 ? 40  GLY A CA   6  
ATOM 11347 C C    . GLY A 1 22  ? 0.165   -9.509  -4.508  1.00 0.00 ? 40  GLY A C    6  
ATOM 11348 O O    . GLY A 1 22  ? 0.305   -8.340  -4.150  1.00 0.00 ? 40  GLY A O    6  
ATOM 11349 H H    . GLY A 1 22  ? 2.010   -10.275 -2.138  1.00 0.00 ? 40  GLY A H    6  
ATOM 11350 H HA2  . GLY A 1 22  ? 1.642   -10.991 -4.894  1.00 0.00 ? 40  GLY A HA2  6  
ATOM 11351 H HA3  . GLY A 1 22  ? 0.560   -11.372 -3.562  1.00 0.00 ? 40  GLY A HA3  6  
ATOM 11352 N N    . ARG A 1 23  ? -0.814  -9.906  -5.316  1.00 0.00 ? 41  ARG A N    6  
ATOM 11353 C CA   . ARG A 1 23  ? -1.799  -8.967  -5.839  1.00 0.00 ? 41  ARG A CA   6  
ATOM 11354 C C    . ARG A 1 23  ? -2.548  -8.276  -4.704  1.00 0.00 ? 41  ARG A C    6  
ATOM 11355 O O    . ARG A 1 23  ? -2.244  -8.484  -3.529  1.00 0.00 ? 41  ARG A O    6  
ATOM 11356 C CB   . ARG A 1 23  ? -2.791  -9.692  -6.752  1.00 0.00 ? 41  ARG A CB   6  
ATOM 11357 C CG   . ARG A 1 23  ? -2.217  -10.049 -8.113  1.00 0.00 ? 41  ARG A CG   6  
ATOM 11358 C CD   . ARG A 1 23  ? -1.649  -11.459 -8.126  1.00 0.00 ? 41  ARG A CD   6  
ATOM 11359 N NE   . ARG A 1 23  ? -2.662  -12.461 -7.802  1.00 0.00 ? 41  ARG A NE   6  
ATOM 11360 C CZ   . ARG A 1 23  ? -2.472  -13.768 -7.937  1.00 0.00 ? 41  ARG A CZ   6  
ATOM 11361 N NH1  . ARG A 1 23  ? -1.314  -14.231 -8.385  1.00 0.00 ? 41  ARG A NH1  6  
ATOM 11362 N NH2  . ARG A 1 23  ? -3.442  -14.617 -7.622  1.00 0.00 ? 41  ARG A NH2  6  
ATOM 11363 H H    . ARG A 1 23  ? -0.873  -10.851 -5.567  1.00 0.00 ? 41  ARG A H    6  
ATOM 11364 H HA   . ARG A 1 23  ? -1.273  -8.221  -6.415  1.00 0.00 ? 41  ARG A HA   6  
ATOM 11365 H HB3  . ARG A 1 23  ? -3.652  -9.059  -6.903  1.00 0.00 ? 41  ARG A HB3  6  
ATOM 11366 H HG3  . ARG A 1 23  ? -1.430  -9.350  -8.355  1.00 0.00 ? 41  ARG A HG3  6  
ATOM 11367 H HD3  . ARG A 1 23  ? -0.853  -11.519 -7.400  1.00 0.00 ? 41  ARG A HD3  6  
ATOM 11368 H HE   . ARG A 1 23  ? -3.525  -12.140 -7.469  1.00 0.00 ? 41  ARG A HE   6  
ATOM 11369 H HH11 . ARG A 1 23  ? -0.580  -13.594 -8.623  1.00 0.00 ? 41  ARG A HH11 6  
ATOM 11370 H HH12 . ARG A 1 23  ? -1.172  -15.216 -8.484  1.00 0.00 ? 41  ARG A HH12 6  
ATOM 11371 H HH21 . ARG A 1 23  ? -4.317  -14.273 -7.282  1.00 0.00 ? 41  ARG A HH21 6  
ATOM 11372 H HH22 . ARG A 1 23  ? -3.298  -15.600 -7.722  1.00 0.00 ? 41  ARG A HH22 6  
ATOM 11373 N N    . TYR A 1 24  ? -3.527  -7.453  -5.063  1.00 0.00 ? 42  TYR A N    6  
ATOM 11374 C CA   . TYR A 1 24  ? -4.317  -6.727  -4.076  1.00 0.00 ? 42  TYR A CA   6  
ATOM 11375 C C    . TYR A 1 24  ? -4.856  -7.675  -3.008  1.00 0.00 ? 42  TYR A C    6  
ATOM 11376 O O    . TYR A 1 24  ? -5.594  -8.612  -3.308  1.00 0.00 ? 42  TYR A O    6  
ATOM 11377 C CB   . TYR A 1 24  ? -5.476  -5.997  -4.756  1.00 0.00 ? 42  TYR A CB   6  
ATOM 11378 C CG   . TYR A 1 24  ? -5.052  -5.162  -5.943  1.00 0.00 ? 42  TYR A CG   6  
ATOM 11379 C CD1  . TYR A 1 24  ? -3.895  -4.395  -5.900  1.00 0.00 ? 42  TYR A CD1  6  
ATOM 11380 C CD2  . TYR A 1 24  ? -5.810  -5.141  -7.107  1.00 0.00 ? 42  TYR A CD2  6  
ATOM 11381 C CE1  . TYR A 1 24  ? -3.504  -3.630  -6.981  1.00 0.00 ? 42  TYR A CE1  6  
ATOM 11382 C CE2  . TYR A 1 24  ? -5.425  -4.380  -8.195  1.00 0.00 ? 42  TYR A CE2  6  
ATOM 11383 C CZ   . TYR A 1 24  ? -4.273  -3.625  -8.127  1.00 0.00 ? 42  TYR A CZ   6  
ATOM 11384 O OH   . TYR A 1 24  ? -3.887  -2.867  -9.207  1.00 0.00 ? 42  TYR A OH   6  
ATOM 11385 H H    . TYR A 1 24  ? -3.721  -7.327  -6.015  1.00 0.00 ? 42  TYR A H    6  
ATOM 11386 H HA   . TYR A 1 24  ? -3.673  -6.000  -3.604  1.00 0.00 ? 42  TYR A HA   6  
ATOM 11387 H HB3  . TYR A 1 24  ? -5.949  -5.340  -4.039  1.00 0.00 ? 42  TYR A HB3  6  
ATOM 11388 H HD1  . TYR A 1 24  ? -3.294  -4.401  -5.001  1.00 0.00 ? 42  TYR A HD1  6  
ATOM 11389 H HD2  . TYR A 1 24  ? -6.712  -5.733  -7.157  1.00 0.00 ? 42  TYR A HD2  6  
ATOM 11390 H HE1  . TYR A 1 24  ? -2.602  -3.040  -6.929  1.00 0.00 ? 42  TYR A HE1  6  
ATOM 11391 H HE2  . TYR A 1 24  ? -6.028  -4.376  -9.092  1.00 0.00 ? 42  TYR A HE2  6  
ATOM 11392 H HH   . TYR A 1 24  ? -3.130  -3.278  -9.633  1.00 0.00 ? 42  TYR A HH   6  
ATOM 11393 N N    . SER A 1 25  ? -4.480  -7.422  -1.758  1.00 0.00 ? 43  SER A N    6  
ATOM 11394 C CA   . SER A 1 25  ? -4.921  -8.253  -0.643  1.00 0.00 ? 43  SER A CA   6  
ATOM 11395 C C    . SER A 1 25  ? -4.811  -7.494  0.677   1.00 0.00 ? 43  SER A C    6  
ATOM 11396 O O    . SER A 1 25  ? -4.189  -7.968  1.626   1.00 0.00 ? 43  SER A O    6  
ATOM 11397 C CB   . SER A 1 25  ? -4.092  -9.536  -0.577  1.00 0.00 ? 43  SER A CB   6  
ATOM 11398 O OG   . SER A 1 25  ? -4.828  -10.589 0.021   1.00 0.00 ? 43  SER A OG   6  
ATOM 11399 H H    . SER A 1 25  ? -3.889  -6.660  -1.582  1.00 0.00 ? 43  SER A H    6  
ATOM 11400 H HA   . SER A 1 25  ? -5.957  -8.510  -0.812  1.00 0.00 ? 43  SER A HA   6  
ATOM 11401 H HB3  . SER A 1 25  ? -3.202  -9.357  0.009   1.00 0.00 ? 43  SER A HB3  6  
ATOM 11402 H HG   . SER A 1 25  ? -5.548  -10.847 -0.559  1.00 0.00 ? 43  SER A HG   6  
ATOM 11403 N N    . ILE A 1 26  ? -5.421  -6.314  0.725   1.00 0.00 ? 44  ILE A N    6  
ATOM 11404 C CA   . ILE A 1 26  ? -5.393  -5.492  1.928   1.00 0.00 ? 44  ILE A CA   6  
ATOM 11405 C C    . ILE A 1 26  ? -6.802  -5.255  2.466   1.00 0.00 ? 44  ILE A C    6  
ATOM 11406 O O    . ILE A 1 26  ? -7.754  -5.114  1.699   1.00 0.00 ? 44  ILE A O    6  
ATOM 11407 C CB   . ILE A 1 26  ? -4.724  -4.130  1.663   1.00 0.00 ? 44  ILE A CB   6  
ATOM 11408 C CG1  . ILE A 1 26  ? -3.291  -4.331  1.163   1.00 0.00 ? 44  ILE A CG1  6  
ATOM 11409 C CG2  . ILE A 1 26  ? -4.735  -3.279  2.924   1.00 0.00 ? 44  ILE A CG2  6  
ATOM 11410 C CD1  . ILE A 1 26  ? -2.963  -3.519  -0.071  1.00 0.00 ? 44  ILE A CD1  6  
ATOM 11411 H H    . ILE A 1 26  ? -5.901  -5.990  -0.064  1.00 0.00 ? 44  ILE A H    6  
ATOM 11412 H HA   . ILE A 1 26  ? -4.817  -6.014  2.676   1.00 0.00 ? 44  ILE A HA   6  
ATOM 11413 H HB   . ILE A 1 26  ? -5.293  -3.615  0.904   1.00 0.00 ? 44  ILE A HB   6  
ATOM 11414 H HG13 . ILE A 1 26  ? -3.144  -5.374  0.925   1.00 0.00 ? 44  ILE A HG13 6  
ATOM 11415 H HG21 . ILE A 1 26  ? -5.580  -2.605  2.895   1.00 0.00 ? 44  ILE A HG21 6  
ATOM 11416 H HG22 . ILE A 1 26  ? -4.818  -3.919  3.789   1.00 0.00 ? 44  ILE A HG22 6  
ATOM 11417 H HG23 . ILE A 1 26  ? -3.821  -2.708  2.983   1.00 0.00 ? 44  ILE A HG23 6  
ATOM 11418 H HD11 . ILE A 1 26  ? -2.289  -2.718  0.195   1.00 0.00 ? 44  ILE A HD11 6  
ATOM 11419 H HD12 . ILE A 1 26  ? -2.494  -4.156  -0.806  1.00 0.00 ? 44  ILE A HD12 6  
ATOM 11420 H HD13 . ILE A 1 26  ? -3.871  -3.104  -0.480  1.00 0.00 ? 44  ILE A HD13 6  
ATOM 11421 N N    . SER A 1 27  ? -6.925  -5.214  3.787   1.00 0.00 ? 45  SER A N    6  
ATOM 11422 C CA   . SER A 1 27  ? -8.216  -4.997  4.430   1.00 0.00 ? 45  SER A CA   6  
ATOM 11423 C C    . SER A 1 27  ? -8.311  -3.584  4.998   1.00 0.00 ? 45  SER A C    6  
ATOM 11424 O O    . SER A 1 27  ? -7.295  -2.943  5.264   1.00 0.00 ? 45  SER A O    6  
ATOM 11425 C CB   . SER A 1 27  ? -8.435  -6.024  5.543   1.00 0.00 ? 45  SER A CB   6  
ATOM 11426 O OG   . SER A 1 27  ? -9.808  -6.125  5.881   1.00 0.00 ? 45  SER A OG   6  
ATOM 11427 H H    . SER A 1 27  ? -6.127  -5.334  4.346   1.00 0.00 ? 45  SER A H    6  
ATOM 11428 H HA   . SER A 1 27  ? -8.983  -5.124  3.680   1.00 0.00 ? 45  SER A HA   6  
ATOM 11429 H HB3  . SER A 1 27  ? -7.881  -5.720  6.420   1.00 0.00 ? 45  SER A HB3  6  
ATOM 11430 H HG   . SER A 1 27  ? -10.002 -7.020  6.165   1.00 0.00 ? 45  SER A HG   6  
ATOM 11431 N N    . ARG A 1 28  ? -9.538  -3.109  5.181   1.00 0.00 ? 46  ARG A N    6  
ATOM 11432 C CA   . ARG A 1 28  ? -9.766  -1.771  5.717   1.00 0.00 ? 46  ARG A CA   6  
ATOM 11433 C C    . ARG A 1 28  ? -9.021  -1.579  7.034   1.00 0.00 ? 46  ARG A C    6  
ATOM 11434 O O    . ARG A 1 28  ? -8.406  -0.538  7.266   1.00 0.00 ? 46  ARG A O    6  
ATOM 11435 C CB   . ARG A 1 28  ? -11.263 -1.532  5.926   1.00 0.00 ? 46  ARG A CB   6  
ATOM 11436 C CG   . ARG A 1 28  ? -11.945 -2.615  6.746   1.00 0.00 ? 46  ARG A CG   6  
ATOM 11437 C CD   . ARG A 1 28  ? -13.458 -2.458  6.726   1.00 0.00 ? 46  ARG A CD   6  
ATOM 11438 N NE   . ARG A 1 28  ? -13.874 -1.114  7.118   1.00 0.00 ? 46  ARG A NE   6  
ATOM 11439 C CZ   . ARG A 1 28  ? -13.900 -0.692  8.376   1.00 0.00 ? 46  ARG A CZ   6  
ATOM 11440 N NH1  . ARG A 1 28  ? -13.532 -1.502  9.360   1.00 0.00 ? 46  ARG A NH1  6  
ATOM 11441 N NH2  . ARG A 1 28  ? -14.291 0.546   8.655   1.00 0.00 ? 46  ARG A NH2  6  
ATOM 11442 H H    . ARG A 1 28  ? -10.308 -3.669  4.949   1.00 0.00 ? 46  ARG A H    6  
ATOM 11443 H HA   . ARG A 1 28  ? -9.392  -1.058  4.999   1.00 0.00 ? 46  ARG A HA   6  
ATOM 11444 H HB3  . ARG A 1 28  ? -11.745 -1.484  4.960   1.00 0.00 ? 46  ARG A HB3  6  
ATOM 11445 H HG3  . ARG A 1 28  ? -11.598 -2.550  7.766   1.00 0.00 ? 46  ARG A HG3  6  
ATOM 11446 H HD3  . ARG A 1 28  ? -13.889 -3.173  7.411   1.00 0.00 ? 46  ARG A HD3  6  
ATOM 11447 H HE   . ARG A 1 28  ? -14.149 -0.499  6.408   1.00 0.00 ? 46  ARG A HE   6  
ATOM 11448 H HH11 . ARG A 1 28  ? -13.236 -2.434  9.154   1.00 0.00 ? 46  ARG A HH11 6  
ATOM 11449 H HH12 . ARG A 1 28  ? -13.552 -1.180  10.307  1.00 0.00 ? 46  ARG A HH12 6  
ATOM 11450 H HH21 . ARG A 1 28  ? -14.568 1.160   7.917   1.00 0.00 ? 46  ARG A HH21 6  
ATOM 11451 H HH22 . ARG A 1 28  ? -14.310 0.864   9.602   1.00 0.00 ? 46  ARG A HH22 6  
ATOM 11452 N N    . THR A 1 29  ? -9.081  -2.590  7.895   1.00 0.00 ? 47  THR A N    6  
ATOM 11453 C CA   . THR A 1 29  ? -8.414  -2.532  9.190   1.00 0.00 ? 47  THR A CA   6  
ATOM 11454 C C    . THR A 1 29  ? -6.906  -2.377  9.025   1.00 0.00 ? 47  THR A C    6  
ATOM 11455 O O    . THR A 1 29  ? -6.231  -1.832  9.898   1.00 0.00 ? 47  THR A O    6  
ATOM 11456 C CB   . THR A 1 29  ? -8.700  -3.794  10.027  1.00 0.00 ? 47  THR A CB   6  
ATOM 11457 O OG1  . THR A 1 29  ? -8.479  -4.967  9.234   1.00 0.00 ? 47  THR A OG1  6  
ATOM 11458 C CG2  . THR A 1 29  ? -10.129 -3.787  10.545  1.00 0.00 ? 47  THR A CG2  6  
ATOM 11459 H H    . THR A 1 29  ? -9.588  -3.394  7.654   1.00 0.00 ? 47  THR A H    6  
ATOM 11460 H HA   . THR A 1 29  ? -8.798  -1.677  9.725   1.00 0.00 ? 47  THR A HA   6  
ATOM 11461 H HB   . THR A 1 29  ? -8.025  -3.809  10.870  1.00 0.00 ? 47  THR A HB   6  
ATOM 11462 H HG1  . THR A 1 29  ? -7.902  -5.570  9.709   1.00 0.00 ? 47  THR A HG1  6  
ATOM 11463 H HG21 . THR A 1 29  ? -10.804 -4.054  9.745   1.00 0.00 ? 47  THR A HG21 6  
ATOM 11464 H HG22 . THR A 1 29  ? -10.375 -2.802  10.911  1.00 0.00 ? 47  THR A HG22 6  
ATOM 11465 H HG23 . THR A 1 29  ? -10.225 -4.504  11.347  1.00 0.00 ? 47  THR A HG23 6  
ATOM 11466 N N    . GLU A 1 30  ? -6.387  -2.858  7.901   1.00 0.00 ? 48  GLU A N    6  
ATOM 11467 C CA   . GLU A 1 30  ? -4.956  -2.770  7.623   1.00 0.00 ? 48  GLU A CA   6  
ATOM 11468 C C    . GLU A 1 30  ? -4.627  -1.486  6.867   1.00 0.00 ? 48  GLU A C    6  
ATOM 11469 O O    . GLU A 1 30  ? -3.497  -1.001  6.909   1.00 0.00 ? 48  GLU A O    6  
ATOM 11470 C CB   . GLU A 1 30  ? -4.498  -3.985  6.814   1.00 0.00 ? 48  GLU A CB   6  
ATOM 11471 C CG   . GLU A 1 30  ? -2.992  -4.193  6.831   1.00 0.00 ? 48  GLU A CG   6  
ATOM 11472 C CD   . GLU A 1 30  ? -2.597  -5.624  6.517   1.00 0.00 ? 48  GLU A CD   6  
ATOM 11473 O OE1  . GLU A 1 30  ? -3.143  -6.190  5.547   1.00 0.00 ? 48  GLU A OE1  6  
ATOM 11474 O OE2  . GLU A 1 30  ? -1.743  -6.176  7.241   1.00 0.00 ? 48  GLU A OE2  6  
ATOM 11475 H H    . GLU A 1 30  ? -6.977  -3.281  7.243   1.00 0.00 ? 48  GLU A H    6  
ATOM 11476 H HA   . GLU A 1 30  ? -4.436  -2.761  8.567   1.00 0.00 ? 48  GLU A HA   6  
ATOM 11477 H HB3  . GLU A 1 30  ? -4.810  -3.858  5.788   1.00 0.00 ? 48  GLU A HB3  6  
ATOM 11478 H HG3  . GLU A 1 30  ? -2.618  -3.940  7.811   1.00 0.00 ? 48  GLU A HG3  6  
ATOM 11479 N N    . ALA A 1 31  ? -5.622  -0.943  6.174   1.00 0.00 ? 49  ALA A N    6  
ATOM 11480 C CA   . ALA A 1 31  ? -5.440  0.285   5.409   1.00 0.00 ? 49  ALA A CA   6  
ATOM 11481 C C    . ALA A 1 31  ? -4.820  1.381   6.269   1.00 0.00 ? 49  ALA A C    6  
ATOM 11482 O O    . ALA A 1 31  ? -3.799  1.964   5.908   1.00 0.00 ? 49  ALA A O    6  
ATOM 11483 C CB   . ALA A 1 31  ? -6.768  0.751   4.832   1.00 0.00 ? 49  ALA A CB   6  
ATOM 11484 H H    . ALA A 1 31  ? -6.500  -1.377  6.178   1.00 0.00 ? 49  ALA A H    6  
ATOM 11485 H HA   . ALA A 1 31  ? -4.773  0.069   4.585   1.00 0.00 ? 49  ALA A HA   6  
ATOM 11486 H HB1  . ALA A 1 31  ? -7.452  0.969   5.638   1.00 0.00 ? 49  ALA A HB1  6  
ATOM 11487 H HB2  . ALA A 1 31  ? -6.611  1.640   4.241   1.00 0.00 ? 49  ALA A HB2  6  
ATOM 11488 H HB3  . ALA A 1 31  ? -7.182  -0.028  4.209   1.00 0.00 ? 49  ALA A HB3  6  
ATOM 11489 N N    . ALA A 1 32  ? -5.447  1.656   7.409   1.00 0.00 ? 50  ALA A N    6  
ATOM 11490 C CA   . ALA A 1 32  ? -4.956  2.681   8.321   1.00 0.00 ? 50  ALA A CA   6  
ATOM 11491 C C    . ALA A 1 32  ? -3.478  2.479   8.632   1.00 0.00 ? 50  ALA A C    6  
ATOM 11492 O O    . ALA A 1 32  ? -2.658  3.367   8.405   1.00 0.00 ? 50  ALA A O    6  
ATOM 11493 C CB   . ALA A 1 32  ? -5.773  2.679   9.605   1.00 0.00 ? 50  ALA A CB   6  
ATOM 11494 H H    . ALA A 1 32  ? -6.257  1.157   7.642   1.00 0.00 ? 50  ALA A H    6  
ATOM 11495 H HA   . ALA A 1 32  ? -5.085  3.642   7.843   1.00 0.00 ? 50  ALA A HA   6  
ATOM 11496 H HB1  . ALA A 1 32  ? -5.469  3.510   10.225  1.00 0.00 ? 50  ALA A HB1  6  
ATOM 11497 H HB2  . ALA A 1 32  ? -6.821  2.772   9.365   1.00 0.00 ? 50  ALA A HB2  6  
ATOM 11498 H HB3  . ALA A 1 32  ? -5.605  1.754   10.136  1.00 0.00 ? 50  ALA A HB3  6  
ATOM 11499 N N    . ASP A 1 33  ? -3.144  1.303   9.154   1.00 0.00 ? 51  ASP A N    6  
ATOM 11500 C CA   . ASP A 1 33  ? -1.763  0.983   9.496   1.00 0.00 ? 51  ASP A CA   6  
ATOM 11501 C C    . ASP A 1 33  ? -0.836  1.246   8.314   1.00 0.00 ? 51  ASP A C    6  
ATOM 11502 O O    . ASP A 1 33  ? 0.209   1.884   8.461   1.00 0.00 ? 51  ASP A O    6  
ATOM 11503 C CB   . ASP A 1 33  ? -1.650  -0.478  9.934   1.00 0.00 ? 51  ASP A CB   6  
ATOM 11504 C CG   . ASP A 1 33  ? -0.330  -0.777  10.618  1.00 0.00 ? 51  ASP A CG   6  
ATOM 11505 O OD1  . ASP A 1 33  ? 0.345   0.183   11.051  1.00 0.00 ? 51  ASP A OD1  6  
ATOM 11506 O OD2  . ASP A 1 33  ? 0.031   -1.968  10.721  1.00 0.00 ? 51  ASP A OD2  6  
ATOM 11507 H H    . ASP A 1 33  ? -3.843  0.634   9.312   1.00 0.00 ? 51  ASP A H    6  
ATOM 11508 H HA   . ASP A 1 33  ? -1.468  1.619   10.317  1.00 0.00 ? 51  ASP A HA   6  
ATOM 11509 H HB3  . ASP A 1 33  ? -1.735  -1.116  9.067   1.00 0.00 ? 51  ASP A HB3  6  
ATOM 11510 N N    . LEU A 1 34  ? -1.221  0.750   7.144   1.00 0.00 ? 52  LEU A N    6  
ATOM 11511 C CA   . LEU A 1 34  ? -0.424  0.930   5.936   1.00 0.00 ? 52  LEU A CA   6  
ATOM 11512 C C    . LEU A 1 34  ? -0.095  2.404   5.715   1.00 0.00 ? 52  LEU A C    6  
ATOM 11513 O O    . LEU A 1 34  ? 1.062   2.768   5.500   1.00 0.00 ? 52  LEU A O    6  
ATOM 11514 C CB   . LEU A 1 34  ? -1.169  0.375   4.721   1.00 0.00 ? 52  LEU A CB   6  
ATOM 11515 C CG   . LEU A 1 34  ? -0.413  -0.657  3.884   1.00 0.00 ? 52  LEU A CG   6  
ATOM 11516 C CD1  . LEU A 1 34  ? 0.025   -1.829  4.750   1.00 0.00 ? 52  LEU A CD1  6  
ATOM 11517 C CD2  . LEU A 1 34  ? -1.276  -1.141  2.727   1.00 0.00 ? 52  LEU A CD2  6  
ATOM 11518 H H    . LEU A 1 34  ? -2.062  0.251   7.090   1.00 0.00 ? 52  LEU A H    6  
ATOM 11519 H HA   . LEU A 1 34  ? 0.499   0.384   6.063   1.00 0.00 ? 52  LEU A HA   6  
ATOM 11520 H HB3  . LEU A 1 34  ? -1.416  1.207   4.077   1.00 0.00 ? 52  LEU A HB3  6  
ATOM 11521 H HG   . LEU A 1 34  ? 0.474   -0.198  3.472   1.00 0.00 ? 52  LEU A HG   6  
ATOM 11522 H HD11 . LEU A 1 34  ? 0.965   -1.594  5.224   1.00 0.00 ? 52  LEU A HD11 6  
ATOM 11523 H HD12 . LEU A 1 34  ? 0.143   -2.708  4.133   1.00 0.00 ? 52