data_2I91
# 
_entry.id   2I91 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I91         
NDB   PR0232       
RCSB  RCSB039289   
WWPDB D_1000039289 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2I91 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reinisch, K.M.' 1 
'Stein, A.J.'    2 
# 
_citation.id                        primary 
_citation.title                     'Structural and biochemical basis for misfolded RNA recognition by the Ro autoantigen.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            13 
_citation.page_first                1002 
_citation.page_last                 1009 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17041599 
_citation.pdbx_database_id_DOI      10.1038/nsmb1156 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fuchs, G.'      1 
primary 'Stein, A.J.'    2 
primary 'Fu, C.'         3 
primary 'Reinisch, K.M.' 4 
primary 'Wolin, S.L.'    5 
# 
_cell.entry_id           2I91 
_cell.length_a           72.680 
_cell.length_b           119.980 
_cell.length_c           73.540 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.91 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2I91 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(*GP*CP*CP*UP*AP*CP*CP*C)-3'"                     2461.529  2   ? ? ? ? 
2 polymer     syn "5'-R(*C*GP*GP*UP*AP*GP*GP*CP*UP*UP*UP*UP*CP*AP*A)-3'" 4769.857  2   ? ? ? ? 
3 polymer     man '60 kDa SS-A/Ro ribonucleoprotein'                     60772.383 2   ? ? ? ? 
4 non-polymer syn 'ACETATE ION'                                          59.044    2   ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                        24.305    2   ? ? ? ? 
6 water       nat water                                                  18.015    561 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        '60 kDa Ro protein, 60 kDa ribonucleoprotein Ro, RoRNP, TROVE domain family member 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GCCUACCC GCCUACCC C,E ? 
2 polyribonucleotide no no CGGUAGGCUUUUCAA CGGUAGGCUUUUCAA D,F ? 
3 'polypeptide(L)'   no no 
;MEATMDQTQPLNEKQVPNSEGCYVWQVSDMNRLRRFLCFGSEGGTYYIEEKKLGQENAEALLRLIEDGKGCEVVQEIKTF
SQEGRAAKQEPTLFALAVCSQCSDIKTKQAAFRAVPEVCRIPTHLFTFIQFKKDLKEGMKCGMWGRALRKAVSDWYNTKD
ALNLAMAVTKYKQRNGWSHKDLLRLSHIKPANEGLTMVAKYVSKGWKEVQEAYKEKELSPETEKVLKYLEATERVKRTKD
ELEIIHLIDEYRLVREHLLTIHLKSKEIWKSLLQDMPLTALLRNLGKMTADSVLAPASSEVSSVCERLTNEKLLKKARIH
PFHILVALETYKKGHGNRGKLRWIPDTSIVEALDNAFYKSFKLVEPTGKRFLLAIDVSASMNQRVLGSILNASVVAAAMC
MLVARTEKDSHMVAFSDEMLPCPITVNMLLHEVVEKMSDITMGSTDCALPMLWAQKTNTAADIFIVFTDCETNVEDVHPA
TALKQYREKMGIPAKLIVCAMTSNGFSIADPDDRGMLDICGFDSGALDVIRNFTLDLI
;
;MEATMDQTQPLNEKQVPNSEGCYVWQVSDMNRLRRFLCFGSEGGTYYIEEKKLGQENAEALLRLIEDGKGCEVVQEIKTF
SQEGRAAKQEPTLFALAVCSQCSDIKTKQAAFRAVPEVCRIPTHLFTFIQFKKDLKEGMKCGMWGRALRKAVSDWYNTKD
ALNLAMAVTKYKQRNGWSHKDLLRLSHIKPANEGLTMVAKYVSKGWKEVQEAYKEKELSPETEKVLKYLEATERVKRTKD
ELEIIHLIDEYRLVREHLLTIHLKSKEIWKSLLQDMPLTALLRNLGKMTADSVLAPASSEVSSVCERLTNEKLLKKARIH
PFHILVALETYKKGHGNRGKLRWIPDTSIVEALDNAFYKSFKLVEPTGKRFLLAIDVSASMNQRVLGSILNASVVAAAMC
MLVARTEKDSHMVAFSDEMLPCPITVNMLLHEVVEKMSDITMGSTDCALPMLWAQKTNTAADIFIVFTDCETNVEDVHPA
TALKQYREKMGIPAKLIVCAMTSNGFSIADPDDRGMLDICGFDSGALDVIRNFTLDLI
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   C   n 
1 3   C   n 
1 4   U   n 
1 5   A   n 
1 6   C   n 
1 7   C   n 
1 8   C   n 
2 1   C   n 
2 2   G   n 
2 3   G   n 
2 4   U   n 
2 5   A   n 
2 6   G   n 
2 7   G   n 
2 8   C   n 
2 9   U   n 
2 10  U   n 
2 11  U   n 
2 12  U   n 
2 13  C   n 
2 14  A   n 
2 15  A   n 
3 1   MET n 
3 2   GLU n 
3 3   ALA n 
3 4   THR n 
3 5   MET n 
3 6   ASP n 
3 7   GLN n 
3 8   THR n 
3 9   GLN n 
3 10  PRO n 
3 11  LEU n 
3 12  ASN n 
3 13  GLU n 
3 14  LYS n 
3 15  GLN n 
3 16  VAL n 
3 17  PRO n 
3 18  ASN n 
3 19  SER n 
3 20  GLU n 
3 21  GLY n 
3 22  CYS n 
3 23  TYR n 
3 24  VAL n 
3 25  TRP n 
3 26  GLN n 
3 27  VAL n 
3 28  SER n 
3 29  ASP n 
3 30  MET n 
3 31  ASN n 
3 32  ARG n 
3 33  LEU n 
3 34  ARG n 
3 35  ARG n 
3 36  PHE n 
3 37  LEU n 
3 38  CYS n 
3 39  PHE n 
3 40  GLY n 
3 41  SER n 
3 42  GLU n 
3 43  GLY n 
3 44  GLY n 
3 45  THR n 
3 46  TYR n 
3 47  TYR n 
3 48  ILE n 
3 49  GLU n 
3 50  GLU n 
3 51  LYS n 
3 52  LYS n 
3 53  LEU n 
3 54  GLY n 
3 55  GLN n 
3 56  GLU n 
3 57  ASN n 
3 58  ALA n 
3 59  GLU n 
3 60  ALA n 
3 61  LEU n 
3 62  LEU n 
3 63  ARG n 
3 64  LEU n 
3 65  ILE n 
3 66  GLU n 
3 67  ASP n 
3 68  GLY n 
3 69  LYS n 
3 70  GLY n 
3 71  CYS n 
3 72  GLU n 
3 73  VAL n 
3 74  VAL n 
3 75  GLN n 
3 76  GLU n 
3 77  ILE n 
3 78  LYS n 
3 79  THR n 
3 80  PHE n 
3 81  SER n 
3 82  GLN n 
3 83  GLU n 
3 84  GLY n 
3 85  ARG n 
3 86  ALA n 
3 87  ALA n 
3 88  LYS n 
3 89  GLN n 
3 90  GLU n 
3 91  PRO n 
3 92  THR n 
3 93  LEU n 
3 94  PHE n 
3 95  ALA n 
3 96  LEU n 
3 97  ALA n 
3 98  VAL n 
3 99  CYS n 
3 100 SER n 
3 101 GLN n 
3 102 CYS n 
3 103 SER n 
3 104 ASP n 
3 105 ILE n 
3 106 LYS n 
3 107 THR n 
3 108 LYS n 
3 109 GLN n 
3 110 ALA n 
3 111 ALA n 
3 112 PHE n 
3 113 ARG n 
3 114 ALA n 
3 115 VAL n 
3 116 PRO n 
3 117 GLU n 
3 118 VAL n 
3 119 CYS n 
3 120 ARG n 
3 121 ILE n 
3 122 PRO n 
3 123 THR n 
3 124 HIS n 
3 125 LEU n 
3 126 PHE n 
3 127 THR n 
3 128 PHE n 
3 129 ILE n 
3 130 GLN n 
3 131 PHE n 
3 132 LYS n 
3 133 LYS n 
3 134 ASP n 
3 135 LEU n 
3 136 LYS n 
3 137 GLU n 
3 138 GLY n 
3 139 MET n 
3 140 LYS n 
3 141 CYS n 
3 142 GLY n 
3 143 MET n 
3 144 TRP n 
3 145 GLY n 
3 146 ARG n 
3 147 ALA n 
3 148 LEU n 
3 149 ARG n 
3 150 LYS n 
3 151 ALA n 
3 152 VAL n 
3 153 SER n 
3 154 ASP n 
3 155 TRP n 
3 156 TYR n 
3 157 ASN n 
3 158 THR n 
3 159 LYS n 
3 160 ASP n 
3 161 ALA n 
3 162 LEU n 
3 163 ASN n 
3 164 LEU n 
3 165 ALA n 
3 166 MET n 
3 167 ALA n 
3 168 VAL n 
3 169 THR n 
3 170 LYS n 
3 171 TYR n 
3 172 LYS n 
3 173 GLN n 
3 174 ARG n 
3 175 ASN n 
3 176 GLY n 
3 177 TRP n 
3 178 SER n 
3 179 HIS n 
3 180 LYS n 
3 181 ASP n 
3 182 LEU n 
3 183 LEU n 
3 184 ARG n 
3 185 LEU n 
3 186 SER n 
3 187 HIS n 
3 188 ILE n 
3 189 LYS n 
3 190 PRO n 
3 191 ALA n 
3 192 ASN n 
3 193 GLU n 
3 194 GLY n 
3 195 LEU n 
3 196 THR n 
3 197 MET n 
3 198 VAL n 
3 199 ALA n 
3 200 LYS n 
3 201 TYR n 
3 202 VAL n 
3 203 SER n 
3 204 LYS n 
3 205 GLY n 
3 206 TRP n 
3 207 LYS n 
3 208 GLU n 
3 209 VAL n 
3 210 GLN n 
3 211 GLU n 
3 212 ALA n 
3 213 TYR n 
3 214 LYS n 
3 215 GLU n 
3 216 LYS n 
3 217 GLU n 
3 218 LEU n 
3 219 SER n 
3 220 PRO n 
3 221 GLU n 
3 222 THR n 
3 223 GLU n 
3 224 LYS n 
3 225 VAL n 
3 226 LEU n 
3 227 LYS n 
3 228 TYR n 
3 229 LEU n 
3 230 GLU n 
3 231 ALA n 
3 232 THR n 
3 233 GLU n 
3 234 ARG n 
3 235 VAL n 
3 236 LYS n 
3 237 ARG n 
3 238 THR n 
3 239 LYS n 
3 240 ASP n 
3 241 GLU n 
3 242 LEU n 
3 243 GLU n 
3 244 ILE n 
3 245 ILE n 
3 246 HIS n 
3 247 LEU n 
3 248 ILE n 
3 249 ASP n 
3 250 GLU n 
3 251 TYR n 
3 252 ARG n 
3 253 LEU n 
3 254 VAL n 
3 255 ARG n 
3 256 GLU n 
3 257 HIS n 
3 258 LEU n 
3 259 LEU n 
3 260 THR n 
3 261 ILE n 
3 262 HIS n 
3 263 LEU n 
3 264 LYS n 
3 265 SER n 
3 266 LYS n 
3 267 GLU n 
3 268 ILE n 
3 269 TRP n 
3 270 LYS n 
3 271 SER n 
3 272 LEU n 
3 273 LEU n 
3 274 GLN n 
3 275 ASP n 
3 276 MET n 
3 277 PRO n 
3 278 LEU n 
3 279 THR n 
3 280 ALA n 
3 281 LEU n 
3 282 LEU n 
3 283 ARG n 
3 284 ASN n 
3 285 LEU n 
3 286 GLY n 
3 287 LYS n 
3 288 MET n 
3 289 THR n 
3 290 ALA n 
3 291 ASP n 
3 292 SER n 
3 293 VAL n 
3 294 LEU n 
3 295 ALA n 
3 296 PRO n 
3 297 ALA n 
3 298 SER n 
3 299 SER n 
3 300 GLU n 
3 301 VAL n 
3 302 SER n 
3 303 SER n 
3 304 VAL n 
3 305 CYS n 
3 306 GLU n 
3 307 ARG n 
3 308 LEU n 
3 309 THR n 
3 310 ASN n 
3 311 GLU n 
3 312 LYS n 
3 313 LEU n 
3 314 LEU n 
3 315 LYS n 
3 316 LYS n 
3 317 ALA n 
3 318 ARG n 
3 319 ILE n 
3 320 HIS n 
3 321 PRO n 
3 322 PHE n 
3 323 HIS n 
3 324 ILE n 
3 325 LEU n 
3 326 VAL n 
3 327 ALA n 
3 328 LEU n 
3 329 GLU n 
3 330 THR n 
3 331 TYR n 
3 332 LYS n 
3 333 LYS n 
3 334 GLY n 
3 335 HIS n 
3 336 GLY n 
3 337 ASN n 
3 338 ARG n 
3 339 GLY n 
3 340 LYS n 
3 341 LEU n 
3 342 ARG n 
3 343 TRP n 
3 344 ILE n 
3 345 PRO n 
3 346 ASP n 
3 347 THR n 
3 348 SER n 
3 349 ILE n 
3 350 VAL n 
3 351 GLU n 
3 352 ALA n 
3 353 LEU n 
3 354 ASP n 
3 355 ASN n 
3 356 ALA n 
3 357 PHE n 
3 358 TYR n 
3 359 LYS n 
3 360 SER n 
3 361 PHE n 
3 362 LYS n 
3 363 LEU n 
3 364 VAL n 
3 365 GLU n 
3 366 PRO n 
3 367 THR n 
3 368 GLY n 
3 369 LYS n 
3 370 ARG n 
3 371 PHE n 
3 372 LEU n 
3 373 LEU n 
3 374 ALA n 
3 375 ILE n 
3 376 ASP n 
3 377 VAL n 
3 378 SER n 
3 379 ALA n 
3 380 SER n 
3 381 MET n 
3 382 ASN n 
3 383 GLN n 
3 384 ARG n 
3 385 VAL n 
3 386 LEU n 
3 387 GLY n 
3 388 SER n 
3 389 ILE n 
3 390 LEU n 
3 391 ASN n 
3 392 ALA n 
3 393 SER n 
3 394 VAL n 
3 395 VAL n 
3 396 ALA n 
3 397 ALA n 
3 398 ALA n 
3 399 MET n 
3 400 CYS n 
3 401 MET n 
3 402 LEU n 
3 403 VAL n 
3 404 ALA n 
3 405 ARG n 
3 406 THR n 
3 407 GLU n 
3 408 LYS n 
3 409 ASP n 
3 410 SER n 
3 411 HIS n 
3 412 MET n 
3 413 VAL n 
3 414 ALA n 
3 415 PHE n 
3 416 SER n 
3 417 ASP n 
3 418 GLU n 
3 419 MET n 
3 420 LEU n 
3 421 PRO n 
3 422 CYS n 
3 423 PRO n 
3 424 ILE n 
3 425 THR n 
3 426 VAL n 
3 427 ASN n 
3 428 MET n 
3 429 LEU n 
3 430 LEU n 
3 431 HIS n 
3 432 GLU n 
3 433 VAL n 
3 434 VAL n 
3 435 GLU n 
3 436 LYS n 
3 437 MET n 
3 438 SER n 
3 439 ASP n 
3 440 ILE n 
3 441 THR n 
3 442 MET n 
3 443 GLY n 
3 444 SER n 
3 445 THR n 
3 446 ASP n 
3 447 CYS n 
3 448 ALA n 
3 449 LEU n 
3 450 PRO n 
3 451 MET n 
3 452 LEU n 
3 453 TRP n 
3 454 ALA n 
3 455 GLN n 
3 456 LYS n 
3 457 THR n 
3 458 ASN n 
3 459 THR n 
3 460 ALA n 
3 461 ALA n 
3 462 ASP n 
3 463 ILE n 
3 464 PHE n 
3 465 ILE n 
3 466 VAL n 
3 467 PHE n 
3 468 THR n 
3 469 ASP n 
3 470 CYS n 
3 471 GLU n 
3 472 THR n 
3 473 ASN n 
3 474 VAL n 
3 475 GLU n 
3 476 ASP n 
3 477 VAL n 
3 478 HIS n 
3 479 PRO n 
3 480 ALA n 
3 481 THR n 
3 482 ALA n 
3 483 LEU n 
3 484 LYS n 
3 485 GLN n 
3 486 TYR n 
3 487 ARG n 
3 488 GLU n 
3 489 LYS n 
3 490 MET n 
3 491 GLY n 
3 492 ILE n 
3 493 PRO n 
3 494 ALA n 
3 495 LYS n 
3 496 LEU n 
3 497 ILE n 
3 498 VAL n 
3 499 CYS n 
3 500 ALA n 
3 501 MET n 
3 502 THR n 
3 503 SER n 
3 504 ASN n 
3 505 GLY n 
3 506 PHE n 
3 507 SER n 
3 508 ILE n 
3 509 ALA n 
3 510 ASP n 
3 511 PRO n 
3 512 ASP n 
3 513 ASP n 
3 514 ARG n 
3 515 GLY n 
3 516 MET n 
3 517 LEU n 
3 518 ASP n 
3 519 ILE n 
3 520 CYS n 
3 521 GLY n 
3 522 PHE n 
3 523 ASP n 
3 524 SER n 
3 525 GLY n 
3 526 ALA n 
3 527 LEU n 
3 528 ASP n 
3 529 VAL n 
3 530 ILE n 
3 531 ARG n 
3 532 ASN n 
3 533 PHE n 
3 534 THR n 
3 535 LEU n 
3 536 ASP n 
3 537 LEU n 
3 538 ILE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'African clawed frog' 
_entity_src_gen.gene_src_genus                     Xenopus 
_entity_src_gen.pdbx_gene_src_gene                 trove2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Xenopus laevis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     8355 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RO60_XENLA P42700 3 
;MEATMDQTQPLNEKQVPNSEGCYVWQVSDMNRLRRFLCFGSEGGTYYIEEKKLGQENAEALLRLIEDGKGCEVVQEIKTF
SQEGRAAKQEPTLFALAVCSQCSDIKTKQAAFRAVPEVCRIPTHLFTFIQFKKDLKEGMKCGMWGRALRKAVSDWYNTKD
ALNLAMAVTKYKQRNGWSHKDLLRLSHIKPANEGLTMVAKYVSKGWKEVQEAYKEKELSPETEKVLKYLEATERVKRTKD
ELEIIHLIDEYRLVREHLLTIHLKSKEIWKSLLQDMPLTALLRNLGKMTADSVLAPASSEVSSVCERLTNEKLLKKARIH
PFHILVALETYKKGHGNRGKLRWIPDTSIVEALDNAFYKSFKLVEPTGKRFLLAIDVSASMNQRVLGSILNASVVAAAMC
MLVARTEKDSHMVAFSDEMLPCPITVNMLLHEVVEKMSDITMGSTDCALPMLWAQKTNTAADIFIVFTDCETNVEDVHPA
TALKQYREKMGIPAKLIVCAMTSNGFSIADPDDRGMLDICGFDSGALDVIRNFTLDLI
;
1 ? 
2 PDB 2I91       2I91   1 ? ? ? 
3 PDB 2I91       2I91   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2I91 A 1 ? 538 ? P42700 1 ? 538 ? 1 538 
2 1 2I91 B 1 ? 538 ? P42700 1 ? 538 ? 1 538 
3 2 2I91 C 1 ? 8   ? 2I91   1 ? 8   ? 1 8   
4 3 2I91 D 1 ? 15  ? 2I91   1 ? 15  ? 1 15  
5 2 2I91 E 1 ? 8   ? 2I91   1 ? 8   ? 1 8   
6 3 2I91 F 1 ? 15  ? 2I91   1 ? 15  ? 1 15  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ACT non-polymer         . 'ACETATE ION'                ? 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2I91 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
;18-20% PEG 6000, 250 mM magnesium acetate, 100 mM sodium acetate 
Protein was mixed with RNA approximately 1:1., pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 6000'          ? ? ? 
1 2 1 'magnesium acetate' ? ? ? 
1 3 1 'sodium acetate'    ? ? ? 
1 4 1 H2O                 ? ? ? 
1 5 2 'PEG 6000'          ? ? ? 
1 6 2 'magnesium acetate' ? ? ? 
1 7 2 'sodium acetate'    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-04-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
'Pt-coated toroidal Si mirror for horizontal and vertical focussing followed by double flat Si crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2I91 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             50 
_reflns.number_all                   35662 
_reflns.number_obs                   34410 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.13 
_reflns.pdbx_Rsym_value              0.13 
_reflns.pdbx_netI_over_sigmaI        12 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.398 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3555 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2I91 
_refine.ls_d_res_high                            2.65 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     35662 
_refine.ls_number_reflns_obs                     34410 
_refine.ls_number_reflns_R_free                  3467 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_all                          0.245 
_refine.ls_R_factor_obs                          0.245 
_refine.ls_R_factor_R_work                       0.241 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1YVP' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8269 
_refine_hist.pdbx_number_atoms_nucleic_acid   934 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             561 
_refine_hist.number_atoms_total               9774 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           .009158 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.626   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.3    ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.85    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.65 2.67 . 0.375 . 0.474 . . 58 . . 669 . 'X-RAY DIFFRACTION' 
. 2.67 2.69 . 0.375 . 0.474 . . 59 . . 647 . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2I91 
_struct.title                     '60kDa Ro autoantigen in complex with a fragment of misfolded RNA' 
_struct.pdbx_descriptor           '60 kDa SS-A/Ro ribonucleoprotein/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2I91 
_struct_keywords.pdbx_keywords   'RNA Binding Protein/RNA' 
_struct_keywords.text            
'von Willebrand factor A, Rossmann-fold, HEAT repeat, MIDAS motif, RNA Binding Protein-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER E 28  ? GLY E 40  ? SER A 28  GLY A 40  1 ? 13 
HELX_P HELX_P2  2  GLU E 49  ? ASP E 67  ? GLU A 49  ASP A 67  1 ? 19 
HELX_P HELX_P3  3  LYS E 69  ? GLU E 83  ? LYS A 69  GLU A 83  1 ? 15 
HELX_P HELX_P4  4  GLN E 89  ? SER E 100 ? GLN A 89  SER A 100 1 ? 12 
HELX_P HELX_P5  5  ASP E 104 ? CYS E 119 ? ASP A 104 CYS A 119 1 ? 16 
HELX_P HELX_P6  6  ILE E 121 ? LEU E 135 ? ILE A 121 LEU A 135 1 ? 15 
HELX_P HELX_P7  7  GLY E 145 ? THR E 158 ? GLY A 145 THR A 158 1 ? 14 
HELX_P HELX_P8  8  ASP E 160 ? TYR E 171 ? ASP A 160 TYR A 171 1 ? 12 
HELX_P HELX_P9  9  HIS E 179 ? SER E 186 ? HIS A 179 SER A 186 1 ? 8  
HELX_P HELX_P10 10 ASN E 192 ? LYS E 204 ? ASN A 192 LYS A 204 1 ? 13 
HELX_P HELX_P11 11 GLY E 205 ? TYR E 213 ? GLY A 205 TYR A 213 1 ? 9  
HELX_P HELX_P12 12 SER E 219 ? VAL E 235 ? SER A 219 VAL A 235 1 ? 17 
HELX_P HELX_P13 13 ASP E 240 ? ARG E 252 ? ASP A 240 ARG A 252 1 ? 13 
HELX_P HELX_P14 14 VAL E 254 ? LEU E 258 ? VAL A 254 LEU A 258 5 ? 5  
HELX_P HELX_P15 15 ILE E 261 ? LYS E 264 ? ILE A 261 LYS A 264 5 ? 4  
HELX_P HELX_P16 16 SER E 265 ? GLN E 274 ? SER A 265 GLN A 274 1 ? 10 
HELX_P HELX_P17 17 PRO E 277 ? ASN E 284 ? PRO A 277 ASN A 284 1 ? 8  
HELX_P HELX_P18 18 ASN E 284 ? ASP E 291 ? ASN A 284 ASP A 291 1 ? 8  
HELX_P HELX_P19 19 SER E 298 ? THR E 309 ? SER A 298 THR A 309 1 ? 12 
HELX_P HELX_P20 20 ASN E 310 ? ALA E 317 ? ASN A 310 ALA A 317 1 ? 8  
HELX_P HELX_P21 21 HIS E 320 ? LYS E 333 ? HIS A 320 LYS A 333 1 ? 14 
HELX_P HELX_P22 22 ASP E 346 ? SER E 360 ? ASP A 346 SER A 360 1 ? 15 
HELX_P HELX_P23 23 SER E 378 ? GLN E 383 ? SER A 378 GLN A 383 5 ? 6  
HELX_P HELX_P24 24 ASN E 391 ? GLU E 407 ? ASN A 391 GLU A 407 1 ? 17 
HELX_P HELX_P25 25 LEU E 429 ? THR E 441 ? LEU A 429 THR A 441 1 ? 13 
HELX_P HELX_P26 26 ALA E 448 ? THR E 457 ? ALA A 448 THR A 457 1 ? 10 
HELX_P HELX_P27 27 HIS E 478 ? GLY E 491 ? HIS A 478 GLY A 491 1 ? 14 
HELX_P HELX_P28 28 GLY E 525 ? LEU E 535 ? GLY A 525 LEU A 535 1 ? 11 
HELX_P HELX_P29 29 SER F 28  ? GLY F 40  ? SER B 28  GLY B 40  1 ? 13 
HELX_P HELX_P30 30 GLU F 49  ? ASP F 67  ? GLU B 49  ASP B 67  1 ? 19 
HELX_P HELX_P31 31 LYS F 69  ? GLU F 83  ? LYS B 69  GLU B 83  1 ? 15 
HELX_P HELX_P32 32 GLN F 89  ? SER F 100 ? GLN B 89  SER B 100 1 ? 12 
HELX_P HELX_P33 33 ASP F 104 ? CYS F 119 ? ASP B 104 CYS B 119 1 ? 16 
HELX_P HELX_P34 34 ILE F 121 ? LYS F 136 ? ILE B 121 LYS B 136 1 ? 16 
HELX_P HELX_P35 35 GLY F 145 ? THR F 158 ? GLY B 145 THR B 158 1 ? 14 
HELX_P HELX_P36 36 ASP F 160 ? TYR F 171 ? ASP B 160 TYR B 171 1 ? 12 
HELX_P HELX_P37 37 HIS F 179 ? SER F 186 ? HIS B 179 SER B 186 1 ? 8  
HELX_P HELX_P38 38 ASN F 192 ? LYS F 204 ? ASN B 192 LYS B 204 1 ? 13 
HELX_P HELX_P39 39 GLY F 205 ? TYR F 213 ? GLY B 205 TYR B 213 1 ? 9  
HELX_P HELX_P40 40 SER F 219 ? VAL F 235 ? SER B 219 VAL B 235 1 ? 17 
HELX_P HELX_P41 41 ASP F 240 ? ARG F 252 ? ASP B 240 ARG B 252 1 ? 13 
HELX_P HELX_P42 42 VAL F 254 ? LEU F 258 ? VAL B 254 LEU B 258 5 ? 5  
HELX_P HELX_P43 43 SER F 265 ? GLN F 274 ? SER B 265 GLN B 274 1 ? 10 
HELX_P HELX_P44 44 PRO F 277 ? ASN F 284 ? PRO B 277 ASN B 284 1 ? 8  
HELX_P HELX_P45 45 ASN F 284 ? ASP F 291 ? ASN B 284 ASP B 291 1 ? 8  
HELX_P HELX_P46 46 SER F 298 ? THR F 309 ? SER B 298 THR B 309 1 ? 12 
HELX_P HELX_P47 47 ASN F 310 ? ALA F 317 ? ASN B 310 ALA B 317 1 ? 8  
HELX_P HELX_P48 48 HIS F 320 ? LYS F 333 ? HIS B 320 LYS B 333 1 ? 14 
HELX_P HELX_P49 49 ASP F 346 ? SER F 360 ? ASP B 346 SER B 360 1 ? 15 
HELX_P HELX_P50 50 SER F 378 ? GLN F 383 ? SER B 378 GLN B 383 5 ? 6  
HELX_P HELX_P51 51 ASN F 391 ? GLU F 407 ? ASN B 391 GLU B 407 1 ? 17 
HELX_P HELX_P52 52 LEU F 429 ? THR F 441 ? LEU B 429 THR B 441 1 ? 13 
HELX_P HELX_P53 53 ALA F 448 ? THR F 457 ? ALA B 448 THR B 457 1 ? 10 
HELX_P HELX_P54 54 HIS F 478 ? GLY F 491 ? HIS B 478 GLY B 491 1 ? 14 
HELX_P HELX_P55 55 GLY F 525 ? LEU F 535 ? GLY B 525 LEU B 535 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G ACT . OXT ? ? ? 1_555 H MG  .   MG  ? ? A ACT 601 A MG  701 1_555 ? ? ? ? ? ? ?            1.918 ? 
metalc2  metalc ? ? H MG  . MG  ? ? ? 1_555 E SER 380 OG  ? ? A MG  701 A SER 380 1_555 ? ? ? ? ? ? ?            2.131 ? 
metalc3  metalc ? ? H MG  . MG  ? ? ? 1_555 G ACT .   O   ? ? A MG  701 A ACT 601 1_555 ? ? ? ? ? ? ?            3.112 ? 
metalc4  metalc ? ? H MG  . MG  ? ? ? 1_555 O HOH .   O   ? ? A MG  701 A HOH 915 1_555 ? ? ? ? ? ? ?            2.331 ? 
metalc5  metalc ? ? H MG  . MG  ? ? ? 1_555 E SER 378 OG  ? ? A MG  701 A SER 378 1_555 ? ? ? ? ? ? ?            1.972 ? 
metalc6  metalc ? ? H MG  . MG  ? ? ? 1_555 E THR 445 OG1 ? ? A MG  701 A THR 445 1_555 ? ? ? ? ? ? ?            1.972 ? 
metalc7  metalc ? ? H MG  . MG  ? ? ? 1_555 O HOH .   O   ? ? A MG  701 A HOH 702 1_555 ? ? ? ? ? ? ?            2.009 ? 
metalc8  metalc ? ? I ACT . OXT ? ? ? 1_555 J MG  .   MG  ? ? B ACT 602 B MG  702 1_555 ? ? ? ? ? ? ?            1.987 ? 
metalc9  metalc ? ? J MG  . MG  ? ? ? 1_555 P HOH .   O   ? ? B MG  702 B HOH 806 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc10 metalc ? ? J MG  . MG  ? ? ? 1_555 F SER 380 OG  ? ? B MG  702 B SER 380 1_555 ? ? ? ? ? ? ?            1.927 ? 
metalc11 metalc ? ? J MG  . MG  ? ? ? 1_555 F SER 378 OG  ? ? B MG  702 B SER 378 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc12 metalc ? ? J MG  . MG  ? ? ? 1_555 F THR 445 OG1 ? ? B MG  702 B THR 445 1_555 ? ? ? ? ? ? ?            2.116 ? 
metalc13 metalc ? ? J MG  . MG  ? ? ? 1_555 P HOH .   O   ? ? B MG  702 B HOH 703 1_555 ? ? ? ? ? ? ?            1.869 ? 
hydrog1  hydrog ? ? A G   1 N1  ? ? ? 1_555 B C   8   N3  ? ? C G   1   D C   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A G   1 N2  ? ? ? 1_555 B C   8   O2  ? ? C G   1   D C   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A G   1 O6  ? ? ? 1_555 B C   8   N4  ? ? C G   1   D C   8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A C   2 O2  ? ? ? 1_555 B G   7   N2  ? ? C C   2   D G   7   1_555 ? ? ? ? ? ? 'C-G PAIR'   ?     ? 
hydrog5  hydrog ? ? A C   3 N3  ? ? ? 1_555 B G   6   N1  ? ? C C   3   D G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A C   3 N4  ? ? ? 1_555 B G   6   O6  ? ? C C   3   D G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A C   3 O2  ? ? ? 1_555 B G   6   N2  ? ? C C   3   D G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A U   4 N3  ? ? ? 1_555 B A   5   N1  ? ? C U   4   D A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A U   4 O4  ? ? ? 1_555 B A   5   N6  ? ? C U   4   D A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A A   5 N1  ? ? ? 1_555 B U   4   N3  ? ? C A   5   D U   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A A   5 N6  ? ? ? 1_555 B U   4   O4  ? ? C A   5   D U   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A C   6 N3  ? ? ? 1_555 B G   3   N1  ? ? C C   6   D G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A C   6 N4  ? ? ? 1_555 B G   3   O6  ? ? C C   6   D G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A C   6 O2  ? ? ? 1_555 B G   3   N2  ? ? C C   6   D G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A C   7 N3  ? ? ? 1_555 B G   2   N1  ? ? C C   7   D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A C   7 N4  ? ? ? 1_555 B G   2   O6  ? ? C C   7   D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A C   7 O2  ? ? ? 1_555 B G   2   N2  ? ? C C   7   D G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C G   1 N1  ? ? ? 1_555 D C   8   N3  ? ? E G   1   F C   8   1_555 ? ? ? ? ? ? 'G-C PAIR'   ?     ? 
hydrog19 hydrog ? ? C C   2 N3  ? ? ? 1_555 D G   7   N1  ? ? E C   2   F G   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C C   2 N4  ? ? ? 1_555 D G   7   O6  ? ? E C   2   F G   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C C   2 O2  ? ? ? 1_555 D G   7   N2  ? ? E C   2   F G   7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C C   3 N3  ? ? ? 1_555 D G   6   N1  ? ? E C   3   F G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C C   3 N4  ? ? ? 1_555 D G   6   O6  ? ? E C   3   F G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C C   3 O2  ? ? ? 1_555 D G   6   N2  ? ? E C   3   F G   6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C U   4 N3  ? ? ? 1_555 D A   5   N1  ? ? E U   4   F A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C U   4 O4  ? ? ? 1_555 D A   5   N6  ? ? E U   4   F A   5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C A   5 N1  ? ? ? 1_555 D U   4   N3  ? ? E A   5   F U   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C A   5 N6  ? ? ? 1_555 D U   4   O4  ? ? E A   5   F U   4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C C   6 N3  ? ? ? 1_555 D G   3   N1  ? ? E C   6   F G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C C   6 N4  ? ? ? 1_555 D G   3   O6  ? ? E C   6   F G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C C   6 O2  ? ? ? 1_555 D G   3   N2  ? ? E C   6   F G   3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C C   7 N3  ? ? ? 1_555 D G   2   N1  ? ? E C   7   F G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C C   7 N4  ? ? ? 1_555 D G   2   O6  ? ? E C   7   F G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C C   7 O2  ? ? ? 1_555 D G   2   N2  ? ? E C   7   F G   2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 6 ? 
D ? 3 ? 
E ? 2 ? 
F ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 16  ? PRO E 17  ? VAL A 16  PRO A 17  
A 2 TYR E 23  ? GLN E 26  ? TYR A 23  GLN A 26  
A 3 PHE E 506 ? SER E 507 ? PHE A 506 SER A 507 
B 1 GLN E 173 ? ARG E 174 ? GLN A 173 ARG A 174 
B 2 TRP E 177 ? SER E 178 ? TRP A 177 SER A 178 
C 1 MET E 419 ? LEU E 420 ? MET A 419 LEU A 420 
C 2 SER E 410 ? PHE E 415 ? SER A 410 PHE A 415 
C 3 PHE E 371 ? ASP E 376 ? PHE A 371 ASP A 376 
C 4 ILE E 463 ? THR E 468 ? ILE A 463 THR A 468 
C 5 LYS E 495 ? ALA E 500 ? LYS A 495 ALA A 500 
C 6 MET E 516 ? CYS E 520 ? MET A 516 CYS A 520 
D 1 VAL F 16  ? PRO F 17  ? VAL B 16  PRO B 17  
D 2 TYR F 23  ? GLN F 26  ? TYR B 23  GLN B 26  
D 3 PHE F 506 ? SER F 507 ? PHE B 506 SER B 507 
E 1 GLN F 173 ? ARG F 174 ? GLN B 173 ARG B 174 
E 2 TRP F 177 ? SER F 178 ? TRP B 177 SER B 178 
F 1 MET F 419 ? LEU F 420 ? MET B 419 LEU B 420 
F 2 SER F 410 ? PHE F 415 ? SER B 410 PHE B 415 
F 3 PHE F 371 ? ASP F 376 ? PHE B 371 ASP B 376 
F 4 ILE F 463 ? THR F 468 ? ILE B 463 THR B 468 
F 5 LYS F 495 ? ALA F 500 ? LYS B 495 ALA B 500 
F 6 MET F 516 ? CYS F 520 ? MET B 516 CYS B 520 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL E 16  ? N VAL A 16  O VAL E 24  ? O VAL A 24  
A 2 3 N TRP E 25  ? N TRP A 25  O SER E 507 ? O SER A 507 
B 1 2 N ARG E 174 ? N ARG A 174 O TRP E 177 ? O TRP A 177 
C 1 2 O LEU E 420 ? O LEU A 420 N ALA E 414 ? N ALA A 414 
C 2 3 O VAL E 413 ? O VAL A 413 N ILE E 375 ? N ILE A 375 
C 3 4 N ALA E 374 ? N ALA A 374 O ILE E 465 ? O ILE A 465 
C 4 5 N PHE E 464 ? N PHE A 464 O ILE E 497 ? O ILE A 497 
C 5 6 N LEU E 496 ? N LEU A 496 O LEU E 517 ? O LEU A 517 
D 1 2 N VAL F 16  ? N VAL B 16  O VAL F 24  ? O VAL B 24  
D 2 3 N TRP F 25  ? N TRP B 25  O SER F 507 ? O SER B 507 
E 1 2 N ARG F 174 ? N ARG B 174 O TRP F 177 ? O TRP B 177 
F 1 2 O LEU F 420 ? O LEU B 420 N ALA F 414 ? N ALA B 414 
F 2 3 O VAL F 413 ? O VAL B 413 N ILE F 375 ? N ILE B 375 
F 3 4 N ALA F 374 ? N ALA B 374 O ILE F 465 ? O ILE B 465 
F 4 5 N PHE F 464 ? N PHE B 464 O ILE F 497 ? O ILE B 497 
F 5 6 N LEU F 496 ? N LEU B 496 O LEU F 517 ? O LEU B 517 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE ACT A 601' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ACT B 602' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 701'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 702'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  TYR E 47  ? TYR A 47  . ? 1_555 ? 
2  AC1 9  SER E 378 ? SER A 378 . ? 1_555 ? 
3  AC1 9  ALA E 379 ? ALA A 379 . ? 1_555 ? 
4  AC1 9  SER E 380 ? SER A 380 . ? 1_555 ? 
5  AC1 9  GLY E 443 ? GLY A 443 . ? 1_555 ? 
6  AC1 9  SER E 444 ? SER A 444 . ? 1_555 ? 
7  AC1 9  THR E 445 ? THR A 445 . ? 1_555 ? 
8  AC1 9  ASN E 473 ? ASN A 473 . ? 1_555 ? 
9  AC1 9  MG  H .   ? MG  A 701 . ? 1_555 ? 
10 AC2 10 TYR F 47  ? TYR B 47  . ? 1_555 ? 
11 AC2 10 SER F 378 ? SER B 378 . ? 1_555 ? 
12 AC2 10 ALA F 379 ? ALA B 379 . ? 1_555 ? 
13 AC2 10 SER F 380 ? SER B 380 . ? 1_555 ? 
14 AC2 10 GLY F 443 ? GLY B 443 . ? 1_555 ? 
15 AC2 10 SER F 444 ? SER B 444 . ? 1_555 ? 
16 AC2 10 THR F 445 ? THR B 445 . ? 1_555 ? 
17 AC2 10 ASN F 473 ? ASN B 473 . ? 1_555 ? 
18 AC2 10 MG  J .   ? MG  B 702 . ? 1_555 ? 
19 AC2 10 HOH P .   ? HOH B 806 . ? 1_555 ? 
20 AC3 6  SER E 378 ? SER A 378 . ? 1_555 ? 
21 AC3 6  SER E 380 ? SER A 380 . ? 1_555 ? 
22 AC3 6  THR E 445 ? THR A 445 . ? 1_555 ? 
23 AC3 6  ACT G .   ? ACT A 601 . ? 1_555 ? 
24 AC3 6  HOH O .   ? HOH A 702 . ? 1_555 ? 
25 AC3 6  HOH O .   ? HOH A 915 . ? 1_555 ? 
26 AC4 6  SER F 378 ? SER B 378 . ? 1_555 ? 
27 AC4 6  SER F 380 ? SER B 380 . ? 1_555 ? 
28 AC4 6  THR F 445 ? THR B 445 . ? 1_555 ? 
29 AC4 6  ACT I .   ? ACT B 602 . ? 1_555 ? 
30 AC4 6  HOH P .   ? HOH B 703 . ? 1_555 ? 
31 AC4 6  HOH P .   ? HOH B 806 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2I91 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2I91 
_atom_sites.fract_transf_matrix[1][1]   0.013759 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002157 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013764 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . G   A 1 1   ? 23.655  -53.356 -51.893 1.00 59.34 ? 1   G   C "O5'" 1 
ATOM   2    C  "C5'" . G   A 1 1   ? 25.060  -53.142 -51.684 1.00 58.92 ? 1   G   C "C5'" 1 
ATOM   3    C  "C4'" . G   A 1 1   ? 25.350  -53.039 -50.207 1.00 57.70 ? 1   G   C "C4'" 1 
ATOM   4    O  "O4'" . G   A 1 1   ? 25.887  -54.295 -49.718 1.00 57.63 ? 1   G   C "O4'" 1 
ATOM   5    C  "C3'" . G   A 1 1   ? 26.419  -52.048 -49.770 1.00 57.29 ? 1   G   C "C3'" 1 
ATOM   6    O  "O3'" . G   A 1 1   ? 25.904  -50.720 -49.715 1.00 54.98 ? 1   G   C "O3'" 1 
ATOM   7    C  "C2'" . G   A 1 1   ? 26.746  -52.537 -48.361 1.00 57.45 ? 1   G   C "C2'" 1 
ATOM   8    O  "O2'" . G   A 1 1   ? 25.849  -52.062 -47.385 1.00 58.93 ? 1   G   C "O2'" 1 
ATOM   9    C  "C1'" . G   A 1 1   ? 26.535  -54.045 -48.488 1.00 56.95 ? 1   G   C "C1'" 1 
ATOM   10   N  N9    . G   A 1 1   ? 27.778  -54.793 -48.378 1.00 56.22 ? 1   G   C N9    1 
ATOM   11   C  C8    . G   A 1 1   ? 28.655  -55.190 -49.360 1.00 56.07 ? 1   G   C C8    1 
ATOM   12   N  N7    . G   A 1 1   ? 29.698  -55.818 -48.883 1.00 55.86 ? 1   G   C N7    1 
ATOM   13   C  C5    . G   A 1 1   ? 29.486  -55.837 -47.509 1.00 55.65 ? 1   G   C C5    1 
ATOM   14   C  C6    . G   A 1 1   ? 30.269  -56.374 -46.461 1.00 56.33 ? 1   G   C C6    1 
ATOM   15   O  O6    . G   A 1 1   ? 31.362  -56.958 -46.531 1.00 56.46 ? 1   G   C O6    1 
ATOM   16   N  N1    . G   A 1 1   ? 29.664  -56.174 -45.221 1.00 56.58 ? 1   G   C N1    1 
ATOM   17   C  C2    . G   A 1 1   ? 28.463  -55.537 -45.019 1.00 55.57 ? 1   G   C C2    1 
ATOM   18   N  N2    . G   A 1 1   ? 28.029  -55.441 -43.755 1.00 55.34 ? 1   G   C N2    1 
ATOM   19   N  N3    . G   A 1 1   ? 27.738  -55.030 -45.985 1.00 55.31 ? 1   G   C N3    1 
ATOM   20   C  C4    . G   A 1 1   ? 28.302  -55.215 -47.195 1.00 55.62 ? 1   G   C C4    1 
ATOM   21   P  P     . C   A 1 2   ? 26.843  -49.515 -49.208 1.00 53.67 ? 2   C   C P     1 
ATOM   22   O  OP1   . C   A 1 2   ? 26.049  -48.277 -49.400 1.00 55.18 ? 2   C   C OP1   1 
ATOM   23   O  OP2   . C   A 1 2   ? 28.184  -49.628 -49.826 1.00 54.68 ? 2   C   C OP2   1 
ATOM   24   O  "O5'" . C   A 1 2   ? 27.007  -49.766 -47.645 1.00 50.68 ? 2   C   C "O5'" 1 
ATOM   25   C  "C5'" . C   A 1 2   ? 25.900  -49.596 -46.770 1.00 48.06 ? 2   C   C "C5'" 1 
ATOM   26   C  "C4'" . C   A 1 2   ? 26.286  -49.922 -45.343 1.00 46.14 ? 2   C   C "C4'" 1 
ATOM   27   O  "O4'" . C   A 1 2   ? 26.754  -51.296 -45.235 1.00 44.72 ? 2   C   C "O4'" 1 
ATOM   28   C  "C3'" . C   A 1 2   ? 27.415  -49.120 -44.719 1.00 43.54 ? 2   C   C "C3'" 1 
ATOM   29   O  "O3'" . C   A 1 2   ? 26.954  -47.823 -44.337 1.00 41.43 ? 2   C   C "O3'" 1 
ATOM   30   C  "C2'" . C   A 1 2   ? 27.746  -50.001 -43.521 1.00 43.44 ? 2   C   C "C2'" 1 
ATOM   31   O  "O2'" . C   A 1 2   ? 26.759  -49.904 -42.514 1.00 39.55 ? 2   C   C "O2'" 1 
ATOM   32   C  "C1'" . C   A 1 2   ? 27.657  -51.397 -44.146 1.00 44.43 ? 2   C   C "C1'" 1 
ATOM   33   N  N1    . C   A 1 2   ? 28.957  -51.891 -44.642 1.00 45.62 ? 2   C   C N1    1 
ATOM   34   C  C2    . C   A 1 2   ? 29.796  -52.567 -43.750 1.00 46.90 ? 2   C   C C2    1 
ATOM   35   O  O2    . C   A 1 2   ? 29.410  -52.740 -42.582 1.00 47.87 ? 2   C   C O2    1 
ATOM   36   N  N3    . C   A 1 2   ? 31.003  -53.014 -44.179 1.00 47.00 ? 2   C   C N3    1 
ATOM   37   C  C4    . C   A 1 2   ? 31.376  -52.812 -45.442 1.00 46.01 ? 2   C   C C4    1 
ATOM   38   N  N4    . C   A 1 2   ? 32.570  -53.273 -45.822 1.00 45.44 ? 2   C   C N4    1 
ATOM   39   C  C5    . C   A 1 2   ? 30.541  -52.130 -46.373 1.00 45.81 ? 2   C   C C5    1 
ATOM   40   C  C6    . C   A 1 2   ? 29.349  -51.693 -45.936 1.00 45.33 ? 2   C   C C6    1 
ATOM   41   P  P     . C   A 1 3   ? 28.010  -46.636 -44.060 1.00 39.36 ? 3   C   C P     1 
ATOM   42   O  OP1   . C   A 1 3   ? 27.214  -45.396 -43.874 1.00 38.34 ? 3   C   C OP1   1 
ATOM   43   O  OP2   . C   A 1 3   ? 29.098  -46.659 -45.073 1.00 36.24 ? 3   C   C OP2   1 
ATOM   44   O  "O5'" . C   A 1 3   ? 28.604  -47.029 -42.638 1.00 37.03 ? 3   C   C "O5'" 1 
ATOM   45   C  "C5'" . C   A 1 3   ? 27.724  -47.321 -41.558 1.00 35.83 ? 3   C   C "C5'" 1 
ATOM   46   C  "C4'" . C   A 1 3   ? 28.507  -47.632 -40.313 1.00 35.65 ? 3   C   C "C4'" 1 
ATOM   47   O  "O4'" . C   A 1 3   ? 29.078  -48.969 -40.357 1.00 36.21 ? 3   C   C "O4'" 1 
ATOM   48   C  "C3'" . C   A 1 3   ? 29.707  -46.746 -40.115 1.00 35.58 ? 3   C   C "C3'" 1 
ATOM   49   O  "O3'" . C   A 1 3   ? 29.318  -45.501 -39.600 1.00 35.89 ? 3   C   C "O3'" 1 
ATOM   50   C  "C2'" . C   A 1 3   ? 30.529  -47.558 -39.134 1.00 36.13 ? 3   C   C "C2'" 1 
ATOM   51   O  "O2'" . C   A 1 3   ? 29.994  -47.462 -37.832 1.00 36.37 ? 3   C   C "O2'" 1 
ATOM   52   C  "C1'" . C   A 1 3   ? 30.332  -48.970 -39.692 1.00 35.78 ? 3   C   C "C1'" 1 
ATOM   53   N  N1    . C   A 1 3   ? 31.366  -49.328 -40.676 1.00 36.30 ? 3   C   C N1    1 
ATOM   54   C  C2    . C   A 1 3   ? 32.583  -49.834 -40.222 1.00 36.55 ? 3   C   C C2    1 
ATOM   55   O  O2    . C   A 1 3   ? 32.749  -49.991 -39.007 1.00 38.34 ? 3   C   C O2    1 
ATOM   56   N  N3    . C   A 1 3   ? 33.546  -50.143 -41.116 1.00 35.97 ? 3   C   C N3    1 
ATOM   57   C  C4    . C   A 1 3   ? 33.328  -49.973 -42.418 1.00 35.10 ? 3   C   C C4    1 
ATOM   58   N  N4    . C   A 1 3   ? 34.309  -50.288 -43.258 1.00 34.21 ? 3   C   C N4    1 
ATOM   59   C  C5    . C   A 1 3   ? 32.092  -49.470 -42.914 1.00 36.21 ? 3   C   C C5    1 
ATOM   60   C  C6    . C   A 1 3   ? 31.146  -49.164 -42.016 1.00 36.50 ? 3   C   C C6    1 
ATOM   61   P  P     . U   A 1 4   ? 30.382  -44.312 -39.580 1.00 36.80 ? 4   U   C P     1 
ATOM   62   O  OP1   . U   A 1 4   ? 29.684  -43.008 -39.412 1.00 37.64 ? 4   U   C OP1   1 
ATOM   63   O  OP2   . U   A 1 4   ? 31.298  -44.508 -40.735 1.00 34.45 ? 4   U   C OP2   1 
ATOM   64   O  "O5'" . U   A 1 4   ? 31.153  -44.622 -38.232 1.00 36.22 ? 4   U   C "O5'" 1 
ATOM   65   C  "C5'" . U   A 1 4   ? 32.272  -43.870 -37.871 1.00 35.41 ? 4   U   C "C5'" 1 
ATOM   66   C  "C4'" . U   A 1 4   ? 33.235  -44.720 -37.103 1.00 34.00 ? 4   U   C "C4'" 1 
ATOM   67   O  "O4'" . U   A 1 4   ? 33.247  -46.084 -37.597 1.00 34.41 ? 4   U   C "O4'" 1 
ATOM   68   C  "C3'" . U   A 1 4   ? 34.642  -44.220 -37.306 1.00 33.84 ? 4   U   C "C3'" 1 
ATOM   69   O  "O3'" . U   A 1 4   ? 34.847  -43.145 -36.413 1.00 31.73 ? 4   U   C "O3'" 1 
ATOM   70   C  "C2'" . U   A 1 4   ? 35.477  -45.466 -37.045 1.00 34.19 ? 4   U   C "C2'" 1 
ATOM   71   O  "O2'" . U   A 1 4   ? 35.696  -45.716 -35.674 1.00 35.13 ? 4   U   C "O2'" 1 
ATOM   72   C  "C1'" . U   A 1 4   ? 34.586  -46.552 -37.657 1.00 34.42 ? 4   U   C "C1'" 1 
ATOM   73   N  N1    . U   A 1 4   ? 34.901  -46.835 -39.063 1.00 35.43 ? 4   U   C N1    1 
ATOM   74   C  C2    . U   A 1 4   ? 36.096  -47.464 -39.337 1.00 36.39 ? 4   U   C C2    1 
ATOM   75   O  O2    . U   A 1 4   ? 36.888  -47.778 -38.466 1.00 38.04 ? 4   U   C O2    1 
ATOM   76   N  N3    . U   A 1 4   ? 36.332  -47.717 -40.664 1.00 35.51 ? 4   U   C N3    1 
ATOM   77   C  C4    . U   A 1 4   ? 35.505  -47.417 -41.725 1.00 36.40 ? 4   U   C C4    1 
ATOM   78   O  O4    . U   A 1 4   ? 35.807  -47.807 -42.859 1.00 35.28 ? 4   U   C O4    1 
ATOM   79   C  C5    . U   A 1 4   ? 34.289  -46.752 -41.359 1.00 36.53 ? 4   U   C C5    1 
ATOM   80   C  C6    . U   A 1 4   ? 34.036  -46.492 -40.072 1.00 35.91 ? 4   U   C C6    1 
ATOM   81   P  P     . A   A 1 5   ? 35.360  -41.743 -36.979 1.00 30.06 ? 5   A   C P     1 
ATOM   82   O  OP1   . A   A 1 5   ? 34.825  -40.668 -36.106 1.00 30.48 ? 5   A   C OP1   1 
ATOM   83   O  OP2   . A   A 1 5   ? 35.106  -41.707 -38.447 1.00 27.98 ? 5   A   C OP2   1 
ATOM   84   O  "O5'" . A   A 1 5   ? 36.927  -41.838 -36.729 1.00 31.68 ? 5   A   C "O5'" 1 
ATOM   85   C  "C5'" . A   A 1 5   ? 37.432  -42.188 -35.444 1.00 30.77 ? 5   A   C "C5'" 1 
ATOM   86   C  "C4'" . A   A 1 5   ? 38.678  -43.014 -35.590 1.00 31.66 ? 5   A   C "C4'" 1 
ATOM   87   O  "O4'" . A   A 1 5   ? 38.361  -44.258 -36.271 1.00 32.83 ? 5   A   C "O4'" 1 
ATOM   88   C  "C3'" . A   A 1 5   ? 39.735  -42.385 -36.476 1.00 31.87 ? 5   A   C "C3'" 1 
ATOM   89   O  "O3'" . A   A 1 5   ? 40.483  -41.426 -35.756 1.00 32.68 ? 5   A   C "O3'" 1 
ATOM   90   C  "C2'" . A   A 1 5   ? 40.558  -43.590 -36.908 1.00 31.38 ? 5   A   C "C2'" 1 
ATOM   91   O  "O2'" . A   A 1 5   ? 41.509  -44.002 -35.952 1.00 31.62 ? 5   A   C "O2'" 1 
ATOM   92   C  "C1'" . A   A 1 5   ? 39.468  -44.654 -37.067 1.00 32.02 ? 5   A   C "C1'" 1 
ATOM   93   N  N9    . A   A 1 5   ? 39.021  -44.778 -38.451 1.00 31.57 ? 5   A   C N9    1 
ATOM   94   C  C8    . A   A 1 5   ? 37.789  -44.509 -38.988 1.00 31.50 ? 5   A   C C8    1 
ATOM   95   N  N7    . A   A 1 5   ? 37.715  -44.735 -40.277 1.00 32.13 ? 5   A   C N7    1 
ATOM   96   C  C5    . A   A 1 5   ? 38.987  -45.181 -40.609 1.00 32.26 ? 5   A   C C5    1 
ATOM   97   C  C6    . A   A 1 5   ? 39.562  -45.595 -41.824 1.00 31.78 ? 5   A   C C6    1 
ATOM   98   N  N6    . A   A 1 5   ? 38.900  -45.648 -42.981 1.00 30.00 ? 5   A   C N6    1 
ATOM   99   N  N1    . A   A 1 5   ? 40.860  -45.965 -41.806 1.00 33.06 ? 5   A   C N1    1 
ATOM   100  C  C2    . A   A 1 5   ? 41.523  -45.928 -40.644 1.00 33.32 ? 5   A   C C2    1 
ATOM   101  N  N3    . A   A 1 5   ? 41.091  -45.572 -39.441 1.00 32.26 ? 5   A   C N3    1 
ATOM   102  C  C4    . A   A 1 5   ? 39.801  -45.205 -39.493 1.00 32.20 ? 5   A   C C4    1 
ATOM   103  P  P     . C   A 1 6   ? 40.908  -40.065 -36.479 1.00 33.50 ? 6   C   C P     1 
ATOM   104  O  OP1   . C   A 1 6   ? 41.241  -39.074 -35.425 1.00 33.68 ? 6   C   C OP1   1 
ATOM   105  O  OP2   . C   A 1 6   ? 39.844  -39.756 -37.458 1.00 34.69 ? 6   C   C OP2   1 
ATOM   106  O  "O5'" . C   A 1 6   ? 42.229  -40.465 -37.283 1.00 35.43 ? 6   C   C "O5'" 1 
ATOM   107  C  "C5'" . C   A 1 6   ? 43.364  -41.017 -36.608 1.00 35.65 ? 6   C   C "C5'" 1 
ATOM   108  C  "C4'" . C   A 1 6   ? 44.293  -41.710 -37.588 1.00 36.83 ? 6   C   C "C4'" 1 
ATOM   109  O  "O4'" . C   A 1 6   ? 43.620  -42.841 -38.202 1.00 36.87 ? 6   C   C "O4'" 1 
ATOM   110  C  "C3'" . C   A 1 6   ? 44.776  -40.899 -38.779 1.00 39.08 ? 6   C   C "C3'" 1 
ATOM   111  O  "O3'" . C   A 1 6   ? 45.868  -40.056 -38.436 1.00 42.54 ? 6   C   C "O3'" 1 
ATOM   112  C  "C2'" . C   A 1 6   ? 45.214  -41.993 -39.743 1.00 38.18 ? 6   C   C "C2'" 1 
ATOM   113  O  "O2'" . C   A 1 6   ? 46.480  -42.527 -39.410 1.00 38.29 ? 6   C   C "O2'" 1 
ATOM   114  C  "C1'" . C   A 1 6   ? 44.133  -43.049 -39.511 1.00 36.97 ? 6   C   C "C1'" 1 
ATOM   115  N  N1    . C   A 1 6   ? 43.025  -42.940 -40.467 1.00 36.70 ? 6   C   C N1    1 
ATOM   116  C  C2    . C   A 1 6   ? 43.216  -43.375 -41.785 1.00 36.92 ? 6   C   C C2    1 
ATOM   117  O  O2    . C   A 1 6   ? 44.308  -43.856 -42.108 1.00 36.77 ? 6   C   C O2    1 
ATOM   118  N  N3    . C   A 1 6   ? 42.206  -43.259 -42.672 1.00 36.63 ? 6   C   C N3    1 
ATOM   119  C  C4    . C   A 1 6   ? 41.038  -42.735 -42.287 1.00 36.70 ? 6   C   C C4    1 
ATOM   120  N  N4    . C   A 1 6   ? 40.065  -42.639 -43.195 1.00 34.51 ? 6   C   C N4    1 
ATOM   121  C  C5    . C   A 1 6   ? 40.816  -42.289 -40.953 1.00 37.22 ? 6   C   C C5    1 
ATOM   122  C  C6    . C   A 1 6   ? 41.825  -42.413 -40.084 1.00 37.36 ? 6   C   C C6    1 
ATOM   123  P  P     . C   A 1 7   ? 46.058  -38.656 -39.205 1.00 44.87 ? 7   C   C P     1 
ATOM   124  O  OP1   . C   A 1 7   ? 47.111  -37.890 -38.487 1.00 44.81 ? 7   C   C OP1   1 
ATOM   125  O  OP2   . C   A 1 7   ? 44.710  -38.059 -39.380 1.00 44.64 ? 7   C   C OP2   1 
ATOM   126  O  "O5'" . C   A 1 7   ? 46.614  -39.072 -40.641 1.00 45.07 ? 7   C   C "O5'" 1 
ATOM   127  C  "C5'" . C   A 1 7   ? 47.934  -39.591 -40.790 1.00 49.25 ? 7   C   C "C5'" 1 
ATOM   128  C  "C4'" . C   A 1 7   ? 48.156  -40.080 -42.206 1.00 52.16 ? 7   C   C "C4'" 1 
ATOM   129  O  "O4'" . C   A 1 7   ? 47.144  -41.075 -42.516 1.00 52.28 ? 7   C   C "O4'" 1 
ATOM   130  C  "C3'" . C   A 1 7   ? 48.000  -39.044 -43.312 1.00 54.89 ? 7   C   C "C3'" 1 
ATOM   131  O  "O3'" . C   A 1 7   ? 49.192  -38.308 -43.551 1.00 58.40 ? 7   C   C "O3'" 1 
ATOM   132  C  "C2'" . C   A 1 7   ? 47.663  -39.910 -44.514 1.00 53.41 ? 7   C   C "C2'" 1 
ATOM   133  O  "O2'" . C   A 1 7   ? 48.806  -40.520 -45.078 1.00 52.73 ? 7   C   C "O2'" 1 
ATOM   134  C  "C1'" . C   A 1 7   ? 46.750  -40.956 -43.875 1.00 52.26 ? 7   C   C "C1'" 1 
ATOM   135  N  N1    . C   A 1 7   ? 45.335  -40.552 -43.916 1.00 50.28 ? 7   C   C N1    1 
ATOM   136  C  C2    . C   A 1 7   ? 44.582  -40.856 -45.051 1.00 49.34 ? 7   C   C C2    1 
ATOM   137  O  O2    . C   A 1 7   ? 45.132  -41.437 -45.991 1.00 50.75 ? 7   C   C O2    1 
ATOM   138  N  N3    . C   A 1 7   ? 43.281  -40.502 -45.100 1.00 49.03 ? 7   C   C N3    1 
ATOM   139  C  C4    . C   A 1 7   ? 42.725  -39.864 -44.067 1.00 49.93 ? 7   C   C C4    1 
ATOM   140  N  N4    . C   A 1 7   ? 41.432  -39.538 -44.155 1.00 49.19 ? 7   C   C N4    1 
ATOM   141  C  C5    . C   A 1 7   ? 43.470  -39.531 -42.898 1.00 49.92 ? 7   C   C C5    1 
ATOM   142  C  C6    . C   A 1 7   ? 44.758  -39.896 -42.864 1.00 50.34 ? 7   C   C C6    1 
ATOM   143  P  P     . C   A 1 8   ? 49.115  -36.936 -44.377 1.00 62.74 ? 8   C   C P     1 
ATOM   144  O  OP1   . C   A 1 8   ? 50.505  -36.508 -44.692 1.00 62.78 ? 8   C   C OP1   1 
ATOM   145  O  OP2   . C   A 1 8   ? 48.207  -36.014 -43.641 1.00 61.76 ? 8   C   C OP2   1 
ATOM   146  O  "O5'" . C   A 1 8   ? 48.402  -37.341 -45.746 1.00 62.15 ? 8   C   C "O5'" 1 
ATOM   147  C  "C5'" . C   A 1 8   ? 49.036  -38.193 -46.700 1.00 61.58 ? 8   C   C "C5'" 1 
ATOM   148  C  "C4'" . C   A 1 8   ? 48.149  -38.347 -47.913 1.00 61.83 ? 8   C   C "C4'" 1 
ATOM   149  O  "O4'" . C   A 1 8   ? 46.884  -38.934 -47.510 1.00 61.18 ? 8   C   C "O4'" 1 
ATOM   150  C  "C3'" . C   A 1 8   ? 47.746  -37.036 -48.566 1.00 61.50 ? 8   C   C "C3'" 1 
ATOM   151  O  "O3'" . C   A 1 8   ? 48.803  -36.557 -49.385 1.00 62.00 ? 8   C   C "O3'" 1 
ATOM   152  C  "C2'" . C   A 1 8   ? 46.459  -37.412 -49.286 1.00 61.13 ? 8   C   C "C2'" 1 
ATOM   153  O  "O2'" . C   A 1 8   ? 46.699  -38.099 -50.496 1.00 60.50 ? 8   C   C "O2'" 1 
ATOM   154  C  "C1'" . C   A 1 8   ? 45.831  -38.374 -48.278 1.00 61.30 ? 8   C   C "C1'" 1 
ATOM   155  N  N1    . C   A 1 8   ? 44.881  -37.737 -47.353 1.00 61.77 ? 8   C   C N1    1 
ATOM   156  C  C2    . C   A 1 8   ? 43.529  -37.701 -47.704 1.00 61.77 ? 8   C   C C2    1 
ATOM   157  O  O2    . C   A 1 8   ? 43.186  -38.173 -48.796 1.00 61.94 ? 8   C   C O2    1 
ATOM   158  N  N3    . C   A 1 8   ? 42.634  -37.159 -46.842 1.00 61.56 ? 8   C   C N3    1 
ATOM   159  C  C4    . C   A 1 8   ? 43.051  -36.646 -45.679 1.00 61.40 ? 8   C   C C4    1 
ATOM   160  N  N4    . C   A 1 8   ? 42.131  -36.143 -44.853 1.00 60.66 ? 8   C   C N4    1 
ATOM   161  C  C5    . C   A 1 8   ? 44.430  -36.639 -45.309 1.00 61.62 ? 8   C   C C5    1 
ATOM   162  C  C6    . C   A 1 8   ? 45.303  -37.191 -46.169 1.00 62.19 ? 8   C   C C6    1 
ATOM   163  O  "O5'" . G   B 2 2   ? 36.797  -42.930 -54.264 1.00 54.32 ? 2   G   D "O5'" 1 
ATOM   164  C  "C5'" . G   B 2 2   ? 37.850  -43.709 -53.669 1.00 55.67 ? 2   G   D "C5'" 1 
ATOM   165  C  "C4'" . G   B 2 2   ? 39.283  -43.327 -54.013 1.00 54.93 ? 2   G   D "C4'" 1 
ATOM   166  O  "O4'" . G   B 2 2   ? 39.520  -41.920 -53.695 1.00 55.82 ? 2   G   D "O4'" 1 
ATOM   167  C  "C3'" . G   B 2 2   ? 40.328  -44.093 -53.208 1.00 54.44 ? 2   G   D "C3'" 1 
ATOM   168  O  "O3'" . G   B 2 2   ? 40.683  -45.330 -53.814 1.00 51.84 ? 2   G   D "O3'" 1 
ATOM   169  C  "C2'" . G   B 2 2   ? 41.497  -43.120 -53.142 1.00 54.17 ? 2   G   D "C2'" 1 
ATOM   170  O  "O2'" . G   B 2 2   ? 42.321  -43.167 -54.288 1.00 54.64 ? 2   G   D "O2'" 1 
ATOM   171  C  "C1'" . G   B 2 2   ? 40.765  -41.778 -53.012 1.00 54.67 ? 2   G   D "C1'" 1 
ATOM   172  N  N9    . G   B 2 2   ? 40.466  -41.472 -51.613 1.00 53.75 ? 2   G   D N9    1 
ATOM   173  C  C8    . G   B 2 2   ? 39.221  -41.248 -51.071 1.00 53.63 ? 2   G   D C8    1 
ATOM   174  N  N7    . G   B 2 2   ? 39.246  -41.089 -49.774 1.00 52.97 ? 2   G   D N7    1 
ATOM   175  C  C5    . G   B 2 2   ? 40.589  -41.197 -49.441 1.00 52.51 ? 2   G   D C5    1 
ATOM   176  C  C6    . G   B 2 2   ? 41.227  -41.135 -48.178 1.00 51.12 ? 2   G   D C6    1 
ATOM   177  O  O6    . G   B 2 2   ? 40.712  -40.988 -47.068 1.00 50.97 ? 2   G   D O6    1 
ATOM   178  N  N1    . G   B 2 2   ? 42.606  -41.277 -48.290 1.00 50.59 ? 2   G   D N1    1 
ATOM   179  C  C2    . G   B 2 2   ? 43.286  -41.465 -49.464 1.00 51.21 ? 2   G   D C2    1 
ATOM   180  N  N2    . G   B 2 2   ? 44.619  -41.578 -49.361 1.00 52.07 ? 2   G   D N2    1 
ATOM   181  N  N3    . G   B 2 2   ? 42.703  -41.539 -50.653 1.00 52.53 ? 2   G   D N3    1 
ATOM   182  C  C4    . G   B 2 2   ? 41.363  -41.401 -50.566 1.00 53.02 ? 2   G   D C4    1 
ATOM   183  P  P     . G   B 2 3   ? 40.863  -46.635 -52.891 1.00 52.53 ? 3   G   D P     1 
ATOM   184  O  OP1   . G   B 2 3   ? 40.976  -47.838 -53.759 1.00 50.57 ? 3   G   D OP1   1 
ATOM   185  O  OP2   . G   B 2 3   ? 39.808  -46.580 -51.838 1.00 51.03 ? 3   G   D OP2   1 
ATOM   186  O  "O5'" . G   B 2 3   ? 42.272  -46.413 -52.187 1.00 50.91 ? 3   G   D "O5'" 1 
ATOM   187  C  "C5'" . G   B 2 3   ? 43.476  -46.460 -52.937 1.00 50.89 ? 3   G   D "C5'" 1 
ATOM   188  C  "C4'" . G   B 2 3   ? 44.649  -46.240 -52.024 1.00 51.09 ? 3   G   D "C4'" 1 
ATOM   189  O  "O4'" . G   B 2 3   ? 44.532  -44.918 -51.429 1.00 50.77 ? 3   G   D "O4'" 1 
ATOM   190  C  "C3'" . G   B 2 3   ? 44.689  -47.172 -50.825 1.00 51.38 ? 3   G   D "C3'" 1 
ATOM   191  O  "O3'" . G   B 2 3   ? 45.289  -48.422 -51.122 1.00 51.25 ? 3   G   D "O3'" 1 
ATOM   192  C  "C2'" . G   B 2 3   ? 45.508  -46.368 -49.829 1.00 51.11 ? 3   G   D "C2'" 1 
ATOM   193  O  "O2'" . G   B 2 3   ? 46.892  -46.407 -50.103 1.00 49.85 ? 3   G   D "O2'" 1 
ATOM   194  C  "C1'" . G   B 2 3   ? 44.953  -44.963 -50.072 1.00 51.67 ? 3   G   D "C1'" 1 
ATOM   195  N  N9    . G   B 2 3   ? 43.795  -44.683 -49.228 1.00 51.48 ? 3   G   D N9    1 
ATOM   196  C  C8    . G   B 2 3   ? 42.486  -44.574 -49.634 1.00 51.07 ? 3   G   D C8    1 
ATOM   197  N  N7    . G   B 2 3   ? 41.662  -44.331 -48.649 1.00 50.33 ? 3   G   D N7    1 
ATOM   198  C  C5    . G   B 2 3   ? 42.473  -44.273 -47.526 1.00 50.34 ? 3   G   D C5    1 
ATOM   199  C  C6    . G   B 2 3   ? 42.139  -44.041 -46.169 1.00 49.84 ? 3   G   D C6    1 
ATOM   200  O  O6    . G   B 2 3   ? 41.032  -43.832 -45.680 1.00 50.60 ? 3   G   D O6    1 
ATOM   201  N  N1    . G   B 2 3   ? 43.261  -44.068 -45.351 1.00 49.53 ? 3   G   D N1    1 
ATOM   202  C  C2    . G   B 2 3   ? 44.542  -44.287 -45.782 1.00 50.60 ? 3   G   D C2    1 
ATOM   203  N  N2    . G   B 2 3   ? 45.493  -44.268 -44.830 1.00 51.50 ? 3   G   D N2    1 
ATOM   204  N  N3    . G   B 2 3   ? 44.872  -44.505 -47.050 1.00 50.73 ? 3   G   D N3    1 
ATOM   205  C  C4    . G   B 2 3   ? 43.792  -44.484 -47.859 1.00 51.03 ? 3   G   D C4    1 
ATOM   206  P  P     . U   B 2 4   ? 44.789  -49.738 -50.349 1.00 52.08 ? 4   U   D P     1 
ATOM   207  O  OP1   . U   B 2 4   ? 45.603  -50.882 -50.843 1.00 53.58 ? 4   U   D OP1   1 
ATOM   208  O  OP2   . U   B 2 4   ? 43.306  -49.791 -50.444 1.00 52.47 ? 4   U   D OP2   1 
ATOM   209  O  "O5'" . U   B 2 4   ? 45.163  -49.468 -48.822 1.00 51.12 ? 4   U   D "O5'" 1 
ATOM   210  C  "C5'" . U   B 2 4   ? 46.521  -49.390 -48.395 1.00 47.07 ? 4   U   D "C5'" 1 
ATOM   211  C  "C4'" . U   B 2 4   ? 46.594  -49.065 -46.917 1.00 44.54 ? 4   U   D "C4'" 1 
ATOM   212  O  "O4'" . U   B 2 4   ? 45.927  -47.796 -46.679 1.00 43.95 ? 4   U   D "O4'" 1 
ATOM   213  C  "C3'" . U   B 2 4   ? 45.884  -50.006 -45.957 1.00 43.83 ? 4   U   D "C3'" 1 
ATOM   214  O  "O3'" . U   B 2 4   ? 46.646  -51.178 -45.680 1.00 43.58 ? 4   U   D "O3'" 1 
ATOM   215  C  "C2'" . U   B 2 4   ? 45.736  -49.118 -44.727 1.00 43.37 ? 4   U   D "C2'" 1 
ATOM   216  O  "O2'" . U   B 2 4   ? 46.944  -48.962 -44.003 1.00 42.17 ? 4   U   D "O2'" 1 
ATOM   217  C  "C1'" . U   B 2 4   ? 45.366  -47.784 -45.375 1.00 42.41 ? 4   U   D "C1'" 1 
ATOM   218  N  N1    . U   B 2 4   ? 43.914  -47.564 -45.485 1.00 40.95 ? 4   U   D N1    1 
ATOM   219  C  C2    . U   B 2 4   ? 43.252  -47.109 -44.360 1.00 40.20 ? 4   U   D C2    1 
ATOM   220  O  O2    . U   B 2 4   ? 43.817  -46.901 -43.302 1.00 38.67 ? 4   U   D O2    1 
ATOM   221  N  N3    . U   B 2 4   ? 41.901  -46.911 -44.519 1.00 39.48 ? 4   U   D N3    1 
ATOM   222  C  C4    . U   B 2 4   ? 41.156  -47.120 -45.662 1.00 39.29 ? 4   U   D C4    1 
ATOM   223  O  O4    . U   B 2 4   ? 39.938  -46.923 -45.637 1.00 37.80 ? 4   U   D O4    1 
ATOM   224  C  C5    . U   B 2 4   ? 41.909  -47.593 -46.785 1.00 39.50 ? 4   U   D C5    1 
ATOM   225  C  C6    . U   B 2 4   ? 43.230  -47.794 -46.662 1.00 40.80 ? 4   U   D C6    1 
ATOM   226  P  P     . A   B 2 5   ? 45.888  -52.558 -45.329 1.00 43.28 ? 5   A   D P     1 
ATOM   227  O  OP1   . A   B 2 5   ? 46.888  -53.654 -45.361 1.00 42.78 ? 5   A   D OP1   1 
ATOM   228  O  OP2   . A   B 2 5   ? 44.669  -52.644 -46.178 1.00 41.21 ? 5   A   D OP2   1 
ATOM   229  O  "O5'" . A   B 2 5   ? 45.405  -52.363 -43.825 1.00 41.98 ? 5   A   D "O5'" 1 
ATOM   230  C  "C5'" . A   B 2 5   ? 46.275  -51.803 -42.850 1.00 40.41 ? 5   A   D "C5'" 1 
ATOM   231  C  "C4'" . A   B 2 5   ? 45.517  -51.514 -41.577 1.00 39.72 ? 5   A   D "C4'" 1 
ATOM   232  O  "O4'" . A   B 2 5   ? 44.738  -50.291 -41.691 1.00 39.37 ? 5   A   D "O4'" 1 
ATOM   233  C  "C3'" . A   B 2 5   ? 44.486  -52.555 -41.192 1.00 39.41 ? 5   A   D "C3'" 1 
ATOM   234  O  "O3'" . A   B 2 5   ? 45.082  -53.683 -40.580 1.00 39.91 ? 5   A   D "O3'" 1 
ATOM   235  C  "C2'" . A   B 2 5   ? 43.622  -51.770 -40.219 1.00 39.09 ? 5   A   D "C2'" 1 
ATOM   236  O  "O2'" . A   B 2 5   ? 44.275  -51.632 -38.973 1.00 37.07 ? 5   A   D "O2'" 1 
ATOM   237  C  "C1'" . A   B 2 5   ? 43.541  -50.415 -40.928 1.00 38.53 ? 5   A   D "C1'" 1 
ATOM   238  N  N9    . A   B 2 5   ? 42.399  -50.310 -41.844 1.00 37.76 ? 5   A   D N9    1 
ATOM   239  C  C8    . A   B 2 5   ? 42.345  -50.729 -43.150 1.00 38.16 ? 5   A   D C8    1 
ATOM   240  N  N7    . A   B 2 5   ? 41.195  -50.494 -43.736 1.00 38.28 ? 5   A   D N7    1 
ATOM   241  C  C5    . A   B 2 5   ? 40.437  -49.884 -42.748 1.00 37.79 ? 5   A   D C5    1 
ATOM   242  C  C6    . A   B 2 5   ? 39.120  -49.390 -42.736 1.00 38.25 ? 5   A   D C6    1 
ATOM   243  N  N6    . A   B 2 5   ? 38.297  -49.437 -43.789 1.00 38.01 ? 5   A   D N6    1 
ATOM   244  N  N1    . A   B 2 5   ? 38.669  -48.840 -41.589 1.00 37.96 ? 5   A   D N1    1 
ATOM   245  C  C2    . A   B 2 5   ? 39.487  -48.797 -40.535 1.00 37.22 ? 5   A   D C2    1 
ATOM   246  N  N3    . A   B 2 5   ? 40.742  -49.226 -40.421 1.00 37.27 ? 5   A   D N3    1 
ATOM   247  C  C4    . A   B 2 5   ? 41.165  -49.766 -41.576 1.00 37.55 ? 5   A   D C4    1 
ATOM   248  P  P     . G   B 2 6   ? 44.168  -54.944 -40.196 1.00 40.64 ? 6   G   D P     1 
ATOM   249  O  OP1   . G   B 2 6   ? 45.028  -56.029 -39.657 1.00 41.15 ? 6   G   D OP1   1 
ATOM   250  O  OP2   . G   B 2 6   ? 43.224  -55.236 -41.307 1.00 39.90 ? 6   G   D OP2   1 
ATOM   251  O  "O5'" . G   B 2 6   ? 43.315  -54.405 -38.978 1.00 40.30 ? 6   G   D "O5'" 1 
ATOM   252  C  "C5'" . G   B 2 6   ? 42.216  -55.148 -38.521 1.00 40.83 ? 6   G   D "C5'" 1 
ATOM   253  C  "C4'" . G   B 2 6   ? 41.539  -54.425 -37.405 1.00 40.16 ? 6   G   D "C4'" 1 
ATOM   254  O  "O4'" . G   B 2 6   ? 41.417  -53.019 -37.744 1.00 39.09 ? 6   G   D "O4'" 1 
ATOM   255  C  "C3'" . G   B 2 6   ? 40.119  -54.903 -37.226 1.00 40.30 ? 6   G   D "C3'" 1 
ATOM   256  O  "O3'" . G   B 2 6   ? 40.094  -56.089 -36.455 1.00 41.11 ? 6   G   D "O3'" 1 
ATOM   257  C  "C2'" . G   B 2 6   ? 39.449  -53.677 -36.629 1.00 39.34 ? 6   G   D "C2'" 1 
ATOM   258  O  "O2'" . G   B 2 6   ? 39.767  -53.479 -35.267 1.00 41.92 ? 6   G   D "O2'" 1 
ATOM   259  C  "C1'" . G   B 2 6   ? 40.098  -52.577 -37.471 1.00 37.69 ? 6   G   D "C1'" 1 
ATOM   260  N  N9    . G   B 2 6   ? 39.433  -52.388 -38.756 1.00 34.17 ? 6   G   D N9    1 
ATOM   261  C  C8    . G   B 2 6   ? 39.946  -52.668 -40.001 1.00 32.54 ? 6   G   D C8    1 
ATOM   262  N  N7    . G   B 2 6   ? 39.113  -52.409 -40.970 1.00 29.79 ? 6   G   D N7    1 
ATOM   263  C  C5    . G   B 2 6   ? 37.985  -51.928 -40.327 1.00 29.51 ? 6   G   D C5    1 
ATOM   264  C  C6    . G   B 2 6   ? 36.762  -51.497 -40.853 1.00 27.51 ? 6   G   D C6    1 
ATOM   265  O  O6    . G   B 2 6   ? 36.409  -51.460 -42.029 1.00 26.66 ? 6   G   D O6    1 
ATOM   266  N  N1    . G   B 2 6   ? 35.893  -51.082 -39.852 1.00 28.77 ? 6   G   D N1    1 
ATOM   267  C  C2    . G   B 2 6   ? 36.170  -51.088 -38.507 1.00 28.86 ? 6   G   D C2    1 
ATOM   268  N  N2    . G   B 2 6   ? 35.209  -50.635 -37.697 1.00 27.87 ? 6   G   D N2    1 
ATOM   269  N  N3    . G   B 2 6   ? 37.310  -51.503 -37.998 1.00 30.25 ? 6   G   D N3    1 
ATOM   270  C  C4    . G   B 2 6   ? 38.167  -51.903 -38.961 1.00 31.77 ? 6   G   D C4    1 
ATOM   271  P  P     . G   B 2 7   ? 39.457  -57.417 -37.093 1.00 42.02 ? 7   G   D P     1 
ATOM   272  O  OP1   . G   B 2 7   ? 39.914  -58.553 -36.253 1.00 41.92 ? 7   G   D OP1   1 
ATOM   273  O  OP2   . G   B 2 7   ? 39.749  -57.419 -38.551 1.00 41.75 ? 7   G   D OP2   1 
ATOM   274  O  "O5'" . G   B 2 7   ? 37.889  -57.188 -36.902 1.00 40.76 ? 7   G   D "O5'" 1 
ATOM   275  C  "C5'" . G   B 2 7   ? 37.379  -56.816 -35.627 1.00 42.13 ? 7   G   D "C5'" 1 
ATOM   276  C  "C4'" . G   B 2 7   ? 36.073  -56.060 -35.750 1.00 40.89 ? 7   G   D "C4'" 1 
ATOM   277  O  "O4'" . G   B 2 7   ? 36.261  -54.808 -36.466 1.00 39.88 ? 7   G   D "O4'" 1 
ATOM   278  C  "C3'" . G   B 2 7   ? 34.949  -56.715 -36.529 1.00 40.84 ? 7   G   D "C3'" 1 
ATOM   279  O  "O3'" . G   B 2 7   ? 34.337  -57.788 -35.821 1.00 40.94 ? 7   G   D "O3'" 1 
ATOM   280  C  "C2'" . G   B 2 7   ? 34.025  -55.523 -36.727 1.00 39.87 ? 7   G   D "C2'" 1 
ATOM   281  O  "O2'" . G   B 2 7   ? 33.381  -55.125 -35.537 1.00 39.29 ? 7   G   D "O2'" 1 
ATOM   282  C  "C1'" . G   B 2 7   ? 35.041  -54.448 -37.107 1.00 39.49 ? 7   G   D "C1'" 1 
ATOM   283  N  N9    . G   B 2 7   ? 35.248  -54.457 -38.553 1.00 38.43 ? 7   G   D N9    1 
ATOM   284  C  C8    . G   B 2 7   ? 36.350  -54.912 -39.235 1.00 37.68 ? 7   G   D C8    1 
ATOM   285  N  N7    . G   B 2 7   ? 36.214  -54.837 -40.532 1.00 38.21 ? 7   G   D N7    1 
ATOM   286  C  C5    . G   B 2 7   ? 34.950  -54.290 -40.718 1.00 37.02 ? 7   G   D C5    1 
ATOM   287  C  C6    . G   B 2 7   ? 34.247  -53.980 -41.911 1.00 36.54 ? 7   G   D C6    1 
ATOM   288  O  O6    . G   B 2 7   ? 34.607  -54.141 -43.081 1.00 37.05 ? 7   G   D O6    1 
ATOM   289  N  N1    . G   B 2 7   ? 33.001  -53.428 -41.643 1.00 36.40 ? 7   G   D N1    1 
ATOM   290  C  C2    . G   B 2 7   ? 32.493  -53.203 -40.394 1.00 36.84 ? 7   G   D C2    1 
ATOM   291  N  N2    . G   B 2 7   ? 31.274  -52.640 -40.353 1.00 36.58 ? 7   G   D N2    1 
ATOM   292  N  N3    . G   B 2 7   ? 33.130  -53.501 -39.271 1.00 36.82 ? 7   G   D N3    1 
ATOM   293  C  C4    . G   B 2 7   ? 34.346  -54.036 -39.507 1.00 37.10 ? 7   G   D C4    1 
ATOM   294  P  P     . C   B 2 8   ? 33.599  -58.952 -36.643 1.00 40.12 ? 8   C   D P     1 
ATOM   295  O  OP1   . C   B 2 8   ? 33.336  -60.089 -35.729 1.00 40.46 ? 8   C   D OP1   1 
ATOM   296  O  OP2   . C   B 2 8   ? 34.345  -59.184 -37.905 1.00 39.05 ? 8   C   D OP2   1 
ATOM   297  O  "O5'" . C   B 2 8   ? 32.203  -58.287 -37.008 1.00 38.71 ? 8   C   D "O5'" 1 
ATOM   298  C  "C5'" . C   B 2 8   ? 31.463  -57.570 -36.027 1.00 36.41 ? 8   C   D "C5'" 1 
ATOM   299  C  "C4'" . C   B 2 8   ? 30.306  -56.848 -36.673 1.00 34.96 ? 8   C   D "C4'" 1 
ATOM   300  O  "O4'" . C   B 2 8   ? 30.806  -55.812 -37.554 1.00 35.75 ? 8   C   D "O4'" 1 
ATOM   301  C  "C3'" . C   B 2 8   ? 29.438  -57.698 -37.582 1.00 32.91 ? 8   C   D "C3'" 1 
ATOM   302  O  "O3'" . C   B 2 8   ? 28.474  -58.397 -36.832 1.00 30.45 ? 8   C   D "O3'" 1 
ATOM   303  C  "C2'" . C   B 2 8   ? 28.778  -56.649 -38.456 1.00 34.01 ? 8   C   D "C2'" 1 
ATOM   304  O  "O2'" . C   B 2 8   ? 27.713  -55.985 -37.811 1.00 35.05 ? 8   C   D "O2'" 1 
ATOM   305  C  "C1'" . C   B 2 8   ? 29.943  -55.687 -38.675 1.00 35.13 ? 8   C   D "C1'" 1 
ATOM   306  N  N1    . C   B 2 8   ? 30.693  -56.040 -39.885 1.00 35.60 ? 8   C   D N1    1 
ATOM   307  C  C2    . C   B 2 8   ? 30.098  -55.818 -41.121 1.00 36.75 ? 8   C   D C2    1 
ATOM   308  O  O2    . C   B 2 8   ? 28.961  -55.336 -41.153 1.00 38.29 ? 8   C   D O2    1 
ATOM   309  N  N3    . C   B 2 8   ? 30.770  -56.135 -42.248 1.00 36.56 ? 8   C   D N3    1 
ATOM   310  C  C4    . C   B 2 8   ? 31.990  -56.668 -42.167 1.00 36.05 ? 8   C   D C4    1 
ATOM   311  N  N4    . C   B 2 8   ? 32.614  -56.978 -43.303 1.00 37.18 ? 8   C   D N4    1 
ATOM   312  C  C5    . C   B 2 8   ? 32.623  -56.909 -40.917 1.00 36.16 ? 8   C   D C5    1 
ATOM   313  C  C6    . C   B 2 8   ? 31.945  -56.580 -39.810 1.00 36.39 ? 8   C   D C6    1 
ATOM   314  P  P     . U   B 2 9   ? 28.119  -59.902 -37.221 1.00 29.83 ? 9   U   D P     1 
ATOM   315  O  OP1   . U   B 2 9   ? 29.373  -60.694 -37.210 1.00 28.86 ? 9   U   D OP1   1 
ATOM   316  O  OP2   . U   B 2 9   ? 27.291  -59.852 -38.460 1.00 27.85 ? 9   U   D OP2   1 
ATOM   317  O  "O5'" . U   B 2 9   ? 27.215  -60.387 -36.001 1.00 27.82 ? 9   U   D "O5'" 1 
ATOM   318  C  "C5'" . U   B 2 9   ? 25.911  -59.858 -35.797 1.00 28.86 ? 9   U   D "C5'" 1 
ATOM   319  C  "C4'" . U   B 2 9   ? 25.886  -59.011 -34.547 1.00 30.10 ? 9   U   D "C4'" 1 
ATOM   320  O  "O4'" . U   B 2 9   ? 26.345  -59.818 -33.446 1.00 30.89 ? 9   U   D "O4'" 1 
ATOM   321  C  "C3'" . U   B 2 9   ? 26.840  -57.817 -34.542 1.00 31.65 ? 9   U   D "C3'" 1 
ATOM   322  O  "O3'" . U   B 2 9   ? 26.235  -56.600 -35.002 1.00 32.45 ? 9   U   D "O3'" 1 
ATOM   323  C  "C2'" . U   B 2 9   ? 27.135  -57.598 -33.058 1.00 32.64 ? 9   U   D "C2'" 1 
ATOM   324  O  "O2'" . U   B 2 9   ? 26.337  -56.585 -32.478 1.00 37.35 ? 9   U   D "O2'" 1 
ATOM   325  C  "C1'" . U   B 2 9   ? 26.801  -58.957 -32.435 1.00 31.34 ? 9   U   D "C1'" 1 
ATOM   326  N  N1    . U   B 2 9   ? 27.888  -59.590 -31.685 1.00 30.25 ? 9   U   D N1    1 
ATOM   327  C  C2    . U   B 2 9   ? 27.956  -59.286 -30.343 1.00 30.63 ? 9   U   D C2    1 
ATOM   328  O  O2    . U   B 2 9   ? 27.162  -58.542 -29.798 1.00 30.76 ? 9   U   D O2    1 
ATOM   329  N  N3    . U   B 2 9   ? 28.989  -59.877 -29.664 1.00 30.56 ? 9   U   D N3    1 
ATOM   330  C  C4    . U   B 2 9   ? 29.946  -60.717 -30.185 1.00 30.32 ? 9   U   D C4    1 
ATOM   331  O  O4    . U   B 2 9   ? 30.822  -61.150 -29.447 1.00 30.25 ? 9   U   D O4    1 
ATOM   332  C  C5    . U   B 2 9   ? 29.809  -60.991 -31.588 1.00 30.20 ? 9   U   D C5    1 
ATOM   333  C  C6    . U   B 2 9   ? 28.803  -60.433 -32.274 1.00 30.78 ? 9   U   D C6    1 
ATOM   334  P  P     . U   B 2 10  ? 24.639  -56.511 -35.205 1.00 31.89 ? 10  U   D P     1 
ATOM   335  O  OP1   . U   B 2 10  ? 23.940  -57.175 -34.092 1.00 31.18 ? 10  U   D OP1   1 
ATOM   336  O  OP2   . U   B 2 10  ? 24.339  -56.909 -36.600 1.00 32.40 ? 10  U   D OP2   1 
ATOM   337  O  "O5'" . U   B 2 10  ? 24.286  -54.969 -35.089 1.00 32.53 ? 10  U   D "O5'" 1 
ATOM   338  C  "C5'" . U   B 2 10  ? 25.212  -53.964 -34.665 1.00 34.50 ? 10  U   D "C5'" 1 
ATOM   339  C  "C4'" . U   B 2 10  ? 24.690  -52.640 -35.161 1.00 36.37 ? 10  U   D "C4'" 1 
ATOM   340  O  "O4'" . U   B 2 10  ? 25.180  -52.412 -36.505 1.00 37.44 ? 10  U   D "O4'" 1 
ATOM   341  C  "C3'" . U   B 2 10  ? 23.175  -52.744 -35.295 1.00 37.43 ? 10  U   D "C3'" 1 
ATOM   342  O  "O3'" . U   B 2 10  ? 22.473  -52.399 -34.077 1.00 36.36 ? 10  U   D "O3'" 1 
ATOM   343  C  "C2'" . U   B 2 10  ? 22.814  -52.087 -36.634 1.00 37.67 ? 10  U   D "C2'" 1 
ATOM   344  O  "O2'" . U   B 2 10  ? 21.951  -50.980 -36.618 1.00 40.85 ? 10  U   D "O2'" 1 
ATOM   345  C  "C1'" . U   B 2 10  ? 24.177  -51.798 -37.284 1.00 38.19 ? 10  U   D "C1'" 1 
ATOM   346  N  N1    . U   B 2 10  ? 24.303  -52.237 -38.683 1.00 39.10 ? 10  U   D N1    1 
ATOM   347  C  C2    . U   B 2 10  ? 25.293  -53.151 -39.011 1.00 41.29 ? 10  U   D C2    1 
ATOM   348  O  O2    . U   B 2 10  ? 26.053  -53.631 -38.190 1.00 45.30 ? 10  U   D O2    1 
ATOM   349  N  N3    . U   B 2 10  ? 25.376  -53.472 -40.344 1.00 40.09 ? 10  U   D N3    1 
ATOM   350  C  C4    . U   B 2 10  ? 24.598  -52.980 -41.361 1.00 40.16 ? 10  U   D C4    1 
ATOM   351  O  O4    . U   B 2 10  ? 24.772  -53.384 -42.513 1.00 40.26 ? 10  U   D O4    1 
ATOM   352  C  C5    . U   B 2 10  ? 23.605  -52.038 -40.946 1.00 39.45 ? 10  U   D C5    1 
ATOM   353  C  C6    . U   B 2 10  ? 23.486  -51.716 -39.654 1.00 39.02 ? 10  U   D C6    1 
ATOM   354  P  P     . U   B 2 11  ? 22.358  -50.851 -33.580 1.00 35.59 ? 11  U   D P     1 
ATOM   355  O  OP1   . U   B 2 11  ? 21.514  -50.874 -32.370 1.00 35.67 ? 11  U   D OP1   1 
ATOM   356  O  OP2   . U   B 2 11  ? 21.972  -49.951 -34.700 1.00 37.04 ? 11  U   D OP2   1 
ATOM   357  O  "O5'" . U   B 2 11  ? 23.838  -50.454 -33.098 1.00 34.04 ? 11  U   D "O5'" 1 
ATOM   358  C  "C5'" . U   B 2 11  ? 24.212  -49.104 -32.712 1.00 29.15 ? 11  U   D "C5'" 1 
ATOM   359  C  "C4'" . U   B 2 11  ? 25.638  -48.843 -33.149 1.00 28.20 ? 11  U   D "C4'" 1 
ATOM   360  O  "O4'" . U   B 2 11  ? 25.781  -49.378 -34.455 1.00 30.30 ? 11  U   D "O4'" 1 
ATOM   361  C  "C3'" . U   B 2 11  ? 26.247  -47.433 -33.179 1.00 27.37 ? 11  U   D "C3'" 1 
ATOM   362  O  "O3'" . U   B 2 11  ? 27.183  -47.449 -32.088 1.00 24.83 ? 11  U   D "O3'" 1 
ATOM   363  C  "C2'" . U   B 2 11  ? 27.055  -47.379 -34.493 1.00 28.78 ? 11  U   D "C2'" 1 
ATOM   364  O  "O2'" . U   B 2 11  ? 28.409  -47.063 -34.282 1.00 31.02 ? 11  U   D "O2'" 1 
ATOM   365  C  "C1'" . U   B 2 11  ? 26.916  -48.815 -35.019 1.00 29.52 ? 11  U   D "C1'" 1 
ATOM   366  N  N1    . U   B 2 11  ? 26.979  -49.218 -36.424 1.00 28.13 ? 11  U   D N1    1 
ATOM   367  C  C2    . U   B 2 11  ? 27.860  -50.237 -36.703 1.00 29.01 ? 11  U   D C2    1 
ATOM   368  O  O2    . U   B 2 11  ? 28.620  -50.701 -35.859 1.00 28.27 ? 11  U   D O2    1 
ATOM   369  N  N3    . U   B 2 11  ? 27.831  -50.692 -37.995 1.00 28.50 ? 11  U   D N3    1 
ATOM   370  C  C4    . U   B 2 11  ? 27.051  -50.214 -39.010 1.00 28.50 ? 11  U   D C4    1 
ATOM   371  O  O4    . U   B 2 11  ? 27.103  -50.751 -40.112 1.00 29.69 ? 11  U   D O4    1 
ATOM   372  C  C5    . U   B 2 11  ? 26.204  -49.124 -38.651 1.00 28.47 ? 11  U   D C5    1 
ATOM   373  C  C6    . U   B 2 11  ? 26.197  -48.674 -37.397 1.00 29.01 ? 11  U   D C6    1 
ATOM   374  P  P     . U   B 2 12  ? 27.787  -46.101 -31.460 1.00 24.38 ? 12  U   D P     1 
ATOM   375  O  OP1   . U   B 2 12  ? 26.696  -45.134 -31.271 1.00 27.68 ? 12  U   D OP1   1 
ATOM   376  O  OP2   . U   B 2 12  ? 29.019  -45.688 -32.156 1.00 23.21 ? 12  U   D OP2   1 
ATOM   377  O  "O5'" . U   B 2 12  ? 28.207  -46.585 -30.005 1.00 25.52 ? 12  U   D "O5'" 1 
ATOM   378  C  "C5'" . U   B 2 12  ? 27.360  -47.453 -29.248 1.00 24.48 ? 12  U   D "C5'" 1 
ATOM   379  C  "C4'" . U   B 2 12  ? 28.140  -48.681 -28.849 1.00 25.19 ? 12  U   D "C4'" 1 
ATOM   380  O  "O4'" . U   B 2 12  ? 28.568  -49.376 -30.023 1.00 25.28 ? 12  U   D "O4'" 1 
ATOM   381  C  "C3'" . U   B 2 12  ? 29.397  -48.371 -28.032 1.00 26.47 ? 12  U   D "C3'" 1 
ATOM   382  O  "O3'" . U   B 2 12  ? 29.135  -48.963 -26.751 1.00 23.49 ? 12  U   D "O3'" 1 
ATOM   383  C  "C2'" . U   B 2 12  ? 30.561  -49.091 -28.731 1.00 27.10 ? 12  U   D "C2'" 1 
ATOM   384  O  "O2'" . U   B 2 12  ? 31.387  -49.853 -27.885 1.00 32.33 ? 12  U   D "O2'" 1 
ATOM   385  C  "C1'" . U   B 2 12  ? 29.831  -49.936 -29.778 1.00 26.84 ? 12  U   D "C1'" 1 
ATOM   386  N  N1    . U   B 2 12  ? 30.469  -50.261 -31.056 1.00 27.37 ? 12  U   D N1    1 
ATOM   387  C  C2    . U   B 2 12  ? 31.236  -51.405 -31.099 1.00 27.42 ? 12  U   D C2    1 
ATOM   388  O  O2    . U   B 2 12  ? 31.453  -52.114 -30.118 1.00 26.20 ? 12  U   D O2    1 
ATOM   389  N  N3    . U   B 2 12  ? 31.748  -51.697 -32.333 1.00 26.95 ? 12  U   D N3    1 
ATOM   390  C  C4    . U   B 2 12  ? 31.565  -50.989 -33.504 1.00 27.47 ? 12  U   D C4    1 
ATOM   391  O  O4    . U   B 2 12  ? 31.969  -51.463 -34.574 1.00 28.36 ? 12  U   D O4    1 
ATOM   392  C  C5    . U   B 2 12  ? 30.790  -49.805 -33.365 1.00 28.43 ? 12  U   D C5    1 
ATOM   393  C  C6    . U   B 2 12  ? 30.282  -49.485 -32.177 1.00 28.07 ? 12  U   D C6    1 
ATOM   394  P  P     . C   B 2 13  ? 29.819  -48.402 -25.411 1.00 24.39 ? 13  C   D P     1 
ATOM   395  O  OP1   . C   B 2 13  ? 31.193  -47.919 -25.682 1.00 24.84 ? 13  C   D OP1   1 
ATOM   396  O  OP2   . C   B 2 13  ? 29.612  -49.493 -24.428 1.00 24.54 ? 13  C   D OP2   1 
ATOM   397  O  "O5'" . C   B 2 13  ? 28.900  -47.165 -24.977 1.00 25.69 ? 13  C   D "O5'" 1 
ATOM   398  C  "C5'" . C   B 2 13  ? 27.517  -47.147 -25.318 1.00 24.42 ? 13  C   D "C5'" 1 
ATOM   399  C  "C4'" . C   B 2 13  ? 26.771  -46.007 -24.648 1.00 25.86 ? 13  C   D "C4'" 1 
ATOM   400  O  "O4'" . C   B 2 13  ? 25.397  -46.174 -25.033 1.00 26.41 ? 13  C   D "O4'" 1 
ATOM   401  C  "C3'" . C   B 2 13  ? 26.809  -45.997 -23.117 1.00 27.78 ? 13  C   D "C3'" 1 
ATOM   402  O  "O3'" . C   B 2 13  ? 27.384  -44.796 -22.548 1.00 34.09 ? 13  C   D "O3'" 1 
ATOM   403  C  "C2'" . C   B 2 13  ? 25.356  -45.844 -22.667 1.00 25.53 ? 13  C   D "C2'" 1 
ATOM   404  O  "O2'" . C   B 2 13  ? 25.175  -44.650 -21.946 1.00 27.30 ? 13  C   D "O2'" 1 
ATOM   405  C  "C1'" . C   B 2 13  ? 24.583  -45.760 -23.981 1.00 26.18 ? 13  C   D "C1'" 1 
ATOM   406  N  N1    . C   B 2 13  ? 23.269  -46.409 -24.076 1.00 26.18 ? 13  C   D N1    1 
ATOM   407  C  C2    . C   B 2 13  ? 22.141  -45.590 -23.999 1.00 26.40 ? 13  C   D C2    1 
ATOM   408  O  O2    . C   B 2 13  ? 22.307  -44.365 -23.860 1.00 25.16 ? 13  C   D O2    1 
ATOM   409  N  N3    . C   B 2 13  ? 20.907  -46.148 -24.084 1.00 25.53 ? 13  C   D N3    1 
ATOM   410  C  C4    . C   B 2 13  ? 20.782  -47.470 -24.222 1.00 25.14 ? 13  C   D C4    1 
ATOM   411  N  N4    . C   B 2 13  ? 19.546  -47.976 -24.285 1.00 23.13 ? 13  C   D N4    1 
ATOM   412  C  C5    . C   B 2 13  ? 21.922  -48.332 -24.301 1.00 25.52 ? 13  C   D C5    1 
ATOM   413  C  C6    . C   B 2 13  ? 23.137  -47.761 -24.224 1.00 26.13 ? 13  C   D C6    1 
ATOM   414  P  P     . A   B 2 14  ? 28.763  -44.151 -23.098 1.00 37.83 ? 14  A   D P     1 
ATOM   415  O  OP1   . A   B 2 14  ? 28.680  -42.695 -22.854 1.00 35.76 ? 14  A   D OP1   1 
ATOM   416  O  OP2   . A   B 2 14  ? 29.134  -44.628 -24.447 1.00 39.01 ? 14  A   D OP2   1 
ATOM   417  O  "O5'" . A   B 2 14  ? 29.841  -44.696 -22.068 1.00 42.90 ? 14  A   D "O5'" 1 
ATOM   418  C  "C5'" . A   B 2 14  ? 29.454  -45.488 -20.950 1.00 49.31 ? 14  A   D "C5'" 1 
ATOM   419  C  "C4'" . A   B 2 14  ? 30.682  -46.059 -20.287 1.00 55.38 ? 14  A   D "C4'" 1 
ATOM   420  O  "O4'" . A   B 2 14  ? 31.583  -44.968 -20.009 1.00 56.78 ? 14  A   D "O4'" 1 
ATOM   421  C  "C3'" . A   B 2 14  ? 30.458  -46.773 -18.960 1.00 57.57 ? 14  A   D "C3'" 1 
ATOM   422  O  "O3'" . A   B 2 14  ? 30.271  -48.183 -19.160 1.00 61.13 ? 14  A   D "O3'" 1 
ATOM   423  C  "C2'" . A   B 2 14  ? 31.754  -46.529 -18.185 1.00 57.52 ? 14  A   D "C2'" 1 
ATOM   424  O  "O2'" . A   B 2 14  ? 32.701  -47.568 -18.361 1.00 56.56 ? 14  A   D "O2'" 1 
ATOM   425  C  "C1'" . A   B 2 14  ? 32.280  -45.231 -18.812 1.00 58.32 ? 14  A   D "C1'" 1 
ATOM   426  N  N9    . A   B 2 14  ? 32.300  -44.007 -18.006 1.00 59.97 ? 14  A   D N9    1 
ATOM   427  C  C8    . A   B 2 14  ? 32.866  -42.812 -18.394 1.00 59.58 ? 14  A   D C8    1 
ATOM   428  N  N7    . A   B 2 14  ? 32.834  -41.885 -17.472 1.00 59.52 ? 14  A   D N7    1 
ATOM   429  C  C5    . A   B 2 14  ? 32.193  -42.499 -16.404 1.00 61.04 ? 14  A   D C5    1 
ATOM   430  C  C6    . A   B 2 14  ? 31.874  -42.047 -15.110 1.00 61.53 ? 14  A   D C6    1 
ATOM   431  N  N6    . A   B 2 14  ? 32.198  -40.835 -14.652 1.00 62.03 ? 14  A   D N6    1 
ATOM   432  N  N1    . A   B 2 14  ? 31.214  -42.898 -14.290 1.00 62.11 ? 14  A   D N1    1 
ATOM   433  C  C2    . A   B 2 14  ? 30.915  -44.128 -14.747 1.00 62.48 ? 14  A   D C2    1 
ATOM   434  N  N3    . A   B 2 14  ? 31.176  -44.675 -15.938 1.00 62.01 ? 14  A   D N3    1 
ATOM   435  C  C4    . A   B 2 14  ? 31.827  -43.799 -16.731 1.00 61.25 ? 14  A   D C4    1 
ATOM   436  P  P     . A   B 2 15  ? 28.846  -48.895 -18.856 1.00 63.74 ? 15  A   D P     1 
ATOM   437  O  OP1   . A   B 2 15  ? 29.174  -50.220 -18.260 1.00 62.54 ? 15  A   D OP1   1 
ATOM   438  O  OP2   . A   B 2 15  ? 28.033  -48.836 -20.104 1.00 62.86 ? 15  A   D OP2   1 
ATOM   439  O  "O5'" . A   B 2 15  ? 28.129  -48.029 -17.719 1.00 63.85 ? 15  A   D "O5'" 1 
ATOM   440  C  "C5'" . A   B 2 15  ? 28.385  -46.640 -17.564 1.00 65.59 ? 15  A   D "C5'" 1 
ATOM   441  C  "C4'" . A   B 2 15  ? 27.255  -45.990 -16.851 1.00 67.53 ? 15  A   D "C4'" 1 
ATOM   442  O  "O4'" . A   B 2 15  ? 27.471  -44.559 -16.757 1.00 68.75 ? 15  A   D "O4'" 1 
ATOM   443  C  "C3'" . A   B 2 15  ? 25.937  -46.068 -17.581 1.00 68.98 ? 15  A   D "C3'" 1 
ATOM   444  O  "O3'" . A   B 2 15  ? 25.476  -47.413 -17.571 1.00 70.36 ? 15  A   D "O3'" 1 
ATOM   445  C  "C2'" . A   B 2 15  ? 25.170  -45.001 -16.756 1.00 69.81 ? 15  A   D "C2'" 1 
ATOM   446  O  "O2'" . A   B 2 15  ? 24.735  -45.462 -15.451 1.00 70.42 ? 15  A   D "O2'" 1 
ATOM   447  C  "C1'" . A   B 2 15  ? 26.214  -43.928 -16.576 1.00 69.57 ? 15  A   D "C1'" 1 
ATOM   448  N  N9    . A   B 2 15  ? 26.069  -42.844 -17.540 1.00 69.84 ? 15  A   D N9    1 
ATOM   449  C  C8    . A   B 2 15  ? 26.763  -42.539 -18.684 1.00 69.67 ? 15  A   D C8    1 
ATOM   450  N  N7    . A   B 2 15  ? 26.258  -41.516 -19.342 1.00 70.60 ? 15  A   D N7    1 
ATOM   451  C  C5    . A   B 2 15  ? 25.171  -41.121 -18.566 1.00 70.90 ? 15  A   D C5    1 
ATOM   452  C  C6    . A   B 2 15  ? 24.200  -40.103 -18.714 1.00 71.10 ? 15  A   D C6    1 
ATOM   453  N  N6    . A   B 2 15  ? 24.148  -39.269 -19.755 1.00 71.26 ? 15  A   D N6    1 
ATOM   454  N  N1    . A   B 2 15  ? 23.268  -39.978 -17.743 1.00 70.85 ? 15  A   D N1    1 
ATOM   455  C  C2    . A   B 2 15  ? 23.305  -40.823 -16.706 1.00 70.62 ? 15  A   D C2    1 
ATOM   456  N  N3    . A   B 2 15  ? 24.150  -41.818 -16.464 1.00 70.74 ? 15  A   D N3    1 
ATOM   457  C  C4    . A   B 2 15  ? 25.065  -41.914 -17.442 1.00 70.55 ? 15  A   D C4    1 
ATOM   458  O  "O5'" . G   C 1 1   ? 12.655  -22.110 20.725  1.00 54.75 ? 1   G   E "O5'" 1 
ATOM   459  C  "C5'" . G   C 1 1   ? 13.970  -22.652 20.553  1.00 54.68 ? 1   G   E "C5'" 1 
ATOM   460  C  "C4'" . G   C 1 1   ? 14.298  -22.733 19.083  1.00 54.03 ? 1   G   E "C4'" 1 
ATOM   461  O  "O4'" . G   C 1 1   ? 14.710  -21.422 18.610  1.00 54.09 ? 1   G   E "O4'" 1 
ATOM   462  C  "C3'" . G   C 1 1   ? 15.460  -23.632 18.683  1.00 54.23 ? 1   G   E "C3'" 1 
ATOM   463  O  "O3'" . G   C 1 1   ? 15.038  -24.991 18.614  1.00 52.65 ? 1   G   E "O3'" 1 
ATOM   464  C  "C2'" . G   C 1 1   ? 15.799  -23.076 17.307  1.00 54.43 ? 1   G   E "C2'" 1 
ATOM   465  O  "O2'" . G   C 1 1   ? 14.897  -23.483 16.297  1.00 54.73 ? 1   G   E "O2'" 1 
ATOM   466  C  "C1'" . G   C 1 1   ? 15.638  -21.577 17.551  1.00 54.03 ? 1   G   E "C1'" 1 
ATOM   467  N  N9    . G   C 1 1   ? 16.913  -21.003 17.952  1.00 53.61 ? 1   G   E N9    1 
ATOM   468  C  C8    . G   C 1 1   ? 17.360  -20.729 19.223  1.00 53.61 ? 1   G   E C8    1 
ATOM   469  N  N7    . G   C 1 1   ? 18.578  -20.260 19.244  1.00 54.13 ? 1   G   E N7    1 
ATOM   470  C  C5    . G   C 1 1   ? 18.949  -20.213 17.906  1.00 54.16 ? 1   G   E C5    1 
ATOM   471  C  C6    . G   C 1 1   ? 20.161  -19.793 17.297  1.00 55.23 ? 1   G   E C6    1 
ATOM   472  O  O6    . G   C 1 1   ? 21.190  -19.358 17.839  1.00 56.48 ? 1   G   E O6    1 
ATOM   473  N  N1    . G   C 1 1   ? 20.103  -19.918 15.908  1.00 55.58 ? 1   G   E N1    1 
ATOM   474  C  C2    . G   C 1 1   ? 19.019  -20.383 15.196  1.00 53.91 ? 1   G   E C2    1 
ATOM   475  N  N2    . G   C 1 1   ? 19.151  -20.438 13.868  1.00 53.07 ? 1   G   E N2    1 
ATOM   476  N  N3    . G   C 1 1   ? 17.888  -20.768 15.752  1.00 52.71 ? 1   G   E N3    1 
ATOM   477  C  C4    . G   C 1 1   ? 17.925  -20.660 17.099  1.00 53.54 ? 1   G   E C4    1 
ATOM   478  P  P     . C   C 1 2   ? 16.064  -26.136 18.145  1.00 50.35 ? 2   C   E P     1 
ATOM   479  O  OP1   . C   C 1 2   ? 15.187  -27.304 17.893  1.00 51.65 ? 2   C   E OP1   1 
ATOM   480  O  OP2   . C   C 1 2   ? 17.204  -26.262 19.085  1.00 50.30 ? 2   C   E OP2   1 
ATOM   481  O  "O5'" . C   C 1 2   ? 16.635  -25.629 16.747  1.00 49.29 ? 2   C   E "O5'" 1 
ATOM   482  C  "C5'" . C   C 1 2   ? 15.917  -25.861 15.540  1.00 47.21 ? 2   C   E "C5'" 1 
ATOM   483  C  "C4'" . C   C 1 2   ? 16.837  -25.765 14.345  1.00 44.80 ? 2   C   E "C4'" 1 
ATOM   484  O  "O4'" . C   C 1 2   ? 17.382  -24.419 14.236  1.00 44.77 ? 2   C   E "O4'" 1 
ATOM   485  C  "C3'" . C   C 1 2   ? 18.079  -26.640 14.363  1.00 42.24 ? 2   C   E "C3'" 1 
ATOM   486  O  "O3'" . C   C 1 2   ? 17.778  -27.982 14.005  1.00 39.22 ? 2   C   E "O3'" 1 
ATOM   487  C  "C2'" . C   C 1 2   ? 18.919  -25.949 13.302  1.00 43.00 ? 2   C   E "C2'" 1 
ATOM   488  O  "O2'" . C   C 1 2   ? 18.393  -26.191 12.015  1.00 40.93 ? 2   C   E "O2'" 1 
ATOM   489  C  "C1'" . C   C 1 2   ? 18.680  -24.482 13.658  1.00 43.79 ? 2   C   E "C1'" 1 
ATOM   490  N  N1    . C   C 1 2   ? 19.662  -23.964 14.630  1.00 45.04 ? 2   C   E N1    1 
ATOM   491  C  C2    . C   C 1 2   ? 20.948  -23.646 14.177  1.00 46.24 ? 2   C   E C2    1 
ATOM   492  O  O2    . C   C 1 2   ? 21.227  -23.846 12.986  1.00 45.21 ? 2   C   E O2    1 
ATOM   493  N  N3    . C   C 1 2   ? 21.857  -23.136 15.052  1.00 46.71 ? 2   C   E N3    1 
ATOM   494  C  C4    . C   C 1 2   ? 21.519  -22.955 16.333  1.00 46.47 ? 2   C   E C4    1 
ATOM   495  N  N4    . C   C 1 2   ? 22.436  -22.440 17.156  1.00 46.44 ? 2   C   E N4    1 
ATOM   496  C  C5    . C   C 1 2   ? 20.221  -23.292 16.825  1.00 45.21 ? 2   C   E C5    1 
ATOM   497  C  C6    . C   C 1 2   ? 19.333  -23.787 15.947  1.00 45.32 ? 2   C   E C6    1 
ATOM   498  P  P     . C   C 1 3   ? 18.866  -29.141 14.254  1.00 36.33 ? 3   C   E P     1 
ATOM   499  O  OP1   . C   C 1 3   ? 18.158  -30.431 14.070  1.00 36.96 ? 3   C   E OP1   1 
ATOM   500  O  OP2   . C   C 1 3   ? 19.598  -28.885 15.516  1.00 36.76 ? 3   C   E OP2   1 
ATOM   501  O  "O5'" . C   C 1 3   ? 19.894  -28.962 13.053  1.00 36.27 ? 3   C   E "O5'" 1 
ATOM   502  C  "C5'" . C   C 1 3   ? 19.436  -28.936 11.707  1.00 35.26 ? 3   C   E "C5'" 1 
ATOM   503  C  "C4'" . C   C 1 3   ? 20.547  -28.506 10.782  1.00 35.05 ? 3   C   E "C4'" 1 
ATOM   504  O  "O4'" . C   C 1 3   ? 20.939  -27.139 11.084  1.00 35.80 ? 3   C   E "O4'" 1 
ATOM   505  C  "C3'" . C   C 1 3   ? 21.848  -29.273 10.917  1.00 34.91 ? 3   C   E "C3'" 1 
ATOM   506  O  "O3'" . C   C 1 3   ? 21.796  -30.506 10.226  1.00 33.44 ? 3   C   E "O3'" 1 
ATOM   507  C  "C2'" . C   C 1 3   ? 22.843  -28.308 10.288  1.00 35.28 ? 3   C   E "C2'" 1 
ATOM   508  O  "O2'" . C   C 1 3   ? 22.793  -28.316 8.881   1.00 35.62 ? 3   C   E "O2'" 1 
ATOM   509  C  "C1'" . C   C 1 3   ? 22.319  -26.967 10.797  1.00 35.44 ? 3   C   E "C1'" 1 
ATOM   510  N  N1    . C   C 1 3   ? 23.002  -26.521 12.019  1.00 36.33 ? 3   C   E N1    1 
ATOM   511  C  C2    . C   C 1 3   ? 24.239  -25.896 11.894  1.00 36.77 ? 3   C   E C2    1 
ATOM   512  O  O2    . C   C 1 3   ? 24.718  -25.753 10.765  1.00 38.34 ? 3   C   E O2    1 
ATOM   513  N  N3    . C   C 1 3   ? 24.879  -25.457 13.003  1.00 37.51 ? 3   C   E N3    1 
ATOM   514  C  C4    . C   C 1 3   ? 24.321  -25.622 14.205  1.00 37.16 ? 3   C   E C4    1 
ATOM   515  N  N4    . C   C 1 3   ? 24.972  -25.141 15.270  1.00 36.39 ? 3   C   E N4    1 
ATOM   516  C  C5    . C   C 1 3   ? 23.064  -26.276 14.366  1.00 36.76 ? 3   C   E C5    1 
ATOM   517  C  C6    . C   C 1 3   ? 22.445  -26.708 13.255  1.00 37.30 ? 3   C   E C6    1 
ATOM   518  P  P     . U   C 1 4   ? 22.826  -31.671 10.615  1.00 34.71 ? 4   U   E P     1 
ATOM   519  O  OP1   . U   C 1 4   ? 22.530  -32.846 9.750   1.00 35.91 ? 4   U   E OP1   1 
ATOM   520  O  OP2   . U   C 1 4   ? 22.860  -31.830 12.094  1.00 32.98 ? 4   U   E OP2   1 
ATOM   521  O  "O5'" . U   C 1 4   ? 24.231  -31.113 10.131  1.00 32.56 ? 4   U   E "O5'" 1 
ATOM   522  C  "C5'" . U   C 1 4   ? 24.599  -31.174 8.761   1.00 31.23 ? 4   U   E "C5'" 1 
ATOM   523  C  "C4'" . U   C 1 4   ? 26.017  -30.713 8.599   1.00 31.06 ? 4   U   E "C4'" 1 
ATOM   524  O  "O4'" . U   C 1 4   ? 26.124  -29.372 9.155   1.00 32.33 ? 4   U   E "O4'" 1 
ATOM   525  C  "C3'" . U   C 1 4   ? 27.028  -31.518 9.397   1.00 31.10 ? 4   U   E "C3'" 1 
ATOM   526  O  "O3'" . U   C 1 4   ? 27.448  -32.685 8.696   1.00 28.84 ? 4   U   E "O3'" 1 
ATOM   527  C  "C2'" . U   C 1 4   ? 28.159  -30.515 9.588   1.00 32.01 ? 4   U   E "C2'" 1 
ATOM   528  O  "O2'" . U   C 1 4   ? 28.975  -30.383 8.445   1.00 34.12 ? 4   U   E "O2'" 1 
ATOM   529  C  "C1'" . U   C 1 4   ? 27.375  -29.221 9.809   1.00 32.23 ? 4   U   E "C1'" 1 
ATOM   530  N  N1    . U   C 1 4   ? 27.125  -28.941 11.230  1.00 33.45 ? 4   U   E N1    1 
ATOM   531  C  C2    . U   C 1 4   ? 28.132  -28.304 11.948  1.00 35.07 ? 4   U   E C2    1 
ATOM   532  O  O2    . U   C 1 4   ? 29.215  -27.995 11.450  1.00 34.60 ? 4   U   E O2    1 
ATOM   533  N  N3    . U   C 1 4   ? 27.829  -28.050 13.266  1.00 33.73 ? 4   U   E N3    1 
ATOM   534  C  C4    . U   C 1 4   ? 26.651  -28.361 13.925  1.00 34.04 ? 4   U   E C4    1 
ATOM   535  O  O4    . U   C 1 4   ? 26.513  -28.039 15.112  1.00 34.62 ? 4   U   E O4    1 
ATOM   536  C  C5    . U   C 1 4   ? 25.672  -29.029 13.116  1.00 32.63 ? 4   U   E C5    1 
ATOM   537  C  C6    . U   C 1 4   ? 25.936  -29.286 11.831  1.00 32.54 ? 4   U   E C6    1 
ATOM   538  P  P     . A   C 1 5   ? 28.086  -33.912 9.518   1.00 26.60 ? 5   A   E P     1 
ATOM   539  O  OP1   . A   C 1 5   ? 28.159  -35.113 8.656   1.00 28.00 ? 5   A   E OP1   1 
ATOM   540  O  OP2   . A   C 1 5   ? 27.369  -33.984 10.814  1.00 26.38 ? 5   A   E OP2   1 
ATOM   541  O  "O5'" . A   C 1 5   ? 29.576  -33.437 9.799   1.00 27.23 ? 5   A   E "O5'" 1 
ATOM   542  C  "C5'" . A   C 1 5   ? 30.531  -33.389 8.752   1.00 27.66 ? 5   A   E "C5'" 1 
ATOM   543  C  "C4'" . A   C 1 5   ? 31.796  -32.736 9.242   1.00 31.14 ? 5   A   E "C4'" 1 
ATOM   544  O  "O4'" . A   C 1 5   ? 31.497  -31.389 9.708   1.00 31.53 ? 5   A   E "O4'" 1 
ATOM   545  C  "C3'" . A   C 1 5   ? 32.439  -33.407 10.444  1.00 31.44 ? 5   A   E "C3'" 1 
ATOM   546  O  "O3'" . A   C 1 5   ? 33.271  -34.474 10.023  1.00 33.67 ? 5   A   E "O3'" 1 
ATOM   547  C  "C2'" . A   C 1 5   ? 33.246  -32.266 11.047  1.00 31.07 ? 5   A   E "C2'" 1 
ATOM   548  O  "O2'" . A   C 1 5   ? 34.443  -32.013 10.340  1.00 29.52 ? 5   A   E "O2'" 1 
ATOM   549  C  "C1'" . A   C 1 5   ? 32.281  -31.095 10.856  1.00 31.81 ? 5   A   E "C1'" 1 
ATOM   550  N  N9    . A   C 1 5   ? 31.373  -30.927 11.988  1.00 32.69 ? 5   A   E N9    1 
ATOM   551  C  C8    . A   C 1 5   ? 30.035  -31.228 12.032  1.00 33.16 ? 5   A   E C8    1 
ATOM   552  N  N7    . A   C 1 5   ? 29.468  -30.957 13.180  1.00 32.56 ? 5   A   E N7    1 
ATOM   553  C  C5    . A   C 1 5   ? 30.502  -30.442 13.948  1.00 31.87 ? 5   A   E C5    1 
ATOM   554  C  C6    . A   C 1 5   ? 30.547  -29.950 15.259  1.00 31.39 ? 5   A   E C6    1 
ATOM   555  N  N6    . A   C 1 5   ? 29.482  -29.878 16.062  1.00 30.27 ? 5   A   E N6    1 
ATOM   556  N  N1    . A   C 1 5   ? 31.738  -29.521 15.726  1.00 32.08 ? 5   A   E N1    1 
ATOM   557  C  C2    . A   C 1 5   ? 32.804  -29.579 14.920  1.00 31.91 ? 5   A   E C2    1 
ATOM   558  N  N3    . A   C 1 5   ? 32.886  -30.006 13.665  1.00 33.21 ? 5   A   E N3    1 
ATOM   559  C  C4    . A   C 1 5   ? 31.684  -30.428 13.230  1.00 32.62 ? 5   A   E C4    1 
ATOM   560  P  P     . C   C 1 6   ? 33.547  -35.699 11.010  1.00 35.21 ? 6   C   E P     1 
ATOM   561  O  OP1   . C   C 1 6   ? 34.368  -36.688 10.262  1.00 37.08 ? 6   C   E OP1   1 
ATOM   562  O  OP2   . C   C 1 6   ? 32.244  -36.115 11.596  1.00 37.15 ? 6   C   E OP2   1 
ATOM   563  O  "O5'" . C   C 1 6   ? 34.454  -35.076 12.163  1.00 37.01 ? 6   C   E "O5'" 1 
ATOM   564  C  "C5'" . C   C 1 6   ? 35.758  -34.564 11.872  1.00 38.82 ? 6   C   E "C5'" 1 
ATOM   565  C  "C4'" . C   C 1 6   ? 36.364  -33.933 13.105  1.00 38.92 ? 6   C   E "C4'" 1 
ATOM   566  O  "O4'" . C   C 1 6   ? 35.572  -32.784 13.496  1.00 36.54 ? 6   C   E "O4'" 1 
ATOM   567  C  "C3'" . C   C 1 6   ? 36.388  -34.819 14.340  1.00 41.35 ? 6   C   E "C3'" 1 
ATOM   568  O  "O3'" . C   C 1 6   ? 37.542  -35.659 14.331  1.00 45.45 ? 6   C   E "O3'" 1 
ATOM   569  C  "C2'" . C   C 1 6   ? 36.437  -33.797 15.469  1.00 40.75 ? 6   C   E "C2'" 1 
ATOM   570  O  "O2'" . C   C 1 6   ? 37.744  -33.311 15.718  1.00 41.45 ? 6   C   E "O2'" 1 
ATOM   571  C  "C1'" . C   C 1 6   ? 35.548  -32.681 14.908  1.00 39.23 ? 6   C   E "C1'" 1 
ATOM   572  N  N1    . C   C 1 6   ? 34.152  -32.788 15.354  1.00 38.22 ? 6   C   E N1    1 
ATOM   573  C  C2    . C   C 1 6   ? 33.813  -32.317 16.625  1.00 37.87 ? 6   C   E C2    1 
ATOM   574  O  O2    . C   C 1 6   ? 34.691  -31.789 17.320  1.00 37.45 ? 6   C   E O2    1 
ATOM   575  N  N3    . C   C 1 6   ? 32.536  -32.439 17.058  1.00 37.85 ? 6   C   E N3    1 
ATOM   576  C  C4    . C   C 1 6   ? 31.614  -32.991 16.266  1.00 37.63 ? 6   C   E C4    1 
ATOM   577  N  N4    . C   C 1 6   ? 30.365  -33.077 16.721  1.00 37.72 ? 6   C   E N4    1 
ATOM   578  C  C5    . C   C 1 6   ? 31.931  -33.473 14.966  1.00 38.10 ? 6   C   E C5    1 
ATOM   579  C  C6    . C   C 1 6   ? 33.201  -33.352 14.552  1.00 38.29 ? 6   C   E C6    1 
ATOM   580  P  P     . C   C 1 7   ? 37.545  -37.031 15.174  1.00 47.58 ? 7   C   E P     1 
ATOM   581  O  OP1   . C   C 1 7   ? 38.780  -37.770 14.795  1.00 46.85 ? 7   C   E OP1   1 
ATOM   582  O  OP2   . C   C 1 7   ? 36.220  -37.692 15.042  1.00 47.33 ? 7   C   E OP2   1 
ATOM   583  O  "O5'" . C   C 1 7   ? 37.701  -36.545 16.680  1.00 47.76 ? 7   C   E "O5'" 1 
ATOM   584  C  "C5'" . C   C 1 7   ? 38.880  -35.876 17.107  1.00 51.11 ? 7   C   E "C5'" 1 
ATOM   585  C  "C4'" . C   C 1 7   ? 38.735  -35.452 18.543  1.00 53.69 ? 7   C   E "C4'" 1 
ATOM   586  O  "O4'" . C   C 1 7   ? 37.659  -34.486 18.650  1.00 54.27 ? 7   C   E "O4'" 1 
ATOM   587  C  "C3'" . C   C 1 7   ? 38.345  -36.567 19.495  1.00 56.16 ? 7   C   E "C3'" 1 
ATOM   588  O  "O3'" . C   C 1 7   ? 39.518  -37.231 19.937  1.00 59.84 ? 7   C   E "O3'" 1 
ATOM   589  C  "C2'" . C   C 1 7   ? 37.665  -35.809 20.626  1.00 55.03 ? 7   C   E "C2'" 1 
ATOM   590  O  "O2'" . C   C 1 7   ? 38.609  -35.259 21.525  1.00 55.48 ? 7   C   E "O2'" 1 
ATOM   591  C  "C1'" . C   C 1 7   ? 36.952  -34.688 19.862  1.00 53.97 ? 7   C   E "C1'" 1 
ATOM   592  N  N1    . C   C 1 7   ? 35.553  -34.982 19.522  1.00 52.58 ? 7   C   E N1    1 
ATOM   593  C  C2    . C   C 1 7   ? 34.548  -34.585 20.402  1.00 52.20 ? 7   C   E C2    1 
ATOM   594  O  O2    . C   C 1 7   ? 34.870  -34.026 21.456  1.00 54.66 ? 7   C   E O2    1 
ATOM   595  N  N3    . C   C 1 7   ? 33.254  -34.823 20.085  1.00 50.52 ? 7   C   E N3    1 
ATOM   596  C  C4    . C   C 1 7   ? 32.953  -35.432 18.936  1.00 50.22 ? 7   C   E C4    1 
ATOM   597  N  N4    . C   C 1 7   ? 31.668  -35.630 18.650  1.00 49.45 ? 7   C   E N4    1 
ATOM   598  C  C5    . C   C 1 7   ? 33.960  -35.864 18.025  1.00 51.07 ? 7   C   E C5    1 
ATOM   599  C  C6    . C   C 1 7   ? 35.236  -35.621 18.356  1.00 52.55 ? 7   C   E C6    1 
ATOM   600  P  P     . C   C 1 8   ? 39.452  -38.207 21.206  1.00 63.50 ? 8   C   E P     1 
ATOM   601  O  OP1   . C   C 1 8   ? 38.037  -38.643 21.355  1.00 63.44 ? 8   C   E OP1   1 
ATOM   602  O  OP2   . C   C 1 8   ? 40.132  -37.532 22.345  1.00 64.25 ? 8   C   E OP2   1 
ATOM   603  O  "O5'" . C   C 1 8   ? 40.336  -39.459 20.760  1.00 64.54 ? 8   C   E "O5'" 1 
ATOM   604  C  "C5'" . C   C 1 8   ? 41.619  -39.290 20.146  1.00 65.51 ? 8   C   E "C5'" 1 
ATOM   605  C  "C4'" . C   C 1 8   ? 41.555  -39.709 18.694  1.00 66.34 ? 8   C   E "C4'" 1 
ATOM   606  O  "O4'" . C   C 1 8   ? 40.684  -40.876 18.612  1.00 67.40 ? 8   C   E "O4'" 1 
ATOM   607  C  "C3'" . C   C 1 8   ? 40.907  -38.707 17.746  1.00 66.24 ? 8   C   E "C3'" 1 
ATOM   608  O  "O3'" . C   C 1 8   ? 41.739  -37.638 17.275  1.00 64.82 ? 8   C   E "O3'" 1 
ATOM   609  C  "C2'" . C   C 1 8   ? 40.396  -39.608 16.636  1.00 66.62 ? 8   C   E "C2'" 1 
ATOM   610  O  "O2'" . C   C 1 8   ? 41.422  -40.048 15.771  1.00 66.27 ? 8   C   E "O2'" 1 
ATOM   611  C  "C1'" . C   C 1 8   ? 39.871  -40.789 17.450  1.00 67.55 ? 8   C   E "C1'" 1 
ATOM   612  N  N1    . C   C 1 8   ? 38.465  -40.617 17.872  1.00 68.28 ? 8   C   E N1    1 
ATOM   613  C  C2    . C   C 1 8   ? 37.493  -40.360 16.889  1.00 69.61 ? 8   C   E C2    1 
ATOM   614  O  O2    . C   C 1 8   ? 37.841  -40.306 15.694  1.00 70.92 ? 8   C   E O2    1 
ATOM   615  N  N3    . C   C 1 8   ? 36.198  -40.191 17.263  1.00 69.45 ? 8   C   E N3    1 
ATOM   616  C  C4    . C   C 1 8   ? 35.862  -40.262 18.552  1.00 68.90 ? 8   C   E C4    1 
ATOM   617  N  N4    . C   C 1 8   ? 34.576  -40.085 18.871  1.00 69.04 ? 8   C   E N4    1 
ATOM   618  C  C5    . C   C 1 8   ? 36.829  -40.524 19.570  1.00 68.39 ? 8   C   E C5    1 
ATOM   619  C  C6    . C   C 1 8   ? 38.107  -40.689 19.189  1.00 67.81 ? 8   C   E C6    1 
ATOM   620  O  "O5'" . C   D 2 1   ? 23.720  -37.130 22.450  1.00 64.16 ? 1   C   F "O5'" 1 
ATOM   621  C  "C5'" . C   D 2 1   ? 22.703  -36.942 23.445  1.00 64.22 ? 1   C   F "C5'" 1 
ATOM   622  C  "C4'" . C   D 2 1   ? 23.278  -36.639 24.812  1.00 64.37 ? 1   C   F "C4'" 1 
ATOM   623  O  "O4'" . C   D 2 1   ? 24.260  -37.656 25.148  1.00 64.56 ? 1   C   F "O4'" 1 
ATOM   624  C  "C3'" . C   D 2 1   ? 23.991  -35.295 24.960  1.00 64.11 ? 1   C   F "C3'" 1 
ATOM   625  O  "O3'" . C   D 2 1   ? 23.025  -34.312 25.370  1.00 64.47 ? 1   C   F "O3'" 1 
ATOM   626  C  "C2'" . C   D 2 1   ? 25.012  -35.597 26.056  1.00 63.92 ? 1   C   F "C2'" 1 
ATOM   627  O  "O2'" . C   D 2 1   ? 24.440  -35.549 27.348  1.00 63.20 ? 1   C   F "O2'" 1 
ATOM   628  C  "C1'" . C   D 2 1   ? 25.392  -37.050 25.742  1.00 64.16 ? 1   C   F "C1'" 1 
ATOM   629  N  N1    . C   D 2 1   ? 26.533  -37.231 24.819  1.00 64.15 ? 1   C   F N1    1 
ATOM   630  C  C2    . C   D 2 1   ? 27.839  -37.183 25.328  1.00 63.59 ? 1   C   F C2    1 
ATOM   631  O  O2    . C   D 2 1   ? 28.004  -36.962 26.542  1.00 63.21 ? 1   C   F O2    1 
ATOM   632  N  N3    . C   D 2 1   ? 28.884  -37.371 24.479  1.00 62.08 ? 1   C   F N3    1 
ATOM   633  C  C4    . C   D 2 1   ? 28.661  -37.595 23.179  1.00 61.22 ? 1   C   F C4    1 
ATOM   634  N  N4    . C   D 2 1   ? 29.715  -37.774 22.384  1.00 60.49 ? 1   C   F N4    1 
ATOM   635  C  C5    . C   D 2 1   ? 27.345  -37.642 22.638  1.00 61.68 ? 1   C   F C5    1 
ATOM   636  C  C6    . C   D 2 1   ? 26.322  -37.456 23.483  1.00 63.48 ? 1   C   F C6    1 
ATOM   637  P  P     . G   D 2 2   ? 23.413  -32.741 25.458  1.00 63.75 ? 2   G   F P     1 
ATOM   638  O  OP1   . G   D 2 2   ? 22.521  -32.171 26.502  1.00 62.04 ? 2   G   F OP1   1 
ATOM   639  O  OP2   . G   D 2 2   ? 23.419  -32.141 24.102  1.00 63.99 ? 2   G   F OP2   1 
ATOM   640  O  "O5'" . G   D 2 2   ? 24.909  -32.708 26.010  1.00 63.43 ? 2   G   F "O5'" 1 
ATOM   641  C  "C5'" . G   D 2 2   ? 25.198  -32.205 27.313  1.00 62.16 ? 2   G   F "C5'" 1 
ATOM   642  C  "C4'" . G   D 2 2   ? 26.678  -32.313 27.606  1.00 60.87 ? 2   G   F "C4'" 1 
ATOM   643  O  "O4'" . G   D 2 2   ? 27.119  -33.637 27.192  1.00 60.12 ? 2   G   F "O4'" 1 
ATOM   644  C  "C3'" . G   D 2 2   ? 27.604  -31.381 26.834  1.00 61.28 ? 2   G   F "C3'" 1 
ATOM   645  O  "O3'" . G   D 2 2   ? 27.694  -30.085 27.420  1.00 61.86 ? 2   G   F "O3'" 1 
ATOM   646  C  "C2'" . G   D 2 2   ? 28.924  -32.131 26.920  1.00 60.47 ? 2   G   F "C2'" 1 
ATOM   647  O  "O2'" . G   D 2 2   ? 29.551  -32.021 28.177  1.00 61.46 ? 2   G   F "O2'" 1 
ATOM   648  C  "C1'" . G   D 2 2   ? 28.453  -33.567 26.703  1.00 59.87 ? 2   G   F "C1'" 1 
ATOM   649  N  N9    . G   D 2 2   ? 28.464  -33.895 25.278  1.00 58.18 ? 2   G   F N9    1 
ATOM   650  C  C8    . G   D 2 2   ? 27.391  -34.094 24.437  1.00 56.72 ? 2   G   F C8    1 
ATOM   651  N  N7    . G   D 2 2   ? 27.746  -34.331 23.202  1.00 55.80 ? 2   G   F N7    1 
ATOM   652  C  C5    . G   D 2 2   ? 29.135  -34.295 23.232  1.00 55.48 ? 2   G   F C5    1 
ATOM   653  C  C6    . G   D 2 2   ? 30.087  -34.478 22.191  1.00 54.89 ? 2   G   F C6    1 
ATOM   654  O  O6    . G   D 2 2   ? 29.884  -34.720 20.997  1.00 54.15 ? 2   G   F O6    1 
ATOM   655  N  N1    . G   D 2 2   ? 31.392  -34.353 22.663  1.00 54.45 ? 2   G   F N1    1 
ATOM   656  C  C2    . G   D 2 2   ? 31.738  -34.093 23.963  1.00 53.72 ? 2   G   F C2    1 
ATOM   657  N  N2    . G   D 2 2   ? 33.049  -34.006 24.219  1.00 53.42 ? 2   G   F N2    1 
ATOM   658  N  N3    . G   D 2 2   ? 30.865  -33.927 24.940  1.00 55.02 ? 2   G   F N3    1 
ATOM   659  C  C4    . G   D 2 2   ? 29.592  -34.037 24.504  1.00 56.09 ? 2   G   F C4    1 
ATOM   660  P  P     . G   D 2 3   ? 27.687  -28.776 26.473  1.00 63.67 ? 3   G   F P     1 
ATOM   661  O  OP1   . G   D 2 3   ? 27.359  -27.616 27.347  1.00 63.86 ? 3   G   F OP1   1 
ATOM   662  O  OP2   . G   D 2 3   ? 26.861  -29.044 25.265  1.00 64.21 ? 3   G   F OP2   1 
ATOM   663  O  "O5'" . G   D 2 3   ? 29.200  -28.605 26.008  1.00 61.81 ? 3   G   F "O5'" 1 
ATOM   664  C  "C5'" . G   D 2 3   ? 30.224  -28.435 26.972  1.00 60.43 ? 3   G   F "C5'" 1 
ATOM   665  C  "C4'" . G   D 2 3   ? 31.508  -29.048 26.484  1.00 59.85 ? 3   G   F "C4'" 1 
ATOM   666  O  "O4'" . G   D 2 3   ? 31.230  -30.375 25.954  1.00 59.00 ? 3   G   F "O4'" 1 
ATOM   667  C  "C3'" . G   D 2 3   ? 32.184  -28.361 25.312  1.00 60.31 ? 3   G   F "C3'" 1 
ATOM   668  O  "O3'" . G   D 2 3   ? 32.908  -27.201 25.718  1.00 59.34 ? 3   G   F "O3'" 1 
ATOM   669  C  "C2'" . G   D 2 3   ? 33.100  -29.474 24.823  1.00 60.88 ? 3   G   F "C2'" 1 
ATOM   670  O  "O2'" . G   D 2 3   ? 34.215  -29.676 25.670  1.00 62.55 ? 3   G   F "O2'" 1 
ATOM   671  C  "C1'" . G   D 2 3   ? 32.165  -30.679 24.928  1.00 60.11 ? 3   G   F "C1'" 1 
ATOM   672  N  N9    . G   D 2 3   ? 31.446  -30.897 23.676  1.00 59.85 ? 3   G   F N9    1 
ATOM   673  C  C8    . G   D 2 3   ? 30.086  -30.919 23.479  1.00 60.58 ? 3   G   F C8    1 
ATOM   674  N  N7    . G   D 2 3   ? 29.752  -31.124 22.232  1.00 60.14 ? 3   G   F N7    1 
ATOM   675  C  C5    . G   D 2 3   ? 30.965  -31.247 21.567  1.00 59.55 ? 3   G   F C5    1 
ATOM   676  C  C6    . G   D 2 3   ? 31.240  -31.476 20.197  1.00 59.65 ? 3   G   F C6    1 
ATOM   677  O  O6    . G   D 2 3   ? 30.443  -31.614 19.265  1.00 60.60 ? 3   G   F O6    1 
ATOM   678  N  N1    . G   D 2 3   ? 32.608  -31.533 19.952  1.00 58.85 ? 3   G   F N1    1 
ATOM   679  C  C2    . G   D 2 3   ? 33.584  -31.386 20.900  1.00 58.88 ? 3   G   F C2    1 
ATOM   680  N  N2    . G   D 2 3   ? 34.849  -31.476 20.461  1.00 58.61 ? 3   G   F N2    1 
ATOM   681  N  N3    . G   D 2 3   ? 33.341  -31.169 22.182  1.00 59.01 ? 3   G   F N3    1 
ATOM   682  C  C4    . G   D 2 3   ? 32.018  -31.112 22.442  1.00 59.41 ? 3   G   F C4    1 
ATOM   683  P  P     . U   D 2 4   ? 32.710  -25.817 24.913  1.00 58.38 ? 4   U   F P     1 
ATOM   684  O  OP1   . U   D 2 4   ? 33.296  -24.725 25.731  1.00 58.12 ? 4   U   F OP1   1 
ATOM   685  O  OP2   . U   D 2 4   ? 31.285  -25.737 24.495  1.00 59.00 ? 4   U   F OP2   1 
ATOM   686  O  "O5'" . U   D 2 4   ? 33.617  -25.984 23.611  1.00 57.47 ? 4   U   F "O5'" 1 
ATOM   687  C  "C5'" . U   D 2 4   ? 35.039  -25.999 23.716  1.00 55.85 ? 4   U   F "C5'" 1 
ATOM   688  C  "C4'" . U   D 2 4   ? 35.678  -26.279 22.372  1.00 53.79 ? 4   U   F "C4'" 1 
ATOM   689  O  "O4'" . U   D 2 4   ? 35.265  -27.590 21.896  1.00 54.74 ? 4   U   F "O4'" 1 
ATOM   690  C  "C3'" . U   D 2 4   ? 35.297  -25.363 21.224  1.00 52.52 ? 4   U   F "C3'" 1 
ATOM   691  O  "O3'" . U   D 2 4   ? 36.019  -24.142 21.262  1.00 49.61 ? 4   U   F "O3'" 1 
ATOM   692  C  "C2'" . U   D 2 4   ? 35.695  -26.209 20.022  1.00 52.98 ? 4   U   F "C2'" 1 
ATOM   693  O  "O2'" . U   D 2 4   ? 37.094  -26.237 19.833  1.00 53.11 ? 4   U   F "O2'" 1 
ATOM   694  C  "C1'" . U   D 2 4   ? 35.239  -27.595 20.475  1.00 53.11 ? 4   U   F "C1'" 1 
ATOM   695  N  N1    . U   D 2 4   ? 33.873  -27.915 20.037  1.00 51.60 ? 4   U   F N1    1 
ATOM   696  C  C2    . U   D 2 4   ? 33.723  -28.464 18.780  1.00 50.94 ? 4   U   F C2    1 
ATOM   697  O  O2    . U   D 2 4   ? 34.668  -28.683 18.040  1.00 50.40 ? 4   U   F O2    1 
ATOM   698  N  N3    . U   D 2 4   ? 32.425  -28.749 18.425  1.00 50.58 ? 4   U   F N3    1 
ATOM   699  C  C4    . U   D 2 4   ? 31.287  -28.544 19.188  1.00 50.50 ? 4   U   F C4    1 
ATOM   700  O  O4    . U   D 2 4   ? 30.194  -28.915 18.759  1.00 49.31 ? 4   U   F O4    1 
ATOM   701  C  C5    . U   D 2 4   ? 31.528  -27.966 20.474  1.00 50.40 ? 4   U   F C5    1 
ATOM   702  C  C6    . U   D 2 4   ? 32.782  -27.679 20.845  1.00 51.20 ? 4   U   F C6    1 
ATOM   703  P  P     . A   D 2 5   ? 35.407  -22.840 20.546  1.00 47.75 ? 5   A   F P     1 
ATOM   704  O  OP1   . A   D 2 5   ? 36.359  -21.716 20.742  1.00 48.95 ? 5   A   F OP1   1 
ATOM   705  O  OP2   . A   D 2 5   ? 33.992  -22.693 20.972  1.00 47.38 ? 5   A   F OP2   1 
ATOM   706  O  "O5'" . A   D 2 5   ? 35.405  -23.227 19.005  1.00 45.72 ? 5   A   F "O5'" 1 
ATOM   707  C  "C5'" . A   D 2 5   ? 36.622  -23.517 18.333  1.00 42.21 ? 5   A   F "C5'" 1 
ATOM   708  C  "C4'" . A   D 2 5   ? 36.344  -23.966 16.924  1.00 39.96 ? 5   A   F "C4'" 1 
ATOM   709  O  "O4'" . A   D 2 5   ? 35.690  -25.265 16.935  1.00 38.68 ? 5   A   F "O4'" 1 
ATOM   710  C  "C3'" . A   D 2 5   ? 35.369  -23.102 16.144  1.00 40.05 ? 5   A   F "C3'" 1 
ATOM   711  O  "O3'" . A   D 2 5   ? 35.968  -21.934 15.615  1.00 39.67 ? 5   A   F "O3'" 1 
ATOM   712  C  "C2'" . A   D 2 5   ? 34.948  -24.055 15.041  1.00 38.29 ? 5   A   F "C2'" 1 
ATOM   713  O  "O2'" . A   D 2 5   ? 35.978  -24.206 14.080  1.00 37.90 ? 5   A   F "O2'" 1 
ATOM   714  C  "C1'" . A   D 2 5   ? 34.783  -25.347 15.839  1.00 36.51 ? 5   A   F "C1'" 1 
ATOM   715  N  N9    . A   D 2 5   ? 33.424  -25.495 16.361  1.00 32.49 ? 5   A   F N9    1 
ATOM   716  C  C8    . A   D 2 5   ? 32.956  -25.215 17.616  1.00 32.30 ? 5   A   F C8    1 
ATOM   717  N  N7    . A   D 2 5   ? 31.678  -25.459 17.774  1.00 31.92 ? 5   A   F N7    1 
ATOM   718  C  C5    . A   D 2 5   ? 31.276  -25.932 16.536  1.00 31.64 ? 5   A   F C5    1 
ATOM   719  C  C6    . A   D 2 5   ? 30.030  -26.375 16.047  1.00 31.65 ? 5   A   F C6    1 
ATOM   720  N  N6    . A   D 2 5   ? 28.910  -26.416 16.775  1.00 29.27 ? 5   A   F N6    1 
ATOM   721  N  N1    . A   D 2 5   ? 29.975  -26.782 14.763  1.00 31.80 ? 5   A   F N1    1 
ATOM   722  C  C2    . A   D 2 5   ? 31.097  -26.749 14.029  1.00 32.53 ? 5   A   F C2    1 
ATOM   723  N  N3    . A   D 2 5   ? 32.320  -26.359 14.375  1.00 31.62 ? 5   A   F N3    1 
ATOM   724  C  C4    . A   D 2 5   ? 32.342  -25.958 15.656  1.00 32.01 ? 5   A   F C4    1 
ATOM   725  P  P     . G   D 2 6   ? 35.036  -20.703 15.192  1.00 40.40 ? 6   G   F P     1 
ATOM   726  O  OP1   . G   D 2 6   ? 35.945  -19.571 14.871  1.00 39.16 ? 6   G   F OP1   1 
ATOM   727  O  OP2   . G   D 2 6   ? 33.965  -20.534 16.210  1.00 39.10 ? 6   G   F OP2   1 
ATOM   728  O  "O5'" . G   D 2 6   ? 34.346  -21.188 13.847  1.00 41.10 ? 6   G   F "O5'" 1 
ATOM   729  C  "C5'" . G   D 2 6   ? 35.088  -21.233 12.634  1.00 43.74 ? 6   G   F "C5'" 1 
ATOM   730  C  "C4'" . G   D 2 6   ? 34.193  -21.640 11.492  1.00 44.72 ? 6   G   F "C4'" 1 
ATOM   731  O  "O4'" . G   D 2 6   ? 33.676  -22.978 11.752  1.00 44.41 ? 6   G   F "O4'" 1 
ATOM   732  C  "C3'" . G   D 2 6   ? 32.934  -20.808 11.312  1.00 44.40 ? 6   G   F "C3'" 1 
ATOM   733  O  "O3'" . G   D 2 6   ? 33.164  -19.597 10.606  1.00 43.34 ? 6   G   F "O3'" 1 
ATOM   734  C  "C2'" . G   D 2 6   ? 32.062  -21.770 10.522  1.00 44.70 ? 6   G   F "C2'" 1 
ATOM   735  O  "O2'" . G   D 2 6   ? 32.479  -21.865 9.173   1.00 46.21 ? 6   G   F "O2'" 1 
ATOM   736  C  "C1'" . G   D 2 6   ? 32.352  -23.082 11.255  1.00 44.14 ? 6   G   F "C1'" 1 
ATOM   737  N  N9    . G   D 2 6   ? 31.446  -23.264 12.387  1.00 42.33 ? 6   G   F N9    1 
ATOM   738  C  C8    . G   D 2 6   ? 31.655  -22.898 13.694  1.00 41.81 ? 6   G   F C8    1 
ATOM   739  N  N7    . G   D 2 6   ? 30.632  -23.148 14.466  1.00 40.74 ? 6   G   F N7    1 
ATOM   740  C  C5    . G   D 2 6   ? 29.699  -23.725 13.619  1.00 41.00 ? 6   G   F C5    1 
ATOM   741  C  C6    . G   D 2 6   ? 28.394  -24.196 13.882  1.00 41.24 ? 6   G   F C6    1 
ATOM   742  O  O6    . G   D 2 6   ? 27.778  -24.197 14.952  1.00 42.12 ? 6   G   F O6    1 
ATOM   743  N  N1    . G   D 2 6   ? 27.791  -24.701 12.734  1.00 42.11 ? 6   G   F N1    1 
ATOM   744  C  C2    . G   D 2 6   ? 28.370  -24.744 11.488  1.00 41.86 ? 6   G   F C2    1 
ATOM   745  N  N2    . G   D 2 6   ? 27.623  -25.258 10.502  1.00 41.09 ? 6   G   F N2    1 
ATOM   746  N  N3    . G   D 2 6   ? 29.590  -24.310 11.231  1.00 41.99 ? 6   G   F N3    1 
ATOM   747  C  C4    . G   D 2 6   ? 30.191  -23.814 12.334  1.00 41.94 ? 6   G   F C4    1 
ATOM   748  P  P     . G   D 2 7   ? 32.209  -18.328 10.881  1.00 43.37 ? 7   G   F P     1 
ATOM   749  O  OP1   . G   D 2 7   ? 32.686  -17.252 9.983   1.00 44.84 ? 7   G   F OP1   1 
ATOM   750  O  OP2   . G   D 2 7   ? 32.156  -18.088 12.340  1.00 43.57 ? 7   G   F OP2   1 
ATOM   751  O  "O5'" . G   D 2 7   ? 30.752  -18.791 10.405  1.00 42.66 ? 7   G   F "O5'" 1 
ATOM   752  C  "C5'" . G   D 2 7   ? 30.521  -19.190 9.053   1.00 41.21 ? 7   G   F "C5'" 1 
ATOM   753  C  "C4'" . G   D 2 7   ? 29.189  -19.913 8.892   1.00 38.57 ? 7   G   F "C4'" 1 
ATOM   754  O  "O4'" . G   D 2 7   ? 29.088  -21.040 9.811   1.00 37.25 ? 7   G   F "O4'" 1 
ATOM   755  C  "C3'" . G   D 2 7   ? 27.895  -19.160 9.171   1.00 37.56 ? 7   G   F "C3'" 1 
ATOM   756  O  "O3'" . G   D 2 7   ? 27.566  -18.220 8.147   1.00 36.99 ? 7   G   F "O3'" 1 
ATOM   757  C  "C2'" . G   D 2 7   ? 26.899  -20.318 9.233   1.00 36.77 ? 7   G   F "C2'" 1 
ATOM   758  O  "O2'" . G   D 2 7   ? 26.541  -20.852 7.972   1.00 33.53 ? 7   G   F "O2'" 1 
ATOM   759  C  "C1'" . G   D 2 7   ? 27.712  -21.368 9.991   1.00 36.43 ? 7   G   F "C1'" 1 
ATOM   760  N  N9    . G   D 2 7   ? 27.371  -21.348 11.414  1.00 35.65 ? 7   G   F N9    1 
ATOM   761  C  C8    . G   D 2 7   ? 28.140  -20.915 12.467  1.00 35.06 ? 7   G   F C8    1 
ATOM   762  N  N7    . G   D 2 7   ? 27.524  -21.005 13.619  1.00 35.00 ? 7   G   F N7    1 
ATOM   763  C  C5    . G   D 2 7   ? 26.279  -21.537 13.305  1.00 34.48 ? 7   G   F C5    1 
ATOM   764  C  C6    . G   D 2 7   ? 25.170  -21.868 14.140  1.00 33.90 ? 7   G   F C6    1 
ATOM   765  O  O6    . G   D 2 7   ? 25.067  -21.764 15.361  1.00 36.63 ? 7   G   F O6    1 
ATOM   766  N  N1    . G   D 2 7   ? 24.110  -22.378 13.408  1.00 33.13 ? 7   G   F N1    1 
ATOM   767  C  C2    . G   D 2 7   ? 24.109  -22.567 12.053  1.00 33.73 ? 7   G   F C2    1 
ATOM   768  N  N2    . G   D 2 7   ? 23.000  -23.105 11.539  1.00 33.58 ? 7   G   F N2    1 
ATOM   769  N  N3    . G   D 2 7   ? 25.125  -22.261 11.261  1.00 34.34 ? 7   G   F N3    1 
ATOM   770  C  C4    . G   D 2 7   ? 26.169  -21.757 11.949  1.00 34.85 ? 7   G   F C4    1 
ATOM   771  P  P     . C   D 2 8   ? 26.515  -17.035 8.451   1.00 36.20 ? 8   C   F P     1 
ATOM   772  O  OP1   . C   D 2 8   ? 26.493  -16.151 7.259   1.00 34.85 ? 8   C   F OP1   1 
ATOM   773  O  OP2   . C   D 2 8   ? 26.787  -16.456 9.790   1.00 34.33 ? 8   C   F OP2   1 
ATOM   774  O  "O5'" . C   D 2 8   ? 25.110  -17.781 8.532   1.00 37.42 ? 8   C   F "O5'" 1 
ATOM   775  C  "C5'" . C   D 2 8   ? 24.610  -18.537 7.425   1.00 37.61 ? 8   C   F "C5'" 1 
ATOM   776  C  "C4'" . C   D 2 8   ? 23.236  -19.076 7.741   1.00 37.55 ? 8   C   F "C4'" 1 
ATOM   777  O  "O4'" . C   D 2 8   ? 23.325  -20.041 8.819   1.00 38.05 ? 8   C   F "O4'" 1 
ATOM   778  C  "C3'" . C   D 2 8   ? 22.263  -18.042 8.270   1.00 37.43 ? 8   C   F "C3'" 1 
ATOM   779  O  "O3'" . C   D 2 8   ? 21.650  -17.358 7.209   1.00 36.07 ? 8   C   F "O3'" 1 
ATOM   780  C  "C2'" . C   D 2 8   ? 21.253  -18.891 9.022   1.00 38.51 ? 8   C   F "C2'" 1 
ATOM   781  O  "O2'" . C   D 2 8   ? 20.272  -19.473 8.182   1.00 39.48 ? 8   C   F "O2'" 1 
ATOM   782  C  "C1'" . C   D 2 8   ? 22.164  -19.957 9.631   1.00 38.18 ? 8   C   F "C1'" 1 
ATOM   783  N  N1    . C   D 2 8   ? 22.574  -19.620 10.999  1.00 38.16 ? 8   C   F N1    1 
ATOM   784  C  C2    . C   D 2 8   ? 21.648  -19.778 12.026  1.00 38.67 ? 8   C   F C2    1 
ATOM   785  O  O2    . C   D 2 8   ? 20.513  -20.180 11.742  1.00 38.09 ? 8   C   F O2    1 
ATOM   786  N  N3    . C   D 2 8   ? 22.009  -19.486 13.298  1.00 40.18 ? 8   C   F N3    1 
ATOM   787  C  C4    . C   D 2 8   ? 23.246  -19.046 13.554  1.00 40.33 ? 8   C   F C4    1 
ATOM   788  N  N4    . C   D 2 8   ? 23.563  -18.770 14.822  1.00 40.83 ? 8   C   F N4    1 
ATOM   789  C  C5    . C   D 2 8   ? 24.211  -18.868 12.521  1.00 39.34 ? 8   C   F C5    1 
ATOM   790  C  C6    . C   D 2 8   ? 23.836  -19.166 11.270  1.00 39.28 ? 8   C   F C6    1 
ATOM   791  P  P     . U   D 2 9   ? 21.053  -15.907 7.464   1.00 36.40 ? 9   U   F P     1 
ATOM   792  O  OP1   . U   D 2 9   ? 22.189  -14.993 7.742   1.00 36.83 ? 9   U   F OP1   1 
ATOM   793  O  OP2   . U   D 2 9   ? 19.964  -16.056 8.461   1.00 36.66 ? 9   U   F OP2   1 
ATOM   794  O  "O5'" . U   D 2 9   ? 20.404  -15.526 6.062   1.00 36.94 ? 9   U   F "O5'" 1 
ATOM   795  C  "C5'" . U   D 2 9   ? 19.193  -16.142 5.622   1.00 37.17 ? 9   U   F "C5'" 1 
ATOM   796  C  "C4'" . U   D 2 9   ? 19.456  -17.020 4.421   1.00 36.81 ? 9   U   F "C4'" 1 
ATOM   797  O  "O4'" . U   D 2 9   ? 20.147  -16.227 3.430   1.00 36.27 ? 9   U   F "O4'" 1 
ATOM   798  C  "C3'" . U   D 2 9   ? 20.381  -18.204 4.687   1.00 37.78 ? 9   U   F "C3'" 1 
ATOM   799  O  "O3'" . U   D 2 9   ? 19.702  -19.429 5.030   1.00 39.20 ? 9   U   F "O3'" 1 
ATOM   800  C  "C2'" . U   D 2 9   ? 21.071  -18.435 3.344   1.00 37.67 ? 9   U   F "C2'" 1 
ATOM   801  O  "O2'" . U   D 2 9   ? 20.428  -19.429 2.573   1.00 39.95 ? 9   U   F "O2'" 1 
ATOM   802  C  "C1'" . U   D 2 9   ? 20.961  -17.069 2.651   1.00 36.22 ? 9   U   F "C1'" 1 
ATOM   803  N  N1    . U   D 2 9   ? 22.218  -16.377 2.327   1.00 33.41 ? 9   U   F N1    1 
ATOM   804  C  C2    . U   D 2 9   ? 22.749  -16.602 1.076   1.00 32.51 ? 9   U   F C2    1 
ATOM   805  O  O2    . U   D 2 9   ? 22.237  -17.360 0.273   1.00 31.89 ? 9   U   F O2    1 
ATOM   806  N  N3    . U   D 2 9   ? 23.905  -15.915 0.800   1.00 31.81 ? 9   U   F N3    1 
ATOM   807  C  C4    . U   D 2 9   ? 24.578  -15.059 1.635   1.00 30.04 ? 9   U   F C4    1 
ATOM   808  O  O4    . U   D 2 9   ? 25.619  -14.544 1.245   1.00 28.69 ? 9   U   F O4    1 
ATOM   809  C  C5    . U   D 2 9   ? 23.979  -14.882 2.922   1.00 30.97 ? 9   U   F C5    1 
ATOM   810  C  C6    . U   D 2 9   ? 22.842  -15.528 3.216   1.00 33.50 ? 9   U   F C6    1 
ATOM   811  P  P     . U   D 2 10  ? 18.132  -19.626 4.691   1.00 37.35 ? 10  U   F P     1 
ATOM   812  O  OP1   . U   D 2 10  ? 17.797  -18.840 3.477   1.00 37.47 ? 10  U   F OP1   1 
ATOM   813  O  OP2   . U   D 2 10  ? 17.334  -19.435 5.919   1.00 36.79 ? 10  U   F OP2   1 
ATOM   814  O  "O5'" . U   D 2 10  ? 17.987  -21.160 4.275   1.00 38.66 ? 10  U   F "O5'" 1 
ATOM   815  C  "C5'" . U   D 2 10  ? 18.986  -22.157 4.560   1.00 39.43 ? 10  U   F "C5'" 1 
ATOM   816  C  "C4'" . U   D 2 10  ? 18.309  -23.394 5.113   1.00 40.74 ? 10  U   F "C4'" 1 
ATOM   817  O  "O4'" . U   D 2 10  ? 18.321  -23.399 6.550   1.00 42.04 ? 10  U   F "O4'" 1 
ATOM   818  C  "C3'" . U   D 2 10  ? 16.860  -23.510 4.637   1.00 41.12 ? 10  U   F "C3'" 1 
ATOM   819  O  "O3'" . U   D 2 10  ? 16.708  -24.762 3.958   1.00 41.03 ? 10  U   F "O3'" 1 
ATOM   820  C  "C2'" . U   D 2 10  ? 16.017  -23.660 5.907   1.00 42.12 ? 10  U   F "C2'" 1 
ATOM   821  O  "O2'" . U   D 2 10  ? 15.172  -24.781 5.875   1.00 45.87 ? 10  U   F "O2'" 1 
ATOM   822  C  "C1'" . U   D 2 10  ? 17.079  -23.854 6.989   1.00 43.29 ? 10  U   F "C1'" 1 
ATOM   823  N  N1    . U   D 2 10  ? 16.847  -23.484 8.386   1.00 44.65 ? 10  U   F N1    1 
ATOM   824  C  C2    . U   D 2 10  ? 17.316  -22.271 8.835   1.00 45.97 ? 10  U   F C2    1 
ATOM   825  O  O2    . U   D 2 10  ? 17.936  -21.504 8.131   1.00 48.86 ? 10  U   F O2    1 
ATOM   826  N  N3    . U   D 2 10  ? 17.037  -21.991 10.149  1.00 46.94 ? 10  U   F N3    1 
ATOM   827  C  C4    . U   D 2 10  ? 16.359  -22.793 11.041  1.00 46.99 ? 10  U   F C4    1 
ATOM   828  O  O4    . U   D 2 10  ? 16.139  -22.379 12.183  1.00 48.02 ? 10  U   F O4    1 
ATOM   829  C  C5    . U   D 2 10  ? 15.919  -24.047 10.499  1.00 46.27 ? 10  U   F C5    1 
ATOM   830  C  C6    . U   D 2 10  ? 16.175  -24.339 9.222   1.00 44.57 ? 10  U   F C6    1 
ATOM   831  P  P     . U   D 2 11  ? 16.834  -24.883 2.363   1.00 39.64 ? 11  U   F P     1 
ATOM   832  O  OP1   . U   D 2 11  ? 16.573  -23.577 1.709   1.00 39.52 ? 11  U   F OP1   1 
ATOM   833  O  OP2   . U   D 2 11  ? 15.963  -26.044 2.059   1.00 38.89 ? 11  U   F OP2   1 
ATOM   834  O  "O5'" . U   D 2 11  ? 18.359  -25.306 2.123   1.00 38.98 ? 11  U   F "O5'" 1 
ATOM   835  C  "C5'" . U   D 2 11  ? 18.783  -26.684 2.164   1.00 37.81 ? 11  U   F "C5'" 1 
ATOM   836  C  "C4'" . U   D 2 11  ? 20.034  -26.813 3.007   1.00 37.25 ? 11  U   F "C4'" 1 
ATOM   837  O  "O4'" . U   D 2 11  ? 19.787  -26.243 4.285   1.00 39.01 ? 11  U   F "O4'" 1 
ATOM   838  C  "C3'" . U   D 2 11  ? 20.612  -28.207 3.263   1.00 36.61 ? 11  U   F "C3'" 1 
ATOM   839  O  "O3'" . U   D 2 11  ? 21.788  -28.225 2.450   1.00 32.72 ? 11  U   F "O3'" 1 
ATOM   840  C  "C2'" . U   D 2 11  ? 21.025  -28.212 4.748   1.00 37.93 ? 11  U   F "C2'" 1 
ATOM   841  O  "O2'" . U   D 2 11  ? 22.384  -28.506 4.971   1.00 41.14 ? 11  U   F "O2'" 1 
ATOM   842  C  "C1'" . U   D 2 11  ? 20.717  -26.773 5.178   1.00 38.50 ? 11  U   F "C1'" 1 
ATOM   843  N  N1    . U   D 2 11  ? 20.300  -26.420 6.537   1.00 37.79 ? 11  U   F N1    1 
ATOM   844  C  C2    . U   D 2 11  ? 21.069  -25.477 7.150   1.00 37.13 ? 11  U   F C2    1 
ATOM   845  O  O2    . U   D 2 11  ? 22.077  -25.025 6.632   1.00 36.63 ? 11  U   F O2    1 
ATOM   846  N  N3    . U   D 2 11  ? 20.621  -25.072 8.378   1.00 36.90 ? 11  U   F N3    1 
ATOM   847  C  C4    . U   D 2 11  ? 19.516  -25.532 9.041   1.00 37.63 ? 11  U   F C4    1 
ATOM   848  O  O4    . U   D 2 11  ? 19.194  -25.008 10.104  1.00 39.93 ? 11  U   F O4    1 
ATOM   849  C  C5    . U   D 2 11  ? 18.793  -26.555 8.358   1.00 37.60 ? 11  U   F C5    1 
ATOM   850  C  C6    . U   D 2 11  ? 19.202  -26.957 7.155   1.00 38.07 ? 11  U   F C6    1 
ATOM   851  P  P     . U   D 2 12  ? 22.525  -29.595 2.083   1.00 31.16 ? 12  U   F P     1 
ATOM   852  O  OP1   . U   D 2 12  ? 21.469  -30.529 1.626   1.00 33.55 ? 12  U   F OP1   1 
ATOM   853  O  OP2   . U   D 2 12  ? 23.446  -29.997 3.172   1.00 28.84 ? 12  U   F OP2   1 
ATOM   854  O  "O5'" . U   D 2 12  ? 23.396  -29.197 0.805   1.00 30.55 ? 12  U   F "O5'" 1 
ATOM   855  C  "C5'" . U   D 2 12  ? 22.850  -28.369 -0.227  1.00 29.84 ? 12  U   F "C5'" 1 
ATOM   856  C  "C4'" . U   D 2 12  ? 23.652  -27.097 -0.338  1.00 29.61 ? 12  U   F "C4'" 1 
ATOM   857  O  "O4'" . U   D 2 12  ? 23.650  -26.428 0.928   1.00 31.42 ? 12  U   F "O4'" 1 
ATOM   858  C  "C3'" . U   D 2 12  ? 25.105  -27.289 -0.750  1.00 30.28 ? 12  U   F "C3'" 1 
ATOM   859  O  "O3'" . U   D 2 12  ? 25.145  -26.754 -2.077  1.00 27.55 ? 12  U   F "O3'" 1 
ATOM   860  C  "C2'" . U   D 2 12  ? 25.924  -26.383 0.188   1.00 31.73 ? 12  U   F "C2'" 1 
ATOM   861  O  "O2'" . U   D 2 12  ? 26.673  -25.390 -0.472  1.00 38.36 ? 12  U   F "O2'" 1 
ATOM   862  C  "C1'" . U   D 2 12  ? 24.853  -25.728 1.068   1.00 31.96 ? 12  U   F "C1'" 1 
ATOM   863  N  N1    . U   D 2 12  ? 25.105  -25.491 2.496   1.00 33.23 ? 12  U   F N1    1 
ATOM   864  C  C2    . U   D 2 12  ? 25.818  -24.357 2.840   1.00 33.36 ? 12  U   F C2    1 
ATOM   865  O  O2    . U   D 2 12  ? 26.306  -23.604 2.011   1.00 31.54 ? 12  U   F O2    1 
ATOM   866  N  N3    . U   D 2 12  ? 25.935  -24.139 4.192   1.00 33.58 ? 12  U   F N3    1 
ATOM   867  C  C4    . U   D 2 12  ? 25.430  -24.928 5.209   1.00 33.80 ? 12  U   F C4    1 
ATOM   868  O  O4    . U   D 2 12  ? 25.534  -24.555 6.380   1.00 34.24 ? 12  U   F O4    1 
ATOM   869  C  C5    . U   D 2 12  ? 24.745  -26.101 4.765   1.00 33.64 ? 12  U   F C5    1 
ATOM   870  C  C6    . U   D 2 12  ? 24.613  -26.338 3.459   1.00 32.66 ? 12  U   F C6    1 
ATOM   871  P  P     . C   D 2 13  ? 26.087  -27.386 -3.211  1.00 27.62 ? 13  C   F P     1 
ATOM   872  O  OP1   . C   D 2 13  ? 27.097  -28.291 -2.625  1.00 28.37 ? 13  C   F OP1   1 
ATOM   873  O  OP2   . C   D 2 13  ? 26.532  -26.215 -3.999  1.00 25.93 ? 13  C   F OP2   1 
ATOM   874  O  "O5'" . C   D 2 13  ? 25.072  -28.234 -4.112  1.00 27.15 ? 13  C   F "O5'" 1 
ATOM   875  C  "C5'" . C   D 2 13  ? 24.519  -29.462 -3.643  1.00 25.81 ? 13  C   F "C5'" 1 
ATOM   876  C  "C4'" . C   D 2 13  ? 23.719  -30.143 -4.737  1.00 26.60 ? 13  C   F "C4'" 1 
ATOM   877  O  "O4'" . C   D 2 13  ? 22.373  -29.645 -4.820  1.00 24.93 ? 13  C   F "O4'" 1 
ATOM   878  C  "C3'" . C   D 2 13  ? 24.292  -30.076 -6.154  1.00 27.11 ? 13  C   F "C3'" 1 
ATOM   879  O  "O3'" . C   D 2 13  ? 24.878  -31.337 -6.517  1.00 29.83 ? 13  C   F "O3'" 1 
ATOM   880  C  "C2'" . C   D 2 13  ? 23.061  -29.957 -7.071  1.00 26.23 ? 13  C   F "C2'" 1 
ATOM   881  O  "O2'" . C   D 2 13  ? 22.947  -31.027 -7.978  1.00 28.48 ? 13  C   F "O2'" 1 
ATOM   882  C  "C1'" . C   D 2 13  ? 21.898  -30.020 -6.076  1.00 26.10 ? 13  C   F "C1'" 1 
ATOM   883  N  N1    . C   D 2 13  ? 20.608  -29.399 -6.376  1.00 25.91 ? 13  C   F N1    1 
ATOM   884  C  C2    . C   D 2 13  ? 19.573  -30.253 -6.776  1.00 26.79 ? 13  C   F C2    1 
ATOM   885  O  O2    . C   D 2 13  ? 19.819  -31.464 -6.900  1.00 24.77 ? 13  C   F O2    1 
ATOM   886  N  N3    . C   D 2 13  ? 18.339  -29.745 -7.022  1.00 27.09 ? 13  C   F N3    1 
ATOM   887  C  C4    . C   D 2 13  ? 18.123  -28.437 -6.885  1.00 27.41 ? 13  C   F C4    1 
ATOM   888  N  N4    . C   D 2 13  ? 16.886  -27.991 -7.110  1.00 26.61 ? 13  C   F N4    1 
ATOM   889  C  C5    . C   D 2 13  ? 19.173  -27.530 -6.503  1.00 28.75 ? 13  C   F C5    1 
ATOM   890  C  C6    . C   D 2 13  ? 20.392  -28.054 -6.260  1.00 27.71 ? 13  C   F C6    1 
ATOM   891  P  P     . A   D 2 14  ? 26.099  -31.971 -5.676  1.00 29.67 ? 14  A   F P     1 
ATOM   892  O  OP1   . A   D 2 14  ? 26.064  -33.413 -5.957  1.00 28.79 ? 14  A   F OP1   1 
ATOM   893  O  OP2   . A   D 2 14  ? 26.150  -31.512 -4.273  1.00 30.57 ? 14  A   F OP2   1 
ATOM   894  O  "O5'" . A   D 2 14  ? 27.363  -31.392 -6.434  1.00 35.68 ? 14  A   F "O5'" 1 
ATOM   895  C  "C5'" . A   D 2 14  ? 27.311  -31.216 -7.838  1.00 42.09 ? 14  A   F "C5'" 1 
ATOM   896  C  "C4'" . A   D 2 14  ? 28.140  -30.034 -8.244  1.00 47.27 ? 14  A   F "C4'" 1 
ATOM   897  O  "O4'" . A   D 2 14  ? 29.538  -30.324 -7.990  1.00 49.74 ? 14  A   F "O4'" 1 
ATOM   898  C  "C3'" . A   D 2 14  ? 28.051  -29.719 -9.725  1.00 50.10 ? 14  A   F "C3'" 1 
ATOM   899  O  "O3'" . A   D 2 14  ? 26.971  -28.817 -9.936  1.00 54.31 ? 14  A   F "O3'" 1 
ATOM   900  C  "C2'" . A   D 2 14  ? 29.413  -29.111 -10.007 1.00 49.80 ? 14  A   F "C2'" 1 
ATOM   901  O  "O2'" . A   D 2 14  ? 29.496  -27.780 -9.554  1.00 49.39 ? 14  A   F "O2'" 1 
ATOM   902  C  "C1'" . A   D 2 14  ? 30.304  -29.991 -9.129  1.00 51.70 ? 14  A   F "C1'" 1 
ATOM   903  N  N9    . A   D 2 14  ? 30.728  -31.252 -9.740  1.00 54.51 ? 14  A   F N9    1 
ATOM   904  C  C8    . A   D 2 14  ? 31.426  -32.260 -9.118  1.00 54.60 ? 14  A   F C8    1 
ATOM   905  N  N7    . A   D 2 14  ? 31.687  -33.284 -9.896  1.00 55.52 ? 14  A   F N7    1 
ATOM   906  C  C5    . A   D 2 14  ? 31.124  -32.930 -11.116 1.00 55.75 ? 14  A   F C5    1 
ATOM   907  C  C6    . A   D 2 14  ? 31.077  -33.583 -12.366 1.00 55.88 ? 14  A   F C6    1 
ATOM   908  N  N6    . A   D 2 14  ? 31.638  -34.774 -12.604 1.00 55.32 ? 14  A   F N6    1 
ATOM   909  N  N1    . A   D 2 14  ? 30.435  -32.956 -13.379 1.00 56.52 ? 14  A   F N1    1 
ATOM   910  C  C2    . A   D 2 14  ? 29.890  -31.751 -13.148 1.00 56.18 ? 14  A   F C2    1 
ATOM   911  N  N3    . A   D 2 14  ? 29.880  -31.031 -12.026 1.00 56.39 ? 14  A   F N3    1 
ATOM   912  C  C4    . A   D 2 14  ? 30.522  -31.682 -11.035 1.00 55.92 ? 14  A   F C4    1 
ATOM   913  P  P     . A   D 2 15  ? 26.653  -28.277 -11.417 1.00 57.28 ? 15  A   F P     1 
ATOM   914  O  OP1   . A   D 2 15  ? 27.541  -28.992 -12.378 1.00 56.88 ? 15  A   F OP1   1 
ATOM   915  O  OP2   . A   D 2 15  ? 26.704  -26.788 -11.335 1.00 57.32 ? 15  A   F OP2   1 
ATOM   916  O  "O5'" . A   D 2 15  ? 25.132  -28.686 -11.681 1.00 57.01 ? 15  A   F "O5'" 1 
ATOM   917  C  "C5'" . A   D 2 15  ? 24.639  -29.986 -11.365 1.00 58.52 ? 15  A   F "C5'" 1 
ATOM   918  C  "C4'" . A   D 2 15  ? 25.346  -31.018 -12.201 1.00 60.64 ? 15  A   F "C4'" 1 
ATOM   919  O  "O4'" . A   D 2 15  ? 26.437  -31.588 -11.426 1.00 61.00 ? 15  A   F "O4'" 1 
ATOM   920  C  "C3'" . A   D 2 15  ? 24.530  -32.238 -12.584 1.00 61.75 ? 15  A   F "C3'" 1 
ATOM   921  O  "O3'" . A   D 2 15  ? 23.544  -31.970 -13.593 1.00 62.62 ? 15  A   F "O3'" 1 
ATOM   922  C  "C2'" . A   D 2 15  ? 25.626  -33.239 -12.931 1.00 62.17 ? 15  A   F "C2'" 1 
ATOM   923  O  "O2'" . A   D 2 15  ? 26.207  -33.010 -14.203 1.00 61.15 ? 15  A   F "O2'" 1 
ATOM   924  C  "C1'" . A   D 2 15  ? 26.652  -32.931 -11.837 1.00 62.75 ? 15  A   F "C1'" 1 
ATOM   925  N  N9    . A   D 2 15  ? 26.502  -33.810 -10.677 1.00 64.40 ? 15  A   F N9    1 
ATOM   926  C  C8    . A   D 2 15  ? 27.414  -34.718 -10.194 1.00 64.62 ? 15  A   F C8    1 
ATOM   927  N  N7    . A   D 2 15  ? 26.969  -35.428 -9.184  1.00 65.39 ? 15  A   F N7    1 
ATOM   928  C  C5    . A   D 2 15  ? 25.681  -34.945 -8.975  1.00 66.01 ? 15  A   F C5    1 
ATOM   929  C  C6    . A   D 2 15  ? 24.663  -35.300 -8.053  1.00 66.00 ? 15  A   F C6    1 
ATOM   930  N  N6    . A   D 2 15  ? 24.781  -36.287 -7.157  1.00 66.93 ? 15  A   F N6    1 
ATOM   931  N  N1    . A   D 2 15  ? 23.503  -34.606 -8.097  1.00 65.73 ? 15  A   F N1    1 
ATOM   932  C  C2    . A   D 2 15  ? 23.370  -33.640 -9.020  1.00 66.86 ? 15  A   F C2    1 
ATOM   933  N  N3    . A   D 2 15  ? 24.241  -33.229 -9.951  1.00 66.62 ? 15  A   F N3    1 
ATOM   934  C  C4    . A   D 2 15  ? 25.389  -33.931 -9.874  1.00 65.81 ? 15  A   F C4    1 
ATOM   935  N  N     . MET E 3 5   ? -19.974 -68.135 -39.144 1.00 37.36 ? 5   MET A N     1 
ATOM   936  C  CA    . MET E 3 5   ? -19.073 -66.949 -38.953 1.00 38.06 ? 5   MET A CA    1 
ATOM   937  C  C     . MET E 3 5   ? -17.640 -67.313 -38.540 1.00 37.07 ? 5   MET A C     1 
ATOM   938  O  O     . MET E 3 5   ? -17.411 -67.880 -37.471 1.00 36.45 ? 5   MET A O     1 
ATOM   939  C  CB    . MET E 3 5   ? -19.703 -66.002 -37.923 1.00 38.71 ? 5   MET A CB    1 
ATOM   940  C  CG    . MET E 3 5   ? -18.734 -65.162 -37.116 1.00 40.42 ? 5   MET A CG    1 
ATOM   941  S  SD    . MET E 3 5   ? -18.000 -63.784 -37.984 1.00 44.08 ? 5   MET A SD    1 
ATOM   942  C  CE    . MET E 3 5   ? -19.405 -63.166 -38.922 1.00 43.92 ? 5   MET A CE    1 
ATOM   943  N  N     . ASP E 3 6   ? -16.680 -66.992 -39.402 1.00 35.74 ? 6   ASP A N     1 
ATOM   944  C  CA    . ASP E 3 6   ? -15.280 -67.268 -39.119 1.00 34.26 ? 6   ASP A CA    1 
ATOM   945  C  C     . ASP E 3 6   ? -14.439 -66.025 -39.374 1.00 33.66 ? 6   ASP A C     1 
ATOM   946  O  O     . ASP E 3 6   ? -14.972 -64.951 -39.627 1.00 33.61 ? 6   ASP A O     1 
ATOM   947  C  CB    . ASP E 3 6   ? -14.770 -68.434 -39.971 1.00 35.82 ? 6   ASP A CB    1 
ATOM   948  C  CG    . ASP E 3 6   ? -14.923 -68.190 -41.455 1.00 37.13 ? 6   ASP A CG    1 
ATOM   949  O  OD1   . ASP E 3 6   ? -14.440 -69.026 -42.247 1.00 38.27 ? 6   ASP A OD1   1 
ATOM   950  O  OD2   . ASP E 3 6   ? -15.528 -67.166 -41.834 1.00 39.25 ? 6   ASP A OD2   1 
ATOM   951  N  N     . GLN E 3 7   ? -13.123 -66.181 -39.321 1.00 33.47 ? 7   GLN A N     1 
ATOM   952  C  CA    . GLN E 3 7   ? -12.198 -65.072 -39.514 1.00 33.78 ? 7   GLN A CA    1 
ATOM   953  C  C     . GLN E 3 7   ? -12.279 -64.406 -40.887 1.00 34.66 ? 7   GLN A C     1 
ATOM   954  O  O     . GLN E 3 7   ? -11.807 -63.279 -41.064 1.00 34.58 ? 7   GLN A O     1 
ATOM   955  C  CB    . GLN E 3 7   ? -10.776 -65.561 -39.262 1.00 32.79 ? 7   GLN A CB    1 
ATOM   956  C  CG    . GLN E 3 7   ? -10.637 -66.366 -37.988 1.00 30.44 ? 7   GLN A CG    1 
ATOM   957  C  CD    . GLN E 3 7   ? -9.269  -66.979 -37.849 1.00 30.41 ? 7   GLN A CD    1 
ATOM   958  O  OE1   . GLN E 3 7   ? -9.056  -67.866 -37.026 1.00 30.31 ? 7   GLN A OE1   1 
ATOM   959  N  NE2   . GLN E 3 7   ? -8.326  -66.510 -38.658 1.00 29.37 ? 7   GLN A NE2   1 
ATOM   960  N  N     . THR E 3 8   ? -12.863 -65.105 -41.856 1.00 35.09 ? 8   THR A N     1 
ATOM   961  C  CA    . THR E 3 8   ? -13.008 -64.557 -43.201 1.00 35.14 ? 8   THR A CA    1 
ATOM   962  C  C     . THR E 3 8   ? -14.041 -63.434 -43.192 1.00 34.95 ? 8   THR A C     1 
ATOM   963  O  O     . THR E 3 8   ? -14.114 -62.647 -44.129 1.00 35.37 ? 8   THR A O     1 
ATOM   964  C  CB    . THR E 3 8   ? -13.465 -65.633 -44.230 1.00 35.12 ? 8   THR A CB    1 
ATOM   965  O  OG1   . THR E 3 8   ? -14.771 -66.118 -43.890 1.00 34.39 ? 8   THR A OG1   1 
ATOM   966  C  CG2   . THR E 3 8   ? -12.490 -66.791 -44.261 1.00 35.51 ? 8   THR A CG2   1 
ATOM   967  N  N     . GLN E 3 9   ? -14.833 -63.364 -42.127 1.00 35.53 ? 9   GLN A N     1 
ATOM   968  C  CA    . GLN E 3 9   ? -15.859 -62.334 -42.005 1.00 36.46 ? 9   GLN A CA    1 
ATOM   969  C  C     . GLN E 3 9   ? -15.635 -61.441 -40.792 1.00 35.71 ? 9   GLN A C     1 
ATOM   970  O  O     . GLN E 3 9   ? -15.031 -61.860 -39.811 1.00 35.33 ? 9   GLN A O     1 
ATOM   971  C  CB    . GLN E 3 9   ? -17.244 -62.971 -41.894 1.00 38.31 ? 9   GLN A CB    1 
ATOM   972  C  CG    . GLN E 3 9   ? -17.602 -63.927 -43.016 1.00 41.51 ? 9   GLN A CG    1 
ATOM   973  C  CD    . GLN E 3 9   ? -18.994 -64.515 -42.839 1.00 44.22 ? 9   GLN A CD    1 
ATOM   974  O  OE1   . GLN E 3 9   ? -19.980 -63.991 -43.368 1.00 43.64 ? 9   GLN A OE1   1 
ATOM   975  N  NE2   . GLN E 3 9   ? -19.081 -65.602 -42.073 1.00 44.80 ? 9   GLN A NE2   1 
ATOM   976  N  N     . PRO E 3 10  ? -16.124 -60.190 -40.851 1.00 35.53 ? 10  PRO A N     1 
ATOM   977  C  CA    . PRO E 3 10  ? -15.990 -59.218 -39.762 1.00 35.80 ? 10  PRO A CA    1 
ATOM   978  C  C     . PRO E 3 10  ? -16.962 -59.472 -38.621 1.00 35.65 ? 10  PRO A C     1 
ATOM   979  O  O     . PRO E 3 10  ? -18.123 -59.781 -38.862 1.00 35.94 ? 10  PRO A O     1 
ATOM   980  C  CB    . PRO E 3 10  ? -16.268 -57.891 -40.456 1.00 35.77 ? 10  PRO A CB    1 
ATOM   981  C  CG    . PRO E 3 10  ? -17.262 -58.276 -41.496 1.00 34.67 ? 10  PRO A CG    1 
ATOM   982  C  CD    . PRO E 3 10  ? -16.679 -59.542 -42.053 1.00 34.55 ? 10  PRO A CD    1 
ATOM   983  N  N     . LEU E 3 11  ? -16.486 -59.352 -37.383 1.00 36.46 ? 11  LEU A N     1 
ATOM   984  C  CA    . LEU E 3 11  ? -17.343 -59.554 -36.214 1.00 37.14 ? 11  LEU A CA    1 
ATOM   985  C  C     . LEU E 3 11  ? -18.210 -58.332 -36.050 1.00 37.49 ? 11  LEU A C     1 
ATOM   986  O  O     . LEU E 3 11  ? -19.355 -58.416 -35.623 1.00 38.31 ? 11  LEU A O     1 
ATOM   987  C  CB    . LEU E 3 11  ? -16.523 -59.761 -34.940 1.00 37.50 ? 11  LEU A CB    1 
ATOM   988  C  CG    . LEU E 3 11  ? -16.218 -61.208 -34.550 1.00 37.99 ? 11  LEU A CG    1 
ATOM   989  C  CD1   . LEU E 3 11  ? -15.425 -61.233 -33.254 1.00 39.03 ? 11  LEU A CD1   1 
ATOM   990  C  CD2   . LEU E 3 11  ? -17.519 -61.976 -34.378 1.00 37.27 ? 11  LEU A CD2   1 
ATOM   991  N  N     . ASN E 3 12  ? -17.644 -57.183 -36.376 1.00 38.11 ? 12  ASN A N     1 
ATOM   992  C  CA    . ASN E 3 12  ? -18.396 -55.945 -36.304 1.00 39.47 ? 12  ASN A CA    1 
ATOM   993  C  C     . ASN E 3 12  ? -17.726 -54.877 -37.145 1.00 40.29 ? 12  ASN A C     1 
ATOM   994  O  O     . ASN E 3 12  ? -16.583 -55.044 -37.566 1.00 40.16 ? 12  ASN A O     1 
ATOM   995  C  CB    . ASN E 3 12  ? -18.561 -55.467 -34.851 1.00 40.58 ? 12  ASN A CB    1 
ATOM   996  C  CG    . ASN E 3 12  ? -17.240 -55.153 -34.165 1.00 40.80 ? 12  ASN A CG    1 
ATOM   997  O  OD1   . ASN E 3 12  ? -16.391 -54.447 -34.706 1.00 40.66 ? 12  ASN A OD1   1 
ATOM   998  N  ND2   . ASN E 3 12  ? -17.078 -55.658 -32.948 1.00 41.02 ? 12  ASN A ND2   1 
ATOM   999  N  N     . GLU E 3 13  ? -18.454 -53.789 -37.383 1.00 41.48 ? 13  GLU A N     1 
ATOM   1000 C  CA    . GLU E 3 13  ? -17.976 -52.673 -38.183 1.00 42.62 ? 13  GLU A CA    1 
ATOM   1001 C  C     . GLU E 3 13  ? -16.542 -52.306 -37.894 1.00 42.04 ? 13  GLU A C     1 
ATOM   1002 O  O     . GLU E 3 13  ? -15.726 -52.233 -38.801 1.00 42.80 ? 13  GLU A O     1 
ATOM   1003 C  CB    . GLU E 3 13  ? -18.868 -51.455 -37.960 1.00 45.14 ? 13  GLU A CB    1 
ATOM   1004 C  CG    . GLU E 3 13  ? -20.359 -51.820 -37.792 1.00 49.05 ? 13  GLU A CG    1 
ATOM   1005 C  CD    . GLU E 3 13  ? -20.867 -51.573 -36.357 1.00 51.50 ? 13  GLU A CD    1 
ATOM   1006 O  OE1   . GLU E 3 13  ? -20.021 -51.298 -35.455 1.00 50.84 ? 13  GLU A OE1   1 
ATOM   1007 O  OE2   . GLU E 3 13  ? -22.100 -51.645 -36.136 1.00 53.68 ? 13  GLU A OE2   1 
ATOM   1008 N  N     . LYS E 3 14  ? -16.240 -52.082 -36.625 1.00 41.17 ? 14  LYS A N     1 
ATOM   1009 C  CA    . LYS E 3 14  ? -14.898 -51.695 -36.206 1.00 40.30 ? 14  LYS A CA    1 
ATOM   1010 C  C     . LYS E 3 14  ? -13.765 -52.488 -36.866 1.00 39.23 ? 14  LYS A C     1 
ATOM   1011 O  O     . LYS E 3 14  ? -12.789 -51.902 -37.319 1.00 38.53 ? 14  LYS A O     1 
ATOM   1012 C  CB    . LYS E 3 14  ? -14.819 -51.784 -34.678 1.00 41.77 ? 14  LYS A CB    1 
ATOM   1013 C  CG    . LYS E 3 14  ? -16.047 -51.150 -34.030 1.00 43.10 ? 14  LYS A CG    1 
ATOM   1014 C  CD    . LYS E 3 14  ? -15.954 -51.078 -32.517 1.00 44.55 ? 14  LYS A CD    1 
ATOM   1015 C  CE    . LYS E 3 14  ? -17.234 -50.496 -31.935 1.00 43.83 ? 14  LYS A CE    1 
ATOM   1016 N  NZ    . LYS E 3 14  ? -17.084 -50.217 -30.492 1.00 44.16 ? 14  LYS A NZ    1 
ATOM   1017 N  N     . GLN E 3 15  ? -13.901 -53.811 -36.931 1.00 38.39 ? 15  GLN A N     1 
ATOM   1018 C  CA    . GLN E 3 15  ? -12.875 -54.659 -37.539 1.00 37.80 ? 15  GLN A CA    1 
ATOM   1019 C  C     . GLN E 3 15  ? -12.493 -54.231 -38.960 1.00 37.45 ? 15  GLN A C     1 
ATOM   1020 O  O     . GLN E 3 15  ? -13.270 -53.578 -39.658 1.00 37.30 ? 15  GLN A O     1 
ATOM   1021 C  CB    . GLN E 3 15  ? -13.327 -56.119 -37.581 1.00 37.81 ? 15  GLN A CB    1 
ATOM   1022 C  CG    . GLN E 3 15  ? -13.479 -56.791 -36.235 1.00 40.45 ? 15  GLN A CG    1 
ATOM   1023 C  CD    . GLN E 3 15  ? -13.222 -58.294 -36.292 1.00 41.29 ? 15  GLN A CD    1 
ATOM   1024 O  OE1   . GLN E 3 15  ? -14.091 -59.095 -35.999 1.00 42.52 ? 15  GLN A OE1   1 
ATOM   1025 N  NE2   . GLN E 3 15  ? -12.019 -58.670 -36.668 1.00 43.70 ? 15  GLN A NE2   1 
ATOM   1026 N  N     . VAL E 3 16  ? -11.281 -54.601 -39.366 1.00 35.70 ? 16  VAL A N     1 
ATOM   1027 C  CA    . VAL E 3 16  ? -10.742 -54.297 -40.687 1.00 33.83 ? 16  VAL A CA    1 
ATOM   1028 C  C     . VAL E 3 16  ? -10.056 -55.583 -41.147 1.00 33.91 ? 16  VAL A C     1 
ATOM   1029 O  O     . VAL E 3 16  ? -9.737  -56.435 -40.328 1.00 34.98 ? 16  VAL A O     1 
ATOM   1030 C  CB    . VAL E 3 16  ? -9.699  -53.164 -40.626 1.00 33.61 ? 16  VAL A CB    1 
ATOM   1031 C  CG1   . VAL E 3 16  ? -10.326 -51.895 -40.085 1.00 32.65 ? 16  VAL A CG1   1 
ATOM   1032 C  CG2   . VAL E 3 16  ? -8.528  -53.593 -39.752 1.00 33.46 ? 16  VAL A CG2   1 
ATOM   1033 N  N     . PRO E 3 17  ? -9.811  -55.742 -42.459 1.00 33.37 ? 17  PRO A N     1 
ATOM   1034 C  CA    . PRO E 3 17  ? -9.163  -56.928 -43.055 1.00 32.62 ? 17  PRO A CA    1 
ATOM   1035 C  C     . PRO E 3 17  ? -7.614  -57.009 -42.851 1.00 31.33 ? 17  PRO A C     1 
ATOM   1036 O  O     . PRO E 3 17  ? -6.955  -55.964 -42.865 1.00 30.38 ? 17  PRO A O     1 
ATOM   1037 C  CB    . PRO E 3 17  ? -9.549  -56.790 -44.530 1.00 32.36 ? 17  PRO A CB    1 
ATOM   1038 C  CG    . PRO E 3 17  ? -9.470  -55.290 -44.729 1.00 31.82 ? 17  PRO A CG    1 
ATOM   1039 C  CD    . PRO E 3 17  ? -10.183 -54.766 -43.503 1.00 32.41 ? 17  PRO A CD    1 
ATOM   1040 N  N     . ASN E 3 18  ? -7.020  -58.199 -42.648 1.00 30.84 ? 18  ASN A N     1 
ATOM   1041 C  CA    . ASN E 3 18  ? -5.558  -58.203 -42.505 1.00 31.80 ? 18  ASN A CA    1 
ATOM   1042 C  C     . ASN E 3 18  ? -4.971  -58.050 -43.882 1.00 30.72 ? 18  ASN A C     1 
ATOM   1043 O  O     . ASN E 3 18  ? -5.588  -57.572 -44.837 1.00 30.38 ? 18  ASN A O     1 
ATOM   1044 C  CB    . ASN E 3 18  ? -4.842  -59.513 -42.068 1.00 32.70 ? 18  ASN A CB    1 
ATOM   1045 C  CG    . ASN E 3 18  ? -5.598  -60.380 -41.156 1.00 32.86 ? 18  ASN A CG    1 
ATOM   1046 O  OD1   . ASN E 3 18  ? -6.071  -59.990 -40.115 1.00 35.11 ? 18  ASN A OD1   1 
ATOM   1047 N  ND2   . ASN E 3 18  ? -5.652  -61.651 -41.531 1.00 34.95 ? 18  ASN A ND2   1 
ATOM   1048 N  N     . SER E 3 19  ? -3.750  -58.573 -43.908 1.00 30.08 ? 19  SER A N     1 
ATOM   1049 C  CA    . SER E 3 19  ? -2.869  -58.673 -45.034 1.00 29.85 ? 19  SER A CA    1 
ATOM   1050 C  C     . SER E 3 19  ? -3.228  -60.006 -45.693 1.00 28.69 ? 19  SER A C     1 
ATOM   1051 O  O     . SER E 3 19  ? -2.696  -60.360 -46.735 1.00 29.45 ? 19  SER A O     1 
ATOM   1052 C  CB    . SER E 3 19  ? -1.429  -58.713 -44.528 1.00 30.57 ? 19  SER A CB    1 
ATOM   1053 O  OG    . SER E 3 19  ? -1.041  -57.472 -43.971 1.00 30.70 ? 19  SER A OG    1 
ATOM   1054 N  N     . GLU E 3 20  ? -4.132  -60.751 -45.075 1.00 27.55 ? 20  GLU A N     1 
ATOM   1055 C  CA    . GLU E 3 20  ? -4.533  -62.028 -45.630 1.00 26.41 ? 20  GLU A CA    1 
ATOM   1056 C  C     . GLU E 3 20  ? -6.009  -62.028 -45.991 1.00 26.40 ? 20  GLU A C     1 
ATOM   1057 O  O     . GLU E 3 20  ? -6.530  -63.019 -46.509 1.00 25.25 ? 20  GLU A O     1 
ATOM   1058 C  CB    . GLU E 3 20  ? -4.244  -63.150 -44.633 1.00 27.26 ? 20  GLU A CB    1 
ATOM   1059 C  CG    . GLU E 3 20  ? -2.799  -63.612 -44.588 1.00 26.30 ? 20  GLU A CG    1 
ATOM   1060 C  CD    . GLU E 3 20  ? -2.353  -64.280 -45.877 1.00 27.66 ? 20  GLU A CD    1 
ATOM   1061 O  OE1   . GLU E 3 20  ? -1.653  -65.314 -45.800 1.00 26.58 ? 20  GLU A OE1   1 
ATOM   1062 O  OE2   . GLU E 3 20  ? -2.692  -63.764 -46.966 1.00 29.22 ? 20  GLU A OE2   1 
ATOM   1063 N  N     . GLY E 3 21  ? -6.683  -60.918 -45.709 1.00 26.98 ? 21  GLY A N     1 
ATOM   1064 C  CA    . GLY E 3 21  ? -8.096  -60.829 -46.023 1.00 27.99 ? 21  GLY A CA    1 
ATOM   1065 C  C     . GLY E 3 21  ? -9.022  -61.129 -44.861 1.00 28.75 ? 21  GLY A C     1 
ATOM   1066 O  O     . GLY E 3 21  ? -10.184 -60.752 -44.906 1.00 29.53 ? 21  GLY A O     1 
ATOM   1067 N  N     . CYS E 3 22  ? -8.517  -61.804 -43.826 1.00 29.32 ? 22  CYS A N     1 
ATOM   1068 C  CA    . CYS E 3 22  ? -9.324  -62.134 -42.655 1.00 28.92 ? 22  CYS A CA    1 
ATOM   1069 C  C     . CYS E 3 22  ? -9.435  -60.937 -41.746 1.00 29.26 ? 22  CYS A C     1 
ATOM   1070 O  O     . CYS E 3 22  ? -8.563  -60.083 -41.745 1.00 30.05 ? 22  CYS A O     1 
ATOM   1071 C  CB    . CYS E 3 22  ? -8.715  -63.301 -41.917 1.00 28.18 ? 22  CYS A CB    1 
ATOM   1072 S  SG    . CYS E 3 22  ? -8.843  -64.787 -42.891 1.00 28.73 ? 22  CYS A SG    1 
ATOM   1073 N  N     . TYR E 3 23  ? -10.498 -60.876 -40.957 1.00 30.38 ? 23  TYR A N     1 
ATOM   1074 C  CA    . TYR E 3 23  ? -10.715 -59.711 -40.108 1.00 31.94 ? 23  TYR A CA    1 
ATOM   1075 C  C     . TYR E 3 23  ? -10.159 -59.653 -38.690 1.00 31.56 ? 23  TYR A C     1 
ATOM   1076 O  O     . TYR E 3 23  ? -10.224 -60.619 -37.926 1.00 31.92 ? 23  TYR A O     1 
ATOM   1077 C  CB    . TYR E 3 23  ? -12.210 -59.392 -40.077 1.00 32.82 ? 23  TYR A CB    1 
ATOM   1078 C  CG    . TYR E 3 23  ? -12.706 -58.837 -41.393 1.00 35.83 ? 23  TYR A CG    1 
ATOM   1079 C  CD1   . TYR E 3 23  ? -12.801 -59.647 -42.531 1.00 35.24 ? 23  TYR A CD1   1 
ATOM   1080 C  CD2   . TYR E 3 23  ? -13.044 -57.489 -41.514 1.00 36.37 ? 23  TYR A CD2   1 
ATOM   1081 C  CE1   . TYR E 3 23  ? -13.218 -59.125 -43.753 1.00 34.86 ? 23  TYR A CE1   1 
ATOM   1082 C  CE2   . TYR E 3 23  ? -13.458 -56.961 -42.725 1.00 36.70 ? 23  TYR A CE2   1 
ATOM   1083 C  CZ    . TYR E 3 23  ? -13.543 -57.780 -43.841 1.00 37.02 ? 23  TYR A CZ    1 
ATOM   1084 O  OH    . TYR E 3 23  ? -13.940 -57.231 -45.044 1.00 38.54 ? 23  TYR A OH    1 
ATOM   1085 N  N     . VAL E 3 24  ? -9.618  -58.485 -38.353 1.00 29.93 ? 24  VAL A N     1 
ATOM   1086 C  CA    . VAL E 3 24  ? -9.061  -58.221 -37.033 1.00 29.72 ? 24  VAL A CA    1 
ATOM   1087 C  C     . VAL E 3 24  ? -9.356  -56.771 -36.672 1.00 29.95 ? 24  VAL A C     1 
ATOM   1088 O  O     . VAL E 3 24  ? -9.985  -56.047 -37.437 1.00 30.76 ? 24  VAL A O     1 
ATOM   1089 C  CB    . VAL E 3 24  ? -7.540  -58.426 -37.007 1.00 29.15 ? 24  VAL A CB    1 
ATOM   1090 C  CG1   . VAL E 3 24  ? -7.199  -59.888 -37.317 1.00 27.10 ? 24  VAL A CG1   1 
ATOM   1091 C  CG2   . VAL E 3 24  ? -6.880  -57.489 -38.004 1.00 29.43 ? 24  VAL A CG2   1 
ATOM   1092 N  N     . TRP E 3 25  ? -8.916  -56.345 -35.502 1.00 30.08 ? 25  TRP A N     1 
ATOM   1093 C  CA    . TRP E 3 25  ? -9.139  -54.970 -35.090 1.00 30.19 ? 25  TRP A CA    1 
ATOM   1094 C  C     . TRP E 3 25  ? -7.890  -54.168 -35.348 1.00 30.81 ? 25  TRP A C     1 
ATOM   1095 O  O     . TRP E 3 25  ? -6.816  -54.721 -35.552 1.00 31.58 ? 25  TRP A O     1 
ATOM   1096 C  CB    . TRP E 3 25  ? -9.479  -54.900 -33.603 1.00 29.95 ? 25  TRP A CB    1 
ATOM   1097 C  CG    . TRP E 3 25  ? -10.890 -55.223 -33.315 1.00 30.52 ? 25  TRP A CG    1 
ATOM   1098 C  CD1   . TRP E 3 25  ? -11.975 -54.438 -33.575 1.00 30.61 ? 25  TRP A CD1   1 
ATOM   1099 C  CD2   . TRP E 3 25  ? -11.395 -56.438 -32.742 1.00 30.46 ? 25  TRP A CD2   1 
ATOM   1100 N  NE1   . TRP E 3 25  ? -13.124 -55.097 -33.222 1.00 30.88 ? 25  TRP A NE1   1 
ATOM   1101 C  CE2   . TRP E 3 25  ? -12.800 -56.332 -32.735 1.00 29.99 ? 25  TRP A CE2   1 
ATOM   1102 C  CE3   . TRP E 3 25  ? -10.802 -57.627 -32.302 1.00 29.99 ? 25  TRP A CE3   1 
ATOM   1103 C  CZ2   . TRP E 3 25  ? -13.615 -57.338 -32.228 1.00 28.95 ? 25  TRP A CZ2   1 
ATOM   1104 C  CZ3   . TRP E 3 25  ? -11.619 -58.628 -31.807 1.00 29.44 ? 25  TRP A CZ3   1 
ATOM   1105 C  CH2   . TRP E 3 25  ? -13.014 -58.487 -31.802 1.00 29.33 ? 25  TRP A CH2   1 
ATOM   1106 N  N     . GLN E 3 26  ? -8.032  -52.857 -35.358 1.00 31.96 ? 26  GLN A N     1 
ATOM   1107 C  CA    . GLN E 3 26  ? -6.881  -52.037 -35.561 1.00 32.50 ? 26  GLN A CA    1 
ATOM   1108 C  C     . GLN E 3 26  ? -6.381  -51.561 -34.213 1.00 32.31 ? 26  GLN A C     1 
ATOM   1109 O  O     . GLN E 3 26  ? -7.065  -50.817 -33.497 1.00 33.59 ? 26  GLN A O     1 
ATOM   1110 C  CB    . GLN E 3 26  ? -7.216  -50.852 -36.449 1.00 34.62 ? 26  GLN A CB    1 
ATOM   1111 C  CG    . GLN E 3 26  ? -5.984  -50.022 -36.789 1.00 38.16 ? 26  GLN A CG    1 
ATOM   1112 C  CD    . GLN E 3 26  ? -6.227  -49.057 -37.943 1.00 41.34 ? 26  GLN A CD    1 
ATOM   1113 O  OE1   . GLN E 3 26  ? -5.300  -48.397 -38.394 1.00 42.85 ? 26  GLN A OE1   1 
ATOM   1114 N  NE2   . GLN E 3 26  ? -7.478  -48.967 -38.422 1.00 42.58 ? 26  GLN A NE2   1 
ATOM   1115 N  N     . VAL E 3 27  ? -5.174  -51.996 -33.881 1.00 31.21 ? 27  VAL A N     1 
ATOM   1116 C  CA    . VAL E 3 27  ? -4.513  -51.610 -32.647 1.00 30.74 ? 27  VAL A CA    1 
ATOM   1117 C  C     . VAL E 3 27  ? -4.667  -50.101 -32.421 1.00 29.04 ? 27  VAL A C     1 
ATOM   1118 O  O     . VAL E 3 27  ? -4.626  -49.325 -33.371 1.00 29.04 ? 27  VAL A O     1 
ATOM   1119 C  CB    . VAL E 3 27  ? -3.005  -51.965 -32.738 1.00 31.97 ? 27  VAL A CB    1 
ATOM   1120 C  CG1   . VAL E 3 27  ? -2.164  -50.976 -31.987 1.00 33.83 ? 27  VAL A CG1   1 
ATOM   1121 C  CG2   . VAL E 3 27  ? -2.790  -53.326 -32.153 1.00 33.14 ? 27  VAL A CG2   1 
ATOM   1122 N  N     . SER E 3 28  ? -4.827  -49.676 -31.172 1.00 27.15 ? 28  SER A N     1 
ATOM   1123 C  CA    . SER E 3 28  ? -4.954  -48.249 -30.898 1.00 26.34 ? 28  SER A CA    1 
ATOM   1124 C  C     . SER E 3 28  ? -3.648  -47.598 -31.339 1.00 27.08 ? 28  SER A C     1 
ATOM   1125 O  O     . SER E 3 28  ? -2.592  -48.225 -31.282 1.00 26.57 ? 28  SER A O     1 
ATOM   1126 C  CB    . SER E 3 28  ? -5.192  -47.986 -29.403 1.00 24.80 ? 28  SER A CB    1 
ATOM   1127 O  OG    . SER E 3 28  ? -3.982  -47.853 -28.683 1.00 22.89 ? 28  SER A OG    1 
ATOM   1128 N  N     . ASP E 3 29  ? -3.718  -46.349 -31.791 1.00 28.08 ? 29  ASP A N     1 
ATOM   1129 C  CA    . ASP E 3 29  ? -2.526  -45.649 -32.245 1.00 28.68 ? 29  ASP A CA    1 
ATOM   1130 C  C     . ASP E 3 29  ? -1.428  -45.597 -31.187 1.00 28.07 ? 29  ASP A C     1 
ATOM   1131 O  O     . ASP E 3 29  ? -0.257  -45.786 -31.503 1.00 27.71 ? 29  ASP A O     1 
ATOM   1132 C  CB    . ASP E 3 29  ? -2.887  -44.240 -32.720 1.00 29.93 ? 29  ASP A CB    1 
ATOM   1133 C  CG    . ASP E 3 29  ? -3.719  -44.251 -33.999 1.00 32.04 ? 29  ASP A CG    1 
ATOM   1134 O  OD1   . ASP E 3 29  ? -3.592  -45.209 -34.796 1.00 32.41 ? 29  ASP A OD1   1 
ATOM   1135 O  OD2   . ASP E 3 29  ? -4.482  -43.287 -34.221 1.00 33.20 ? 29  ASP A OD2   1 
ATOM   1136 N  N     . MET E 3 30  ? -1.809  -45.352 -29.936 1.00 28.08 ? 30  MET A N     1 
ATOM   1137 C  CA    . MET E 3 30  ? -0.849  -45.302 -28.841 1.00 28.17 ? 30  MET A CA    1 
ATOM   1138 C  C     . MET E 3 30  ? -0.108  -46.615 -28.725 1.00 27.51 ? 30  MET A C     1 
ATOM   1139 O  O     . MET E 3 30  ? 1.109   -46.641 -28.518 1.00 27.44 ? 30  MET A O     1 
ATOM   1140 C  CB    . MET E 3 30  ? -1.551  -44.983 -27.516 1.00 30.31 ? 30  MET A CB    1 
ATOM   1141 C  CG    . MET E 3 30  ? -1.456  -43.528 -27.171 1.00 33.67 ? 30  MET A CG    1 
ATOM   1142 S  SD    . MET E 3 30  ? 0.254   -43.052 -27.376 1.00 36.93 ? 30  MET A SD    1 
ATOM   1143 C  CE    . MET E 3 30  ? 0.244   -41.471 -26.525 1.00 32.89 ? 30  MET A CE    1 
ATOM   1144 N  N     . ASN E 3 31  ? -0.842  -47.713 -28.860 1.00 26.24 ? 31  ASN A N     1 
ATOM   1145 C  CA    . ASN E 3 31  ? -0.219  -49.018 -28.783 1.00 25.74 ? 31  ASN A CA    1 
ATOM   1146 C  C     . ASN E 3 31  ? 0.666   -49.285 -29.984 1.00 24.96 ? 31  ASN A C     1 
ATOM   1147 O  O     . ASN E 3 31  ? 1.685   -49.978 -29.871 1.00 24.65 ? 31  ASN A O     1 
ATOM   1148 C  CB    . ASN E 3 31  ? -1.277  -50.102 -28.626 1.00 26.21 ? 31  ASN A CB    1 
ATOM   1149 C  CG    . ASN E 3 31  ? -1.776  -50.200 -27.206 1.00 26.96 ? 31  ASN A CG    1 
ATOM   1150 O  OD1   . ASN E 3 31  ? -1.721  -51.241 -26.588 1.00 28.48 ? 31  ASN A OD1   1 
ATOM   1151 N  ND2   . ASN E 3 31  ? -2.255  -49.099 -26.682 1.00 30.64 ? 31  ASN A ND2   1 
ATOM   1152 N  N     . ARG E 3 32  ? 0.302   -48.712 -31.128 1.00 23.89 ? 32  ARG A N     1 
ATOM   1153 C  CA    . ARG E 3 32  ? 1.110   -48.909 -32.312 1.00 21.84 ? 32  ARG A CA    1 
ATOM   1154 C  C     . ARG E 3 32  ? 2.380   -48.090 -32.176 1.00 20.20 ? 32  ARG A C     1 
ATOM   1155 O  O     . ARG E 3 32  ? 3.387   -48.390 -32.791 1.00 19.38 ? 32  ARG A O     1 
ATOM   1156 C  CB    . ARG E 3 32  ? 0.349   -48.521 -33.580 1.00 22.30 ? 32  ARG A CB    1 
ATOM   1157 C  CG    . ARG E 3 32  ? 1.004   -49.131 -34.806 1.00 24.03 ? 32  ARG A CG    1 
ATOM   1158 C  CD    . ARG E 3 32  ? 0.302   -48.847 -36.111 1.00 23.83 ? 32  ARG A CD    1 
ATOM   1159 N  NE    . ARG E 3 32  ? 0.998   -49.545 -37.191 1.00 24.13 ? 32  ARG A NE    1 
ATOM   1160 C  CZ    . ARG E 3 32  ? 0.604   -49.567 -38.457 1.00 22.29 ? 32  ARG A CZ    1 
ATOM   1161 N  NH1   . ARG E 3 32  ? -0.491  -48.925 -38.826 1.00 21.45 ? 32  ARG A NH1   1 
ATOM   1162 N  NH2   . ARG E 3 32  ? 1.305   -50.246 -39.347 1.00 21.85 ? 32  ARG A NH2   1 
ATOM   1163 N  N     . LEU E 3 33  ? 2.326   -47.046 -31.366 1.00 19.97 ? 33  LEU A N     1 
ATOM   1164 C  CA    . LEU E 3 33  ? 3.502   -46.235 -31.148 1.00 20.14 ? 33  LEU A CA    1 
ATOM   1165 C  C     . LEU E 3 33  ? 4.499   -47.132 -30.443 1.00 21.30 ? 33  LEU A C     1 
ATOM   1166 O  O     . LEU E 3 33  ? 5.668   -47.173 -30.805 1.00 22.00 ? 33  LEU A O     1 
ATOM   1167 C  CB    . LEU E 3 33  ? 3.183   -45.037 -30.259 1.00 20.00 ? 33  LEU A CB    1 
ATOM   1168 C  CG    . LEU E 3 33  ? 4.398   -44.231 -29.791 1.00 20.12 ? 33  LEU A CG    1 
ATOM   1169 C  CD1   . LEU E 3 33  ? 5.016   -43.510 -30.986 1.00 17.68 ? 33  LEU A CD1   1 
ATOM   1170 C  CD2   . LEU E 3 33  ? 3.984   -43.234 -28.719 1.00 17.88 ? 33  LEU A CD2   1 
ATOM   1171 N  N     . ARG E 3 34  ? 4.032   -47.865 -29.436 1.00 22.47 ? 34  ARG A N     1 
ATOM   1172 C  CA    . ARG E 3 34  ? 4.917   -48.757 -28.691 1.00 22.06 ? 34  ARG A CA    1 
ATOM   1173 C  C     . ARG E 3 34  ? 5.473   -49.856 -29.569 1.00 20.29 ? 34  ARG A C     1 
ATOM   1174 O  O     . ARG E 3 34  ? 6.660   -50.143 -29.521 1.00 20.18 ? 34  ARG A O     1 
ATOM   1175 C  CB    . ARG E 3 34  ? 4.193   -49.346 -27.478 1.00 23.67 ? 34  ARG A CB    1 
ATOM   1176 C  CG    . ARG E 3 34  ? 3.836   -48.259 -26.536 1.00 26.08 ? 34  ARG A CG    1 
ATOM   1177 C  CD    . ARG E 3 34  ? 3.277   -48.654 -25.192 1.00 27.67 ? 34  ARG A CD    1 
ATOM   1178 N  NE    . ARG E 3 34  ? 2.305   -47.615 -25.114 1.00 30.54 ? 34  ARG A NE    1 
ATOM   1179 C  CZ    . ARG E 3 34  ? 1.082   -47.482 -24.648 1.00 31.66 ? 34  ARG A CZ    1 
ATOM   1180 N  NH1   . ARG E 3 34  ? 0.377   -48.383 -23.997 1.00 34.38 ? 34  ARG A NH1   1 
ATOM   1181 N  NH2   . ARG E 3 34  ? 0.550   -46.316 -24.974 1.00 33.02 ? 34  ARG A NH2   1 
ATOM   1182 N  N     . ARG E 3 35  ? 4.618   -50.467 -30.376 1.00 19.99 ? 35  ARG A N     1 
ATOM   1183 C  CA    . ARG E 3 35  ? 5.081   -51.518 -31.271 1.00 18.87 ? 35  ARG A CA    1 
ATOM   1184 C  C     . ARG E 3 35  ? 6.225   -50.948 -32.085 1.00 18.57 ? 35  ARG A C     1 
ATOM   1185 O  O     . ARG E 3 35  ? 7.292   -51.548 -32.187 1.00 19.92 ? 35  ARG A O     1 
ATOM   1186 C  CB    . ARG E 3 35  ? 3.970   -51.956 -32.219 1.00 17.51 ? 35  ARG A CB    1 
ATOM   1187 C  CG    . ARG E 3 35  ? 2.806   -52.649 -31.547 1.00 17.68 ? 35  ARG A CG    1 
ATOM   1188 C  CD    . ARG E 3 35  ? 1.814   -53.140 -32.583 1.00 16.96 ? 35  ARG A CD    1 
ATOM   1189 N  NE    . ARG E 3 35  ? 0.821   -54.030 -32.001 1.00 18.97 ? 35  ARG A NE    1 
ATOM   1190 C  CZ    . ARG E 3 35  ? -0.104  -54.677 -32.699 1.00 19.34 ? 35  ARG A CZ    1 
ATOM   1191 N  NH1   . ARG E 3 35  ? -0.159  -54.524 -34.017 1.00 20.65 ? 35  ARG A NH1   1 
ATOM   1192 N  NH2   . ARG E 3 35  ? -0.968  -55.481 -32.084 1.00 17.93 ? 35  ARG A NH2   1 
ATOM   1193 N  N     . PHE E 3 36  ? 5.988   -49.767 -32.644 1.00 17.19 ? 36  PHE A N     1 
ATOM   1194 C  CA    . PHE E 3 36  ? 6.964   -49.078 -33.468 1.00 15.72 ? 36  PHE A CA    1 
ATOM   1195 C  C     . PHE E 3 36  ? 8.265   -48.815 -32.738 1.00 15.82 ? 36  PHE A C     1 
ATOM   1196 O  O     . PHE E 3 36  ? 9.345   -49.059 -33.276 1.00 15.71 ? 36  PHE A O     1 
ATOM   1197 C  CB    . PHE E 3 36  ? 6.385   -47.749 -33.966 1.00 14.42 ? 36  PHE A CB    1 
ATOM   1198 C  CG    . PHE E 3 36  ? 7.319   -46.971 -34.839 1.00 14.58 ? 36  PHE A CG    1 
ATOM   1199 C  CD1   . PHE E 3 36  ? 7.799   -45.730 -34.432 1.00 14.90 ? 36  PHE A CD1   1 
ATOM   1200 C  CD2   . PHE E 3 36  ? 7.758   -47.496 -36.052 1.00 15.52 ? 36  PHE A CD2   1 
ATOM   1201 C  CE1   . PHE E 3 36  ? 8.708   -45.019 -35.213 1.00 14.80 ? 36  PHE A CE1   1 
ATOM   1202 C  CE2   . PHE E 3 36  ? 8.671   -46.794 -36.847 1.00 16.35 ? 36  PHE A CE2   1 
ATOM   1203 C  CZ    . PHE E 3 36  ? 9.147   -45.551 -36.423 1.00 15.98 ? 36  PHE A CZ    1 
ATOM   1204 N  N     . LEU E 3 37  ? 8.168   -48.311 -31.513 1.00 16.84 ? 37  LEU A N     1 
ATOM   1205 C  CA    . LEU E 3 37  ? 9.362   -47.997 -30.758 1.00 16.59 ? 37  LEU A CA    1 
ATOM   1206 C  C     . LEU E 3 37  ? 10.220  -49.226 -30.570 1.00 18.15 ? 37  LEU A C     1 
ATOM   1207 O  O     . LEU E 3 37  ? 11.442  -49.130 -30.624 1.00 19.47 ? 37  LEU A O     1 
ATOM   1208 C  CB    . LEU E 3 37  ? 9.002   -47.383 -29.407 1.00 15.31 ? 37  LEU A CB    1 
ATOM   1209 C  CG    . LEU E 3 37  ? 8.404   -45.974 -29.443 1.00 14.91 ? 37  LEU A CG    1 
ATOM   1210 C  CD1   . LEU E 3 37  ? 8.085   -45.540 -28.016 1.00 14.33 ? 37  LEU A CD1   1 
ATOM   1211 C  CD2   . LEU E 3 37  ? 9.363   -44.994 -30.095 1.00 11.24 ? 37  LEU A CD2   1 
ATOM   1212 N  N     . CYS E 3 38  ? 9.583   -50.381 -30.383 1.00 18.41 ? 38  CYS A N     1 
ATOM   1213 C  CA    . CYS E 3 38  ? 10.308  -51.639 -30.168 1.00 19.61 ? 38  CYS A CA    1 
ATOM   1214 C  C     . CYS E 3 38  ? 10.787  -52.375 -31.413 1.00 18.82 ? 38  CYS A C     1 
ATOM   1215 O  O     . CYS E 3 38  ? 11.892  -52.916 -31.434 1.00 19.66 ? 38  CYS A O     1 
ATOM   1216 C  CB    . CYS E 3 38  ? 9.455   -52.608 -29.344 1.00 19.85 ? 38  CYS A CB    1 
ATOM   1217 S  SG    . CYS E 3 38  ? 9.095   -52.040 -27.675 1.00 21.83 ? 38  CYS A SG    1 
ATOM   1218 N  N     . PHE E 3 39  ? 9.964   -52.388 -32.449 1.00 19.18 ? 39  PHE A N     1 
ATOM   1219 C  CA    . PHE E 3 39  ? 10.297  -53.103 -33.673 1.00 19.87 ? 39  PHE A CA    1 
ATOM   1220 C  C     . PHE E 3 39  ? 10.697  -52.269 -34.888 1.00 21.76 ? 39  PHE A C     1 
ATOM   1221 O  O     . PHE E 3 39  ? 11.309  -52.793 -35.818 1.00 22.63 ? 39  PHE A O     1 
ATOM   1222 C  CB    . PHE E 3 39  ? 9.127   -54.004 -34.058 1.00 18.73 ? 39  PHE A CB    1 
ATOM   1223 C  CG    . PHE E 3 39  ? 8.802   -55.055 -33.027 1.00 19.62 ? 39  PHE A CG    1 
ATOM   1224 C  CD1   . PHE E 3 39  ? 7.575   -55.051 -32.367 1.00 18.42 ? 39  PHE A CD1   1 
ATOM   1225 C  CD2   . PHE E 3 39  ? 9.703   -56.079 -32.749 1.00 19.41 ? 39  PHE A CD2   1 
ATOM   1226 C  CE1   . PHE E 3 39  ? 7.248   -56.054 -31.454 1.00 18.82 ? 39  PHE A CE1   1 
ATOM   1227 C  CE2   . PHE E 3 39  ? 9.380   -57.081 -31.838 1.00 19.03 ? 39  PHE A CE2   1 
ATOM   1228 C  CZ    . PHE E 3 39  ? 8.151   -57.068 -31.192 1.00 18.00 ? 39  PHE A CZ    1 
ATOM   1229 N  N     . GLY E 3 40  ? 10.346  -50.987 -34.897 1.00 23.14 ? 40  GLY A N     1 
ATOM   1230 C  CA    . GLY E 3 40  ? 10.691  -50.144 -36.030 1.00 25.17 ? 40  GLY A CA    1 
ATOM   1231 C  C     . GLY E 3 40  ? 10.054  -50.649 -37.306 1.00 26.99 ? 40  GLY A C     1 
ATOM   1232 O  O     . GLY E 3 40  ? 8.997   -51.274 -37.258 1.00 27.23 ? 40  GLY A O     1 
ATOM   1233 N  N     . SER E 3 41  ? 10.680  -50.390 -38.450 1.00 29.72 ? 41  SER A N     1 
ATOM   1234 C  CA    . SER E 3 41  ? 10.115  -50.850 -39.716 1.00 30.92 ? 41  SER A CA    1 
ATOM   1235 C  C     . SER E 3 41  ? 11.113  -51.381 -40.747 1.00 31.63 ? 41  SER A C     1 
ATOM   1236 O  O     . SER E 3 41  ? 10.758  -51.512 -41.914 1.00 33.02 ? 41  SER A O     1 
ATOM   1237 C  CB    . SER E 3 41  ? 9.278   -49.736 -40.354 1.00 30.23 ? 41  SER A CB    1 
ATOM   1238 O  OG    . SER E 3 41  ? 9.627   -48.470 -39.821 1.00 32.20 ? 41  SER A OG    1 
ATOM   1239 N  N     . GLU E 3 42  ? 12.337  -51.705 -40.338 1.00 31.73 ? 42  GLU A N     1 
ATOM   1240 C  CA    . GLU E 3 42  ? 13.303  -52.240 -41.284 1.00 32.16 ? 42  GLU A CA    1 
ATOM   1241 C  C     . GLU E 3 42  ? 12.815  -53.612 -41.702 1.00 30.58 ? 42  GLU A C     1 
ATOM   1242 O  O     . GLU E 3 42  ? 12.336  -54.379 -40.864 1.00 31.57 ? 42  GLU A O     1 
ATOM   1243 C  CB    . GLU E 3 42  ? 14.669  -52.425 -40.639 1.00 34.69 ? 42  GLU A CB    1 
ATOM   1244 C  CG    . GLU E 3 42  ? 15.178  -51.280 -39.826 1.00 37.98 ? 42  GLU A CG    1 
ATOM   1245 C  CD    . GLU E 3 42  ? 16.564  -51.555 -39.293 1.00 39.98 ? 42  GLU A CD    1 
ATOM   1246 O  OE1   . GLU E 3 42  ? 17.490  -51.499 -39.895 1.00 40.94 ? 42  GLU A OE1   1 
ATOM   1247 O  OE2   . GLU E 3 42  ? 16.921  -51.922 -38.269 1.00 40.15 ? 42  GLU A OE2   1 
ATOM   1248 N  N     . GLY E 3 43  ? 12.947  -53.925 -42.986 1.00 29.37 ? 43  GLY A N     1 
ATOM   1249 C  CA    . GLY E 3 43  ? 12.532  -55.226 -43.482 1.00 28.44 ? 43  GLY A CA    1 
ATOM   1250 C  C     . GLY E 3 43  ? 11.030  -55.450 -43.465 1.00 27.51 ? 43  GLY A C     1 
ATOM   1251 O  O     . GLY E 3 43  ? 10.537  -56.456 -43.989 1.00 28.25 ? 43  GLY A O     1 
ATOM   1252 N  N     . GLY E 3 44  ? 10.299  -54.518 -42.864 1.00 25.25 ? 44  GLY A N     1 
ATOM   1253 C  CA    . GLY E 3 44  ? 8.860   -54.650 -42.794 1.00 22.28 ? 44  GLY A CA    1 
ATOM   1254 C  C     . GLY E 3 44  ? 8.470   -55.957 -42.136 1.00 21.10 ? 44  GLY A C     1 
ATOM   1255 O  O     . GLY E 3 44  ? 9.225   -56.528 -41.349 1.00 20.40 ? 44  GLY A O     1 
ATOM   1256 N  N     . THR E 3 45  ? 7.274   -56.425 -42.451 1.00 19.48 ? 45  THR A N     1 
ATOM   1257 C  CA    . THR E 3 45  ? 6.800   -57.678 -41.915 1.00 17.60 ? 45  THR A CA    1 
ATOM   1258 C  C     . THR E 3 45  ? 6.734   -58.640 -43.083 1.00 17.82 ? 45  THR A C     1 
ATOM   1259 O  O     . THR E 3 45  ? 7.102   -58.299 -44.206 1.00 16.59 ? 45  THR A O     1 
ATOM   1260 C  CB    . THR E 3 45  ? 5.391   -57.550 -41.314 1.00 18.09 ? 45  THR A CB    1 
ATOM   1261 O  OG1   . THR E 3 45  ? 4.420   -57.485 -42.368 1.00 17.14 ? 45  THR A OG1   1 
ATOM   1262 C  CG2   . THR E 3 45  ? 5.288   -56.290 -40.477 1.00 17.62 ? 45  THR A CG2   1 
ATOM   1263 N  N     . TYR E 3 46  ? 6.257   -59.842 -42.799 1.00 18.50 ? 46  TYR A N     1 
ATOM   1264 C  CA    . TYR E 3 46  ? 6.113   -60.882 -43.794 1.00 18.59 ? 46  TYR A CA    1 
ATOM   1265 C  C     . TYR E 3 46  ? 5.185   -60.434 -44.937 1.00 20.25 ? 46  TYR A C     1 
ATOM   1266 O  O     . TYR E 3 46  ? 5.406   -60.790 -46.099 1.00 22.37 ? 46  TYR A O     1 
ATOM   1267 C  CB    . TYR E 3 46  ? 5.560   -62.129 -43.106 1.00 16.45 ? 46  TYR A CB    1 
ATOM   1268 C  CG    . TYR E 3 46  ? 5.449   -63.349 -43.980 1.00 15.82 ? 46  TYR A CG    1 
ATOM   1269 C  CD1   . TYR E 3 46  ? 4.206   -63.847 -44.347 1.00 13.74 ? 46  TYR A CD1   1 
ATOM   1270 C  CD2   . TYR E 3 46  ? 6.592   -64.038 -44.395 1.00 16.45 ? 46  TYR A CD2   1 
ATOM   1271 C  CE1   . TYR E 3 46  ? 4.094   -65.000 -45.095 1.00 15.73 ? 46  TYR A CE1   1 
ATOM   1272 C  CE2   . TYR E 3 46  ? 6.498   -65.202 -45.151 1.00 17.01 ? 46  TYR A CE2   1 
ATOM   1273 C  CZ    . TYR E 3 46  ? 5.242   -65.681 -45.493 1.00 17.26 ? 46  TYR A CZ    1 
ATOM   1274 O  OH    . TYR E 3 46  ? 5.128   -66.856 -46.204 1.00 17.90 ? 46  TYR A OH    1 
ATOM   1275 N  N     . TYR E 3 47  ? 4.167   -59.639 -44.615 1.00 19.98 ? 47  TYR A N     1 
ATOM   1276 C  CA    . TYR E 3 47  ? 3.208   -59.180 -45.611 1.00 20.69 ? 47  TYR A CA    1 
ATOM   1277 C  C     . TYR E 3 47  ? 3.359   -57.739 -46.092 1.00 22.49 ? 47  TYR A C     1 
ATOM   1278 O  O     . TYR E 3 47  ? 2.948   -57.397 -47.208 1.00 22.39 ? 47  TYR A O     1 
ATOM   1279 C  CB    . TYR E 3 47  ? 1.786   -59.322 -45.074 1.00 19.56 ? 47  TYR A CB    1 
ATOM   1280 C  CG    . TYR E 3 47  ? 1.425   -60.696 -44.592 1.00 21.30 ? 47  TYR A CG    1 
ATOM   1281 C  CD1   . TYR E 3 47  ? 1.600   -61.048 -43.259 1.00 20.57 ? 47  TYR A CD1   1 
ATOM   1282 C  CD2   . TYR E 3 47  ? 0.901   -61.653 -45.466 1.00 21.27 ? 47  TYR A CD2   1 
ATOM   1283 C  CE1   . TYR E 3 47  ? 1.258   -62.314 -42.798 1.00 20.02 ? 47  TYR A CE1   1 
ATOM   1284 C  CE2   . TYR E 3 47  ? 0.556   -62.928 -45.009 1.00 21.64 ? 47  TYR A CE2   1 
ATOM   1285 C  CZ    . TYR E 3 47  ? 0.738   -63.246 -43.672 1.00 20.66 ? 47  TYR A CZ    1 
ATOM   1286 O  OH    . TYR E 3 47  ? 0.383   -64.486 -43.204 1.00 21.13 ? 47  TYR A OH    1 
ATOM   1287 N  N     . ILE E 3 48  ? 3.925   -56.890 -45.246 1.00 24.08 ? 48  ILE A N     1 
ATOM   1288 C  CA    . ILE E 3 48  ? 4.051   -55.484 -45.573 1.00 24.20 ? 48  ILE A CA    1 
ATOM   1289 C  C     . ILE E 3 48  ? 5.483   -55.096 -45.854 1.00 26.21 ? 48  ILE A C     1 
ATOM   1290 O  O     . ILE E 3 48  ? 6.378   -55.402 -45.072 1.00 28.12 ? 48  ILE A O     1 
ATOM   1291 C  CB    . ILE E 3 48  ? 3.506   -54.650 -44.420 1.00 23.18 ? 48  ILE A CB    1 
ATOM   1292 C  CG1   . ILE E 3 48  ? 2.092   -55.126 -44.079 1.00 21.27 ? 48  ILE A CG1   1 
ATOM   1293 C  CG2   . ILE E 3 48  ? 3.496   -53.185 -44.798 1.00 24.53 ? 48  ILE A CG2   1 
ATOM   1294 C  CD1   . ILE E 3 48  ? 1.662   -54.831 -42.655 1.00 19.82 ? 48  ILE A CD1   1 
ATOM   1295 N  N     . GLU E 3 49  ? 5.706   -54.430 -46.980 1.00 28.11 ? 49  GLU A N     1 
ATOM   1296 C  CA    . GLU E 3 49  ? 7.048   -54.025 -47.337 1.00 29.83 ? 49  GLU A CA    1 
ATOM   1297 C  C     . GLU E 3 49  ? 7.525   -52.886 -46.460 1.00 30.26 ? 49  GLU A C     1 
ATOM   1298 O  O     . GLU E 3 49  ? 6.740   -52.038 -46.036 1.00 29.82 ? 49  GLU A O     1 
ATOM   1299 C  CB    . GLU E 3 49  ? 7.120   -53.659 -48.823 1.00 31.98 ? 49  GLU A CB    1 
ATOM   1300 C  CG    . GLU E 3 49  ? 7.339   -54.878 -49.709 1.00 36.51 ? 49  GLU A CG    1 
ATOM   1301 C  CD    . GLU E 3 49  ? 8.635   -55.616 -49.370 1.00 40.54 ? 49  GLU A CD    1 
ATOM   1302 O  OE1   . GLU E 3 49  ? 8.752   -56.815 -49.699 1.00 40.95 ? 49  GLU A OE1   1 
ATOM   1303 O  OE2   . GLU E 3 49  ? 9.554   -55.002 -48.776 1.00 43.26 ? 49  GLU A OE2   1 
ATOM   1304 N  N     . GLU E 3 50  ? 8.823   -52.895 -46.187 1.00 31.38 ? 50  GLU A N     1 
ATOM   1305 C  CA    . GLU E 3 50  ? 9.472   -51.908 -45.336 1.00 33.10 ? 50  GLU A CA    1 
ATOM   1306 C  C     . GLU E 3 50  ? 8.946   -50.481 -45.486 1.00 33.63 ? 50  GLU A C     1 
ATOM   1307 O  O     . GLU E 3 50  ? 8.493   -49.866 -44.523 1.00 34.82 ? 50  GLU A O     1 
ATOM   1308 C  CB    . GLU E 3 50  ? 10.977  -51.941 -45.600 1.00 34.63 ? 50  GLU A CB    1 
ATOM   1309 C  CG    . GLU E 3 50  ? 11.800  -51.169 -44.596 1.00 38.77 ? 50  GLU A CG    1 
ATOM   1310 C  CD    . GLU E 3 50  ? 13.273  -51.180 -44.929 1.00 40.21 ? 50  GLU A CD    1 
ATOM   1311 O  OE1   . GLU E 3 50  ? 13.657  -50.565 -45.944 1.00 42.30 ? 50  GLU A OE1   1 
ATOM   1312 O  OE2   . GLU E 3 50  ? 14.052  -51.809 -44.183 1.00 41.55 ? 50  GLU A OE2   1 
ATOM   1313 N  N     . LYS E 3 51  ? 9.019   -49.961 -46.701 1.00 33.64 ? 51  LYS A N     1 
ATOM   1314 C  CA    . LYS E 3 51  ? 8.565   -48.614 -47.007 1.00 33.47 ? 51  LYS A CA    1 
ATOM   1315 C  C     . LYS E 3 51  ? 7.151   -48.322 -46.512 1.00 32.16 ? 51  LYS A C     1 
ATOM   1316 O  O     . LYS E 3 51  ? 6.933   -47.367 -45.767 1.00 32.57 ? 51  LYS A O     1 
ATOM   1317 C  CB    . LYS E 3 51  ? 8.639   -48.393 -48.518 1.00 36.21 ? 51  LYS A CB    1 
ATOM   1318 C  CG    . LYS E 3 51  ? 8.113   -47.045 -49.027 1.00 37.99 ? 51  LYS A CG    1 
ATOM   1319 C  CD    . LYS E 3 51  ? 8.208   -47.056 -50.554 1.00 42.03 ? 51  LYS A CD    1 
ATOM   1320 C  CE    . LYS E 3 51  ? 7.510   -45.855 -51.197 1.00 44.56 ? 51  LYS A CE    1 
ATOM   1321 N  NZ    . LYS E 3 51  ? 7.306   -46.084 -52.670 1.00 44.60 ? 51  LYS A NZ    1 
ATOM   1322 N  N     . LYS E 3 52  ? 6.189   -49.143 -46.922 1.00 31.06 ? 52  LYS A N     1 
ATOM   1323 C  CA    . LYS E 3 52  ? 4.803   -48.934 -46.513 1.00 30.35 ? 52  LYS A CA    1 
ATOM   1324 C  C     . LYS E 3 52  ? 4.575   -49.145 -45.019 1.00 29.46 ? 52  LYS A C     1 
ATOM   1325 O  O     . LYS E 3 52  ? 3.594   -48.649 -44.464 1.00 29.09 ? 52  LYS A O     1 
ATOM   1326 C  CB    . LYS E 3 52  ? 3.866   -49.850 -47.300 1.00 30.51 ? 52  LYS A CB    1 
ATOM   1327 C  CG    . LYS E 3 52  ? 2.400   -49.681 -46.931 1.00 30.73 ? 52  LYS A CG    1 
ATOM   1328 C  CD    . LYS E 3 52  ? 1.521   -50.679 -47.670 1.00 32.96 ? 52  LYS A CD    1 
ATOM   1329 C  CE    . LYS E 3 52  ? 0.056   -50.575 -47.234 1.00 34.01 ? 52  LYS A CE    1 
ATOM   1330 N  NZ    . LYS E 3 52  ? -0.797  -51.648 -47.825 1.00 33.75 ? 52  LYS A NZ    1 
ATOM   1331 N  N     . LEU E 3 53  ? 5.469   -49.888 -44.370 1.00 28.52 ? 53  LEU A N     1 
ATOM   1332 C  CA    . LEU E 3 53  ? 5.327   -50.133 -42.942 1.00 26.86 ? 53  LEU A CA    1 
ATOM   1333 C  C     . LEU E 3 53  ? 5.634   -48.838 -42.228 1.00 26.71 ? 53  LEU A C     1 
ATOM   1334 O  O     . LEU E 3 53  ? 4.939   -48.452 -41.295 1.00 26.36 ? 53  LEU A O     1 
ATOM   1335 C  CB    . LEU E 3 53  ? 6.293   -51.212 -42.463 1.00 25.15 ? 53  LEU A CB    1 
ATOM   1336 C  CG    . LEU E 3 53  ? 5.726   -52.242 -41.477 1.00 22.90 ? 53  LEU A CG    1 
ATOM   1337 C  CD1   . LEU E 3 53  ? 6.870   -52.809 -40.672 1.00 23.39 ? 53  LEU A CD1   1 
ATOM   1338 C  CD2   . LEU E 3 53  ? 4.706   -51.615 -40.552 1.00 21.30 ? 53  LEU A CD2   1 
ATOM   1339 N  N     . GLY E 3 54  ? 6.688   -48.170 -42.679 1.00 27.90 ? 54  GLY A N     1 
ATOM   1340 C  CA    . GLY E 3 54  ? 7.068   -46.901 -42.082 1.00 28.64 ? 54  GLY A CA    1 
ATOM   1341 C  C     . GLY E 3 54  ? 5.975   -45.873 -42.329 1.00 28.44 ? 54  GLY A C     1 
ATOM   1342 O  O     . GLY E 3 54  ? 5.658   -45.058 -41.452 1.00 27.54 ? 54  GLY A O     1 
ATOM   1343 N  N     . GLN E 3 55  ? 5.393   -45.920 -43.527 1.00 28.33 ? 55  GLN A N     1 
ATOM   1344 C  CA    . GLN E 3 55  ? 4.326   -44.999 -43.900 1.00 28.69 ? 55  GLN A CA    1 
ATOM   1345 C  C     . GLN E 3 55  ? 3.090   -45.224 -43.045 1.00 27.35 ? 55  GLN A C     1 
ATOM   1346 O  O     . GLN E 3 55  ? 2.444   -44.272 -42.615 1.00 26.88 ? 55  GLN A O     1 
ATOM   1347 C  CB    . GLN E 3 55  ? 3.969   -45.166 -45.370 1.00 30.64 ? 55  GLN A CB    1 
ATOM   1348 C  CG    . GLN E 3 55  ? 4.909   -44.463 -46.321 1.00 34.16 ? 55  GLN A CG    1 
ATOM   1349 C  CD    . GLN E 3 55  ? 4.425   -44.557 -47.756 1.00 38.03 ? 55  GLN A CD    1 
ATOM   1350 O  OE1   . GLN E 3 55  ? 4.386   -45.640 -48.340 1.00 41.46 ? 55  GLN A OE1   1 
ATOM   1351 N  NE2   . GLN E 3 55  ? 4.038   -43.425 -48.327 1.00 39.67 ? 55  GLN A NE2   1 
ATOM   1352 N  N     . GLU E 3 56  ? 2.761   -46.490 -42.807 1.00 26.58 ? 56  GLU A N     1 
ATOM   1353 C  CA    . GLU E 3 56  ? 1.622   -46.830 -41.977 1.00 25.57 ? 56  GLU A CA    1 
ATOM   1354 C  C     . GLU E 3 56  ? 1.878   -46.297 -40.580 1.00 24.99 ? 56  GLU A C     1 
ATOM   1355 O  O     . GLU E 3 56  ? 0.978   -45.771 -39.934 1.00 25.70 ? 56  GLU A O     1 
ATOM   1356 C  CB    . GLU E 3 56  ? 1.434   -48.345 -41.916 1.00 26.50 ? 56  GLU A CB    1 
ATOM   1357 C  CG    . GLU E 3 56  ? 0.682   -48.933 -43.083 1.00 26.87 ? 56  GLU A CG    1 
ATOM   1358 C  CD    . GLU E 3 56  ? 0.408   -50.410 -42.892 1.00 27.55 ? 56  GLU A CD    1 
ATOM   1359 O  OE1   . GLU E 3 56  ? 0.325   -50.867 -41.737 1.00 27.23 ? 56  GLU A OE1   1 
ATOM   1360 O  OE2   . GLU E 3 56  ? 0.253   -51.128 -43.894 1.00 30.08 ? 56  GLU A OE2   1 
ATOM   1361 N  N     . ASN E 3 57  ? 3.116   -46.431 -40.119 1.00 24.22 ? 57  ASN A N     1 
ATOM   1362 C  CA    . ASN E 3 57  ? 3.465   -45.964 -38.795 1.00 24.49 ? 57  ASN A CA    1 
ATOM   1363 C  C     . ASN E 3 57  ? 3.548   -44.458 -38.697 1.00 25.17 ? 57  ASN A C     1 
ATOM   1364 O  O     . ASN E 3 57  ? 3.159   -43.882 -37.682 1.00 25.40 ? 57  ASN A O     1 
ATOM   1365 C  CB    . ASN E 3 57  ? 4.765   -46.601 -38.336 1.00 24.04 ? 57  ASN A CB    1 
ATOM   1366 C  CG    . ASN E 3 57  ? 4.571   -48.026 -37.945 1.00 23.48 ? 57  ASN A CG    1 
ATOM   1367 O  OD1   . ASN E 3 57  ? 4.727   -48.932 -38.751 1.00 24.14 ? 57  ASN A OD1   1 
ATOM   1368 N  ND2   . ASN E 3 57  ? 4.184   -48.237 -36.701 1.00 25.30 ? 57  ASN A ND2   1 
ATOM   1369 N  N     . ALA E 3 58  ? 4.045   -43.813 -39.746 1.00 25.78 ? 58  ALA A N     1 
ATOM   1370 C  CA    . ALA E 3 58  ? 4.136   -42.359 -39.741 1.00 26.89 ? 58  ALA A CA    1 
ATOM   1371 C  C     . ALA E 3 58  ? 2.723   -41.785 -39.672 1.00 27.55 ? 58  ALA A C     1 
ATOM   1372 O  O     . ALA E 3 58  ? 2.481   -40.815 -38.966 1.00 27.97 ? 58  ALA A O     1 
ATOM   1373 C  CB    . ALA E 3 58  ? 4.837   -41.862 -40.992 1.00 27.11 ? 58  ALA A CB    1 
ATOM   1374 N  N     . GLU E 3 59  ? 1.792   -42.395 -40.401 1.00 28.69 ? 59  GLU A N     1 
ATOM   1375 C  CA    . GLU E 3 59  ? 0.412   -41.936 -40.405 1.00 31.14 ? 59  GLU A CA    1 
ATOM   1376 C  C     . GLU E 3 59  ? -0.202  -41.965 -39.009 1.00 30.77 ? 59  GLU A C     1 
ATOM   1377 O  O     . GLU E 3 59  ? -0.863  -41.021 -38.599 1.00 31.70 ? 59  GLU A O     1 
ATOM   1378 C  CB    . GLU E 3 59  ? -0.451  -42.788 -41.349 1.00 34.66 ? 59  GLU A CB    1 
ATOM   1379 C  CG    . GLU E 3 59  ? -0.048  -42.698 -42.809 1.00 39.74 ? 59  GLU A CG    1 
ATOM   1380 C  CD    . GLU E 3 59  ? -0.839  -43.657 -43.692 1.00 42.68 ? 59  GLU A CD    1 
ATOM   1381 O  OE1   . GLU E 3 59  ? -1.079  -44.813 -43.271 1.00 43.31 ? 59  GLU A OE1   1 
ATOM   1382 O  OE2   . GLU E 3 59  ? -1.210  -43.261 -44.820 1.00 45.15 ? 59  GLU A OE2   1 
ATOM   1383 N  N     . ALA E 3 60  ? 0.000   -43.064 -38.291 1.00 30.81 ? 60  ALA A N     1 
ATOM   1384 C  CA    . ALA E 3 60  ? -0.555  -43.208 -36.953 1.00 30.19 ? 60  ALA A CA    1 
ATOM   1385 C  C     . ALA E 3 60  ? 0.046   -42.175 -36.028 1.00 30.07 ? 60  ALA A C     1 
ATOM   1386 O  O     . ALA E 3 60  ? -0.640  -41.634 -35.141 1.00 29.15 ? 60  ALA A O     1 
ATOM   1387 C  CB    . ALA E 3 60  ? -0.294  -44.595 -36.401 1.00 30.12 ? 60  ALA A CB    1 
ATOM   1388 N  N     . LEU E 3 61  ? 1.329   -41.882 -36.223 1.00 31.01 ? 61  LEU A N     1 
ATOM   1389 C  CA    . LEU E 3 61  ? 1.980   -40.879 -35.375 1.00 33.09 ? 61  LEU A CA    1 
ATOM   1390 C  C     . LEU E 3 61  ? 1.267   -39.532 -35.530 1.00 34.32 ? 61  LEU A C     1 
ATOM   1391 O  O     . LEU E 3 61  ? 0.747   -38.978 -34.583 1.00 35.01 ? 61  LEU A O     1 
ATOM   1392 C  CB    . LEU E 3 61  ? 3.453   -40.727 -35.737 1.00 32.33 ? 61  LEU A CB    1 
ATOM   1393 C  CG    . LEU E 3 61  ? 4.258   -39.736 -34.887 1.00 31.76 ? 61  LEU A CG    1 
ATOM   1394 C  CD1   . LEU E 3 61  ? 3.807   -39.732 -33.457 1.00 30.31 ? 61  LEU A CD1   1 
ATOM   1395 C  CD2   . LEU E 3 61  ? 5.712   -40.082 -34.960 1.00 32.52 ? 61  LEU A CD2   1 
ATOM   1396 N  N     . LEU E 3 62  ? 1.201   -39.053 -36.761 1.00 34.83 ? 62  LEU A N     1 
ATOM   1397 C  CA    . LEU E 3 62  ? 0.549   -37.790 -37.048 1.00 35.42 ? 62  LEU A CA    1 
ATOM   1398 C  C     . LEU E 3 62  ? -0.897  -37.783 -36.561 1.00 35.00 ? 62  LEU A C     1 
ATOM   1399 O  O     . LEU E 3 62  ? -1.416  -36.746 -36.103 1.00 34.72 ? 62  LEU A O     1 
ATOM   1400 C  CB    . LEU E 3 62  ? 0.596   -37.503 -38.553 1.00 35.68 ? 62  LEU A CB    1 
ATOM   1401 C  CG    . LEU E 3 62  ? 1.995   -37.130 -39.036 1.00 36.24 ? 62  LEU A CG    1 
ATOM   1402 C  CD1   . LEU E 3 62  ? 2.450   -38.126 -40.096 1.00 37.27 ? 62  LEU A CD1   1 
ATOM   1403 C  CD2   . LEU E 3 62  ? 1.978   -35.724 -39.623 1.00 37.73 ? 62  LEU A CD2   1 
ATOM   1404 N  N     . ARG E 3 63  ? -1.549  -38.935 -36.653 1.00 34.29 ? 63  ARG A N     1 
ATOM   1405 C  CA    . ARG E 3 63  ? -2.926  -39.040 -36.206 1.00 34.58 ? 63  ARG A CA    1 
ATOM   1406 C  C     . ARG E 3 63  ? -2.990  -38.675 -34.722 1.00 34.56 ? 63  ARG A C     1 
ATOM   1407 O  O     . ARG E 3 63  ? -3.875  -37.933 -34.306 1.00 35.62 ? 63  ARG A O     1 
ATOM   1408 C  CB    . ARG E 3 63  ? -3.427  -40.467 -36.438 1.00 34.44 ? 63  ARG A CB    1 
ATOM   1409 C  CG    . ARG E 3 63  ? -4.886  -40.543 -36.871 1.00 35.54 ? 63  ARG A CG    1 
ATOM   1410 C  CD    . ARG E 3 63  ? -5.293  -41.954 -37.272 1.00 34.43 ? 63  ARG A CD    1 
ATOM   1411 N  NE    . ARG E 3 63  ? -4.502  -42.502 -38.322 1.00 34.49 ? 63  ARG A NE    1 
ATOM   1412 C  CZ    . ARG E 3 63  ? -3.874  -43.666 -38.450 1.00 34.13 ? 63  ARG A CZ    1 
ATOM   1413 N  NH1   . ARG E 3 63  ? -3.242  -43.809 -39.593 1.00 33.89 ? 63  ARG A NH1   1 
ATOM   1414 N  NH2   . ARG E 3 63  ? -3.822  -44.639 -37.542 1.00 33.62 ? 63  ARG A NH2   1 
ATOM   1415 N  N     . LEU E 3 64  ? -2.050  -39.188 -33.928 1.00 33.68 ? 64  LEU A N     1 
ATOM   1416 C  CA    . LEU E 3 64  ? -2.014  -38.887 -32.500 1.00 33.04 ? 64  LEU A CA    1 
ATOM   1417 C  C     . LEU E 3 64  ? -1.916  -37.373 -32.266 1.00 33.48 ? 64  LEU A C     1 
ATOM   1418 O  O     . LEU E 3 64  ? -2.674  -36.802 -31.487 1.00 32.31 ? 64  LEU A O     1 
ATOM   1419 C  CB    . LEU E 3 64  ? -0.815  -39.585 -31.849 1.00 31.07 ? 64  LEU A CB    1 
ATOM   1420 C  CG    . LEU E 3 64  ? -0.846  -41.110 -31.735 1.00 29.78 ? 64  LEU A CG    1 
ATOM   1421 C  CD1   . LEU E 3 64  ? 0.499   -41.617 -31.231 1.00 28.04 ? 64  LEU A CD1   1 
ATOM   1422 C  CD2   . LEU E 3 64  ? -1.958  -41.521 -30.795 1.00 27.47 ? 64  LEU A CD2   1 
ATOM   1423 N  N     . ILE E 3 65  ? -0.964  -36.740 -32.943 1.00 34.55 ? 65  ILE A N     1 
ATOM   1424 C  CA    . ILE E 3 65  ? -0.746  -35.306 -32.833 1.00 36.21 ? 65  ILE A CA    1 
ATOM   1425 C  C     . ILE E 3 65  ? -2.034  -34.561 -33.200 1.00 38.32 ? 65  ILE A C     1 
ATOM   1426 O  O     . ILE E 3 65  ? -2.462  -33.649 -32.478 1.00 38.76 ? 65  ILE A O     1 
ATOM   1427 C  CB    . ILE E 3 65  ? 0.412   -34.873 -33.764 1.00 35.85 ? 65  ILE A CB    1 
ATOM   1428 C  CG1   . ILE E 3 65  ? 1.698   -35.613 -33.352 1.00 35.67 ? 65  ILE A CG1   1 
ATOM   1429 C  CG2   . ILE E 3 65  ? 0.607   -33.363 -33.707 1.00 34.60 ? 65  ILE A CG2   1 
ATOM   1430 C  CD1   . ILE E 3 65  ? 2.853   -35.482 -34.323 1.00 33.54 ? 65  ILE A CD1   1 
ATOM   1431 N  N     . GLU E 3 66  ? -2.637  -34.960 -34.324 1.00 39.85 ? 66  GLU A N     1 
ATOM   1432 C  CA    . GLU E 3 66  ? -3.902  -34.394 -34.816 1.00 41.01 ? 66  GLU A CA    1 
ATOM   1433 C  C     . GLU E 3 66  ? -4.843  -34.321 -33.600 1.00 40.64 ? 66  GLU A C     1 
ATOM   1434 O  O     . GLU E 3 66  ? -5.350  -33.265 -33.217 1.00 40.74 ? 66  GLU A O     1 
ATOM   1435 C  CB    . GLU E 3 66  ? -4.627  -35.358 -35.776 1.00 44.25 ? 66  GLU A CB    1 
ATOM   1436 C  CG    . GLU E 3 66  ? -4.484  -35.402 -37.330 1.00 48.75 ? 66  GLU A CG    1 
ATOM   1437 C  CD    . GLU E 3 66  ? -4.208  -34.117 -38.073 1.00 52.53 ? 66  GLU A CD    1 
ATOM   1438 O  OE1   . GLU E 3 66  ? -4.795  -33.952 -39.166 1.00 55.04 ? 66  GLU A OE1   1 
ATOM   1439 O  OE2   . GLU E 3 66  ? -3.366  -33.302 -37.627 1.00 54.83 ? 66  GLU A OE2   1 
ATOM   1440 N  N     . ASP E 3 67  ? -5.073  -35.498 -33.026 1.00 39.67 ? 67  ASP A N     1 
ATOM   1441 C  CA    . ASP E 3 67  ? -5.983  -35.702 -31.912 1.00 39.95 ? 67  ASP A CA    1 
ATOM   1442 C  C     . ASP E 3 67  ? -5.605  -35.159 -30.550 1.00 38.98 ? 67  ASP A C     1 
ATOM   1443 O  O     . ASP E 3 67  ? -6.265  -35.468 -29.567 1.00 39.23 ? 67  ASP A O     1 
ATOM   1444 C  CB    . ASP E 3 67  ? -6.285  -37.207 -31.801 1.00 42.90 ? 67  ASP A CB    1 
ATOM   1445 C  CG    . ASP E 3 67  ? -6.736  -37.828 -33.153 1.00 44.94 ? 67  ASP A CG    1 
ATOM   1446 O  OD1   . ASP E 3 67  ? -7.773  -37.352 -33.701 1.00 47.98 ? 67  ASP A OD1   1 
ATOM   1447 O  OD2   . ASP E 3 67  ? -6.047  -38.775 -33.638 1.00 47.50 ? 67  ASP A OD2   1 
ATOM   1448 N  N     . GLY E 3 68  ? -4.539  -34.373 -30.488 1.00 39.31 ? 68  GLY A N     1 
ATOM   1449 C  CA    . GLY E 3 68  ? -4.111  -33.809 -29.220 1.00 38.74 ? 68  GLY A CA    1 
ATOM   1450 C  C     . GLY E 3 68  ? -3.090  -34.624 -28.438 1.00 38.44 ? 68  GLY A C     1 
ATOM   1451 O  O     . GLY E 3 68  ? -2.440  -34.109 -27.532 1.00 38.85 ? 68  GLY A O     1 
ATOM   1452 N  N     . LYS E 3 69  ? -2.942  -35.896 -28.779 1.00 37.51 ? 69  LYS A N     1 
ATOM   1453 C  CA    . LYS E 3 69  ? -1.993  -36.769 -28.098 1.00 36.86 ? 69  LYS A CA    1 
ATOM   1454 C  C     . LYS E 3 69  ? -0.537  -36.334 -28.227 1.00 35.25 ? 69  LYS A C     1 
ATOM   1455 O  O     . LYS E 3 69  ? 0.371   -37.078 -27.856 1.00 34.57 ? 69  LYS A O     1 
ATOM   1456 C  CB    . LYS E 3 69  ? -2.138  -38.188 -28.650 1.00 39.32 ? 69  LYS A CB    1 
ATOM   1457 C  CG    . LYS E 3 69  ? -3.470  -38.820 -28.310 1.00 42.54 ? 69  LYS A CG    1 
ATOM   1458 C  CD    . LYS E 3 69  ? -3.524  -39.058 -26.796 1.00 45.44 ? 69  LYS A CD    1 
ATOM   1459 C  CE    . LYS E 3 69  ? -4.832  -39.753 -26.357 1.00 46.70 ? 69  LYS A CE    1 
ATOM   1460 N  NZ    . LYS E 3 69  ? -5.861  -38.751 -25.982 1.00 48.15 ? 69  LYS A NZ    1 
ATOM   1461 N  N     . GLY E 3 70  ? -0.315  -35.143 -28.762 1.00 33.92 ? 70  GLY A N     1 
ATOM   1462 C  CA    . GLY E 3 70  ? 1.040   -34.666 -28.954 1.00 33.33 ? 70  GLY A CA    1 
ATOM   1463 C  C     . GLY E 3 70  ? 2.017   -34.826 -27.800 1.00 32.34 ? 70  GLY A C     1 
ATOM   1464 O  O     . GLY E 3 70  ? 3.103   -35.381 -27.983 1.00 31.94 ? 70  GLY A O     1 
ATOM   1465 N  N     . CYS E 3 71  ? 1.646   -34.348 -26.615 1.00 31.50 ? 71  CYS A N     1 
ATOM   1466 C  CA    . CYS E 3 71  ? 2.526   -34.437 -25.452 1.00 30.68 ? 71  CYS A CA    1 
ATOM   1467 C  C     . CYS E 3 71  ? 2.590   -35.806 -24.792 1.00 29.56 ? 71  CYS A C     1 
ATOM   1468 O  O     . CYS E 3 71  ? 3.572   -36.136 -24.126 1.00 29.53 ? 71  CYS A O     1 
ATOM   1469 C  CB    . CYS E 3 71  ? 2.140   -33.376 -24.422 1.00 31.26 ? 71  CYS A CB    1 
ATOM   1470 S  SG    . CYS E 3 71  ? 2.479   -31.673 -24.979 1.00 31.99 ? 71  CYS A SG    1 
ATOM   1471 N  N     . GLU E 3 72  ? 1.550   -36.608 -24.975 1.00 29.43 ? 72  GLU A N     1 
ATOM   1472 C  CA    . GLU E 3 72  ? 1.535   -37.946 -24.400 1.00 29.29 ? 72  GLU A CA    1 
ATOM   1473 C  C     . GLU E 3 72  ? 2.573   -38.766 -25.165 1.00 27.68 ? 72  GLU A C     1 
ATOM   1474 O  O     . GLU E 3 72  ? 3.294   -39.577 -24.584 1.00 28.24 ? 72  GLU A O     1 
ATOM   1475 C  CB    . GLU E 3 72  ? 0.146   -38.571 -24.552 1.00 31.64 ? 72  GLU A CB    1 
ATOM   1476 C  CG    . GLU E 3 72  ? -0.148  -39.744 -23.618 1.00 34.86 ? 72  GLU A CG    1 
ATOM   1477 C  CD    . GLU E 3 72  ? -1.394  -40.520 -24.039 1.00 37.42 ? 72  GLU A CD    1 
ATOM   1478 O  OE1   . GLU E 3 72  ? -2.437  -39.874 -24.298 1.00 37.80 ? 72  GLU A OE1   1 
ATOM   1479 O  OE2   . GLU E 3 72  ? -1.331  -41.772 -24.112 1.00 38.09 ? 72  GLU A OE2   1 
ATOM   1480 N  N     . VAL E 3 73  ? 2.647   -38.537 -26.473 1.00 25.18 ? 73  VAL A N     1 
ATOM   1481 C  CA    . VAL E 3 73  ? 3.600   -39.235 -27.330 1.00 23.08 ? 73  VAL A CA    1 
ATOM   1482 C  C     . VAL E 3 73  ? 5.045   -38.990 -26.873 1.00 21.32 ? 73  VAL A C     1 
ATOM   1483 O  O     . VAL E 3 73  ? 5.799   -39.937 -26.622 1.00 20.25 ? 73  VAL A O     1 
ATOM   1484 C  CB    . VAL E 3 73  ? 3.421   -38.791 -28.812 1.00 23.62 ? 73  VAL A CB    1 
ATOM   1485 C  CG1   . VAL E 3 73  ? 4.600   -39.256 -29.665 1.00 24.38 ? 73  VAL A CG1   1 
ATOM   1486 C  CG2   . VAL E 3 73  ? 2.138   -39.371 -29.365 1.00 21.18 ? 73  VAL A CG2   1 
ATOM   1487 N  N     . VAL E 3 74  ? 5.423   -37.720 -26.758 1.00 20.18 ? 74  VAL A N     1 
ATOM   1488 C  CA    . VAL E 3 74  ? 6.772   -37.347 -26.326 1.00 19.08 ? 74  VAL A CA    1 
ATOM   1489 C  C     . VAL E 3 74  ? 7.088   -37.961 -24.962 1.00 19.45 ? 74  VAL A C     1 
ATOM   1490 O  O     . VAL E 3 74  ? 8.176   -38.485 -24.740 1.00 19.87 ? 74  VAL A O     1 
ATOM   1491 C  CB    . VAL E 3 74  ? 6.922   -35.800 -26.246 1.00 16.41 ? 74  VAL A CB    1 
ATOM   1492 C  CG1   . VAL E 3 74  ? 8.252   -35.419 -25.615 1.00 14.45 ? 74  VAL A CG1   1 
ATOM   1493 C  CG2   . VAL E 3 74  ? 6.811   -35.210 -27.631 1.00 13.36 ? 74  VAL A CG2   1 
ATOM   1494 N  N     . GLN E 3 75  ? 6.117   -37.891 -24.059 1.00 20.47 ? 75  GLN A N     1 
ATOM   1495 C  CA    . GLN E 3 75  ? 6.248   -38.434 -22.715 1.00 20.04 ? 75  GLN A CA    1 
ATOM   1496 C  C     . GLN E 3 75  ? 6.523   -39.924 -22.795 1.00 20.43 ? 75  GLN A C     1 
ATOM   1497 O  O     . GLN E 3 75  ? 7.354   -40.451 -22.062 1.00 19.11 ? 75  GLN A O     1 
ATOM   1498 C  CB    . GLN E 3 75  ? 4.952   -38.183 -21.946 1.00 21.44 ? 75  GLN A CB    1 
ATOM   1499 C  CG    . GLN E 3 75  ? 4.939   -38.705 -20.531 1.00 23.95 ? 75  GLN A CG    1 
ATOM   1500 C  CD    . GLN E 3 75  ? 6.040   -38.108 -19.668 1.00 28.22 ? 75  GLN A CD    1 
ATOM   1501 O  OE1   . GLN E 3 75  ? 6.478   -36.970 -19.874 1.00 29.62 ? 75  GLN A OE1   1 
ATOM   1502 N  NE2   . GLN E 3 75  ? 6.481   -38.872 -18.678 1.00 30.21 ? 75  GLN A NE2   1 
ATOM   1503 N  N     . GLU E 3 76  ? 5.812   -40.605 -23.690 1.00 21.94 ? 76  GLU A N     1 
ATOM   1504 C  CA    . GLU E 3 76  ? 5.999   -42.037 -23.859 1.00 23.17 ? 76  GLU A CA    1 
ATOM   1505 C  C     . GLU E 3 76  ? 7.373   -42.275 -24.470 1.00 23.25 ? 76  GLU A C     1 
ATOM   1506 O  O     . GLU E 3 76  ? 8.102   -43.168 -24.043 1.00 25.16 ? 76  GLU A O     1 
ATOM   1507 C  CB    . GLU E 3 76  ? 4.922   -42.622 -24.771 1.00 23.01 ? 76  GLU A CB    1 
ATOM   1508 C  CG    . GLU E 3 76  ? 4.841   -44.129 -24.703 1.00 23.85 ? 76  GLU A CG    1 
ATOM   1509 C  CD    . GLU E 3 76  ? 4.316   -44.625 -23.360 1.00 26.48 ? 76  GLU A CD    1 
ATOM   1510 O  OE1   . GLU E 3 76  ? 4.415   -45.842 -23.087 1.00 28.34 ? 76  GLU A OE1   1 
ATOM   1511 O  OE2   . GLU E 3 76  ? 3.796   -43.805 -22.576 1.00 25.70 ? 76  GLU A OE2   1 
ATOM   1512 N  N     . ILE E 3 77  ? 7.713   -41.476 -25.475 1.00 21.89 ? 77  ILE A N     1 
ATOM   1513 C  CA    . ILE E 3 77  ? 9.004   -41.583 -26.137 1.00 22.74 ? 77  ILE A CA    1 
ATOM   1514 C  C     . ILE E 3 77  ? 10.101  -41.398 -25.103 1.00 23.31 ? 77  ILE A C     1 
ATOM   1515 O  O     . ILE E 3 77  ? 11.086  -42.140 -25.066 1.00 24.16 ? 77  ILE A O     1 
ATOM   1516 C  CB    . ILE E 3 77  ? 9.191   -40.472 -27.207 1.00 22.60 ? 77  ILE A CB    1 
ATOM   1517 C  CG1   . ILE E 3 77  ? 8.340   -40.775 -28.441 1.00 21.63 ? 77  ILE A CG1   1 
ATOM   1518 C  CG2   . ILE E 3 77  ? 10.681  -40.325 -27.555 1.00 22.02 ? 77  ILE A CG2   1 
ATOM   1519 C  CD1   . ILE E 3 77  ? 8.415   -39.709 -29.510 1.00 19.05 ? 77  ILE A CD1   1 
ATOM   1520 N  N     . LYS E 3 78  ? 9.924   -40.375 -24.280 1.00 23.36 ? 78  LYS A N     1 
ATOM   1521 C  CA    . LYS E 3 78  ? 10.878  -40.024 -23.238 1.00 24.61 ? 78  LYS A CA    1 
ATOM   1522 C  C     . LYS E 3 78  ? 11.057  -41.173 -22.242 1.00 24.47 ? 78  LYS A C     1 
ATOM   1523 O  O     . LYS E 3 78  ? 12.166  -41.487 -21.829 1.00 24.39 ? 78  LYS A O     1 
ATOM   1524 C  CB    . LYS E 3 78  ? 10.380  -38.749 -22.536 1.00 24.63 ? 78  LYS A CB    1 
ATOM   1525 C  CG    . LYS E 3 78  ? 11.388  -38.005 -21.678 1.00 25.58 ? 78  LYS A CG    1 
ATOM   1526 C  CD    . LYS E 3 78  ? 10.850  -36.624 -21.345 1.00 27.97 ? 78  LYS A CD    1 
ATOM   1527 C  CE    . LYS E 3 78  ? 11.742  -35.871 -20.383 1.00 29.72 ? 78  LYS A CE    1 
ATOM   1528 N  NZ    . LYS E 3 78  ? 11.297  -36.024 -18.973 1.00 31.65 ? 78  LYS A NZ    1 
ATOM   1529 N  N     . THR E 3 79  ? 9.950   -41.810 -21.888 1.00 25.58 ? 79  THR A N     1 
ATOM   1530 C  CA    . THR E 3 79  ? 9.945   -42.909 -20.938 1.00 26.06 ? 79  THR A CA    1 
ATOM   1531 C  C     . THR E 3 79  ? 10.569  -44.215 -21.447 1.00 25.85 ? 79  THR A C     1 
ATOM   1532 O  O     . THR E 3 79  ? 11.322  -44.873 -20.720 1.00 25.89 ? 79  THR A O     1 
ATOM   1533 C  CB    . THR E 3 79  ? 8.509   -43.174 -20.464 1.00 26.42 ? 79  THR A CB    1 
ATOM   1534 O  OG1   . THR E 3 79  ? 7.990   -41.999 -19.826 1.00 27.65 ? 79  THR A OG1   1 
ATOM   1535 C  CG2   . THR E 3 79  ? 8.479   -44.296 -19.483 1.00 26.26 ? 79  THR A CG2   1 
ATOM   1536 N  N     . PHE E 3 80  ? 10.259  -44.593 -22.682 1.00 24.46 ? 80  PHE A N     1 
ATOM   1537 C  CA    . PHE E 3 80  ? 10.816  -45.814 -23.248 1.00 23.90 ? 80  PHE A CA    1 
ATOM   1538 C  C     . PHE E 3 80  ? 12.326  -45.725 -23.365 1.00 24.31 ? 80  PHE A C     1 
ATOM   1539 O  O     . PHE E 3 80  ? 13.037  -46.672 -23.054 1.00 24.50 ? 80  PHE A O     1 
ATOM   1540 C  CB    . PHE E 3 80  ? 10.243  -46.078 -24.631 1.00 24.67 ? 80  PHE A CB    1 
ATOM   1541 C  CG    . PHE E 3 80  ? 9.179   -47.126 -24.663 1.00 24.39 ? 80  PHE A CG    1 
ATOM   1542 C  CD1   . PHE E 3 80  ? 7.905   -46.868 -24.151 1.00 26.60 ? 80  PHE A CD1   1 
ATOM   1543 C  CD2   . PHE E 3 80  ? 9.432   -48.361 -25.246 1.00 23.84 ? 80  PHE A CD2   1 
ATOM   1544 C  CE1   . PHE E 3 80  ? 6.890   -47.840 -24.223 1.00 26.89 ? 80  PHE A CE1   1 
ATOM   1545 C  CE2   . PHE E 3 80  ? 8.435   -49.333 -25.324 1.00 25.24 ? 80  PHE A CE2   1 
ATOM   1546 C  CZ    . PHE E 3 80  ? 7.159   -49.072 -24.814 1.00 25.99 ? 80  PHE A CZ    1 
ATOM   1547 N  N     . SER E 3 81  ? 12.815  -44.582 -23.824 1.00 26.32 ? 81  SER A N     1 
ATOM   1548 C  CA    . SER E 3 81  ? 14.253  -44.377 -23.995 1.00 28.01 ? 81  SER A CA    1 
ATOM   1549 C  C     . SER E 3 81  ? 15.004  -44.380 -22.665 1.00 28.84 ? 81  SER A C     1 
ATOM   1550 O  O     . SER E 3 81  ? 15.953  -45.143 -22.477 1.00 28.95 ? 81  SER A O     1 
ATOM   1551 C  CB    . SER E 3 81  ? 14.505  -43.061 -24.732 1.00 27.97 ? 81  SER A CB    1 
ATOM   1552 O  OG    . SER E 3 81  ? 15.889  -42.806 -24.879 1.00 28.61 ? 81  SER A OG    1 
ATOM   1553 N  N     . GLN E 3 82  ? 14.578  -43.532 -21.738 1.00 29.70 ? 82  GLN A N     1 
ATOM   1554 C  CA    . GLN E 3 82  ? 15.238  -43.469 -20.446 1.00 31.44 ? 82  GLN A CA    1 
ATOM   1555 C  C     . GLN E 3 82  ? 15.248  -44.811 -19.732 1.00 30.38 ? 82  GLN A C     1 
ATOM   1556 O  O     . GLN E 3 82  ? 16.259  -45.204 -19.155 1.00 30.40 ? 82  GLN A O     1 
ATOM   1557 C  CB    . GLN E 3 82  ? 14.584  -42.408 -19.572 1.00 33.20 ? 82  GLN A CB    1 
ATOM   1558 C  CG    . GLN E 3 82  ? 14.779  -41.008 -20.127 1.00 38.33 ? 82  GLN A CG    1 
ATOM   1559 C  CD    . GLN E 3 82  ? 14.737  -39.944 -19.047 1.00 41.07 ? 82  GLN A CD    1 
ATOM   1560 O  OE1   . GLN E 3 82  ? 14.804  -40.245 -17.865 1.00 43.96 ? 82  GLN A OE1   1 
ATOM   1561 N  NE2   . GLN E 3 82  ? 14.646  -38.696 -19.452 1.00 43.33 ? 82  GLN A NE2   1 
ATOM   1562 N  N     . GLU E 3 83  ? 14.129  -45.524 -19.792 1.00 30.03 ? 83  GLU A N     1 
ATOM   1563 C  CA    . GLU E 3 83  ? 14.033  -46.826 -19.145 1.00 29.20 ? 83  GLU A CA    1 
ATOM   1564 C  C     . GLU E 3 83  ? 14.626  -47.897 -20.036 1.00 26.61 ? 83  GLU A C     1 
ATOM   1565 O  O     . GLU E 3 83  ? 14.607  -49.066 -19.693 1.00 25.63 ? 83  GLU A O     1 
ATOM   1566 C  CB    . GLU E 3 83  ? 12.578  -47.165 -18.836 1.00 30.46 ? 83  GLU A CB    1 
ATOM   1567 C  CG    . GLU E 3 83  ? 11.920  -46.177 -17.901 1.00 34.97 ? 83  GLU A CG    1 
ATOM   1568 C  CD    . GLU E 3 83  ? 10.518  -46.573 -17.554 1.00 37.39 ? 83  GLU A CD    1 
ATOM   1569 O  OE1   . GLU E 3 83  ? 9.601   -45.787 -17.840 1.00 39.55 ? 83  GLU A OE1   1 
ATOM   1570 O  OE2   . GLU E 3 83  ? 10.322  -47.672 -16.981 1.00 40.39 ? 83  GLU A OE2   1 
ATOM   1571 N  N     . GLY E 3 84  ? 15.145  -47.476 -21.184 1.00 24.88 ? 84  GLY A N     1 
ATOM   1572 C  CA    . GLY E 3 84  ? 15.752  -48.393 -22.128 1.00 24.17 ? 84  GLY A CA    1 
ATOM   1573 C  C     . GLY E 3 84  ? 14.944  -49.612 -22.532 1.00 23.29 ? 84  GLY A C     1 
ATOM   1574 O  O     . GLY E 3 84  ? 15.525  -50.671 -22.754 1.00 21.80 ? 84  GLY A O     1 
ATOM   1575 N  N     . ARG E 3 85  ? 13.626  -49.467 -22.666 1.00 23.60 ? 85  ARG A N     1 
ATOM   1576 C  CA    . ARG E 3 85  ? 12.771  -50.594 -23.046 1.00 24.29 ? 85  ARG A CA    1 
ATOM   1577 C  C     . ARG E 3 85  ? 12.782  -50.952 -24.531 1.00 24.08 ? 85  ARG A C     1 
ATOM   1578 O  O     . ARG E 3 85  ? 12.183  -51.949 -24.924 1.00 23.57 ? 85  ARG A O     1 
ATOM   1579 C  CB    . ARG E 3 85  ? 11.318  -50.371 -22.574 1.00 25.51 ? 85  ARG A CB    1 
ATOM   1580 C  CG    . ARG E 3 85  ? 11.114  -49.060 -21.843 1.00 28.06 ? 85  ARG A CG    1 
ATOM   1581 C  CD    . ARG E 3 85  ? 9.994   -48.925 -20.773 1.00 29.17 ? 85  ARG A CD    1 
ATOM   1582 N  NE    . ARG E 3 85  ? 8.948   -49.896 -20.731 1.00 30.89 ? 85  ARG A NE    1 
ATOM   1583 C  CZ    . ARG E 3 85  ? 7.624   -49.797 -20.819 1.00 33.05 ? 85  ARG A CZ    1 
ATOM   1584 N  NH1   . ARG E 3 85  ? 7.000   -50.944 -20.709 1.00 34.64 ? 85  ARG A NH1   1 
ATOM   1585 N  NH2   . ARG E 3 85  ? 6.914   -48.695 -21.021 1.00 33.52 ? 85  ARG A NH2   1 
ATOM   1586 N  N     . ALA E 3 86  ? 13.476  -50.166 -25.352 1.00 24.44 ? 86  ALA A N     1 
ATOM   1587 C  CA    . ALA E 3 86  ? 13.524  -50.444 -26.789 1.00 25.35 ? 86  ALA A CA    1 
ATOM   1588 C  C     . ALA E 3 86  ? 14.927  -50.769 -27.270 1.00 25.99 ? 86  ALA A C     1 
ATOM   1589 O  O     . ALA E 3 86  ? 15.849  -49.973 -27.103 1.00 26.85 ? 86  ALA A O     1 
ATOM   1590 C  CB    . ALA E 3 86  ? 12.967  -49.253 -27.581 1.00 25.38 ? 86  ALA A CB    1 
ATOM   1591 N  N     . ALA E 3 87  ? 15.074  -51.940 -27.883 1.00 26.77 ? 87  ALA A N     1 
ATOM   1592 C  CA    . ALA E 3 87  ? 16.360  -52.403 -28.402 1.00 27.02 ? 87  ALA A CA    1 
ATOM   1593 C  C     . ALA E 3 87  ? 17.148  -51.321 -29.148 1.00 27.91 ? 87  ALA A C     1 
ATOM   1594 O  O     . ALA E 3 87  ? 18.261  -50.972 -28.730 1.00 27.85 ? 87  ALA A O     1 
ATOM   1595 C  CB    . ALA E 3 87  ? 16.148  -53.607 -29.309 1.00 25.39 ? 87  ALA A CB    1 
ATOM   1596 N  N     . LYS E 3 88  ? 16.577  -50.792 -30.236 1.00 27.94 ? 88  LYS A N     1 
ATOM   1597 C  CA    . LYS E 3 88  ? 17.244  -49.758 -31.035 1.00 27.23 ? 88  LYS A CA    1 
ATOM   1598 C  C     . LYS E 3 88  ? 16.675  -48.344 -30.858 1.00 27.37 ? 88  LYS A C     1 
ATOM   1599 O  O     . LYS E 3 88  ? 15.534  -48.161 -30.440 1.00 27.11 ? 88  LYS A O     1 
ATOM   1600 C  CB    . LYS E 3 88  ? 17.226  -50.140 -32.515 1.00 26.54 ? 88  LYS A CB    1 
ATOM   1601 C  CG    . LYS E 3 88  ? 17.864  -51.479 -32.817 1.00 26.18 ? 88  LYS A CG    1 
ATOM   1602 C  CD    . LYS E 3 88  ? 18.565  -51.443 -34.177 1.00 26.86 ? 88  LYS A CD    1 
ATOM   1603 C  CE    . LYS E 3 88  ? 18.549  -52.805 -34.844 1.00 29.35 ? 88  LYS A CE    1 
ATOM   1604 N  NZ    . LYS E 3 88  ? 19.341  -52.857 -36.098 1.00 30.33 ? 88  LYS A NZ    1 
ATOM   1605 N  N     . GLN E 3 89  ? 17.474  -47.344 -31.215 1.00 27.63 ? 89  GLN A N     1 
ATOM   1606 C  CA    . GLN E 3 89  ? 17.080  -45.945 -31.047 1.00 27.63 ? 89  GLN A CA    1 
ATOM   1607 C  C     . GLN E 3 89  ? 16.356  -45.255 -32.196 1.00 27.13 ? 89  GLN A C     1 
ATOM   1608 O  O     . GLN E 3 89  ? 15.509  -44.391 -31.970 1.00 24.92 ? 89  GLN A O     1 
ATOM   1609 C  CB    . GLN E 3 89  ? 18.315  -45.108 -30.672 1.00 28.70 ? 89  GLN A CB    1 
ATOM   1610 C  CG    . GLN E 3 89  ? 18.981  -45.557 -29.388 1.00 29.45 ? 89  GLN A CG    1 
ATOM   1611 C  CD    . GLN E 3 89  ? 18.066  -45.417 -28.191 1.00 30.97 ? 89  GLN A CD    1 
ATOM   1612 O  OE1   . GLN E 3 89  ? 18.405  -44.767 -27.225 1.00 34.55 ? 89  GLN A OE1   1 
ATOM   1613 N  NE2   . GLN E 3 89  ? 16.902  -46.027 -28.253 1.00 34.01 ? 89  GLN A NE2   1 
ATOM   1614 N  N     . GLU E 3 90  ? 16.692  -45.632 -33.423 1.00 27.28 ? 90  GLU A N     1 
ATOM   1615 C  CA    . GLU E 3 90  ? 16.101  -45.014 -34.606 1.00 27.83 ? 90  GLU A CA    1 
ATOM   1616 C  C     . GLU E 3 90  ? 14.612  -44.697 -34.483 1.00 26.65 ? 90  GLU A C     1 
ATOM   1617 O  O     . GLU E 3 90  ? 14.210  -43.546 -34.647 1.00 26.54 ? 90  GLU A O     1 
ATOM   1618 C  CB    . GLU E 3 90  ? 16.360  -45.877 -35.849 1.00 29.97 ? 90  GLU A CB    1 
ATOM   1619 C  CG    . GLU E 3 90  ? 17.762  -45.771 -36.431 1.00 33.27 ? 90  GLU A CG    1 
ATOM   1620 C  CD    . GLU E 3 90  ? 18.848  -46.093 -35.414 1.00 36.64 ? 90  GLU A CD    1 
ATOM   1621 O  OE1   . GLU E 3 90  ? 19.727  -46.933 -35.702 1.00 39.86 ? 90  GLU A OE1   1 
ATOM   1622 O  OE2   . GLU E 3 90  ? 18.875  -45.510 -34.311 1.00 38.14 ? 90  GLU A OE2   1 
ATOM   1623 N  N     . PRO E 3 91  ? 13.771  -45.700 -34.178 1.00 26.38 ? 91  PRO A N     1 
ATOM   1624 C  CA    . PRO E 3 91  ? 12.332  -45.409 -34.054 1.00 25.62 ? 91  PRO A CA    1 
ATOM   1625 C  C     . PRO E 3 91  ? 11.992  -44.289 -33.061 1.00 25.25 ? 91  PRO A C     1 
ATOM   1626 O  O     . PRO E 3 91  ? 11.153  -43.448 -33.351 1.00 23.98 ? 91  PRO A O     1 
ATOM   1627 C  CB    . PRO E 3 91  ? 11.744  -46.757 -33.646 1.00 25.04 ? 91  PRO A CB    1 
ATOM   1628 C  CG    . PRO E 3 91  ? 12.649  -47.717 -34.341 1.00 25.50 ? 91  PRO A CG    1 
ATOM   1629 C  CD    . PRO E 3 91  ? 14.019  -47.148 -34.065 1.00 24.90 ? 91  PRO A CD    1 
ATOM   1630 N  N     . THR E 3 92  ? 12.650  -44.283 -31.905 1.00 26.32 ? 92  THR A N     1 
ATOM   1631 C  CA    . THR E 3 92  ? 12.402  -43.259 -30.896 1.00 28.10 ? 92  THR A CA    1 
ATOM   1632 C  C     . THR E 3 92  ? 12.874  -41.899 -31.394 1.00 27.84 ? 92  THR A C     1 
ATOM   1633 O  O     . THR E 3 92  ? 12.131  -40.918 -31.341 1.00 28.38 ? 92  THR A O     1 
ATOM   1634 C  CB    . THR E 3 92  ? 13.133  -43.592 -29.586 1.00 28.76 ? 92  THR A CB    1 
ATOM   1635 O  OG1   . THR E 3 92  ? 13.787  -44.858 -29.728 1.00 31.95 ? 92  THR A OG1   1 
ATOM   1636 C  CG2   . THR E 3 92  ? 12.145  -43.698 -28.442 1.00 30.99 ? 92  THR A CG2   1 
ATOM   1637 N  N     . LEU E 3 93  ? 14.107  -41.849 -31.890 1.00 27.20 ? 93  LEU A N     1 
ATOM   1638 C  CA    . LEU E 3 93  ? 14.674  -40.614 -32.399 1.00 24.91 ? 93  LEU A CA    1 
ATOM   1639 C  C     . LEU E 3 93  ? 13.907  -40.084 -33.606 1.00 24.85 ? 93  LEU A C     1 
ATOM   1640 O  O     . LEU E 3 93  ? 13.790  -38.873 -33.786 1.00 24.81 ? 93  LEU A O     1 
ATOM   1641 C  CB    . LEU E 3 93  ? 16.149  -40.822 -32.738 1.00 24.11 ? 93  LEU A CB    1 
ATOM   1642 C  CG    . LEU E 3 93  ? 17.009  -41.131 -31.508 1.00 23.65 ? 93  LEU A CG    1 
ATOM   1643 C  CD1   . LEU E 3 93  ? 18.444  -41.416 -31.928 1.00 24.15 ? 93  LEU A CD1   1 
ATOM   1644 C  CD2   . LEU E 3 93  ? 16.961  -39.961 -30.544 1.00 23.63 ? 93  LEU A CD2   1 
ATOM   1645 N  N     . PHE E 3 94  ? 13.381  -40.977 -34.434 1.00 24.61 ? 94  PHE A N     1 
ATOM   1646 C  CA    . PHE E 3 94  ? 12.605  -40.536 -35.585 1.00 24.32 ? 94  PHE A CA    1 
ATOM   1647 C  C     . PHE E 3 94  ? 11.271  -39.970 -35.091 1.00 24.91 ? 94  PHE A C     1 
ATOM   1648 O  O     . PHE E 3 94  ? 10.765  -38.990 -35.633 1.00 26.71 ? 94  PHE A O     1 
ATOM   1649 C  CB    . PHE E 3 94  ? 12.335  -41.697 -36.538 1.00 24.34 ? 94  PHE A CB    1 
ATOM   1650 C  CG    . PHE E 3 94  ? 11.451  -41.334 -37.705 1.00 24.60 ? 94  PHE A CG    1 
ATOM   1651 C  CD1   . PHE E 3 94  ? 11.922  -40.514 -38.728 1.00 23.58 ? 94  PHE A CD1   1 
ATOM   1652 C  CD2   . PHE E 3 94  ? 10.154  -41.823 -37.787 1.00 24.55 ? 94  PHE A CD2   1 
ATOM   1653 C  CE1   . PHE E 3 94  ? 11.119  -40.197 -39.814 1.00 23.12 ? 94  PHE A CE1   1 
ATOM   1654 C  CE2   . PHE E 3 94  ? 9.349   -41.510 -38.870 1.00 25.59 ? 94  PHE A CE2   1 
ATOM   1655 C  CZ    . PHE E 3 94  ? 9.832   -40.693 -39.886 1.00 24.42 ? 94  PHE A CZ    1 
ATOM   1656 N  N     . ALA E 3 95  ? 10.704  -40.588 -34.061 1.00 23.25 ? 95  ALA A N     1 
ATOM   1657 C  CA    . ALA E 3 95  ? 9.440   -40.127 -33.503 1.00 22.47 ? 95  ALA A CA    1 
ATOM   1658 C  C     . ALA E 3 95  ? 9.597   -38.741 -32.873 1.00 22.88 ? 95  ALA A C     1 
ATOM   1659 O  O     . ALA E 3 95  ? 8.744   -37.871 -33.043 1.00 21.10 ? 95  ALA A O     1 
ATOM   1660 C  CB    . ALA E 3 95  ? 8.940   -41.112 -32.458 1.00 21.28 ? 95  ALA A CB    1 
ATOM   1661 N  N     . LEU E 3 96  ? 10.694  -38.549 -32.140 1.00 24.21 ? 96  LEU A N     1 
ATOM   1662 C  CA    . LEU E 3 96  ? 10.970  -37.280 -31.476 1.00 25.20 ? 96  LEU A CA    1 
ATOM   1663 C  C     . LEU E 3 96  ? 11.279  -36.210 -32.517 1.00 24.93 ? 96  LEU A C     1 
ATOM   1664 O  O     . LEU E 3 96  ? 11.155  -35.017 -32.259 1.00 25.12 ? 96  LEU A O     1 
ATOM   1665 C  CB    . LEU E 3 96  ? 12.140  -37.434 -30.490 1.00 26.27 ? 96  LEU A CB    1 
ATOM   1666 C  CG    . LEU E 3 96  ? 12.230  -36.375 -29.384 1.00 26.65 ? 96  LEU A CG    1 
ATOM   1667 C  CD1   . LEU E 3 96  ? 12.775  -36.982 -28.146 1.00 29.47 ? 96  LEU A CD1   1 
ATOM   1668 C  CD2   . LEU E 3 96  ? 13.101  -35.254 -29.819 1.00 29.95 ? 96  LEU A CD2   1 
ATOM   1669 N  N     . ALA E 3 97  ? 11.682  -36.648 -33.701 1.00 25.76 ? 97  ALA A N     1 
ATOM   1670 C  CA    . ALA E 3 97  ? 11.978  -35.727 -34.782 1.00 26.22 ? 97  ALA A CA    1 
ATOM   1671 C  C     . ALA E 3 97  ? 10.663  -35.260 -35.405 1.00 26.26 ? 97  ALA A C     1 
ATOM   1672 O  O     . ALA E 3 97  ? 10.458  -34.063 -35.600 1.00 26.37 ? 97  ALA A O     1 
ATOM   1673 C  CB    . ALA E 3 97  ? 12.846  -36.410 -35.828 1.00 25.97 ? 97  ALA A CB    1 
ATOM   1674 N  N     . VAL E 3 98  ? 9.773   -36.199 -35.712 1.00 26.65 ? 98  VAL A N     1 
ATOM   1675 C  CA    . VAL E 3 98  ? 8.488   -35.837 -36.310 1.00 28.38 ? 98  VAL A CA    1 
ATOM   1676 C  C     . VAL E 3 98  ? 7.775   -34.882 -35.358 1.00 29.46 ? 98  VAL A C     1 
ATOM   1677 O  O     . VAL E 3 98  ? 7.243   -33.847 -35.772 1.00 29.41 ? 98  VAL A O     1 
ATOM   1678 C  CB    . VAL E 3 98  ? 7.575   -37.065 -36.535 1.00 27.51 ? 98  VAL A CB    1 
ATOM   1679 C  CG1   . VAL E 3 98  ? 6.288   -36.628 -37.184 1.00 25.54 ? 98  VAL A CG1   1 
ATOM   1680 C  CG2   . VAL E 3 98  ? 8.275   -38.102 -37.393 1.00 27.40 ? 98  VAL A CG2   1 
ATOM   1681 N  N     . CYS E 3 99  ? 7.768   -35.237 -34.080 1.00 29.75 ? 99  CYS A N     1 
ATOM   1682 C  CA    . CYS E 3 99  ? 7.136   -34.399 -33.080 1.00 30.47 ? 99  CYS A CA    1 
ATOM   1683 C  C     . CYS E 3 99  ? 7.799   -33.034 -33.060 1.00 31.77 ? 99  CYS A C     1 
ATOM   1684 O  O     . CYS E 3 99  ? 7.136   -32.028 -32.825 1.00 31.37 ? 99  CYS A O     1 
ATOM   1685 C  CB    . CYS E 3 99  ? 7.241   -35.042 -31.697 1.00 29.51 ? 99  CYS A CB    1 
ATOM   1686 S  SG    . CYS E 3 99  ? 6.117   -36.425 -31.483 1.00 27.55 ? 99  CYS A SG    1 
ATOM   1687 N  N     . SER E 3 100 ? 9.106   -33.008 -33.314 1.00 33.28 ? 100 SER A N     1 
ATOM   1688 C  CA    . SER E 3 100 ? 9.872   -31.761 -33.326 1.00 35.28 ? 100 SER A CA    1 
ATOM   1689 C  C     . SER E 3 100 ? 9.452   -30.843 -34.479 1.00 37.67 ? 100 SER A C     1 
ATOM   1690 O  O     . SER E 3 100 ? 9.992   -29.749 -34.649 1.00 37.41 ? 100 SER A O     1 
ATOM   1691 C  CB    . SER E 3 100 ? 11.375  -32.072 -33.414 1.00 33.19 ? 100 SER A CB    1 
ATOM   1692 O  OG    . SER E 3 100 ? 11.977  -31.517 -34.572 1.00 29.50 ? 100 SER A OG    1 
ATOM   1693 N  N     . GLN E 3 101 ? 8.451   -31.272 -35.242 1.00 40.62 ? 101 GLN A N     1 
ATOM   1694 C  CA    . GLN E 3 101 ? 7.991   -30.490 -36.390 1.00 43.22 ? 101 GLN A CA    1 
ATOM   1695 C  C     . GLN E 3 101 ? 6.487   -30.355 -36.502 1.00 43.23 ? 101 GLN A C     1 
ATOM   1696 O  O     . GLN E 3 101 ? 6.000   -29.378 -37.065 1.00 44.20 ? 101 GLN A O     1 
ATOM   1697 C  CB    . GLN E 3 101 ? 8.489   -31.116 -37.688 1.00 45.03 ? 101 GLN A CB    1 
ATOM   1698 C  CG    . GLN E 3 101 ? 9.914   -31.588 -37.598 1.00 49.04 ? 101 GLN A CG    1 
ATOM   1699 C  CD    . GLN E 3 101 ? 10.646  -31.376 -38.897 1.00 51.73 ? 101 GLN A CD    1 
ATOM   1700 O  OE1   . GLN E 3 101 ? 11.817  -31.729 -39.026 1.00 53.22 ? 101 GLN A OE1   1 
ATOM   1701 N  NE2   . GLN E 3 101 ? 9.963   -30.772 -39.872 1.00 52.75 ? 101 GLN A NE2   1 
ATOM   1702 N  N     . CYS E 3 102 ? 5.754   -31.334 -35.987 1.00 43.70 ? 102 CYS A N     1 
ATOM   1703 C  CA    . CYS E 3 102 ? 4.300   -31.326 -36.082 1.00 44.30 ? 102 CYS A CA    1 
ATOM   1704 C  C     . CYS E 3 102 ? 3.661   -29.949 -35.919 1.00 45.24 ? 102 CYS A C     1 
ATOM   1705 O  O     . CYS E 3 102 ? 4.284   -29.011 -35.408 1.00 45.70 ? 102 CYS A O     1 
ATOM   1706 C  CB    . CYS E 3 102 ? 3.709   -32.281 -35.051 1.00 44.12 ? 102 CYS A CB    1 
ATOM   1707 S  SG    . CYS E 3 102 ? 3.935   -31.761 -33.359 1.00 42.85 ? 102 CYS A SG    1 
ATOM   1708 N  N     . SER E 3 103 ? 2.411   -29.844 -36.362 1.00 45.47 ? 103 SER A N     1 
ATOM   1709 C  CA    . SER E 3 103 ? 1.668   -28.604 -36.263 1.00 45.91 ? 103 SER A CA    1 
ATOM   1710 C  C     . SER E 3 103 ? 1.568   -28.096 -34.824 1.00 46.08 ? 103 SER A C     1 
ATOM   1711 O  O     . SER E 3 103 ? 1.821   -26.917 -34.559 1.00 47.29 ? 103 SER A O     1 
ATOM   1712 C  CB    . SER E 3 103 ? 0.272   -28.792 -36.855 1.00 45.66 ? 103 SER A CB    1 
ATOM   1713 O  OG    . SER E 3 103 ? -0.271  -30.053 -36.501 1.00 45.78 ? 103 SER A OG    1 
ATOM   1714 N  N     . ASP E 3 104 ? 1.205   -28.977 -33.897 1.00 45.03 ? 104 ASP A N     1 
ATOM   1715 C  CA    . ASP E 3 104 ? 1.072   -28.590 -32.497 1.00 44.85 ? 104 ASP A CA    1 
ATOM   1716 C  C     . ASP E 3 104 ? 2.347   -27.881 -32.048 1.00 45.25 ? 104 ASP A C     1 
ATOM   1717 O  O     . ASP E 3 104 ? 3.431   -28.256 -32.485 1.00 45.41 ? 104 ASP A O     1 
ATOM   1718 C  CB    . ASP E 3 104 ? 0.847   -29.833 -31.633 1.00 44.44 ? 104 ASP A CB    1 
ATOM   1719 C  CG    . ASP E 3 104 ? 0.069   -29.531 -30.368 1.00 45.16 ? 104 ASP A CG    1 
ATOM   1720 O  OD1   . ASP E 3 104 ? 0.489   -29.979 -29.278 1.00 45.83 ? 104 ASP A OD1   1 
ATOM   1721 O  OD2   . ASP E 3 104 ? -0.972  -28.853 -30.466 1.00 45.25 ? 104 ASP A OD2   1 
ATOM   1722 N  N     . ILE E 3 105 ? 2.229   -26.858 -31.196 1.00 44.92 ? 105 ILE A N     1 
ATOM   1723 C  CA    . ILE E 3 105 ? 3.408   -26.135 -30.698 1.00 44.18 ? 105 ILE A CA    1 
ATOM   1724 C  C     . ILE E 3 105 ? 3.734   -26.598 -29.270 1.00 42.38 ? 105 ILE A C     1 
ATOM   1725 O  O     . ILE E 3 105 ? 4.843   -26.413 -28.773 1.00 41.05 ? 105 ILE A O     1 
ATOM   1726 C  CB    . ILE E 3 105 ? 3.195   -24.584 -30.691 1.00 45.58 ? 105 ILE A CB    1 
ATOM   1727 C  CG1   . ILE E 3 105 ? 1.786   -24.213 -31.164 1.00 46.64 ? 105 ILE A CG1   1 
ATOM   1728 C  CG2   . ILE E 3 105 ? 4.195   -23.927 -31.629 1.00 46.69 ? 105 ILE A CG2   1 
ATOM   1729 C  CD1   . ILE E 3 105 ? 0.773   -24.296 -30.064 1.00 50.31 ? 105 ILE A CD1   1 
ATOM   1730 N  N     . LYS E 3 106 ? 2.739   -27.206 -28.631 1.00 40.92 ? 106 LYS A N     1 
ATOM   1731 C  CA    . LYS E 3 106 ? 2.832   -27.763 -27.279 1.00 40.78 ? 106 LYS A CA    1 
ATOM   1732 C  C     . LYS E 3 106 ? 3.793   -28.945 -27.426 1.00 40.29 ? 106 LYS A C     1 
ATOM   1733 O  O     . LYS E 3 106 ? 4.784   -29.071 -26.705 1.00 39.77 ? 106 LYS A O     1 
ATOM   1734 C  CB    . LYS E 3 106 ? 1.463   -28.312 -26.891 1.00 41.22 ? 106 LYS A CB    1 
ATOM   1735 C  CG    . LYS E 3 106 ? 0.821   -27.918 -25.551 1.00 42.71 ? 106 LYS A CG    1 
ATOM   1736 C  CD    . LYS E 3 106 ? 1.704   -27.241 -24.501 1.00 44.43 ? 106 LYS A CD    1 
ATOM   1737 C  CE    . LYS E 3 106 ? 0.819   -27.031 -23.243 1.00 47.56 ? 106 LYS A CE    1 
ATOM   1738 N  NZ    . LYS E 3 106 ? -0.339  -27.979 -23.204 1.00 48.95 ? 106 LYS A NZ    1 
ATOM   1739 N  N     . THR E 3 107 ? 3.467   -29.799 -28.393 1.00 39.75 ? 107 THR A N     1 
ATOM   1740 C  CA    . THR E 3 107 ? 4.238   -30.997 -28.705 1.00 38.58 ? 107 THR A CA    1 
ATOM   1741 C  C     . THR E 3 107 ? 5.646   -30.671 -29.168 1.00 38.92 ? 107 THR A C     1 
ATOM   1742 O  O     . THR E 3 107 ? 6.602   -31.306 -28.738 1.00 39.24 ? 107 THR A O     1 
ATOM   1743 C  CB    . THR E 3 107 ? 3.570   -31.812 -29.816 1.00 37.80 ? 107 THR A CB    1 
ATOM   1744 O  OG1   . THR E 3 107 ? 2.255   -32.184 -29.405 1.00 37.70 ? 107 THR A OG1   1 
ATOM   1745 C  CG2   . THR E 3 107 ? 4.369   -33.061 -30.122 1.00 35.67 ? 107 THR A CG2   1 
ATOM   1746 N  N     . LYS E 3 108 ? 5.770   -29.692 -30.060 1.00 39.09 ? 108 LYS A N     1 
ATOM   1747 C  CA    . LYS E 3 108 ? 7.078   -29.297 -30.579 1.00 38.90 ? 108 LYS A CA    1 
ATOM   1748 C  C     . LYS E 3 108 ? 7.961   -28.832 -29.436 1.00 38.44 ? 108 LYS A C     1 
ATOM   1749 O  O     . LYS E 3 108 ? 9.084   -29.289 -29.280 1.00 39.47 ? 108 LYS A O     1 
ATOM   1750 C  CB    . LYS E 3 108 ? 6.944   -28.160 -31.594 1.00 38.84 ? 108 LYS A CB    1 
ATOM   1751 C  CG    . LYS E 3 108 ? 7.294   -28.546 -33.031 1.00 41.54 ? 108 LYS A CG    1 
ATOM   1752 C  CD    . LYS E 3 108 ? 7.463   -27.311 -33.922 1.00 42.67 ? 108 LYS A CD    1 
ATOM   1753 C  CE    . LYS E 3 108 ? 6.228   -26.434 -33.869 1.00 43.88 ? 108 LYS A CE    1 
ATOM   1754 N  NZ    . LYS E 3 108 ? 6.224   -25.358 -34.887 1.00 43.59 ? 108 LYS A NZ    1 
ATOM   1755 N  N     . GLN E 3 109 ? 7.442   -27.910 -28.641 1.00 38.29 ? 109 GLN A N     1 
ATOM   1756 C  CA    . GLN E 3 109 ? 8.171   -27.376 -27.516 1.00 38.26 ? 109 GLN A CA    1 
ATOM   1757 C  C     . GLN E 3 109 ? 8.516   -28.479 -26.528 1.00 37.42 ? 109 GLN A C     1 
ATOM   1758 O  O     . GLN E 3 109 ? 9.524   -28.402 -25.833 1.00 38.31 ? 109 GLN A O     1 
ATOM   1759 C  CB    . GLN E 3 109 ? 7.330   -26.256 -26.897 1.00 40.27 ? 109 GLN A CB    1 
ATOM   1760 C  CG    . GLN E 3 109 ? 7.203   -26.203 -25.392 1.00 43.58 ? 109 GLN A CG    1 
ATOM   1761 C  CD    . GLN E 3 109 ? 6.156   -25.163 -24.975 1.00 45.76 ? 109 GLN A CD    1 
ATOM   1762 O  OE1   . GLN E 3 109 ? 4.988   -25.264 -25.330 1.00 46.97 ? 109 GLN A OE1   1 
ATOM   1763 N  NE2   . GLN E 3 109 ? 6.577   -24.169 -24.227 1.00 46.72 ? 109 GLN A NE2   1 
ATOM   1764 N  N     . ALA E 3 110 ? 7.701   -29.524 -26.488 1.00 36.29 ? 110 ALA A N     1 
ATOM   1765 C  CA    . ALA E 3 110 ? 7.955   -30.632 -25.568 1.00 35.92 ? 110 ALA A CA    1 
ATOM   1766 C  C     . ALA E 3 110 ? 9.017   -31.558 -26.141 1.00 35.28 ? 110 ALA A C     1 
ATOM   1767 O  O     . ALA E 3 110 ? 9.770   -32.195 -25.400 1.00 35.57 ? 110 ALA A O     1 
ATOM   1768 C  CB    . ALA E 3 110 ? 6.663   -31.417 -25.295 1.00 35.14 ? 110 ALA A CB    1 
ATOM   1769 N  N     . ALA E 3 111 ? 9.077   -31.628 -27.467 1.00 34.28 ? 111 ALA A N     1 
ATOM   1770 C  CA    . ALA E 3 111 ? 10.051  -32.479 -28.133 1.00 33.36 ? 111 ALA A CA    1 
ATOM   1771 C  C     . ALA E 3 111 ? 11.480  -31.996 -27.879 1.00 33.10 ? 111 ALA A C     1 
ATOM   1772 O  O     . ALA E 3 111 ? 12.323  -32.771 -27.421 1.00 33.02 ? 111 ALA A O     1 
ATOM   1773 C  CB    . ALA E 3 111 ? 9.772   -32.525 -29.626 1.00 32.56 ? 111 ALA A CB    1 
ATOM   1774 N  N     . PHE E 3 112 ? 11.750  -30.721 -28.171 1.00 31.81 ? 112 PHE A N     1 
ATOM   1775 C  CA    . PHE E 3 112 ? 13.090  -30.173 -27.971 1.00 30.24 ? 112 PHE A CA    1 
ATOM   1776 C  C     . PHE E 3 112 ? 13.443  -30.136 -26.499 1.00 29.54 ? 112 PHE A C     1 
ATOM   1777 O  O     . PHE E 3 112 ? 14.618  -30.175 -26.129 1.00 30.64 ? 112 PHE A O     1 
ATOM   1778 C  CB    . PHE E 3 112 ? 13.201  -28.760 -28.547 1.00 27.12 ? 112 PHE A CB    1 
ATOM   1779 C  CG    . PHE E 3 112 ? 13.017  -28.694 -30.026 1.00 25.23 ? 112 PHE A CG    1 
ATOM   1780 C  CD1   . PHE E 3 112 ? 11.821  -28.241 -30.577 1.00 23.15 ? 112 PHE A CD1   1 
ATOM   1781 C  CD2   . PHE E 3 112 ? 14.029  -29.109 -30.879 1.00 23.87 ? 112 PHE A CD2   1 
ATOM   1782 C  CE1   . PHE E 3 112 ? 11.640  -28.201 -31.949 1.00 19.57 ? 112 PHE A CE1   1 
ATOM   1783 C  CE2   . PHE E 3 112 ? 13.851  -29.071 -32.255 1.00 20.91 ? 112 PHE A CE2   1 
ATOM   1784 C  CZ    . PHE E 3 112 ? 12.654  -28.619 -32.785 1.00 20.23 ? 112 PHE A CZ    1 
ATOM   1785 N  N     . ARG E 3 113 ? 12.417  -30.066 -25.665 1.00 29.10 ? 113 ARG A N     1 
ATOM   1786 C  CA    . ARG E 3 113 ? 12.606  -30.003 -24.227 1.00 30.15 ? 113 ARG A CA    1 
ATOM   1787 C  C     . ARG E 3 113 ? 13.170  -31.315 -23.695 1.00 29.10 ? 113 ARG A C     1 
ATOM   1788 O  O     . ARG E 3 113 ? 13.972  -31.318 -22.765 1.00 27.48 ? 113 ARG A O     1 
ATOM   1789 C  CB    . ARG E 3 113 ? 11.268  -29.683 -23.552 1.00 32.78 ? 113 ARG A CB    1 
ATOM   1790 C  CG    . ARG E 3 113 ? 11.357  -29.355 -22.070 1.00 36.50 ? 113 ARG A CG    1 
ATOM   1791 C  CD    . ARG E 3 113 ? 10.006  -28.898 -21.537 1.00 39.43 ? 113 ARG A CD    1 
ATOM   1792 N  NE    . ARG E 3 113 ? 8.982   -29.898 -21.571 1.00 41.78 ? 113 ARG A NE    1 
ATOM   1793 C  CZ    . ARG E 3 113 ? 7.705   -29.863 -21.943 1.00 42.24 ? 113 ARG A CZ    1 
ATOM   1794 N  NH1   . ARG E 3 113 ? 7.075   -31.016 -21.809 1.00 39.87 ? 113 ARG A NH1   1 
ATOM   1795 N  NH2   . ARG E 3 113 ? 7.062   -28.806 -22.439 1.00 42.68 ? 113 ARG A NH2   1 
ATOM   1796 N  N     . ALA E 3 114 ? 12.762  -32.422 -24.312 1.00 28.65 ? 114 ALA A N     1 
ATOM   1797 C  CA    . ALA E 3 114 ? 13.194  -33.749 -23.897 1.00 28.32 ? 114 ALA A CA    1 
ATOM   1798 C  C     . ALA E 3 114 ? 14.452  -34.266 -24.605 1.00 28.66 ? 114 ALA A C     1 
ATOM   1799 O  O     . ALA E 3 114 ? 14.960  -35.341 -24.272 1.00 29.46 ? 114 ALA A O     1 
ATOM   1800 C  CB    . ALA E 3 114 ? 12.052  -34.722 -24.093 1.00 27.87 ? 114 ALA A CB    1 
ATOM   1801 N  N     . VAL E 3 115 ? 14.961  -33.499 -25.565 1.00 28.37 ? 115 VAL A N     1 
ATOM   1802 C  CA    . VAL E 3 115 ? 16.146  -33.886 -26.330 1.00 28.18 ? 115 VAL A CA    1 
ATOM   1803 C  C     . VAL E 3 115 ? 17.377  -34.353 -25.529 1.00 29.35 ? 115 VAL A C     1 
ATOM   1804 O  O     . VAL E 3 115 ? 17.998  -35.361 -25.873 1.00 30.45 ? 115 VAL A O     1 
ATOM   1805 C  CB    . VAL E 3 115 ? 16.567  -32.741 -27.282 1.00 26.87 ? 115 VAL A CB    1 
ATOM   1806 C  CG1   . VAL E 3 115 ? 17.993  -32.931 -27.741 1.00 26.39 ? 115 VAL A CG1   1 
ATOM   1807 C  CG2   . VAL E 3 115 ? 15.643  -32.712 -28.489 1.00 24.79 ? 115 VAL A CG2   1 
ATOM   1808 N  N     . PRO E 3 116 ? 17.749  -33.630 -24.459 1.00 29.76 ? 116 PRO A N     1 
ATOM   1809 C  CA    . PRO E 3 116 ? 18.916  -34.019 -23.657 1.00 29.81 ? 116 PRO A CA    1 
ATOM   1810 C  C     . PRO E 3 116 ? 18.743  -35.267 -22.788 1.00 30.40 ? 116 PRO A C     1 
ATOM   1811 O  O     . PRO E 3 116 ? 19.732  -35.886 -22.367 1.00 29.63 ? 116 PRO A O     1 
ATOM   1812 C  CB    . PRO E 3 116 ? 19.190  -32.767 -22.833 1.00 29.36 ? 116 PRO A CB    1 
ATOM   1813 C  CG    . PRO E 3 116 ? 17.820  -32.227 -22.618 1.00 29.41 ? 116 PRO A CG    1 
ATOM   1814 C  CD    . PRO E 3 116 ? 17.200  -32.345 -23.991 1.00 29.48 ? 116 PRO A CD    1 
ATOM   1815 N  N     . GLU E 3 117 ? 17.493  -35.633 -22.511 1.00 30.60 ? 117 GLU A N     1 
ATOM   1816 C  CA    . GLU E 3 117 ? 17.230  -36.822 -21.706 1.00 31.29 ? 117 GLU A CA    1 
ATOM   1817 C  C     . GLU E 3 117 ? 17.024  -38.027 -22.616 1.00 29.97 ? 117 GLU A C     1 
ATOM   1818 O  O     . GLU E 3 117 ? 17.010  -39.169 -22.153 1.00 31.26 ? 117 GLU A O     1 
ATOM   1819 C  CB    . GLU E 3 117 ? 15.989  -36.638 -20.840 1.00 33.69 ? 117 GLU A CB    1 
ATOM   1820 C  CG    . GLU E 3 117 ? 16.035  -35.451 -19.910 1.00 37.76 ? 117 GLU A CG    1 
ATOM   1821 C  CD    . GLU E 3 117 ? 14.884  -35.474 -18.922 1.00 40.99 ? 117 GLU A CD    1 
ATOM   1822 O  OE1   . GLU E 3 117 ? 14.905  -36.333 -18.010 1.00 41.89 ? 117 GLU A OE1   1 
ATOM   1823 O  OE2   . GLU E 3 117 ? 13.955  -34.644 -19.061 1.00 41.98 ? 117 GLU A OE2   1 
ATOM   1824 N  N     . VAL E 3 118 ? 16.856  -37.762 -23.910 1.00 27.05 ? 118 VAL A N     1 
ATOM   1825 C  CA    . VAL E 3 118 ? 16.666  -38.819 -24.883 1.00 24.45 ? 118 VAL A CA    1 
ATOM   1826 C  C     . VAL E 3 118 ? 17.917  -39.004 -25.723 1.00 23.99 ? 118 VAL A C     1 
ATOM   1827 O  O     . VAL E 3 118 ? 18.173  -40.086 -26.244 1.00 25.95 ? 118 VAL A O     1 
ATOM   1828 C  CB    . VAL E 3 118 ? 15.464  -38.520 -25.805 1.00 24.06 ? 118 VAL A CB    1 
ATOM   1829 C  CG1   . VAL E 3 118 ? 15.426  -39.510 -26.969 1.00 21.48 ? 118 VAL A CG1   1 
ATOM   1830 C  CG2   . VAL E 3 118 ? 14.170  -38.619 -25.004 1.00 21.99 ? 118 VAL A CG2   1 
ATOM   1831 N  N     . CYS E 3 119 ? 18.693  -37.944 -25.867 1.00 22.41 ? 119 CYS A N     1 
ATOM   1832 C  CA    . CYS E 3 119 ? 19.922  -38.021 -26.642 1.00 22.80 ? 119 CYS A CA    1 
ATOM   1833 C  C     . CYS E 3 119 ? 21.076  -37.994 -25.666 1.00 22.97 ? 119 CYS A C     1 
ATOM   1834 O  O     . CYS E 3 119 ? 21.698  -36.950 -25.434 1.00 24.25 ? 119 CYS A O     1 
ATOM   1835 C  CB    . CYS E 3 119 ? 20.018  -36.849 -27.604 1.00 21.60 ? 119 CYS A CB    1 
ATOM   1836 S  SG    . CYS E 3 119 ? 18.706  -36.874 -28.778 1.00 22.15 ? 119 CYS A SG    1 
ATOM   1837 N  N     . ARG E 3 120 ? 21.362  -39.156 -25.095 1.00 22.35 ? 120 ARG A N     1 
ATOM   1838 C  CA    . ARG E 3 120 ? 22.419  -39.270 -24.112 1.00 20.72 ? 120 ARG A CA    1 
ATOM   1839 C  C     . ARG E 3 120 ? 23.820  -39.308 -24.684 1.00 20.61 ? 120 ARG A C     1 
ATOM   1840 O  O     . ARG E 3 120 ? 24.760  -38.880 -24.016 1.00 21.78 ? 120 ARG A O     1 
ATOM   1841 C  CB    . ARG E 3 120 ? 22.161  -40.484 -23.245 1.00 18.48 ? 120 ARG A CB    1 
ATOM   1842 C  CG    . ARG E 3 120 ? 20.922  -40.323 -22.420 1.00 15.30 ? 120 ARG A CG    1 
ATOM   1843 C  CD    . ARG E 3 120 ? 20.682  -41.575 -21.674 1.00 12.01 ? 120 ARG A CD    1 
ATOM   1844 N  NE    . ARG E 3 120 ? 20.224  -42.623 -22.566 1.00 10.38 ? 120 ARG A NE    1 
ATOM   1845 C  CZ    . ARG E 3 120 ? 19.000  -42.681 -23.062 1.00 11.07 ? 120 ARG A CZ    1 
ATOM   1846 N  NH1   . ARG E 3 120 ? 18.110  -41.748 -22.746 1.00 11.87 ? 120 ARG A NH1   1 
ATOM   1847 N  NH2   . ARG E 3 120 ? 18.672  -43.667 -23.877 1.00 11.89 ? 120 ARG A NH2   1 
ATOM   1848 N  N     . ILE E 3 121 ? 23.968  -39.816 -25.905 1.00 19.42 ? 121 ILE A N     1 
ATOM   1849 C  CA    . ILE E 3 121 ? 25.283  -39.852 -26.533 1.00 20.81 ? 121 ILE A CA    1 
ATOM   1850 C  C     . ILE E 3 121 ? 25.242  -39.156 -27.895 1.00 21.47 ? 121 ILE A C     1 
ATOM   1851 O  O     . ILE E 3 121 ? 24.192  -39.075 -28.526 1.00 23.27 ? 121 ILE A O     1 
ATOM   1852 C  CB    . ILE E 3 121 ? 25.800  -41.305 -26.710 1.00 20.29 ? 121 ILE A CB    1 
ATOM   1853 C  CG1   . ILE E 3 121 ? 24.877  -42.090 -27.645 1.00 20.54 ? 121 ILE A CG1   1 
ATOM   1854 C  CG2   . ILE E 3 121 ? 25.902  -41.990 -25.346 1.00 19.89 ? 121 ILE A CG2   1 
ATOM   1855 C  CD1   . ILE E 3 121 ? 25.398  -43.470 -28.019 1.00 20.06 ? 121 ILE A CD1   1 
ATOM   1856 N  N     . PRO E 3 122 ? 26.385  -38.627 -28.360 1.00 22.15 ? 122 PRO A N     1 
ATOM   1857 C  CA    . PRO E 3 122 ? 26.436  -37.945 -29.657 1.00 22.72 ? 122 PRO A CA    1 
ATOM   1858 C  C     . PRO E 3 122 ? 25.648  -38.633 -30.778 1.00 22.72 ? 122 PRO A C     1 
ATOM   1859 O  O     . PRO E 3 122 ? 24.874  -37.986 -31.487 1.00 24.19 ? 122 PRO A O     1 
ATOM   1860 C  CB    . PRO E 3 122 ? 27.931  -37.881 -29.942 1.00 21.92 ? 122 PRO A CB    1 
ATOM   1861 C  CG    . PRO E 3 122 ? 28.492  -37.637 -28.574 1.00 21.47 ? 122 PRO A CG    1 
ATOM   1862 C  CD    . PRO E 3 122 ? 27.707  -38.603 -27.704 1.00 21.43 ? 122 PRO A CD    1 
ATOM   1863 N  N     . THR E 3 123 ? 25.841  -39.940 -30.934 1.00 22.78 ? 123 THR A N     1 
ATOM   1864 C  CA    . THR E 3 123 ? 25.140  -40.706 -31.969 1.00 21.53 ? 123 THR A CA    1 
ATOM   1865 C  C     . THR E 3 123 ? 23.638  -40.412 -31.945 1.00 21.70 ? 123 THR A C     1 
ATOM   1866 O  O     . THR E 3 123 ? 23.040  -40.124 -32.978 1.00 22.31 ? 123 THR A O     1 
ATOM   1867 C  CB    . THR E 3 123 ? 25.362  -42.217 -31.784 1.00 20.17 ? 123 THR A CB    1 
ATOM   1868 O  OG1   . THR E 3 123 ? 26.757  -42.463 -31.584 1.00 18.91 ? 123 THR A OG1   1 
ATOM   1869 C  CG2   . THR E 3 123 ? 24.902  -42.989 -33.020 1.00 18.75 ? 123 THR A CG2   1 
ATOM   1870 N  N     . HIS E 3 124 ? 23.042  -40.476 -30.759 1.00 21.00 ? 124 HIS A N     1 
ATOM   1871 C  CA    . HIS E 3 124 ? 21.621  -40.203 -30.591 1.00 21.67 ? 124 HIS A CA    1 
ATOM   1872 C  C     . HIS E 3 124 ? 21.236  -38.862 -31.217 1.00 22.39 ? 124 HIS A C     1 
ATOM   1873 O  O     . HIS E 3 124 ? 20.219  -38.757 -31.912 1.00 22.67 ? 124 HIS A O     1 
ATOM   1874 C  CB    . HIS E 3 124 ? 21.272  -40.175 -29.103 1.00 21.97 ? 124 HIS A CB    1 
ATOM   1875 C  CG    . HIS E 3 124 ? 21.336  -41.514 -28.441 1.00 22.48 ? 124 HIS A CG    1 
ATOM   1876 N  ND1   . HIS E 3 124 ? 21.362  -41.665 -27.068 1.00 21.23 ? 124 HIS A ND1   1 
ATOM   1877 C  CD2   . HIS E 3 124 ? 21.341  -42.767 -28.954 1.00 22.12 ? 124 HIS A CD2   1 
ATOM   1878 C  CE1   . HIS E 3 124 ? 21.378  -42.948 -26.770 1.00 21.53 ? 124 HIS A CE1   1 
ATOM   1879 N  NE2   . HIS E 3 124 ? 21.365  -43.641 -27.896 1.00 21.68 ? 124 HIS A NE2   1 
ATOM   1880 N  N     . LEU E 3 125 ? 22.050  -37.839 -30.956 1.00 21.49 ? 125 LEU A N     1 
ATOM   1881 C  CA    . LEU E 3 125 ? 21.799  -36.492 -31.468 1.00 20.33 ? 125 LEU A CA    1 
ATOM   1882 C  C     . LEU E 3 125 ? 21.997  -36.446 -32.975 1.00 20.46 ? 125 LEU A C     1 
ATOM   1883 O  O     . LEU E 3 125 ? 21.165  -35.908 -33.703 1.00 21.53 ? 125 LEU A O     1 
ATOM   1884 C  CB    . LEU E 3 125 ? 22.751  -35.483 -30.820 1.00 18.86 ? 125 LEU A CB    1 
ATOM   1885 C  CG    . LEU E 3 125 ? 22.232  -34.176 -30.217 1.00 17.46 ? 125 LEU A CG    1 
ATOM   1886 C  CD1   . LEU E 3 125 ? 23.408  -33.214 -30.128 1.00 18.60 ? 125 LEU A CD1   1 
ATOM   1887 C  CD2   . LEU E 3 125 ? 21.132  -33.573 -31.046 1.00 16.41 ? 125 LEU A CD2   1 
ATOM   1888 N  N     . PHE E 3 126 ? 23.113  -36.994 -33.435 1.00 18.99 ? 126 PHE A N     1 
ATOM   1889 C  CA    . PHE E 3 126 ? 23.411  -37.009 -34.851 1.00 18.61 ? 126 PHE A CA    1 
ATOM   1890 C  C     . PHE E 3 126 ? 22.256  -37.651 -35.606 1.00 18.94 ? 126 PHE A C     1 
ATOM   1891 O  O     . PHE E 3 126 ? 21.817  -37.151 -36.638 1.00 18.68 ? 126 PHE A O     1 
ATOM   1892 C  CB    . PHE E 3 126 ? 24.702  -37.790 -35.100 1.00 19.23 ? 126 PHE A CB    1 
ATOM   1893 C  CG    . PHE E 3 126 ? 25.925  -37.137 -34.531 1.00 20.55 ? 126 PHE A CG    1 
ATOM   1894 C  CD1   . PHE E 3 126 ? 27.008  -37.902 -34.132 1.00 21.03 ? 126 PHE A CD1   1 
ATOM   1895 C  CD2   . PHE E 3 126 ? 26.004  -35.747 -34.406 1.00 21.21 ? 126 PHE A CD2   1 
ATOM   1896 C  CE1   . PHE E 3 126 ? 28.154  -37.297 -33.614 1.00 21.50 ? 126 PHE A CE1   1 
ATOM   1897 C  CE2   . PHE E 3 126 ? 27.146  -35.133 -33.891 1.00 20.11 ? 126 PHE A CE2   1 
ATOM   1898 C  CZ    . PHE E 3 126 ? 28.217  -35.906 -33.496 1.00 21.01 ? 126 PHE A CZ    1 
ATOM   1899 N  N     . THR E 3 127 ? 21.759  -38.760 -35.081 1.00 18.90 ? 127 THR A N     1 
ATOM   1900 C  CA    . THR E 3 127 ? 20.658  -39.457 -35.721 1.00 19.76 ? 127 THR A CA    1 
ATOM   1901 C  C     . THR E 3 127 ? 19.371  -38.634 -35.654 1.00 19.14 ? 127 THR A C     1 
ATOM   1902 O  O     . THR E 3 127 ? 18.539  -38.703 -36.553 1.00 18.10 ? 127 THR A O     1 
ATOM   1903 C  CB    . THR E 3 127 ? 20.455  -40.851 -35.080 1.00 21.08 ? 127 THR A CB    1 
ATOM   1904 O  OG1   . THR E 3 127 ? 21.586  -41.685 -35.392 1.00 23.25 ? 127 THR A OG1   1 
ATOM   1905 C  CG2   . THR E 3 127 ? 19.189  -41.508 -35.600 1.00 21.31 ? 127 THR A CG2   1 
ATOM   1906 N  N     . PHE E 3 128 ? 19.222  -37.845 -34.597 1.00 19.25 ? 128 PHE A N     1 
ATOM   1907 C  CA    . PHE E 3 128 ? 18.048  -37.001 -34.439 1.00 19.97 ? 128 PHE A CA    1 
ATOM   1908 C  C     . PHE E 3 128 ? 18.089  -35.863 -35.455 1.00 20.23 ? 128 PHE A C     1 
ATOM   1909 O  O     . PHE E 3 128 ? 17.109  -35.613 -36.155 1.00 20.29 ? 128 PHE A O     1 
ATOM   1910 C  CB    . PHE E 3 128 ? 17.988  -36.435 -33.016 1.00 19.84 ? 128 PHE A CB    1 
ATOM   1911 C  CG    . PHE E 3 128 ? 16.946  -35.363 -32.822 1.00 18.42 ? 128 PHE A CG    1 
ATOM   1912 C  CD1   . PHE E 3 128 ? 17.324  -34.032 -32.683 1.00 19.09 ? 128 PHE A CD1   1 
ATOM   1913 C  CD2   . PHE E 3 128 ? 15.595  -35.683 -32.761 1.00 16.82 ? 128 PHE A CD2   1 
ATOM   1914 C  CE1   . PHE E 3 128 ? 16.374  -33.031 -32.477 1.00 18.39 ? 128 PHE A CE1   1 
ATOM   1915 C  CE2   . PHE E 3 128 ? 14.636  -34.690 -32.556 1.00 17.98 ? 128 PHE A CE2   1 
ATOM   1916 C  CZ    . PHE E 3 128 ? 15.029  -33.361 -32.415 1.00 17.76 ? 128 PHE A CZ    1 
ATOM   1917 N  N     . ILE E 3 129 ? 19.233  -35.192 -35.537 1.00 20.63 ? 129 ILE A N     1 
ATOM   1918 C  CA    . ILE E 3 129 ? 19.419  -34.082 -36.458 1.00 20.67 ? 129 ILE A CA    1 
ATOM   1919 C  C     . ILE E 3 129 ? 19.270  -34.497 -37.916 1.00 20.23 ? 129 ILE A C     1 
ATOM   1920 O  O     . ILE E 3 129 ? 18.729  -33.755 -38.725 1.00 19.65 ? 129 ILE A O     1 
ATOM   1921 C  CB    . ILE E 3 129 ? 20.792  -33.427 -36.234 1.00 21.22 ? 129 ILE A CB    1 
ATOM   1922 C  CG1   . ILE E 3 129 ? 20.598  -32.128 -35.450 1.00 22.31 ? 129 ILE A CG1   1 
ATOM   1923 C  CG2   . ILE E 3 129 ? 21.497  -33.169 -37.557 1.00 21.53 ? 129 ILE A CG2   1 
ATOM   1924 C  CD1   . ILE E 3 129 ? 21.318  -32.110 -34.131 1.00 23.70 ? 129 ILE A CD1   1 
ATOM   1925 N  N     . GLN E 3 130 ? 19.763  -35.683 -38.246 1.00 21.38 ? 130 GLN A N     1 
ATOM   1926 C  CA    . GLN E 3 130 ? 19.669  -36.199 -39.604 1.00 20.84 ? 130 GLN A CA    1 
ATOM   1927 C  C     . GLN E 3 130 ? 18.222  -36.490 -39.964 1.00 21.07 ? 130 GLN A C     1 
ATOM   1928 O  O     . GLN E 3 130 ? 17.823  -36.338 -41.115 1.00 19.83 ? 130 GLN A O     1 
ATOM   1929 C  CB    . GLN E 3 130 ? 20.497  -37.475 -39.752 1.00 20.56 ? 130 GLN A CB    1 
ATOM   1930 C  CG    . GLN E 3 130 ? 20.254  -38.206 -41.059 1.00 22.69 ? 130 GLN A CG    1 
ATOM   1931 C  CD    . GLN E 3 130 ? 20.695  -37.417 -42.278 1.00 24.54 ? 130 GLN A CD    1 
ATOM   1932 O  OE1   . GLN E 3 130 ? 20.755  -36.190 -42.264 1.00 26.21 ? 130 GLN A OE1   1 
ATOM   1933 N  NE2   . GLN E 3 130 ? 20.990  -38.126 -43.347 1.00 26.27 ? 130 GLN A NE2   1 
ATOM   1934 N  N     . PHE E 3 131 ? 17.438  -36.919 -38.980 1.00 20.91 ? 131 PHE A N     1 
ATOM   1935 C  CA    . PHE E 3 131 ? 16.034  -37.217 -39.228 1.00 22.85 ? 131 PHE A CA    1 
ATOM   1936 C  C     . PHE E 3 131 ? 15.281  -35.924 -39.520 1.00 23.37 ? 131 PHE A C     1 
ATOM   1937 O  O     . PHE E 3 131 ? 14.408  -35.883 -40.386 1.00 21.95 ? 131 PHE A O     1 
ATOM   1938 C  CB    . PHE E 3 131 ? 15.415  -37.948 -38.024 1.00 22.83 ? 131 PHE A CB    1 
ATOM   1939 C  CG    . PHE E 3 131 ? 15.548  -39.458 -38.079 1.00 21.76 ? 131 PHE A CG    1 
ATOM   1940 C  CD1   . PHE E 3 131 ? 15.694  -40.198 -36.906 1.00 22.39 ? 131 PHE A CD1   1 
ATOM   1941 C  CD2   . PHE E 3 131 ? 15.510  -40.140 -39.296 1.00 22.14 ? 131 PHE A CD2   1 
ATOM   1942 C  CE1   . PHE E 3 131 ? 15.796  -41.590 -36.945 1.00 21.64 ? 131 PHE A CE1   1 
ATOM   1943 C  CE2   . PHE E 3 131 ? 15.610  -41.535 -39.344 1.00 21.69 ? 131 PHE A CE2   1 
ATOM   1944 C  CZ    . PHE E 3 131 ? 15.756  -42.261 -38.167 1.00 20.77 ? 131 PHE A CZ    1 
ATOM   1945 N  N     . LYS E 3 132 ? 15.629  -34.865 -38.795 1.00 25.19 ? 132 LYS A N     1 
ATOM   1946 C  CA    . LYS E 3 132 ? 14.999  -33.571 -39.006 1.00 26.73 ? 132 LYS A CA    1 
ATOM   1947 C  C     . LYS E 3 132 ? 15.276  -33.120 -40.439 1.00 28.57 ? 132 LYS A C     1 
ATOM   1948 O  O     . LYS E 3 132 ? 14.451  -32.449 -41.063 1.00 27.90 ? 132 LYS A O     1 
ATOM   1949 C  CB    . LYS E 3 132 ? 15.536  -32.535 -38.018 1.00 25.13 ? 132 LYS A CB    1 
ATOM   1950 C  CG    . LYS E 3 132 ? 15.076  -32.745 -36.596 1.00 25.86 ? 132 LYS A CG    1 
ATOM   1951 C  CD    . LYS E 3 132 ? 15.276  -31.493 -35.731 1.00 27.69 ? 132 LYS A CD    1 
ATOM   1952 C  CE    . LYS E 3 132 ? 14.495  -30.293 -36.277 1.00 30.69 ? 132 LYS A CE    1 
ATOM   1953 N  NZ    . LYS E 3 132 ? 13.086  -30.616 -36.694 1.00 31.98 ? 132 LYS A NZ    1 
ATOM   1954 N  N     . LYS E 3 133 ? 16.438  -33.504 -40.961 1.00 31.03 ? 133 LYS A N     1 
ATOM   1955 C  CA    . LYS E 3 133 ? 16.821  -33.147 -42.321 1.00 33.85 ? 133 LYS A CA    1 
ATOM   1956 C  C     . LYS E 3 133 ? 15.998  -33.941 -43.339 1.00 34.66 ? 133 LYS A C     1 
ATOM   1957 O  O     . LYS E 3 133 ? 15.490  -33.382 -44.310 1.00 35.47 ? 133 LYS A O     1 
ATOM   1958 C  CB    . LYS E 3 133 ? 18.313  -33.405 -42.522 1.00 35.30 ? 133 LYS A CB    1 
ATOM   1959 C  CG    . LYS E 3 133 ? 18.900  -32.819 -43.799 1.00 37.28 ? 133 LYS A CG    1 
ATOM   1960 C  CD    . LYS E 3 133 ? 20.405  -33.064 -43.848 1.00 39.84 ? 133 LYS A CD    1 
ATOM   1961 C  CE    . LYS E 3 133 ? 21.030  -32.525 -45.120 1.00 39.87 ? 133 LYS A CE    1 
ATOM   1962 N  NZ    . LYS E 3 133 ? 22.142  -33.408 -45.564 1.00 41.71 ? 133 LYS A NZ    1 
ATOM   1963 N  N     . ASP E 3 134 ? 15.860  -35.244 -43.115 1.00 35.66 ? 134 ASP A N     1 
ATOM   1964 C  CA    . ASP E 3 134 ? 15.079  -36.085 -44.021 1.00 37.19 ? 134 ASP A CA    1 
ATOM   1965 C  C     . ASP E 3 134 ? 13.640  -35.561 -44.059 1.00 37.59 ? 134 ASP A C     1 
ATOM   1966 O  O     . ASP E 3 134 ? 12.932  -35.721 -45.056 1.00 37.54 ? 134 ASP A O     1 
ATOM   1967 C  CB    . ASP E 3 134 ? 15.093  -37.552 -43.559 1.00 38.34 ? 134 ASP A CB    1 
ATOM   1968 C  CG    . ASP E 3 134 ? 16.499  -38.159 -43.556 1.00 39.98 ? 134 ASP A CG    1 
ATOM   1969 O  OD1   . ASP E 3 134 ? 17.214  -38.036 -44.576 1.00 41.19 ? 134 ASP A OD1   1 
ATOM   1970 O  OD2   . ASP E 3 134 ? 16.891  -38.767 -42.533 1.00 39.91 ? 134 ASP A OD2   1 
ATOM   1971 N  N     . LEU E 3 135 ? 13.219  -34.928 -42.970 1.00 37.95 ? 135 LEU A N     1 
ATOM   1972 C  CA    . LEU E 3 135 ? 11.882  -34.367 -42.886 1.00 38.09 ? 135 LEU A CA    1 
ATOM   1973 C  C     . LEU E 3 135 ? 11.920  -32.934 -43.415 1.00 39.17 ? 135 LEU A C     1 
ATOM   1974 O  O     . LEU E 3 135 ? 10.913  -32.424 -43.923 1.00 41.49 ? 135 LEU A O     1 
ATOM   1975 C  CB    . LEU E 3 135 ? 11.387  -34.369 -41.432 1.00 36.25 ? 135 LEU A CB    1 
ATOM   1976 C  CG    . LEU E 3 135 ? 11.217  -35.738 -40.763 1.00 35.10 ? 135 LEU A CG    1 
ATOM   1977 C  CD1   . LEU E 3 135 ? 10.904  -35.568 -39.280 1.00 34.35 ? 135 LEU A CD1   1 
ATOM   1978 C  CD2   . LEU E 3 135 ? 10.123  -36.512 -41.457 1.00 31.76 ? 135 LEU A CD2   1 
ATOM   1979 N  N     . TRP E 3 144 ? 19.079  -23.519 -39.813 1.00 37.21 ? 144 TRP A N     1 
ATOM   1980 C  CA    . TRP E 3 144 ? 18.523  -24.069 -38.578 1.00 38.04 ? 144 TRP A CA    1 
ATOM   1981 C  C     . TRP E 3 144 ? 17.529  -23.114 -37.944 1.00 38.53 ? 144 TRP A C     1 
ATOM   1982 O  O     . TRP E 3 144 ? 17.121  -22.138 -38.619 1.00 41.93 ? 144 TRP A O     1 
ATOM   1983 C  CB    . TRP E 3 144 ? 19.648  -24.436 -37.607 1.00 38.08 ? 144 TRP A CB    1 
ATOM   1984 C  CG    . TRP E 3 144 ? 20.311  -25.755 -37.984 1.00 37.05 ? 144 TRP A CG    1 
ATOM   1985 C  CD1   . TRP E 3 144 ? 20.377  -26.314 -39.235 1.00 36.04 ? 144 TRP A CD1   1 
ATOM   1986 C  CD2   . TRP E 3 144 ? 20.977  -26.671 -37.104 1.00 35.86 ? 144 TRP A CD2   1 
ATOM   1987 N  NE1   . TRP E 3 144 ? 21.039  -27.517 -39.182 1.00 35.67 ? 144 TRP A NE1   1 
ATOM   1988 C  CE2   . TRP E 3 144 ? 21.423  -27.757 -37.889 1.00 35.21 ? 144 TRP A CE2   1 
ATOM   1989 C  CE3   . TRP E 3 144 ? 21.250  -26.673 -35.731 1.00 35.63 ? 144 TRP A CE3   1 
ATOM   1990 C  CZ2   . TRP E 3 144 ? 22.113  -28.840 -37.347 1.00 34.70 ? 144 TRP A CZ2   1 
ATOM   1991 C  CZ3   . TRP E 3 144 ? 21.943  -27.758 -35.189 1.00 35.54 ? 144 TRP A CZ3   1 
ATOM   1992 C  CH2   . TRP E 3 144 ? 22.368  -28.822 -36.001 1.00 35.28 ? 144 TRP A CH2   1 
ATOM   1993 N  N     . GLY E 3 145 ? 17.122  -23.358 -36.692 1.00 37.64 ? 145 GLY A N     1 
ATOM   1994 C  CA    . GLY E 3 145 ? 16.135  -22.468 -36.102 1.00 36.09 ? 145 GLY A CA    1 
ATOM   1995 C  C     . GLY E 3 145 ? 16.251  -22.269 -34.604 1.00 34.87 ? 145 GLY A C     1 
ATOM   1996 O  O     . GLY E 3 145 ? 17.010  -22.962 -33.928 1.00 34.70 ? 145 GLY A O     1 
ATOM   1997 N  N     . ARG E 3 146 ? 15.490  -21.314 -34.076 1.00 33.31 ? 146 ARG A N     1 
ATOM   1998 C  CA    . ARG E 3 146 ? 15.506  -21.022 -32.644 1.00 32.56 ? 146 ARG A CA    1 
ATOM   1999 C  C     . ARG E 3 146 ? 15.542  -22.330 -31.849 1.00 31.04 ? 146 ARG A C     1 
ATOM   2000 O  O     . ARG E 3 146 ? 16.576  -22.713 -31.307 1.00 30.12 ? 146 ARG A O     1 
ATOM   2001 C  CB    . ARG E 3 146 ? 14.264  -20.212 -32.243 1.00 34.27 ? 146 ARG A CB    1 
ATOM   2002 C  CG    . ARG E 3 146 ? 14.344  -19.524 -30.891 1.00 36.86 ? 146 ARG A CG    1 
ATOM   2003 C  CD    . ARG E 3 146 ? 15.189  -18.356 -31.155 1.00 39.59 ? 146 ARG A CD    1 
ATOM   2004 N  NE    . ARG E 3 146 ? 16.485  -18.405 -30.489 1.00 43.38 ? 146 ARG A NE    1 
ATOM   2005 C  CZ    . ARG E 3 146 ? 17.425  -19.327 -30.276 1.00 43.76 ? 146 ARG A CZ    1 
ATOM   2006 N  NH1   . ARG E 3 146 ? 17.500  -20.605 -30.674 1.00 44.57 ? 146 ARG A NH1   1 
ATOM   2007 N  NH2   . ARG E 3 146 ? 18.311  -18.905 -29.418 1.00 45.33 ? 146 ARG A NH2   1 
ATOM   2008 N  N     . ALA E 3 147 ? 14.419  -23.038 -31.824 1.00 30.04 ? 147 ALA A N     1 
ATOM   2009 C  CA    . ALA E 3 147 ? 14.322  -24.295 -31.092 1.00 28.41 ? 147 ALA A CA    1 
ATOM   2010 C  C     . ALA E 3 147 ? 15.496  -25.243 -31.335 1.00 28.20 ? 147 ALA A C     1 
ATOM   2011 O  O     . ALA E 3 147 ? 16.127  -25.712 -30.387 1.00 27.55 ? 147 ALA A O     1 
ATOM   2012 C  CB    . ALA E 3 147 ? 13.020  -24.981 -31.423 1.00 27.32 ? 147 ALA A CB    1 
ATOM   2013 N  N     . LEU E 3 148 ? 15.798  -25.521 -32.596 1.00 27.99 ? 148 LEU A N     1 
ATOM   2014 C  CA    . LEU E 3 148 ? 16.904  -26.418 -32.894 1.00 29.18 ? 148 LEU A CA    1 
ATOM   2015 C  C     . LEU E 3 148 ? 18.229  -25.918 -32.300 1.00 29.48 ? 148 LEU A C     1 
ATOM   2016 O  O     . LEU E 3 148 ? 18.861  -26.606 -31.496 1.00 29.34 ? 148 LEU A O     1 
ATOM   2017 C  CB    . LEU E 3 148 ? 17.061  -26.597 -34.408 1.00 28.00 ? 148 LEU A CB    1 
ATOM   2018 C  CG    . LEU E 3 148 ? 17.156  -28.037 -34.915 1.00 28.00 ? 148 LEU A CG    1 
ATOM   2019 C  CD1   . LEU E 3 148 ? 17.911  -28.024 -36.220 1.00 28.92 ? 148 LEU A CD1   1 
ATOM   2020 C  CD2   . LEU E 3 148 ? 17.876  -28.935 -33.910 1.00 28.28 ? 148 LEU A CD2   1 
ATOM   2021 N  N     . ARG E 3 149 ? 18.642  -24.719 -32.703 1.00 30.17 ? 149 ARG A N     1 
ATOM   2022 C  CA    . ARG E 3 149 ? 19.891  -24.129 -32.235 1.00 30.87 ? 149 ARG A CA    1 
ATOM   2023 C  C     . ARG E 3 149 ? 19.996  -24.136 -30.718 1.00 30.61 ? 149 ARG A C     1 
ATOM   2024 O  O     . ARG E 3 149 ? 21.069  -24.397 -30.164 1.00 29.69 ? 149 ARG A O     1 
ATOM   2025 C  CB    . ARG E 3 149 ? 20.033  -22.689 -32.738 1.00 33.31 ? 149 ARG A CB    1 
ATOM   2026 C  CG    . ARG E 3 149 ? 20.140  -22.510 -34.245 1.00 35.57 ? 149 ARG A CG    1 
ATOM   2027 C  CD    . ARG E 3 149 ? 20.984  -21.303 -34.526 1.00 38.75 ? 149 ARG A CD    1 
ATOM   2028 N  NE    . ARG E 3 149 ? 20.529  -20.396 -35.535 1.00 42.01 ? 149 ARG A NE    1 
ATOM   2029 C  CZ    . ARG E 3 149 ? 21.186  -19.648 -36.414 1.00 41.61 ? 149 ARG A CZ    1 
ATOM   2030 N  NH1   . ARG E 3 149 ? 20.418  -18.900 -37.185 1.00 43.49 ? 149 ARG A NH1   1 
ATOM   2031 N  NH2   . ARG E 3 149 ? 22.493  -19.641 -36.577 1.00 41.19 ? 149 ARG A NH2   1 
ATOM   2032 N  N     . LYS E 3 150 ? 18.877  -23.847 -30.058 1.00 29.99 ? 150 LYS A N     1 
ATOM   2033 C  CA    . LYS E 3 150 ? 18.818  -23.829 -28.604 1.00 29.84 ? 150 LYS A CA    1 
ATOM   2034 C  C     . LYS E 3 150 ? 19.017  -25.245 -28.044 1.00 29.73 ? 150 LYS A C     1 
ATOM   2035 O  O     . LYS E 3 150 ? 19.850  -25.464 -27.164 1.00 29.91 ? 150 LYS A O     1 
ATOM   2036 C  CB    . LYS E 3 150 ? 17.469  -23.278 -28.138 1.00 30.96 ? 150 LYS A CB    1 
ATOM   2037 C  CG    . LYS E 3 150 ? 17.403  -23.038 -26.642 1.00 33.38 ? 150 LYS A CG    1 
ATOM   2038 C  CD    . LYS E 3 150 ? 15.976  -22.929 -26.140 1.00 35.10 ? 150 LYS A CD    1 
ATOM   2039 C  CE    . LYS E 3 150 ? 15.972  -22.524 -24.678 1.00 35.55 ? 150 LYS A CE    1 
ATOM   2040 N  NZ    . LYS E 3 150 ? 16.894  -23.397 -23.910 1.00 37.24 ? 150 LYS A NZ    1 
ATOM   2041 N  N     . ALA E 3 151 ? 18.252  -26.204 -28.557 1.00 28.71 ? 151 ALA A N     1 
ATOM   2042 C  CA    . ALA E 3 151 ? 18.362  -27.588 -28.102 1.00 27.66 ? 151 ALA A CA    1 
ATOM   2043 C  C     . ALA E 3 151 ? 19.787  -28.141 -28.250 1.00 27.11 ? 151 ALA A C     1 
ATOM   2044 O  O     . ALA E 3 151 ? 20.313  -28.768 -27.328 1.00 27.09 ? 151 ALA A O     1 
ATOM   2045 C  CB    . ALA E 3 151 ? 17.359  -28.480 -28.861 1.00 25.92 ? 151 ALA A CB    1 
ATOM   2046 N  N     . VAL E 3 152 ? 20.412  -27.918 -29.401 1.00 26.16 ? 152 VAL A N     1 
ATOM   2047 C  CA    . VAL E 3 152 ? 21.762  -28.413 -29.609 1.00 26.66 ? 152 VAL A CA    1 
ATOM   2048 C  C     . VAL E 3 152 ? 22.745  -27.754 -28.652 1.00 27.20 ? 152 VAL A C     1 
ATOM   2049 O  O     . VAL E 3 152 ? 23.603  -28.423 -28.087 1.00 27.39 ? 152 VAL A O     1 
ATOM   2050 C  CB    . VAL E 3 152 ? 22.223  -28.190 -31.066 1.00 26.40 ? 152 VAL A CB    1 
ATOM   2051 C  CG1   . VAL E 3 152 ? 23.699  -28.499 -31.209 1.00 27.13 ? 152 VAL A CG1   1 
ATOM   2052 C  CG2   . VAL E 3 152 ? 21.439  -29.095 -31.989 1.00 26.06 ? 152 VAL A CG2   1 
ATOM   2053 N  N     . SER E 3 153 ? 22.615  -26.445 -28.465 1.00 28.67 ? 153 SER A N     1 
ATOM   2054 C  CA    . SER E 3 153 ? 23.501  -25.708 -27.565 1.00 29.93 ? 153 SER A CA    1 
ATOM   2055 C  C     . SER E 3 153 ? 23.387  -26.203 -26.142 1.00 30.38 ? 153 SER A C     1 
ATOM   2056 O  O     . SER E 3 153 ? 24.397  -26.421 -25.472 1.00 31.44 ? 153 SER A O     1 
ATOM   2057 C  CB    . SER E 3 153 ? 23.170  -24.230 -27.596 1.00 30.39 ? 153 SER A CB    1 
ATOM   2058 O  OG    . SER E 3 153 ? 23.299  -23.738 -28.906 1.00 35.27 ? 153 SER A OG    1 
ATOM   2059 N  N     . ASP E 3 154 ? 22.149  -26.354 -25.680 1.00 30.61 ? 154 ASP A N     1 
ATOM   2060 C  CA    . ASP E 3 154 ? 21.884  -26.856 -24.340 1.00 32.02 ? 154 ASP A CA    1 
ATOM   2061 C  C     . ASP E 3 154 ? 22.511  -28.224 -24.139 1.00 31.12 ? 154 ASP A C     1 
ATOM   2062 O  O     . ASP E 3 154 ? 22.947  -28.563 -23.039 1.00 31.30 ? 154 ASP A O     1 
ATOM   2063 C  CB    . ASP E 3 154 ? 20.381  -26.936 -24.100 1.00 34.72 ? 154 ASP A CB    1 
ATOM   2064 C  CG    . ASP E 3 154 ? 19.768  -25.570 -23.886 1.00 37.36 ? 154 ASP A CG    1 
ATOM   2065 O  OD1   . ASP E 3 154 ? 19.344  -25.270 -22.750 1.00 39.09 ? 154 ASP A OD1   1 
ATOM   2066 O  OD2   . ASP E 3 154 ? 19.699  -24.746 -24.828 1.00 40.69 ? 154 ASP A OD2   1 
ATOM   2067 N  N     . TRP E 3 155 ? 22.550  -29.014 -25.207 1.00 29.06 ? 155 TRP A N     1 
ATOM   2068 C  CA    . TRP E 3 155 ? 23.118  -30.352 -25.130 1.00 28.25 ? 155 TRP A CA    1 
ATOM   2069 C  C     . TRP E 3 155 ? 24.578  -30.285 -24.722 1.00 28.22 ? 155 TRP A C     1 
ATOM   2070 O  O     . TRP E 3 155 ? 25.046  -31.114 -23.951 1.00 28.55 ? 155 TRP A O     1 
ATOM   2071 C  CB    . TRP E 3 155 ? 23.013  -31.087 -26.465 1.00 27.18 ? 155 TRP A CB    1 
ATOM   2072 C  CG    . TRP E 3 155 ? 23.282  -32.568 -26.336 1.00 27.02 ? 155 TRP A CG    1 
ATOM   2073 C  CD1   . TRP E 3 155 ? 22.366  -33.552 -26.070 1.00 27.18 ? 155 TRP A CD1   1 
ATOM   2074 C  CD2   . TRP E 3 155 ? 24.546  -33.231 -26.476 1.00 26.11 ? 155 TRP A CD2   1 
ATOM   2075 N  NE1   . TRP E 3 155 ? 22.982  -34.781 -26.041 1.00 25.15 ? 155 TRP A NE1   1 
ATOM   2076 C  CE2   . TRP E 3 155 ? 24.318  -34.613 -26.284 1.00 25.32 ? 155 TRP A CE2   1 
ATOM   2077 C  CE3   . TRP E 3 155 ? 25.852  -32.788 -26.739 1.00 25.83 ? 155 TRP A CE3   1 
ATOM   2078 C  CZ2   . TRP E 3 155 ? 25.342  -35.559 -26.360 1.00 25.13 ? 155 TRP A CZ2   1 
ATOM   2079 C  CZ3   . TRP E 3 155 ? 26.873  -33.732 -26.813 1.00 25.14 ? 155 TRP A CZ3   1 
ATOM   2080 C  CH2   . TRP E 3 155 ? 26.610  -35.103 -26.621 1.00 24.77 ? 155 TRP A CH2   1 
ATOM   2081 N  N     . TYR E 3 156 ? 25.297  -29.293 -25.227 1.00 27.41 ? 156 TYR A N     1 
ATOM   2082 C  CA    . TYR E 3 156 ? 26.702  -29.159 -24.886 1.00 27.47 ? 156 TYR A CA    1 
ATOM   2083 C  C     . TYR E 3 156 ? 26.989  -28.347 -23.622 1.00 29.01 ? 156 TYR A C     1 
ATOM   2084 O  O     . TYR E 3 156 ? 27.737  -28.785 -22.758 1.00 28.34 ? 156 TYR A O     1 
ATOM   2085 C  CB    . TYR E 3 156 ? 27.475  -28.520 -26.034 1.00 24.87 ? 156 TYR A CB    1 
ATOM   2086 C  CG    . TYR E 3 156 ? 27.585  -29.351 -27.279 1.00 24.11 ? 156 TYR A CG    1 
ATOM   2087 C  CD1   . TYR E 3 156 ? 26.579  -29.335 -28.243 1.00 23.81 ? 156 TYR A CD1   1 
ATOM   2088 C  CD2   . TYR E 3 156 ? 28.730  -30.105 -27.529 1.00 24.16 ? 156 TYR A CD2   1 
ATOM   2089 C  CE1   . TYR E 3 156 ? 26.717  -30.032 -29.432 1.00 22.33 ? 156 TYR A CE1   1 
ATOM   2090 C  CE2   . TYR E 3 156 ? 28.877  -30.812 -28.715 1.00 23.30 ? 156 TYR A CE2   1 
ATOM   2091 C  CZ    . TYR E 3 156 ? 27.868  -30.766 -29.664 1.00 23.16 ? 156 TYR A CZ    1 
ATOM   2092 O  OH    . TYR E 3 156 ? 28.029  -31.421 -30.863 1.00 24.03 ? 156 TYR A OH    1 
ATOM   2093 N  N     . ASN E 3 157 ? 26.406  -27.158 -23.518 1.00 30.89 ? 157 ASN A N     1 
ATOM   2094 C  CA    . ASN E 3 157 ? 26.688  -26.295 -22.381 1.00 31.98 ? 157 ASN A CA    1 
ATOM   2095 C  C     . ASN E 3 157 ? 26.212  -26.791 -21.031 1.00 32.41 ? 157 ASN A C     1 
ATOM   2096 O  O     . ASN E 3 157 ? 26.693  -26.309 -20.005 1.00 33.74 ? 157 ASN A O     1 
ATOM   2097 C  CB    . ASN E 3 157 ? 26.151  -24.878 -22.631 1.00 33.06 ? 157 ASN A CB    1 
ATOM   2098 C  CG    . ASN E 3 157 ? 26.958  -24.115 -23.676 1.00 34.04 ? 157 ASN A CG    1 
ATOM   2099 O  OD1   . ASN E 3 157 ? 27.106  -22.945 -23.613 1.00 37.27 ? 157 ASN A OD1   1 
ATOM   2100 N  ND2   . ASN E 3 157 ? 27.448  -24.797 -24.615 1.00 35.82 ? 157 ASN A ND2   1 
ATOM   2101 N  N     . THR E 3 158 ? 25.285  -27.744 -21.005 1.00 32.68 ? 158 THR A N     1 
ATOM   2102 C  CA    . THR E 3 158 ? 24.803  -28.248 -19.727 1.00 32.44 ? 158 THR A CA    1 
ATOM   2103 C  C     . THR E 3 158 ? 25.681  -29.390 -19.262 1.00 32.37 ? 158 THR A C     1 
ATOM   2104 O  O     . THR E 3 158 ? 25.541  -29.881 -18.141 1.00 32.07 ? 158 THR A O     1 
ATOM   2105 C  CB    . THR E 3 158 ? 23.341  -28.741 -19.812 1.00 32.66 ? 158 THR A CB    1 
ATOM   2106 O  OG1   . THR E 3 158 ? 23.252  -29.841 -20.723 1.00 30.85 ? 158 THR A OG1   1 
ATOM   2107 C  CG2   . THR E 3 158 ? 22.428  -27.616 -20.278 1.00 32.83 ? 158 THR A CG2   1 
ATOM   2108 N  N     . LYS E 3 159 ? 26.583  -29.821 -20.132 1.00 32.85 ? 159 LYS A N     1 
ATOM   2109 C  CA    . LYS E 3 159 ? 27.487  -30.906 -19.785 1.00 34.98 ? 159 LYS A CA    1 
ATOM   2110 C  C     . LYS E 3 159 ? 28.639  -30.371 -18.968 1.00 34.92 ? 159 LYS A C     1 
ATOM   2111 O  O     . LYS E 3 159 ? 28.750  -29.173 -18.736 1.00 36.47 ? 159 LYS A O     1 
ATOM   2112 C  CB    . LYS E 3 159 ? 28.070  -31.574 -21.035 1.00 35.21 ? 159 LYS A CB    1 
ATOM   2113 C  CG    . LYS E 3 159 ? 27.494  -32.918 -21.390 1.00 34.89 ? 159 LYS A CG    1 
ATOM   2114 C  CD    . LYS E 3 159 ? 26.584  -32.774 -22.566 1.00 36.97 ? 159 LYS A CD    1 
ATOM   2115 C  CE    . LYS E 3 159 ? 25.903  -34.075 -22.927 1.00 36.21 ? 159 LYS A CE    1 
ATOM   2116 N  NZ    . LYS E 3 159 ? 26.842  -35.076 -23.466 1.00 37.19 ? 159 LYS A NZ    1 
ATOM   2117 N  N     . ASP E 3 160 ? 29.512  -31.282 -18.568 1.00 34.77 ? 160 ASP A N     1 
ATOM   2118 C  CA    . ASP E 3 160 ? 30.687  -30.947 -17.782 1.00 35.17 ? 160 ASP A CA    1 
ATOM   2119 C  C     . ASP E 3 160 ? 31.870  -31.072 -18.751 1.00 33.59 ? 160 ASP A C     1 
ATOM   2120 O  O     . ASP E 3 160 ? 32.038  -32.100 -19.405 1.00 33.38 ? 160 ASP A O     1 
ATOM   2121 C  CB    . ASP E 3 160 ? 30.783  -31.933 -16.622 1.00 38.45 ? 160 ASP A CB    1 
ATOM   2122 C  CG    . ASP E 3 160 ? 29.475  -32.669 -16.403 1.00 42.03 ? 160 ASP A CG    1 
ATOM   2123 O  OD1   . ASP E 3 160 ? 28.405  -32.005 -16.409 1.00 43.59 ? 160 ASP A OD1   1 
ATOM   2124 O  OD2   . ASP E 3 160 ? 29.493  -33.913 -16.223 1.00 43.87 ? 160 ASP A OD2   1 
ATOM   2125 N  N     . ALA E 3 161 ? 32.659  -30.010 -18.868 1.00 31.32 ? 161 ALA A N     1 
ATOM   2126 C  CA    . ALA E 3 161 ? 33.798  -29.993 -19.769 1.00 30.59 ? 161 ALA A CA    1 
ATOM   2127 C  C     . ALA E 3 161 ? 34.473  -31.348 -19.893 1.00 30.75 ? 161 ALA A C     1 
ATOM   2128 O  O     . ALA E 3 161 ? 34.610  -31.874 -20.994 1.00 31.88 ? 161 ALA A O     1 
ATOM   2129 C  CB    . ALA E 3 161 ? 34.808  -28.946 -19.316 1.00 30.48 ? 161 ALA A CB    1 
ATOM   2130 N  N     . LEU E 3 162 ? 34.885  -31.920 -18.767 1.00 30.26 ? 162 LEU A N     1 
ATOM   2131 C  CA    . LEU E 3 162 ? 35.562  -33.210 -18.783 1.00 30.38 ? 162 LEU A CA    1 
ATOM   2132 C  C     . LEU E 3 162 ? 34.742  -34.333 -19.397 1.00 30.70 ? 162 LEU A C     1 
ATOM   2133 O  O     . LEU E 3 162 ? 35.291  -35.240 -20.018 1.00 31.90 ? 162 LEU A O     1 
ATOM   2134 C  CB    . LEU E 3 162 ? 35.981  -33.611 -17.372 1.00 30.42 ? 162 LEU A CB    1 
ATOM   2135 C  CG    . LEU E 3 162 ? 36.866  -34.856 -17.331 1.00 28.63 ? 162 LEU A CG    1 
ATOM   2136 C  CD1   . LEU E 3 162 ? 38.146  -34.609 -18.114 1.00 26.98 ? 162 LEU A CD1   1 
ATOM   2137 C  CD2   . LEU E 3 162 ? 37.172  -35.199 -15.891 1.00 28.91 ? 162 LEU A CD2   1 
ATOM   2138 N  N     . ASN E 3 163 ? 33.430  -34.291 -19.213 1.00 31.05 ? 163 ASN A N     1 
ATOM   2139 C  CA    . ASN E 3 163 ? 32.574  -35.315 -19.785 1.00 31.10 ? 163 ASN A CA    1 
ATOM   2140 C  C     . ASN E 3 163 ? 32.421  -35.106 -21.283 1.00 31.74 ? 163 ASN A C     1 
ATOM   2141 O  O     . ASN E 3 163 ? 32.515  -36.059 -22.062 1.00 32.20 ? 163 ASN A O     1 
ATOM   2142 C  CB    . ASN E 3 163 ? 31.197  -35.283 -19.141 1.00 32.54 ? 163 ASN A CB    1 
ATOM   2143 C  CG    . ASN E 3 163 ? 31.142  -36.061 -17.857 1.00 34.88 ? 163 ASN A CG    1 
ATOM   2144 O  OD1   . ASN E 3 163 ? 31.648  -35.623 -16.818 1.00 35.87 ? 163 ASN A OD1   1 
ATOM   2145 N  ND2   . ASN E 3 163 ? 30.527  -37.238 -17.917 1.00 36.38 ? 163 ASN A ND2   1 
ATOM   2146 N  N     . LEU E 3 164 ? 32.178  -33.856 -21.674 1.00 30.46 ? 164 LEU A N     1 
ATOM   2147 C  CA    . LEU E 3 164 ? 31.999  -33.513 -23.076 1.00 29.44 ? 164 LEU A CA    1 
ATOM   2148 C  C     . LEU E 3 164 ? 33.239  -33.927 -23.850 1.00 28.82 ? 164 LEU A C     1 
ATOM   2149 O  O     . LEU E 3 164 ? 33.141  -34.428 -24.974 1.00 29.15 ? 164 LEU A O     1 
ATOM   2150 C  CB    . LEU E 3 164 ? 31.746  -32.008 -23.227 1.00 28.41 ? 164 LEU A CB    1 
ATOM   2151 C  CG    . LEU E 3 164 ? 30.805  -31.517 -24.336 1.00 28.03 ? 164 LEU A CG    1 
ATOM   2152 C  CD1   . LEU E 3 164 ? 31.576  -30.731 -25.354 1.00 28.26 ? 164 LEU A CD1   1 
ATOM   2153 C  CD2   . LEU E 3 164 ? 30.086  -32.677 -24.979 1.00 26.67 ? 164 LEU A CD2   1 
ATOM   2154 N  N     . ALA E 3 165 ? 34.401  -33.737 -23.231 1.00 27.27 ? 165 ALA A N     1 
ATOM   2155 C  CA    . ALA E 3 165 ? 35.669  -34.096 -23.855 1.00 26.98 ? 165 ALA A CA    1 
ATOM   2156 C  C     . ALA E 3 165 ? 35.682  -35.570 -24.268 1.00 27.20 ? 165 ALA A C     1 
ATOM   2157 O  O     . ALA E 3 165 ? 36.086  -35.911 -25.380 1.00 24.99 ? 165 ALA A O     1 
ATOM   2158 C  CB    . ALA E 3 165 ? 36.822  -33.806 -22.899 1.00 24.69 ? 165 ALA A CB    1 
ATOM   2159 N  N     . MET E 3 166 ? 35.239  -36.440 -23.367 1.00 29.33 ? 166 MET A N     1 
ATOM   2160 C  CA    . MET E 3 166 ? 35.199  -37.872 -23.656 1.00 31.07 ? 166 MET A CA    1 
ATOM   2161 C  C     . MET E 3 166 ? 34.191  -38.104 -24.774 1.00 29.78 ? 166 MET A C     1 
ATOM   2162 O  O     . MET E 3 166 ? 34.504  -38.721 -25.791 1.00 29.09 ? 166 MET A O     1 
ATOM   2163 C  CB    . MET E 3 166 ? 34.795  -38.662 -22.403 1.00 33.77 ? 166 MET A CB    1 
ATOM   2164 C  CG    . MET E 3 166 ? 35.281  -38.014 -21.102 1.00 39.13 ? 166 MET A CG    1 
ATOM   2165 S  SD    . MET E 3 166 ? 35.316  -39.099 -19.634 1.00 44.55 ? 166 MET A SD    1 
ATOM   2166 C  CE    . MET E 3 166 ? 33.541  -39.410 -19.356 1.00 43.05 ? 166 MET A CE    1 
ATOM   2167 N  N     . ALA E 3 167 ? 32.987  -37.574 -24.587 1.00 29.32 ? 167 ALA A N     1 
ATOM   2168 C  CA    . ALA E 3 167 ? 31.927  -37.725 -25.570 1.00 29.14 ? 167 ALA A CA    1 
ATOM   2169 C  C     . ALA E 3 167 ? 32.390  -37.348 -26.975 1.00 29.28 ? 167 ALA A C     1 
ATOM   2170 O  O     . ALA E 3 167 ? 32.181  -38.106 -27.923 1.00 30.27 ? 167 ALA A O     1 
ATOM   2171 C  CB    . ALA E 3 167 ? 30.729  -36.890 -25.174 1.00 27.73 ? 167 ALA A CB    1 
ATOM   2172 N  N     . VAL E 3 168 ? 33.033  -36.192 -27.114 1.00 28.58 ? 168 VAL A N     1 
ATOM   2173 C  CA    . VAL E 3 168 ? 33.486  -35.755 -28.434 1.00 29.04 ? 168 VAL A CA    1 
ATOM   2174 C  C     . VAL E 3 168 ? 34.707  -36.491 -28.987 1.00 29.01 ? 168 VAL A C     1 
ATOM   2175 O  O     . VAL E 3 168 ? 34.978  -36.426 -30.190 1.00 30.28 ? 168 VAL A O     1 
ATOM   2176 C  CB    . VAL E 3 168 ? 33.766  -34.235 -28.465 1.00 28.81 ? 168 VAL A CB    1 
ATOM   2177 C  CG1   . VAL E 3 168 ? 32.496  -33.477 -28.124 1.00 28.49 ? 168 VAL A CG1   1 
ATOM   2178 C  CG2   . VAL E 3 168 ? 34.900  -33.886 -27.502 1.00 28.90 ? 168 VAL A CG2   1 
ATOM   2179 N  N     . THR E 3 169 ? 35.442  -37.187 -28.129 1.00 27.51 ? 169 THR A N     1 
ATOM   2180 C  CA    . THR E 3 169 ? 36.604  -37.927 -28.598 1.00 27.68 ? 169 THR A CA    1 
ATOM   2181 C  C     . THR E 3 169 ? 36.240  -39.402 -28.813 1.00 27.01 ? 169 THR A C     1 
ATOM   2182 O  O     . THR E 3 169 ? 36.852  -40.111 -29.612 1.00 26.19 ? 169 THR A O     1 
ATOM   2183 C  CB    . THR E 3 169 ? 37.783  -37.799 -27.604 1.00 28.31 ? 169 THR A CB    1 
ATOM   2184 O  OG1   . THR E 3 169 ? 37.319  -38.040 -26.271 1.00 30.00 ? 169 THR A OG1   1 
ATOM   2185 C  CG2   . THR E 3 169 ? 38.391  -36.402 -27.684 1.00 28.41 ? 169 THR A CG2   1 
ATOM   2186 N  N     . LYS E 3 170 ? 35.230  -39.864 -28.094 1.00 26.61 ? 170 LYS A N     1 
ATOM   2187 C  CA    . LYS E 3 170 ? 34.784  -41.237 -28.250 1.00 25.59 ? 170 LYS A CA    1 
ATOM   2188 C  C     . LYS E 3 170 ? 33.987  -41.298 -29.549 1.00 25.67 ? 170 LYS A C     1 
ATOM   2189 O  O     . LYS E 3 170 ? 34.166  -42.192 -30.372 1.00 27.16 ? 170 LYS A O     1 
ATOM   2190 C  CB    . LYS E 3 170 ? 33.890  -41.643 -27.077 1.00 23.85 ? 170 LYS A CB    1 
ATOM   2191 C  CG    . LYS E 3 170 ? 33.417  -43.075 -27.137 1.00 22.23 ? 170 LYS A CG    1 
ATOM   2192 C  CD    . LYS E 3 170 ? 32.705  -43.481 -25.861 1.00 20.67 ? 170 LYS A CD    1 
ATOM   2193 C  CE    . LYS E 3 170 ? 32.310  -44.949 -25.906 1.00 20.21 ? 170 LYS A CE    1 
ATOM   2194 N  NZ    . LYS E 3 170 ? 31.711  -45.415 -24.628 1.00 19.85 ? 170 LYS A NZ    1 
ATOM   2195 N  N     . TYR E 3 171 ? 33.105  -40.328 -29.730 1.00 25.06 ? 171 TYR A N     1 
ATOM   2196 C  CA    . TYR E 3 171 ? 32.273  -40.275 -30.918 1.00 24.65 ? 171 TYR A CA    1 
ATOM   2197 C  C     . TYR E 3 171 ? 32.606  -39.019 -31.710 1.00 25.71 ? 171 TYR A C     1 
ATOM   2198 O  O     . TYR E 3 171 ? 31.879  -38.033 -31.620 1.00 26.44 ? 171 TYR A O     1 
ATOM   2199 C  CB    . TYR E 3 171 ? 30.788  -40.238 -30.526 1.00 23.02 ? 171 TYR A CB    1 
ATOM   2200 C  CG    . TYR E 3 171 ? 30.349  -41.289 -29.522 1.00 21.66 ? 171 TYR A CG    1 
ATOM   2201 C  CD1   . TYR E 3 171 ? 30.560  -41.109 -28.154 1.00 21.48 ? 171 TYR A CD1   1 
ATOM   2202 C  CD2   . TYR E 3 171 ? 29.704  -42.457 -29.937 1.00 20.93 ? 171 TYR A CD2   1 
ATOM   2203 C  CE1   . TYR E 3 171 ? 30.146  -42.056 -27.233 1.00 19.29 ? 171 TYR A CE1   1 
ATOM   2204 C  CE2   . TYR E 3 171 ? 29.287  -43.413 -29.016 1.00 19.29 ? 171 TYR A CE2   1 
ATOM   2205 C  CZ    . TYR E 3 171 ? 29.511  -43.200 -27.669 1.00 19.14 ? 171 TYR A CZ    1 
ATOM   2206 O  OH    . TYR E 3 171 ? 29.117  -44.130 -26.751 1.00 17.58 ? 171 TYR A OH    1 
ATOM   2207 N  N     . LYS E 3 172 ? 33.679  -39.043 -32.494 1.00 26.86 ? 172 LYS A N     1 
ATOM   2208 C  CA    . LYS E 3 172 ? 34.057  -37.852 -33.254 1.00 28.16 ? 172 LYS A CA    1 
ATOM   2209 C  C     . LYS E 3 172 ? 32.983  -37.443 -34.256 1.00 28.01 ? 172 LYS A C     1 
ATOM   2210 O  O     . LYS E 3 172 ? 32.666  -36.259 -34.382 1.00 26.77 ? 172 LYS A O     1 
ATOM   2211 C  CB    . LYS E 3 172 ? 35.413  -38.061 -33.938 1.00 30.09 ? 172 LYS A CB    1 
ATOM   2212 C  CG    . LYS E 3 172 ? 36.573  -38.127 -32.940 1.00 33.06 ? 172 LYS A CG    1 
ATOM   2213 C  CD    . LYS E 3 172 ? 37.910  -37.998 -33.648 1.00 35.48 ? 172 LYS A CD    1 
ATOM   2214 C  CE    . LYS E 3 172 ? 38.733  -36.888 -33.026 1.00 37.86 ? 172 LYS A CE    1 
ATOM   2215 N  NZ    . LYS E 3 172 ? 39.641  -36.285 -34.041 1.00 39.51 ? 172 LYS A NZ    1 
ATOM   2216 N  N     . GLN E 3 173 ? 32.414  -38.419 -34.962 1.00 28.62 ? 173 GLN A N     1 
ATOM   2217 C  CA    . GLN E 3 173 ? 31.341  -38.149 -35.923 1.00 29.38 ? 173 GLN A CA    1 
ATOM   2218 C  C     . GLN E 3 173 ? 30.633  -39.437 -36.320 1.00 28.81 ? 173 GLN A C     1 
ATOM   2219 O  O     . GLN E 3 173 ? 31.270  -40.473 -36.478 1.00 28.51 ? 173 GLN A O     1 
ATOM   2220 C  CB    . GLN E 3 173 ? 31.875  -37.421 -37.179 1.00 30.25 ? 173 GLN A CB    1 
ATOM   2221 C  CG    . GLN E 3 173 ? 32.829  -38.211 -38.073 1.00 30.47 ? 173 GLN A CG    1 
ATOM   2222 C  CD    . GLN E 3 173 ? 32.142  -39.327 -38.853 1.00 32.60 ? 173 GLN A CD    1 
ATOM   2223 O  OE1   . GLN E 3 173 ? 31.062  -39.142 -39.431 1.00 33.59 ? 173 GLN A OE1   1 
ATOM   2224 N  NE2   . GLN E 3 173 ? 32.774  -40.492 -38.880 1.00 32.07 ? 173 GLN A NE2   1 
ATOM   2225 N  N     . ARG E 3 174 ? 29.310  -39.369 -36.462 1.00 28.87 ? 174 ARG A N     1 
ATOM   2226 C  CA    . ARG E 3 174 ? 28.514  -40.533 -36.845 1.00 29.59 ? 174 ARG A CA    1 
ATOM   2227 C  C     . ARG E 3 174 ? 27.532  -40.199 -37.961 1.00 31.45 ? 174 ARG A C     1 
ATOM   2228 O  O     . ARG E 3 174 ? 27.039  -39.076 -38.055 1.00 32.97 ? 174 ARG A O     1 
ATOM   2229 C  CB    . ARG E 3 174 ? 27.697  -41.061 -35.664 1.00 26.31 ? 174 ARG A CB    1 
ATOM   2230 C  CG    . ARG E 3 174 ? 28.466  -41.543 -34.462 1.00 25.78 ? 174 ARG A CG    1 
ATOM   2231 C  CD    . ARG E 3 174 ? 29.189  -42.891 -34.622 1.00 26.27 ? 174 ARG A CD    1 
ATOM   2232 N  NE    . ARG E 3 174 ? 30.554  -42.649 -34.286 1.00 26.61 ? 174 ARG A NE    1 
ATOM   2233 C  CZ    . ARG E 3 174 ? 31.338  -43.014 -33.285 1.00 25.43 ? 174 ARG A CZ    1 
ATOM   2234 N  NH1   . ARG E 3 174 ? 31.031  -43.800 -32.259 1.00 24.96 ? 174 ARG A NH1   1 
ATOM   2235 N  NH2   . ARG E 3 174 ? 32.504  -42.415 -33.321 1.00 26.13 ? 174 ARG A NH2   1 
ATOM   2236 N  N     . ASN E 3 175 ? 27.255  -41.189 -38.801 1.00 32.85 ? 175 ASN A N     1 
ATOM   2237 C  CA    . ASN E 3 175 ? 26.292  -41.049 -39.885 1.00 33.87 ? 175 ASN A CA    1 
ATOM   2238 C  C     . ASN E 3 175 ? 26.462  -39.811 -40.757 1.00 33.40 ? 175 ASN A C     1 
ATOM   2239 O  O     . ASN E 3 175 ? 25.524  -39.404 -41.434 1.00 34.05 ? 175 ASN A O     1 
ATOM   2240 C  CB    . ASN E 3 175 ? 24.881  -41.055 -39.292 1.00 35.50 ? 175 ASN A CB    1 
ATOM   2241 C  CG    . ASN E 3 175 ? 24.733  -42.053 -38.153 1.00 37.81 ? 175 ASN A CG    1 
ATOM   2242 O  OD1   . ASN E 3 175 ? 24.230  -41.714 -37.071 1.00 39.46 ? 175 ASN A OD1   1 
ATOM   2243 N  ND2   . ASN E 3 175 ? 25.168  -43.289 -38.388 1.00 36.06 ? 175 ASN A ND2   1 
ATOM   2244 N  N     . GLY E 3 176 ? 27.642  -39.206 -40.741 1.00 32.82 ? 176 GLY A N     1 
ATOM   2245 C  CA    . GLY E 3 176 ? 27.857  -38.028 -41.564 1.00 32.55 ? 176 GLY A CA    1 
ATOM   2246 C  C     . GLY E 3 176 ? 27.789  -36.706 -40.821 1.00 32.02 ? 176 GLY A C     1 
ATOM   2247 O  O     . GLY E 3 176 ? 27.858  -35.641 -41.435 1.00 32.76 ? 176 GLY A O     1 
ATOM   2248 N  N     . TRP E 3 177 ? 27.646  -36.771 -39.504 1.00 30.75 ? 177 TRP A N     1 
ATOM   2249 C  CA    . TRP E 3 177 ? 27.584  -35.568 -38.690 1.00 30.16 ? 177 TRP A CA    1 
ATOM   2250 C  C     . TRP E 3 177 ? 28.674  -35.550 -37.625 1.00 29.93 ? 177 TRP A C     1 
ATOM   2251 O  O     . TRP E 3 177 ? 28.896  -36.549 -36.936 1.00 30.25 ? 177 TRP A O     1 
ATOM   2252 C  CB    . TRP E 3 177 ? 26.217  -35.439 -38.010 1.00 30.24 ? 177 TRP A CB    1 
ATOM   2253 C  CG    . TRP E 3 177 ? 25.083  -35.151 -38.950 1.00 29.73 ? 177 TRP A CG    1 
ATOM   2254 C  CD1   . TRP E 3 177 ? 24.326  -36.062 -39.626 1.00 29.55 ? 177 TRP A CD1   1 
ATOM   2255 C  CD2   . TRP E 3 177 ? 24.579  -33.859 -39.314 1.00 29.08 ? 177 TRP A CD2   1 
ATOM   2256 N  NE1   . TRP E 3 177 ? 23.384  -35.417 -40.396 1.00 29.05 ? 177 TRP A NE1   1 
ATOM   2257 C  CE2   . TRP E 3 177 ? 23.528  -34.065 -40.234 1.00 29.09 ? 177 TRP A CE2   1 
ATOM   2258 C  CE3   . TRP E 3 177 ? 24.939  -32.549 -38.982 1.00 27.50 ? 177 TRP A CE3   1 
ATOM   2259 C  CZ2   . TRP E 3 177 ? 22.803  -33.005 -40.790 1.00 28.45 ? 177 TRP A CZ2   1 
ATOM   2260 C  CZ3   . TRP E 3 177 ? 24.221  -31.497 -39.540 1.00 27.19 ? 177 TRP A CZ3   1 
ATOM   2261 C  CH2   . TRP E 3 177 ? 23.176  -31.732 -40.446 1.00 26.66 ? 177 TRP A CH2   1 
ATOM   2262 N  N     . SER E 3 178 ? 29.344  -34.406 -37.495 1.00 29.22 ? 178 SER A N     1 
ATOM   2263 C  CA    . SER E 3 178 ? 30.408  -34.234 -36.513 1.00 29.52 ? 178 SER A CA    1 
ATOM   2264 C  C     . SER E 3 178 ? 29.995  -33.153 -35.521 1.00 29.77 ? 178 SER A C     1 
ATOM   2265 O  O     . SER E 3 178 ? 29.027  -32.432 -35.757 1.00 30.58 ? 178 SER A O     1 
ATOM   2266 C  CB    . SER E 3 178 ? 31.695  -33.792 -37.202 1.00 29.74 ? 178 SER A CB    1 
ATOM   2267 O  OG    . SER E 3 178 ? 31.690  -32.389 -37.430 1.00 28.69 ? 178 SER A OG    1 
ATOM   2268 N  N     . HIS E 3 179 ? 30.720  -33.035 -34.413 1.00 29.50 ? 179 HIS A N     1 
ATOM   2269 C  CA    . HIS E 3 179 ? 30.395  -32.001 -33.442 1.00 29.64 ? 179 HIS A CA    1 
ATOM   2270 C  C     . HIS E 3 179 ? 30.838  -30.682 -34.027 1.00 29.25 ? 179 HIS A C     1 
ATOM   2271 O  O     . HIS E 3 179 ? 30.423  -29.616 -33.574 1.00 28.03 ? 179 HIS A O     1 
ATOM   2272 C  CB    . HIS E 3 179 ? 31.098  -32.246 -32.111 1.00 29.08 ? 179 HIS A CB    1 
ATOM   2273 C  CG    . HIS E 3 179 ? 30.688  -33.523 -31.450 1.00 29.37 ? 179 HIS A CG    1 
ATOM   2274 N  ND1   . HIS E 3 179 ? 31.449  -34.670 -31.512 1.00 29.10 ? 179 HIS A ND1   1 
ATOM   2275 C  CD2   . HIS E 3 179 ? 29.575  -33.842 -30.747 1.00 28.77 ? 179 HIS A CD2   1 
ATOM   2276 C  CE1   . HIS E 3 179 ? 30.822  -35.642 -30.873 1.00 28.70 ? 179 HIS A CE1   1 
ATOM   2277 N  NE2   . HIS E 3 179 ? 29.684  -35.167 -30.401 1.00 29.72 ? 179 HIS A NE2   1 
ATOM   2278 N  N     . LYS E 3 180 ? 31.679  -30.770 -35.053 1.00 30.47 ? 180 LYS A N     1 
ATOM   2279 C  CA    . LYS E 3 180 ? 32.171  -29.579 -35.728 1.00 31.73 ? 180 LYS A CA    1 
ATOM   2280 C  C     . LYS E 3 180 ? 31.037  -28.888 -36.489 1.00 31.46 ? 180 LYS A C     1 
ATOM   2281 O  O     . LYS E 3 180 ? 30.951  -27.659 -36.502 1.00 31.71 ? 180 LYS A O     1 
ATOM   2282 C  CB    . LYS E 3 180 ? 33.305  -29.928 -36.695 1.00 32.40 ? 180 LYS A CB    1 
ATOM   2283 C  CG    . LYS E 3 180 ? 33.984  -28.685 -37.251 1.00 32.63 ? 180 LYS A CG    1 
ATOM   2284 C  CD    . LYS E 3 180 ? 35.144  -29.028 -38.151 1.00 34.60 ? 180 LYS A CD    1 
ATOM   2285 C  CE    . LYS E 3 180 ? 35.944  -27.785 -38.519 1.00 34.25 ? 180 LYS A CE    1 
ATOM   2286 N  NZ    . LYS E 3 180 ? 37.373  -28.122 -38.775 1.00 34.82 ? 180 LYS A NZ    1 
ATOM   2287 N  N     . ASP E 3 181 ? 30.171  -29.673 -37.124 1.00 30.54 ? 181 ASP A N     1 
ATOM   2288 C  CA    . ASP E 3 181 ? 29.050  -29.096 -37.851 1.00 30.88 ? 181 ASP A CA    1 
ATOM   2289 C  C     . ASP E 3 181 ? 27.982  -28.598 -36.875 1.00 30.36 ? 181 ASP A C     1 
ATOM   2290 O  O     . ASP E 3 181 ? 27.470  -27.487 -37.020 1.00 30.32 ? 181 ASP A O     1 
ATOM   2291 C  CB    . ASP E 3 181 ? 28.438  -30.126 -38.805 1.00 31.41 ? 181 ASP A CB    1 
ATOM   2292 C  CG    . ASP E 3 181 ? 29.471  -30.763 -39.717 1.00 31.65 ? 181 ASP A CG    1 
ATOM   2293 O  OD1   . ASP E 3 181 ? 29.705  -31.982 -39.575 1.00 30.95 ? 181 ASP A OD1   1 
ATOM   2294 O  OD2   . ASP E 3 181 ? 30.051  -30.050 -40.568 1.00 32.00 ? 181 ASP A OD2   1 
ATOM   2295 N  N     . LEU E 3 182 ? 27.653  -29.409 -35.874 1.00 29.81 ? 182 LEU A N     1 
ATOM   2296 C  CA    . LEU E 3 182 ? 26.642  -29.011 -34.906 1.00 29.85 ? 182 LEU A CA    1 
ATOM   2297 C  C     . LEU E 3 182 ? 27.040  -27.744 -34.166 1.00 30.68 ? 182 LEU A C     1 
ATOM   2298 O  O     . LEU E 3 182 ? 26.234  -26.820 -34.029 1.00 31.83 ? 182 LEU A O     1 
ATOM   2299 C  CB    . LEU E 3 182 ? 26.377  -30.126 -33.894 1.00 29.56 ? 182 LEU A CB    1 
ATOM   2300 C  CG    . LEU E 3 182 ? 25.893  -31.489 -34.404 1.00 28.68 ? 182 LEU A CG    1 
ATOM   2301 C  CD1   . LEU E 3 182 ? 25.420  -32.289 -33.209 1.00 28.32 ? 182 LEU A CD1   1 
ATOM   2302 C  CD2   . LEU E 3 182 ? 24.769  -31.347 -35.406 1.00 26.24 ? 182 LEU A CD2   1 
ATOM   2303 N  N     . LEU E 3 183 ? 28.281  -27.694 -33.693 1.00 30.73 ? 183 LEU A N     1 
ATOM   2304 C  CA    . LEU E 3 183 ? 28.762  -26.519 -32.963 1.00 30.34 ? 183 LEU A CA    1 
ATOM   2305 C  C     . LEU E 3 183 ? 28.632  -25.247 -33.794 1.00 30.94 ? 183 LEU A C     1 
ATOM   2306 O  O     . LEU E 3 183 ? 28.304  -24.176 -33.277 1.00 30.60 ? 183 LEU A O     1 
ATOM   2307 C  CB    . LEU E 3 183 ? 30.225  -26.723 -32.558 1.00 29.42 ? 183 LEU A CB    1 
ATOM   2308 C  CG    . LEU E 3 183 ? 30.510  -26.978 -31.079 1.00 27.89 ? 183 LEU A CG    1 
ATOM   2309 C  CD1   . LEU E 3 183 ? 29.451  -27.889 -30.485 1.00 26.35 ? 183 LEU A CD1   1 
ATOM   2310 C  CD2   . LEU E 3 183 ? 31.900  -27.569 -30.938 1.00 27.09 ? 183 LEU A CD2   1 
ATOM   2311 N  N     . ARG E 3 184 ? 28.882  -25.385 -35.092 1.00 31.54 ? 184 ARG A N     1 
ATOM   2312 C  CA    . ARG E 3 184 ? 28.821  -24.272 -36.026 1.00 31.20 ? 184 ARG A CA    1 
ATOM   2313 C  C     . ARG E 3 184 ? 27.402  -23.921 -36.443 1.00 31.26 ? 184 ARG A C     1 
ATOM   2314 O  O     . ARG E 3 184 ? 27.063  -22.746 -36.536 1.00 31.71 ? 184 ARG A O     1 
ATOM   2315 C  CB    . ARG E 3 184 ? 29.636  -24.601 -37.276 1.00 31.47 ? 184 ARG A CB    1 
ATOM   2316 C  CG    . ARG E 3 184 ? 29.818  -23.453 -38.249 1.00 32.04 ? 184 ARG A CG    1 
ATOM   2317 C  CD    . ARG E 3 184 ? 29.516  -23.916 -39.665 1.00 33.75 ? 184 ARG A CD    1 
ATOM   2318 N  NE    . ARG E 3 184 ? 29.983  -25.278 -39.890 1.00 35.65 ? 184 ARG A NE    1 
ATOM   2319 C  CZ    . ARG E 3 184 ? 29.459  -26.110 -40.789 1.00 37.91 ? 184 ARG A CZ    1 
ATOM   2320 N  NH1   . ARG E 3 184 ? 29.947  -27.343 -40.924 1.00 38.87 ? 184 ARG A NH1   1 
ATOM   2321 N  NH2   . ARG E 3 184 ? 28.444  -25.714 -41.553 1.00 35.36 ? 184 ARG A NH2   1 
ATOM   2322 N  N     . LEU E 3 185 ? 26.575  -24.927 -36.710 1.00 30.56 ? 185 LEU A N     1 
ATOM   2323 C  CA    . LEU E 3 185 ? 25.209  -24.661 -37.136 1.00 30.23 ? 185 LEU A CA    1 
ATOM   2324 C  C     . LEU E 3 185 ? 24.331  -24.089 -36.033 1.00 30.16 ? 185 LEU A C     1 
ATOM   2325 O  O     . LEU E 3 185 ? 23.364  -23.385 -36.303 1.00 29.63 ? 185 LEU A O     1 
ATOM   2326 C  CB    . LEU E 3 185 ? 24.575  -25.934 -37.707 1.00 30.30 ? 185 LEU A CB    1 
ATOM   2327 C  CG    . LEU E 3 185 ? 25.167  -26.402 -39.046 1.00 28.78 ? 185 LEU A CG    1 
ATOM   2328 C  CD1   . LEU E 3 185 ? 24.393  -27.602 -39.584 1.00 25.11 ? 185 LEU A CD1   1 
ATOM   2329 C  CD2   . LEU E 3 185 ? 25.120  -25.240 -40.032 1.00 28.79 ? 185 LEU A CD2   1 
ATOM   2330 N  N     . SER E 3 186 ? 24.677  -24.378 -34.787 1.00 31.23 ? 186 SER A N     1 
ATOM   2331 C  CA    . SER E 3 186 ? 23.895  -23.886 -33.664 1.00 32.72 ? 186 SER A CA    1 
ATOM   2332 C  C     . SER E 3 186 ? 24.470  -22.597 -33.078 1.00 34.31 ? 186 SER A C     1 
ATOM   2333 O  O     . SER E 3 186 ? 23.863  -21.977 -32.194 1.00 34.21 ? 186 SER A O     1 
ATOM   2334 C  CB    . SER E 3 186 ? 23.796  -24.971 -32.582 1.00 32.24 ? 186 SER A CB    1 
ATOM   2335 O  OG    . SER E 3 186 ? 25.073  -25.450 -32.207 1.00 30.05 ? 186 SER A OG    1 
ATOM   2336 N  N     . HIS E 3 187 ? 25.632  -22.194 -33.585 1.00 35.74 ? 187 HIS A N     1 
ATOM   2337 C  CA    . HIS E 3 187 ? 26.317  -20.983 -33.126 1.00 37.69 ? 187 HIS A CA    1 
ATOM   2338 C  C     . HIS E 3 187 ? 26.395  -20.896 -31.613 1.00 38.69 ? 187 HIS A C     1 
ATOM   2339 O  O     . HIS E 3 187 ? 26.175  -19.836 -31.046 1.00 40.14 ? 187 HIS A O     1 
ATOM   2340 C  CB    . HIS E 3 187 ? 25.602  -19.727 -33.622 1.00 38.52 ? 187 HIS A CB    1 
ATOM   2341 C  CG    . HIS E 3 187 ? 25.485  -19.634 -35.105 1.00 39.69 ? 187 HIS A CG    1 
ATOM   2342 N  ND1   . HIS E 3 187 ? 26.068  -20.525 -35.970 1.00 40.70 ? 187 HIS A ND1   1 
ATOM   2343 C  CD2   . HIS E 3 187 ? 24.841  -18.727 -35.890 1.00 40.56 ? 187 HIS A CD2   1 
ATOM   2344 C  CE1   . HIS E 3 187 ? 25.795  -20.186 -37.218 1.00 41.52 ? 187 HIS A CE1   1 
ATOM   2345 N  NE2   . HIS E 3 187 ? 25.047  -19.092 -37.190 1.00 41.50 ? 187 HIS A NE2   1 
ATOM   2346 N  N     . ILE E 3 188 ? 26.701  -22.008 -30.965 1.00 39.87 ? 188 ILE A N     1 
ATOM   2347 C  CA    . ILE E 3 188 ? 26.793  -22.083 -29.511 1.00 40.25 ? 188 ILE A CA    1 
ATOM   2348 C  C     . ILE E 3 188 ? 27.878  -21.176 -28.914 1.00 40.93 ? 188 ILE A C     1 
ATOM   2349 O  O     . ILE E 3 188 ? 28.828  -20.797 -29.598 1.00 40.83 ? 188 ILE A O     1 
ATOM   2350 C  CB    . ILE E 3 188 ? 27.126  -23.527 -29.129 1.00 41.08 ? 188 ILE A CB    1 
ATOM   2351 C  CG1   . ILE E 3 188 ? 27.100  -23.725 -27.619 1.00 40.63 ? 188 ILE A CG1   1 
ATOM   2352 C  CG2   . ILE E 3 188 ? 28.526  -23.875 -29.664 1.00 40.65 ? 188 ILE A CG2   1 
ATOM   2353 C  CD1   . ILE E 3 188 ? 27.502  -25.120 -27.252 1.00 41.91 ? 188 ILE A CD1   1 
ATOM   2354 N  N     . LYS E 3 189 ? 27.724  -20.828 -27.640 1.00 41.10 ? 189 LYS A N     1 
ATOM   2355 C  CA    . LYS E 3 189 ? 28.715  -20.038 -26.936 1.00 40.63 ? 189 LYS A CA    1 
ATOM   2356 C  C     . LYS E 3 189 ? 28.989  -20.780 -25.644 1.00 40.25 ? 189 LYS A C     1 
ATOM   2357 O  O     . LYS E 3 189 ? 28.136  -20.856 -24.755 1.00 40.40 ? 189 LYS A O     1 
ATOM   2358 C  CB    . LYS E 3 189 ? 28.218  -18.632 -26.621 1.00 41.92 ? 189 LYS A CB    1 
ATOM   2359 C  CG    . LYS E 3 189 ? 26.813  -18.375 -26.938 1.00 43.70 ? 189 LYS A CG    1 
ATOM   2360 C  CD    . LYS E 3 189 ? 26.464  -16.947 -26.634 1.00 44.70 ? 189 LYS A CD    1 
ATOM   2361 C  CE    . LYS E 3 189 ? 25.186  -16.566 -27.371 1.00 46.77 ? 189 LYS A CE    1 
ATOM   2362 N  NZ    . LYS E 3 189 ? 24.442  -15.391 -26.809 1.00 49.01 ? 189 LYS A NZ    1 
ATOM   2363 N  N     . PRO E 3 190 ? 30.175  -21.382 -25.549 1.00 39.57 ? 190 PRO A N     1 
ATOM   2364 C  CA    . PRO E 3 190 ? 30.618  -22.141 -24.383 1.00 39.44 ? 190 PRO A CA    1 
ATOM   2365 C  C     . PRO E 3 190 ? 30.272  -21.395 -23.097 1.00 39.07 ? 190 PRO A C     1 
ATOM   2366 O  O     . PRO E 3 190 ? 30.599  -20.220 -22.950 1.00 39.58 ? 190 PRO A O     1 
ATOM   2367 C  CB    . PRO E 3 190 ? 32.117  -22.261 -24.627 1.00 39.78 ? 190 PRO A CB    1 
ATOM   2368 C  CG    . PRO E 3 190 ? 32.166  -22.451 -26.114 1.00 40.16 ? 190 PRO A CG    1 
ATOM   2369 C  CD    . PRO E 3 190 ? 31.192  -21.405 -26.616 1.00 39.68 ? 190 PRO A CD    1 
ATOM   2370 N  N     . ALA E 3 191 ? 29.605  -22.087 -22.179 1.00 38.17 ? 191 ALA A N     1 
ATOM   2371 C  CA    . ALA E 3 191 ? 29.189  -21.497 -20.918 1.00 38.21 ? 191 ALA A CA    1 
ATOM   2372 C  C     . ALA E 3 191 ? 30.324  -21.310 -19.921 1.00 38.63 ? 191 ALA A C     1 
ATOM   2373 O  O     . ALA E 3 191 ? 30.144  -20.667 -18.886 1.00 39.75 ? 191 ALA A O     1 
ATOM   2374 C  CB    . ALA E 3 191 ? 28.089  -22.342 -20.288 1.00 37.01 ? 191 ALA A CB    1 
ATOM   2375 N  N     . ASN E 3 192 ? 31.490  -21.870 -20.212 1.00 38.38 ? 192 ASN A N     1 
ATOM   2376 C  CA    . ASN E 3 192 ? 32.610  -21.738 -19.289 1.00 38.21 ? 192 ASN A CA    1 
ATOM   2377 C  C     . ASN E 3 192 ? 33.917  -22.040 -19.995 1.00 37.37 ? 192 ASN A C     1 
ATOM   2378 O  O     . ASN E 3 192 ? 33.922  -22.540 -21.120 1.00 35.94 ? 192 ASN A O     1 
ATOM   2379 C  CB    . ASN E 3 192 ? 32.432  -22.680 -18.081 1.00 39.66 ? 192 ASN A CB    1 
ATOM   2380 C  CG    . ASN E 3 192 ? 32.601  -24.148 -18.442 1.00 41.17 ? 192 ASN A CG    1 
ATOM   2381 O  OD1   . ASN E 3 192 ? 32.828  -24.501 -19.602 1.00 43.45 ? 192 ASN A OD1   1 
ATOM   2382 N  ND2   . ASN E 3 192 ? 32.490  -25.014 -17.439 1.00 40.88 ? 192 ASN A ND2   1 
ATOM   2383 N  N     . GLU E 3 193 ? 35.023  -21.745 -19.318 1.00 37.04 ? 193 GLU A N     1 
ATOM   2384 C  CA    . GLU E 3 193 ? 36.349  -21.980 -19.873 1.00 37.13 ? 193 GLU A CA    1 
ATOM   2385 C  C     . GLU E 3 193 ? 36.562  -23.436 -20.300 1.00 35.05 ? 193 GLU A C     1 
ATOM   2386 O  O     . GLU E 3 193 ? 37.166  -23.694 -21.344 1.00 33.95 ? 193 GLU A O     1 
ATOM   2387 C  CB    . GLU E 3 193 ? 37.423  -21.569 -18.860 1.00 39.41 ? 193 GLU A CB    1 
ATOM   2388 C  CG    . GLU E 3 193 ? 38.843  -21.586 -19.425 1.00 43.80 ? 193 GLU A CG    1 
ATOM   2389 C  CD    . GLU E 3 193 ? 39.434  -20.195 -19.589 1.00 46.11 ? 193 GLU A CD    1 
ATOM   2390 O  OE1   . GLU E 3 193 ? 39.678  -19.523 -18.563 1.00 47.75 ? 193 GLU A OE1   1 
ATOM   2391 O  OE2   . GLU E 3 193 ? 39.659  -19.775 -20.743 1.00 46.65 ? 193 GLU A OE2   1 
ATOM   2392 N  N     . GLY E 3 194 ? 36.068  -24.378 -19.499 1.00 33.56 ? 194 GLY A N     1 
ATOM   2393 C  CA    . GLY E 3 194 ? 36.220  -25.784 -19.836 1.00 32.31 ? 194 GLY A CA    1 
ATOM   2394 C  C     . GLY E 3 194 ? 35.596  -26.128 -21.180 1.00 32.04 ? 194 GLY A C     1 
ATOM   2395 O  O     . GLY E 3 194 ? 36.187  -26.852 -21.982 1.00 31.48 ? 194 GLY A O     1 
ATOM   2396 N  N     . LEU E 3 195 ? 34.402  -25.589 -21.425 1.00 31.61 ? 195 LEU A N     1 
ATOM   2397 C  CA    . LEU E 3 195 ? 33.654  -25.825 -22.654 1.00 30.64 ? 195 LEU A CA    1 
ATOM   2398 C  C     . LEU E 3 195 ? 34.243  -25.146 -23.894 1.00 30.19 ? 195 LEU A C     1 
ATOM   2399 O  O     . LEU E 3 195 ? 34.179  -25.686 -25.001 1.00 29.43 ? 195 LEU A O     1 
ATOM   2400 C  CB    . LEU E 3 195 ? 32.195  -25.391 -22.449 1.00 30.86 ? 195 LEU A CB    1 
ATOM   2401 C  CG    . LEU E 3 195 ? 31.360  -26.356 -21.597 1.00 31.58 ? 195 LEU A CG    1 
ATOM   2402 C  CD1   . LEU E 3 195 ? 30.078  -25.696 -21.133 1.00 32.39 ? 195 LEU A CD1   1 
ATOM   2403 C  CD2   . LEU E 3 195 ? 31.055  -27.600 -22.411 1.00 32.82 ? 195 LEU A CD2   1 
ATOM   2404 N  N     . THR E 3 196 ? 34.809  -23.961 -23.712 1.00 29.96 ? 196 THR A N     1 
ATOM   2405 C  CA    . THR E 3 196 ? 35.410  -23.239 -24.827 1.00 29.09 ? 196 THR A CA    1 
ATOM   2406 C  C     . THR E 3 196 ? 36.603  -24.028 -25.326 1.00 29.79 ? 196 THR A C     1 
ATOM   2407 O  O     . THR E 3 196 ? 36.848  -24.103 -26.527 1.00 30.79 ? 196 THR A O     1 
ATOM   2408 C  CB    . THR E 3 196 ? 35.907  -21.853 -24.407 1.00 27.18 ? 196 THR A CB    1 
ATOM   2409 O  OG1   . THR E 3 196 ? 34.803  -21.064 -23.964 1.00 26.55 ? 196 THR A OG1   1 
ATOM   2410 C  CG2   . THR E 3 196 ? 36.571  -21.168 -25.565 1.00 25.66 ? 196 THR A CG2   1 
ATOM   2411 N  N     . MET E 3 197 ? 37.346  -24.614 -24.394 1.00 29.63 ? 197 MET A N     1 
ATOM   2412 C  CA    . MET E 3 197 ? 38.518  -25.387 -24.751 1.00 29.85 ? 197 MET A CA    1 
ATOM   2413 C  C     . MET E 3 197 ? 38.104  -26.579 -25.589 1.00 29.34 ? 197 MET A C     1 
ATOM   2414 O  O     . MET E 3 197 ? 38.689  -26.853 -26.641 1.00 29.05 ? 197 MET A O     1 
ATOM   2415 C  CB    . MET E 3 197 ? 39.250  -25.877 -23.503 1.00 30.21 ? 197 MET A CB    1 
ATOM   2416 C  CG    . MET E 3 197 ? 40.550  -26.575 -23.840 1.00 31.30 ? 197 MET A CG    1 
ATOM   2417 S  SD    . MET E 3 197 ? 41.291  -27.397 -22.450 1.00 34.51 ? 197 MET A SD    1 
ATOM   2418 C  CE    . MET E 3 197 ? 41.988  -25.977 -21.552 1.00 34.24 ? 197 MET A CE    1 
ATOM   2419 N  N     . VAL E 3 198 ? 37.095  -27.295 -25.108 1.00 29.09 ? 198 VAL A N     1 
ATOM   2420 C  CA    . VAL E 3 198 ? 36.594  -28.457 -25.818 1.00 29.07 ? 198 VAL A CA    1 
ATOM   2421 C  C     . VAL E 3 198 ? 36.052  -28.026 -27.179 1.00 28.80 ? 198 VAL A C     1 
ATOM   2422 O  O     . VAL E 3 198 ? 36.298  -28.688 -28.186 1.00 28.93 ? 198 VAL A O     1 
ATOM   2423 C  CB    . VAL E 3 198 ? 35.493  -29.164 -25.014 1.00 28.51 ? 198 VAL A CB    1 
ATOM   2424 C  CG1   . VAL E 3 198 ? 34.842  -30.231 -25.859 1.00 29.05 ? 198 VAL A CG1   1 
ATOM   2425 C  CG2   . VAL E 3 198 ? 36.094  -29.791 -23.775 1.00 28.10 ? 198 VAL A CG2   1 
ATOM   2426 N  N     . ALA E 3 199 ? 35.327  -26.910 -27.205 1.00 29.25 ? 199 ALA A N     1 
ATOM   2427 C  CA    . ALA E 3 199 ? 34.771  -26.387 -28.450 1.00 29.19 ? 199 ALA A CA    1 
ATOM   2428 C  C     . ALA E 3 199 ? 35.893  -26.033 -29.429 1.00 29.29 ? 199 ALA A C     1 
ATOM   2429 O  O     . ALA E 3 199 ? 35.835  -26.393 -30.600 1.00 28.06 ? 199 ALA A O     1 
ATOM   2430 C  CB    . ALA E 3 199 ? 33.916  -25.166 -28.168 1.00 29.00 ? 199 ALA A CB    1 
ATOM   2431 N  N     . LYS E 3 200 ? 36.909  -25.327 -28.942 1.00 29.96 ? 200 LYS A N     1 
ATOM   2432 C  CA    . LYS E 3 200 ? 38.054  -24.953 -29.767 1.00 30.51 ? 200 LYS A CA    1 
ATOM   2433 C  C     . LYS E 3 200 ? 38.746  -26.224 -30.269 1.00 29.59 ? 200 LYS A C     1 
ATOM   2434 O  O     . LYS E 3 200 ? 39.179  -26.293 -31.419 1.00 28.70 ? 200 LYS A O     1 
ATOM   2435 C  CB    . LYS E 3 200 ? 39.032  -24.103 -28.946 1.00 31.68 ? 200 LYS A CB    1 
ATOM   2436 C  CG    . LYS E 3 200 ? 40.188  -23.503 -29.737 1.00 34.30 ? 200 LYS A CG    1 
ATOM   2437 C  CD    . LYS E 3 200 ? 40.906  -22.422 -28.920 1.00 36.75 ? 200 LYS A CD    1 
ATOM   2438 C  CE    . LYS E 3 200 ? 39.937  -21.317 -28.502 1.00 38.17 ? 200 LYS A CE    1 
ATOM   2439 N  NZ    . LYS E 3 200 ? 40.548  -20.311 -27.591 1.00 41.15 ? 200 LYS A NZ    1 
ATOM   2440 N  N     . TYR E 3 201 ? 38.847  -27.229 -29.403 1.00 29.15 ? 201 TYR A N     1 
ATOM   2441 C  CA    . TYR E 3 201 ? 39.467  -28.496 -29.787 1.00 30.55 ? 201 TYR A CA    1 
ATOM   2442 C  C     . TYR E 3 201 ? 38.740  -29.115 -30.971 1.00 30.24 ? 201 TYR A C     1 
ATOM   2443 O  O     . TYR E 3 201 ? 39.369  -29.594 -31.914 1.00 29.71 ? 201 TYR A O     1 
ATOM   2444 C  CB    . TYR E 3 201 ? 39.452  -29.494 -28.621 1.00 31.33 ? 201 TYR A CB    1 
ATOM   2445 C  CG    . TYR E 3 201 ? 39.837  -30.902 -29.020 1.00 31.55 ? 201 TYR A CG    1 
ATOM   2446 C  CD1   . TYR E 3 201 ? 38.876  -31.815 -29.458 1.00 31.18 ? 201 TYR A CD1   1 
ATOM   2447 C  CD2   . TYR E 3 201 ? 41.173  -31.306 -29.014 1.00 33.05 ? 201 TYR A CD2   1 
ATOM   2448 C  CE1   . TYR E 3 201 ? 39.234  -33.092 -29.879 1.00 32.16 ? 201 TYR A CE1   1 
ATOM   2449 C  CE2   . TYR E 3 201 ? 41.545  -32.583 -29.435 1.00 33.70 ? 201 TYR A CE2   1 
ATOM   2450 C  CZ    . TYR E 3 201 ? 40.571  -33.469 -29.869 1.00 33.89 ? 201 TYR A CZ    1 
ATOM   2451 O  OH    . TYR E 3 201 ? 40.943  -34.723 -30.306 1.00 36.58 ? 201 TYR A OH    1 
ATOM   2452 N  N     . VAL E 3 202 ? 37.411  -29.104 -30.899 1.00 30.40 ? 202 VAL A N     1 
ATOM   2453 C  CA    . VAL E 3 202 ? 36.562  -29.659 -31.941 1.00 30.77 ? 202 VAL A CA    1 
ATOM   2454 C  C     . VAL E 3 202 ? 36.655  -28.896 -33.263 1.00 32.15 ? 202 VAL A C     1 
ATOM   2455 O  O     . VAL E 3 202 ? 37.099  -29.447 -34.267 1.00 32.67 ? 202 VAL A O     1 
ATOM   2456 C  CB    . VAL E 3 202 ? 35.087  -29.705 -31.466 1.00 30.45 ? 202 VAL A CB    1 
ATOM   2457 C  CG1   . VAL E 3 202 ? 34.158  -30.019 -32.631 1.00 28.58 ? 202 VAL A CG1   1 
ATOM   2458 C  CG2   . VAL E 3 202 ? 34.933  -30.761 -30.373 1.00 28.85 ? 202 VAL A CG2   1 
ATOM   2459 N  N     . SER E 3 203 ? 36.253  -27.631 -33.260 1.00 33.34 ? 203 SER A N     1 
ATOM   2460 C  CA    . SER E 3 203 ? 36.278  -26.822 -34.477 1.00 35.88 ? 203 SER A CA    1 
ATOM   2461 C  C     . SER E 3 203 ? 37.650  -26.449 -35.044 1.00 37.38 ? 203 SER A C     1 
ATOM   2462 O  O     . SER E 3 203 ? 37.865  -26.557 -36.245 1.00 37.55 ? 203 SER A O     1 
ATOM   2463 C  CB    . SER E 3 203 ? 35.453  -25.546 -34.277 1.00 36.58 ? 203 SER A CB    1 
ATOM   2464 O  OG    . SER E 3 203 ? 35.071  -25.390 -32.918 1.00 39.59 ? 203 SER A OG    1 
ATOM   2465 N  N     . LYS E 3 204 ? 38.581  -26.018 -34.196 1.00 39.80 ? 204 LYS A N     1 
ATOM   2466 C  CA    . LYS E 3 204 ? 39.908  -25.614 -34.672 1.00 41.01 ? 204 LYS A CA    1 
ATOM   2467 C  C     . LYS E 3 204 ? 41.003  -26.686 -34.572 1.00 41.86 ? 204 LYS A C     1 
ATOM   2468 O  O     . LYS E 3 204 ? 41.996  -26.620 -35.294 1.00 42.32 ? 204 LYS A O     1 
ATOM   2469 C  CB    . LYS E 3 204 ? 40.357  -24.336 -33.942 1.00 41.53 ? 204 LYS A CB    1 
ATOM   2470 C  CG    . LYS E 3 204 ? 39.422  -23.109 -34.131 1.00 43.05 ? 204 LYS A CG    1 
ATOM   2471 C  CD    . LYS E 3 204 ? 39.844  -22.069 -35.211 1.00 44.80 ? 204 LYS A CD    1 
ATOM   2472 C  CE    . LYS E 3 204 ? 40.209  -20.702 -34.568 1.00 45.99 ? 204 LYS A CE    1 
ATOM   2473 N  NZ    . LYS E 3 204 ? 39.798  -20.634 -33.132 1.00 47.22 ? 204 LYS A NZ    1 
ATOM   2474 N  N     . GLY E 3 205 ? 40.841  -27.664 -33.684 1.00 42.64 ? 205 GLY A N     1 
ATOM   2475 C  CA    . GLY E 3 205 ? 41.854  -28.702 -33.570 1.00 43.02 ? 205 GLY A CA    1 
ATOM   2476 C  C     . GLY E 3 205 ? 42.786  -28.572 -32.376 1.00 44.17 ? 205 GLY A C     1 
ATOM   2477 O  O     . GLY E 3 205 ? 42.865  -27.523 -31.733 1.00 43.72 ? 205 GLY A O     1 
ATOM   2478 N  N     . TRP E 3 206 ? 43.512  -29.645 -32.091 1.00 44.76 ? 206 TRP A N     1 
ATOM   2479 C  CA    . TRP E 3 206 ? 44.447  -29.696 -30.965 1.00 45.91 ? 206 TRP A CA    1 
ATOM   2480 C  C     . TRP E 3 206 ? 45.522  -28.619 -30.996 1.00 47.18 ? 206 TRP A C     1 
ATOM   2481 O  O     . TRP E 3 206 ? 45.777  -27.946 -29.995 1.00 47.36 ? 206 TRP A O     1 
ATOM   2482 C  CB    . TRP E 3 206 ? 45.122  -31.068 -30.934 1.00 44.28 ? 206 TRP A CB    1 
ATOM   2483 C  CG    . TRP E 3 206 ? 46.085  -31.268 -29.819 1.00 42.27 ? 206 TRP A CG    1 
ATOM   2484 C  CD1   . TRP E 3 206 ? 47.340  -31.791 -29.916 1.00 42.39 ? 206 TRP A CD1   1 
ATOM   2485 C  CD2   . TRP E 3 206 ? 45.858  -31.022 -28.427 1.00 42.25 ? 206 TRP A CD2   1 
ATOM   2486 N  NE1   . TRP E 3 206 ? 47.914  -31.881 -28.674 1.00 41.86 ? 206 TRP A NE1   1 
ATOM   2487 C  CE2   . TRP E 3 206 ? 47.033  -31.403 -27.742 1.00 42.23 ? 206 TRP A CE2   1 
ATOM   2488 C  CE3   . TRP E 3 206 ? 44.793  -30.486 -27.693 1.00 41.87 ? 206 TRP A CE3   1 
ATOM   2489 C  CZ2   . TRP E 3 206 ? 47.156  -31.307 -26.353 1.00 41.97 ? 206 TRP A CZ2   1 
ATOM   2490 C  CZ3   . TRP E 3 206 ? 44.918  -30.388 -26.308 1.00 41.51 ? 206 TRP A CZ3   1 
ATOM   2491 C  CH2   . TRP E 3 206 ? 46.096  -30.782 -25.658 1.00 42.05 ? 206 TRP A CH2   1 
ATOM   2492 N  N     . LYS E 3 207 ? 46.169  -28.488 -32.149 1.00 48.75 ? 207 LYS A N     1 
ATOM   2493 C  CA    . LYS E 3 207 ? 47.235  -27.510 -32.328 1.00 50.37 ? 207 LYS A CA    1 
ATOM   2494 C  C     . LYS E 3 207 ? 46.724  -26.140 -31.943 1.00 50.39 ? 207 LYS A C     1 
ATOM   2495 O  O     . LYS E 3 207 ? 47.341  -25.457 -31.127 1.00 49.75 ? 207 LYS A O     1 
ATOM   2496 C  CB    . LYS E 3 207 ? 47.712  -27.496 -33.774 1.00 51.72 ? 207 LYS A CB    1 
ATOM   2497 C  CG    . LYS E 3 207 ? 48.477  -28.745 -34.175 1.00 53.42 ? 207 LYS A CG    1 
ATOM   2498 C  CD    . LYS E 3 207 ? 47.679  -30.005 -33.833 1.00 56.22 ? 207 LYS A CD    1 
ATOM   2499 C  CE    . LYS E 3 207 ? 48.438  -31.300 -34.122 1.00 57.95 ? 207 LYS A CE    1 
ATOM   2500 N  NZ    . LYS E 3 207 ? 49.364  -31.717 -33.023 1.00 58.77 ? 207 LYS A NZ    1 
ATOM   2501 N  N     . GLU E 3 208 ? 45.592  -25.743 -32.514 1.00 51.29 ? 208 GLU A N     1 
ATOM   2502 C  CA    . GLU E 3 208 ? 45.034  -24.454 -32.181 1.00 52.90 ? 208 GLU A CA    1 
ATOM   2503 C  C     . GLU E 3 208 ? 44.757  -24.194 -30.740 1.00 53.10 ? 208 GLU A C     1 
ATOM   2504 O  O     . GLU E 3 208 ? 44.952  -23.091 -30.220 1.00 53.12 ? 208 GLU A O     1 
ATOM   2505 C  CB    . GLU E 3 208 ? 43.798  -24.181 -33.005 1.00 53.40 ? 208 GLU A CB    1 
ATOM   2506 C  CG    . GLU E 3 208 ? 44.286  -23.182 -33.919 1.00 56.93 ? 208 GLU A CG    1 
ATOM   2507 C  CD    . GLU E 3 208 ? 43.333  -22.209 -34.461 1.00 58.71 ? 208 GLU A CD    1 
ATOM   2508 O  OE1   . GLU E 3 208 ? 43.803  -21.125 -34.627 1.00 59.29 ? 208 GLU A OE1   1 
ATOM   2509 O  OE2   . GLU E 3 208 ? 42.181  -22.447 -34.680 1.00 60.35 ? 208 GLU A OE2   1 
ATOM   2510 N  N     . VAL E 3 209 ? 44.306  -25.245 -30.096 1.00 53.44 ? 209 VAL A N     1 
ATOM   2511 C  CA    . VAL E 3 209 ? 43.974  -25.164 -28.705 1.00 53.24 ? 209 VAL A CA    1 
ATOM   2512 C  C     . VAL E 3 209 ? 45.242  -25.235 -27.875 1.00 53.21 ? 209 VAL A C     1 
ATOM   2513 O  O     . VAL E 3 209 ? 45.402  -24.504 -26.904 1.00 53.28 ? 209 VAL A O     1 
ATOM   2514 C  CB    . VAL E 3 209 ? 42.989  -26.301 -28.337 1.00 53.25 ? 209 VAL A CB    1 
ATOM   2515 C  CG1   . VAL E 3 209 ? 43.696  -27.365 -27.536 1.00 53.41 ? 209 VAL A CG1   1 
ATOM   2516 C  CG2   . VAL E 3 209 ? 41.819  -25.748 -27.594 1.00 54.16 ? 209 VAL A CG2   1 
ATOM   2517 N  N     . GLN E 3 210 ? 46.157  -26.102 -28.284 1.00 53.18 ? 210 GLN A N     1 
ATOM   2518 C  CA    . GLN E 3 210 ? 47.411  -26.255 -27.568 1.00 53.73 ? 210 GLN A CA    1 
ATOM   2519 C  C     . GLN E 3 210 ? 48.168  -24.935 -27.616 1.00 54.02 ? 210 GLN A C     1 
ATOM   2520 O  O     . GLN E 3 210 ? 48.817  -24.534 -26.643 1.00 54.52 ? 210 GLN A O     1 
ATOM   2521 C  CB    . GLN E 3 210 ? 48.262  -27.364 -28.202 1.00 53.66 ? 210 GLN A CB    1 
ATOM   2522 C  CG    . GLN E 3 210 ? 49.370  -27.872 -27.289 1.00 53.93 ? 210 GLN A CG    1 
ATOM   2523 C  CD    . GLN E 3 210 ? 50.248  -28.924 -27.943 1.00 54.54 ? 210 GLN A CD    1 
ATOM   2524 O  OE1   . GLN E 3 210 ? 51.015  -29.614 -27.264 1.00 55.64 ? 210 GLN A OE1   1 
ATOM   2525 N  NE2   . GLN E 3 210 ? 50.149  -29.050 -29.267 1.00 53.38 ? 210 GLN A NE2   1 
ATOM   2526 N  N     . GLU E 3 211 ? 48.073  -24.269 -28.761 1.00 53.95 ? 211 GLU A N     1 
ATOM   2527 C  CA    . GLU E 3 211 ? 48.735  -22.995 -28.982 1.00 53.83 ? 211 GLU A CA    1 
ATOM   2528 C  C     . GLU E 3 211 ? 48.052  -21.854 -28.226 1.00 53.05 ? 211 GLU A C     1 
ATOM   2529 O  O     . GLU E 3 211 ? 48.696  -20.877 -27.853 1.00 53.31 ? 211 GLU A O     1 
ATOM   2530 C  CB    . GLU E 3 211 ? 48.758  -22.697 -30.486 1.00 54.75 ? 211 GLU A CB    1 
ATOM   2531 C  CG    . GLU E 3 211 ? 49.067  -21.250 -30.847 1.00 56.96 ? 211 GLU A CG    1 
ATOM   2532 C  CD    . GLU E 3 211 ? 50.451  -20.806 -30.408 1.00 58.32 ? 211 GLU A CD    1 
ATOM   2533 O  OE1   . GLU E 3 211 ? 50.731  -19.589 -30.477 1.00 58.99 ? 211 GLU A OE1   1 
ATOM   2534 O  OE2   . GLU E 3 211 ? 51.259  -21.670 -30.001 1.00 59.03 ? 211 GLU A OE2   1 
ATOM   2535 N  N     . ALA E 3 212 ? 46.749  -21.981 -27.993 1.00 52.05 ? 212 ALA A N     1 
ATOM   2536 C  CA    . ALA E 3 212 ? 45.998  -20.939 -27.296 1.00 50.43 ? 212 ALA A CA    1 
ATOM   2537 C  C     . ALA E 3 212 ? 46.087  -21.033 -25.777 1.00 49.96 ? 212 ALA A C     1 
ATOM   2538 O  O     . ALA E 3 212 ? 45.844  -20.049 -25.078 1.00 50.84 ? 212 ALA A O     1 
ATOM   2539 C  CB    . ALA E 3 212 ? 44.542  -20.979 -27.726 1.00 49.86 ? 212 ALA A CB    1 
ATOM   2540 N  N     . TYR E 3 213 ? 46.432  -22.210 -25.264 1.00 48.74 ? 213 TYR A N     1 
ATOM   2541 C  CA    . TYR E 3 213 ? 46.529  -22.407 -23.824 1.00 47.33 ? 213 TYR A CA    1 
ATOM   2542 C  C     . TYR E 3 213 ? 47.959  -22.664 -23.352 1.00 47.25 ? 213 TYR A C     1 
ATOM   2543 O  O     . TYR E 3 213 ? 48.176  -23.179 -22.252 1.00 47.32 ? 213 TYR A O     1 
ATOM   2544 C  CB    . TYR E 3 213 ? 45.627  -23.567 -23.397 1.00 45.00 ? 213 TYR A CB    1 
ATOM   2545 C  CG    . TYR E 3 213 ? 44.152  -23.283 -23.552 1.00 43.03 ? 213 TYR A CG    1 
ATOM   2546 C  CD1   . TYR E 3 213 ? 43.525  -23.383 -24.794 1.00 41.62 ? 213 TYR A CD1   1 
ATOM   2547 C  CD2   . TYR E 3 213 ? 43.378  -22.902 -22.454 1.00 42.42 ? 213 TYR A CD2   1 
ATOM   2548 C  CE1   . TYR E 3 213 ? 42.169  -23.112 -24.938 1.00 39.91 ? 213 TYR A CE1   1 
ATOM   2549 C  CE2   . TYR E 3 213 ? 42.018  -22.626 -22.591 1.00 40.80 ? 213 TYR A CE2   1 
ATOM   2550 C  CZ    . TYR E 3 213 ? 41.423  -22.730 -23.833 1.00 39.78 ? 213 TYR A CZ    1 
ATOM   2551 O  OH    . TYR E 3 213 ? 40.091  -22.420 -23.969 1.00 38.79 ? 213 TYR A OH    1 
ATOM   2552 N  N     . SER E 3 219 ? 42.522  -23.016 -14.506 1.00 43.48 ? 219 SER A N     1 
ATOM   2553 C  CA    . SER E 3 219 ? 41.913  -23.550 -13.296 1.00 44.45 ? 219 SER A CA    1 
ATOM   2554 C  C     . SER E 3 219 ? 42.252  -25.022 -13.146 1.00 44.46 ? 219 SER A C     1 
ATOM   2555 O  O     . SER E 3 219 ? 42.619  -25.680 -14.118 1.00 45.28 ? 219 SER A O     1 
ATOM   2556 C  CB    . SER E 3 219 ? 40.392  -23.384 -13.357 1.00 45.06 ? 219 SER A CB    1 
ATOM   2557 O  OG    . SER E 3 219 ? 39.743  -24.255 -12.445 1.00 47.40 ? 219 SER A OG    1 
ATOM   2558 N  N     . PRO E 3 220 ? 42.151  -25.561 -11.921 1.00 44.48 ? 220 PRO A N     1 
ATOM   2559 C  CA    . PRO E 3 220 ? 42.458  -26.978 -11.713 1.00 44.99 ? 220 PRO A CA    1 
ATOM   2560 C  C     . PRO E 3 220 ? 41.509  -27.883 -12.507 1.00 44.86 ? 220 PRO A C     1 
ATOM   2561 O  O     . PRO E 3 220 ? 41.905  -28.935 -13.026 1.00 43.65 ? 220 PRO A O     1 
ATOM   2562 C  CB    . PRO E 3 220 ? 42.316  -27.139 -10.194 1.00 44.79 ? 220 PRO A CB    1 
ATOM   2563 C  CG    . PRO E 3 220 ? 41.358  -26.056 -9.817  1.00 44.66 ? 220 PRO A CG    1 
ATOM   2564 C  CD    . PRO E 3 220 ? 41.846  -24.905 -10.641 1.00 44.25 ? 220 PRO A CD    1 
ATOM   2565 N  N     . GLU E 3 221 ? 40.260  -27.444 -12.605 1.00 45.81 ? 221 GLU A N     1 
ATOM   2566 C  CA    . GLU E 3 221 ? 39.219  -28.165 -13.329 1.00 47.01 ? 221 GLU A CA    1 
ATOM   2567 C  C     . GLU E 3 221 ? 39.455  -28.104 -14.840 1.00 46.95 ? 221 GLU A C     1 
ATOM   2568 O  O     . GLU E 3 221 ? 39.194  -29.067 -15.557 1.00 46.56 ? 221 GLU A O     1 
ATOM   2569 C  CB    . GLU E 3 221 ? 37.869  -27.526 -13.036 1.00 48.68 ? 221 GLU A CB    1 
ATOM   2570 C  CG    . GLU E 3 221 ? 36.691  -28.455 -12.696 1.00 52.35 ? 221 GLU A CG    1 
ATOM   2571 C  CD    . GLU E 3 221 ? 36.865  -29.880 -13.166 1.00 55.15 ? 221 GLU A CD    1 
ATOM   2572 O  OE1   . GLU E 3 221 ? 37.694  -30.595 -12.567 1.00 56.90 ? 221 GLU A OE1   1 
ATOM   2573 O  OE2   . GLU E 3 221 ? 36.171  -30.295 -14.127 1.00 56.22 ? 221 GLU A OE2   1 
ATOM   2574 N  N     . THR E 3 222 ? 39.924  -26.954 -15.317 1.00 46.38 ? 222 THR A N     1 
ATOM   2575 C  CA    . THR E 3 222 ? 40.175  -26.754 -16.736 1.00 46.50 ? 222 THR A CA    1 
ATOM   2576 C  C     . THR E 3 222 ? 41.415  -27.523 -17.163 1.00 46.90 ? 222 THR A C     1 
ATOM   2577 O  O     . THR E 3 222 ? 41.475  -28.054 -18.271 1.00 46.16 ? 222 THR A O     1 
ATOM   2578 C  CB    . THR E 3 222 ? 40.379  -25.255 -17.057 1.00 47.78 ? 222 THR A CB    1 
ATOM   2579 O  OG1   . THR E 3 222 ? 39.303  -24.491 -16.495 1.00 47.71 ? 222 THR A OG1   1 
ATOM   2580 C  CG2   . THR E 3 222 ? 40.422  -25.033 -18.566 1.00 47.80 ? 222 THR A CG2   1 
ATOM   2581 N  N     . GLU E 3 223 ? 42.412  -27.566 -16.285 1.00 47.70 ? 223 GLU A N     1 
ATOM   2582 C  CA    . GLU E 3 223 ? 43.642  -28.292 -16.584 1.00 48.29 ? 223 GLU A CA    1 
ATOM   2583 C  C     . GLU E 3 223 ? 43.285  -29.757 -16.821 1.00 47.51 ? 223 GLU A C     1 
ATOM   2584 O  O     . GLU E 3 223 ? 43.811  -30.400 -17.735 1.00 47.37 ? 223 GLU A O     1 
ATOM   2585 C  CB    . GLU E 3 223 ? 44.643  -28.177 -15.423 1.00 49.87 ? 223 GLU A CB    1 
ATOM   2586 C  CG    . GLU E 3 223 ? 45.924  -27.398 -15.756 1.00 51.13 ? 223 GLU A CG    1 
ATOM   2587 C  CD    . GLU E 3 223 ? 46.636  -27.920 -16.999 1.00 51.85 ? 223 GLU A CD    1 
ATOM   2588 O  OE1   . GLU E 3 223 ? 47.716  -28.532 -16.872 1.00 52.20 ? 223 GLU A OE1   1 
ATOM   2589 O  OE2   . GLU E 3 223 ? 46.111  -27.721 -18.117 1.00 53.50 ? 223 GLU A OE2   1 
ATOM   2590 N  N     . LYS E 3 224 ? 42.387  -30.273 -15.988 1.00 46.89 ? 224 LYS A N     1 
ATOM   2591 C  CA    . LYS E 3 224 ? 41.925  -31.657 -16.099 1.00 46.08 ? 224 LYS A CA    1 
ATOM   2592 C  C     . LYS E 3 224 ? 41.438  -31.917 -17.523 1.00 44.18 ? 224 LYS A C     1 
ATOM   2593 O  O     . LYS E 3 224 ? 41.754  -32.949 -18.115 1.00 43.20 ? 224 LYS A O     1 
ATOM   2594 C  CB    . LYS E 3 224 ? 40.769  -31.912 -15.123 1.00 48.24 ? 224 LYS A CB    1 
ATOM   2595 C  CG    . LYS E 3 224 ? 41.150  -32.384 -13.727 1.00 50.71 ? 224 LYS A CG    1 
ATOM   2596 C  CD    . LYS E 3 224 ? 41.387  -33.882 -13.713 1.00 54.98 ? 224 LYS A CD    1 
ATOM   2597 C  CE    . LYS E 3 224 ? 41.449  -34.447 -12.286 1.00 57.47 ? 224 LYS A CE    1 
ATOM   2598 N  NZ    . LYS E 3 224 ? 40.111  -34.568 -11.613 1.00 58.97 ? 224 LYS A NZ    1 
ATOM   2599 N  N     . VAL E 3 225 ? 40.679  -30.965 -18.066 1.00 42.01 ? 225 VAL A N     1 
ATOM   2600 C  CA    . VAL E 3 225 ? 40.138  -31.083 -19.417 1.00 40.62 ? 225 VAL A CA    1 
ATOM   2601 C  C     . VAL E 3 225 ? 41.230  -31.054 -20.493 1.00 39.78 ? 225 VAL A C     1 
ATOM   2602 O  O     . VAL E 3 225 ? 41.163  -31.824 -21.455 1.00 39.89 ? 225 VAL A O     1 
ATOM   2603 C  CB    . VAL E 3 225 ? 39.079  -29.971 -19.702 1.00 40.36 ? 225 VAL A CB    1 
ATOM   2604 C  CG1   . VAL E 3 225 ? 38.588  -30.054 -21.149 1.00 38.10 ? 225 VAL A CG1   1 
ATOM   2605 C  CG2   . VAL E 3 225 ? 37.903  -30.122 -18.738 1.00 38.44 ? 225 VAL A CG2   1 
ATOM   2606 N  N     . LEU E 3 226 ? 42.227  -30.184 -20.330 1.00 38.16 ? 226 LEU A N     1 
ATOM   2607 C  CA    . LEU E 3 226 ? 43.323  -30.102 -21.295 1.00 37.58 ? 226 LEU A CA    1 
ATOM   2608 C  C     . LEU E 3 226 ? 44.114  -31.411 -21.251 1.00 37.16 ? 226 LEU A C     1 
ATOM   2609 O  O     . LEU E 3 226 ? 44.388  -32.027 -22.286 1.00 36.96 ? 226 LEU A O     1 
ATOM   2610 C  CB    . LEU E 3 226 ? 44.257  -28.933 -20.965 1.00 37.06 ? 226 LEU A CB    1 
ATOM   2611 C  CG    . LEU E 3 226 ? 45.438  -28.823 -21.933 1.00 37.27 ? 226 LEU A CG    1 
ATOM   2612 C  CD1   . LEU E 3 226 ? 44.931  -28.428 -23.319 1.00 36.64 ? 226 LEU A CD1   1 
ATOM   2613 C  CD2   . LEU E 3 226 ? 46.440  -27.815 -21.409 1.00 36.67 ? 226 LEU A CD2   1 
ATOM   2614 N  N     . LYS E 3 227 ? 44.469  -31.825 -20.034 1.00 37.26 ? 227 LYS A N     1 
ATOM   2615 C  CA    . LYS E 3 227 ? 45.228  -33.058 -19.790 1.00 37.39 ? 227 LYS A CA    1 
ATOM   2616 C  C     . LYS E 3 227 ? 44.698  -34.170 -20.634 1.00 35.91 ? 227 LYS A C     1 
ATOM   2617 O  O     . LYS E 3 227 ? 45.441  -34.844 -21.353 1.00 36.32 ? 227 LYS A O     1 
ATOM   2618 C  CB    . LYS E 3 227 ? 45.096  -33.528 -18.333 1.00 40.30 ? 227 LYS A CB    1 
ATOM   2619 C  CG    . LYS E 3 227 ? 46.097  -32.972 -17.366 1.00 43.99 ? 227 LYS A CG    1 
ATOM   2620 C  CD    . LYS E 3 227 ? 47.473  -33.535 -17.748 1.00 46.92 ? 227 LYS A CD    1 
ATOM   2621 C  CE    . LYS E 3 227 ? 48.404  -33.681 -16.526 1.00 49.35 ? 227 LYS A CE    1 
ATOM   2622 N  NZ    . LYS E 3 227 ? 49.686  -34.385 -16.848 1.00 51.46 ? 227 LYS A NZ    1 
ATOM   2623 N  N     . TYR E 3 228 ? 43.392  -34.359 -20.488 1.00 33.26 ? 228 TYR A N     1 
ATOM   2624 C  CA    . TYR E 3 228 ? 42.654  -35.403 -21.161 1.00 30.46 ? 228 TYR A CA    1 
ATOM   2625 C  C     . TYR E 3 228 ? 42.762  -35.288 -22.666 1.00 29.40 ? 228 TYR A C     1 
ATOM   2626 O  O     . TYR E 3 228 ? 43.174  -36.239 -23.335 1.00 28.01 ? 228 TYR A O     1 
ATOM   2627 C  CB    . TYR E 3 228 ? 41.196  -35.345 -20.712 1.00 29.46 ? 228 TYR A CB    1 
ATOM   2628 C  CG    . TYR E 3 228 ? 40.315  -36.412 -21.316 1.00 29.44 ? 228 TYR A CG    1 
ATOM   2629 C  CD1   . TYR E 3 228 ? 39.526  -36.138 -22.441 1.00 28.26 ? 228 TYR A CD1   1 
ATOM   2630 C  CD2   . TYR E 3 228 ? 40.270  -37.699 -20.772 1.00 27.61 ? 228 TYR A CD2   1 
ATOM   2631 C  CE1   . TYR E 3 228 ? 38.714  -37.117 -23.008 1.00 26.89 ? 228 TYR A CE1   1 
ATOM   2632 C  CE2   . TYR E 3 228 ? 39.465  -38.681 -21.332 1.00 26.82 ? 228 TYR A CE2   1 
ATOM   2633 C  CZ    . TYR E 3 228 ? 38.686  -38.382 -22.447 1.00 27.48 ? 228 TYR A CZ    1 
ATOM   2634 O  OH    . TYR E 3 228 ? 37.859  -39.338 -22.984 1.00 27.14 ? 228 TYR A OH    1 
ATOM   2635 N  N     . LEU E 3 229 ? 42.384  -34.126 -23.193 1.00 28.78 ? 229 LEU A N     1 
ATOM   2636 C  CA    . LEU E 3 229 ? 42.451  -33.885 -24.621 1.00 28.34 ? 229 LEU A CA    1 
ATOM   2637 C  C     . LEU E 3 229 ? 43.852  -34.244 -25.093 1.00 29.62 ? 229 LEU A C     1 
ATOM   2638 O  O     . LEU E 3 229 ? 44.027  -34.897 -26.124 1.00 29.11 ? 229 LEU A O     1 
ATOM   2639 C  CB    . LEU E 3 229 ? 42.133  -32.420 -24.913 1.00 26.73 ? 229 LEU A CB    1 
ATOM   2640 C  CG    . LEU E 3 229 ? 40.652  -32.037 -24.938 1.00 25.42 ? 229 LEU A CG    1 
ATOM   2641 C  CD1   . LEU E 3 229 ? 40.508  -30.535 -24.991 1.00 24.14 ? 229 LEU A CD1   1 
ATOM   2642 C  CD2   . LEU E 3 229 ? 39.981  -32.683 -26.142 1.00 24.98 ? 229 LEU A CD2   1 
ATOM   2643 N  N     . GLU E 3 230 ? 44.850  -33.819 -24.322 1.00 31.47 ? 230 GLU A N     1 
ATOM   2644 C  CA    . GLU E 3 230 ? 46.238  -34.119 -24.641 1.00 32.82 ? 230 GLU A CA    1 
ATOM   2645 C  C     . GLU E 3 230 ? 46.457  -35.622 -24.700 1.00 31.84 ? 230 GLU A C     1 
ATOM   2646 O  O     . GLU E 3 230 ? 47.103  -36.143 -25.611 1.00 31.07 ? 230 GLU A O     1 
ATOM   2647 C  CB    . GLU E 3 230 ? 47.165  -33.512 -23.595 1.00 35.36 ? 230 GLU A CB    1 
ATOM   2648 C  CG    . GLU E 3 230 ? 48.612  -33.910 -23.790 1.00 39.17 ? 230 GLU A CG    1 
ATOM   2649 C  CD    . GLU E 3 230 ? 49.481  -33.445 -22.653 1.00 41.97 ? 230 GLU A CD    1 
ATOM   2650 O  OE1   . GLU E 3 230 ? 49.086  -33.665 -21.484 1.00 42.08 ? 230 GLU A OE1   1 
ATOM   2651 O  OE2   . GLU E 3 230 ? 50.557  -32.869 -22.929 1.00 44.65 ? 230 GLU A OE2   1 
ATOM   2652 N  N     . ALA E 3 231 ? 45.915  -36.315 -23.710 1.00 30.98 ? 231 ALA A N     1 
ATOM   2653 C  CA    . ALA E 3 231 ? 46.025  -37.764 -23.662 1.00 31.43 ? 231 ALA A CA    1 
ATOM   2654 C  C     . ALA E 3 231 ? 45.453  -38.353 -24.947 1.00 31.80 ? 231 ALA A C     1 
ATOM   2655 O  O     . ALA E 3 231 ? 46.137  -39.116 -25.627 1.00 32.78 ? 231 ALA A O     1 
ATOM   2656 C  CB    . ALA E 3 231 ? 45.278  -38.306 -22.455 1.00 30.93 ? 231 ALA A CB    1 
ATOM   2657 N  N     . THR E 3 232 ? 44.221  -37.982 -25.288 1.00 31.49 ? 232 THR A N     1 
ATOM   2658 C  CA    . THR E 3 232 ? 43.597  -38.506 -26.494 1.00 32.29 ? 232 THR A CA    1 
ATOM   2659 C  C     . THR E 3 232 ? 44.444  -38.268 -27.745 1.00 33.13 ? 232 THR A C     1 
ATOM   2660 O  O     . THR E 3 232 ? 44.513  -39.109 -28.630 1.00 32.97 ? 232 THR A O     1 
ATOM   2661 C  CB    . THR E 3 232 ? 42.177  -37.924 -26.708 1.00 32.11 ? 232 THR A CB    1 
ATOM   2662 O  OG1   . THR E 3 232 ? 42.203  -36.517 -26.485 1.00 33.69 ? 232 THR A OG1   1 
ATOM   2663 C  CG2   . THR E 3 232 ? 41.193  -38.582 -25.779 1.00 30.92 ? 232 THR A CG2   1 
ATOM   2664 N  N     . GLU E 3 233 ? 45.125  -37.134 -27.820 1.00 33.58 ? 233 GLU A N     1 
ATOM   2665 C  CA    . GLU E 3 233 ? 45.976  -36.865 -28.986 1.00 34.71 ? 233 GLU A CA    1 
ATOM   2666 C  C     . GLU E 3 233 ? 47.217  -37.730 -28.952 1.00 36.41 ? 233 GLU A C     1 
ATOM   2667 O  O     . GLU E 3 233 ? 47.638  -38.273 -29.962 1.00 35.27 ? 233 GLU A O     1 
ATOM   2668 C  CB    . GLU E 3 233 ? 46.433  -35.401 -29.040 1.00 35.28 ? 233 GLU A CB    1 
ATOM   2669 C  CG    . GLU E 3 233 ? 45.399  -34.456 -29.606 1.00 35.49 ? 233 GLU A CG    1 
ATOM   2670 C  CD    . GLU E 3 233 ? 44.773  -34.986 -30.874 1.00 35.52 ? 233 GLU A CD    1 
ATOM   2671 O  OE1   . GLU E 3 233 ? 43.544  -34.821 -31.024 1.00 34.88 ? 233 GLU A OE1   1 
ATOM   2672 O  OE2   . GLU E 3 233 ? 45.509  -35.554 -31.712 1.00 35.94 ? 233 GLU A OE2   1 
ATOM   2673 N  N     . ARG E 3 234 ? 47.784  -37.863 -27.758 1.00 39.70 ? 234 ARG A N     1 
ATOM   2674 C  CA    . ARG E 3 234 ? 48.997  -38.647 -27.516 1.00 42.29 ? 234 ARG A CA    1 
ATOM   2675 C  C     . ARG E 3 234 ? 48.917  -40.122 -27.886 1.00 41.77 ? 234 ARG A C     1 
ATOM   2676 O  O     . ARG E 3 234 ? 49.863  -40.664 -28.455 1.00 41.90 ? 234 ARG A O     1 
ATOM   2677 C  CB    . ARG E 3 234 ? 49.392  -38.554 -26.042 1.00 46.08 ? 234 ARG A CB    1 
ATOM   2678 C  CG    . ARG E 3 234 ? 50.804  -39.008 -25.754 1.00 51.23 ? 234 ARG A CG    1 
ATOM   2679 C  CD    . ARG E 3 234 ? 51.780  -37.869 -26.013 1.00 57.48 ? 234 ARG A CD    1 
ATOM   2680 N  NE    . ARG E 3 234 ? 53.177  -38.287 -25.944 1.00 61.76 ? 234 ARG A NE    1 
ATOM   2681 C  CZ    . ARG E 3 234 ? 54.175  -37.619 -26.520 1.00 63.70 ? 234 ARG A CZ    1 
ATOM   2682 N  NH1   . ARG E 3 234 ? 53.922  -36.507 -27.207 1.00 63.57 ? 234 ARG A NH1   1 
ATOM   2683 N  NH2   . ARG E 3 234 ? 55.424  -38.058 -26.411 1.00 65.11 ? 234 ARG A NH2   1 
ATOM   2684 N  N     . VAL E 3 235 ? 47.806  -40.772 -27.550 1.00 40.53 ? 235 VAL A N     1 
ATOM   2685 C  CA    . VAL E 3 235 ? 47.654  -42.188 -27.853 1.00 40.71 ? 235 VAL A CA    1 
ATOM   2686 C  C     . VAL E 3 235 ? 47.548  -42.464 -29.360 1.00 40.63 ? 235 VAL A C     1 
ATOM   2687 O  O     . VAL E 3 235 ? 47.467  -43.612 -29.797 1.00 40.18 ? 235 VAL A O     1 
ATOM   2688 C  CB    . VAL E 3 235 ? 46.449  -42.792 -27.042 1.00 40.77 ? 235 VAL A CB    1 
ATOM   2689 C  CG1   . VAL E 3 235 ? 45.507  -41.693 -26.642 1.00 42.15 ? 235 VAL A CG1   1 
ATOM   2690 C  CG2   . VAL E 3 235 ? 45.698  -43.818 -27.842 1.00 42.57 ? 235 VAL A CG2   1 
ATOM   2691 N  N     . LYS E 3 236 ? 47.605  -41.404 -30.157 1.00 41.25 ? 236 LYS A N     1 
ATOM   2692 C  CA    . LYS E 3 236 ? 47.525  -41.533 -31.610 1.00 42.19 ? 236 LYS A CA    1 
ATOM   2693 C  C     . LYS E 3 236 ? 48.830  -41.186 -32.317 1.00 42.36 ? 236 LYS A C     1 
ATOM   2694 O  O     . LYS E 3 236 ? 48.919  -41.274 -33.537 1.00 41.99 ? 236 LYS A O     1 
ATOM   2695 C  CB    . LYS E 3 236 ? 46.423  -40.635 -32.173 1.00 42.53 ? 236 LYS A CB    1 
ATOM   2696 C  CG    . LYS E 3 236 ? 45.031  -40.972 -31.685 1.00 44.15 ? 236 LYS A CG    1 
ATOM   2697 C  CD    . LYS E 3 236 ? 44.033  -40.751 -32.801 1.00 44.02 ? 236 LYS A CD    1 
ATOM   2698 C  CE    . LYS E 3 236 ? 42.677  -40.391 -32.258 1.00 44.71 ? 236 LYS A CE    1 
ATOM   2699 N  NZ    . LYS E 3 236 ? 41.724  -40.093 -33.360 1.00 46.07 ? 236 LYS A NZ    1 
ATOM   2700 N  N     . ARG E 3 237 ? 49.835  -40.765 -31.558 1.00 43.23 ? 237 ARG A N     1 
ATOM   2701 C  CA    . ARG E 3 237 ? 51.124  -40.413 -32.147 1.00 44.36 ? 237 ARG A CA    1 
ATOM   2702 C  C     . ARG E 3 237 ? 52.205  -41.378 -31.671 1.00 44.01 ? 237 ARG A C     1 
ATOM   2703 O  O     . ARG E 3 237 ? 53.104  -41.750 -32.422 1.00 42.80 ? 237 ARG A O     1 
ATOM   2704 C  CB    . ARG E 3 237 ? 51.516  -38.979 -31.770 1.00 44.82 ? 237 ARG A CB    1 
ATOM   2705 C  CG    . ARG E 3 237 ? 50.472  -37.942 -32.130 1.00 48.01 ? 237 ARG A CG    1 
ATOM   2706 C  CD    . ARG E 3 237 ? 50.181  -37.905 -33.619 1.00 49.02 ? 237 ARG A CD    1 
ATOM   2707 N  NE    . ARG E 3 237 ? 48.909  -37.241 -33.891 1.00 51.23 ? 237 ARG A NE    1 
ATOM   2708 C  CZ    . ARG E 3 237 ? 48.445  -36.969 -35.109 1.00 52.32 ? 237 ARG A CZ    1 
ATOM   2709 N  NH1   . ARG E 3 237 ? 47.271  -36.364 -35.253 1.00 52.35 ? 237 ARG A NH1   1 
ATOM   2710 N  NH2   . ARG E 3 237 ? 49.155  -37.292 -36.184 1.00 52.89 ? 237 ARG A NH2   1 
ATOM   2711 N  N     . THR E 3 238 ? 52.098  -41.787 -30.416 1.00 44.03 ? 238 THR A N     1 
ATOM   2712 C  CA    . THR E 3 238 ? 53.057  -42.701 -29.819 1.00 44.24 ? 238 THR A CA    1 
ATOM   2713 C  C     . THR E 3 238 ? 53.104  -44.069 -30.486 1.00 44.96 ? 238 THR A C     1 
ATOM   2714 O  O     . THR E 3 238 ? 52.070  -44.608 -30.888 1.00 45.03 ? 238 THR A O     1 
ATOM   2715 C  CB    . THR E 3 238 ? 52.741  -42.929 -28.336 1.00 44.63 ? 238 THR A CB    1 
ATOM   2716 O  OG1   . THR E 3 238 ? 53.775  -43.731 -27.754 1.00 45.02 ? 238 THR A OG1   1 
ATOM   2717 C  CG2   . THR E 3 238 ? 51.390  -43.640 -28.175 1.00 43.35 ? 238 THR A CG2   1 
ATOM   2718 N  N     . LYS E 3 239 ? 54.307  -44.623 -30.608 1.00 46.02 ? 239 LYS A N     1 
ATOM   2719 C  CA    . LYS E 3 239 ? 54.477  -45.951 -31.186 1.00 47.58 ? 239 LYS A CA    1 
ATOM   2720 C  C     . LYS E 3 239 ? 54.549  -46.942 -30.024 1.00 47.40 ? 239 LYS A C     1 
ATOM   2721 O  O     . LYS E 3 239 ? 54.237  -48.120 -30.180 1.00 47.62 ? 239 LYS A O     1 
ATOM   2722 C  CB    . LYS E 3 239 ? 55.765  -46.035 -32.000 1.00 48.88 ? 239 LYS A CB    1 
ATOM   2723 C  CG    . LYS E 3 239 ? 55.787  -45.237 -33.303 1.00 50.89 ? 239 LYS A CG    1 
ATOM   2724 C  CD    . LYS E 3 239 ? 54.781  -45.802 -34.333 1.00 52.61 ? 239 LYS A CD    1 
ATOM   2725 C  CE    . LYS E 3 239 ? 55.160  -45.397 -35.774 1.00 53.39 ? 239 LYS A CE    1 
ATOM   2726 N  NZ    . LYS E 3 239 ? 54.028  -45.473 -36.759 1.00 54.47 ? 239 LYS A NZ    1 
ATOM   2727 N  N     . ASP E 3 240 ? 54.920  -46.439 -28.849 1.00 46.30 ? 240 ASP A N     1 
ATOM   2728 C  CA    . ASP E 3 240 ? 55.044  -47.266 -27.654 1.00 46.25 ? 240 ASP A CA    1 
ATOM   2729 C  C     . ASP E 3 240 ? 53.706  -47.798 -27.135 1.00 46.06 ? 240 ASP A C     1 
ATOM   2730 O  O     . ASP E 3 240 ? 52.826  -47.033 -26.740 1.00 46.57 ? 240 ASP A O     1 
ATOM   2731 C  CB    . ASP E 3 240 ? 55.757  -46.473 -26.548 1.00 46.80 ? 240 ASP A CB    1 
ATOM   2732 C  CG    . ASP E 3 240 ? 56.063  -47.321 -25.309 1.00 47.75 ? 240 ASP A CG    1 
ATOM   2733 O  OD1   . ASP E 3 240 ? 56.660  -46.781 -24.355 1.00 47.41 ? 240 ASP A OD1   1 
ATOM   2734 O  OD2   . ASP E 3 240 ? 55.712  -48.523 -25.281 1.00 49.41 ? 240 ASP A OD2   1 
ATOM   2735 N  N     . GLU E 3 241 ? 53.562  -49.120 -27.135 1.00 45.46 ? 241 GLU A N     1 
ATOM   2736 C  CA    . GLU E 3 241 ? 52.340  -49.752 -26.659 1.00 45.04 ? 241 GLU A CA    1 
ATOM   2737 C  C     . GLU E 3 241 ? 52.211  -49.545 -25.161 1.00 44.18 ? 241 GLU A C     1 
ATOM   2738 O  O     . GLU E 3 241 ? 51.121  -49.330 -24.646 1.00 44.67 ? 241 GLU A O     1 
ATOM   2739 C  CB    . GLU E 3 241 ? 52.361  -51.255 -26.948 1.00 45.80 ? 241 GLU A CB    1 
ATOM   2740 C  CG    . GLU E 3 241 ? 51.210  -51.739 -27.810 1.00 48.50 ? 241 GLU A CG    1 
ATOM   2741 C  CD    . GLU E 3 241 ? 51.162  -53.241 -27.917 1.00 49.69 ? 241 GLU A CD    1 
ATOM   2742 O  OE1   . GLU E 3 241 ? 52.147  -53.856 -28.400 1.00 52.55 ? 241 GLU A OE1   1 
ATOM   2743 O  OE2   . GLU E 3 241 ? 50.146  -53.816 -27.493 1.00 49.45 ? 241 GLU A OE2   1 
ATOM   2744 N  N     . LEU E 3 242 ? 53.330  -49.625 -24.457 1.00 43.31 ? 242 LEU A N     1 
ATOM   2745 C  CA    . LEU E 3 242 ? 53.311  -49.458 -23.013 1.00 43.11 ? 242 LEU A CA    1 
ATOM   2746 C  C     . LEU E 3 242 ? 52.714  -48.122 -22.601 1.00 42.35 ? 242 LEU A C     1 
ATOM   2747 O  O     . LEU E 3 242 ? 52.005  -48.039 -21.594 1.00 42.20 ? 242 LEU A O     1 
ATOM   2748 C  CB    . LEU E 3 242 ? 54.723  -49.601 -22.434 1.00 43.21 ? 242 LEU A CB    1 
ATOM   2749 C  CG    . LEU E 3 242 ? 55.153  -51.014 -22.018 1.00 43.69 ? 242 LEU A CG    1 
ATOM   2750 C  CD1   . LEU E 3 242 ? 54.178  -51.539 -20.975 1.00 43.85 ? 242 LEU A CD1   1 
ATOM   2751 C  CD2   . LEU E 3 242 ? 55.196  -51.936 -23.214 1.00 43.41 ? 242 LEU A CD2   1 
ATOM   2752 N  N     . GLU E 3 243 ? 52.991  -47.078 -23.380 1.00 41.18 ? 243 GLU A N     1 
ATOM   2753 C  CA    . GLU E 3 243 ? 52.463  -45.749 -23.070 1.00 40.22 ? 243 GLU A CA    1 
ATOM   2754 C  C     . GLU E 3 243 ? 50.958  -45.709 -23.343 1.00 39.11 ? 243 GLU A C     1 
ATOM   2755 O  O     . GLU E 3 243 ? 50.200  -45.072 -22.610 1.00 38.98 ? 243 GLU A O     1 
ATOM   2756 C  CB    . GLU E 3 243 ? 53.173  -44.677 -23.900 1.00 41.11 ? 243 GLU A CB    1 
ATOM   2757 C  CG    . GLU E 3 243 ? 52.788  -43.261 -23.518 1.00 42.75 ? 243 GLU A CG    1 
ATOM   2758 C  CD    . GLU E 3 243 ? 53.445  -42.215 -24.396 1.00 44.04 ? 243 GLU A CD    1 
ATOM   2759 O  OE1   . GLU E 3 243 ? 53.206  -41.009 -24.163 1.00 44.85 ? 243 GLU A OE1   1 
ATOM   2760 O  OE2   . GLU E 3 243 ? 54.198  -42.598 -25.317 1.00 44.95 ? 243 GLU A OE2   1 
ATOM   2761 N  N     . ILE E 3 244 ? 50.535  -46.391 -24.404 1.00 37.10 ? 244 ILE A N     1 
ATOM   2762 C  CA    . ILE E 3 244 ? 49.129  -46.458 -24.750 1.00 35.90 ? 244 ILE A CA    1 
ATOM   2763 C  C     . ILE E 3 244 ? 48.392  -47.044 -23.555 1.00 36.36 ? 244 ILE A C     1 
ATOM   2764 O  O     . ILE E 3 244 ? 47.484  -46.426 -23.010 1.00 36.81 ? 244 ILE A O     1 
ATOM   2765 C  CB    . ILE E 3 244 ? 48.895  -47.363 -25.983 1.00 35.23 ? 244 ILE A CB    1 
ATOM   2766 C  CG1   . ILE E 3 244 ? 49.491  -46.705 -27.228 1.00 33.75 ? 244 ILE A CG1   1 
ATOM   2767 C  CG2   . ILE E 3 244 ? 47.406  -47.613 -26.174 1.00 34.23 ? 244 ILE A CG2   1 
ATOM   2768 C  CD1   . ILE E 3 244 ? 49.214  -47.471 -28.513 1.00 32.84 ? 244 ILE A CD1   1 
ATOM   2769 N  N     . ILE E 3 245 ? 48.792  -48.250 -23.166 1.00 36.67 ? 245 ILE A N     1 
ATOM   2770 C  CA    . ILE E 3 245 ? 48.202  -48.955 -22.032 1.00 37.03 ? 245 ILE A CA    1 
ATOM   2771 C  C     . ILE E 3 245 ? 48.137  -48.028 -20.831 1.00 37.96 ? 245 ILE A C     1 
ATOM   2772 O  O     . ILE E 3 245 ? 47.136  -47.963 -20.127 1.00 37.38 ? 245 ILE A O     1 
ATOM   2773 C  CB    . ILE E 3 245 ? 49.040  -50.212 -21.657 1.00 36.40 ? 245 ILE A CB    1 
ATOM   2774 C  CG1   . ILE E 3 245 ? 48.858  -51.291 -22.724 1.00 35.42 ? 245 ILE A CG1   1 
ATOM   2775 C  CG2   . ILE E 3 245 ? 48.632  -50.725 -20.287 1.00 36.19 ? 245 ILE A CG2   1 
ATOM   2776 C  CD1   . ILE E 3 245 ? 49.629  -52.549 -22.439 1.00 33.35 ? 245 ILE A CD1   1 
ATOM   2777 N  N     . HIS E 3 246 ? 49.229  -47.311 -20.612 1.00 40.10 ? 246 HIS A N     1 
ATOM   2778 C  CA    . HIS E 3 246 ? 49.349  -46.372 -19.504 1.00 42.57 ? 246 HIS A CA    1 
ATOM   2779 C  C     . HIS E 3 246 ? 48.258  -45.304 -19.546 1.00 41.62 ? 246 HIS A C     1 
ATOM   2780 O  O     . HIS E 3 246 ? 47.539  -45.094 -18.567 1.00 41.15 ? 246 HIS A O     1 
ATOM   2781 C  CB    . HIS E 3 246 ? 50.704  -45.679 -19.561 1.00 47.63 ? 246 HIS A CB    1 
ATOM   2782 C  CG    . HIS E 3 246 ? 51.452  -45.707 -18.261 1.00 52.95 ? 246 HIS A CG    1 
ATOM   2783 N  ND1   . HIS E 3 246 ? 52.495  -44.837 -17.992 1.00 55.80 ? 246 HIS A ND1   1 
ATOM   2784 C  CD2   . HIS E 3 246 ? 51.345  -46.507 -17.180 1.00 55.30 ? 246 HIS A CD2   1 
ATOM   2785 C  CE1   . HIS E 3 246 ? 52.988  -45.107 -16.797 1.00 56.52 ? 246 HIS A CE1   1 
ATOM   2786 N  NE2   . HIS E 3 246 ? 52.313  -46.114 -16.276 1.00 56.50 ? 246 HIS A NE2   1 
ATOM   2787 N  N     . LEU E 3 247 ? 48.150  -44.621 -20.682 1.00 40.08 ? 247 LEU A N     1 
ATOM   2788 C  CA    . LEU E 3 247 ? 47.152  -43.563 -20.866 1.00 39.48 ? 247 LEU A CA    1 
ATOM   2789 C  C     . LEU E 3 247 ? 45.726  -44.099 -20.714 1.00 39.45 ? 247 LEU A C     1 
ATOM   2790 O  O     . LEU E 3 247 ? 44.846  -43.420 -20.164 1.00 39.78 ? 247 LEU A O     1 
ATOM   2791 C  CB    . LEU E 3 247 ? 47.315  -42.923 -22.241 1.00 38.59 ? 247 LEU A CB    1 
ATOM   2792 C  CG    . LEU E 3 247 ? 48.604  -42.119 -22.393 1.00 37.26 ? 247 LEU A CG    1 
ATOM   2793 C  CD1   . LEU E 3 247 ? 48.724  -41.566 -23.801 1.00 35.94 ? 247 LEU A CD1   1 
ATOM   2794 C  CD2   . LEU E 3 247 ? 48.599  -40.996 -21.367 1.00 36.58 ? 247 LEU A CD2   1 
ATOM   2795 N  N     . ILE E 3 248 ? 45.504  -45.318 -21.200 1.00 37.90 ? 248 ILE A N     1 
ATOM   2796 C  CA    . ILE E 3 248 ? 44.201  -45.943 -21.096 1.00 36.83 ? 248 ILE A CA    1 
ATOM   2797 C  C     . ILE E 3 248 ? 43.851  -46.037 -19.616 1.00 37.51 ? 248 ILE A C     1 
ATOM   2798 O  O     . ILE E 3 248 ? 42.737  -45.717 -19.202 1.00 38.80 ? 248 ILE A O     1 
ATOM   2799 C  CB    . ILE E 3 248 ? 44.221  -47.344 -21.729 1.00 35.05 ? 248 ILE A CB    1 
ATOM   2800 C  CG1   . ILE E 3 248 ? 44.452  -47.217 -23.233 1.00 33.15 ? 248 ILE A CG1   1 
ATOM   2801 C  CG2   . ILE E 3 248 ? 42.924  -48.068 -21.459 1.00 34.62 ? 248 ILE A CG2   1 
ATOM   2802 C  CD1   . ILE E 3 248 ? 44.472  -48.533 -23.951 1.00 34.90 ? 248 ILE A CD1   1 
ATOM   2803 N  N     . ASP E 3 249 ? 44.816  -46.467 -18.819 1.00 37.73 ? 249 ASP A N     1 
ATOM   2804 C  CA    . ASP E 3 249 ? 44.615  -46.600 -17.383 1.00 38.61 ? 249 ASP A CA    1 
ATOM   2805 C  C     . ASP E 3 249 ? 44.342  -45.250 -16.719 1.00 38.16 ? 249 ASP A C     1 
ATOM   2806 O  O     . ASP E 3 249 ? 43.406  -45.103 -15.937 1.00 36.94 ? 249 ASP A O     1 
ATOM   2807 C  CB    . ASP E 3 249 ? 45.856  -47.229 -16.749 1.00 40.54 ? 249 ASP A CB    1 
ATOM   2808 C  CG    . ASP E 3 249 ? 45.816  -48.747 -16.751 1.00 41.92 ? 249 ASP A CG    1 
ATOM   2809 O  OD1   . ASP E 3 249 ? 45.349  -49.352 -17.740 1.00 42.81 ? 249 ASP A OD1   1 
ATOM   2810 O  OD2   . ASP E 3 249 ? 46.274  -49.339 -15.753 1.00 44.42 ? 249 ASP A OD2   1 
ATOM   2811 N  N     . GLU E 3 250 ? 45.168  -44.264 -17.042 1.00 38.34 ? 250 GLU A N     1 
ATOM   2812 C  CA    . GLU E 3 250 ? 45.045  -42.939 -16.455 1.00 38.70 ? 250 GLU A CA    1 
ATOM   2813 C  C     . GLU E 3 250 ? 43.816  -42.134 -16.872 1.00 38.02 ? 250 GLU A C     1 
ATOM   2814 O  O     . GLU E 3 250 ? 43.249  -41.399 -16.058 1.00 37.55 ? 250 GLU A O     1 
ATOM   2815 C  CB    . GLU E 3 250 ? 46.305  -42.116 -16.746 1.00 39.97 ? 250 GLU A CB    1 
ATOM   2816 C  CG    . GLU E 3 250 ? 46.939  -41.531 -15.492 1.00 42.84 ? 250 GLU A CG    1 
ATOM   2817 C  CD    . GLU E 3 250 ? 47.962  -40.454 -15.796 1.00 44.62 ? 250 GLU A CD    1 
ATOM   2818 O  OE1   . GLU E 3 250 ? 49.084  -40.781 -16.257 1.00 46.58 ? 250 GLU A OE1   1 
ATOM   2819 O  OE2   . GLU E 3 250 ? 47.640  -39.269 -15.575 1.00 44.84 ? 250 GLU A OE2   1 
ATOM   2820 N  N     . TYR E 3 251 ? 43.396  -42.260 -18.126 1.00 37.34 ? 251 TYR A N     1 
ATOM   2821 C  CA    . TYR E 3 251 ? 42.254  -41.481 -18.573 1.00 36.74 ? 251 TYR A CA    1 
ATOM   2822 C  C     . TYR E 3 251 ? 41.038  -42.272 -19.039 1.00 36.26 ? 251 TYR A C     1 
ATOM   2823 O  O     . TYR E 3 251 ? 40.170  -41.732 -19.725 1.00 37.00 ? 251 TYR A O     1 
ATOM   2824 C  CB    . TYR E 3 251 ? 42.701  -40.499 -19.661 1.00 35.56 ? 251 TYR A CB    1 
ATOM   2825 C  CG    . TYR E 3 251 ? 43.820  -39.582 -19.212 1.00 35.57 ? 251 TYR A CG    1 
ATOM   2826 C  CD1   . TYR E 3 251 ? 45.150  -39.870 -19.524 1.00 35.16 ? 251 TYR A CD1   1 
ATOM   2827 C  CD2   . TYR E 3 251 ? 43.555  -38.446 -18.440 1.00 35.54 ? 251 TYR A CD2   1 
ATOM   2828 C  CE1   . TYR E 3 251 ? 46.193  -39.054 -19.084 1.00 33.65 ? 251 TYR A CE1   1 
ATOM   2829 C  CE2   . TYR E 3 251 ? 44.595  -37.619 -17.988 1.00 35.31 ? 251 TYR A CE2   1 
ATOM   2830 C  CZ    . TYR E 3 251 ? 45.914  -37.931 -18.317 1.00 34.86 ? 251 TYR A CZ    1 
ATOM   2831 O  OH    . TYR E 3 251 ? 46.948  -37.117 -17.890 1.00 34.28 ? 251 TYR A OH    1 
ATOM   2832 N  N     . ARG E 3 252 ? 40.956  -43.540 -18.657 1.00 34.73 ? 252 ARG A N     1 
ATOM   2833 C  CA    . ARG E 3 252 ? 39.812  -44.346 -19.058 1.00 34.25 ? 252 ARG A CA    1 
ATOM   2834 C  C     . ARG E 3 252 ? 39.490  -44.171 -20.531 1.00 32.59 ? 252 ARG A C     1 
ATOM   2835 O  O     . ARG E 3 252 ? 38.336  -43.939 -20.876 1.00 32.98 ? 252 ARG A O     1 
ATOM   2836 C  CB    . ARG E 3 252 ? 38.571  -43.951 -18.253 1.00 36.03 ? 252 ARG A CB    1 
ATOM   2837 C  CG    . ARG E 3 252 ? 38.430  -44.657 -16.921 1.00 41.00 ? 252 ARG A CG    1 
ATOM   2838 C  CD    . ARG E 3 252 ? 37.282  -45.642 -16.861 1.00 42.89 ? 252 ARG A CD    1 
ATOM   2839 N  NE    . ARG E 3 252 ? 36.016  -45.096 -16.517 1.00 46.91 ? 252 ARG A NE    1 
ATOM   2840 C  CZ    . ARG E 3 252 ? 34.960  -45.618 -15.896 1.00 48.79 ? 252 ARG A CZ    1 
ATOM   2841 N  NH1   . ARG E 3 252 ? 34.838  -46.851 -15.408 1.00 49.33 ? 252 ARG A NH1   1 
ATOM   2842 N  NH2   . ARG E 3 252 ? 33.950  -44.796 -15.804 1.00 49.44 ? 252 ARG A NH2   1 
ATOM   2843 N  N     . LEU E 3 253 ? 40.492  -44.249 -21.398 1.00 29.72 ? 253 LEU A N     1 
ATOM   2844 C  CA    . LEU E 3 253 ? 40.236  -44.114 -22.825 1.00 28.82 ? 253 LEU A CA    1 
ATOM   2845 C  C     . LEU E 3 253 ? 39.665  -45.460 -23.297 1.00 28.47 ? 253 LEU A C     1 
ATOM   2846 O  O     . LEU E 3 253 ? 40.040  -46.515 -22.775 1.00 30.62 ? 253 LEU A O     1 
ATOM   2847 C  CB    . LEU E 3 253 ? 41.533  -43.776 -23.568 1.00 29.17 ? 253 LEU A CB    1 
ATOM   2848 C  CG    . LEU E 3 253 ? 42.271  -42.500 -23.129 1.00 28.64 ? 253 LEU A CG    1 
ATOM   2849 C  CD1   . LEU E 3 253 ? 43.559  -42.360 -23.924 1.00 26.92 ? 253 LEU A CD1   1 
ATOM   2850 C  CD2   . LEU E 3 253 ? 41.395  -41.275 -23.341 1.00 27.26 ? 253 LEU A CD2   1 
ATOM   2851 N  N     . VAL E 3 254 ? 38.742  -45.435 -24.252 1.00 25.28 ? 254 VAL A N     1 
ATOM   2852 C  CA    . VAL E 3 254 ? 38.140  -46.670 -24.731 1.00 22.41 ? 254 VAL A CA    1 
ATOM   2853 C  C     . VAL E 3 254 ? 38.522  -46.970 -26.183 1.00 22.15 ? 254 VAL A C     1 
ATOM   2854 O  O     . VAL E 3 254 ? 39.208  -46.174 -26.820 1.00 20.59 ? 254 VAL A O     1 
ATOM   2855 C  CB    . VAL E 3 254 ? 36.593  -46.630 -24.568 1.00 21.58 ? 254 VAL A CB    1 
ATOM   2856 C  CG1   . VAL E 3 254 ? 36.235  -46.628 -23.108 1.00 18.11 ? 254 VAL A CG1   1 
ATOM   2857 C  CG2   . VAL E 3 254 ? 36.008  -45.395 -25.242 1.00 19.55 ? 254 VAL A CG2   1 
ATOM   2858 N  N     . ARG E 3 255 ? 38.076  -48.121 -26.689 1.00 22.20 ? 255 ARG A N     1 
ATOM   2859 C  CA    . ARG E 3 255 ? 38.374  -48.579 -28.048 1.00 21.62 ? 255 ARG A CA    1 
ATOM   2860 C  C     . ARG E 3 255 ? 38.452  -47.489 -29.126 1.00 22.39 ? 255 ARG A C     1 
ATOM   2861 O  O     . ARG E 3 255 ? 39.457  -47.387 -29.845 1.00 22.10 ? 255 ARG A O     1 
ATOM   2862 C  CB    . ARG E 3 255 ? 37.351  -49.634 -28.474 1.00 20.36 ? 255 ARG A CB    1 
ATOM   2863 C  CG    . ARG E 3 255 ? 37.865  -50.561 -29.555 1.00 19.95 ? 255 ARG A CG    1 
ATOM   2864 C  CD    . ARG E 3 255 ? 36.796  -51.489 -30.117 1.00 18.75 ? 255 ARG A CD    1 
ATOM   2865 N  NE    . ARG E 3 255 ? 35.756  -50.756 -30.833 1.00 19.21 ? 255 ARG A NE    1 
ATOM   2866 C  CZ    . ARG E 3 255 ? 34.635  -50.306 -30.275 1.00 18.79 ? 255 ARG A CZ    1 
ATOM   2867 N  NH1   . ARG E 3 255 ? 33.748  -49.639 -31.002 1.00 18.72 ? 255 ARG A NH1   1 
ATOM   2868 N  NH2   . ARG E 3 255 ? 34.390  -50.539 -28.995 1.00 17.92 ? 255 ARG A NH2   1 
ATOM   2869 N  N     . GLU E 3 256 ? 37.388  -46.695 -29.245 1.00 22.55 ? 256 GLU A N     1 
ATOM   2870 C  CA    . GLU E 3 256 ? 37.319  -45.612 -30.232 1.00 23.51 ? 256 GLU A CA    1 
ATOM   2871 C  C     . GLU E 3 256 ? 38.516  -44.654 -30.163 1.00 24.09 ? 256 GLU A C     1 
ATOM   2872 O  O     . GLU E 3 256 ? 38.833  -43.965 -31.135 1.00 23.82 ? 256 GLU A O     1 
ATOM   2873 C  CB    . GLU E 3 256 ? 36.028  -44.803 -30.049 1.00 22.04 ? 256 GLU A CB    1 
ATOM   2874 C  CG    . GLU E 3 256 ? 34.750  -45.577 -30.284 1.00 23.85 ? 256 GLU A CG    1 
ATOM   2875 C  CD    . GLU E 3 256 ? 34.332  -46.422 -29.092 1.00 26.23 ? 256 GLU A CD    1 
ATOM   2876 O  OE1   . GLU E 3 256 ? 35.196  -46.773 -28.260 1.00 26.18 ? 256 GLU A OE1   1 
ATOM   2877 O  OE2   . GLU E 3 256 ? 33.132  -46.754 -28.992 1.00 27.52 ? 256 GLU A OE2   1 
ATOM   2878 N  N     . HIS E 3 257 ? 39.175  -44.625 -29.010 1.00 24.51 ? 257 HIS A N     1 
ATOM   2879 C  CA    . HIS E 3 257 ? 40.315  -43.748 -28.783 1.00 25.65 ? 257 HIS A CA    1 
ATOM   2880 C  C     . HIS E 3 257 ? 41.608  -44.227 -29.403 1.00 26.59 ? 257 HIS A C     1 
ATOM   2881 O  O     . HIS E 3 257 ? 42.552  -43.451 -29.572 1.00 28.62 ? 257 HIS A O     1 
ATOM   2882 C  CB    . HIS E 3 257 ? 40.541  -43.565 -27.281 1.00 23.82 ? 257 HIS A CB    1 
ATOM   2883 C  CG    . HIS E 3 257 ? 39.522  -42.693 -26.621 1.00 22.54 ? 257 HIS A CG    1 
ATOM   2884 N  ND1   . HIS E 3 257 ? 39.321  -41.381 -26.990 1.00 21.87 ? 257 HIS A ND1   1 
ATOM   2885 C  CD2   . HIS E 3 257 ? 38.658  -42.939 -25.610 1.00 22.19 ? 257 HIS A CD2   1 
ATOM   2886 C  CE1   . HIS E 3 257 ? 38.374  -40.855 -26.232 1.00 23.74 ? 257 HIS A CE1   1 
ATOM   2887 N  NE2   . HIS E 3 257 ? 37.956  -41.779 -25.386 1.00 23.95 ? 257 HIS A NE2   1 
ATOM   2888 N  N     . LEU E 3 258 ? 41.650  -45.504 -29.746 1.00 27.56 ? 258 LEU A N     1 
ATOM   2889 C  CA    . LEU E 3 258 ? 42.850  -46.103 -30.302 1.00 28.04 ? 258 LEU A CA    1 
ATOM   2890 C  C     . LEU E 3 258 ? 42.900  -46.212 -31.818 1.00 29.06 ? 258 LEU A C     1 
ATOM   2891 O  O     . LEU E 3 258 ? 41.868  -46.336 -32.475 1.00 30.01 ? 258 LEU A O     1 
ATOM   2892 C  CB    . LEU E 3 258 ? 43.043  -47.490 -29.682 1.00 26.42 ? 258 LEU A CB    1 
ATOM   2893 C  CG    . LEU E 3 258 ? 43.674  -47.485 -28.292 1.00 24.76 ? 258 LEU A CG    1 
ATOM   2894 C  CD1   . LEU E 3 258 ? 43.061  -46.416 -27.436 1.00 24.86 ? 258 LEU A CD1   1 
ATOM   2895 C  CD2   . LEU E 3 258 ? 43.498  -48.836 -27.665 1.00 24.71 ? 258 LEU A CD2   1 
ATOM   2896 N  N     . LEU E 3 259 ? 44.112  -46.147 -32.365 1.00 29.60 ? 259 LEU A N     1 
ATOM   2897 C  CA    . LEU E 3 259 ? 44.304  -46.292 -33.797 1.00 30.51 ? 259 LEU A CA    1 
ATOM   2898 C  C     . LEU E 3 259 ? 43.986  -47.744 -34.062 1.00 31.63 ? 259 LEU A C     1 
ATOM   2899 O  O     . LEU E 3 259 ? 44.387  -48.611 -33.303 1.00 32.38 ? 259 LEU A O     1 
ATOM   2900 C  CB    . LEU E 3 259 ? 45.746  -45.991 -34.181 1.00 30.34 ? 259 LEU A CB    1 
ATOM   2901 C  CG    . LEU E 3 259 ? 46.179  -44.524 -34.064 1.00 30.89 ? 259 LEU A CG    1 
ATOM   2902 C  CD1   . LEU E 3 259 ? 47.649  -44.406 -34.385 1.00 30.20 ? 259 LEU A CD1   1 
ATOM   2903 C  CD2   . LEU E 3 259 ? 45.358  -43.653 -35.018 1.00 31.06 ? 259 LEU A CD2   1 
ATOM   2904 N  N     . THR E 3 260 ? 43.255  -48.010 -35.130 1.00 33.25 ? 260 THR A N     1 
ATOM   2905 C  CA    . THR E 3 260 ? 42.857  -49.373 -35.443 1.00 35.88 ? 260 THR A CA    1 
ATOM   2906 C  C     . THR E 3 260 ? 44.001  -50.379 -35.600 1.00 35.51 ? 260 THR A C     1 
ATOM   2907 O  O     . THR E 3 260 ? 43.770  -51.583 -35.581 1.00 35.51 ? 260 THR A O     1 
ATOM   2908 C  CB    . THR E 3 260 ? 41.947  -49.401 -36.698 1.00 37.13 ? 260 THR A CB    1 
ATOM   2909 O  OG1   . THR E 3 260 ? 42.342  -50.463 -37.570 1.00 41.32 ? 260 THR A OG1   1 
ATOM   2910 C  CG2   . THR E 3 260 ? 42.029  -48.090 -37.432 1.00 39.28 ? 260 THR A CG2   1 
ATOM   2911 N  N     . ILE E 3 261 ? 45.232  -49.898 -35.724 1.00 36.07 ? 261 ILE A N     1 
ATOM   2912 C  CA    . ILE E 3 261 ? 46.361  -50.812 -35.845 1.00 37.02 ? 261 ILE A CA    1 
ATOM   2913 C  C     . ILE E 3 261 ? 46.697  -51.433 -34.487 1.00 36.79 ? 261 ILE A C     1 
ATOM   2914 O  O     . ILE E 3 261 ? 47.294  -52.510 -34.412 1.00 37.21 ? 261 ILE A O     1 
ATOM   2915 C  CB    . ILE E 3 261 ? 47.615  -50.107 -36.418 1.00 38.15 ? 261 ILE A CB    1 
ATOM   2916 C  CG1   . ILE E 3 261 ? 47.492  -48.585 -36.266 1.00 41.24 ? 261 ILE A CG1   1 
ATOM   2917 C  CG2   . ILE E 3 261 ? 47.811  -50.506 -37.867 1.00 39.59 ? 261 ILE A CG2   1 
ATOM   2918 C  CD1   . ILE E 3 261 ? 48.072  -47.767 -37.432 1.00 42.57 ? 261 ILE A CD1   1 
ATOM   2919 N  N     . HIS E 3 262 ? 46.282  -50.761 -33.419 1.00 35.47 ? 262 HIS A N     1 
ATOM   2920 C  CA    . HIS E 3 262 ? 46.531  -51.222 -32.058 1.00 34.79 ? 262 HIS A CA    1 
ATOM   2921 C  C     . HIS E 3 262 ? 45.534  -52.283 -31.631 1.00 34.60 ? 262 HIS A C     1 
ATOM   2922 O  O     . HIS E 3 262 ? 45.779  -53.020 -30.672 1.00 33.42 ? 262 HIS A O     1 
ATOM   2923 C  CB    . HIS E 3 262 ? 46.451  -50.044 -31.095 1.00 35.33 ? 262 HIS A CB    1 
ATOM   2924 C  CG    . HIS E 3 262 ? 47.425  -48.951 -31.402 1.00 36.80 ? 262 HIS A CG    1 
ATOM   2925 N  ND1   . HIS E 3 262 ? 47.072  -47.621 -31.406 1.00 36.94 ? 262 HIS A ND1   1 
ATOM   2926 C  CD2   . HIS E 3 262 ? 48.739  -48.994 -31.727 1.00 37.70 ? 262 HIS A CD2   1 
ATOM   2927 C  CE1   . HIS E 3 262 ? 48.125  -46.888 -31.725 1.00 37.73 ? 262 HIS A CE1   1 
ATOM   2928 N  NE2   . HIS E 3 262 ? 49.148  -47.698 -31.924 1.00 38.67 ? 262 HIS A NE2   1 
ATOM   2929 N  N     . LEU E 3 263 ? 44.409  -52.345 -32.339 1.00 34.52 ? 263 LEU A N     1 
ATOM   2930 C  CA    . LEU E 3 263 ? 43.356  -53.300 -32.029 1.00 35.11 ? 263 LEU A CA    1 
ATOM   2931 C  C     . LEU E 3 263 ? 43.666  -54.733 -32.427 1.00 36.18 ? 263 LEU A C     1 
ATOM   2932 O  O     . LEU E 3 263 ? 42.758  -55.549 -32.574 1.00 36.16 ? 263 LEU A O     1 
ATOM   2933 C  CB    . LEU E 3 263 ? 42.042  -52.867 -32.679 1.00 34.80 ? 263 LEU A CB    1 
ATOM   2934 C  CG    . LEU E 3 263 ? 41.142  -51.905 -31.897 1.00 34.82 ? 263 LEU A CG    1 
ATOM   2935 C  CD1   . LEU E 3 263 ? 41.758  -51.564 -30.546 1.00 34.01 ? 263 LEU A CD1   1 
ATOM   2936 C  CD2   . LEU E 3 263 ? 40.913  -50.658 -32.730 1.00 35.02 ? 263 LEU A CD2   1 
ATOM   2937 N  N     . LYS E 3 264 ? 44.944  -55.040 -32.619 1.00 37.25 ? 264 LYS A N     1 
ATOM   2938 C  CA    . LYS E 3 264 ? 45.334  -56.392 -32.979 1.00 38.05 ? 264 LYS A CA    1 
ATOM   2939 C  C     . LYS E 3 264 ? 46.245  -56.908 -31.873 1.00 38.04 ? 264 LYS A C     1 
ATOM   2940 O  O     . LYS E 3 264 ? 46.659  -58.070 -31.873 1.00 37.72 ? 264 LYS A O     1 
ATOM   2941 C  CB    . LYS E 3 264 ? 46.067  -56.406 -34.320 1.00 38.85 ? 264 LYS A CB    1 
ATOM   2942 C  CG    . LYS E 3 264 ? 45.880  -57.720 -35.104 1.00 42.10 ? 264 LYS A CG    1 
ATOM   2943 C  CD    . LYS E 3 264 ? 44.875  -57.555 -36.246 1.00 43.65 ? 264 LYS A CD    1 
ATOM   2944 C  CE    . LYS E 3 264 ? 44.567  -58.885 -36.934 1.00 44.70 ? 264 LYS A CE    1 
ATOM   2945 N  NZ    . LYS E 3 264 ? 43.775  -58.694 -38.193 1.00 45.62 ? 264 LYS A NZ    1 
ATOM   2946 N  N     . SER E 3 265 ? 46.540  -56.025 -30.922 1.00 37.52 ? 265 SER A N     1 
ATOM   2947 C  CA    . SER E 3 265 ? 47.396  -56.358 -29.793 1.00 37.16 ? 265 SER A CA    1 
ATOM   2948 C  C     . SER E 3 265 ? 46.662  -56.916 -28.588 1.00 36.88 ? 265 SER A C     1 
ATOM   2949 O  O     . SER E 3 265 ? 45.839  -56.241 -27.978 1.00 36.76 ? 265 SER A O     1 
ATOM   2950 C  CB    . SER E 3 265 ? 48.164  -55.143 -29.321 1.00 37.70 ? 265 SER A CB    1 
ATOM   2951 O  OG    . SER E 3 265 ? 48.399  -55.283 -27.933 1.00 38.93 ? 265 SER A OG    1 
ATOM   2952 N  N     . LYS E 3 266 ? 47.010  -58.139 -28.227 1.00 37.06 ? 266 LYS A N     1 
ATOM   2953 C  CA    . LYS E 3 266 ? 46.419  -58.825 -27.096 1.00 37.31 ? 266 LYS A CA    1 
ATOM   2954 C  C     . LYS E 3 266 ? 46.466  -57.962 -25.831 1.00 37.68 ? 266 LYS A C     1 
ATOM   2955 O  O     . LYS E 3 266 ? 45.467  -57.831 -25.119 1.00 38.19 ? 266 LYS A O     1 
ATOM   2956 C  CB    . LYS E 3 266 ? 47.186  -60.121 -26.864 1.00 37.28 ? 266 LYS A CB    1 
ATOM   2957 C  CG    . LYS E 3 266 ? 46.496  -61.141 -25.984 1.00 38.54 ? 266 LYS A CG    1 
ATOM   2958 C  CD    . LYS E 3 266 ? 47.549  -62.067 -25.402 1.00 38.12 ? 266 LYS A CD    1 
ATOM   2959 C  CE    . LYS E 3 266 ? 47.019  -63.457 -25.146 1.00 39.09 ? 266 LYS A CE    1 
ATOM   2960 N  NZ    . LYS E 3 266 ? 48.114  -64.316 -24.631 1.00 37.58 ? 266 LYS A NZ    1 
ATOM   2961 N  N     . GLU E 3 267 ? 47.623  -57.368 -25.554 1.00 37.58 ? 267 GLU A N     1 
ATOM   2962 C  CA    . GLU E 3 267 ? 47.776  -56.550 -24.355 1.00 37.74 ? 267 GLU A CA    1 
ATOM   2963 C  C     . GLU E 3 267 ? 46.948  -55.271 -24.321 1.00 36.62 ? 267 GLU A C     1 
ATOM   2964 O  O     . GLU E 3 267 ? 46.565  -54.812 -23.241 1.00 37.10 ? 267 GLU A O     1 
ATOM   2965 C  CB    . GLU E 3 267 ? 49.260  -56.240 -24.109 1.00 38.98 ? 267 GLU A CB    1 
ATOM   2966 C  CG    . GLU E 3 267 ? 50.054  -57.466 -23.660 1.00 41.20 ? 267 GLU A CG    1 
ATOM   2967 C  CD    . GLU E 3 267 ? 49.417  -58.163 -22.464 1.00 42.39 ? 267 GLU A CD    1 
ATOM   2968 O  OE1   . GLU E 3 267 ? 49.331  -59.411 -22.471 1.00 44.06 ? 267 GLU A OE1   1 
ATOM   2969 O  OE2   . GLU E 3 267 ? 49.005  -57.469 -21.514 1.00 43.53 ? 267 GLU A OE2   1 
ATOM   2970 N  N     . ILE E 3 268 ? 46.666  -54.696 -25.488 1.00 35.26 ? 268 ILE A N     1 
ATOM   2971 C  CA    . ILE E 3 268 ? 45.844  -53.482 -25.556 1.00 34.25 ? 268 ILE A CA    1 
ATOM   2972 C  C     . ILE E 3 268 ? 44.436  -53.798 -25.012 1.00 33.69 ? 268 ILE A C     1 
ATOM   2973 O  O     . ILE E 3 268 ? 43.901  -53.079 -24.161 1.00 33.56 ? 268 ILE A O     1 
ATOM   2974 C  CB    . ILE E 3 268 ? 45.703  -52.969 -27.020 1.00 33.42 ? 268 ILE A CB    1 
ATOM   2975 C  CG1   . ILE E 3 268 ? 47.056  -52.520 -27.562 1.00 32.83 ? 268 ILE A CG1   1 
ATOM   2976 C  CG2   . ILE E 3 268 ? 44.733  -51.807 -27.079 1.00 31.94 ? 268 ILE A CG2   1 
ATOM   2977 C  CD1   . ILE E 3 268 ? 47.606  -51.285 -26.896 1.00 32.65 ? 268 ILE A CD1   1 
ATOM   2978 N  N     . TRP E 3 269 ? 43.856  -54.888 -25.510 1.00 32.57 ? 269 TRP A N     1 
ATOM   2979 C  CA    . TRP E 3 269 ? 42.531  -55.310 -25.100 1.00 32.62 ? 269 TRP A CA    1 
ATOM   2980 C  C     . TRP E 3 269 ? 42.475  -55.755 -23.645 1.00 34.13 ? 269 TRP A C     1 
ATOM   2981 O  O     . TRP E 3 269 ? 41.484  -55.503 -22.958 1.00 34.71 ? 269 TRP A O     1 
ATOM   2982 C  CB    . TRP E 3 269 ? 42.033  -56.435 -26.003 1.00 30.55 ? 269 TRP A CB    1 
ATOM   2983 C  CG    . TRP E 3 269 ? 41.712  -55.998 -27.395 1.00 29.85 ? 269 TRP A CG    1 
ATOM   2984 C  CD1   . TRP E 3 269 ? 42.576  -55.911 -28.448 1.00 29.21 ? 269 TRP A CD1   1 
ATOM   2985 C  CD2   . TRP E 3 269 ? 40.424  -55.630 -27.903 1.00 29.17 ? 269 TRP A CD2   1 
ATOM   2986 N  NE1   . TRP E 3 269 ? 41.908  -55.522 -29.581 1.00 28.06 ? 269 TRP A NE1   1 
ATOM   2987 C  CE2   . TRP E 3 269 ? 40.582  -55.342 -29.275 1.00 29.10 ? 269 TRP A CE2   1 
ATOM   2988 C  CE3   . TRP E 3 269 ? 39.148  -55.512 -27.329 1.00 28.40 ? 269 TRP A CE3   1 
ATOM   2989 C  CZ2   . TRP E 3 269 ? 39.509  -54.953 -30.091 1.00 28.92 ? 269 TRP A CZ2   1 
ATOM   2990 C  CZ3   . TRP E 3 269 ? 38.084  -55.124 -28.136 1.00 27.94 ? 269 TRP A CZ3   1 
ATOM   2991 C  CH2   . TRP E 3 269 ? 38.272  -54.847 -29.502 1.00 28.22 ? 269 TRP A CH2   1 
ATOM   2992 N  N     . LYS E 3 270 ? 43.521  -56.429 -23.176 1.00 35.00 ? 270 LYS A N     1 
ATOM   2993 C  CA    . LYS E 3 270 ? 43.548  -56.874 -21.787 1.00 35.75 ? 270 LYS A CA    1 
ATOM   2994 C  C     . LYS E 3 270 ? 43.512  -55.629 -20.929 1.00 35.15 ? 270 LYS A C     1 
ATOM   2995 O  O     . LYS E 3 270 ? 43.118  -55.655 -19.766 1.00 36.18 ? 270 LYS A O     1 
ATOM   2996 C  CB    . LYS E 3 270 ? 44.819  -57.661 -21.488 1.00 37.50 ? 270 LYS A CB    1 
ATOM   2997 C  CG    . LYS E 3 270 ? 44.788  -59.094 -21.978 1.00 39.92 ? 270 LYS A CG    1 
ATOM   2998 C  CD    . LYS E 3 270 ? 45.969  -59.863 -21.408 1.00 41.93 ? 270 LYS A CD    1 
ATOM   2999 C  CE    . LYS E 3 270 ? 45.686  -61.358 -21.371 1.00 42.94 ? 270 LYS A CE    1 
ATOM   3000 N  NZ    . LYS E 3 270 ? 46.766  -62.093 -20.654 1.00 43.25 ? 270 LYS A NZ    1 
ATOM   3001 N  N     . SER E 3 271 ? 43.939  -54.530 -21.530 1.00 34.33 ? 271 SER A N     1 
ATOM   3002 C  CA    . SER E 3 271 ? 43.955  -53.243 -20.867 1.00 34.25 ? 271 SER A CA    1 
ATOM   3003 C  C     . SER E 3 271 ? 42.616  -52.560 -21.144 1.00 33.57 ? 271 SER A C     1 
ATOM   3004 O  O     . SER E 3 271 ? 42.114  -51.781 -20.336 1.00 32.86 ? 271 SER A O     1 
ATOM   3005 C  CB    . SER E 3 271 ? 45.124  -52.415 -21.408 1.00 33.68 ? 271 SER A CB    1 
ATOM   3006 O  OG    . SER E 3 271 ? 44.813  -51.030 -21.424 1.00 35.12 ? 271 SER A OG    1 
ATOM   3007 N  N     . LEU E 3 272 ? 42.036  -52.886 -22.290 1.00 33.62 ? 272 LEU A N     1 
ATOM   3008 C  CA    . LEU E 3 272 ? 40.760  -52.323 -22.693 1.00 34.26 ? 272 LEU A CA    1 
ATOM   3009 C  C     . LEU E 3 272 ? 39.596  -53.010 -21.968 1.00 35.04 ? 272 LEU A C     1 
ATOM   3010 O  O     . LEU E 3 272 ? 38.581  -52.384 -21.668 1.00 35.96 ? 272 LEU A O     1 
ATOM   3011 C  CB    . LEU E 3 272 ? 40.612  -52.455 -24.209 1.00 32.39 ? 272 LEU A CB    1 
ATOM   3012 C  CG    . LEU E 3 272 ? 40.390  -51.176 -25.032 1.00 31.82 ? 272 LEU A CG    1 
ATOM   3013 C  CD1   . LEU E 3 272 ? 41.064  -49.976 -24.389 1.00 32.23 ? 272 LEU A CD1   1 
ATOM   3014 C  CD2   . LEU E 3 272 ? 40.932  -51.397 -26.436 1.00 31.84 ? 272 LEU A CD2   1 
ATOM   3015 N  N     . LEU E 3 273 ? 39.761  -54.292 -21.667 1.00 35.73 ? 273 LEU A N     1 
ATOM   3016 C  CA    . LEU E 3 273 ? 38.732  -55.069 -20.989 1.00 37.04 ? 273 LEU A CA    1 
ATOM   3017 C  C     . LEU E 3 273 ? 38.527  -54.656 -19.539 1.00 38.26 ? 273 LEU A C     1 
ATOM   3018 O  O     . LEU E 3 273 ? 37.403  -54.662 -19.029 1.00 38.66 ? 273 LEU A O     1 
ATOM   3019 C  CB    . LEU E 3 273 ? 39.094  -56.554 -21.027 1.00 36.79 ? 273 LEU A CB    1 
ATOM   3020 C  CG    . LEU E 3 273 ? 38.114  -57.501 -20.327 1.00 37.25 ? 273 LEU A CG    1 
ATOM   3021 C  CD1   . LEU E 3 273 ? 36.788  -57.576 -21.095 1.00 37.26 ? 273 LEU A CD1   1 
ATOM   3022 C  CD2   . LEU E 3 273 ? 38.746  -58.878 -20.234 1.00 38.37 ? 273 LEU A CD2   1 
ATOM   3023 N  N     . GLN E 3 274 ? 39.629  -54.325 -18.880 1.00 39.06 ? 274 GLN A N     1 
ATOM   3024 C  CA    . GLN E 3 274 ? 39.628  -53.920 -17.481 1.00 39.49 ? 274 GLN A CA    1 
ATOM   3025 C  C     . GLN E 3 274 ? 38.311  -53.311 -17.018 1.00 40.00 ? 274 GLN A C     1 
ATOM   3026 O  O     . GLN E 3 274 ? 37.641  -53.852 -16.132 1.00 40.32 ? 274 GLN A O     1 
ATOM   3027 C  CB    . GLN E 3 274 ? 40.742  -52.912 -17.239 1.00 39.56 ? 274 GLN A CB    1 
ATOM   3028 C  CG    . GLN E 3 274 ? 41.240  -52.907 -15.825 1.00 39.69 ? 274 GLN A CG    1 
ATOM   3029 C  CD    . GLN E 3 274 ? 42.658  -53.390 -15.740 1.00 39.52 ? 274 GLN A CD    1 
ATOM   3030 O  OE1   . GLN E 3 274 ? 42.961  -54.306 -14.989 1.00 41.41 ? 274 GLN A OE1   1 
ATOM   3031 N  NE2   . GLN E 3 274 ? 43.542  -52.778 -16.516 1.00 38.74 ? 274 GLN A NE2   1 
ATOM   3032 N  N     . ASP E 3 275 ? 37.947  -52.182 -17.623 1.00 39.96 ? 275 ASP A N     1 
ATOM   3033 C  CA    . ASP E 3 275 ? 36.716  -51.474 -17.272 1.00 39.25 ? 275 ASP A CA    1 
ATOM   3034 C  C     . ASP E 3 275 ? 35.892  -51.149 -18.496 1.00 36.72 ? 275 ASP A C     1 
ATOM   3035 O  O     . ASP E 3 275 ? 35.212  -50.130 -18.551 1.00 36.94 ? 275 ASP A O     1 
ATOM   3036 C  CB    . ASP E 3 275 ? 37.054  -50.191 -16.538 1.00 42.42 ? 275 ASP A CB    1 
ATOM   3037 C  CG    . ASP E 3 275 ? 37.249  -50.415 -15.063 1.00 46.90 ? 275 ASP A CG    1 
ATOM   3038 O  OD1   . ASP E 3 275 ? 37.797  -51.467 -14.654 1.00 49.31 ? 275 ASP A OD1   1 
ATOM   3039 O  OD2   . ASP E 3 275 ? 36.842  -49.533 -14.300 1.00 49.66 ? 275 ASP A OD2   1 
ATOM   3040 N  N     . MET E 3 276 ? 35.948  -52.038 -19.474 1.00 33.60 ? 276 MET A N     1 
ATOM   3041 C  CA    . MET E 3 276 ? 35.220  -51.855 -20.711 1.00 30.24 ? 276 MET A CA    1 
ATOM   3042 C  C     . MET E 3 276 ? 33.741  -51.650 -20.465 1.00 28.41 ? 276 MET A C     1 
ATOM   3043 O  O     . MET E 3 276 ? 33.152  -52.291 -19.608 1.00 29.41 ? 276 MET A O     1 
ATOM   3044 C  CB    . MET E 3 276 ? 35.413  -53.071 -21.610 1.00 28.51 ? 276 MET A CB    1 
ATOM   3045 C  CG    . MET E 3 276 ? 34.933  -52.852 -23.018 1.00 27.93 ? 276 MET A CG    1 
ATOM   3046 S  SD    . MET E 3 276 ? 35.481  -54.176 -24.069 1.00 27.86 ? 276 MET A SD    1 
ATOM   3047 C  CE    . MET E 3 276 ? 37.247  -53.967 -23.883 1.00 28.04 ? 276 MET A CE    1 
ATOM   3048 N  N     . PRO E 3 277 ? 33.128  -50.709 -21.187 1.00 27.34 ? 277 PRO A N     1 
ATOM   3049 C  CA    . PRO E 3 277 ? 31.693  -50.495 -20.989 1.00 26.43 ? 277 PRO A CA    1 
ATOM   3050 C  C     . PRO E 3 277 ? 30.967  -51.779 -21.422 1.00 26.39 ? 277 PRO A C     1 
ATOM   3051 O  O     . PRO E 3 277 ? 31.476  -52.532 -22.255 1.00 27.45 ? 277 PRO A O     1 
ATOM   3052 C  CB    . PRO E 3 277 ? 31.405  -49.298 -21.890 1.00 26.58 ? 277 PRO A CB    1 
ATOM   3053 C  CG    . PRO E 3 277 ? 32.691  -48.518 -21.804 1.00 25.91 ? 277 PRO A CG    1 
ATOM   3054 C  CD    . PRO E 3 277 ? 33.729  -49.599 -21.951 1.00 26.09 ? 277 PRO A CD    1 
ATOM   3055 N  N     . LEU E 3 278 ? 29.784  -52.026 -20.867 1.00 26.75 ? 278 LEU A N     1 
ATOM   3056 C  CA    . LEU E 3 278 ? 29.033  -53.250 -21.168 1.00 25.90 ? 278 LEU A CA    1 
ATOM   3057 C  C     . LEU E 3 278 ? 28.623  -53.553 -22.607 1.00 24.54 ? 278 LEU A C     1 
ATOM   3058 O  O     . LEU E 3 278 ? 28.701  -54.707 -23.040 1.00 23.80 ? 278 LEU A O     1 
ATOM   3059 C  CB    . LEU E 3 278 ? 27.806  -53.347 -20.255 1.00 27.38 ? 278 LEU A CB    1 
ATOM   3060 C  CG    . LEU E 3 278 ? 28.176  -53.759 -18.828 1.00 28.09 ? 278 LEU A CG    1 
ATOM   3061 C  CD1   . LEU E 3 278 ? 26.925  -54.032 -18.012 1.00 27.79 ? 278 LEU A CD1   1 
ATOM   3062 C  CD2   . LEU E 3 278 ? 29.038  -55.009 -18.887 1.00 29.21 ? 278 LEU A CD2   1 
ATOM   3063 N  N     . THR E 3 279 ? 28.178  -52.552 -23.355 1.00 22.80 ? 279 THR A N     1 
ATOM   3064 C  CA    . THR E 3 279 ? 27.792  -52.824 -24.728 1.00 21.54 ? 279 THR A CA    1 
ATOM   3065 C  C     . THR E 3 279 ? 29.060  -53.133 -25.496 1.00 21.77 ? 279 THR A C     1 
ATOM   3066 O  O     . THR E 3 279 ? 29.105  -54.061 -26.307 1.00 20.28 ? 279 THR A O     1 
ATOM   3067 C  CB    . THR E 3 279 ? 27.062  -51.630 -25.361 1.00 20.89 ? 279 THR A CB    1 
ATOM   3068 O  OG1   . THR E 3 279 ? 25.770  -51.508 -24.762 1.00 21.32 ? 279 THR A OG1   1 
ATOM   3069 C  CG2   . THR E 3 279 ? 26.897  -51.823 -26.847 1.00 16.97 ? 279 THR A CG2   1 
ATOM   3070 N  N     . ALA E 3 280 ? 30.104  -52.364 -25.221 1.00 22.35 ? 280 ALA A N     1 
ATOM   3071 C  CA    . ALA E 3 280 ? 31.372  -52.583 -25.893 1.00 23.86 ? 280 ALA A CA    1 
ATOM   3072 C  C     . ALA E 3 280 ? 31.794  -54.020 -25.623 1.00 25.00 ? 280 ALA A C     1 
ATOM   3073 O  O     . ALA E 3 280 ? 32.131  -54.765 -26.543 1.00 24.62 ? 280 ALA A O     1 
ATOM   3074 C  CB    . ALA E 3 280 ? 32.426  -51.610 -25.366 1.00 23.64 ? 280 ALA A CB    1 
ATOM   3075 N  N     . LEU E 3 281 ? 31.760  -54.404 -24.350 1.00 25.87 ? 281 LEU A N     1 
ATOM   3076 C  CA    . LEU E 3 281 ? 32.140  -55.752 -23.944 1.00 26.68 ? 281 LEU A CA    1 
ATOM   3077 C  C     . LEU E 3 281 ? 31.272  -56.800 -24.615 1.00 27.53 ? 281 LEU A C     1 
ATOM   3078 O  O     . LEU E 3 281 ? 31.771  -57.829 -25.074 1.00 27.60 ? 281 LEU A O     1 
ATOM   3079 C  CB    . LEU E 3 281 ? 32.028  -55.901 -22.427 1.00 27.24 ? 281 LEU A CB    1 
ATOM   3080 C  CG    . LEU E 3 281 ? 32.031  -57.330 -21.871 1.00 26.99 ? 281 LEU A CG    1 
ATOM   3081 C  CD1   . LEU E 3 281 ? 33.251  -58.078 -22.366 1.00 27.71 ? 281 LEU A CD1   1 
ATOM   3082 C  CD2   . LEU E 3 281 ? 32.005  -57.283 -20.354 1.00 26.16 ? 281 LEU A CD2   1 
ATOM   3083 N  N     . LEU E 3 282 ? 29.970  -56.534 -24.666 1.00 27.75 ? 282 LEU A N     1 
ATOM   3084 C  CA    . LEU E 3 282 ? 29.029  -57.456 -25.281 1.00 27.66 ? 282 LEU A CA    1 
ATOM   3085 C  C     . LEU E 3 282 ? 29.279  -57.649 -26.781 1.00 29.61 ? 282 LEU A C     1 
ATOM   3086 O  O     . LEU E 3 282 ? 29.288  -58.779 -27.268 1.00 30.81 ? 282 LEU A O     1 
ATOM   3087 C  CB    . LEU E 3 282 ? 27.609  -56.958 -25.054 1.00 25.67 ? 282 LEU A CB    1 
ATOM   3088 C  CG    . LEU E 3 282 ? 26.504  -57.959 -25.370 1.00 24.86 ? 282 LEU A CG    1 
ATOM   3089 C  CD1   . LEU E 3 282 ? 26.619  -59.154 -24.449 1.00 23.16 ? 282 LEU A CD1   1 
ATOM   3090 C  CD2   . LEU E 3 282 ? 25.151  -57.281 -25.195 1.00 24.98 ? 282 LEU A CD2   1 
ATOM   3091 N  N     . ARG E 3 283 ? 29.495  -56.552 -27.508 1.00 30.85 ? 283 ARG A N     1 
ATOM   3092 C  CA    . ARG E 3 283 ? 29.720  -56.620 -28.951 1.00 32.72 ? 283 ARG A CA    1 
ATOM   3093 C  C     . ARG E 3 283 ? 31.088  -57.150 -29.353 1.00 33.40 ? 283 ARG A C     1 
ATOM   3094 O  O     . ARG E 3 283 ? 31.325  -57.436 -30.531 1.00 35.00 ? 283 ARG A O     1 
ATOM   3095 C  CB    . ARG E 3 283 ? 29.527  -55.238 -29.600 1.00 33.54 ? 283 ARG A CB    1 
ATOM   3096 C  CG    . ARG E 3 283 ? 28.087  -54.756 -29.673 1.00 34.93 ? 283 ARG A CG    1 
ATOM   3097 C  CD    . ARG E 3 283 ? 27.954  -53.480 -30.500 1.00 34.47 ? 283 ARG A CD    1 
ATOM   3098 N  NE    . ARG E 3 283 ? 28.472  -53.663 -31.856 1.00 37.94 ? 283 ARG A NE    1 
ATOM   3099 C  CZ    . ARG E 3 283 ? 28.348  -52.778 -32.842 1.00 36.93 ? 283 ARG A CZ    1 
ATOM   3100 N  NH1   . ARG E 3 283 ? 27.715  -51.636 -32.637 1.00 36.47 ? 283 ARG A NH1   1 
ATOM   3101 N  NH2   . ARG E 3 283 ? 28.871  -53.033 -34.035 1.00 36.43 ? 283 ARG A NH2   1 
ATOM   3102 N  N     . ASN E 3 284 ? 31.992  -57.288 -28.395 1.00 33.04 ? 284 ASN A N     1 
ATOM   3103 C  CA    . ASN E 3 284 ? 33.329  -57.746 -28.735 1.00 33.16 ? 284 ASN A CA    1 
ATOM   3104 C  C     . ASN E 3 284 ? 33.723  -59.026 -28.021 1.00 33.40 ? 284 ASN A C     1 
ATOM   3105 O  O     . ASN E 3 284 ? 34.909  -59.288 -27.804 1.00 34.12 ? 284 ASN A O     1 
ATOM   3106 C  CB    . ASN E 3 284 ? 34.348  -56.634 -28.442 1.00 33.09 ? 284 ASN A CB    1 
ATOM   3107 C  CG    . ASN E 3 284 ? 34.180  -55.421 -29.360 1.00 32.97 ? 284 ASN A CG    1 
ATOM   3108 O  OD1   . ASN E 3 284 ? 34.520  -55.469 -30.542 1.00 32.02 ? 284 ASN A OD1   1 
ATOM   3109 N  ND2   . ASN E 3 284 ? 33.647  -54.335 -28.815 1.00 32.78 ? 284 ASN A ND2   1 
ATOM   3110 N  N     . LEU E 3 285 ? 32.728  -59.823 -27.651 1.00 32.86 ? 285 LEU A N     1 
ATOM   3111 C  CA    . LEU E 3 285 ? 32.998  -61.085 -26.984 1.00 32.75 ? 285 LEU A CA    1 
ATOM   3112 C  C     . LEU E 3 285 ? 33.698  -62.004 -27.978 1.00 33.42 ? 285 LEU A C     1 
ATOM   3113 O  O     . LEU E 3 285 ? 34.721  -62.619 -27.664 1.00 33.72 ? 285 LEU A O     1 
ATOM   3114 C  CB    . LEU E 3 285 ? 31.694  -61.728 -26.499 1.00 31.14 ? 285 LEU A CB    1 
ATOM   3115 C  CG    . LEU E 3 285 ? 31.066  -61.164 -25.218 1.00 31.57 ? 285 LEU A CG    1 
ATOM   3116 C  CD1   . LEU E 3 285 ? 29.741  -61.865 -24.945 1.00 31.37 ? 285 LEU A CD1   1 
ATOM   3117 C  CD2   . LEU E 3 285 ? 32.017  -61.358 -24.032 1.00 30.35 ? 285 LEU A CD2   1 
ATOM   3118 N  N     . GLY E 3 286 ? 33.148  -62.071 -29.187 1.00 33.70 ? 286 GLY A N     1 
ATOM   3119 C  CA    . GLY E 3 286 ? 33.706  -62.916 -30.226 1.00 33.68 ? 286 GLY A CA    1 
ATOM   3120 C  C     . GLY E 3 286 ? 35.148  -62.605 -30.572 1.00 33.24 ? 286 GLY A C     1 
ATOM   3121 O  O     . GLY E 3 286 ? 35.969  -63.507 -30.679 1.00 32.94 ? 286 GLY A O     1 
ATOM   3122 N  N     . LYS E 3 287 ? 35.457  -61.327 -30.754 1.00 32.88 ? 287 LYS A N     1 
ATOM   3123 C  CA    . LYS E 3 287 ? 36.806  -60.917 -31.093 1.00 33.01 ? 287 LYS A CA    1 
ATOM   3124 C  C     . LYS E 3 287 ? 37.812  -61.197 -29.984 1.00 33.54 ? 287 LYS A C     1 
ATOM   3125 O  O     . LYS E 3 287 ? 38.927  -61.642 -30.248 1.00 33.61 ? 287 LYS A O     1 
ATOM   3126 C  CB    . LYS E 3 287 ? 36.835  -59.429 -31.437 1.00 33.70 ? 287 LYS A CB    1 
ATOM   3127 C  CG    . LYS E 3 287 ? 38.216  -58.793 -31.308 1.00 35.05 ? 287 LYS A CG    1 
ATOM   3128 C  CD    . LYS E 3 287 ? 38.670  -58.129 -32.597 1.00 35.95 ? 287 LYS A CD    1 
ATOM   3129 C  CE    . LYS E 3 287 ? 40.040  -57.506 -32.408 1.00 36.74 ? 287 LYS A CE    1 
ATOM   3130 N  NZ    . LYS E 3 287 ? 40.922  -57.777 -33.571 1.00 36.69 ? 287 LYS A NZ    1 
ATOM   3131 N  N     . MET E 3 288 ? 37.431  -60.933 -28.743 1.00 34.02 ? 288 MET A N     1 
ATOM   3132 C  CA    . MET E 3 288 ? 38.343  -61.161 -27.636 1.00 35.06 ? 288 MET A CA    1 
ATOM   3133 C  C     . MET E 3 288 ? 38.651  -62.632 -27.383 1.00 35.45 ? 288 MET A C     1 
ATOM   3134 O  O     . MET E 3 288 ? 39.721  -62.976 -26.893 1.00 34.99 ? 288 MET A O     1 
ATOM   3135 C  CB    . MET E 3 288 ? 37.797  -60.520 -26.366 1.00 35.75 ? 288 MET A CB    1 
ATOM   3136 C  CG    . MET E 3 288 ? 37.994  -59.030 -26.324 1.00 36.79 ? 288 MET A CG    1 
ATOM   3137 S  SD    . MET E 3 288 ? 37.490  -58.378 -24.753 1.00 38.41 ? 288 MET A SD    1 
ATOM   3138 C  CE    . MET E 3 288 ? 36.914  -56.802 -25.252 1.00 39.53 ? 288 MET A CE    1 
ATOM   3139 N  N     . THR E 3 289 ? 37.711  -63.503 -27.715 1.00 36.70 ? 289 THR A N     1 
ATOM   3140 C  CA    . THR E 3 289 ? 37.923  -64.925 -27.509 1.00 37.59 ? 289 THR A CA    1 
ATOM   3141 C  C     . THR E 3 289 ? 38.915  -65.376 -28.567 1.00 38.35 ? 289 THR A C     1 
ATOM   3142 O  O     . THR E 3 289 ? 39.860  -66.116 -28.275 1.00 39.13 ? 289 THR A O     1 
ATOM   3143 C  CB    . THR E 3 289 ? 36.599  -65.721 -27.663 1.00 36.98 ? 289 THR A CB    1 
ATOM   3144 O  OG1   . THR E 3 289 ? 35.624  -65.211 -26.748 1.00 36.37 ? 289 THR A OG1   1 
ATOM   3145 C  CG2   . THR E 3 289 ? 36.816  -67.190 -27.367 1.00 36.52 ? 289 THR A CG2   1 
ATOM   3146 N  N     . ALA E 3 290 ? 38.699  -64.903 -29.793 1.00 38.50 ? 290 ALA A N     1 
ATOM   3147 C  CA    . ALA E 3 290 ? 39.549  -65.241 -30.926 1.00 39.30 ? 290 ALA A CA    1 
ATOM   3148 C  C     . ALA E 3 290 ? 40.994  -64.803 -30.726 1.00 40.51 ? 290 ALA A C     1 
ATOM   3149 O  O     . ALA E 3 290 ? 41.918  -65.512 -31.114 1.00 40.98 ? 290 ALA A O     1 
ATOM   3150 C  CB    . ALA E 3 290 ? 38.994  -64.609 -32.197 1.00 38.72 ? 290 ALA A CB    1 
ATOM   3151 N  N     . ASP E 3 291 ? 41.184  -63.633 -30.120 1.00 42.13 ? 291 ASP A N     1 
ATOM   3152 C  CA    . ASP E 3 291 ? 42.524  -63.097 -29.881 1.00 42.23 ? 291 ASP A CA    1 
ATOM   3153 C  C     . ASP E 3 291 ? 43.138  -63.622 -28.577 1.00 41.98 ? 291 ASP A C     1 
ATOM   3154 O  O     . ASP E 3 291 ? 44.134  -63.088 -28.080 1.00 43.10 ? 291 ASP A O     1 
ATOM   3155 C  CB    . ASP E 3 291 ? 42.470  -61.572 -29.856 1.00 44.19 ? 291 ASP A CB    1 
ATOM   3156 C  CG    . ASP E 3 291 ? 42.193  -60.988 -31.210 1.00 46.51 ? 291 ASP A CG    1 
ATOM   3157 O  OD1   . ASP E 3 291 ? 43.143  -60.463 -31.840 1.00 49.40 ? 291 ASP A OD1   1 
ATOM   3158 O  OD2   . ASP E 3 291 ? 41.027  -61.046 -31.666 1.00 48.08 ? 291 ASP A OD2   1 
ATOM   3159 N  N     . SER E 3 292 ? 42.544  -64.674 -28.026 1.00 39.85 ? 292 SER A N     1 
ATOM   3160 C  CA    . SER E 3 292 ? 43.035  -65.264 -26.794 1.00 38.51 ? 292 SER A CA    1 
ATOM   3161 C  C     . SER E 3 292 ? 43.044  -64.337 -25.600 1.00 38.58 ? 292 SER A C     1 
ATOM   3162 O  O     . SER E 3 292 ? 43.654  -64.655 -24.587 1.00 38.99 ? 292 SER A O     1 
ATOM   3163 C  CB    . SER E 3 292 ? 44.437  -65.812 -26.992 1.00 38.22 ? 292 SER A CB    1 
ATOM   3164 O  OG    . SER E 3 292 ? 44.380  -67.213 -27.219 1.00 38.47 ? 292 SER A OG    1 
ATOM   3165 N  N     . VAL E 3 293 ? 42.383  -63.191 -25.704 1.00 39.02 ? 293 VAL A N     1 
ATOM   3166 C  CA    . VAL E 3 293 ? 42.335  -62.272 -24.572 1.00 39.77 ? 293 VAL A CA    1 
ATOM   3167 C  C     . VAL E 3 293 ? 41.332  -62.839 -23.578 1.00 40.23 ? 293 VAL A C     1 
ATOM   3168 O  O     . VAL E 3 293 ? 41.381  -62.539 -22.384 1.00 41.75 ? 293 VAL A O     1 
ATOM   3169 C  CB    . VAL E 3 293 ? 41.922  -60.837 -25.011 1.00 40.10 ? 293 VAL A CB    1 
ATOM   3170 C  CG1   . VAL E 3 293 ? 41.719  -60.787 -26.523 1.00 39.79 ? 293 VAL A CG1   1 
ATOM   3171 C  CG2   . VAL E 3 293 ? 40.680  -60.386 -24.260 1.00 40.23 ? 293 VAL A CG2   1 
ATOM   3172 N  N     . LEU E 3 294 ? 40.420  -63.660 -24.088 1.00 40.20 ? 294 LEU A N     1 
ATOM   3173 C  CA    . LEU E 3 294 ? 39.425  -64.322 -23.256 1.00 40.27 ? 294 LEU A CA    1 
ATOM   3174 C  C     . LEU E 3 294 ? 39.681  -65.817 -23.356 1.00 39.91 ? 294 LEU A C     1 
ATOM   3175 O  O     . LEU E 3 294 ? 38.812  -66.583 -23.769 1.00 41.23 ? 294 LEU A O     1 
ATOM   3176 C  CB    . LEU E 3 294 ? 38.005  -63.993 -23.725 1.00 39.70 ? 294 LEU A CB    1 
ATOM   3177 C  CG    . LEU E 3 294 ? 37.440  -62.698 -23.135 1.00 39.99 ? 294 LEU A CG    1 
ATOM   3178 C  CD1   . LEU E 3 294 ? 36.030  -62.457 -23.656 1.00 40.38 ? 294 LEU A CD1   1 
ATOM   3179 C  CD2   . LEU E 3 294 ? 37.442  -62.797 -21.610 1.00 40.24 ? 294 LEU A CD2   1 
ATOM   3180 N  N     . ALA E 3 295 ? 40.889  -66.221 -22.980 1.00 39.14 ? 295 ALA A N     1 
ATOM   3181 C  CA    . ALA E 3 295 ? 41.283  -67.621 -23.036 1.00 38.17 ? 295 ALA A CA    1 
ATOM   3182 C  C     . ALA E 3 295 ? 40.546  -68.463 -22.008 1.00 37.32 ? 295 ALA A C     1 
ATOM   3183 O  O     . ALA E 3 295 ? 40.260  -68.014 -20.904 1.00 36.93 ? 295 ALA A O     1 
ATOM   3184 C  CB    . ALA E 3 295 ? 42.781  -67.749 -22.829 1.00 38.14 ? 295 ALA A CB    1 
ATOM   3185 N  N     . PRO E 3 296 ? 40.239  -69.713 -22.363 1.00 37.47 ? 296 PRO A N     1 
ATOM   3186 C  CA    . PRO E 3 296 ? 39.530  -70.621 -21.459 1.00 37.68 ? 296 PRO A CA    1 
ATOM   3187 C  C     . PRO E 3 296 ? 40.165  -70.737 -20.078 1.00 37.73 ? 296 PRO A C     1 
ATOM   3188 O  O     . PRO E 3 296 ? 41.382  -70.804 -19.957 1.00 37.76 ? 296 PRO A O     1 
ATOM   3189 C  CB    . PRO E 3 296 ? 39.533  -71.943 -22.224 1.00 37.02 ? 296 PRO A CB    1 
ATOM   3190 C  CG    . PRO E 3 296 ? 40.701  -71.811 -23.162 1.00 35.85 ? 296 PRO A CG    1 
ATOM   3191 C  CD    . PRO E 3 296 ? 40.608  -70.398 -23.610 1.00 36.63 ? 296 PRO A CD    1 
ATOM   3192 N  N     . ALA E 3 297 ? 39.322  -70.742 -19.045 1.00 38.45 ? 297 ALA A N     1 
ATOM   3193 C  CA    . ALA E 3 297 ? 39.753  -70.858 -17.652 1.00 37.83 ? 297 ALA A CA    1 
ATOM   3194 C  C     . ALA E 3 297 ? 40.276  -69.552 -17.071 1.00 38.59 ? 297 ALA A C     1 
ATOM   3195 O  O     . ALA E 3 297 ? 40.305  -69.381 -15.851 1.00 38.66 ? 297 ALA A O     1 
ATOM   3196 C  CB    . ALA E 3 297 ? 40.820  -71.943 -17.524 1.00 37.19 ? 297 ALA A CB    1 
ATOM   3197 N  N     . SER E 3 298 ? 40.676  -68.634 -17.946 1.00 38.84 ? 298 SER A N     1 
ATOM   3198 C  CA    . SER E 3 298 ? 41.232  -67.346 -17.531 1.00 38.82 ? 298 SER A CA    1 
ATOM   3199 C  C     . SER E 3 298 ? 40.455  -66.531 -16.508 1.00 38.63 ? 298 SER A C     1 
ATOM   3200 O  O     . SER E 3 298 ? 39.257  -66.723 -16.294 1.00 37.98 ? 298 SER A O     1 
ATOM   3201 C  CB    . SER E 3 298 ? 41.486  -66.455 -18.747 1.00 38.89 ? 298 SER A CB    1 
ATOM   3202 O  OG    . SER E 3 298 ? 40.280  -66.044 -19.352 1.00 40.06 ? 298 SER A OG    1 
ATOM   3203 N  N     . SER E 3 299 ? 41.180  -65.612 -15.882 1.00 39.21 ? 299 SER A N     1 
ATOM   3204 C  CA    . SER E 3 299 ? 40.629  -64.716 -14.888 1.00 40.33 ? 299 SER A CA    1 
ATOM   3205 C  C     . SER E 3 299 ? 39.703  -63.772 -15.650 1.00 41.17 ? 299 SER A C     1 
ATOM   3206 O  O     . SER E 3 299 ? 38.555  -63.560 -15.253 1.00 41.29 ? 299 SER A O     1 
ATOM   3207 C  CB    . SER E 3 299 ? 41.757  -63.926 -14.220 1.00 40.71 ? 299 SER A CB    1 
ATOM   3208 O  OG    . SER E 3 299 ? 41.413  -63.578 -12.879 1.00 41.93 ? 299 SER A OG    1 
ATOM   3209 N  N     . GLU E 3 300 ? 40.216  -63.235 -16.761 1.00 41.30 ? 300 GLU A N     1 
ATOM   3210 C  CA    . GLU E 3 300 ? 39.483  -62.309 -17.625 1.00 41.69 ? 300 GLU A CA    1 
ATOM   3211 C  C     . GLU E 3 300 ? 38.070  -62.827 -17.926 1.00 41.29 ? 300 GLU A C     1 
ATOM   3212 O  O     . GLU E 3 300 ? 37.079  -62.096 -17.832 1.00 40.84 ? 300 GLU A O     1 
ATOM   3213 C  CB    . GLU E 3 300 ? 40.109  -62.181 -19.017 1.00 43.77 ? 300 GLU A CB    1 
ATOM   3214 C  CG    . GLU E 3 300 ? 41.527  -61.765 -19.348 1.00 46.98 ? 300 GLU A CG    1 
ATOM   3215 C  CD    . GLU E 3 300 ? 42.711  -62.397 -18.643 1.00 47.61 ? 300 GLU A CD    1 
ATOM   3216 O  OE1   . GLU E 3 300 ? 42.612  -62.706 -17.440 1.00 48.28 ? 300 GLU A OE1   1 
ATOM   3217 O  OE2   . GLU E 3 300 ? 43.759  -62.532 -19.306 1.00 48.79 ? 300 GLU A OE2   1 
ATOM   3218 N  N     . VAL E 3 301 ? 37.999  -64.073 -18.380 1.00 39.79 ? 301 VAL A N     1 
ATOM   3219 C  CA    . VAL E 3 301 ? 36.720  -64.661 -18.724 1.00 39.76 ? 301 VAL A CA    1 
ATOM   3220 C  C     . VAL E 3 301 ? 35.833  -64.674 -17.492 1.00 39.41 ? 301 VAL A C     1 
ATOM   3221 O  O     . VAL E 3 301 ? 34.661  -64.296 -17.550 1.00 40.62 ? 301 VAL A O     1 
ATOM   3222 C  CB    . VAL E 3 301 ? 36.881  -66.106 -19.278 1.00 39.35 ? 301 VAL A CB    1 
ATOM   3223 C  CG1   . VAL E 3 301 ? 35.524  -66.804 -19.333 1.00 38.54 ? 301 VAL A CG1   1 
ATOM   3224 C  CG2   . VAL E 3 301 ? 37.476  -66.060 -20.677 1.00 37.86 ? 301 VAL A CG2   1 
ATOM   3225 N  N     . SER E 3 302 ? 36.394  -65.105 -16.374 1.00 38.48 ? 302 SER A N     1 
ATOM   3226 C  CA    . SER E 3 302 ? 35.639  -65.149 -15.135 1.00 38.78 ? 302 SER A CA    1 
ATOM   3227 C  C     . SER E 3 302 ? 35.053  -63.764 -14.852 1.00 39.04 ? 302 SER A C     1 
ATOM   3228 O  O     . SER E 3 302 ? 33.896  -63.620 -14.440 1.00 38.66 ? 302 SER A O     1 
ATOM   3229 C  CB    . SER E 3 302 ? 36.557  -65.567 -13.992 1.00 37.67 ? 302 SER A CB    1 
ATOM   3230 O  OG    . SER E 3 302 ? 35.836  -65.661 -12.779 1.00 38.66 ? 302 SER A OG    1 
ATOM   3231 N  N     . SER E 3 303 ? 35.874  -62.748 -15.088 1.00 38.80 ? 303 SER A N     1 
ATOM   3232 C  CA    . SER E 3 303 ? 35.490  -61.363 -14.866 1.00 38.27 ? 303 SER A CA    1 
ATOM   3233 C  C     . SER E 3 303 ? 34.297  -61.016 -15.752 1.00 37.52 ? 303 SER A C     1 
ATOM   3234 O  O     . SER E 3 303 ? 33.282  -60.520 -15.260 1.00 37.93 ? 303 SER A O     1 
ATOM   3235 C  CB    . SER E 3 303 ? 36.687  -60.440 -15.173 1.00 39.01 ? 303 SER A CB    1 
ATOM   3236 O  OG    . SER E 3 303 ? 36.514  -59.118 -14.678 1.00 38.28 ? 303 SER A OG    1 
ATOM   3237 N  N     . VAL E 3 304 ? 34.428  -61.284 -17.052 1.00 36.70 ? 304 VAL A N     1 
ATOM   3238 C  CA    . VAL E 3 304 ? 33.365  -61.012 -18.024 1.00 35.72 ? 304 VAL A CA    1 
ATOM   3239 C  C     . VAL E 3 304 ? 32.012  -61.553 -17.574 1.00 35.18 ? 304 VAL A C     1 
ATOM   3240 O  O     . VAL E 3 304 ? 31.037  -60.800 -17.476 1.00 35.44 ? 304 VAL A O     1 
ATOM   3241 C  CB    . VAL E 3 304 ? 33.689  -61.627 -19.412 1.00 35.06 ? 304 VAL A CB    1 
ATOM   3242 C  CG1   . VAL E 3 304 ? 32.434  -61.675 -20.266 1.00 34.08 ? 304 VAL A CG1   1 
ATOM   3243 C  CG2   . VAL E 3 304 ? 34.752  -60.797 -20.111 1.00 34.67 ? 304 VAL A CG2   1 
ATOM   3244 N  N     . CYS E 3 305 ? 31.960  -62.855 -17.306 1.00 33.55 ? 305 CYS A N     1 
ATOM   3245 C  CA    . CYS E 3 305 ? 30.727  -63.495 -16.866 1.00 33.75 ? 305 CYS A CA    1 
ATOM   3246 C  C     . CYS E 3 305 ? 30.108  -62.806 -15.655 1.00 33.35 ? 305 CYS A C     1 
ATOM   3247 O  O     . CYS E 3 305 ? 28.893  -62.623 -15.586 1.00 32.32 ? 305 CYS A O     1 
ATOM   3248 C  CB    . CYS E 3 305 ? 30.987  -64.960 -16.526 1.00 32.93 ? 305 CYS A CB    1 
ATOM   3249 S  SG    . CYS E 3 305 ? 31.581  -65.925 -17.901 1.00 32.71 ? 305 CYS A SG    1 
ATOM   3250 N  N     . GLU E 3 306 ? 30.948  -62.420 -14.702 1.00 33.80 ? 306 GLU A N     1 
ATOM   3251 C  CA    . GLU E 3 306 ? 30.463  -61.773 -13.498 1.00 34.80 ? 306 GLU A CA    1 
ATOM   3252 C  C     . GLU E 3 306 ? 29.867  -60.395 -13.805 1.00 34.13 ? 306 GLU A C     1 
ATOM   3253 O  O     . GLU E 3 306 ? 28.971  -59.936 -13.105 1.00 35.22 ? 306 GLU A O     1 
ATOM   3254 C  CB    . GLU E 3 306 ? 31.601  -61.672 -12.476 1.00 36.93 ? 306 GLU A CB    1 
ATOM   3255 C  CG    . GLU E 3 306 ? 31.154  -61.769 -11.005 1.00 40.63 ? 306 GLU A CG    1 
ATOM   3256 C  CD    . GLU E 3 306 ? 31.916  -62.847 -10.199 1.00 43.52 ? 306 GLU A CD    1 
ATOM   3257 O  OE1   . GLU E 3 306 ? 31.660  -62.984 -8.976  1.00 43.76 ? 306 GLU A OE1   1 
ATOM   3258 O  OE2   . GLU E 3 306 ? 32.768  -63.562 -10.783 1.00 43.48 ? 306 GLU A OE2   1 
ATOM   3259 N  N     . ARG E 3 307 ? 30.345  -59.739 -14.856 1.00 32.71 ? 307 ARG A N     1 
ATOM   3260 C  CA    . ARG E 3 307 ? 29.807  -58.433 -15.211 1.00 32.58 ? 307 ARG A CA    1 
ATOM   3261 C  C     . ARG E 3 307 ? 28.497  -58.552 -16.007 1.00 32.14 ? 307 ARG A C     1 
ATOM   3262 O  O     . ARG E 3 307 ? 27.512  -57.868 -15.716 1.00 31.66 ? 307 ARG A O     1 
ATOM   3263 C  CB    . ARG E 3 307 ? 30.837  -57.641 -16.015 1.00 33.34 ? 307 ARG A CB    1 
ATOM   3264 C  CG    . ARG E 3 307 ? 32.126  -57.356 -15.253 1.00 34.38 ? 307 ARG A CG    1 
ATOM   3265 C  CD    . ARG E 3 307 ? 33.005  -56.404 -16.033 1.00 34.53 ? 307 ARG A CD    1 
ATOM   3266 N  NE    . ARG E 3 307 ? 32.291  -55.163 -16.308 1.00 35.67 ? 307 ARG A NE    1 
ATOM   3267 C  CZ    . ARG E 3 307 ? 32.621  -54.300 -17.262 1.00 35.19 ? 307 ARG A CZ    1 
ATOM   3268 N  NH1   . ARG E 3 307 ? 33.663  -54.534 -18.042 1.00 34.37 ? 307 ARG A NH1   1 
ATOM   3269 N  NH2   . ARG E 3 307 ? 31.886  -53.214 -17.451 1.00 36.01 ? 307 ARG A NH2   1 
ATOM   3270 N  N     . LEU E 3 308 ? 28.492  -59.436 -17.001 1.00 31.12 ? 308 LEU A N     1 
ATOM   3271 C  CA    . LEU E 3 308 ? 27.320  -59.654 -17.840 1.00 30.54 ? 308 LEU A CA    1 
ATOM   3272 C  C     . LEU E 3 308 ? 26.078  -60.100 -17.064 1.00 31.02 ? 308 LEU A C     1 
ATOM   3273 O  O     . LEU E 3 308 ? 24.949  -59.898 -17.519 1.00 29.70 ? 308 LEU A O     1 
ATOM   3274 C  CB    . LEU E 3 308 ? 27.639  -60.700 -18.909 1.00 28.66 ? 308 LEU A CB    1 
ATOM   3275 C  CG    . LEU E 3 308 ? 28.644  -60.293 -19.982 1.00 28.24 ? 308 LEU A CG    1 
ATOM   3276 C  CD1   . LEU E 3 308 ? 29.089  -61.516 -20.776 1.00 27.12 ? 308 LEU A CD1   1 
ATOM   3277 C  CD2   . LEU E 3 308 ? 28.012  -59.243 -20.883 1.00 27.11 ? 308 LEU A CD2   1 
ATOM   3278 N  N     . THR E 3 309 ? 26.283  -60.700 -15.895 1.00 31.70 ? 309 THR A N     1 
ATOM   3279 C  CA    . THR E 3 309 ? 25.161  -61.194 -15.107 1.00 32.02 ? 309 THR A CA    1 
ATOM   3280 C  C     . THR E 3 309 ? 24.846  -60.355 -13.886 1.00 31.27 ? 309 THR A C     1 
ATOM   3281 O  O     . THR E 3 309 ? 24.144  -60.794 -12.981 1.00 31.68 ? 309 THR A O     1 
ATOM   3282 C  CB    . THR E 3 309 ? 25.399  -62.648 -14.671 1.00 32.57 ? 309 THR A CB    1 
ATOM   3283 O  OG1   . THR E 3 309 ? 26.564  -62.714 -13.839 1.00 34.39 ? 309 THR A OG1   1 
ATOM   3284 C  CG2   . THR E 3 309 ? 25.600  -63.538 -15.892 1.00 31.06 ? 309 THR A CG2   1 
ATOM   3285 N  N     . ASN E 3 310 ? 25.371  -59.141 -13.871 1.00 32.09 ? 310 ASN A N     1 
ATOM   3286 C  CA    . ASN E 3 310 ? 25.133  -58.208 -12.778 1.00 32.69 ? 310 ASN A CA    1 
ATOM   3287 C  C     . ASN E 3 310 ? 23.929  -57.404 -13.249 1.00 32.21 ? 310 ASN A C     1 
ATOM   3288 O  O     . ASN E 3 310 ? 24.080  -56.504 -14.069 1.00 32.50 ? 310 ASN A O     1 
ATOM   3289 C  CB    . ASN E 3 310 ? 26.346  -57.291 -12.618 1.00 33.48 ? 310 ASN A CB    1 
ATOM   3290 C  CG    . ASN E 3 310 ? 26.264  -56.423 -11.386 1.00 34.73 ? 310 ASN A CG    1 
ATOM   3291 O  OD1   . ASN E 3 310 ? 25.268  -55.741 -11.152 1.00 35.33 ? 310 ASN A OD1   1 
ATOM   3292 N  ND2   . ASN E 3 310 ? 27.322  -56.439 -10.590 1.00 36.17 ? 310 ASN A ND2   1 
ATOM   3293 N  N     . GLU E 3 311 ? 22.739  -57.718 -12.747 1.00 32.26 ? 311 GLU A N     1 
ATOM   3294 C  CA    . GLU E 3 311 ? 21.553  -57.018 -13.207 1.00 33.74 ? 311 GLU A CA    1 
ATOM   3295 C  C     . GLU E 3 311 ? 21.607  -55.522 -13.053 1.00 34.44 ? 311 GLU A C     1 
ATOM   3296 O  O     . GLU E 3 311 ? 21.102  -54.809 -13.914 1.00 35.16 ? 311 GLU A O     1 
ATOM   3297 C  CB    . GLU E 3 311 ? 20.289  -57.510 -12.516 1.00 35.38 ? 311 GLU A CB    1 
ATOM   3298 C  CG    . GLU E 3 311 ? 19.032  -57.084 -13.263 1.00 40.22 ? 311 GLU A CG    1 
ATOM   3299 C  CD    . GLU E 3 311 ? 17.843  -56.848 -12.355 1.00 43.02 ? 311 GLU A CD    1 
ATOM   3300 O  OE1   . GLU E 3 311 ? 16.688  -56.891 -12.839 1.00 44.92 ? 311 GLU A OE1   1 
ATOM   3301 O  OE2   . GLU E 3 311 ? 18.059  -56.585 -11.152 1.00 46.04 ? 311 GLU A OE2   1 
ATOM   3302 N  N     . LYS E 3 312 ? 22.203  -55.031 -11.970 1.00 34.86 ? 312 LYS A N     1 
ATOM   3303 C  CA    . LYS E 3 312 ? 22.256  -53.591 -11.770 1.00 35.02 ? 312 LYS A CA    1 
ATOM   3304 C  C     . LYS E 3 312 ? 23.050  -52.842 -12.829 1.00 34.06 ? 312 LYS A C     1 
ATOM   3305 O  O     . LYS E 3 312 ? 22.610  -51.805 -13.320 1.00 33.88 ? 312 LYS A O     1 
ATOM   3306 C  CB    . LYS E 3 312 ? 22.787  -53.261 -10.373 1.00 36.66 ? 312 LYS A CB    1 
ATOM   3307 C  CG    . LYS E 3 312 ? 21.824  -53.624 -9.236  1.00 38.99 ? 312 LYS A CG    1 
ATOM   3308 C  CD    . LYS E 3 312 ? 20.353  -53.505 -9.644  1.00 40.82 ? 312 LYS A CD    1 
ATOM   3309 C  CE    . LYS E 3 312 ? 19.987  -52.108 -10.148 1.00 43.36 ? 312 LYS A CE    1 
ATOM   3310 N  NZ    . LYS E 3 312 ? 18.628  -52.093 -10.777 1.00 47.34 ? 312 LYS A NZ    1 
ATOM   3311 N  N     . LEU E 3 313 ? 24.211  -53.370 -13.189 1.00 33.60 ? 313 LEU A N     1 
ATOM   3312 C  CA    . LEU E 3 313 ? 25.051  -52.740 -14.196 1.00 33.40 ? 313 LEU A CA    1 
ATOM   3313 C  C     . LEU E 3 313 ? 24.434  -52.882 -15.590 1.00 32.30 ? 313 LEU A C     1 
ATOM   3314 O  O     . LEU E 3 313 ? 24.527  -51.969 -16.415 1.00 31.14 ? 313 LEU A O     1 
ATOM   3315 C  CB    . LEU E 3 313 ? 26.456  -53.355 -14.162 1.00 35.18 ? 313 LEU A CB    1 
ATOM   3316 C  CG    . LEU E 3 313 ? 27.147  -53.368 -12.789 1.00 35.69 ? 313 LEU A CG    1 
ATOM   3317 C  CD1   . LEU E 3 313 ? 28.576  -53.868 -12.965 1.00 36.04 ? 313 LEU A CD1   1 
ATOM   3318 C  CD2   . LEU E 3 313 ? 27.139  -51.972 -12.164 1.00 35.66 ? 313 LEU A CD2   1 
ATOM   3319 N  N     . LEU E 3 314 ? 23.813  -54.035 -15.843 1.00 31.71 ? 314 LEU A N     1 
ATOM   3320 C  CA    . LEU E 3 314 ? 23.139  -54.308 -17.119 1.00 30.73 ? 314 LEU A CA    1 
ATOM   3321 C  C     . LEU E 3 314 ? 22.094  -53.225 -17.269 1.00 30.29 ? 314 LEU A C     1 
ATOM   3322 O  O     . LEU E 3 314 ? 21.877  -52.671 -18.347 1.00 30.17 ? 314 LEU A O     1 
ATOM   3323 C  CB    . LEU E 3 314 ? 22.431  -55.666 -17.076 1.00 29.59 ? 314 LEU A CB    1 
ATOM   3324 C  CG    . LEU E 3 314 ? 23.260  -56.941 -17.228 1.00 30.51 ? 314 LEU A CG    1 
ATOM   3325 C  CD1   . LEU E 3 314 ? 22.404  -58.177 -16.975 1.00 29.81 ? 314 LEU A CD1   1 
ATOM   3326 C  CD2   . LEU E 3 314 ? 23.840  -56.976 -18.629 1.00 31.20 ? 314 LEU A CD2   1 
ATOM   3327 N  N     . LYS E 3 315 ? 21.452  -52.953 -16.144 1.00 29.17 ? 315 LYS A N     1 
ATOM   3328 C  CA    . LYS E 3 315 ? 20.424  -51.960 -16.021 1.00 29.45 ? 315 LYS A CA    1 
ATOM   3329 C  C     . LYS E 3 315 ? 21.009  -50.579 -16.227 1.00 28.66 ? 315 LYS A C     1 
ATOM   3330 O  O     . LYS E 3 315 ? 20.465  -49.760 -16.964 1.00 28.88 ? 315 LYS A O     1 
ATOM   3331 C  CB    . LYS E 3 315 ? 19.842  -52.051 -14.627 1.00 34.23 ? 315 LYS A CB    1 
ATOM   3332 C  CG    . LYS E 3 315 ? 18.444  -52.588 -14.585 1.00 39.13 ? 315 LYS A CG    1 
ATOM   3333 C  CD    . LYS E 3 315 ? 17.476  -51.551 -15.170 1.00 44.79 ? 315 LYS A CD    1 
ATOM   3334 C  CE    . LYS E 3 315 ? 16.041  -51.808 -14.686 1.00 46.80 ? 315 LYS A CE    1 
ATOM   3335 N  NZ    . LYS E 3 315 ? 15.959  -51.784 -13.186 1.00 48.17 ? 315 LYS A NZ    1 
ATOM   3336 N  N     . LYS E 3 316 ? 22.130  -50.324 -15.568 1.00 26.82 ? 316 LYS A N     1 
ATOM   3337 C  CA    . LYS E 3 316 ? 22.778  -49.030 -15.667 1.00 25.07 ? 316 LYS A CA    1 
ATOM   3338 C  C     . LYS E 3 316 ? 23.269  -48.778 -17.079 1.00 23.97 ? 316 LYS A C     1 
ATOM   3339 O  O     . LYS E 3 316 ? 23.188  -47.654 -17.580 1.00 25.59 ? 316 LYS A O     1 
ATOM   3340 C  CB    . LYS E 3 316 ? 23.952  -48.944 -14.695 1.00 25.82 ? 316 LYS A CB    1 
ATOM   3341 C  CG    . LYS E 3 316 ? 24.493  -47.534 -14.509 1.00 26.41 ? 316 LYS A CG    1 
ATOM   3342 C  CD    . LYS E 3 316 ? 25.793  -47.546 -13.724 1.00 25.01 ? 316 LYS A CD    1 
ATOM   3343 C  CE    . LYS E 3 316 ? 26.390  -46.165 -13.656 1.00 25.10 ? 316 LYS A CE    1 
ATOM   3344 N  NZ    . LYS E 3 316 ? 27.878  -46.233 -13.587 1.00 27.51 ? 316 LYS A NZ    1 
ATOM   3345 N  N     . ALA E 3 317 ? 23.776  -49.820 -17.726 1.00 21.20 ? 317 ALA A N     1 
ATOM   3346 C  CA    . ALA E 3 317 ? 24.276  -49.670 -19.082 1.00 19.69 ? 317 ALA A CA    1 
ATOM   3347 C  C     . ALA E 3 317 ? 23.152  -49.771 -20.104 1.00 18.31 ? 317 ALA A C     1 
ATOM   3348 O  O     . ALA E 3 317 ? 23.379  -49.614 -21.300 1.00 15.12 ? 317 ALA A O     1 
ATOM   3349 C  CB    . ALA E 3 317 ? 25.332  -50.711 -19.360 1.00 20.38 ? 317 ALA A CB    1 
ATOM   3350 N  N     . ARG E 3 318 ? 21.941  -50.034 -19.620 1.00 18.73 ? 318 ARG A N     1 
ATOM   3351 C  CA    . ARG E 3 318 ? 20.769  -50.148 -20.485 1.00 21.05 ? 318 ARG A CA    1 
ATOM   3352 C  C     . ARG E 3 318 ? 20.897  -51.251 -21.543 1.00 20.82 ? 318 ARG A C     1 
ATOM   3353 O  O     . ARG E 3 318 ? 20.562  -51.057 -22.715 1.00 20.82 ? 318 ARG A O     1 
ATOM   3354 C  CB    . ARG E 3 318 ? 20.487  -48.808 -21.176 1.00 23.26 ? 318 ARG A CB    1 
ATOM   3355 C  CG    . ARG E 3 318 ? 20.190  -47.667 -20.219 1.00 27.56 ? 318 ARG A CG    1 
ATOM   3356 C  CD    . ARG E 3 318 ? 19.207  -46.679 -20.829 1.00 29.88 ? 318 ARG A CD    1 
ATOM   3357 N  NE    . ARG E 3 318 ? 19.597  -45.267 -20.636 1.00 33.87 ? 318 ARG A NE    1 
ATOM   3358 C  CZ    . ARG E 3 318 ? 19.758  -44.461 -19.577 1.00 35.18 ? 318 ARG A CZ    1 
ATOM   3359 N  NH1   . ARG E 3 318 ? 19.587  -44.784 -18.288 1.00 38.11 ? 318 ARG A NH1   1 
ATOM   3360 N  NH2   . ARG E 3 318 ? 19.897  -43.173 -19.891 1.00 37.27 ? 318 ARG A NH2   1 
ATOM   3361 N  N     . ILE E 3 319 ? 21.388  -52.409 -21.128 1.00 20.16 ? 319 ILE A N     1 
ATOM   3362 C  CA    . ILE E 3 319 ? 21.552  -53.522 -22.049 1.00 18.98 ? 319 ILE A CA    1 
ATOM   3363 C  C     . ILE E 3 319 ? 20.182  -54.127 -22.327 1.00 18.38 ? 319 ILE A C     1 
ATOM   3364 O  O     . ILE E 3 319 ? 19.560  -54.685 -21.434 1.00 19.32 ? 319 ILE A O     1 
ATOM   3365 C  CB    . ILE E 3 319 ? 22.470  -54.605 -21.446 1.00 18.22 ? 319 ILE A CB    1 
ATOM   3366 C  CG1   . ILE E 3 319 ? 23.828  -53.996 -21.072 1.00 18.34 ? 319 ILE A CG1   1 
ATOM   3367 C  CG2   . ILE E 3 319 ? 22.653  -55.731 -22.436 1.00 16.52 ? 319 ILE A CG2   1 
ATOM   3368 C  CD1   . ILE E 3 319 ? 24.568  -53.315 -22.236 1.00 14.43 ? 319 ILE A CD1   1 
ATOM   3369 N  N     . HIS E 3 320 ? 19.707  -54.013 -23.559 1.00 17.25 ? 320 HIS A N     1 
ATOM   3370 C  CA    . HIS E 3 320 ? 18.406  -54.553 -23.900 1.00 18.96 ? 320 HIS A CA    1 
ATOM   3371 C  C     . HIS E 3 320 ? 18.506  -56.062 -24.120 1.00 20.00 ? 320 HIS A C     1 
ATOM   3372 O  O     . HIS E 3 320 ? 19.540  -56.555 -24.553 1.00 20.68 ? 320 HIS A O     1 
ATOM   3373 C  CB    . HIS E 3 320 ? 17.873  -53.881 -25.167 1.00 18.93 ? 320 HIS A CB    1 
ATOM   3374 C  CG    . HIS E 3 320 ? 16.435  -54.188 -25.452 1.00 19.37 ? 320 HIS A CG    1 
ATOM   3375 N  ND1   . HIS E 3 320 ? 15.397  -53.550 -24.807 1.00 20.11 ? 320 HIS A ND1   1 
ATOM   3376 C  CD2   . HIS E 3 320 ? 15.864  -55.098 -26.274 1.00 18.49 ? 320 HIS A CD2   1 
ATOM   3377 C  CE1   . HIS E 3 320 ? 14.248  -54.054 -25.222 1.00 20.30 ? 320 HIS A CE1   1 
ATOM   3378 N  NE2   . HIS E 3 320 ? 14.503  -54.995 -26.112 1.00 18.45 ? 320 HIS A NE2   1 
ATOM   3379 N  N     . PRO E 3 321 ? 17.434  -56.819 -23.817 1.00 20.28 ? 321 PRO A N     1 
ATOM   3380 C  CA    . PRO E 3 321 ? 17.506  -58.269 -24.025 1.00 21.55 ? 321 PRO A CA    1 
ATOM   3381 C  C     . PRO E 3 321 ? 17.787  -58.671 -25.469 1.00 20.95 ? 321 PRO A C     1 
ATOM   3382 O  O     . PRO E 3 321 ? 18.435  -59.686 -25.721 1.00 20.10 ? 321 PRO A O     1 
ATOM   3383 C  CB    . PRO E 3 321 ? 16.138  -58.764 -23.532 1.00 21.95 ? 321 PRO A CB    1 
ATOM   3384 C  CG    . PRO E 3 321 ? 15.268  -57.565 -23.659 1.00 21.33 ? 321 PRO A CG    1 
ATOM   3385 C  CD    . PRO E 3 321 ? 16.156  -56.456 -23.189 1.00 19.68 ? 321 PRO A CD    1 
ATOM   3386 N  N     . PHE E 3 322 ? 17.301  -57.877 -26.416 1.00 21.26 ? 322 PHE A N     1 
ATOM   3387 C  CA    . PHE E 3 322 ? 17.526  -58.177 -27.830 1.00 20.59 ? 322 PHE A CA    1 
ATOM   3388 C  C     . PHE E 3 322 ? 19.018  -58.236 -28.128 1.00 21.59 ? 322 PHE A C     1 
ATOM   3389 O  O     . PHE E 3 322 ? 19.501  -59.194 -28.740 1.00 20.81 ? 322 PHE A O     1 
ATOM   3390 C  CB    . PHE E 3 322 ? 16.826  -57.127 -28.697 1.00 18.44 ? 322 PHE A CB    1 
ATOM   3391 C  CG    . PHE E 3 322 ? 17.352  -57.032 -30.102 1.00 17.87 ? 322 PHE A CG    1 
ATOM   3392 C  CD1   . PHE E 3 322 ? 18.381  -56.151 -30.414 1.00 17.03 ? 322 PHE A CD1   1 
ATOM   3393 C  CD2   . PHE E 3 322 ? 16.784  -57.774 -31.120 1.00 16.84 ? 322 PHE A CD2   1 
ATOM   3394 C  CE1   . PHE E 3 322 ? 18.832  -56.015 -31.718 1.00 16.22 ? 322 PHE A CE1   1 
ATOM   3395 C  CE2   . PHE E 3 322 ? 17.235  -57.641 -32.424 1.00 16.94 ? 322 PHE A CE2   1 
ATOM   3396 C  CZ    . PHE E 3 322 ? 18.257  -56.756 -32.722 1.00 15.59 ? 322 PHE A CZ    1 
ATOM   3397 N  N     . HIS E 3 323 ? 19.743  -57.218 -27.671 1.00 22.11 ? 323 HIS A N     1 
ATOM   3398 C  CA    . HIS E 3 323 ? 21.175  -57.154 -27.880 1.00 22.61 ? 323 HIS A CA    1 
ATOM   3399 C  C     . HIS E 3 323 ? 21.835  -58.398 -27.310 1.00 22.95 ? 323 HIS A C     1 
ATOM   3400 O  O     . HIS E 3 323 ? 22.826  -58.881 -27.850 1.00 23.38 ? 323 HIS A O     1 
ATOM   3401 C  CB    . HIS E 3 323 ? 21.751  -55.894 -27.231 1.00 25.78 ? 323 HIS A CB    1 
ATOM   3402 C  CG    . HIS E 3 323 ? 21.243  -54.616 -27.832 1.00 27.49 ? 323 HIS A CG    1 
ATOM   3403 N  ND1   . HIS E 3 323 ? 21.129  -54.428 -29.195 1.00 27.76 ? 323 HIS A ND1   1 
ATOM   3404 C  CD2   . HIS E 3 323 ? 20.847  -53.456 -27.256 1.00 27.94 ? 323 HIS A CD2   1 
ATOM   3405 C  CE1   . HIS E 3 323 ? 20.684  -53.207 -29.433 1.00 28.71 ? 323 HIS A CE1   1 
ATOM   3406 N  NE2   . HIS E 3 323 ? 20.505  -52.596 -28.275 1.00 31.33 ? 323 HIS A NE2   1 
ATOM   3407 N  N     . ILE E 3 324 ? 21.285  -58.917 -26.218 1.00 22.51 ? 324 ILE A N     1 
ATOM   3408 C  CA    . ILE E 3 324 ? 21.826  -60.125 -25.608 1.00 22.54 ? 324 ILE A CA    1 
ATOM   3409 C  C     . ILE E 3 324 ? 21.553  -61.298 -26.548 1.00 23.14 ? 324 ILE A C     1 
ATOM   3410 O  O     . ILE E 3 324 ? 22.454  -62.073 -26.877 1.00 23.59 ? 324 ILE A O     1 
ATOM   3411 C  CB    . ILE E 3 324 ? 21.146  -60.449 -24.251 1.00 23.37 ? 324 ILE A CB    1 
ATOM   3412 C  CG1   . ILE E 3 324 ? 21.228  -59.252 -23.309 1.00 23.78 ? 324 ILE A CG1   1 
ATOM   3413 C  CG2   . ILE E 3 324 ? 21.828  -61.639 -23.604 1.00 21.34 ? 324 ILE A CG2   1 
ATOM   3414 C  CD1   . ILE E 3 324 ? 22.637  -58.880 -22.944 1.00 25.61 ? 324 ILE A CD1   1 
ATOM   3415 N  N     . LEU E 3 325 ? 20.301  -61.426 -26.980 1.00 22.49 ? 325 LEU A N     1 
ATOM   3416 C  CA    . LEU E 3 325 ? 19.927  -62.515 -27.863 1.00 22.50 ? 325 LEU A CA    1 
ATOM   3417 C  C     . LEU E 3 325 ? 20.793  -62.530 -29.122 1.00 22.44 ? 325 LEU A C     1 
ATOM   3418 O  O     . LEU E 3 325 ? 21.320  -63.578 -29.483 1.00 22.92 ? 325 LEU A O     1 
ATOM   3419 C  CB    . LEU E 3 325 ? 18.445  -62.415 -28.239 1.00 23.42 ? 325 LEU A CB    1 
ATOM   3420 C  CG    . LEU E 3 325 ? 17.753  -63.751 -28.541 1.00 24.21 ? 325 LEU A CG    1 
ATOM   3421 C  CD1   . LEU E 3 325 ? 16.330  -63.510 -29.015 1.00 25.85 ? 325 LEU A CD1   1 
ATOM   3422 C  CD2   . LEU E 3 325 ? 18.523  -64.503 -29.583 1.00 23.21 ? 325 LEU A CD2   1 
ATOM   3423 N  N     . VAL E 3 326 ? 20.951  -61.381 -29.785 1.00 22.14 ? 326 VAL A N     1 
ATOM   3424 C  CA    . VAL E 3 326 ? 21.769  -61.314 -31.003 1.00 21.69 ? 326 VAL A CA    1 
ATOM   3425 C  C     . VAL E 3 326 ? 23.210  -61.762 -30.749 1.00 22.49 ? 326 VAL A C     1 
ATOM   3426 O  O     . VAL E 3 326 ? 23.778  -62.502 -31.543 1.00 22.78 ? 326 VAL A O     1 
ATOM   3427 C  CB    . VAL E 3 326 ? 21.814  -59.877 -31.617 1.00 21.22 ? 326 VAL A CB    1 
ATOM   3428 C  CG1   . VAL E 3 326 ? 22.800  -59.841 -32.778 1.00 18.68 ? 326 VAL A CG1   1 
ATOM   3429 C  CG2   . VAL E 3 326 ? 20.434  -59.461 -32.104 1.00 20.14 ? 326 VAL A CG2   1 
ATOM   3430 N  N     . ALA E 3 327 ? 23.795  -61.310 -29.642 1.00 23.05 ? 327 ALA A N     1 
ATOM   3431 C  CA    . ALA E 3 327 ? 25.167  -61.668 -29.289 1.00 23.31 ? 327 ALA A CA    1 
ATOM   3432 C  C     . ALA E 3 327 ? 25.288  -63.146 -28.930 1.00 24.04 ? 327 ALA A C     1 
ATOM   3433 O  O     . ALA E 3 327 ? 26.265  -63.805 -29.270 1.00 23.30 ? 327 ALA A O     1 
ATOM   3434 C  CB    . ALA E 3 327 ? 25.641  -60.819 -28.119 1.00 23.01 ? 327 ALA A CB    1 
ATOM   3435 N  N     . LEU E 3 328 ? 24.301  -63.668 -28.224 1.00 25.57 ? 328 LEU A N     1 
ATOM   3436 C  CA    . LEU E 3 328 ? 24.361  -65.059 -27.856 1.00 27.72 ? 328 LEU A CA    1 
ATOM   3437 C  C     . LEU E 3 328 ? 24.315  -65.908 -29.107 1.00 28.65 ? 328 LEU A C     1 
ATOM   3438 O  O     . LEU E 3 328 ? 25.131  -66.807 -29.281 1.00 28.61 ? 328 LEU A O     1 
ATOM   3439 C  CB    . LEU E 3 328 ? 23.204  -65.423 -26.944 1.00 29.32 ? 328 LEU A CB    1 
ATOM   3440 C  CG    . LEU E 3 328 ? 23.303  -66.854 -26.423 1.00 31.18 ? 328 LEU A CG    1 
ATOM   3441 C  CD1   . LEU E 3 328 ? 23.070  -66.821 -24.941 1.00 33.71 ? 328 LEU A CD1   1 
ATOM   3442 C  CD2   . LEU E 3 328 ? 22.297  -67.744 -27.106 1.00 32.11 ? 328 LEU A CD2   1 
ATOM   3443 N  N     . GLU E 3 329 ? 23.363  -65.615 -29.986 1.00 29.42 ? 329 GLU A N     1 
ATOM   3444 C  CA    . GLU E 3 329 ? 23.221  -66.369 -31.223 1.00 31.22 ? 329 GLU A CA    1 
ATOM   3445 C  C     . GLU E 3 329 ? 24.504  -66.349 -32.041 1.00 30.60 ? 329 GLU A C     1 
ATOM   3446 O  O     . GLU E 3 329 ? 24.990  -67.393 -32.481 1.00 30.99 ? 329 GLU A O     1 
ATOM   3447 C  CB    . GLU E 3 329 ? 22.072  -65.806 -32.065 1.00 33.70 ? 329 GLU A CB    1 
ATOM   3448 C  CG    . GLU E 3 329 ? 21.060  -66.857 -32.513 1.00 39.00 ? 329 GLU A CG    1 
ATOM   3449 C  CD    . GLU E 3 329 ? 21.699  -67.998 -33.312 1.00 44.10 ? 329 GLU A CD    1 
ATOM   3450 O  OE1   . GLU E 3 329 ? 22.186  -67.760 -34.442 1.00 45.06 ? 329 GLU A OE1   1 
ATOM   3451 O  OE2   . GLU E 3 329 ? 21.717  -69.143 -32.803 1.00 46.08 ? 329 GLU A OE2   1 
ATOM   3452 N  N     . THR E 3 330 ? 25.057  -65.161 -32.243 1.00 29.99 ? 330 THR A N     1 
ATOM   3453 C  CA    . THR E 3 330 ? 26.278  -65.038 -33.023 1.00 30.71 ? 330 THR A CA    1 
ATOM   3454 C  C     . THR E 3 330 ? 27.513  -65.589 -32.305 1.00 31.64 ? 330 THR A C     1 
ATOM   3455 O  O     . THR E 3 330 ? 28.361  -66.233 -32.923 1.00 31.44 ? 330 THR A O     1 
ATOM   3456 C  CB    . THR E 3 330 ? 26.525  -63.567 -33.433 1.00 29.76 ? 330 THR A CB    1 
ATOM   3457 O  OG1   . THR E 3 330 ? 25.447  -63.119 -34.269 1.00 29.85 ? 330 THR A OG1   1 
ATOM   3458 C  CG2   . THR E 3 330 ? 27.837  -63.436 -34.200 1.00 28.14 ? 330 THR A CG2   1 
ATOM   3459 N  N     . TYR E 3 331 ? 27.607  -65.356 -31.000 1.00 32.31 ? 331 TYR A N     1 
ATOM   3460 C  CA    . TYR E 3 331 ? 28.756  -65.834 -30.237 1.00 32.74 ? 331 TYR A CA    1 
ATOM   3461 C  C     . TYR E 3 331 ? 28.927  -67.351 -30.211 1.00 33.76 ? 331 TYR A C     1 
ATOM   3462 O  O     . TYR E 3 331 ? 30.029  -67.849 -30.399 1.00 34.02 ? 331 TYR A O     1 
ATOM   3463 C  CB    . TYR E 3 331 ? 28.700  -65.334 -28.799 1.00 30.89 ? 331 TYR A CB    1 
ATOM   3464 C  CG    . TYR E 3 331 ? 29.965  -65.663 -28.045 1.00 29.46 ? 331 TYR A CG    1 
ATOM   3465 C  CD1   . TYR E 3 331 ? 31.192  -65.127 -28.443 1.00 28.14 ? 331 TYR A CD1   1 
ATOM   3466 C  CD2   . TYR E 3 331 ? 29.948  -66.533 -26.958 1.00 28.19 ? 331 TYR A CD2   1 
ATOM   3467 C  CE1   . TYR E 3 331 ? 32.361  -65.452 -27.785 1.00 26.89 ? 331 TYR A CE1   1 
ATOM   3468 C  CE2   . TYR E 3 331 ? 31.113  -66.867 -26.294 1.00 27.23 ? 331 TYR A CE2   1 
ATOM   3469 C  CZ    . TYR E 3 331 ? 32.318  -66.324 -26.711 1.00 27.68 ? 331 TYR A CZ    1 
ATOM   3470 O  OH    . TYR E 3 331 ? 33.485  -66.672 -26.063 1.00 27.24 ? 331 TYR A OH    1 
ATOM   3471 N  N     . LYS E 3 332 ? 27.846  -68.082 -29.963 1.00 35.28 ? 332 LYS A N     1 
ATOM   3472 C  CA    . LYS E 3 332 ? 27.920  -69.538 -29.916 1.00 37.21 ? 332 LYS A CA    1 
ATOM   3473 C  C     . LYS E 3 332 ? 28.149  -70.142 -31.296 1.00 37.87 ? 332 LYS A C     1 
ATOM   3474 O  O     . LYS E 3 332 ? 28.546  -71.296 -31.413 1.00 38.50 ? 332 LYS A O     1 
ATOM   3475 C  CB    . LYS E 3 332 ? 26.637  -70.124 -29.330 1.00 38.01 ? 332 LYS A CB    1 
ATOM   3476 C  CG    . LYS E 3 332 ? 25.384  -69.679 -30.057 1.00 39.82 ? 332 LYS A CG    1 
ATOM   3477 C  CD    . LYS E 3 332 ? 24.314  -70.756 -29.991 1.00 42.09 ? 332 LYS A CD    1 
ATOM   3478 C  CE    . LYS E 3 332 ? 22.994  -70.276 -30.564 1.00 43.40 ? 332 LYS A CE    1 
ATOM   3479 N  NZ    . LYS E 3 332 ? 22.009  -71.397 -30.611 1.00 43.70 ? 332 LYS A NZ    1 
ATOM   3480 N  N     . LYS E 3 333 ? 27.889  -69.365 -32.340 1.00 38.47 ? 333 LYS A N     1 
ATOM   3481 C  CA    . LYS E 3 333 ? 28.076  -69.844 -33.703 1.00 40.03 ? 333 LYS A CA    1 
ATOM   3482 C  C     . LYS E 3 333 ? 29.568  -69.914 -34.045 1.00 40.54 ? 333 LYS A C     1 
ATOM   3483 O  O     . LYS E 3 333 ? 29.943  -70.314 -35.148 1.00 40.43 ? 333 LYS A O     1 
ATOM   3484 C  CB    . LYS E 3 333 ? 27.380  -68.905 -34.693 1.00 41.85 ? 333 LYS A CB    1 
ATOM   3485 C  CG    . LYS E 3 333 ? 26.090  -69.424 -35.299 1.00 43.51 ? 333 LYS A CG    1 
ATOM   3486 C  CD    . LYS E 3 333 ? 25.638  -68.479 -36.412 1.00 45.24 ? 333 LYS A CD    1 
ATOM   3487 C  CE    . LYS E 3 333 ? 24.466  -69.070 -37.212 1.00 47.21 ? 333 LYS A CE    1 
ATOM   3488 N  NZ    . LYS E 3 333 ? 23.211  -69.222 -36.405 1.00 47.55 ? 333 LYS A NZ    1 
ATOM   3489 N  N     . GLY E 3 334 ? 30.415  -69.496 -33.108 1.00 40.82 ? 334 GLY A N     1 
ATOM   3490 C  CA    . GLY E 3 334 ? 31.849  -69.530 -33.336 1.00 41.16 ? 334 GLY A CA    1 
ATOM   3491 C  C     . GLY E 3 334 ? 32.345  -68.534 -34.359 1.00 42.15 ? 334 GLY A C     1 
ATOM   3492 O  O     . GLY E 3 334 ? 33.527  -68.203 -34.362 1.00 42.73 ? 334 GLY A O     1 
ATOM   3493 N  N     . HIS E 3 335 ? 31.452  -68.065 -35.229 1.00 43.34 ? 335 HIS A N     1 
ATOM   3494 C  CA    . HIS E 3 335 ? 31.798  -67.085 -36.265 1.00 43.76 ? 335 HIS A CA    1 
ATOM   3495 C  C     . HIS E 3 335 ? 30.656  -66.090 -36.471 1.00 44.93 ? 335 HIS A C     1 
ATOM   3496 O  O     . HIS E 3 335 ? 29.505  -66.363 -36.122 1.00 44.89 ? 335 HIS A O     1 
ATOM   3497 C  CB    . HIS E 3 335 ? 32.098  -67.788 -37.592 1.00 43.16 ? 335 HIS A CB    1 
ATOM   3498 C  CG    . HIS E 3 335 ? 30.949  -68.586 -38.124 1.00 44.14 ? 335 HIS A CG    1 
ATOM   3499 N  ND1   . HIS E 3 335 ? 29.736  -68.020 -38.451 1.00 45.17 ? 335 HIS A ND1   1 
ATOM   3500 C  CD2   . HIS E 3 335 ? 30.820  -69.913 -38.366 1.00 45.50 ? 335 HIS A CD2   1 
ATOM   3501 C  CE1   . HIS E 3 335 ? 28.909  -68.961 -38.869 1.00 45.54 ? 335 HIS A CE1   1 
ATOM   3502 N  NE2   . HIS E 3 335 ? 29.543  -70.121 -38.826 1.00 46.44 ? 335 HIS A NE2   1 
ATOM   3503 N  N     . GLY E 3 336 ? 30.970  -64.940 -37.056 1.00 45.92 ? 336 GLY A N     1 
ATOM   3504 C  CA    . GLY E 3 336 ? 29.947  -63.931 -37.271 1.00 47.05 ? 336 GLY A CA    1 
ATOM   3505 C  C     . GLY E 3 336 ? 29.100  -64.137 -38.509 1.00 47.98 ? 336 GLY A C     1 
ATOM   3506 O  O     . GLY E 3 336 ? 29.331  -65.067 -39.280 1.00 47.52 ? 336 GLY A O     1 
ATOM   3507 N  N     . ASN E 3 337 ? 28.106  -63.271 -38.692 1.00 48.99 ? 337 ASN A N     1 
ATOM   3508 C  CA    . ASN E 3 337 ? 27.237  -63.357 -39.857 1.00 50.35 ? 337 ASN A CA    1 
ATOM   3509 C  C     . ASN E 3 337 ? 27.821  -62.518 -40.983 1.00 51.44 ? 337 ASN A C     1 
ATOM   3510 O  O     . ASN E 3 337 ? 27.954  -62.991 -42.113 1.00 51.90 ? 337 ASN A O     1 
ATOM   3511 C  CB    . ASN E 3 337 ? 25.802  -62.887 -39.542 1.00 50.81 ? 337 ASN A CB    1 
ATOM   3512 C  CG    . ASN E 3 337 ? 24.932  -62.805 -40.789 1.00 51.11 ? 337 ASN A CG    1 
ATOM   3513 O  OD1   . ASN E 3 337 ? 23.687  -62.665 -40.695 1.00 50.05 ? 337 ASN A OD1   1 
ATOM   3514 N  ND2   . ASN E 3 337 ? 25.588  -62.878 -41.983 1.00 52.07 ? 337 ASN A ND2   1 
ATOM   3515 N  N     . ARG E 3 338 ? 28.152  -61.267 -40.685 1.00 52.58 ? 338 ARG A N     1 
ATOM   3516 C  CA    . ARG E 3 338 ? 28.745  -60.384 -41.689 1.00 53.61 ? 338 ARG A CA    1 
ATOM   3517 C  C     . ARG E 3 338 ? 30.249  -60.323 -41.453 1.00 53.07 ? 338 ARG A C     1 
ATOM   3518 O  O     . ARG E 3 338 ? 31.029  -60.107 -42.382 1.00 52.45 ? 338 ARG A O     1 
ATOM   3519 C  CB    . ARG E 3 338 ? 28.146  -58.979 -41.601 1.00 55.86 ? 338 ARG A CB    1 
ATOM   3520 C  CG    . ARG E 3 338 ? 26.816  -58.798 -42.333 1.00 58.67 ? 338 ARG A CG    1 
ATOM   3521 C  CD    . ARG E 3 338 ? 25.966  -57.814 -41.548 1.00 61.26 ? 338 ARG A CD    1 
ATOM   3522 N  NE    . ARG E 3 338 ? 25.082  -56.977 -42.297 1.00 63.11 ? 338 ARG A NE    1 
ATOM   3523 C  CZ    . ARG E 3 338 ? 23.801  -56.650 -42.126 1.00 64.36 ? 338 ARG A CZ    1 
ATOM   3524 N  NH1   . ARG E 3 338 ? 22.990  -57.079 -41.158 1.00 64.08 ? 338 ARG A NH1   1 
ATOM   3525 N  NH2   . ARG E 3 338 ? 23.352  -55.768 -42.997 1.00 64.99 ? 338 ARG A NH2   1 
ATOM   3526 N  N     . GLY E 3 339 ? 30.639  -60.521 -40.196 1.00 52.61 ? 339 GLY A N     1 
ATOM   3527 C  CA    . GLY E 3 339 ? 32.040  -60.507 -39.830 1.00 51.90 ? 339 GLY A CA    1 
ATOM   3528 C  C     . GLY E 3 339 ? 32.816  -61.568 -40.586 1.00 51.21 ? 339 GLY A C     1 
ATOM   3529 O  O     . GLY E 3 339 ? 32.264  -62.250 -41.454 1.00 51.11 ? 339 GLY A O     1 
ATOM   3530 N  N     . LYS E 3 340 ? 34.096  -61.717 -40.262 1.00 50.09 ? 340 LYS A N     1 
ATOM   3531 C  CA    . LYS E 3 340 ? 34.919  -62.700 -40.939 1.00 49.51 ? 340 LYS A CA    1 
ATOM   3532 C  C     . LYS E 3 340 ? 35.990  -63.311 -40.042 1.00 48.78 ? 340 LYS A C     1 
ATOM   3533 O  O     . LYS E 3 340 ? 37.068  -63.676 -40.513 1.00 48.94 ? 340 LYS A O     1 
ATOM   3534 C  CB    . LYS E 3 340 ? 35.553  -62.059 -42.178 1.00 50.71 ? 340 LYS A CB    1 
ATOM   3535 C  CG    . LYS E 3 340 ? 34.509  -61.521 -43.147 1.00 53.12 ? 340 LYS A CG    1 
ATOM   3536 C  CD    . LYS E 3 340 ? 35.118  -60.837 -44.359 1.00 56.06 ? 340 LYS A CD    1 
ATOM   3537 C  CE    . LYS E 3 340 ? 34.017  -60.260 -45.252 1.00 57.40 ? 340 LYS A CE    1 
ATOM   3538 N  NZ    . LYS E 3 340 ? 34.542  -59.473 -46.408 1.00 59.05 ? 340 LYS A NZ    1 
ATOM   3539 N  N     . LEU E 3 341 ? 35.686  -63.431 -38.754 1.00 47.20 ? 341 LEU A N     1 
ATOM   3540 C  CA    . LEU E 3 341 ? 36.624  -64.021 -37.807 1.00 45.46 ? 341 LEU A CA    1 
ATOM   3541 C  C     . LEU E 3 341 ? 35.989  -65.232 -37.164 1.00 44.60 ? 341 LEU A C     1 
ATOM   3542 O  O     . LEU E 3 341 ? 34.764  -65.357 -37.123 1.00 44.04 ? 341 LEU A O     1 
ATOM   3543 C  CB    . LEU E 3 341 ? 37.028  -63.023 -36.720 1.00 44.73 ? 341 LEU A CB    1 
ATOM   3544 C  CG    . LEU E 3 341 ? 37.763  -61.791 -37.230 1.00 44.15 ? 341 LEU A CG    1 
ATOM   3545 C  CD1   . LEU E 3 341 ? 36.756  -60.805 -37.770 1.00 46.20 ? 341 LEU A CD1   1 
ATOM   3546 C  CD2   . LEU E 3 341 ? 38.550  -61.167 -36.113 1.00 44.03 ? 341 LEU A CD2   1 
ATOM   3547 N  N     . ARG E 3 342 ? 36.829  -66.129 -36.663 1.00 43.96 ? 342 ARG A N     1 
ATOM   3548 C  CA    . ARG E 3 342 ? 36.345  -67.349 -36.029 1.00 42.72 ? 342 ARG A CA    1 
ATOM   3549 C  C     . ARG E 3 342 ? 36.877  -67.446 -34.618 1.00 40.38 ? 342 ARG A C     1 
ATOM   3550 O  O     . ARG E 3 342 ? 37.967  -66.954 -34.317 1.00 40.67 ? 342 ARG A O     1 
ATOM   3551 C  CB    . ARG E 3 342 ? 36.776  -68.569 -36.852 1.00 44.77 ? 342 ARG A CB    1 
ATOM   3552 C  CG    . ARG E 3 342 ? 36.267  -68.487 -38.287 1.00 48.74 ? 342 ARG A CG    1 
ATOM   3553 C  CD    . ARG E 3 342 ? 36.620  -69.700 -39.159 1.00 51.76 ? 342 ARG A CD    1 
ATOM   3554 N  NE    . ARG E 3 342 ? 35.475  -70.090 -39.929 1.00 54.12 ? 342 ARG A NE    1 
ATOM   3555 C  CZ    . ARG E 3 342 ? 35.192  -70.087 -41.227 1.00 54.86 ? 342 ARG A CZ    1 
ATOM   3556 N  NH1   . ARG E 3 342 ? 35.982  -69.696 -42.218 1.00 54.85 ? 342 ARG A NH1   1 
ATOM   3557 N  NH2   . ARG E 3 342 ? 33.973  -70.492 -41.497 1.00 56.30 ? 342 ARG A NH2   1 
ATOM   3558 N  N     . TRP E 3 343 ? 36.097  -68.074 -33.750 1.00 37.55 ? 343 TRP A N     1 
ATOM   3559 C  CA    . TRP E 3 343 ? 36.500  -68.240 -32.366 1.00 36.18 ? 343 TRP A CA    1 
ATOM   3560 C  C     . TRP E 3 343 ? 35.829  -69.476 -31.788 1.00 35.17 ? 343 TRP A C     1 
ATOM   3561 O  O     . TRP E 3 343 ? 34.740  -69.855 -32.215 1.00 35.84 ? 343 TRP A O     1 
ATOM   3562 C  CB    . TRP E 3 343 ? 36.131  -66.986 -31.542 1.00 34.53 ? 343 TRP A CB    1 
ATOM   3563 C  CG    . TRP E 3 343 ? 34.654  -66.658 -31.534 1.00 33.46 ? 343 TRP A CG    1 
ATOM   3564 C  CD1   . TRP E 3 343 ? 33.675  -67.296 -30.824 1.00 32.87 ? 343 TRP A CD1   1 
ATOM   3565 C  CD2   . TRP E 3 343 ? 33.983  -65.691 -32.358 1.00 31.99 ? 343 TRP A CD2   1 
ATOM   3566 N  NE1   . TRP E 3 343 ? 32.441  -66.793 -31.159 1.00 31.93 ? 343 TRP A NE1   1 
ATOM   3567 C  CE2   . TRP E 3 343 ? 32.600  -65.807 -32.090 1.00 31.43 ? 343 TRP A CE2   1 
ATOM   3568 C  CE3   . TRP E 3 343 ? 34.416  -64.737 -33.284 1.00 31.10 ? 343 TRP A CE3   1 
ATOM   3569 C  CZ2   . TRP E 3 343 ? 31.647  -65.016 -32.737 1.00 30.23 ? 343 TRP A CZ2   1 
ATOM   3570 C  CZ3   . TRP E 3 343 ? 33.465  -63.951 -33.924 1.00 31.01 ? 343 TRP A CZ3   1 
ATOM   3571 C  CH2   . TRP E 3 343 ? 32.096  -64.094 -33.641 1.00 30.43 ? 343 TRP A CH2   1 
ATOM   3572 N  N     . ILE E 3 344 ? 36.504  -70.120 -30.843 1.00 34.46 ? 344 ILE A N     1 
ATOM   3573 C  CA    . ILE E 3 344 ? 35.958  -71.293 -30.178 1.00 33.37 ? 344 ILE A CA    1 
ATOM   3574 C  C     . ILE E 3 344 ? 35.087  -70.716 -29.074 1.00 33.75 ? 344 ILE A C     1 
ATOM   3575 O  O     . ILE E 3 344 ? 35.598  -70.208 -28.077 1.00 35.25 ? 344 ILE A O     1 
ATOM   3576 C  CB    . ILE E 3 344 ? 37.075  -72.143 -29.552 1.00 33.75 ? 344 ILE A CB    1 
ATOM   3577 C  CG1   . ILE E 3 344 ? 38.067  -72.570 -30.640 1.00 33.95 ? 344 ILE A CG1   1 
ATOM   3578 C  CG2   . ILE E 3 344 ? 36.484  -73.357 -28.854 1.00 31.59 ? 344 ILE A CG2   1 
ATOM   3579 C  CD1   . ILE E 3 344 ? 39.272  -73.332 -30.123 1.00 33.36 ? 344 ILE A CD1   1 
ATOM   3580 N  N     . PRO E 3 345 ? 33.759  -70.768 -29.241 1.00 33.13 ? 345 PRO A N     1 
ATOM   3581 C  CA    . PRO E 3 345 ? 32.855  -70.225 -28.223 1.00 32.76 ? 345 PRO A CA    1 
ATOM   3582 C  C     . PRO E 3 345 ? 33.100  -70.767 -26.819 1.00 32.68 ? 345 PRO A C     1 
ATOM   3583 O  O     . PRO E 3 345 ? 33.077  -71.972 -26.591 1.00 32.58 ? 345 PRO A O     1 
ATOM   3584 C  CB    . PRO E 3 345 ? 31.469  -70.575 -28.768 1.00 32.03 ? 345 PRO A CB    1 
ATOM   3585 C  CG    . PRO E 3 345 ? 31.722  -71.789 -29.595 1.00 32.03 ? 345 PRO A CG    1 
ATOM   3586 C  CD    . PRO E 3 345 ? 33.003  -71.453 -30.301 1.00 32.20 ? 345 PRO A CD    1 
ATOM   3587 N  N     . ASP E 3 346 ? 33.348  -69.857 -25.887 1.00 33.47 ? 346 ASP A N     1 
ATOM   3588 C  CA    . ASP E 3 346 ? 33.594  -70.218 -24.501 1.00 34.29 ? 346 ASP A CA    1 
ATOM   3589 C  C     . ASP E 3 346 ? 32.256  -70.579 -23.849 1.00 34.58 ? 346 ASP A C     1 
ATOM   3590 O  O     . ASP E 3 346 ? 31.312  -69.799 -23.892 1.00 36.30 ? 346 ASP A O     1 
ATOM   3591 C  CB    . ASP E 3 346 ? 34.254  -69.046 -23.784 1.00 33.95 ? 346 ASP A CB    1 
ATOM   3592 C  CG    . ASP E 3 346 ? 34.702  -69.402 -22.394 1.00 36.38 ? 346 ASP A CG    1 
ATOM   3593 O  OD1   . ASP E 3 346 ? 33.864  -69.380 -21.468 1.00 36.65 ? 346 ASP A OD1   1 
ATOM   3594 O  OD2   . ASP E 3 346 ? 35.901  -69.719 -22.228 1.00 39.03 ? 346 ASP A OD2   1 
ATOM   3595 N  N     . THR E 3 347 ? 32.176  -71.760 -23.246 1.00 34.61 ? 347 THR A N     1 
ATOM   3596 C  CA    . THR E 3 347 ? 30.938  -72.212 -22.624 1.00 34.88 ? 347 THR A CA    1 
ATOM   3597 C  C     . THR E 3 347 ? 30.543  -71.435 -21.385 1.00 34.88 ? 347 THR A C     1 
ATOM   3598 O  O     . THR E 3 347 ? 29.374  -71.444 -20.997 1.00 37.25 ? 347 THR A O     1 
ATOM   3599 C  CB    . THR E 3 347 ? 31.009  -73.698 -22.252 1.00 36.39 ? 347 THR A CB    1 
ATOM   3600 O  OG1   . THR E 3 347 ? 31.479  -74.442 -23.383 1.00 36.82 ? 347 THR A OG1   1 
ATOM   3601 C  CG2   . THR E 3 347 ? 29.622  -74.213 -21.850 1.00 35.92 ? 347 THR A CG2   1 
ATOM   3602 N  N     . SER E 3 348 ? 31.498  -70.778 -20.743 1.00 34.03 ? 348 SER A N     1 
ATOM   3603 C  CA    . SER E 3 348 ? 31.176  -69.993 -19.552 1.00 34.20 ? 348 SER A CA    1 
ATOM   3604 C  C     . SER E 3 348 ? 30.396  -68.742 -19.965 1.00 33.01 ? 348 SER A C     1 
ATOM   3605 O  O     . SER E 3 348 ? 29.447  -68.328 -19.294 1.00 31.83 ? 348 SER A O     1 
ATOM   3606 C  CB    . SER E 3 348 ? 32.455  -69.577 -18.826 1.00 34.14 ? 348 SER A CB    1 
ATOM   3607 O  OG    . SER E 3 348 ? 32.342  -69.836 -17.430 1.00 36.31 ? 348 SER A OG    1 
ATOM   3608 N  N     . ILE E 3 349 ? 30.815  -68.155 -21.085 1.00 32.23 ? 349 ILE A N     1 
ATOM   3609 C  CA    . ILE E 3 349 ? 30.197  -66.953 -21.632 1.00 30.89 ? 349 ILE A CA    1 
ATOM   3610 C  C     . ILE E 3 349 ? 28.797  -67.233 -22.168 1.00 30.67 ? 349 ILE A C     1 
ATOM   3611 O  O     . ILE E 3 349 ? 27.870  -66.452 -21.957 1.00 29.60 ? 349 ILE A O     1 
ATOM   3612 C  CB    . ILE E 3 349 ? 31.033  -66.394 -22.780 1.00 30.14 ? 349 ILE A CB    1 
ATOM   3613 C  CG1   . ILE E 3 349 ? 32.483  -66.229 -22.335 1.00 30.46 ? 349 ILE A CG1   1 
ATOM   3614 C  CG2   . ILE E 3 349 ? 30.443  -65.082 -23.249 1.00 30.63 ? 349 ILE A CG2   1 
ATOM   3615 C  CD1   . ILE E 3 349 ? 32.653  -65.412 -21.085 1.00 31.18 ? 349 ILE A CD1   1 
ATOM   3616 N  N     . VAL E 3 350 ? 28.653  -68.349 -22.872 1.00 29.51 ? 350 VAL A N     1 
ATOM   3617 C  CA    . VAL E 3 350 ? 27.370  -68.725 -23.422 1.00 29.60 ? 350 VAL A CA    1 
ATOM   3618 C  C     . VAL E 3 350 ? 26.366  -68.901 -22.291 1.00 31.31 ? 350 VAL A C     1 
ATOM   3619 O  O     . VAL E 3 350 ? 25.175  -68.626 -22.455 1.00 32.28 ? 350 VAL A O     1 
ATOM   3620 C  CB    . VAL E 3 350 ? 27.475  -70.039 -24.203 1.00 28.54 ? 350 VAL A CB    1 
ATOM   3621 C  CG1   . VAL E 3 350 ? 26.104  -70.438 -24.733 1.00 28.75 ? 350 VAL A CG1   1 
ATOM   3622 C  CG2   . VAL E 3 350 ? 28.464  -69.885 -25.340 1.00 26.73 ? 350 VAL A CG2   1 
ATOM   3623 N  N     . GLU E 3 351 ? 26.849  -69.357 -21.139 1.00 32.78 ? 351 GLU A N     1 
ATOM   3624 C  CA    . GLU E 3 351 ? 25.980  -69.577 -19.987 1.00 34.22 ? 351 GLU A CA    1 
ATOM   3625 C  C     . GLU E 3 351 ? 25.730  -68.281 -19.228 1.00 33.49 ? 351 GLU A C     1 
ATOM   3626 O  O     . GLU E 3 351 ? 24.744  -68.164 -18.502 1.00 34.44 ? 351 GLU A O     1 
ATOM   3627 C  CB    . GLU E 3 351 ? 26.595  -70.622 -19.047 1.00 37.09 ? 351 GLU A CB    1 
ATOM   3628 C  CG    . GLU E 3 351 ? 25.777  -70.870 -17.789 1.00 41.08 ? 351 GLU A CG    1 
ATOM   3629 C  CD    . GLU E 3 351 ? 26.590  -70.755 -16.526 1.00 43.79 ? 351 GLU A CD    1 
ATOM   3630 O  OE1   . GLU E 3 351 ? 27.698  -70.159 -16.582 1.00 44.47 ? 351 GLU A OE1   1 
ATOM   3631 O  OE2   . GLU E 3 351 ? 26.120  -71.243 -15.476 1.00 45.06 ? 351 GLU A OE2   1 
ATOM   3632 N  N     . ALA E 3 352 ? 26.620  -67.310 -19.408 1.00 32.43 ? 352 ALA A N     1 
ATOM   3633 C  CA    . ALA E 3 352 ? 26.493  -66.019 -18.743 1.00 31.51 ? 352 ALA A CA    1 
ATOM   3634 C  C     . ALA E 3 352 ? 25.576  -65.088 -19.535 1.00 31.49 ? 352 ALA A C     1 
ATOM   3635 O  O     . ALA E 3 352 ? 24.800  -64.328 -18.953 1.00 30.70 ? 352 ALA A O     1 
ATOM   3636 C  CB    . ALA E 3 352 ? 27.866  -65.387 -18.574 1.00 31.15 ? 352 ALA A CB    1 
ATOM   3637 N  N     . LEU E 3 353 ? 25.676  -65.150 -20.863 1.00 31.95 ? 353 LEU A N     1 
ATOM   3638 C  CA    . LEU E 3 353 ? 24.849  -64.330 -21.743 1.00 32.93 ? 353 LEU A CA    1 
ATOM   3639 C  C     . LEU E 3 353 ? 23.415  -64.823 -21.626 1.00 34.08 ? 353 LEU A C     1 
ATOM   3640 O  O     . LEU E 3 353 ? 22.484  -64.056 -21.375 1.00 33.89 ? 353 LEU A O     1 
ATOM   3641 C  CB    . LEU E 3 353 ? 25.293  -64.481 -23.199 1.00 33.09 ? 353 LEU A CB    1 
ATOM   3642 C  CG    . LEU E 3 353 ? 26.574  -63.795 -23.653 1.00 32.61 ? 353 LEU A CG    1 
ATOM   3643 C  CD1   . LEU E 3 353 ? 26.806  -64.079 -25.120 1.00 31.81 ? 353 LEU A CD1   1 
ATOM   3644 C  CD2   . LEU E 3 353 ? 26.457  -62.314 -23.414 1.00 32.80 ? 353 LEU A CD2   1 
ATOM   3645 N  N     . ASP E 3 354 ? 23.257  -66.123 -21.816 1.00 35.16 ? 354 ASP A N     1 
ATOM   3646 C  CA    . ASP E 3 354 ? 21.958  -66.747 -21.741 1.00 37.53 ? 354 ASP A CA    1 
ATOM   3647 C  C     . ASP E 3 354 ? 21.322  -66.499 -20.371 1.00 36.80 ? 354 ASP A C     1 
ATOM   3648 O  O     . ASP E 3 354 ? 20.103  -66.576 -20.219 1.00 37.61 ? 354 ASP A O     1 
ATOM   3649 C  CB    . ASP E 3 354 ? 22.115  -68.240 -22.059 1.00 40.21 ? 354 ASP A CB    1 
ATOM   3650 C  CG    . ASP E 3 354 ? 21.340  -69.124 -21.139 1.00 43.88 ? 354 ASP A CG    1 
ATOM   3651 O  OD1   . ASP E 3 354 ? 20.102  -68.980 -21.048 1.00 46.69 ? 354 ASP A OD1   1 
ATOM   3652 O  OD2   . ASP E 3 354 ? 21.970  -70.001 -20.514 1.00 46.43 ? 354 ASP A OD2   1 
ATOM   3653 N  N     . ASN E 3 355 ? 22.139  -66.169 -19.380 1.00 35.78 ? 355 ASN A N     1 
ATOM   3654 C  CA    . ASN E 3 355 ? 21.624  -65.901 -18.040 1.00 34.85 ? 355 ASN A CA    1 
ATOM   3655 C  C     . ASN E 3 355 ? 21.299  -64.413 -17.968 1.00 32.87 ? 355 ASN A C     1 
ATOM   3656 O  O     . ASN E 3 355 ? 20.292  -64.013 -17.376 1.00 34.12 ? 355 ASN A O     1 
ATOM   3657 C  CB    . ASN E 3 355 ? 22.684  -66.270 -16.990 1.00 38.06 ? 355 ASN A CB    1 
ATOM   3658 C  CG    . ASN E 3 355 ? 22.090  -66.761 -15.700 1.00 39.97 ? 355 ASN A CG    1 
ATOM   3659 O  OD1   . ASN E 3 355 ? 22.691  -67.602 -15.004 1.00 42.26 ? 355 ASN A OD1   1 
ATOM   3660 N  ND2   . ASN E 3 355 ? 20.918  -66.225 -15.346 1.00 42.60 ? 355 ASN A ND2   1 
ATOM   3661 N  N     . ALA E 3 356 ? 22.160  -63.598 -18.569 1.00 30.17 ? 356 ALA A N     1 
ATOM   3662 C  CA    . ALA E 3 356 ? 21.972  -62.155 -18.574 1.00 27.41 ? 356 ALA A CA    1 
ATOM   3663 C  C     . ALA E 3 356 ? 20.677  -61.774 -19.282 1.00 25.71 ? 356 ALA A C     1 
ATOM   3664 O  O     . ALA E 3 356 ? 20.047  -60.784 -18.933 1.00 25.02 ? 356 ALA A O     1 
ATOM   3665 C  CB    . ALA E 3 356 ? 23.158  -61.484 -19.253 1.00 27.15 ? 356 ALA A CB    1 
ATOM   3666 N  N     . PHE E 3 357 ? 20.288  -62.563 -20.276 1.00 24.42 ? 357 PHE A N     1 
ATOM   3667 C  CA    . PHE E 3 357 ? 19.074  -62.300 -21.036 1.00 24.80 ? 357 PHE A CA    1 
ATOM   3668 C  C     . PHE E 3 357 ? 17.870  -62.060 -20.131 1.00 25.26 ? 357 PHE A C     1 
ATOM   3669 O  O     . PHE E 3 357 ? 17.105  -61.131 -20.339 1.00 25.33 ? 357 PHE A O     1 
ATOM   3670 C  CB    . PHE E 3 357 ? 18.767  -63.479 -21.963 1.00 23.52 ? 357 PHE A CB    1 
ATOM   3671 C  CG    . PHE E 3 357 ? 17.511  -63.311 -22.764 1.00 21.52 ? 357 PHE A CG    1 
ATOM   3672 C  CD1   . PHE E 3 357 ? 17.516  -62.570 -23.939 1.00 20.97 ? 357 PHE A CD1   1 
ATOM   3673 C  CD2   . PHE E 3 357 ? 16.309  -63.865 -22.326 1.00 20.61 ? 357 PHE A CD2   1 
ATOM   3674 C  CE1   . PHE E 3 357 ? 16.338  -62.380 -24.674 1.00 20.08 ? 357 PHE A CE1   1 
ATOM   3675 C  CE2   . PHE E 3 357 ? 15.126  -63.679 -23.054 1.00 20.28 ? 357 PHE A CE2   1 
ATOM   3676 C  CZ    . PHE E 3 357 ? 15.145  -62.932 -24.231 1.00 19.04 ? 357 PHE A CZ    1 
ATOM   3677 N  N     . TYR E 3 358 ? 17.709  -62.911 -19.126 1.00 27.08 ? 358 TYR A N     1 
ATOM   3678 C  CA    . TYR E 3 358 ? 16.581  -62.803 -18.210 1.00 27.74 ? 358 TYR A CA    1 
ATOM   3679 C  C     . TYR E 3 358 ? 16.693  -61.682 -17.199 1.00 27.73 ? 358 TYR A C     1 
ATOM   3680 O  O     . TYR E 3 358 ? 15.685  -61.239 -16.643 1.00 28.23 ? 358 TYR A O     1 
ATOM   3681 C  CB    . TYR E 3 358 ? 16.377  -64.131 -17.504 1.00 26.48 ? 358 TYR A CB    1 
ATOM   3682 C  CG    . TYR E 3 358 ? 15.971  -65.195 -18.483 1.00 27.87 ? 358 TYR A CG    1 
ATOM   3683 C  CD1   . TYR E 3 358 ? 14.734  -65.130 -19.129 1.00 27.81 ? 358 TYR A CD1   1 
ATOM   3684 C  CD2   . TYR E 3 358 ? 16.830  -66.249 -18.799 1.00 28.35 ? 358 TYR A CD2   1 
ATOM   3685 C  CE1   . TYR E 3 358 ? 14.359  -66.088 -20.065 1.00 28.77 ? 358 TYR A CE1   1 
ATOM   3686 C  CE2   . TYR E 3 358 ? 16.465  -67.215 -19.734 1.00 29.09 ? 358 TYR A CE2   1 
ATOM   3687 C  CZ    . TYR E 3 358 ? 15.229  -67.130 -20.362 1.00 29.25 ? 358 TYR A CZ    1 
ATOM   3688 O  OH    . TYR E 3 358 ? 14.865  -68.092 -21.282 1.00 31.10 ? 358 TYR A OH    1 
ATOM   3689 N  N     . LYS E 3 359 ? 17.914  -61.216 -16.964 1.00 27.50 ? 359 LYS A N     1 
ATOM   3690 C  CA    . LYS E 3 359 ? 18.119  -60.130 -16.018 1.00 26.76 ? 359 LYS A CA    1 
ATOM   3691 C  C     . LYS E 3 359 ? 17.978  -58.756 -16.654 1.00 25.85 ? 359 LYS A C     1 
ATOM   3692 O  O     . LYS E 3 359 ? 17.848  -57.769 -15.945 1.00 25.31 ? 359 LYS A O     1 
ATOM   3693 C  CB    . LYS E 3 359 ? 19.492  -60.257 -15.362 1.00 28.10 ? 359 LYS A CB    1 
ATOM   3694 C  CG    . LYS E 3 359 ? 19.683  -61.542 -14.578 1.00 29.87 ? 359 LYS A CG    1 
ATOM   3695 C  CD    . LYS E 3 359 ? 21.025  -61.576 -13.856 1.00 30.46 ? 359 LYS A CD    1 
ATOM   3696 C  CE    . LYS E 3 359 ? 21.291  -62.959 -13.284 1.00 32.01 ? 359 LYS A CE    1 
ATOM   3697 N  NZ    . LYS E 3 359 ? 21.884  -62.900 -11.920 1.00 32.65 ? 359 LYS A NZ    1 
ATOM   3698 N  N     . SER E 3 360 ? 18.003  -58.684 -17.984 1.00 25.43 ? 360 SER A N     1 
ATOM   3699 C  CA    . SER E 3 360 ? 17.876  -57.392 -18.652 1.00 25.13 ? 360 SER A CA    1 
ATOM   3700 C  C     . SER E 3 360 ? 16.459  -56.827 -18.684 1.00 24.55 ? 360 SER A C     1 
ATOM   3701 O  O     . SER E 3 360 ? 16.285  -55.635 -18.924 1.00 24.53 ? 360 SER A O     1 
ATOM   3702 C  CB    . SER E 3 360 ? 18.457  -57.440 -20.071 1.00 24.79 ? 360 SER A CB    1 
ATOM   3703 O  OG    . SER E 3 360 ? 18.351  -58.734 -20.622 1.00 26.65 ? 360 SER A OG    1 
ATOM   3704 N  N     . PHE E 3 361 ? 15.455  -57.670 -18.452 1.00 23.93 ? 361 PHE A N     1 
ATOM   3705 C  CA    . PHE E 3 361 ? 14.066  -57.202 -18.414 1.00 24.05 ? 361 PHE A CA    1 
ATOM   3706 C  C     . PHE E 3 361 ? 13.776  -56.665 -17.016 1.00 25.15 ? 361 PHE A C     1 
ATOM   3707 O  O     . PHE E 3 361 ? 14.374  -57.108 -16.044 1.00 25.38 ? 361 PHE A O     1 
ATOM   3708 C  CB    . PHE E 3 361 ? 13.065  -58.337 -18.657 1.00 21.66 ? 361 PHE A CB    1 
ATOM   3709 C  CG    . PHE E 3 361 ? 13.081  -58.897 -20.036 1.00 17.99 ? 361 PHE A CG    1 
ATOM   3710 C  CD1   . PHE E 3 361 ? 13.903  -59.961 -20.352 1.00 16.82 ? 361 PHE A CD1   1 
ATOM   3711 C  CD2   . PHE E 3 361 ? 12.237  -58.386 -21.012 1.00 16.79 ? 361 PHE A CD2   1 
ATOM   3712 C  CE1   . PHE E 3 361 ? 13.879  -60.514 -21.616 1.00 17.70 ? 361 PHE A CE1   1 
ATOM   3713 C  CE2   . PHE E 3 361 ? 12.209  -58.933 -22.283 1.00 16.66 ? 361 PHE A CE2   1 
ATOM   3714 C  CZ    . PHE E 3 361 ? 13.026  -59.994 -22.588 1.00 16.57 ? 361 PHE A CZ    1 
ATOM   3715 N  N     . LYS E 3 362 ? 12.862  -55.711 -16.911 1.00 26.58 ? 362 LYS A N     1 
ATOM   3716 C  CA    . LYS E 3 362 ? 12.503  -55.205 -15.602 1.00 29.15 ? 362 LYS A CA    1 
ATOM   3717 C  C     . LYS E 3 362 ? 11.761  -56.370 -14.976 1.00 29.55 ? 362 LYS A C     1 
ATOM   3718 O  O     . LYS E 3 362 ? 10.652  -56.712 -15.380 1.00 31.83 ? 362 LYS A O     1 
ATOM   3719 C  CB    . LYS E 3 362 ? 11.614  -53.971 -15.735 1.00 31.10 ? 362 LYS A CB    1 
ATOM   3720 C  CG    . LYS E 3 362 ? 12.420  -52.730 -16.132 1.00 35.86 ? 362 LYS A CG    1 
ATOM   3721 C  CD    . LYS E 3 362 ? 11.612  -51.735 -16.959 1.00 38.84 ? 362 LYS A CD    1 
ATOM   3722 C  CE    . LYS E 3 362 ? 12.519  -50.626 -17.496 1.00 39.08 ? 362 LYS A CE    1 
ATOM   3723 N  NZ    . LYS E 3 362 ? 11.802  -49.733 -18.449 1.00 40.40 ? 362 LYS A NZ    1 
ATOM   3724 N  N     . LEU E 3 363 ? 12.399  -57.005 -14.004 1.00 29.42 ? 363 LEU A N     1 
ATOM   3725 C  CA    . LEU E 3 363 ? 11.824  -58.160 -13.338 1.00 27.91 ? 363 LEU A CA    1 
ATOM   3726 C  C     . LEU E 3 363 ? 10.726  -57.775 -12.354 1.00 27.44 ? 363 LEU A C     1 
ATOM   3727 O  O     . LEU E 3 363 ? 10.757  -56.692 -11.760 1.00 26.74 ? 363 LEU A O     1 
ATOM   3728 C  CB    . LEU E 3 363 ? 12.941  -58.917 -12.632 1.00 28.66 ? 363 LEU A CB    1 
ATOM   3729 C  CG    . LEU E 3 363 ? 14.179  -59.080 -13.524 1.00 29.44 ? 363 LEU A CG    1 
ATOM   3730 C  CD1   . LEU E 3 363 ? 15.320  -59.707 -12.744 1.00 29.91 ? 363 LEU A CD1   1 
ATOM   3731 C  CD2   . LEU E 3 363 ? 13.822  -59.929 -14.735 1.00 31.36 ? 363 LEU A CD2   1 
ATOM   3732 N  N     . VAL E 3 364 ? 9.749   -58.664 -12.190 1.00 26.73 ? 364 VAL A N     1 
ATOM   3733 C  CA    . VAL E 3 364 ? 8.642   -58.401 -11.277 1.00 26.62 ? 364 VAL A CA    1 
ATOM   3734 C  C     . VAL E 3 364 ? 8.324   -59.570 -10.350 1.00 25.92 ? 364 VAL A C     1 
ATOM   3735 O  O     . VAL E 3 364 ? 8.727   -60.708 -10.608 1.00 26.51 ? 364 VAL A O     1 
ATOM   3736 C  CB    . VAL E 3 364 ? 7.347   -58.045 -12.043 1.00 26.47 ? 364 VAL A CB    1 
ATOM   3737 C  CG1   . VAL E 3 364 ? 7.558   -56.783 -12.863 1.00 25.54 ? 364 VAL A CG1   1 
ATOM   3738 C  CG2   . VAL E 3 364 ? 6.935   -59.209 -12.928 1.00 25.35 ? 364 VAL A CG2   1 
ATOM   3739 N  N     . GLU E 3 365 ? 7.599   -59.274 -9.272  1.00 24.03 ? 365 GLU A N     1 
ATOM   3740 C  CA    . GLU E 3 365 ? 7.193   -60.284 -8.303  1.00 21.99 ? 365 GLU A CA    1 
ATOM   3741 C  C     . GLU E 3 365 ? 6.114   -61.154 -8.954  1.00 20.30 ? 365 GLU A C     1 
ATOM   3742 O  O     . GLU E 3 365 ? 5.231   -60.656 -9.648  1.00 19.97 ? 365 GLU A O     1 
ATOM   3743 C  CB    . GLU E 3 365 ? 6.628   -59.614 -7.052  1.00 22.33 ? 365 GLU A CB    1 
ATOM   3744 C  CG    . GLU E 3 365 ? 7.568   -58.645 -6.360  1.00 25.27 ? 365 GLU A CG    1 
ATOM   3745 C  CD    . GLU E 3 365 ? 8.457   -59.304 -5.311  1.00 28.48 ? 365 GLU A CD    1 
ATOM   3746 O  OE1   . GLU E 3 365 ? 9.289   -58.584 -4.706  1.00 30.52 ? 365 GLU A OE1   1 
ATOM   3747 O  OE2   . GLU E 3 365 ? 8.325   -60.531 -5.082  1.00 29.09 ? 365 GLU A OE2   1 
ATOM   3748 N  N     . PRO E 3 366 ? 6.168   -62.471 -8.734  1.00 19.80 ? 366 PRO A N     1 
ATOM   3749 C  CA    . PRO E 3 366 ? 5.156   -63.338 -9.343  1.00 19.69 ? 366 PRO A CA    1 
ATOM   3750 C  C     . PRO E 3 366 ? 3.764   -63.064 -8.799  1.00 19.64 ? 366 PRO A C     1 
ATOM   3751 O  O     . PRO E 3 366 ? 3.623   -62.596 -7.679  1.00 20.78 ? 366 PRO A O     1 
ATOM   3752 C  CB    . PRO E 3 366 ? 5.650   -64.737 -8.986  1.00 19.68 ? 366 PRO A CB    1 
ATOM   3753 C  CG    . PRO E 3 366 ? 6.316   -64.521 -7.653  1.00 17.83 ? 366 PRO A CG    1 
ATOM   3754 C  CD    . PRO E 3 366 ? 7.083   -63.244 -7.872  1.00 18.54 ? 366 PRO A CD    1 
ATOM   3755 N  N     . THR E 3 367 ? 2.735   -63.346 -9.587  1.00 20.25 ? 367 THR A N     1 
ATOM   3756 C  CA    . THR E 3 367 ? 1.368   -63.144 -9.119  1.00 21.33 ? 367 THR A CA    1 
ATOM   3757 C  C     . THR E 3 367 ? 0.779   -64.488 -8.690  1.00 21.56 ? 367 THR A C     1 
ATOM   3758 O  O     . THR E 3 367 ? -0.112  -64.544 -7.838  1.00 23.48 ? 367 THR A O     1 
ATOM   3759 C  CB    . THR E 3 367 ? 0.487   -62.550 -10.201 1.00 21.54 ? 367 THR A CB    1 
ATOM   3760 O  OG1   . THR E 3 367 ? 0.330   -63.500 -11.261 1.00 23.02 ? 367 THR A OG1   1 
ATOM   3761 C  CG2   . THR E 3 367 ? 1.118   -61.286 -10.739 1.00 22.46 ? 367 THR A CG2   1 
ATOM   3762 N  N     . GLY E 3 368 ? 1.291   -65.565 -9.279  1.00 20.58 ? 368 GLY A N     1 
ATOM   3763 C  CA    . GLY E 3 368 ? 0.824   -66.896 -8.936  1.00 19.97 ? 368 GLY A CA    1 
ATOM   3764 C  C     . GLY E 3 368 ? -0.330  -67.407 -9.774  1.00 19.30 ? 368 GLY A C     1 
ATOM   3765 O  O     . GLY E 3 368 ? -0.738  -68.551 -9.624  1.00 19.69 ? 368 GLY A O     1 
ATOM   3766 N  N     . LYS E 3 369 ? -0.867  -66.560 -10.643 1.00 19.88 ? 369 LYS A N     1 
ATOM   3767 C  CA    . LYS E 3 369 ? -1.979  -66.944 -11.504 1.00 19.37 ? 369 LYS A CA    1 
ATOM   3768 C  C     . LYS E 3 369 ? -1.620  -68.110 -12.424 1.00 20.04 ? 369 LYS A C     1 
ATOM   3769 O  O     . LYS E 3 369 ? -0.471  -68.580 -12.454 1.00 18.45 ? 369 LYS A O     1 
ATOM   3770 C  CB    . LYS E 3 369 ? -2.415  -65.753 -12.357 1.00 20.57 ? 369 LYS A CB    1 
ATOM   3771 C  CG    . LYS E 3 369 ? -3.475  -64.825 -11.762 1.00 20.16 ? 369 LYS A CG    1 
ATOM   3772 C  CD    . LYS E 3 369 ? -3.344  -64.716 -10.252 1.00 24.96 ? 369 LYS A CD    1 
ATOM   3773 C  CE    . LYS E 3 369 ? -4.260  -63.628 -9.717  1.00 25.23 ? 369 LYS A CE    1 
ATOM   3774 N  NZ    . LYS E 3 369 ? -4.443  -63.752 -8.250  1.00 26.31 ? 369 LYS A NZ    1 
ATOM   3775 N  N     . ARG E 3 370 ? -2.626  -68.584 -13.156 1.00 19.59 ? 370 ARG A N     1 
ATOM   3776 C  CA    . ARG E 3 370 ? -2.447  -69.683 -14.100 1.00 18.21 ? 370 ARG A CA    1 
ATOM   3777 C  C     . ARG E 3 370 ? -2.331  -69.082 -15.496 1.00 17.48 ? 370 ARG A C     1 
ATOM   3778 O  O     . ARG E 3 370 ? -3.278  -68.480 -16.007 1.00 17.64 ? 370 ARG A O     1 
ATOM   3779 C  CB    . ARG E 3 370 ? -3.636  -70.648 -14.017 1.00 18.52 ? 370 ARG A CB    1 
ATOM   3780 C  CG    . ARG E 3 370 ? -3.797  -71.265 -12.627 1.00 21.06 ? 370 ARG A CG    1 
ATOM   3781 C  CD    . ARG E 3 370 ? -5.169  -71.858 -12.406 1.00 21.00 ? 370 ARG A CD    1 
ATOM   3782 N  NE    . ARG E 3 370 ? -6.240  -70.869 -12.514 1.00 21.65 ? 370 ARG A NE    1 
ATOM   3783 C  CZ    . ARG E 3 370 ? -7.534  -71.168 -12.446 1.00 23.17 ? 370 ARG A CZ    1 
ATOM   3784 N  NH1   . ARG E 3 370 ? -7.921  -72.430 -12.270 1.00 23.00 ? 370 ARG A NH1   1 
ATOM   3785 N  NH2   . ARG E 3 370 ? -8.443  -70.208 -12.552 1.00 22.36 ? 370 ARG A NH2   1 
ATOM   3786 N  N     . PHE E 3 371 ? -1.164  -69.236 -16.105 1.00 15.48 ? 371 PHE A N     1 
ATOM   3787 C  CA    . PHE E 3 371 ? -0.941  -68.686 -17.426 1.00 15.55 ? 371 PHE A CA    1 
ATOM   3788 C  C     . PHE E 3 371 ? -0.821  -69.722 -18.533 1.00 15.35 ? 371 PHE A C     1 
ATOM   3789 O  O     . PHE E 3 371 ? -0.234  -70.784 -18.343 1.00 15.60 ? 371 PHE A O     1 
ATOM   3790 C  CB    . PHE E 3 371 ? 0.347   -67.859 -17.455 1.00 16.57 ? 371 PHE A CB    1 
ATOM   3791 C  CG    . PHE E 3 371 ? 0.357   -66.687 -16.517 1.00 16.15 ? 371 PHE A CG    1 
ATOM   3792 C  CD1   . PHE E 3 371 ? 0.560   -66.866 -15.149 1.00 15.82 ? 371 PHE A CD1   1 
ATOM   3793 C  CD2   . PHE E 3 371 ? 0.213   -65.396 -17.009 1.00 15.98 ? 371 PHE A CD2   1 
ATOM   3794 C  CE1   . PHE E 3 371 ? 0.623   -65.784 -14.290 1.00 14.62 ? 371 PHE A CE1   1 
ATOM   3795 C  CE2   . PHE E 3 371 ? 0.276   -64.301 -16.150 1.00 16.83 ? 371 PHE A CE2   1 
ATOM   3796 C  CZ    . PHE E 3 371 ? 0.484   -64.500 -14.789 1.00 15.47 ? 371 PHE A CZ    1 
ATOM   3797 N  N     . LEU E 3 372 ? -1.384  -69.398 -19.691 1.00 14.53 ? 372 LEU A N     1 
ATOM   3798 C  CA    . LEU E 3 372 ? -1.263  -70.247 -20.867 1.00 12.98 ? 372 LEU A CA    1 
ATOM   3799 C  C     . LEU E 3 372 ? -0.483  -69.343 -21.823 1.00 12.55 ? 372 LEU A C     1 
ATOM   3800 O  O     . LEU E 3 372 ? -0.939  -68.260 -22.190 1.00 12.46 ? 372 LEU A O     1 
ATOM   3801 C  CB    . LEU E 3 372 ? -2.631  -70.603 -21.460 1.00 13.72 ? 372 LEU A CB    1 
ATOM   3802 C  CG    . LEU E 3 372 ? -2.674  -71.621 -22.618 1.00 12.30 ? 372 LEU A CG    1 
ATOM   3803 C  CD1   . LEU E 3 372 ? -2.110  -71.025 -23.881 1.00 13.84 ? 372 LEU A CD1   1 
ATOM   3804 C  CD2   . LEU E 3 372 ? -1.881  -72.835 -22.252 1.00 12.78 ? 372 LEU A CD2   1 
ATOM   3805 N  N     . LEU E 3 373 ? 0.711   -69.773 -22.190 1.00 11.75 ? 373 LEU A N     1 
ATOM   3806 C  CA    . LEU E 3 373 ? 1.547   -68.998 -23.081 1.00 12.39 ? 373 LEU A CA    1 
ATOM   3807 C  C     . LEU E 3 373 ? 1.595   -69.679 -24.446 1.00 12.44 ? 373 LEU A C     1 
ATOM   3808 O  O     . LEU E 3 373 ? 2.113   -70.784 -24.567 1.00 15.34 ? 373 LEU A O     1 
ATOM   3809 C  CB    . LEU E 3 373 ? 2.942   -68.880 -22.462 1.00 12.45 ? 373 LEU A CB    1 
ATOM   3810 C  CG    . LEU E 3 373 ? 2.924   -68.458 -20.977 1.00 13.44 ? 373 LEU A CG    1 
ATOM   3811 C  CD1   . LEU E 3 373 ? 4.350   -68.320 -20.448 1.00 13.87 ? 373 LEU A CD1   1 
ATOM   3812 C  CD2   . LEU E 3 373 ? 2.186   -67.138 -20.812 1.00 13.78 ? 373 LEU A CD2   1 
ATOM   3813 N  N     . ALA E 3 374 ? 1.044   -69.020 -25.467 1.00 12.27 ? 374 ALA A N     1 
ATOM   3814 C  CA    . ALA E 3 374 ? 0.995   -69.577 -26.824 1.00 11.94 ? 374 ALA A CA    1 
ATOM   3815 C  C     . ALA E 3 374 ? 1.852   -68.840 -27.860 1.00 11.35 ? 374 ALA A C     1 
ATOM   3816 O  O     . ALA E 3 374 ? 1.665   -67.652 -28.125 1.00 9.26  ? 374 ALA A O     1 
ATOM   3817 C  CB    . ALA E 3 374 ? -0.450  -69.639 -27.300 1.00 11.54 ? 374 ALA A CB    1 
ATOM   3818 N  N     . ILE E 3 375 ? 2.772   -69.581 -28.464 1.00 12.24 ? 375 ILE A N     1 
ATOM   3819 C  CA    . ILE E 3 375 ? 3.683   -69.033 -29.458 1.00 13.39 ? 375 ILE A CA    1 
ATOM   3820 C  C     . ILE E 3 375 ? 3.246   -69.293 -30.897 1.00 14.71 ? 375 ILE A C     1 
ATOM   3821 O  O     . ILE E 3 375 ? 3.159   -70.434 -31.335 1.00 17.69 ? 375 ILE A O     1 
ATOM   3822 C  CB    . ILE E 3 375 ? 5.099   -69.625 -29.288 1.00 13.96 ? 375 ILE A CB    1 
ATOM   3823 C  CG1   . ILE E 3 375 ? 5.613   -69.349 -27.871 1.00 15.32 ? 375 ILE A CG1   1 
ATOM   3824 C  CG2   . ILE E 3 375 ? 6.043   -69.029 -30.320 1.00 13.00 ? 375 ILE A CG2   1 
ATOM   3825 C  CD1   . ILE E 3 375 ? 6.924   -70.011 -27.581 1.00 14.88 ? 375 ILE A CD1   1 
ATOM   3826 N  N     . ASP E 3 376 ? 2.984   -68.228 -31.636 1.00 13.16 ? 376 ASP A N     1 
ATOM   3827 C  CA    . ASP E 3 376 ? 2.589   -68.345 -33.020 1.00 12.36 ? 376 ASP A CA    1 
ATOM   3828 C  C     . ASP E 3 376 ? 3.835   -68.793 -33.806 1.00 12.70 ? 376 ASP A C     1 
ATOM   3829 O  O     . ASP E 3 376 ? 4.817   -68.059 -33.899 1.00 11.65 ? 376 ASP A O     1 
ATOM   3830 C  CB    . ASP E 3 376 ? 2.116   -66.978 -33.483 1.00 14.77 ? 376 ASP A CB    1 
ATOM   3831 C  CG    . ASP E 3 376 ? 1.604   -66.981 -34.877 1.00 16.47 ? 376 ASP A CG    1 
ATOM   3832 O  OD1   . ASP E 3 376 ? 2.113   -67.759 -35.700 1.00 20.52 ? 376 ASP A OD1   1 
ATOM   3833 O  OD2   . ASP E 3 376 ? 0.701   -66.183 -35.159 1.00 18.05 ? 376 ASP A OD2   1 
ATOM   3834 N  N     . VAL E 3 377 ? 3.800   -70.002 -34.360 1.00 13.17 ? 377 VAL A N     1 
ATOM   3835 C  CA    . VAL E 3 377 ? 4.936   -70.534 -35.113 1.00 13.51 ? 377 VAL A CA    1 
ATOM   3836 C  C     . VAL E 3 377 ? 4.678   -70.726 -36.602 1.00 15.57 ? 377 VAL A C     1 
ATOM   3837 O  O     . VAL E 3 377 ? 5.384   -71.494 -37.259 1.00 16.24 ? 377 VAL A O     1 
ATOM   3838 C  CB    . VAL E 3 377 ? 5.421   -71.889 -34.538 1.00 12.03 ? 377 VAL A CB    1 
ATOM   3839 C  CG1   . VAL E 3 377 ? 6.211   -71.651 -33.276 1.00 13.61 ? 377 VAL A CG1   1 
ATOM   3840 C  CG2   . VAL E 3 377 ? 4.241   -72.791 -34.225 1.00 10.22 ? 377 VAL A CG2   1 
ATOM   3841 N  N     . SER E 3 378 ? 3.680   -70.017 -37.132 1.00 17.09 ? 378 SER A N     1 
ATOM   3842 C  CA    . SER E 3 378 ? 3.324   -70.103 -38.550 1.00 17.86 ? 378 SER A CA    1 
ATOM   3843 C  C     . SER E 3 378 ? 4.411   -69.511 -39.454 1.00 19.87 ? 378 SER A C     1 
ATOM   3844 O  O     . SER E 3 378 ? 5.301   -68.802 -38.986 1.00 20.94 ? 378 SER A O     1 
ATOM   3845 C  CB    . SER E 3 378 ? 1.977   -69.405 -38.805 1.00 15.82 ? 378 SER A CB    1 
ATOM   3846 O  OG    . SER E 3 378 ? 1.991   -68.059 -38.363 1.00 13.31 ? 378 SER A OG    1 
ATOM   3847 N  N     . ALA E 3 379 ? 4.329   -69.814 -40.748 1.00 20.62 ? 379 ALA A N     1 
ATOM   3848 C  CA    . ALA E 3 379 ? 5.299   -69.346 -41.737 1.00 21.59 ? 379 ALA A CA    1 
ATOM   3849 C  C     . ALA E 3 379 ? 5.680   -67.875 -41.615 1.00 22.31 ? 379 ALA A C     1 
ATOM   3850 O  O     . ALA E 3 379 ? 6.863   -67.522 -41.694 1.00 23.37 ? 379 ALA A O     1 
ATOM   3851 C  CB    . ALA E 3 379 ? 4.776   -69.624 -43.144 1.00 21.37 ? 379 ALA A CB    1 
ATOM   3852 N  N     . SER E 3 380 ? 4.679   -67.020 -41.441 1.00 21.11 ? 380 SER A N     1 
ATOM   3853 C  CA    . SER E 3 380 ? 4.929   -65.596 -41.322 1.00 20.91 ? 380 SER A CA    1 
ATOM   3854 C  C     . SER E 3 380 ? 5.887   -65.254 -40.183 1.00 19.57 ? 380 SER A C     1 
ATOM   3855 O  O     . SER E 3 380 ? 6.676   -64.341 -40.311 1.00 18.29 ? 380 SER A O     1 
ATOM   3856 C  CB    . SER E 3 380 ? 3.604   -64.840 -41.142 1.00 22.43 ? 380 SER A CB    1 
ATOM   3857 O  OG    . SER E 3 380 ? 2.842   -65.362 -40.064 1.00 22.92 ? 380 SER A OG    1 
ATOM   3858 N  N     . MET E 3 381 ? 5.822   -65.987 -39.075 1.00 20.11 ? 381 MET A N     1 
ATOM   3859 C  CA    . MET E 3 381 ? 6.704   -65.719 -37.938 1.00 20.23 ? 381 MET A CA    1 
ATOM   3860 C  C     . MET E 3 381 ? 8.175   -65.972 -38.274 1.00 20.21 ? 381 MET A C     1 
ATOM   3861 O  O     . MET E 3 381 ? 9.046   -65.937 -37.406 1.00 18.92 ? 381 MET A O     1 
ATOM   3862 C  CB    . MET E 3 381 ? 6.281   -66.552 -36.732 1.00 20.62 ? 381 MET A CB    1 
ATOM   3863 C  CG    . MET E 3 381 ? 4.896   -66.176 -36.221 1.00 23.46 ? 381 MET A CG    1 
ATOM   3864 S  SD    . MET E 3 381 ? 4.782   -64.415 -35.742 1.00 25.55 ? 381 MET A SD    1 
ATOM   3865 C  CE    . MET E 3 381 ? 5.546   -64.440 -34.144 1.00 22.38 ? 381 MET A CE    1 
ATOM   3866 N  N     . ASN E 3 382 ? 8.425   -66.219 -39.554 1.00 20.65 ? 382 ASN A N     1 
ATOM   3867 C  CA    . ASN E 3 382 ? 9.756   -66.446 -40.067 1.00 19.88 ? 382 ASN A CA    1 
ATOM   3868 C  C     . ASN E 3 382 ? 10.362  -65.075 -40.348 1.00 18.87 ? 382 ASN A C     1 
ATOM   3869 O  O     . ASN E 3 382 ? 11.569  -64.929 -40.485 1.00 18.83 ? 382 ASN A O     1 
ATOM   3870 C  CB    . ASN E 3 382 ? 9.681   -67.261 -41.351 1.00 22.76 ? 382 ASN A CB    1 
ATOM   3871 C  CG    . ASN E 3 382 ? 10.584  -68.460 -41.316 1.00 27.35 ? 382 ASN A CG    1 
ATOM   3872 O  OD1   . ASN E 3 382 ? 10.144  -69.579 -41.046 1.00 29.36 ? 382 ASN A OD1   1 
ATOM   3873 N  ND2   . ASN E 3 382 ? 11.868  -68.236 -41.574 1.00 30.02 ? 382 ASN A ND2   1 
ATOM   3874 N  N     . GLN E 3 383 ? 9.501   -64.070 -40.444 1.00 19.62 ? 383 GLN A N     1 
ATOM   3875 C  CA    . GLN E 3 383 ? 9.914   -62.690 -40.683 1.00 20.95 ? 383 GLN A CA    1 
ATOM   3876 C  C     . GLN E 3 383 ? 11.000  -62.272 -39.696 1.00 22.85 ? 383 GLN A C     1 
ATOM   3877 O  O     . GLN E 3 383 ? 10.930  -62.574 -38.501 1.00 23.10 ? 383 GLN A O     1 
ATOM   3878 C  CB    . GLN E 3 383 ? 8.727   -61.761 -40.508 1.00 19.63 ? 383 GLN A CB    1 
ATOM   3879 C  CG    . GLN E 3 383 ? 8.130   -61.878 -39.132 1.00 22.61 ? 383 GLN A CG    1 
ATOM   3880 C  CD    . GLN E 3 383 ? 6.691   -61.443 -39.102 1.00 24.49 ? 383 GLN A CD    1 
ATOM   3881 O  OE1   . GLN E 3 383 ? 6.364   -60.397 -38.527 1.00 28.15 ? 383 GLN A OE1   1 
ATOM   3882 N  NE2   . GLN E 3 383 ? 5.813   -62.242 -39.730 1.00 27.67 ? 383 GLN A NE2   1 
ATOM   3883 N  N     . ARG E 3 384 ? 11.989  -61.552 -40.203 1.00 23.62 ? 384 ARG A N     1 
ATOM   3884 C  CA    . ARG E 3 384 ? 13.087  -61.090 -39.382 1.00 24.80 ? 384 ARG A CA    1 
ATOM   3885 C  C     . ARG E 3 384 ? 12.754  -59.843 -38.562 1.00 24.12 ? 384 ARG A C     1 
ATOM   3886 O  O     . ARG E 3 384 ? 12.060  -58.945 -39.030 1.00 24.23 ? 384 ARG A O     1 
ATOM   3887 C  CB    . ARG E 3 384 ? 14.308  -60.862 -40.270 1.00 25.51 ? 384 ARG A CB    1 
ATOM   3888 C  CG    . ARG E 3 384 ? 15.283  -62.006 -40.162 1.00 27.26 ? 384 ARG A CG    1 
ATOM   3889 C  CD    . ARG E 3 384 ? 15.583  -62.695 -41.457 1.00 30.47 ? 384 ARG A CD    1 
ATOM   3890 N  NE    . ARG E 3 384 ? 16.975  -63.000 -41.499 1.00 34.58 ? 384 ARG A NE    1 
ATOM   3891 C  CZ    . ARG E 3 384 ? 17.659  -64.137 -41.512 1.00 35.92 ? 384 ARG A CZ    1 
ATOM   3892 N  NH1   . ARG E 3 384 ? 18.959  -63.958 -41.542 1.00 36.38 ? 384 ARG A NH1   1 
ATOM   3893 N  NH2   . ARG E 3 384 ? 17.167  -65.375 -41.499 1.00 37.33 ? 384 ARG A NH2   1 
ATOM   3894 N  N     . VAL E 3 385 ? 13.242  -59.820 -37.323 1.00 25.37 ? 385 VAL A N     1 
ATOM   3895 C  CA    . VAL E 3 385 ? 13.004  -58.709 -36.406 1.00 26.05 ? 385 VAL A CA    1 
ATOM   3896 C  C     . VAL E 3 385 ? 14.180  -57.758 -36.371 1.00 26.07 ? 385 VAL A C     1 
ATOM   3897 O  O     . VAL E 3 385 ? 15.323  -58.184 -36.480 1.00 27.05 ? 385 VAL A O     1 
ATOM   3898 C  CB    . VAL E 3 385 ? 12.790  -59.187 -34.952 1.00 25.28 ? 385 VAL A CB    1 
ATOM   3899 C  CG1   . VAL E 3 385 ? 11.458  -58.738 -34.442 1.00 28.82 ? 385 VAL A CG1   1 
ATOM   3900 C  CG2   . VAL E 3 385 ? 12.883  -60.686 -34.877 1.00 27.18 ? 385 VAL A CG2   1 
ATOM   3901 N  N     . LEU E 3 386 ? 13.883  -56.471 -36.221 1.00 26.72 ? 386 LEU A N     1 
ATOM   3902 C  CA    . LEU E 3 386 ? 14.891  -55.416 -36.132 1.00 26.68 ? 386 LEU A CA    1 
ATOM   3903 C  C     . LEU E 3 386 ? 16.034  -55.561 -37.117 1.00 25.37 ? 386 LEU A C     1 
ATOM   3904 O  O     . LEU E 3 386 ? 17.172  -55.222 -36.808 1.00 25.66 ? 386 LEU A O     1 
ATOM   3905 C  CB    . LEU E 3 386 ? 15.454  -55.349 -34.709 1.00 26.95 ? 386 LEU A CB    1 
ATOM   3906 C  CG    . LEU E 3 386 ? 14.454  -55.185 -33.558 1.00 29.02 ? 386 LEU A CG    1 
ATOM   3907 C  CD1   . LEU E 3 386 ? 14.981  -54.162 -32.580 1.00 31.57 ? 386 LEU A CD1   1 
ATOM   3908 C  CD2   . LEU E 3 386 ? 13.105  -54.718 -34.074 1.00 30.93 ? 386 LEU A CD2   1 
ATOM   3909 N  N     . GLY E 3 387 ? 15.722  -56.062 -38.304 1.00 24.93 ? 387 GLY A N     1 
ATOM   3910 C  CA    . GLY E 3 387 ? 16.729  -56.230 -39.327 1.00 24.54 ? 387 GLY A CA    1 
ATOM   3911 C  C     . GLY E 3 387 ? 17.877  -57.081 -38.852 1.00 24.42 ? 387 GLY A C     1 
ATOM   3912 O  O     . GLY E 3 387 ? 19.001  -56.957 -39.352 1.00 26.42 ? 387 GLY A O     1 
ATOM   3913 N  N     . SER E 3 388 ? 17.592  -57.943 -37.882 1.00 23.80 ? 388 SER A N     1 
ATOM   3914 C  CA    . SER E 3 388 ? 18.591  -58.850 -37.335 1.00 22.87 ? 388 SER A CA    1 
ATOM   3915 C  C     . SER E 3 388 ? 18.391  -60.233 -37.935 1.00 23.84 ? 388 SER A C     1 
ATOM   3916 O  O     . SER E 3 388 ? 17.647  -60.413 -38.900 1.00 21.93 ? 388 SER A O     1 
ATOM   3917 C  CB    . SER E 3 388 ? 18.475  -58.932 -35.810 1.00 22.03 ? 388 SER A CB    1 
ATOM   3918 O  OG    . SER E 3 388 ? 17.357  -59.714 -35.422 1.00 20.93 ? 388 SER A OG    1 
ATOM   3919 N  N     . ILE E 3 389 ? 19.053  -61.203 -37.324 1.00 24.86 ? 389 ILE A N     1 
ATOM   3920 C  CA    . ILE E 3 389 ? 18.999  -62.568 -37.786 1.00 25.90 ? 389 ILE A CA    1 
ATOM   3921 C  C     . ILE E 3 389 ? 18.046  -63.407 -36.973 1.00 24.50 ? 389 ILE A C     1 
ATOM   3922 O  O     . ILE E 3 389 ? 17.924  -64.615 -37.172 1.00 25.40 ? 389 ILE A O     1 
ATOM   3923 C  CB    . ILE E 3 389 ? 20.362  -63.204 -37.735 1.00 28.48 ? 389 ILE A CB    1 
ATOM   3924 C  CG1   . ILE E 3 389 ? 21.270  -62.561 -38.763 1.00 31.01 ? 389 ILE A CG1   1 
ATOM   3925 C  CG2   . ILE E 3 389 ? 20.257  -64.673 -38.112 1.00 31.58 ? 389 ILE A CG2   1 
ATOM   3926 C  CD1   . ILE E 3 389 ? 22.643  -63.034 -38.589 1.00 34.09 ? 389 ILE A CD1   1 
ATOM   3927 N  N     . LEU E 3 390 ? 17.357  -62.765 -36.055 1.00 23.04 ? 390 LEU A N     1 
ATOM   3928 C  CA    . LEU E 3 390 ? 16.394  -63.464 -35.241 1.00 22.53 ? 390 LEU A CA    1 
ATOM   3929 C  C     . LEU E 3 390 ? 15.043  -63.246 -35.900 1.00 22.49 ? 390 LEU A C     1 
ATOM   3930 O  O     . LEU E 3 390 ? 14.809  -62.191 -36.486 1.00 23.72 ? 390 LEU A O     1 
ATOM   3931 C  CB    . LEU E 3 390 ? 16.439  -62.873 -33.836 1.00 22.83 ? 390 LEU A CB    1 
ATOM   3932 C  CG    . LEU E 3 390 ? 17.798  -63.044 -33.144 1.00 23.02 ? 390 LEU A CG    1 
ATOM   3933 C  CD1   . LEU E 3 390 ? 17.871  -62.164 -31.902 1.00 23.36 ? 390 LEU A CD1   1 
ATOM   3934 C  CD2   . LEU E 3 390 ? 17.979  -64.513 -32.787 1.00 22.01 ? 390 LEU A CD2   1 
ATOM   3935 N  N     . ASN E 3 391 ? 14.163  -64.236 -35.833 1.00 20.76 ? 391 ASN A N     1 
ATOM   3936 C  CA    . ASN E 3 391 ? 12.834  -64.084 -36.430 1.00 17.90 ? 391 ASN A CA    1 
ATOM   3937 C  C     . ASN E 3 391 ? 11.787  -63.895 -35.332 1.00 15.83 ? 391 ASN A C     1 
ATOM   3938 O  O     . ASN E 3 391 ? 12.090  -64.034 -34.154 1.00 16.76 ? 391 ASN A O     1 
ATOM   3939 C  CB    . ASN E 3 391 ? 12.481  -65.303 -37.275 1.00 17.89 ? 391 ASN A CB    1 
ATOM   3940 C  CG    . ASN E 3 391 ? 12.416  -66.570 -36.461 1.00 19.75 ? 391 ASN A CG    1 
ATOM   3941 O  OD1   . ASN E 3 391 ? 11.952  -66.557 -35.323 1.00 20.12 ? 391 ASN A OD1   1 
ATOM   3942 N  ND2   . ASN E 3 391 ? 12.858  -67.681 -37.047 1.00 19.24 ? 391 ASN A ND2   1 
ATOM   3943 N  N     . ALA E 3 392 ? 10.555  -63.572 -35.697 1.00 13.79 ? 392 ALA A N     1 
ATOM   3944 C  CA    . ALA E 3 392 ? 9.540   -63.374 -34.672 1.00 12.04 ? 392 ALA A CA    1 
ATOM   3945 C  C     . ALA E 3 392 ? 9.348   -64.642 -33.864 1.00 13.15 ? 392 ALA A C     1 
ATOM   3946 O  O     . ALA E 3 392 ? 9.087   -64.598 -32.665 1.00 12.71 ? 392 ALA A O     1 
ATOM   3947 C  CB    . ALA E 3 392 ? 8.227   -62.955 -35.301 1.00 9.57  ? 392 ALA A CB    1 
ATOM   3948 N  N     . SER E 3 393 ? 9.481   -65.779 -34.526 1.00 14.42 ? 393 SER A N     1 
ATOM   3949 C  CA    . SER E 3 393 ? 9.294   -67.039 -33.849 1.00 16.05 ? 393 SER A CA    1 
ATOM   3950 C  C     . SER E 3 393 ? 10.194  -67.139 -32.607 1.00 16.43 ? 393 SER A C     1 
ATOM   3951 O  O     . SER E 3 393 ? 9.711   -67.337 -31.486 1.00 14.65 ? 393 SER A O     1 
ATOM   3952 C  CB    . SER E 3 393 ? 9.584   -68.166 -34.819 1.00 17.34 ? 393 SER A CB    1 
ATOM   3953 O  OG    . SER E 3 393 ? 8.912   -69.341 -34.407 1.00 22.47 ? 393 SER A OG    1 
ATOM   3954 N  N     . VAL E 3 394 ? 11.496  -66.978 -32.826 1.00 17.27 ? 394 VAL A N     1 
ATOM   3955 C  CA    . VAL E 3 394 ? 12.509  -67.049 -31.776 1.00 17.91 ? 394 VAL A CA    1 
ATOM   3956 C  C     . VAL E 3 394 ? 12.271  -66.031 -30.665 1.00 19.34 ? 394 VAL A C     1 
ATOM   3957 O  O     . VAL E 3 394 ? 12.290  -66.366 -29.480 1.00 20.00 ? 394 VAL A O     1 
ATOM   3958 C  CB    . VAL E 3 394 ? 13.930  -66.814 -32.362 1.00 17.13 ? 394 VAL A CB    1 
ATOM   3959 C  CG1   . VAL E 3 394 ? 14.959  -67.039 -31.300 1.00 18.19 ? 394 VAL A CG1   1 
ATOM   3960 C  CG2   . VAL E 3 394 ? 14.188  -67.760 -33.531 1.00 18.63 ? 394 VAL A CG2   1 
ATOM   3961 N  N     . VAL E 3 395 ? 12.052  -64.782 -31.053 1.00 19.72 ? 395 VAL A N     1 
ATOM   3962 C  CA    . VAL E 3 395 ? 11.804  -63.715 -30.096 1.00 20.15 ? 395 VAL A CA    1 
ATOM   3963 C  C     . VAL E 3 395 ? 10.561  -64.007 -29.255 1.00 20.79 ? 395 VAL A C     1 
ATOM   3964 O  O     . VAL E 3 395 ? 10.570  -63.831 -28.037 1.00 22.46 ? 395 VAL A O     1 
ATOM   3965 C  CB    . VAL E 3 395 ? 11.631  -62.364 -30.824 1.00 20.46 ? 395 VAL A CB    1 
ATOM   3966 C  CG1   . VAL E 3 395 ? 10.916  -61.384 -29.942 1.00 19.39 ? 395 VAL A CG1   1 
ATOM   3967 C  CG2   . VAL E 3 395 ? 12.977  -61.817 -31.209 1.00 19.99 ? 395 VAL A CG2   1 
ATOM   3968 N  N     . ALA E 3 396 ? 9.491   -64.447 -29.901 1.00 20.81 ? 396 ALA A N     1 
ATOM   3969 C  CA    . ALA E 3 396 ? 8.269   -64.756 -29.183 1.00 22.60 ? 396 ALA A CA    1 
ATOM   3970 C  C     . ALA E 3 396 ? 8.542   -65.858 -28.158 1.00 23.82 ? 396 ALA A C     1 
ATOM   3971 O  O     . ALA E 3 396 ? 8.048   -65.816 -27.024 1.00 24.04 ? 396 ALA A O     1 
ATOM   3972 C  CB    . ALA E 3 396 ? 7.186   -65.198 -30.162 1.00 24.21 ? 396 ALA A CB    1 
ATOM   3973 N  N     . ALA E 3 397 ? 9.337   -66.845 -28.554 1.00 23.96 ? 397 ALA A N     1 
ATOM   3974 C  CA    . ALA E 3 397 ? 9.657   -67.937 -27.651 1.00 23.85 ? 397 ALA A CA    1 
ATOM   3975 C  C     . ALA E 3 397 ? 10.441  -67.419 -26.446 1.00 23.05 ? 397 ALA A C     1 
ATOM   3976 O  O     . ALA E 3 397 ? 10.184  -67.814 -25.312 1.00 22.21 ? 397 ALA A O     1 
ATOM   3977 C  CB    . ALA E 3 397 ? 10.446  -69.011 -28.389 1.00 24.43 ? 397 ALA A CB    1 
ATOM   3978 N  N     . ALA E 3 398 ? 11.390  -66.524 -26.696 1.00 23.27 ? 398 ALA A N     1 
ATOM   3979 C  CA    . ALA E 3 398 ? 12.198  -65.948 -25.623 1.00 23.23 ? 398 ALA A CA    1 
ATOM   3980 C  C     . ALA E 3 398 ? 11.308  -65.192 -24.635 1.00 23.37 ? 398 ALA A C     1 
ATOM   3981 O  O     . ALA E 3 398 ? 11.437  -65.349 -23.423 1.00 21.20 ? 398 ALA A O     1 
ATOM   3982 C  CB    . ALA E 3 398 ? 13.245  -65.016 -26.208 1.00 22.04 ? 398 ALA A CB    1 
ATOM   3983 N  N     . MET E 3 399 ? 10.408  -64.363 -25.159 1.00 24.93 ? 399 MET A N     1 
ATOM   3984 C  CA    . MET E 3 399 ? 9.493   -63.612 -24.305 1.00 26.30 ? 399 MET A CA    1 
ATOM   3985 C  C     . MET E 3 399 ? 8.686   -64.614 -23.497 1.00 26.59 ? 399 MET A C     1 
ATOM   3986 O  O     . MET E 3 399 ? 8.353   -64.393 -22.335 1.00 25.76 ? 399 MET A O     1 
ATOM   3987 C  CB    . MET E 3 399 ? 8.552   -62.764 -25.156 1.00 27.29 ? 399 MET A CB    1 
ATOM   3988 C  CG    . MET E 3 399 ? 9.181   -61.495 -25.672 1.00 31.03 ? 399 MET A CG    1 
ATOM   3989 S  SD    . MET E 3 399 ? 9.708   -60.417 -24.315 1.00 34.31 ? 399 MET A SD    1 
ATOM   3990 C  CE    . MET E 3 399 ? 8.157   -59.667 -23.888 1.00 35.34 ? 399 MET A CE    1 
ATOM   3991 N  N     . CYS E 3 400 ? 8.378   -65.727 -24.148 1.00 27.75 ? 400 CYS A N     1 
ATOM   3992 C  CA    . CYS E 3 400 ? 7.611   -66.804 -23.547 1.00 26.89 ? 400 CYS A CA    1 
ATOM   3993 C  C     . CYS E 3 400 ? 8.386   -67.411 -22.374 1.00 25.25 ? 400 CYS A C     1 
ATOM   3994 O  O     . CYS E 3 400 ? 7.833   -67.599 -21.283 1.00 24.08 ? 400 CYS A O     1 
ATOM   3995 C  CB    . CYS E 3 400 ? 7.334   -67.862 -24.609 1.00 27.51 ? 400 CYS A CB    1 
ATOM   3996 S  SG    . CYS E 3 400 ? 6.237   -69.142 -24.074 1.00 31.80 ? 400 CYS A SG    1 
ATOM   3997 N  N     . MET E 3 401 ? 9.662   -67.718 -22.606 1.00 23.05 ? 401 MET A N     1 
ATOM   3998 C  CA    . MET E 3 401 ? 10.495  -68.291 -21.567 1.00 21.25 ? 401 MET A CA    1 
ATOM   3999 C  C     . MET E 3 401 ? 10.539  -67.335 -20.387 1.00 23.27 ? 401 MET A C     1 
ATOM   4000 O  O     . MET E 3 401 ? 10.448  -67.768 -19.243 1.00 25.37 ? 401 MET A O     1 
ATOM   4001 C  CB    . MET E 3 401 ? 11.909  -68.556 -22.084 1.00 19.90 ? 401 MET A CB    1 
ATOM   4002 C  CG    . MET E 3 401 ? 12.054  -69.780 -23.010 1.00 17.25 ? 401 MET A CG    1 
ATOM   4003 S  SD    . MET E 3 401 ? 12.020  -71.424 -22.184 1.00 16.01 ? 401 MET A SD    1 
ATOM   4004 C  CE    . MET E 3 401 ? 13.631  -71.486 -21.522 1.00 12.74 ? 401 MET A CE    1 
ATOM   4005 N  N     . LEU E 3 402 ? 10.655  -66.035 -20.658 1.00 23.33 ? 402 LEU A N     1 
ATOM   4006 C  CA    . LEU E 3 402 ? 10.701  -65.037 -19.589 1.00 22.60 ? 402 LEU A CA    1 
ATOM   4007 C  C     . LEU E 3 402 ? 9.475   -65.110 -18.668 1.00 23.15 ? 402 LEU A C     1 
ATOM   4008 O  O     . LEU E 3 402 ? 9.610   -65.208 -17.437 1.00 23.20 ? 402 LEU A O     1 
ATOM   4009 C  CB    . LEU E 3 402 ? 10.800  -63.625 -20.180 1.00 22.72 ? 402 LEU A CB    1 
ATOM   4010 C  CG    . LEU E 3 402 ? 10.815  -62.446 -19.189 1.00 22.43 ? 402 LEU A CG    1 
ATOM   4011 C  CD1   . LEU E 3 402 ? 12.093  -62.439 -18.377 1.00 21.91 ? 402 LEU A CD1   1 
ATOM   4012 C  CD2   . LEU E 3 402 ? 10.695  -61.157 -19.943 1.00 23.99 ? 402 LEU A CD2   1 
ATOM   4013 N  N     . VAL E 3 403 ? 8.285   -65.043 -19.263 1.00 22.61 ? 403 VAL A N     1 
ATOM   4014 C  CA    . VAL E 3 403 ? 7.037   -65.102 -18.504 1.00 23.03 ? 403 VAL A CA    1 
ATOM   4015 C  C     . VAL E 3 403 ? 6.883   -66.434 -17.778 1.00 23.45 ? 403 VAL A C     1 
ATOM   4016 O  O     . VAL E 3 403 ? 6.311   -66.491 -16.695 1.00 22.72 ? 403 VAL A O     1 
ATOM   4017 C  CB    . VAL E 3 403 ? 5.804   -64.893 -19.428 1.00 23.58 ? 403 VAL A CB    1 
ATOM   4018 C  CG1   . VAL E 3 403 ? 4.549   -65.488 -18.791 1.00 23.51 ? 403 VAL A CG1   1 
ATOM   4019 C  CG2   . VAL E 3 403 ? 5.592   -63.424 -19.671 1.00 23.31 ? 403 VAL A CG2   1 
ATOM   4020 N  N     . ALA E 3 404 ? 7.395   -67.502 -18.382 1.00 24.54 ? 404 ALA A N     1 
ATOM   4021 C  CA    . ALA E 3 404 ? 7.303   -68.827 -17.794 1.00 25.88 ? 404 ALA A CA    1 
ATOM   4022 C  C     . ALA E 3 404 ? 8.243   -69.059 -16.604 1.00 28.73 ? 404 ALA A C     1 
ATOM   4023 O  O     . ALA E 3 404 ? 7.971   -69.910 -15.745 1.00 28.37 ? 404 ALA A O     1 
ATOM   4024 C  CB    . ALA E 3 404 ? 7.564   -69.861 -18.850 1.00 24.26 ? 404 ALA A CB    1 
ATOM   4025 N  N     . ARG E 3 405 ? 9.348   -68.321 -16.540 1.00 29.53 ? 405 ARG A N     1 
ATOM   4026 C  CA    . ARG E 3 405 ? 10.279  -68.525 -15.440 1.00 30.89 ? 405 ARG A CA    1 
ATOM   4027 C  C     . ARG E 3 405 ? 9.983   -67.602 -14.271 1.00 30.05 ? 405 ARG A C     1 
ATOM   4028 O  O     . ARG E 3 405 ? 10.621  -67.686 -13.230 1.00 31.68 ? 405 ARG A O     1 
ATOM   4029 C  CB    . ARG E 3 405 ? 11.729  -68.396 -15.949 1.00 32.38 ? 405 ARG A CB    1 
ATOM   4030 C  CG    . ARG E 3 405 ? 11.817  -68.917 -17.384 1.00 34.24 ? 405 ARG A CG    1 
ATOM   4031 C  CD    . ARG E 3 405 ? 12.996  -69.805 -17.849 1.00 36.03 ? 405 ARG A CD    1 
ATOM   4032 N  NE    . ARG E 3 405 ? 14.314  -69.641 -17.243 1.00 36.13 ? 405 ARG A NE    1 
ATOM   4033 C  CZ    . ARG E 3 405 ? 15.414  -70.159 -17.789 1.00 36.59 ? 405 ARG A CZ    1 
ATOM   4034 N  NH1   . ARG E 3 405 ? 15.319  -70.838 -18.925 1.00 35.20 ? 405 ARG A NH1   1 
ATOM   4035 N  NH2   . ARG E 3 405 ? 16.599  -70.021 -17.211 1.00 38.29 ? 405 ARG A NH2   1 
ATOM   4036 N  N     . THR E 3 406 ? 8.977   -66.753 -14.439 1.00 29.20 ? 406 THR A N     1 
ATOM   4037 C  CA    . THR E 3 406 ? 8.552   -65.830 -13.394 1.00 27.04 ? 406 THR A CA    1 
ATOM   4038 C  C     . THR E 3 406 ? 7.293   -66.373 -12.724 1.00 26.19 ? 406 THR A C     1 
ATOM   4039 O  O     . THR E 3 406 ? 7.172   -66.357 -11.509 1.00 25.29 ? 406 THR A O     1 
ATOM   4040 C  CB    . THR E 3 406 ? 8.229   -64.466 -13.987 1.00 27.00 ? 406 THR A CB    1 
ATOM   4041 O  OG1   . THR E 3 406 ? 9.401   -63.938 -14.615 1.00 26.83 ? 406 THR A OG1   1 
ATOM   4042 C  CG2   . THR E 3 406 ? 7.727   -63.523 -12.904 1.00 26.65 ? 406 THR A CG2   1 
ATOM   4043 N  N     . GLU E 3 407 ? 6.357   -66.839 -13.543 1.00 26.19 ? 407 GLU A N     1 
ATOM   4044 C  CA    . GLU E 3 407 ? 5.093   -67.406 -13.082 1.00 26.12 ? 407 GLU A CA    1 
ATOM   4045 C  C     . GLU E 3 407 ? 5.221   -68.904 -13.290 1.00 26.62 ? 407 GLU A C     1 
ATOM   4046 O  O     . GLU E 3 407 ? 4.978   -69.393 -14.394 1.00 27.79 ? 407 GLU A O     1 
ATOM   4047 C  CB    . GLU E 3 407 ? 3.943   -66.901 -13.947 1.00 26.15 ? 407 GLU A CB    1 
ATOM   4048 C  CG    . GLU E 3 407 ? 3.870   -65.411 -14.112 1.00 28.08 ? 407 GLU A CG    1 
ATOM   4049 C  CD    . GLU E 3 407 ? 3.530   -64.714 -12.815 1.00 31.41 ? 407 GLU A CD    1 
ATOM   4050 O  OE1   . GLU E 3 407 ? 2.922   -65.384 -11.948 1.00 32.16 ? 407 GLU A OE1   1 
ATOM   4051 O  OE2   . GLU E 3 407 ? 3.855   -63.507 -12.667 1.00 31.57 ? 407 GLU A OE2   1 
ATOM   4052 N  N     . LYS E 3 408 ? 5.602   -69.641 -12.255 1.00 26.84 ? 408 LYS A N     1 
ATOM   4053 C  CA    . LYS E 3 408 ? 5.759   -71.079 -12.410 1.00 27.44 ? 408 LYS A CA    1 
ATOM   4054 C  C     . LYS E 3 408 ? 4.522   -71.796 -12.907 1.00 26.27 ? 408 LYS A C     1 
ATOM   4055 O  O     . LYS E 3 408 ? 4.636   -72.738 -13.670 1.00 26.91 ? 408 LYS A O     1 
ATOM   4056 C  CB    . LYS E 3 408 ? 6.234   -71.711 -11.105 1.00 29.03 ? 408 LYS A CB    1 
ATOM   4057 C  CG    . LYS E 3 408 ? 7.744   -71.780 -10.985 1.00 32.10 ? 408 LYS A CG    1 
ATOM   4058 C  CD    . LYS E 3 408 ? 8.370   -70.396 -11.052 1.00 33.64 ? 408 LYS A CD    1 
ATOM   4059 C  CE    . LYS E 3 408 ? 9.878   -70.451 -10.882 1.00 35.23 ? 408 LYS A CE    1 
ATOM   4060 N  NZ    . LYS E 3 408 ? 10.431  -69.081 -10.684 1.00 35.85 ? 408 LYS A NZ    1 
ATOM   4061 N  N     . ASP E 3 409 ? 3.346   -71.362 -12.483 1.00 25.76 ? 409 ASP A N     1 
ATOM   4062 C  CA    . ASP E 3 409 ? 2.126   -72.009 -12.925 1.00 27.36 ? 409 ASP A CA    1 
ATOM   4063 C  C     . ASP E 3 409 ? 1.828   -71.539 -14.341 1.00 26.89 ? 409 ASP A C     1 
ATOM   4064 O  O     . ASP E 3 409 ? 0.970   -70.693 -14.560 1.00 28.04 ? 409 ASP A O     1 
ATOM   4065 C  CB    . ASP E 3 409 ? 0.971   -71.662 -11.981 1.00 29.74 ? 409 ASP A CB    1 
ATOM   4066 C  CG    . ASP E 3 409 ? -0.229  -72.567 -12.175 1.00 32.71 ? 409 ASP A CG    1 
ATOM   4067 O  OD1   . ASP E 3 409 ? -1.269  -72.138 -12.704 1.00 36.76 ? 409 ASP A OD1   1 
ATOM   4068 O  OD2   . ASP E 3 409 ? -0.157  -73.750 -11.797 1.00 36.72 ? 409 ASP A OD2   1 
ATOM   4069 N  N     . SER E 3 410 ? 2.553   -72.085 -15.308 1.00 26.67 ? 410 SER A N     1 
ATOM   4070 C  CA    . SER E 3 410 ? 2.357   -71.699 -16.696 1.00 26.69 ? 410 SER A CA    1 
ATOM   4071 C  C     . SER E 3 410 ? 2.679   -72.822 -17.672 1.00 26.75 ? 410 SER A C     1 
ATOM   4072 O  O     . SER E 3 410 ? 3.737   -73.439 -17.590 1.00 26.46 ? 410 SER A O     1 
ATOM   4073 C  CB    . SER E 3 410 ? 3.211   -70.468 -17.010 1.00 26.37 ? 410 SER A CB    1 
ATOM   4074 O  OG    . SER E 3 410 ? 4.558   -70.669 -16.619 1.00 25.63 ? 410 SER A OG    1 
ATOM   4075 N  N     . HIS E 3 411 ? 1.755   -73.085 -18.590 1.00 27.09 ? 411 HIS A N     1 
ATOM   4076 C  CA    . HIS E 3 411 ? 1.942   -74.123 -19.598 1.00 28.47 ? 411 HIS A CA    1 
ATOM   4077 C  C     . HIS E 3 411 ? 2.158   -73.435 -20.956 1.00 27.58 ? 411 HIS A C     1 
ATOM   4078 O  O     . HIS E 3 411 ? 1.353   -72.604 -21.368 1.00 27.36 ? 411 HIS A O     1 
ATOM   4079 C  CB    . HIS E 3 411 ? 0.704   -75.029 -19.633 1.00 31.16 ? 411 HIS A CB    1 
ATOM   4080 C  CG    . HIS E 3 411 ? 0.850   -76.237 -20.506 1.00 34.13 ? 411 HIS A CG    1 
ATOM   4081 N  ND1   . HIS E 3 411 ? 0.984   -76.159 -21.876 1.00 36.33 ? 411 HIS A ND1   1 
ATOM   4082 C  CD2   . HIS E 3 411 ? 0.858   -77.559 -20.206 1.00 35.57 ? 411 HIS A CD2   1 
ATOM   4083 C  CE1   . HIS E 3 411 ? 1.065   -77.378 -22.382 1.00 37.04 ? 411 HIS A CE1   1 
ATOM   4084 N  NE2   . HIS E 3 411 ? 0.991   -78.245 -21.387 1.00 36.70 ? 411 HIS A NE2   1 
ATOM   4085 N  N     . MET E 3 412 ? 3.254   -73.775 -21.633 1.00 26.76 ? 412 MET A N     1 
ATOM   4086 C  CA    . MET E 3 412 ? 3.596   -73.191 -22.929 1.00 24.65 ? 412 MET A CA    1 
ATOM   4087 C  C     . MET E 3 412 ? 3.110   -74.062 -24.076 1.00 24.54 ? 412 MET A C     1 
ATOM   4088 O  O     . MET E 3 412 ? 3.150   -75.293 -23.996 1.00 24.43 ? 412 MET A O     1 
ATOM   4089 C  CB    . MET E 3 412 ? 5.115   -73.028 -23.062 1.00 24.42 ? 412 MET A CB    1 
ATOM   4090 C  CG    . MET E 3 412 ? 5.798   -72.263 -21.937 1.00 24.82 ? 412 MET A CG    1 
ATOM   4091 S  SD    . MET E 3 412 ? 7.612   -72.176 -22.139 1.00 27.56 ? 412 MET A SD    1 
ATOM   4092 C  CE    . MET E 3 412 ? 8.026   -73.844 -21.917 1.00 25.94 ? 412 MET A CE    1 
ATOM   4093 N  N     . VAL E 3 413 ? 2.655   -73.419 -25.145 1.00 23.22 ? 413 VAL A N     1 
ATOM   4094 C  CA    . VAL E 3 413 ? 2.194   -74.141 -26.325 1.00 22.97 ? 413 VAL A CA    1 
ATOM   4095 C  C     . VAL E 3 413 ? 2.525   -73.363 -27.590 1.00 23.26 ? 413 VAL A C     1 
ATOM   4096 O  O     . VAL E 3 413 ? 2.612   -72.132 -27.567 1.00 24.08 ? 413 VAL A O     1 
ATOM   4097 C  CB    . VAL E 3 413 ? 0.660   -74.396 -26.299 1.00 23.01 ? 413 VAL A CB    1 
ATOM   4098 C  CG1   . VAL E 3 413 ? 0.296   -75.255 -25.096 1.00 20.91 ? 413 VAL A CG1   1 
ATOM   4099 C  CG2   . VAL E 3 413 ? -0.098  -73.073 -26.293 1.00 21.74 ? 413 VAL A CG2   1 
ATOM   4100 N  N     . ALA E 3 414 ? 2.710   -74.089 -28.689 1.00 22.36 ? 414 ALA A N     1 
ATOM   4101 C  CA    . ALA E 3 414 ? 3.013   -73.487 -29.987 1.00 22.71 ? 414 ALA A CA    1 
ATOM   4102 C  C     . ALA E 3 414 ? 1.898   -73.811 -30.985 1.00 23.06 ? 414 ALA A C     1 
ATOM   4103 O  O     . ALA E 3 414 ? 1.253   -74.852 -30.880 1.00 23.46 ? 414 ALA A O     1 
ATOM   4104 C  CB    . ALA E 3 414 ? 4.340   -74.005 -30.503 1.00 22.51 ? 414 ALA A CB    1 
ATOM   4105 N  N     . PHE E 3 415 ? 1.675   -72.932 -31.957 1.00 23.11 ? 415 PHE A N     1 
ATOM   4106 C  CA    . PHE E 3 415 ? 0.614   -73.173 -32.930 1.00 23.66 ? 415 PHE A CA    1 
ATOM   4107 C  C     . PHE E 3 415 ? 0.797   -72.421 -34.238 1.00 24.17 ? 415 PHE A C     1 
ATOM   4108 O  O     . PHE E 3 415 ? 1.450   -71.379 -34.295 1.00 24.41 ? 415 PHE A O     1 
ATOM   4109 C  CB    . PHE E 3 415 ? -0.735  -72.759 -32.335 1.00 22.38 ? 415 PHE A CB    1 
ATOM   4110 C  CG    . PHE E 3 415 ? -0.925  -71.267 -32.266 1.00 21.87 ? 415 PHE A CG    1 
ATOM   4111 C  CD1   . PHE E 3 415 ? -1.493  -70.578 -33.332 1.00 19.85 ? 415 PHE A CD1   1 
ATOM   4112 C  CD2   . PHE E 3 415 ? -0.493  -70.544 -31.149 1.00 20.63 ? 415 PHE A CD2   1 
ATOM   4113 C  CE1   . PHE E 3 415 ? -1.630  -69.184 -33.289 1.00 20.75 ? 415 PHE A CE1   1 
ATOM   4114 C  CE2   . PHE E 3 415 ? -0.624  -69.158 -31.099 1.00 19.85 ? 415 PHE A CE2   1 
ATOM   4115 C  CZ    . PHE E 3 415 ? -1.194  -68.475 -32.171 1.00 20.34 ? 415 PHE A CZ    1 
ATOM   4116 N  N     . SER E 3 416 ? 0.196   -72.975 -35.283 1.00 24.54 ? 416 SER A N     1 
ATOM   4117 C  CA    . SER E 3 416 ? 0.188   -72.381 -36.612 1.00 24.59 ? 416 SER A CA    1 
ATOM   4118 C  C     . SER E 3 416 ? -1.290  -72.475 -37.001 1.00 25.48 ? 416 SER A C     1 
ATOM   4119 O  O     . SER E 3 416 ? -2.089  -71.673 -36.538 1.00 25.34 ? 416 SER A O     1 
ATOM   4120 C  CB    . SER E 3 416 ? 1.067   -73.179 -37.570 1.00 22.58 ? 416 SER A CB    1 
ATOM   4121 O  OG    . SER E 3 416 ? 0.715   -74.544 -37.544 1.00 22.54 ? 416 SER A OG    1 
ATOM   4122 N  N     . ASP E 3 417 ? -1.653  -73.458 -37.824 1.00 27.61 ? 417 ASP A N     1 
ATOM   4123 C  CA    . ASP E 3 417 ? -3.051  -73.647 -38.216 1.00 28.64 ? 417 ASP A CA    1 
ATOM   4124 C  C     . ASP E 3 417 ? -3.562  -74.890 -37.490 1.00 28.81 ? 417 ASP A C     1 
ATOM   4125 O  O     . ASP E 3 417 ? -4.643  -75.400 -37.768 1.00 26.95 ? 417 ASP A O     1 
ATOM   4126 C  CB    . ASP E 3 417 ? -3.199  -73.777 -39.748 1.00 30.46 ? 417 ASP A CB    1 
ATOM   4127 C  CG    . ASP E 3 417 ? -2.447  -74.949 -40.319 1.00 33.60 ? 417 ASP A CG    1 
ATOM   4128 O  OD1   . ASP E 3 417 ? -1.548  -74.747 -41.164 1.00 35.67 ? 417 ASP A OD1   1 
ATOM   4129 O  OD2   . ASP E 3 417 ? -2.761  -76.103 -39.953 1.00 37.42 ? 417 ASP A OD2   1 
ATOM   4130 N  N     . GLU E 3 418 ? -2.745  -75.367 -36.551 1.00 29.14 ? 418 GLU A N     1 
ATOM   4131 C  CA    . GLU E 3 418 ? -3.056  -76.536 -35.731 1.00 30.10 ? 418 GLU A CA    1 
ATOM   4132 C  C     . GLU E 3 418 ? -2.156  -76.495 -34.496 1.00 31.29 ? 418 GLU A C     1 
ATOM   4133 O  O     . GLU E 3 418 ? -1.115  -75.830 -34.493 1.00 31.83 ? 418 GLU A O     1 
ATOM   4134 C  CB    . GLU E 3 418 ? -2.779  -77.828 -36.496 1.00 29.97 ? 418 GLU A CB    1 
ATOM   4135 C  CG    . GLU E 3 418 ? -1.308  -78.166 -36.603 1.00 30.14 ? 418 GLU A CG    1 
ATOM   4136 C  CD    . GLU E 3 418 ? -1.057  -79.506 -37.263 1.00 31.76 ? 418 GLU A CD    1 
ATOM   4137 O  OE1   . GLU E 3 418 ? -1.492  -80.546 -36.713 1.00 31.63 ? 418 GLU A OE1   1 
ATOM   4138 O  OE2   . GLU E 3 418 ? -0.421  -79.513 -38.339 1.00 32.82 ? 418 GLU A OE2   1 
ATOM   4139 N  N     . MET E 3 419 ? -2.557  -77.189 -33.440 1.00 31.76 ? 419 MET A N     1 
ATOM   4140 C  CA    . MET E 3 419 ? -1.743  -77.232 -32.236 1.00 32.15 ? 419 MET A CA    1 
ATOM   4141 C  C     . MET E 3 419 ? -0.542  -78.144 -32.511 1.00 33.36 ? 419 MET A C     1 
ATOM   4142 O  O     . MET E 3 419 ? -0.696  -79.254 -33.023 1.00 33.23 ? 419 MET A O     1 
ATOM   4143 C  CB    . MET E 3 419 ? -2.557  -77.787 -31.064 1.00 31.37 ? 419 MET A CB    1 
ATOM   4144 C  CG    . MET E 3 419 ? -3.719  -76.914 -30.624 1.00 32.03 ? 419 MET A CG    1 
ATOM   4145 S  SD    . MET E 3 419 ? -3.232  -75.249 -30.050 1.00 31.99 ? 419 MET A SD    1 
ATOM   4146 C  CE    . MET E 3 419 ? -2.491  -75.611 -28.456 1.00 32.96 ? 419 MET A CE    1 
ATOM   4147 N  N     . LEU E 3 420 ? 0.654   -77.664 -32.199 1.00 34.44 ? 420 LEU A N     1 
ATOM   4148 C  CA    . LEU E 3 420 ? 1.866   -78.451 -32.401 1.00 35.78 ? 420 LEU A CA    1 
ATOM   4149 C  C     . LEU E 3 420 ? 2.520   -78.734 -31.068 1.00 36.97 ? 420 LEU A C     1 
ATOM   4150 O  O     . LEU E 3 420 ? 2.435   -77.931 -30.142 1.00 38.10 ? 420 LEU A O     1 
ATOM   4151 C  CB    . LEU E 3 420 ? 2.894   -77.713 -33.261 1.00 36.01 ? 420 LEU A CB    1 
ATOM   4152 C  CG    . LEU E 3 420 ? 2.787   -77.624 -34.780 1.00 36.80 ? 420 LEU A CG    1 
ATOM   4153 C  CD1   . LEU E 3 420 ? 2.563   -79.007 -35.373 1.00 37.12 ? 420 LEU A CD1   1 
ATOM   4154 C  CD2   . LEU E 3 420 ? 1.672   -76.687 -35.148 1.00 38.78 ? 420 LEU A CD2   1 
ATOM   4155 N  N     . PRO E 3 421 ? 3.187   -79.885 -30.947 1.00 37.61 ? 421 PRO A N     1 
ATOM   4156 C  CA    . PRO E 3 421 ? 3.833   -80.164 -29.667 1.00 38.43 ? 421 PRO A CA    1 
ATOM   4157 C  C     . PRO E 3 421 ? 4.814   -79.026 -29.355 1.00 40.20 ? 421 PRO A C     1 
ATOM   4158 O  O     . PRO E 3 421 ? 5.594   -78.611 -30.225 1.00 40.57 ? 421 PRO A O     1 
ATOM   4159 C  CB    . PRO E 3 421 ? 4.536   -81.494 -29.928 1.00 38.58 ? 421 PRO A CB    1 
ATOM   4160 C  CG    . PRO E 3 421 ? 4.810   -81.455 -31.409 1.00 37.04 ? 421 PRO A CG    1 
ATOM   4161 C  CD    . PRO E 3 421 ? 3.518   -80.916 -31.943 1.00 37.18 ? 421 PRO A CD    1 
ATOM   4162 N  N     . CYS E 3 422 ? 4.766   -78.502 -28.134 1.00 40.30 ? 422 CYS A N     1 
ATOM   4163 C  CA    . CYS E 3 422 ? 5.670   -77.421 -27.775 1.00 40.37 ? 422 CYS A CA    1 
ATOM   4164 C  C     . CYS E 3 422 ? 7.098   -77.950 -27.732 1.00 39.86 ? 422 CYS A C     1 
ATOM   4165 O  O     . CYS E 3 422 ? 7.437   -78.781 -26.897 1.00 39.52 ? 422 CYS A O     1 
ATOM   4166 C  CB    . CYS E 3 422 ? 5.301   -76.832 -26.426 1.00 41.29 ? 422 CYS A CB    1 
ATOM   4167 S  SG    . CYS E 3 422 ? 6.168   -75.293 -26.125 1.00 43.50 ? 422 CYS A SG    1 
ATOM   4168 N  N     . PRO E 3 423 ? 7.958   -77.452 -28.631 1.00 39.97 ? 423 PRO A N     1 
ATOM   4169 C  CA    . PRO E 3 423 ? 9.369   -77.818 -28.789 1.00 39.94 ? 423 PRO A CA    1 
ATOM   4170 C  C     . PRO E 3 423 ? 10.325  -77.402 -27.670 1.00 39.56 ? 423 PRO A C     1 
ATOM   4171 O  O     . PRO E 3 423 ? 11.425  -77.956 -27.548 1.00 39.54 ? 423 PRO A O     1 
ATOM   4172 C  CB    . PRO E 3 423 ? 9.729   -77.153 -30.104 1.00 40.27 ? 423 PRO A CB    1 
ATOM   4173 C  CG    . PRO E 3 423 ? 8.978   -75.861 -29.992 1.00 40.89 ? 423 PRO A CG    1 
ATOM   4174 C  CD    . PRO E 3 423 ? 7.617   -76.329 -29.523 1.00 40.39 ? 423 PRO A CD    1 
ATOM   4175 N  N     . ILE E 3 424 ? 9.920   -76.432 -26.858 1.00 38.16 ? 424 ILE A N     1 
ATOM   4176 C  CA    . ILE E 3 424 ? 10.790  -75.971 -25.787 1.00 37.42 ? 424 ILE A CA    1 
ATOM   4177 C  C     . ILE E 3 424 ? 10.242  -76.172 -24.389 1.00 36.87 ? 424 ILE A C     1 
ATOM   4178 O  O     . ILE E 3 424 ? 9.042   -76.380 -24.204 1.00 36.43 ? 424 ILE A O     1 
ATOM   4179 C  CB    . ILE E 3 424 ? 11.117  -74.495 -25.961 1.00 37.39 ? 424 ILE A CB    1 
ATOM   4180 C  CG1   . ILE E 3 424 ? 9.824   -73.688 -26.077 1.00 35.98 ? 424 ILE A CG1   1 
ATOM   4181 C  CG2   . ILE E 3 424 ? 11.983  -74.307 -27.197 1.00 38.71 ? 424 ILE A CG2   1 
ATOM   4182 C  CD1   . ILE E 3 424 ? 10.064  -72.210 -26.236 1.00 35.53 ? 424 ILE A CD1   1 
ATOM   4183 N  N     . THR E 3 425 ? 11.137  -76.124 -23.407 1.00 36.51 ? 425 THR A N     1 
ATOM   4184 C  CA    . THR E 3 425 ? 10.742  -76.283 -22.010 1.00 38.33 ? 425 THR A CA    1 
ATOM   4185 C  C     . THR E 3 425 ? 11.369  -75.207 -21.139 1.00 38.56 ? 425 THR A C     1 
ATOM   4186 O  O     . THR E 3 425 ? 12.368  -74.587 -21.501 1.00 37.80 ? 425 THR A O     1 
ATOM   4187 C  CB    . THR E 3 425 ? 11.122  -77.681 -21.423 1.00 38.68 ? 425 THR A CB    1 
ATOM   4188 O  OG1   . THR E 3 425 ? 12.531  -77.904 -21.567 1.00 38.42 ? 425 THR A OG1   1 
ATOM   4189 C  CG2   . THR E 3 425 ? 10.336  -78.798 -22.123 1.00 38.48 ? 425 THR A CG2   1 
ATOM   4190 N  N     . VAL E 3 426 ? 10.766  -75.005 -19.978 1.00 39.38 ? 426 VAL A N     1 
ATOM   4191 C  CA    . VAL E 3 426 ? 11.209  -73.997 -19.034 1.00 41.45 ? 426 VAL A CA    1 
ATOM   4192 C  C     . VAL E 3 426 ? 12.672  -74.101 -18.616 1.00 42.70 ? 426 VAL A C     1 
ATOM   4193 O  O     . VAL E 3 426 ? 13.290  -73.100 -18.272 1.00 44.41 ? 426 VAL A O     1 
ATOM   4194 C  CB    . VAL E 3 426 ? 10.358  -74.048 -17.760 1.00 41.49 ? 426 VAL A CB    1 
ATOM   4195 C  CG1   . VAL E 3 426 ? 10.330  -72.677 -17.105 1.00 43.18 ? 426 VAL A CG1   1 
ATOM   4196 C  CG2   . VAL E 3 426 ? 8.962   -74.535 -18.090 1.00 41.83 ? 426 VAL A CG2   1 
ATOM   4197 N  N     . ASN E 3 427 ? 13.230  -75.302 -18.647 1.00 43.45 ? 427 ASN A N     1 
ATOM   4198 C  CA    . ASN E 3 427 ? 14.607  -75.492 -18.213 1.00 43.35 ? 427 ASN A CA    1 
ATOM   4199 C  C     . ASN E 3 427 ? 15.657  -75.391 -19.296 1.00 43.40 ? 427 ASN A C     1 
ATOM   4200 O  O     . ASN E 3 427 ? 16.838  -75.559 -19.012 1.00 43.55 ? 427 ASN A O     1 
ATOM   4201 C  CB    . ASN E 3 427 ? 14.752  -76.848 -17.519 1.00 44.76 ? 427 ASN A CB    1 
ATOM   4202 C  CG    . ASN E 3 427 ? 13.872  -76.972 -16.283 1.00 46.15 ? 427 ASN A CG    1 
ATOM   4203 O  OD1   . ASN E 3 427 ? 14.018  -76.213 -15.317 1.00 45.89 ? 427 ASN A OD1   1 
ATOM   4204 N  ND2   . ASN E 3 427 ? 12.951  -77.931 -16.309 1.00 46.59 ? 427 ASN A ND2   1 
ATOM   4205 N  N     . MET E 3 428 ? 15.247  -75.124 -20.529 1.00 43.65 ? 428 MET A N     1 
ATOM   4206 C  CA    . MET E 3 428 ? 16.209  -75.040 -21.619 1.00 43.69 ? 428 MET A CA    1 
ATOM   4207 C  C     . MET E 3 428 ? 17.004  -73.751 -21.615 1.00 43.85 ? 428 MET A C     1 
ATOM   4208 O  O     . MET E 3 428 ? 16.525  -72.715 -21.155 1.00 44.47 ? 428 MET A O     1 
ATOM   4209 C  CB    . MET E 3 428 ? 15.505  -75.144 -22.959 1.00 44.33 ? 428 MET A CB    1 
ATOM   4210 C  CG    . MET E 3 428 ? 14.839  -76.463 -23.236 1.00 46.21 ? 428 MET A CG    1 
ATOM   4211 S  SD    . MET E 3 428 ? 13.917  -76.352 -24.774 1.00 48.57 ? 428 MET A SD    1 
ATOM   4212 C  CE    . MET E 3 428 ? 14.564  -77.643 -25.625 1.00 47.97 ? 428 MET A CE    1 
ATOM   4213 N  N     . LEU E 3 429 ? 18.223  -73.828 -22.138 1.00 44.03 ? 429 LEU A N     1 
ATOM   4214 C  CA    . LEU E 3 429 ? 19.103  -72.673 -22.251 1.00 44.43 ? 429 LEU A CA    1 
ATOM   4215 C  C     . LEU E 3 429 ? 18.612  -71.955 -23.497 1.00 44.98 ? 429 LEU A C     1 
ATOM   4216 O  O     . LEU E 3 429 ? 18.120  -72.594 -24.426 1.00 44.57 ? 429 LEU A O     1 
ATOM   4217 C  CB    . LEU E 3 429 ? 20.539  -73.135 -22.432 1.00 45.12 ? 429 LEU A CB    1 
ATOM   4218 C  CG    . LEU E 3 429 ? 21.045  -73.903 -21.216 1.00 44.96 ? 429 LEU A CG    1 
ATOM   4219 C  CD1   . LEU E 3 429 ? 22.272  -74.718 -21.565 1.00 44.61 ? 429 LEU A CD1   1 
ATOM   4220 C  CD2   . LEU E 3 429 ? 21.342  -72.913 -20.104 1.00 46.02 ? 429 LEU A CD2   1 
ATOM   4221 N  N     . LEU E 3 430 ? 18.740  -70.636 -23.528 1.00 45.77 ? 430 LEU A N     1 
ATOM   4222 C  CA    . LEU E 3 430 ? 18.235  -69.856 -24.651 1.00 47.38 ? 430 LEU A CA    1 
ATOM   4223 C  C     . LEU E 3 430 ? 18.612  -70.287 -26.051 1.00 48.61 ? 430 LEU A C     1 
ATOM   4224 O  O     . LEU E 3 430 ? 17.797  -70.182 -26.979 1.00 48.49 ? 430 LEU A O     1 
ATOM   4225 C  CB    . LEU E 3 430 ? 18.585  -68.378 -24.471 1.00 46.74 ? 430 LEU A CB    1 
ATOM   4226 C  CG    . LEU E 3 430 ? 17.325  -67.517 -24.352 1.00 45.85 ? 430 LEU A CG    1 
ATOM   4227 C  CD1   . LEU E 3 430 ? 17.315  -66.781 -23.043 1.00 46.74 ? 430 LEU A CD1   1 
ATOM   4228 C  CD2   . LEU E 3 430 ? 17.282  -66.552 -25.499 1.00 46.21 ? 430 LEU A CD2   1 
ATOM   4229 N  N     . HIS E 3 431 ? 19.826  -70.777 -26.249 1.00 50.67 ? 431 HIS A N     1 
ATOM   4230 C  CA    . HIS E 3 431 ? 20.180  -71.163 -27.607 1.00 52.56 ? 431 HIS A CA    1 
ATOM   4231 C  C     . HIS E 3 431 ? 19.599  -72.497 -28.034 1.00 51.83 ? 431 HIS A C     1 
ATOM   4232 O  O     . HIS E 3 431 ? 19.608  -72.802 -29.234 1.00 52.73 ? 431 HIS A O     1 
ATOM   4233 C  CB    . HIS E 3 431 ? 21.717  -71.100 -27.809 1.00 56.89 ? 431 HIS A CB    1 
ATOM   4234 C  CG    . HIS E 3 431 ? 22.436  -72.395 -27.598 1.00 61.23 ? 431 HIS A CG    1 
ATOM   4235 N  ND1   . HIS E 3 431 ? 23.831  -72.495 -27.594 1.00 63.58 ? 431 HIS A ND1   1 
ATOM   4236 C  CD2   . HIS E 3 431 ? 22.020  -73.676 -27.455 1.00 63.31 ? 431 HIS A CD2   1 
ATOM   4237 C  CE1   . HIS E 3 431 ? 24.210  -73.737 -27.468 1.00 64.43 ? 431 HIS A CE1   1 
ATOM   4238 N  NE2   . HIS E 3 431 ? 23.107  -74.495 -27.379 1.00 64.53 ? 431 HIS A NE2   1 
ATOM   4239 N  N     . GLU E 3 432 ? 19.082  -73.274 -27.079 1.00 50.71 ? 432 GLU A N     1 
ATOM   4240 C  CA    . GLU E 3 432 ? 18.469  -74.543 -27.426 1.00 49.35 ? 432 GLU A CA    1 
ATOM   4241 C  C     . GLU E 3 432 ? 17.051  -74.217 -27.880 1.00 47.78 ? 432 GLU A C     1 
ATOM   4242 O  O     . GLU E 3 432 ? 16.494  -74.912 -28.726 1.00 47.53 ? 432 GLU A O     1 
ATOM   4243 C  CB    . GLU E 3 432 ? 18.419  -75.491 -26.228 1.00 50.14 ? 432 GLU A CB    1 
ATOM   4244 C  CG    . GLU E 3 432 ? 17.839  -76.888 -26.558 1.00 50.24 ? 432 GLU A CG    1 
ATOM   4245 C  CD    . GLU E 3 432 ? 17.838  -77.845 -25.373 1.00 51.40 ? 432 GLU A CD    1 
ATOM   4246 O  OE1   . GLU E 3 432 ? 17.360  -78.989 -25.537 1.00 50.99 ? 432 GLU A OE1   1 
ATOM   4247 O  OE2   . GLU E 3 432 ? 18.313  -77.459 -24.282 1.00 52.02 ? 432 GLU A OE2   1 
ATOM   4248 N  N     . VAL E 3 433 ? 16.469  -73.162 -27.316 1.00 46.40 ? 433 VAL A N     1 
ATOM   4249 C  CA    . VAL E 3 433 ? 15.120  -72.771 -27.687 1.00 45.47 ? 433 VAL A CA    1 
ATOM   4250 C  C     . VAL E 3 433 ? 15.158  -72.106 -29.053 1.00 45.46 ? 433 VAL A C     1 
ATOM   4251 O  O     . VAL E 3 433 ? 14.154  -72.067 -29.763 1.00 44.08 ? 433 VAL A O     1 
ATOM   4252 C  CB    . VAL E 3 433 ? 14.507  -71.789 -26.647 1.00 44.61 ? 433 VAL A CB    1 
ATOM   4253 C  CG1   . VAL E 3 433 ? 15.441  -71.625 -25.471 1.00 45.87 ? 433 VAL A CG1   1 
ATOM   4254 C  CG2   . VAL E 3 433 ? 14.205  -70.438 -27.296 1.00 44.07 ? 433 VAL A CG2   1 
ATOM   4255 N  N     . VAL E 3 434 ? 16.322  -71.578 -29.415 1.00 45.54 ? 434 VAL A N     1 
ATOM   4256 C  CA    . VAL E 3 434 ? 16.462  -70.910 -30.699 1.00 46.46 ? 434 VAL A CA    1 
ATOM   4257 C  C     . VAL E 3 434 ? 16.436  -71.906 -31.851 1.00 47.39 ? 434 VAL A C     1 
ATOM   4258 O  O     . VAL E 3 434 ? 15.630  -71.795 -32.777 1.00 47.43 ? 434 VAL A O     1 
ATOM   4259 C  CB    . VAL E 3 434 ? 17.774  -70.098 -30.778 1.00 46.65 ? 434 VAL A CB    1 
ATOM   4260 C  CG1   . VAL E 3 434 ? 17.955  -69.534 -32.195 1.00 46.44 ? 434 VAL A CG1   1 
ATOM   4261 C  CG2   . VAL E 3 434 ? 17.749  -68.959 -29.764 1.00 45.48 ? 434 VAL A CG2   1 
ATOM   4262 N  N     . GLU E 3 435 ? 17.320  -72.891 -31.799 1.00 48.71 ? 435 GLU A N     1 
ATOM   4263 C  CA    . GLU E 3 435 ? 17.366  -73.866 -32.873 1.00 49.93 ? 435 GLU A CA    1 
ATOM   4264 C  C     . GLU E 3 435 ? 16.119  -74.736 -32.906 1.00 49.75 ? 435 GLU A C     1 
ATOM   4265 O  O     . GLU E 3 435 ? 15.786  -75.294 -33.942 1.00 49.80 ? 435 GLU A O     1 
ATOM   4266 C  CB    . GLU E 3 435 ? 18.620  -74.739 -32.761 1.00 51.69 ? 435 GLU A CB    1 
ATOM   4267 C  CG    . GLU E 3 435 ? 18.380  -76.100 -32.150 1.00 56.24 ? 435 GLU A CG    1 
ATOM   4268 C  CD    . GLU E 3 435 ? 19.669  -76.818 -31.827 1.00 59.17 ? 435 GLU A CD    1 
ATOM   4269 O  OE1   . GLU E 3 435 ? 20.171  -77.600 -32.673 1.00 60.01 ? 435 GLU A OE1   1 
ATOM   4270 O  OE2   . GLU E 3 435 ? 20.181  -76.592 -30.714 1.00 60.46 ? 435 GLU A OE2   1 
ATOM   4271 N  N     . LYS E 3 436 ? 15.427  -74.866 -31.780 1.00 50.02 ? 436 LYS A N     1 
ATOM   4272 C  CA    . LYS E 3 436 ? 14.218  -75.686 -31.763 1.00 50.29 ? 436 LYS A CA    1 
ATOM   4273 C  C     . LYS E 3 436 ? 13.088  -74.973 -32.502 1.00 50.54 ? 436 LYS A C     1 
ATOM   4274 O  O     . LYS E 3 436 ? 12.250  -75.623 -33.130 1.00 50.28 ? 436 LYS A O     1 
ATOM   4275 C  CB    . LYS E 3 436 ? 13.799  -76.022 -30.324 1.00 50.47 ? 436 LYS A CB    1 
ATOM   4276 C  CG    . LYS E 3 436 ? 14.852  -76.836 -29.552 1.00 51.58 ? 436 LYS A CG    1 
ATOM   4277 C  CD    . LYS E 3 436 ? 14.337  -78.201 -29.114 1.00 52.54 ? 436 LYS A CD    1 
ATOM   4278 C  CE    . LYS E 3 436 ? 15.330  -78.934 -28.197 1.00 52.86 ? 436 LYS A CE    1 
ATOM   4279 N  NZ    . LYS E 3 436 ? 16.673  -79.168 -28.778 1.00 52.90 ? 436 LYS A NZ    1 
ATOM   4280 N  N     . MET E 3 437 ? 13.064  -73.641 -32.428 1.00 50.82 ? 437 MET A N     1 
ATOM   4281 C  CA    . MET E 3 437 ? 12.041  -72.854 -33.125 1.00 50.55 ? 437 MET A CA    1 
ATOM   4282 C  C     . MET E 3 437 ? 12.378  -72.915 -34.608 1.00 50.96 ? 437 MET A C     1 
ATOM   4283 O  O     . MET E 3 437 ? 11.529  -72.684 -35.469 1.00 51.16 ? 437 MET A O     1 
ATOM   4284 C  CB    . MET E 3 437 ? 12.065  -71.395 -32.668 1.00 49.52 ? 437 MET A CB    1 
ATOM   4285 C  CG    . MET E 3 437 ? 11.829  -71.222 -31.193 1.00 48.92 ? 437 MET A CG    1 
ATOM   4286 S  SD    . MET E 3 437 ? 10.459  -72.233 -30.637 1.00 47.82 ? 437 MET A SD    1 
ATOM   4287 C  CE    . MET E 3 437 ? 9.091   -71.242 -31.174 1.00 47.80 ? 437 MET A CE    1 
ATOM   4288 N  N     . SER E 3 438 ? 13.642  -73.226 -34.881 1.00 50.91 ? 438 SER A N     1 
ATOM   4289 C  CA    . SER E 3 438 ? 14.165  -73.351 -36.234 1.00 50.22 ? 438 SER A CA    1 
ATOM   4290 C  C     . SER E 3 438 ? 13.375  -74.390 -37.030 1.00 49.57 ? 438 SER A C     1 
ATOM   4291 O  O     . SER E 3 438 ? 12.698  -74.076 -38.014 1.00 48.91 ? 438 SER A O     1 
ATOM   4292 C  CB    . SER E 3 438 ? 15.628  -73.794 -36.173 1.00 51.01 ? 438 SER A CB    1 
ATOM   4293 O  OG    . SER E 3 438 ? 16.490  -72.832 -36.774 1.00 53.71 ? 438 SER A OG    1 
ATOM   4294 N  N     . ASP E 3 439 ? 13.463  -75.634 -36.573 1.00 48.29 ? 439 ASP A N     1 
ATOM   4295 C  CA    . ASP E 3 439 ? 12.813  -76.766 -37.226 1.00 46.45 ? 439 ASP A CA    1 
ATOM   4296 C  C     . ASP E 3 439 ? 11.294  -76.683 -37.290 1.00 43.03 ? 439 ASP A C     1 
ATOM   4297 O  O     . ASP E 3 439 ? 10.674  -77.355 -38.106 1.00 43.88 ? 439 ASP A O     1 
ATOM   4298 C  CB    . ASP E 3 439 ? 13.175  -78.062 -36.494 1.00 49.53 ? 439 ASP A CB    1 
ATOM   4299 C  CG    . ASP E 3 439 ? 14.656  -78.190 -36.229 1.00 52.59 ? 439 ASP A CG    1 
ATOM   4300 O  OD1   . ASP E 3 439 ? 15.366  -78.796 -37.071 1.00 54.68 ? 439 ASP A OD1   1 
ATOM   4301 O  OD2   . ASP E 3 439 ? 15.124  -77.685 -35.180 1.00 54.42 ? 439 ASP A OD2   1 
ATOM   4302 N  N     . ILE E 3 440 ? 10.692  -75.850 -36.454 1.00 39.11 ? 440 ILE A N     1 
ATOM   4303 C  CA    . ILE E 3 440 ? 9.241   -75.803 -36.394 1.00 35.98 ? 440 ILE A CA    1 
ATOM   4304 C  C     . ILE E 3 440 ? 8.467   -74.628 -37.001 1.00 33.21 ? 440 ILE A C     1 
ATOM   4305 O  O     . ILE E 3 440 ? 7.265   -74.752 -37.229 1.00 33.18 ? 440 ILE A O     1 
ATOM   4306 C  CB    . ILE E 3 440 ? 8.809   -76.043 -34.913 1.00 36.31 ? 440 ILE A CB    1 
ATOM   4307 C  CG1   . ILE E 3 440 ? 7.455   -75.399 -34.600 1.00 36.20 ? 440 ILE A CG1   1 
ATOM   4308 C  CG2   . ILE E 3 440 ? 9.851   -75.493 -33.989 1.00 37.30 ? 440 ILE A CG2   1 
ATOM   4309 C  CD1   . ILE E 3 440 ? 7.064   -75.533 -33.140 1.00 36.77 ? 440 ILE A CD1   1 
ATOM   4310 N  N     . THR E 3 441 ? 9.123   -73.509 -37.293 1.00 29.42 ? 441 THR A N     1 
ATOM   4311 C  CA    . THR E 3 441 ? 8.399   -72.370 -37.857 1.00 27.60 ? 441 THR A CA    1 
ATOM   4312 C  C     . THR E 3 441 ? 7.946   -72.623 -39.295 1.00 25.75 ? 441 THR A C     1 
ATOM   4313 O  O     . THR E 3 441 ? 8.772   -72.897 -40.162 1.00 26.05 ? 441 THR A O     1 
ATOM   4314 C  CB    . THR E 3 441 ? 9.251   -71.100 -37.796 1.00 28.37 ? 441 THR A CB    1 
ATOM   4315 O  OG1   . THR E 3 441 ? 9.650   -70.874 -36.439 1.00 28.82 ? 441 THR A OG1   1 
ATOM   4316 C  CG2   . THR E 3 441 ? 8.448   -69.906 -38.258 1.00 29.07 ? 441 THR A CG2   1 
ATOM   4317 N  N     . MET E 3 442 ? 6.633   -72.520 -39.530 1.00 22.62 ? 442 MET A N     1 
ATOM   4318 C  CA    . MET E 3 442 ? 6.015   -72.762 -40.843 1.00 20.24 ? 442 MET A CA    1 
ATOM   4319 C  C     . MET E 3 442 ? 4.490   -72.870 -40.710 1.00 19.22 ? 442 MET A C     1 
ATOM   4320 O  O     . MET E 3 442 ? 3.956   -72.865 -39.607 1.00 19.81 ? 442 MET A O     1 
ATOM   4321 C  CB    . MET E 3 442 ? 6.534   -74.072 -41.435 1.00 19.96 ? 442 MET A CB    1 
ATOM   4322 C  CG    . MET E 3 442 ? 6.185   -75.304 -40.603 1.00 20.63 ? 442 MET A CG    1 
ATOM   4323 S  SD    . MET E 3 442 ? 6.878   -76.894 -41.178 1.00 22.32 ? 442 MET A SD    1 
ATOM   4324 C  CE    . MET E 3 442 ? 8.629   -76.703 -40.705 1.00 19.20 ? 442 MET A CE    1 
ATOM   4325 N  N     . GLY E 3 443 ? 3.787   -72.980 -41.832 1.00 18.19 ? 443 GLY A N     1 
ATOM   4326 C  CA    . GLY E 3 443 ? 2.336   -73.114 -41.780 1.00 16.95 ? 443 GLY A CA    1 
ATOM   4327 C  C     . GLY E 3 443 ? 1.495   -71.843 -41.763 1.00 16.89 ? 443 GLY A C     1 
ATOM   4328 O  O     . GLY E 3 443 ? 2.004   -70.723 -41.716 1.00 17.08 ? 443 GLY A O     1 
ATOM   4329 N  N     . SER E 3 444 ? 0.182   -72.024 -41.809 1.00 16.57 ? 444 SER A N     1 
ATOM   4330 C  CA    . SER E 3 444 ? -0.748  -70.903 -41.783 1.00 17.35 ? 444 SER A CA    1 
ATOM   4331 C  C     . SER E 3 444 ? -1.099  -70.525 -40.347 1.00 17.11 ? 444 SER A C     1 
ATOM   4332 O  O     . SER E 3 444 ? -0.681  -71.192 -39.404 1.00 16.37 ? 444 SER A O     1 
ATOM   4333 C  CB    . SER E 3 444 ? -2.005  -71.241 -42.570 1.00 16.99 ? 444 SER A CB    1 
ATOM   4334 O  OG    . SER E 3 444 ? -1.655  -71.512 -43.918 1.00 18.44 ? 444 SER A OG    1 
ATOM   4335 N  N     . THR E 3 445 ? -1.895  -69.478 -40.192 1.00 16.80 ? 445 THR A N     1 
ATOM   4336 C  CA    . THR E 3 445 ? -2.220  -68.963 -38.873 1.00 17.96 ? 445 THR A CA    1 
ATOM   4337 C  C     . THR E 3 445 ? -3.659  -69.061 -38.378 1.00 19.14 ? 445 THR A C     1 
ATOM   4338 O  O     . THR E 3 445 ? -4.565  -68.486 -38.981 1.00 19.66 ? 445 THR A O     1 
ATOM   4339 C  CB    . THR E 3 445 ? -1.837  -67.482 -38.802 1.00 16.72 ? 445 THR A CB    1 
ATOM   4340 O  OG1   . THR E 3 445 ? -0.510  -67.312 -39.305 1.00 16.30 ? 445 THR A OG1   1 
ATOM   4341 C  CG2   . THR E 3 445 ? -1.927  -66.977 -37.391 1.00 18.64 ? 445 THR A CG2   1 
ATOM   4342 N  N     . ASP E 3 446 ? -3.856  -69.763 -37.263 1.00 19.49 ? 446 ASP A N     1 
ATOM   4343 C  CA    . ASP E 3 446 ? -5.174  -69.877 -36.644 1.00 19.93 ? 446 ASP A CA    1 
ATOM   4344 C  C     . ASP E 3 446 ? -5.023  -69.429 -35.188 1.00 20.70 ? 446 ASP A C     1 
ATOM   4345 O  O     . ASP E 3 446 ? -4.856  -70.252 -34.283 1.00 21.44 ? 446 ASP A O     1 
ATOM   4346 C  CB    . ASP E 3 446 ? -5.708  -71.313 -36.688 1.00 19.85 ? 446 ASP A CB    1 
ATOM   4347 C  CG    . ASP E 3 446 ? -7.149  -71.410 -36.194 1.00 19.89 ? 446 ASP A CG    1 
ATOM   4348 O  OD1   . ASP E 3 446 ? -7.733  -72.514 -36.176 1.00 21.61 ? 446 ASP A OD1   1 
ATOM   4349 O  OD2   . ASP E 3 446 ? -7.702  -70.362 -35.820 1.00 21.60 ? 446 ASP A OD2   1 
ATOM   4350 N  N     . CYS E 3 447 ? -5.092  -68.118 -34.972 1.00 20.64 ? 447 CYS A N     1 
ATOM   4351 C  CA    . CYS E 3 447 ? -4.928  -67.539 -33.647 1.00 21.70 ? 447 CYS A CA    1 
ATOM   4352 C  C     . CYS E 3 447 ? -6.007  -67.813 -32.615 1.00 20.51 ? 447 CYS A C     1 
ATOM   4353 O  O     . CYS E 3 447 ? -6.009  -67.207 -31.550 1.00 19.85 ? 447 CYS A O     1 
ATOM   4354 C  CB    . CYS E 3 447 ? -4.716  -66.033 -33.766 1.00 21.85 ? 447 CYS A CB    1 
ATOM   4355 S  SG    . CYS E 3 447 ? -3.152  -65.652 -34.549 1.00 27.29 ? 447 CYS A SG    1 
ATOM   4356 N  N     . ALA E 3 448 ? -6.928  -68.715 -32.915 1.00 20.18 ? 448 ALA A N     1 
ATOM   4357 C  CA    . ALA E 3 448 ? -7.966  -69.030 -31.940 1.00 18.92 ? 448 ALA A CA    1 
ATOM   4358 C  C     . ALA E 3 448 ? -7.650  -70.384 -31.296 1.00 18.43 ? 448 ALA A C     1 
ATOM   4359 O  O     . ALA E 3 448 ? -8.230  -70.748 -30.278 1.00 17.86 ? 448 ALA A O     1 
ATOM   4360 C  CB    . ALA E 3 448 ? -9.325  -69.065 -32.622 1.00 18.27 ? 448 ALA A CB    1 
ATOM   4361 N  N     . LEU E 3 449 ? -6.704  -71.112 -31.886 1.00 18.34 ? 449 LEU A N     1 
ATOM   4362 C  CA    . LEU E 3 449 ? -6.338  -72.432 -31.394 1.00 19.34 ? 449 LEU A CA    1 
ATOM   4363 C  C     . LEU E 3 449 ? -6.048  -72.533 -29.903 1.00 19.05 ? 449 LEU A C     1 
ATOM   4364 O  O     . LEU E 3 449 ? -6.519  -73.456 -29.248 1.00 19.39 ? 449 LEU A O     1 
ATOM   4365 C  CB    . LEU E 3 449 ? -5.159  -72.974 -32.195 1.00 19.43 ? 449 LEU A CB    1 
ATOM   4366 C  CG    . LEU E 3 449 ? -5.493  -73.182 -33.673 1.00 19.42 ? 449 LEU A CG    1 
ATOM   4367 C  CD1   . LEU E 3 449 ? -4.264  -73.677 -34.400 1.00 18.81 ? 449 LEU A CD1   1 
ATOM   4368 C  CD2   . LEU E 3 449 ? -6.642  -74.176 -33.817 1.00 16.77 ? 449 LEU A CD2   1 
ATOM   4369 N  N     . PRO E 3 450 ? -5.267  -71.591 -29.348 1.00 18.42 ? 450 PRO A N     1 
ATOM   4370 C  CA    . PRO E 3 450 ? -4.945  -71.621 -27.918 1.00 17.57 ? 450 PRO A CA    1 
ATOM   4371 C  C     . PRO E 3 450 ? -6.190  -71.736 -27.039 1.00 17.36 ? 450 PRO A C     1 
ATOM   4372 O  O     . PRO E 3 450 ? -6.355  -72.700 -26.297 1.00 16.50 ? 450 PRO A O     1 
ATOM   4373 C  CB    . PRO E 3 450 ? -4.200  -70.302 -27.703 1.00 18.36 ? 450 PRO A CB    1 
ATOM   4374 C  CG    . PRO E 3 450 ? -3.489  -70.107 -29.024 1.00 19.59 ? 450 PRO A CG    1 
ATOM   4375 C  CD    . PRO E 3 450 ? -4.577  -70.471 -30.022 1.00 19.56 ? 450 PRO A CD    1 
ATOM   4376 N  N     . MET E 3 451 ? -7.057  -70.736 -27.111 1.00 18.39 ? 451 MET A N     1 
ATOM   4377 C  CA    . MET E 3 451 ? -8.275  -70.752 -26.326 1.00 19.10 ? 451 MET A CA    1 
ATOM   4378 C  C     . MET E 3 451 ? -8.994  -72.067 -26.582 1.00 19.44 ? 451 MET A C     1 
ATOM   4379 O  O     . MET E 3 451 ? -9.328  -72.798 -25.648 1.00 18.65 ? 451 MET A O     1 
ATOM   4380 C  CB    . MET E 3 451 ? -9.173  -69.576 -26.718 1.00 20.27 ? 451 MET A CB    1 
ATOM   4381 C  CG    . MET E 3 451 ? -8.719  -68.214 -26.202 1.00 21.91 ? 451 MET A CG    1 
ATOM   4382 S  SD    . MET E 3 451 ? -7.129  -67.659 -26.816 1.00 26.34 ? 451 MET A SD    1 
ATOM   4383 C  CE    . MET E 3 451 ? -7.603  -66.792 -28.324 1.00 23.92 ? 451 MET A CE    1 
ATOM   4384 N  N     . LEU E 3 452 ? -9.221  -72.364 -27.859 1.00 20.27 ? 452 LEU A N     1 
ATOM   4385 C  CA    . LEU E 3 452 ? -9.894  -73.592 -28.255 1.00 19.97 ? 452 LEU A CA    1 
ATOM   4386 C  C     . LEU E 3 452 ? -9.224  -74.835 -27.669 1.00 20.27 ? 452 LEU A C     1 
ATOM   4387 O  O     . LEU E 3 452 ? -9.902  -75.712 -27.140 1.00 20.63 ? 452 LEU A O     1 
ATOM   4388 C  CB    . LEU E 3 452 ? -9.941  -73.702 -29.782 1.00 20.75 ? 452 LEU A CB    1 
ATOM   4389 C  CG    . LEU E 3 452 ? -10.839 -72.733 -30.558 1.00 21.15 ? 452 LEU A CG    1 
ATOM   4390 C  CD1   . LEU E 3 452 ? -10.709 -73.031 -32.034 1.00 18.63 ? 452 LEU A CD1   1 
ATOM   4391 C  CD2   . LEU E 3 452 ? -12.296 -72.876 -30.112 1.00 21.12 ? 452 LEU A CD2   1 
ATOM   4392 N  N     . TRP E 3 453 ? -7.902  -74.924 -27.768 1.00 20.20 ? 453 TRP A N     1 
ATOM   4393 C  CA    . TRP E 3 453 ? -7.209  -76.080 -27.218 1.00 21.38 ? 453 TRP A CA    1 
ATOM   4394 C  C     . TRP E 3 453 ? -7.484  -76.135 -25.721 1.00 22.65 ? 453 TRP A C     1 
ATOM   4395 O  O     . TRP E 3 453 ? -7.840  -77.173 -25.177 1.00 22.79 ? 453 TRP A O     1 
ATOM   4396 C  CB    . TRP E 3 453 ? -5.702  -75.978 -27.452 1.00 19.91 ? 453 TRP A CB    1 
ATOM   4397 C  CG    . TRP E 3 453 ? -4.930  -77.054 -26.720 1.00 21.45 ? 453 TRP A CG    1 
ATOM   4398 C  CD1   . TRP E 3 453 ? -4.741  -78.353 -27.119 1.00 20.17 ? 453 TRP A CD1   1 
ATOM   4399 C  CD2   . TRP E 3 453 ? -4.315  -76.941 -25.431 1.00 20.17 ? 453 TRP A CD2   1 
ATOM   4400 N  NE1   . TRP E 3 453 ? -4.053  -79.048 -26.156 1.00 19.67 ? 453 TRP A NE1   1 
ATOM   4401 C  CE2   . TRP E 3 453 ? -3.781  -78.207 -25.106 1.00 19.55 ? 453 TRP A CE2   1 
ATOM   4402 C  CE3   . TRP E 3 453 ? -4.173  -75.891 -24.509 1.00 20.76 ? 453 TRP A CE3   1 
ATOM   4403 C  CZ2   . TRP E 3 453 ? -3.103  -78.455 -23.900 1.00 21.37 ? 453 TRP A CZ2   1 
ATOM   4404 C  CZ3   . TRP E 3 453 ? -3.494  -76.138 -23.300 1.00 20.78 ? 453 TRP A CZ3   1 
ATOM   4405 C  CH2   . TRP E 3 453 ? -2.975  -77.410 -23.011 1.00 20.34 ? 453 TRP A CH2   1 
ATOM   4406 N  N     . ALA E 3 454 ? -7.324  -74.994 -25.069 1.00 25.08 ? 454 ALA A N     1 
ATOM   4407 C  CA    . ALA E 3 454 ? -7.539  -74.875 -23.637 1.00 26.48 ? 454 ALA A CA    1 
ATOM   4408 C  C     . ALA E 3 454 ? -8.889  -75.411 -23.162 1.00 27.97 ? 454 ALA A C     1 
ATOM   4409 O  O     . ALA E 3 454 ? -8.945  -76.131 -22.164 1.00 29.17 ? 454 ALA A O     1 
ATOM   4410 C  CB    . ALA E 3 454 ? -7.378  -73.415 -23.214 1.00 25.03 ? 454 ALA A CB    1 
ATOM   4411 N  N     . GLN E 3 455 ? -9.972  -75.067 -23.857 1.00 29.23 ? 455 GLN A N     1 
ATOM   4412 C  CA    . GLN E 3 455 ? -11.299 -75.528 -23.443 1.00 31.22 ? 455 GLN A CA    1 
ATOM   4413 C  C     . GLN E 3 455 ? -11.405 -77.036 -23.575 1.00 32.56 ? 455 GLN A C     1 
ATOM   4414 O  O     . GLN E 3 455 ? -11.876 -77.731 -22.678 1.00 32.79 ? 455 GLN A O     1 
ATOM   4415 C  CB    . GLN E 3 455 ? -12.393 -74.906 -24.303 1.00 31.45 ? 455 GLN A CB    1 
ATOM   4416 C  CG    . GLN E 3 455 ? -13.802 -75.320 -23.869 1.00 33.46 ? 455 GLN A CG    1 
ATOM   4417 C  CD    . GLN E 3 455 ? -14.858 -75.123 -24.954 1.00 34.21 ? 455 GLN A CD    1 
ATOM   4418 O  OE1   . GLN E 3 455 ? -15.005 -74.035 -25.519 1.00 34.18 ? 455 GLN A OE1   1 
ATOM   4419 N  NE2   . GLN E 3 455 ? -15.605 -76.186 -25.243 1.00 34.66 ? 455 GLN A NE2   1 
ATOM   4420 N  N     . LYS E 3 456 ? -10.945 -77.519 -24.720 1.00 33.52 ? 456 LYS A N     1 
ATOM   4421 C  CA    . LYS E 3 456 ? -10.963 -78.932 -25.086 1.00 34.14 ? 456 LYS A CA    1 
ATOM   4422 C  C     . LYS E 3 456 ? -10.202 -79.884 -24.187 1.00 33.03 ? 456 LYS A C     1 
ATOM   4423 O  O     . LYS E 3 456 ? -10.568 -81.052 -24.049 1.00 32.56 ? 456 LYS A O     1 
ATOM   4424 C  CB    . LYS E 3 456 ? -10.417 -79.085 -26.493 1.00 37.42 ? 456 LYS A CB    1 
ATOM   4425 C  CG    . LYS E 3 456 ? -11.486 -79.237 -27.539 1.00 40.53 ? 456 LYS A CG    1 
ATOM   4426 C  CD    . LYS E 3 456 ? -11.116 -80.453 -28.364 1.00 44.41 ? 456 LYS A CD    1 
ATOM   4427 C  CE    . LYS E 3 456 ? -12.359 -81.222 -28.736 1.00 45.82 ? 456 LYS A CE    1 
ATOM   4428 N  NZ    . LYS E 3 456 ? -12.014 -82.659 -28.906 1.00 46.95 ? 456 LYS A NZ    1 
ATOM   4429 N  N     . THR E 3 457 ? -9.102  -79.394 -23.635 1.00 32.36 ? 457 THR A N     1 
ATOM   4430 C  CA    . THR E 3 457 ? -8.271  -80.190 -22.742 1.00 31.56 ? 457 THR A CA    1 
ATOM   4431 C  C     . THR E 3 457 ? -8.674  -79.829 -21.329 1.00 29.53 ? 457 THR A C     1 
ATOM   4432 O  O     . THR E 3 457 ? -7.993  -80.171 -20.371 1.00 30.47 ? 457 THR A O     1 
ATOM   4433 C  CB    . THR E 3 457 ? -6.779  -79.883 -22.943 1.00 32.20 ? 457 THR A CB    1 
ATOM   4434 O  OG1   . THR E 3 457 ? -6.648  -78.686 -23.716 1.00 34.06 ? 457 THR A OG1   1 
ATOM   4435 C  CG2   . THR E 3 457 ? -6.098  -81.022 -23.660 1.00 32.65 ? 457 THR A CG2   1 
ATOM   4436 N  N     . ASN E 3 458 ? -9.803  -79.144 -21.213 1.00 27.93 ? 458 ASN A N     1 
ATOM   4437 C  CA    . ASN E 3 458 ? -10.317 -78.720 -19.926 1.00 27.39 ? 458 ASN A CA    1 
ATOM   4438 C  C     . ASN E 3 458 ? -9.189  -78.112 -19.109 1.00 26.96 ? 458 ASN A C     1 
ATOM   4439 O  O     . ASN E 3 458 ? -9.114  -78.294 -17.891 1.00 27.89 ? 458 ASN A O     1 
ATOM   4440 C  CB    . ASN E 3 458 ? -10.936 -79.910 -19.197 1.00 28.25 ? 458 ASN A CB    1 
ATOM   4441 C  CG    . ASN E 3 458 ? -11.633 -79.512 -17.907 1.00 30.20 ? 458 ASN A CG    1 
ATOM   4442 O  OD1   . ASN E 3 458 ? -12.484 -78.614 -17.891 1.00 31.37 ? 458 ASN A OD1   1 
ATOM   4443 N  ND2   . ASN E 3 458 ? -11.279 -80.186 -16.814 1.00 30.48 ? 458 ASN A ND2   1 
ATOM   4444 N  N     . THR E 3 459 ? -8.313  -77.382 -19.789 1.00 25.57 ? 459 THR A N     1 
ATOM   4445 C  CA    . THR E 3 459 ? -7.182  -76.748 -19.132 1.00 26.00 ? 459 THR A CA    1 
ATOM   4446 C  C     . THR E 3 459 ? -7.561  -75.369 -18.601 1.00 25.85 ? 459 THR A C     1 
ATOM   4447 O  O     . THR E 3 459 ? -8.043  -74.510 -19.343 1.00 25.92 ? 459 THR A O     1 
ATOM   4448 C  CB    . THR E 3 459 ? -5.990  -76.614 -20.096 1.00 26.89 ? 459 THR A CB    1 
ATOM   4449 O  OG1   . THR E 3 459 ? -5.498  -77.917 -20.432 1.00 26.31 ? 459 THR A OG1   1 
ATOM   4450 C  CG2   . THR E 3 459 ? -4.878  -75.797 -19.453 1.00 26.46 ? 459 THR A CG2   1 
ATOM   4451 N  N     . ALA E 3 460 ? -7.331  -75.164 -17.309 1.00 25.20 ? 460 ALA A N     1 
ATOM   4452 C  CA    . ALA E 3 460 ? -7.662  -73.903 -16.662 1.00 25.24 ? 460 ALA A CA    1 
ATOM   4453 C  C     . ALA E 3 460 ? -6.554  -72.855 -16.777 1.00 25.64 ? 460 ALA A C     1 
ATOM   4454 O  O     . ALA E 3 460 ? -5.370  -73.189 -16.722 1.00 27.04 ? 460 ALA A O     1 
ATOM   4455 C  CB    . ALA E 3 460 ? -7.980  -74.159 -15.201 1.00 24.81 ? 460 ALA A CB    1 
ATOM   4456 N  N     . ALA E 3 461 ? -6.948  -71.591 -16.938 1.00 24.83 ? 461 ALA A N     1 
ATOM   4457 C  CA    . ALA E 3 461 ? -6.003  -70.466 -17.033 1.00 24.86 ? 461 ALA A CA    1 
ATOM   4458 C  C     . ALA E 3 461 ? -6.722  -69.143 -16.775 1.00 24.97 ? 461 ALA A C     1 
ATOM   4459 O  O     . ALA E 3 461 ? -7.873  -68.968 -17.145 1.00 26.42 ? 461 ALA A O     1 
ATOM   4460 C  CB    . ALA E 3 461 ? -5.331  -70.433 -18.400 1.00 23.17 ? 461 ALA A CB    1 
ATOM   4461 N  N     . ASP E 3 462 ? -6.034  -68.205 -16.143 1.00 25.06 ? 462 ASP A N     1 
ATOM   4462 C  CA    . ASP E 3 462 ? -6.631  -66.916 -15.835 1.00 24.02 ? 462 ASP A CA    1 
ATOM   4463 C  C     . ASP E 3 462 ? -6.158  -65.924 -16.880 1.00 23.70 ? 462 ASP A C     1 
ATOM   4464 O  O     . ASP E 3 462 ? -6.832  -64.928 -17.194 1.00 21.08 ? 462 ASP A O     1 
ATOM   4465 C  CB    . ASP E 3 462 ? -6.177  -66.478 -14.444 1.00 24.30 ? 462 ASP A CB    1 
ATOM   4466 C  CG    . ASP E 3 462 ? -6.465  -67.520 -13.399 1.00 26.30 ? 462 ASP A CG    1 
ATOM   4467 O  OD1   . ASP E 3 462 ? -7.657  -67.695 -13.068 1.00 25.21 ? 462 ASP A OD1   1 
ATOM   4468 O  OD2   . ASP E 3 462 ? -5.504  -68.179 -12.927 1.00 27.60 ? 462 ASP A OD2   1 
ATOM   4469 N  N     . ILE E 3 463 ? -4.982  -66.218 -17.419 1.00 23.10 ? 463 ILE A N     1 
ATOM   4470 C  CA    . ILE E 3 463 ? -4.390  -65.367 -18.419 1.00 23.29 ? 463 ILE A CA    1 
ATOM   4471 C  C     . ILE E 3 463 ? -3.940  -66.187 -19.620 1.00 24.43 ? 463 ILE A C     1 
ATOM   4472 O  O     . ILE E 3 463 ? -3.450  -67.302 -19.497 1.00 24.97 ? 463 ILE A O     1 
ATOM   4473 C  CB    . ILE E 3 463 ? -3.159  -64.616 -17.873 1.00 23.08 ? 463 ILE A CB    1 
ATOM   4474 C  CG1   . ILE E 3 463 ? -3.546  -63.827 -16.612 1.00 23.73 ? 463 ILE A CG1   1 
ATOM   4475 C  CG2   . ILE E 3 463 ? -2.599  -63.694 -18.958 1.00 21.59 ? 463 ILE A CG2   1 
ATOM   4476 C  CD1   . ILE E 3 463 ? -4.620  -62.778 -16.815 1.00 22.18 ? 463 ILE A CD1   1 
ATOM   4477 N  N     . PHE E 3 464 ? -4.130  -65.606 -20.794 1.00 24.80 ? 464 PHE A N     1 
ATOM   4478 C  CA    . PHE E 3 464 ? -3.696  -66.189 -22.043 1.00 24.88 ? 464 PHE A CA    1 
ATOM   4479 C  C     . PHE E 3 464 ? -2.796  -65.148 -22.615 1.00 22.70 ? 464 PHE A C     1 
ATOM   4480 O  O     . PHE E 3 464 ? -3.166  -63.979 -22.664 1.00 22.76 ? 464 PHE A O     1 
ATOM   4481 C  CB    . PHE E 3 464 ? -4.865  -66.404 -23.006 1.00 28.54 ? 464 PHE A CB    1 
ATOM   4482 C  CG    . PHE E 3 464 ? -5.687  -67.637 -22.730 1.00 32.93 ? 464 PHE A CG    1 
ATOM   4483 C  CD1   . PHE E 3 464 ? -5.421  -68.473 -21.651 1.00 36.22 ? 464 PHE A CD1   1 
ATOM   4484 C  CD2   . PHE E 3 464 ? -6.759  -67.969 -23.553 1.00 36.09 ? 464 PHE A CD2   1 
ATOM   4485 C  CE1   . PHE E 3 464 ? -6.251  -69.582 -21.408 1.00 38.08 ? 464 PHE A CE1   1 
ATOM   4486 C  CE2   . PHE E 3 464 ? -7.532  -69.082 -23.276 1.00 37.90 ? 464 PHE A CE2   1 
ATOM   4487 C  CZ    . PHE E 3 464 ? -7.257  -69.879 -22.205 1.00 37.43 ? 464 PHE A CZ    1 
ATOM   4488 N  N     . ILE E 3 465 ? -1.601  -65.570 -23.005 1.00 21.27 ? 465 ILE A N     1 
ATOM   4489 C  CA    . ILE E 3 465 ? -0.674  -64.645 -23.649 1.00 19.57 ? 465 ILE A CA    1 
ATOM   4490 C  C     . ILE E 3 465 ? -0.343  -65.299 -24.988 1.00 18.71 ? 465 ILE A C     1 
ATOM   4491 O  O     . ILE E 3 465 ? 0.198   -66.406 -25.041 1.00 19.05 ? 465 ILE A O     1 
ATOM   4492 C  CB    . ILE E 3 465 ? 0.621   -64.434 -22.872 1.00 18.46 ? 465 ILE A CB    1 
ATOM   4493 C  CG1   . ILE E 3 465 ? 0.336   -63.695 -21.573 1.00 17.87 ? 465 ILE A CG1   1 
ATOM   4494 C  CG2   . ILE E 3 465 ? 1.585   -63.613 -23.700 1.00 18.10 ? 465 ILE A CG2   1 
ATOM   4495 C  CD1   . ILE E 3 465 ? 1.597   -63.307 -20.821 1.00 18.82 ? 465 ILE A CD1   1 
ATOM   4496 N  N     . VAL E 3 466 ? -0.713  -64.625 -26.067 1.00 17.59 ? 466 VAL A N     1 
ATOM   4497 C  CA    . VAL E 3 466 ? -0.474  -65.134 -27.407 1.00 16.17 ? 466 VAL A CA    1 
ATOM   4498 C  C     . VAL E 3 466 ? 0.567   -64.248 -28.079 1.00 15.98 ? 466 VAL A C     1 
ATOM   4499 O  O     . VAL E 3 466 ? 0.347   -63.042 -28.240 1.00 15.19 ? 466 VAL A O     1 
ATOM   4500 C  CB    . VAL E 3 466 ? -1.780  -65.118 -28.226 1.00 15.21 ? 466 VAL A CB    1 
ATOM   4501 C  CG1   . VAL E 3 466 ? -1.543  -65.715 -29.583 1.00 15.55 ? 466 VAL A CG1   1 
ATOM   4502 C  CG2   . VAL E 3 466 ? -2.864  -65.890 -27.490 1.00 14.17 ? 466 VAL A CG2   1 
ATOM   4503 N  N     . PHE E 3 467 ? 1.706   -64.835 -28.442 1.00 14.90 ? 467 PHE A N     1 
ATOM   4504 C  CA    . PHE E 3 467 ? 2.764   -64.066 -29.093 1.00 16.46 ? 467 PHE A CA    1 
ATOM   4505 C  C     . PHE E 3 467 ? 2.571   -64.237 -30.585 1.00 17.62 ? 467 PHE A C     1 
ATOM   4506 O  O     . PHE E 3 467 ? 3.012   -65.220 -31.176 1.00 16.77 ? 467 PHE A O     1 
ATOM   4507 C  CB    . PHE E 3 467 ? 4.151   -64.554 -28.658 1.00 15.73 ? 467 PHE A CB    1 
ATOM   4508 C  CG    . PHE E 3 467 ? 4.409   -64.397 -27.184 1.00 16.34 ? 467 PHE A CG    1 
ATOM   4509 C  CD1   . PHE E 3 467 ? 3.956   -65.354 -26.282 1.00 16.70 ? 467 PHE A CD1   1 
ATOM   4510 C  CD2   . PHE E 3 467 ? 5.070   -63.275 -26.692 1.00 15.50 ? 467 PHE A CD2   1 
ATOM   4511 C  CE1   . PHE E 3 467 ? 4.154   -65.198 -24.915 1.00 16.96 ? 467 PHE A CE1   1 
ATOM   4512 C  CE2   . PHE E 3 467 ? 5.273   -63.110 -25.334 1.00 14.95 ? 467 PHE A CE2   1 
ATOM   4513 C  CZ    . PHE E 3 467 ? 4.814   -64.072 -24.439 1.00 15.79 ? 467 PHE A CZ    1 
ATOM   4514 N  N     . THR E 3 468 ? 1.921   -63.250 -31.185 1.00 17.91 ? 468 THR A N     1 
ATOM   4515 C  CA    . THR E 3 468 ? 1.591   -63.302 -32.593 1.00 19.15 ? 468 THR A CA    1 
ATOM   4516 C  C     . THR E 3 468 ? 1.707   -61.947 -33.302 1.00 18.40 ? 468 THR A C     1 
ATOM   4517 O  O     . THR E 3 468 ? 1.918   -60.914 -32.667 1.00 18.34 ? 468 THR A O     1 
ATOM   4518 C  CB    . THR E 3 468 ? 0.136   -63.818 -32.724 1.00 20.47 ? 468 THR A CB    1 
ATOM   4519 O  OG1   . THR E 3 468 ? -0.251  -63.876 -34.099 1.00 20.57 ? 468 THR A OG1   1 
ATOM   4520 C  CG2   . THR E 3 468 ? -0.810  -62.879 -31.983 1.00 20.42 ? 468 THR A CG2   1 
ATOM   4521 N  N     . ASP E 3 469 ? 1.568   -61.970 -34.627 1.00 18.52 ? 469 ASP A N     1 
ATOM   4522 C  CA    . ASP E 3 469 ? 1.616   -60.752 -35.440 1.00 19.08 ? 469 ASP A CA    1 
ATOM   4523 C  C     . ASP E 3 469 ? 0.183   -60.404 -35.860 1.00 19.73 ? 469 ASP A C     1 
ATOM   4524 O  O     . ASP E 3 469 ? -0.047  -59.463 -36.625 1.00 18.39 ? 469 ASP A O     1 
ATOM   4525 C  CB    . ASP E 3 469 ? 2.516   -60.939 -36.667 1.00 17.07 ? 469 ASP A CB    1 
ATOM   4526 C  CG    . ASP E 3 469 ? 2.116   -62.121 -37.512 1.00 14.77 ? 469 ASP A CG    1 
ATOM   4527 O  OD1   . ASP E 3 469 ? 2.921   -62.543 -38.354 1.00 16.25 ? 469 ASP A OD1   1 
ATOM   4528 O  OD2   . ASP E 3 469 ? 1.004   -62.632 -37.346 1.00 13.69 ? 469 ASP A OD2   1 
ATOM   4529 N  N     . CYS E 3 470 ? -0.762  -61.189 -35.336 1.00 20.05 ? 470 CYS A N     1 
ATOM   4530 C  CA    . CYS E 3 470 ? -2.192  -61.014 -35.563 1.00 20.05 ? 470 CYS A CA    1 
ATOM   4531 C  C     . CYS E 3 470 ? -2.697  -61.236 -36.989 1.00 19.71 ? 470 CYS A C     1 
ATOM   4532 O  O     . CYS E 3 470 ? -3.828  -60.888 -37.324 1.00 18.78 ? 470 CYS A O     1 
ATOM   4533 C  CB    . CYS E 3 470 ? -2.613  -59.634 -35.052 1.00 20.87 ? 470 CYS A CB    1 
ATOM   4534 S  SG    . CYS E 3 470 ? -2.353  -59.418 -33.265 1.00 25.00 ? 470 CYS A SG    1 
ATOM   4535 N  N     . GLU E 3 471 ? -1.855  -61.825 -37.823 1.00 20.38 ? 471 GLU A N     1 
ATOM   4536 C  CA    . GLU E 3 471 ? -2.215  -62.114 -39.203 1.00 21.20 ? 471 GLU A CA    1 
ATOM   4537 C  C     . GLU E 3 471 ? -2.887  -63.495 -39.268 1.00 21.80 ? 471 GLU A C     1 
ATOM   4538 O  O     . GLU E 3 471 ? -2.404  -64.412 -39.924 1.00 20.82 ? 471 GLU A O     1 
ATOM   4539 C  CB    . GLU E 3 471 ? -0.957  -62.099 -40.071 1.00 21.17 ? 471 GLU A CB    1 
ATOM   4540 C  CG    . GLU E 3 471 ? -0.183  -60.773 -40.085 1.00 20.89 ? 471 GLU A CG    1 
ATOM   4541 C  CD    . GLU E 3 471 ? -0.712  -59.770 -41.100 1.00 21.15 ? 471 GLU A CD    1 
ATOM   4542 O  OE1   . GLU E 3 471 ? 0.091   -58.964 -41.612 1.00 21.22 ? 471 GLU A OE1   1 
ATOM   4543 O  OE2   . GLU E 3 471 ? -1.926  -59.776 -41.384 1.00 20.96 ? 471 GLU A OE2   1 
ATOM   4544 N  N     . THR E 3 472 ? -4.001  -63.636 -38.564 1.00 23.05 ? 472 THR A N     1 
ATOM   4545 C  CA    . THR E 3 472 ? -4.732  -64.893 -38.540 1.00 24.55 ? 472 THR A CA    1 
ATOM   4546 C  C     . THR E 3 472 ? -5.371  -65.062 -39.928 1.00 25.67 ? 472 THR A C     1 
ATOM   4547 O  O     . THR E 3 472 ? -5.758  -64.075 -40.552 1.00 25.49 ? 472 THR A O     1 
ATOM   4548 C  CB    . THR E 3 472 ? -5.793  -64.866 -37.404 1.00 23.95 ? 472 THR A CB    1 
ATOM   4549 O  OG1   . THR E 3 472 ? -6.395  -66.155 -37.276 1.00 25.31 ? 472 THR A OG1   1 
ATOM   4550 C  CG2   . THR E 3 472 ? -6.855  -63.834 -37.682 1.00 24.47 ? 472 THR A CG2   1 
ATOM   4551 N  N     . ASN E 3 473 ? -5.481  -66.296 -40.416 1.00 26.54 ? 473 ASN A N     1 
ATOM   4552 C  CA    . ASN E 3 473 ? -6.013  -66.489 -41.755 1.00 28.19 ? 473 ASN A CA    1 
ATOM   4553 C  C     . ASN E 3 473 ? -6.728  -67.796 -42.077 1.00 28.91 ? 473 ASN A C     1 
ATOM   4554 O  O     . ASN E 3 473 ? -6.890  -68.125 -43.254 1.00 28.33 ? 473 ASN A O     1 
ATOM   4555 C  CB    . ASN E 3 473 ? -4.883  -66.295 -42.775 1.00 30.23 ? 473 ASN A CB    1 
ATOM   4556 C  CG    . ASN E 3 473 ? -3.757  -67.323 -42.611 1.00 31.33 ? 473 ASN A CG    1 
ATOM   4557 O  OD1   . ASN E 3 473 ? -3.090  -67.371 -41.593 1.00 33.71 ? 473 ASN A OD1   1 
ATOM   4558 N  ND2   . ASN E 3 473 ? -3.556  -68.146 -43.620 1.00 33.81 ? 473 ASN A ND2   1 
ATOM   4559 N  N     . VAL E 3 474 ? -7.137  -68.564 -41.074 1.00 30.24 ? 474 VAL A N     1 
ATOM   4560 C  CA    . VAL E 3 474 ? -7.850  -69.801 -41.384 1.00 31.51 ? 474 VAL A CA    1 
ATOM   4561 C  C     . VAL E 3 474 ? -9.338  -69.614 -41.110 1.00 32.48 ? 474 VAL A C     1 
ATOM   4562 O  O     . VAL E 3 474 ? -9.742  -68.706 -40.385 1.00 33.18 ? 474 VAL A O     1 
ATOM   4563 C  CB    . VAL E 3 474 ? -7.341  -71.007 -40.574 1.00 30.22 ? 474 VAL A CB    1 
ATOM   4564 C  CG1   . VAL E 3 474 ? -5.843  -71.134 -40.715 1.00 27.89 ? 474 VAL A CG1   1 
ATOM   4565 C  CG2   . VAL E 3 474 ? -7.759  -70.872 -39.140 1.00 32.24 ? 474 VAL A CG2   1 
ATOM   4566 N  N     . GLU E 3 475 ? -10.151 -70.476 -41.705 1.00 33.38 ? 475 GLU A N     1 
ATOM   4567 C  CA    . GLU E 3 475 ? -11.595 -70.402 -41.552 1.00 32.84 ? 475 GLU A CA    1 
ATOM   4568 C  C     . GLU E 3 475 ? -12.017 -71.157 -40.299 1.00 31.48 ? 475 GLU A C     1 
ATOM   4569 O  O     . GLU E 3 475 ? -12.464 -72.301 -40.336 1.00 30.70 ? 475 GLU A O     1 
ATOM   4570 C  CB    . GLU E 3 475 ? -12.227 -70.934 -42.830 1.00 34.76 ? 475 GLU A CB    1 
ATOM   4571 C  CG    . GLU E 3 475 ? -11.772 -70.065 -43.996 1.00 39.35 ? 475 GLU A CG    1 
ATOM   4572 C  CD    . GLU E 3 475 ? -12.045 -70.666 -45.350 1.00 43.35 ? 475 GLU A CD    1 
ATOM   4573 O  OE1   . GLU E 3 475 ? -12.194 -69.880 -46.323 1.00 46.28 ? 475 GLU A OE1   1 
ATOM   4574 O  OE2   . GLU E 3 475 ? -12.095 -71.912 -45.452 1.00 44.62 ? 475 GLU A OE2   1 
ATOM   4575 N  N     . ASP E 3 476 ? -11.835 -70.475 -39.177 1.00 30.63 ? 476 ASP A N     1 
ATOM   4576 C  CA    . ASP E 3 476 ? -12.131 -70.991 -37.853 1.00 29.61 ? 476 ASP A CA    1 
ATOM   4577 C  C     . ASP E 3 476 ? -12.747 -69.795 -37.125 1.00 27.74 ? 476 ASP A C     1 
ATOM   4578 O  O     . ASP E 3 476 ? -12.647 -68.667 -37.599 1.00 27.68 ? 476 ASP A O     1 
ATOM   4579 C  CB    . ASP E 3 476 ? -10.811 -71.385 -37.192 1.00 33.13 ? 476 ASP A CB    1 
ATOM   4580 C  CG    . ASP E 3 476 ? -10.989 -72.312 -36.020 1.00 35.66 ? 476 ASP A CG    1 
ATOM   4581 O  OD1   . ASP E 3 476 ? -10.362 -72.056 -34.965 1.00 36.90 ? 476 ASP A OD1   1 
ATOM   4582 O  OD2   . ASP E 3 476 ? -11.733 -73.314 -36.146 1.00 40.32 ? 476 ASP A OD2   1 
ATOM   4583 N  N     . VAL E 3 477 ? -13.375 -70.022 -35.980 1.00 25.23 ? 477 VAL A N     1 
ATOM   4584 C  CA    . VAL E 3 477 ? -13.973 -68.915 -35.249 1.00 24.07 ? 477 VAL A CA    1 
ATOM   4585 C  C     . VAL E 3 477 ? -12.940 -67.847 -34.892 1.00 23.93 ? 477 VAL A C     1 
ATOM   4586 O  O     . VAL E 3 477 ? -11.749 -68.135 -34.797 1.00 24.35 ? 477 VAL A O     1 
ATOM   4587 C  CB    . VAL E 3 477 ? -14.612 -69.396 -33.940 1.00 24.15 ? 477 VAL A CB    1 
ATOM   4588 C  CG1   . VAL E 3 477 ? -15.655 -70.456 -34.230 1.00 25.25 ? 477 VAL A CG1   1 
ATOM   4589 C  CG2   . VAL E 3 477 ? -13.541 -69.935 -33.010 1.00 24.23 ? 477 VAL A CG2   1 
ATOM   4590 N  N     . HIS E 3 478 ? -13.401 -66.614 -34.695 1.00 23.20 ? 478 HIS A N     1 
ATOM   4591 C  CA    . HIS E 3 478 ? -12.525 -65.502 -34.306 1.00 22.38 ? 478 HIS A CA    1 
ATOM   4592 C  C     . HIS E 3 478 ? -11.928 -65.766 -32.921 1.00 21.33 ? 478 HIS A C     1 
ATOM   4593 O  O     . HIS E 3 478 ? -12.627 -66.231 -32.020 1.00 20.49 ? 478 HIS A O     1 
ATOM   4594 C  CB    . HIS E 3 478 ? -13.318 -64.199 -34.230 1.00 21.73 ? 478 HIS A CB    1 
ATOM   4595 C  CG    . HIS E 3 478 ? -13.600 -63.585 -35.555 1.00 21.59 ? 478 HIS A CG    1 
ATOM   4596 N  ND1   . HIS E 3 478 ? -12.734 -62.707 -36.164 1.00 21.76 ? 478 HIS A ND1   1 
ATOM   4597 C  CD2   . HIS E 3 478 ? -14.652 -63.724 -36.395 1.00 22.58 ? 478 HIS A CD2   1 
ATOM   4598 C  CE1   . HIS E 3 478 ? -13.241 -62.328 -37.323 1.00 23.38 ? 478 HIS A CE1   1 
ATOM   4599 N  NE2   . HIS E 3 478 ? -14.404 -62.931 -37.487 1.00 23.01 ? 478 HIS A NE2   1 
ATOM   4600 N  N     . PRO E 3 479 ? -10.638 -65.448 -32.727 1.00 20.58 ? 479 PRO A N     1 
ATOM   4601 C  CA    . PRO E 3 479 ? -10.016 -65.679 -31.421 1.00 21.31 ? 479 PRO A CA    1 
ATOM   4602 C  C     . PRO E 3 479 ? -10.800 -65.055 -30.273 1.00 21.97 ? 479 PRO A C     1 
ATOM   4603 O  O     . PRO E 3 479 ? -10.920 -65.656 -29.207 1.00 22.96 ? 479 PRO A O     1 
ATOM   4604 C  CB    . PRO E 3 479 ? -8.610  -65.088 -31.586 1.00 21.35 ? 479 PRO A CB    1 
ATOM   4605 C  CG    . PRO E 3 479 ? -8.775  -64.084 -32.681 1.00 21.65 ? 479 PRO A CG    1 
ATOM   4606 C  CD    . PRO E 3 479 ? -9.697  -64.785 -33.644 1.00 21.27 ? 479 PRO A CD    1 
ATOM   4607 N  N     . ALA E 3 480 ? -11.347 -63.863 -30.487 1.00 22.67 ? 480 ALA A N     1 
ATOM   4608 C  CA    . ALA E 3 480 ? -12.129 -63.204 -29.443 1.00 23.94 ? 480 ALA A CA    1 
ATOM   4609 C  C     . ALA E 3 480 ? -13.349 -64.069 -29.119 1.00 25.09 ? 480 ALA A C     1 
ATOM   4610 O  O     . ALA E 3 480 ? -13.779 -64.165 -27.964 1.00 25.00 ? 480 ALA A O     1 
ATOM   4611 C  CB    . ALA E 3 480 ? -12.566 -61.820 -29.911 1.00 24.02 ? 480 ALA A CB    1 
ATOM   4612 N  N     . THR E 3 481 ? -13.899 -64.700 -30.152 1.00 25.68 ? 481 THR A N     1 
ATOM   4613 C  CA    . THR E 3 481 ? -15.054 -65.572 -29.993 1.00 26.70 ? 481 THR A CA    1 
ATOM   4614 C  C     . THR E 3 481 ? -14.605 -66.818 -29.223 1.00 26.16 ? 481 THR A C     1 
ATOM   4615 O  O     . THR E 3 481 ? -15.325 -67.334 -28.365 1.00 26.43 ? 481 THR A O     1 
ATOM   4616 C  CB    . THR E 3 481 ? -15.631 -65.997 -31.380 1.00 27.71 ? 481 THR A CB    1 
ATOM   4617 O  OG1   . THR E 3 481 ? -16.071 -64.837 -32.095 1.00 27.76 ? 481 THR A OG1   1 
ATOM   4618 C  CG2   . THR E 3 481 ? -16.806 -66.947 -31.213 1.00 26.44 ? 481 THR A CG2   1 
ATOM   4619 N  N     . ALA E 3 482 ? -13.402 -67.283 -29.536 1.00 24.46 ? 482 ALA A N     1 
ATOM   4620 C  CA    . ALA E 3 482 ? -12.833 -68.457 -28.894 1.00 24.39 ? 482 ALA A CA    1 
ATOM   4621 C  C     . ALA E 3 482 ? -12.637 -68.241 -27.399 1.00 24.12 ? 482 ALA A C     1 
ATOM   4622 O  O     . ALA E 3 482 ? -12.829 -69.155 -26.599 1.00 24.39 ? 482 ALA A O     1 
ATOM   4623 C  CB    . ALA E 3 482 ? -11.509 -68.810 -29.553 1.00 22.80 ? 482 ALA A CB    1 
ATOM   4624 N  N     . LEU E 3 483 ? -12.249 -67.030 -27.026 1.00 24.70 ? 483 LEU A N     1 
ATOM   4625 C  CA    . LEU E 3 483 ? -12.041 -66.702 -25.619 1.00 25.57 ? 483 LEU A CA    1 
ATOM   4626 C  C     . LEU E 3 483 ? -13.377 -66.689 -24.874 1.00 26.36 ? 483 LEU A C     1 
ATOM   4627 O  O     . LEU E 3 483 ? -13.497 -67.270 -23.794 1.00 27.80 ? 483 LEU A O     1 
ATOM   4628 C  CB    . LEU E 3 483 ? -11.350 -65.342 -25.483 1.00 24.07 ? 483 LEU A CB    1 
ATOM   4629 C  CG    . LEU E 3 483 ? -11.019 -64.862 -24.069 1.00 22.83 ? 483 LEU A CG    1 
ATOM   4630 C  CD1   . LEU E 3 483 ? -10.084 -65.850 -23.384 1.00 20.82 ? 483 LEU A CD1   1 
ATOM   4631 C  CD2   . LEU E 3 483 ? -10.386 -63.478 -24.149 1.00 23.35 ? 483 LEU A CD2   1 
ATOM   4632 N  N     . LYS E 3 484 ? -14.378 -66.025 -25.445 1.00 27.16 ? 484 LYS A N     1 
ATOM   4633 C  CA    . LYS E 3 484 ? -15.699 -65.981 -24.825 1.00 28.03 ? 484 LYS A CA    1 
ATOM   4634 C  C     . LYS E 3 484 ? -16.222 -67.405 -24.603 1.00 27.69 ? 484 LYS A C     1 
ATOM   4635 O  O     . LYS E 3 484 ? -16.632 -67.763 -23.503 1.00 27.10 ? 484 LYS A O     1 
ATOM   4636 C  CB    . LYS E 3 484 ? -16.676 -65.198 -25.708 1.00 27.99 ? 484 LYS A CB    1 
ATOM   4637 C  CG    . LYS E 3 484 ? -16.378 -63.712 -25.762 1.00 30.57 ? 484 LYS A CG    1 
ATOM   4638 C  CD    . LYS E 3 484 ? -17.398 -62.967 -26.594 1.00 31.40 ? 484 LYS A CD    1 
ATOM   4639 C  CE    . LYS E 3 484 ? -17.252 -61.462 -26.423 1.00 33.44 ? 484 LYS A CE    1 
ATOM   4640 N  NZ    . LYS E 3 484 ? -17.627 -61.008 -25.050 1.00 33.53 ? 484 LYS A NZ    1 
ATOM   4641 N  N     . GLN E 3 485 ? -16.199 -68.215 -25.655 1.00 27.76 ? 485 GLN A N     1 
ATOM   4642 C  CA    . GLN E 3 485 ? -16.656 -69.589 -25.552 1.00 28.04 ? 485 GLN A CA    1 
ATOM   4643 C  C     . GLN E 3 485 ? -15.903 -70.270 -24.427 1.00 27.61 ? 485 GLN A C     1 
ATOM   4644 O  O     . GLN E 3 485 ? -16.456 -71.128 -23.737 1.00 27.51 ? 485 GLN A O     1 
ATOM   4645 C  CB    . GLN E 3 485 ? -16.429 -70.334 -26.871 1.00 28.89 ? 485 GLN A CB    1 
ATOM   4646 C  CG    . GLN E 3 485 ? -17.412 -69.923 -27.968 1.00 31.20 ? 485 GLN A CG    1 
ATOM   4647 C  CD    . GLN E 3 485 ? -17.233 -70.686 -29.273 1.00 31.03 ? 485 GLN A CD    1 
ATOM   4648 O  OE1   . GLN E 3 485 ? -18.031 -70.539 -30.200 1.00 33.12 ? 485 GLN A OE1   1 
ATOM   4649 N  NE2   . GLN E 3 485 ? -16.185 -71.492 -29.353 1.00 29.33 ? 485 GLN A NE2   1 
ATOM   4650 N  N     . TYR E 3 486 ? -14.644 -69.876 -24.237 1.00 26.51 ? 486 TYR A N     1 
ATOM   4651 C  CA    . TYR E 3 486 ? -13.826 -70.449 -23.178 1.00 25.35 ? 486 TYR A CA    1 
ATOM   4652 C  C     . TYR E 3 486 ? -14.372 -70.006 -21.823 1.00 24.81 ? 486 TYR A C     1 
ATOM   4653 O  O     . TYR E 3 486 ? -14.676 -70.826 -20.958 1.00 23.23 ? 486 TYR A O     1 
ATOM   4654 C  CB    . TYR E 3 486 ? -12.365 -70.001 -23.310 1.00 23.91 ? 486 TYR A CB    1 
ATOM   4655 C  CG    . TYR E 3 486 ? -11.471 -70.549 -22.206 1.00 24.75 ? 486 TYR A CG    1 
ATOM   4656 C  CD1   . TYR E 3 486 ? -10.913 -71.829 -22.297 1.00 23.15 ? 486 TYR A CD1   1 
ATOM   4657 C  CD2   . TYR E 3 486 ? -11.246 -69.815 -21.030 1.00 24.07 ? 486 TYR A CD2   1 
ATOM   4658 C  CE1   . TYR E 3 486 ? -10.154 -72.363 -21.248 1.00 22.06 ? 486 TYR A CE1   1 
ATOM   4659 C  CE2   . TYR E 3 486 ? -10.491 -70.346 -19.978 1.00 22.96 ? 486 TYR A CE2   1 
ATOM   4660 C  CZ    . TYR E 3 486 ? -9.955  -71.617 -20.096 1.00 22.84 ? 486 TYR A CZ    1 
ATOM   4661 O  OH    . TYR E 3 486 ? -9.224  -72.140 -19.061 1.00 23.96 ? 486 TYR A OH    1 
ATOM   4662 N  N     . ARG E 3 487 ? -14.487 -68.702 -21.641 1.00 25.98 ? 487 ARG A N     1 
ATOM   4663 C  CA    . ARG E 3 487 ? -14.988 -68.183 -20.382 1.00 30.16 ? 487 ARG A CA    1 
ATOM   4664 C  C     . ARG E 3 487 ? -16.256 -68.952 -19.975 1.00 31.40 ? 487 ARG A C     1 
ATOM   4665 O  O     . ARG E 3 487 ? -16.285 -69.622 -18.931 1.00 30.52 ? 487 ARG A O     1 
ATOM   4666 C  CB    . ARG E 3 487 ? -15.269 -66.677 -20.507 1.00 31.35 ? 487 ARG A CB    1 
ATOM   4667 C  CG    . ARG E 3 487 ? -14.016 -65.787 -20.558 1.00 33.01 ? 487 ARG A CG    1 
ATOM   4668 C  CD    . ARG E 3 487 ? -14.208 -64.619 -21.482 1.00 33.44 ? 487 ARG A CD    1 
ATOM   4669 N  NE    . ARG E 3 487 ? -13.800 -63.337 -21.002 1.00 35.46 ? 487 ARG A NE    1 
ATOM   4670 C  CZ    . ARG E 3 487 ? -13.187 -62.306 -21.578 1.00 37.27 ? 487 ARG A CZ    1 
ATOM   4671 N  NH1   . ARG E 3 487 ? -12.768 -62.247 -22.836 1.00 37.43 ? 487 ARG A NH1   1 
ATOM   4672 N  NH2   . ARG E 3 487 ? -13.035 -61.263 -20.776 1.00 38.86 ? 487 ARG A NH2   1 
ATOM   4673 N  N     . GLU E 3 488 ? -17.279 -68.888 -20.823 1.00 32.68 ? 488 GLU A N     1 
ATOM   4674 C  CA    . GLU E 3 488 ? -18.541 -69.568 -20.557 1.00 35.05 ? 488 GLU A CA    1 
ATOM   4675 C  C     . GLU E 3 488 ? -18.366 -71.046 -20.244 1.00 35.11 ? 488 GLU A C     1 
ATOM   4676 O  O     . GLU E 3 488 ? -18.890 -71.542 -19.252 1.00 35.76 ? 488 GLU A O     1 
ATOM   4677 C  CB    . GLU E 3 488 ? -19.498 -69.401 -21.744 1.00 37.24 ? 488 GLU A CB    1 
ATOM   4678 C  CG    . GLU E 3 488 ? -19.840 -67.952 -22.018 1.00 42.65 ? 488 GLU A CG    1 
ATOM   4679 C  CD    . GLU E 3 488 ? -20.660 -67.755 -23.300 1.00 45.63 ? 488 GLU A CD    1 
ATOM   4680 O  OE1   . GLU E 3 488 ? -20.148 -68.140 -24.398 1.00 48.51 ? 488 GLU A OE1   1 
ATOM   4681 O  OE2   . GLU E 3 488 ? -21.801 -67.199 -23.188 1.00 46.53 ? 488 GLU A OE2   1 
ATOM   4682 N  N     . LYS E 3 489 ? -17.623 -71.754 -21.078 1.00 35.87 ? 489 LYS A N     1 
ATOM   4683 C  CA    . LYS E 3 489 ? -17.436 -73.169 -20.844 1.00 36.50 ? 489 LYS A CA    1 
ATOM   4684 C  C     . LYS E 3 489 ? -16.740 -73.476 -19.529 1.00 36.40 ? 489 LYS A C     1 
ATOM   4685 O  O     . LYS E 3 489 ? -17.264 -74.245 -18.731 1.00 37.37 ? 489 LYS A O     1 
ATOM   4686 C  CB    . LYS E 3 489 ? -16.668 -73.804 -21.999 1.00 38.68 ? 489 LYS A CB    1 
ATOM   4687 C  CG    . LYS E 3 489 ? -16.689 -75.332 -22.002 1.00 41.97 ? 489 LYS A CG    1 
ATOM   4688 C  CD    . LYS E 3 489 ? -17.958 -75.950 -21.393 1.00 45.52 ? 489 LYS A CD    1 
ATOM   4689 C  CE    . LYS E 3 489 ? -18.704 -76.787 -22.427 1.00 48.02 ? 489 LYS A CE    1 
ATOM   4690 N  NZ    . LYS E 3 489 ? -17.749 -77.712 -23.138 1.00 50.67 ? 489 LYS A NZ    1 
ATOM   4691 N  N     . MET E 3 490 ? -15.586 -72.856 -19.285 1.00 35.58 ? 490 MET A N     1 
ATOM   4692 C  CA    . MET E 3 490 ? -14.813 -73.118 -18.066 1.00 34.24 ? 490 MET A CA    1 
ATOM   4693 C  C     . MET E 3 490 ? -15.270 -72.366 -16.826 1.00 34.05 ? 490 MET A C     1 
ATOM   4694 O  O     . MET E 3 490 ? -14.883 -72.714 -15.715 1.00 34.41 ? 490 MET A O     1 
ATOM   4695 C  CB    . MET E 3 490 ? -13.332 -72.813 -18.304 1.00 33.75 ? 490 MET A CB    1 
ATOM   4696 C  CG    . MET E 3 490 ? -12.720 -73.546 -19.481 1.00 32.85 ? 490 MET A CG    1 
ATOM   4697 S  SD    . MET E 3 490 ? -12.620 -75.329 -19.246 1.00 33.22 ? 490 MET A SD    1 
ATOM   4698 C  CE    . MET E 3 490 ? -11.339 -75.455 -17.966 1.00 31.29 ? 490 MET A CE    1 
ATOM   4699 N  N     . GLY E 3 491 ? -16.076 -71.329 -17.005 1.00 33.08 ? 491 GLY A N     1 
ATOM   4700 C  CA    . GLY E 3 491 ? -16.540 -70.583 -15.852 1.00 30.91 ? 491 GLY A CA    1 
ATOM   4701 C  C     . GLY E 3 491 ? -15.447 -69.747 -15.220 1.00 30.21 ? 491 GLY A C     1 
ATOM   4702 O  O     . GLY E 3 491 ? -15.500 -69.455 -14.028 1.00 30.76 ? 491 GLY A O     1 
ATOM   4703 N  N     . ILE E 3 492 ? -14.455 -69.367 -16.020 1.00 29.02 ? 492 ILE A N     1 
ATOM   4704 C  CA    . ILE E 3 492 ? -13.341 -68.534 -15.557 1.00 27.34 ? 492 ILE A CA    1 
ATOM   4705 C  C     . ILE E 3 492 ? -13.347 -67.217 -16.342 1.00 26.61 ? 492 ILE A C     1 
ATOM   4706 O  O     . ILE E 3 492 ? -13.611 -67.207 -17.545 1.00 27.51 ? 492 ILE A O     1 
ATOM   4707 C  CB    . ILE E 3 492 ? -11.978 -69.237 -15.787 1.00 26.96 ? 492 ILE A CB    1 
ATOM   4708 C  CG1   . ILE E 3 492 ? -11.932 -70.560 -15.015 1.00 26.16 ? 492 ILE A CG1   1 
ATOM   4709 C  CG2   . ILE E 3 492 ? -10.838 -68.311 -15.375 1.00 26.11 ? 492 ILE A CG2   1 
ATOM   4710 C  CD1   . ILE E 3 492 ? -10.648 -71.344 -15.210 1.00 23.37 ? 492 ILE A CD1   1 
ATOM   4711 N  N     . PRO E 3 493 ? -13.061 -66.089 -15.675 1.00 25.26 ? 493 PRO A N     1 
ATOM   4712 C  CA    . PRO E 3 493 ? -13.047 -64.791 -16.356 1.00 25.52 ? 493 PRO A CA    1 
ATOM   4713 C  C     . PRO E 3 493 ? -11.778 -64.586 -17.186 1.00 26.00 ? 493 PRO A C     1 
ATOM   4714 O  O     . PRO E 3 493 ? -11.348 -63.444 -17.397 1.00 28.33 ? 493 PRO A O     1 
ATOM   4715 C  CB    . PRO E 3 493 ? -13.119 -63.783 -15.200 1.00 25.71 ? 493 PRO A CB    1 
ATOM   4716 C  CG    . PRO E 3 493 ? -13.576 -64.584 -14.019 1.00 23.89 ? 493 PRO A CG    1 
ATOM   4717 C  CD    . PRO E 3 493 ? -12.919 -65.910 -14.224 1.00 24.81 ? 493 PRO A CD    1 
ATOM   4718 N  N     . ALA E 3 494 ? -11.179 -65.687 -17.640 1.00 24.18 ? 494 ALA A N     1 
ATOM   4719 C  CA    . ALA E 3 494 ? -9.946  -65.657 -18.438 1.00 22.58 ? 494 ALA A CA    1 
ATOM   4720 C  C     . ALA E 3 494 ? -9.732  -64.377 -19.259 1.00 22.74 ? 494 ALA A C     1 
ATOM   4721 O  O     . ALA E 3 494 ? -10.622 -63.930 -20.002 1.00 23.69 ? 494 ALA A O     1 
ATOM   4722 C  CB    . ALA E 3 494 ? -9.901  -66.868 -19.346 1.00 19.49 ? 494 ALA A CB    1 
ATOM   4723 N  N     . LYS E 3 495 ? -8.550  -63.783 -19.109 1.00 22.29 ? 495 LYS A N     1 
ATOM   4724 C  CA    . LYS E 3 495 ? -8.205  -62.564 -19.838 1.00 22.43 ? 495 LYS A CA    1 
ATOM   4725 C  C     . LYS E 3 495 ? -7.338  -62.934 -21.036 1.00 21.15 ? 495 LYS A C     1 
ATOM   4726 O  O     . LYS E 3 495 ? -6.849  -64.056 -21.123 1.00 21.07 ? 495 LYS A O     1 
ATOM   4727 C  CB    . LYS E 3 495 ? -7.437  -61.594 -18.933 1.00 22.88 ? 495 LYS A CB    1 
ATOM   4728 C  CG    . LYS E 3 495 ? -8.208  -61.147 -17.703 1.00 25.46 ? 495 LYS A CG    1 
ATOM   4729 C  CD    . LYS E 3 495 ? -7.296  -60.462 -16.688 1.00 26.84 ? 495 LYS A CD    1 
ATOM   4730 C  CE    . LYS E 3 495 ? -8.110  -59.865 -15.546 1.00 28.97 ? 495 LYS A CE    1 
ATOM   4731 N  NZ    . LYS E 3 495 ? -7.538  -60.197 -14.207 1.00 30.41 ? 495 LYS A NZ    1 
ATOM   4732 N  N     . LEU E 3 496 ? -7.153  -62.000 -21.962 1.00 20.41 ? 496 LEU A N     1 
ATOM   4733 C  CA    . LEU E 3 496 ? -6.323  -62.266 -23.130 1.00 20.15 ? 496 LEU A CA    1 
ATOM   4734 C  C     . LEU E 3 496 ? -5.361  -61.127 -23.444 1.00 20.55 ? 496 LEU A C     1 
ATOM   4735 O  O     . LEU E 3 496 ? -5.788  -60.002 -23.739 1.00 20.39 ? 496 LEU A O     1 
ATOM   4736 C  CB    . LEU E 3 496 ? -7.180  -62.524 -24.358 1.00 20.48 ? 496 LEU A CB    1 
ATOM   4737 C  CG    . LEU E 3 496 ? -6.314  -62.641 -25.610 1.00 21.48 ? 496 LEU A CG    1 
ATOM   4738 C  CD1   . LEU E 3 496 ? -5.453  -63.875 -25.477 1.00 22.49 ? 496 LEU A CD1   1 
ATOM   4739 C  CD2   . LEU E 3 496 ? -7.177  -62.725 -26.873 1.00 22.65 ? 496 LEU A CD2   1 
ATOM   4740 N  N     . ILE E 3 497 ? -4.064  -61.435 -23.380 1.00 19.54 ? 497 ILE A N     1 
ATOM   4741 C  CA    . ILE E 3 497 ? -2.998  -60.477 -23.667 1.00 17.58 ? 497 ILE A CA    1 
ATOM   4742 C  C     . ILE E 3 497 ? -2.368  -60.865 -24.986 1.00 17.80 ? 497 ILE A C     1 
ATOM   4743 O  O     . ILE E 3 497 ? -1.860  -61.968 -25.129 1.00 18.74 ? 497 ILE A O     1 
ATOM   4744 C  CB    . ILE E 3 497 ? -1.905  -60.498 -22.583 1.00 15.89 ? 497 ILE A CB    1 
ATOM   4745 C  CG1   . ILE E 3 497 ? -2.485  -60.005 -21.272 1.00 17.71 ? 497 ILE A CG1   1 
ATOM   4746 C  CG2   . ILE E 3 497 ? -0.750  -59.618 -22.973 1.00 12.72 ? 497 ILE A CG2   1 
ATOM   4747 C  CD1   . ILE E 3 497 ? -1.464  -59.917 -20.176 1.00 19.88 ? 497 ILE A CD1   1 
ATOM   4748 N  N     . VAL E 3 498 ? -2.407  -59.962 -25.955 1.00 17.81 ? 498 VAL A N     1 
ATOM   4749 C  CA    . VAL E 3 498 ? -1.833  -60.238 -27.263 1.00 19.02 ? 498 VAL A CA    1 
ATOM   4750 C  C     . VAL E 3 498 ? -0.503  -59.552 -27.335 1.00 18.89 ? 498 VAL A C     1 
ATOM   4751 O  O     . VAL E 3 498 ? -0.444  -58.330 -27.403 1.00 19.98 ? 498 VAL A O     1 
ATOM   4752 C  CB    . VAL E 3 498 ? -2.678  -59.668 -28.404 1.00 18.57 ? 498 VAL A CB    1 
ATOM   4753 C  CG1   . VAL E 3 498 ? -2.818  -60.681 -29.486 1.00 20.69 ? 498 VAL A CG1   1 
ATOM   4754 C  CG2   . VAL E 3 498 ? -4.026  -59.273 -27.903 1.00 19.46 ? 498 VAL A CG2   1 
ATOM   4755 N  N     . CYS E 3 499 ? 0.567   -60.325 -27.313 1.00 18.83 ? 499 CYS A N     1 
ATOM   4756 C  CA    . CYS E 3 499 ? 1.888   -59.741 -27.382 1.00 19.56 ? 499 CYS A CA    1 
ATOM   4757 C  C     . CYS E 3 499 ? 2.290   -59.609 -28.854 1.00 19.86 ? 499 CYS A C     1 
ATOM   4758 O  O     . CYS E 3 499 ? 2.620   -60.602 -29.512 1.00 20.66 ? 499 CYS A O     1 
ATOM   4759 C  CB    . CYS E 3 499 ? 2.870   -60.627 -26.627 1.00 21.24 ? 499 CYS A CB    1 
ATOM   4760 S  SG    . CYS E 3 499 ? 4.476   -59.905 -26.511 1.00 29.15 ? 499 CYS A SG    1 
ATOM   4761 N  N     . ALA E 3 500 ? 2.259   -58.380 -29.365 1.00 19.96 ? 500 ALA A N     1 
ATOM   4762 C  CA    . ALA E 3 500 ? 2.596   -58.093 -30.765 1.00 19.33 ? 500 ALA A CA    1 
ATOM   4763 C  C     . ALA E 3 500 ? 4.061   -58.324 -31.110 1.00 19.68 ? 500 ALA A C     1 
ATOM   4764 O  O     . ALA E 3 500 ? 4.960   -57.976 -30.336 1.00 18.92 ? 500 ALA A O     1 
ATOM   4765 C  CB    . ALA E 3 500 ? 2.220   -56.666 -31.107 1.00 18.34 ? 500 ALA A CB    1 
ATOM   4766 N  N     . MET E 3 501 ? 4.295   -58.897 -32.288 1.00 19.26 ? 501 MET A N     1 
ATOM   4767 C  CA    . MET E 3 501 ? 5.652   -59.186 -32.730 1.00 18.85 ? 501 MET A CA    1 
ATOM   4768 C  C     . MET E 3 501 ? 6.106   -58.281 -33.873 1.00 17.11 ? 501 MET A C     1 
ATOM   4769 O  O     . MET E 3 501 ? 7.224   -58.416 -34.366 1.00 16.72 ? 501 MET A O     1 
ATOM   4770 C  CB    . MET E 3 501 ? 5.775   -60.665 -33.147 1.00 20.98 ? 501 MET A CB    1 
ATOM   4771 C  CG    . MET E 3 501 ? 5.553   -61.686 -32.029 1.00 20.67 ? 501 MET A CG    1 
ATOM   4772 S  SD    . MET E 3 501 ? 6.713   -61.449 -30.655 1.00 26.59 ? 501 MET A SD    1 
ATOM   4773 C  CE    . MET E 3 501 ? 8.305   -61.592 -31.503 1.00 20.67 ? 501 MET A CE    1 
ATOM   4774 N  N     . THR E 3 502 ? 5.242   -57.369 -34.302 1.00 16.41 ? 502 THR A N     1 
ATOM   4775 C  CA    . THR E 3 502 ? 5.608   -56.443 -35.378 1.00 17.31 ? 502 THR A CA    1 
ATOM   4776 C  C     . THR E 3 502 ? 5.029   -55.057 -35.136 1.00 17.80 ? 502 THR A C     1 
ATOM   4777 O  O     . THR E 3 502 ? 4.435   -54.794 -34.091 1.00 16.80 ? 502 THR A O     1 
ATOM   4778 C  CB    . THR E 3 502 ? 5.084   -56.890 -36.727 1.00 15.10 ? 502 THR A CB    1 
ATOM   4779 O  OG1   . THR E 3 502 ? 3.676   -56.704 -36.744 1.00 14.16 ? 502 THR A OG1   1 
ATOM   4780 C  CG2   . THR E 3 502 ? 5.400   -58.334 -36.969 1.00 14.80 ? 502 THR A CG2   1 
ATOM   4781 N  N     . SER E 3 503 ? 5.212   -54.167 -36.108 1.00 19.02 ? 503 SER A N     1 
ATOM   4782 C  CA    . SER E 3 503 ? 4.678   -52.815 -35.992 1.00 19.19 ? 503 SER A CA    1 
ATOM   4783 C  C     . SER E 3 503 ? 3.504   -52.595 -36.955 1.00 19.57 ? 503 SER A C     1 
ATOM   4784 O  O     . SER E 3 503 ? 3.164   -51.456 -37.280 1.00 19.50 ? 503 SER A O     1 
ATOM   4785 C  CB    . SER E 3 503 ? 5.772   -51.770 -36.236 1.00 18.69 ? 503 SER A CB    1 
ATOM   4786 O  OG    . SER E 3 503 ? 6.213   -51.792 -37.580 1.00 20.10 ? 503 SER A OG    1 
ATOM   4787 N  N     . ASN E 3 504 ? 2.895   -53.689 -37.424 1.00 19.84 ? 504 ASN A N     1 
ATOM   4788 C  CA    . ASN E 3 504 ? 1.724   -53.592 -38.303 1.00 20.81 ? 504 ASN A CA    1 
ATOM   4789 C  C     . ASN E 3 504 ? 0.635   -53.064 -37.375 1.00 21.09 ? 504 ASN A C     1 
ATOM   4790 O  O     . ASN E 3 504 ? 0.816   -53.086 -36.160 1.00 23.15 ? 504 ASN A O     1 
ATOM   4791 C  CB    . ASN E 3 504 ? 1.293   -54.964 -38.835 1.00 19.90 ? 504 ASN A CB    1 
ATOM   4792 C  CG    . ASN E 3 504 ? 0.734   -55.849 -37.752 1.00 20.76 ? 504 ASN A CG    1 
ATOM   4793 O  OD1   . ASN E 3 504 ? 1.478   -56.391 -36.950 1.00 25.84 ? 504 ASN A OD1   1 
ATOM   4794 N  ND2   . ASN E 3 504 ? -0.577  -55.975 -37.706 1.00 22.37 ? 504 ASN A ND2   1 
ATOM   4795 N  N     . GLY E 3 505 ? -0.496  -52.632 -37.924 1.00 20.13 ? 505 GLY A N     1 
ATOM   4796 C  CA    . GLY E 3 505 ? -1.554  -52.108 -37.079 1.00 19.27 ? 505 GLY A CA    1 
ATOM   4797 C  C     . GLY E 3 505 ? -2.725  -53.038 -36.803 1.00 19.02 ? 505 GLY A C     1 
ATOM   4798 O  O     . GLY E 3 505 ? -3.845  -52.575 -36.644 1.00 20.20 ? 505 GLY A O     1 
ATOM   4799 N  N     . PHE E 3 506 ? -2.467  -54.339 -36.721 1.00 18.68 ? 506 PHE A N     1 
ATOM   4800 C  CA    . PHE E 3 506 ? -3.509  -55.332 -36.464 1.00 16.73 ? 506 PHE A CA    1 
ATOM   4801 C  C     . PHE E 3 506 ? -3.518  -55.955 -35.048 1.00 17.21 ? 506 PHE A C     1 
ATOM   4802 O  O     . PHE E 3 506 ? -2.494  -56.060 -34.371 1.00 16.21 ? 506 PHE A O     1 
ATOM   4803 C  CB    . PHE E 3 506 ? -3.395  -56.454 -37.491 1.00 14.82 ? 506 PHE A CB    1 
ATOM   4804 C  CG    . PHE E 3 506 ? -3.310  -55.972 -38.912 1.00 13.81 ? 506 PHE A CG    1 
ATOM   4805 C  CD1   . PHE E 3 506 ? -4.264  -55.103 -39.427 1.00 13.58 ? 506 PHE A CD1   1 
ATOM   4806 C  CD2   . PHE E 3 506 ? -2.305  -56.427 -39.755 1.00 11.59 ? 506 PHE A CD2   1 
ATOM   4807 C  CE1   . PHE E 3 506 ? -4.214  -54.709 -40.759 1.00 11.44 ? 506 PHE A CE1   1 
ATOM   4808 C  CE2   . PHE E 3 506 ? -2.252  -56.035 -41.078 1.00 9.20  ? 506 PHE A CE2   1 
ATOM   4809 C  CZ    . PHE E 3 506 ? -3.203  -55.180 -41.583 1.00 8.14  ? 506 PHE A CZ    1 
ATOM   4810 N  N     . SER E 3 507 ? -4.694  -56.381 -34.607 1.00 17.04 ? 507 SER A N     1 
ATOM   4811 C  CA    . SER E 3 507 ? -4.812  -56.999 -33.297 1.00 17.80 ? 507 SER A CA    1 
ATOM   4812 C  C     . SER E 3 507 ? -6.025  -57.903 -33.233 1.00 18.56 ? 507 SER A C     1 
ATOM   4813 O  O     . SER E 3 507 ? -7.094  -57.540 -33.707 1.00 19.57 ? 507 SER A O     1 
ATOM   4814 C  CB    . SER E 3 507 ? -4.919  -55.939 -32.193 1.00 16.14 ? 507 SER A CB    1 
ATOM   4815 O  OG    . SER E 3 507 ? -5.203  -56.553 -30.941 1.00 13.21 ? 507 SER A OG    1 
ATOM   4816 N  N     . ILE E 3 508 ? -5.853  -59.087 -32.656 1.00 18.53 ? 508 ILE A N     1 
ATOM   4817 C  CA    . ILE E 3 508 ? -6.966  -60.005 -32.504 1.00 18.64 ? 508 ILE A CA    1 
ATOM   4818 C  C     . ILE E 3 508 ? -7.672  -59.719 -31.176 1.00 21.34 ? 508 ILE A C     1 
ATOM   4819 O  O     . ILE E 3 508 ? -8.509  -60.509 -30.730 1.00 21.64 ? 508 ILE A O     1 
ATOM   4820 C  CB    . ILE E 3 508 ? -6.484  -61.447 -32.489 1.00 16.93 ? 508 ILE A CB    1 
ATOM   4821 C  CG1   . ILE E 3 508 ? -5.500  -61.656 -31.328 1.00 14.41 ? 508 ILE A CG1   1 
ATOM   4822 C  CG2   . ILE E 3 508 ? -5.878  -61.778 -33.840 1.00 17.17 ? 508 ILE A CG2   1 
ATOM   4823 C  CD1   . ILE E 3 508 ? -5.025  -63.082 -31.152 1.00 8.34  ? 508 ILE A CD1   1 
ATOM   4824 N  N     . ALA E 3 509 ? -7.320  -58.593 -30.550 1.00 22.66 ? 509 ALA A N     1 
ATOM   4825 C  CA    . ALA E 3 509 ? -7.903  -58.196 -29.272 1.00 22.57 ? 509 ALA A CA    1 
ATOM   4826 C  C     . ALA E 3 509 ? -9.076  -57.237 -29.447 1.00 23.07 ? 509 ALA A C     1 
ATOM   4827 O  O     . ALA E 3 509 ? -8.946  -56.199 -30.083 1.00 23.60 ? 509 ALA A O     1 
ATOM   4828 C  CB    . ALA E 3 509 ? -6.841  -57.556 -28.403 1.00 21.48 ? 509 ALA A CB    1 
ATOM   4829 N  N     . ASP E 3 510 ? -10.216 -57.594 -28.865 1.00 24.00 ? 510 ASP A N     1 
ATOM   4830 C  CA    . ASP E 3 510 ? -11.433 -56.791 -28.937 1.00 24.52 ? 510 ASP A CA    1 
ATOM   4831 C  C     . ASP E 3 510 ? -11.360 -55.571 -28.015 1.00 25.88 ? 510 ASP A C     1 
ATOM   4832 O  O     . ASP E 3 510 ? -11.335 -55.705 -26.781 1.00 25.67 ? 510 ASP A O     1 
ATOM   4833 C  CB    . ASP E 3 510 ? -12.644 -57.639 -28.536 1.00 24.24 ? 510 ASP A CB    1 
ATOM   4834 C  CG    . ASP E 3 510 ? -13.965 -56.969 -28.874 1.00 24.62 ? 510 ASP A CG    1 
ATOM   4835 O  OD1   . ASP E 3 510 ? -14.058 -55.725 -28.746 1.00 23.49 ? 510 ASP A OD1   1 
ATOM   4836 O  OD2   . ASP E 3 510 ? -14.913 -57.692 -29.256 1.00 23.86 ? 510 ASP A OD2   1 
ATOM   4837 N  N     . PRO E 3 511 ? -11.342 -54.361 -28.605 1.00 25.52 ? 511 PRO A N     1 
ATOM   4838 C  CA    . PRO E 3 511 ? -11.274 -53.120 -27.828 1.00 26.27 ? 511 PRO A CA    1 
ATOM   4839 C  C     . PRO E 3 511 ? -12.436 -52.974 -26.847 1.00 27.05 ? 511 PRO A C     1 
ATOM   4840 O  O     . PRO E 3 511 ? -12.312 -52.316 -25.825 1.00 27.18 ? 511 PRO A O     1 
ATOM   4841 C  CB    . PRO E 3 511 ? -11.304 -52.032 -28.905 1.00 25.62 ? 511 PRO A CB    1 
ATOM   4842 C  CG    . PRO E 3 511 ? -10.727 -52.706 -30.106 1.00 24.99 ? 511 PRO A CG    1 
ATOM   4843 C  CD    . PRO E 3 511 ? -11.351 -54.073 -30.051 1.00 25.14 ? 511 PRO A CD    1 
ATOM   4844 N  N     . ASP E 3 512 ? -13.567 -53.593 -27.161 1.00 29.18 ? 512 ASP A N     1 
ATOM   4845 C  CA    . ASP E 3 512 ? -14.732 -53.484 -26.292 1.00 31.19 ? 512 ASP A CA    1 
ATOM   4846 C  C     . ASP E 3 512 ? -14.758 -54.482 -25.131 1.00 31.17 ? 512 ASP A C     1 
ATOM   4847 O  O     . ASP E 3 512 ? -15.673 -54.459 -24.312 1.00 31.14 ? 512 ASP A O     1 
ATOM   4848 C  CB    . ASP E 3 512 ? -16.019 -53.593 -27.118 1.00 32.42 ? 512 ASP A CB    1 
ATOM   4849 C  CG    . ASP E 3 512 ? -16.159 -52.466 -28.132 1.00 34.59 ? 512 ASP A CG    1 
ATOM   4850 O  OD1   . ASP E 3 512 ? -15.872 -51.305 -27.761 1.00 34.98 ? 512 ASP A OD1   1 
ATOM   4851 O  OD2   . ASP E 3 512 ? -16.566 -52.733 -29.290 1.00 35.29 ? 512 ASP A OD2   1 
ATOM   4852 N  N     . ASP E 3 513 ? -13.758 -55.352 -25.052 1.00 31.12 ? 513 ASP A N     1 
ATOM   4853 C  CA    . ASP E 3 513 ? -13.692 -56.310 -23.956 1.00 30.92 ? 513 ASP A CA    1 
ATOM   4854 C  C     . ASP E 3 513 ? -12.571 -55.876 -22.998 1.00 28.99 ? 513 ASP A C     1 
ATOM   4855 O  O     . ASP E 3 513 ? -11.401 -55.834 -23.371 1.00 28.70 ? 513 ASP A O     1 
ATOM   4856 C  CB    . ASP E 3 513 ? -13.441 -57.717 -24.513 1.00 33.24 ? 513 ASP A CB    1 
ATOM   4857 C  CG    . ASP E 3 513 ? -13.515 -58.798 -23.447 1.00 34.68 ? 513 ASP A CG    1 
ATOM   4858 O  OD1   . ASP E 3 513 ? -14.172 -59.830 -23.687 1.00 37.06 ? 513 ASP A OD1   1 
ATOM   4859 O  OD2   . ASP E 3 513 ? -12.906 -58.646 -22.370 1.00 36.26 ? 513 ASP A OD2   1 
ATOM   4860 N  N     . ARG E 3 514 ? -12.936 -55.541 -21.767 1.00 27.87 ? 514 ARG A N     1 
ATOM   4861 C  CA    . ARG E 3 514 ? -11.950 -55.099 -20.787 1.00 27.73 ? 514 ARG A CA    1 
ATOM   4862 C  C     . ARG E 3 514 ? -10.949 -56.185 -20.382 1.00 24.22 ? 514 ARG A C     1 
ATOM   4863 O  O     . ARG E 3 514 ? -9.925  -55.897 -19.775 1.00 22.88 ? 514 ARG A O     1 
ATOM   4864 C  CB    . ARG E 3 514 ? -12.654 -54.536 -19.539 1.00 30.49 ? 514 ARG A CB    1 
ATOM   4865 C  CG    . ARG E 3 514 ? -13.733 -55.437 -18.964 1.00 35.79 ? 514 ARG A CG    1 
ATOM   4866 C  CD    . ARG E 3 514 ? -14.299 -54.904 -17.641 1.00 40.28 ? 514 ARG A CD    1 
ATOM   4867 N  NE    . ARG E 3 514 ? -13.346 -55.016 -16.534 1.00 44.54 ? 514 ARG A NE    1 
ATOM   4868 C  CZ    . ARG E 3 514 ? -13.689 -55.263 -15.268 1.00 46.52 ? 514 ARG A CZ    1 
ATOM   4869 N  NH1   . ARG E 3 514 ? -12.752 -55.349 -14.323 1.00 46.57 ? 514 ARG A NH1   1 
ATOM   4870 N  NH2   . ARG E 3 514 ? -14.970 -55.435 -14.946 1.00 47.07 ? 514 ARG A NH2   1 
ATOM   4871 N  N     . GLY E 3 515 ? -11.243 -57.429 -20.729 1.00 22.02 ? 515 GLY A N     1 
ATOM   4872 C  CA    . GLY E 3 515 ? -10.351 -58.516 -20.377 1.00 21.49 ? 515 GLY A CA    1 
ATOM   4873 C  C     . GLY E 3 515 ? -9.325  -58.840 -21.438 1.00 20.66 ? 515 GLY A C     1 
ATOM   4874 O  O     . GLY E 3 515 ? -8.602  -59.827 -21.328 1.00 21.33 ? 515 GLY A O     1 
ATOM   4875 N  N     . MET E 3 516 ? -9.263  -58.013 -22.473 1.00 20.81 ? 516 MET A N     1 
ATOM   4876 C  CA    . MET E 3 516 ? -8.307  -58.222 -23.549 1.00 21.86 ? 516 MET A CA    1 
ATOM   4877 C  C     . MET E 3 516 ? -7.363  -57.029 -23.658 1.00 21.24 ? 516 MET A C     1 
ATOM   4878 O  O     . MET E 3 516 ? -7.795  -55.890 -23.813 1.00 19.70 ? 516 MET A O     1 
ATOM   4879 C  CB    . MET E 3 516 ? -9.049  -58.473 -24.866 1.00 23.21 ? 516 MET A CB    1 
ATOM   4880 C  CG    . MET E 3 516 ? -9.705  -59.849 -24.920 1.00 23.22 ? 516 MET A CG    1 
ATOM   4881 S  SD    . MET E 3 516 ? -10.444 -60.283 -26.499 1.00 24.70 ? 516 MET A SD    1 
ATOM   4882 C  CE    . MET E 3 516 ? -12.156 -60.459 -26.031 1.00 21.61 ? 516 MET A CE    1 
ATOM   4883 N  N     . LEU E 3 517 ? -6.067  -57.303 -23.560 1.00 21.52 ? 517 LEU A N     1 
ATOM   4884 C  CA    . LEU E 3 517 ? -5.068  -56.247 -23.604 1.00 22.18 ? 517 LEU A CA    1 
ATOM   4885 C  C     . LEU E 3 517 ? -4.100  -56.387 -24.774 1.00 23.42 ? 517 LEU A C     1 
ATOM   4886 O  O     . LEU E 3 517 ? -3.759  -57.494 -25.191 1.00 23.75 ? 517 LEU A O     1 
ATOM   4887 C  CB    . LEU E 3 517 ? -4.275  -56.233 -22.295 1.00 21.75 ? 517 LEU A CB    1 
ATOM   4888 C  CG    . LEU E 3 517 ? -3.207  -55.143 -22.176 1.00 20.99 ? 517 LEU A CG    1 
ATOM   4889 C  CD1   . LEU E 3 517 ? -3.900  -53.788 -22.138 1.00 18.48 ? 517 LEU A CD1   1 
ATOM   4890 C  CD2   . LEU E 3 517 ? -2.362  -55.355 -20.937 1.00 18.95 ? 517 LEU A CD2   1 
ATOM   4891 N  N     . ASP E 3 518 ? -3.633  -55.250 -25.277 1.00 24.63 ? 518 ASP A N     1 
ATOM   4892 C  CA    . ASP E 3 518 ? -2.710  -55.231 -26.400 1.00 25.86 ? 518 ASP A CA    1 
ATOM   4893 C  C     . ASP E 3 518 ? -1.358  -54.735 -25.936 1.00 25.20 ? 518 ASP A C     1 
ATOM   4894 O  O     . ASP E 3 518 ? -1.224  -53.571 -25.600 1.00 25.28 ? 518 ASP A O     1 
ATOM   4895 C  CB    . ASP E 3 518 ? -3.215  -54.285 -27.477 1.00 28.56 ? 518 ASP A CB    1 
ATOM   4896 C  CG    . ASP E 3 518 ? -3.535  -54.988 -28.744 1.00 31.80 ? 518 ASP A CG    1 
ATOM   4897 O  OD1   . ASP E 3 518 ? -3.254  -54.423 -29.816 1.00 37.75 ? 518 ASP A OD1   1 
ATOM   4898 O  OD2   . ASP E 3 518 ? -4.087  -56.103 -28.691 1.00 34.07 ? 518 ASP A OD2   1 
ATOM   4899 N  N     . ILE E 3 519 ? -0.352  -55.602 -25.890 1.00 25.07 ? 519 ILE A N     1 
ATOM   4900 C  CA    . ILE E 3 519 ? 0.972   -55.149 -25.472 1.00 24.03 ? 519 ILE A CA    1 
ATOM   4901 C  C     . ILE E 3 519 ? 1.979   -55.417 -26.579 1.00 24.65 ? 519 ILE A C     1 
ATOM   4902 O  O     . ILE E 3 519 ? 1.697   -56.118 -27.545 1.00 23.72 ? 519 ILE A O     1 
ATOM   4903 C  CB    . ILE E 3 519 ? 1.446   -55.839 -24.172 1.00 21.94 ? 519 ILE A CB    1 
ATOM   4904 C  CG1   . ILE E 3 519 ? 1.822   -57.293 -24.447 1.00 20.56 ? 519 ILE A CG1   1 
ATOM   4905 C  CG2   . ILE E 3 519 ? 0.344   -55.777 -23.136 1.00 21.20 ? 519 ILE A CG2   1 
ATOM   4906 C  CD1   . ILE E 3 519 ? 2.639   -57.905 -23.354 1.00 21.06 ? 519 ILE A CD1   1 
ATOM   4907 N  N     . CYS E 3 520 ? 3.161   -54.845 -26.431 1.00 26.96 ? 520 CYS A N     1 
ATOM   4908 C  CA    . CYS E 3 520 ? 4.206   -55.008 -27.417 1.00 29.16 ? 520 CYS A CA    1 
ATOM   4909 C  C     . CYS E 3 520 ? 5.253   -56.033 -27.026 1.00 29.05 ? 520 CYS A C     1 
ATOM   4910 O  O     . CYS E 3 520 ? 5.651   -56.111 -25.867 1.00 29.78 ? 520 CYS A O     1 
ATOM   4911 C  CB    . CYS E 3 520 ? 4.884   -53.667 -27.666 1.00 31.27 ? 520 CYS A CB    1 
ATOM   4912 S  SG    . CYS E 3 520 ? 6.217   -53.792 -28.855 1.00 38.79 ? 520 CYS A SG    1 
ATOM   4913 N  N     . GLY E 3 521 ? 5.703   -56.816 -28.000 1.00 29.97 ? 521 GLY A N     1 
ATOM   4914 C  CA    . GLY E 3 521 ? 6.723   -57.810 -27.726 1.00 31.57 ? 521 GLY A CA    1 
ATOM   4915 C  C     . GLY E 3 521 ? 8.090   -57.161 -27.632 1.00 32.78 ? 521 GLY A C     1 
ATOM   4916 O  O     . GLY E 3 521 ? 8.385   -56.179 -28.318 1.00 34.63 ? 521 GLY A O     1 
ATOM   4917 N  N     . PHE E 3 522 ? 8.932   -57.696 -26.769 1.00 33.10 ? 522 PHE A N     1 
ATOM   4918 C  CA    . PHE E 3 522 ? 10.274  -57.169 -26.603 1.00 34.37 ? 522 PHE A CA    1 
ATOM   4919 C  C     . PHE E 3 522 ? 10.388  -55.741 -26.081 1.00 33.73 ? 522 PHE A C     1 
ATOM   4920 O  O     . PHE E 3 522 ? 11.205  -54.928 -26.544 1.00 33.57 ? 522 PHE A O     1 
ATOM   4921 C  CB    . PHE E 3 522 ? 11.073  -57.342 -27.886 1.00 36.24 ? 522 PHE A CB    1 
ATOM   4922 C  CG    . PHE E 3 522 ? 12.245  -58.241 -27.721 1.00 38.55 ? 522 PHE A CG    1 
ATOM   4923 C  CD1   . PHE E 3 522 ? 13.464  -57.769 -27.297 1.00 40.96 ? 522 PHE A CD1   1 
ATOM   4924 C  CD2   . PHE E 3 522 ? 12.143  -59.597 -27.967 1.00 40.33 ? 522 PHE A CD2   1 
ATOM   4925 C  CE1   . PHE E 3 522 ? 14.537  -58.674 -27.120 1.00 42.29 ? 522 PHE A CE1   1 
ATOM   4926 C  CE2   . PHE E 3 522 ? 13.238  -60.448 -27.783 1.00 42.37 ? 522 PHE A CE2   1 
ATOM   4927 C  CZ    . PHE E 3 522 ? 14.412  -59.960 -27.367 1.00 41.95 ? 522 PHE A CZ    1 
ATOM   4928 N  N     . ASP E 3 523 ? 9.533   -55.451 -25.108 1.00 32.73 ? 523 ASP A N     1 
ATOM   4929 C  CA    . ASP E 3 523 ? 9.540   -54.186 -24.396 1.00 30.71 ? 523 ASP A CA    1 
ATOM   4930 C  C     . ASP E 3 523 ? 10.151  -54.738 -23.108 1.00 29.92 ? 523 ASP A C     1 
ATOM   4931 O  O     . ASP E 3 523 ? 9.564   -55.626 -22.476 1.00 29.01 ? 523 ASP A O     1 
ATOM   4932 C  CB    . ASP E 3 523 ? 8.109   -53.709 -24.134 1.00 31.17 ? 523 ASP A CB    1 
ATOM   4933 C  CG    . ASP E 3 523 ? 8.036   -52.534 -23.162 1.00 30.91 ? 523 ASP A CG    1 
ATOM   4934 O  OD1   . ASP E 3 523 ? 6.916   -52.006 -22.962 1.00 32.69 ? 523 ASP A OD1   1 
ATOM   4935 O  OD2   . ASP E 3 523 ? 9.073   -52.139 -22.599 1.00 29.91 ? 523 ASP A OD2   1 
ATOM   4936 N  N     . SER E 3 524 ? 11.345  -54.280 -22.740 1.00 29.66 ? 524 SER A N     1 
ATOM   4937 C  CA    . SER E 3 524 ? 11.969  -54.793 -21.523 1.00 29.27 ? 524 SER A CA    1 
ATOM   4938 C  C     . SER E 3 524 ? 11.076  -54.543 -20.313 1.00 27.93 ? 524 SER A C     1 
ATOM   4939 O  O     . SER E 3 524 ? 11.306  -55.087 -19.237 1.00 28.91 ? 524 SER A O     1 
ATOM   4940 C  CB    . SER E 3 524 ? 13.359  -54.173 -21.317 1.00 29.50 ? 524 SER A CB    1 
ATOM   4941 O  OG    . SER E 3 524 ? 13.459  -52.916 -21.954 1.00 30.56 ? 524 SER A OG    1 
ATOM   4942 N  N     . GLY E 3 525 ? 10.039  -53.736 -20.501 1.00 26.52 ? 525 GLY A N     1 
ATOM   4943 C  CA    . GLY E 3 525 ? 9.125   -53.464 -19.413 1.00 24.90 ? 525 GLY A CA    1 
ATOM   4944 C  C     . GLY E 3 525 ? 7.840   -54.254 -19.561 1.00 23.58 ? 525 GLY A C     1 
ATOM   4945 O  O     . GLY E 3 525 ? 6.925   -54.117 -18.754 1.00 23.85 ? 525 GLY A O     1 
ATOM   4946 N  N     . ALA E 3 526 ? 7.772   -55.084 -20.594 1.00 21.83 ? 526 ALA A N     1 
ATOM   4947 C  CA    . ALA E 3 526 ? 6.599   -55.903 -20.854 1.00 21.59 ? 526 ALA A CA    1 
ATOM   4948 C  C     . ALA E 3 526 ? 6.079   -56.619 -19.599 1.00 21.63 ? 526 ALA A C     1 
ATOM   4949 O  O     . ALA E 3 526 ? 4.873   -56.694 -19.364 1.00 21.40 ? 526 ALA A O     1 
ATOM   4950 C  CB    . ALA E 3 526 ? 6.918   -56.928 -21.942 1.00 21.60 ? 526 ALA A CB    1 
ATOM   4951 N  N     . LEU E 3 527 ? 7.003   -57.139 -18.802 1.00 21.43 ? 527 LEU A N     1 
ATOM   4952 C  CA    . LEU E 3 527 ? 6.676   -57.860 -17.584 1.00 20.99 ? 527 LEU A CA    1 
ATOM   4953 C  C     . LEU E 3 527 ? 5.765   -57.091 -16.631 1.00 22.62 ? 527 LEU A C     1 
ATOM   4954 O  O     . LEU E 3 527 ? 4.815   -57.657 -16.090 1.00 22.97 ? 527 LEU A O     1 
ATOM   4955 C  CB    . LEU E 3 527 ? 7.968   -58.251 -16.870 1.00 19.82 ? 527 LEU A CB    1 
ATOM   4956 C  CG    . LEU E 3 527 ? 8.322   -59.740 -16.759 1.00 19.60 ? 527 LEU A CG    1 
ATOM   4957 C  CD1   . LEU E 3 527 ? 7.930   -60.527 -18.000 1.00 19.13 ? 527 LEU A CD1   1 
ATOM   4958 C  CD2   . LEU E 3 527 ? 9.807   -59.842 -16.514 1.00 17.38 ? 527 LEU A CD2   1 
ATOM   4959 N  N     . ASP E 3 528 ? 6.042   -55.804 -16.432 1.00 24.12 ? 528 ASP A N     1 
ATOM   4960 C  CA    . ASP E 3 528 ? 5.246   -54.978 -15.531 1.00 25.44 ? 528 ASP A CA    1 
ATOM   4961 C  C     . ASP E 3 528 ? 3.829   -54.766 -16.071 1.00 25.42 ? 528 ASP A C     1 
ATOM   4962 O  O     . ASP E 3 528 ? 2.859   -54.805 -15.311 1.00 25.67 ? 528 ASP A O     1 
ATOM   4963 C  CB    . ASP E 3 528 ? 5.932   -53.626 -15.317 1.00 28.85 ? 528 ASP A CB    1 
ATOM   4964 C  CG    . ASP E 3 528 ? 6.033   -53.244 -13.846 1.00 33.33 ? 528 ASP A CG    1 
ATOM   4965 O  OD1   . ASP E 3 528 ? 5.696   -52.091 -13.508 1.00 37.39 ? 528 ASP A OD1   1 
ATOM   4966 O  OD2   . ASP E 3 528 ? 6.464   -54.077 -13.012 1.00 36.22 ? 528 ASP A OD2   1 
ATOM   4967 N  N     . VAL E 3 529 ? 3.708   -54.552 -17.381 1.00 23.77 ? 529 VAL A N     1 
ATOM   4968 C  CA    . VAL E 3 529 ? 2.395   -54.341 -17.994 1.00 23.08 ? 529 VAL A CA    1 
ATOM   4969 C  C     . VAL E 3 529 ? 1.516   -55.587 -17.884 1.00 22.10 ? 529 VAL A C     1 
ATOM   4970 O  O     . VAL E 3 529 ? 0.327   -55.492 -17.556 1.00 21.80 ? 529 VAL A O     1 
ATOM   4971 C  CB    . VAL E 3 529 ? 2.495   -53.963 -19.491 1.00 23.82 ? 529 VAL A CB    1 
ATOM   4972 C  CG1   . VAL E 3 529 ? 1.776   -52.666 -19.735 1.00 22.85 ? 529 VAL A CG1   1 
ATOM   4973 C  CG2   . VAL E 3 529 ? 3.946   -53.840 -19.904 1.00 25.66 ? 529 VAL A CG2   1 
ATOM   4974 N  N     . ILE E 3 530 ? 2.099   -56.749 -18.162 1.00 18.85 ? 530 ILE A N     1 
ATOM   4975 C  CA    . ILE E 3 530 ? 1.355   -57.987 -18.070 1.00 17.88 ? 530 ILE A CA    1 
ATOM   4976 C  C     . ILE E 3 530 ? 0.897   -58.198 -16.634 1.00 18.10 ? 530 ILE A C     1 
ATOM   4977 O  O     . ILE E 3 530 ? -0.209  -58.684 -16.377 1.00 17.68 ? 530 ILE A O     1 
ATOM   4978 C  CB    . ILE E 3 530 ? 2.204   -59.189 -18.499 1.00 17.26 ? 530 ILE A CB    1 
ATOM   4979 C  CG1   . ILE E 3 530 ? 2.589   -59.067 -19.981 1.00 16.98 ? 530 ILE A CG1   1 
ATOM   4980 C  CG2   . ILE E 3 530 ? 1.425   -60.460 -18.253 1.00 15.18 ? 530 ILE A CG2   1 
ATOM   4981 C  CD1   . ILE E 3 530 ? 3.608   -60.094 -20.433 1.00 15.43 ? 530 ILE A CD1   1 
ATOM   4982 N  N     . ARG E 3 531 ? 1.753   -57.822 -15.694 1.00 17.66 ? 531 ARG A N     1 
ATOM   4983 C  CA    . ARG E 3 531 ? 1.423   -57.978 -14.290 1.00 17.13 ? 531 ARG A CA    1 
ATOM   4984 C  C     . ARG E 3 531 ? 0.289   -57.062 -13.891 1.00 17.48 ? 531 ARG A C     1 
ATOM   4985 O  O     . ARG E 3 531 ? -0.714  -57.510 -13.353 1.00 15.86 ? 531 ARG A O     1 
ATOM   4986 C  CB    . ARG E 3 531 ? 2.642   -57.696 -13.420 1.00 16.13 ? 531 ARG A CB    1 
ATOM   4987 C  CG    . ARG E 3 531 ? 2.357   -57.778 -11.948 1.00 17.53 ? 531 ARG A CG    1 
ATOM   4988 C  CD    . ARG E 3 531 ? 3.610   -58.142 -11.182 1.00 20.51 ? 531 ARG A CD    1 
ATOM   4989 N  NE    . ARG E 3 531 ? 3.412   -58.089 -9.737  1.00 22.01 ? 531 ARG A NE    1 
ATOM   4990 C  CZ    . ARG E 3 531 ? 3.225   -56.966 -9.050  1.00 23.53 ? 531 ARG A CZ    1 
ATOM   4991 N  NH1   . ARG E 3 531 ? 3.051   -57.015 -7.736  1.00 25.51 ? 531 ARG A NH1   1 
ATOM   4992 N  NH2   . ARG E 3 531 ? 3.217   -55.793 -9.670  1.00 23.62 ? 531 ARG A NH2   1 
ATOM   4993 N  N     . ASN E 3 532 ? 0.452   -55.769 -14.151 1.00 20.41 ? 532 ASN A N     1 
ATOM   4994 C  CA    . ASN E 3 532 ? -0.576  -54.798 -13.804 1.00 21.52 ? 532 ASN A CA    1 
ATOM   4995 C  C     . ASN E 3 532 ? -1.935  -55.220 -14.328 1.00 22.98 ? 532 ASN A C     1 
ATOM   4996 O  O     . ASN E 3 532 ? -2.955  -54.994 -13.683 1.00 24.13 ? 532 ASN A O     1 
ATOM   4997 C  CB    . ASN E 3 532 ? -0.238  -53.418 -14.365 1.00 22.82 ? 532 ASN A CB    1 
ATOM   4998 C  CG    . ASN E 3 532 ? 0.917   -52.771 -13.652 1.00 24.13 ? 532 ASN A CG    1 
ATOM   4999 O  OD1   . ASN E 3 532 ? 1.202   -53.087 -12.495 1.00 26.80 ? 532 ASN A OD1   1 
ATOM   5000 N  ND2   . ASN E 3 532 ? 1.581   -51.844 -14.324 1.00 23.82 ? 532 ASN A ND2   1 
ATOM   5001 N  N     . PHE E 3 533 ? -1.950  -55.835 -15.503 1.00 22.81 ? 533 PHE A N     1 
ATOM   5002 C  CA    . PHE E 3 533 ? -3.196  -56.260 -16.090 1.00 23.56 ? 533 PHE A CA    1 
ATOM   5003 C  C     . PHE E 3 533 ? -3.729  -57.514 -15.398 1.00 25.94 ? 533 PHE A C     1 
ATOM   5004 O  O     . PHE E 3 533 ? -4.927  -57.613 -15.124 1.00 27.69 ? 533 PHE A O     1 
ATOM   5005 C  CB    . PHE E 3 533 ? -3.009  -56.505 -17.582 1.00 22.75 ? 533 PHE A CB    1 
ATOM   5006 C  CG    . PHE E 3 533 ? -4.297  -56.657 -18.330 1.00 22.20 ? 533 PHE A CG    1 
ATOM   5007 C  CD1   . PHE E 3 533 ? -4.722  -57.913 -18.759 1.00 22.60 ? 533 PHE A CD1   1 
ATOM   5008 C  CD2   . PHE E 3 533 ? -5.109  -55.548 -18.566 1.00 20.56 ? 533 PHE A CD2   1 
ATOM   5009 C  CE1   . PHE E 3 533 ? -5.944  -58.064 -19.413 1.00 23.14 ? 533 PHE A CE1   1 
ATOM   5010 C  CE2   . PHE E 3 533 ? -6.322  -55.679 -19.211 1.00 20.47 ? 533 PHE A CE2   1 
ATOM   5011 C  CZ    . PHE E 3 533 ? -6.748  -56.944 -19.638 1.00 23.03 ? 533 PHE A CZ    1 
ATOM   5012 N  N     . THR E 3 534 ? -2.850  -58.471 -15.113 1.00 26.28 ? 534 THR A N     1 
ATOM   5013 C  CA    . THR E 3 534 ? -3.267  -59.691 -14.437 1.00 26.37 ? 534 THR A CA    1 
ATOM   5014 C  C     . THR E 3 534 ? -3.939  -59.338 -13.113 1.00 27.96 ? 534 THR A C     1 
ATOM   5015 O  O     . THR E 3 534 ? -4.983  -59.891 -12.762 1.00 26.93 ? 534 THR A O     1 
ATOM   5016 C  CB    . THR E 3 534 ? -2.060  -60.602 -14.161 1.00 25.51 ? 534 THR A CB    1 
ATOM   5017 O  OG1   . THR E 3 534 ? -1.534  -61.079 -15.402 1.00 25.19 ? 534 THR A OG1   1 
ATOM   5018 C  CG2   . THR E 3 534 ? -2.461  -61.789 -13.309 1.00 26.44 ? 534 THR A CG2   1 
ATOM   5019 N  N     . LEU E 3 535 ? -3.336  -58.393 -12.397 1.00 30.29 ? 535 LEU A N     1 
ATOM   5020 C  CA    . LEU E 3 535 ? -3.835  -57.956 -11.099 1.00 33.37 ? 535 LEU A CA    1 
ATOM   5021 C  C     . LEU E 3 535 ? -4.966  -56.919 -11.136 1.00 35.67 ? 535 LEU A C     1 
ATOM   5022 O  O     . LEU E 3 535 ? -5.244  -56.272 -10.131 1.00 37.63 ? 535 LEU A O     1 
ATOM   5023 C  CB    . LEU E 3 535 ? -2.666  -57.423 -10.264 1.00 31.87 ? 535 LEU A CB    1 
ATOM   5024 C  CG    . LEU E 3 535 ? -1.577  -58.456 -9.962  1.00 31.96 ? 535 LEU A CG    1 
ATOM   5025 C  CD1   . LEU E 3 535 ? -0.419  -57.834 -9.181  1.00 30.17 ? 535 LEU A CD1   1 
ATOM   5026 C  CD2   . LEU E 3 535 ? -2.196  -59.590 -9.183  1.00 32.83 ? 535 LEU A CD2   1 
ATOM   5027 N  N     . ASP E 3 536 ? -5.618  -56.764 -12.286 1.00 37.77 ? 536 ASP A N     1 
ATOM   5028 C  CA    . ASP E 3 536 ? -6.727  -55.814 -12.437 1.00 39.80 ? 536 ASP A CA    1 
ATOM   5029 C  C     . ASP E 3 536 ? -6.345  -54.390 -12.074 1.00 40.86 ? 536 ASP A C     1 
ATOM   5030 O  O     . ASP E 3 536 ? -7.006  -53.760 -11.253 1.00 40.83 ? 536 ASP A O     1 
ATOM   5031 C  CB    . ASP E 3 536 ? -7.927  -56.230 -11.574 1.00 41.42 ? 536 ASP A CB    1 
ATOM   5032 C  CG    . ASP E 3 536 ? -8.716  -57.367 -12.176 1.00 43.76 ? 536 ASP A CG    1 
ATOM   5033 O  OD1   . ASP E 3 536 ? -8.362  -57.841 -13.277 1.00 45.45 ? 536 ASP A OD1   1 
ATOM   5034 O  OD2   . ASP E 3 536 ? -9.703  -57.798 -11.548 1.00 45.67 ? 536 ASP A OD2   1 
ATOM   5035 N  N     . LEU E 3 537 ? -5.287  -53.877 -12.689 1.00 42.88 ? 537 LEU A N     1 
ATOM   5036 C  CA    . LEU E 3 537 ? -4.834  -52.520 -12.411 1.00 43.74 ? 537 LEU A CA    1 
ATOM   5037 C  C     . LEU E 3 537 ? -4.899  -51.685 -13.697 1.00 44.81 ? 537 LEU A C     1 
ATOM   5038 O  O     . LEU E 3 537 ? -5.414  -50.539 -13.634 1.00 44.99 ? 537 LEU A O     1 
ATOM   5039 C  CB    . LEU E 3 537 ? -3.404  -52.551 -11.849 1.00 43.53 ? 537 LEU A CB    1 
ATOM   5040 C  CG    . LEU E 3 537 ? -3.192  -53.514 -10.671 1.00 43.10 ? 537 LEU A CG    1 
ATOM   5041 C  CD1   . LEU E 3 537 ? -1.765  -53.411 -10.128 1.00 41.34 ? 537 LEU A CD1   1 
ATOM   5042 C  CD2   . LEU E 3 537 ? -4.209  -53.192 -9.588  1.00 43.02 ? 537 LEU A CD2   1 
ATOM   5043 N  N     . MET F 3 5   ? -25.396 -7.856  -5.152  1.00 37.50 ? 5   MET B N     1 
ATOM   5044 C  CA    . MET F 3 5   ? -24.483 -9.048  -5.044  1.00 38.66 ? 5   MET B CA    1 
ATOM   5045 C  C     . MET F 3 5   ? -22.989 -8.685  -4.997  1.00 37.74 ? 5   MET B C     1 
ATOM   5046 O  O     . MET F 3 5   ? -22.444 -8.129  -5.947  1.00 37.55 ? 5   MET B O     1 
ATOM   5047 C  CB    . MET F 3 5   ? -24.767 -10.001 -6.213  1.00 38.78 ? 5   MET B CB    1 
ATOM   5048 C  CG    . MET F 3 5   ? -23.610 -10.845 -6.670  1.00 40.37 ? 5   MET B CG    1 
ATOM   5049 S  SD    . MET F 3 5   ? -23.177 -12.178 -5.579  1.00 44.53 ? 5   MET B SD    1 
ATOM   5050 C  CE    . MET F 3 5   ? -24.784 -12.820 -5.148  1.00 43.66 ? 5   MET B CE    1 
ATOM   5051 N  N     . ASP F 3 6   ? -22.337 -8.988  -3.880  1.00 36.59 ? 6   ASP B N     1 
ATOM   5052 C  CA    . ASP F 3 6   ? -20.919 -8.699  -3.732  1.00 35.58 ? 6   ASP B CA    1 
ATOM   5053 C  C     . ASP F 3 6   ? -20.187 -9.939  -3.239  1.00 35.66 ? 6   ASP B C     1 
ATOM   5054 O  O     . ASP F 3 6   ? -20.765 -11.020 -3.166  1.00 36.01 ? 6   ASP B O     1 
ATOM   5055 C  CB    . ASP F 3 6   ? -20.695 -7.531  -2.762  1.00 36.98 ? 6   ASP B CB    1 
ATOM   5056 C  CG    . ASP F 3 6   ? -21.304 -7.774  -1.386  1.00 37.70 ? 6   ASP B CG    1 
ATOM   5057 O  OD1   . ASP F 3 6   ? -21.093 -6.934  -0.484  1.00 37.11 ? 6   ASP B OD1   1 
ATOM   5058 O  OD2   . ASP F 3 6   ? -21.995 -8.795  -1.203  1.00 38.38 ? 6   ASP B OD2   1 
ATOM   5059 N  N     . GLN F 3 7   ? -18.917 -9.778  -2.891  1.00 35.38 ? 7   GLN B N     1 
ATOM   5060 C  CA    . GLN F 3 7   ? -18.090 -10.886 -2.422  1.00 35.16 ? 7   GLN B CA    1 
ATOM   5061 C  C     . GLN F 3 7   ? -18.587 -11.548 -1.130  1.00 35.94 ? 7   GLN B C     1 
ATOM   5062 O  O     . GLN F 3 7   ? -18.201 -12.679 -0.816  1.00 35.48 ? 7   GLN B O     1 
ATOM   5063 C  CB    . GLN F 3 7   ? -16.660 -10.392 -2.231  1.00 33.86 ? 7   GLN B CB    1 
ATOM   5064 C  CG    . GLN F 3 7   ? -16.150 -9.578  -3.398  1.00 31.26 ? 7   GLN B CG    1 
ATOM   5065 C  CD    . GLN F 3 7   ? -14.811 -8.957  -3.117  1.00 30.78 ? 7   GLN B CD    1 
ATOM   5066 O  OE1   . GLN F 3 7   ? -14.365 -8.071  -3.844  1.00 31.66 ? 7   GLN B OE1   1 
ATOM   5067 N  NE2   . GLN F 3 7   ? -14.152 -9.418  -2.056  1.00 29.13 ? 7   GLN B NE2   1 
ATOM   5068 N  N     . THR F 3 8   ? -19.432 -10.845 -0.380  1.00 35.98 ? 8   THR B N     1 
ATOM   5069 C  CA    . THR F 3 8   ? -19.967 -11.391 0.857   1.00 36.28 ? 8   THR B CA    1 
ATOM   5070 C  C     . THR F 3 8   ? -20.934 -12.529 0.544   1.00 36.81 ? 8   THR B C     1 
ATOM   5071 O  O     . THR F 3 8   ? -21.266 -13.327 1.419   1.00 37.66 ? 8   THR B O     1 
ATOM   5072 C  CB    . THR F 3 8   ? -20.719 -10.319 1.689   1.00 35.84 ? 8   THR B CB    1 
ATOM   5073 O  OG1   . THR F 3 8   ? -21.856 -9.837  0.959   1.00 34.18 ? 8   THR B OG1   1 
ATOM   5074 C  CG2   . THR F 3 8   ? -19.798 -9.164  2.019   1.00 35.59 ? 8   THR B CG2   1 
ATOM   5075 N  N     . GLN F 3 9   ? -21.377 -12.603 -0.707  1.00 37.29 ? 9   GLN B N     1 
ATOM   5076 C  CA    . GLN F 3 9   ? -22.311 -13.644 -1.122  1.00 38.55 ? 9   GLN B CA    1 
ATOM   5077 C  C     . GLN F 3 9   ? -21.727 -14.533 -2.216  1.00 37.96 ? 9   GLN B C     1 
ATOM   5078 O  O     . GLN F 3 9   ? -20.867 -14.107 -2.979  1.00 38.12 ? 9   GLN B O     1 
ATOM   5079 C  CB    . GLN F 3 9   ? -23.613 -13.019 -1.637  1.00 40.87 ? 9   GLN B CB    1 
ATOM   5080 C  CG    . GLN F 3 9   ? -24.292 -12.047 -0.683  1.00 43.39 ? 9   GLN B CG    1 
ATOM   5081 C  CD    . GLN F 3 9   ? -25.559 -11.455 -1.282  1.00 45.86 ? 9   GLN B CD    1 
ATOM   5082 O  OE1   . GLN F 3 9   ? -26.661 -11.971 -1.075  1.00 47.21 ? 9   GLN B OE1   1 
ATOM   5083 N  NE2   . GLN F 3 9   ? -25.405 -10.377 -2.044  1.00 46.58 ? 9   GLN B NE2   1 
ATOM   5084 N  N     . PRO F 3 10  ? -22.200 -15.787 -2.305  1.00 37.78 ? 10  PRO B N     1 
ATOM   5085 C  CA    . PRO F 3 10  ? -21.742 -16.761 -3.303  1.00 37.14 ? 10  PRO B CA    1 
ATOM   5086 C  C     . PRO F 3 10  ? -22.328 -16.510 -4.682  1.00 36.32 ? 10  PRO B C     1 
ATOM   5087 O  O     . PRO F 3 10  ? -23.512 -16.220 -4.799  1.00 36.52 ? 10  PRO B O     1 
ATOM   5088 C  CB    . PRO F 3 10  ? -22.217 -18.088 -2.722  1.00 37.18 ? 10  PRO B CB    1 
ATOM   5089 C  CG    . PRO F 3 10  ? -23.490 -17.702 -2.052  1.00 36.64 ? 10  PRO B CG    1 
ATOM   5090 C  CD    . PRO F 3 10  ? -23.104 -16.431 -1.333  1.00 37.17 ? 10  PRO B CD    1 
ATOM   5091 N  N     . LEU F 3 11  ? -21.498 -16.616 -5.718  1.00 36.57 ? 11  LEU B N     1 
ATOM   5092 C  CA    . LEU F 3 11  ? -21.963 -16.428 -7.093  1.00 37.09 ? 11  LEU B CA    1 
ATOM   5093 C  C     . LEU F 3 11  ? -22.735 -17.661 -7.513  1.00 37.75 ? 11  LEU B C     1 
ATOM   5094 O  O     . LEU F 3 11  ? -23.698 -17.585 -8.270  1.00 38.23 ? 11  LEU B O     1 
ATOM   5095 C  CB    . LEU F 3 11  ? -20.795 -16.212 -8.058  1.00 36.84 ? 11  LEU B CB    1 
ATOM   5096 C  CG    . LEU F 3 11  ? -20.401 -14.765 -8.351  1.00 36.75 ? 11  LEU B CG    1 
ATOM   5097 C  CD1   . LEU F 3 11  ? -19.253 -14.730 -9.347  1.00 37.51 ? 11  LEU B CD1   1 
ATOM   5098 C  CD2   . LEU F 3 11  ? -21.594 -14.019 -8.907  1.00 35.51 ? 11  LEU B CD2   1 
ATOM   5099 N  N     . ASN F 3 12  ? -22.293 -18.810 -7.030  1.00 38.60 ? 12  ASN B N     1 
ATOM   5100 C  CA    . ASN F 3 12  ? -22.980 -20.050 -7.325  1.00 39.93 ? 12  ASN B CA    1 
ATOM   5101 C  C     . ASN F 3 12  ? -22.596 -21.111 -6.312  1.00 40.65 ? 12  ASN B C     1 
ATOM   5102 O  O     . ASN F 3 12  ? -21.647 -20.942 -5.543  1.00 40.61 ? 12  ASN B O     1 
ATOM   5103 C  CB    . ASN F 3 12  ? -22.691 -20.535 -8.756  1.00 40.67 ? 12  ASN B CB    1 
ATOM   5104 C  CG    . ASN F 3 12  ? -21.221 -20.824 -9.008  1.00 41.01 ? 12  ASN B CG    1 
ATOM   5105 O  OD1   . ASN F 3 12  ? -20.561 -21.512 -8.229  1.00 41.39 ? 12  ASN B OD1   1 
ATOM   5106 N  ND2   . ASN F 3 12  ? -20.708 -20.313 -10.119 1.00 40.73 ? 12  ASN B ND2   1 
ATOM   5107 N  N     . GLU F 3 13  ? -23.354 -22.200 -6.316  1.00 41.65 ? 13  GLU B N     1 
ATOM   5108 C  CA    . GLU F 3 13  ? -23.138 -23.306 -5.394  1.00 42.99 ? 13  GLU B CA    1 
ATOM   5109 C  C     . GLU F 3 13  ? -21.670 -23.655 -5.230  1.00 42.56 ? 13  GLU B C     1 
ATOM   5110 O  O     . GLU F 3 13  ? -21.154 -23.719 -4.110  1.00 43.30 ? 13  GLU B O     1 
ATOM   5111 C  CB    . GLU F 3 13  ? -23.906 -24.548 -5.873  1.00 45.61 ? 13  GLU B CB    1 
ATOM   5112 C  CG    . GLU F 3 13  ? -25.299 -24.224 -6.480  1.00 49.45 ? 13  GLU B CG    1 
ATOM   5113 C  CD    . GLU F 3 13  ? -25.352 -24.424 -8.003  1.00 51.40 ? 13  GLU B CD    1 
ATOM   5114 O  OE1   . GLU F 3 13  ? -24.277 -24.660 -8.601  1.00 52.12 ? 13  GLU B OE1   1 
ATOM   5115 O  OE2   . GLU F 3 13  ? -26.463 -24.358 -8.588  1.00 51.95 ? 13  GLU B OE2   1 
ATOM   5116 N  N     . LYS F 3 14  ? -21.003 -23.892 -6.350  1.00 41.28 ? 14  LYS B N     1 
ATOM   5117 C  CA    . LYS F 3 14  ? -19.598 -24.269 -6.343  1.00 40.56 ? 14  LYS B CA    1 
ATOM   5118 C  C     . LYS F 3 14  ? -18.720 -23.475 -5.377  1.00 39.58 ? 14  LYS B C     1 
ATOM   5119 O  O     . LYS F 3 14  ? -17.921 -24.060 -4.655  1.00 39.01 ? 14  LYS B O     1 
ATOM   5120 C  CB    . LYS F 3 14  ? -19.064 -24.180 -7.770  1.00 41.38 ? 14  LYS B CB    1 
ATOM   5121 C  CG    . LYS F 3 14  ? -20.029 -24.824 -8.755  1.00 42.61 ? 14  LYS B CG    1 
ATOM   5122 C  CD    . LYS F 3 14  ? -19.485 -24.905 -10.168 1.00 44.43 ? 14  LYS B CD    1 
ATOM   5123 C  CE    . LYS F 3 14  ? -20.532 -25.505 -11.107 1.00 44.39 ? 14  LYS B CE    1 
ATOM   5124 N  NZ    . LYS F 3 14  ? -19.957 -25.858 -12.431 1.00 44.94 ? 14  LYS B NZ    1 
ATOM   5125 N  N     . GLN F 3 15  ? -18.873 -22.152 -5.358  1.00 39.19 ? 15  GLN B N     1 
ATOM   5126 C  CA    . GLN F 3 15  ? -18.079 -21.300 -4.471  1.00 38.82 ? 15  GLN B CA    1 
ATOM   5127 C  C     . GLN F 3 15  ? -18.139 -21.725 -3.002  1.00 38.49 ? 15  GLN B C     1 
ATOM   5128 O  O     . GLN F 3 15  ? -19.087 -22.383 -2.569  1.00 39.32 ? 15  GLN B O     1 
ATOM   5129 C  CB    . GLN F 3 15  ? -18.531 -19.844 -4.567  1.00 39.46 ? 15  GLN B CB    1 
ATOM   5130 C  CG    . GLN F 3 15  ? -18.285 -19.178 -5.896  1.00 41.60 ? 15  GLN B CG    1 
ATOM   5131 C  CD    . GLN F 3 15  ? -18.070 -17.670 -5.758  1.00 42.57 ? 15  GLN B CD    1 
ATOM   5132 O  OE1   . GLN F 3 15  ? -18.813 -16.874 -6.306  1.00 43.89 ? 15  GLN B OE1   1 
ATOM   5133 N  NE2   . GLN F 3 15  ? -17.042 -17.284 -5.030  1.00 44.12 ? 15  GLN B NE2   1 
ATOM   5134 N  N     . VAL F 3 16  ? -17.109 -21.346 -2.251  1.00 36.67 ? 16  VAL B N     1 
ATOM   5135 C  CA    . VAL F 3 16  ? -17.003 -21.644 -0.827  1.00 35.99 ? 16  VAL B CA    1 
ATOM   5136 C  C     . VAL F 3 16  ? -16.490 -20.362 -0.175  1.00 35.96 ? 16  VAL B C     1 
ATOM   5137 O  O     . VAL F 3 16  ? -15.936 -19.509 -0.855  1.00 37.47 ? 16  VAL B O     1 
ATOM   5138 C  CB    . VAL F 3 16  ? -15.986 -22.767 -0.567  1.00 36.06 ? 16  VAL B CB    1 
ATOM   5139 C  CG1   . VAL F 3 16  ? -16.408 -24.034 -1.293  1.00 35.08 ? 16  VAL B CG1   1 
ATOM   5140 C  CG2   . VAL F 3 16  ? -14.604 -22.319 -1.025  1.00 35.15 ? 16  VAL B CG2   1 
ATOM   5141 N  N     . PRO F 3 17  ? -16.653 -20.212 1.149   1.00 35.28 ? 17  PRO B N     1 
ATOM   5142 C  CA    . PRO F 3 17  ? -16.212 -19.025 1.905   1.00 34.73 ? 17  PRO B CA    1 
ATOM   5143 C  C     . PRO F 3 17  ? -14.678 -18.941 2.184   1.00 33.06 ? 17  PRO B C     1 
ATOM   5144 O  O     . PRO F 3 17  ? -14.057 -19.976 2.407   1.00 31.30 ? 17  PRO B O     1 
ATOM   5145 C  CB    . PRO F 3 17  ? -17.031 -19.148 3.190   1.00 34.84 ? 17  PRO B CB    1 
ATOM   5146 C  CG    . PRO F 3 17  ? -17.005 -20.646 3.424   1.00 35.07 ? 17  PRO B CG    1 
ATOM   5147 C  CD    . PRO F 3 17  ? -17.314 -21.189 2.037   1.00 35.46 ? 17  PRO B CD    1 
ATOM   5148 N  N     . ASN F 3 18  ? -14.068 -17.743 2.168   1.00 32.86 ? 18  ASN B N     1 
ATOM   5149 C  CA    . ASN F 3 18  ? -12.636 -17.652 2.471   1.00 33.34 ? 18  ASN B CA    1 
ATOM   5150 C  C     . ASN F 3 18  ? -12.494 -17.852 3.953   1.00 32.85 ? 18  ASN B C     1 
ATOM   5151 O  O     . ASN F 3 18  ? -13.369 -18.362 4.675   1.00 32.61 ? 18  ASN B O     1 
ATOM   5152 C  CB    . ASN F 3 18  ? -11.943 -16.273 2.374   1.00 34.28 ? 18  ASN B CB    1 
ATOM   5153 C  CG    . ASN F 3 18  ? -12.271 -15.486 1.170   1.00 35.64 ? 18  ASN B CG    1 
ATOM   5154 O  OD1   . ASN F 3 18  ? -12.394 -15.992 0.079   1.00 37.28 ? 18  ASN B OD1   1 
ATOM   5155 N  ND2   . ASN F 3 18  ? -12.376 -14.186 1.365   1.00 38.05 ? 18  ASN B ND2   1 
ATOM   5156 N  N     . SER F 3 19  ? -11.347 -17.313 4.352   1.00 32.15 ? 19  SER B N     1 
ATOM   5157 C  CA    . SER F 3 19  ? -10.845 -17.218 5.692   1.00 31.41 ? 19  SER B CA    1 
ATOM   5158 C  C     . SER F 3 19  ? -11.395 -15.888 6.199   1.00 30.07 ? 19  SER B C     1 
ATOM   5159 O  O     . SER F 3 19  ? -11.200 -15.527 7.347   1.00 31.24 ? 19  SER B O     1 
ATOM   5160 C  CB    . SER F 3 19  ? -9.321  -17.154 5.646   1.00 31.49 ? 19  SER B CB    1 
ATOM   5161 O  OG    . SER F 3 19  ? -8.759  -18.399 5.266   1.00 33.64 ? 19  SER B OG    1 
ATOM   5162 N  N     . GLU F 3 20  ? -12.079 -15.148 5.336   1.00 28.57 ? 20  GLU B N     1 
ATOM   5163 C  CA    . GLU F 3 20  ? -12.634 -13.868 5.746   1.00 26.51 ? 20  GLU B CA    1 
ATOM   5164 C  C     . GLU F 3 20  ? -14.145 -13.879 5.639   1.00 25.98 ? 20  GLU B C     1 
ATOM   5165 O  O     . GLU F 3 20  ? -14.810 -12.900 5.953   1.00 25.62 ? 20  GLU B O     1 
ATOM   5166 C  CB    . GLU F 3 20  ? -12.068 -12.736 4.886   1.00 27.37 ? 20  GLU B CB    1 
ATOM   5167 C  CG    . GLU F 3 20  ? -10.677 -12.261 5.272   1.00 27.60 ? 20  GLU B CG    1 
ATOM   5168 C  CD    . GLU F 3 20  ? -10.641 -11.595 6.639   1.00 28.52 ? 20  GLU B CD    1 
ATOM   5169 O  OE1   . GLU F 3 20  ? -9.956  -10.559 6.775   1.00 28.14 ? 20  GLU B OE1   1 
ATOM   5170 O  OE2   . GLU F 3 20  ? -11.284 -12.113 7.580   1.00 29.37 ? 20  GLU B OE2   1 
ATOM   5171 N  N     . GLY F 3 21  ? -14.689 -14.992 5.181   1.00 26.56 ? 21  GLY B N     1 
ATOM   5172 C  CA    . GLY F 3 21  ? -16.127 -15.086 5.052   1.00 27.86 ? 21  GLY B CA    1 
ATOM   5173 C  C     . GLY F 3 21  ? -16.657 -14.792 3.667   1.00 29.04 ? 21  GLY B C     1 
ATOM   5174 O  O     . GLY F 3 21  ? -17.784 -15.162 3.364   1.00 30.52 ? 21  GLY B O     1 
ATOM   5175 N  N     . CYS F 3 22  ? -15.863 -14.130 2.827   1.00 29.74 ? 22  CYS B N     1 
ATOM   5176 C  CA    . CYS F 3 22  ? -16.293 -13.806 1.470   1.00 29.81 ? 22  CYS B CA    1 
ATOM   5177 C  C     . CYS F 3 22  ? -16.116 -15.002 0.573   1.00 30.14 ? 22  CYS B C     1 
ATOM   5178 O  O     . CYS F 3 22  ? -15.281 -15.847 0.836   1.00 31.70 ? 22  CYS B O     1 
ATOM   5179 C  CB    . CYS F 3 22  ? -15.514 -12.616 0.937   1.00 29.93 ? 22  CYS B CB    1 
ATOM   5180 S  SG    . CYS F 3 22  ? -15.953 -11.117 1.808   1.00 27.11 ? 22  CYS B SG    1 
ATOM   5181 N  N     . TYR F 3 23  ? -16.888 -15.073 -0.500  1.00 31.30 ? 23  TYR B N     1 
ATOM   5182 C  CA    . TYR F 3 23  ? -16.823 -16.239 -1.372  1.00 32.37 ? 23  TYR B CA    1 
ATOM   5183 C  C     . TYR F 3 23  ? -15.860 -16.284 -2.554  1.00 31.77 ? 23  TYR B C     1 
ATOM   5184 O  O     . TYR F 3 23  ? -15.686 -15.311 -3.293  1.00 32.22 ? 23  TYR B O     1 
ATOM   5185 C  CB    . TYR F 3 23  ? -18.234 -16.575 -1.861  1.00 33.78 ? 23  TYR B CB    1 
ATOM   5186 C  CG    . TYR F 3 23  ? -19.107 -17.127 -0.760  1.00 36.54 ? 23  TYR B CG    1 
ATOM   5187 C  CD1   . TYR F 3 23  ? -19.541 -16.316 0.295   1.00 37.20 ? 23  TYR B CD1   1 
ATOM   5188 C  CD2   . TYR F 3 23  ? -19.465 -18.474 -0.746  1.00 37.82 ? 23  TYR B CD2   1 
ATOM   5189 C  CE1   . TYR F 3 23  ? -20.308 -16.842 1.340   1.00 37.70 ? 23  TYR B CE1   1 
ATOM   5190 C  CE2   . TYR F 3 23  ? -20.227 -19.009 0.290   1.00 38.05 ? 23  TYR B CE2   1 
ATOM   5191 C  CZ    . TYR F 3 23  ? -20.646 -18.194 1.327   1.00 38.61 ? 23  TYR B CZ    1 
ATOM   5192 O  OH    . TYR F 3 23  ? -21.392 -18.750 2.347   1.00 38.75 ? 23  TYR B OH    1 
ATOM   5193 N  N     . VAL F 3 24  ? -15.241 -17.449 -2.713  1.00 30.75 ? 24  VAL B N     1 
ATOM   5194 C  CA    . VAL F 3 24  ? -14.311 -17.715 -3.804  1.00 30.30 ? 24  VAL B CA    1 
ATOM   5195 C  C     . VAL F 3 24  ? -14.483 -19.166 -4.240  1.00 30.47 ? 24  VAL B C     1 
ATOM   5196 O  O     . VAL F 3 24  ? -15.330 -19.892 -3.720  1.00 31.37 ? 24  VAL B O     1 
ATOM   5197 C  CB    . VAL F 3 24  ? -12.852 -17.501 -3.373  1.00 29.21 ? 24  VAL B CB    1 
ATOM   5198 C  CG1   . VAL F 3 24  ? -12.635 -16.047 -2.984  1.00 28.12 ? 24  VAL B CG1   1 
ATOM   5199 C  CG2   . VAL F 3 24  ? -12.521 -18.423 -2.220  1.00 29.70 ? 24  VAL B CG2   1 
ATOM   5200 N  N     . TRP F 3 25  ? -13.690 -19.590 -5.208  1.00 30.36 ? 25  TRP B N     1 
ATOM   5201 C  CA    . TRP F 3 25  ? -13.774 -20.962 -5.673  1.00 31.08 ? 25  TRP B CA    1 
ATOM   5202 C  C     . TRP F 3 25  ? -12.662 -21.765 -5.045  1.00 31.37 ? 25  TRP B C     1 
ATOM   5203 O  O     . TRP F 3 25  ? -11.706 -21.214 -4.522  1.00 32.16 ? 25  TRP B O     1 
ATOM   5204 C  CB    . TRP F 3 25  ? -13.654 -21.028 -7.194  1.00 29.84 ? 25  TRP B CB    1 
ATOM   5205 C  CG    . TRP F 3 25  ? -14.917 -20.708 -7.873  1.00 30.35 ? 25  TRP B CG    1 
ATOM   5206 C  CD1   . TRP F 3 25  ? -16.028 -21.503 -7.945  1.00 30.51 ? 25  TRP B CD1   1 
ATOM   5207 C  CD2   . TRP F 3 25  ? -15.243 -19.502 -8.559  1.00 30.02 ? 25  TRP B CD2   1 
ATOM   5208 N  NE1   . TRP F 3 25  ? -17.022 -20.869 -8.641  1.00 31.09 ? 25  TRP B NE1   1 
ATOM   5209 C  CE2   . TRP F 3 25  ? -16.563 -19.635 -9.034  1.00 29.72 ? 25  TRP B CE2   1 
ATOM   5210 C  CE3   . TRP F 3 25  ? -14.543 -18.324 -8.841  1.00 29.48 ? 25  TRP B CE3   1 
ATOM   5211 C  CZ2   . TRP F 3 25  ? -17.203 -18.624 -9.743  1.00 28.59 ? 25  TRP B CZ2   1 
ATOM   5212 C  CZ3   . TRP F 3 25  ? -15.178 -17.331 -9.544  1.00 28.03 ? 25  TRP B CZ3   1 
ATOM   5213 C  CH2   . TRP F 3 25  ? -16.484 -17.485 -9.993  1.00 28.95 ? 25  TRP B CH2   1 
ATOM   5214 N  N     . GLN F 3 26  ? -12.798 -23.078 -5.074  1.00 31.91 ? 26  GLN B N     1 
ATOM   5215 C  CA    . GLN F 3 26  ? -11.762 -23.907 -4.534  1.00 32.61 ? 26  GLN B CA    1 
ATOM   5216 C  C     . GLN F 3 26  ? -10.871 -24.380 -5.666  1.00 32.31 ? 26  GLN B C     1 
ATOM   5217 O  O     . GLN F 3 26  ? -11.298 -25.115 -6.562  1.00 32.38 ? 26  GLN B O     1 
ATOM   5218 C  CB    . GLN F 3 26  ? -12.349 -25.095 -3.792  1.00 34.06 ? 26  GLN B CB    1 
ATOM   5219 C  CG    . GLN F 3 26  ? -11.282 -25.906 -3.087  1.00 38.34 ? 26  GLN B CG    1 
ATOM   5220 C  CD    . GLN F 3 26  ? -11.855 -26.845 -2.038  1.00 41.02 ? 26  GLN B CD    1 
ATOM   5221 O  OE1   . GLN F 3 26  ? -11.101 -27.476 -1.316  1.00 43.19 ? 26  GLN B OE1   1 
ATOM   5222 N  NE2   . GLN F 3 26  ? -13.188 -26.931 -1.941  1.00 42.42 ? 26  GLN B NE2   1 
ATOM   5223 N  N     . VAL F 3 27  ? -9.624  -23.935 -5.616  1.00 32.39 ? 27  VAL B N     1 
ATOM   5224 C  CA    . VAL F 3 27  ? -8.618  -24.308 -6.593  1.00 31.83 ? 27  VAL B CA    1 
ATOM   5225 C  C     . VAL F 3 27  ? -8.691  -25.815 -6.847  1.00 30.59 ? 27  VAL B C     1 
ATOM   5226 O  O     . VAL F 3 27  ? -8.953  -26.583 -5.926  1.00 30.50 ? 27  VAL B O     1 
ATOM   5227 C  CB    . VAL F 3 27  ? -7.223  -23.940 -6.046  1.00 31.70 ? 27  VAL B CB    1 
ATOM   5228 C  CG1   . VAL F 3 27  ? -6.178  -24.951 -6.478  1.00 33.40 ? 27  VAL B CG1   1 
ATOM   5229 C  CG2   . VAL F 3 27  ? -6.839  -22.604 -6.564  1.00 32.80 ? 27  VAL B CG2   1 
ATOM   5230 N  N     . SER F 3 28  ? -8.464  -26.244 -8.086  1.00 28.61 ? 28  SER B N     1 
ATOM   5231 C  CA    . SER F 3 28  ? -8.495  -27.674 -8.376  1.00 27.47 ? 28  SER B CA    1 
ATOM   5232 C  C     . SER F 3 28  ? -7.368  -28.313 -7.561  1.00 29.11 ? 28  SER B C     1 
ATOM   5233 O  O     . SER F 3 28  ? -6.335  -27.679 -7.307  1.00 27.97 ? 28  SER B O     1 
ATOM   5234 C  CB    . SER F 3 28  ? -8.270  -27.948 -9.870  1.00 26.33 ? 28  SER B CB    1 
ATOM   5235 O  OG    . SER F 3 28  ? -6.891  -28.075 -10.186 1.00 23.20 ? 28  SER B OG    1 
ATOM   5236 N  N     . ASP F 3 29  ? -7.571  -29.560 -7.139  1.00 29.69 ? 29  ASP B N     1 
ATOM   5237 C  CA    . ASP F 3 29  ? -6.576  -30.257 -6.340  1.00 29.68 ? 29  ASP B CA    1 
ATOM   5238 C  C     . ASP F 3 29  ? -5.211  -30.311 -7.018  1.00 29.77 ? 29  ASP B C     1 
ATOM   5239 O  O     . ASP F 3 29  ? -4.185  -30.122 -6.361  1.00 30.45 ? 29  ASP B O     1 
ATOM   5240 C  CB    . ASP F 3 29  ? -7.064  -31.665 -5.998  1.00 31.34 ? 29  ASP B CB    1 
ATOM   5241 C  CG    . ASP F 3 29  ? -8.243  -31.655 -5.037  1.00 33.65 ? 29  ASP B CG    1 
ATOM   5242 O  OD1   . ASP F 3 29  ? -8.372  -30.690 -4.248  1.00 35.18 ? 29  ASP B OD1   1 
ATOM   5243 O  OD2   . ASP F 3 29  ? -9.036  -32.621 -5.058  1.00 35.15 ? 29  ASP B OD2   1 
ATOM   5244 N  N     . MET F 3 30  ? -5.200  -30.558 -8.324  1.00 29.48 ? 30  MET B N     1 
ATOM   5245 C  CA    . MET F 3 30  ? -3.957  -30.608 -9.087  1.00 29.38 ? 30  MET B CA    1 
ATOM   5246 C  C     . MET F 3 30  ? -3.215  -29.292 -8.968  1.00 27.75 ? 30  MET B C     1 
ATOM   5247 O  O     . MET F 3 30  ? -1.995  -29.265 -8.785  1.00 27.36 ? 30  MET B O     1 
ATOM   5248 C  CB    . MET F 3 30  ? -4.230  -30.907 -10.570 1.00 31.43 ? 30  MET B CB    1 
ATOM   5249 C  CG    . MET F 3 30  ? -3.964  -32.347 -10.909 1.00 34.75 ? 30  MET B CG    1 
ATOM   5250 S  SD    . MET F 3 30  ? -2.463  -32.876 -10.079 1.00 38.74 ? 30  MET B SD    1 
ATOM   5251 C  CE    . MET F 3 30  ? -2.133  -34.391 -10.977 1.00 36.38 ? 30  MET B CE    1 
ATOM   5252 N  N     . ASN F 3 31  ? -3.956  -28.197 -9.073  1.00 26.31 ? 31  ASN B N     1 
ATOM   5253 C  CA    . ASN F 3 31  ? -3.342  -26.888 -8.966  1.00 26.58 ? 31  ASN B CA    1 
ATOM   5254 C  C     . ASN F 3 31  ? -2.867  -26.612 -7.547  1.00 25.51 ? 31  ASN B C     1 
ATOM   5255 O  O     . ASN F 3 31  ? -1.871  -25.912 -7.348  1.00 24.64 ? 31  ASN B O     1 
ATOM   5256 C  CB    . ASN F 3 31  ? -4.307  -25.804 -9.445  1.00 27.54 ? 31  ASN B CB    1 
ATOM   5257 C  CG    . ASN F 3 31  ? -4.356  -25.717 -10.950 1.00 29.60 ? 31  ASN B CG    1 
ATOM   5258 O  OD1   . ASN F 3 31  ? -4.159  -24.671 -11.530 1.00 32.49 ? 31  ASN B OD1   1 
ATOM   5259 N  ND2   . ASN F 3 31  ? -4.612  -26.831 -11.589 1.00 33.33 ? 31  ASN B ND2   1 
ATOM   5260 N  N     . ARG F 3 32  ? -3.568  -27.169 -6.565  1.00 24.65 ? 32  ARG B N     1 
ATOM   5261 C  CA    . ARG F 3 32  ? -3.158  -26.967 -5.196  1.00 22.81 ? 32  ARG B CA    1 
ATOM   5262 C  C     . ARG F 3 32  ? -1.903  -27.785 -4.945  1.00 20.65 ? 32  ARG B C     1 
ATOM   5263 O  O     . ARG F 3 32  ? -1.115  -27.473 -4.058  1.00 19.35 ? 32  ARG B O     1 
ATOM   5264 C  CB    . ARG F 3 32  ? -4.259  -27.357 -4.212  1.00 23.12 ? 32  ARG B CB    1 
ATOM   5265 C  CG    . ARG F 3 32  ? -3.996  -26.744 -2.844  1.00 22.77 ? 32  ARG B CG    1 
ATOM   5266 C  CD    . ARG F 3 32  ? -5.073  -27.010 -1.822  1.00 22.91 ? 32  ARG B CD    1 
ATOM   5267 N  NE    . ARG F 3 32  ? -4.739  -26.325 -0.575  1.00 21.97 ? 32  ARG B NE    1 
ATOM   5268 C  CZ    . ARG F 3 32  ? -5.506  -26.306 0.508   1.00 20.15 ? 32  ARG B CZ    1 
ATOM   5269 N  NH1   . ARG F 3 32  ? -6.668  -26.935 0.525   1.00 18.41 ? 32  ARG B NH1   1 
ATOM   5270 N  NH2   . ARG F 3 32  ? -5.108  -25.641 1.577   1.00 20.63 ? 32  ARG B NH2   1 
ATOM   5271 N  N     . LEU F 3 33  ? -1.714  -28.832 -5.730  1.00 19.76 ? 33  LEU B N     1 
ATOM   5272 C  CA    . LEU F 3 33  ? -0.517  -29.634 -5.575  1.00 21.07 ? 33  LEU B CA    1 
ATOM   5273 C  C     . LEU F 3 33  ? 0.651   -28.733 -5.946  1.00 21.69 ? 33  LEU B C     1 
ATOM   5274 O  O     . LEU F 3 33  ? 1.667   -28.684 -5.248  1.00 22.23 ? 33  LEU B O     1 
ATOM   5275 C  CB    . LEU F 3 33  ? -0.538  -30.845 -6.509  1.00 21.09 ? 33  LEU B CB    1 
ATOM   5276 C  CG    . LEU F 3 33  ? 0.780   -31.636 -6.584  1.00 21.30 ? 33  LEU B CG    1 
ATOM   5277 C  CD1   . LEU F 3 33  ? 1.041   -32.344 -5.250  1.00 19.30 ? 33  LEU B CD1   1 
ATOM   5278 C  CD2   . LEU F 3 33  ? 0.707   -32.643 -7.726  1.00 19.57 ? 33  LEU B CD2   1 
ATOM   5279 N  N     . ARG F 3 34  ? 0.503   -28.003 -7.045  1.00 22.02 ? 34  ARG B N     1 
ATOM   5280 C  CA    . ARG F 3 34  ? 1.576   -27.122 -7.486  1.00 22.29 ? 34  ARG B CA    1 
ATOM   5281 C  C     . ARG F 3 34  ? 1.832   -26.011 -6.492  1.00 21.10 ? 34  ARG B C     1 
ATOM   5282 O  O     . ARG F 3 34  ? 2.978   -25.710 -6.187  1.00 22.41 ? 34  ARG B O     1 
ATOM   5283 C  CB    . ARG F 3 34  ? 1.268   -26.577 -8.887  1.00 24.77 ? 34  ARG B CB    1 
ATOM   5284 C  CG    . ARG F 3 34  ? 0.862   -27.750 -9.767  1.00 27.20 ? 34  ARG B CG    1 
ATOM   5285 C  CD    . ARG F 3 34  ? 1.272   -27.710 -11.187 1.00 28.00 ? 34  ARG B CD    1 
ATOM   5286 N  NE    . ARG F 3 34  ? 0.187   -27.568 -12.125 1.00 29.18 ? 34  ARG B NE    1 
ATOM   5287 C  CZ    . ARG F 3 34  ? -0.843  -28.321 -12.501 1.00 30.28 ? 34  ARG B CZ    1 
ATOM   5288 N  NH1   . ARG F 3 34  ? -1.592  -27.745 -13.416 1.00 33.31 ? 34  ARG B NH1   1 
ATOM   5289 N  NH2   . ARG F 3 34  ? -1.148  -29.535 -12.086 1.00 32.90 ? 34  ARG B NH2   1 
ATOM   5290 N  N     . ARG F 3 35  ? 0.773   -25.400 -5.982  1.00 19.87 ? 35  ARG B N     1 
ATOM   5291 C  CA    . ARG F 3 35  ? 0.943   -24.342 -4.994  1.00 19.30 ? 35  ARG B CA    1 
ATOM   5292 C  C     . ARG F 3 35  ? 1.791   -24.907 -3.863  1.00 19.67 ? 35  ARG B C     1 
ATOM   5293 O  O     . ARG F 3 35  ? 2.779   -24.307 -3.439  1.00 21.13 ? 35  ARG B O     1 
ATOM   5294 C  CB    . ARG F 3 35  ? -0.404  -23.901 -4.423  1.00 18.64 ? 35  ARG B CB    1 
ATOM   5295 C  CG    . ARG F 3 35  ? -1.316  -23.218 -5.418  1.00 18.72 ? 35  ARG B CG    1 
ATOM   5296 C  CD    . ARG F 3 35  ? -2.588  -22.749 -4.743  1.00 17.51 ? 35  ARG B CD    1 
ATOM   5297 N  NE    . ARG F 3 35  ? -3.346  -21.842 -5.594  1.00 18.71 ? 35  ARG B NE    1 
ATOM   5298 C  CZ    . ARG F 3 35  ? -4.441  -21.201 -5.200  1.00 17.96 ? 35  ARG B CZ    1 
ATOM   5299 N  NH1   . ARG F 3 35  ? -4.891  -21.379 -3.972  1.00 19.39 ? 35  ARG B NH1   1 
ATOM   5300 N  NH2   . ARG F 3 35  ? -5.086  -20.386 -6.024  1.00 17.87 ? 35  ARG B NH2   1 
ATOM   5301 N  N     . PHE F 3 36  ? 1.392   -26.080 -3.389  1.00 19.16 ? 36  PHE B N     1 
ATOM   5302 C  CA    . PHE F 3 36  ? 2.079   -26.768 -2.310  1.00 17.56 ? 36  PHE B CA    1 
ATOM   5303 C  C     . PHE F 3 36  ? 3.543   -27.037 -2.619  1.00 17.03 ? 36  PHE B C     1 
ATOM   5304 O  O     . PHE F 3 36  ? 4.409   -26.807 -1.782  1.00 17.74 ? 36  PHE B O     1 
ATOM   5305 C  CB    . PHE F 3 36  ? 1.381   -28.100 -2.009  1.00 17.36 ? 36  PHE B CB    1 
ATOM   5306 C  CG    . PHE F 3 36  ? 2.016   -28.874 -0.900  1.00 17.41 ? 36  PHE B CG    1 
ATOM   5307 C  CD1   . PHE F 3 36  ? 2.595   -30.117 -1.145  1.00 17.88 ? 36  PHE B CD1   1 
ATOM   5308 C  CD2   . PHE F 3 36  ? 2.072   -28.341 0.389   1.00 17.79 ? 36  PHE B CD2   1 
ATOM   5309 C  CE1   . PHE F 3 36  ? 3.230   -30.828 -0.124  1.00 18.27 ? 36  PHE B CE1   1 
ATOM   5310 C  CE2   . PHE F 3 36  ? 2.701   -29.034 1.424   1.00 18.29 ? 36  PHE B CE2   1 
ATOM   5311 C  CZ    . PHE F 3 36  ? 3.284   -30.284 1.168   1.00 19.27 ? 36  PHE B CZ    1 
ATOM   5312 N  N     . LEU F 3 37  ? 3.822   -27.534 -3.818  1.00 17.06 ? 37  LEU B N     1 
ATOM   5313 C  CA    . LEU F 3 37  ? 5.194   -27.843 -4.181  1.00 16.86 ? 37  LEU B CA    1 
ATOM   5314 C  C     . LEU F 3 37  ? 6.072   -26.616 -4.114  1.00 17.54 ? 37  LEU B C     1 
ATOM   5315 O  O     . LEU F 3 37  ? 7.229   -26.711 -3.719  1.00 17.98 ? 37  LEU B O     1 
ATOM   5316 C  CB    . LEU F 3 37  ? 5.258   -28.460 -5.582  1.00 15.71 ? 37  LEU B CB    1 
ATOM   5317 C  CG    . LEU F 3 37  ? 4.693   -29.879 -5.728  1.00 15.73 ? 37  LEU B CG    1 
ATOM   5318 C  CD1   . LEU F 3 37  ? 4.804   -30.319 -7.175  1.00 13.24 ? 37  LEU B CD1   1 
ATOM   5319 C  CD2   . LEU F 3 37  ? 5.446   -30.857 -4.820  1.00 12.67 ? 37  LEU B CD2   1 
ATOM   5320 N  N     . CYS F 3 38  ? 5.514   -25.462 -4.470  1.00 18.06 ? 38  CYS B N     1 
ATOM   5321 C  CA    . CYS F 3 38  ? 6.267   -24.209 -4.470  1.00 19.52 ? 38  CYS B CA    1 
ATOM   5322 C  C     . CYS F 3 38  ? 6.348   -23.469 -3.143  1.00 19.81 ? 38  CYS B C     1 
ATOM   5323 O  O     . CYS F 3 38  ? 7.398   -22.927 -2.799  1.00 19.48 ? 38  CYS B O     1 
ATOM   5324 C  CB    . CYS F 3 38  ? 5.691   -23.256 -5.514  1.00 20.91 ? 38  CYS B CB    1 
ATOM   5325 S  SG    . CYS F 3 38  ? 5.837   -23.856 -7.193  1.00 25.07 ? 38  CYS B SG    1 
ATOM   5326 N  N     . PHE F 3 39  ? 5.247   -23.455 -2.400  1.00 20.13 ? 39  PHE B N     1 
ATOM   5327 C  CA    . PHE F 3 39  ? 5.186   -22.737 -1.135  1.00 22.00 ? 39  PHE B CA    1 
ATOM   5328 C  C     . PHE F 3 39  ? 5.198   -23.566 0.149   1.00 23.80 ? 39  PHE B C     1 
ATOM   5329 O  O     . PHE F 3 39  ? 5.485   -23.040 1.222   1.00 24.57 ? 39  PHE B O     1 
ATOM   5330 C  CB    . PHE F 3 39  ? 3.947   -21.837 -1.132  1.00 22.20 ? 39  PHE B CB    1 
ATOM   5331 C  CG    . PHE F 3 39  ? 3.947   -20.793 -2.219  1.00 21.93 ? 39  PHE B CG    1 
ATOM   5332 C  CD1   . PHE F 3 39  ? 2.974   -20.804 -3.214  1.00 21.83 ? 39  PHE B CD1   1 
ATOM   5333 C  CD2   . PHE F 3 39  ? 4.887   -19.766 -2.217  1.00 22.26 ? 39  PHE B CD2   1 
ATOM   5334 C  CE1   . PHE F 3 39  ? 2.930   -19.800 -4.195  1.00 21.75 ? 39  PHE B CE1   1 
ATOM   5335 C  CE2   . PHE F 3 39  ? 4.850   -18.763 -3.189  1.00 22.16 ? 39  PHE B CE2   1 
ATOM   5336 C  CZ    . PHE F 3 39  ? 3.868   -18.780 -4.177  1.00 21.40 ? 39  PHE B CZ    1 
ATOM   5337 N  N     . GLY F 3 40  ? 4.877   -24.850 0.056   1.00 25.88 ? 40  GLY B N     1 
ATOM   5338 C  CA    . GLY F 3 40  ? 4.866   -25.685 1.247   1.00 27.06 ? 40  GLY B CA    1 
ATOM   5339 C  C     . GLY F 3 40  ? 3.869   -25.184 2.270   1.00 28.75 ? 40  GLY B C     1 
ATOM   5340 O  O     . GLY F 3 40  ? 2.877   -24.559 1.904   1.00 29.93 ? 40  GLY B O     1 
ATOM   5341 N  N     . SER F 3 41  ? 4.119   -25.440 3.552   1.00 30.55 ? 41  SER B N     1 
ATOM   5342 C  CA    . SER F 3 41  ? 3.200   -24.985 4.592   1.00 31.96 ? 41  SER B CA    1 
ATOM   5343 C  C     . SER F 3 41  ? 3.833   -24.443 5.876   1.00 32.09 ? 41  SER B C     1 
ATOM   5344 O  O     . SER F 3 41  ? 3.143   -24.317 6.884   1.00 32.73 ? 41  SER B O     1 
ATOM   5345 C  CB    . SER F 3 41  ? 2.203   -26.101 4.938   1.00 33.25 ? 41  SER B CB    1 
ATOM   5346 O  OG    . SER F 3 41  ? 2.701   -27.367 4.515   1.00 36.30 ? 41  SER B OG    1 
ATOM   5347 N  N     . GLU F 3 42  ? 5.124   -24.122 5.853   1.00 32.68 ? 42  GLU B N     1 
ATOM   5348 C  CA    . GLU F 3 42  ? 5.754   -23.552 7.035   1.00 32.93 ? 42  GLU B CA    1 
ATOM   5349 C  C     . GLU F 3 42  ? 5.155   -22.185 7.290   1.00 32.54 ? 42  GLU B C     1 
ATOM   5350 O  O     . GLU F 3 42  ? 4.935   -21.425 6.350   1.00 33.11 ? 42  GLU B O     1 
ATOM   5351 C  CB    . GLU F 3 42  ? 7.240   -23.359 6.821   1.00 35.06 ? 42  GLU B CB    1 
ATOM   5352 C  CG    . GLU F 3 42  ? 8.026   -24.597 6.471   1.00 38.32 ? 42  GLU B CG    1 
ATOM   5353 C  CD    . GLU F 3 42  ? 9.460   -24.260 6.167   1.00 40.54 ? 42  GLU B CD    1 
ATOM   5354 O  OE1   . GLU F 3 42  ? 9.835   -23.947 5.180   1.00 42.73 ? 42  GLU B OE1   1 
ATOM   5355 O  OE2   . GLU F 3 42  ? 10.386  -24.208 6.844   1.00 41.41 ? 42  GLU B OE2   1 
ATOM   5356 N  N     . GLY F 3 43  ? 4.883   -21.879 8.555   1.00 31.45 ? 43  GLY B N     1 
ATOM   5357 C  CA    . GLY F 3 43  ? 4.320   -20.588 8.897   1.00 29.24 ? 43  GLY B CA    1 
ATOM   5358 C  C     . GLY F 3 43  ? 2.898   -20.363 8.417   1.00 27.48 ? 43  GLY B C     1 
ATOM   5359 O  O     . GLY F 3 43  ? 2.262   -19.360 8.766   1.00 28.83 ? 43  GLY B O     1 
ATOM   5360 N  N     . GLY F 3 44  ? 2.392   -21.299 7.628   1.00 24.51 ? 44  GLY B N     1 
ATOM   5361 C  CA    . GLY F 3 44  ? 1.044   -21.171 7.121   1.00 22.19 ? 44  GLY B CA    1 
ATOM   5362 C  C     . GLY F 3 44  ? 0.868   -19.871 6.373   1.00 20.60 ? 44  GLY B C     1 
ATOM   5363 O  O     . GLY F 3 44  ? 1.830   -19.305 5.847   1.00 20.26 ? 44  GLY B O     1 
ATOM   5364 N  N     . THR F 3 45  ? -0.370  -19.403 6.311   1.00 19.15 ? 45  THR B N     1 
ATOM   5365 C  CA    . THR F 3 45  ? -0.674  -18.153 5.651   1.00 17.55 ? 45  THR B CA    1 
ATOM   5366 C  C     . THR F 3 45  ? -1.084  -17.183 6.742   1.00 18.42 ? 45  THR B C     1 
ATOM   5367 O  O     . THR F 3 45  ? -1.043  -17.501 7.931   1.00 18.02 ? 45  THR B O     1 
ATOM   5368 C  CB    . THR F 3 45  ? -1.843  -18.283 4.647   1.00 17.46 ? 45  THR B CB    1 
ATOM   5369 O  OG1   . THR F 3 45  ? -3.094  -18.345 5.354   1.00 17.10 ? 45  THR B OG1   1 
ATOM   5370 C  CG2   . THR F 3 45  ? -1.676  -19.533 3.810   1.00 16.34 ? 45  THR B CG2   1 
ATOM   5371 N  N     . TYR F 3 46  ? -1.479  -15.993 6.318   1.00 19.22 ? 46  TYR B N     1 
ATOM   5372 C  CA    . TYR F 3 46  ? -1.917  -14.949 7.222   1.00 19.39 ? 46  TYR B CA    1 
ATOM   5373 C  C     . TYR F 3 46  ? -3.140  -15.398 8.030   1.00 21.24 ? 46  TYR B C     1 
ATOM   5374 O  O     . TYR F 3 46  ? -3.287  -15.027 9.197   1.00 23.01 ? 46  TYR B O     1 
ATOM   5375 C  CB    . TYR F 3 46  ? -2.249  -13.709 6.398   1.00 17.18 ? 46  TYR B CB    1 
ATOM   5376 C  CG    . TYR F 3 46  ? -2.623  -12.492 7.196   1.00 16.47 ? 46  TYR B CG    1 
ATOM   5377 C  CD1   . TYR F 3 46  ? -3.922  -12.000 7.169   1.00 15.23 ? 46  TYR B CD1   1 
ATOM   5378 C  CD2   . TYR F 3 46  ? -1.660  -11.793 7.932   1.00 17.11 ? 46  TYR B CD2   1 
ATOM   5379 C  CE1   . TYR F 3 46  ? -4.260  -10.843 7.846   1.00 16.43 ? 46  TYR B CE1   1 
ATOM   5380 C  CE2   . TYR F 3 46  ? -1.981  -10.633 8.616   1.00 16.00 ? 46  TYR B CE2   1 
ATOM   5381 C  CZ    . TYR F 3 46  ? -3.284  -10.158 8.565   1.00 17.24 ? 46  TYR B CZ    1 
ATOM   5382 O  OH    . TYR F 3 46  ? -3.611  -8.991  9.214   1.00 16.51 ? 46  TYR B OH    1 
ATOM   5383 N  N     . TYR F 3 47  ? -4.002  -16.211 7.421   1.00 21.44 ? 47  TYR B N     1 
ATOM   5384 C  CA    . TYR F 3 47  ? -5.214  -16.665 8.091   1.00 21.84 ? 47  TYR B CA    1 
ATOM   5385 C  C     . TYR F 3 47  ? -5.205  -18.100 8.588   1.00 23.54 ? 47  TYR B C     1 
ATOM   5386 O  O     . TYR F 3 47  ? -5.929  -18.443 9.524   1.00 23.48 ? 47  TYR B O     1 
ATOM   5387 C  CB    . TYR F 3 47  ? -6.418  -16.524 7.165   1.00 21.03 ? 47  TYR B CB    1 
ATOM   5388 C  CG    . TYR F 3 47  ? -6.618  -15.156 6.579   1.00 20.90 ? 47  TYR B CG    1 
ATOM   5389 C  CD1   . TYR F 3 47  ? -6.057  -14.817 5.352   1.00 20.15 ? 47  TYR B CD1   1 
ATOM   5390 C  CD2   . TYR F 3 47  ? -7.384  -14.201 7.242   1.00 20.46 ? 47  TYR B CD2   1 
ATOM   5391 C  CE1   . TYR F 3 47  ? -6.258  -13.560 4.796   1.00 20.82 ? 47  TYR B CE1   1 
ATOM   5392 C  CE2   . TYR F 3 47  ? -7.589  -12.939 6.695   1.00 20.91 ? 47  TYR B CE2   1 
ATOM   5393 C  CZ    . TYR F 3 47  ? -7.024  -12.630 5.474   1.00 21.35 ? 47  TYR B CZ    1 
ATOM   5394 O  OH    . TYR F 3 47  ? -7.222  -11.393 4.935   1.00 22.44 ? 47  TYR B OH    1 
ATOM   5395 N  N     . ILE F 3 48  ? -4.401  -18.944 7.958   1.00 24.86 ? 48  ILE B N     1 
ATOM   5396 C  CA    . ILE F 3 48  ? -4.383  -20.350 8.315   1.00 25.20 ? 48  ILE B CA    1 
ATOM   5397 C  C     . ILE F 3 48  ? -3.107  -20.734 9.021   1.00 26.96 ? 48  ILE B C     1 
ATOM   5398 O  O     . ILE F 3 48  ? -2.013  -20.424 8.550   1.00 27.09 ? 48  ILE B O     1 
ATOM   5399 C  CB    . ILE F 3 48  ? -4.559  -21.198 7.047   1.00 24.40 ? 48  ILE B CB    1 
ATOM   5400 C  CG1   . ILE F 3 48  ? -5.812  -20.733 6.295   1.00 23.13 ? 48  ILE B CG1   1 
ATOM   5401 C  CG2   . ILE F 3 48  ? -4.676  -22.665 7.410   1.00 25.12 ? 48  ILE B CG2   1 
ATOM   5402 C  CD1   . ILE F 3 48  ? -5.791  -21.025 4.815   1.00 21.68 ? 48  ILE B CD1   1 
ATOM   5403 N  N     . GLU F 3 49  ? -3.242  -21.405 10.162  1.00 29.24 ? 49  GLU B N     1 
ATOM   5404 C  CA    . GLU F 3 49  ? -2.066  -21.810 10.908  1.00 30.58 ? 49  GLU B CA    1 
ATOM   5405 C  C     . GLU F 3 49  ? -1.337  -22.946 10.218  1.00 31.23 ? 49  GLU B C     1 
ATOM   5406 O  O     . GLU F 3 49  ? -1.950  -23.801 9.583   1.00 31.54 ? 49  GLU B O     1 
ATOM   5407 C  CB    . GLU F 3 49  ? -2.439  -22.172 12.343  1.00 32.01 ? 49  GLU B CB    1 
ATOM   5408 C  CG    . GLU F 3 49  ? -2.499  -20.948 13.246  1.00 37.09 ? 49  GLU B CG    1 
ATOM   5409 C  CD    . GLU F 3 49  ? -1.165  -20.202 13.305  1.00 41.45 ? 49  GLU B CD    1 
ATOM   5410 O  OE1   . GLU F 3 49  ? -1.162  -18.996 13.642  1.00 43.32 ? 49  GLU B OE1   1 
ATOM   5411 O  OE2   . GLU F 3 49  ? -0.107  -20.813 13.018  1.00 43.17 ? 49  GLU B OE2   1 
ATOM   5412 N  N     . GLU F 3 50  ? -0.015  -22.923 10.337  1.00 32.07 ? 50  GLU B N     1 
ATOM   5413 C  CA    . GLU F 3 50  ? 0.867   -23.906 9.726   1.00 33.44 ? 50  GLU B CA    1 
ATOM   5414 C  C     . GLU F 3 50  ? 0.324   -25.334 9.724   1.00 34.12 ? 50  GLU B C     1 
ATOM   5415 O  O     . GLU F 3 50  ? 0.182   -25.951 8.674   1.00 35.02 ? 50  GLU B O     1 
ATOM   5416 C  CB    . GLU F 3 50  ? 2.221   -23.868 10.433  1.00 35.29 ? 50  GLU B CB    1 
ATOM   5417 C  CG    . GLU F 3 50  ? 3.307   -24.650 9.737   1.00 38.67 ? 50  GLU B CG    1 
ATOM   5418 C  CD    . GLU F 3 50  ? 4.611   -24.624 10.500  1.00 40.41 ? 50  GLU B CD    1 
ATOM   5419 O  OE1   . GLU F 3 50  ? 4.676   -25.241 11.587  1.00 41.89 ? 50  GLU B OE1   1 
ATOM   5420 O  OE2   . GLU F 3 50  ? 5.569   -23.983 10.017  1.00 41.56 ? 50  GLU B OE2   1 
ATOM   5421 N  N     . LYS F 3 51  ? 0.034   -25.853 10.909  1.00 34.12 ? 51  LYS B N     1 
ATOM   5422 C  CA    . LYS F 3 51  ? -0.485  -27.203 11.069  1.00 33.66 ? 51  LYS B CA    1 
ATOM   5423 C  C     . LYS F 3 51  ? -1.683  -27.506 10.164  1.00 32.37 ? 51  LYS B C     1 
ATOM   5424 O  O     . LYS F 3 51  ? -1.657  -28.464 9.391   1.00 32.09 ? 51  LYS B O     1 
ATOM   5425 C  CB    . LYS F 3 51  ? -0.867  -27.417 12.536  1.00 36.55 ? 51  LYS B CB    1 
ATOM   5426 C  CG    . LYS F 3 51  ? -1.530  -28.763 12.868  1.00 38.93 ? 51  LYS B CG    1 
ATOM   5427 C  CD    . LYS F 3 51  ? -1.878  -28.761 14.357  1.00 42.05 ? 51  LYS B CD    1 
ATOM   5428 C  CE    . LYS F 3 51  ? -2.755  -29.945 14.748  1.00 44.19 ? 51  LYS B CE    1 
ATOM   5429 N  NZ    . LYS F 3 51  ? -3.364  -29.734 16.099  1.00 44.55 ? 51  LYS B NZ    1 
ATOM   5430 N  N     . LYS F 3 52  ? -2.730  -26.693 10.260  1.00 31.27 ? 52  LYS B N     1 
ATOM   5431 C  CA    . LYS F 3 52  ? -3.927  -26.906 9.451   1.00 30.51 ? 52  LYS B CA    1 
ATOM   5432 C  C     . LYS F 3 52  ? -3.693  -26.698 7.959   1.00 29.81 ? 52  LYS B C     1 
ATOM   5433 O  O     . LYS F 3 52  ? -4.455  -27.201 7.131   1.00 29.38 ? 52  LYS B O     1 
ATOM   5434 C  CB    . LYS F 3 52  ? -5.060  -25.991 9.911   1.00 31.06 ? 52  LYS B CB    1 
ATOM   5435 C  CG    . LYS F 3 52  ? -6.346  -26.169 9.116   1.00 31.26 ? 52  LYS B CG    1 
ATOM   5436 C  CD    . LYS F 3 52  ? -7.411  -25.183 9.559   1.00 33.53 ? 52  LYS B CD    1 
ATOM   5437 C  CE    . LYS F 3 52  ? -8.672  -25.294 8.704   1.00 34.63 ? 52  LYS B CE    1 
ATOM   5438 N  NZ    . LYS F 3 52  ? -9.655  -24.208 9.013   1.00 35.45 ? 52  LYS B NZ    1 
ATOM   5439 N  N     . LEU F 3 53  ? -2.652  -25.948 7.613   1.00 28.52 ? 53  LEU B N     1 
ATOM   5440 C  CA    . LEU F 3 53  ? -2.354  -25.712 6.209   1.00 27.96 ? 53  LEU B CA    1 
ATOM   5441 C  C     . LEU F 3 53  ? -1.834  -27.013 5.629   1.00 28.70 ? 53  LEU B C     1 
ATOM   5442 O  O     . LEU F 3 53  ? -2.211  -27.408 4.525   1.00 29.85 ? 53  LEU B O     1 
ATOM   5443 C  CB    . LEU F 3 53  ? -1.293  -24.626 6.039   1.00 26.09 ? 53  LEU B CB    1 
ATOM   5444 C  CG    . LEU F 3 53  ? -1.533  -23.602 4.922   1.00 24.69 ? 53  LEU B CG    1 
ATOM   5445 C  CD1   . LEU F 3 53  ? -0.190  -23.026 4.499   1.00 23.45 ? 53  LEU B CD1   1 
ATOM   5446 C  CD2   . LEU F 3 53  ? -2.232  -24.242 3.727   1.00 22.29 ? 53  LEU B CD2   1 
ATOM   5447 N  N     . GLY F 3 54  ? -0.962  -27.676 6.382   1.00 29.38 ? 54  GLY B N     1 
ATOM   5448 C  CA    . GLY F 3 54  ? -0.409  -28.945 5.940   1.00 28.90 ? 54  GLY B CA    1 
ATOM   5449 C  C     . GLY F 3 54  ? -1.522  -29.972 5.839   1.00 29.29 ? 54  GLY B C     1 
ATOM   5450 O  O     . GLY F 3 54  ? -1.563  -30.777 4.905   1.00 29.34 ? 54  GLY B O     1 
ATOM   5451 N  N     . GLN F 3 55  ? -2.434  -29.936 6.806   1.00 29.83 ? 55  GLN B N     1 
ATOM   5452 C  CA    . GLN F 3 55  ? -3.562  -30.854 6.832   1.00 29.50 ? 55  GLN B CA    1 
ATOM   5453 C  C     . GLN F 3 55  ? -4.475  -30.629 5.636   1.00 28.73 ? 55  GLN B C     1 
ATOM   5454 O  O     . GLN F 3 55  ? -4.947  -31.581 5.018   1.00 29.00 ? 55  GLN B O     1 
ATOM   5455 C  CB    . GLN F 3 55  ? -4.351  -30.682 8.122   1.00 31.14 ? 55  GLN B CB    1 
ATOM   5456 C  CG    . GLN F 3 55  ? -3.736  -31.368 9.321   1.00 34.43 ? 55  GLN B CG    1 
ATOM   5457 C  CD    . GLN F 3 55  ? -4.630  -31.276 10.547  1.00 37.32 ? 55  GLN B CD    1 
ATOM   5458 O  OE1   . GLN F 3 55  ? -4.869  -30.189 11.074  1.00 38.95 ? 55  GLN B OE1   1 
ATOM   5459 N  NE2   . GLN F 3 55  ? -5.140  -32.418 11.000  1.00 39.22 ? 55  GLN B NE2   1 
ATOM   5460 N  N     . GLU F 3 56  ? -4.731  -29.366 5.316   1.00 28.02 ? 56  GLU B N     1 
ATOM   5461 C  CA    . GLU F 3 56  ? -5.572  -29.040 4.174   1.00 27.34 ? 56  GLU B CA    1 
ATOM   5462 C  C     . GLU F 3 56  ? -4.901  -29.573 2.916   1.00 26.41 ? 56  GLU B C     1 
ATOM   5463 O  O     . GLU F 3 56  ? -5.556  -30.099 2.018   1.00 25.92 ? 56  GLU B O     1 
ATOM   5464 C  CB    . GLU F 3 56  ? -5.752  -27.526 4.050   1.00 28.17 ? 56  GLU B CB    1 
ATOM   5465 C  CG    . GLU F 3 56  ? -6.837  -26.942 4.928   1.00 28.69 ? 56  GLU B CG    1 
ATOM   5466 C  CD    . GLU F 3 56  ? -7.061  -25.465 4.660   1.00 29.04 ? 56  GLU B CD    1 
ATOM   5467 O  OE1   . GLU F 3 56  ? -6.830  -25.010 3.525   1.00 30.27 ? 56  GLU B OE1   1 
ATOM   5468 O  OE2   . GLU F 3 56  ? -7.481  -24.749 5.581   1.00 29.59 ? 56  GLU B OE2   1 
ATOM   5469 N  N     . ASN F 3 57  ? -3.582  -29.436 2.860   1.00 25.99 ? 57  ASN B N     1 
ATOM   5470 C  CA    . ASN F 3 57  ? -2.845  -29.902 1.708   1.00 26.28 ? 57  ASN B CA    1 
ATOM   5471 C  C     . ASN F 3 57  ? -2.711  -31.401 1.644   1.00 27.02 ? 57  ASN B C     1 
ATOM   5472 O  O     . ASN F 3 57  ? -2.730  -31.974 0.559   1.00 27.82 ? 57  ASN B O     1 
ATOM   5473 C  CB    . ASN F 3 57  ? -1.477  -29.250 1.661   1.00 25.84 ? 57  ASN B CB    1 
ATOM   5474 C  CG    . ASN F 3 57  ? -1.560  -27.824 1.230   1.00 25.88 ? 57  ASN B CG    1 
ATOM   5475 O  OD1   . ASN F 3 57  ? -1.683  -26.923 2.050   1.00 25.36 ? 57  ASN B OD1   1 
ATOM   5476 N  ND2   . ASN F 3 57  ? -1.535  -27.608 -0.077  1.00 26.69 ? 57  ASN B ND2   1 
ATOM   5477 N  N     . ALA F 3 58  ? -2.573  -32.042 2.798   1.00 27.72 ? 58  ALA B N     1 
ATOM   5478 C  CA    . ALA F 3 58  ? -2.466  -33.491 2.823   1.00 28.67 ? 58  ALA B CA    1 
ATOM   5479 C  C     . ALA F 3 58  ? -3.790  -34.073 2.327   1.00 29.82 ? 58  ALA B C     1 
ATOM   5480 O  O     . ALA F 3 58  ? -3.801  -35.039 1.570   1.00 30.72 ? 58  ALA B O     1 
ATOM   5481 C  CB    . ALA F 3 58  ? -2.180  -33.969 4.224   1.00 27.62 ? 58  ALA B CB    1 
ATOM   5482 N  N     . GLU F 3 59  ? -4.905  -33.475 2.745   1.00 31.29 ? 59  GLU B N     1 
ATOM   5483 C  CA    . GLU F 3 59  ? -6.224  -33.955 2.334   1.00 33.46 ? 59  GLU B CA    1 
ATOM   5484 C  C     . GLU F 3 59  ? -6.380  -33.921 0.818   1.00 33.20 ? 59  GLU B C     1 
ATOM   5485 O  O     . GLU F 3 59  ? -6.880  -34.877 0.222   1.00 34.17 ? 59  GLU B O     1 
ATOM   5486 C  CB    . GLU F 3 59  ? -7.344  -33.119 2.971   1.00 35.61 ? 59  GLU B CB    1 
ATOM   5487 C  CG    . GLU F 3 59  ? -7.400  -33.203 4.481   1.00 41.12 ? 59  GLU B CG    1 
ATOM   5488 C  CD    . GLU F 3 59  ? -8.441  -32.270 5.085   1.00 44.89 ? 59  GLU B CD    1 
ATOM   5489 O  OE1   . GLU F 3 59  ? -8.520  -31.099 4.642   1.00 46.85 ? 59  GLU B OE1   1 
ATOM   5490 O  OE2   . GLU F 3 59  ? -9.182  -32.702 6.000   1.00 46.74 ? 59  GLU B OE2   1 
ATOM   5491 N  N     . ALA F 3 60  ? -5.969  -32.822 0.195   1.00 32.45 ? 60  ALA B N     1 
ATOM   5492 C  CA    . ALA F 3 60  ? -6.090  -32.689 -1.247  1.00 31.96 ? 60  ALA B CA    1 
ATOM   5493 C  C     . ALA F 3 60  ? -5.251  -33.721 -1.950  1.00 31.37 ? 60  ALA B C     1 
ATOM   5494 O  O     . ALA F 3 60  ? -5.633  -34.243 -2.999  1.00 29.81 ? 60  ALA B O     1 
ATOM   5495 C  CB    . ALA F 3 60  ? -5.683  -31.287 -1.679  1.00 32.30 ? 60  ALA B CB    1 
ATOM   5496 N  N     . LEU F 3 61  ? -4.088  -34.005 -1.383  1.00 31.84 ? 61  LEU B N     1 
ATOM   5497 C  CA    . LEU F 3 61  ? -3.223  -35.006 -1.981  1.00 33.59 ? 61  LEU B CA    1 
ATOM   5498 C  C     . LEU F 3 61  ? -3.943  -36.335 -2.047  1.00 34.68 ? 61  LEU B C     1 
ATOM   5499 O  O     . LEU F 3 61  ? -4.114  -36.886 -3.136  1.00 35.38 ? 61  LEU B O     1 
ATOM   5500 C  CB    . LEU F 3 61  ? -1.901  -35.151 -1.201  1.00 32.39 ? 61  LEU B CB    1 
ATOM   5501 C  CG    . LEU F 3 61  ? -0.872  -36.150 -1.742  1.00 31.76 ? 61  LEU B CG    1 
ATOM   5502 C  CD1   . LEU F 3 61  ? -0.955  -36.217 -3.245  1.00 30.59 ? 61  LEU B CD1   1 
ATOM   5503 C  CD2   . LEU F 3 61  ? 0.498   -35.733 -1.319  1.00 32.29 ? 61  LEU B CD2   1 
ATOM   5504 N  N     . LEU F 3 62  ? -4.370  -36.829 -0.885  1.00 35.03 ? 62  LEU B N     1 
ATOM   5505 C  CA    . LEU F 3 62  ? -5.077  -38.098 -0.802  1.00 35.63 ? 62  LEU B CA    1 
ATOM   5506 C  C     . LEU F 3 62  ? -6.291  -38.111 -1.702  1.00 35.23 ? 62  LEU B C     1 
ATOM   5507 O  O     . LEU F 3 62  ? -6.633  -39.145 -2.274  1.00 35.48 ? 62  LEU B O     1 
ATOM   5508 C  CB    . LEU F 3 62  ? -5.501  -38.398 0.641   1.00 36.15 ? 62  LEU B CB    1 
ATOM   5509 C  CG    . LEU F 3 62  ? -4.304  -38.735 1.540   1.00 37.71 ? 62  LEU B CG    1 
ATOM   5510 C  CD1   . LEU F 3 62  ? -4.157  -37.725 2.669   1.00 37.80 ? 62  LEU B CD1   1 
ATOM   5511 C  CD2   . LEU F 3 62  ? -4.501  -40.128 2.097   1.00 38.57 ? 62  LEU B CD2   1 
ATOM   5512 N  N     . ARG F 3 63  ? -6.950  -36.965 -1.816  1.00 34.80 ? 63  ARG B N     1 
ATOM   5513 C  CA    . ARG F 3 63  ? -8.121  -36.860 -2.665  1.00 34.81 ? 63  ARG B CA    1 
ATOM   5514 C  C     . ARG F 3 63  ? -7.738  -37.228 -4.108  1.00 34.82 ? 63  ARG B C     1 
ATOM   5515 O  O     . ARG F 3 63  ? -8.453  -37.974 -4.777  1.00 36.42 ? 63  ARG B O     1 
ATOM   5516 C  CB    . ARG F 3 63  ? -8.688  -35.438 -2.588  1.00 34.76 ? 63  ARG B CB    1 
ATOM   5517 C  CG    . ARG F 3 63  ? -10.208 -35.353 -2.685  1.00 34.75 ? 63  ARG B CG    1 
ATOM   5518 C  CD    . ARG F 3 63  ? -10.782 -34.343 -1.690  1.00 33.79 ? 63  ARG B CD    1 
ATOM   5519 N  NE    . ARG F 3 63  ? -10.211 -33.045 -1.824  1.00 34.22 ? 63  ARG B NE    1 
ATOM   5520 C  CZ    . ARG F 3 63  ? -9.718  -32.184 -0.941  1.00 34.36 ? 63  ARG B CZ    1 
ATOM   5521 N  NH1   . ARG F 3 63  ? -9.643  -32.362 0.373   1.00 34.70 ? 63  ARG B NH1   1 
ATOM   5522 N  NH2   . ARG F 3 63  ? -9.273  -31.068 -1.476  1.00 33.29 ? 63  ARG B NH2   1 
ATOM   5523 N  N     . LEU F 3 64  ? -6.608  -36.714 -4.582  1.00 33.93 ? 64  LEU B N     1 
ATOM   5524 C  CA    . LEU F 3 64  ? -6.133  -37.017 -5.932  1.00 33.43 ? 64  LEU B CA    1 
ATOM   5525 C  C     . LEU F 3 64  ? -5.958  -38.529 -6.119  1.00 34.12 ? 64  LEU B C     1 
ATOM   5526 O  O     . LEU F 3 64  ? -6.445  -39.106 -7.094  1.00 33.87 ? 64  LEU B O     1 
ATOM   5527 C  CB    . LEU F 3 64  ? -4.794  -36.314 -6.194  1.00 31.07 ? 64  LEU B CB    1 
ATOM   5528 C  CG    . LEU F 3 64  ? -4.798  -34.788 -6.309  1.00 29.82 ? 64  LEU B CG    1 
ATOM   5529 C  CD1   . LEU F 3 64  ? -3.368  -34.280 -6.382  1.00 28.56 ? 64  LEU B CD1   1 
ATOM   5530 C  CD2   . LEU F 3 64  ? -5.584  -34.368 -7.538  1.00 27.84 ? 64  LEU B CD2   1 
ATOM   5531 N  N     . ILE F 3 65  ? -5.263  -39.160 -5.176  1.00 34.63 ? 65  ILE B N     1 
ATOM   5532 C  CA    . ILE F 3 65  ? -5.007  -40.597 -5.212  1.00 35.86 ? 65  ILE B CA    1 
ATOM   5533 C  C     . ILE F 3 65  ? -6.329  -41.355 -5.271  1.00 37.71 ? 65  ILE B C     1 
ATOM   5534 O  O     . ILE F 3 65  ? -6.518  -42.255 -6.100  1.00 38.50 ? 65  ILE B O     1 
ATOM   5535 C  CB    . ILE F 3 65  ? -4.190  -41.017 -3.969  1.00 35.14 ? 65  ILE B CB    1 
ATOM   5536 C  CG1   . ILE F 3 65  ? -2.846  -40.270 -3.972  1.00 35.18 ? 65  ILE B CG1   1 
ATOM   5537 C  CG2   . ILE F 3 65  ? -3.968  -42.516 -3.962  1.00 33.79 ? 65  ILE B CG2   1 
ATOM   5538 C  CD1   . ILE F 3 65  ? -2.035  -40.396 -2.698  1.00 34.36 ? 65  ILE B CD1   1 
ATOM   5539 N  N     . GLU F 3 66  ? -7.230  -40.963 -4.375  1.00 39.26 ? 66  GLU B N     1 
ATOM   5540 C  CA    . GLU F 3 66  ? -8.600  -41.485 -4.250  1.00 41.10 ? 66  GLU B CA    1 
ATOM   5541 C  C     . GLU F 3 66  ? -9.162  -41.561 -5.688  1.00 40.71 ? 66  GLU B C     1 
ATOM   5542 O  O     . GLU F 3 66  ? -9.534  -42.624 -6.189  1.00 41.15 ? 66  GLU B O     1 
ATOM   5543 C  CB    . GLU F 3 66  ? -9.408  -40.428 -3.495  1.00 43.95 ? 66  GLU B CB    1 
ATOM   5544 C  CG    . GLU F 3 66  ? -10.247 -40.660 -2.213  1.00 47.69 ? 66  GLU B CG    1 
ATOM   5545 C  CD    . GLU F 3 66  ? -9.909  -41.806 -1.281  1.00 51.09 ? 66  GLU B CD    1 
ATOM   5546 O  OE1   . GLU F 3 66  ? -10.729 -41.979 -0.349  1.00 53.29 ? 66  GLU B OE1   1 
ATOM   5547 O  OE2   . GLU F 3 66  ? -8.892  -42.520 -1.430  1.00 52.71 ? 66  GLU B OE2   1 
ATOM   5548 N  N     . ASP F 3 67  ? -9.201  -40.395 -6.330  1.00 39.96 ? 67  ASP B N     1 
ATOM   5549 C  CA    . ASP F 3 67  ? -9.734  -40.216 -7.670  1.00 40.31 ? 67  ASP B CA    1 
ATOM   5550 C  C     . ASP F 3 67  ? -8.946  -40.766 -8.855  1.00 40.28 ? 67  ASP B C     1 
ATOM   5551 O  O     . ASP F 3 67  ? -9.288  -40.483 -10.005 1.00 40.13 ? 67  ASP B O     1 
ATOM   5552 C  CB    . ASP F 3 67  ? -10.012 -38.723 -7.878  1.00 42.16 ? 67  ASP B CB    1 
ATOM   5553 C  CG    . ASP F 3 67  ? -10.823 -38.104 -6.722  1.00 43.29 ? 67  ASP B CG    1 
ATOM   5554 O  OD1   . ASP F 3 67  ? -11.896 -38.683 -6.398  1.00 46.31 ? 67  ASP B OD1   1 
ATOM   5555 O  OD2   . ASP F 3 67  ? -10.384 -37.054 -6.168  1.00 45.93 ? 67  ASP B OD2   1 
ATOM   5556 N  N     . GLY F 3 68  ? -7.893  -41.530 -8.580  1.00 39.73 ? 68  GLY B N     1 
ATOM   5557 C  CA    . GLY F 3 68  ? -7.105  -42.108 -9.653  1.00 39.12 ? 68  GLY B CA    1 
ATOM   5558 C  C     . GLY F 3 68  ? -5.904  -41.292 -10.099 1.00 38.51 ? 68  GLY B C     1 
ATOM   5559 O  O     . GLY F 3 68  ? -5.010  -41.800 -10.774 1.00 38.36 ? 68  GLY B O     1 
ATOM   5560 N  N     . LYS F 3 69  ? -5.876  -40.022 -9.720  1.00 37.55 ? 69  LYS B N     1 
ATOM   5561 C  CA    . LYS F 3 69  ? -4.780  -39.137 -10.093 1.00 37.61 ? 69  LYS B CA    1 
ATOM   5562 C  C     . LYS F 3 69  ? -3.421  -39.559 -9.535  1.00 36.17 ? 69  LYS B C     1 
ATOM   5563 O  O     . LYS F 3 69  ? -2.448  -38.811 -9.640  1.00 35.46 ? 69  LYS B O     1 
ATOM   5564 C  CB    . LYS F 3 69  ? -5.106  -37.716 -9.630  1.00 39.60 ? 69  LYS B CB    1 
ATOM   5565 C  CG    . LYS F 3 69  ? -6.269  -37.094 -10.374 1.00 42.46 ? 69  LYS B CG    1 
ATOM   5566 C  CD    . LYS F 3 69  ? -5.836  -36.848 -11.813 1.00 45.79 ? 69  LYS B CD    1 
ATOM   5567 C  CE    . LYS F 3 69  ? -6.951  -36.182 -12.638 1.00 48.21 ? 69  LYS B CE    1 
ATOM   5568 N  NZ    . LYS F 3 69  ? -7.839  -37.191 -13.317 1.00 50.08 ? 69  LYS B NZ    1 
ATOM   5569 N  N     . GLY F 3 70  ? -3.357  -40.756 -8.960  1.00 34.23 ? 70  GLY B N     1 
ATOM   5570 C  CA    . GLY F 3 70  ? -2.121  -41.233 -8.373  1.00 33.17 ? 70  GLY B CA    1 
ATOM   5571 C  C     . GLY F 3 70  ? -0.847  -41.054 -9.182  1.00 32.18 ? 70  GLY B C     1 
ATOM   5572 O  O     . GLY F 3 70  ? 0.124   -40.474 -8.692  1.00 31.27 ? 70  GLY B O     1 
ATOM   5573 N  N     . CYS F 3 71  ? -0.840  -41.545 -10.418 1.00 31.62 ? 71  CYS B N     1 
ATOM   5574 C  CA    . CYS F 3 71  ? 0.354   -41.448 -11.258 1.00 30.34 ? 71  CYS B CA    1 
ATOM   5575 C  C     . CYS F 3 71  ? 0.604   -40.084 -11.876 1.00 29.50 ? 71  CYS B C     1 
ATOM   5576 O  O     . CYS F 3 71  ? 1.740   -39.758 -12.221 1.00 28.75 ? 71  CYS B O     1 
ATOM   5577 C  CB    . CYS F 3 71  ? 0.320   -42.516 -12.353 1.00 30.16 ? 71  CYS B CB    1 
ATOM   5578 S  SG    . CYS F 3 71  ? 0.494   -44.189 -11.694 1.00 29.53 ? 71  CYS B SG    1 
ATOM   5579 N  N     . GLU F 3 72  ? -0.449  -39.287 -12.013 1.00 28.46 ? 72  GLU B N     1 
ATOM   5580 C  CA    . GLU F 3 72  ? -0.301  -37.953 -12.568 1.00 28.94 ? 72  GLU B CA    1 
ATOM   5581 C  C     . GLU F 3 72  ? 0.453   -37.125 -11.529 1.00 27.14 ? 72  GLU B C     1 
ATOM   5582 O  O     . GLU F 3 72  ? 1.302   -36.307 -11.870 1.00 27.78 ? 72  GLU B O     1 
ATOM   5583 C  CB    . GLU F 3 72  ? -1.675  -37.334 -12.841 1.00 31.25 ? 72  GLU B CB    1 
ATOM   5584 C  CG    . GLU F 3 72  ? -1.673  -36.162 -13.825 1.00 33.85 ? 72  GLU B CG    1 
ATOM   5585 C  CD    . GLU F 3 72  ? -2.990  -35.389 -13.807 1.00 36.57 ? 72  GLU B CD    1 
ATOM   5586 O  OE1   . GLU F 3 72  ? -4.061  -36.035 -13.866 1.00 36.97 ? 72  GLU B OE1   1 
ATOM   5587 O  OE2   . GLU F 3 72  ? -2.957  -34.135 -13.733 1.00 37.29 ? 72  GLU B OE2   1 
ATOM   5588 N  N     . VAL F 3 73  ? 0.140   -37.358 -10.258 1.00 25.08 ? 73  VAL B N     1 
ATOM   5589 C  CA    . VAL F 3 73  ? 0.784   -36.651 -9.154  1.00 22.94 ? 73  VAL B CA    1 
ATOM   5590 C  C     . VAL F 3 73  ? 2.298   -36.896 -9.147  1.00 21.56 ? 73  VAL B C     1 
ATOM   5591 O  O     . VAL F 3 73  ? 3.093   -35.953 -9.155  1.00 20.90 ? 73  VAL B O     1 
ATOM   5592 C  CB    . VAL F 3 73  ? 0.162   -37.087 -7.795  1.00 23.58 ? 73  VAL B CB    1 
ATOM   5593 C  CG1   . VAL F 3 73  ? 1.019   -36.614 -6.633  1.00 23.93 ? 73  VAL B CG1   1 
ATOM   5594 C  CG2   . VAL F 3 73  ? -1.239  -36.510 -7.666  1.00 21.47 ? 73  VAL B CG2   1 
ATOM   5595 N  N     . VAL F 3 74  ? 2.694   -38.163 -9.144  1.00 20.48 ? 74  VAL B N     1 
ATOM   5596 C  CA    . VAL F 3 74  ? 4.114   -38.516 -9.150  1.00 19.78 ? 74  VAL B CA    1 
ATOM   5597 C  C     . VAL F 3 74  ? 4.823   -37.892 -10.367 1.00 20.20 ? 74  VAL B C     1 
ATOM   5598 O  O     . VAL F 3 74  ? 5.923   -37.348 -10.264 1.00 20.34 ? 74  VAL B O     1 
ATOM   5599 C  CB    . VAL F 3 74  ? 4.297   -40.061 -9.169  1.00 17.22 ? 74  VAL B CB    1 
ATOM   5600 C  CG1   . VAL F 3 74  ? 5.757   -40.429 -9.353  1.00 13.71 ? 74  VAL B CG1   1 
ATOM   5601 C  CG2   . VAL F 3 74  ? 3.767   -40.646 -7.883  1.00 14.78 ? 74  VAL B CG2   1 
ATOM   5602 N  N     . GLN F 3 75  ? 4.171   -37.977 -11.518 1.00 20.33 ? 75  GLN B N     1 
ATOM   5603 C  CA    . GLN F 3 75  ? 4.699   -37.433 -12.756 1.00 20.21 ? 75  GLN B CA    1 
ATOM   5604 C  C     . GLN F 3 75  ? 4.929   -35.940 -12.605 1.00 20.57 ? 75  GLN B C     1 
ATOM   5605 O  O     . GLN F 3 75  ? 5.933   -35.410 -13.072 1.00 18.59 ? 75  GLN B O     1 
ATOM   5606 C  CB    . GLN F 3 75  ? 3.705   -37.692 -13.888 1.00 20.38 ? 75  GLN B CB    1 
ATOM   5607 C  CG    . GLN F 3 75  ? 4.125   -37.152 -15.232 1.00 21.35 ? 75  GLN B CG    1 
ATOM   5608 C  CD    . GLN F 3 75  ? 5.431   -37.750 -15.718 1.00 25.75 ? 75  GLN B CD    1 
ATOM   5609 O  OE1   . GLN F 3 75  ? 5.784   -38.878 -15.376 1.00 28.03 ? 75  GLN B OE1   1 
ATOM   5610 N  NE2   . GLN F 3 75  ? 6.151   -36.997 -16.532 1.00 27.69 ? 75  GLN B NE2   1 
ATOM   5611 N  N     . GLU F 3 76  ? 3.983   -35.265 -11.958 1.00 21.24 ? 76  GLU B N     1 
ATOM   5612 C  CA    . GLU F 3 76  ? 4.096   -33.832 -11.743 1.00 22.62 ? 76  GLU B CA    1 
ATOM   5613 C  C     . GLU F 3 76  ? 5.205   -33.565 -10.736 1.00 22.12 ? 76  GLU B C     1 
ATOM   5614 O  O     . GLU F 3 76  ? 5.988   -32.632 -10.900 1.00 23.28 ? 76  GLU B O     1 
ATOM   5615 C  CB    . GLU F 3 76  ? 2.787   -33.256 -11.215 1.00 22.57 ? 76  GLU B CB    1 
ATOM   5616 C  CG    . GLU F 3 76  ? 2.731   -31.750 -11.302 1.00 24.74 ? 76  GLU B CG    1 
ATOM   5617 C  CD    . GLU F 3 76  ? 2.633   -31.246 -12.732 1.00 26.38 ? 76  GLU B CD    1 
ATOM   5618 O  OE1   . GLU F 3 76  ? 2.770   -30.024 -12.947 1.00 27.54 ? 76  GLU B OE1   1 
ATOM   5619 O  OE2   . GLU F 3 76  ? 2.411   -32.068 -13.645 1.00 27.63 ? 76  GLU B OE2   1 
ATOM   5620 N  N     . ILE F 3 77  ? 5.257   -34.387 -9.694  1.00 21.15 ? 77  ILE B N     1 
ATOM   5621 C  CA    . ILE F 3 77  ? 6.283   -34.265 -8.666  1.00 22.58 ? 77  ILE B CA    1 
ATOM   5622 C  C     . ILE F 3 77  ? 7.644   -34.439 -9.315  1.00 23.27 ? 77  ILE B C     1 
ATOM   5623 O  O     . ILE F 3 77  ? 8.575   -33.678 -9.063  1.00 23.04 ? 77  ILE B O     1 
ATOM   5624 C  CB    . ILE F 3 77  ? 6.145   -35.371 -7.581  1.00 23.03 ? 77  ILE B CB    1 
ATOM   5625 C  CG1   . ILE F 3 77  ? 4.952   -35.072 -6.662  1.00 21.90 ? 77  ILE B CG1   1 
ATOM   5626 C  CG2   . ILE F 3 77  ? 7.456   -35.507 -6.804  1.00 22.28 ? 77  ILE B CG2   1 
ATOM   5627 C  CD1   . ILE F 3 77  ? 4.712   -36.133 -5.612  1.00 18.52 ? 77  ILE B CD1   1 
ATOM   5628 N  N     . LYS F 3 78  ? 7.740   -35.468 -10.148 1.00 23.99 ? 78  LYS B N     1 
ATOM   5629 C  CA    . LYS F 3 78  ? 8.965   -35.816 -10.851 1.00 24.75 ? 78  LYS B CA    1 
ATOM   5630 C  C     . LYS F 3 78  ? 9.430   -34.678 -11.764 1.00 25.00 ? 78  LYS B C     1 
ATOM   5631 O  O     . LYS F 3 78  ? 10.610  -34.378 -11.855 1.00 25.34 ? 78  LYS B O     1 
ATOM   5632 C  CB    . LYS F 3 78  ? 8.704   -37.095 -11.654 1.00 26.13 ? 78  LYS B CB    1 
ATOM   5633 C  CG    . LYS F 3 78  ? 9.931   -37.837 -12.165 1.00 27.97 ? 78  LYS B CG    1 
ATOM   5634 C  CD    . LYS F 3 78  ? 9.524   -39.223 -12.654 1.00 28.26 ? 78  LYS B CD    1 
ATOM   5635 C  CE    . LYS F 3 78  ? 10.675  -39.943 -13.313 1.00 28.98 ? 78  LYS B CE    1 
ATOM   5636 N  NZ    . LYS F 3 78  ? 10.621  -39.852 -14.792 1.00 29.87 ? 78  LYS B NZ    1 
ATOM   5637 N  N     . THR F 3 79  ? 8.478   -34.035 -12.420 1.00 26.15 ? 79  THR B N     1 
ATOM   5638 C  CA    . THR F 3 79  ? 8.754   -32.944 -13.341 1.00 26.25 ? 79  THR B CA    1 
ATOM   5639 C  C     . THR F 3 79  ? 9.183   -31.636 -12.661 1.00 26.13 ? 79  THR B C     1 
ATOM   5640 O  O     . THR F 3 79  ? 10.121  -30.970 -13.115 1.00 25.20 ? 79  THR B O     1 
ATOM   5641 C  CB    . THR F 3 79  ? 7.514   -32.691 -14.231 1.00 27.00 ? 79  THR B CB    1 
ATOM   5642 O  OG1   . THR F 3 79  ? 7.221   -33.875 -14.985 1.00 27.69 ? 79  THR B OG1   1 
ATOM   5643 C  CG2   . THR F 3 79  ? 7.758   -31.553 -15.181 1.00 25.08 ? 79  THR B CG2   1 
ATOM   5644 N  N     . PHE F 3 80  ? 8.499   -31.254 -11.587 1.00 25.17 ? 80  PHE B N     1 
ATOM   5645 C  CA    . PHE F 3 80  ? 8.859   -30.027 -10.881 1.00 25.09 ? 80  PHE B CA    1 
ATOM   5646 C  C     . PHE F 3 80  ? 10.271  -30.101 -10.312 1.00 24.92 ? 80  PHE B C     1 
ATOM   5647 O  O     . PHE F 3 80  ? 11.036  -29.146 -10.401 1.00 23.70 ? 80  PHE B O     1 
ATOM   5648 C  CB    . PHE F 3 80  ? 7.893   -29.759 -9.737  1.00 25.55 ? 80  PHE B CB    1 
ATOM   5649 C  CG    . PHE F 3 80  ? 6.861   -28.718 -10.042 1.00 25.79 ? 80  PHE B CG    1 
ATOM   5650 C  CD1   . PHE F 3 80  ? 5.807   -28.986 -10.911 1.00 28.05 ? 80  PHE B CD1   1 
ATOM   5651 C  CD2   . PHE F 3 80  ? 6.928   -27.475 -9.435  1.00 25.62 ? 80  PHE B CD2   1 
ATOM   5652 C  CE1   . PHE F 3 80  ? 4.830   -28.019 -11.168 1.00 27.24 ? 80  PHE B CE1   1 
ATOM   5653 C  CE2   . PHE F 3 80  ? 5.967   -26.509 -9.682  1.00 25.86 ? 80  PHE B CE2   1 
ATOM   5654 C  CZ    . PHE F 3 80  ? 4.912   -26.781 -10.549 1.00 26.91 ? 80  PHE B CZ    1 
ATOM   5655 N  N     . SER F 3 81  ? 10.606  -31.243 -9.721  1.00 25.72 ? 81  SER B N     1 
ATOM   5656 C  CA    . SER F 3 81  ? 11.922  -31.449 -9.129  1.00 27.49 ? 81  SER B CA    1 
ATOM   5657 C  C     . SER F 3 81  ? 13.034  -31.438 -10.177 1.00 28.40 ? 81  SER B C     1 
ATOM   5658 O  O     . SER F 3 81  ? 13.989  -30.666 -10.078 1.00 27.94 ? 81  SER B O     1 
ATOM   5659 C  CB    . SER F 3 81  ? 11.951  -32.774 -8.357  1.00 27.88 ? 81  SER B CB    1 
ATOM   5660 O  OG    . SER F 3 81  ? 13.225  -33.014 -7.771  1.00 27.79 ? 81  SER B OG    1 
ATOM   5661 N  N     . GLN F 3 82  ? 12.913  -32.294 -11.183 1.00 29.35 ? 82  GLN B N     1 
ATOM   5662 C  CA    . GLN F 3 82  ? 13.929  -32.354 -12.221 1.00 31.48 ? 82  GLN B CA    1 
ATOM   5663 C  C     . GLN F 3 82  ? 14.156  -31.017 -12.909 1.00 30.61 ? 82  GLN B C     1 
ATOM   5664 O  O     . GLN F 3 82  ? 15.293  -30.632 -13.163 1.00 31.90 ? 82  GLN B O     1 
ATOM   5665 C  CB    . GLN F 3 82  ? 13.565  -33.422 -13.245 1.00 33.80 ? 82  GLN B CB    1 
ATOM   5666 C  CG    . GLN F 3 82  ? 13.601  -34.822 -12.650 1.00 39.03 ? 82  GLN B CG    1 
ATOM   5667 C  CD    . GLN F 3 82  ? 13.902  -35.891 -13.683 1.00 41.62 ? 82  GLN B CD    1 
ATOM   5668 O  OE1   . GLN F 3 82  ? 14.351  -35.600 -14.781 1.00 44.49 ? 82  GLN B OE1   1 
ATOM   5669 N  NE2   . GLN F 3 82  ? 13.669  -37.134 -13.325 1.00 43.91 ? 82  GLN B NE2   1 
ATOM   5670 N  N     . GLU F 3 83  ? 13.076  -30.303 -13.188 1.00 29.39 ? 83  GLU B N     1 
ATOM   5671 C  CA    . GLU F 3 83  ? 13.182  -29.007 -13.838 1.00 28.31 ? 83  GLU B CA    1 
ATOM   5672 C  C     . GLU F 3 83  ? 13.465  -27.927 -12.808 1.00 26.50 ? 83  GLU B C     1 
ATOM   5673 O  O     . GLU F 3 83  ? 13.522  -26.756 -13.144 1.00 24.44 ? 83  GLU B O     1 
ATOM   5674 C  CB    . GLU F 3 83  ? 11.887  -28.675 -14.578 1.00 30.72 ? 83  GLU B CB    1 
ATOM   5675 C  CG    . GLU F 3 83  ? 11.536  -29.677 -15.653 1.00 34.57 ? 83  GLU B CG    1 
ATOM   5676 C  CD    . GLU F 3 83  ? 10.301  -29.296 -16.412 1.00 37.38 ? 83  GLU B CD    1 
ATOM   5677 O  OE1   . GLU F 3 83  ? 9.361   -30.109 -16.410 1.00 39.02 ? 83  GLU B OE1   1 
ATOM   5678 O  OE2   . GLU F 3 83  ? 10.259  -28.190 -17.011 1.00 40.87 ? 83  GLU B OE2   1 
ATOM   5679 N  N     . GLY F 3 84  ? 13.623  -28.342 -11.553 1.00 25.94 ? 84  GLY B N     1 
ATOM   5680 C  CA    . GLY F 3 84  ? 13.899  -27.421 -10.462 1.00 25.17 ? 84  GLY B CA    1 
ATOM   5681 C  C     . GLY F 3 84  ? 12.986  -26.213 -10.318 1.00 24.66 ? 84  GLY B C     1 
ATOM   5682 O  O     . GLY F 3 84  ? 13.445  -25.143 -9.934  1.00 23.36 ? 84  GLY B O     1 
ATOM   5683 N  N     . ARG F 3 85  ? 11.694  -26.374 -10.588 1.00 25.21 ? 85  ARG B N     1 
ATOM   5684 C  CA    . ARG F 3 85  ? 10.758  -25.253 -10.485 1.00 25.93 ? 85  ARG B CA    1 
ATOM   5685 C  C     . ARG F 3 85  ? 10.336  -24.881 -9.073  1.00 24.96 ? 85  ARG B C     1 
ATOM   5686 O  O     . ARG F 3 85  ? 9.659   -23.873 -8.880  1.00 24.68 ? 85  ARG B O     1 
ATOM   5687 C  CB    . ARG F 3 85  ? 9.488   -25.510 -11.304 1.00 26.30 ? 85  ARG B CB    1 
ATOM   5688 C  CG    . ARG F 3 85  ? 9.555   -26.682 -12.245 1.00 28.81 ? 85  ARG B CG    1 
ATOM   5689 C  CD    . ARG F 3 85  ? 8.959   -26.264 -13.585 1.00 29.49 ? 85  ARG B CD    1 
ATOM   5690 N  NE    . ARG F 3 85  ? 7.638   -26.760 -13.793 1.00 31.87 ? 85  ARG B NE    1 
ATOM   5691 C  CZ    . ARG F 3 85  ? 6.506   -26.185 -14.184 1.00 34.23 ? 85  ARG B CZ    1 
ATOM   5692 N  NH1   . ARG F 3 85  ? 6.329   -24.910 -14.489 1.00 36.42 ? 85  ARG B NH1   1 
ATOM   5693 N  NH2   . ARG F 3 85  ? 5.485   -27.003 -14.266 1.00 35.15 ? 85  ARG B NH2   1 
ATOM   5694 N  N     . ALA F 3 86  ? 10.727  -25.678 -8.087  1.00 25.45 ? 86  ALA B N     1 
ATOM   5695 C  CA    . ALA F 3 86  ? 10.342  -25.391 -6.701  1.00 26.54 ? 86  ALA B CA    1 
ATOM   5696 C  C     . ALA F 3 86  ? 11.533  -25.051 -5.818  1.00 26.86 ? 86  ALA B C     1 
ATOM   5697 O  O     . ALA F 3 86  ? 12.475  -25.836 -5.699  1.00 27.87 ? 86  ALA B O     1 
ATOM   5698 C  CB    . ALA F 3 86  ? 9.582   -26.577 -6.110  1.00 26.11 ? 86  ALA B CB    1 
ATOM   5699 N  N     . ALA F 3 87  ? 11.472  -23.883 -5.185  1.00 26.85 ? 87  ALA B N     1 
ATOM   5700 C  CA    . ALA F 3 87  ? 12.544  -23.415 -4.317  1.00 27.13 ? 87  ALA B CA    1 
ATOM   5701 C  C     . ALA F 3 87  ? 13.072  -24.492 -3.367  1.00 26.79 ? 87  ALA B C     1 
ATOM   5702 O  O     . ALA F 3 87  ? 14.250  -24.842 -3.425  1.00 26.07 ? 87  ALA B O     1 
ATOM   5703 C  CB    . ALA F 3 87  ? 12.072  -22.198 -3.523  1.00 26.74 ? 87  ALA B CB    1 
ATOM   5704 N  N     . LYS F 3 88  ? 12.205  -25.016 -2.503  1.00 26.05 ? 88  LYS B N     1 
ATOM   5705 C  CA    . LYS F 3 88  ? 12.619  -26.039 -1.541  1.00 27.11 ? 88  LYS B CA    1 
ATOM   5706 C  C     . LYS F 3 88  ? 12.134  -27.461 -1.874  1.00 27.23 ? 88  LYS B C     1 
ATOM   5707 O  O     . LYS F 3 88  ? 11.159  -27.653 -2.606  1.00 26.88 ? 88  LYS B O     1 
ATOM   5708 C  CB    . LYS F 3 88  ? 12.160  -25.662 -0.129  1.00 27.30 ? 88  LYS B CB    1 
ATOM   5709 C  CG    . LYS F 3 88  ? 12.648  -24.306 0.349   1.00 28.27 ? 88  LYS B CG    1 
ATOM   5710 C  CD    . LYS F 3 88  ? 12.906  -24.324 1.854   1.00 29.08 ? 88  LYS B CD    1 
ATOM   5711 C  CE    . LYS F 3 88  ? 12.671  -22.957 2.475   1.00 30.86 ? 88  LYS B CE    1 
ATOM   5712 N  NZ    . LYS F 3 88  ? 13.042  -22.915 3.922   1.00 32.50 ? 88  LYS B NZ    1 
ATOM   5713 N  N     . GLN F 3 89  ? 12.803  -28.456 -1.294  1.00 26.68 ? 89  GLN B N     1 
ATOM   5714 C  CA    . GLN F 3 89  ? 12.481  -29.856 -1.562  1.00 26.27 ? 89  GLN B CA    1 
ATOM   5715 C  C     . GLN F 3 89  ? 11.441  -30.541 -0.685  1.00 25.68 ? 89  GLN B C     1 
ATOM   5716 O  O     . GLN F 3 89  ? 10.708  -31.412 -1.150  1.00 22.38 ? 89  GLN B O     1 
ATOM   5717 C  CB    . GLN F 3 89  ? 13.772  -30.684 -1.533  1.00 27.26 ? 89  GLN B CB    1 
ATOM   5718 C  CG    . GLN F 3 89  ? 14.799  -30.243 -2.565  1.00 29.23 ? 89  GLN B CG    1 
ATOM   5719 C  CD    . GLN F 3 89  ? 14.286  -30.381 -3.994  1.00 31.29 ? 89  GLN B CD    1 
ATOM   5720 O  OE1   . GLN F 3 89  ? 14.892  -31.047 -4.809  1.00 32.74 ? 89  GLN B OE1   1 
ATOM   5721 N  NE2   . GLN F 3 89  ? 13.163  -29.754 -4.291  1.00 34.49 ? 89  GLN B NE2   1 
ATOM   5722 N  N     . GLU F 3 90  ? 11.384  -30.154 0.584   1.00 26.84 ? 90  GLU B N     1 
ATOM   5723 C  CA    . GLU F 3 90  ? 10.463  -30.769 1.535   1.00 28.31 ? 90  GLU B CA    1 
ATOM   5724 C  C     . GLU F 3 90  ? 9.086   -31.101 0.973   1.00 27.41 ? 90  GLU B C     1 
ATOM   5725 O  O     . GLU F 3 90  ? 8.661   -32.261 1.020   1.00 27.75 ? 90  GLU B O     1 
ATOM   5726 C  CB    . GLU F 3 90  ? 10.333  -29.902 2.793   1.00 30.68 ? 90  GLU B CB    1 
ATOM   5727 C  CG    . GLU F 3 90  ? 11.492  -30.004 3.769   1.00 35.08 ? 90  GLU B CG    1 
ATOM   5728 C  CD    . GLU F 3 90  ? 12.837  -29.678 3.139   1.00 38.27 ? 90  GLU B CD    1 
ATOM   5729 O  OE1   . GLU F 3 90  ? 13.544  -28.784 3.642   1.00 40.71 ? 90  GLU B OE1   1 
ATOM   5730 O  OE2   . GLU F 3 90  ? 13.235  -30.299 2.131   1.00 40.58 ? 90  GLU B OE2   1 
ATOM   5731 N  N     . PRO F 3 91  ? 8.375   -30.107 0.417   1.00 26.37 ? 91  PRO B N     1 
ATOM   5732 C  CA    . PRO F 3 91  ? 7.044   -30.409 -0.132  1.00 25.59 ? 91  PRO B CA    1 
ATOM   5733 C  C     . PRO F 3 91  ? 7.026   -31.538 -1.172  1.00 25.38 ? 91  PRO B C     1 
ATOM   5734 O  O     . PRO F 3 91  ? 6.142   -32.386 -1.143  1.00 24.88 ? 91  PRO B O     1 
ATOM   5735 C  CB    . PRO F 3 91  ? 6.600   -29.068 -0.709  1.00 24.48 ? 91  PRO B CB    1 
ATOM   5736 C  CG    . PRO F 3 91  ? 7.245   -28.093 0.215   1.00 25.50 ? 91  PRO B CG    1 
ATOM   5737 C  CD    . PRO F 3 91  ? 8.643   -28.660 0.373   1.00 24.86 ? 91  PRO B CD    1 
ATOM   5738 N  N     . THR F 3 92  ? 8.004   -31.552 -2.072  1.00 26.39 ? 92  THR B N     1 
ATOM   5739 C  CA    . THR F 3 92  ? 8.074   -32.578 -3.107  1.00 28.41 ? 92  THR B CA    1 
ATOM   5740 C  C     . THR F 3 92  ? 8.389   -33.933 -2.485  1.00 28.25 ? 92  THR B C     1 
ATOM   5741 O  O     . THR F 3 92  ? 7.720   -34.931 -2.755  1.00 28.94 ? 92  THR B O     1 
ATOM   5742 C  CB    . THR F 3 92  ? 9.166   -32.243 -4.143  1.00 29.57 ? 92  THR B CB    1 
ATOM   5743 O  OG1   . THR F 3 92  ? 9.785   -30.995 -3.816  1.00 33.84 ? 92  THR B OG1   1 
ATOM   5744 C  CG2   . THR F 3 92  ? 8.549   -32.106 -5.520  1.00 31.79 ? 92  THR B CG2   1 
ATOM   5745 N  N     . LEU F 3 93  ? 9.399   -33.960 -1.629  1.00 27.66 ? 93  LEU B N     1 
ATOM   5746 C  CA    . LEU F 3 93  ? 9.795   -35.192 -0.976  1.00 25.72 ? 93  LEU B CA    1 
ATOM   5747 C  C     . LEU F 3 93  ? 8.709   -35.729 -0.063  1.00 25.75 ? 93  LEU B C     1 
ATOM   5748 O  O     . LEU F 3 93  ? 8.551   -36.939 0.066   1.00 26.98 ? 93  LEU B O     1 
ATOM   5749 C  CB    . LEU F 3 93  ? 11.097  -34.970 -0.210  1.00 24.87 ? 93  LEU B CB    1 
ATOM   5750 C  CG    . LEU F 3 93  ? 12.288  -34.670 -1.120  1.00 22.58 ? 93  LEU B CG    1 
ATOM   5751 C  CD1   . LEU F 3 93  ? 13.526  -34.380 -0.294  1.00 24.23 ? 93  LEU B CD1   1 
ATOM   5752 C  CD2   . LEU F 3 93  ? 12.522  -35.848 -2.033  1.00 23.60 ? 93  LEU B CD2   1 
ATOM   5753 N  N     . PHE F 3 94  ? 7.953   -34.841 0.566   1.00 25.96 ? 94  PHE B N     1 
ATOM   5754 C  CA    . PHE F 3 94  ? 6.861   -35.279 1.429   1.00 25.48 ? 94  PHE B CA    1 
ATOM   5755 C  C     . PHE F 3 94  ? 5.749   -35.853 0.553   1.00 25.58 ? 94  PHE B C     1 
ATOM   5756 O  O     . PHE F 3 94  ? 5.101   -36.832 0.920   1.00 27.54 ? 94  PHE B O     1 
ATOM   5757 C  CB    . PHE F 3 94  ? 6.305   -34.112 2.247   1.00 24.78 ? 94  PHE B CB    1 
ATOM   5758 C  CG    . PHE F 3 94  ? 5.117   -34.476 3.095   1.00 25.01 ? 94  PHE B CG    1 
ATOM   5759 C  CD1   . PHE F 3 94  ? 5.260   -35.308 4.205   1.00 23.95 ? 94  PHE B CD1   1 
ATOM   5760 C  CD2   . PHE F 3 94  ? 3.851   -33.978 2.790   1.00 25.18 ? 94  PHE B CD2   1 
ATOM   5761 C  CE1   . PHE F 3 94  ? 4.162   -35.628 5.000   1.00 23.60 ? 94  PHE B CE1   1 
ATOM   5762 C  CE2   . PHE F 3 94  ? 2.747   -34.294 3.582   1.00 24.43 ? 94  PHE B CE2   1 
ATOM   5763 C  CZ    . PHE F 3 94  ? 2.906   -35.121 4.687   1.00 24.59 ? 94  PHE B CZ    1 
ATOM   5764 N  N     . ALA F 3 95  ? 5.531   -35.240 -0.605  1.00 24.04 ? 95  ALA B N     1 
ATOM   5765 C  CA    . ALA F 3 95  ? 4.495   -35.703 -1.518  1.00 24.20 ? 95  ALA B CA    1 
ATOM   5766 C  C     . ALA F 3 95  ? 4.835   -37.093 -2.055  1.00 24.92 ? 95  ALA B C     1 
ATOM   5767 O  O     . ALA F 3 95  ? 3.970   -37.968 -2.129  1.00 25.54 ? 95  ALA B O     1 
ATOM   5768 C  CB    . ALA F 3 95  ? 4.338   -34.721 -2.678  1.00 21.80 ? 95  ALA B CB    1 
ATOM   5769 N  N     . LEU F 3 96  ? 6.099   -37.283 -2.431  1.00 25.63 ? 96  LEU B N     1 
ATOM   5770 C  CA    . LEU F 3 96  ? 6.569   -38.551 -2.971  1.00 25.91 ? 96  LEU B CA    1 
ATOM   5771 C  C     . LEU F 3 96  ? 6.560   -39.616 -1.884  1.00 25.73 ? 96  LEU B C     1 
ATOM   5772 O  O     . LEU F 3 96  ? 6.539   -40.813 -2.164  1.00 25.06 ? 96  LEU B O     1 
ATOM   5773 C  CB    . LEU F 3 96  ? 7.975   -38.391 -3.557  1.00 26.75 ? 96  LEU B CB    1 
ATOM   5774 C  CG    . LEU F 3 96  ? 8.399   -39.441 -4.589  1.00 27.27 ? 96  LEU B CG    1 
ATOM   5775 C  CD1   . LEU F 3 96  ? 9.330   -38.836 -5.571  1.00 28.73 ? 96  LEU B CD1   1 
ATOM   5776 C  CD2   . LEU F 3 96  ? 9.060   -40.586 -3.918  1.00 30.42 ? 96  LEU B CD2   1 
ATOM   5777 N  N     . ALA F 3 97  ? 6.571   -39.173 -0.634  1.00 27.09 ? 97  ALA B N     1 
ATOM   5778 C  CA    . ALA F 3 97  ? 6.525   -40.098 0.494   1.00 28.03 ? 97  ALA B CA    1 
ATOM   5779 C  C     . ALA F 3 97  ? 5.078   -40.571 0.693   1.00 28.13 ? 97  ALA B C     1 
ATOM   5780 O  O     . ALA F 3 97  ? 4.824   -41.768 0.813   1.00 28.54 ? 97  ALA B O     1 
ATOM   5781 C  CB    . ALA F 3 97  ? 7.041   -39.414 1.762   1.00 27.60 ? 97  ALA B CB    1 
ATOM   5782 N  N     . VAL F 3 98  ? 4.133   -39.635 0.721   1.00 28.02 ? 98  VAL B N     1 
ATOM   5783 C  CA    . VAL F 3 98  ? 2.739   -40.006 0.898   1.00 28.67 ? 98  VAL B CA    1 
ATOM   5784 C  C     . VAL F 3 98  ? 2.368   -40.958 -0.226  1.00 30.31 ? 98  VAL B C     1 
ATOM   5785 O  O     . VAL F 3 98  ? 1.741   -41.996 0.001   1.00 31.68 ? 98  VAL B O     1 
ATOM   5786 C  CB    . VAL F 3 98  ? 1.799   -38.789 0.824   1.00 28.35 ? 98  VAL B CB    1 
ATOM   5787 C  CG1   . VAL F 3 98  ? 0.370   -39.228 1.072   1.00 24.38 ? 98  VAL B CG1   1 
ATOM   5788 C  CG2   . VAL F 3 98  ? 2.218   -37.742 1.833   1.00 28.89 ? 98  VAL B CG2   1 
ATOM   5789 N  N     . CYS F 3 99  ? 2.759   -40.602 -1.444  1.00 30.56 ? 99  CYS B N     1 
ATOM   5790 C  CA    . CYS F 3 99  ? 2.458   -41.443 -2.586  1.00 30.94 ? 99  CYS B CA    1 
ATOM   5791 C  C     . CYS F 3 99  ? 3.084   -42.805 -2.400  1.00 32.39 ? 99  CYS B C     1 
ATOM   5792 O  O     . CYS F 3 99  ? 2.511   -43.811 -2.802  1.00 32.10 ? 99  CYS B O     1 
ATOM   5793 C  CB    . CYS F 3 99  ? 2.977   -40.805 -3.871  1.00 29.63 ? 99  CYS B CB    1 
ATOM   5794 S  SG    . CYS F 3 99  ? 1.974   -39.403 -4.408  1.00 29.55 ? 99  CYS B SG    1 
ATOM   5795 N  N     . SER F 3 100 ? 4.255   -42.830 -1.770  1.00 34.24 ? 100 SER B N     1 
ATOM   5796 C  CA    . SER F 3 100 ? 4.980   -44.078 -1.528  1.00 36.21 ? 100 SER B CA    1 
ATOM   5797 C  C     . SER F 3 100 ? 4.232   -44.994 -0.550  1.00 38.73 ? 100 SER B C     1 
ATOM   5798 O  O     . SER F 3 100 ? 4.695   -46.090 -0.223  1.00 38.51 ? 100 SER B O     1 
ATOM   5799 C  CB    . SER F 3 100 ? 6.388   -43.770 -0.996  1.00 34.81 ? 100 SER B CB    1 
ATOM   5800 O  OG    . SER F 3 100 ? 6.612   -44.293 0.311   1.00 31.93 ? 100 SER B OG    1 
ATOM   5801 N  N     . GLN F 3 101 ? 3.046   -44.565 -0.125  1.00 41.02 ? 101 GLN B N     1 
ATOM   5802 C  CA    . GLN F 3 101 ? 2.263   -45.348 0.829   1.00 43.14 ? 101 GLN B CA    1 
ATOM   5803 C  C     . GLN F 3 101 ? 0.801   -45.488 0.482   1.00 43.81 ? 101 GLN B C     1 
ATOM   5804 O  O     . GLN F 3 101 ? 0.164   -46.458 0.875   1.00 44.58 ? 101 GLN B O     1 
ATOM   5805 C  CB    . GLN F 3 101 ? 2.344   -44.722 2.216   1.00 44.61 ? 101 GLN B CB    1 
ATOM   5806 C  CG    . GLN F 3 101 ? 3.732   -44.234 2.568   1.00 48.35 ? 101 GLN B CG    1 
ATOM   5807 C  CD    . GLN F 3 101 ? 4.037   -44.448 4.028   1.00 50.82 ? 101 GLN B CD    1 
ATOM   5808 O  OE1   . GLN F 3 101 ? 5.105   -44.080 4.511   1.00 52.41 ? 101 GLN B OE1   1 
ATOM   5809 N  NE2   . GLN F 3 101 ? 3.096   -45.059 4.745   1.00 51.42 ? 101 GLN B NE2   1 
ATOM   5810 N  N     . CYS F 3 102 ? 0.263   -44.513 -0.236  1.00 44.34 ? 102 CYS B N     1 
ATOM   5811 C  CA    . CYS F 3 102 ? -1.155  -44.527 -0.586  1.00 45.33 ? 102 CYS B CA    1 
ATOM   5812 C  C     . CYS F 3 102 ? -1.717  -45.908 -0.922  1.00 45.22 ? 102 CYS B C     1 
ATOM   5813 O  O     . CYS F 3 102 ? -0.965  -46.851 -1.194  1.00 45.67 ? 102 CYS B O     1 
ATOM   5814 C  CB    . CYS F 3 102 ? -1.413  -43.582 -1.755  1.00 45.44 ? 102 CYS B CB    1 
ATOM   5815 S  SG    . CYS F 3 102 ? -0.707  -44.109 -3.310  1.00 43.97 ? 102 CYS B SG    1 
ATOM   5816 N  N     . SER F 3 103 ? -3.042  -46.017 -0.887  1.00 45.35 ? 103 SER B N     1 
ATOM   5817 C  CA    . SER F 3 103 ? -3.707  -47.267 -1.196  1.00 46.09 ? 103 SER B CA    1 
ATOM   5818 C  C     . SER F 3 103 ? -3.362  -47.775 -2.604  1.00 45.88 ? 103 SER B C     1 
ATOM   5819 O  O     . SER F 3 103 ? -3.030  -48.948 -2.783  1.00 46.35 ? 103 SER B O     1 
ATOM   5820 C  CB    . SER F 3 103 ? -5.220  -47.088 -1.040  1.00 45.90 ? 103 SER B CB    1 
ATOM   5821 O  OG    . SER F 3 103 ? -5.642  -45.827 -1.532  1.00 47.18 ? 103 SER B OG    1 
ATOM   5822 N  N     . ASP F 3 104 ? -3.438  -46.899 -3.598  1.00 45.09 ? 104 ASP B N     1 
ATOM   5823 C  CA    . ASP F 3 104 ? -3.144  -47.292 -4.972  1.00 45.28 ? 104 ASP B CA    1 
ATOM   5824 C  C     . ASP F 3 104 ? -1.782  -47.989 -5.016  1.00 45.70 ? 104 ASP B C     1 
ATOM   5825 O  O     . ASP F 3 104 ? -0.875  -47.593 -4.281  1.00 46.75 ? 104 ASP B O     1 
ATOM   5826 C  CB    . ASP F 3 104 ? -3.099  -46.055 -5.862  1.00 45.09 ? 104 ASP B CB    1 
ATOM   5827 C  CG    . ASP F 3 104 ? -3.453  -46.361 -7.303  1.00 45.71 ? 104 ASP B CG    1 
ATOM   5828 O  OD1   . ASP F 3 104 ? -2.727  -45.904 -8.212  1.00 45.81 ? 104 ASP B OD1   1 
ATOM   5829 O  OD2   . ASP F 3 104 ? -4.466  -47.057 -7.531  1.00 46.54 ? 104 ASP B OD2   1 
ATOM   5830 N  N     . ILE F 3 105 ? -1.642  -49.022 -5.854  1.00 45.32 ? 105 ILE B N     1 
ATOM   5831 C  CA    . ILE F 3 105 ? -0.368  -49.739 -5.986  1.00 44.80 ? 105 ILE B CA    1 
ATOM   5832 C  C     . ILE F 3 105 ? 0.384   -49.278 -7.236  1.00 42.97 ? 105 ILE B C     1 
ATOM   5833 O  O     . ILE F 3 105 ? 1.602   -49.474 -7.371  1.00 41.34 ? 105 ILE B O     1 
ATOM   5834 C  CB    . ILE F 3 105 ? -0.552  -51.301 -6.023  1.00 46.17 ? 105 ILE B CB    1 
ATOM   5835 C  CG1   . ILE F 3 105 ? -2.023  -51.666 -6.031  1.00 47.03 ? 105 ILE B CG1   1 
ATOM   5836 C  CG2   . ILE F 3 105 ? 0.111   -51.936 -4.828  1.00 47.81 ? 105 ILE B CG2   1 
ATOM   5837 C  CD1   . ILE F 3 105 ? -2.646  -51.596 -7.375  1.00 50.61 ? 105 ILE B CD1   1 
ATOM   5838 N  N     . LYS F 3 106 ? -0.377  -48.677 -8.144  1.00 41.64 ? 106 LYS B N     1 
ATOM   5839 C  CA    . LYS F 3 106 ? 0.112   -48.121 -9.403  1.00 40.88 ? 106 LYS B CA    1 
ATOM   5840 C  C     . LYS F 3 106 ? 0.980   -46.929 -8.981  1.00 40.55 ? 106 LYS B C     1 
ATOM   5841 O  O     . LYS F 3 106 ? 2.144   -46.793 -9.376  1.00 40.49 ? 106 LYS B O     1 
ATOM   5842 C  CB    . LYS F 3 106 ? -1.093  -47.606 -10.192 1.00 41.13 ? 106 LYS B CB    1 
ATOM   5843 C  CG    . LYS F 3 106 ? -1.268  -47.944 -11.674 1.00 42.35 ? 106 LYS B CG    1 
ATOM   5844 C  CD    . LYS F 3 106 ? -0.156  -48.698 -12.366 1.00 44.14 ? 106 LYS B CD    1 
ATOM   5845 C  CE    . LYS F 3 106 ? -0.548  -48.865 -13.839 1.00 46.63 ? 106 LYS B CE    1 
ATOM   5846 N  NZ    . LYS F 3 106 ? -1.669  -47.925 -14.234 1.00 49.07 ? 106 LYS B NZ    1 
ATOM   5847 N  N     . THR F 3 107 ? 0.379   -46.076 -8.156  1.00 39.75 ? 107 THR B N     1 
ATOM   5848 C  CA    . THR F 3 107 ? 1.013   -44.870 -7.626  1.00 37.80 ? 107 THR B CA    1 
ATOM   5849 C  C     . THR F 3 107 ? 2.221   -45.190 -6.765  1.00 37.81 ? 107 THR B C     1 
ATOM   5850 O  O     . THR F 3 107 ? 3.268   -44.560 -6.903  1.00 36.92 ? 107 THR B O     1 
ATOM   5851 C  CB    . THR F 3 107 ? 0.034   -44.067 -6.759  1.00 36.41 ? 107 THR B CB    1 
ATOM   5852 O  OG1   . THR F 3 107 ? -1.111  -43.715 -7.538  1.00 36.42 ? 107 THR B OG1   1 
ATOM   5853 C  CG2   . THR F 3 107 ? 0.688   -42.809 -6.241  1.00 33.20 ? 107 THR B CG2   1 
ATOM   5854 N  N     . LYS F 3 108 ? 2.064   -46.157 -5.860  1.00 38.41 ? 108 LYS B N     1 
ATOM   5855 C  CA    . LYS F 3 108 ? 3.158   -46.561 -4.976  1.00 38.92 ? 108 LYS B CA    1 
ATOM   5856 C  C     . LYS F 3 108 ? 4.353   -47.024 -5.792  1.00 38.56 ? 108 LYS B C     1 
ATOM   5857 O  O     . LYS F 3 108 ? 5.481   -46.572 -5.592  1.00 39.10 ? 108 LYS B O     1 
ATOM   5858 C  CB    . LYS F 3 108 ? 2.730   -47.702 -4.047  1.00 38.74 ? 108 LYS B CB    1 
ATOM   5859 C  CG    . LYS F 3 108 ? 2.638   -47.306 -2.574  1.00 41.03 ? 108 LYS B CG    1 
ATOM   5860 C  CD    . LYS F 3 108 ? 2.521   -48.529 -1.666  1.00 41.59 ? 108 LYS B CD    1 
ATOM   5861 C  CE    . LYS F 3 108 ? 1.360   -49.412 -2.087  1.00 42.89 ? 108 LYS B CE    1 
ATOM   5862 N  NZ    . LYS F 3 108 ? 1.043   -50.485 -1.110  1.00 42.79 ? 108 LYS B NZ    1 
ATOM   5863 N  N     . GLN F 3 109 ? 4.098   -47.946 -6.707  1.00 38.74 ? 109 GLN B N     1 
ATOM   5864 C  CA    . GLN F 3 109 ? 5.138   -48.483 -7.561  1.00 38.64 ? 109 GLN B CA    1 
ATOM   5865 C  C     . GLN F 3 109 ? 5.760   -47.378 -8.402  1.00 37.72 ? 109 GLN B C     1 
ATOM   5866 O  O     . GLN F 3 109 ? 6.930   -47.447 -8.748  1.00 38.52 ? 109 GLN B O     1 
ATOM   5867 C  CB    . GLN F 3 109 ? 4.532   -49.608 -8.408  1.00 40.03 ? 109 GLN B CB    1 
ATOM   5868 C  CG    . GLN F 3 109 ? 4.872   -49.667 -9.877  1.00 43.39 ? 109 GLN B CG    1 
ATOM   5869 C  CD    . GLN F 3 109 ? 4.002   -50.703 -10.600 1.00 44.74 ? 109 GLN B CD    1 
ATOM   5870 O  OE1   . GLN F 3 109 ? 2.783   -50.602 -10.615 1.00 46.21 ? 109 GLN B OE1   1 
ATOM   5871 N  NE2   . GLN F 3 109 ? 4.630   -51.697 -11.183 1.00 45.38 ? 109 GLN B NE2   1 
ATOM   5872 N  N     . ALA F 3 110 ? 4.987   -46.343 -8.709  1.00 37.10 ? 110 ALA B N     1 
ATOM   5873 C  CA    . ALA F 3 110 ? 5.506   -45.227 -9.504  1.00 36.41 ? 110 ALA B CA    1 
ATOM   5874 C  C     . ALA F 3 110 ? 6.345   -44.299 -8.627  1.00 36.11 ? 110 ALA B C     1 
ATOM   5875 O  O     . ALA F 3 110 ? 7.287   -43.663 -9.103  1.00 36.99 ? 110 ALA B O     1 
ATOM   5876 C  CB    . ALA F 3 110 ? 4.350   -44.440 -10.147 1.00 34.87 ? 110 ALA B CB    1 
ATOM   5877 N  N     . ALA F 3 111 ? 5.997   -44.222 -7.347  1.00 34.75 ? 111 ALA B N     1 
ATOM   5878 C  CA    . ALA F 3 111 ? 6.719   -43.372 -6.418  1.00 33.80 ? 111 ALA B CA    1 
ATOM   5879 C  C     . ALA F 3 111 ? 8.157   -43.847 -6.227  1.00 33.86 ? 111 ALA B C     1 
ATOM   5880 O  O     . ALA F 3 111 ? 9.100   -43.068 -6.403  1.00 34.01 ? 111 ALA B O     1 
ATOM   5881 C  CB    . ALA F 3 111 ? 5.999   -43.336 -5.082  1.00 33.96 ? 111 ALA B CB    1 
ATOM   5882 N  N     . PHE F 3 112 ? 8.329   -45.120 -5.869  1.00 32.47 ? 112 PHE B N     1 
ATOM   5883 C  CA    . PHE F 3 112 ? 9.673   -45.654 -5.652  1.00 30.52 ? 112 PHE B CA    1 
ATOM   5884 C  C     . PHE F 3 112 ? 10.458  -45.687 -6.949  1.00 30.67 ? 112 PHE B C     1 
ATOM   5885 O  O     . PHE F 3 112 ? 11.696  -45.636 -6.943  1.00 31.52 ? 112 PHE B O     1 
ATOM   5886 C  CB    . PHE F 3 112 ? 9.623   -47.066 -5.061  1.00 26.92 ? 112 PHE B CB    1 
ATOM   5887 C  CG    . PHE F 3 112 ? 9.001   -47.130 -3.708  1.00 24.49 ? 112 PHE B CG    1 
ATOM   5888 C  CD1   . PHE F 3 112 ? 7.695   -47.577 -3.547  1.00 22.97 ? 112 PHE B CD1   1 
ATOM   5889 C  CD2   . PHE F 3 112 ? 9.706   -46.715 -2.591  1.00 22.38 ? 112 PHE B CD2   1 
ATOM   5890 C  CE1   . PHE F 3 112 ? 7.106   -47.611 -2.296  1.00 20.32 ? 112 PHE B CE1   1 
ATOM   5891 C  CE2   . PHE F 3 112 ? 9.122   -46.747 -1.338  1.00 20.99 ? 112 PHE B CE2   1 
ATOM   5892 C  CZ    . PHE F 3 112 ? 7.822   -47.194 -1.192  1.00 20.67 ? 112 PHE B CZ    1 
ATOM   5893 N  N     . ARG F 3 113 ? 9.733   -45.766 -8.058  1.00 29.34 ? 113 ARG B N     1 
ATOM   5894 C  CA    . ARG F 3 113 ? 10.350  -45.824 -9.369  1.00 29.67 ? 113 ARG B CA    1 
ATOM   5895 C  C     . ARG F 3 113 ? 11.041  -44.503 -9.696  1.00 29.24 ? 113 ARG B C     1 
ATOM   5896 O  O     . ARG F 3 113 ? 12.095  -44.481 -10.331 1.00 28.46 ? 113 ARG B O     1 
ATOM   5897 C  CB    . ARG F 3 113 ? 9.281   -46.125 -10.423 1.00 32.54 ? 113 ARG B CB    1 
ATOM   5898 C  CG    . ARG F 3 113 ? 9.827   -46.533 -11.778 1.00 36.49 ? 113 ARG B CG    1 
ATOM   5899 C  CD    . ARG F 3 113 ? 8.869   -46.176 -12.909 1.00 39.93 ? 113 ARG B CD    1 
ATOM   5900 N  NE    . ARG F 3 113 ? 7.534   -46.666 -12.752 1.00 42.33 ? 113 ARG B NE    1 
ATOM   5901 C  CZ    . ARG F 3 113 ? 6.343   -46.105 -12.956 1.00 42.91 ? 113 ARG B CZ    1 
ATOM   5902 N  NH1   . ARG F 3 113 ? 6.115   -44.859 -13.371 1.00 41.55 ? 113 ARG B NH1   1 
ATOM   5903 N  NH2   . ARG F 3 113 ? 5.325   -46.914 -12.738 1.00 43.43 ? 113 ARG B NH2   1 
ATOM   5904 N  N     . ALA F 3 114 ? 10.447  -43.404 -9.242  1.00 28.85 ? 114 ALA B N     1 
ATOM   5905 C  CA    . ALA F 3 114 ? 10.975  -42.072 -9.503  1.00 28.23 ? 114 ALA B CA    1 
ATOM   5906 C  C     . ALA F 3 114 ? 11.961  -41.542 -8.457  1.00 28.92 ? 114 ALA B C     1 
ATOM   5907 O  O     . ALA F 3 114 ? 12.529  -40.457 -8.626  1.00 29.71 ? 114 ALA B O     1 
ATOM   5908 C  CB    . ALA F 3 114 ? 9.826   -41.110 -9.652  1.00 26.38 ? 114 ALA B CB    1 
ATOM   5909 N  N     . VAL F 3 115 ? 12.167  -42.305 -7.386  1.00 28.51 ? 115 VAL B N     1 
ATOM   5910 C  CA    . VAL F 3 115 ? 13.071  -41.914 -6.302  1.00 27.95 ? 115 VAL B CA    1 
ATOM   5911 C  C     . VAL F 3 115 ? 14.483  -41.443 -6.706  1.00 28.26 ? 115 VAL B C     1 
ATOM   5912 O  O     . VAL F 3 115 ? 14.956  -40.420 -6.225  1.00 29.06 ? 115 VAL B O     1 
ATOM   5913 C  CB    . VAL F 3 115 ? 13.194  -43.062 -5.261  1.00 26.27 ? 115 VAL B CB    1 
ATOM   5914 C  CG1   . VAL F 3 115 ? 14.417  -42.866 -4.402  1.00 25.36 ? 115 VAL B CG1   1 
ATOM   5915 C  CG2   . VAL F 3 115 ? 11.947  -43.104 -4.392  1.00 24.43 ? 115 VAL B CG2   1 
ATOM   5916 N  N     . PRO F 3 116 ? 15.168  -42.172 -7.596  1.00 28.62 ? 116 PRO B N     1 
ATOM   5917 C  CA    . PRO F 3 116 ? 16.518  -41.776 -8.013  1.00 30.02 ? 116 PRO B CA    1 
ATOM   5918 C  C     . PRO F 3 116 ? 16.609  -40.530 -8.900  1.00 30.64 ? 116 PRO B C     1 
ATOM   5919 O  O     . PRO F 3 116 ? 17.680  -39.912 -9.016  1.00 29.51 ? 116 PRO B O     1 
ATOM   5920 C  CB    . PRO F 3 116 ? 17.038  -43.027 -8.711  1.00 28.96 ? 116 PRO B CB    1 
ATOM   5921 C  CG    . PRO F 3 116 ? 15.801  -43.571 -9.332  1.00 30.14 ? 116 PRO B CG    1 
ATOM   5922 C  CD    . PRO F 3 116 ? 14.787  -43.450 -8.218  1.00 29.97 ? 116 PRO B CD    1 
ATOM   5923 N  N     . GLU F 3 117 ? 15.495  -40.164 -9.532  1.00 31.04 ? 117 GLU B N     1 
ATOM   5924 C  CA    . GLU F 3 117 ? 15.484  -38.982 -10.386 1.00 31.01 ? 117 GLU B CA    1 
ATOM   5925 C  C     . GLU F 3 117 ? 15.005  -37.779 -9.589  1.00 29.89 ? 117 GLU B C     1 
ATOM   5926 O  O     . GLU F 3 117 ? 15.111  -36.639 -10.041 1.00 30.66 ? 117 GLU B O     1 
ATOM   5927 C  CB    . GLU F 3 117 ? 14.564  -39.182 -11.579 1.00 32.99 ? 117 GLU B CB    1 
ATOM   5928 C  CG    . GLU F 3 117 ? 14.889  -40.374 -12.438 1.00 37.53 ? 117 GLU B CG    1 
ATOM   5929 C  CD    . GLU F 3 117 ? 14.091  -40.364 -13.725 1.00 40.72 ? 117 GLU B CD    1 
ATOM   5930 O  OE1   . GLU F 3 117 ? 14.373  -39.504 -14.594 1.00 41.30 ? 117 GLU B OE1   1 
ATOM   5931 O  OE2   . GLU F 3 117 ? 13.174  -41.208 -13.861 1.00 42.53 ? 117 GLU B OE2   1 
ATOM   5932 N  N     . VAL F 3 118 ? 14.466  -38.043 -8.402  1.00 27.86 ? 118 VAL B N     1 
ATOM   5933 C  CA    . VAL F 3 118 ? 13.975  -36.985 -7.537  1.00 25.38 ? 118 VAL B CA    1 
ATOM   5934 C  C     . VAL F 3 118 ? 14.902  -36.785 -6.350  1.00 25.25 ? 118 VAL B C     1 
ATOM   5935 O  O     . VAL F 3 118 ? 14.962  -35.699 -5.773  1.00 27.59 ? 118 VAL B O     1 
ATOM   5936 C  CB    . VAL F 3 118 ? 12.554  -37.295 -7.026  1.00 24.54 ? 118 VAL B CB    1 
ATOM   5937 C  CG1   . VAL F 3 118 ? 12.161  -36.309 -5.927  1.00 22.91 ? 118 VAL B CG1   1 
ATOM   5938 C  CG2   . VAL F 3 118 ? 11.566  -37.206 -8.177  1.00 21.81 ? 118 VAL B CG2   1 
ATOM   5939 N  N     . CYS F 3 119 ? 15.615  -37.837 -5.976  1.00 23.68 ? 119 CYS B N     1 
ATOM   5940 C  CA    . CYS F 3 119 ? 16.543  -37.756 -4.865  1.00 22.59 ? 119 CYS B CA    1 
ATOM   5941 C  C     . CYS F 3 119 ? 17.935  -37.789 -5.449  1.00 22.98 ? 119 CYS B C     1 
ATOM   5942 O  O     . CYS F 3 119 ? 18.584  -38.834 -5.485  1.00 24.26 ? 119 CYS B O     1 
ATOM   5943 C  CB    . CYS F 3 119 ? 16.334  -38.927 -3.916  1.00 21.46 ? 119 CYS B CB    1 
ATOM   5944 S  SG    . CYS F 3 119 ? 14.710  -38.914 -3.166  1.00 22.39 ? 119 CYS B SG    1 
ATOM   5945 N  N     . ARG F 3 120 ? 18.387  -36.630 -5.909  1.00 22.77 ? 120 ARG B N     1 
ATOM   5946 C  CA    . ARG F 3 120 ? 19.695  -36.509 -6.531  1.00 21.12 ? 120 ARG B CA    1 
ATOM   5947 C  C     . ARG F 3 120 ? 20.860  -36.456 -5.569  1.00 21.94 ? 120 ARG B C     1 
ATOM   5948 O  O     . ARG F 3 120 ? 21.966  -36.856 -5.930  1.00 23.03 ? 120 ARG B O     1 
ATOM   5949 C  CB    . ARG F 3 120 ? 19.703  -35.296 -7.439  1.00 18.00 ? 120 ARG B CB    1 
ATOM   5950 C  CG    . ARG F 3 120 ? 18.787  -35.481 -8.608  1.00 14.61 ? 120 ARG B CG    1 
ATOM   5951 C  CD    . ARG F 3 120 ? 18.751  -34.235 -9.388  1.00 11.87 ? 120 ARG B CD    1 
ATOM   5952 N  NE    . ARG F 3 120 ? 18.031  -33.199 -8.671  1.00 9.00  ? 120 ARG B NE    1 
ATOM   5953 C  CZ    . ARG F 3 120 ? 16.709  -33.144 -8.573  1.00 11.21 ? 120 ARG B CZ    1 
ATOM   5954 N  NH1   . ARG F 3 120 ? 15.955  -34.072 -9.149  1.00 9.66  ? 120 ARG B NH1   1 
ATOM   5955 N  NH2   . ARG F 3 120 ? 16.137  -32.152 -7.906  1.00 12.70 ? 120 ARG B NH2   1 
ATOM   5956 N  N     . ILE F 3 121 ? 20.628  -35.965 -4.354  1.00 21.50 ? 121 ILE B N     1 
ATOM   5957 C  CA    . ILE F 3 121 ? 21.697  -35.908 -3.357  1.00 21.52 ? 121 ILE B CA    1 
ATOM   5958 C  C     . ILE F 3 121 ? 21.239  -36.592 -2.074  1.00 21.47 ? 121 ILE B C     1 
ATOM   5959 O  O     . ILE F 3 121 ? 20.050  -36.647 -1.788  1.00 23.31 ? 121 ILE B O     1 
ATOM   5960 C  CB    . ILE F 3 121 ? 22.124  -34.446 -3.036  1.00 21.70 ? 121 ILE B CB    1 
ATOM   5961 C  CG1   . ILE F 3 121 ? 20.947  -33.670 -2.426  1.00 21.64 ? 121 ILE B CG1   1 
ATOM   5962 C  CG2   . ILE F 3 121 ? 22.630  -33.765 -4.309  1.00 20.93 ? 121 ILE B CG2   1 
ATOM   5963 C  CD1   . ILE F 3 121 ? 21.307  -32.284 -1.919  1.00 21.10 ? 121 ILE B CD1   1 
ATOM   5964 N  N     . PRO F 3 122 ? 22.179  -37.131 -1.286  1.00 21.53 ? 122 PRO B N     1 
ATOM   5965 C  CA    . PRO F 3 122 ? 21.835  -37.813 -0.032  1.00 20.96 ? 122 PRO B CA    1 
ATOM   5966 C  C     . PRO F 3 122 ? 20.747  -37.121 0.794   1.00 21.61 ? 122 PRO B C     1 
ATOM   5967 O  O     . PRO F 3 122 ? 19.800  -37.769 1.242   1.00 21.78 ? 122 PRO B O     1 
ATOM   5968 C  CB    . PRO F 3 122 ? 23.173  -37.878 0.698   1.00 21.17 ? 122 PRO B CB    1 
ATOM   5969 C  CG    . PRO F 3 122 ? 24.136  -38.104 -0.432  1.00 21.14 ? 122 PRO B CG    1 
ATOM   5970 C  CD    . PRO F 3 122 ? 23.638  -37.142 -1.509  1.00 21.24 ? 122 PRO B CD    1 
ATOM   5971 N  N     . THR F 3 123 ? 20.880  -35.811 0.994   1.00 22.16 ? 123 THR B N     1 
ATOM   5972 C  CA    . THR F 3 123 ? 19.898  -35.046 1.771   1.00 21.42 ? 123 THR B CA    1 
ATOM   5973 C  C     . THR F 3 123 ? 18.473  -35.352 1.305   1.00 21.64 ? 123 THR B C     1 
ATOM   5974 O  O     . THR F 3 123 ? 17.595  -35.647 2.120   1.00 21.50 ? 123 THR B O     1 
ATOM   5975 C  CB    . THR F 3 123 ? 20.152  -33.524 1.649   1.00 21.23 ? 123 THR B CB    1 
ATOM   5976 O  OG1   . THR F 3 123 ? 21.546  -33.260 1.854   1.00 21.22 ? 123 THR B OG1   1 
ATOM   5977 C  CG2   . THR F 3 123 ? 19.333  -32.751 2.687   1.00 18.53 ? 123 THR B CG2   1 
ATOM   5978 N  N     . HIS F 3 124 ? 18.259  -35.289 -0.008  1.00 21.14 ? 124 HIS B N     1 
ATOM   5979 C  CA    . HIS F 3 124 ? 16.959  -35.572 -0.601  1.00 21.00 ? 124 HIS B CA    1 
ATOM   5980 C  C     . HIS F 3 124 ? 16.414  -36.914 -0.121  1.00 21.47 ? 124 HIS B C     1 
ATOM   5981 O  O     . HIS F 3 124 ? 15.234  -37.026 0.242   1.00 21.59 ? 124 HIS B O     1 
ATOM   5982 C  CB    . HIS F 3 124 ? 17.082  -35.603 -2.122  1.00 21.74 ? 124 HIS B CB    1 
ATOM   5983 C  CG    . HIS F 3 124 ? 17.336  -34.261 -2.739  1.00 22.03 ? 124 HIS B CG    1 
ATOM   5984 N  ND1   . HIS F 3 124 ? 17.756  -34.112 -4.041  1.00 20.88 ? 124 HIS B ND1   1 
ATOM   5985 C  CD2   . HIS F 3 124 ? 17.199  -33.009 -2.240  1.00 21.79 ? 124 HIS B CD2   1 
ATOM   5986 C  CE1   . HIS F 3 124 ? 17.867  -32.823 -4.321  1.00 21.67 ? 124 HIS B CE1   1 
ATOM   5987 N  NE2   . HIS F 3 124 ? 17.535  -32.135 -3.246  1.00 21.63 ? 124 HIS B NE2   1 
ATOM   5988 N  N     . LEU F 3 125 ? 17.279  -37.928 -0.124  1.00 20.84 ? 125 LEU B N     1 
ATOM   5989 C  CA    . LEU F 3 125 ? 16.891  -39.274 0.293   1.00 20.66 ? 125 LEU B CA    1 
ATOM   5990 C  C     . LEU F 3 125 ? 16.619  -39.320 1.796   1.00 21.08 ? 125 LEU B C     1 
ATOM   5991 O  O     . LEU F 3 125 ? 15.604  -39.854 2.242   1.00 21.95 ? 125 LEU B O     1 
ATOM   5992 C  CB    . LEU F 3 125 ? 18.000  -40.279 -0.049  1.00 19.63 ? 125 LEU B CB    1 
ATOM   5993 C  CG    . LEU F 3 125 ? 17.695  -41.605 -0.758  1.00 19.13 ? 125 LEU B CG    1 
ATOM   5994 C  CD1   . LEU F 3 125 ? 18.836  -42.559 -0.454  1.00 20.67 ? 125 LEU B CD1   1 
ATOM   5995 C  CD2   . LEU F 3 125 ? 16.403  -42.222 -0.297  1.00 18.42 ? 125 LEU B CD2   1 
ATOM   5996 N  N     . PHE F 3 126 ? 17.540  -38.768 2.574   1.00 20.64 ? 126 PHE B N     1 
ATOM   5997 C  CA    . PHE F 3 126 ? 17.397  -38.753 4.015   1.00 20.51 ? 126 PHE B CA    1 
ATOM   5998 C  C     . PHE F 3 126 ? 16.071  -38.112 4.376   1.00 21.02 ? 126 PHE B C     1 
ATOM   5999 O  O     . PHE F 3 126 ? 15.337  -38.621 5.225   1.00 21.88 ? 126 PHE B O     1 
ATOM   6000 C  CB    . PHE F 3 126 ? 18.548  -37.972 4.650   1.00 20.55 ? 126 PHE B CB    1 
ATOM   6001 C  CG    . PHE F 3 126 ? 19.893  -38.617 4.468   1.00 20.08 ? 126 PHE B CG    1 
ATOM   6002 C  CD1   . PHE F 3 126 ? 21.042  -37.845 4.417   1.00 20.28 ? 126 PHE B CD1   1 
ATOM   6003 C  CD2   . PHE F 3 126 ? 20.010  -40.000 4.365   1.00 20.55 ? 126 PHE B CD2   1 
ATOM   6004 C  CE1   . PHE F 3 126 ? 22.289  -38.436 4.269   1.00 20.28 ? 126 PHE B CE1   1 
ATOM   6005 C  CE2   . PHE F 3 126 ? 21.247  -40.599 4.218   1.00 20.03 ? 126 PHE B CE2   1 
ATOM   6006 C  CZ    . PHE F 3 126 ? 22.391  -39.812 4.168   1.00 21.47 ? 126 PHE B CZ    1 
ATOM   6007 N  N     . THR F 3 127 ? 15.756  -37.000 3.723   1.00 20.77 ? 127 THR B N     1 
ATOM   6008 C  CA    . THR F 3 127 ? 14.504  -36.309 3.993   1.00 21.25 ? 127 THR B CA    1 
ATOM   6009 C  C     . THR F 3 127 ? 13.310  -37.147 3.544   1.00 20.44 ? 127 THR B C     1 
ATOM   6010 O  O     . THR F 3 127 ? 12.252  -37.102 4.161   1.00 20.16 ? 127 THR B O     1 
ATOM   6011 C  CB    . THR F 3 127 ? 14.490  -34.925 3.310   1.00 22.78 ? 127 THR B CB    1 
ATOM   6012 O  OG1   . THR F 3 127 ? 15.467  -34.081 3.945   1.00 24.68 ? 127 THR B OG1   1 
ATOM   6013 C  CG2   . THR F 3 127 ? 13.111  -34.278 3.407   1.00 22.76 ? 127 THR B CG2   1 
ATOM   6014 N  N     . PHE F 3 128 ? 13.487  -37.926 2.486   1.00 20.05 ? 128 PHE B N     1 
ATOM   6015 C  CA    . PHE F 3 128 ? 12.414  -38.782 1.999   1.00 20.84 ? 128 PHE B CA    1 
ATOM   6016 C  C     . PHE F 3 128 ? 12.145  -39.911 2.992   1.00 21.34 ? 128 PHE B C     1 
ATOM   6017 O  O     . PHE F 3 128 ? 11.002  -40.141 3.393   1.00 20.83 ? 128 PHE B O     1 
ATOM   6018 C  CB    . PHE F 3 128 ? 12.786  -39.357 0.631   1.00 21.07 ? 128 PHE B CB    1 
ATOM   6019 C  CG    . PHE F 3 128 ? 11.860  -40.434 0.144   1.00 20.11 ? 128 PHE B CG    1 
ATOM   6020 C  CD1   . PHE F 3 128 ? 12.271  -41.766 0.133   1.00 20.82 ? 128 PHE B CD1   1 
ATOM   6021 C  CD2   . PHE F 3 128 ? 10.595  -40.122 -0.331  1.00 19.43 ? 128 PHE B CD2   1 
ATOM   6022 C  CE1   . PHE F 3 128 ? 11.432  -42.772 -0.350  1.00 20.09 ? 128 PHE B CE1   1 
ATOM   6023 C  CE2   . PHE F 3 128 ? 9.751   -41.126 -0.815  1.00 20.16 ? 128 PHE B CE2   1 
ATOM   6024 C  CZ    . PHE F 3 128 ? 10.175  -42.450 -0.823  1.00 19.86 ? 128 PHE B CZ    1 
ATOM   6025 N  N     . ILE F 3 129 ? 13.208  -40.595 3.400   1.00 22.15 ? 129 ILE B N     1 
ATOM   6026 C  CA    . ILE F 3 129 ? 13.109  -41.702 4.341   1.00 21.27 ? 129 ILE B CA    1 
ATOM   6027 C  C     . ILE F 3 129 ? 12.527  -41.281 5.681   1.00 21.25 ? 129 ILE B C     1 
ATOM   6028 O  O     . ILE F 3 129 ? 11.768  -42.029 6.293   1.00 21.06 ? 129 ILE B O     1 
ATOM   6029 C  CB    . ILE F 3 129 ? 14.495  -42.351 4.547   1.00 21.87 ? 129 ILE B CB    1 
ATOM   6030 C  CG1   . ILE F 3 129 ? 14.563  -43.657 3.753   1.00 22.48 ? 129 ILE B CG1   1 
ATOM   6031 C  CG2   . ILE F 3 129 ? 14.768  -42.604 6.017   1.00 22.62 ? 129 ILE B CG2   1 
ATOM   6032 C  CD1   . ILE F 3 129 ? 15.665  -43.681 2.731   1.00 22.57 ? 129 ILE B CD1   1 
ATOM   6033 N  N     . GLN F 3 130 ? 12.895  -40.088 6.139   1.00 22.08 ? 130 GLN B N     1 
ATOM   6034 C  CA    . GLN F 3 130 ? 12.396  -39.568 7.410   1.00 21.99 ? 130 GLN B CA    1 
ATOM   6035 C  C     . GLN F 3 130 ? 10.907  -39.285 7.322   1.00 21.95 ? 130 GLN B C     1 
ATOM   6036 O  O     . GLN F 3 130 ? 10.183  -39.443 8.301   1.00 21.46 ? 130 GLN B O     1 
ATOM   6037 C  CB    . GLN F 3 130 ? 13.129  -38.281 7.804   1.00 21.95 ? 130 GLN B CB    1 
ATOM   6038 C  CG    . GLN F 3 130 ? 12.479  -37.547 8.962   1.00 22.98 ? 130 GLN B CG    1 
ATOM   6039 C  CD    . GLN F 3 130 ? 12.535  -38.330 10.263  1.00 25.71 ? 130 GLN B CD    1 
ATOM   6040 O  OE1   . GLN F 3 130 ? 12.605  -39.557 10.272  1.00 29.55 ? 130 GLN B OE1   1 
ATOM   6041 N  NE2   . GLN F 3 130 ? 12.492  -37.619 11.371  1.00 27.36 ? 130 GLN B NE2   1 
ATOM   6042 N  N     . PHE F 3 131 ? 10.452  -38.856 6.149   1.00 22.36 ? 131 PHE B N     1 
ATOM   6043 C  CA    . PHE F 3 131 ? 9.037   -38.566 5.961   1.00 23.46 ? 131 PHE B CA    1 
ATOM   6044 C  C     . PHE F 3 131 ? 8.248   -39.871 6.012   1.00 24.21 ? 131 PHE B C     1 
ATOM   6045 O  O     . PHE F 3 131 ? 7.151   -39.924 6.565   1.00 23.30 ? 131 PHE B O     1 
ATOM   6046 C  CB    . PHE F 3 131 ? 8.805   -37.845 4.621   1.00 23.68 ? 131 PHE B CB    1 
ATOM   6047 C  CG    . PHE F 3 131 ? 8.913   -36.342 4.702   1.00 22.59 ? 131 PHE B CG    1 
ATOM   6048 C  CD1   . PHE F 3 131 ? 9.408   -35.610 3.625   1.00 23.41 ? 131 PHE B CD1   1 
ATOM   6049 C  CD2   . PHE F 3 131 ? 8.503   -35.657 5.844   1.00 22.40 ? 131 PHE B CD2   1 
ATOM   6050 C  CE1   . PHE F 3 131 ? 9.499   -34.213 3.691   1.00 23.41 ? 131 PHE B CE1   1 
ATOM   6051 C  CE2   . PHE F 3 131 ? 8.590   -34.262 5.919   1.00 22.54 ? 131 PHE B CE2   1 
ATOM   6052 C  CZ    . PHE F 3 131 ? 9.086   -33.540 4.844   1.00 22.61 ? 131 PHE B CZ    1 
ATOM   6053 N  N     . LYS F 3 132 ? 8.814   -40.927 5.434   1.00 26.11 ? 132 LYS B N     1 
ATOM   6054 C  CA    . LYS F 3 132 ? 8.157   -42.224 5.441   1.00 27.75 ? 132 LYS B CA    1 
ATOM   6055 C  C     . LYS F 3 132 ? 7.980   -42.667 6.885   1.00 29.48 ? 132 LYS B C     1 
ATOM   6056 O  O     . LYS F 3 132 ? 6.995   -43.324 7.225   1.00 30.41 ? 132 LYS B O     1 
ATOM   6057 C  CB    . LYS F 3 132 ? 8.978   -43.263 4.669   1.00 25.85 ? 132 LYS B CB    1 
ATOM   6058 C  CG    . LYS F 3 132 ? 8.963   -43.065 3.168   1.00 25.86 ? 132 LYS B CG    1 
ATOM   6059 C  CD    . LYS F 3 132 ? 9.410   -44.313 2.410   1.00 26.63 ? 132 LYS B CD    1 
ATOM   6060 C  CE    . LYS F 3 132 ? 8.506   -45.510 2.704   1.00 28.88 ? 132 LYS B CE    1 
ATOM   6061 N  NZ    . LYS F 3 132 ? 7.038   -45.190 2.652   1.00 30.28 ? 132 LYS B NZ    1 
ATOM   6062 N  N     . LYS F 3 133 ? 8.933   -42.294 7.733   1.00 31.52 ? 133 LYS B N     1 
ATOM   6063 C  CA    . LYS F 3 133 ? 8.881   -42.642 9.147   1.00 33.98 ? 133 LYS B CA    1 
ATOM   6064 C  C     . LYS F 3 133 ? 7.781   -41.850 9.869   1.00 35.03 ? 133 LYS B C     1 
ATOM   6065 O  O     . LYS F 3 133 ? 7.006   -42.413 10.643  1.00 34.69 ? 133 LYS B O     1 
ATOM   6066 C  CB    . LYS F 3 133 ? 10.241  -42.371 9.785   1.00 35.71 ? 133 LYS B CB    1 
ATOM   6067 C  CG    . LYS F 3 133 ? 10.426  -42.953 11.182  1.00 38.60 ? 133 LYS B CG    1 
ATOM   6068 C  CD    . LYS F 3 133 ? 11.847  -42.683 11.675  1.00 40.02 ? 133 LYS B CD    1 
ATOM   6069 C  CE    . LYS F 3 133 ? 12.063  -43.215 13.079  1.00 41.36 ? 133 LYS B CE    1 
ATOM   6070 N  NZ    . LYS F 3 133 ? 12.963  -42.317 13.848  1.00 42.78 ? 133 LYS B NZ    1 
ATOM   6071 N  N     . ASP F 3 134 ? 7.714   -40.545 9.613   1.00 36.43 ? 134 ASP B N     1 
ATOM   6072 C  CA    . ASP F 3 134 ? 6.691   -39.704 10.230  1.00 37.50 ? 134 ASP B CA    1 
ATOM   6073 C  C     . ASP F 3 134 ? 5.313   -40.233 9.831   1.00 37.84 ? 134 ASP B C     1 
ATOM   6074 O  O     . ASP F 3 134 ? 4.338   -40.071 10.562  1.00 37.79 ? 134 ASP B O     1 
ATOM   6075 C  CB    . ASP F 3 134 ? 6.840   -38.242 9.786   1.00 39.05 ? 134 ASP B CB    1 
ATOM   6076 C  CG    . ASP F 3 134 ? 8.168   -37.621 10.217  1.00 41.10 ? 134 ASP B CG    1 
ATOM   6077 O  OD1   . ASP F 3 134 ? 8.526   -37.727 11.411  1.00 42.72 ? 134 ASP B OD1   1 
ATOM   6078 O  OD2   . ASP F 3 134 ? 8.856   -37.016 9.368   1.00 40.83 ? 134 ASP B OD2   1 
ATOM   6079 N  N     . LEU F 3 135 ? 5.243   -40.879 8.671   1.00 38.39 ? 135 LEU B N     1 
ATOM   6080 C  CA    . LEU F 3 135 ? 3.993   -41.451 8.186   1.00 39.58 ? 135 LEU B CA    1 
ATOM   6081 C  C     . LEU F 3 135 ? 3.827   -42.874 8.727   1.00 41.00 ? 135 LEU B C     1 
ATOM   6082 O  O     . LEU F 3 135 ? 2.699   -43.344 8.889   1.00 41.96 ? 135 LEU B O     1 
ATOM   6083 C  CB    . LEU F 3 135 ? 3.965   -41.447 6.646   1.00 37.39 ? 135 LEU B CB    1 
ATOM   6084 C  CG    . LEU F 3 135 ? 4.015   -40.078 5.957   1.00 35.23 ? 135 LEU B CG    1 
ATOM   6085 C  CD1   . LEU F 3 135 ? 4.166   -40.269 4.461   1.00 34.21 ? 135 LEU B CD1   1 
ATOM   6086 C  CD2   . LEU F 3 135 ? 2.757   -39.303 6.277   1.00 33.98 ? 135 LEU B CD2   1 
ATOM   6087 N  N     . LYS F 3 136 ? 4.934   -43.564 8.996   1.00 43.07 ? 136 LYS B N     1 
ATOM   6088 C  CA    . LYS F 3 136 ? 4.855   -44.921 9.541   1.00 44.38 ? 136 LYS B CA    1 
ATOM   6089 C  C     . LYS F 3 136 ? 4.880   -44.885 11.071  1.00 44.83 ? 136 LYS B C     1 
ATOM   6090 O  O     . LYS F 3 136 ? 3.846   -44.714 11.724  1.00 45.28 ? 136 LYS B O     1 
ATOM   6091 C  CB    . LYS F 3 136 ? 6.025   -45.773 9.048   1.00 45.19 ? 136 LYS B CB    1 
ATOM   6092 C  CG    . LYS F 3 136 ? 6.131   -47.121 9.752   1.00 47.13 ? 136 LYS B CG    1 
ATOM   6093 C  CD    . LYS F 3 136 ? 7.468   -47.806 9.516   1.00 49.32 ? 136 LYS B CD    1 
ATOM   6094 C  CE    . LYS F 3 136 ? 7.663   -48.986 10.472  1.00 49.74 ? 136 LYS B CE    1 
ATOM   6095 N  NZ    . LYS F 3 136 ? 9.082   -49.444 10.534  1.00 49.73 ? 136 LYS B NZ    1 
ATOM   6096 N  N     . TRP F 3 144 ? 11.857  -52.298 7.415   1.00 38.14 ? 144 TRP B N     1 
ATOM   6097 C  CA    . TRP F 3 144 ? 11.670  -51.743 6.070   1.00 38.81 ? 144 TRP B CA    1 
ATOM   6098 C  C     . TRP F 3 144 ? 10.895  -52.695 5.155   1.00 38.81 ? 144 TRP B C     1 
ATOM   6099 O  O     . TRP F 3 144 ? 10.252  -53.631 5.667   1.00 41.46 ? 144 TRP B O     1 
ATOM   6100 C  CB    . TRP F 3 144 ? 13.032  -51.372 5.481   1.00 38.12 ? 144 TRP B CB    1 
ATOM   6101 C  CG    . TRP F 3 144 ? 13.546  -50.055 6.033   1.00 37.26 ? 144 TRP B CG    1 
ATOM   6102 C  CD1   . TRP F 3 144 ? 13.230  -49.497 7.246   1.00 36.63 ? 144 TRP B CD1   1 
ATOM   6103 C  CD2   . TRP F 3 144 ? 14.443  -49.132 5.394   1.00 36.31 ? 144 TRP B CD2   1 
ATOM   6104 N  NE1   . TRP F 3 144 ? 13.869  -48.290 7.395   1.00 36.18 ? 144 TRP B NE1   1 
ATOM   6105 C  CE2   . TRP F 3 144 ? 14.621  -48.042 6.278   1.00 36.05 ? 144 TRP B CE2   1 
ATOM   6106 C  CE3   . TRP F 3 144 ? 15.117  -49.124 4.166   1.00 36.38 ? 144 TRP B CE3   1 
ATOM   6107 C  CZ2   . TRP F 3 144 ? 15.441  -46.950 5.969   1.00 35.67 ? 144 TRP B CZ2   1 
ATOM   6108 C  CZ3   . TRP F 3 144 ? 15.936  -48.036 3.861   1.00 36.09 ? 144 TRP B CZ3   1 
ATOM   6109 C  CH2   . TRP F 3 144 ? 16.091  -46.967 4.761   1.00 35.91 ? 144 TRP B CH2   1 
ATOM   6110 N  N     . GLY F 3 145 ? 10.926  -52.489 3.836   1.00 37.77 ? 145 GLY B N     1 
ATOM   6111 C  CA    . GLY F 3 145 ? 10.165  -53.386 2.980   1.00 35.96 ? 145 GLY B CA    1 
ATOM   6112 C  C     . GLY F 3 145 ? 10.718  -53.578 1.580   1.00 35.64 ? 145 GLY B C     1 
ATOM   6113 O  O     . GLY F 3 145 ? 11.639  -52.867 1.168   1.00 35.55 ? 145 GLY B O     1 
ATOM   6114 N  N     . ARG F 3 146 ? 10.165  -54.549 0.848   1.00 34.14 ? 146 ARG B N     1 
ATOM   6115 C  CA    . ARG F 3 146 ? 10.611  -54.851 -0.519  1.00 33.20 ? 146 ARG B CA    1 
ATOM   6116 C  C     . ARG F 3 146 ? 10.878  -53.534 -1.254  1.00 31.65 ? 146 ARG B C     1 
ATOM   6117 O  O     . ARG F 3 146 ? 12.023  -53.146 -1.446  1.00 30.80 ? 146 ARG B O     1 
ATOM   6118 C  CB    . ARG F 3 146 ? 9.538   -55.718 -1.265  1.00 35.17 ? 146 ARG B CB    1 
ATOM   6119 C  CG    . ARG F 3 146 ? 9.929   -56.605 -2.541  1.00 37.15 ? 146 ARG B CG    1 
ATOM   6120 C  CD    . ARG F 3 146 ? 10.990  -57.668 -2.214  1.00 39.94 ? 146 ARG B CD    1 
ATOM   6121 N  NE    . ARG F 3 146 ? 11.926  -56.674 -1.859  1.00 43.73 ? 146 ARG B NE    1 
ATOM   6122 C  CZ    . ARG F 3 146 ? 13.170  -56.402 -2.176  1.00 44.49 ? 146 ARG B CZ    1 
ATOM   6123 N  NH1   . ARG F 3 146 ? 13.571  -55.285 -1.592  1.00 44.96 ? 146 ARG B NH1   1 
ATOM   6124 N  NH2   . ARG F 3 146 ? 13.976  -57.114 -2.934  1.00 45.94 ? 146 ARG B NH2   1 
ATOM   6125 N  N     . ALA F 3 147 ? 9.815   -52.824 -1.610  1.00 31.16 ? 147 ALA B N     1 
ATOM   6126 C  CA    . ALA F 3 147 ? 9.932   -51.562 -2.337  1.00 29.42 ? 147 ALA B CA    1 
ATOM   6127 C  C     . ALA F 3 147 ? 10.963  -50.600 -1.758  1.00 29.99 ? 147 ALA B C     1 
ATOM   6128 O  O     . ALA F 3 147 ? 11.842  -50.121 -2.483  1.00 31.22 ? 147 ALA B O     1 
ATOM   6129 C  CB    . ALA F 3 147 ? 8.591   -50.892 -2.415  1.00 28.11 ? 147 ALA B CB    1 
ATOM   6130 N  N     . LEU F 3 148 ? 10.877  -50.319 -0.462  1.00 28.79 ? 148 LEU B N     1 
ATOM   6131 C  CA    . LEU F 3 148 ? 11.839  -49.411 0.149   1.00 29.45 ? 148 LEU B CA    1 
ATOM   6132 C  C     . LEU F 3 148 ? 13.282  -49.905 -0.014  1.00 30.36 ? 148 LEU B C     1 
ATOM   6133 O  O     . LEU F 3 148 ? 14.118  -49.211 -0.598  1.00 30.28 ? 148 LEU B O     1 
ATOM   6134 C  CB    . LEU F 3 148 ? 11.547  -49.228 1.636   1.00 28.55 ? 148 LEU B CB    1 
ATOM   6135 C  CG    . LEU F 3 148 ? 11.477  -47.788 2.148   1.00 28.70 ? 148 LEU B CG    1 
ATOM   6136 C  CD1   . LEU F 3 148 ? 11.786  -47.789 3.629   1.00 28.37 ? 148 LEU B CD1   1 
ATOM   6137 C  CD2   . LEU F 3 148 ? 12.470  -46.901 1.405   1.00 28.45 ? 148 LEU B CD2   1 
ATOM   6138 N  N     . ARG F 3 149 ? 13.565  -51.099 0.509   1.00 31.12 ? 149 ARG B N     1 
ATOM   6139 C  CA    . ARG F 3 149 ? 14.902  -51.694 0.442   1.00 31.57 ? 149 ARG B CA    1 
ATOM   6140 C  C     . ARG F 3 149 ? 15.454  -51.689 -0.975  1.00 31.30 ? 149 ARG B C     1 
ATOM   6141 O  O     . ARG F 3 149 ? 16.647  -51.419 -1.182  1.00 30.62 ? 149 ARG B O     1 
ATOM   6142 C  CB    . ARG F 3 149 ? 14.887  -53.136 0.975   1.00 33.11 ? 149 ARG B CB    1 
ATOM   6143 C  CG    . ARG F 3 149 ? 14.642  -53.269 2.473   1.00 34.93 ? 149 ARG B CG    1 
ATOM   6144 C  CD    . ARG F 3 149 ? 14.381  -54.689 2.852   1.00 37.55 ? 149 ARG B CD    1 
ATOM   6145 N  NE    . ARG F 3 149 ? 15.222  -55.258 3.860   1.00 41.09 ? 149 ARG B NE    1 
ATOM   6146 C  CZ    . ARG F 3 149 ? 14.993  -56.141 4.828   1.00 41.23 ? 149 ARG B CZ    1 
ATOM   6147 N  NH1   . ARG F 3 149 ? 13.827  -56.715 5.081   1.00 43.17 ? 149 ARG B NH1   1 
ATOM   6148 N  NH2   . ARG F 3 149 ? 16.054  -56.444 5.561   1.00 41.49 ? 149 ARG B NH2   1 
ATOM   6149 N  N     . LYS F 3 150 ? 14.581  -51.977 -1.940  1.00 30.14 ? 150 LYS B N     1 
ATOM   6150 C  CA    . LYS F 3 150 ? 14.965  -52.002 -3.345  1.00 29.76 ? 150 LYS B CA    1 
ATOM   6151 C  C     . LYS F 3 150 ? 15.327  -50.592 -3.814  1.00 29.35 ? 150 LYS B C     1 
ATOM   6152 O  O     . LYS F 3 150 ? 16.398  -50.373 -4.383  1.00 29.09 ? 150 LYS B O     1 
ATOM   6153 C  CB    . LYS F 3 150 ? 13.818  -52.552 -4.200  1.00 30.08 ? 150 LYS B CB    1 
ATOM   6154 C  CG    . LYS F 3 150 ? 14.214  -52.805 -5.639  1.00 31.93 ? 150 LYS B CG    1 
ATOM   6155 C  CD    . LYS F 3 150 ? 13.015  -52.926 -6.552  1.00 33.45 ? 150 LYS B CD    1 
ATOM   6156 C  CE    . LYS F 3 150 ? 13.458  -53.332 -7.947  1.00 34.40 ? 150 LYS B CE    1 
ATOM   6157 N  NZ    . LYS F 3 150 ? 14.542  -52.439 -8.428  1.00 36.72 ? 150 LYS B NZ    1 
ATOM   6158 N  N     . ALA F 3 151 ? 14.432  -49.638 -3.570  1.00 29.11 ? 151 ALA B N     1 
ATOM   6159 C  CA    . ALA F 3 151 ? 14.668  -48.250 -3.970  1.00 28.90 ? 151 ALA B CA    1 
ATOM   6160 C  C     . ALA F 3 151 ? 15.983  -47.684 -3.402  1.00 28.15 ? 151 ALA B C     1 
ATOM   6161 O  O     . ALA F 3 151 ? 16.761  -47.063 -4.126  1.00 28.36 ? 151 ALA B O     1 
ATOM   6162 C  CB    . ALA F 3 151 ? 13.482  -47.366 -3.548  1.00 27.28 ? 151 ALA B CB    1 
ATOM   6163 N  N     . VAL F 3 152 ? 16.235  -47.899 -2.116  1.00 26.44 ? 152 VAL B N     1 
ATOM   6164 C  CA    . VAL F 3 152 ? 17.458  -47.394 -1.516  1.00 26.68 ? 152 VAL B CA    1 
ATOM   6165 C  C     . VAL F 3 152 ? 18.690  -48.056 -2.132  1.00 27.97 ? 152 VAL B C     1 
ATOM   6166 O  O     . VAL F 3 152 ? 19.681  -47.391 -2.420  1.00 28.37 ? 152 VAL B O     1 
ATOM   6167 C  CB    . VAL F 3 152 ? 17.461  -47.611 0.013   1.00 25.65 ? 152 VAL B CB    1 
ATOM   6168 C  CG1   . VAL F 3 152 ? 18.821  -47.292 0.591   1.00 26.19 ? 152 VAL B CG1   1 
ATOM   6169 C  CG2   . VAL F 3 152 ? 16.429  -46.723 0.654   1.00 25.20 ? 152 VAL B CG2   1 
ATOM   6170 N  N     . SER F 3 153 ? 18.627  -49.363 -2.343  1.00 29.77 ? 153 SER B N     1 
ATOM   6171 C  CA    . SER F 3 153 ? 19.753  -50.091 -2.926  1.00 31.40 ? 153 SER B CA    1 
ATOM   6172 C  C     . SER F 3 153 ? 20.071  -49.602 -4.323  1.00 32.40 ? 153 SER B C     1 
ATOM   6173 O  O     . SER F 3 153 ? 21.239  -49.384 -4.664  1.00 32.59 ? 153 SER B O     1 
ATOM   6174 C  CB    . SER F 3 153 ? 19.445  -51.574 -2.981  1.00 31.68 ? 153 SER B CB    1 
ATOM   6175 O  OG    . SER F 3 153 ? 19.169  -52.054 -1.685  1.00 35.19 ? 153 SER B OG    1 
ATOM   6176 N  N     . ASP F 3 154 ? 19.026  -49.456 -5.136  1.00 33.32 ? 154 ASP B N     1 
ATOM   6177 C  CA    . ASP F 3 154 ? 19.176  -48.963 -6.499  1.00 33.97 ? 154 ASP B CA    1 
ATOM   6178 C  C     . ASP F 3 154 ? 19.819  -47.584 -6.506  1.00 33.28 ? 154 ASP B C     1 
ATOM   6179 O  O     . ASP F 3 154 ? 20.569  -47.244 -7.419  1.00 33.62 ? 154 ASP B O     1 
ATOM   6180 C  CB    . ASP F 3 154 ? 17.817  -48.897 -7.173  1.00 36.53 ? 154 ASP B CB    1 
ATOM   6181 C  CG    . ASP F 3 154 ? 17.311  -50.273 -7.562  1.00 38.56 ? 154 ASP B CG    1 
ATOM   6182 O  OD1   . ASP F 3 154 ? 17.331  -50.613 -8.758  1.00 41.46 ? 154 ASP B OD1   1 
ATOM   6183 O  OD2   . ASP F 3 154 ? 16.893  -51.067 -6.683  1.00 39.99 ? 154 ASP B OD2   1 
ATOM   6184 N  N     . TRP F 3 155 ? 19.529  -46.794 -5.475  1.00 31.03 ? 155 TRP B N     1 
ATOM   6185 C  CA    . TRP F 3 155 ? 20.085  -45.453 -5.379  1.00 29.56 ? 155 TRP B CA    1 
ATOM   6186 C  C     . TRP F 3 155 ? 21.602  -45.520 -5.323  1.00 29.43 ? 155 TRP B C     1 
ATOM   6187 O  O     . TRP F 3 155 ? 22.290  -44.694 -5.921  1.00 30.04 ? 155 TRP B O     1 
ATOM   6188 C  CB    . TRP F 3 155 ? 19.575  -44.721 -4.137  1.00 27.70 ? 155 TRP B CB    1 
ATOM   6189 C  CG    . TRP F 3 155 ? 19.854  -43.238 -4.170  1.00 26.82 ? 155 TRP B CG    1 
ATOM   6190 C  CD1   . TRP F 3 155 ? 19.051  -42.263 -4.699  1.00 26.18 ? 155 TRP B CD1   1 
ATOM   6191 C  CD2   . TRP F 3 155 ? 21.015  -42.566 -3.664  1.00 26.04 ? 155 TRP B CD2   1 
ATOM   6192 N  NE1   . TRP F 3 155 ? 19.637  -41.030 -4.549  1.00 25.26 ? 155 TRP B NE1   1 
ATOM   6193 C  CE2   . TRP F 3 155 ? 20.845  -41.186 -3.919  1.00 26.02 ? 155 TRP B CE2   1 
ATOM   6194 C  CE3   . TRP F 3 155 ? 22.187  -42.995 -3.023  1.00 25.19 ? 155 TRP B CE3   1 
ATOM   6195 C  CZ2   . TRP F 3 155 ? 21.799  -40.231 -3.546  1.00 24.72 ? 155 TRP B CZ2   1 
ATOM   6196 C  CZ3   . TRP F 3 155 ? 23.135  -42.042 -2.654  1.00 23.87 ? 155 TRP B CZ3   1 
ATOM   6197 C  CH2   . TRP F 3 155 ? 22.934  -40.680 -2.919  1.00 23.35 ? 155 TRP B CH2   1 
ATOM   6198 N  N     . TYR F 3 156 ? 22.130  -46.505 -4.613  1.00 28.74 ? 156 TYR B N     1 
ATOM   6199 C  CA    . TYR F 3 156 ? 23.575  -46.627 -4.517  1.00 29.19 ? 156 TYR B CA    1 
ATOM   6200 C  C     . TYR F 3 156 ? 24.248  -47.438 -5.632  1.00 30.94 ? 156 TYR B C     1 
ATOM   6201 O  O     . TYR F 3 156 ? 25.230  -46.996 -6.225  1.00 30.82 ? 156 TYR B O     1 
ATOM   6202 C  CB    . TYR F 3 156 ? 23.969  -47.251 -3.187  1.00 25.30 ? 156 TYR B CB    1 
ATOM   6203 C  CG    . TYR F 3 156 ? 23.692  -46.410 -1.983  1.00 23.56 ? 156 TYR B CG    1 
ATOM   6204 C  CD1   . TYR F 3 156 ? 22.447  -46.437 -1.367  1.00 23.51 ? 156 TYR B CD1   1 
ATOM   6205 C  CD2   . TYR F 3 156 ? 24.704  -45.653 -1.399  1.00 23.64 ? 156 TYR B CD2   1 
ATOM   6206 C  CE1   . TYR F 3 156 ? 22.220  -45.748 -0.187  1.00 23.03 ? 156 TYR B CE1   1 
ATOM   6207 C  CE2   . TYR F 3 156 ? 24.488  -44.954 -0.227  1.00 23.21 ? 156 TYR B CE2   1 
ATOM   6208 C  CZ    . TYR F 3 156 ? 23.249  -45.012 0.377   1.00 23.82 ? 156 TYR B CZ    1 
ATOM   6209 O  OH    . TYR F 3 156 ? 23.051  -44.365 1.570   1.00 26.57 ? 156 TYR B OH    1 
ATOM   6210 N  N     . ASN F 3 157 ? 23.730  -48.629 -5.906  1.00 32.46 ? 157 ASN B N     1 
ATOM   6211 C  CA    . ASN F 3 157 ? 24.341  -49.497 -6.904  1.00 33.36 ? 157 ASN B CA    1 
ATOM   6212 C  C     . ASN F 3 157 ? 24.294  -49.006 -8.337  1.00 34.26 ? 157 ASN B C     1 
ATOM   6213 O  O     . ASN F 3 157 ? 25.066  -49.488 -9.171  1.00 36.29 ? 157 ASN B O     1 
ATOM   6214 C  CB    . ASN F 3 157 ? 23.752  -50.909 -6.820  1.00 34.23 ? 157 ASN B CB    1 
ATOM   6215 C  CG    . ASN F 3 157 ? 24.237  -51.672 -5.591  1.00 34.92 ? 157 ASN B CG    1 
ATOM   6216 O  OD1   . ASN F 3 157 ? 24.808  -52.705 -5.679  1.00 37.08 ? 157 ASN B OD1   1 
ATOM   6217 N  ND2   . ASN F 3 157 ? 23.992  -51.138 -4.474  1.00 35.66 ? 157 ASN B ND2   1 
ATOM   6218 N  N     . THR F 3 158 ? 23.413  -48.059 -8.648  1.00 34.34 ? 158 THR B N     1 
ATOM   6219 C  CA    . THR F 3 158 ? 23.350  -47.563 -10.018 1.00 33.51 ? 158 THR B CA    1 
ATOM   6220 C  C     . THR F 3 158 ? 24.325  -46.416 -10.205 1.00 32.86 ? 158 THR B C     1 
ATOM   6221 O  O     . THR F 3 158 ? 24.530  -45.946 -11.318 1.00 33.53 ? 158 THR B O     1 
ATOM   6222 C  CB    . THR F 3 158 ? 21.938  -47.086 -10.387 1.00 33.57 ? 158 THR B CB    1 
ATOM   6223 O  OG1   . THR F 3 158 ? 21.576  -45.972 -9.564  1.00 33.10 ? 158 THR B OG1   1 
ATOM   6224 C  CG2   . THR F 3 158 ? 20.931  -48.219 -10.210 1.00 33.16 ? 158 THR B CG2   1 
ATOM   6225 N  N     . LYS F 3 159 ? 24.913  -45.964 -9.106  1.00 33.34 ? 159 LYS B N     1 
ATOM   6226 C  CA    . LYS F 3 159 ? 25.882  -44.881 -9.152  1.00 34.71 ? 159 LYS B CA    1 
ATOM   6227 C  C     . LYS F 3 159 ? 27.224  -45.416 -9.581  1.00 35.14 ? 159 LYS B C     1 
ATOM   6228 O  O     . LYS F 3 159 ? 27.405  -46.613 -9.760  1.00 36.85 ? 159 LYS B O     1 
ATOM   6229 C  CB    . LYS F 3 159 ? 26.062  -44.221 -7.781  1.00 34.71 ? 159 LYS B CB    1 
ATOM   6230 C  CG    . LYS F 3 159 ? 25.392  -42.876 -7.631  1.00 34.54 ? 159 LYS B CG    1 
ATOM   6231 C  CD    . LYS F 3 159 ? 24.151  -43.017 -6.789  1.00 37.06 ? 159 LYS B CD    1 
ATOM   6232 C  CE    . LYS F 3 159 ? 23.366  -41.707 -6.663  1.00 37.06 ? 159 LYS B CE    1 
ATOM   6233 N  NZ    . LYS F 3 159 ? 24.108  -40.692 -5.866  1.00 39.71 ? 159 LYS B NZ    1 
ATOM   6234 N  N     . ASP F 3 160 ? 28.174  -44.504 -9.701  1.00 35.34 ? 160 ASP B N     1 
ATOM   6235 C  CA    . ASP F 3 160 ? 29.534  -44.825 -10.101 1.00 35.62 ? 160 ASP B CA    1 
ATOM   6236 C  C     . ASP F 3 160 ? 30.363  -44.685 -8.826  1.00 34.47 ? 160 ASP B C     1 
ATOM   6237 O  O     . ASP F 3 160 ? 30.322  -43.646 -8.164  1.00 34.33 ? 160 ASP B O     1 
ATOM   6238 C  CB    . ASP F 3 160 ? 29.975  -43.834 -11.171 1.00 38.51 ? 160 ASP B CB    1 
ATOM   6239 C  CG    . ASP F 3 160 ? 28.795  -43.120 -11.791 1.00 42.31 ? 160 ASP B CG    1 
ATOM   6240 O  OD1   . ASP F 3 160 ? 27.796  -43.808 -12.143 1.00 44.58 ? 160 ASP B OD1   1 
ATOM   6241 O  OD2   . ASP F 3 160 ? 28.846  -41.874 -11.936 1.00 44.46 ? 160 ASP B OD2   1 
ATOM   6242 N  N     . ALA F 3 161 ? 31.087  -45.741 -8.472  1.00 32.94 ? 161 ALA B N     1 
ATOM   6243 C  CA    . ALA F 3 161 ? 31.901  -45.751 -7.266  1.00 32.48 ? 161 ALA B CA    1 
ATOM   6244 C  C     . ALA F 3 161 ? 32.491  -44.392 -6.932  1.00 32.15 ? 161 ALA B C     1 
ATOM   6245 O  O     . ALA F 3 161 ? 32.273  -43.866 -5.839  1.00 31.96 ? 161 ALA B O     1 
ATOM   6246 C  CB    . ALA F 3 161 ? 33.010  -46.786 -7.397  1.00 32.94 ? 161 ALA B CB    1 
ATOM   6247 N  N     . LEU F 3 162 ? 33.223  -43.818 -7.880  1.00 31.73 ? 162 LEU B N     1 
ATOM   6248 C  CA    . LEU F 3 162 ? 33.858  -42.521 -7.664  1.00 31.04 ? 162 LEU B CA    1 
ATOM   6249 C  C     . LEU F 3 162 ? 32.882  -41.402 -7.335  1.00 31.39 ? 162 LEU B C     1 
ATOM   6250 O  O     . LEU F 3 162 ? 33.213  -40.486 -6.585  1.00 31.67 ? 162 LEU B O     1 
ATOM   6251 C  CB    . LEU F 3 162 ? 34.683  -42.123 -8.880  1.00 30.70 ? 162 LEU B CB    1 
ATOM   6252 C  CG    . LEU F 3 162 ? 35.526  -40.873 -8.659  1.00 28.94 ? 162 LEU B CG    1 
ATOM   6253 C  CD1   . LEU F 3 162 ? 36.517  -41.113 -7.538  1.00 28.49 ? 162 LEU B CD1   1 
ATOM   6254 C  CD2   . LEU F 3 162 ? 36.250  -40.533 -9.939  1.00 30.01 ? 162 LEU B CD2   1 
ATOM   6255 N  N     . ASN F 3 163 ? 31.685  -41.461 -7.904  1.00 31.40 ? 163 ASN B N     1 
ATOM   6256 C  CA    . ASN F 3 163 ? 30.688  -40.445 -7.617  1.00 31.81 ? 163 ASN B CA    1 
ATOM   6257 C  C     . ASN F 3 163 ? 30.084  -40.658 -6.238  1.00 31.80 ? 163 ASN B C     1 
ATOM   6258 O  O     . ASN F 3 163 ? 29.922  -39.710 -5.464  1.00 32.20 ? 163 ASN B O     1 
ATOM   6259 C  CB    . ASN F 3 163 ? 29.574  -40.475 -8.653  1.00 33.37 ? 163 ASN B CB    1 
ATOM   6260 C  CG    . ASN F 3 163 ? 29.919  -39.690 -9.892  1.00 36.08 ? 163 ASN B CG    1 
ATOM   6261 O  OD1   . ASN F 3 163 ? 30.738  -40.117 -10.716 1.00 36.61 ? 163 ASN B OD1   1 
ATOM   6262 N  ND2   . ASN F 3 163 ? 29.304  -38.517 -10.029 1.00 38.34 ? 163 ASN B ND2   1 
ATOM   6263 N  N     . LEU F 3 164 ? 29.749  -41.909 -5.939  1.00 30.27 ? 164 LEU B N     1 
ATOM   6264 C  CA    . LEU F 3 164 ? 29.146  -42.245 -4.663  1.00 29.27 ? 164 LEU B CA    1 
ATOM   6265 C  C     . LEU F 3 164 ? 30.091  -41.821 -3.548  1.00 28.86 ? 164 LEU B C     1 
ATOM   6266 O  O     . LEU F 3 164 ? 29.653  -41.324 -2.510  1.00 28.77 ? 164 LEU B O     1 
ATOM   6267 C  CB    . LEU F 3 164 ? 28.859  -43.749 -4.600  1.00 28.79 ? 164 LEU B CB    1 
ATOM   6268 C  CG    . LEU F 3 164 ? 27.633  -44.255 -3.828  1.00 28.40 ? 164 LEU B CG    1 
ATOM   6269 C  CD1   . LEU F 3 164 ? 28.078  -45.047 -2.620  1.00 28.12 ? 164 LEU B CD1   1 
ATOM   6270 C  CD2   . LEU F 3 164 ? 26.740  -43.098 -3.430  1.00 26.21 ? 164 LEU B CD2   1 
ATOM   6271 N  N     . ALA F 3 165 ? 31.390  -42.000 -3.778  1.00 28.40 ? 165 ALA B N     1 
ATOM   6272 C  CA    . ALA F 3 165 ? 32.406  -41.627 -2.799  1.00 27.70 ? 165 ALA B CA    1 
ATOM   6273 C  C     . ALA F 3 165 ? 32.284  -40.147 -2.417  1.00 28.12 ? 165 ALA B C     1 
ATOM   6274 O  O     . ALA F 3 165 ? 32.322  -39.797 -1.242  1.00 27.10 ? 165 ALA B O     1 
ATOM   6275 C  CB    . ALA F 3 165 ? 33.796  -41.913 -3.356  1.00 26.70 ? 165 ALA B CB    1 
ATOM   6276 N  N     . MET F 3 166 ? 32.131  -39.282 -3.414  1.00 29.50 ? 166 MET B N     1 
ATOM   6277 C  CA    . MET F 3 166 ? 32.001  -37.851 -3.156  1.00 30.82 ? 166 MET B CA    1 
ATOM   6278 C  C     . MET F 3 166 ? 30.701  -37.612 -2.401  1.00 29.94 ? 166 MET B C     1 
ATOM   6279 O  O     . MET F 3 166 ? 30.685  -36.971 -1.345  1.00 29.28 ? 166 MET B O     1 
ATOM   6280 C  CB    . MET F 3 166 ? 32.000  -37.066 -4.475  1.00 33.39 ? 166 MET B CB    1 
ATOM   6281 C  CG    . MET F 3 166 ? 32.861  -37.717 -5.561  1.00 39.38 ? 166 MET B CG    1 
ATOM   6282 S  SD    . MET F 3 166 ? 33.325  -36.683 -6.983  1.00 44.12 ? 166 MET B SD    1 
ATOM   6283 C  CE    . MET F 3 166 ? 31.720  -36.358 -7.759  1.00 43.80 ? 166 MET B CE    1 
ATOM   6284 N  N     . ALA F 3 167 ? 29.614  -38.155 -2.937  1.00 29.47 ? 167 ALA B N     1 
ATOM   6285 C  CA    . ALA F 3 167 ? 28.304  -38.004 -2.322  1.00 28.77 ? 167 ALA B CA    1 
ATOM   6286 C  C     . ALA F 3 167 ? 28.319  -38.374 -0.835  1.00 28.92 ? 167 ALA B C     1 
ATOM   6287 O  O     . ALA F 3 167 ? 27.826  -37.611 -0.003  1.00 28.39 ? 167 ALA B O     1 
ATOM   6288 C  CB    . ALA F 3 167 ? 27.281  -38.855 -3.067  1.00 27.66 ? 167 ALA B CB    1 
ATOM   6289 N  N     . VAL F 3 168 ? 28.893  -39.531 -0.499  1.00 28.69 ? 168 VAL B N     1 
ATOM   6290 C  CA    . VAL F 3 168 ? 28.927  -39.973 0.893   1.00 29.10 ? 168 VAL B CA    1 
ATOM   6291 C  C     . VAL F 3 168 ? 29.914  -39.224 1.792   1.00 29.48 ? 168 VAL B C     1 
ATOM   6292 O  O     . VAL F 3 168 ? 29.789  -39.260 3.018   1.00 30.72 ? 168 VAL B O     1 
ATOM   6293 C  CB    . VAL F 3 168 ? 29.200  -41.497 1.007   1.00 28.07 ? 168 VAL B CB    1 
ATOM   6294 C  CG1   . VAL F 3 168 ? 28.101  -42.261 0.307   1.00 27.32 ? 168 VAL B CG1   1 
ATOM   6295 C  CG2   . VAL F 3 168 ? 30.568  -41.844 0.434   1.00 27.74 ? 168 VAL B CG2   1 
ATOM   6296 N  N     . THR F 3 169 ? 30.884  -38.541 1.197   1.00 28.98 ? 169 THR B N     1 
ATOM   6297 C  CA    . THR F 3 169 ? 31.846  -37.787 1.988   1.00 28.18 ? 169 THR B CA    1 
ATOM   6298 C  C     . THR F 3 169 ? 31.428  -36.314 2.075   1.00 28.37 ? 169 THR B C     1 
ATOM   6299 O  O     . THR F 3 169 ? 31.766  -35.607 3.026   1.00 27.22 ? 169 THR B O     1 
ATOM   6300 C  CB    . THR F 3 169 ? 33.260  -37.910 1.394   1.00 27.78 ? 169 THR B CB    1 
ATOM   6301 O  OG1   . THR F 3 169 ? 33.214  -37.656 -0.016  1.00 27.35 ? 169 THR B OG1   1 
ATOM   6302 C  CG2   . THR F 3 169 ? 33.819  -39.306 1.654   1.00 26.34 ? 169 THR B CG2   1 
ATOM   6303 N  N     . LYS F 3 170 ? 30.681  -35.856 1.079   1.00 28.10 ? 170 LYS B N     1 
ATOM   6304 C  CA    . LYS F 3 170 ? 30.210  -34.485 1.087   1.00 26.85 ? 170 LYS B CA    1 
ATOM   6305 C  C     . LYS F 3 170 ? 29.064  -34.420 2.080   1.00 27.27 ? 170 LYS B C     1 
ATOM   6306 O  O     . LYS F 3 170 ? 28.996  -33.510 2.911   1.00 28.84 ? 170 LYS B O     1 
ATOM   6307 C  CB    . LYS F 3 170 ? 29.711  -34.078 -0.297  1.00 25.59 ? 170 LYS B CB    1 
ATOM   6308 C  CG    . LYS F 3 170 ? 29.223  -32.646 -0.378  1.00 22.79 ? 170 LYS B CG    1 
ATOM   6309 C  CD    . LYS F 3 170 ? 28.940  -32.243 -1.816  1.00 22.59 ? 170 LYS B CD    1 
ATOM   6310 C  CE    . LYS F 3 170 ? 28.539  -30.782 -1.904  1.00 21.03 ? 170 LYS B CE    1 
ATOM   6311 N  NZ    . LYS F 3 170 ? 28.338  -30.344 -3.308  1.00 22.45 ? 170 LYS B NZ    1 
ATOM   6312 N  N     . TYR F 3 171 ? 28.164  -35.395 1.988   1.00 26.63 ? 171 TYR B N     1 
ATOM   6313 C  CA    . TYR F 3 171 ? 27.006  -35.456 2.871   1.00 25.50 ? 171 TYR B CA    1 
ATOM   6314 C  C     . TYR F 3 171 ? 27.093  -36.711 3.729   1.00 25.20 ? 171 TYR B C     1 
ATOM   6315 O  O     . TYR F 3 171 ? 26.442  -37.700 3.429   1.00 24.64 ? 171 TYR B O     1 
ATOM   6316 C  CB    . TYR F 3 171 ? 25.706  -35.500 2.054   1.00 23.83 ? 171 TYR B CB    1 
ATOM   6317 C  CG    . TYR F 3 171 ? 25.586  -34.459 0.963   1.00 22.12 ? 171 TYR B CG    1 
ATOM   6318 C  CD1   . TYR F 3 171 ? 26.217  -34.636 -0.265  1.00 22.91 ? 171 TYR B CD1   1 
ATOM   6319 C  CD2   . TYR F 3 171 ? 24.823  -33.307 1.148   1.00 21.45 ? 171 TYR B CD2   1 
ATOM   6320 C  CE1   . TYR F 3 171 ? 26.087  -33.698 -1.282  1.00 21.56 ? 171 TYR B CE1   1 
ATOM   6321 C  CE2   . TYR F 3 171 ? 24.694  -32.366 0.141   1.00 19.52 ? 171 TYR B CE2   1 
ATOM   6322 C  CZ    . TYR F 3 171 ? 25.330  -32.571 -1.069  1.00 21.17 ? 171 TYR B CZ    1 
ATOM   6323 O  OH    . TYR F 3 171 ? 25.236  -31.651 -2.080  1.00 21.89 ? 171 TYR B OH    1 
ATOM   6324 N  N     . LYS F 3 172 ? 27.877  -36.676 4.799   1.00 26.39 ? 172 LYS B N     1 
ATOM   6325 C  CA    . LYS F 3 172 ? 28.010  -37.860 5.644   1.00 28.22 ? 172 LYS B CA    1 
ATOM   6326 C  C     . LYS F 3 172 ? 26.684  -38.277 6.287   1.00 27.78 ? 172 LYS B C     1 
ATOM   6327 O  O     . LYS F 3 172 ? 26.361  -39.463 6.335   1.00 26.46 ? 172 LYS B O     1 
ATOM   6328 C  CB    . LYS F 3 172 ? 29.090  -37.634 6.704   1.00 30.88 ? 172 LYS B CB    1 
ATOM   6329 C  CG    . LYS F 3 172 ? 30.495  -37.559 6.103   1.00 33.44 ? 172 LYS B CG    1 
ATOM   6330 C  CD    . LYS F 3 172 ? 31.565  -37.677 7.176   1.00 36.22 ? 172 LYS B CD    1 
ATOM   6331 C  CE    . LYS F 3 172 ? 32.554  -38.786 6.843   1.00 38.26 ? 172 LYS B CE    1 
ATOM   6332 N  NZ    . LYS F 3 172 ? 33.111  -39.387 8.094   1.00 40.50 ? 172 LYS B NZ    1 
ATOM   6333 N  N     . GLN F 3 173 ? 25.921  -37.308 6.787   1.00 27.83 ? 173 GLN B N     1 
ATOM   6334 C  CA    . GLN F 3 173 ? 24.609  -37.589 7.372   1.00 28.18 ? 173 GLN B CA    1 
ATOM   6335 C  C     . GLN F 3 173 ? 23.800  -36.305 7.530   1.00 28.43 ? 173 GLN B C     1 
ATOM   6336 O  O     . GLN F 3 173 ? 24.345  -35.253 7.887   1.00 28.68 ? 173 GLN B O     1 
ATOM   6337 C  CB    . GLN F 3 173 ? 24.739  -38.311 8.732   1.00 28.54 ? 173 GLN B CB    1 
ATOM   6338 C  CG    . GLN F 3 173 ? 25.368  -37.519 9.886   1.00 28.76 ? 173 GLN B CG    1 
ATOM   6339 C  CD    . GLN F 3 173 ? 24.480  -36.382 10.409  1.00 30.35 ? 173 GLN B CD    1 
ATOM   6340 O  OE1   . GLN F 3 173 ? 23.281  -36.566 10.611  1.00 31.48 ? 173 GLN B OE1   1 
ATOM   6341 N  NE2   . GLN F 3 173 ? 25.065  -35.210 10.622  1.00 30.19 ? 173 GLN B NE2   1 
ATOM   6342 N  N     . ARG F 3 174 ? 22.499  -36.395 7.259   1.00 28.36 ? 174 ARG B N     1 
ATOM   6343 C  CA    . ARG F 3 174 ? 21.605  -35.244 7.377   1.00 28.96 ? 174 ARG B CA    1 
ATOM   6344 C  C     . ARG F 3 174 ? 20.332  -35.564 8.147   1.00 30.51 ? 174 ARG B C     1 
ATOM   6345 O  O     . ARG F 3 174 ? 19.824  -36.680 8.084   1.00 31.06 ? 174 ARG B O     1 
ATOM   6346 C  CB    . ARG F 3 174 ? 21.185  -34.731 6.001   1.00 26.60 ? 174 ARG B CB    1 
ATOM   6347 C  CG    . ARG F 3 174 ? 22.299  -34.227 5.146   1.00 26.47 ? 174 ARG B CG    1 
ATOM   6348 C  CD    . ARG F 3 174 ? 23.140  -33.204 5.881   1.00 25.45 ? 174 ARG B CD    1 
ATOM   6349 N  NE    . ARG F 3 174 ? 24.020  -32.571 4.955   1.00 25.71 ? 174 ARG B NE    1 
ATOM   6350 C  CZ    . ARG F 3 174 ? 25.316  -32.703 4.702   1.00 24.81 ? 174 ARG B CZ    1 
ATOM   6351 N  NH1   . ARG F 3 174 ? 25.740  -31.932 3.727   1.00 23.73 ? 174 ARG B NH1   1 
ATOM   6352 N  NH2   . ARG F 3 174 ? 26.178  -33.484 5.351   1.00 25.10 ? 174 ARG B NH2   1 
ATOM   6353 N  N     . ASN F 3 175 ? 19.824  -34.571 8.869   1.00 31.65 ? 175 ASN B N     1 
ATOM   6354 C  CA    . ASN F 3 175 ? 18.578  -34.705 9.607   1.00 33.55 ? 175 ASN B CA    1 
ATOM   6355 C  C     . ASN F 3 175 ? 18.482  -35.942 10.496  1.00 33.68 ? 175 ASN B C     1 
ATOM   6356 O  O     . ASN F 3 175 ? 17.385  -36.358 10.860  1.00 34.59 ? 175 ASN B O     1 
ATOM   6357 C  CB    . ASN F 3 175 ? 17.415  -34.704 8.609   1.00 35.83 ? 175 ASN B CB    1 
ATOM   6358 C  CG    . ASN F 3 175 ? 17.623  -33.708 7.474   1.00 37.90 ? 175 ASN B CG    1 
ATOM   6359 O  OD1   . ASN F 3 175 ? 17.475  -34.047 6.290   1.00 39.67 ? 175 ASN B OD1   1 
ATOM   6360 N  ND2   . ASN F 3 175 ? 17.977  -32.474 7.829   1.00 36.79 ? 175 ASN B ND2   1 
ATOM   6361 N  N     . GLY F 3 176 ? 19.615  -36.538 10.840  1.00 32.78 ? 176 GLY B N     1 
ATOM   6362 C  CA    . GLY F 3 176 ? 19.574  -37.713 11.692  1.00 32.72 ? 176 GLY B CA    1 
ATOM   6363 C  C     . GLY F 3 176 ? 19.740  -39.035 10.963  1.00 32.16 ? 176 GLY B C     1 
ATOM   6364 O  O     . GLY F 3 176 ? 19.617  -40.100 11.570  1.00 32.50 ? 176 GLY B O     1 
ATOM   6365 N  N     . TRP F 3 177 ? 20.007  -38.973 9.663   1.00 30.84 ? 177 TRP B N     1 
ATOM   6366 C  CA    . TRP F 3 177 ? 20.203  -40.180 8.876   1.00 29.48 ? 177 TRP B CA    1 
ATOM   6367 C  C     . TRP F 3 177 ? 21.566  -40.194 8.196   1.00 29.05 ? 177 TRP B C     1 
ATOM   6368 O  O     . TRP F 3 177 ? 21.990  -39.192 7.626   1.00 29.68 ? 177 TRP B O     1 
ATOM   6369 C  CB    . TRP F 3 177 ? 19.107  -40.323 7.817   1.00 29.37 ? 177 TRP B CB    1 
ATOM   6370 C  CG    . TRP F 3 177 ? 17.746  -40.619 8.372   1.00 29.07 ? 177 TRP B CG    1 
ATOM   6371 C  CD1   . TRP F 3 177 ? 16.812  -39.714 8.778   1.00 28.96 ? 177 TRP B CD1   1 
ATOM   6372 C  CD2   . TRP F 3 177 ? 17.173  -41.915 8.591   1.00 28.73 ? 177 TRP B CD2   1 
ATOM   6373 N  NE1   . TRP F 3 177 ? 15.686  -40.363 9.223   1.00 28.17 ? 177 TRP B NE1   1 
ATOM   6374 C  CE2   . TRP F 3 177 ? 15.878  -41.715 9.110   1.00 28.17 ? 177 TRP B CE2   1 
ATOM   6375 C  CE3   . TRP F 3 177 ? 17.617  -43.226 8.366   1.00 27.74 ? 177 TRP B CE3   1 
ATOM   6376 C  CZ2   . TRP F 3 177 ? 15.034  -42.780 9.451   1.00 28.68 ? 177 TRP B CZ2   1 
ATOM   6377 C  CZ3   . TRP F 3 177 ? 16.777  -44.284 8.700   1.00 27.29 ? 177 TRP B CZ3   1 
ATOM   6378 C  CH2   . TRP F 3 177 ? 15.493  -44.052 9.223   1.00 26.95 ? 177 TRP B CH2   1 
ATOM   6379 N  N     . SER F 3 178 ? 22.245  -41.336 8.264   1.00 28.68 ? 178 SER B N     1 
ATOM   6380 C  CA    . SER F 3 178 ? 23.560  -41.498 7.648   1.00 29.47 ? 178 SER B CA    1 
ATOM   6381 C  C     . SER F 3 178 ? 23.466  -42.586 6.586   1.00 28.82 ? 178 SER B C     1 
ATOM   6382 O  O     . SER F 3 178 ? 22.472  -43.312 6.527   1.00 28.18 ? 178 SER B O     1 
ATOM   6383 C  CB    . SER F 3 178 ? 24.596  -41.924 8.690   1.00 29.53 ? 178 SER B CB    1 
ATOM   6384 O  OG    . SER F 3 178 ? 24.537  -43.325 8.918   1.00 31.66 ? 178 SER B OG    1 
ATOM   6385 N  N     . HIS F 3 179 ? 24.493  -42.704 5.750   1.00 28.14 ? 179 HIS B N     1 
ATOM   6386 C  CA    . HIS F 3 179 ? 24.488  -43.740 4.730   1.00 28.64 ? 179 HIS B CA    1 
ATOM   6387 C  C     . HIS F 3 179 ? 24.742  -45.052 5.435   1.00 29.07 ? 179 HIS B C     1 
ATOM   6388 O  O     . HIS F 3 179 ? 24.502  -46.121 4.883   1.00 28.50 ? 179 HIS B O     1 
ATOM   6389 C  CB    . HIS F 3 179 ? 25.572  -43.494 3.685   1.00 27.89 ? 179 HIS B CB    1 
ATOM   6390 C  CG    . HIS F 3 179 ? 25.382  -42.228 2.919   1.00 27.77 ? 179 HIS B CG    1 
ATOM   6391 N  ND1   . HIS F 3 179 ? 26.093  -41.082 3.194   1.00 27.67 ? 179 HIS B ND1   1 
ATOM   6392 C  CD2   . HIS F 3 179 ? 24.521  -41.912 1.926   1.00 28.32 ? 179 HIS B CD2   1 
ATOM   6393 C  CE1   . HIS F 3 179 ? 25.677  -40.111 2.403   1.00 27.87 ? 179 HIS B CE1   1 
ATOM   6394 N  NE2   . HIS F 3 179 ? 24.722  -40.587 1.624   1.00 30.22 ? 179 HIS B NE2   1 
ATOM   6395 N  N     . LYS F 3 180 ? 25.224  -44.957 6.673   1.00 30.67 ? 180 LYS B N     1 
ATOM   6396 C  CA    . LYS F 3 180 ? 25.500  -46.144 7.470   1.00 31.52 ? 180 LYS B CA    1 
ATOM   6397 C  C     . LYS F 3 180 ? 24.198  -46.841 7.849   1.00 31.22 ? 180 LYS B C     1 
ATOM   6398 O  O     . LYS F 3 180 ? 24.123  -48.070 7.839   1.00 31.69 ? 180 LYS B O     1 
ATOM   6399 C  CB    . LYS F 3 180 ? 26.278  -45.788 8.740   1.00 31.85 ? 180 LYS B CB    1 
ATOM   6400 C  CG    . LYS F 3 180 ? 26.777  -47.022 9.483   1.00 32.12 ? 180 LYS B CG    1 
ATOM   6401 C  CD    . LYS F 3 180 ? 27.607  -46.661 10.681  1.00 33.83 ? 180 LYS B CD    1 
ATOM   6402 C  CE    . LYS F 3 180 ? 28.266  -47.897 11.264  1.00 35.10 ? 180 LYS B CE    1 
ATOM   6403 N  NZ    . LYS F 3 180 ? 29.549  -47.552 11.942  1.00 35.89 ? 180 LYS B NZ    1 
ATOM   6404 N  N     . ASP F 3 181 ? 23.176  -46.062 8.188   1.00 30.44 ? 181 ASP B N     1 
ATOM   6405 C  CA    . ASP F 3 181 ? 21.893  -46.647 8.546   1.00 31.34 ? 181 ASP B CA    1 
ATOM   6406 C  C     . ASP F 3 181 ? 21.168  -47.147 7.289   1.00 30.95 ? 181 ASP B C     1 
ATOM   6407 O  O     . ASP F 3 181 ? 20.625  -48.250 7.276   1.00 31.97 ? 181 ASP B O     1 
ATOM   6408 C  CB    . ASP F 3 181 ? 21.014  -45.624 9.273   1.00 32.09 ? 181 ASP B CB    1 
ATOM   6409 C  CG    . ASP F 3 181 ? 21.717  -44.974 10.453  1.00 31.04 ? 181 ASP B CG    1 
ATOM   6410 O  OD1   . ASP F 3 181 ? 21.978  -43.756 10.383  1.00 29.40 ? 181 ASP B OD1   1 
ATOM   6411 O  OD2   . ASP F 3 181 ? 22.005  -45.677 11.447  1.00 31.79 ? 181 ASP B OD2   1 
ATOM   6412 N  N     . LEU F 3 182 ? 21.162  -46.343 6.230   1.00 29.84 ? 182 LEU B N     1 
ATOM   6413 C  CA    . LEU F 3 182 ? 20.496  -46.751 5.003   1.00 29.73 ? 182 LEU B CA    1 
ATOM   6414 C  C     . LEU F 3 182 ? 21.112  -48.018 4.420   1.00 30.55 ? 182 LEU B C     1 
ATOM   6415 O  O     . LEU F 3 182 ? 20.394  -48.953 4.048   1.00 32.18 ? 182 LEU B O     1 
ATOM   6416 C  CB    . LEU F 3 182 ? 20.548  -45.640 3.958   1.00 29.51 ? 182 LEU B CB    1 
ATOM   6417 C  CG    . LEU F 3 182 ? 19.927  -44.282 4.292   1.00 28.78 ? 182 LEU B CG    1 
ATOM   6418 C  CD1   . LEU F 3 182 ? 19.841  -43.499 3.006   1.00 29.46 ? 182 LEU B CD1   1 
ATOM   6419 C  CD2   . LEU F 3 182 ? 18.542  -44.426 4.908   1.00 27.39 ? 182 LEU B CD2   1 
ATOM   6420 N  N     . LEU F 3 183 ? 22.436  -48.057 4.336   1.00 29.60 ? 183 LEU B N     1 
ATOM   6421 C  CA    . LEU F 3 183 ? 23.116  -49.231 3.801   1.00 30.04 ? 183 LEU B CA    1 
ATOM   6422 C  C     . LEU F 3 183 ? 22.741  -50.496 4.571   1.00 30.94 ? 183 LEU B C     1 
ATOM   6423 O  O     . LEU F 3 183 ? 22.580  -51.573 3.987   1.00 31.72 ? 183 LEU B O     1 
ATOM   6424 C  CB    . LEU F 3 183 ? 24.634  -49.030 3.854   1.00 28.94 ? 183 LEU B CB    1 
ATOM   6425 C  CG    . LEU F 3 183 ? 25.351  -48.781 2.525   1.00 28.11 ? 183 LEU B CG    1 
ATOM   6426 C  CD1   . LEU F 3 183 ? 24.513  -47.883 1.631   1.00 27.71 ? 183 LEU B CD1   1 
ATOM   6427 C  CD2   . LEU F 3 183 ? 26.707  -48.170 2.802   1.00 27.92 ? 183 LEU B CD2   1 
ATOM   6428 N  N     . ARG F 3 184 ? 22.588  -50.349 5.882   1.00 30.76 ? 184 ARG B N     1 
ATOM   6429 C  CA    . ARG F 3 184 ? 22.254  -51.464 6.756   1.00 31.26 ? 184 ARG B CA    1 
ATOM   6430 C  C     . ARG F 3 184 ? 20.780  -51.830 6.727   1.00 31.65 ? 184 ARG B C     1 
ATOM   6431 O  O     . ARG F 3 184 ? 20.438  -53.003 6.722   1.00 32.30 ? 184 ARG B O     1 
ATOM   6432 C  CB    . ARG F 3 184 ? 22.649  -51.128 8.195   1.00 31.21 ? 184 ARG B CB    1 
ATOM   6433 C  CG    . ARG F 3 184 ? 22.541  -52.271 9.179   1.00 31.90 ? 184 ARG B CG    1 
ATOM   6434 C  CD    . ARG F 3 184 ? 21.845  -51.805 10.440  1.00 33.53 ? 184 ARG B CD    1 
ATOM   6435 N  NE    . ARG F 3 184 ? 22.213  -50.434 10.770  1.00 35.31 ? 184 ARG B NE    1 
ATOM   6436 C  CZ    . ARG F 3 184 ? 21.432  -49.601 11.448  1.00 36.92 ? 184 ARG B CZ    1 
ATOM   6437 N  NH1   . ARG F 3 184 ? 21.837  -48.363 11.703  1.00 36.88 ? 184 ARG B NH1   1 
ATOM   6438 N  NH2   . ARG F 3 184 ? 20.239  -50.010 11.868  1.00 36.36 ? 184 ARG B NH2   1 
ATOM   6439 N  N     . LEU F 3 185 ? 19.904  -50.833 6.721   1.00 30.95 ? 185 LEU B N     1 
ATOM   6440 C  CA    . LEU F 3 185 ? 18.481  -51.114 6.722   1.00 29.58 ? 185 LEU B CA    1 
ATOM   6441 C  C     . LEU F 3 185 ? 17.984  -51.698 5.413   1.00 29.57 ? 185 LEU B C     1 
ATOM   6442 O  O     . LEU F 3 185 ? 16.991  -52.418 5.386   1.00 29.27 ? 185 LEU B O     1 
ATOM   6443 C  CB    . LEU F 3 185 ? 17.699  -49.846 7.073   1.00 28.73 ? 185 LEU B CB    1 
ATOM   6444 C  CG    . LEU F 3 185 ? 17.849  -49.371 8.522   1.00 26.50 ? 185 LEU B CG    1 
ATOM   6445 C  CD1   . LEU F 3 185 ? 16.929  -48.192 8.801   1.00 25.05 ? 185 LEU B CD1   1 
ATOM   6446 C  CD2   . LEU F 3 185 ? 17.519  -50.521 9.444   1.00 26.65 ? 185 LEU B CD2   1 
ATOM   6447 N  N     . SER F 3 186 ? 18.684  -51.400 4.327   1.00 30.96 ? 186 SER B N     1 
ATOM   6448 C  CA    . SER F 3 186 ? 18.279  -51.900 3.021   1.00 32.36 ? 186 SER B CA    1 
ATOM   6449 C  C     . SER F 3 186 ? 19.014  -53.184 2.643   1.00 33.22 ? 186 SER B C     1 
ATOM   6450 O  O     . SER F 3 186 ? 18.707  -53.809 1.624   1.00 33.39 ? 186 SER B O     1 
ATOM   6451 C  CB    . SER F 3 186 ? 18.494  -50.812 1.954   1.00 31.55 ? 186 SER B CB    1 
ATOM   6452 O  OG    . SER F 3 186 ? 19.813  -50.310 1.986   1.00 30.19 ? 186 SER B OG    1 
ATOM   6453 N  N     . HIS F 3 187 ? 19.972  -53.577 3.477   1.00 34.51 ? 187 HIS B N     1 
ATOM   6454 C  CA    . HIS F 3 187 ? 20.768  -54.785 3.249   1.00 36.46 ? 187 HIS B CA    1 
ATOM   6455 C  C     . HIS F 3 187 ? 21.300  -54.873 1.827   1.00 37.68 ? 187 HIS B C     1 
ATOM   6456 O  O     . HIS F 3 187 ? 21.264  -55.927 1.216   1.00 39.25 ? 187 HIS B O     1 
ATOM   6457 C  CB    . HIS F 3 187 ? 19.942  -56.044 3.508   1.00 37.68 ? 187 HIS B CB    1 
ATOM   6458 C  CG    . HIS F 3 187 ? 19.387  -56.142 4.889   1.00 39.34 ? 187 HIS B CG    1 
ATOM   6459 N  ND1   . HIS F 3 187 ? 19.655  -55.235 5.879   1.00 40.85 ? 187 HIS B ND1   1 
ATOM   6460 C  CD2   . HIS F 3 187 ? 18.563  -57.070 5.448   1.00 40.27 ? 187 HIS B CD2   1 
ATOM   6461 C  CE1   . HIS F 3 187 ? 19.025  -55.583 6.990   1.00 41.13 ? 187 HIS B CE1   1 
ATOM   6462 N  NE2   . HIS F 3 187 ? 18.355  -56.697 6.745   1.00 41.22 ? 187 HIS B NE2   1 
ATOM   6463 N  N     . ILE F 3 188 ? 21.789  -53.767 1.300   1.00 39.16 ? 188 ILE B N     1 
ATOM   6464 C  CA    . ILE F 3 188 ? 22.323  -53.700 -0.056  1.00 39.83 ? 188 ILE B CA    1 
ATOM   6465 C  C     . ILE F 3 188 ? 23.536  -54.607 -0.303  1.00 40.31 ? 188 ILE B C     1 
ATOM   6466 O  O     . ILE F 3 188 ? 24.226  -55.010 0.634   1.00 39.76 ? 188 ILE B O     1 
ATOM   6467 C  CB    . ILE F 3 188 ? 22.741  -52.254 -0.325  1.00 40.95 ? 188 ILE B CB    1 
ATOM   6468 C  CG1   . ILE F 3 188 ? 23.195  -52.057 -1.762  1.00 39.95 ? 188 ILE B CG1   1 
ATOM   6469 C  CG2   . ILE F 3 188 ? 23.898  -51.874 0.614   1.00 40.67 ? 188 ILE B CG2   1 
ATOM   6470 C  CD1   . ILE F 3 188 ? 23.678  -50.652 -1.965  1.00 40.89 ? 188 ILE B CD1   1 
ATOM   6471 N  N     . LYS F 3 189 ? 23.782  -54.930 -1.570  1.00 40.80 ? 189 LYS B N     1 
ATOM   6472 C  CA    . LYS F 3 189 ? 24.939  -55.732 -1.952  1.00 41.09 ? 189 LYS B CA    1 
ATOM   6473 C  C     . LYS F 3 189 ? 25.601  -54.972 -3.079  1.00 40.64 ? 189 LYS B C     1 
ATOM   6474 O  O     . LYS F 3 189 ? 25.066  -54.902 -4.188  1.00 41.09 ? 189 LYS B O     1 
ATOM   6475 C  CB    . LYS F 3 189 ? 24.552  -57.102 -2.493  1.00 42.44 ? 189 LYS B CB    1 
ATOM   6476 C  CG    . LYS F 3 189 ? 23.160  -57.499 -2.291  1.00 44.12 ? 189 LYS B CG    1 
ATOM   6477 C  CD    . LYS F 3 189 ? 22.880  -58.825 -2.904  1.00 45.29 ? 189 LYS B CD    1 
ATOM   6478 C  CE    . LYS F 3 189 ? 21.470  -59.245 -2.564  1.00 47.05 ? 189 LYS B CE    1 
ATOM   6479 N  NZ    . LYS F 3 189 ? 20.938  -60.414 -3.331  1.00 48.41 ? 189 LYS B NZ    1 
ATOM   6480 N  N     . PRO F 3 190 ? 26.753  -54.367 -2.803  1.00 40.13 ? 190 PRO B N     1 
ATOM   6481 C  CA    . PRO F 3 190 ? 27.518  -53.599 -3.781  1.00 39.66 ? 190 PRO B CA    1 
ATOM   6482 C  C     . PRO F 3 190 ? 27.584  -54.360 -5.108  1.00 39.13 ? 190 PRO B C     1 
ATOM   6483 O  O     . PRO F 3 190 ? 27.948  -55.534 -5.138  1.00 38.68 ? 190 PRO B O     1 
ATOM   6484 C  CB    . PRO F 3 190 ? 28.867  -53.470 -3.100  1.00 40.27 ? 190 PRO B CB    1 
ATOM   6485 C  CG    . PRO F 3 190 ? 28.468  -53.289 -1.671  1.00 40.57 ? 190 PRO B CG    1 
ATOM   6486 C  CD    . PRO F 3 190 ? 27.394  -54.335 -1.479  1.00 40.16 ? 190 PRO B CD    1 
ATOM   6487 N  N     . ALA F 3 191 ? 27.231  -53.680 -6.196  1.00 38.52 ? 191 ALA B N     1 
ATOM   6488 C  CA    . ALA F 3 191 ? 27.216  -54.283 -7.522  1.00 38.12 ? 191 ALA B CA    1 
ATOM   6489 C  C     . ALA F 3 191 ? 28.594  -54.458 -8.137  1.00 38.25 ? 191 ALA B C     1 
ATOM   6490 O  O     . ALA F 3 191 ? 28.731  -55.091 -9.182  1.00 39.43 ? 191 ALA B O     1 
ATOM   6491 C  CB    . ALA F 3 191 ? 26.330  -53.459 -8.462  1.00 37.21 ? 191 ALA B CB    1 
ATOM   6492 N  N     . ASN F 3 192 ? 29.617  -53.900 -7.507  1.00 37.95 ? 192 ASN B N     1 
ATOM   6493 C  CA    . ASN F 3 192 ? 30.960  -54.023 -8.050  1.00 37.17 ? 192 ASN B CA    1 
ATOM   6494 C  C     . ASN F 3 192 ? 31.985  -53.712 -6.981  1.00 36.86 ? 192 ASN B C     1 
ATOM   6495 O  O     . ASN F 3 192 ? 31.635  -53.223 -5.902  1.00 36.28 ? 192 ASN B O     1 
ATOM   6496 C  CB    . ASN F 3 192 ? 31.146  -53.083 -9.249  1.00 38.26 ? 192 ASN B CB    1 
ATOM   6497 C  CG    . ASN F 3 192 ? 31.204  -51.618 -8.856  1.00 39.70 ? 192 ASN B CG    1 
ATOM   6498 O  OD1   . ASN F 3 192 ? 31.144  -51.265 -7.680  1.00 41.79 ? 192 ASN B OD1   1 
ATOM   6499 N  ND2   . ASN F 3 192 ? 31.324  -50.754 -9.855  1.00 40.36 ? 192 ASN B ND2   1 
ATOM   6500 N  N     . GLU F 3 193 ? 33.249  -53.988 -7.287  1.00 36.11 ? 193 GLU B N     1 
ATOM   6501 C  CA    . GLU F 3 193 ? 34.340  -53.743 -6.352  1.00 36.37 ? 193 GLU B CA    1 
ATOM   6502 C  C     . GLU F 3 193 ? 34.394  -52.285 -5.877  1.00 34.71 ? 193 GLU B C     1 
ATOM   6503 O  O     . GLU F 3 193 ? 34.637  -52.025 -4.697  1.00 33.20 ? 193 GLU B O     1 
ATOM   6504 C  CB    . GLU F 3 193 ? 35.679  -54.132 -6.991  1.00 38.54 ? 193 GLU B CB    1 
ATOM   6505 C  CG    . GLU F 3 193 ? 36.855  -54.116 -6.014  1.00 42.64 ? 193 GLU B CG    1 
ATOM   6506 C  CD    . GLU F 3 193 ? 37.359  -55.507 -5.672  1.00 44.80 ? 193 GLU B CD    1 
ATOM   6507 O  OE1   . GLU F 3 193 ? 37.895  -56.189 -6.572  1.00 46.77 ? 193 GLU B OE1   1 
ATOM   6508 O  OE2   . GLU F 3 193 ? 37.221  -55.918 -4.501  1.00 45.10 ? 193 GLU B OE2   1 
ATOM   6509 N  N     . GLY F 3 194 ? 34.166  -51.343 -6.793  1.00 33.78 ? 194 GLY B N     1 
ATOM   6510 C  CA    . GLY F 3 194 ? 34.199  -49.939 -6.427  1.00 32.20 ? 194 GLY B CA    1 
ATOM   6511 C  C     . GLY F 3 194 ? 33.192  -49.606 -5.342  1.00 32.05 ? 194 GLY B C     1 
ATOM   6512 O  O     . GLY F 3 194 ? 33.500  -48.884 -4.393  1.00 31.80 ? 194 GLY B O     1 
ATOM   6513 N  N     . LEU F 3 195 ? 31.987  -50.151 -5.481  1.00 31.45 ? 195 LEU B N     1 
ATOM   6514 C  CA    . LEU F 3 195 ? 30.901  -49.924 -4.531  1.00 31.59 ? 195 LEU B CA    1 
ATOM   6515 C  C     . LEU F 3 195 ? 31.095  -50.599 -3.175  1.00 30.50 ? 195 LEU B C     1 
ATOM   6516 O  O     . LEU F 3 195 ? 30.688  -50.066 -2.141  1.00 30.49 ? 195 LEU B O     1 
ATOM   6517 C  CB    . LEU F 3 195 ? 29.570  -50.368 -5.156  1.00 31.76 ? 195 LEU B CB    1 
ATOM   6518 C  CG    . LEU F 3 195 ? 29.027  -49.406 -6.225  1.00 32.81 ? 195 LEU B CG    1 
ATOM   6519 C  CD1   . LEU F 3 195 ? 27.959  -50.078 -7.078  1.00 32.22 ? 195 LEU B CD1   1 
ATOM   6520 C  CD2   . LEU F 3 195 ? 28.477  -48.168 -5.534  1.00 33.22 ? 195 LEU B CD2   1 
ATOM   6521 N  N     . THR F 3 196 ? 31.705  -51.776 -3.175  1.00 30.35 ? 196 THR B N     1 
ATOM   6522 C  CA    . THR F 3 196 ? 31.950  -52.491 -1.928  1.00 29.79 ? 196 THR B CA    1 
ATOM   6523 C  C     . THR F 3 196 ? 32.932  -51.696 -1.089  1.00 29.74 ? 196 THR B C     1 
ATOM   6524 O  O     . THR F 3 196 ? 32.800  -51.612 0.132   1.00 29.40 ? 196 THR B O     1 
ATOM   6525 C  CB    . THR F 3 196 ? 32.556  -53.868 -2.173  1.00 27.95 ? 196 THR B CB    1 
ATOM   6526 O  OG1   . THR F 3 196 ? 31.640  -54.657 -2.933  1.00 27.22 ? 196 THR B OG1   1 
ATOM   6527 C  CG2   . THR F 3 196 ? 32.835  -54.552 -0.855  1.00 26.45 ? 196 THR B CG2   1 
ATOM   6528 N  N     . MET F 3 197 ? 33.920  -51.111 -1.756  1.00 29.62 ? 197 MET B N     1 
ATOM   6529 C  CA    . MET F 3 197 ? 34.920  -50.316 -1.064  1.00 30.22 ? 197 MET B CA    1 
ATOM   6530 C  C     . MET F 3 197 ? 34.264  -49.120 -0.393  1.00 29.92 ? 197 MET B C     1 
ATOM   6531 O  O     . MET F 3 197 ? 34.509  -48.844 0.786   1.00 30.33 ? 197 MET B O     1 
ATOM   6532 C  CB    . MET F 3 197 ? 35.983  -49.819 -2.034  1.00 30.05 ? 197 MET B CB    1 
ATOM   6533 C  CG    . MET F 3 197 ? 37.103  -49.095 -1.325  1.00 30.54 ? 197 MET B CG    1 
ATOM   6534 S  SD    . MET F 3 197 ? 38.198  -48.275 -2.464  1.00 30.71 ? 197 MET B SD    1 
ATOM   6535 C  CE    . MET F 3 197 ? 39.159  -49.691 -3.068  1.00 31.49 ? 197 MET B CE    1 
ATOM   6536 N  N     . VAL F 3 198 ? 33.443  -48.406 -1.155  1.00 28.76 ? 198 VAL B N     1 
ATOM   6537 C  CA    . VAL F 3 198 ? 32.747  -47.250 -0.628  1.00 28.12 ? 198 VAL B CA    1 
ATOM   6538 C  C     . VAL F 3 198 ? 31.825  -47.694 0.506   1.00 29.29 ? 198 VAL B C     1 
ATOM   6539 O  O     . VAL F 3 198 ? 31.751  -47.030 1.550   1.00 29.26 ? 198 VAL B O     1 
ATOM   6540 C  CB    . VAL F 3 198 ? 31.934  -46.551 -1.727  1.00 27.51 ? 198 VAL B CB    1 
ATOM   6541 C  CG1   . VAL F 3 198 ? 31.033  -45.496 -1.124  1.00 27.49 ? 198 VAL B CG1   1 
ATOM   6542 C  CG2   . VAL F 3 198 ? 32.875  -45.913 -2.724  1.00 27.39 ? 198 VAL B CG2   1 
ATOM   6543 N  N     . ALA F 3 199 ? 31.141  -48.821 0.308   1.00 28.85 ? 199 ALA B N     1 
ATOM   6544 C  CA    . ALA F 3 199 ? 30.229  -49.348 1.319   1.00 29.96 ? 199 ALA B CA    1 
ATOM   6545 C  C     . ALA F 3 199 ? 30.987  -49.704 2.598   1.00 30.31 ? 199 ALA B C     1 
ATOM   6546 O  O     . ALA F 3 199 ? 30.551  -49.379 3.703   1.00 30.21 ? 199 ALA B O     1 
ATOM   6547 C  CB    . ALA F 3 199 ? 29.495  -50.568 0.778   1.00 29.69 ? 199 ALA B CB    1 
ATOM   6548 N  N     . LYS F 3 200 ? 32.125  -50.370 2.442   1.00 30.98 ? 200 LYS B N     1 
ATOM   6549 C  CA    . LYS F 3 200 ? 32.963  -50.742 3.581   1.00 31.58 ? 200 LYS B CA    1 
ATOM   6550 C  C     . LYS F 3 200 ? 33.467  -49.470 4.274   1.00 31.17 ? 200 LYS B C     1 
ATOM   6551 O  O     . LYS F 3 200 ? 33.545  -49.412 5.499   1.00 30.97 ? 200 LYS B O     1 
ATOM   6552 C  CB    . LYS F 3 200 ? 34.151  -51.582 3.104   1.00 32.18 ? 200 LYS B CB    1 
ATOM   6553 C  CG    . LYS F 3 200 ? 34.995  -52.186 4.217   1.00 34.67 ? 200 LYS B CG    1 
ATOM   6554 C  CD    . LYS F 3 200 ? 35.926  -53.274 3.681   1.00 37.12 ? 200 LYS B CD    1 
ATOM   6555 C  CE    . LYS F 3 200 ? 35.136  -54.376 2.975   1.00 38.57 ? 200 LYS B CE    1 
ATOM   6556 N  NZ    . LYS F 3 200 ? 36.011  -55.375 2.289   1.00 41.52 ? 200 LYS B NZ    1 
ATOM   6557 N  N     . TYR F 3 201 ? 33.804  -48.455 3.483   1.00 30.61 ? 201 TYR B N     1 
ATOM   6558 C  CA    . TYR F 3 201 ? 34.272  -47.187 4.029   1.00 30.73 ? 201 TYR B CA    1 
ATOM   6559 C  C     . TYR F 3 201 ? 33.205  -46.573 4.925   1.00 30.51 ? 201 TYR B C     1 
ATOM   6560 O  O     . TYR F 3 201 ? 33.498  -46.076 6.013   1.00 29.75 ? 201 TYR B O     1 
ATOM   6561 C  CB    . TYR F 3 201 ? 34.602  -46.199 2.904   1.00 32.14 ? 201 TYR B CB    1 
ATOM   6562 C  CG    . TYR F 3 201 ? 34.839  -44.783 3.388   1.00 32.90 ? 201 TYR B CG    1 
ATOM   6563 C  CD1   . TYR F 3 201 ? 33.783  -43.870 3.497   1.00 32.38 ? 201 TYR B CD1   1 
ATOM   6564 C  CD2   . TYR F 3 201 ? 36.109  -44.373 3.798   1.00 33.50 ? 201 TYR B CD2   1 
ATOM   6565 C  CE1   . TYR F 3 201 ? 33.987  -42.588 4.004   1.00 32.68 ? 201 TYR B CE1   1 
ATOM   6566 C  CE2   . TYR F 3 201 ? 36.323  -43.091 4.309   1.00 34.30 ? 201 TYR B CE2   1 
ATOM   6567 C  CZ    . TYR F 3 201 ? 35.257  -42.206 4.412   1.00 34.48 ? 201 TYR B CZ    1 
ATOM   6568 O  OH    . TYR F 3 201 ? 35.467  -40.950 4.938   1.00 36.95 ? 201 TYR B OH    1 
ATOM   6569 N  N     . VAL F 3 202 ? 31.966  -46.608 4.450   1.00 31.03 ? 202 VAL B N     1 
ATOM   6570 C  CA    . VAL F 3 202 ? 30.842  -46.048 5.184   1.00 31.62 ? 202 VAL B CA    1 
ATOM   6571 C  C     . VAL F 3 202 ? 30.535  -46.800 6.474   1.00 33.08 ? 202 VAL B C     1 
ATOM   6572 O  O     . VAL F 3 202 ? 30.640  -46.238 7.565   1.00 33.36 ? 202 VAL B O     1 
ATOM   6573 C  CB    . VAL F 3 202 ? 29.584  -46.014 4.292   1.00 30.85 ? 202 VAL B CB    1 
ATOM   6574 C  CG1   . VAL F 3 202 ? 28.352  -45.702 5.123   1.00 29.67 ? 202 VAL B CG1   1 
ATOM   6575 C  CG2   . VAL F 3 202 ? 29.770  -44.970 3.195   1.00 29.96 ? 202 VAL B CG2   1 
ATOM   6576 N  N     . SER F 3 203 ? 30.167  -48.070 6.352   1.00 34.07 ? 203 SER B N     1 
ATOM   6577 C  CA    . SER F 3 203 ? 29.829  -48.877 7.519   1.00 35.60 ? 203 SER B CA    1 
ATOM   6578 C  C     . SER F 3 203 ? 30.962  -49.236 8.485   1.00 36.21 ? 203 SER B C     1 
ATOM   6579 O  O     . SER F 3 203 ? 30.795  -49.116 9.689   1.00 34.65 ? 203 SER B O     1 
ATOM   6580 C  CB    . SER F 3 203 ? 29.121  -50.156 7.072   1.00 36.44 ? 203 SER B CB    1 
ATOM   6581 O  OG    . SER F 3 203 ? 29.187  -50.299 5.665   1.00 37.83 ? 203 SER B OG    1 
ATOM   6582 N  N     . LYS F 3 204 ? 32.105  -49.669 7.963   1.00 38.05 ? 204 LYS B N     1 
ATOM   6583 C  CA    . LYS F 3 204 ? 33.226  -50.064 8.813   1.00 40.29 ? 204 LYS B CA    1 
ATOM   6584 C  C     . LYS F 3 204 ? 34.299  -48.989 9.041   1.00 41.55 ? 204 LYS B C     1 
ATOM   6585 O  O     . LYS F 3 204 ? 35.045  -49.060 10.019  1.00 42.43 ? 204 LYS B O     1 
ATOM   6586 C  CB    . LYS F 3 204 ? 33.880  -51.343 8.258   1.00 40.96 ? 204 LYS B CB    1 
ATOM   6587 C  CG    . LYS F 3 204 ? 32.942  -52.575 8.158   1.00 43.31 ? 204 LYS B CG    1 
ATOM   6588 C  CD    . LYS F 3 204 ? 33.029  -53.610 9.326   1.00 44.67 ? 204 LYS B CD    1 
ATOM   6589 C  CE    . LYS F 3 204 ? 33.569  -54.994 8.828   1.00 44.43 ? 204 LYS B CE    1 
ATOM   6590 N  NZ    . LYS F 3 204 ? 33.640  -55.033 7.329   1.00 44.41 ? 204 LYS B NZ    1 
ATOM   6591 N  N     . GLY F 3 205 ? 34.400  -48.010 8.147   1.00 42.49 ? 205 GLY B N     1 
ATOM   6592 C  CA    . GLY F 3 205 ? 35.391  -46.964 8.344   1.00 42.90 ? 205 GLY B CA    1 
ATOM   6593 C  C     . GLY F 3 205 ? 36.636  -47.087 7.490   1.00 43.59 ? 205 GLY B C     1 
ATOM   6594 O  O     . GLY F 3 205 ? 36.900  -48.132 6.900   1.00 44.38 ? 205 GLY B O     1 
ATOM   6595 N  N     . TRP F 3 206 ? 37.413  -46.011 7.439   1.00 44.31 ? 206 TRP B N     1 
ATOM   6596 C  CA    . TRP F 3 206 ? 38.644  -45.954 6.653   1.00 45.02 ? 206 TRP B CA    1 
ATOM   6597 C  C     . TRP F 3 206 ? 39.668  -47.019 7.010   1.00 46.25 ? 206 TRP B C     1 
ATOM   6598 O  O     . TRP F 3 206 ? 40.207  -47.695 6.128   1.00 46.34 ? 206 TRP B O     1 
ATOM   6599 C  CB    . TRP F 3 206 ? 39.281  -44.575 6.814   1.00 43.21 ? 206 TRP B CB    1 
ATOM   6600 C  CG    . TRP F 3 206 ? 40.534  -44.373 6.047   1.00 41.92 ? 206 TRP B CG    1 
ATOM   6601 C  CD1   . TRP F 3 206 ? 41.701  -43.849 6.522   1.00 41.83 ? 206 TRP B CD1   1 
ATOM   6602 C  CD2   . TRP F 3 206 ? 40.748  -44.629 4.654   1.00 41.80 ? 206 TRP B CD2   1 
ATOM   6603 N  NE1   . TRP F 3 206 ? 42.627  -43.758 5.513   1.00 42.23 ? 206 TRP B NE1   1 
ATOM   6604 C  CE2   . TRP F 3 206 ? 42.069  -44.228 4.355   1.00 41.59 ? 206 TRP B CE2   1 
ATOM   6605 C  CE3   . TRP F 3 206 ? 39.953  -45.149 3.629   1.00 40.87 ? 206 TRP B CE3   1 
ATOM   6606 C  CZ2   . TRP F 3 206 ? 42.615  -44.344 3.071   1.00 41.23 ? 206 TRP B CZ2   1 
ATOM   6607 C  CZ3   . TRP F 3 206 ? 40.500  -45.262 2.351   1.00 41.38 ? 206 TRP B CZ3   1 
ATOM   6608 C  CH2   . TRP F 3 206 ? 41.813  -44.859 2.086   1.00 41.37 ? 206 TRP B CH2   1 
ATOM   6609 N  N     . LYS F 3 207 ? 39.952  -47.142 8.302   1.00 48.09 ? 207 LYS B N     1 
ATOM   6610 C  CA    . LYS F 3 207 ? 40.923  -48.106 8.794   1.00 49.80 ? 207 LYS B CA    1 
ATOM   6611 C  C     . LYS F 3 207 ? 40.568  -49.466 8.298   1.00 50.22 ? 207 LYS B C     1 
ATOM   6612 O  O     . LYS F 3 207 ? 41.376  -50.170 7.705   1.00 49.04 ? 207 LYS B O     1 
ATOM   6613 C  CB    . LYS F 3 207 ? 40.914  -48.114 10.320  1.00 51.71 ? 207 LYS B CB    1 
ATOM   6614 C  CG    . LYS F 3 207 ? 41.496  -46.867 10.940  1.00 54.09 ? 207 LYS B CG    1 
ATOM   6615 C  CD    . LYS F 3 207 ? 40.829  -45.610 10.372  1.00 56.07 ? 207 LYS B CD    1 
ATOM   6616 C  CE    . LYS F 3 207 ? 41.469  -44.307 10.865  1.00 57.39 ? 207 LYS B CE    1 
ATOM   6617 N  NZ    . LYS F 3 207 ? 42.689  -43.899 10.094  1.00 58.51 ? 207 LYS B NZ    1 
ATOM   6618 N  N     . GLU F 3 208 ? 39.318  -49.817 8.522   1.00 51.21 ? 208 GLU B N     1 
ATOM   6619 C  CA    . GLU F 3 208 ? 38.893  -51.114 8.101   1.00 52.85 ? 208 GLU B CA    1 
ATOM   6620 C  C     . GLU F 3 208 ? 39.019  -51.398 6.630   1.00 53.27 ? 208 GLU B C     1 
ATOM   6621 O  O     . GLU F 3 208 ? 39.322  -52.528 6.225   1.00 53.35 ? 208 GLU B O     1 
ATOM   6622 C  CB    . GLU F 3 208 ? 37.478  -51.409 8.528   1.00 53.87 ? 208 GLU B CB    1 
ATOM   6623 C  CG    . GLU F 3 208 ? 37.634  -52.779 8.953   1.00 57.68 ? 208 GLU B CG    1 
ATOM   6624 C  CD    . GLU F 3 208 ? 36.596  -53.483 9.612   1.00 59.93 ? 208 GLU B CD    1 
ATOM   6625 O  OE1   . GLU F 3 208 ? 37.004  -54.260 10.398  1.00 60.69 ? 208 GLU B OE1   1 
ATOM   6626 O  OE2   . GLU F 3 208 ? 35.436  -53.268 9.473   1.00 61.33 ? 208 GLU B OE2   1 
ATOM   6627 N  N     . VAL F 3 209 ? 38.804  -50.371 5.825   1.00 53.15 ? 209 VAL B N     1 
ATOM   6628 C  CA    . VAL F 3 209 ? 38.890  -50.498 4.390   1.00 52.96 ? 209 VAL B CA    1 
ATOM   6629 C  C     . VAL F 3 209 ? 40.360  -50.421 3.974   1.00 52.85 ? 209 VAL B C     1 
ATOM   6630 O  O     . VAL F 3 209 ? 40.799  -51.141 3.080   1.00 52.55 ? 209 VAL B O     1 
ATOM   6631 C  CB    . VAL F 3 209 ? 38.076  -49.358 3.728   1.00 52.95 ? 209 VAL B CB    1 
ATOM   6632 C  CG1   . VAL F 3 209 ? 38.987  -48.316 3.149   1.00 53.60 ? 209 VAL B CG1   1 
ATOM   6633 C  CG2   . VAL F 3 209 ? 37.178  -49.925 2.656   1.00 54.47 ? 209 VAL B CG2   1 
ATOM   6634 N  N     . GLN F 3 210 ? 41.115  -49.542 4.630   1.00 53.18 ? 210 GLN B N     1 
ATOM   6635 C  CA    . GLN F 3 210 ? 42.534  -49.375 4.318   1.00 52.99 ? 210 GLN B CA    1 
ATOM   6636 C  C     . GLN F 3 210 ? 43.251  -50.690 4.602   1.00 53.22 ? 210 GLN B C     1 
ATOM   6637 O  O     . GLN F 3 210 ? 44.170  -51.087 3.884   1.00 53.63 ? 210 GLN B O     1 
ATOM   6638 C  CB    . GLN F 3 210 ? 43.143  -48.257 5.170   1.00 52.38 ? 210 GLN B CB    1 
ATOM   6639 C  CG    . GLN F 3 210 ? 44.462  -47.741 4.637   1.00 52.20 ? 210 GLN B CG    1 
ATOM   6640 C  CD    . GLN F 3 210 ? 45.086  -46.682 5.525   1.00 52.89 ? 210 GLN B CD    1 
ATOM   6641 O  OE1   . GLN F 3 210 ? 46.018  -45.992 5.116   1.00 54.18 ? 210 GLN B OE1   1 
ATOM   6642 N  NE2   . GLN F 3 210 ? 44.584  -46.555 6.750   1.00 51.87 ? 210 GLN B NE2   1 
ATOM   6643 N  N     . GLU F 3 211 ? 42.812  -51.359 5.661   1.00 53.35 ? 211 GLU B N     1 
ATOM   6644 C  CA    . GLU F 3 211 ? 43.380  -52.633 6.076   1.00 53.25 ? 211 GLU B CA    1 
ATOM   6645 C  C     . GLU F 3 211 ? 42.964  -53.779 5.148   1.00 52.40 ? 211 GLU B C     1 
ATOM   6646 O  O     . GLU F 3 211 ? 43.693  -54.748 4.984   1.00 52.67 ? 211 GLU B O     1 
ATOM   6647 C  CB    . GLU F 3 211 ? 42.942  -52.931 7.518   1.00 53.92 ? 211 GLU B CB    1 
ATOM   6648 C  CG    . GLU F 3 211 ? 43.137  -54.374 7.969   1.00 55.61 ? 211 GLU B CG    1 
ATOM   6649 C  CD    . GLU F 3 211 ? 44.591  -54.810 7.967   1.00 57.33 ? 211 GLU B CD    1 
ATOM   6650 O  OE1   . GLU F 3 211 ? 44.843  -56.028 8.125   1.00 57.42 ? 211 GLU B OE1   1 
ATOM   6651 O  OE2   . GLU F 3 211 ? 45.480  -53.941 7.810   1.00 57.54 ? 211 GLU B OE2   1 
ATOM   6652 N  N     . ALA F 3 212 ? 41.794  -53.665 4.534   1.00 51.91 ? 212 ALA B N     1 
ATOM   6653 C  CA    . ALA F 3 212 ? 41.295  -54.712 3.647   1.00 50.54 ? 212 ALA B CA    1 
ATOM   6654 C  C     . ALA F 3 212 ? 41.840  -54.623 2.223   1.00 50.04 ? 212 ALA B C     1 
ATOM   6655 O  O     . ALA F 3 212 ? 41.831  -55.612 1.489   1.00 49.60 ? 212 ALA B O     1 
ATOM   6656 C  CB    . ALA F 3 212 ? 39.772  -54.676 3.617   1.00 50.73 ? 212 ALA B CB    1 
ATOM   6657 N  N     . TYR F 3 213 ? 42.309  -53.441 1.833   1.00 49.64 ? 213 TYR B N     1 
ATOM   6658 C  CA    . TYR F 3 213 ? 42.837  -53.244 0.489   1.00 48.79 ? 213 TYR B CA    1 
ATOM   6659 C  C     . TYR F 3 213 ? 44.343  -53.007 0.438   1.00 50.35 ? 213 TYR B C     1 
ATOM   6660 O  O     . TYR F 3 213 ? 44.850  -52.453 -0.535  1.00 50.60 ? 213 TYR B O     1 
ATOM   6661 C  CB    . TYR F 3 213 ? 42.109  -52.083 -0.195  1.00 45.39 ? 213 TYR B CB    1 
ATOM   6662 C  CG    . TYR F 3 213 ? 40.656  -52.366 -0.489  1.00 43.16 ? 213 TYR B CG    1 
ATOM   6663 C  CD1   . TYR F 3 213 ? 39.688  -52.275 0.507   1.00 41.93 ? 213 TYR B CD1   1 
ATOM   6664 C  CD2   . TYR F 3 213 ? 40.250  -52.752 -1.764  1.00 42.27 ? 213 TYR B CD2   1 
ATOM   6665 C  CE1   . TYR F 3 213 ? 38.350  -52.561 0.240   1.00 40.90 ? 213 TYR B CE1   1 
ATOM   6666 C  CE2   . TYR F 3 213 ? 38.915  -53.042 -2.041  1.00 40.62 ? 213 TYR B CE2   1 
ATOM   6667 C  CZ    . TYR F 3 213 ? 37.973  -52.945 -1.035  1.00 40.12 ? 213 TYR B CZ    1 
ATOM   6668 O  OH    . TYR F 3 213 ? 36.659  -53.251 -1.297  1.00 38.69 ? 213 TYR B OH    1 
ATOM   6669 N  N     . LYS F 3 214 ? 45.056  -53.444 1.471   1.00 53.05 ? 214 LYS B N     1 
ATOM   6670 C  CA    . LYS F 3 214 ? 46.507  -53.276 1.535   1.00 55.15 ? 214 LYS B CA    1 
ATOM   6671 C  C     . LYS F 3 214 ? 47.191  -53.537 0.188   1.00 56.36 ? 214 LYS B C     1 
ATOM   6672 O  O     . LYS F 3 214 ? 47.893  -52.666 -0.331  1.00 56.64 ? 214 LYS B O     1 
ATOM   6673 C  CB    . LYS F 3 214 ? 47.071  -54.193 2.612   1.00 54.92 ? 214 LYS B CB    1 
ATOM   6674 C  CG    . LYS F 3 214 ? 46.378  -53.991 3.944   1.00 55.90 ? 214 LYS B CG    1 
ATOM   6675 C  CD    . LYS F 3 214 ? 46.966  -54.856 5.037   1.00 57.94 ? 214 LYS B CD    1 
ATOM   6676 C  CE    . LYS F 3 214 ? 48.383  -54.427 5.403   1.00 58.72 ? 214 LYS B CE    1 
ATOM   6677 N  NZ    . LYS F 3 214 ? 48.910  -55.235 6.540   1.00 58.89 ? 214 LYS B NZ    1 
ATOM   6678 N  N     . GLU F 3 215 ? 46.994  -54.725 -0.378  1.00 58.07 ? 215 GLU B N     1 
ATOM   6679 C  CA    . GLU F 3 215 ? 47.594  -55.035 -1.674  1.00 59.56 ? 215 GLU B CA    1 
ATOM   6680 C  C     . GLU F 3 215 ? 46.672  -55.898 -2.538  1.00 59.68 ? 215 GLU B C     1 
ATOM   6681 O  O     . GLU F 3 215 ? 47.114  -56.741 -3.322  1.00 59.38 ? 215 GLU B O     1 
ATOM   6682 C  CB    . GLU F 3 215 ? 48.958  -55.708 -1.492  1.00 60.56 ? 215 GLU B CB    1 
ATOM   6683 C  CG    . GLU F 3 215 ? 49.955  -55.365 -2.606  1.00 61.86 ? 215 GLU B CG    1 
ATOM   6684 C  CD    . GLU F 3 215 ? 49.712  -56.142 -3.892  1.00 62.64 ? 215 GLU B CD    1 
ATOM   6685 O  OE1   . GLU F 3 215 ? 49.951  -57.370 -3.892  1.00 62.02 ? 215 GLU B OE1   1 
ATOM   6686 O  OE2   . GLU F 3 215 ? 49.282  -55.529 -4.897  1.00 63.79 ? 215 GLU B OE2   1 
ATOM   6687 N  N     . LYS F 3 216 ? 45.376  -55.684 -2.372  1.00 59.84 ? 216 LYS B N     1 
ATOM   6688 C  CA    . LYS F 3 216 ? 44.387  -56.391 -3.161  1.00 59.79 ? 216 LYS B CA    1 
ATOM   6689 C  C     . LYS F 3 216 ? 44.617  -55.708 -4.504  1.00 59.88 ? 216 LYS B C     1 
ATOM   6690 O  O     . LYS F 3 216 ? 44.254  -54.543 -4.663  1.00 60.29 ? 216 LYS B O     1 
ATOM   6691 C  CB    . LYS F 3 216 ? 42.994  -56.052 -2.635  1.00 60.74 ? 216 LYS B CB    1 
ATOM   6692 C  CG    . LYS F 3 216 ? 41.920  -57.093 -2.858  1.00 61.58 ? 216 LYS B CG    1 
ATOM   6693 C  CD    . LYS F 3 216 ? 40.608  -56.560 -2.313  1.00 62.36 ? 216 LYS B CD    1 
ATOM   6694 C  CE    . LYS F 3 216 ? 39.532  -57.623 -2.272  1.00 63.76 ? 216 LYS B CE    1 
ATOM   6695 N  NZ    . LYS F 3 216 ? 38.246  -57.045 -1.775  1.00 65.22 ? 216 LYS B NZ    1 
ATOM   6696 N  N     . GLU F 3 217 ? 45.256  -56.391 -5.452  1.00 59.16 ? 217 GLU B N     1 
ATOM   6697 C  CA    . GLU F 3 217 ? 45.499  -55.766 -6.751  1.00 57.60 ? 217 GLU B CA    1 
ATOM   6698 C  C     . GLU F 3 217 ? 44.180  -55.217 -7.268  1.00 56.42 ? 217 GLU B C     1 
ATOM   6699 O  O     . GLU F 3 217 ? 43.281  -55.969 -7.659  1.00 55.99 ? 217 GLU B O     1 
ATOM   6700 C  CB    . GLU F 3 217 ? 46.089  -56.763 -7.761  1.00 58.31 ? 217 GLU B CB    1 
ATOM   6701 C  CG    . GLU F 3 217 ? 47.510  -56.403 -8.239  1.00 59.46 ? 217 GLU B CG    1 
ATOM   6702 C  CD    . GLU F 3 217 ? 47.602  -55.026 -8.913  1.00 60.01 ? 217 GLU B CD    1 
ATOM   6703 O  OE1   . GLU F 3 217 ? 48.723  -54.631 -9.313  1.00 59.12 ? 217 GLU B OE1   1 
ATOM   6704 O  OE2   . GLU F 3 217 ? 46.562  -54.340 -9.045  1.00 59.74 ? 217 GLU B OE2   1 
ATOM   6705 N  N     . LEU F 3 218 ? 44.064  -53.894 -7.249  1.00 54.23 ? 218 LEU B N     1 
ATOM   6706 C  CA    . LEU F 3 218 ? 42.848  -53.255 -7.707  1.00 51.72 ? 218 LEU B CA    1 
ATOM   6707 C  C     . LEU F 3 218 ? 42.930  -52.779 -9.139  1.00 50.41 ? 218 LEU B C     1 
ATOM   6708 O  O     . LEU F 3 218 ? 44.013  -52.614 -9.715  1.00 51.32 ? 218 LEU B O     1 
ATOM   6709 C  CB    . LEU F 3 218 ? 42.488  -52.057 -6.825  1.00 51.59 ? 218 LEU B CB    1 
ATOM   6710 C  CG    . LEU F 3 218 ? 42.337  -52.264 -5.323  1.00 51.17 ? 218 LEU B CG    1 
ATOM   6711 C  CD1   . LEU F 3 218 ? 43.632  -51.882 -4.625  1.00 51.06 ? 218 LEU B CD1   1 
ATOM   6712 C  CD2   . LEU F 3 218 ? 41.210  -51.395 -4.814  1.00 51.20 ? 218 LEU B CD2   1 
ATOM   6713 N  N     . SER F 3 219 ? 41.755  -52.559 -9.700  1.00 48.12 ? 219 SER B N     1 
ATOM   6714 C  CA    . SER F 3 219 ? 41.611  -52.067 -11.050 1.00 47.07 ? 219 SER B CA    1 
ATOM   6715 C  C     . SER F 3 219 ? 41.984  -50.589 -11.079 1.00 46.61 ? 219 SER B C     1 
ATOM   6716 O  O     . SER F 3 219 ? 42.027  -49.930 -10.036 1.00 46.92 ? 219 SER B O     1 
ATOM   6717 C  CB    . SER F 3 219 ? 40.156  -52.234 -11.475 1.00 47.02 ? 219 SER B CB    1 
ATOM   6718 O  OG    . SER F 3 219 ? 39.817  -51.342 -12.521 1.00 46.96 ? 219 SER B OG    1 
ATOM   6719 N  N     . PRO F 3 220 ? 42.265  -50.046 -12.272 1.00 45.90 ? 220 PRO B N     1 
ATOM   6720 C  CA    . PRO F 3 220 ? 42.620  -48.628 -12.369 1.00 45.76 ? 220 PRO B CA    1 
ATOM   6721 C  C     . PRO F 3 220 ? 41.462  -47.736 -11.898 1.00 45.97 ? 220 PRO B C     1 
ATOM   6722 O  O     . PRO F 3 220 ? 41.673  -46.689 -11.277 1.00 45.63 ? 220 PRO B O     1 
ATOM   6723 C  CB    . PRO F 3 220 ? 42.940  -48.457 -13.856 1.00 45.51 ? 220 PRO B CB    1 
ATOM   6724 C  CG    . PRO F 3 220 ? 42.138  -49.540 -14.514 1.00 45.87 ? 220 PRO B CG    1 
ATOM   6725 C  CD    . PRO F 3 220 ? 42.365  -50.699 -13.586 1.00 45.09 ? 220 PRO B CD    1 
ATOM   6726 N  N     . GLU F 3 221 ? 40.242  -48.180 -12.183 1.00 46.28 ? 221 GLU B N     1 
ATOM   6727 C  CA    . GLU F 3 221 ? 39.027  -47.462 -11.807 1.00 47.34 ? 221 GLU B CA    1 
ATOM   6728 C  C     . GLU F 3 221 ? 38.793  -47.525 -10.294 1.00 46.56 ? 221 GLU B C     1 
ATOM   6729 O  O     . GLU F 3 221 ? 38.332  -46.563 -9.684  1.00 45.28 ? 221 GLU B O     1 
ATOM   6730 C  CB    . GLU F 3 221 ? 37.835  -48.104 -12.499 1.00 49.14 ? 221 GLU B CB    1 
ATOM   6731 C  CG    . GLU F 3 221 ? 36.822  -47.176 -13.183 1.00 52.61 ? 221 GLU B CG    1 
ATOM   6732 C  CD    . GLU F 3 221 ? 36.842  -45.757 -12.674 1.00 55.58 ? 221 GLU B CD    1 
ATOM   6733 O  OE1   . GLU F 3 221 ? 37.808  -45.028 -12.995 1.00 56.24 ? 221 GLU B OE1   1 
ATOM   6734 O  OE2   . GLU F 3 221 ? 35.885  -45.361 -11.965 1.00 57.29 ? 221 GLU B OE2   1 
ATOM   6735 N  N     . THR F 3 222 ? 39.093  -48.678 -9.703  1.00 46.84 ? 222 THR B N     1 
ATOM   6736 C  CA    . THR F 3 222 ? 38.910  -48.886 -8.272  1.00 46.99 ? 222 THR B CA    1 
ATOM   6737 C  C     . THR F 3 222 ? 39.960  -48.114 -7.489  1.00 46.55 ? 222 THR B C     1 
ATOM   6738 O  O     . THR F 3 222 ? 39.672  -47.582 -6.420  1.00 46.12 ? 222 THR B O     1 
ATOM   6739 C  CB    . THR F 3 222 ? 39.017  -50.387 -7.910  1.00 48.30 ? 222 THR B CB    1 
ATOM   6740 O  OG1   . THR F 3 222 ? 38.164  -51.154 -8.772  1.00 48.65 ? 222 THR B OG1   1 
ATOM   6741 C  CG2   . THR F 3 222 ? 38.595  -50.617 -6.465  1.00 49.08 ? 222 THR B CG2   1 
ATOM   6742 N  N     . GLU F 3 223 ? 41.179  -48.064 -8.019  1.00 46.67 ? 223 GLU B N     1 
ATOM   6743 C  CA    . GLU F 3 223 ? 42.252  -47.331 -7.361  1.00 47.57 ? 223 GLU B CA    1 
ATOM   6744 C  C     . GLU F 3 223 ? 41.832  -45.871 -7.242  1.00 46.87 ? 223 GLU B C     1 
ATOM   6745 O  O     . GLU F 3 223 ? 42.051  -45.232 -6.209  1.00 46.48 ? 223 GLU B O     1 
ATOM   6746 C  CB    . GLU F 3 223 ? 43.557  -47.433 -8.164  1.00 49.70 ? 223 GLU B CB    1 
ATOM   6747 C  CG    . GLU F 3 223 ? 44.674  -48.222 -7.466  1.00 51.95 ? 223 GLU B CG    1 
ATOM   6748 C  CD    . GLU F 3 223 ? 44.978  -47.707 -6.060  1.00 53.08 ? 223 GLU B CD    1 
ATOM   6749 O  OE1   . GLU F 3 223 ? 46.046  -47.092 -5.848  1.00 53.95 ? 223 GLU B OE1   1 
ATOM   6750 O  OE2   . GLU F 3 223 ? 44.143  -47.919 -5.155  1.00 54.75 ? 223 GLU B OE2   1 
ATOM   6751 N  N     . LYS F 3 224 ? 41.231  -45.352 -8.311  1.00 46.43 ? 224 LYS B N     1 
ATOM   6752 C  CA    . LYS F 3 224 ? 40.741  -43.974 -8.339  1.00 45.91 ? 224 LYS B CA    1 
ATOM   6753 C  C     . LYS F 3 224 ? 39.844  -43.727 -7.130  1.00 44.10 ? 224 LYS B C     1 
ATOM   6754 O  O     . LYS F 3 224 ? 39.957  -42.698 -6.466  1.00 44.22 ? 224 LYS B O     1 
ATOM   6755 C  CB    . LYS F 3 224 ? 39.935  -43.717 -9.617  1.00 48.13 ? 224 LYS B CB    1 
ATOM   6756 C  CG    . LYS F 3 224 ? 40.730  -43.235 -10.823 1.00 51.06 ? 224 LYS B CG    1 
ATOM   6757 C  CD    . LYS F 3 224 ? 40.935  -41.725 -10.758 1.00 55.19 ? 224 LYS B CD    1 
ATOM   6758 C  CE    . LYS F 3 224 ? 41.424  -41.140 -12.103 1.00 58.51 ? 224 LYS B CE    1 
ATOM   6759 N  NZ    . LYS F 3 224 ? 40.353  -41.024 -13.144 1.00 60.06 ? 224 LYS B NZ    1 
ATOM   6760 N  N     . VAL F 3 225 ? 38.960  -44.682 -6.845  1.00 42.01 ? 225 VAL B N     1 
ATOM   6761 C  CA    . VAL F 3 225 ? 38.034  -44.570 -5.719  1.00 40.36 ? 225 VAL B CA    1 
ATOM   6762 C  C     . VAL F 3 225 ? 38.747  -44.597 -4.360  1.00 39.74 ? 225 VAL B C     1 
ATOM   6763 O  O     . VAL F 3 225 ? 38.392  -43.836 -3.461  1.00 39.97 ? 225 VAL B O     1 
ATOM   6764 C  CB    . VAL F 3 225 ? 36.948  -45.687 -5.769  1.00 39.48 ? 225 VAL B CB    1 
ATOM   6765 C  CG1   . VAL F 3 225 ? 36.042  -45.605 -4.550  1.00 36.28 ? 225 VAL B CG1   1 
ATOM   6766 C  CG2   . VAL F 3 225 ? 36.123  -45.545 -7.045  1.00 37.83 ? 225 VAL B CG2   1 
ATOM   6767 N  N     . LEU F 3 226 ? 39.750  -45.458 -4.211  1.00 38.22 ? 226 LEU B N     1 
ATOM   6768 C  CA    . LEU F 3 226 ? 40.495  -45.536 -2.956  1.00 37.27 ? 226 LEU B CA    1 
ATOM   6769 C  C     . LEU F 3 226 ? 41.258  -44.233 -2.745  1.00 37.40 ? 226 LEU B C     1 
ATOM   6770 O  O     . LEU F 3 226 ? 41.203  -43.630 -1.665  1.00 36.27 ? 226 LEU B O     1 
ATOM   6771 C  CB    . LEU F 3 226 ? 41.498  -46.688 -2.987  1.00 37.27 ? 226 LEU B CB    1 
ATOM   6772 C  CG    . LEU F 3 226 ? 42.339  -46.807 -1.712  1.00 36.65 ? 226 LEU B CG    1 
ATOM   6773 C  CD1   . LEU F 3 226 ? 41.451  -47.229 -0.555  1.00 35.97 ? 226 LEU B CD1   1 
ATOM   6774 C  CD2   . LEU F 3 226 ? 43.458  -47.807 -1.914  1.00 37.05 ? 226 LEU B CD2   1 
ATOM   6775 N  N     . LYS F 3 227 ? 41.979  -43.829 -3.794  1.00 37.52 ? 227 LYS B N     1 
ATOM   6776 C  CA    . LYS F 3 227 ? 42.775  -42.590 -3.819  1.00 37.27 ? 227 LYS B CA    1 
ATOM   6777 C  C     . LYS F 3 227 ? 41.992  -41.460 -3.173  1.00 36.07 ? 227 LYS B C     1 
ATOM   6778 O  O     . LYS F 3 227 ? 42.460  -40.776 -2.251  1.00 36.36 ? 227 LYS B O     1 
ATOM   6779 C  CB    . LYS F 3 227 ? 43.042  -42.139 -5.263  1.00 40.45 ? 227 LYS B CB    1 
ATOM   6780 C  CG    . LYS F 3 227 ? 44.346  -42.557 -5.912  1.00 43.51 ? 227 LYS B CG    1 
ATOM   6781 C  CD    . LYS F 3 227 ? 45.534  -42.099 -5.082  1.00 46.05 ? 227 LYS B CD    1 
ATOM   6782 C  CE    . LYS F 3 227 ? 46.773  -41.935 -5.962  1.00 48.39 ? 227 LYS B CE    1 
ATOM   6783 N  NZ    . LYS F 3 227 ? 47.895  -41.200 -5.279  1.00 49.69 ? 227 LYS B NZ    1 
ATOM   6784 N  N     . TYR F 3 228 ? 40.800  -41.261 -3.724  1.00 32.68 ? 228 TYR B N     1 
ATOM   6785 C  CA    . TYR F 3 228 ? 39.883  -40.228 -3.299  1.00 30.62 ? 228 TYR B CA    1 
ATOM   6786 C  C     . TYR F 3 228 ? 39.524  -40.358 -1.830  1.00 29.88 ? 228 TYR B C     1 
ATOM   6787 O  O     . TYR F 3 228 ? 39.713  -39.415 -1.061  1.00 29.52 ? 228 TYR B O     1 
ATOM   6788 C  CB    . TYR F 3 228 ? 38.628  -40.291 -4.163  1.00 30.47 ? 228 TYR B CB    1 
ATOM   6789 C  CG    . TYR F 3 228 ? 37.606  -39.233 -3.837  1.00 30.31 ? 228 TYR B CG    1 
ATOM   6790 C  CD1   . TYR F 3 228 ? 36.525  -39.514 -3.001  1.00 30.66 ? 228 TYR B CD1   1 
ATOM   6791 C  CD2   . TYR F 3 228 ? 37.709  -37.951 -4.374  1.00 29.62 ? 228 TYR B CD2   1 
ATOM   6792 C  CE1   . TYR F 3 228 ? 35.568  -38.544 -2.714  1.00 30.13 ? 228 TYR B CE1   1 
ATOM   6793 C  CE2   . TYR F 3 228 ? 36.761  -36.976 -4.094  1.00 28.63 ? 228 TYR B CE2   1 
ATOM   6794 C  CZ    . TYR F 3 228 ? 35.692  -37.281 -3.269  1.00 29.60 ? 228 TYR B CZ    1 
ATOM   6795 O  OH    . TYR F 3 228 ? 34.722  -36.340 -3.029  1.00 29.69 ? 228 TYR B OH    1 
ATOM   6796 N  N     . LEU F 3 229 ? 39.001  -41.520 -1.443  1.00 28.47 ? 229 LEU B N     1 
ATOM   6797 C  CA    . LEU F 3 229 ? 38.639  -41.760 -0.056  1.00 27.24 ? 229 LEU B CA    1 
ATOM   6798 C  C     . LEU F 3 229 ? 39.835  -41.402 0.812   1.00 28.37 ? 229 LEU B C     1 
ATOM   6799 O  O     . LEU F 3 229 ? 39.697  -40.744 1.840   1.00 27.71 ? 229 LEU B O     1 
ATOM   6800 C  CB    . LEU F 3 229 ? 38.256  -43.225 0.144   1.00 26.24 ? 229 LEU B CB    1 
ATOM   6801 C  CG    . LEU F 3 229 ? 36.848  -43.625 -0.298  1.00 25.97 ? 229 LEU B CG    1 
ATOM   6802 C  CD1   . LEU F 3 229 ? 36.725  -45.129 -0.301  1.00 26.28 ? 229 LEU B CD1   1 
ATOM   6803 C  CD2   . LEU F 3 229 ? 35.819  -43.002 0.636   1.00 25.56 ? 229 LEU B CD2   1 
ATOM   6804 N  N     . GLU F 3 230 ? 41.018  -41.825 0.381   1.00 30.14 ? 230 GLU B N     1 
ATOM   6805 C  CA    . GLU F 3 230 ? 42.244  -41.529 1.112   1.00 31.43 ? 230 GLU B CA    1 
ATOM   6806 C  C     . GLU F 3 230 ? 42.424  -40.019 1.234   1.00 31.25 ? 230 GLU B C     1 
ATOM   6807 O  O     . GLU F 3 230 ? 42.757  -39.504 2.303   1.00 30.28 ? 230 GLU B O     1 
ATOM   6808 C  CB    . GLU F 3 230 ? 43.442  -42.114 0.385   1.00 33.77 ? 230 GLU B CB    1 
ATOM   6809 C  CG    . GLU F 3 230 ? 44.759  -41.726 1.015   1.00 38.65 ? 230 GLU B CG    1 
ATOM   6810 C  CD    . GLU F 3 230 ? 45.943  -42.185 0.199   1.00 41.35 ? 230 GLU B CD    1 
ATOM   6811 O  OE1   . GLU F 3 230 ? 45.941  -41.960 -1.036  1.00 41.26 ? 230 GLU B OE1   1 
ATOM   6812 O  OE2   . GLU F 3 230 ? 46.878  -42.760 0.800   1.00 44.16 ? 230 GLU B OE2   1 
ATOM   6813 N  N     . ALA F 3 231 ? 42.209  -39.319 0.123   1.00 31.18 ? 231 ALA B N     1 
ATOM   6814 C  CA    . ALA F 3 231 ? 42.320  -37.867 0.110   1.00 30.57 ? 231 ALA B CA    1 
ATOM   6815 C  C     . ALA F 3 231 ? 41.383  -37.279 1.163   1.00 30.63 ? 231 ALA B C     1 
ATOM   6816 O  O     . ALA F 3 231 ? 41.812  -36.498 2.011   1.00 30.46 ? 231 ALA B O     1 
ATOM   6817 C  CB    . ALA F 3 231 ? 41.970  -37.334 -1.249  1.00 29.70 ? 231 ALA B CB    1 
ATOM   6818 N  N     . THR F 3 232 ? 40.106  -37.650 1.111   1.00 31.54 ? 232 THR B N     1 
ATOM   6819 C  CA    . THR F 3 232 ? 39.147  -37.144 2.093   1.00 32.56 ? 232 THR B CA    1 
ATOM   6820 C  C     . THR F 3 232 ? 39.578  -37.384 3.537   1.00 33.53 ? 232 THR B C     1 
ATOM   6821 O  O     . THR F 3 232 ? 39.351  -36.541 4.397   1.00 33.51 ? 232 THR B O     1 
ATOM   6822 C  CB    . THR F 3 232 ? 37.726  -37.728 1.867   1.00 32.28 ? 232 THR B CB    1 
ATOM   6823 O  OG1   . THR F 3 232 ? 37.822  -39.122 1.578   1.00 34.63 ? 232 THR B OG1   1 
ATOM   6824 C  CG2   . THR F 3 232 ? 37.051  -36.994 0.708   1.00 30.19 ? 232 THR B CG2   1 
ATOM   6825 N  N     . GLU F 3 233 ? 40.193  -38.528 3.817   1.00 34.59 ? 233 GLU B N     1 
ATOM   6826 C  CA    . GLU F 3 233 ? 40.657  -38.792 5.180   1.00 36.22 ? 233 GLU B CA    1 
ATOM   6827 C  C     . GLU F 3 233 ? 41.844  -37.907 5.518   1.00 38.24 ? 233 GLU B C     1 
ATOM   6828 O  O     . GLU F 3 233 ? 41.939  -37.360 6.613   1.00 38.21 ? 233 GLU B O     1 
ATOM   6829 C  CB    . GLU F 3 233 ? 41.089  -40.255 5.378   1.00 35.54 ? 233 GLU B CB    1 
ATOM   6830 C  CG    . GLU F 3 233 ? 39.939  -41.194 5.590   1.00 35.77 ? 233 GLU B CG    1 
ATOM   6831 C  CD    . GLU F 3 233 ? 38.952  -40.658 6.602   1.00 36.21 ? 233 GLU B CD    1 
ATOM   6832 O  OE1   . GLU F 3 233 ? 37.736  -40.828 6.376   1.00 35.32 ? 233 GLU B OE1   1 
ATOM   6833 O  OE2   . GLU F 3 233 ? 39.385  -40.076 7.625   1.00 37.04 ? 233 GLU B OE2   1 
ATOM   6834 N  N     . ARG F 3 234 ? 42.750  -37.776 4.555   1.00 40.15 ? 234 ARG B N     1 
ATOM   6835 C  CA    . ARG F 3 234 ? 43.972  -36.987 4.697   1.00 42.24 ? 234 ARG B CA    1 
ATOM   6836 C  C     . ARG F 3 234 ? 43.783  -35.513 5.023   1.00 42.32 ? 234 ARG B C     1 
ATOM   6837 O  O     . ARG F 3 234 ? 44.522  -34.970 5.834   1.00 42.89 ? 234 ARG B O     1 
ATOM   6838 C  CB    . ARG F 3 234 ? 44.803  -37.082 3.419   1.00 45.77 ? 234 ARG B CB    1 
ATOM   6839 C  CG    . ARG F 3 234 ? 46.241  -36.622 3.562   1.00 51.32 ? 234 ARG B CG    1 
ATOM   6840 C  CD    . ARG F 3 234 ? 47.087  -37.760 4.095   1.00 57.17 ? 234 ARG B CD    1 
ATOM   6841 N  NE    . ARG F 3 234 ? 48.445  -37.345 4.436   1.00 62.56 ? 234 ARG B NE    1 
ATOM   6842 C  CZ    . ARG F 3 234 ? 49.228  -38.009 5.284   1.00 64.79 ? 234 ARG B CZ    1 
ATOM   6843 N  NH1   . ARG F 3 234 ? 48.783  -39.119 5.870   1.00 65.10 ? 234 ARG B NH1   1 
ATOM   6844 N  NH2   . ARG F 3 234 ? 50.442  -37.549 5.572   1.00 65.61 ? 234 ARG B NH2   1 
ATOM   6845 N  N     . VAL F 3 235 ? 42.819  -34.861 4.382   1.00 41.31 ? 235 VAL B N     1 
ATOM   6846 C  CA    . VAL F 3 235 ? 42.582  -33.447 4.618   1.00 41.36 ? 235 VAL B CA    1 
ATOM   6847 C  C     . VAL F 3 235 ? 42.020  -33.181 6.016   1.00 41.68 ? 235 VAL B C     1 
ATOM   6848 O  O     . VAL F 3 235 ? 41.811  -32.030 6.401   1.00 40.89 ? 235 VAL B O     1 
ATOM   6849 C  CB    . VAL F 3 235 ? 41.675  -32.860 3.478   1.00 41.73 ? 235 VAL B CB    1 
ATOM   6850 C  CG1   . VAL F 3 235 ? 40.887  -33.953 2.837   1.00 43.00 ? 235 VAL B CG1   1 
ATOM   6851 C  CG2   . VAL F 3 235 ? 40.722  -31.816 4.013   1.00 43.90 ? 235 VAL B CG2   1 
ATOM   6852 N  N     . LYS F 3 236 ? 41.823  -34.250 6.787   1.00 42.21 ? 236 LYS B N     1 
ATOM   6853 C  CA    . LYS F 3 236 ? 41.306  -34.122 8.150   1.00 42.61 ? 236 LYS B CA    1 
ATOM   6854 C  C     . LYS F 3 236 ? 42.337  -34.467 9.222   1.00 43.23 ? 236 LYS B C     1 
ATOM   6855 O  O     . LYS F 3 236 ? 42.046  -34.390 10.420  1.00 43.19 ? 236 LYS B O     1 
ATOM   6856 C  CB    . LYS F 3 236 ? 40.089  -35.014 8.354   1.00 42.18 ? 236 LYS B CB    1 
ATOM   6857 C  CG    . LYS F 3 236 ? 38.919  -34.677 7.468   1.00 43.13 ? 236 LYS B CG    1 
ATOM   6858 C  CD    . LYS F 3 236 ? 37.629  -34.912 8.233   1.00 43.65 ? 236 LYS B CD    1 
ATOM   6859 C  CE    . LYS F 3 236 ? 36.495  -35.274 7.311   1.00 44.59 ? 236 LYS B CE    1 
ATOM   6860 N  NZ    . LYS F 3 236 ? 35.247  -35.571 8.071   1.00 45.38 ? 236 LYS B NZ    1 
ATOM   6861 N  N     . ARG F 3 237 ? 43.531  -34.873 8.801   1.00 43.60 ? 237 ARG B N     1 
ATOM   6862 C  CA    . ARG F 3 237 ? 44.578  -35.224 9.756   1.00 44.70 ? 237 ARG B CA    1 
ATOM   6863 C  C     . ARG F 3 237 ? 45.739  -34.250 9.637   1.00 44.24 ? 237 ARG B C     1 
ATOM   6864 O  O     . ARG F 3 237 ? 46.351  -33.867 10.631  1.00 43.82 ? 237 ARG B O     1 
ATOM   6865 C  CB    . ARG F 3 237 ? 45.073  -36.655 9.508   1.00 45.47 ? 237 ARG B CB    1 
ATOM   6866 C  CG    . ARG F 3 237 ? 43.973  -37.697 9.524   1.00 47.52 ? 237 ARG B CG    1 
ATOM   6867 C  CD    . ARG F 3 237 ? 43.252  -37.740 10.865  1.00 48.68 ? 237 ARG B CD    1 
ATOM   6868 N  NE    . ARG F 3 237 ? 41.963  -38.419 10.748  1.00 50.71 ? 237 ARG B NE    1 
ATOM   6869 C  CZ    . ARG F 3 237 ? 41.157  -38.697 11.770  1.00 51.24 ? 237 ARG B CZ    1 
ATOM   6870 N  NH1   . ARG F 3 237 ? 40.003  -39.314 11.552  1.00 50.31 ? 237 ARG B NH1   1 
ATOM   6871 N  NH2   . ARG F 3 237 ? 41.501  -38.368 13.010  1.00 51.41 ? 237 ARG B NH2   1 
ATOM   6872 N  N     . THR F 3 238 ? 46.024  -33.843 8.408   1.00 44.19 ? 238 THR B N     1 
ATOM   6873 C  CA    . THR F 3 238 ? 47.114  -32.917 8.136   1.00 44.64 ? 238 THR B CA    1 
ATOM   6874 C  C     . THR F 3 238 ? 46.931  -31.548 8.796   1.00 45.37 ? 238 THR B C     1 
ATOM   6875 O  O     . THR F 3 238 ? 45.813  -31.026 8.875   1.00 44.71 ? 238 THR B O     1 
ATOM   6876 C  CB    . THR F 3 238 ? 47.269  -32.686 6.623   1.00 44.54 ? 238 THR B CB    1 
ATOM   6877 O  OG1   . THR F 3 238 ? 48.429  -31.879 6.381   1.00 44.51 ? 238 THR B OG1   1 
ATOM   6878 C  CG2   . THR F 3 238 ? 46.033  -31.982 6.058   1.00 43.04 ? 238 THR B CG2   1 
ATOM   6879 N  N     . LYS F 3 239 ? 48.034  -30.978 9.275   1.00 46.60 ? 239 LYS B N     1 
ATOM   6880 C  CA    . LYS F 3 239 ? 48.012  -29.654 9.880   1.00 47.05 ? 239 LYS B CA    1 
ATOM   6881 C  C     . LYS F 3 239 ? 48.438  -28.662 8.795   1.00 47.18 ? 239 LYS B C     1 
ATOM   6882 O  O     . LYS F 3 239 ? 48.106  -27.477 8.858   1.00 47.58 ? 239 LYS B O     1 
ATOM   6883 C  CB    . LYS F 3 239 ? 48.994  -29.582 11.044  1.00 47.77 ? 239 LYS B CB    1 
ATOM   6884 C  CG    . LYS F 3 239 ? 48.622  -30.386 12.284  1.00 49.10 ? 239 LYS B CG    1 
ATOM   6885 C  CD    . LYS F 3 239 ? 47.368  -29.829 12.969  1.00 50.08 ? 239 LYS B CD    1 
ATOM   6886 C  CE    . LYS F 3 239 ? 47.305  -30.243 14.450  1.00 50.91 ? 239 LYS B CE    1 
ATOM   6887 N  NZ    . LYS F 3 239 ? 45.929  -30.171 15.043  1.00 51.55 ? 239 LYS B NZ    1 
ATOM   6888 N  N     . ASP F 3 240 ? 49.147  -29.168 7.786   1.00 46.17 ? 240 ASP B N     1 
ATOM   6889 C  CA    . ASP F 3 240 ? 49.632  -28.337 6.688   1.00 46.32 ? 240 ASP B CA    1 
ATOM   6890 C  C     . ASP F 3 240 ? 48.508  -27.813 5.790   1.00 45.81 ? 240 ASP B C     1 
ATOM   6891 O  O     . ASP F 3 240 ? 47.795  -28.578 5.147   1.00 46.34 ? 240 ASP B O     1 
ATOM   6892 C  CB    . ASP F 3 240 ? 50.648  -29.124 5.845   1.00 47.35 ? 240 ASP B CB    1 
ATOM   6893 C  CG    . ASP F 3 240 ? 51.311  -28.272 4.762   1.00 48.22 ? 240 ASP B CG    1 
ATOM   6894 O  OD1   . ASP F 3 240 ? 52.172  -28.813 4.028   1.00 49.74 ? 240 ASP B OD1   1 
ATOM   6895 O  OD2   . ASP F 3 240 ? 50.979  -27.072 4.644   1.00 48.65 ? 240 ASP B OD2   1 
ATOM   6896 N  N     . GLU F 3 241 ? 48.356  -26.497 5.753   1.00 45.35 ? 241 GLU B N     1 
ATOM   6897 C  CA    . GLU F 3 241 ? 47.337  -25.871 4.923   1.00 45.10 ? 241 GLU B CA    1 
ATOM   6898 C  C     . GLU F 3 241 ? 47.675  -26.072 3.444   1.00 44.31 ? 241 GLU B C     1 
ATOM   6899 O  O     . GLU F 3 241 ? 46.793  -26.313 2.616   1.00 44.00 ? 241 GLU B O     1 
ATOM   6900 C  CB    . GLU F 3 241 ? 47.262  -24.374 5.221   1.00 45.76 ? 241 GLU B CB    1 
ATOM   6901 C  CG    . GLU F 3 241 ? 45.910  -23.901 5.694   1.00 48.37 ? 241 GLU B CG    1 
ATOM   6902 C  CD    . GLU F 3 241 ? 45.832  -22.401 5.763   1.00 50.60 ? 241 GLU B CD    1 
ATOM   6903 O  OE1   . GLU F 3 241 ? 46.598  -21.774 6.545   1.00 52.99 ? 241 GLU B OE1   1 
ATOM   6904 O  OE2   . GLU F 3 241 ? 44.984  -21.836 5.056   1.00 51.66 ? 241 GLU B OE2   1 
ATOM   6905 N  N     . LEU F 3 242 ? 48.957  -25.974 3.115   1.00 43.50 ? 242 LEU B N     1 
ATOM   6906 C  CA    . LEU F 3 242 ? 49.380  -26.131 1.738   1.00 43.15 ? 242 LEU B CA    1 
ATOM   6907 C  C     . LEU F 3 242 ? 48.945  -27.469 1.166   1.00 42.88 ? 242 LEU B C     1 
ATOM   6908 O  O     . LEU F 3 242 ? 48.577  -27.550 -0.008  1.00 42.64 ? 242 LEU B O     1 
ATOM   6909 C  CB    . LEU F 3 242 ? 50.901  -25.977 1.621   1.00 43.49 ? 242 LEU B CB    1 
ATOM   6910 C  CG    . LEU F 3 242 ? 51.436  -24.567 1.355   1.00 43.40 ? 242 LEU B CG    1 
ATOM   6911 C  CD1   . LEU F 3 242 ? 50.828  -24.038 0.065   1.00 43.68 ? 242 LEU B CD1   1 
ATOM   6912 C  CD2   . LEU F 3 242 ? 51.102  -23.648 2.514   1.00 43.40 ? 242 LEU B CD2   1 
ATOM   6913 N  N     . GLU F 3 243 ? 48.986  -28.517 1.990   1.00 42.07 ? 243 GLU B N     1 
ATOM   6914 C  CA    . GLU F 3 243 ? 48.586  -29.846 1.532   1.00 40.92 ? 243 GLU B CA    1 
ATOM   6915 C  C     . GLU F 3 243 ? 47.072  -29.891 1.331   1.00 39.30 ? 243 GLU B C     1 
ATOM   6916 O  O     . GLU F 3 243 ? 46.574  -30.531 0.401   1.00 38.80 ? 243 GLU B O     1 
ATOM   6917 C  CB    . GLU F 3 243 ? 49.011  -30.916 2.543   1.00 41.77 ? 243 GLU B CB    1 
ATOM   6918 C  CG    . GLU F 3 243 ? 48.748  -32.340 2.072   1.00 42.54 ? 243 GLU B CG    1 
ATOM   6919 C  CD    . GLU F 3 243 ? 49.108  -33.381 3.110   1.00 43.55 ? 243 GLU B CD    1 
ATOM   6920 O  OE1   . GLU F 3 243 ? 48.951  -34.588 2.816   1.00 44.77 ? 243 GLU B OE1   1 
ATOM   6921 O  OE2   . GLU F 3 243 ? 49.547  -32.994 4.216   1.00 43.09 ? 243 GLU B OE2   1 
ATOM   6922 N  N     . ILE F 3 244 ? 46.346  -29.209 2.211   1.00 37.80 ? 244 ILE B N     1 
ATOM   6923 C  CA    . ILE F 3 244 ? 44.894  -29.151 2.119   1.00 36.97 ? 244 ILE B CA    1 
ATOM   6924 C  C     . ILE F 3 244 ? 44.538  -28.567 0.759   1.00 37.68 ? 244 ILE B C     1 
ATOM   6925 O  O     . ILE F 3 244 ? 43.837  -29.187 -0.033  1.00 38.03 ? 244 ILE B O     1 
ATOM   6926 C  CB    . ILE F 3 244 ? 44.291  -28.251 3.228   1.00 35.61 ? 244 ILE B CB    1 
ATOM   6927 C  CG1   . ILE F 3 244 ? 44.487  -28.905 4.596   1.00 33.91 ? 244 ILE B CG1   1 
ATOM   6928 C  CG2   . ILE F 3 244 ? 42.814  -28.017 2.967   1.00 34.70 ? 244 ILE B CG2   1 
ATOM   6929 C  CD1   . ILE F 3 244 ? 43.831  -28.148 5.730   1.00 31.46 ? 244 ILE B CD1   1 
ATOM   6930 N  N     . ILE F 3 245 ? 45.038  -27.363 0.505   1.00 38.24 ? 245 ILE B N     1 
ATOM   6931 C  CA    . ILE F 3 245 ? 44.812  -26.661 -0.755  1.00 38.83 ? 245 ILE B CA    1 
ATOM   6932 C  C     . ILE F 3 245 ? 45.128  -27.589 -1.920  1.00 39.90 ? 245 ILE B C     1 
ATOM   6933 O  O     . ILE F 3 245 ? 44.392  -27.670 -2.893  1.00 39.57 ? 245 ILE B O     1 
ATOM   6934 C  CB    . ILE F 3 245 ? 45.711  -25.393 -0.855  1.00 38.57 ? 245 ILE B CB    1 
ATOM   6935 C  CG1   . ILE F 3 245 ? 45.196  -24.316 0.103   1.00 36.40 ? 245 ILE B CG1   1 
ATOM   6936 C  CG2   . ILE F 3 245 ? 45.742  -24.886 -2.286  1.00 38.25 ? 245 ILE B CG2   1 
ATOM   6937 C  CD1   . ILE F 3 245 ? 46.017  -23.070 0.080   1.00 36.73 ? 245 ILE B CD1   1 
ATOM   6938 N  N     . HIS F 3 246 ? 46.242  -28.292 -1.795  1.00 41.84 ? 246 HIS B N     1 
ATOM   6939 C  CA    . HIS F 3 246 ? 46.699  -29.222 -2.815  1.00 44.12 ? 246 HIS B CA    1 
ATOM   6940 C  C     . HIS F 3 246 ? 45.649  -30.298 -3.107  1.00 43.23 ? 246 HIS B C     1 
ATOM   6941 O  O     . HIS F 3 246 ? 45.267  -30.522 -4.262  1.00 43.27 ? 246 HIS B O     1 
ATOM   6942 C  CB    . HIS F 3 246 ? 47.983  -29.900 -2.347  1.00 48.61 ? 246 HIS B CB    1 
ATOM   6943 C  CG    . HIS F 3 246 ? 49.089  -29.878 -3.370  1.00 53.77 ? 246 HIS B CG    1 
ATOM   6944 N  ND1   . HIS F 3 246 ? 50.160  -30.741 -3.311  1.00 56.82 ? 246 HIS B ND1   1 
ATOM   6945 C  CD2   . HIS F 3 246 ? 49.300  -29.074 -4.431  1.00 55.77 ? 246 HIS B CD2   1 
ATOM   6946 C  CE1   . HIS F 3 246 ? 50.998  -30.460 -4.304  1.00 57.07 ? 246 HIS B CE1   1 
ATOM   6947 N  NE2   . HIS F 3 246 ? 50.505  -29.456 -4.995  1.00 57.02 ? 246 HIS B NE2   1 
ATOM   6948 N  N     . LEU F 3 247 ? 45.191  -30.971 -2.054  1.00 41.62 ? 247 LEU B N     1 
ATOM   6949 C  CA    . LEU F 3 247 ? 44.203  -32.040 -2.187  1.00 40.57 ? 247 LEU B CA    1 
ATOM   6950 C  C     . LEU F 3 247 ? 42.897  -31.520 -2.767  1.00 40.10 ? 247 LEU B C     1 
ATOM   6951 O  O     . LEU F 3 247 ? 42.243  -32.204 -3.560  1.00 40.24 ? 247 LEU B O     1 
ATOM   6952 C  CB    . LEU F 3 247 ? 43.950  -32.693 -0.829  1.00 39.61 ? 247 LEU B CB    1 
ATOM   6953 C  CG    . LEU F 3 247 ? 45.140  -33.498 -0.298  1.00 38.25 ? 247 LEU B CG    1 
ATOM   6954 C  CD1   . LEU F 3 247 ? 44.830  -34.066 1.070   1.00 37.87 ? 247 LEU B CD1   1 
ATOM   6955 C  CD2   . LEU F 3 247 ? 45.454  -34.614 -1.276  1.00 37.60 ? 247 LEU B CD2   1 
ATOM   6956 N  N     . ILE F 3 248 ? 42.521  -30.310 -2.366  1.00 39.32 ? 248 ILE B N     1 
ATOM   6957 C  CA    . ILE F 3 248 ? 41.301  -29.697 -2.862  1.00 38.64 ? 248 ILE B CA    1 
ATOM   6958 C  C     . ILE F 3 248 ? 41.420  -29.598 -4.380  1.00 39.22 ? 248 ILE B C     1 
ATOM   6959 O  O     . ILE F 3 248 ? 40.491  -29.932 -5.114  1.00 39.96 ? 248 ILE B O     1 
ATOM   6960 C  CB    . ILE F 3 248 ? 41.111  -28.294 -2.255  1.00 37.10 ? 248 ILE B CB    1 
ATOM   6961 C  CG1   . ILE F 3 248 ? 40.894  -28.416 -0.748  1.00 36.02 ? 248 ILE B CG1   1 
ATOM   6962 C  CG2   . ILE F 3 248 ? 39.934  -27.589 -2.895  1.00 35.70 ? 248 ILE B CG2   1 
ATOM   6963 C  CD1   . ILE F 3 248 ? 40.681  -27.089 -0.060  1.00 36.67 ? 248 ILE B CD1   1 
ATOM   6964 N  N     . ASP F 3 249 ? 42.582  -29.152 -4.842  1.00 39.28 ? 249 ASP B N     1 
ATOM   6965 C  CA    . ASP F 3 249 ? 42.836  -29.012 -6.263  1.00 39.44 ? 249 ASP B CA    1 
ATOM   6966 C  C     . ASP F 3 249 ? 42.788  -30.350 -6.984  1.00 39.80 ? 249 ASP B C     1 
ATOM   6967 O  O     . ASP F 3 249 ? 42.137  -30.479 -8.021  1.00 40.03 ? 249 ASP B O     1 
ATOM   6968 C  CB    . ASP F 3 249 ? 44.203  -28.376 -6.473  1.00 41.00 ? 249 ASP B CB    1 
ATOM   6969 C  CG    . ASP F 3 249 ? 44.147  -26.859 -6.493  1.00 43.21 ? 249 ASP B CG    1 
ATOM   6970 O  OD1   . ASP F 3 249 ? 43.380  -26.253 -5.706  1.00 43.91 ? 249 ASP B OD1   1 
ATOM   6971 O  OD2   . ASP F 3 249 ? 44.888  -26.271 -7.305  1.00 43.61 ? 249 ASP B OD2   1 
ATOM   6972 N  N     . GLU F 3 250 ? 43.472  -31.343 -6.422  1.00 39.18 ? 250 GLU B N     1 
ATOM   6973 C  CA    . GLU F 3 250 ? 43.543  -32.666 -7.021  1.00 39.67 ? 250 GLU B CA    1 
ATOM   6974 C  C     . GLU F 3 250 ? 42.254  -33.489 -7.004  1.00 38.72 ? 250 GLU B C     1 
ATOM   6975 O  O     . GLU F 3 250 ? 41.974  -34.226 -7.956  1.00 39.20 ? 250 GLU B O     1 
ATOM   6976 C  CB    . GLU F 3 250 ? 44.665  -33.477 -6.364  1.00 41.29 ? 250 GLU B CB    1 
ATOM   6977 C  CG    . GLU F 3 250 ? 45.647  -34.071 -7.373  1.00 43.32 ? 250 GLU B CG    1 
ATOM   6978 C  CD    . GLU F 3 250 ? 46.539  -35.141 -6.770  1.00 44.92 ? 250 GLU B CD    1 
ATOM   6979 O  OE1   . GLU F 3 250 ? 47.466  -34.804 -5.991  1.00 45.67 ? 250 GLU B OE1   1 
ATOM   6980 O  OE2   . GLU F 3 250 ? 46.308  -36.330 -7.075  1.00 45.89 ? 250 GLU B OE2   1 
ATOM   6981 N  N     . TYR F 3 251 ? 41.468  -33.375 -5.941  1.00 37.16 ? 251 TYR B N     1 
ATOM   6982 C  CA    . TYR F 3 251 ? 40.252  -34.163 -5.866  1.00 36.36 ? 251 TYR B CA    1 
ATOM   6983 C  C     . TYR F 3 251 ? 38.952  -33.377 -5.790  1.00 36.32 ? 251 TYR B C     1 
ATOM   6984 O  O     . TYR F 3 251 ? 37.911  -33.916 -5.416  1.00 36.97 ? 251 TYR B O     1 
ATOM   6985 C  CB    . TYR F 3 251 ? 40.353  -35.140 -4.693  1.00 36.04 ? 251 TYR B CB    1 
ATOM   6986 C  CG    . TYR F 3 251 ? 41.563  -36.044 -4.783  1.00 35.71 ? 251 TYR B CG    1 
ATOM   6987 C  CD1   . TYR F 3 251 ? 42.733  -35.746 -4.088  1.00 35.16 ? 251 TYR B CD1   1 
ATOM   6988 C  CD2   . TYR F 3 251 ? 41.552  -37.179 -5.596  1.00 35.68 ? 251 TYR B CD2   1 
ATOM   6989 C  CE1   . TYR F 3 251 ? 43.866  -36.558 -4.193  1.00 34.46 ? 251 TYR B CE1   1 
ATOM   6990 C  CE2   . TYR F 3 251 ? 42.681  -37.995 -5.714  1.00 35.47 ? 251 TYR B CE2   1 
ATOM   6991 C  CZ    . TYR F 3 251 ? 43.836  -37.677 -5.007  1.00 35.35 ? 251 TYR B CZ    1 
ATOM   6992 O  OH    . TYR F 3 251 ? 44.955  -38.478 -5.113  1.00 35.78 ? 251 TYR B OH    1 
ATOM   6993 N  N     . ARG F 3 252 ? 38.996  -32.107 -6.159  1.00 35.57 ? 252 ARG B N     1 
ATOM   6994 C  CA    . ARG F 3 252 ? 37.788  -31.313 -6.123  1.00 34.83 ? 252 ARG B CA    1 
ATOM   6995 C  C     . ARG F 3 252 ? 37.014  -31.492 -4.831  1.00 33.61 ? 252 ARG B C     1 
ATOM   6996 O  O     . ARG F 3 252 ? 35.808  -31.722 -4.862  1.00 34.22 ? 252 ARG B O     1 
ATOM   6997 C  CB    . ARG F 3 252 ? 36.901  -31.714 -7.272  1.00 36.50 ? 252 ARG B CB    1 
ATOM   6998 C  CG    . ARG F 3 252 ? 37.025  -30.852 -8.484  1.00 41.60 ? 252 ARG B CG    1 
ATOM   6999 C  CD    . ARG F 3 252 ? 35.629  -30.856 -8.963  1.00 43.93 ? 252 ARG B CD    1 
ATOM   7000 N  NE    . ARG F 3 252 ? 35.180  -29.874 -9.867  1.00 47.11 ? 252 ARG B NE    1 
ATOM   7001 C  CZ    . ARG F 3 252 ? 34.117  -29.909 -10.659 1.00 48.81 ? 252 ARG B CZ    1 
ATOM   7002 N  NH1   . ARG F 3 252 ? 33.909  -28.829 -11.373 1.00 49.32 ? 252 ARG B NH1   1 
ATOM   7003 N  NH2   . ARG F 3 252 ? 33.320  -30.956 -10.803 1.00 49.06 ? 252 ARG B NH2   1 
ATOM   7004 N  N     . LEU F 3 253 ? 37.697  -31.408 -3.695  1.00 31.91 ? 253 LEU B N     1 
ATOM   7005 C  CA    . LEU F 3 253 ? 37.016  -31.542 -2.415  1.00 29.58 ? 253 LEU B CA    1 
ATOM   7006 C  C     . LEU F 3 253 ? 36.330  -30.196 -2.148  1.00 29.14 ? 253 LEU B C     1 
ATOM   7007 O  O     . LEU F 3 253 ? 36.837  -29.145 -2.547  1.00 29.95 ? 253 LEU B O     1 
ATOM   7008 C  CB    . LEU F 3 253 ? 38.027  -31.880 -1.320  1.00 29.32 ? 253 LEU B CB    1 
ATOM   7009 C  CG    . LEU F 3 253 ? 38.881  -33.140 -1.540  1.00 28.75 ? 253 LEU B CG    1 
ATOM   7010 C  CD1   . LEU F 3 253 ? 39.872  -33.280 -0.398  1.00 26.87 ? 253 LEU B CD1   1 
ATOM   7011 C  CD2   . LEU F 3 253 ? 37.995  -34.377 -1.627  1.00 27.37 ? 253 LEU B CD2   1 
ATOM   7012 N  N     . VAL F 3 254 ? 35.163  -30.222 -1.511  1.00 27.46 ? 254 VAL B N     1 
ATOM   7013 C  CA    . VAL F 3 254 ? 34.434  -28.987 -1.240  1.00 24.56 ? 254 VAL B CA    1 
ATOM   7014 C  C     . VAL F 3 254 ? 34.352  -28.692 0.255   1.00 24.23 ? 254 VAL B C     1 
ATOM   7015 O  O     . VAL F 3 254 ? 34.803  -29.495 1.074   1.00 24.64 ? 254 VAL B O     1 
ATOM   7016 C  CB    . VAL F 3 254 ? 33.014  -29.040 -1.856  1.00 23.77 ? 254 VAL B CB    1 
ATOM   7017 C  CG1   . VAL F 3 254 ? 33.112  -29.053 -3.352  1.00 21.93 ? 254 VAL B CG1   1 
ATOM   7018 C  CG2   . VAL F 3 254 ? 32.275  -30.283 -1.397  1.00 23.52 ? 254 VAL B CG2   1 
ATOM   7019 N  N     . ARG F 3 255 ? 33.776  -27.544 0.603   1.00 22.81 ? 255 ARG B N     1 
ATOM   7020 C  CA    . ARG F 3 255 ? 33.648  -27.107 1.998   1.00 23.14 ? 255 ARG B CA    1 
ATOM   7021 C  C     . ARG F 3 255 ? 33.397  -28.216 3.043   1.00 24.61 ? 255 ARG B C     1 
ATOM   7022 O  O     . ARG F 3 255 ? 34.149  -28.347 4.016   1.00 25.97 ? 255 ARG B O     1 
ATOM   7023 C  CB    . ARG F 3 255 ? 32.542  -26.050 2.107   1.00 21.36 ? 255 ARG B CB    1 
ATOM   7024 C  CG    . ARG F 3 255 ? 32.690  -25.137 3.304   1.00 17.82 ? 255 ARG B CG    1 
ATOM   7025 C  CD    . ARG F 3 255 ? 31.494  -24.218 3.503   1.00 16.34 ? 255 ARG B CD    1 
ATOM   7026 N  NE    . ARG F 3 255 ? 30.284  -24.947 3.875   1.00 16.09 ? 255 ARG B NE    1 
ATOM   7027 C  CZ    . ARG F 3 255 ? 29.379  -25.397 3.010   1.00 17.44 ? 255 ARG B CZ    1 
ATOM   7028 N  NH1   . ARG F 3 255 ? 28.315  -26.052 3.446   1.00 16.19 ? 255 ARG B NH1   1 
ATOM   7029 N  NH2   . ARG F 3 255 ? 29.526  -25.179 1.709   1.00 18.93 ? 255 ARG B NH2   1 
ATOM   7030 N  N     . GLU F 3 256 ? 32.336  -28.996 2.849   1.00 24.61 ? 256 GLU B N     1 
ATOM   7031 C  CA    . GLU F 3 256 ? 31.982  -30.084 3.760   1.00 24.54 ? 256 GLU B CA    1 
ATOM   7032 C  C     . GLU F 3 256 ? 33.145  -31.037 4.047   1.00 24.60 ? 256 GLU B C     1 
ATOM   7033 O  O     . GLU F 3 256 ? 33.149  -31.732 5.065   1.00 24.48 ? 256 GLU B O     1 
ATOM   7034 C  CB    . GLU F 3 256 ? 30.810  -30.904 3.190   1.00 24.47 ? 256 GLU B CB    1 
ATOM   7035 C  CG    . GLU F 3 256 ? 29.512  -30.138 3.027   1.00 24.78 ? 256 GLU B CG    1 
ATOM   7036 C  CD    . GLU F 3 256 ? 29.471  -29.286 1.766   1.00 27.48 ? 256 GLU B CD    1 
ATOM   7037 O  OE1   . GLU F 3 256 ? 30.548  -28.939 1.224   1.00 27.48 ? 256 GLU B OE1   1 
ATOM   7038 O  OE2   . GLU F 3 256 ? 28.347  -28.948 1.320   1.00 28.52 ? 256 GLU B OE2   1 
ATOM   7039 N  N     . HIS F 3 257 ? 34.119  -31.069 3.147   1.00 24.46 ? 257 HIS B N     1 
ATOM   7040 C  CA    . HIS F 3 257 ? 35.268  -31.949 3.284   1.00 25.98 ? 257 HIS B CA    1 
ATOM   7041 C  C     . HIS F 3 257 ? 36.305  -31.458 4.271   1.00 27.36 ? 257 HIS B C     1 
ATOM   7042 O  O     . HIS F 3 257 ? 37.152  -32.233 4.718   1.00 29.04 ? 257 HIS B O     1 
ATOM   7043 C  CB    . HIS F 3 257 ? 35.954  -32.130 1.926   1.00 25.56 ? 257 HIS B CB    1 
ATOM   7044 C  CG    . HIS F 3 257 ? 35.196  -33.000 0.975   1.00 25.99 ? 257 HIS B CG    1 
ATOM   7045 N  ND1   . HIS F 3 257 ? 34.883  -34.311 1.263   1.00 25.65 ? 257 HIS B ND1   1 
ATOM   7046 C  CD2   . HIS F 3 257 ? 34.695  -32.751 -0.257  1.00 24.85 ? 257 HIS B CD2   1 
ATOM   7047 C  CE1   . HIS F 3 257 ? 34.219  -34.833 0.245   1.00 25.42 ? 257 HIS B CE1   1 
ATOM   7048 N  NE2   . HIS F 3 257 ? 34.092  -33.909 -0.688  1.00 25.02 ? 257 HIS B NE2   1 
ATOM   7049 N  N     . LEU F 3 258 ? 36.244  -30.176 4.604   1.00 27.98 ? 258 LEU B N     1 
ATOM   7050 C  CA    . LEU F 3 258 ? 37.226  -29.578 5.498   1.00 28.45 ? 258 LEU B CA    1 
ATOM   7051 C  C     . LEU F 3 258 ? 36.816  -29.469 6.958   1.00 29.29 ? 258 LEU B C     1 
ATOM   7052 O  O     . LEU F 3 258 ? 35.629  -29.361 7.274   1.00 29.36 ? 258 LEU B O     1 
ATOM   7053 C  CB    . LEU F 3 258 ? 37.603  -28.194 4.974   1.00 27.25 ? 258 LEU B CB    1 
ATOM   7054 C  CG    . LEU F 3 258 ? 38.631  -28.185 3.841   1.00 26.45 ? 258 LEU B CG    1 
ATOM   7055 C  CD1   . LEU F 3 258 ? 38.317  -29.255 2.832   1.00 26.78 ? 258 LEU B CD1   1 
ATOM   7056 C  CD2   . LEU F 3 258 ? 38.650  -26.824 3.188   1.00 25.85 ? 258 LEU B CD2   1 
ATOM   7057 N  N     . LEU F 3 259 ? 37.811  -29.524 7.843   1.00 29.20 ? 259 LEU B N     1 
ATOM   7058 C  CA    . LEU F 3 259 ? 37.556  -29.385 9.264   1.00 29.96 ? 259 LEU B CA    1 
ATOM   7059 C  C     . LEU F 3 259 ? 37.172  -27.921 9.426   1.00 31.05 ? 259 LEU B C     1 
ATOM   7060 O  O     . LEU F 3 259 ? 37.799  -27.043 8.836   1.00 30.06 ? 259 LEU B O     1 
ATOM   7061 C  CB    . LEU F 3 259 ? 38.814  -29.687 10.072  1.00 30.34 ? 259 LEU B CB    1 
ATOM   7062 C  CG    . LEU F 3 259 ? 39.260  -31.152 10.096  1.00 30.65 ? 259 LEU B CG    1 
ATOM   7063 C  CD1   . LEU F 3 259 ? 40.577  -31.253 10.838  1.00 29.01 ? 259 LEU B CD1   1 
ATOM   7064 C  CD2   . LEU F 3 259 ? 38.192  -32.019 10.759  1.00 29.47 ? 259 LEU B CD2   1 
ATOM   7065 N  N     . THR F 3 260 ? 36.140  -27.662 10.219  1.00 33.09 ? 260 THR B N     1 
ATOM   7066 C  CA    . THR F 3 260 ? 35.660  -26.309 10.414  1.00 35.38 ? 260 THR B CA    1 
ATOM   7067 C  C     . THR F 3 260 ? 36.697  -25.299 10.906  1.00 35.89 ? 260 THR B C     1 
ATOM   7068 O  O     . THR F 3 260 ? 36.473  -24.095 10.832  1.00 35.59 ? 260 THR B O     1 
ATOM   7069 C  CB    . THR F 3 260 ? 34.423  -26.297 11.330  1.00 36.42 ? 260 THR B CB    1 
ATOM   7070 O  OG1   . THR F 3 260 ? 34.552  -25.258 12.303  1.00 39.68 ? 260 THR B OG1   1 
ATOM   7071 C  CG2   . THR F 3 260 ? 34.265  -27.634 12.026  1.00 39.04 ? 260 THR B CG2   1 
ATOM   7072 N  N     . ILE F 3 261 ? 37.837  -25.777 11.390  1.00 37.19 ? 261 ILE B N     1 
ATOM   7073 C  CA    . ILE F 3 261 ? 38.874  -24.865 11.860  1.00 37.72 ? 261 ILE B CA    1 
ATOM   7074 C  C     . ILE F 3 261 ? 39.608  -24.237 10.672  1.00 37.04 ? 261 ILE B C     1 
ATOM   7075 O  O     . ILE F 3 261 ? 40.188  -23.156 10.787  1.00 37.40 ? 261 ILE B O     1 
ATOM   7076 C  CB    . ILE F 3 261 ? 39.900  -25.570 12.785  1.00 38.33 ? 261 ILE B CB    1 
ATOM   7077 C  CG1   . ILE F 3 261 ? 39.822  -27.084 12.605  1.00 40.04 ? 261 ILE B CG1   1 
ATOM   7078 C  CG2   . ILE F 3 261 ? 39.655  -25.180 14.224  1.00 39.52 ? 261 ILE B CG2   1 
ATOM   7079 C  CD1   . ILE F 3 261 ? 40.024  -27.905 13.880  1.00 41.97 ? 261 ILE B CD1   1 
ATOM   7080 N  N     . HIS F 3 262 ? 39.550  -24.908 9.525   1.00 36.08 ? 262 HIS B N     1 
ATOM   7081 C  CA    . HIS F 3 262 ? 40.192  -24.433 8.307   1.00 35.35 ? 262 HIS B CA    1 
ATOM   7082 C  C     . HIS F 3 262 ? 39.353  -23.382 7.596   1.00 35.28 ? 262 HIS B C     1 
ATOM   7083 O  O     . HIS F 3 262 ? 39.861  -22.642 6.753   1.00 34.25 ? 262 HIS B O     1 
ATOM   7084 C  CB    . HIS F 3 262 ? 40.418  -25.599 7.364   1.00 36.38 ? 262 HIS B CB    1 
ATOM   7085 C  CG    . HIS F 3 262 ? 41.255  -26.684 7.950   1.00 38.20 ? 262 HIS B CG    1 
ATOM   7086 N  ND1   . HIS F 3 262 ? 40.919  -28.021 7.853   1.00 38.87 ? 262 HIS B ND1   1 
ATOM   7087 C  CD2   . HIS F 3 262 ? 42.413  -26.637 8.646   1.00 37.84 ? 262 HIS B CD2   1 
ATOM   7088 C  CE1   . HIS F 3 262 ? 41.833  -28.745 8.467   1.00 39.61 ? 262 HIS B CE1   1 
ATOM   7089 N  NE2   . HIS F 3 262 ? 42.753  -27.929 8.957   1.00 39.61 ? 262 HIS B NE2   1 
ATOM   7090 N  N     . LEU F 3 263 ? 38.068  -23.326 7.938   1.00 35.68 ? 263 LEU B N     1 
ATOM   7091 C  CA    . LEU F 3 263 ? 37.146  -22.376 7.328   1.00 36.28 ? 263 LEU B CA    1 
ATOM   7092 C  C     . LEU F 3 263 ? 37.303  -20.947 7.811   1.00 36.96 ? 263 LEU B C     1 
ATOM   7093 O  O     . LEU F 3 263 ? 36.372  -20.151 7.706   1.00 37.78 ? 263 LEU B O     1 
ATOM   7094 C  CB    . LEU F 3 263 ? 35.699  -22.822 7.548   1.00 35.59 ? 263 LEU B CB    1 
ATOM   7095 C  CG    . LEU F 3 263 ? 35.081  -23.783 6.529   1.00 36.15 ? 263 LEU B CG    1 
ATOM   7096 C  CD1   . LEU F 3 263 ? 36.082  -24.114 5.415   1.00 36.19 ? 263 LEU B CD1   1 
ATOM   7097 C  CD2   . LEU F 3 263 ? 34.623  -25.036 7.249   1.00 35.32 ? 263 LEU B CD2   1 
ATOM   7098 N  N     . LYS F 3 264 ? 38.465  -20.623 8.360   1.00 37.49 ? 264 LYS B N     1 
ATOM   7099 C  CA    . LYS F 3 264 ? 38.704  -19.267 8.818   1.00 38.33 ? 264 LYS B CA    1 
ATOM   7100 C  C     . LYS F 3 264 ? 39.901  -18.746 8.037   1.00 38.09 ? 264 LYS B C     1 
ATOM   7101 O  O     . LYS F 3 264 ? 40.275  -17.585 8.153   1.00 37.77 ? 264 LYS B O     1 
ATOM   7102 C  CB    . LYS F 3 264 ? 38.999  -19.249 10.315  1.00 39.36 ? 264 LYS B CB    1 
ATOM   7103 C  CG    . LYS F 3 264 ? 38.577  -17.942 11.006  1.00 41.63 ? 264 LYS B CG    1 
ATOM   7104 C  CD    . LYS F 3 264 ? 37.272  -18.122 11.781  1.00 42.54 ? 264 LYS B CD    1 
ATOM   7105 C  CE    . LYS F 3 264 ? 36.763  -16.804 12.349  1.00 43.04 ? 264 LYS B CE    1 
ATOM   7106 N  NZ    . LYS F 3 264 ? 35.630  -17.014 13.301  1.00 42.53 ? 264 LYS B NZ    1 
ATOM   7107 N  N     . SER F 3 265 ? 40.490  -19.627 7.234   1.00 38.00 ? 265 SER B N     1 
ATOM   7108 C  CA    . SER F 3 265 ? 41.647  -19.288 6.415   1.00 37.71 ? 265 SER B CA    1 
ATOM   7109 C  C     . SER F 3 265 ? 41.302  -18.724 5.045   1.00 38.10 ? 265 SER B C     1 
ATOM   7110 O  O     . SER F 3 265 ? 40.685  -19.395 4.215   1.00 38.08 ? 265 SER B O     1 
ATOM   7111 C  CB    . SER F 3 265 ? 42.530  -20.503 6.185   1.00 37.67 ? 265 SER B CB    1 
ATOM   7112 O  OG    . SER F 3 265 ? 43.193  -20.337 4.942   1.00 36.05 ? 265 SER B OG    1 
ATOM   7113 N  N     . LYS F 3 266 ? 41.755  -17.503 4.805   1.00 37.65 ? 266 LYS B N     1 
ATOM   7114 C  CA    . LYS F 3 266 ? 41.523  -16.816 3.553   1.00 37.63 ? 266 LYS B CA    1 
ATOM   7115 C  C     . LYS F 3 266 ? 41.953  -17.673 2.364   1.00 38.20 ? 266 LYS B C     1 
ATOM   7116 O  O     . LYS F 3 266 ? 41.210  -17.804 1.389   1.00 37.71 ? 266 LYS B O     1 
ATOM   7117 C  CB    . LYS F 3 266 ? 42.313  -15.513 3.556   1.00 37.95 ? 266 LYS B CB    1 
ATOM   7118 C  CG    . LYS F 3 266 ? 41.910  -14.499 2.511   1.00 38.34 ? 266 LYS B CG    1 
ATOM   7119 C  CD    . LYS F 3 266 ? 43.089  -13.573 2.273   1.00 39.87 ? 266 LYS B CD    1 
ATOM   7120 C  CE    . LYS F 3 266 ? 42.660  -12.178 1.894   1.00 40.09 ? 266 LYS B CE    1 
ATOM   7121 N  NZ    . LYS F 3 266 ? 43.857  -11.312 1.733   1.00 39.11 ? 266 LYS B NZ    1 
ATOM   7122 N  N     . GLU F 3 267 ? 43.149  -18.259 2.444   1.00 38.45 ? 267 GLU B N     1 
ATOM   7123 C  CA    . GLU F 3 267 ? 43.663  -19.071 1.343   1.00 38.73 ? 267 GLU B CA    1 
ATOM   7124 C  C     . GLU F 3 267 ? 42.895  -20.354 1.047   1.00 37.98 ? 267 GLU B C     1 
ATOM   7125 O  O     . GLU F 3 267 ? 42.871  -20.805 -0.100  1.00 38.24 ? 267 GLU B O     1 
ATOM   7126 C  CB    . GLU F 3 267 ? 45.151  -19.374 1.555   1.00 40.27 ? 267 GLU B CB    1 
ATOM   7127 C  CG    . GLU F 3 267 ? 46.028  -18.139 1.376   1.00 42.75 ? 267 GLU B CG    1 
ATOM   7128 C  CD    . GLU F 3 267 ? 45.763  -17.430 0.050   1.00 44.19 ? 267 GLU B CD    1 
ATOM   7129 O  OE1   . GLU F 3 267 ? 45.669  -16.182 0.037   1.00 44.84 ? 267 GLU B OE1   1 
ATOM   7130 O  OE2   . GLU F 3 267 ? 45.645  -18.121 -0.983  1.00 44.82 ? 267 GLU B OE2   1 
ATOM   7131 N  N     . ILE F 3 268 ? 42.270  -20.939 2.067   1.00 36.69 ? 268 ILE B N     1 
ATOM   7132 C  CA    . ILE F 3 268 ? 41.477  -22.163 1.886   1.00 34.86 ? 268 ILE B CA    1 
ATOM   7133 C  C     . ILE F 3 268 ? 40.296  -21.852 0.949   1.00 34.50 ? 268 ILE B C     1 
ATOM   7134 O  O     . ILE F 3 268 ? 40.034  -22.580 -0.019  1.00 33.61 ? 268 ILE B O     1 
ATOM   7135 C  CB    . ILE F 3 268 ? 40.910  -22.682 3.243   1.00 33.52 ? 268 ILE B CB    1 
ATOM   7136 C  CG1   . ILE F 3 268 ? 42.042  -23.132 4.166   1.00 33.14 ? 268 ILE B CG1   1 
ATOM   7137 C  CG2   . ILE F 3 268 ? 39.975  -23.836 3.011   1.00 32.36 ? 268 ILE B CG2   1 
ATOM   7138 C  CD1   . ILE F 3 268 ? 42.766  -24.367 3.700   1.00 32.19 ? 268 ILE B CD1   1 
ATOM   7139 N  N     . TRP F 3 269 ? 39.595  -20.760 1.248   1.00 33.50 ? 269 TRP B N     1 
ATOM   7140 C  CA    . TRP F 3 269 ? 38.450  -20.344 0.462   1.00 33.63 ? 269 TRP B CA    1 
ATOM   7141 C  C     . TRP F 3 269 ? 38.829  -19.893 -0.947  1.00 34.98 ? 269 TRP B C     1 
ATOM   7142 O  O     . TRP F 3 269 ? 38.104  -20.160 -1.907  1.00 35.49 ? 269 TRP B O     1 
ATOM   7143 C  CB    . TRP F 3 269 ? 37.692  -19.228 1.177   1.00 31.36 ? 269 TRP B CB    1 
ATOM   7144 C  CG    . TRP F 3 269 ? 36.968  -19.678 2.405   1.00 30.85 ? 269 TRP B CG    1 
ATOM   7145 C  CD1   . TRP F 3 269 ? 37.473  -19.767 3.672   1.00 31.85 ? 269 TRP B CD1   1 
ATOM   7146 C  CD2   . TRP F 3 269 ? 35.588  -20.060 2.496   1.00 30.56 ? 269 TRP B CD2   1 
ATOM   7147 N  NE1   . TRP F 3 269 ? 36.490  -20.169 4.550   1.00 31.00 ? 269 TRP B NE1   1 
ATOM   7148 C  CE2   . TRP F 3 269 ? 35.325  -20.349 3.856   1.00 30.62 ? 269 TRP B CE2   1 
ATOM   7149 C  CE3   . TRP F 3 269 ? 34.548  -20.173 1.563   1.00 29.93 ? 269 TRP B CE3   1 
ATOM   7150 C  CZ2   . TRP F 3 269 ? 34.064  -20.754 4.302   1.00 29.48 ? 269 TRP B CZ2   1 
ATOM   7151 C  CZ3   . TRP F 3 269 ? 33.293  -20.576 2.008   1.00 29.06 ? 269 TRP B CZ3   1 
ATOM   7152 C  CH2   . TRP F 3 269 ? 33.061  -20.856 3.370   1.00 29.75 ? 269 TRP B CH2   1 
ATOM   7153 N  N     . LYS F 3 270 ? 39.953  -19.197 -1.077  1.00 35.67 ? 270 LYS B N     1 
ATOM   7154 C  CA    . LYS F 3 270 ? 40.393  -18.753 -2.393  1.00 35.57 ? 270 LYS B CA    1 
ATOM   7155 C  C     . LYS F 3 270 ? 40.633  -20.003 -3.223  1.00 35.36 ? 270 LYS B C     1 
ATOM   7156 O  O     . LYS F 3 270 ? 40.618  -19.971 -4.453  1.00 35.53 ? 270 LYS B O     1 
ATOM   7157 C  CB    . LYS F 3 270 ? 41.688  -17.955 -2.293  1.00 37.59 ? 270 LYS B CB    1 
ATOM   7158 C  CG    . LYS F 3 270 ? 41.511  -16.528 -1.827  1.00 39.09 ? 270 LYS B CG    1 
ATOM   7159 C  CD    . LYS F 3 270 ? 42.806  -15.757 -2.010  1.00 40.72 ? 270 LYS B CD    1 
ATOM   7160 C  CE    . LYS F 3 270 ? 42.539  -14.270 -2.128  1.00 40.76 ? 270 LYS B CE    1 
ATOM   7161 N  NZ    . LYS F 3 270 ? 43.786  -13.537 -2.470  1.00 43.05 ? 270 LYS B NZ    1 
ATOM   7162 N  N     . SER F 3 271 ? 40.871  -21.103 -2.522  1.00 35.12 ? 271 SER B N     1 
ATOM   7163 C  CA    . SER F 3 271 ? 41.101  -22.394 -3.142  1.00 34.98 ? 271 SER B CA    1 
ATOM   7164 C  C     . SER F 3 271 ? 39.742  -23.083 -3.285  1.00 34.45 ? 271 SER B C     1 
ATOM   7165 O  O     . SER F 3 271 ? 39.505  -23.861 -4.213  1.00 33.19 ? 271 SER B O     1 
ATOM   7166 C  CB    . SER F 3 271 ? 42.050  -23.214 -2.259  1.00 35.22 ? 271 SER B CB    1 
ATOM   7167 O  OG    . SER F 3 271 ? 41.769  -24.605 -2.336  1.00 37.42 ? 271 SER B OG    1 
ATOM   7168 N  N     . LEU F 3 272 ? 38.844  -22.763 -2.364  1.00 33.59 ? 272 LEU B N     1 
ATOM   7169 C  CA    . LEU F 3 272 ? 37.518  -23.335 -2.369  1.00 34.36 ? 272 LEU B CA    1 
ATOM   7170 C  C     . LEU F 3 272 ? 36.626  -22.657 -3.411  1.00 36.02 ? 272 LEU B C     1 
ATOM   7171 O  O     . LEU F 3 272 ? 35.753  -23.293 -4.007  1.00 37.06 ? 272 LEU B O     1 
ATOM   7172 C  CB    . LEU F 3 272 ? 36.915  -23.206 -0.971  1.00 33.42 ? 272 LEU B CB    1 
ATOM   7173 C  CG    . LEU F 3 272 ? 36.453  -24.487 -0.257  1.00 33.38 ? 272 LEU B CG    1 
ATOM   7174 C  CD1   . LEU F 3 272 ? 37.325  -25.676 -0.644  1.00 33.57 ? 272 LEU B CD1   1 
ATOM   7175 C  CD2   . LEU F 3 272 ? 36.502  -24.261 1.250   1.00 32.38 ? 272 LEU B CD2   1 
ATOM   7176 N  N     . LEU F 3 273 ? 36.860  -21.369 -3.642  1.00 37.47 ? 273 LEU B N     1 
ATOM   7177 C  CA    . LEU F 3 273 ? 36.080  -20.591 -4.603  1.00 37.96 ? 273 LEU B CA    1 
ATOM   7178 C  C     . LEU F 3 273 ? 36.333  -20.999 -6.051  1.00 38.38 ? 273 LEU B C     1 
ATOM   7179 O  O     . LEU F 3 273 ? 35.418  -21.003 -6.878  1.00 38.63 ? 273 LEU B O     1 
ATOM   7180 C  CB    . LEU F 3 273 ? 36.402  -19.102 -4.448  1.00 38.20 ? 273 LEU B CB    1 
ATOM   7181 C  CG    . LEU F 3 273 ? 35.678  -18.163 -5.421  1.00 39.21 ? 273 LEU B CG    1 
ATOM   7182 C  CD1   . LEU F 3 273 ? 34.181  -18.116 -5.103  1.00 38.83 ? 273 LEU B CD1   1 
ATOM   7183 C  CD2   . LEU F 3 273 ? 36.284  -16.778 -5.321  1.00 39.12 ? 273 LEU B CD2   1 
ATOM   7184 N  N     . GLN F 3 274 ? 37.587  -21.319 -6.346  1.00 38.28 ? 274 GLN B N     1 
ATOM   7185 C  CA    . GLN F 3 274 ? 38.005  -21.723 -7.676  1.00 38.85 ? 274 GLN B CA    1 
ATOM   7186 C  C     . GLN F 3 274 ? 36.893  -22.332 -8.523  1.00 39.91 ? 274 GLN B C     1 
ATOM   7187 O  O     . GLN F 3 274 ? 36.512  -21.784 -9.566  1.00 40.67 ? 274 GLN B O     1 
ATOM   7188 C  CB    . GLN F 3 274 ? 39.146  -22.728 -7.568  1.00 38.85 ? 274 GLN B CB    1 
ATOM   7189 C  CG    . GLN F 3 274 ? 40.051  -22.722 -8.761  1.00 39.56 ? 274 GLN B CG    1 
ATOM   7190 C  CD    . GLN F 3 274 ? 41.430  -22.236 -8.404  1.00 38.86 ? 274 GLN B CD    1 
ATOM   7191 O  OE1   . GLN F 3 274 ? 41.953  -21.309 -9.016  1.00 38.69 ? 274 GLN B OE1   1 
ATOM   7192 N  NE2   . GLN F 3 274 ? 42.031  -22.866 -7.409  1.00 38.92 ? 274 GLN B NE2   1 
ATOM   7193 N  N     . ASP F 3 275 ? 36.368  -23.464 -8.064  1.00 39.99 ? 275 ASP B N     1 
ATOM   7194 C  CA    . ASP F 3 275 ? 35.313  -24.171 -8.779  1.00 39.21 ? 275 ASP B CA    1 
ATOM   7195 C  C     . ASP F 3 275 ? 34.154  -24.494 -7.857  1.00 37.28 ? 275 ASP B C     1 
ATOM   7196 O  O     . ASP F 3 275 ? 33.490  -25.518 -8.001  1.00 38.51 ? 275 ASP B O     1 
ATOM   7197 C  CB    . ASP F 3 275 ? 35.876  -25.451 -9.362  1.00 42.35 ? 275 ASP B CB    1 
ATOM   7198 C  CG    . ASP F 3 275 ? 36.506  -25.229 -10.702 1.00 46.40 ? 275 ASP B CG    1 
ATOM   7199 O  OD1   . ASP F 3 275 ? 37.149  -24.178 -10.918 1.00 47.61 ? 275 ASP B OD1   1 
ATOM   7200 O  OD2   . ASP F 3 275 ? 36.375  -26.117 -11.553 1.00 50.01 ? 275 ASP B OD2   1 
ATOM   7201 N  N     . MET F 3 276 ? 33.907  -23.604 -6.909  1.00 33.51 ? 276 MET B N     1 
ATOM   7202 C  CA    . MET F 3 276 ? 32.844  -23.806 -5.945  1.00 30.46 ? 276 MET B CA    1 
ATOM   7203 C  C     . MET F 3 276 ? 31.504  -24.033 -6.628  1.00 28.76 ? 276 MET B C     1 
ATOM   7204 O  O     . MET F 3 276 ? 31.204  -23.417 -7.646  1.00 28.32 ? 276 MET B O     1 
ATOM   7205 C  CB    . MET F 3 276 ? 32.756  -22.594 -5.025  1.00 27.50 ? 276 MET B CB    1 
ATOM   7206 C  CG    . MET F 3 276 ? 31.869  -22.807 -3.827  1.00 28.13 ? 276 MET B CG    1 
ATOM   7207 S  SD    . MET F 3 276 ? 32.085  -21.500 -2.616  1.00 26.32 ? 276 MET B SD    1 
ATOM   7208 C  CE    . MET F 3 276 ? 33.791  -21.723 -2.303  1.00 26.61 ? 276 MET B CE    1 
ATOM   7209 N  N     . PRO F 3 277 ? 30.702  -24.970 -6.107  1.00 28.00 ? 277 PRO B N     1 
ATOM   7210 C  CA    . PRO F 3 277 ? 29.398  -25.197 -6.736  1.00 27.50 ? 277 PRO B CA    1 
ATOM   7211 C  C     . PRO F 3 277 ? 28.570  -23.920 -6.549  1.00 28.26 ? 277 PRO B C     1 
ATOM   7212 O  O     . PRO F 3 277 ? 28.798  -23.165 -5.596  1.00 27.97 ? 277 PRO B O     1 
ATOM   7213 C  CB    . PRO F 3 277 ? 28.855  -26.391 -5.959  1.00 27.29 ? 277 PRO B CB    1 
ATOM   7214 C  CG    . PRO F 3 277 ? 30.115  -27.168 -5.643  1.00 26.33 ? 277 PRO B CG    1 
ATOM   7215 C  CD    . PRO F 3 277 ? 31.055  -26.078 -5.195  1.00 25.98 ? 277 PRO B CD    1 
ATOM   7216 N  N     . LEU F 3 278 ? 27.614  -23.680 -7.446  1.00 28.09 ? 278 LEU B N     1 
ATOM   7217 C  CA    . LEU F 3 278 ? 26.800  -22.468 -7.392  1.00 27.43 ? 278 LEU B CA    1 
ATOM   7218 C  C     . LEU F 3 278 ? 25.963  -22.172 -6.142  1.00 26.70 ? 278 LEU B C     1 
ATOM   7219 O  O     . LEU F 3 278 ? 25.896  -21.015 -5.701  1.00 26.17 ? 278 LEU B O     1 
ATOM   7220 C  CB    . LEU F 3 278 ? 25.920  -22.390 -8.637  1.00 29.36 ? 278 LEU B CB    1 
ATOM   7221 C  CG    . LEU F 3 278 ? 26.710  -21.965 -9.878  1.00 29.89 ? 278 LEU B CG    1 
ATOM   7222 C  CD1   . LEU F 3 278 ? 25.754  -21.684 -11.042 1.00 29.56 ? 278 LEU B CD1   1 
ATOM   7223 C  CD2   . LEU F 3 278 ? 27.510  -20.705 -9.547  1.00 30.76 ? 278 LEU B CD2   1 
ATOM   7224 N  N     . THR F 3 279 ? 25.313  -23.179 -5.570  1.00 24.77 ? 279 THR B N     1 
ATOM   7225 C  CA    . THR F 3 279 ? 24.528  -22.917 -4.373  1.00 22.96 ? 279 THR B CA    1 
ATOM   7226 C  C     . THR F 3 279 ? 25.497  -22.601 -3.249  1.00 22.45 ? 279 THR B C     1 
ATOM   7227 O  O     . THR F 3 279 ? 25.286  -21.668 -2.475  1.00 20.92 ? 279 THR B O     1 
ATOM   7228 C  CB    . THR F 3 279 ? 23.642  -24.116 -3.992  1.00 22.12 ? 279 THR B CB    1 
ATOM   7229 O  OG1   . THR F 3 279 ? 22.585  -24.234 -4.946  1.00 20.08 ? 279 THR B OG1   1 
ATOM   7230 C  CG2   . THR F 3 279 ? 23.032  -23.925 -2.611  1.00 19.43 ? 279 THR B CG2   1 
ATOM   7231 N  N     . ALA F 3 280 ? 26.571  -23.373 -3.177  1.00 23.23 ? 280 ALA B N     1 
ATOM   7232 C  CA    . ALA F 3 280 ? 27.580  -23.138 -2.156  1.00 24.25 ? 280 ALA B CA    1 
ATOM   7233 C  C     . ALA F 3 280 ? 28.058  -21.692 -2.293  1.00 24.93 ? 280 ALA B C     1 
ATOM   7234 O  O     . ALA F 3 280 ? 28.090  -20.946 -1.319  1.00 23.83 ? 280 ALA B O     1 
ATOM   7235 C  CB    . ALA F 3 280 ? 28.748  -24.100 -2.337  1.00 25.39 ? 280 ALA B CB    1 
ATOM   7236 N  N     . LEU F 3 281 ? 28.412  -21.304 -3.515  1.00 26.03 ? 281 LEU B N     1 
ATOM   7237 C  CA    . LEU F 3 281 ? 28.885  -19.951 -3.783  1.00 27.01 ? 281 LEU B CA    1 
ATOM   7238 C  C     . LEU F 3 281 ? 27.852  -18.914 -3.399  1.00 27.21 ? 281 LEU B C     1 
ATOM   7239 O  O     . LEU F 3 281 ? 28.179  -17.886 -2.812  1.00 27.41 ? 281 LEU B O     1 
ATOM   7240 C  CB    . LEU F 3 281 ? 29.228  -19.784 -5.266  1.00 27.32 ? 281 LEU B CB    1 
ATOM   7241 C  CG    . LEU F 3 281 ? 29.406  -18.355 -5.791  1.00 25.53 ? 281 LEU B CG    1 
ATOM   7242 C  CD1   . LEU F 3 281 ? 30.422  -17.614 -4.957  1.00 26.23 ? 281 LEU B CD1   1 
ATOM   7243 C  CD2   . LEU F 3 281 ? 29.845  -18.410 -7.244  1.00 25.29 ? 281 LEU B CD2   1 
ATOM   7244 N  N     . LEU F 3 282 ? 26.601  -19.194 -3.734  1.00 27.21 ? 282 LEU B N     1 
ATOM   7245 C  CA    . LEU F 3 282 ? 25.511  -18.277 -3.437  1.00 27.84 ? 282 LEU B CA    1 
ATOM   7246 C  C     . LEU F 3 282 ? 25.284  -18.083 -1.935  1.00 29.40 ? 282 LEU B C     1 
ATOM   7247 O  O     . LEU F 3 282 ? 25.110  -16.958 -1.466  1.00 29.60 ? 282 LEU B O     1 
ATOM   7248 C  CB    . LEU F 3 282 ? 24.226  -18.780 -4.089  1.00 25.30 ? 282 LEU B CB    1 
ATOM   7249 C  CG    . LEU F 3 282 ? 23.083  -17.774 -4.133  1.00 24.44 ? 282 LEU B CG    1 
ATOM   7250 C  CD1   . LEU F 3 282 ? 23.475  -16.580 -4.994  1.00 22.17 ? 282 LEU B CD1   1 
ATOM   7251 C  CD2   . LEU F 3 282 ? 21.846  -18.455 -4.697  1.00 26.07 ? 282 LEU B CD2   1 
ATOM   7252 N  N     . ARG F 3 283 ? 25.287  -19.178 -1.183  1.00 30.65 ? 283 ARG B N     1 
ATOM   7253 C  CA    . ARG F 3 283 ? 25.064  -19.113 0.257   1.00 32.78 ? 283 ARG B CA    1 
ATOM   7254 C  C     . ARG F 3 283 ? 26.246  -18.581 1.058   1.00 33.59 ? 283 ARG B C     1 
ATOM   7255 O  O     . ARG F 3 283 ? 26.115  -18.309 2.255   1.00 34.77 ? 283 ARG B O     1 
ATOM   7256 C  CB    . ARG F 3 283 ? 24.690  -20.499 0.809   1.00 33.47 ? 283 ARG B CB    1 
ATOM   7257 C  CG    . ARG F 3 283 ? 23.294  -20.970 0.443   1.00 34.47 ? 283 ARG B CG    1 
ATOM   7258 C  CD    . ARG F 3 283 ? 22.923  -22.245 1.185   1.00 36.34 ? 283 ARG B CD    1 
ATOM   7259 N  NE    . ARG F 3 283 ? 23.006  -22.068 2.634   1.00 39.97 ? 283 ARG B NE    1 
ATOM   7260 C  CZ    . ARG F 3 283 ? 22.597  -22.962 3.531   1.00 39.57 ? 283 ARG B CZ    1 
ATOM   7261 N  NH1   . ARG F 3 283 ? 22.065  -24.111 3.138   1.00 39.27 ? 283 ARG B NH1   1 
ATOM   7262 N  NH2   . ARG F 3 283 ? 22.725  -22.706 4.826   1.00 39.44 ? 283 ARG B NH2   1 
ATOM   7263 N  N     . ASN F 3 284 ? 27.396  -18.431 0.417   1.00 33.43 ? 284 ASN B N     1 
ATOM   7264 C  CA    . ASN F 3 284 ? 28.566  -17.968 1.143   1.00 33.56 ? 284 ASN B CA    1 
ATOM   7265 C  C     . ASN F 3 284 ? 29.147  -16.680 0.590   1.00 33.35 ? 284 ASN B C     1 
ATOM   7266 O  O     . ASN F 3 284 ? 30.341  -16.404 0.753   1.00 33.18 ? 284 ASN B O     1 
ATOM   7267 C  CB    . ASN F 3 284 ? 29.636  -19.074 1.165   1.00 34.59 ? 284 ASN B CB    1 
ATOM   7268 C  CG    . ASN F 3 284 ? 29.214  -20.289 1.999   1.00 35.37 ? 284 ASN B CG    1 
ATOM   7269 O  OD1   . ASN F 3 284 ? 29.166  -20.229 3.231   1.00 36.44 ? 284 ASN B OD1   1 
ATOM   7270 N  ND2   . ASN F 3 284 ? 28.903  -21.393 1.325   1.00 35.13 ? 284 ASN B ND2   1 
ATOM   7271 N  N     . LEU F 3 285 ? 28.304  -15.889 -0.066  1.00 32.82 ? 285 LEU B N     1 
ATOM   7272 C  CA    . LEU F 3 285 ? 28.761  -14.620 -0.614  1.00 33.16 ? 285 LEU B CA    1 
ATOM   7273 C  C     . LEU F 3 285 ? 29.123  -13.702 0.552   1.00 34.07 ? 285 LEU B C     1 
ATOM   7274 O  O     . LEU F 3 285 ? 30.196  -13.096 0.577   1.00 34.11 ? 285 LEU B O     1 
ATOM   7275 C  CB    . LEU F 3 285 ? 27.668  -13.976 -1.474  1.00 31.47 ? 285 LEU B CB    1 
ATOM   7276 C  CG    . LEU F 3 285 ? 27.454  -14.545 -2.885  1.00 32.18 ? 285 LEU B CG    1 
ATOM   7277 C  CD1   . LEU F 3 285 ? 26.277  -13.848 -3.544  1.00 30.73 ? 285 LEU B CD1   1 
ATOM   7278 C  CD2   . LEU F 3 285 ? 28.718  -14.364 -3.729  1.00 32.43 ? 285 LEU B CD2   1 
ATOM   7279 N  N     . GLY F 3 286 ? 28.222  -13.631 1.528   1.00 34.72 ? 286 GLY B N     1 
ATOM   7280 C  CA    . GLY F 3 286 ? 28.431  -12.793 2.698   1.00 34.76 ? 286 GLY B CA    1 
ATOM   7281 C  C     . GLY F 3 286 ? 29.699  -13.099 3.470   1.00 34.99 ? 286 GLY B C     1 
ATOM   7282 O  O     . GLY F 3 286 ? 30.434  -12.188 3.831   1.00 35.55 ? 286 GLY B O     1 
ATOM   7283 N  N     . LYS F 3 287 ? 29.955  -14.375 3.735   1.00 34.38 ? 287 LYS B N     1 
ATOM   7284 C  CA    . LYS F 3 287 ? 31.144  -14.775 4.469   1.00 34.00 ? 287 LYS B CA    1 
ATOM   7285 C  C     . LYS F 3 287 ? 32.429  -14.491 3.706   1.00 34.56 ? 287 LYS B C     1 
ATOM   7286 O  O     . LYS F 3 287 ? 33.403  -14.034 4.290   1.00 35.64 ? 287 LYS B O     1 
ATOM   7287 C  CB    . LYS F 3 287 ? 31.076  -16.265 4.820   1.00 34.65 ? 287 LYS B CB    1 
ATOM   7288 C  CG    . LYS F 3 287 ? 32.435  -16.909 5.092   1.00 34.61 ? 287 LYS B CG    1 
ATOM   7289 C  CD    . LYS F 3 287 ? 32.485  -17.593 6.438   1.00 34.59 ? 287 LYS B CD    1 
ATOM   7290 C  CE    . LYS F 3 287 ? 33.854  -18.205 6.654   1.00 34.51 ? 287 LYS B CE    1 
ATOM   7291 N  NZ    . LYS F 3 287 ? 34.347  -17.939 8.028   1.00 36.16 ? 287 LYS B NZ    1 
ATOM   7292 N  N     . MET F 3 288 ? 32.444  -14.757 2.407   1.00 34.76 ? 288 MET B N     1 
ATOM   7293 C  CA    . MET F 3 288 ? 33.652  -14.524 1.628   1.00 35.86 ? 288 MET B CA    1 
ATOM   7294 C  C     . MET F 3 288 ? 34.020  -13.053 1.481   1.00 36.06 ? 288 MET B C     1 
ATOM   7295 O  O     . MET F 3 288 ? 35.194  -12.703 1.334   1.00 35.44 ? 288 MET B O     1 
ATOM   7296 C  CB    . MET F 3 288 ? 33.524  -15.167 0.250   1.00 36.32 ? 288 MET B CB    1 
ATOM   7297 C  CG    . MET F 3 288 ? 33.738  -16.661 0.265   1.00 37.18 ? 288 MET B CG    1 
ATOM   7298 S  SD    . MET F 3 288 ? 33.685  -17.316 -1.391  1.00 39.04 ? 288 MET B SD    1 
ATOM   7299 C  CE    . MET F 3 288 ? 33.022  -18.872 -1.088  1.00 39.66 ? 288 MET B CE    1 
ATOM   7300 N  N     . THR F 3 289 ? 33.017  -12.189 1.515   1.00 36.90 ? 289 THR B N     1 
ATOM   7301 C  CA    . THR F 3 289 ? 33.272  -10.766 1.386   1.00 37.38 ? 289 THR B CA    1 
ATOM   7302 C  C     . THR F 3 289 ? 33.901  -10.321 2.696   1.00 38.69 ? 289 THR B C     1 
ATOM   7303 O  O     . THR F 3 289 ? 34.894  -9.590  2.707   1.00 39.88 ? 289 THR B O     1 
ATOM   7304 C  CB    . THR F 3 289 ? 31.958  -9.977  1.138   1.00 36.62 ? 289 THR B CB    1 
ATOM   7305 O  OG1   . THR F 3 289 ? 31.300  -10.483 -0.033  1.00 34.78 ? 289 THR B OG1   1 
ATOM   7306 C  CG2   . THR F 3 289 ? 32.252  -8.502  0.935   1.00 36.20 ? 289 THR B CG2   1 
ATOM   7307 N  N     . ALA F 3 290 ? 33.324  -10.793 3.797   1.00 38.77 ? 290 ALA B N     1 
ATOM   7308 C  CA    . ALA F 3 290 ? 33.789  -10.454 5.134   1.00 39.60 ? 290 ALA B CA    1 
ATOM   7309 C  C     . ALA F 3 290 ? 35.226  -10.885 5.372   1.00 41.38 ? 290 ALA B C     1 
ATOM   7310 O  O     . ALA F 3 290 ? 35.993  -10.172 6.023   1.00 42.80 ? 290 ALA B O     1 
ATOM   7311 C  CB    . ALA F 3 290 ? 32.878  -11.095 6.178   1.00 38.59 ? 290 ALA B CB    1 
ATOM   7312 N  N     . ASP F 3 291 ? 35.592  -12.051 4.844   1.00 42.21 ? 291 ASP B N     1 
ATOM   7313 C  CA    . ASP F 3 291 ? 36.943  -12.584 5.016   1.00 41.90 ? 291 ASP B CA    1 
ATOM   7314 C  C     . ASP F 3 291 ? 37.924  -12.053 3.964   1.00 41.47 ? 291 ASP B C     1 
ATOM   7315 O  O     . ASP F 3 291 ? 39.023  -12.584 3.790   1.00 42.35 ? 291 ASP B O     1 
ATOM   7316 C  CB    . ASP F 3 291 ? 36.905  -14.110 4.979   1.00 43.82 ? 291 ASP B CB    1 
ATOM   7317 C  CG    . ASP F 3 291 ? 36.245  -14.697 6.195   1.00 46.44 ? 291 ASP B CG    1 
ATOM   7318 O  OD1   . ASP F 3 291 ? 36.960  -15.198 7.090   1.00 48.71 ? 291 ASP B OD1   1 
ATOM   7319 O  OD2   . ASP F 3 291 ? 34.994  -14.668 6.273   1.00 49.81 ? 291 ASP B OD2   1 
ATOM   7320 N  N     . SER F 3 292 ? 37.519  -11.005 3.260   1.00 39.77 ? 292 SER B N     1 
ATOM   7321 C  CA    . SER F 3 292 ? 38.362  -10.398 2.249   1.00 38.89 ? 292 SER B CA    1 
ATOM   7322 C  C     . SER F 3 292 ? 38.733  -11.321 1.105   1.00 39.33 ? 292 SER B C     1 
ATOM   7323 O  O     . SER F 3 292 ? 39.614  -10.994 0.309   1.00 39.21 ? 292 SER B O     1 
ATOM   7324 C  CB    . SER F 3 292 ? 39.636  -9.858  2.882   1.00 37.62 ? 292 SER B CB    1 
ATOM   7325 O  OG    . SER F 3 292 ? 39.526  -8.457  3.079   1.00 38.53 ? 292 SER B OG    1 
ATOM   7326 N  N     . VAL F 3 293 ? 38.079  -12.473 1.012   1.00 40.03 ? 293 VAL B N     1 
ATOM   7327 C  CA    . VAL F 3 293 ? 38.377  -13.386 -0.085  1.00 40.58 ? 293 VAL B CA    1 
ATOM   7328 C  C     . VAL F 3 293 ? 37.727  -12.818 -1.339  1.00 40.83 ? 293 VAL B C     1 
ATOM   7329 O  O     . VAL F 3 293 ? 38.143  -13.107 -2.460  1.00 41.85 ? 293 VAL B O     1 
ATOM   7330 C  CB    . VAL F 3 293 ? 37.859  -14.817 0.200   1.00 40.40 ? 293 VAL B CB    1 
ATOM   7331 C  CG1   . VAL F 3 293 ? 37.206  -14.872 1.568   1.00 40.42 ? 293 VAL B CG1   1 
ATOM   7332 C  CG2   . VAL F 3 293 ? 36.907  -15.267 -0.897  1.00 39.66 ? 293 VAL B CG2   1 
ATOM   7333 N  N     . LEU F 3 294 ? 36.694  -12.010 -1.130  1.00 40.98 ? 294 LEU B N     1 
ATOM   7334 C  CA    . LEU F 3 294 ? 35.995  -11.343 -2.221  1.00 40.78 ? 294 LEU B CA    1 
ATOM   7335 C  C     . LEU F 3 294 ? 36.200  -9.846  -2.042  1.00 40.28 ? 294 LEU B C     1 
ATOM   7336 O  O     . LEU F 3 294 ? 35.239  -9.085  -1.898  1.00 39.95 ? 294 LEU B O     1 
ATOM   7337 C  CB    . LEU F 3 294 ? 34.501  -11.677 -2.201  1.00 40.22 ? 294 LEU B CB    1 
ATOM   7338 C  CG    . LEU F 3 294 ? 34.151  -12.976 -2.938  1.00 40.85 ? 294 LEU B CG    1 
ATOM   7339 C  CD1   . LEU F 3 294 ? 32.649  -13.232 -2.884  1.00 41.25 ? 294 LEU B CD1   1 
ATOM   7340 C  CD2   . LEU F 3 294 ? 34.615  -12.873 -4.386  1.00 41.36 ? 294 LEU B CD2   1 
ATOM   7341 N  N     . ALA F 3 295 ? 37.467  -9.436  -2.040  1.00 39.28 ? 295 ALA B N     1 
ATOM   7342 C  CA    . ALA F 3 295 ? 37.821  -8.036  -1.860  1.00 38.13 ? 295 ALA B CA    1 
ATOM   7343 C  C     . ALA F 3 295 ? 37.427  -7.195  -3.060  1.00 38.03 ? 295 ALA B C     1 
ATOM   7344 O  O     . ALA F 3 295 ? 37.486  -7.647  -4.202  1.00 37.69 ? 295 ALA B O     1 
ATOM   7345 C  CB    . ALA F 3 295 ? 39.307  -7.909  -1.604  1.00 38.31 ? 295 ALA B CB    1 
ATOM   7346 N  N     . PRO F 3 296 ? 37.017  -5.945  -2.814  1.00 37.68 ? 296 PRO B N     1 
ATOM   7347 C  CA    . PRO F 3 296 ? 36.613  -5.037  -3.889  1.00 37.34 ? 296 PRO B CA    1 
ATOM   7348 C  C     . PRO F 3 296 ? 37.638  -4.914  -5.006  1.00 37.42 ? 296 PRO B C     1 
ATOM   7349 O  O     . PRO F 3 296 ? 38.835  -4.847  -4.754  1.00 37.16 ? 296 PRO B O     1 
ATOM   7350 C  CB    . PRO F 3 296 ? 36.378  -3.718  -3.159  1.00 37.66 ? 296 PRO B CB    1 
ATOM   7351 C  CG    . PRO F 3 296 ? 37.206  -3.845  -1.912  1.00 36.63 ? 296 PRO B CG    1 
ATOM   7352 C  CD    . PRO F 3 296 ? 36.983  -5.263  -1.511  1.00 37.12 ? 296 PRO B CD    1 
ATOM   7353 N  N     . ALA F 3 297 ? 37.144  -4.902  -6.242  1.00 38.43 ? 297 ALA B N     1 
ATOM   7354 C  CA    . ALA F 3 297 ? 37.974  -4.782  -7.437  1.00 38.37 ? 297 ALA B CA    1 
ATOM   7355 C  C     . ALA F 3 297 ? 38.636  -6.083  -7.841  1.00 38.78 ? 297 ALA B C     1 
ATOM   7356 O  O     . ALA F 3 297 ? 39.004  -6.254  -9.002  1.00 39.51 ? 297 ALA B O     1 
ATOM   7357 C  CB    . ALA F 3 297 ? 39.041  -3.709  -7.230  1.00 39.02 ? 297 ALA B CB    1 
ATOM   7358 N  N     . SER F 3 298 ? 38.776  -6.997  -6.884  1.00 39.57 ? 298 SER B N     1 
ATOM   7359 C  CA    . SER F 3 298 ? 39.434  -8.288  -7.114  1.00 39.70 ? 298 SER B CA    1 
ATOM   7360 C  C     . SER F 3 298 ? 39.013  -9.112  -8.325  1.00 39.77 ? 298 SER B C     1 
ATOM   7361 O  O     . SER F 3 298 ? 37.928  -8.944  -8.890  1.00 38.61 ? 298 SER B O     1 
ATOM   7362 C  CB    . SER F 3 298 ? 39.306  -9.177  -5.880  1.00 40.23 ? 298 SER B CB    1 
ATOM   7363 O  OG    . SER F 3 298 ? 37.965  -9.591  -5.677  1.00 40.68 ? 298 SER B OG    1 
ATOM   7364 N  N     . SER F 3 299 ? 39.910  -10.016 -8.700  1.00 40.68 ? 299 SER B N     1 
ATOM   7365 C  CA    . SER F 3 299 ? 39.696  -10.911 -9.816  1.00 41.74 ? 299 SER B CA    1 
ATOM   7366 C  C     . SER F 3 299 ? 38.595  -11.872 -9.369  1.00 42.39 ? 299 SER B C     1 
ATOM   7367 O  O     . SER F 3 299 ? 37.613  -12.091 -10.098 1.00 43.15 ? 299 SER B O     1 
ATOM   7368 C  CB    . SER F 3 299 ? 40.983  -11.682 -10.118 1.00 41.78 ? 299 SER B CB    1 
ATOM   7369 O  OG    . SER F 3 299 ? 41.053  -12.023 -11.502 1.00 42.93 ? 299 SER B OG    1 
ATOM   7370 N  N     . GLU F 3 300 ? 38.740  -12.410 -8.150  1.00 42.40 ? 300 GLU B N     1 
ATOM   7371 C  CA    . GLU F 3 300 ? 37.753  -13.348 -7.643  1.00 41.86 ? 300 GLU B CA    1 
ATOM   7372 C  C     . GLU F 3 300 ? 36.324  -12.824 -7.682  1.00 41.16 ? 300 GLU B C     1 
ATOM   7373 O  O     . GLU F 3 300 ? 35.399  -13.550 -8.054  1.00 39.95 ? 300 GLU B O     1 
ATOM   7374 C  CB    . GLU F 3 300 ? 38.060  -13.913 -6.230  1.00 42.92 ? 300 GLU B CB    1 
ATOM   7375 C  CG    . GLU F 3 300 ? 39.060  -13.357 -5.216  1.00 46.58 ? 300 GLU B CG    1 
ATOM   7376 C  CD    . GLU F 3 300 ? 40.515  -13.179 -5.604  1.00 47.85 ? 300 GLU B CD    1 
ATOM   7377 O  OE1   . GLU F 3 300 ? 40.815  -12.951 -6.797  1.00 48.49 ? 300 GLU B OE1   1 
ATOM   7378 O  OE2   . GLU F 3 300 ? 41.353  -13.213 -4.678  1.00 50.01 ? 300 GLU B OE2   1 
ATOM   7379 N  N     . VAL F 3 301 ? 36.132  -11.568 -7.304  1.00 40.79 ? 301 VAL B N     1 
ATOM   7380 C  CA    . VAL F 3 301 ? 34.795  -11.004 -7.337  1.00 40.05 ? 301 VAL B CA    1 
ATOM   7381 C  C     . VAL F 3 301 ? 34.318  -10.986 -8.784  1.00 39.84 ? 301 VAL B C     1 
ATOM   7382 O  O     . VAL F 3 301 ? 33.187  -11.361 -9.085  1.00 40.66 ? 301 VAL B O     1 
ATOM   7383 C  CB    . VAL F 3 301 ? 34.767  -9.572  -6.764  1.00 39.81 ? 301 VAL B CB    1 
ATOM   7384 C  CG1   . VAL F 3 301 ? 33.459  -8.881  -7.140  1.00 39.82 ? 301 VAL B CG1   1 
ATOM   7385 C  CG2   . VAL F 3 301 ? 34.905  -9.620  -5.247  1.00 38.02 ? 301 VAL B CG2   1 
ATOM   7386 N  N     . SER F 3 302 ? 35.192  -10.558 -9.685  1.00 39.56 ? 302 SER B N     1 
ATOM   7387 C  CA    . SER F 3 302 ? 34.845  -10.505 -11.098 1.00 39.41 ? 302 SER B CA    1 
ATOM   7388 C  C     . SER F 3 302 ? 34.387  -11.888 -11.557 1.00 39.64 ? 302 SER B C     1 
ATOM   7389 O  O     . SER F 3 302 ? 33.420  -12.030 -12.309 1.00 39.27 ? 302 SER B O     1 
ATOM   7390 C  CB    . SER F 3 302 ? 36.060  -10.065 -11.911 1.00 39.06 ? 302 SER B CB    1 
ATOM   7391 O  OG    . SER F 3 302 ? 35.729  -9.968  -13.280 1.00 39.84 ? 302 SER B OG    1 
ATOM   7392 N  N     . SER F 3 303 ? 35.099  -12.905 -11.085 1.00 39.08 ? 303 SER B N     1 
ATOM   7393 C  CA    . SER F 3 303 ? 34.810  -14.287 -11.423 1.00 37.87 ? 303 SER B CA    1 
ATOM   7394 C  C     . SER F 3 303 ? 33.410  -14.639 -10.935 1.00 36.62 ? 303 SER B C     1 
ATOM   7395 O  O     . SER F 3 303 ? 32.591  -15.129 -11.706 1.00 36.35 ? 303 SER B O     1 
ATOM   7396 C  CB    . SER F 3 303 ? 35.862  -15.198 -10.771 1.00 39.54 ? 303 SER B CB    1 
ATOM   7397 O  OG    . SER F 3 303 ? 35.848  -16.516 -11.298 1.00 41.27 ? 303 SER B OG    1 
ATOM   7398 N  N     . VAL F 3 304 ? 33.143  -14.378 -9.655  1.00 35.71 ? 304 VAL B N     1 
ATOM   7399 C  CA    . VAL F 3 304 ? 31.834  -14.659 -9.049  1.00 34.97 ? 304 VAL B CA    1 
ATOM   7400 C  C     . VAL F 3 304 ? 30.674  -14.124 -9.882  1.00 34.79 ? 304 VAL B C     1 
ATOM   7401 O  O     . VAL F 3 304 ? 29.777  -14.879 -10.264 1.00 35.34 ? 304 VAL B O     1 
ATOM   7402 C  CB    . VAL F 3 304 ? 31.710  -14.056 -7.625  1.00 33.41 ? 304 VAL B CB    1 
ATOM   7403 C  CG1   . VAL F 3 304 ? 30.254  -14.025 -7.199  1.00 32.33 ? 304 VAL B CG1   1 
ATOM   7404 C  CG2   . VAL F 3 304 ? 32.512  -14.884 -6.642  1.00 32.39 ? 304 VAL B CG2   1 
ATOM   7405 N  N     . CYS F 3 305 ? 30.694  -12.823 -10.154 1.00 34.02 ? 305 CYS B N     1 
ATOM   7406 C  CA    . CYS F 3 305 ? 29.648  -12.190 -10.948 1.00 33.82 ? 305 CYS B CA    1 
ATOM   7407 C  C     . CYS F 3 305 ? 29.435  -12.874 -12.293 1.00 33.43 ? 305 CYS B C     1 
ATOM   7408 O  O     . CYS F 3 305 ? 28.304  -13.042 -12.743 1.00 31.80 ? 305 CYS B O     1 
ATOM   7409 C  CB    . CYS F 3 305 ? 29.991  -10.727 -11.192 1.00 33.49 ? 305 CYS B CB    1 
ATOM   7410 S  SG    . CYS F 3 305 ? 30.118  -9.788  -9.693  1.00 38.41 ? 305 CYS B SG    1 
ATOM   7411 N  N     . GLU F 3 306 ? 30.528  -13.266 -12.936 1.00 33.71 ? 306 GLU B N     1 
ATOM   7412 C  CA    . GLU F 3 306 ? 30.432  -13.903 -14.234 1.00 34.71 ? 306 GLU B CA    1 
ATOM   7413 C  C     . GLU F 3 306 ? 29.773  -15.282 -14.129 1.00 34.27 ? 306 GLU B C     1 
ATOM   7414 O  O     . GLU F 3 306 ? 29.129  -15.740 -15.070 1.00 34.63 ? 306 GLU B O     1 
ATOM   7415 C  CB    . GLU F 3 306 ? 31.830  -13.997 -14.864 1.00 36.89 ? 306 GLU B CB    1 
ATOM   7416 C  CG    . GLU F 3 306 ? 31.852  -13.902 -16.401 1.00 40.89 ? 306 GLU B CG    1 
ATOM   7417 C  CD    . GLU F 3 306 ? 32.814  -12.824 -16.940 1.00 43.85 ? 306 GLU B CD    1 
ATOM   7418 O  OE1   . GLU F 3 306 ? 32.929  -12.698 -18.183 1.00 44.72 ? 306 GLU B OE1   1 
ATOM   7419 O  OE2   . GLU F 3 306 ? 33.452  -12.102 -16.131 1.00 44.58 ? 306 GLU B OE2   1 
ATOM   7420 N  N     . ARG F 3 307 ? 29.910  -15.939 -12.983 1.00 32.75 ? 307 ARG B N     1 
ATOM   7421 C  CA    . ARG F 3 307 ? 29.304  -17.252 -12.813 1.00 32.12 ? 307 ARG B CA    1 
ATOM   7422 C  C     . ARG F 3 307 ? 27.821  -17.143 -12.448 1.00 31.80 ? 307 ARG B C     1 
ATOM   7423 O  O     . ARG F 3 307 ? 26.982  -17.837 -13.016 1.00 31.67 ? 307 ARG B O     1 
ATOM   7424 C  CB    . ARG F 3 307 ? 30.048  -18.043 -11.737 1.00 33.96 ? 307 ARG B CB    1 
ATOM   7425 C  CG    . ARG F 3 307 ? 31.511  -18.309 -12.064 1.00 35.64 ? 307 ARG B CG    1 
ATOM   7426 C  CD    . ARG F 3 307 ? 32.115  -19.265 -11.061 1.00 35.90 ? 307 ARG B CD    1 
ATOM   7427 N  NE    . ARG F 3 307 ? 31.355  -20.511 -11.022 1.00 36.86 ? 307 ARG B NE    1 
ATOM   7428 C  CZ    . ARG F 3 307 ? 31.392  -21.386 -10.021 1.00 36.83 ? 307 ARG B CZ    1 
ATOM   7429 N  NH1   . ARG F 3 307 ? 32.158  -21.163 -8.960  1.00 36.49 ? 307 ARG B NH1   1 
ATOM   7430 N  NH2   . ARG F 3 307 ? 30.644  -22.477 -10.072 1.00 36.27 ? 307 ARG B NH2   1 
ATOM   7431 N  N     . LEU F 3 308 ? 27.507  -16.260 -11.506 1.00 30.82 ? 308 LEU B N     1 
ATOM   7432 C  CA    . LEU F 3 308 ? 26.135  -16.048 -11.059 1.00 30.68 ? 308 LEU B CA    1 
ATOM   7433 C  C     . LEU F 3 308 ? 25.188  -15.600 -12.169 1.00 31.67 ? 308 LEU B C     1 
ATOM   7434 O  O     . LEU F 3 308 ? 23.975  -15.790 -12.066 1.00 32.38 ? 308 LEU B O     1 
ATOM   7435 C  CB    . LEU F 3 308 ? 26.105  -15.002 -9.940  1.00 28.59 ? 308 LEU B CB    1 
ATOM   7436 C  CG    . LEU F 3 308 ? 26.738  -15.409 -8.611  1.00 27.97 ? 308 LEU B CG    1 
ATOM   7437 C  CD1   . LEU F 3 308 ? 26.923  -14.190 -7.724  1.00 27.59 ? 308 LEU B CD1   1 
ATOM   7438 C  CD2   . LEU F 3 308 ? 25.867  -16.452 -7.933  1.00 26.40 ? 308 LEU B CD2   1 
ATOM   7439 N  N     . THR F 3 309 ? 25.733  -15.008 -13.228 1.00 31.72 ? 309 THR B N     1 
ATOM   7440 C  CA    . THR F 3 309 ? 24.898  -14.512 -14.312 1.00 31.97 ? 309 THR B CA    1 
ATOM   7441 C  C     . THR F 3 309 ? 24.977  -15.350 -15.574 1.00 31.94 ? 309 THR B C     1 
ATOM   7442 O  O     . THR F 3 309 ? 24.589  -14.911 -16.653 1.00 31.78 ? 309 THR B O     1 
ATOM   7443 C  CB    . THR F 3 309 ? 25.246  -13.051 -14.648 1.00 31.90 ? 309 THR B CB    1 
ATOM   7444 O  OG1   . THR F 3 309 ? 26.608  -12.970 -15.081 1.00 33.68 ? 309 THR B OG1   1 
ATOM   7445 C  CG2   . THR F 3 309 ? 25.060  -12.170 -13.421 1.00 30.41 ? 309 THR B CG2   1 
ATOM   7446 N  N     . ASN F 3 310 ? 25.485  -16.562 -15.430 1.00 32.50 ? 310 ASN B N     1 
ATOM   7447 C  CA    . ASN F 3 310 ? 25.598  -17.492 -16.547 1.00 33.28 ? 310 ASN B CA    1 
ATOM   7448 C  C     . ASN F 3 310 ? 24.313  -18.305 -16.475 1.00 33.74 ? 310 ASN B C     1 
ATOM   7449 O  O     . ASN F 3 310 ? 24.212  -19.213 -15.652 1.00 34.22 ? 310 ASN B O     1 
ATOM   7450 C  CB    . ASN F 3 310 ? 26.807  -18.405 -16.332 1.00 33.70 ? 310 ASN B CB    1 
ATOM   7451 C  CG    . ASN F 3 310 ? 27.111  -19.265 -17.536 1.00 33.93 ? 310 ASN B CG    1 
ATOM   7452 O  OD1   . ASN F 3 310 ? 26.239  -19.958 -18.059 1.00 34.43 ? 310 ASN B OD1   1 
ATOM   7453 N  ND2   . ASN F 3 310 ? 28.358  -19.229 -17.981 1.00 33.32 ? 310 ASN B ND2   1 
ATOM   7454 N  N     . GLU F 3 311 ? 23.332  -17.995 -17.319 1.00 33.95 ? 311 GLU B N     1 
ATOM   7455 C  CA    . GLU F 3 311 ? 22.061  -18.702 -17.238 1.00 34.94 ? 311 GLU B CA    1 
ATOM   7456 C  C     . GLU F 3 311 ? 22.164  -20.199 -17.367 1.00 35.36 ? 311 GLU B C     1 
ATOM   7457 O  O     . GLU F 3 311 ? 21.429  -20.916 -16.702 1.00 35.94 ? 311 GLU B O     1 
ATOM   7458 C  CB    . GLU F 3 311 ? 21.065  -18.212 -18.279 1.00 36.17 ? 311 GLU B CB    1 
ATOM   7459 C  CG    . GLU F 3 311 ? 19.638  -18.620 -17.938 1.00 40.61 ? 311 GLU B CG    1 
ATOM   7460 C  CD    . GLU F 3 311 ? 18.779  -18.877 -19.155 1.00 43.89 ? 311 GLU B CD    1 
ATOM   7461 O  OE1   . GLU F 3 311 ? 17.532  -18.833 -19.033 1.00 44.56 ? 311 GLU B OE1   1 
ATOM   7462 O  OE2   . GLU F 3 311 ? 19.353  -19.117 -20.240 1.00 46.78 ? 311 GLU B OE2   1 
ATOM   7463 N  N     . LYS F 3 312 ? 23.065  -20.681 -18.214 1.00 35.92 ? 312 LYS B N     1 
ATOM   7464 C  CA    . LYS F 3 312 ? 23.190  -22.119 -18.394 1.00 35.68 ? 312 LYS B CA    1 
ATOM   7465 C  C     . LYS F 3 312 ? 23.634  -22.870 -17.148 1.00 34.86 ? 312 LYS B C     1 
ATOM   7466 O  O     . LYS F 3 312 ? 23.084  -23.922 -16.826 1.00 35.00 ? 312 LYS B O     1 
ATOM   7467 C  CB    . LYS F 3 312 ? 24.121  -22.439 -19.567 1.00 37.01 ? 312 LYS B CB    1 
ATOM   7468 C  CG    . LYS F 3 312 ? 23.545  -22.082 -20.942 1.00 38.44 ? 312 LYS B CG    1 
ATOM   7469 C  CD    . LYS F 3 312 ? 22.023  -22.206 -21.000 1.00 40.62 ? 312 LYS B CD    1 
ATOM   7470 C  CE    . LYS F 3 312 ? 21.529  -23.606 -20.639 1.00 43.04 ? 312 LYS B CE    1 
ATOM   7471 N  NZ    . LYS F 3 312 ? 20.041  -23.627 -20.443 1.00 47.05 ? 312 LYS B NZ    1 
ATOM   7472 N  N     . LEU F 3 313 ? 24.624  -22.334 -16.448 1.00 34.50 ? 313 LEU B N     1 
ATOM   7473 C  CA    . LEU F 3 313 ? 25.122  -22.970 -15.235 1.00 34.02 ? 313 LEU B CA    1 
ATOM   7474 C  C     . LEU F 3 313 ? 24.103  -22.832 -14.097 1.00 33.61 ? 313 LEU B C     1 
ATOM   7475 O  O     . LEU F 3 313 ? 23.933  -23.752 -13.292 1.00 32.59 ? 313 LEU B O     1 
ATOM   7476 C  CB    . LEU F 3 313 ? 26.467  -22.349 -14.838 1.00 35.25 ? 313 LEU B CB    1 
ATOM   7477 C  CG    . LEU F 3 313 ? 27.544  -22.330 -15.933 1.00 35.22 ? 313 LEU B CG    1 
ATOM   7478 C  CD1   . LEU F 3 313 ? 28.852  -21.835 -15.332 1.00 35.66 ? 313 LEU B CD1   1 
ATOM   7479 C  CD2   . LEU F 3 313 ? 27.723  -23.714 -16.530 1.00 34.52 ? 313 LEU B CD2   1 
ATOM   7480 N  N     . LEU F 3 314 ? 23.434  -21.677 -14.039 1.00 33.35 ? 314 LEU B N     1 
ATOM   7481 C  CA    . LEU F 3 314 ? 22.403  -21.409 -13.030 1.00 32.41 ? 314 LEU B CA    1 
ATOM   7482 C  C     . LEU F 3 314 ? 21.373  -22.502 -13.215 1.00 32.22 ? 314 LEU B C     1 
ATOM   7483 O  O     . LEU F 3 314 ? 20.843  -23.070 -12.257 1.00 33.56 ? 314 LEU B O     1 
ATOM   7484 C  CB    . LEU F 3 314 ? 21.730  -20.056 -13.286 1.00 31.13 ? 314 LEU B CB    1 
ATOM   7485 C  CG    . LEU F 3 314 ? 22.463  -18.777 -12.882 1.00 31.89 ? 314 LEU B CG    1 
ATOM   7486 C  CD1   . LEU F 3 314 ? 21.723  -17.544 -13.382 1.00 30.37 ? 314 LEU B CD1   1 
ATOM   7487 C  CD2   . LEU F 3 314 ? 22.575  -18.751 -11.368 1.00 32.57 ? 314 LEU B CD2   1 
ATOM   7488 N  N     . LYS F 3 315 ? 21.107  -22.770 -14.484 1.00 30.86 ? 315 LYS B N     1 
ATOM   7489 C  CA    . LYS F 3 315 ? 20.171  -23.778 -14.917 1.00 30.59 ? 315 LYS B CA    1 
ATOM   7490 C  C     . LYS F 3 315 ? 20.665  -25.158 -14.535 1.00 28.94 ? 315 LYS B C     1 
ATOM   7491 O  O     . LYS F 3 315 ? 19.920  -25.980 -14.010 1.00 27.74 ? 315 LYS B O     1 
ATOM   7492 C  CB    . LYS F 3 315 ? 20.038  -23.701 -16.425 1.00 34.06 ? 315 LYS B CB    1 
ATOM   7493 C  CG    . LYS F 3 315 ? 18.715  -23.173 -16.890 1.00 39.58 ? 315 LYS B CG    1 
ATOM   7494 C  CD    . LYS F 3 315 ? 17.639  -24.206 -16.615 1.00 44.78 ? 315 LYS B CD    1 
ATOM   7495 C  CE    . LYS F 3 315 ? 16.413  -23.938 -17.490 1.00 47.09 ? 315 LYS B CE    1 
ATOM   7496 N  NZ    . LYS F 3 315 ? 16.777  -23.949 -18.953 1.00 49.38 ? 315 LYS B NZ    1 
ATOM   7497 N  N     . LYS F 3 316 ? 21.937  -25.407 -14.813 1.00 27.26 ? 316 LYS B N     1 
ATOM   7498 C  CA    . LYS F 3 316 ? 22.534  -26.695 -14.520 1.00 25.29 ? 316 LYS B CA    1 
ATOM   7499 C  C     . LYS F 3 316 ? 22.579  -26.949 -13.030 1.00 24.74 ? 316 LYS B C     1 
ATOM   7500 O  O     . LYS F 3 316 ? 22.374  -28.072 -12.574 1.00 26.97 ? 316 LYS B O     1 
ATOM   7501 C  CB    . LYS F 3 316 ? 23.946  -26.773 -15.092 1.00 25.36 ? 316 LYS B CB    1 
ATOM   7502 C  CG    . LYS F 3 316 ? 24.525  -28.175 -15.098 1.00 24.85 ? 316 LYS B CG    1 
ATOM   7503 C  CD    . LYS F 3 316 ? 25.988  -28.160 -15.476 1.00 24.67 ? 316 LYS B CD    1 
ATOM   7504 C  CE    . LYS F 3 316 ? 26.596  -29.532 -15.324 1.00 24.60 ? 316 LYS B CE    1 
ATOM   7505 N  NZ    . LYS F 3 316 ? 28.041  -29.439 -14.972 1.00 26.10 ? 316 LYS B NZ    1 
ATOM   7506 N  N     . ALA F 3 317 ? 22.839  -25.905 -12.259 1.00 22.68 ? 317 ALA B N     1 
ATOM   7507 C  CA    . ALA F 3 317 ? 22.904  -26.069 -10.817 1.00 20.97 ? 317 ALA B CA    1 
ATOM   7508 C  C     . ALA F 3 317 ? 21.526  -25.986 -10.177 1.00 19.60 ? 317 ALA B C     1 
ATOM   7509 O  O     . ALA F 3 317 ? 21.381  -26.164 -8.970  1.00 17.80 ? 317 ALA B O     1 
ATOM   7510 C  CB    . ALA F 3 317 ? 23.830  -25.022 -10.220 1.00 22.41 ? 317 ALA B CB    1 
ATOM   7511 N  N     . ARG F 3 318 ? 20.513  -25.712 -10.989 1.00 19.71 ? 318 ARG B N     1 
ATOM   7512 C  CA    . ARG F 3 318 ? 19.140  -25.613 -10.491 1.00 21.05 ? 318 ARG B CA    1 
ATOM   7513 C  C     . ARG F 3 318 ? 18.945  -24.495 -9.473  1.00 20.64 ? 318 ARG B C     1 
ATOM   7514 O  O     . ARG F 3 318 ? 18.265  -24.674 -8.459  1.00 20.58 ? 318 ARG B O     1 
ATOM   7515 C  CB    . ARG F 3 318 ? 18.685  -26.935 -9.848  1.00 23.14 ? 318 ARG B CB    1 
ATOM   7516 C  CG    . ARG F 3 318 ? 18.517  -28.026 -10.835 1.00 26.32 ? 318 ARG B CG    1 
ATOM   7517 C  CD    . ARG F 3 318 ? 17.810  -29.307 -10.346 1.00 29.91 ? 318 ARG B CD    1 
ATOM   7518 N  NE    . ARG F 3 318 ? 18.179  -30.061 -11.497 1.00 32.84 ? 318 ARG B NE    1 
ATOM   7519 C  CZ    . ARG F 3 318 ? 18.440  -31.313 -11.817 1.00 34.19 ? 318 ARG B CZ    1 
ATOM   7520 N  NH1   . ARG F 3 318 ? 18.763  -31.411 -13.085 1.00 37.19 ? 318 ARG B NH1   1 
ATOM   7521 N  NH2   . ARG F 3 318 ? 18.381  -32.383 -11.074 1.00 36.00 ? 318 ARG B NH2   1 
ATOM   7522 N  N     . ILE F 3 319 ? 19.535  -23.338 -9.734  1.00 19.90 ? 319 ILE B N     1 
ATOM   7523 C  CA    . ILE F 3 319 ? 19.399  -22.223 -8.815  1.00 18.51 ? 319 ILE B CA    1 
ATOM   7524 C  C     . ILE F 3 319 ? 18.006  -21.630 -8.971  1.00 18.41 ? 319 ILE B C     1 
ATOM   7525 O  O     . ILE F 3 319 ? 17.676  -21.073 -10.008 1.00 18.83 ? 319 ILE B O     1 
ATOM   7526 C  CB    . ILE F 3 319 ? 20.453  -21.140 -9.106  1.00 17.61 ? 319 ILE B CB    1 
ATOM   7527 C  CG1   . ILE F 3 319 ? 21.859  -21.747 -9.069  1.00 17.43 ? 319 ILE B CG1   1 
ATOM   7528 C  CG2   . ILE F 3 319 ? 20.344  -20.036 -8.078  1.00 17.70 ? 319 ILE B CG2   1 
ATOM   7529 C  CD1   . ILE F 3 319 ? 22.227  -22.403 -7.738  1.00 14.35 ? 319 ILE B CD1   1 
ATOM   7530 N  N     . HIS F 3 320 ? 17.179  -21.756 -7.944  1.00 18.72 ? 320 HIS B N     1 
ATOM   7531 C  CA    . HIS F 3 320 ? 15.832  -21.221 -8.017  1.00 19.02 ? 320 HIS B CA    1 
ATOM   7532 C  C     . HIS F 3 320 ? 15.857  -19.718 -7.769  1.00 20.21 ? 320 HIS B C     1 
ATOM   7533 O  O     . HIS F 3 320 ? 16.714  -19.229 -7.039  1.00 22.73 ? 320 HIS B O     1 
ATOM   7534 C  CB    . HIS F 3 320 ? 14.949  -21.895 -6.976  1.00 18.28 ? 320 HIS B CB    1 
ATOM   7535 C  CG    . HIS F 3 320 ? 13.495  -21.587 -7.142  1.00 19.43 ? 320 HIS B CG    1 
ATOM   7536 N  ND1   . HIS F 3 320 ? 12.699  -22.232 -8.068  1.00 19.75 ? 320 HIS B ND1   1 
ATOM   7537 C  CD2   . HIS F 3 320 ? 12.698  -20.681 -6.532  1.00 18.59 ? 320 HIS B CD2   1 
ATOM   7538 C  CE1   . HIS F 3 320 ? 11.478  -21.739 -8.012  1.00 21.20 ? 320 HIS B CE1   1 
ATOM   7539 N  NE2   . HIS F 3 320 ? 11.449  -20.795 -7.088  1.00 19.65 ? 320 HIS B NE2   1 
ATOM   7540 N  N     . PRO F 3 321 ? 14.925  -18.958 -8.374  1.00 21.02 ? 321 PRO B N     1 
ATOM   7541 C  CA    . PRO F 3 321 ? 14.921  -17.508 -8.152  1.00 21.54 ? 321 PRO B CA    1 
ATOM   7542 C  C     . PRO F 3 321 ? 14.736  -17.114 -6.695  1.00 21.22 ? 321 PRO B C     1 
ATOM   7543 O  O     . PRO F 3 321 ? 15.254  -16.097 -6.259  1.00 22.70 ? 321 PRO B O     1 
ATOM   7544 C  CB    . PRO F 3 321 ? 13.775  -17.013 -9.050  1.00 21.28 ? 321 PRO B CB    1 
ATOM   7545 C  CG    . PRO F 3 321 ? 12.909  -18.203 -9.197  1.00 20.91 ? 321 PRO B CG    1 
ATOM   7546 C  CD    . PRO F 3 321 ? 13.901  -19.322 -9.364  1.00 21.03 ? 321 PRO B CD    1 
ATOM   7547 N  N     . PHE F 3 322 ? 14.005  -17.921 -5.937  1.00 21.55 ? 322 PHE B N     1 
ATOM   7548 C  CA    . PHE F 3 322 ? 13.785  -17.618 -4.522  1.00 21.35 ? 322 PHE B CA    1 
ATOM   7549 C  C     . PHE F 3 322 ? 15.114  -17.558 -3.784  1.00 21.25 ? 322 PHE B C     1 
ATOM   7550 O  O     . PHE F 3 322 ? 15.379  -16.611 -3.042  1.00 20.53 ? 322 PHE B O     1 
ATOM   7551 C  CB    . PHE F 3 322 ? 12.843  -18.670 -3.906  1.00 19.11 ? 322 PHE B CB    1 
ATOM   7552 C  CG    . PHE F 3 322 ? 12.919  -18.774 -2.413  1.00 18.27 ? 322 PHE B CG    1 
ATOM   7553 C  CD1   . PHE F 3 322 ? 13.818  -19.644 -1.807  1.00 17.61 ? 322 PHE B CD1   1 
ATOM   7554 C  CD2   . PHE F 3 322 ? 12.065  -18.042 -1.613  1.00 18.42 ? 322 PHE B CD2   1 
ATOM   7555 C  CE1   . PHE F 3 322 ? 13.853  -19.788 -0.423  1.00 17.53 ? 322 PHE B CE1   1 
ATOM   7556 C  CE2   . PHE F 3 322 ? 12.096  -18.182 -0.227  1.00 18.29 ? 322 PHE B CE2   1 
ATOM   7557 C  CZ    . PHE F 3 322 ? 12.993  -19.059 0.368   1.00 16.53 ? 322 PHE B CZ    1 
ATOM   7558 N  N     . HIS F 3 323 ? 15.953  -18.562 -4.014  1.00 21.65 ? 323 HIS B N     1 
ATOM   7559 C  CA    . HIS F 3 323 ? 17.252  -18.618 -3.373  1.00 23.59 ? 323 HIS B CA    1 
ATOM   7560 C  C     . HIS F 3 323 ? 18.050  -17.364 -3.710  1.00 24.23 ? 323 HIS B C     1 
ATOM   7561 O  O     . HIS F 3 323 ? 18.842  -16.883 -2.894  1.00 24.45 ? 323 HIS B O     1 
ATOM   7562 C  CB    . HIS F 3 323 ? 18.016  -19.875 -3.810  1.00 25.52 ? 323 HIS B CB    1 
ATOM   7563 C  CG    . HIS F 3 323 ? 17.362  -21.155 -3.390  1.00 27.67 ? 323 HIS B CG    1 
ATOM   7564 N  ND1   . HIS F 3 323 ? 16.839  -21.346 -2.125  1.00 28.28 ? 323 HIS B ND1   1 
ATOM   7565 C  CD2   . HIS F 3 323 ? 17.149  -22.312 -4.063  1.00 28.53 ? 323 HIS B CD2   1 
ATOM   7566 C  CE1   . HIS F 3 323 ? 16.331  -22.563 -2.040  1.00 29.17 ? 323 HIS B CE1   1 
ATOM   7567 N  NE2   . HIS F 3 323 ? 16.506  -23.171 -3.202  1.00 30.83 ? 323 HIS B NE2   1 
ATOM   7568 N  N     . ILE F 3 324 ? 17.841  -16.835 -4.913  1.00 24.12 ? 324 ILE B N     1 
ATOM   7569 C  CA    . ILE F 3 324 ? 18.530  -15.619 -5.335  1.00 23.41 ? 324 ILE B CA    1 
ATOM   7570 C  C     . ILE F 3 324 ? 17.986  -14.450 -4.522  1.00 23.06 ? 324 ILE B C     1 
ATOM   7571 O  O     . ILE F 3 324 ? 18.746  -13.673 -3.939  1.00 23.93 ? 324 ILE B O     1 
ATOM   7572 C  CB    . ILE F 3 324 ? 18.285  -15.303 -6.822  1.00 23.66 ? 324 ILE B CB    1 
ATOM   7573 C  CG1   . ILE F 3 324 ? 18.665  -16.498 -7.689  1.00 24.34 ? 324 ILE B CG1   1 
ATOM   7574 C  CG2   . ILE F 3 324 ? 19.120  -14.107 -7.237  1.00 23.00 ? 324 ILE B CG2   1 
ATOM   7575 C  CD1   . ILE F 3 324 ? 20.125  -16.853 -7.612  1.00 25.97 ? 324 ILE B CD1   1 
ATOM   7576 N  N     . LEU F 3 325 ? 16.665  -14.332 -4.479  1.00 22.02 ? 325 LEU B N     1 
ATOM   7577 C  CA    . LEU F 3 325 ? 16.030  -13.255 -3.742  1.00 22.12 ? 325 LEU B CA    1 
ATOM   7578 C  C     . LEU F 3 325 ? 16.468  -13.243 -2.282  1.00 22.04 ? 325 LEU B C     1 
ATOM   7579 O  O     . LEU F 3 325 ? 16.853  -12.191 -1.775  1.00 23.10 ? 325 LEU B O     1 
ATOM   7580 C  CB    . LEU F 3 325 ? 14.506  -13.368 -3.829  1.00 23.30 ? 325 LEU B CB    1 
ATOM   7581 C  CG    . LEU F 3 325 ? 13.747  -12.036 -3.745  1.00 23.69 ? 325 LEU B CG    1 
ATOM   7582 C  CD1   . LEU F 3 325 ? 12.259  -12.295 -3.700  1.00 24.37 ? 325 LEU B CD1   1 
ATOM   7583 C  CD2   . LEU F 3 325 ? 14.161  -11.269 -2.525  1.00 24.20 ? 325 LEU B CD2   1 
ATOM   7584 N  N     . VAL F 3 326 ? 16.418  -14.394 -1.607  1.00 21.39 ? 326 VAL B N     1 
ATOM   7585 C  CA    . VAL F 3 326 ? 16.837  -14.464 -0.198  1.00 22.57 ? 326 VAL B CA    1 
ATOM   7586 C  C     . VAL F 3 326 ? 18.290  -14.006 -0.007  1.00 23.43 ? 326 VAL B C     1 
ATOM   7587 O  O     . VAL F 3 326 ? 18.588  -13.255 0.919   1.00 23.80 ? 326 VAL B O     1 
ATOM   7588 C  CB    . VAL F 3 326 ? 16.713  -15.906 0.402   1.00 22.92 ? 326 VAL B CB    1 
ATOM   7589 C  CG1   . VAL F 3 326 ? 17.289  -15.932 1.813   1.00 20.81 ? 326 VAL B CG1   1 
ATOM   7590 C  CG2   . VAL F 3 326 ? 15.259  -16.343 0.446   1.00 22.33 ? 326 VAL B CG2   1 
ATOM   7591 N  N     . ALA F 3 327 ? 19.185  -14.458 -0.884  1.00 22.97 ? 327 ALA B N     1 
ATOM   7592 C  CA    . ALA F 3 327 ? 20.590  -14.089 -0.799  1.00 22.96 ? 327 ALA B CA    1 
ATOM   7593 C  C     . ALA F 3 327 ? 20.794  -12.609 -1.090  1.00 23.98 ? 327 ALA B C     1 
ATOM   7594 O  O     . ALA F 3 327 ? 21.596  -11.937 -0.445  1.00 22.53 ? 327 ALA B O     1 
ATOM   7595 C  CB    . ALA F 3 327 ? 21.405  -14.923 -1.768  1.00 22.20 ? 327 ALA B CB    1 
ATOM   7596 N  N     . LEU F 3 328 ? 20.075  -12.097 -2.073  1.00 25.68 ? 328 LEU B N     1 
ATOM   7597 C  CA    . LEU F 3 328 ? 20.232  -10.703 -2.403  1.00 27.90 ? 328 LEU B CA    1 
ATOM   7598 C  C     . LEU F 3 328 ? 19.810  -9.859  -1.217  1.00 28.88 ? 328 LEU B C     1 
ATOM   7599 O  O     . LEU F 3 328 ? 20.540  -8.970  -0.790  1.00 28.98 ? 328 LEU B O     1 
ATOM   7600 C  CB    . LEU F 3 328 ? 19.397  -10.346 -3.622  1.00 29.27 ? 328 LEU B CB    1 
ATOM   7601 C  CG    . LEU F 3 328 ? 19.650  -8.919  -4.094  1.00 31.58 ? 328 LEU B CG    1 
ATOM   7602 C  CD1   . LEU F 3 328 ? 19.862  -8.944  -5.584  1.00 34.24 ? 328 LEU B CD1   1 
ATOM   7603 C  CD2   . LEU F 3 328 ? 18.494  -8.028  -3.717  1.00 33.52 ? 328 LEU B CD2   1 
ATOM   7604 N  N     . GLU F 3 329 ? 18.633  -10.147 -0.676  1.00 30.17 ? 329 GLU B N     1 
ATOM   7605 C  CA    . GLU F 3 329 ? 18.127  -9.397  0.466   1.00 31.84 ? 329 GLU B CA    1 
ATOM   7606 C  C     . GLU F 3 329 ? 19.102  -9.413  1.639   1.00 31.18 ? 329 GLU B C     1 
ATOM   7607 O  O     . GLU F 3 329 ? 19.416  -8.371  2.211   1.00 31.53 ? 329 GLU B O     1 
ATOM   7608 C  CB    . GLU F 3 329 ? 16.791  -9.968  0.924   1.00 34.46 ? 329 GLU B CB    1 
ATOM   7609 C  CG    . GLU F 3 329 ? 15.697  -8.929  1.045   1.00 39.94 ? 329 GLU B CG    1 
ATOM   7610 C  CD    . GLU F 3 329 ? 16.056  -7.796  2.004   1.00 44.35 ? 329 GLU B CD    1 
ATOM   7611 O  OE1   . GLU F 3 329 ? 16.189  -8.049  3.224   1.00 45.56 ? 329 GLU B OE1   1 
ATOM   7612 O  OE2   . GLU F 3 329 ? 16.207  -6.643  1.538   1.00 46.76 ? 329 GLU B OE2   1 
ATOM   7613 N  N     . THR F 3 330 ? 19.582  -10.597 1.996   1.00 30.65 ? 330 THR B N     1 
ATOM   7614 C  CA    . THR F 3 330 ? 20.509  -10.721 3.112   1.00 30.73 ? 330 THR B CA    1 
ATOM   7615 C  C     . THR F 3 330 ? 21.905  -10.168 2.802   1.00 31.60 ? 330 THR B C     1 
ATOM   7616 O  O     . THR F 3 330 ? 22.532  -9.540  3.659   1.00 30.83 ? 330 THR B O     1 
ATOM   7617 C  CB    . THR F 3 330 ? 20.617  -12.195 3.572   1.00 30.00 ? 330 THR B CB    1 
ATOM   7618 O  OG1   . THR F 3 330 ? 19.335  -12.639 4.047   1.00 29.77 ? 330 THR B OG1   1 
ATOM   7619 C  CG2   . THR F 3 330 ? 21.632  -12.337 4.692   1.00 29.02 ? 330 THR B CG2   1 
ATOM   7620 N  N     . TYR F 3 331 ? 22.384  -10.381 1.578   1.00 32.19 ? 331 TYR B N     1 
ATOM   7621 C  CA    . TYR F 3 331 ? 23.707  -9.899  1.198   1.00 32.64 ? 331 TYR B CA    1 
ATOM   7622 C  C     . TYR F 3 331 ? 23.871  -8.382  1.230   1.00 33.88 ? 331 TYR B C     1 
ATOM   7623 O  O     . TYR F 3 331 ? 24.859  -7.874  1.758   1.00 34.25 ? 331 TYR B O     1 
ATOM   7624 C  CB    . TYR F 3 331 ? 24.093  -10.394 -0.194  1.00 31.42 ? 331 TYR B CB    1 
ATOM   7625 C  CG    . TYR F 3 331 ? 25.529  -10.069 -0.532  1.00 29.40 ? 331 TYR B CG    1 
ATOM   7626 C  CD1   . TYR F 3 331 ? 26.577  -10.600 0.222   1.00 28.21 ? 331 TYR B CD1   1 
ATOM   7627 C  CD2   . TYR F 3 331 ? 25.840  -9.196  -1.565  1.00 28.52 ? 331 TYR B CD2   1 
ATOM   7628 C  CE1   . TYR F 3 331 ? 27.886  -10.269 -0.048  1.00 27.58 ? 331 TYR B CE1   1 
ATOM   7629 C  CE2   . TYR F 3 331 ? 27.152  -8.857  -1.841  1.00 27.01 ? 331 TYR B CE2   1 
ATOM   7630 C  CZ    . TYR F 3 331 ? 28.167  -9.394  -1.076  1.00 27.45 ? 331 TYR B CZ    1 
ATOM   7631 O  OH    . TYR F 3 331 ? 29.471  -9.049  -1.326  1.00 28.57 ? 331 TYR B OH    1 
ATOM   7632 N  N     . LYS F 3 332 ? 22.917  -7.658  0.658   1.00 35.90 ? 332 LYS B N     1 
ATOM   7633 C  CA    . LYS F 3 332 ? 22.988  -6.200  0.640   1.00 37.78 ? 332 LYS B CA    1 
ATOM   7634 C  C     . LYS F 3 332 ? 22.785  -5.601  2.031   1.00 38.10 ? 332 LYS B C     1 
ATOM   7635 O  O     . LYS F 3 332 ? 23.140  -4.450  2.273   1.00 38.61 ? 332 LYS B O     1 
ATOM   7636 C  CB    . LYS F 3 332 ? 21.942  -5.621  -0.305  1.00 38.03 ? 332 LYS B CB    1 
ATOM   7637 C  CG    . LYS F 3 332 ? 20.534  -6.063  0.024   1.00 39.77 ? 332 LYS B CG    1 
ATOM   7638 C  CD    . LYS F 3 332 ? 19.527  -4.992  -0.355  1.00 41.02 ? 332 LYS B CD    1 
ATOM   7639 C  CE    . LYS F 3 332 ? 18.102  -5.491  -0.216  1.00 42.47 ? 332 LYS B CE    1 
ATOM   7640 N  NZ    . LYS F 3 332 ? 17.135  -4.393  -0.490  1.00 42.43 ? 332 LYS B NZ    1 
ATOM   7641 N  N     . LYS F 3 333 ? 22.210  -6.379  2.940   1.00 38.73 ? 333 LYS B N     1 
ATOM   7642 C  CA    . LYS F 3 333 ? 21.983  -5.916  4.304   1.00 40.47 ? 333 LYS B CA    1 
ATOM   7643 C  C     . LYS F 3 333 ? 23.303  -5.837  5.081   1.00 41.20 ? 333 LYS B C     1 
ATOM   7644 O  O     . LYS F 3 333 ? 23.321  -5.441  6.247   1.00 41.37 ? 333 LYS B O     1 
ATOM   7645 C  CB    . LYS F 3 333 ? 21.030  -6.863  5.036   1.00 41.76 ? 333 LYS B CB    1 
ATOM   7646 C  CG    . LYS F 3 333 ? 19.615  -6.340  5.212   1.00 43.75 ? 333 LYS B CG    1 
ATOM   7647 C  CD    . LYS F 3 333 ? 18.843  -7.282  6.150   1.00 45.66 ? 333 LYS B CD    1 
ATOM   7648 C  CE    . LYS F 3 333 ? 17.480  -6.706  6.581   1.00 47.12 ? 333 LYS B CE    1 
ATOM   7649 N  NZ    . LYS F 3 333 ? 16.534  -6.563  5.431   1.00 49.31 ? 333 LYS B NZ    1 
ATOM   7650 N  N     . GLY F 3 334 ? 24.398  -6.248  4.445   1.00 41.10 ? 334 GLY B N     1 
ATOM   7651 C  CA    . GLY F 3 334 ? 25.693  -6.206  5.102   1.00 41.89 ? 334 GLY B CA    1 
ATOM   7652 C  C     . GLY F 3 334 ? 25.858  -7.204  6.231   1.00 42.93 ? 334 GLY B C     1 
ATOM   7653 O  O     . GLY F 3 334 ? 26.981  -7.532  6.605   1.00 44.16 ? 334 GLY B O     1 
ATOM   7654 N  N     . HIS F 3 335 ? 24.746  -7.683  6.779   1.00 44.04 ? 335 HIS B N     1 
ATOM   7655 C  CA    . HIS F 3 335 ? 24.769  -8.662  7.869   1.00 44.91 ? 335 HIS B CA    1 
ATOM   7656 C  C     . HIS F 3 335 ? 23.623  -9.666  7.722   1.00 46.39 ? 335 HIS B C     1 
ATOM   7657 O  O     . HIS F 3 335 ? 22.630  -9.395  7.042   1.00 46.34 ? 335 HIS B O     1 
ATOM   7658 C  CB    . HIS F 3 335 ? 24.651  -7.959  9.224   1.00 44.34 ? 335 HIS B CB    1 
ATOM   7659 C  CG    . HIS F 3 335 ? 23.391  -7.167  9.385   1.00 45.23 ? 335 HIS B CG    1 
ATOM   7660 N  ND1   . HIS F 3 335 ? 22.140  -7.740  9.325   1.00 46.07 ? 335 HIS B ND1   1 
ATOM   7661 C  CD2   . HIS F 3 335 ? 23.191  -5.843  9.593   1.00 45.81 ? 335 HIS B CD2   1 
ATOM   7662 C  CE1   . HIS F 3 335 ? 21.221  -6.803  9.489   1.00 46.53 ? 335 HIS B CE1   1 
ATOM   7663 N  NE2   . HIS F 3 335 ? 21.834  -5.644  9.654   1.00 46.87 ? 335 HIS B NE2   1 
ATOM   7664 N  N     . GLY F 3 336 ? 23.754  -10.815 8.378   1.00 47.31 ? 336 GLY B N     1 
ATOM   7665 C  CA    . GLY F 3 336 ? 22.729  -11.838 8.281   1.00 48.34 ? 336 GLY B CA    1 
ATOM   7666 C  C     . GLY F 3 336 ? 21.538  -11.637 9.189   1.00 49.30 ? 336 GLY B C     1 
ATOM   7667 O  O     . GLY F 3 336 ? 21.512  -10.708 9.996   1.00 49.31 ? 336 GLY B O     1 
ATOM   7668 N  N     . ASN F 3 337 ? 20.540  -12.507 9.056   1.00 49.84 ? 337 ASN B N     1 
ATOM   7669 C  CA    . ASN F 3 337 ? 19.353  -12.419 9.900   1.00 51.02 ? 337 ASN B CA    1 
ATOM   7670 C  C     . ASN F 3 337 ? 19.582  -13.259 11.147  1.00 52.27 ? 337 ASN B C     1 
ATOM   7671 O  O     . ASN F 3 337 ? 19.364  -12.787 12.267  1.00 52.84 ? 337 ASN B O     1 
ATOM   7672 C  CB    . ASN F 3 337 ? 18.093  -12.909 9.169   1.00 50.61 ? 337 ASN B CB    1 
ATOM   7673 C  CG    . ASN F 3 337 ? 16.892  -13.018 10.094  1.00 50.88 ? 337 ASN B CG    1 
ATOM   7674 O  OD1   . ASN F 3 337 ? 15.749  -13.218 9.639   1.00 51.43 ? 337 ASN B OD1   1 
ATOM   7675 N  ND2   . ASN F 3 337 ? 17.145  -12.904 11.417  1.00 51.83 ? 337 ASN B ND2   1 
ATOM   7676 N  N     . ARG F 3 338 ? 19.994  -14.510 10.956  1.00 53.22 ? 338 ARG B N     1 
ATOM   7677 C  CA    . ARG F 3 338 ? 20.254  -15.398 12.090  1.00 53.82 ? 338 ARG B CA    1 
ATOM   7678 C  C     . ARG F 3 338 ? 21.757  -15.456 12.321  1.00 53.45 ? 338 ARG B C     1 
ATOM   7679 O  O     . ARG F 3 338 ? 22.222  -15.685 13.441  1.00 53.04 ? 338 ARG B O     1 
ATOM   7680 C  CB    . ARG F 3 338 ? 19.703  -16.808 11.822  1.00 55.50 ? 338 ARG B CB    1 
ATOM   7681 C  CG    . ARG F 3 338 ? 18.199  -16.963 12.084  1.00 57.48 ? 338 ARG B CG    1 
ATOM   7682 C  CD    . ARG F 3 338 ? 17.691  -18.386 11.801  1.00 59.87 ? 338 ARG B CD    1 
ATOM   7683 N  NE    . ARG F 3 338 ? 16.573  -18.409 10.908  1.00 62.96 ? 338 ARG B NE    1 
ATOM   7684 C  CZ    . ARG F 3 338 ? 15.441  -19.108 10.894  1.00 63.88 ? 338 ARG B CZ    1 
ATOM   7685 N  NH1   . ARG F 3 338 ? 14.658  -18.834 9.871   1.00 63.85 ? 338 ARG B NH1   1 
ATOM   7686 N  NH2   . ARG F 3 338 ? 15.054  -19.999 11.804  1.00 64.95 ? 338 ARG B NH2   1 
ATOM   7687 N  N     . GLY F 3 339 ? 22.509  -15.237 11.245  1.00 53.06 ? 339 GLY B N     1 
ATOM   7688 C  CA    . GLY F 3 339 ? 23.958  -15.254 11.327  1.00 52.91 ? 339 GLY B CA    1 
ATOM   7689 C  C     . GLY F 3 339 ? 24.462  -14.190 12.282  1.00 52.15 ? 339 GLY B C     1 
ATOM   7690 O  O     . GLY F 3 339 ? 23.664  -13.505 12.932  1.00 52.52 ? 339 GLY B O     1 
ATOM   7691 N  N     . LYS F 3 340 ? 25.781  -14.038 12.368  1.00 50.85 ? 340 LYS B N     1 
ATOM   7692 C  CA    . LYS F 3 340 ? 26.352  -13.052 13.266  1.00 49.83 ? 340 LYS B CA    1 
ATOM   7693 C  C     . LYS F 3 340 ? 27.639  -12.437 12.736  1.00 49.20 ? 340 LYS B C     1 
ATOM   7694 O  O     . LYS F 3 340 ? 28.528  -12.079 13.512  1.00 49.37 ? 340 LYS B O     1 
ATOM   7695 C  CB    . LYS F 3 340 ? 26.581  -13.695 14.635  1.00 50.50 ? 340 LYS B CB    1 
ATOM   7696 C  CG    . LYS F 3 340 ? 25.297  -14.243 15.240  1.00 52.61 ? 340 LYS B CG    1 
ATOM   7697 C  CD    . LYS F 3 340 ? 25.510  -14.921 16.579  1.00 55.63 ? 340 LYS B CD    1 
ATOM   7698 C  CE    . LYS F 3 340 ? 24.191  -15.497 17.094  1.00 56.99 ? 340 LYS B CE    1 
ATOM   7699 N  NZ    . LYS F 3 340 ? 24.350  -16.288 18.353  1.00 59.14 ? 340 LYS B NZ    1 
ATOM   7700 N  N     . LEU F 3 341 ? 27.738  -12.317 11.414  1.00 47.88 ? 341 LEU B N     1 
ATOM   7701 C  CA    . LEU F 3 341 ? 28.915  -11.718 10.795  1.00 46.33 ? 341 LEU B CA    1 
ATOM   7702 C  C     . LEU F 3 341 ? 28.501  -10.509 9.989   1.00 45.34 ? 341 LEU B C     1 
ATOM   7703 O  O     . LEU F 3 341 ? 27.352  -10.400 9.572   1.00 45.79 ? 341 LEU B O     1 
ATOM   7704 C  CB    . LEU F 3 341 ? 29.631  -12.708 9.879   1.00 45.71 ? 341 LEU B CB    1 
ATOM   7705 C  CG    . LEU F 3 341 ? 30.187  -13.930 10.594  1.00 44.81 ? 341 LEU B CG    1 
ATOM   7706 C  CD1   . LEU F 3 341 ? 29.071  -14.927 10.811  1.00 46.37 ? 341 LEU B CD1   1 
ATOM   7707 C  CD2   . LEU F 3 341 ? 31.280  -14.547 9.769   1.00 45.08 ? 341 LEU B CD2   1 
ATOM   7708 N  N     . ARG F 3 342 ? 29.442  -9.598  9.776   1.00 44.47 ? 342 ARG B N     1 
ATOM   7709 C  CA    . ARG F 3 342 ? 29.160  -8.389  9.021   1.00 43.49 ? 342 ARG B CA    1 
ATOM   7710 C  C     . ARG F 3 342 ? 30.100  -8.281  7.838   1.00 41.15 ? 342 ARG B C     1 
ATOM   7711 O  O     . ARG F 3 342 ? 31.233  -8.769  7.880   1.00 42.02 ? 342 ARG B O     1 
ATOM   7712 C  CB    . ARG F 3 342 ? 29.300  -7.156  9.917   1.00 45.40 ? 342 ARG B CB    1 
ATOM   7713 C  CG    . ARG F 3 342 ? 28.419  -7.215  11.146  1.00 49.82 ? 342 ARG B CG    1 
ATOM   7714 C  CD    . ARG F 3 342 ? 28.036  -5.828  11.662  1.00 52.99 ? 342 ARG B CD    1 
ATOM   7715 N  NE    . ARG F 3 342 ? 27.669  -5.929  13.039  1.00 55.56 ? 342 ARG B NE    1 
ATOM   7716 C  CZ    . ARG F 3 342 ? 26.547  -5.696  13.708  1.00 56.37 ? 342 ARG B CZ    1 
ATOM   7717 N  NH1   . ARG F 3 342 ? 26.650  -5.942  14.994  1.00 56.28 ? 342 ARG B NH1   1 
ATOM   7718 N  NH2   . ARG F 3 342 ? 25.392  -5.257  13.210  1.00 57.72 ? 342 ARG B NH2   1 
ATOM   7719 N  N     . TRP F 3 343 ? 29.621  -7.647  6.779   1.00 37.87 ? 343 TRP B N     1 
ATOM   7720 C  CA    . TRP F 3 343 ? 30.421  -7.469  5.582   1.00 35.90 ? 343 TRP B CA    1 
ATOM   7721 C  C     . TRP F 3 343 ? 29.949  -6.241  4.823   1.00 35.47 ? 343 TRP B C     1 
ATOM   7722 O  O     . TRP F 3 343 ? 28.774  -5.863  4.886   1.00 35.32 ? 343 TRP B O     1 
ATOM   7723 C  CB    . TRP F 3 343 ? 30.328  -8.717  4.685   1.00 35.56 ? 343 TRP B CB    1 
ATOM   7724 C  CG    . TRP F 3 343 ? 28.926  -9.057  4.232   1.00 34.15 ? 343 TRP B CG    1 
ATOM   7725 C  CD1   . TRP F 3 343 ? 28.204  -8.424  3.252   1.00 33.96 ? 343 TRP B CD1   1 
ATOM   7726 C  CD2   . TRP F 3 343 ? 28.045  -10.027 4.808   1.00 32.45 ? 343 TRP B CD2   1 
ATOM   7727 N  NE1   . TRP F 3 343 ? 26.930  -8.931  3.194   1.00 32.65 ? 343 TRP B NE1   1 
ATOM   7728 C  CE2   . TRP F 3 343 ? 26.802  -9.915  4.142   1.00 32.42 ? 343 TRP B CE2   1 
ATOM   7729 C  CE3   . TRP F 3 343 ? 28.178  -10.971 5.833   1.00 31.28 ? 343 TRP B CE3   1 
ATOM   7730 C  CZ2   . TRP F 3 343 ? 25.702  -10.715 4.464   1.00 31.36 ? 343 TRP B CZ2   1 
ATOM   7731 C  CZ3   . TRP F 3 343 ? 27.084  -11.765 6.154   1.00 31.01 ? 343 TRP B CZ3   1 
ATOM   7732 C  CH2   . TRP F 3 343 ? 25.862  -11.628 5.475   1.00 31.45 ? 343 TRP B CH2   1 
ATOM   7733 N  N     . ILE F 3 344 ? 30.882  -5.593  4.137   1.00 34.77 ? 344 ILE B N     1 
ATOM   7734 C  CA    . ILE F 3 344 ? 30.561  -4.425  3.334   1.00 33.89 ? 344 ILE B CA    1 
ATOM   7735 C  C     . ILE F 3 344 ? 30.062  -5.002  2.011   1.00 33.63 ? 344 ILE B C     1 
ATOM   7736 O  O     . ILE F 3 344 ? 30.849  -5.498  1.207   1.00 34.18 ? 344 ILE B O     1 
ATOM   7737 C  CB    . ILE F 3 344 ? 31.812  -3.569  3.078   1.00 33.04 ? 344 ILE B CB    1 
ATOM   7738 C  CG1   . ILE F 3 344 ? 32.417  -3.140  4.415   1.00 33.92 ? 344 ILE B CG1   1 
ATOM   7739 C  CG2   . ILE F 3 344 ? 31.451  -2.363  2.228   1.00 31.66 ? 344 ILE B CG2   1 
ATOM   7740 C  CD1   . ILE F 3 344 ? 33.717  -2.367  4.286   1.00 34.05 ? 344 ILE B CD1   1 
ATOM   7741 N  N     . PRO F 3 345 ? 28.743  -4.960  1.774   1.00 33.09 ? 345 PRO B N     1 
ATOM   7742 C  CA    . PRO F 3 345 ? 28.190  -5.500  0.528   1.00 33.16 ? 345 PRO B CA    1 
ATOM   7743 C  C     . PRO F 3 345 ? 28.840  -4.950  -0.741  1.00 33.11 ? 345 PRO B C     1 
ATOM   7744 O  O     . PRO F 3 345 ? 28.862  -3.747  -0.978  1.00 33.65 ? 345 PRO B O     1 
ATOM   7745 C  CB    . PRO F 3 345 ? 26.703  -5.159  0.631   1.00 32.52 ? 345 PRO B CB    1 
ATOM   7746 C  CG    . PRO F 3 345 ? 26.691  -3.936  1.506   1.00 32.62 ? 345 PRO B CG    1 
ATOM   7747 C  CD    . PRO F 3 345 ? 27.698  -4.284  2.564   1.00 32.71 ? 345 PRO B CD    1 
ATOM   7748 N  N     . ASP F 3 346 ? 29.378  -5.852  -1.550  1.00 33.42 ? 346 ASP B N     1 
ATOM   7749 C  CA    . ASP F 3 346 ? 30.033  -5.479  -2.794  1.00 34.14 ? 346 ASP B CA    1 
ATOM   7750 C  C     . ASP F 3 346 ? 28.960  -5.124  -3.819  1.00 34.77 ? 346 ASP B C     1 
ATOM   7751 O  O     . ASP F 3 346 ? 28.056  -5.915  -4.075  1.00 36.42 ? 346 ASP B O     1 
ATOM   7752 C  CB    . ASP F 3 346 ? 30.891  -6.646  -3.281  1.00 33.90 ? 346 ASP B CB    1 
ATOM   7753 C  CG    . ASP F 3 346 ? 31.738  -6.286  -4.477  1.00 35.63 ? 346 ASP B CG    1 
ATOM   7754 O  OD1   . ASP F 3 346 ? 31.216  -6.309  -5.610  1.00 35.38 ? 346 ASP B OD1   1 
ATOM   7755 O  OD2   . ASP F 3 346 ? 32.933  -5.965  -4.287  1.00 38.28 ? 346 ASP B OD2   1 
ATOM   7756 N  N     . THR F 3 347 ? 29.060  -3.936  -4.408  1.00 34.80 ? 347 THR B N     1 
ATOM   7757 C  CA    . THR F 3 347 ? 28.067  -3.487  -5.382  1.00 35.34 ? 347 THR B CA    1 
ATOM   7758 C  C     . THR F 3 347 ? 28.063  -4.272  -6.693  1.00 35.06 ? 347 THR B C     1 
ATOM   7759 O  O     . THR F 3 347 ? 27.063  -4.284  -7.406  1.00 35.86 ? 347 THR B O     1 
ATOM   7760 C  CB    . THR F 3 347 ? 28.239  -1.989  -5.718  1.00 35.71 ? 347 THR B CB    1 
ATOM   7761 O  OG1   . THR F 3 347 ? 28.320  -1.239  -4.501  1.00 37.04 ? 347 THR B OG1   1 
ATOM   7762 C  CG2   . THR F 3 347 ? 27.048  -1.484  -6.526  1.00 34.52 ? 347 THR B CG2   1 
ATOM   7763 N  N     . SER F 3 348 ? 29.172  -4.914  -7.026  1.00 33.85 ? 348 SER B N     1 
ATOM   7764 C  CA    . SER F 3 348 ? 29.226  -5.688  -8.255  1.00 33.39 ? 348 SER B CA    1 
ATOM   7765 C  C     . SER F 3 348 ? 28.363  -6.947  -8.091  1.00 33.57 ? 348 SER B C     1 
ATOM   7766 O  O     . SER F 3 348 ? 27.658  -7.367  -9.012  1.00 32.65 ? 348 SER B O     1 
ATOM   7767 C  CB    . SER F 3 348 ? 30.669  -6.088  -8.545  1.00 33.96 ? 348 SER B CB    1 
ATOM   7768 O  OG    . SER F 3 348 ? 30.999  -5.837  -9.904  1.00 36.04 ? 348 SER B OG    1 
ATOM   7769 N  N     . ILE F 3 349 ? 28.428  -7.533  -6.896  1.00 32.59 ? 349 ILE B N     1 
ATOM   7770 C  CA    . ILE F 3 349 ? 27.688  -8.738  -6.565  1.00 30.92 ? 349 ILE B CA    1 
ATOM   7771 C  C     . ILE F 3 349 ? 26.196  -8.464  -6.481  1.00 30.51 ? 349 ILE B C     1 
ATOM   7772 O  O     . ILE F 3 349 ? 25.385  -9.257  -6.960  1.00 29.86 ? 349 ILE B O     1 
ATOM   7773 C  CB    . ILE F 3 349 ? 28.135  -9.302  -5.212  1.00 30.68 ? 349 ILE B CB    1 
ATOM   7774 C  CG1   . ILE F 3 349 ? 29.654  -9.472  -5.188  1.00 31.29 ? 349 ILE B CG1   1 
ATOM   7775 C  CG2   . ILE F 3 349 ? 27.427  -10.613 -4.949  1.00 30.08 ? 349 ILE B CG2   1 
ATOM   7776 C  CD1   . ILE F 3 349 ? 30.206  -10.272 -6.341  1.00 31.49 ? 349 ILE B CD1   1 
ATOM   7777 N  N     . VAL F 3 350 ? 25.836  -7.349  -5.855  1.00 29.90 ? 350 VAL B N     1 
ATOM   7778 C  CA    . VAL F 3 350 ? 24.437  -6.985  -5.713  1.00 30.12 ? 350 VAL B CA    1 
ATOM   7779 C  C     . VAL F 3 350 ? 23.815  -6.809  -7.091  1.00 31.88 ? 350 VAL B C     1 
ATOM   7780 O  O     . VAL F 3 350 ? 22.638  -7.094  -7.299  1.00 32.40 ? 350 VAL B O     1 
ATOM   7781 C  CB    . VAL F 3 350 ? 24.284  -5.678  -4.925  1.00 28.92 ? 350 VAL B CB    1 
ATOM   7782 C  CG1   . VAL F 3 350 ? 22.829  -5.301  -4.829  1.00 27.61 ? 350 VAL B CG1   1 
ATOM   7783 C  CG2   . VAL F 3 350 ? 24.890  -5.837  -3.545  1.00 28.22 ? 350 VAL B CG2   1 
ATOM   7784 N  N     . GLU F 3 351 ? 24.619  -6.345  -8.039  1.00 33.48 ? 351 GLU B N     1 
ATOM   7785 C  CA    . GLU F 3 351 ? 24.140  -6.132  -9.401  1.00 35.19 ? 351 GLU B CA    1 
ATOM   7786 C  C     . GLU F 3 351 ? 24.142  -7.434  -10.203 1.00 34.69 ? 351 GLU B C     1 
ATOM   7787 O  O     . GLU F 3 351 ? 23.429  -7.553  -11.200 1.00 35.66 ? 351 GLU B O     1 
ATOM   7788 C  CB    . GLU F 3 351 ? 25.008  -5.081  -10.111 1.00 37.23 ? 351 GLU B CB    1 
ATOM   7789 C  CG    . GLU F 3 351 ? 24.615  -4.828  -11.558 1.00 40.98 ? 351 GLU B CG    1 
ATOM   7790 C  CD    . GLU F 3 351 ? 25.776  -4.945  -12.513 1.00 44.22 ? 351 GLU B CD    1 
ATOM   7791 O  OE1   . GLU F 3 351 ? 26.826  -5.527  -12.126 1.00 45.40 ? 351 GLU B OE1   1 
ATOM   7792 O  OE2   . GLU F 3 351 ? 25.636  -4.468  -13.659 1.00 45.41 ? 351 GLU B OE2   1 
ATOM   7793 N  N     . ALA F 3 352 ? 24.942  -8.400  -9.766  1.00 33.44 ? 352 ALA B N     1 
ATOM   7794 C  CA    . ALA F 3 352 ? 25.036  -9.686  -10.439 1.00 32.84 ? 352 ALA B CA    1 
ATOM   7795 C  C     . ALA F 3 352 ? 23.922  -10.625 -9.965  1.00 32.84 ? 352 ALA B C     1 
ATOM   7796 O  O     . ALA F 3 352 ? 23.348  -11.374 -10.761 1.00 30.69 ? 352 ALA B O     1 
ATOM   7797 C  CB    . ALA F 3 352 ? 26.405  -10.304 -10.175 1.00 31.68 ? 352 ALA B CB    1 
ATOM   7798 N  N     . LEU F 3 353 ? 23.630  -10.581 -8.666  1.00 33.16 ? 353 LEU B N     1 
ATOM   7799 C  CA    . LEU F 3 353 ? 22.574  -11.405 -8.080  1.00 34.46 ? 353 LEU B CA    1 
ATOM   7800 C  C     . LEU F 3 353 ? 21.238  -10.916 -8.634  1.00 35.81 ? 353 LEU B C     1 
ATOM   7801 O  O     . LEU F 3 353 ? 20.436  -11.684 -9.171  1.00 35.34 ? 353 LEU B O     1 
ATOM   7802 C  CB    . LEU F 3 353 ? 22.545  -11.253 -6.557  1.00 33.51 ? 353 LEU B CB    1 
ATOM   7803 C  CG    . LEU F 3 353 ? 23.629  -11.932 -5.727  1.00 33.05 ? 353 LEU B CG    1 
ATOM   7804 C  CD1   . LEU F 3 353 ? 23.400  -11.652 -4.255  1.00 30.91 ? 353 LEU B CD1   1 
ATOM   7805 C  CD2   . LEU F 3 353 ? 23.603  -13.421 -6.004  1.00 33.57 ? 353 LEU B CD2   1 
ATOM   7806 N  N     . ASP F 3 354 ? 21.012  -9.620  -8.485  1.00 36.28 ? 354 ASP B N     1 
ATOM   7807 C  CA    . ASP F 3 354 ? 19.794  -9.006  -8.952  1.00 37.58 ? 354 ASP B CA    1 
ATOM   7808 C  C     . ASP F 3 354 ? 19.618  -9.252  -10.448 1.00 36.88 ? 354 ASP B C     1 
ATOM   7809 O  O     . ASP F 3 354 ? 18.512  -9.180  -10.970 1.00 37.84 ? 354 ASP B O     1 
ATOM   7810 C  CB    . ASP F 3 354 ? 19.838  -7.514  -8.594  1.00 40.95 ? 354 ASP B CB    1 
ATOM   7811 C  CG    . ASP F 3 354 ? 19.385  -6.625  -9.710  1.00 44.93 ? 354 ASP B CG    1 
ATOM   7812 O  OD1   . ASP F 3 354 ? 18.237  -6.776  -10.191 1.00 47.18 ? 354 ASP B OD1   1 
ATOM   7813 O  OD2   . ASP F 3 354 ? 20.181  -5.741  -10.097 1.00 48.08 ? 354 ASP B OD2   1 
ATOM   7814 N  N     . ASN F 3 355 ? 20.704  -9.574  -11.138 1.00 35.91 ? 355 ASN B N     1 
ATOM   7815 C  CA    . ASN F 3 355 ? 20.628  -9.832  -12.576 1.00 34.91 ? 355 ASN B CA    1 
ATOM   7816 C  C     . ASN F 3 355 ? 20.347  -11.319 -12.756 1.00 32.82 ? 355 ASN B C     1 
ATOM   7817 O  O     . ASN F 3 355 ? 19.587  -11.717 -13.639 1.00 33.27 ? 355 ASN B O     1 
ATOM   7818 C  CB    . ASN F 3 355 ? 21.955  -9.450  -13.255 1.00 37.75 ? 355 ASN B CB    1 
ATOM   7819 C  CG    . ASN F 3 355 ? 21.774  -8.959  -14.665 1.00 40.15 ? 355 ASN B CG    1 
ATOM   7820 O  OD1   . ASN F 3 355 ? 22.612  -8.193  -15.187 1.00 41.07 ? 355 ASN B OD1   1 
ATOM   7821 N  ND2   . ASN F 3 355 ? 20.694  -9.411  -15.312 1.00 43.36 ? 355 ASN B ND2   1 
ATOM   7822 N  N     . ALA F 3 356 ? 20.970  -12.134 -11.909 1.00 30.33 ? 356 ALA B N     1 
ATOM   7823 C  CA    . ALA F 3 356 ? 20.805  -13.576 -11.970 1.00 27.33 ? 356 ALA B CA    1 
ATOM   7824 C  C     . ALA F 3 356 ? 19.359  -13.964 -11.694 1.00 26.19 ? 356 ALA B C     1 
ATOM   7825 O  O     . ALA F 3 356 ? 18.871  -14.959 -12.207 1.00 25.91 ? 356 ALA B O     1 
ATOM   7826 C  CB    . ALA F 3 356 ? 21.730  -14.239 -10.962 1.00 26.24 ? 356 ALA B CB    1 
ATOM   7827 N  N     . PHE F 3 357 ? 18.678  -13.167 -10.884 1.00 25.68 ? 357 PHE B N     1 
ATOM   7828 C  CA    . PHE F 3 357 ? 17.294  -13.442 -10.523 1.00 24.69 ? 357 PHE B CA    1 
ATOM   7829 C  C     . PHE F 3 357 ? 16.426  -13.693 -11.742 1.00 25.49 ? 357 PHE B C     1 
ATOM   7830 O  O     . PHE F 3 357 ? 15.641  -14.629 -11.771 1.00 26.83 ? 357 PHE B O     1 
ATOM   7831 C  CB    . PHE F 3 357 ? 16.713  -12.273 -9.726  1.00 22.25 ? 357 PHE B CB    1 
ATOM   7832 C  CG    . PHE F 3 357 ? 15.276  -12.461 -9.337  1.00 20.67 ? 357 PHE B CG    1 
ATOM   7833 C  CD1   . PHE F 3 357 ? 14.934  -13.198 -8.204  1.00 19.45 ? 357 PHE B CD1   1 
ATOM   7834 C  CD2   . PHE F 3 357 ? 14.258  -11.923 -10.120 1.00 19.52 ? 357 PHE B CD2   1 
ATOM   7835 C  CE1   . PHE F 3 357 ? 13.597  -13.401 -7.861  1.00 19.71 ? 357 PHE B CE1   1 
ATOM   7836 C  CE2   . PHE F 3 357 ? 12.912  -12.119 -9.787  1.00 19.43 ? 357 PHE B CE2   1 
ATOM   7837 C  CZ    . PHE F 3 357 ? 12.579  -12.858 -8.656  1.00 19.61 ? 357 PHE B CZ    1 
ATOM   7838 N  N     . TYR F 3 358 ? 16.576  -12.850 -12.753 1.00 27.32 ? 358 TYR B N     1 
ATOM   7839 C  CA    . TYR F 3 358 ? 15.775  -12.958 -13.959 1.00 27.16 ? 358 TYR B CA    1 
ATOM   7840 C  C     . TYR F 3 358 ? 16.190  -14.077 -14.886 1.00 28.24 ? 358 TYR B C     1 
ATOM   7841 O  O     . TYR F 3 358 ? 15.399  -14.532 -15.720 1.00 28.49 ? 358 TYR B O     1 
ATOM   7842 C  CB    . TYR F 3 358 ? 15.791  -11.625 -14.686 1.00 26.34 ? 358 TYR B CB    1 
ATOM   7843 C  CG    . TYR F 3 358 ? 15.098  -10.560 -13.881 1.00 27.99 ? 358 TYR B CG    1 
ATOM   7844 C  CD1   . TYR F 3 358 ? 13.722  -10.641 -13.628 1.00 28.30 ? 358 TYR B CD1   1 
ATOM   7845 C  CD2   . TYR F 3 358 ? 15.813  -9.495  -13.325 1.00 28.46 ? 358 TYR B CD2   1 
ATOM   7846 C  CE1   . TYR F 3 358 ? 13.076  -9.692  -12.841 1.00 28.48 ? 358 TYR B CE1   1 
ATOM   7847 C  CE2   . TYR F 3 358 ? 15.172  -8.535  -12.532 1.00 28.76 ? 358 TYR B CE2   1 
ATOM   7848 C  CZ    . TYR F 3 358 ? 13.808  -8.644  -12.298 1.00 28.86 ? 358 TYR B CZ    1 
ATOM   7849 O  OH    . TYR F 3 358 ? 13.176  -7.701  -11.528 1.00 30.59 ? 358 TYR B OH    1 
ATOM   7850 N  N     . LYS F 3 359 ? 17.424  -14.534 -14.736 1.00 28.17 ? 359 LYS B N     1 
ATOM   7851 C  CA    . LYS F 3 359 ? 17.913  -15.602 -15.581 1.00 27.53 ? 359 LYS B CA    1 
ATOM   7852 C  C     . LYS F 3 359 ? 17.584  -16.976 -15.021 1.00 27.27 ? 359 LYS B C     1 
ATOM   7853 O  O     . LYS F 3 359 ? 17.669  -17.967 -15.746 1.00 28.68 ? 359 LYS B O     1 
ATOM   7854 C  CB    . LYS F 3 359 ? 19.423  -15.462 -15.782 1.00 28.09 ? 359 LYS B CB    1 
ATOM   7855 C  CG    . LYS F 3 359 ? 19.830  -14.170 -16.465 1.00 28.97 ? 359 LYS B CG    1 
ATOM   7856 C  CD    . LYS F 3 359 ? 21.317  -14.122 -16.764 1.00 30.24 ? 359 LYS B CD    1 
ATOM   7857 C  CE    . LYS F 3 359 ? 21.713  -12.729 -17.237 1.00 31.62 ? 359 LYS B CE    1 
ATOM   7858 N  NZ    . LYS F 3 359 ? 22.688  -12.785 -18.356 1.00 33.57 ? 359 LYS B NZ    1 
ATOM   7859 N  N     . SER F 3 360 ? 17.202  -17.051 -13.749 1.00 25.56 ? 360 SER B N     1 
ATOM   7860 C  CA    . SER F 3 360 ? 16.901  -18.352 -13.160 1.00 25.86 ? 360 SER B CA    1 
ATOM   7861 C  C     . SER F 3 360 ? 15.553  -18.926 -13.562 1.00 25.27 ? 360 SER B C     1 
ATOM   7862 O  O     . SER F 3 360 ? 15.338  -20.122 -13.411 1.00 25.77 ? 360 SER B O     1 
ATOM   7863 C  CB    . SER F 3 360 ? 17.026  -18.313 -11.631 1.00 26.54 ? 360 SER B CB    1 
ATOM   7864 O  OG    . SER F 3 360 ? 16.813  -17.002 -11.136 1.00 29.53 ? 360 SER B OG    1 
ATOM   7865 N  N     . PHE F 3 361 ? 14.653  -18.087 -14.070 1.00 24.63 ? 361 PHE B N     1 
ATOM   7866 C  CA    . PHE F 3 361 ? 13.349  -18.569 -14.536 1.00 24.06 ? 361 PHE B CA    1 
ATOM   7867 C  C     . PHE F 3 361 ? 13.515  -19.110 -15.952 1.00 24.49 ? 361 PHE B C     1 
ATOM   7868 O  O     . PHE F 3 361 ? 14.392  -18.671 -16.688 1.00 23.75 ? 361 PHE B O     1 
ATOM   7869 C  CB    . PHE F 3 361 ? 12.309  -17.440 -14.618 1.00 21.62 ? 361 PHE B CB    1 
ATOM   7870 C  CG    . PHE F 3 361 ? 11.900  -16.879 -13.296 1.00 18.94 ? 361 PHE B CG    1 
ATOM   7871 C  CD1   . PHE F 3 361 ? 12.592  -15.823 -12.735 1.00 17.02 ? 361 PHE B CD1   1 
ATOM   7872 C  CD2   . PHE F 3 361 ? 10.794  -17.391 -12.626 1.00 17.74 ? 361 PHE B CD2   1 
ATOM   7873 C  CE1   . PHE F 3 361 ? 12.190  -15.282 -11.527 1.00 17.66 ? 361 PHE B CE1   1 
ATOM   7874 C  CE2   . PHE F 3 361 ? 10.387  -16.857 -11.418 1.00 17.60 ? 361 PHE B CE2   1 
ATOM   7875 C  CZ    . PHE F 3 361 ? 11.083  -15.800 -10.866 1.00 16.89 ? 361 PHE B CZ    1 
ATOM   7876 N  N     . LYS F 3 362 ? 12.677  -20.063 -16.336 1.00 26.26 ? 362 LYS B N     1 
ATOM   7877 C  CA    . LYS F 3 362 ? 12.729  -20.570 -17.696 1.00 28.45 ? 362 LYS B CA    1 
ATOM   7878 C  C     . LYS F 3 362 ? 12.199  -19.404 -18.519 1.00 29.43 ? 362 LYS B C     1 
ATOM   7879 O  O     . LYS F 3 362 ? 11.012  -19.067 -18.468 1.00 30.98 ? 362 LYS B O     1 
ATOM   7880 C  CB    . LYS F 3 362 ? 11.842  -21.806 -17.836 1.00 30.81 ? 362 LYS B CB    1 
ATOM   7881 C  CG    . LYS F 3 362 ? 12.489  -23.039 -17.221 1.00 35.00 ? 362 LYS B CG    1 
ATOM   7882 C  CD    . LYS F 3 362 ? 11.480  -24.036 -16.674 1.00 38.02 ? 362 LYS B CD    1 
ATOM   7883 C  CE    . LYS F 3 362 ? 12.194  -25.130 -15.876 1.00 38.82 ? 362 LYS B CE    1 
ATOM   7884 N  NZ    . LYS F 3 362 ? 11.232  -26.034 -15.185 1.00 40.33 ? 362 LYS B NZ    1 
ATOM   7885 N  N     . LEU F 3 363 ? 13.098  -18.763 -19.251 1.00 29.61 ? 363 LEU B N     1 
ATOM   7886 C  CA    . LEU F 3 363 ? 12.742  -17.604 -20.049 1.00 28.78 ? 363 LEU B CA    1 
ATOM   7887 C  C     . LEU F 3 363 ? 12.003  -17.992 -21.324 1.00 28.19 ? 363 LEU B C     1 
ATOM   7888 O  O     . LEU F 3 363 ? 12.231  -19.071 -21.885 1.00 27.28 ? 363 LEU B O     1 
ATOM   7889 C  CB    . LEU F 3 363 ? 14.017  -16.829 -20.378 1.00 29.35 ? 363 LEU B CB    1 
ATOM   7890 C  CG    . LEU F 3 363 ? 14.923  -16.664 -19.155 1.00 28.71 ? 363 LEU B CG    1 
ATOM   7891 C  CD1   . LEU F 3 363 ? 16.249  -16.040 -19.550 1.00 28.63 ? 363 LEU B CD1   1 
ATOM   7892 C  CD2   . LEU F 3 363 ? 14.201  -15.824 -18.117 1.00 29.89 ? 363 LEU B CD2   1 
ATOM   7893 N  N     . VAL F 3 364 ? 11.113  -17.108 -21.776 1.00 27.23 ? 364 VAL B N     1 
ATOM   7894 C  CA    . VAL F 3 364 ? 10.345  -17.372 -22.984 1.00 25.51 ? 364 VAL B CA    1 
ATOM   7895 C  C     . VAL F 3 364 ? 10.329  -16.200 -23.953 1.00 24.79 ? 364 VAL B C     1 
ATOM   7896 O  O     . VAL F 3 364 ? 10.635  -15.067 -23.587 1.00 25.21 ? 364 VAL B O     1 
ATOM   7897 C  CB    . VAL F 3 364 ? 8.882   -17.730 -22.644 1.00 25.53 ? 364 VAL B CB    1 
ATOM   7898 C  CG1   . VAL F 3 364 ? 8.838   -18.991 -21.803 1.00 24.54 ? 364 VAL B CG1   1 
ATOM   7899 C  CG2   . VAL F 3 364 ? 8.217   -16.563 -21.924 1.00 23.98 ? 364 VAL B CG2   1 
ATOM   7900 N  N     . GLU F 3 365 ? 9.967   -16.493 -25.196 1.00 24.00 ? 365 GLU B N     1 
ATOM   7901 C  CA    . GLU F 3 365 ? 9.866   -15.481 -26.240 1.00 23.04 ? 365 GLU B CA    1 
ATOM   7902 C  C     . GLU F 3 365 ? 8.629   -14.623 -25.942 1.00 21.02 ? 365 GLU B C     1 
ATOM   7903 O  O     . GLU F 3 365 ? 7.583   -15.141 -25.543 1.00 19.48 ? 365 GLU B O     1 
ATOM   7904 C  CB    . GLU F 3 365 ? 9.705   -16.154 -27.609 1.00 23.29 ? 365 GLU B CB    1 
ATOM   7905 C  CG    . GLU F 3 365 ? 10.828  -17.104 -27.976 1.00 24.85 ? 365 GLU B CG    1 
ATOM   7906 C  CD    . GLU F 3 365 ? 11.995  -16.422 -28.681 1.00 28.04 ? 365 GLU B CD    1 
ATOM   7907 O  OE1   . GLU F 3 365 ? 12.994  -17.114 -28.982 1.00 30.66 ? 365 GLU B OE1   1 
ATOM   7908 O  OE2   . GLU F 3 365 ? 11.920  -15.205 -28.950 1.00 28.38 ? 365 GLU B OE2   1 
ATOM   7909 N  N     . PRO F 3 366 ? 8.735   -13.300 -26.132 1.00 19.64 ? 366 PRO B N     1 
ATOM   7910 C  CA    . PRO F 3 366 ? 7.582   -12.440 -25.861 1.00 19.04 ? 366 PRO B CA    1 
ATOM   7911 C  C     . PRO F 3 366 ? 6.429   -12.721 -26.816 1.00 18.74 ? 366 PRO B C     1 
ATOM   7912 O  O     . PRO F 3 366 ? 6.640   -13.194 -27.926 1.00 19.57 ? 366 PRO B O     1 
ATOM   7913 C  CB    . PRO F 3 366 ? 8.158   -11.044 -26.038 1.00 19.56 ? 366 PRO B CB    1 
ATOM   7914 C  CG    . PRO F 3 366 ? 9.196   -11.256 -27.109 1.00 19.26 ? 366 PRO B CG    1 
ATOM   7915 C  CD    . PRO F 3 366 ? 9.864   -12.524 -26.674 1.00 17.88 ? 366 PRO B CD    1 
ATOM   7916 N  N     . THR F 3 367 ? 5.210   -12.443 -26.383 1.00 19.72 ? 367 THR B N     1 
ATOM   7917 C  CA    . THR F 3 367 ? 4.050   -12.654 -27.241 1.00 21.03 ? 367 THR B CA    1 
ATOM   7918 C  C     . THR F 3 367 ? 3.610   -11.311 -27.830 1.00 20.97 ? 367 THR B C     1 
ATOM   7919 O  O     . THR F 3 367 ? 3.009   -11.259 -28.901 1.00 21.10 ? 367 THR B O     1 
ATOM   7920 C  CB    . THR F 3 367 ? 2.885   -13.248 -26.453 1.00 22.37 ? 367 THR B CB    1 
ATOM   7921 O  OG1   . THR F 3 367 ? 2.425   -12.294 -25.481 1.00 22.86 ? 367 THR B OG1   1 
ATOM   7922 C  CG2   . THR F 3 367 ? 3.330   -14.516 -25.745 1.00 22.46 ? 367 THR B CG2   1 
ATOM   7923 N  N     . GLY F 3 368 ? 3.919   -10.229 -27.114 1.00 20.68 ? 368 GLY B N     1 
ATOM   7924 C  CA    . GLY F 3 368 ? 3.566   -8.894  -27.570 1.00 20.15 ? 368 GLY B CA    1 
ATOM   7925 C  C     . GLY F 3 368 ? 2.201   -8.400  -27.130 1.00 18.60 ? 368 GLY B C     1 
ATOM   7926 O  O     . GLY F 3 368 ? 1.838   -7.268  -27.422 1.00 18.19 ? 368 GLY B O     1 
ATOM   7927 N  N     . LYS F 3 369 ? 1.443   -9.250  -26.445 1.00 18.38 ? 369 LYS B N     1 
ATOM   7928 C  CA    . LYS F 3 369 ? 0.116   -8.876  -25.965 1.00 18.11 ? 369 LYS B CA    1 
ATOM   7929 C  C     . LYS F 3 369 ? 0.158   -7.712  -24.983 1.00 17.52 ? 369 LYS B C     1 
ATOM   7930 O  O     . LYS F 3 369 ? 1.227   -7.230  -24.609 1.00 14.84 ? 369 LYS B O     1 
ATOM   7931 C  CB    . LYS F 3 369 ? -0.559  -10.073 -25.294 1.00 19.54 ? 369 LYS B CB    1 
ATOM   7932 C  CG    . LYS F 3 369 ? -1.391  -10.992 -26.195 1.00 19.47 ? 369 LYS B CG    1 
ATOM   7933 C  CD    . LYS F 3 369 ? -0.808  -11.099 -27.584 1.00 23.69 ? 369 LYS B CD    1 
ATOM   7934 C  CE    . LYS F 3 369 ? -1.507  -12.188 -28.363 1.00 25.38 ? 369 LYS B CE    1 
ATOM   7935 N  NZ    . LYS F 3 369 ? -1.219  -12.066 -29.819 1.00 28.62 ? 369 LYS B NZ    1 
ATOM   7936 N  N     . ARG F 3 370 ? -1.024  -7.253  -24.591 1.00 17.08 ? 370 ARG B N     1 
ATOM   7937 C  CA    . ARG F 3 370 ? -1.143  -6.156  -23.645 1.00 17.28 ? 370 ARG B CA    1 
ATOM   7938 C  C     . ARG F 3 370 ? -1.456  -6.743  -22.274 1.00 16.25 ? 370 ARG B C     1 
ATOM   7939 O  O     . ARG F 3 370 ? -2.524  -7.316  -22.061 1.00 15.87 ? 370 ARG B O     1 
ATOM   7940 C  CB    . ARG F 3 370 ? -2.253  -5.199  -24.098 1.00 18.47 ? 370 ARG B CB    1 
ATOM   7941 C  CG    . ARG F 3 370 ? -1.991  -4.602  -25.468 1.00 20.70 ? 370 ARG B CG    1 
ATOM   7942 C  CD    . ARG F 3 370 ? -3.229  -3.997  -26.083 1.00 21.52 ? 370 ARG B CD    1 
ATOM   7943 N  NE    . ARG F 3 370 ? -4.287  -4.979  -26.302 1.00 21.25 ? 370 ARG B NE    1 
ATOM   7944 C  CZ    . ARG F 3 370 ? -5.504  -4.673  -26.748 1.00 22.23 ? 370 ARG B CZ    1 
ATOM   7945 N  NH1   . ARG F 3 370 ? -5.825  -3.409  -27.023 1.00 20.38 ? 370 ARG B NH1   1 
ATOM   7946 N  NH2   . ARG F 3 370 ? -6.401  -5.635  -26.923 1.00 22.58 ? 370 ARG B NH2   1 
ATOM   7947 N  N     . PHE F 3 371 ? -0.522  -6.596  -21.345 1.00 15.58 ? 371 PHE B N     1 
ATOM   7948 C  CA    . PHE F 3 371 ? -0.703  -7.145  -20.011 1.00 15.72 ? 371 PHE B CA    1 
ATOM   7949 C  C     . PHE F 3 371 ? -0.933  -6.110  -18.923 1.00 14.90 ? 371 PHE B C     1 
ATOM   7950 O  O     . PHE F 3 371 ? -0.340  -5.037  -18.939 1.00 16.09 ? 371 PHE B O     1 
ATOM   7951 C  CB    . PHE F 3 371 ? 0.522   -7.965  -19.596 1.00 15.50 ? 371 PHE B CB    1 
ATOM   7952 C  CG    . PHE F 3 371 ? 0.819   -9.136  -20.485 1.00 15.10 ? 371 PHE B CG    1 
ATOM   7953 C  CD1   . PHE F 3 371 ? 1.440   -8.954  -21.718 1.00 15.15 ? 371 PHE B CD1   1 
ATOM   7954 C  CD2   . PHE F 3 371 ? 0.525   -10.434 -20.069 1.00 15.33 ? 371 PHE B CD2   1 
ATOM   7955 C  CE1   . PHE F 3 371 ? 1.766   -10.048 -22.523 1.00 13.45 ? 371 PHE B CE1   1 
ATOM   7956 C  CE2   . PHE F 3 371 ? 0.849   -11.532 -20.870 1.00 14.29 ? 371 PHE B CE2   1 
ATOM   7957 C  CZ    . PHE F 3 371 ? 1.474   -11.334 -22.095 1.00 12.35 ? 371 PHE B CZ    1 
ATOM   7958 N  N     . LEU F 3 372 ? -1.810  -6.443  -17.984 1.00 14.61 ? 372 LEU B N     1 
ATOM   7959 C  CA    . LEU F 3 372 ? -2.066  -5.595  -16.824 1.00 13.92 ? 372 LEU B CA    1 
ATOM   7960 C  C     . LEU F 3 372 ? -1.628  -6.505  -15.671 1.00 13.17 ? 372 LEU B C     1 
ATOM   7961 O  O     . LEU F 3 372 ? -2.181  -7.591  -15.455 1.00 11.21 ? 372 LEU B O     1 
ATOM   7962 C  CB    . LEU F 3 372 ? -3.549  -5.234  -16.692 1.00 14.78 ? 372 LEU B CB    1 
ATOM   7963 C  CG    . LEU F 3 372 ? -3.951  -4.247  -15.580 1.00 15.08 ? 372 LEU B CG    1 
ATOM   7964 C  CD1   . LEU F 3 372 ? -3.799  -4.867  -14.203 1.00 12.87 ? 372 LEU B CD1   1 
ATOM   7965 C  CD2   . LEU F 3 372 ? -3.105  -3.013  -15.687 1.00 14.29 ? 372 LEU B CD2   1 
ATOM   7966 N  N     . LEU F 3 373 ? -0.596  -6.076  -14.966 1.00 13.44 ? 373 LEU B N     1 
ATOM   7967 C  CA    . LEU F 3 373 ? -0.059  -6.846  -13.858 1.00 13.51 ? 373 LEU B CA    1 
ATOM   7968 C  C     . LEU F 3 373 ? -0.433  -6.159  -12.554 1.00 13.55 ? 373 LEU B C     1 
ATOM   7969 O  O     . LEU F 3 373 ? 0.005   -5.045  -12.295 1.00 15.70 ? 373 LEU B O     1 
ATOM   7970 C  CB    . LEU F 3 373 ? 1.455   -6.955  -14.020 1.00 12.02 ? 373 LEU B CB    1 
ATOM   7971 C  CG    . LEU F 3 373 ? 1.872   -7.357  -15.446 1.00 12.91 ? 373 LEU B CG    1 
ATOM   7972 C  CD1   . LEU F 3 373 ? 3.402   -7.490  -15.522 1.00 15.42 ? 373 LEU B CD1   1 
ATOM   7973 C  CD2   . LEU F 3 373 ? 1.211   -8.671  -15.839 1.00 11.96 ? 373 LEU B CD2   1 
ATOM   7974 N  N     . ALA F 3 374 ? -1.255  -6.824  -11.745 1.00 14.17 ? 374 ALA B N     1 
ATOM   7975 C  CA    . ALA F 3 374 ? -1.722  -6.271  -10.473 1.00 14.01 ? 374 ALA B CA    1 
ATOM   7976 C  C     . ALA F 3 374 ? -1.219  -7.018  -9.236  1.00 14.24 ? 374 ALA B C     1 
ATOM   7977 O  O     . ALA F 3 374 ? -1.495  -8.209  -9.048  1.00 12.22 ? 374 ALA B O     1 
ATOM   7978 C  CB    . ALA F 3 374 ? -3.246  -6.234  -10.464 1.00 14.08 ? 374 ALA B CB    1 
ATOM   7979 N  N     . ILE F 3 375 ? -0.515  -6.284  -8.381  1.00 15.37 ? 375 ILE B N     1 
ATOM   7980 C  CA    . ILE F 3 375 ? 0.050   -6.828  -7.148  1.00 16.04 ? 375 ILE B CA    1 
ATOM   7981 C  C     . ILE F 3 375 ? -0.802  -6.575  -5.901  1.00 17.08 ? 375 ILE B C     1 
ATOM   7982 O  O     . ILE F 3 375 ? -1.014  -5.435  -5.494  1.00 19.81 ? 375 ILE B O     1 
ATOM   7983 C  CB    . ILE F 3 375 ? 1.448   -6.237  -6.884  1.00 15.78 ? 375 ILE B CB    1 
ATOM   7984 C  CG1   . ILE F 3 375 ? 2.359   -6.530  -8.076  1.00 16.07 ? 375 ILE B CG1   1 
ATOM   7985 C  CG2   . ILE F 3 375 ? 2.036   -6.809  -5.598  1.00 15.56 ? 375 ILE B CG2   1 
ATOM   7986 C  CD1   . ILE F 3 375 ? 3.696   -5.850  -7.983  1.00 16.71 ? 375 ILE B CD1   1 
ATOM   7987 N  N     . ASP F 3 376 ? -1.279  -7.647  -5.289  1.00 16.20 ? 376 ASP B N     1 
ATOM   7988 C  CA    . ASP F 3 376 ? -2.077  -7.540  -4.081  1.00 16.02 ? 376 ASP B CA    1 
ATOM   7989 C  C     . ASP F 3 376 ? -1.143  -7.080  -2.953  1.00 15.97 ? 376 ASP B C     1 
ATOM   7990 O  O     . ASP F 3 376 ? -0.239  -7.814  -2.556  1.00 16.68 ? 376 ASP B O     1 
ATOM   7991 C  CB    . ASP F 3 376 ? -2.646  -8.911  -3.770  1.00 17.10 ? 376 ASP B CB    1 
ATOM   7992 C  CG    . ASP F 3 376 ? -3.584  -8.894  -2.620  1.00 19.37 ? 376 ASP B CG    1 
ATOM   7993 O  OD1   . ASP F 3 376 ? -3.357  -8.096  -1.690  1.00 23.45 ? 376 ASP B OD1   1 
ATOM   7994 O  OD2   . ASP F 3 376 ? -4.541  -9.690  -2.637  1.00 19.76 ? 376 ASP B OD2   1 
ATOM   7995 N  N     . VAL F 3 377 ? -1.348  -5.870  -2.444  1.00 15.78 ? 377 VAL B N     1 
ATOM   7996 C  CA    . VAL F 3 377 ? -0.495  -5.338  -1.377  1.00 16.30 ? 377 VAL B CA    1 
ATOM   7997 C  C     . VAL F 3 377 ? -1.202  -5.151  -0.037  1.00 17.20 ? 377 VAL B C     1 
ATOM   7998 O  O     . VAL F 3 377 ? -0.737  -4.374  0.804   1.00 17.69 ? 377 VAL B O     1 
ATOM   7999 C  CB    . VAL F 3 377 ? 0.152   -3.975  -1.774  1.00 14.74 ? 377 VAL B CB    1 
ATOM   8000 C  CG1   . VAL F 3 377 ? 1.294   -4.205  -2.713  1.00 15.35 ? 377 VAL B CG1   1 
ATOM   8001 C  CG2   . VAL F 3 377 ? -0.868  -3.085  -2.448  1.00 13.64 ? 377 VAL B CG2   1 
ATOM   8002 N  N     . SER F 3 378 ? -2.306  -5.871  0.163   1.00 17.48 ? 378 SER B N     1 
ATOM   8003 C  CA    . SER F 3 378 ? -3.071  -5.791  1.408   1.00 18.13 ? 378 SER B CA    1 
ATOM   8004 C  C     . SER F 3 378 ? -2.307  -6.383  2.600   1.00 20.05 ? 378 SER B C     1 
ATOM   8005 O  O     . SER F 3 378 ? -1.318  -7.090  2.428   1.00 21.21 ? 378 SER B O     1 
ATOM   8006 C  CB    . SER F 3 378 ? -4.430  -6.489  1.240   1.00 16.55 ? 378 SER B CB    1 
ATOM   8007 O  OG    . SER F 3 378 ? -4.288  -7.832  0.811   1.00 13.93 ? 378 SER B OG    1 
ATOM   8008 N  N     . ALA F 3 379 ? -2.774  -6.085  3.808   1.00 21.41 ? 379 ALA B N     1 
ATOM   8009 C  CA    . ALA F 3 379 ? -2.145  -6.550  5.046   1.00 22.18 ? 379 ALA B CA    1 
ATOM   8010 C  C     . ALA F 3 379 ? -1.738  -8.026  5.050   1.00 22.90 ? 379 ALA B C     1 
ATOM   8011 O  O     . ALA F 3 379 ? -0.640  -8.380  5.491   1.00 23.55 ? 379 ALA B O     1 
ATOM   8012 C  CB    . ALA F 3 379 ? -3.074  -6.268  6.229   1.00 23.27 ? 379 ALA B CB    1 
ATOM   8013 N  N     . SER F 3 380 ? -2.631  -8.886  4.576   1.00 22.69 ? 380 SER B N     1 
ATOM   8014 C  CA    . SER F 3 380 ? -2.350  -10.313 4.533   1.00 21.25 ? 380 SER B CA    1 
ATOM   8015 C  C     . SER F 3 380 ? -1.098  -10.640 3.726   1.00 20.22 ? 380 SER B C     1 
ATOM   8016 O  O     . SER F 3 380 ? -0.383  -11.565 4.060   1.00 19.30 ? 380 SER B O     1 
ATOM   8017 C  CB    . SER F 3 380 ? -3.554  -11.076 3.961   1.00 22.89 ? 380 SER B CB    1 
ATOM   8018 O  OG    . SER F 3 380 ? -3.963  -10.568 2.701   1.00 22.31 ? 380 SER B OG    1 
ATOM   8019 N  N     . MET F 3 381 ? -0.825  -9.881  2.670   1.00 20.13 ? 381 MET B N     1 
ATOM   8020 C  CA    . MET F 3 381 ? 0.353   -10.140 1.853   1.00 19.98 ? 381 MET B CA    1 
ATOM   8021 C  C     . MET F 3 381 ? 1.643   -9.891  2.613   1.00 19.30 ? 381 MET B C     1 
ATOM   8022 O  O     . MET F 3 381 ? 2.733   -9.931  2.045   1.00 18.47 ? 381 MET B O     1 
ATOM   8023 C  CB    . MET F 3 381 ? 0.313   -9.303  0.575   1.00 21.37 ? 381 MET B CB    1 
ATOM   8024 C  CG    . MET F 3 381 ? -0.862  -9.677  -0.331  1.00 24.24 ? 381 MET B CG    1 
ATOM   8025 S  SD    . MET F 3 381 ? -0.851  -11.434 -0.826  1.00 26.75 ? 381 MET B SD    1 
ATOM   8026 C  CE    . MET F 3 381 ? 0.418   -11.420 -2.105  1.00 22.03 ? 381 MET B CE    1 
ATOM   8027 N  N     . ASN F 3 382 ? 1.495   -9.631  3.908   1.00 19.31 ? 382 ASN B N     1 
ATOM   8028 C  CA    . ASN F 3 382 ? 2.619   -9.410  4.801   1.00 19.22 ? 382 ASN B CA    1 
ATOM   8029 C  C     . ASN F 3 382 ? 3.128   -10.779 5.253   1.00 18.16 ? 382 ASN B C     1 
ATOM   8030 O  O     . ASN F 3 382 ? 4.236   -10.906 5.744   1.00 17.58 ? 382 ASN B O     1 
ATOM   8031 C  CB    . ASN F 3 382 ? 2.164   -8.609  6.008   1.00 22.84 ? 382 ASN B CB    1 
ATOM   8032 C  CG    . ASN F 3 382 ? 3.017   -7.386  6.242   1.00 27.71 ? 382 ASN B CG    1 
ATOM   8033 O  OD1   . ASN F 3 382 ? 2.655   -6.268  5.861   1.00 28.22 ? 382 ASN B OD1   1 
ATOM   8034 N  ND2   . ASN F 3 382 ? 4.171   -7.591  6.867   1.00 30.07 ? 382 ASN B ND2   1 
ATOM   8035 N  N     . GLN F 3 383 ? 2.289   -11.797 5.085   1.00 19.63 ? 383 GLN B N     1 
ATOM   8036 C  CA    . GLN F 3 383 ? 2.617   -13.170 5.440   1.00 20.96 ? 383 GLN B CA    1 
ATOM   8037 C  C     . GLN F 3 383 ? 3.951   -13.577 4.832   1.00 23.10 ? 383 GLN B C     1 
ATOM   8038 O  O     . GLN F 3 383 ? 4.246   -13.254 3.677   1.00 25.28 ? 383 GLN B O     1 
ATOM   8039 C  CB    . GLN F 3 383 ? 1.534   -14.102 4.917   1.00 20.64 ? 383 GLN B CB    1 
ATOM   8040 C  CG    . GLN F 3 383 ? 1.392   -14.017 3.414   1.00 22.79 ? 383 GLN B CG    1 
ATOM   8041 C  CD    . GLN F 3 383 ? 0.019   -14.422 2.941   1.00 23.86 ? 383 GLN B CD    1 
ATOM   8042 O  OE1   . GLN F 3 383 ? -0.114  -15.317 2.110   1.00 28.75 ? 383 GLN B OE1   1 
ATOM   8043 N  NE2   . GLN F 3 383 ? -1.014  -13.753 3.463   1.00 27.61 ? 383 GLN B NE2   1 
ATOM   8044 N  N     . ARG F 3 384 ? 4.748   -14.303 5.606   1.00 23.75 ? 384 ARG B N     1 
ATOM   8045 C  CA    . ARG F 3 384 ? 6.046   -14.765 5.157   1.00 23.77 ? 384 ARG B CA    1 
ATOM   8046 C  C     . ARG F 3 384 ? 5.970   -16.003 4.278   1.00 24.52 ? 384 ARG B C     1 
ATOM   8047 O  O     . ARG F 3 384 ? 5.174   -16.905 4.535   1.00 24.98 ? 384 ARG B O     1 
ATOM   8048 C  CB    . ARG F 3 384 ? 6.932   -15.005 6.374   1.00 24.09 ? 384 ARG B CB    1 
ATOM   8049 C  CG    . ARG F 3 384 ? 7.830   -13.836 6.585   1.00 27.64 ? 384 ARG B CG    1 
ATOM   8050 C  CD    . ARG F 3 384 ? 8.231   -13.629 8.023   1.00 30.87 ? 384 ARG B CD    1 
ATOM   8051 N  NE    . ARG F 3 384 ? 8.543   -12.253 8.193   1.00 33.39 ? 384 ARG B NE    1 
ATOM   8052 C  CZ    . ARG F 3 384 ? 9.639   -11.618 8.581   1.00 36.97 ? 384 ARG B CZ    1 
ATOM   8053 N  NH1   . ARG F 3 384 ? 10.801  -12.163 8.946   1.00 38.16 ? 384 ARG B NH1   1 
ATOM   8054 N  NH2   . ARG F 3 384 ? 9.528   -10.309 8.538   1.00 39.22 ? 384 ARG B NH2   1 
ATOM   8055 N  N     . VAL F 3 385 ? 6.808   -16.035 3.244   1.00 24.82 ? 385 VAL B N     1 
ATOM   8056 C  CA    . VAL F 3 385 ? 6.856   -17.131 2.292   1.00 26.08 ? 385 VAL B CA    1 
ATOM   8057 C  C     . VAL F 3 385 ? 8.004   -18.071 2.606   1.00 26.74 ? 385 VAL B C     1 
ATOM   8058 O  O     . VAL F 3 385 ? 9.076   -17.639 3.029   1.00 27.67 ? 385 VAL B O     1 
ATOM   8059 C  CB    . VAL F 3 385 ? 7.092   -16.630 0.839   1.00 26.77 ? 385 VAL B CB    1 
ATOM   8060 C  CG1   . VAL F 3 385 ? 5.985   -17.107 -0.060  1.00 28.45 ? 385 VAL B CG1   1 
ATOM   8061 C  CG2   . VAL F 3 385 ? 7.169   -15.144 0.799   1.00 29.38 ? 385 VAL B CG2   1 
ATOM   8062 N  N     . LEU F 3 386 ? 7.773   -19.358 2.369   1.00 27.70 ? 386 LEU B N     1 
ATOM   8063 C  CA    . LEU F 3 386 ? 8.772   -20.404 2.579   1.00 27.51 ? 386 LEU B CA    1 
ATOM   8064 C  C     . LEU F 3 386 ? 9.566   -20.280 3.873   1.00 26.91 ? 386 LEU B C     1 
ATOM   8065 O  O     . LEU F 3 386 ? 10.752  -20.625 3.912   1.00 27.03 ? 386 LEU B O     1 
ATOM   8066 C  CB    . LEU F 3 386 ? 9.743   -20.445 1.392   1.00 28.03 ? 386 LEU B CB    1 
ATOM   8067 C  CG    . LEU F 3 386 ? 9.128   -20.627 -0.003  1.00 28.88 ? 386 LEU B CG    1 
ATOM   8068 C  CD1   . LEU F 3 386 ? 9.942   -21.628 -0.783  1.00 29.77 ? 386 LEU B CD1   1 
ATOM   8069 C  CD2   . LEU F 3 386 ? 7.702   -21.126 0.101   1.00 31.91 ? 386 LEU B CD2   1 
ATOM   8070 N  N     . GLY F 3 387 ? 8.908   -19.794 4.922   1.00 26.27 ? 387 GLY B N     1 
ATOM   8071 C  CA    . GLY F 3 387 ? 9.570   -19.634 6.197   1.00 24.94 ? 387 GLY B CA    1 
ATOM   8072 C  C     . GLY F 3 387 ? 10.788  -18.747 6.092   1.00 23.22 ? 387 GLY B C     1 
ATOM   8073 O  O     . GLY F 3 387 ? 11.702  -18.852 6.905   1.00 24.47 ? 387 GLY B O     1 
ATOM   8074 N  N     . SER F 3 388 ? 10.801  -17.883 5.084   1.00 22.98 ? 388 SER B N     1 
ATOM   8075 C  CA    . SER F 3 388 ? 11.908  -16.969 4.857   1.00 22.88 ? 388 SER B CA    1 
ATOM   8076 C  C     . SER F 3 388 ? 11.539  -15.586 5.361   1.00 23.83 ? 388 SER B C     1 
ATOM   8077 O  O     . SER F 3 388 ? 10.532  -15.392 6.048   1.00 24.81 ? 388 SER B O     1 
ATOM   8078 C  CB    . SER F 3 388 ? 12.235  -16.877 3.369   1.00 21.58 ? 388 SER B CB    1 
ATOM   8079 O  OG    . SER F 3 388 ? 11.263  -16.106 2.697   1.00 17.03 ? 388 SER B OG    1 
ATOM   8080 N  N     . ILE F 3 389 ? 12.357  -14.614 4.999   1.00 24.48 ? 389 ILE B N     1 
ATOM   8081 C  CA    . ILE F 3 389 ? 12.145  -13.246 5.427   1.00 25.61 ? 389 ILE B CA    1 
ATOM   8082 C  C     . ILE F 3 389 ? 11.493  -12.410 4.361   1.00 23.89 ? 389 ILE B C     1 
ATOM   8083 O  O     . ILE F 3 389 ? 11.332  -11.204 4.510   1.00 25.04 ? 389 ILE B O     1 
ATOM   8084 C  CB    . ILE F 3 389 ? 13.449  -12.609 5.801   1.00 28.85 ? 389 ILE B CB    1 
ATOM   8085 C  CG1   . ILE F 3 389 ? 13.982  -13.211 7.078   1.00 31.14 ? 389 ILE B CG1   1 
ATOM   8086 C  CG2   . ILE F 3 389 ? 13.240  -11.156 6.082   1.00 31.53 ? 389 ILE B CG2   1 
ATOM   8087 C  CD1   . ILE F 3 389 ? 15.338  -12.689 7.354   1.00 34.66 ? 389 ILE B CD1   1 
ATOM   8088 N  N     . LEU F 3 390 ? 11.115  -13.060 3.279   1.00 22.68 ? 390 LEU B N     1 
ATOM   8089 C  CA    . LEU F 3 390 ? 10.442  -12.362 2.198   1.00 23.06 ? 390 LEU B CA    1 
ATOM   8090 C  C     . LEU F 3 390 ? 8.942   -12.585 2.418   1.00 22.90 ? 390 LEU B C     1 
ATOM   8091 O  O     . LEU F 3 390 ? 8.547   -13.634 2.924   1.00 24.15 ? 390 LEU B O     1 
ATOM   8092 C  CB    . LEU F 3 390 ? 10.894  -12.960 0.878   1.00 22.05 ? 390 LEU B CB    1 
ATOM   8093 C  CG    . LEU F 3 390 ? 12.394  -12.764 0.637   1.00 22.95 ? 390 LEU B CG    1 
ATOM   8094 C  CD1   . LEU F 3 390 ? 12.864  -13.635 -0.520  1.00 23.25 ? 390 LEU B CD1   1 
ATOM   8095 C  CD2   . LEU F 3 390 ? 12.676  -11.290 0.359   1.00 23.28 ? 390 LEU B CD2   1 
ATOM   8096 N  N     . ASN F 3 391 ? 8.113   -11.599 2.089   1.00 20.71 ? 391 ASN B N     1 
ATOM   8097 C  CA    . ASN F 3 391 ? 6.669   -11.761 2.259   1.00 18.50 ? 391 ASN B CA    1 
ATOM   8098 C  C     . ASN F 3 391 ? 6.009   -11.950 0.904   1.00 15.86 ? 391 ASN B C     1 
ATOM   8099 O  O     . ASN F 3 391 ? 6.651   -11.808 -0.116  1.00 16.83 ? 391 ASN B O     1 
ATOM   8100 C  CB    . ASN F 3 391 ? 6.073   -10.540 2.959   1.00 19.76 ? 391 ASN B CB    1 
ATOM   8101 C  CG    . ASN F 3 391 ? 6.267   -9.272  2.169   1.00 21.46 ? 391 ASN B CG    1 
ATOM   8102 O  OD1   . ASN F 3 391 ? 6.182   -9.282  0.942   1.00 23.01 ? 391 ASN B OD1   1 
ATOM   8103 N  ND2   . ASN F 3 391 ? 6.511   -8.163  2.865   1.00 22.50 ? 391 ASN B ND2   1 
ATOM   8104 N  N     . ALA F 3 392 ? 4.724   -12.261 0.879   1.00 14.77 ? 392 ALA B N     1 
ATOM   8105 C  CA    . ALA F 3 392 ? 4.050   -12.458 -0.401  1.00 13.97 ? 392 ALA B CA    1 
ATOM   8106 C  C     . ALA F 3 392 ? 4.108   -11.184 -1.237  1.00 15.64 ? 392 ALA B C     1 
ATOM   8107 O  O     . ALA F 3 392 ? 4.234   -11.216 -2.467  1.00 16.46 ? 392 ALA B O     1 
ATOM   8108 C  CB    . ALA F 3 392 ? 2.611   -12.867 -0.185  1.00 10.04 ? 392 ALA B CB    1 
ATOM   8109 N  N     . SER F 3 393 ? 4.017   -10.052 -0.562  1.00 16.05 ? 393 SER B N     1 
ATOM   8110 C  CA    . SER F 3 393 ? 4.052   -8.792  -1.247  1.00 16.84 ? 393 SER B CA    1 
ATOM   8111 C  C     . SER F 3 393 ? 5.288   -8.696  -2.151  1.00 18.11 ? 393 SER B C     1 
ATOM   8112 O  O     . SER F 3 393 ? 5.176   -8.491  -3.369  1.00 18.14 ? 393 SER B O     1 
ATOM   8113 C  CB    . SER F 3 393 ? 4.060   -7.680  -0.217  1.00 17.17 ? 393 SER B CB    1 
ATOM   8114 O  OG    . SER F 3 393 ? 3.575   -6.480  -0.793  1.00 24.75 ? 393 SER B OG    1 
ATOM   8115 N  N     . VAL F 3 394 ? 6.463   -8.869  -1.545  1.00 18.51 ? 394 VAL B N     1 
ATOM   8116 C  CA    . VAL F 3 394 ? 7.746   -8.786  -2.244  1.00 18.14 ? 394 VAL B CA    1 
ATOM   8117 C  C     . VAL F 3 394 ? 7.868   -9.795  -3.385  1.00 18.59 ? 394 VAL B C     1 
ATOM   8118 O  O     . VAL F 3 394 ? 8.260   -9.443  -4.506  1.00 18.51 ? 394 VAL B O     1 
ATOM   8119 C  CB    . VAL F 3 394 ? 8.934   -8.995  -1.250  1.00 16.43 ? 394 VAL B CB    1 
ATOM   8120 C  CG1   . VAL F 3 394 ? 10.237  -8.737  -1.941  1.00 16.58 ? 394 VAL B CG1   1 
ATOM   8121 C  CG2   . VAL F 3 394 ? 8.802   -8.059  -0.069  1.00 17.39 ? 394 VAL B CG2   1 
ATOM   8122 N  N     . VAL F 3 395 ? 7.534   -11.048 -3.092  1.00 18.60 ? 395 VAL B N     1 
ATOM   8123 C  CA    . VAL F 3 395 ? 7.602   -12.114 -4.080  1.00 19.17 ? 395 VAL B CA    1 
ATOM   8124 C  C     . VAL F 3 395 ? 6.678   -11.827 -5.255  1.00 20.18 ? 395 VAL B C     1 
ATOM   8125 O  O     . VAL F 3 395 ? 7.061   -11.991 -6.413  1.00 21.14 ? 395 VAL B O     1 
ATOM   8126 C  CB    . VAL F 3 395 ? 7.227   -13.459 -3.443  1.00 19.91 ? 395 VAL B CB    1 
ATOM   8127 C  CG1   . VAL F 3 395 ? 6.800   -14.427 -4.493  1.00 18.91 ? 395 VAL B CG1   1 
ATOM   8128 C  CG2   . VAL F 3 395 ? 8.407   -14.015 -2.686  1.00 19.37 ? 395 VAL B CG2   1 
ATOM   8129 N  N     . ALA F 3 396 ? 5.462   -11.393 -4.957  1.00 20.80 ? 396 ALA B N     1 
ATOM   8130 C  CA    . ALA F 3 396 ? 4.507   -11.074 -6.004  1.00 22.28 ? 396 ALA B CA    1 
ATOM   8131 C  C     . ALA F 3 396 ? 5.071   -9.968  -6.904  1.00 23.61 ? 396 ALA B C     1 
ATOM   8132 O  O     . ALA F 3 396 ? 4.942   -10.011 -8.134  1.00 24.34 ? 396 ALA B O     1 
ATOM   8133 C  CB    . ALA F 3 396 ? 3.194   -10.628 -5.386  1.00 23.46 ? 396 ALA B CB    1 
ATOM   8134 N  N     . ALA F 3 397 ? 5.704   -8.976  -6.288  1.00 23.47 ? 397 ALA B N     1 
ATOM   8135 C  CA    . ALA F 3 397 ? 6.282   -7.881  -7.054  1.00 22.86 ? 397 ALA B CA    1 
ATOM   8136 C  C     . ALA F 3 397 ? 7.399   -8.392  -7.964  1.00 22.59 ? 397 ALA B C     1 
ATOM   8137 O  O     . ALA F 3 397 ? 7.506   -7.982  -9.114  1.00 22.31 ? 397 ALA B O     1 
ATOM   8138 C  CB    . ALA F 3 397 ? 6.809   -6.804  -6.111  1.00 22.60 ? 397 ALA B CB    1 
ATOM   8139 N  N     . ALA F 3 398 ? 8.224   -9.296  -7.444  1.00 23.03 ? 398 ALA B N     1 
ATOM   8140 C  CA    . ALA F 3 398 ? 9.328   -9.861  -8.214  1.00 22.33 ? 398 ALA B CA    1 
ATOM   8141 C  C     . ALA F 3 398 ? 8.791   -10.622 -9.418  1.00 22.79 ? 398 ALA B C     1 
ATOM   8142 O  O     . ALA F 3 398 ? 9.303   -10.474 -10.526 1.00 20.74 ? 398 ALA B O     1 
ATOM   8143 C  CB    . ALA F 3 398 ? 10.159  -10.782 -7.335  1.00 20.59 ? 398 ALA B CB    1 
ATOM   8144 N  N     . MET F 3 399 ? 7.763   -11.441 -9.198  1.00 24.36 ? 399 MET B N     1 
ATOM   8145 C  CA    . MET F 3 399 ? 7.157   -12.199 -10.290 1.00 26.78 ? 399 MET B CA    1 
ATOM   8146 C  C     . MET F 3 399 ? 6.627   -11.197 -11.306 1.00 27.51 ? 399 MET B C     1 
ATOM   8147 O  O     . MET F 3 399 ? 6.682   -11.410 -12.521 1.00 27.40 ? 399 MET B O     1 
ATOM   8148 C  CB    . MET F 3 399 ? 6.007   -13.058 -9.777  1.00 27.82 ? 399 MET B CB    1 
ATOM   8149 C  CG    . MET F 3 399 ? 6.450   -14.326 -9.078  1.00 32.06 ? 399 MET B CG    1 
ATOM   8150 S  SD    . MET F 3 399 ? 7.357   -15.429 -10.181 1.00 35.44 ? 399 MET B SD    1 
ATOM   8151 C  CE    . MET F 3 399 ? 6.016   -16.168 -11.082 1.00 36.14 ? 399 MET B CE    1 
ATOM   8152 N  N     . CYS F 3 400 ? 6.125   -10.089 -10.776 1.00 27.38 ? 400 CYS B N     1 
ATOM   8153 C  CA    . CYS F 3 400 ? 5.579   -9.011  -11.577 1.00 27.19 ? 400 CYS B CA    1 
ATOM   8154 C  C     . CYS F 3 400 ? 6.674   -8.400  -12.456 1.00 25.37 ? 400 CYS B C     1 
ATOM   8155 O  O     . CYS F 3 400 ? 6.484   -8.217  -13.661 1.00 25.51 ? 400 CYS B O     1 
ATOM   8156 C  CB    . CYS F 3 400 ? 4.985   -7.958  -10.644 1.00 28.72 ? 400 CYS B CB    1 
ATOM   8157 S  SG    . CYS F 3 400 ? 4.091   -6.648  -11.458 1.00 34.41 ? 400 CYS B SG    1 
ATOM   8158 N  N     . MET F 3 401 ? 7.815   -8.082  -11.851 1.00 23.26 ? 401 MET B N     1 
ATOM   8159 C  CA    . MET F 3 401 ? 8.925   -7.507  -12.591 1.00 21.19 ? 401 MET B CA    1 
ATOM   8160 C  C     . MET F 3 401 ? 9.330   -8.458  -13.706 1.00 22.56 ? 401 MET B C     1 
ATOM   8161 O  O     . MET F 3 401 ? 9.594   -8.022  -14.827 1.00 24.48 ? 401 MET B O     1 
ATOM   8162 C  CB    . MET F 3 401 ? 10.118  -7.243  -11.669 1.00 19.32 ? 401 MET B CB    1 
ATOM   8163 C  CG    . MET F 3 401 ? 9.969   -6.027  -10.734 1.00 17.39 ? 401 MET B CG    1 
ATOM   8164 S  SD    . MET F 3 401 ? 10.162  -4.393  -11.532 1.00 16.76 ? 401 MET B SD    1 
ATOM   8165 C  CE    . MET F 3 401 ? 11.908  -4.267  -11.686 1.00 11.90 ? 401 MET B CE    1 
ATOM   8166 N  N     . LEU F 3 402 ? 9.348   -9.757  -13.413 1.00 22.52 ? 402 LEU B N     1 
ATOM   8167 C  CA    . LEU F 3 402 ? 9.727   -10.759 -14.412 1.00 22.60 ? 402 LEU B CA    1 
ATOM   8168 C  C     . LEU F 3 402 ? 8.842   -10.694 -15.667 1.00 22.77 ? 402 LEU B C     1 
ATOM   8169 O  O     . LEU F 3 402 ? 9.346   -10.608 -16.796 1.00 22.49 ? 402 LEU B O     1 
ATOM   8170 C  CB    . LEU F 3 402 ? 9.661   -12.169 -13.806 1.00 22.36 ? 402 LEU B CB    1 
ATOM   8171 C  CG    . LEU F 3 402 ? 9.981   -13.332 -14.759 1.00 22.72 ? 402 LEU B CG    1 
ATOM   8172 C  CD1   . LEU F 3 402 ? 11.442  -13.318 -15.168 1.00 23.13 ? 402 LEU B CD1   1 
ATOM   8173 C  CD2   . LEU F 3 402 ? 9.652   -14.630 -14.082 1.00 24.58 ? 402 LEU B CD2   1 
ATOM   8174 N  N     . VAL F 3 403 ? 7.528   -10.747 -15.461 1.00 21.52 ? 403 VAL B N     1 
ATOM   8175 C  CA    . VAL F 3 403 ? 6.571   -10.689 -16.555 1.00 21.24 ? 403 VAL B CA    1 
ATOM   8176 C  C     . VAL F 3 403 ? 6.629   -9.357  -17.289 1.00 21.71 ? 403 VAL B C     1 
ATOM   8177 O  O     . VAL F 3 403 ? 6.379   -9.291  -18.486 1.00 21.53 ? 403 VAL B O     1 
ATOM   8178 C  CB    . VAL F 3 403 ? 5.122   -10.907 -16.045 1.00 21.56 ? 403 VAL B CB    1 
ATOM   8179 C  CG1   . VAL F 3 403 ? 4.125   -10.297 -17.014 1.00 22.94 ? 403 VAL B CG1   1 
ATOM   8180 C  CG2   . VAL F 3 403 ? 4.837   -12.393 -15.918 1.00 21.87 ? 403 VAL B CG2   1 
ATOM   8181 N  N     . ALA F 3 404 ? 6.964   -8.297  -16.567 1.00 22.42 ? 404 ALA B N     1 
ATOM   8182 C  CA    . ALA F 3 404 ? 7.035   -6.974  -17.157 1.00 24.34 ? 404 ALA B CA    1 
ATOM   8183 C  C     . ALA F 3 404 ? 8.274   -6.732  -18.002 1.00 26.59 ? 404 ALA B C     1 
ATOM   8184 O  O     . ALA F 3 404 ? 8.262   -5.875  -18.891 1.00 26.02 ? 404 ALA B O     1 
ATOM   8185 C  CB    . ALA F 3 404 ? 6.959   -5.934  -16.077 1.00 24.08 ? 404 ALA B CB    1 
ATOM   8186 N  N     . ARG F 3 405 ? 9.349   -7.469  -17.733 1.00 28.42 ? 405 ARG B N     1 
ATOM   8187 C  CA    . ARG F 3 405 ? 10.577  -7.263  -18.492 1.00 29.53 ? 405 ARG B CA    1 
ATOM   8188 C  C     . ARG F 3 405 ? 10.652  -8.183  -19.693 1.00 28.85 ? 405 ARG B C     1 
ATOM   8189 O  O     . ARG F 3 405 ? 11.582  -8.096  -20.489 1.00 30.43 ? 405 ARG B O     1 
ATOM   8190 C  CB    . ARG F 3 405 ? 11.795  -7.389  -17.552 1.00 31.56 ? 405 ARG B CB    1 
ATOM   8191 C  CG    . ARG F 3 405 ? 11.414  -6.755  -16.214 1.00 33.20 ? 405 ARG B CG    1 
ATOM   8192 C  CD    . ARG F 3 405 ? 12.433  -6.029  -15.312 1.00 35.77 ? 405 ARG B CD    1 
ATOM   8193 N  NE    . ARG F 3 405 ? 13.869  -6.141  -15.541 1.00 35.72 ? 405 ARG B NE    1 
ATOM   8194 C  CZ    . ARG F 3 405 ? 14.754  -5.585  -14.708 1.00 36.41 ? 405 ARG B CZ    1 
ATOM   8195 N  NH1   . ARG F 3 405 ? 14.321  -4.918  -13.639 1.00 33.61 ? 405 ARG B NH1   1 
ATOM   8196 N  NH2   . ARG F 3 405 ? 16.060  -5.669  -14.937 1.00 37.84 ? 405 ARG B NH2   1 
ATOM   8197 N  N     . THR F 3 406 ? 9.641   -9.034  -19.837 1.00 27.63 ? 406 THR B N     1 
ATOM   8198 C  CA    . THR F 3 406 ? 9.556   -9.957  -20.961 1.00 26.57 ? 406 THR B CA    1 
ATOM   8199 C  C     . THR F 3 406 ? 8.558   -9.433  -21.990 1.00 25.88 ? 406 THR B C     1 
ATOM   8200 O  O     . THR F 3 406 ? 8.805   -9.475  -23.190 1.00 25.61 ? 406 THR B O     1 
ATOM   8201 C  CB    . THR F 3 406 ? 9.090   -11.319 -20.498 1.00 26.72 ? 406 THR B CB    1 
ATOM   8202 O  OG1   . THR F 3 406 ? 10.041  -11.842 -19.565 1.00 26.29 ? 406 THR B OG1   1 
ATOM   8203 C  CG2   . THR F 3 406 ? 8.942   -12.261 -21.689 1.00 27.41 ? 406 THR B CG2   1 
ATOM   8204 N  N     . GLU F 3 407 ? 7.428   -8.950  -21.491 1.00 24.95 ? 407 GLU B N     1 
ATOM   8205 C  CA    . GLU F 3 407 ? 6.374   -8.389  -22.306 1.00 24.79 ? 407 GLU B CA    1 
ATOM   8206 C  C     . GLU F 3 407 ? 6.435   -6.891  -22.057 1.00 24.73 ? 407 GLU B C     1 
ATOM   8207 O  O     . GLU F 3 407 ? 5.886   -6.405  -21.075 1.00 25.48 ? 407 GLU B O     1 
ATOM   8208 C  CB    . GLU F 3 407 ? 5.022   -8.906  -21.830 1.00 25.65 ? 407 GLU B CB    1 
ATOM   8209 C  CG    . GLU F 3 407 ? 4.924   -10.390 -21.710 1.00 27.25 ? 407 GLU B CG    1 
ATOM   8210 C  CD    . GLU F 3 407 ? 4.978   -11.064 -23.057 1.00 30.95 ? 407 GLU B CD    1 
ATOM   8211 O  OE1   . GLU F 3 407 ? 4.633   -10.395 -24.059 1.00 30.61 ? 407 GLU B OE1   1 
ATOM   8212 O  OE2   . GLU F 3 407 ? 5.344   -12.262 -23.112 1.00 32.65 ? 407 GLU B OE2   1 
ATOM   8213 N  N     . LYS F 3 408 ? 7.091   -6.147  -22.932 1.00 26.36 ? 408 LYS B N     1 
ATOM   8214 C  CA    . LYS F 3 408 ? 7.182   -4.708  -22.729 1.00 27.34 ? 408 LYS B CA    1 
ATOM   8215 C  C     . LYS F 3 408 ? 5.832   -4.005  -22.624 1.00 26.98 ? 408 LYS B C     1 
ATOM   8216 O  O     . LYS F 3 408 ? 5.686   -3.070  -21.842 1.00 26.46 ? 408 LYS B O     1 
ATOM   8217 C  CB    . LYS F 3 408 ? 8.024   -4.066  -23.832 1.00 28.81 ? 408 LYS B CB    1 
ATOM   8218 C  CG    . LYS F 3 408 ? 9.491   -3.993  -23.497 1.00 32.11 ? 408 LYS B CG    1 
ATOM   8219 C  CD    . LYS F 3 408 ? 10.076  -5.376  -23.255 1.00 33.71 ? 408 LYS B CD    1 
ATOM   8220 C  CE    . LYS F 3 408 ? 11.563  -5.311  -22.935 1.00 34.57 ? 408 LYS B CE    1 
ATOM   8221 N  NZ    . LYS F 3 408 ? 12.166  -6.674  -22.978 1.00 35.93 ? 408 LYS B NZ    1 
ATOM   8222 N  N     . ASP F 3 409 ? 4.851   -4.441  -23.407 1.00 27.26 ? 409 ASP B N     1 
ATOM   8223 C  CA    . ASP F 3 409 ? 3.544   -3.807  -23.358 1.00 28.47 ? 409 ASP B CA    1 
ATOM   8224 C  C     . ASP F 3 409 ? 2.829   -4.281  -22.096 1.00 28.01 ? 409 ASP B C     1 
ATOM   8225 O  O     . ASP F 3 409 ? 1.949   -5.131  -22.144 1.00 28.78 ? 409 ASP B O     1 
ATOM   8226 C  CB    . ASP F 3 409 ? 2.738   -4.155  -24.610 1.00 30.03 ? 409 ASP B CB    1 
ATOM   8227 C  CG    . ASP F 3 409 ? 1.530   -3.266  -24.784 1.00 32.95 ? 409 ASP B CG    1 
ATOM   8228 O  OD1   . ASP F 3 409 ? 0.381   -3.721  -24.639 1.00 36.31 ? 409 ASP B OD1   1 
ATOM   8229 O  OD2   . ASP F 3 409 ? 1.702   -2.073  -25.073 1.00 38.31 ? 409 ASP B OD2   1 
ATOM   8230 N  N     . SER F 3 410 ? 3.228   -3.734  -20.955 1.00 28.20 ? 410 SER B N     1 
ATOM   8231 C  CA    . SER F 3 410 ? 2.624   -4.120  -19.684 1.00 27.20 ? 410 SER B CA    1 
ATOM   8232 C  C     . SER F 3 410 ? 2.637   -2.994  -18.662 1.00 26.94 ? 410 SER B C     1 
ATOM   8233 O  O     . SER F 3 410 ? 3.668   -2.373  -18.421 1.00 25.24 ? 410 SER B O     1 
ATOM   8234 C  CB    . SER F 3 410 ? 3.352   -5.344  -19.108 1.00 26.42 ? 410 SER B CB    1 
ATOM   8235 O  OG    . SER F 3 410 ? 4.757   -5.136  -19.079 1.00 24.62 ? 410 SER B OG    1 
ATOM   8236 N  N     . HIS F 3 411 ? 1.479   -2.741  -18.063 1.00 27.79 ? 411 HIS B N     1 
ATOM   8237 C  CA    . HIS F 3 411 ? 1.346   -1.702  -17.048 1.00 28.45 ? 411 HIS B CA    1 
ATOM   8238 C  C     . HIS F 3 411 ? 1.141   -2.391  -15.699 1.00 26.98 ? 411 HIS B C     1 
ATOM   8239 O  O     . HIS F 3 411 ? 0.248   -3.226  -15.553 1.00 25.83 ? 411 HIS B O     1 
ATOM   8240 C  CB    . HIS F 3 411 ? 0.149   -0.806  -17.387 1.00 31.74 ? 411 HIS B CB    1 
ATOM   8241 C  CG    . HIS F 3 411 ? 0.015   0.398   -16.504 1.00 35.25 ? 411 HIS B CG    1 
ATOM   8242 N  ND1   . HIS F 3 411 ? -0.293  0.313   -15.163 1.00 37.27 ? 411 HIS B ND1   1 
ATOM   8243 C  CD2   . HIS F 3 411 ? 0.115   1.721   -16.784 1.00 36.89 ? 411 HIS B CD2   1 
ATOM   8244 C  CE1   . HIS F 3 411 ? -0.379  1.532   -14.653 1.00 37.31 ? 411 HIS B CE1   1 
ATOM   8245 N  NE2   . HIS F 3 411 ? -0.137  2.402   -15.616 1.00 37.09 ? 411 HIS B NE2   1 
ATOM   8246 N  N     . MET F 3 412 ? 1.978   -2.041  -14.723 1.00 26.36 ? 412 MET B N     1 
ATOM   8247 C  CA    . MET F 3 412 ? 1.915   -2.628  -13.380 1.00 25.22 ? 412 MET B CA    1 
ATOM   8248 C  C     . MET F 3 412 ? 1.096   -1.774  -12.427 1.00 24.62 ? 412 MET B C     1 
ATOM   8249 O  O     . MET F 3 412 ? 1.150   -0.544  -12.481 1.00 25.09 ? 412 MET B O     1 
ATOM   8250 C  CB    . MET F 3 412 ? 3.323   -2.781  -12.788 1.00 25.15 ? 412 MET B CB    1 
ATOM   8251 C  CG    . MET F 3 412 ? 4.327   -3.543  -13.645 1.00 25.17 ? 412 MET B CG    1 
ATOM   8252 S  SD    . MET F 3 412 ? 5.980   -3.598  -12.874 1.00 25.27 ? 412 MET B SD    1 
ATOM   8253 C  CE    . MET F 3 412 ? 6.434   -1.956  -12.996 1.00 23.88 ? 412 MET B CE    1 
ATOM   8254 N  N     . VAL F 3 413 ? 0.343   -2.428  -11.550 1.00 22.97 ? 413 VAL B N     1 
ATOM   8255 C  CA    . VAL F 3 413 ? -0.462  -1.722  -10.565 1.00 21.91 ? 413 VAL B CA    1 
ATOM   8256 C  C     . VAL F 3 413 ? -0.531  -2.509  -9.270  1.00 21.61 ? 413 VAL B C     1 
ATOM   8257 O  O     . VAL F 3 413 ? -0.433  -3.735  -9.276  1.00 21.11 ? 413 VAL B O     1 
ATOM   8258 C  CB    . VAL F 3 413 ? -1.913  -1.469  -11.056 1.00 22.04 ? 413 VAL B CB    1 
ATOM   8259 C  CG1   . VAL F 3 413 ? -1.896  -0.605  -12.295 1.00 22.46 ? 413 VAL B CG1   1 
ATOM   8260 C  CG2   . VAL F 3 413 ? -2.632  -2.789  -11.306 1.00 21.02 ? 413 VAL B CG2   1 
ATOM   8261 N  N     . ALA F 3 414 ? -0.706  -1.790  -8.165  1.00 21.87 ? 414 ALA B N     1 
ATOM   8262 C  CA    . ALA F 3 414 ? -0.799  -2.387  -6.833  1.00 21.99 ? 414 ALA B CA    1 
ATOM   8263 C  C     . ALA F 3 414 ? -2.159  -2.066  -6.225  1.00 22.51 ? 414 ALA B C     1 
ATOM   8264 O  O     . ALA F 3 414 ? -2.753  -1.028  -6.527  1.00 22.83 ? 414 ALA B O     1 
ATOM   8265 C  CB    . ALA F 3 414 ? 0.309   -1.850  -5.939  1.00 21.77 ? 414 ALA B CB    1 
ATOM   8266 N  N     . PHE F 3 415 ? -2.655  -2.945  -5.359  1.00 23.05 ? 415 PHE B N     1 
ATOM   8267 C  CA    . PHE F 3 415 ? -3.959  -2.717  -4.754  1.00 23.54 ? 415 PHE B CA    1 
ATOM   8268 C  C     . PHE F 3 415 ? -4.182  -3.473  -3.452  1.00 23.90 ? 415 PHE B C     1 
ATOM   8269 O  O     . PHE F 3 415 ? -3.577  -4.509  -3.200  1.00 24.98 ? 415 PHE B O     1 
ATOM   8270 C  CB    . PHE F 3 415 ? -5.051  -3.138  -5.735  1.00 22.38 ? 415 PHE B CB    1 
ATOM   8271 C  CG    . PHE F 3 415 ? -5.206  -4.627  -5.850  1.00 22.11 ? 415 PHE B CG    1 
ATOM   8272 C  CD1   . PHE F 3 415 ? -6.090  -5.318  -5.024  1.00 20.29 ? 415 PHE B CD1   1 
ATOM   8273 C  CD2   . PHE F 3 415 ? -4.443  -5.349  -6.770  1.00 21.96 ? 415 PHE B CD2   1 
ATOM   8274 C  CE1   . PHE F 3 415 ? -6.212  -6.707  -5.115  1.00 20.31 ? 415 PHE B CE1   1 
ATOM   8275 C  CE2   . PHE F 3 415 ? -4.557  -6.738  -6.868  1.00 19.97 ? 415 PHE B CE2   1 
ATOM   8276 C  CZ    . PHE F 3 415 ? -5.443  -7.415  -6.040  1.00 20.03 ? 415 PHE B CZ    1 
ATOM   8277 N  N     . SER F 3 416 ? -5.079  -2.929  -2.640  1.00 24.81 ? 416 SER B N     1 
ATOM   8278 C  CA    . SER F 3 416 ? -5.494  -3.520  -1.374  1.00 24.62 ? 416 SER B CA    1 
ATOM   8279 C  C     . SER F 3 416 ? -7.016  -3.432  -1.449  1.00 24.94 ? 416 SER B C     1 
ATOM   8280 O  O     . SER F 3 416 ? -7.636  -4.245  -2.127  1.00 24.28 ? 416 SER B O     1 
ATOM   8281 C  CB    . SER F 3 416 ? -4.952  -2.720  -0.189  1.00 21.40 ? 416 SER B CB    1 
ATOM   8282 O  OG    . SER F 3 416 ? -5.261  -1.353  -0.331  1.00 18.38 ? 416 SER B OG    1 
ATOM   8283 N  N     . ASP F 3 417 ? -7.612  -2.450  -0.772  1.00 26.55 ? 417 ASP B N     1 
ATOM   8284 C  CA    . ASP F 3 417 ? -9.061  -2.269  -0.826  1.00 28.12 ? 417 ASP B CA    1 
ATOM   8285 C  C     . ASP F 3 417 ? -9.340  -1.027  -1.674  1.00 27.44 ? 417 ASP B C     1 
ATOM   8286 O  O     . ASP F 3 417 ? -10.459 -0.527  -1.739  1.00 25.12 ? 417 ASP B O     1 
ATOM   8287 C  CB    . ASP F 3 417 ? -9.669  -2.155  0.588   1.00 30.43 ? 417 ASP B CB    1 
ATOM   8288 C  CG    . ASP F 3 417 ? -9.143  -0.982  1.365   1.00 34.10 ? 417 ASP B CG    1 
ATOM   8289 O  OD1   . ASP F 3 417 ? -8.539  -1.188  2.445   1.00 36.14 ? 417 ASP B OD1   1 
ATOM   8290 O  OD2   . ASP F 3 417 ? -9.343  0.174   0.922   1.00 38.27 ? 417 ASP B OD2   1 
ATOM   8291 N  N     . GLU F 3 418 ? -8.282  -0.541  -2.319  1.00 28.31 ? 418 GLU B N     1 
ATOM   8292 C  CA    . GLU F 3 418 ? -8.338  0.626   -3.192  1.00 29.22 ? 418 GLU B CA    1 
ATOM   8293 C  C     . GLU F 3 418 ? -7.107  0.596   -4.098  1.00 30.32 ? 418 GLU B C     1 
ATOM   8294 O  O     . GLU F 3 418 ? -6.111  -0.064  -3.797  1.00 30.62 ? 418 GLU B O     1 
ATOM   8295 C  CB    . GLU F 3 418 ? -8.311  1.913   -2.375  1.00 29.90 ? 418 GLU B CB    1 
ATOM   8296 C  CG    . GLU F 3 418 ? -6.936  2.267   -1.824  1.00 31.04 ? 418 GLU B CG    1 
ATOM   8297 C  CD    . GLU F 3 418 ? -6.907  3.608   -1.111  1.00 32.07 ? 418 GLU B CD    1 
ATOM   8298 O  OE1   . GLU F 3 418 ? -7.164  4.645   -1.760  1.00 33.04 ? 418 GLU B OE1   1 
ATOM   8299 O  OE2   . GLU F 3 418 ? -6.624  3.625   0.105   1.00 32.20 ? 418 GLU B OE2   1 
ATOM   8300 N  N     . MET F 3 419 ? -7.173  1.300   -5.217  1.00 31.17 ? 419 MET B N     1 
ATOM   8301 C  CA    . MET F 3 419 ? -6.033  1.347   -6.118  1.00 32.39 ? 419 MET B CA    1 
ATOM   8302 C  C     . MET F 3 419 ? -4.973  2.251   -5.492  1.00 33.03 ? 419 MET B C     1 
ATOM   8303 O  O     . MET F 3 419 ? -5.283  3.354   -5.045  1.00 34.05 ? 419 MET B O     1 
ATOM   8304 C  CB    . MET F 3 419 ? -6.454  1.908   -7.481  1.00 31.69 ? 419 MET B CB    1 
ATOM   8305 C  CG    . MET F 3 419 ? -7.402  1.021   -8.268  1.00 30.96 ? 419 MET B CG    1 
ATOM   8306 S  SD    . MET F 3 419 ? -6.703  -0.618  -8.648  1.00 31.31 ? 419 MET B SD    1 
ATOM   8307 C  CE    . MET F 3 419 ? -5.583  -0.259  -9.976  1.00 29.57 ? 419 MET B CE    1 
ATOM   8308 N  N     . LEU F 3 420 ? -3.733  1.779   -5.439  1.00 34.09 ? 420 LEU B N     1 
ATOM   8309 C  CA    . LEU F 3 420 ? -2.645  2.573   -4.877  1.00 35.08 ? 420 LEU B CA    1 
ATOM   8310 C  C     . LEU F 3 420 ? -1.629  2.862   -5.946  1.00 35.66 ? 420 LEU B C     1 
ATOM   8311 O  O     . LEU F 3 420 ? -1.436  2.062   -6.855  1.00 36.84 ? 420 LEU B O     1 
ATOM   8312 C  CB    . LEU F 3 420 ? -1.919  1.833   -3.748  1.00 35.86 ? 420 LEU B CB    1 
ATOM   8313 C  CG    . LEU F 3 420 ? -2.479  1.739   -2.331  1.00 36.51 ? 420 LEU B CG    1 
ATOM   8314 C  CD1   . LEU F 3 420 ? -2.887  3.112   -1.840  1.00 38.32 ? 420 LEU B CD1   1 
ATOM   8315 C  CD2   . LEU F 3 420 ? -3.646  0.806   -2.317  1.00 38.81 ? 420 LEU B CD2   1 
ATOM   8316 N  N     . PRO F 3 421 ? -0.954  4.015   -5.857  1.00 37.29 ? 421 PRO B N     1 
ATOM   8317 C  CA    . PRO F 3 421 ? 0.052   4.304   -6.884  1.00 37.35 ? 421 PRO B CA    1 
ATOM   8318 C  C     . PRO F 3 421 ? 1.082   3.169   -6.880  1.00 37.86 ? 421 PRO B C     1 
ATOM   8319 O  O     . PRO F 3 421 ? 1.544   2.739   -5.819  1.00 37.56 ? 421 PRO B O     1 
ATOM   8320 C  CB    . PRO F 3 421 ? 0.637   5.636   -6.422  1.00 36.57 ? 421 PRO B CB    1 
ATOM   8321 C  CG    . PRO F 3 421 ? 0.451   5.597   -4.921  1.00 36.46 ? 421 PRO B CG    1 
ATOM   8322 C  CD    . PRO F 3 421 ? -0.946  5.043   -4.800  1.00 36.82 ? 421 PRO B CD    1 
ATOM   8323 N  N     . CYS F 3 422 ? 1.422   2.658   -8.055  1.00 38.52 ? 422 CYS B N     1 
ATOM   8324 C  CA    . CYS F 3 422 ? 2.393   1.580   -8.118  1.00 39.14 ? 422 CYS B CA    1 
ATOM   8325 C  C     . CYS F 3 422 ? 3.762   2.117   -7.732  1.00 39.01 ? 422 CYS B C     1 
ATOM   8326 O  O     . CYS F 3 422 ? 4.330   2.951   -8.428  1.00 38.25 ? 422 CYS B O     1 
ATOM   8327 C  CB    . CYS F 3 422 ? 2.449   0.988   -9.509  1.00 40.13 ? 422 CYS B CB    1 
ATOM   8328 S  SG    . CYS F 3 422 ? 3.405   -0.512  -9.515  1.00 45.28 ? 422 CYS B SG    1 
ATOM   8329 N  N     . PRO F 3 423 ? 4.313   1.622   -6.615  1.00 39.86 ? 423 PRO B N     1 
ATOM   8330 C  CA    . PRO F 3 423 ? 5.610   1.992   -6.035  1.00 40.14 ? 423 PRO B CA    1 
ATOM   8331 C  C     . PRO F 3 423 ? 6.858   1.585   -6.813  1.00 40.33 ? 423 PRO B C     1 
ATOM   8332 O  O     . PRO F 3 423 ? 7.937   2.149   -6.597  1.00 41.51 ? 423 PRO B O     1 
ATOM   8333 C  CB    . PRO F 3 423 ? 5.564   1.323   -4.673  1.00 40.40 ? 423 PRO B CB    1 
ATOM   8334 C  CG    . PRO F 3 423 ? 4.886   0.028   -5.012  1.00 41.02 ? 423 PRO B CG    1 
ATOM   8335 C  CD    . PRO F 3 423 ? 3.729   0.486   -5.878  1.00 40.14 ? 423 PRO B CD    1 
ATOM   8336 N  N     . ILE F 3 424 ? 6.728   0.615   -7.711  1.00 38.65 ? 424 ILE B N     1 
ATOM   8337 C  CA    . ILE F 3 424 ? 7.884   0.170   -8.463  1.00 37.58 ? 424 ILE B CA    1 
ATOM   8338 C  C     . ILE F 3 424 ? 7.779   0.381   -9.960  1.00 37.88 ? 424 ILE B C     1 
ATOM   8339 O  O     . ILE F 3 424 ? 6.691   0.606   -10.489 1.00 38.65 ? 424 ILE B O     1 
ATOM   8340 C  CB    . ILE F 3 424 ? 8.159   -1.308  -8.197  1.00 36.99 ? 424 ILE B CB    1 
ATOM   8341 C  CG1   . ILE F 3 424 ? 6.908   -2.131  -8.481  1.00 35.98 ? 424 ILE B CG1   1 
ATOM   8342 C  CG2   . ILE F 3 424 ? 8.594   -1.497  -6.757  1.00 39.16 ? 424 ILE B CG2   1 
ATOM   8343 C  CD1   . ILE F 3 424 ? 7.097   -3.602  -8.255  1.00 34.69 ? 424 ILE B CD1   1 
ATOM   8344 N  N     . THR F 3 425 ? 8.926   0.326   -10.634 1.00 37.88 ? 425 THR B N     1 
ATOM   8345 C  CA    . THR F 3 425 ? 8.977   0.487   -12.083 1.00 39.17 ? 425 THR B CA    1 
ATOM   8346 C  C     . THR F 3 425 ? 9.846   -0.590  -12.721 1.00 39.29 ? 425 THR B C     1 
ATOM   8347 O  O     . THR F 3 425 ? 10.689  -1.211  -12.070 1.00 37.64 ? 425 THR B O     1 
ATOM   8348 C  CB    . THR F 3 425 ? 9.518   1.898   -12.526 1.00 39.37 ? 425 THR B CB    1 
ATOM   8349 O  OG1   . THR F 3 425 ? 10.816  2.136   -11.961 1.00 38.75 ? 425 THR B OG1   1 
ATOM   8350 C  CG2   . THR F 3 425 ? 8.553   2.999   -12.101 1.00 38.84 ? 425 THR B CG2   1 
ATOM   8351 N  N     . VAL F 3 426 ? 9.632   -0.787  -14.013 1.00 40.18 ? 426 VAL B N     1 
ATOM   8352 C  CA    . VAL F 3 426 ? 10.346  -1.790  -14.780 1.00 42.16 ? 426 VAL B CA    1 
ATOM   8353 C  C     . VAL F 3 426 ? 11.864  -1.677  -14.735 1.00 42.94 ? 426 VAL B C     1 
ATOM   8354 O  O     . VAL F 3 426 ? 12.564  -2.672  -14.882 1.00 44.54 ? 426 VAL B O     1 
ATOM   8355 C  CB    . VAL F 3 426 ? 9.922   -1.738  -16.253 1.00 42.72 ? 426 VAL B CB    1 
ATOM   8356 C  CG1   . VAL F 3 426 ? 10.093  -3.107  -16.889 1.00 43.39 ? 426 VAL B CG1   1 
ATOM   8357 C  CG2   . VAL F 3 426 ? 8.488   -1.251  -16.364 1.00 43.97 ? 426 VAL B CG2   1 
ATOM   8358 N  N     . ASN F 3 427 ? 12.379  -0.474  -14.528 1.00 43.68 ? 427 ASN B N     1 
ATOM   8359 C  CA    . ASN F 3 427 ? 13.820  -0.276  -14.528 1.00 43.94 ? 427 ASN B CA    1 
ATOM   8360 C  C     . ASN F 3 427 ? 14.502  -0.391  -13.182 1.00 43.72 ? 427 ASN B C     1 
ATOM   8361 O  O     . ASN F 3 427 ? 15.725  -0.255  -13.102 1.00 43.44 ? 427 ASN B O     1 
ATOM   8362 C  CB    . ASN F 3 427 ? 14.156  1.090   -15.138 1.00 45.42 ? 427 ASN B CB    1 
ATOM   8363 C  CG    . ASN F 3 427 ? 13.695  1.220   -16.579 1.00 46.68 ? 427 ASN B CG    1 
ATOM   8364 O  OD1   . ASN F 3 427 ? 14.138  0.475   -17.460 1.00 47.59 ? 427 ASN B OD1   1 
ATOM   8365 N  ND2   . ASN F 3 427 ? 12.797  2.168   -16.827 1.00 47.18 ? 427 ASN B ND2   1 
ATOM   8366 N  N     . MET F 3 428 ? 13.734  -0.639  -12.127 1.00 43.81 ? 428 MET B N     1 
ATOM   8367 C  CA    . MET F 3 428 ? 14.320  -0.735  -10.793 1.00 43.94 ? 428 MET B CA    1 
ATOM   8368 C  C     . MET F 3 428 ? 15.074  -2.026  -10.561 1.00 44.15 ? 428 MET B C     1 
ATOM   8369 O  O     . MET F 3 428 ? 14.753  -3.065  -11.146 1.00 44.17 ? 428 MET B O     1 
ATOM   8370 C  CB    . MET F 3 428 ? 13.244  -0.628  -9.723  1.00 44.85 ? 428 MET B CB    1 
ATOM   8371 C  CG    . MET F 3 428 ? 12.498  0.681   -9.683  1.00 46.90 ? 428 MET B CG    1 
ATOM   8372 S  SD    . MET F 3 428 ? 11.132  0.554   -8.514  1.00 50.57 ? 428 MET B SD    1 
ATOM   8373 C  CE    . MET F 3 428 ? 11.511  1.828   -7.450  1.00 49.53 ? 428 MET B CE    1 
ATOM   8374 N  N     . LEU F 3 429 ? 16.083  -1.938  -9.699  1.00 44.77 ? 429 LEU B N     1 
ATOM   8375 C  CA    . LEU F 3 429 ? 16.886  -3.089  -9.317  1.00 45.39 ? 429 LEU B CA    1 
ATOM   8376 C  C     . LEU F 3 429 ? 16.050  -3.817  -8.279  1.00 45.80 ? 429 LEU B C     1 
ATOM   8377 O  O     . LEU F 3 429 ? 15.306  -3.177  -7.537  1.00 45.80 ? 429 LEU B O     1 
ATOM   8378 C  CB    . LEU F 3 429 ? 18.209  -2.628  -8.711  1.00 45.22 ? 429 LEU B CB    1 
ATOM   8379 C  CG    . LEU F 3 429 ? 19.057  -1.850  -9.712  1.00 45.63 ? 429 LEU B CG    1 
ATOM   8380 C  CD1   . LEU F 3 429 ? 20.114  -1.033  -8.997  1.00 45.70 ? 429 LEU B CD1   1 
ATOM   8381 C  CD2   . LEU F 3 429 ? 19.676  -2.823  -10.681 1.00 46.15 ? 429 LEU B CD2   1 
ATOM   8382 N  N     . LEU F 3 430 ? 16.169  -5.137  -8.221  1.00 46.11 ? 430 LEU B N     1 
ATOM   8383 C  CA    . LEU F 3 430 ? 15.372  -5.913  -7.296  1.00 47.55 ? 430 LEU B CA    1 
ATOM   8384 C  C     . LEU F 3 430 ? 15.297  -5.483  -5.840  1.00 49.01 ? 430 LEU B C     1 
ATOM   8385 O  O     . LEU F 3 430 ? 14.256  -5.584  -5.204  1.00 48.84 ? 430 LEU B O     1 
ATOM   8386 C  CB    . LEU F 3 430 ? 15.763  -7.397  -7.387  1.00 47.01 ? 430 LEU B CB    1 
ATOM   8387 C  CG    . LEU F 3 430 ? 14.598  -8.258  -7.876  1.00 45.79 ? 430 LEU B CG    1 
ATOM   8388 C  CD1   . LEU F 3 430 ? 15.020  -9.006  -9.105  1.00 46.38 ? 430 LEU B CD1   1 
ATOM   8389 C  CD2   . LEU F 3 430 ? 14.181  -9.198  -6.787  1.00 46.39 ? 430 LEU B CD2   1 
ATOM   8390 N  N     . HIS F 3 431 ? 16.385  -5.000  -5.284  1.00 51.01 ? 431 HIS B N     1 
ATOM   8391 C  CA    . HIS F 3 431 ? 16.313  -4.611  -3.890  1.00 53.29 ? 431 HIS B CA    1 
ATOM   8392 C  C     . HIS F 3 431 ? 15.604  -3.272  -3.653  1.00 52.41 ? 431 HIS B C     1 
ATOM   8393 O  O     . HIS F 3 431 ? 15.228  -2.948  -2.507  1.00 52.82 ? 431 HIS B O     1 
ATOM   8394 C  CB    . HIS F 3 431 ? 17.719  -4.663  -3.265  1.00 57.76 ? 431 HIS B CB    1 
ATOM   8395 C  CG    . HIS F 3 431 ? 18.444  -3.356  -3.224  1.00 62.28 ? 431 HIS B CG    1 
ATOM   8396 N  ND1   . HIS F 3 431 ? 19.791  -3.287  -2.898  1.00 64.47 ? 431 HIS B ND1   1 
ATOM   8397 C  CD2   . HIS F 3 431 ? 18.070  -2.080  -3.431  1.00 64.25 ? 431 HIS B CD2   1 
ATOM   8398 C  CE1   . HIS F 3 431 ? 20.202  -2.044  -2.916  1.00 64.92 ? 431 HIS B CE1   1 
ATOM   8399 N  NE2   . HIS F 3 431 ? 19.165  -1.275  -3.242  1.00 65.60 ? 431 HIS B NE2   1 
ATOM   8400 N  N     . GLU F 3 432 ? 15.394  -2.507  -4.725  1.00 50.98 ? 432 GLU B N     1 
ATOM   8401 C  CA    . GLU F 3 432 ? 14.706  -1.244  -4.589  1.00 49.54 ? 432 GLU B CA    1 
ATOM   8402 C  C     . GLU F 3 432 ? 13.229  -1.568  -4.592  1.00 48.26 ? 432 GLU B C     1 
ATOM   8403 O  O     . GLU F 3 432 ? 12.440  -0.866  -3.962  1.00 48.53 ? 432 GLU B O     1 
ATOM   8404 C  CB    . GLU F 3 432 ? 15.031  -0.285  -5.738  1.00 50.11 ? 432 GLU B CB    1 
ATOM   8405 C  CG    . GLU F 3 432 ? 14.360  1.108   -5.592  1.00 50.06 ? 432 GLU B CG    1 
ATOM   8406 C  CD    . GLU F 3 432 ? 14.719  2.075   -6.718  1.00 50.50 ? 432 GLU B CD    1 
ATOM   8407 O  OE1   . GLU F 3 432 ? 14.222  3.222   -6.698  1.00 50.33 ? 432 GLU B OE1   1 
ATOM   8408 O  OE2   . GLU F 3 432 ? 15.495  1.692   -7.620  1.00 49.11 ? 432 GLU B OE2   1 
ATOM   8409 N  N     . VAL F 3 433 ? 12.853  -2.634  -5.296  1.00 46.73 ? 433 VAL B N     1 
ATOM   8410 C  CA    . VAL F 3 433 ? 11.459  -3.034  -5.356  1.00 45.32 ? 433 VAL B CA    1 
ATOM   8411 C  C     . VAL F 3 433 ? 11.079  -3.702  -4.039  1.00 45.64 ? 433 VAL B C     1 
ATOM   8412 O  O     . VAL F 3 433 ? 9.907   -3.730  -3.660  1.00 45.22 ? 433 VAL B O     1 
ATOM   8413 C  CB    . VAL F 3 433 ? 11.203  -4.017  -6.527  1.00 44.17 ? 433 VAL B CB    1 
ATOM   8414 C  CG1   . VAL F 3 433 ? 12.439  -4.159  -7.362  1.00 44.13 ? 433 VAL B CG1   1 
ATOM   8415 C  CG2   . VAL F 3 433 ? 10.743  -5.371  -6.002  1.00 43.89 ? 433 VAL B CG2   1 
ATOM   8416 N  N     . VAL F 3 434 ? 12.074  -4.244  -3.347  1.00 45.90 ? 434 VAL B N     1 
ATOM   8417 C  CA    . VAL F 3 434 ? 11.824  -4.902  -2.077  1.00 46.35 ? 434 VAL B CA    1 
ATOM   8418 C  C     . VAL F 3 434 ? 11.447  -3.905  -0.989  1.00 47.39 ? 434 VAL B C     1 
ATOM   8419 O  O     . VAL F 3 434 ? 10.398  -4.022  -0.358  1.00 47.57 ? 434 VAL B O     1 
ATOM   8420 C  CB    . VAL F 3 434 ? 13.057  -5.703  -1.604  1.00 46.25 ? 434 VAL B CB    1 
ATOM   8421 C  CG1   . VAL F 3 434 ? 12.804  -6.270  -0.197  1.00 45.64 ? 434 VAL B CG1   1 
ATOM   8422 C  CG2   . VAL F 3 434 ? 13.352  -6.830  -2.573  1.00 45.19 ? 434 VAL B CG2   1 
ATOM   8423 N  N     . GLU F 3 435 ? 12.299  -2.918  -0.763  1.00 48.88 ? 435 GLU B N     1 
ATOM   8424 C  CA    . GLU F 3 435 ? 12.003  -1.949  0.275   1.00 50.38 ? 435 GLU B CA    1 
ATOM   8425 C  C     . GLU F 3 435 ? 10.792  -1.086  -0.075  1.00 49.82 ? 435 GLU B C     1 
ATOM   8426 O  O     . GLU F 3 435 ? 10.138  -0.537  0.806   1.00 50.25 ? 435 GLU B O     1 
ATOM   8427 C  CB    . GLU F 3 435 ? 13.231  -1.071  0.545   1.00 52.41 ? 435 GLU B CB    1 
ATOM   8428 C  CG    . GLU F 3 435 ? 13.182  0.304   -0.092  1.00 57.18 ? 435 GLU B CG    1 
ATOM   8429 C  CD    . GLU F 3 435 ? 14.518  1.016   -0.018  1.00 60.29 ? 435 GLU B CD    1 
ATOM   8430 O  OE1   . GLU F 3 435 ? 14.739  1.796   0.935   1.00 60.93 ? 435 GLU B OE1   1 
ATOM   8431 O  OE2   . GLU F 3 435 ? 15.353  0.790   -0.927  1.00 61.44 ? 435 GLU B OE2   1 
ATOM   8432 N  N     . LYS F 3 436 ? 10.484  -0.960  -1.357  1.00 49.33 ? 436 LYS B N     1 
ATOM   8433 C  CA    . LYS F 3 436 ? 9.345   -0.141  -1.730  1.00 49.83 ? 436 LYS B CA    1 
ATOM   8434 C  C     . LYS F 3 436 ? 8.045   -0.854  -1.380  1.00 50.22 ? 436 LYS B C     1 
ATOM   8435 O  O     . LYS F 3 436 ? 7.056   -0.207  -1.048  1.00 49.85 ? 436 LYS B O     1 
ATOM   8436 C  CB    . LYS F 3 436 ? 9.386   0.214   -3.220  1.00 50.18 ? 436 LYS B CB    1 
ATOM   8437 C  CG    . LYS F 3 436 ? 10.608  1.041   -3.636  1.00 51.20 ? 436 LYS B CG    1 
ATOM   8438 C  CD    . LYS F 3 436 ? 10.237  2.400   -4.211  1.00 52.14 ? 436 LYS B CD    1 
ATOM   8439 C  CE    . LYS F 3 436 ? 11.454  3.127   -4.799  1.00 52.81 ? 436 LYS B CE    1 
ATOM   8440 N  NZ    . LYS F 3 436 ? 12.572  3.358   -3.838  1.00 53.98 ? 436 LYS B NZ    1 
ATOM   8441 N  N     . MET F 3 437 ? 8.050   -2.185  -1.449  1.00 50.83 ? 437 MET B N     1 
ATOM   8442 C  CA    . MET F 3 437 ? 6.871   -2.981  -1.104  1.00 50.76 ? 437 MET B CA    1 
ATOM   8443 C  C     . MET F 3 437 ? 6.743   -2.926  0.410   1.00 51.47 ? 437 MET B C     1 
ATOM   8444 O  O     . MET F 3 437 ? 5.678   -3.176  0.975   1.00 51.82 ? 437 MET B O     1 
ATOM   8445 C  CB    . MET F 3 437 ? 7.046   -4.439  -1.538  1.00 49.85 ? 437 MET B CB    1 
ATOM   8446 C  CG    . MET F 3 437 ? 7.257   -4.613  -3.015  1.00 48.28 ? 437 MET B CG    1 
ATOM   8447 S  SD    . MET F 3 437 ? 6.102   -3.594  -3.926  1.00 47.01 ? 437 MET B SD    1 
ATOM   8448 C  CE    . MET F 3 437 ? 4.664   -4.603  -3.863  1.00 47.48 ? 437 MET B CE    1 
ATOM   8449 N  N     . SER F 3 438 ? 7.861   -2.602  1.053   1.00 51.56 ? 438 SER B N     1 
ATOM   8450 C  CA    . SER F 3 438 ? 7.937   -2.483  2.501   1.00 50.73 ? 438 SER B CA    1 
ATOM   8451 C  C     . SER F 3 438 ? 6.936   -1.446  3.027   1.00 49.13 ? 438 SER B C     1 
ATOM   8452 O  O     . SER F 3 438 ? 5.989   -1.761  3.757   1.00 47.75 ? 438 SER B O     1 
ATOM   8453 C  CB    . SER F 3 438 ? 9.349   -2.046  2.893   1.00 51.77 ? 438 SER B CB    1 
ATOM   8454 O  OG    . SER F 3 438 ? 9.995   -3.023  3.711   1.00 54.20 ? 438 SER B OG    1 
ATOM   8455 N  N     . ASP F 3 439 ? 7.162   -0.200  2.625   1.00 47.78 ? 439 ASP B N     1 
ATOM   8456 C  CA    . ASP F 3 439 ? 6.339   0.930   3.043   1.00 46.36 ? 439 ASP B CA    1 
ATOM   8457 C  C     . ASP F 3 439 ? 4.872   0.843   2.637   1.00 44.11 ? 439 ASP B C     1 
ATOM   8458 O  O     . ASP F 3 439 ? 4.033   1.529   3.215   1.00 45.19 ? 439 ASP B O     1 
ATOM   8459 C  CB    . ASP F 3 439 ? 6.904   2.230   2.461   1.00 49.24 ? 439 ASP B CB    1 
ATOM   8460 C  CG    . ASP F 3 439 ? 8.396   2.365   2.655   1.00 52.07 ? 439 ASP B CG    1 
ATOM   8461 O  OD1   . ASP F 3 439 ? 8.824   3.002   3.652   1.00 54.05 ? 439 ASP B OD1   1 
ATOM   8462 O  OD2   . ASP F 3 439 ? 9.157   1.846   1.807   1.00 53.36 ? 439 ASP B OD2   1 
ATOM   8463 N  N     . ILE F 3 440 ? 4.551   0.000   1.664   1.00 40.41 ? 440 ILE B N     1 
ATOM   8464 C  CA    . ILE F 3 440 ? 3.186   -0.054  1.164   1.00 36.76 ? 440 ILE B CA    1 
ATOM   8465 C  C     . ILE F 3 440 ? 2.272   -1.236  1.502   1.00 34.50 ? 440 ILE B C     1 
ATOM   8466 O  O     . ILE F 3 440 ? 1.053   -1.128  1.350   1.00 34.61 ? 440 ILE B O     1 
ATOM   8467 C  CB    . ILE F 3 440 ? 3.232   0.187   -0.369  1.00 37.05 ? 440 ILE B CB    1 
ATOM   8468 C  CG1   . ILE F 3 440 ? 2.042   -0.453  -1.084  1.00 38.09 ? 440 ILE B CG1   1 
ATOM   8469 C  CG2   . ILE F 3 440 ? 4.507   -0.356  -0.918  1.00 37.72 ? 440 ILE B CG2   1 
ATOM   8470 C  CD1   . ILE F 3 440 ? 2.105   -0.304  -2.603  1.00 37.40 ? 440 ILE B CD1   1 
ATOM   8471 N  N     . THR F 3 441 ? 2.820   -2.351  1.974   1.00 31.66 ? 441 THR B N     1 
ATOM   8472 C  CA    . THR F 3 441 ? 1.965   -3.498  2.298   1.00 28.94 ? 441 THR B CA    1 
ATOM   8473 C  C     . THR F 3 441 ? 1.096   -3.245  3.537   1.00 26.70 ? 441 THR B C     1 
ATOM   8474 O  O     . THR F 3 441 ? 1.625   -2.969  4.615   1.00 28.04 ? 441 THR B O     1 
ATOM   8475 C  CB    . THR F 3 441 ? 2.805   -4.763  2.515   1.00 28.64 ? 441 THR B CB    1 
ATOM   8476 O  OG1   . THR F 3 441 ? 3.626   -4.987  1.362   1.00 29.73 ? 441 THR B OG1   1 
ATOM   8477 C  CG2   . THR F 3 441 ? 1.902   -5.965  2.700   1.00 28.28 ? 441 THR B CG2   1 
ATOM   8478 N  N     . MET F 3 442 ? -0.227  -3.349  3.368   1.00 23.68 ? 442 MET B N     1 
ATOM   8479 C  CA    . MET F 3 442 ? -1.219  -3.118  4.434   1.00 20.50 ? 442 MET B CA    1 
ATOM   8480 C  C     . MET F 3 442 ? -2.630  -3.017  3.834   1.00 18.73 ? 442 MET B C     1 
ATOM   8481 O  O     . MET F 3 442 ? -2.793  -3.031  2.625   1.00 18.63 ? 442 MET B O     1 
ATOM   8482 C  CB    . MET F 3 442 ? -0.921  -1.806  5.160   1.00 20.15 ? 442 MET B CB    1 
ATOM   8483 C  CG    . MET F 3 442 ? -1.017  -0.573  4.261   1.00 19.83 ? 442 MET B CG    1 
ATOM   8484 S  SD    . MET F 3 442 ? -0.526  1.028   4.997   1.00 21.52 ? 442 MET B SD    1 
ATOM   8485 C  CE    . MET F 3 442 ? 1.299   0.841   5.082   1.00 16.57 ? 442 MET B CE    1 
ATOM   8486 N  N     . GLY F 3 443 ? -3.647  -2.904  4.681   1.00 18.04 ? 443 GLY B N     1 
ATOM   8487 C  CA    . GLY F 3 443 ? -5.013  -2.778  4.192   1.00 16.50 ? 443 GLY B CA    1 
ATOM   8488 C  C     . GLY F 3 443 ? -5.792  -4.057  3.928   1.00 16.52 ? 443 GLY B C     1 
ATOM   8489 O  O     . GLY F 3 443 ? -5.281  -5.167  4.061   1.00 16.17 ? 443 GLY B O     1 
ATOM   8490 N  N     . SER F 3 444 ? -7.055  -3.892  3.556   1.00 16.89 ? 444 SER B N     1 
ATOM   8491 C  CA    . SER F 3 444 ? -7.929  -5.020  3.256   1.00 17.64 ? 444 SER B CA    1 
ATOM   8492 C  C     . SER F 3 444 ? -7.813  -5.405  1.785   1.00 18.37 ? 444 SER B C     1 
ATOM   8493 O  O     . SER F 3 444 ? -7.112  -4.751  1.022   1.00 20.17 ? 444 SER B O     1 
ATOM   8494 C  CB    . SER F 3 444 ? -9.371  -4.679  3.615   1.00 16.64 ? 444 SER B CB    1 
ATOM   8495 O  OG    . SER F 3 444 ? -9.461  -4.403  5.001   1.00 16.63 ? 444 SER B OG    1 
ATOM   8496 N  N     . THR F 3 445 ? -8.520  -6.450  1.387   1.00 18.51 ? 445 THR B N     1 
ATOM   8497 C  CA    . THR F 3 445 ? -8.423  -6.963  0.031   1.00 17.95 ? 445 THR B CA    1 
ATOM   8498 C  C     . THR F 3 445 ? -9.643  -6.870  -0.857  1.00 18.64 ? 445 THR B C     1 
ATOM   8499 O  O     . THR F 3 445 ? -10.677 -7.455  -0.541  1.00 18.30 ? 445 THR B O     1 
ATOM   8500 C  CB    . THR F 3 445 ? -8.053  -8.442  0.076   1.00 17.15 ? 445 THR B CB    1 
ATOM   8501 O  OG1   . THR F 3 445 ? -6.955  -8.628  0.970   1.00 17.40 ? 445 THR B OG1   1 
ATOM   8502 C  CG2   . THR F 3 445 ? -7.691  -8.940  -1.290  1.00 17.53 ? 445 THR B CG2   1 
ATOM   8503 N  N     . ASP F 3 446 ? -9.509  -6.160  -1.976  1.00 19.90 ? 446 ASP B N     1 
ATOM   8504 C  CA    . ASP F 3 446 ? -10.587 -6.049  -2.968  1.00 20.97 ? 446 ASP B CA    1 
ATOM   8505 C  C     . ASP F 3 446 ? -9.993  -6.485  -4.311  1.00 21.02 ? 446 ASP B C     1 
ATOM   8506 O  O     . ASP F 3 446 ? -9.559  -5.652  -5.109  1.00 21.15 ? 446 ASP B O     1 
ATOM   8507 C  CB    . ASP F 3 446 ? -11.121 -4.614  -3.087  1.00 19.92 ? 446 ASP B CB    1 
ATOM   8508 C  CG    . ASP F 3 446 ? -12.350 -4.527  -3.989  1.00 20.03 ? 446 ASP B CG    1 
ATOM   8509 O  OD1   . ASP F 3 446 ? -12.892 -3.422  -4.204  1.00 21.12 ? 446 ASP B OD1   1 
ATOM   8510 O  OD2   . ASP F 3 446 ? -12.781 -5.581  -4.484  1.00 22.00 ? 446 ASP B OD2   1 
ATOM   8511 N  N     . CYS F 3 447 ? -9.987  -7.794  -4.551  1.00 20.96 ? 447 CYS B N     1 
ATOM   8512 C  CA    . CYS F 3 447 ? -9.425  -8.365  -5.767  1.00 21.58 ? 447 CYS B CA    1 
ATOM   8513 C  C     . CYS F 3 447 ? -10.150 -8.090  -7.079  1.00 20.95 ? 447 CYS B C     1 
ATOM   8514 O  O     . CYS F 3 447 ? -9.833  -8.692  -8.104  1.00 21.27 ? 447 CYS B O     1 
ATOM   8515 C  CB    . CYS F 3 447 ? -9.258  -9.865  -5.584  1.00 22.35 ? 447 CYS B CB    1 
ATOM   8516 S  SG    . CYS F 3 447 ? -7.990  -10.238 -4.371  1.00 27.20 ? 447 CYS B SG    1 
ATOM   8517 N  N     . ALA F 3 448 ? -11.117 -7.187  -7.066  1.00 19.74 ? 448 ALA B N     1 
ATOM   8518 C  CA    . ALA F 3 448 ? -11.821 -6.871  -8.294  1.00 19.04 ? 448 ALA B CA    1 
ATOM   8519 C  C     . ALA F 3 448 ? -11.334 -5.519  -8.809  1.00 19.27 ? 448 ALA B C     1 
ATOM   8520 O  O     . ALA F 3 448 ? -11.577 -5.151  -9.957  1.00 19.82 ? 448 ALA B O     1 
ATOM   8521 C  CB    . ALA F 3 448 ? -13.313 -6.839  -8.044  1.00 17.93 ? 448 ALA B CB    1 
ATOM   8522 N  N     . LEU F 3 449 ? -10.621 -4.789  -7.958  1.00 19.19 ? 449 LEU B N     1 
ATOM   8523 C  CA    . LEU F 3 449 ? -10.120 -3.469  -8.323  1.00 19.48 ? 449 LEU B CA    1 
ATOM   8524 C  C     . LEU F 3 449 ? -9.393  -3.369  -9.649  1.00 18.89 ? 449 LEU B C     1 
ATOM   8525 O  O     . LEU F 3 449 ? -9.643  -2.442  -10.408 1.00 20.14 ? 449 LEU B O     1 
ATOM   8526 C  CB    . LEU F 3 449 ? -9.227  -2.924  -7.216  1.00 20.00 ? 449 LEU B CB    1 
ATOM   8527 C  CG    . LEU F 3 449 ? -9.995  -2.738  -5.904  1.00 21.75 ? 449 LEU B CG    1 
ATOM   8528 C  CD1   . LEU F 3 449 ? -9.047  -2.245  -4.818  1.00 19.85 ? 449 LEU B CD1   1 
ATOM   8529 C  CD2   . LEU F 3 449 ? -11.158 -1.759  -6.117  1.00 20.58 ? 449 LEU B CD2   1 
ATOM   8530 N  N     . PRO F 3 450 ? -8.475  -4.310  -9.943  1.00 18.89 ? 450 PRO B N     1 
ATOM   8531 C  CA    . PRO F 3 450 ? -7.732  -4.276  -11.212 1.00 18.31 ? 450 PRO B CA    1 
ATOM   8532 C  C     . PRO F 3 450 ? -8.652  -4.161  -12.438 1.00 18.23 ? 450 PRO B C     1 
ATOM   8533 O  O     . PRO F 3 450 ? -8.597  -3.181  -13.181 1.00 17.17 ? 450 PRO B O     1 
ATOM   8534 C  CB    . PRO F 3 450 ? -6.944  -5.588  -11.187 1.00 18.32 ? 450 PRO B CB    1 
ATOM   8535 C  CG    . PRO F 3 450 ? -6.663  -5.775  -9.712  1.00 18.13 ? 450 PRO B CG    1 
ATOM   8536 C  CD    . PRO F 3 450 ? -8.008  -5.425  -9.091  1.00 19.18 ? 450 PRO B CD    1 
ATOM   8537 N  N     . MET F 3 451 ? -9.492  -5.169  -12.644 1.00 19.00 ? 451 MET B N     1 
ATOM   8538 C  CA    . MET F 3 451 ? -10.417 -5.152  -13.760 1.00 18.90 ? 451 MET B CA    1 
ATOM   8539 C  C     . MET F 3 451 ? -11.197 -3.839  -13.720 1.00 19.36 ? 451 MET B C     1 
ATOM   8540 O  O     . MET F 3 451 ? -11.264 -3.110  -14.714 1.00 19.29 ? 451 MET B O     1 
ATOM   8541 C  CB    . MET F 3 451 ? -11.383 -6.334  -13.662 1.00 20.12 ? 451 MET B CB    1 
ATOM   8542 C  CG    . MET F 3 451 ? -10.783 -7.693  -14.002 1.00 22.28 ? 451 MET B CG    1 
ATOM   8543 S  SD    . MET F 3 451 ? -9.430  -8.251  -12.920 1.00 26.30 ? 451 MET B SD    1 
ATOM   8544 C  CE    . MET F 3 451 ? -10.354 -9.156  -11.649 1.00 22.89 ? 451 MET B CE    1 
ATOM   8545 N  N     . LEU F 3 452 ? -11.775 -3.538  -12.561 1.00 18.63 ? 452 LEU B N     1 
ATOM   8546 C  CA    . LEU F 3 452 ? -12.548 -2.320  -12.390 1.00 19.39 ? 452 LEU B CA    1 
ATOM   8547 C  C     . LEU F 3 452 ? -11.740 -1.074  -12.740 1.00 20.53 ? 452 LEU B C     1 
ATOM   8548 O  O     . LEU F 3 452 ? -12.226 -0.189  -13.454 1.00 21.45 ? 452 LEU B O     1 
ATOM   8549 C  CB    . LEU F 3 452 ? -13.072 -2.213  -10.956 1.00 19.80 ? 452 LEU B CB    1 
ATOM   8550 C  CG    . LEU F 3 452 ? -14.162 -3.190  -10.501 1.00 18.68 ? 452 LEU B CG    1 
ATOM   8551 C  CD1   . LEU F 3 452 ? -14.494 -2.899  -9.060  1.00 18.17 ? 452 LEU B CD1   1 
ATOM   8552 C  CD2   . LEU F 3 452 ? -15.399 -3.051  -11.357 1.00 18.41 ? 452 LEU B CD2   1 
ATOM   8553 N  N     . TRP F 3 453 ? -10.512 -0.985  -12.244 1.00 19.98 ? 453 TRP B N     1 
ATOM   8554 C  CA    . TRP F 3 453 ? -9.698  0.176   -12.562 1.00 21.17 ? 453 TRP B CA    1 
ATOM   8555 C  C     . TRP F 3 453 ? -9.507  0.240   -14.077 1.00 22.38 ? 453 TRP B C     1 
ATOM   8556 O  O     . TRP F 3 453 ? -9.682  1.284   -14.699 1.00 21.41 ? 453 TRP B O     1 
ATOM   8557 C  CB    . TRP F 3 453 ? -8.334  0.086   -11.883 1.00 18.98 ? 453 TRP B CB    1 
ATOM   8558 C  CG    . TRP F 3 453 ? -7.388  1.174   -12.343 1.00 20.17 ? 453 TRP B CG    1 
ATOM   8559 C  CD1   . TRP F 3 453 ? -7.345  2.469   -11.906 1.00 18.23 ? 453 TRP B CD1   1 
ATOM   8560 C  CD2   . TRP F 3 453 ? -6.397  1.068   -13.382 1.00 18.81 ? 453 TRP B CD2   1 
ATOM   8561 N  NE1   . TRP F 3 453 ? -6.395  3.170   -12.610 1.00 17.38 ? 453 TRP B NE1   1 
ATOM   8562 C  CE2   . TRP F 3 453 ? -5.801  2.337   -13.519 1.00 17.52 ? 453 TRP B CE2   1 
ATOM   8563 C  CE3   . TRP F 3 453 ? -5.964  0.024   -14.206 1.00 18.82 ? 453 TRP B CE3   1 
ATOM   8564 C  CZ2   . TRP F 3 453 ? -4.789  2.591   -14.454 1.00 19.75 ? 453 TRP B CZ2   1 
ATOM   8565 C  CZ3   . TRP F 3 453 ? -4.954  0.277   -15.137 1.00 19.82 ? 453 TRP B CZ3   1 
ATOM   8566 C  CH2   . TRP F 3 453 ? -4.380  1.550   -15.253 1.00 19.86 ? 453 TRP B CH2   1 
ATOM   8567 N  N     . ALA F 3 454 ? -9.157  -0.901  -14.657 1.00 24.75 ? 454 ALA B N     1 
ATOM   8568 C  CA    . ALA F 3 454 ? -8.924  -1.016  -16.088 1.00 26.33 ? 454 ALA B CA    1 
ATOM   8569 C  C     . ALA F 3 454 ? -10.071 -0.500  -16.949 1.00 28.58 ? 454 ALA B C     1 
ATOM   8570 O  O     . ALA F 3 454 ? -9.832  0.210   -17.922 1.00 30.32 ? 454 ALA B O     1 
ATOM   8571 C  CB    . ALA F 3 454 ? -8.626  -2.465  -16.441 1.00 25.34 ? 454 ALA B CB    1 
ATOM   8572 N  N     . GLN F 3 455 ? -11.311 -0.845  -16.608 1.00 30.06 ? 455 GLN B N     1 
ATOM   8573 C  CA    . GLN F 3 455 ? -12.454 -0.387  -17.405 1.00 31.46 ? 455 GLN B CA    1 
ATOM   8574 C  C     . GLN F 3 455 ? -12.608 1.121   -17.316 1.00 32.57 ? 455 GLN B C     1 
ATOM   8575 O  O     . GLN F 3 455 ? -12.797 1.806   -18.326 1.00 32.58 ? 455 GLN B O     1 
ATOM   8576 C  CB    . GLN F 3 455 ? -13.752 -1.015  -16.916 1.00 31.85 ? 455 GLN B CB    1 
ATOM   8577 C  CG    . GLN F 3 455 ? -14.957 -0.603  -17.749 1.00 33.88 ? 455 GLN B CG    1 
ATOM   8578 C  CD    . GLN F 3 455 ? -16.278 -0.813  -17.029 1.00 35.08 ? 455 GLN B CD    1 
ATOM   8579 O  OE1   . GLN F 3 455 ? -16.574 -1.913  -16.549 1.00 35.09 ? 455 GLN B OE1   1 
ATOM   8580 N  NE2   . GLN F 3 455 ? -17.089 0.247   -16.959 1.00 35.51 ? 455 GLN B NE2   1 
ATOM   8581 N  N     . LYS F 3 456 ? -12.530 1.611   -16.083 1.00 33.43 ? 456 LYS B N     1 
ATOM   8582 C  CA    . LYS F 3 456 ? -12.655 3.026   -15.742 1.00 34.15 ? 456 LYS B CA    1 
ATOM   8583 C  C     . LYS F 3 456 ? -11.657 3.974   -16.376 1.00 32.89 ? 456 LYS B C     1 
ATOM   8584 O  O     . LYS F 3 456 ? -11.962 5.130   -16.643 1.00 32.27 ? 456 LYS B O     1 
ATOM   8585 C  CB    . LYS F 3 456 ? -12.550 3.188   -14.235 1.00 37.78 ? 456 LYS B CB    1 
ATOM   8586 C  CG    . LYS F 3 456 ? -13.888 3.329   -13.559 1.00 41.07 ? 456 LYS B CG    1 
ATOM   8587 C  CD    . LYS F 3 456 ? -13.786 4.519   -12.638 1.00 44.56 ? 456 LYS B CD    1 
ATOM   8588 C  CE    . LYS F 3 456 ? -15.083 5.295   -12.665 1.00 46.34 ? 456 LYS B CE    1 
ATOM   8589 N  NZ    . LYS F 3 456 ? -14.797 6.743   -12.415 1.00 47.07 ? 456 LYS B NZ    1 
ATOM   8590 N  N     . THR F 3 457 ? -10.443 3.489   -16.566 1.00 32.04 ? 457 THR B N     1 
ATOM   8591 C  CA    . THR F 3 457 ? -9.385  4.287   -17.161 1.00 31.80 ? 457 THR B CA    1 
ATOM   8592 C  C     . THR F 3 457 ? -9.336  3.927   -18.618 1.00 30.42 ? 457 THR B C     1 
ATOM   8593 O  O     . THR F 3 457 ? -8.398  4.261   -19.327 1.00 33.70 ? 457 THR B O     1 
ATOM   8594 C  CB    . THR F 3 457 ? -8.019  3.985   -16.517 1.00 32.54 ? 457 THR B CB    1 
ATOM   8595 O  OG1   . THR F 3 457 ? -8.122  2.781   -15.753 1.00 34.12 ? 457 THR B OG1   1 
ATOM   8596 C  CG2   . THR F 3 457 ? -7.591  5.132   -15.616 1.00 33.77 ? 457 THR B CG2   1 
ATOM   8597 N  N     . ASN F 3 458 ? -10.369 3.243   -19.068 1.00 28.73 ? 458 ASN B N     1 
ATOM   8598 C  CA    . ASN F 3 458 ? -10.451 2.828   -20.458 1.00 28.53 ? 458 ASN B CA    1 
ATOM   8599 C  C     . ASN F 3 458 ? -9.116  2.238   -20.899 1.00 27.94 ? 458 ASN B C     1 
ATOM   8600 O  O     . ASN F 3 458 ? -8.665  2.440   -22.031 1.00 27.46 ? 458 ASN B O     1 
ATOM   8601 C  CB    . ASN F 3 458 ? -10.828 4.019   -21.343 1.00 29.31 ? 458 ASN B CB    1 
ATOM   8602 C  CG    . ASN F 3 458 ? -11.099 3.613   -22.784 1.00 30.04 ? 458 ASN B CG    1 
ATOM   8603 O  OD1   . ASN F 3 458 ? -11.886 2.703   -23.053 1.00 30.04 ? 458 ASN B OD1   1 
ATOM   8604 N  ND2   . ASN F 3 458 ? -10.448 4.295   -23.719 1.00 30.21 ? 458 ASN B ND2   1 
ATOM   8605 N  N     . THR F 3 459 ? -8.485  1.507   -19.988 1.00 26.60 ? 459 THR B N     1 
ATOM   8606 C  CA    . THR F 3 459 ? -7.208  0.877   -20.264 1.00 25.61 ? 459 THR B CA    1 
ATOM   8607 C  C     . THR F 3 459 ? -7.397  -0.497  -20.878 1.00 25.16 ? 459 THR B C     1 
ATOM   8608 O  O     . THR F 3 459 ? -8.062  -1.360  -20.312 1.00 24.34 ? 459 THR B O     1 
ATOM   8609 C  CB    . THR F 3 459 ? -6.379  0.747   -18.989 1.00 26.32 ? 459 THR B CB    1 
ATOM   8610 O  OG1   . THR F 3 459 ? -6.037  2.055   -18.513 1.00 26.90 ? 459 THR B OG1   1 
ATOM   8611 C  CG2   . THR F 3 459 ? -5.118  -0.043  -19.258 1.00 26.41 ? 459 THR B CG2   1 
ATOM   8612 N  N     . ALA F 3 460 ? -6.798  -0.691  -22.045 1.00 25.58 ? 460 ALA B N     1 
ATOM   8613 C  CA    . ALA F 3 460 ? -6.904  -1.951  -22.766 1.00 26.40 ? 460 ALA B CA    1 
ATOM   8614 C  C     . ALA F 3 460 ? -5.883  -3.004  -22.320 1.00 26.38 ? 460 ALA B C     1 
ATOM   8615 O  O     . ALA F 3 460 ? -4.743  -2.672  -22.010 1.00 28.63 ? 460 ALA B O     1 
ATOM   8616 C  CB    . ALA F 3 460 ? -6.755  -1.685  -24.257 1.00 25.08 ? 460 ALA B CB    1 
ATOM   8617 N  N     . ALA F 3 461 ? -6.302  -4.268  -22.294 1.00 25.67 ? 461 ALA B N     1 
ATOM   8618 C  CA    . ALA F 3 461 ? -5.428  -5.390  -21.923 1.00 26.05 ? 461 ALA B CA    1 
ATOM   8619 C  C     . ALA F 3 461 ? -6.028  -6.715  -22.390 1.00 25.67 ? 461 ALA B C     1 
ATOM   8620 O  O     . ALA F 3 461 ? -7.246  -6.893  -22.395 1.00 26.07 ? 461 ALA B O     1 
ATOM   8621 C  CB    . ALA F 3 461 ? -5.194  -5.430  -20.404 1.00 23.86 ? 461 ALA B CB    1 
ATOM   8622 N  N     . ASP F 3 462 ? -5.168  -7.647  -22.774 1.00 25.11 ? 462 ASP B N     1 
ATOM   8623 C  CA    . ASP F 3 462 ? -5.631  -8.943  -23.251 1.00 25.17 ? 462 ASP B CA    1 
ATOM   8624 C  C     . ASP F 3 462 ? -5.499  -9.941  -22.122 1.00 24.25 ? 462 ASP B C     1 
ATOM   8625 O  O     . ASP F 3 462 ? -6.233  -10.942 -22.036 1.00 22.85 ? 462 ASP B O     1 
ATOM   8626 C  CB    . ASP F 3 462 ? -4.774  -9.374  -24.440 1.00 25.31 ? 462 ASP B CB    1 
ATOM   8627 C  CG    . ASP F 3 462 ? -4.744  -8.326  -25.530 1.00 27.83 ? 462 ASP B CG    1 
ATOM   8628 O  OD1   . ASP F 3 462 ? -5.787  -8.159  -26.202 1.00 27.53 ? 462 ASP B OD1   1 
ATOM   8629 O  OD2   . ASP F 3 462 ? -3.690  -7.656  -25.698 1.00 29.30 ? 462 ASP B OD2   1 
ATOM   8630 N  N     . ILE F 3 463 ? -4.553  -9.639  -21.245 1.00 23.80 ? 463 ILE B N     1 
ATOM   8631 C  CA    . ILE F 3 463 ? -4.275  -10.489 -20.117 1.00 23.63 ? 463 ILE B CA    1 
ATOM   8632 C  C     . ILE F 3 463 ? -4.202  -9.670  -18.838 1.00 23.97 ? 463 ILE B C     1 
ATOM   8633 O  O     . ILE F 3 463 ? -3.697  -8.559  -18.810 1.00 24.18 ? 463 ILE B O     1 
ATOM   8634 C  CB    . ILE F 3 463 ? -2.930  -11.221 -20.273 1.00 23.71 ? 463 ILE B CB    1 
ATOM   8635 C  CG1   . ILE F 3 463 ? -2.918  -12.001 -21.589 1.00 23.19 ? 463 ILE B CG1   1 
ATOM   8636 C  CG2   . ILE F 3 463 ? -2.714  -12.149 -19.076 1.00 23.79 ? 463 ILE B CG2   1 
ATOM   8637 C  CD1   . ILE F 3 463 ? -4.002  -13.050 -21.712 1.00 21.45 ? 463 ILE B CD1   1 
ATOM   8638 N  N     . PHE F 3 464 ? -4.731  -10.253 -17.777 1.00 24.42 ? 464 PHE B N     1 
ATOM   8639 C  CA    . PHE F 3 464 ? -4.711  -9.680  -16.452 1.00 24.12 ? 464 PHE B CA    1 
ATOM   8640 C  C     . PHE F 3 464 ? -4.002  -10.708 -15.649 1.00 22.91 ? 464 PHE B C     1 
ATOM   8641 O  O     . PHE F 3 464 ? -4.389  -11.876 -15.681 1.00 23.68 ? 464 PHE B O     1 
ATOM   8642 C  CB    . PHE F 3 464 ? -6.148  -9.457  -15.888 1.00 28.00 ? 464 PHE B CB    1 
ATOM   8643 C  CG    . PHE F 3 464 ? -6.830  -8.218  -16.401 1.00 32.23 ? 464 PHE B CG    1 
ATOM   8644 C  CD1   . PHE F 3 464 ? -6.321  -7.478  -17.427 1.00 35.19 ? 464 PHE B CD1   1 
ATOM   8645 C  CD2   . PHE F 3 464 ? -8.052  -7.845  -15.889 1.00 34.74 ? 464 PHE B CD2   1 
ATOM   8646 C  CE1   . PHE F 3 464 ? -7.052  -6.371  -17.887 1.00 37.17 ? 464 PHE B CE1   1 
ATOM   8647 C  CE2   . PHE F 3 464 ? -8.731  -6.757  -16.330 1.00 36.83 ? 464 PHE B CE2   1 
ATOM   8648 C  CZ    . PHE F 3 464 ? -8.193  -6.005  -17.399 1.00 35.77 ? 464 PHE B CZ    1 
ATOM   8649 N  N     . ILE F 3 465 ? -2.998  -10.269 -14.900 1.00 20.84 ? 465 ILE B N     1 
ATOM   8650 C  CA    . ILE F 3 465 ? -2.317  -11.196 -14.011 1.00 19.13 ? 465 ILE B CA    1 
ATOM   8651 C  C     . ILE F 3 465 ? -2.431  -10.550 -12.634 1.00 18.07 ? 465 ILE B C     1 
ATOM   8652 O  O     . ILE F 3 465 ? -1.938  -9.446  -12.412 1.00 18.31 ? 465 ILE B O     1 
ATOM   8653 C  CB    . ILE F 3 465 ? -0.839  -11.401 -14.359 1.00 17.72 ? 465 ILE B CB    1 
ATOM   8654 C  CG1   . ILE F 3 465 ? -0.714  -12.142 -15.694 1.00 16.71 ? 465 ILE B CG1   1 
ATOM   8655 C  CG2   . ILE F 3 465 ? -0.177  -12.229 -13.288 1.00 17.43 ? 465 ILE B CG2   1 
ATOM   8656 C  CD1   . ILE F 3 465 ? 0.715   -12.516 -16.046 1.00 14.29 ? 465 ILE B CD1   1 
ATOM   8657 N  N     . VAL F 3 466 ? -3.098  -11.239 -11.721 1.00 16.30 ? 466 VAL B N     1 
ATOM   8658 C  CA    . VAL F 3 466 ? -3.278  -10.735 -10.373 1.00 16.04 ? 466 VAL B CA    1 
ATOM   8659 C  C     . VAL F 3 466 ? -2.478  -11.620 -9.425  1.00 15.78 ? 466 VAL B C     1 
ATOM   8660 O  O     . VAL F 3 466 ? -2.726  -12.826 -9.351  1.00 16.17 ? 466 VAL B O     1 
ATOM   8661 C  CB    . VAL F 3 466 ? -4.779  -10.765 -9.979  1.00 14.59 ? 466 VAL B CB    1 
ATOM   8662 C  CG1   . VAL F 3 466 ? -4.957  -10.163 -8.611  1.00 15.05 ? 466 VAL B CG1   1 
ATOM   8663 C  CG2   . VAL F 3 466 ? -5.613  -10.014 -11.002 1.00 12.22 ? 466 VAL B CG2   1 
ATOM   8664 N  N     . PHE F 3 467 ? -1.513  -11.032 -8.720  1.00 14.88 ? 467 PHE B N     1 
ATOM   8665 C  CA    . PHE F 3 467 ? -0.699  -11.800 -7.781  1.00 15.65 ? 467 PHE B CA    1 
ATOM   8666 C  C     . PHE F 3 467 ? -1.324  -11.641 -6.419  1.00 17.15 ? 467 PHE B C     1 
ATOM   8667 O  O     . PHE F 3 467 ? -1.068  -10.667 -5.713  1.00 18.36 ? 467 PHE B O     1 
ATOM   8668 C  CB    . PHE F 3 467 ? 0.743   -11.305 -7.775  1.00 13.49 ? 467 PHE B CB    1 
ATOM   8669 C  CG    . PHE F 3 467 ? 1.430   -11.456 -9.102  1.00 15.07 ? 467 PHE B CG    1 
ATOM   8670 C  CD1   . PHE F 3 467 ? 1.256   -10.505 -10.104 1.00 14.84 ? 467 PHE B CD1   1 
ATOM   8671 C  CD2   . PHE F 3 467 ? 2.242   -12.563 -9.363  1.00 15.19 ? 467 PHE B CD2   1 
ATOM   8672 C  CE1   . PHE F 3 467 ? 1.877   -10.647 -11.342 1.00 15.49 ? 467 PHE B CE1   1 
ATOM   8673 C  CE2   . PHE F 3 467 ? 2.865   -12.713 -10.600 1.00 14.72 ? 467 PHE B CE2   1 
ATOM   8674 C  CZ    . PHE F 3 467 ? 2.683   -11.752 -11.594 1.00 13.38 ? 467 PHE B CZ    1 
ATOM   8675 N  N     . THR F 3 468 ? -2.137  -12.623 -6.051  1.00 17.81 ? 468 THR B N     1 
ATOM   8676 C  CA    . THR F 3 468 ? -2.870  -12.575 -4.801  1.00 18.88 ? 468 THR B CA    1 
ATOM   8677 C  C     . THR F 3 468 ? -2.960  -13.925 -4.079  1.00 18.37 ? 468 THR B C     1 
ATOM   8678 O  O     . THR F 3 468 ? -2.545  -14.953 -4.607  1.00 19.34 ? 468 THR B O     1 
ATOM   8679 C  CB    . THR F 3 468 ? -4.293  -12.062 -5.108  1.00 18.50 ? 468 THR B CB    1 
ATOM   8680 O  OG1   . THR F 3 468 ? -5.076  -12.021 -3.912  1.00 19.96 ? 468 THR B OG1   1 
ATOM   8681 C  CG2   . THR F 3 468 ? -4.963  -12.984 -6.109  1.00 19.69 ? 468 THR B CG2   1 
ATOM   8682 N  N     . ASP F 3 469 ? -3.498  -13.910 -2.862  1.00 18.33 ? 469 ASP B N     1 
ATOM   8683 C  CA    . ASP F 3 469 ? -3.693  -15.133 -2.088  1.00 18.54 ? 469 ASP B CA    1 
ATOM   8684 C  C     . ASP F 3 469 ? -5.179  -15.485 -2.133  1.00 20.48 ? 469 ASP B C     1 
ATOM   8685 O  O     . ASP F 3 469 ? -5.627  -16.429 -1.482  1.00 21.39 ? 469 ASP B O     1 
ATOM   8686 C  CB    . ASP F 3 469 ? -3.224  -14.957 -0.644  1.00 16.20 ? 469 ASP B CB    1 
ATOM   8687 C  CG    . ASP F 3 469 ? -3.869  -13.784 0.044   1.00 15.85 ? 469 ASP B CG    1 
ATOM   8688 O  OD1   . ASP F 3 469 ? -3.348  -13.362 1.093   1.00 16.98 ? 469 ASP B OD1   1 
ATOM   8689 O  OD2   . ASP F 3 469 ? -4.893  -13.281 -0.448  1.00 16.29 ? 469 ASP B OD2   1 
ATOM   8690 N  N     . CYS F 3 470 ? -5.927  -14.703 -2.915  1.00 20.77 ? 470 CYS B N     1 
ATOM   8691 C  CA    . CYS F 3 470 ? -7.359  -14.894 -3.124  1.00 21.60 ? 470 CYS B CA    1 
ATOM   8692 C  C     . CYS F 3 470 ? -8.280  -14.680 -1.918  1.00 21.33 ? 470 CYS B C     1 
ATOM   8693 O  O     . CYS F 3 470 ? -9.461  -15.030 -1.954  1.00 20.56 ? 470 CYS B O     1 
ATOM   8694 C  CB    . CYS F 3 470 ? -7.596  -16.280 -3.730  1.00 22.30 ? 470 CYS B CB    1 
ATOM   8695 S  SG    . CYS F 3 470 ? -6.796  -16.503 -5.337  1.00 25.15 ? 470 CYS B SG    1 
ATOM   8696 N  N     . GLU F 3 471 ? -7.739  -14.088 -0.861  1.00 22.19 ? 471 GLU B N     1 
ATOM   8697 C  CA    . GLU F 3 471 ? -8.508  -13.804 0.347   1.00 21.80 ? 471 GLU B CA    1 
ATOM   8698 C  C     . GLU F 3 471 ? -9.172  -12.430 0.204   1.00 21.91 ? 471 GLU B C     1 
ATOM   8699 O  O     . GLU F 3 471 ? -8.920  -11.510 0.972   1.00 20.44 ? 471 GLU B O     1 
ATOM   8700 C  CB    . GLU F 3 471 ? -7.577  -13.809 1.566   1.00 21.92 ? 471 GLU B CB    1 
ATOM   8701 C  CG    . GLU F 3 471 ? -6.822  -15.128 1.829   1.00 21.03 ? 471 GLU B CG    1 
ATOM   8702 C  CD    . GLU F 3 471 ? -7.628  -16.142 2.619   1.00 19.91 ? 471 GLU B CD    1 
ATOM   8703 O  OE1   . GLU F 3 471 ? -7.018  -16.929 3.366   1.00 18.58 ? 471 GLU B OE1   1 
ATOM   8704 O  OE2   . GLU F 3 471 ? -8.867  -16.158 2.495   1.00 21.23 ? 471 GLU B OE2   1 
ATOM   8705 N  N     . THR F 3 472 ? -10.014 -12.293 -0.807  1.00 24.05 ? 472 THR B N     1 
ATOM   8706 C  CA    . THR F 3 472 ? -10.707 -11.039 -1.047  1.00 25.91 ? 472 THR B CA    1 
ATOM   8707 C  C     . THR F 3 472 ? -11.730 -10.882 0.086   1.00 26.31 ? 472 THR B C     1 
ATOM   8708 O  O     . THR F 3 472 ? -12.266 -11.875 0.565   1.00 25.28 ? 472 THR B O     1 
ATOM   8709 C  CB    . THR F 3 472 ? -11.384 -11.064 -2.446  1.00 26.27 ? 472 THR B CB    1 
ATOM   8710 O  OG1   . THR F 3 472 ? -11.915 -9.770  -2.753  1.00 27.83 ? 472 THR B OG1   1 
ATOM   8711 C  CG2   . THR F 3 472 ? -12.493 -12.101 -2.486  1.00 26.63 ? 472 THR B CG2   1 
ATOM   8712 N  N     . ASN F 3 473 ? -12.003 -9.650  0.515   1.00 27.40 ? 473 ASN B N     1 
ATOM   8713 C  CA    . ASN F 3 473 ? -12.918 -9.460  1.633   1.00 29.28 ? 473 ASN B CA    1 
ATOM   8714 C  C     . ASN F 3 473 ? -13.710 -8.156  1.723   1.00 29.87 ? 473 ASN B C     1 
ATOM   8715 O  O     . ASN F 3 473 ? -14.235 -7.835  2.794   1.00 29.36 ? 473 ASN B O     1 
ATOM   8716 C  CB    . ASN F 3 473 ? -12.149 -9.647  2.951   1.00 31.08 ? 473 ASN B CB    1 
ATOM   8717 C  CG    . ASN F 3 473 ? -11.034 -8.612  3.132   1.00 33.58 ? 473 ASN B CG    1 
ATOM   8718 O  OD1   . ASN F 3 473 ? -10.096 -8.549  2.351   1.00 36.30 ? 473 ASN B OD1   1 
ATOM   8719 N  ND2   . ASN F 3 473 ? -11.144 -7.796  4.163   1.00 36.46 ? 473 ASN B ND2   1 
ATOM   8720 N  N     . VAL F 3 474 ? -13.796 -7.386  0.645   1.00 30.36 ? 474 VAL B N     1 
ATOM   8721 C  CA    . VAL F 3 474 ? -14.572 -6.157  0.732   1.00 31.30 ? 474 VAL B CA    1 
ATOM   8722 C  C     . VAL F 3 474 ? -15.905 -6.352  0.020   1.00 33.31 ? 474 VAL B C     1 
ATOM   8723 O  O     . VAL F 3 474 ? -16.062 -7.257  -0.805  1.00 34.05 ? 474 VAL B O     1 
ATOM   8724 C  CB    . VAL F 3 474 ? -13.847 -4.951  0.113   1.00 30.69 ? 474 VAL B CB    1 
ATOM   8725 C  CG1   . VAL F 3 474 ? -12.466 -4.813  0.709   1.00 28.38 ? 474 VAL B CG1   1 
ATOM   8726 C  CG2   . VAL F 3 474 ? -13.791 -5.093  -1.385  1.00 32.33 ? 474 VAL B CG2   1 
ATOM   8727 N  N     . GLU F 3 475 ? -16.867 -5.499  0.346   1.00 34.02 ? 475 GLU B N     1 
ATOM   8728 C  CA    . GLU F 3 475 ? -18.191 -5.579  -0.242  1.00 33.87 ? 475 GLU B CA    1 
ATOM   8729 C  C     . GLU F 3 475 ? -18.212 -4.815  -1.556  1.00 32.69 ? 475 GLU B C     1 
ATOM   8730 O  O     . GLU F 3 475 ? -18.637 -3.661  -1.630  1.00 32.40 ? 475 GLU B O     1 
ATOM   8731 C  CB    . GLU F 3 475 ? -19.179 -5.051  0.782   1.00 35.87 ? 475 GLU B CB    1 
ATOM   8732 C  CG    . GLU F 3 475 ? -19.098 -5.919  2.033   1.00 39.14 ? 475 GLU B CG    1 
ATOM   8733 C  CD    . GLU F 3 475 ? -19.783 -5.327  3.237   1.00 41.83 ? 475 GLU B CD    1 
ATOM   8734 O  OE1   . GLU F 3 475 ? -20.240 -6.118  4.095   1.00 43.47 ? 475 GLU B OE1   1 
ATOM   8735 O  OE2   . GLU F 3 475 ? -19.856 -4.085  3.337   1.00 43.19 ? 475 GLU B OE2   1 
ATOM   8736 N  N     . ASP F 3 476 ? -17.718 -5.497  -2.584  1.00 31.41 ? 476 ASP B N     1 
ATOM   8737 C  CA    . ASP F 3 476 ? -17.594 -4.977  -3.938  1.00 30.78 ? 476 ASP B CA    1 
ATOM   8738 C  C     . ASP F 3 476 ? -17.951 -6.172  -4.819  1.00 29.73 ? 476 ASP B C     1 
ATOM   8739 O  O     . ASP F 3 476 ? -17.996 -7.303  -4.340  1.00 30.90 ? 476 ASP B O     1 
ATOM   8740 C  CB    . ASP F 3 476 ? -16.138 -4.571  -4.170  1.00 33.25 ? 476 ASP B CB    1 
ATOM   8741 C  CG    . ASP F 3 476 ? -15.960 -3.638  -5.334  1.00 35.02 ? 476 ASP B CG    1 
ATOM   8742 O  OD1   . ASP F 3 476 ? -15.063 -3.897  -6.166  1.00 37.93 ? 476 ASP B OD1   1 
ATOM   8743 O  OD2   . ASP F 3 476 ? -16.689 -2.622  -5.416  1.00 38.33 ? 476 ASP B OD2   1 
ATOM   8744 N  N     . VAL F 3 477 ? -18.205 -5.942  -6.098  1.00 27.59 ? 477 VAL B N     1 
ATOM   8745 C  CA    . VAL F 3 477 ? -18.547 -7.048  -6.979  1.00 25.44 ? 477 VAL B CA    1 
ATOM   8746 C  C     . VAL F 3 477 ? -17.440 -8.102  -7.010  1.00 25.51 ? 477 VAL B C     1 
ATOM   8747 O  O     . VAL F 3 477 ? -16.280 -7.794  -6.751  1.00 25.43 ? 477 VAL B O     1 
ATOM   8748 C  CB    . VAL F 3 477 ? -18.764 -6.565  -8.416  1.00 24.91 ? 477 VAL B CB    1 
ATOM   8749 C  CG1   . VAL F 3 477 ? -19.842 -5.508  -8.450  1.00 24.60 ? 477 VAL B CG1   1 
ATOM   8750 C  CG2   . VAL F 3 477 ? -17.456 -6.031  -8.982  1.00 24.31 ? 477 VAL B CG2   1 
ATOM   8751 N  N     . HIS F 3 478 ? -17.808 -9.342  -7.332  1.00 25.13 ? 478 HIS B N     1 
ATOM   8752 C  CA    . HIS F 3 478 ? -16.849 -10.445 -7.440  1.00 23.36 ? 478 HIS B CA    1 
ATOM   8753 C  C     . HIS F 3 478 ? -15.872 -10.169 -8.576  1.00 22.39 ? 478 HIS B C     1 
ATOM   8754 O  O     . HIS F 3 478 ? -16.266 -9.683  -9.635  1.00 22.28 ? 478 HIS B O     1 
ATOM   8755 C  CB    . HIS F 3 478 ? -17.573 -11.751 -7.759  1.00 23.97 ? 478 HIS B CB    1 
ATOM   8756 C  CG    . HIS F 3 478 ? -18.252 -12.371 -6.587  1.00 24.06 ? 478 HIS B CG    1 
ATOM   8757 N  ND1   . HIS F 3 478 ? -17.607 -13.235 -5.729  1.00 25.00 ? 478 HIS B ND1   1 
ATOM   8758 C  CD2   . HIS F 3 478 ? -19.515 -12.245 -6.116  1.00 24.06 ? 478 HIS B CD2   1 
ATOM   8759 C  CE1   . HIS F 3 478 ? -18.444 -13.616 -4.781  1.00 25.07 ? 478 HIS B CE1   1 
ATOM   8760 N  NE2   . HIS F 3 478 ? -19.609 -13.029 -4.993  1.00 25.53 ? 478 HIS B NE2   1 
ATOM   8761 N  N     . PRO F 3 479 ? -14.587 -10.501 -8.383  1.00 22.05 ? 479 PRO B N     1 
ATOM   8762 C  CA    . PRO F 3 479 ? -13.597 -10.265 -9.437  1.00 22.15 ? 479 PRO B CA    1 
ATOM   8763 C  C     . PRO F 3 479 ? -13.990 -10.886 -10.774 1.00 21.12 ? 479 PRO B C     1 
ATOM   8764 O  O     . PRO F 3 479 ? -13.792 -10.277 -11.819 1.00 21.78 ? 479 PRO B O     1 
ATOM   8765 C  CB    . PRO F 3 479 ? -12.307 -10.856 -8.852  1.00 22.22 ? 479 PRO B CB    1 
ATOM   8766 C  CG    . PRO F 3 479 ? -12.796 -11.856 -7.874  1.00 22.59 ? 479 PRO B CG    1 
ATOM   8767 C  CD    . PRO F 3 479 ? -13.975 -11.178 -7.231  1.00 21.87 ? 479 PRO B CD    1 
ATOM   8768 N  N     . ALA F 3 480 ? -14.550 -12.089 -10.742 1.00 21.45 ? 480 ALA B N     1 
ATOM   8769 C  CA    . ALA F 3 480 ? -14.987 -12.747 -11.974 1.00 23.45 ? 480 ALA B CA    1 
ATOM   8770 C  C     . ALA F 3 480 ? -16.063 -11.884 -12.650 1.00 24.88 ? 480 ALA B C     1 
ATOM   8771 O  O     . ALA F 3 480 ? -16.122 -11.783 -13.876 1.00 24.24 ? 480 ALA B O     1 
ATOM   8772 C  CB    . ALA F 3 480 ? -15.540 -14.125 -11.662 1.00 21.73 ? 480 ALA B CB    1 
ATOM   8773 N  N     . THR F 3 481 ? -16.909 -11.264 -11.832 1.00 25.97 ? 481 THR B N     1 
ATOM   8774 C  CA    . THR F 3 481 ? -17.961 -10.387 -12.326 1.00 27.44 ? 481 THR B CA    1 
ATOM   8775 C  C     . THR F 3 481 ? -17.300 -9.140  -12.924 1.00 27.29 ? 481 THR B C     1 
ATOM   8776 O  O     . THR F 3 481 ? -17.716 -8.641  -13.974 1.00 28.30 ? 481 THR B O     1 
ATOM   8777 C  CB    . THR F 3 481 ? -18.924 -9.949  -11.175 1.00 29.08 ? 481 THR B CB    1 
ATOM   8778 O  OG1   . THR F 3 481 ? -19.549 -11.105 -10.594 1.00 31.09 ? 481 THR B OG1   1 
ATOM   8779 C  CG2   . THR F 3 481 ? -20.001 -9.008  -11.707 1.00 28.05 ? 481 THR B CG2   1 
ATOM   8780 N  N     . ALA F 3 482 ? -16.268 -8.648  -12.243 1.00 25.34 ? 482 ALA B N     1 
ATOM   8781 C  CA    . ALA F 3 482 ? -15.533 -7.471  -12.686 1.00 25.31 ? 482 ALA B CA    1 
ATOM   8782 C  C     . ALA F 3 482 ? -14.880 -7.682  -14.059 1.00 25.20 ? 482 ALA B C     1 
ATOM   8783 O  O     . ALA F 3 482 ? -14.820 -6.762  -14.879 1.00 24.73 ? 482 ALA B O     1 
ATOM   8784 C  CB    . ALA F 3 482 ? -14.478 -7.111  -11.649 1.00 24.08 ? 482 ALA B CB    1 
ATOM   8785 N  N     . LEU F 3 483 ? -14.389 -8.894  -14.302 1.00 24.97 ? 483 LEU B N     1 
ATOM   8786 C  CA    . LEU F 3 483 ? -13.760 -9.215  -15.574 1.00 25.81 ? 483 LEU B CA    1 
ATOM   8787 C  C     . LEU F 3 483 ? -14.808 -9.237  -16.687 1.00 27.03 ? 483 LEU B C     1 
ATOM   8788 O  O     . LEU F 3 483 ? -14.598 -8.662  -17.755 1.00 28.14 ? 483 LEU B O     1 
ATOM   8789 C  CB    . LEU F 3 483 ? -13.053 -10.568 -15.491 1.00 25.10 ? 483 LEU B CB    1 
ATOM   8790 C  CG    . LEU F 3 483 ? -12.325 -11.050 -16.747 1.00 24.28 ? 483 LEU B CG    1 
ATOM   8791 C  CD1   . LEU F 3 483 ? -11.231 -10.060 -17.124 1.00 23.79 ? 483 LEU B CD1   1 
ATOM   8792 C  CD2   . LEU F 3 483 ? -11.738 -12.431 -16.486 1.00 25.15 ? 483 LEU B CD2   1 
ATOM   8793 N  N     . LYS F 3 484 ? -15.934 -9.898  -16.441 1.00 27.93 ? 484 LYS B N     1 
ATOM   8794 C  CA    . LYS F 3 484 ? -17.002 -9.950  -17.432 1.00 29.02 ? 484 LYS B CA    1 
ATOM   8795 C  C     . LYS F 3 484 ? -17.439 -8.532  -17.807 1.00 28.37 ? 484 LYS B C     1 
ATOM   8796 O  O     . LYS F 3 484 ? -17.494 -8.175  -18.987 1.00 27.06 ? 484 LYS B O     1 
ATOM   8797 C  CB    . LYS F 3 484 ? -18.198 -10.738 -16.890 1.00 29.88 ? 484 LYS B CB    1 
ATOM   8798 C  CG    . LYS F 3 484 ? -17.929 -12.228 -16.766 1.00 32.59 ? 484 LYS B CG    1 
ATOM   8799 C  CD    . LYS F 3 484 ? -19.162 -12.973 -16.294 1.00 34.57 ? 484 LYS B CD    1 
ATOM   8800 C  CE    . LYS F 3 484 ? -18.965 -14.479 -16.413 1.00 37.33 ? 484 LYS B CE    1 
ATOM   8801 N  NZ    . LYS F 3 484 ? -18.915 -14.934 -17.844 1.00 38.09 ? 484 LYS B NZ    1 
ATOM   8802 N  N     . GLN F 3 485 ? -17.750 -7.729  -16.797 1.00 28.28 ? 485 GLN B N     1 
ATOM   8803 C  CA    . GLN F 3 485 ? -18.160 -6.354  -17.035 1.00 28.35 ? 485 GLN B CA    1 
ATOM   8804 C  C     . GLN F 3 485 ? -17.104 -5.658  -17.875 1.00 27.13 ? 485 GLN B C     1 
ATOM   8805 O  O     . GLN F 3 485 ? -17.427 -4.794  -18.684 1.00 27.33 ? 485 GLN B O     1 
ATOM   8806 C  CB    . GLN F 3 485 ? -18.359 -5.611  -15.707 1.00 29.19 ? 485 GLN B CB    1 
ATOM   8807 C  CG    . GLN F 3 485 ? -19.620 -6.035  -14.962 1.00 31.05 ? 485 GLN B CG    1 
ATOM   8808 C  CD    . GLN F 3 485 ? -19.855 -5.264  -13.670 1.00 32.31 ? 485 GLN B CD    1 
ATOM   8809 O  OE1   . GLN F 3 485 ? -20.899 -5.420  -13.023 1.00 33.52 ? 485 GLN B OE1   1 
ATOM   8810 N  NE2   . GLN F 3 485 ? -18.886 -4.436  -13.283 1.00 29.89 ? 485 GLN B NE2   1 
ATOM   8811 N  N     . TYR F 3 486 ? -15.843 -6.048  -17.686 1.00 26.00 ? 486 TYR B N     1 
ATOM   8812 C  CA    . TYR F 3 486 ? -14.742 -5.462  -18.440 1.00 24.37 ? 486 TYR B CA    1 
ATOM   8813 C  C     . TYR F 3 486 ? -14.839 -5.900  -19.893 1.00 24.34 ? 486 TYR B C     1 
ATOM   8814 O  O     . TYR F 3 486 ? -14.866 -5.083  -20.807 1.00 22.16 ? 486 TYR B O     1 
ATOM   8815 C  CB    . TYR F 3 486 ? -13.395 -5.909  -17.871 1.00 23.16 ? 486 TYR B CB    1 
ATOM   8816 C  CG    . TYR F 3 486 ? -12.211 -5.356  -18.641 1.00 24.20 ? 486 TYR B CG    1 
ATOM   8817 C  CD1   . TYR F 3 486 ? -11.708 -4.074  -18.377 1.00 23.16 ? 486 TYR B CD1   1 
ATOM   8818 C  CD2   . TYR F 3 486 ? -11.635 -6.081  -19.691 1.00 23.72 ? 486 TYR B CD2   1 
ATOM   8819 C  CE1   . TYR F 3 486 ? -10.667 -3.526  -19.151 1.00 22.05 ? 486 TYR B CE1   1 
ATOM   8820 C  CE2   . TYR F 3 486 ? -10.597 -5.540  -20.466 1.00 22.62 ? 486 TYR B CE2   1 
ATOM   8821 C  CZ    . TYR F 3 486 ? -10.122 -4.268  -20.190 1.00 21.48 ? 486 TYR B CZ    1 
ATOM   8822 O  OH    . TYR F 3 486 ? -9.112  -3.746  -20.962 1.00 20.55 ? 486 TYR B OH    1 
ATOM   8823 N  N     . ARG F 3 487 ? -14.895 -7.206  -20.104 1.00 27.33 ? 487 ARG B N     1 
ATOM   8824 C  CA    . ARG F 3 487 ? -14.983 -7.725  -21.459 1.00 30.53 ? 487 ARG B CA    1 
ATOM   8825 C  C     . ARG F 3 487 ? -16.071 -6.967  -22.219 1.00 31.19 ? 487 ARG B C     1 
ATOM   8826 O  O     . ARG F 3 487 ? -15.777 -6.288  -23.203 1.00 31.13 ? 487 ARG B O     1 
ATOM   8827 C  CB    . ARG F 3 487 ? -15.272 -9.231  -21.438 1.00 31.34 ? 487 ARG B CB    1 
ATOM   8828 C  CG    . ARG F 3 487 ? -14.119 -10.089 -20.895 1.00 32.36 ? 487 ARG B CG    1 
ATOM   8829 C  CD    . ARG F 3 487 ? -14.421 -11.563 -20.989 1.00 32.77 ? 487 ARG B CD    1 
ATOM   8830 N  NE    . ARG F 3 487 ? -14.072 -12.332 -19.835 1.00 33.81 ? 487 ARG B NE    1 
ATOM   8831 C  CZ    . ARG F 3 487 ? -13.615 -13.569 -19.685 1.00 34.77 ? 487 ARG B CZ    1 
ATOM   8832 N  NH1   . ARG F 3 487 ? -13.446 -13.939 -18.424 1.00 36.34 ? 487 ARG B NH1   1 
ATOM   8833 N  NH2   . ARG F 3 487 ? -13.293 -14.386 -20.675 1.00 36.66 ? 487 ARG B NH2   1 
ATOM   8834 N  N     . GLU F 3 488 ? -17.308 -7.050  -21.735 1.00 32.75 ? 488 GLU B N     1 
ATOM   8835 C  CA    . GLU F 3 488 ? -18.427 -6.368  -22.380 1.00 34.76 ? 488 GLU B CA    1 
ATOM   8836 C  C     . GLU F 3 488 ? -18.167 -4.891  -22.612 1.00 34.48 ? 488 GLU B C     1 
ATOM   8837 O  O     . GLU F 3 488 ? -18.357 -4.396  -23.722 1.00 34.90 ? 488 GLU B O     1 
ATOM   8838 C  CB    . GLU F 3 488 ? -19.710 -6.532  -21.557 1.00 37.32 ? 488 GLU B CB    1 
ATOM   8839 C  CG    . GLU F 3 488 ? -20.112 -7.987  -21.370 1.00 42.30 ? 488 GLU B CG    1 
ATOM   8840 C  CD    . GLU F 3 488 ? -21.285 -8.179  -20.395 1.00 45.34 ? 488 GLU B CD    1 
ATOM   8841 O  OE1   . GLU F 3 488 ? -21.117 -7.890  -19.179 1.00 47.62 ? 488 GLU B OE1   1 
ATOM   8842 O  OE2   . GLU F 3 488 ? -22.381 -8.609  -20.887 1.00 47.99 ? 488 GLU B OE2   1 
ATOM   8843 N  N     . LYS F 3 489 ? -17.717 -4.184  -21.585 1.00 34.60 ? 489 LYS B N     1 
ATOM   8844 C  CA    . LYS F 3 489 ? -17.484 -2.766  -21.748 1.00 35.58 ? 489 LYS B CA    1 
ATOM   8845 C  C     . LYS F 3 489 ? -16.435 -2.442  -22.790 1.00 35.44 ? 489 LYS B C     1 
ATOM   8846 O  O     . LYS F 3 489 ? -16.698 -1.664  -23.699 1.00 36.17 ? 489 LYS B O     1 
ATOM   8847 C  CB    . LYS F 3 489 ? -17.100 -2.130  -20.414 1.00 38.80 ? 489 LYS B CB    1 
ATOM   8848 C  CG    . LYS F 3 489 ? -17.143 -0.596  -20.399 1.00 42.34 ? 489 LYS B CG    1 
ATOM   8849 C  CD    . LYS F 3 489 ? -18.209 -0.022  -21.354 1.00 46.04 ? 489 LYS B CD    1 
ATOM   8850 C  CE    . LYS F 3 489 ? -19.208 0.902   -20.645 1.00 47.56 ? 489 LYS B CE    1 
ATOM   8851 N  NZ    . LYS F 3 489 ? -18.519 1.746   -19.616 1.00 50.82 ? 489 LYS B NZ    1 
ATOM   8852 N  N     . MET F 3 490 ? -15.259 -3.054  -22.676 1.00 34.68 ? 490 MET B N     1 
ATOM   8853 C  CA    . MET F 3 490 ? -14.149 -2.785  -23.600 1.00 33.76 ? 490 MET B CA    1 
ATOM   8854 C  C     . MET F 3 490 ? -14.201 -3.536  -24.932 1.00 33.29 ? 490 MET B C     1 
ATOM   8855 O  O     . MET F 3 490 ? -13.495 -3.185  -25.878 1.00 33.35 ? 490 MET B O     1 
ATOM   8856 C  CB    . MET F 3 490 ? -12.805 -3.087  -22.919 1.00 33.65 ? 490 MET B CB    1 
ATOM   8857 C  CG    . MET F 3 490 ? -12.573 -2.368  -21.605 1.00 32.39 ? 490 MET B CG    1 
ATOM   8858 S  SD    . MET F 3 490 ? -12.401 -0.594  -21.797 1.00 36.10 ? 490 MET B SD    1 
ATOM   8859 C  CE    . MET F 3 490 ? -10.813 -0.446  -22.647 1.00 32.89 ? 490 MET B CE    1 
ATOM   8860 N  N     . GLY F 3 491 ? -15.014 -4.577  -25.010 1.00 32.20 ? 491 GLY B N     1 
ATOM   8861 C  CA    . GLY F 3 491 ? -15.099 -5.316  -26.250 1.00 30.94 ? 491 GLY B CA    1 
ATOM   8862 C  C     . GLY F 3 491 ? -13.859 -6.141  -26.514 1.00 31.08 ? 491 GLY B C     1 
ATOM   8863 O  O     . GLY F 3 491 ? -13.530 -6.427  -27.665 1.00 32.29 ? 491 GLY B O     1 
ATOM   8864 N  N     . ILE F 3 492 ? -13.167 -6.525  -25.446 1.00 30.24 ? 492 ILE B N     1 
ATOM   8865 C  CA    . ILE F 3 492 ? -11.964 -7.351  -25.553 1.00 28.62 ? 492 ILE B CA    1 
ATOM   8866 C  C     . ILE F 3 492 ? -12.196 -8.668  -24.809 1.00 27.96 ? 492 ILE B C     1 
ATOM   8867 O  O     . ILE F 3 492 ? -12.803 -8.675  -23.738 1.00 29.02 ? 492 ILE B O     1 
ATOM   8868 C  CB    . ILE F 3 492 ? -10.742 -6.646  -24.923 1.00 28.39 ? 492 ILE B CB    1 
ATOM   8869 C  CG1   . ILE F 3 492 ? -10.472 -5.324  -25.648 1.00 27.87 ? 492 ILE B CG1   1 
ATOM   8870 C  CG2   . ILE F 3 492 ? -9.525  -7.569  -24.973 1.00 28.20 ? 492 ILE B CG2   1 
ATOM   8871 C  CD1   . ILE F 3 492 ? -9.314  -4.524  -25.075 1.00 26.09 ? 492 ILE B CD1   1 
ATOM   8872 N  N     . PRO F 3 493 ? -11.722 -9.798  -25.364 1.00 27.21 ? 493 PRO B N     1 
ATOM   8873 C  CA    . PRO F 3 493 ? -11.902 -11.101 -24.714 1.00 26.58 ? 493 PRO B CA    1 
ATOM   8874 C  C     . PRO F 3 493 ? -10.932 -11.302 -23.544 1.00 26.75 ? 493 PRO B C     1 
ATOM   8875 O  O     . PRO F 3 493 ? -10.562 -12.442 -23.227 1.00 28.48 ? 493 PRO B O     1 
ATOM   8876 C  CB    . PRO F 3 493 ? -11.619 -12.104 -25.843 1.00 25.87 ? 493 PRO B CB    1 
ATOM   8877 C  CG    . PRO F 3 493 ? -11.677 -11.307 -27.095 1.00 24.67 ? 493 PRO B CG    1 
ATOM   8878 C  CD    . PRO F 3 493 ? -11.131 -9.977  -26.699 1.00 26.23 ? 493 PRO B CD    1 
ATOM   8879 N  N     . ALA F 3 494 ? -10.515 -10.201 -22.919 1.00 26.13 ? 494 ALA B N     1 
ATOM   8880 C  CA    . ALA F 3 494 ? -9.576  -10.228 -21.782 1.00 24.13 ? 494 ALA B CA    1 
ATOM   8881 C  C     . ALA F 3 494 ? -9.620  -11.500 -20.931 1.00 22.99 ? 494 ALA B C     1 
ATOM   8882 O  O     . ALA F 3 494 ? -10.682 -11.922 -20.464 1.00 24.28 ? 494 ALA B O     1 
ATOM   8883 C  CB    . ALA F 3 494 ? -9.807  -9.012  -20.895 1.00 21.78 ? 494 ALA B CB    1 
ATOM   8884 N  N     . LYS F 3 495 ? -8.456  -12.108 -20.739 1.00 22.96 ? 495 LYS B N     1 
ATOM   8885 C  CA    . LYS F 3 495 ? -8.338  -13.323 -19.934 1.00 22.94 ? 495 LYS B CA    1 
ATOM   8886 C  C     . LYS F 3 495 ? -7.869  -12.948 -18.526 1.00 22.84 ? 495 LYS B C     1 
ATOM   8887 O  O     . LYS F 3 495 ? -7.420  -11.823 -18.292 1.00 22.06 ? 495 LYS B O     1 
ATOM   8888 C  CB    . LYS F 3 495 ? -7.321  -14.275 -20.567 1.00 23.49 ? 495 LYS B CB    1 
ATOM   8889 C  CG    . LYS F 3 495 ? -7.670  -14.719 -21.977 1.00 24.92 ? 495 LYS B CG    1 
ATOM   8890 C  CD    . LYS F 3 495 ? -6.496  -15.421 -22.649 1.00 24.78 ? 495 LYS B CD    1 
ATOM   8891 C  CE    . LYS F 3 495 ? -6.920  -16.002 -23.983 1.00 26.31 ? 495 LYS B CE    1 
ATOM   8892 N  NZ    . LYS F 3 495 ? -5.985  -15.644 -25.083 1.00 27.68 ? 495 LYS B NZ    1 
ATOM   8893 N  N     . LEU F 3 496 ? -7.970  -13.884 -17.590 1.00 22.41 ? 496 LEU B N     1 
ATOM   8894 C  CA    . LEU F 3 496 ? -7.532  -13.617 -16.223 1.00 21.96 ? 496 LEU B CA    1 
ATOM   8895 C  C     . LEU F 3 496 ? -6.702  -14.751 -15.639 1.00 22.39 ? 496 LEU B C     1 
ATOM   8896 O  O     . LEU F 3 496 ? -7.182  -15.882 -15.505 1.00 21.85 ? 496 LEU B O     1 
ATOM   8897 C  CB    . LEU F 3 496 ? -8.724  -13.378 -15.304 1.00 22.35 ? 496 LEU B CB    1 
ATOM   8898 C  CG    . LEU F 3 496 ? -8.282  -13.259 -13.843 1.00 22.48 ? 496 LEU B CG    1 
ATOM   8899 C  CD1   . LEU F 3 496 ? -7.439  -12.019 -13.699 1.00 22.18 ? 496 LEU B CD1   1 
ATOM   8900 C  CD2   . LEU F 3 496 ? -9.483  -13.200 -12.913 1.00 22.40 ? 496 LEU B CD2   1 
ATOM   8901 N  N     . ILE F 3 497 ? -5.455  -14.430 -15.292 1.00 21.97 ? 497 ILE B N     1 
ATOM   8902 C  CA    . ILE F 3 497 ? -4.523  -15.389 -14.701 1.00 19.29 ? 497 ILE B CA    1 
ATOM   8903 C  C     . ILE F 3 497 ? -4.319  -15.006 -13.250 1.00 19.68 ? 497 ILE B C     1 
ATOM   8904 O  O     . ILE F 3 497 ? -3.885  -13.900 -12.952 1.00 20.58 ? 497 ILE B O     1 
ATOM   8905 C  CB    . ILE F 3 497 ? -3.166  -15.356 -15.406 1.00 17.92 ? 497 ILE B CB    1 
ATOM   8906 C  CG1   . ILE F 3 497 ? -3.329  -15.826 -16.843 1.00 18.07 ? 497 ILE B CG1   1 
ATOM   8907 C  CG2   . ILE F 3 497 ? -2.160  -16.242 -14.669 1.00 16.66 ? 497 ILE B CG2   1 
ATOM   8908 C  CD1   . ILE F 3 497 ? -2.021  -15.926 -17.588 1.00 20.68 ? 497 ILE B CD1   1 
ATOM   8909 N  N     . VAL F 3 498 ? -4.646  -15.914 -12.344 1.00 20.39 ? 498 VAL B N     1 
ATOM   8910 C  CA    . VAL F 3 498 ? -4.496  -15.639 -10.920 1.00 20.37 ? 498 VAL B CA    1 
ATOM   8911 C  C     . VAL F 3 498 ? -3.241  -16.306 -10.447 1.00 20.20 ? 498 VAL B C     1 
ATOM   8912 O  O     . VAL F 3 498 ? -3.186  -17.523 -10.362 1.00 21.81 ? 498 VAL B O     1 
ATOM   8913 C  CB    . VAL F 3 498 ? -5.640  -16.222 -10.088 1.00 18.65 ? 498 VAL B CB    1 
ATOM   8914 C  CG1   . VAL F 3 498 ? -6.124  -15.203 -9.114  1.00 22.85 ? 498 VAL B CG1   1 
ATOM   8915 C  CG2   . VAL F 3 498 ? -6.760  -16.656 -10.983 1.00 19.41 ? 498 VAL B CG2   1 
ATOM   8916 N  N     . CYS F 3 499 ? -2.221  -15.523 -10.151 1.00 20.21 ? 499 CYS B N     1 
ATOM   8917 C  CA    . CYS F 3 499 ? -0.983  -16.106 -9.685  1.00 20.83 ? 499 CYS B CA    1 
ATOM   8918 C  C     . CYS F 3 499 ? -1.038  -16.238 -8.168  1.00 19.93 ? 499 CYS B C     1 
ATOM   8919 O  O     . CYS F 3 499 ? -0.916  -15.247 -7.454  1.00 20.21 ? 499 CYS B O     1 
ATOM   8920 C  CB    . CYS F 3 499 ? 0.181   -15.225 -10.104 1.00 22.97 ? 499 CYS B CB    1 
ATOM   8921 S  SG    . CYS F 3 499 ? 1.768   -15.949 -9.702  1.00 31.18 ? 499 CYS B SG    1 
ATOM   8922 N  N     . ALA F 3 500 ? -1.219  -17.466 -7.683  1.00 20.42 ? 500 ALA B N     1 
ATOM   8923 C  CA    . ALA F 3 500 ? -1.324  -17.755 -6.246  1.00 19.59 ? 500 ALA B CA    1 
ATOM   8924 C  C     . ALA F 3 500 ? -0.039  -17.519 -5.472  1.00 20.22 ? 500 ALA B C     1 
ATOM   8925 O  O     . ALA F 3 500 ? 1.054   -17.864 -5.930  1.00 19.85 ? 500 ALA B O     1 
ATOM   8926 C  CB    . ALA F 3 500 ? -1.789  -19.190 -6.031  1.00 17.99 ? 500 ALA B CB    1 
ATOM   8927 N  N     . MET F 3 501 ? -0.182  -16.948 -4.279  1.00 20.47 ? 501 MET B N     1 
ATOM   8928 C  CA    . MET F 3 501 ? 0.977   -16.664 -3.437  1.00 20.80 ? 501 MET B CA    1 
ATOM   8929 C  C     . MET F 3 501 ? 1.074   -17.576 -2.209  1.00 19.36 ? 501 MET B C     1 
ATOM   8930 O  O     . MET F 3 501 ? 1.993   -17.435 -1.404  1.00 19.67 ? 501 MET B O     1 
ATOM   8931 C  CB    . MET F 3 501 ? 0.967   -15.189 -2.995  1.00 21.12 ? 501 MET B CB    1 
ATOM   8932 C  CG    . MET F 3 501 ? 1.068   -14.180 -4.126  1.00 19.52 ? 501 MET B CG    1 
ATOM   8933 S  SD    . MET F 3 501 ? 2.566   -14.415 -5.093  1.00 23.46 ? 501 MET B SD    1 
ATOM   8934 C  CE    . MET F 3 501 ? 3.857   -14.252 -3.807  1.00 21.28 ? 501 MET B CE    1 
ATOM   8935 N  N     . THR F 3 502 ? 0.131   -18.501 -2.060  1.00 18.03 ? 502 THR B N     1 
ATOM   8936 C  CA    . THR F 3 502 ? 0.163   -19.426 -0.926  1.00 17.61 ? 502 THR B CA    1 
ATOM   8937 C  C     . THR F 3 502 ? -0.298  -20.816 -1.343  1.00 19.48 ? 502 THR B C     1 
ATOM   8938 O  O     . THR F 3 502 ? -0.525  -21.081 -2.529  1.00 19.89 ? 502 THR B O     1 
ATOM   8939 C  CB    . THR F 3 502 ? -0.760  -18.992 0.194   1.00 15.33 ? 502 THR B CB    1 
ATOM   8940 O  OG1   . THR F 3 502 ? -2.107  -19.211 -0.210  1.00 12.98 ? 502 THR B OG1   1 
ATOM   8941 C  CG2   . THR F 3 502 ? -0.561  -17.547 0.508   1.00 13.67 ? 502 THR B CG2   1 
ATOM   8942 N  N     . SER F 3 503 ? -0.427  -21.709 -0.363  1.00 19.52 ? 503 SER B N     1 
ATOM   8943 C  CA    . SER F 3 503 ? -0.896  -23.062 -0.641  1.00 18.60 ? 503 SER B CA    1 
ATOM   8944 C  C     . SER F 3 503 ? -2.306  -23.296 -0.075  1.00 19.16 ? 503 SER B C     1 
ATOM   8945 O  O     . SER F 3 503 ? -2.713  -24.435 0.138   1.00 18.74 ? 503 SER B O     1 
ATOM   8946 C  CB    . SER F 3 503 ? 0.080   -24.098 -0.091  1.00 17.28 ? 503 SER B CB    1 
ATOM   8947 O  OG    . SER F 3 503 ? 0.094   -24.109 1.317   1.00 19.52 ? 503 SER B OG    1 
ATOM   8948 N  N     . ASN F 3 504 ? -3.040  -22.209 0.177   1.00 19.51 ? 504 ASN B N     1 
ATOM   8949 C  CA    . ASN F 3 504 ? -4.420  -22.306 0.658   1.00 20.31 ? 504 ASN B CA    1 
ATOM   8950 C  C     . ASN F 3 504 ? -5.164  -22.832 -0.553  1.00 19.99 ? 504 ASN B C     1 
ATOM   8951 O  O     . ASN F 3 504 ? -4.610  -22.818 -1.645  1.00 22.42 ? 504 ASN B O     1 
ATOM   8952 C  CB    . ASN F 3 504 ? -4.983  -20.933 1.029   1.00 20.31 ? 504 ASN B CB    1 
ATOM   8953 C  CG    . ASN F 3 504 ? -5.188  -20.055 -0.173  1.00 21.44 ? 504 ASN B CG    1 
ATOM   8954 O  OD1   . ASN F 3 504 ? -4.241  -19.729 -0.862  1.00 26.43 ? 504 ASN B OD1   1 
ATOM   8955 N  ND2   . ASN F 3 504 ? -6.426  -19.681 -0.436  1.00 24.70 ? 504 ASN B ND2   1 
ATOM   8956 N  N     . GLY F 3 505 ? -6.410  -23.259 -0.384  1.00 19.16 ? 505 GLY B N     1 
ATOM   8957 C  CA    . GLY F 3 505 ? -7.152  -23.794 -1.513  1.00 17.52 ? 505 GLY B CA    1 
ATOM   8958 C  C     . GLY F 3 505 ? -8.188  -22.880 -2.134  1.00 17.86 ? 505 GLY B C     1 
ATOM   8959 O  O     . GLY F 3 505 ? -9.209  -23.353 -2.637  1.00 17.79 ? 505 GLY B O     1 
ATOM   8960 N  N     . PHE F 3 506 ? -7.920  -21.577 -2.126  1.00 17.94 ? 506 PHE B N     1 
ATOM   8961 C  CA    . PHE F 3 506 ? -8.845  -20.593 -2.683  1.00 17.31 ? 506 PHE B CA    1 
ATOM   8962 C  C     . PHE F 3 506 ? -8.430  -19.967 -4.032  1.00 17.43 ? 506 PHE B C     1 
ATOM   8963 O  O     . PHE F 3 506 ? -7.249  -19.870 -4.369  1.00 16.17 ? 506 PHE B O     1 
ATOM   8964 C  CB    . PHE F 3 506 ? -9.074  -19.475 -1.666  1.00 15.94 ? 506 PHE B CB    1 
ATOM   8965 C  CG    . PHE F 3 506 ? -9.423  -19.963 -0.285  1.00 14.35 ? 506 PHE B CG    1 
ATOM   8966 C  CD1   . PHE F 3 506 ? -10.479 -20.841 -0.088  1.00 13.33 ? 506 PHE B CD1   1 
ATOM   8967 C  CD2   . PHE F 3 506 ? -8.719  -19.502 0.829   1.00 13.28 ? 506 PHE B CD2   1 
ATOM   8968 C  CE1   . PHE F 3 506 ? -10.835 -21.246 1.190   1.00 10.86 ? 506 PHE B CE1   1 
ATOM   8969 C  CE2   . PHE F 3 506 ? -9.062  -19.897 2.101   1.00 11.49 ? 506 PHE B CE2   1 
ATOM   8970 C  CZ    . PHE F 3 506 ? -10.125 -20.774 2.288   1.00 10.66 ? 506 PHE B CZ    1 
ATOM   8971 N  N     . SER F 3 507 ? -9.419  -19.538 -4.805  1.00 18.04 ? 507 SER B N     1 
ATOM   8972 C  CA    . SER F 3 507 ? -9.142  -18.916 -6.092  1.00 18.57 ? 507 SER B CA    1 
ATOM   8973 C  C     . SER F 3 507 ? -10.277 -18.008 -6.517  1.00 19.79 ? 507 SER B C     1 
ATOM   8974 O  O     . SER F 3 507 ? -11.443 -18.363 -6.378  1.00 23.08 ? 507 SER B O     1 
ATOM   8975 C  CB    . SER F 3 507 ? -8.926  -19.981 -7.166  1.00 17.14 ? 507 SER B CB    1 
ATOM   8976 O  OG    . SER F 3 507 ? -8.793  -19.378 -8.440  1.00 15.82 ? 507 SER B OG    1 
ATOM   8977 N  N     . ILE F 3 508 ? -9.941  -16.827 -7.015  1.00 18.92 ? 508 ILE B N     1 
ATOM   8978 C  CA    . ILE F 3 508 ? -10.966 -15.912 -7.498  1.00 19.17 ? 508 ILE B CA    1 
ATOM   8979 C  C     . ILE F 3 508 ? -11.233 -16.196 -8.986  1.00 20.93 ? 508 ILE B C     1 
ATOM   8980 O  O     . ILE F 3 508 ? -11.889 -15.411 -9.669  1.00 20.83 ? 508 ILE B O     1 
ATOM   8981 C  CB    . ILE F 3 508 ? -10.514 -14.462 -7.366  1.00 16.65 ? 508 ILE B CB    1 
ATOM   8982 C  CG1   . ILE F 3 508 ? -9.233  -14.255 -8.184  1.00 14.68 ? 508 ILE B CG1   1 
ATOM   8983 C  CG2   . ILE F 3 508 ? -10.342 -14.119 -5.902  1.00 15.30 ? 508 ILE B CG2   1 
ATOM   8984 C  CD1   . ILE F 3 508 ? -8.723  -12.833 -8.197  1.00 12.52 ? 508 ILE B CD1   1 
ATOM   8985 N  N     . ALA F 3 509 ? -10.713 -17.320 -9.476  1.00 21.86 ? 509 ALA B N     1 
ATOM   8986 C  CA    . ALA F 3 509 ? -10.877 -17.712 -10.869 1.00 23.01 ? 509 ALA B CA    1 
ATOM   8987 C  C     . ALA F 3 509 ? -12.045 -18.678 -11.059 1.00 24.13 ? 509 ALA B C     1 
ATOM   8988 O  O     . ALA F 3 509 ? -12.117 -19.719 -10.403 1.00 24.54 ? 509 ALA B O     1 
ATOM   8989 C  CB    . ALA F 3 509 ? -9.590  -18.346 -11.385 1.00 21.83 ? 509 ALA B CB    1 
ATOM   8990 N  N     . ASP F 3 510 ? -12.946 -18.326 -11.974 1.00 24.65 ? 510 ASP B N     1 
ATOM   8991 C  CA    . ASP F 3 510 ? -14.124 -19.133 -12.268 1.00 26.38 ? 510 ASP B CA    1 
ATOM   8992 C  C     . ASP F 3 510 ? -13.779 -20.358 -13.118 1.00 27.22 ? 510 ASP B C     1 
ATOM   8993 O  O     . ASP F 3 510 ? -13.402 -20.232 -14.283 1.00 27.45 ? 510 ASP B O     1 
ATOM   8994 C  CB    . ASP F 3 510 ? -15.166 -18.296 -13.005 1.00 26.05 ? 510 ASP B CB    1 
ATOM   8995 C  CG    . ASP F 3 510 ? -16.518 -18.974 -13.060 1.00 27.17 ? 510 ASP B CG    1 
ATOM   8996 O  OD1   . ASP F 3 510 ? -16.553 -20.217 -13.212 1.00 26.30 ? 510 ASP B OD1   1 
ATOM   8997 O  OD2   . ASP F 3 510 ? -17.544 -18.261 -12.956 1.00 27.99 ? 510 ASP B OD2   1 
ATOM   8998 N  N     . PRO F 3 511 ? -13.929 -21.563 -12.547 1.00 27.36 ? 511 PRO B N     1 
ATOM   8999 C  CA    . PRO F 3 511 ? -13.622 -22.800 -13.271 1.00 27.37 ? 511 PRO B CA    1 
ATOM   9000 C  C     . PRO F 3 511 ? -14.426 -22.953 -14.552 1.00 27.78 ? 511 PRO B C     1 
ATOM   9001 O  O     . PRO F 3 511 ? -13.990 -23.615 -15.483 1.00 27.74 ? 511 PRO B O     1 
ATOM   9002 C  CB    . PRO F 3 511 ? -13.964 -23.891 -12.257 1.00 27.29 ? 511 PRO B CB    1 
ATOM   9003 C  CG    . PRO F 3 511 ? -13.781 -23.213 -10.931 1.00 27.80 ? 511 PRO B CG    1 
ATOM   9004 C  CD    . PRO F 3 511 ? -14.378 -21.854 -11.173 1.00 27.20 ? 511 PRO B CD    1 
ATOM   9005 N  N     . ASP F 3 512 ? -15.605 -22.345 -14.600 1.00 29.73 ? 512 ASP B N     1 
ATOM   9006 C  CA    . ASP F 3 512 ? -16.450 -22.459 -15.781 1.00 31.19 ? 512 ASP B CA    1 
ATOM   9007 C  C     . ASP F 3 512 ? -16.124 -21.465 -16.895 1.00 31.72 ? 512 ASP B C     1 
ATOM   9008 O  O     . ASP F 3 512 ? -16.754 -21.491 -17.953 1.00 31.89 ? 512 ASP B O     1 
ATOM   9009 C  CB    . ASP F 3 512 ? -17.927 -22.347 -15.386 1.00 33.20 ? 512 ASP B CB    1 
ATOM   9010 C  CG    . ASP F 3 512 ? -18.366 -23.475 -14.462 1.00 36.39 ? 512 ASP B CG    1 
ATOM   9011 O  OD1   . ASP F 3 512 ? -17.990 -24.639 -14.738 1.00 36.80 ? 512 ASP B OD1   1 
ATOM   9012 O  OD2   . ASP F 3 512 ? -19.089 -23.203 -13.472 1.00 37.71 ? 512 ASP B OD2   1 
ATOM   9013 N  N     . ASP F 3 513 ? -15.149 -20.591 -16.663 1.00 31.26 ? 513 ASP B N     1 
ATOM   9014 C  CA    . ASP F 3 513 ? -14.758 -19.622 -17.677 1.00 30.99 ? 513 ASP B CA    1 
ATOM   9015 C  C     . ASP F 3 513 ? -13.402 -20.037 -18.256 1.00 29.76 ? 513 ASP B C     1 
ATOM   9016 O  O     . ASP F 3 513 ? -12.387 -20.053 -17.558 1.00 28.45 ? 513 ASP B O     1 
ATOM   9017 C  CB    . ASP F 3 513 ? -14.687 -18.217 -17.060 1.00 33.69 ? 513 ASP B CB    1 
ATOM   9018 C  CG    . ASP F 3 513 ? -14.459 -17.125 -18.100 1.00 35.35 ? 513 ASP B CG    1 
ATOM   9019 O  OD1   . ASP F 3 513 ? -15.184 -16.107 -18.074 1.00 36.28 ? 513 ASP B OD1   1 
ATOM   9020 O  OD2   . ASP F 3 513 ? -13.552 -17.270 -18.949 1.00 37.27 ? 513 ASP B OD2   1 
ATOM   9021 N  N     . ARG F 3 514 ? -13.387 -20.376 -19.539 1.00 28.81 ? 514 ARG B N     1 
ATOM   9022 C  CA    . ARG F 3 514 ? -12.148 -20.801 -20.178 1.00 28.16 ? 514 ARG B CA    1 
ATOM   9023 C  C     . ARG F 3 514 ? -11.077 -19.713 -20.249 1.00 25.45 ? 514 ARG B C     1 
ATOM   9024 O  O     . ARG F 3 514 ? -9.913  -20.003 -20.514 1.00 24.47 ? 514 ARG B O     1 
ATOM   9025 C  CB    . ARG F 3 514 ? -12.434 -21.353 -21.586 1.00 30.09 ? 514 ARG B CB    1 
ATOM   9026 C  CG    . ARG F 3 514 ? -13.279 -20.446 -22.454 1.00 35.25 ? 514 ARG B CG    1 
ATOM   9027 C  CD    . ARG F 3 514 ? -13.430 -20.975 -23.889 1.00 39.41 ? 514 ARG B CD    1 
ATOM   9028 N  NE    . ARG F 3 514 ? -12.191 -20.861 -24.658 1.00 43.25 ? 514 ARG B NE    1 
ATOM   9029 C  CZ    . ARG F 3 514 ? -12.138 -20.609 -25.967 1.00 45.27 ? 514 ARG B CZ    1 
ATOM   9030 N  NH1   . ARG F 3 514 ? -10.963 -20.522 -26.582 1.00 46.22 ? 514 ARG B NH1   1 
ATOM   9031 N  NH2   . ARG F 3 514 ? -13.257 -20.431 -26.664 1.00 45.96 ? 514 ARG B NH2   1 
ATOM   9032 N  N     . GLY F 3 515 ? -11.464 -18.466 -20.009 1.00 23.90 ? 515 GLY B N     1 
ATOM   9033 C  CA    . GLY F 3 515 ? -10.507 -17.377 -20.073 1.00 22.48 ? 515 GLY B CA    1 
ATOM   9034 C  C     . GLY F 3 515 ? -9.858  -17.045 -18.745 1.00 22.32 ? 515 GLY B C     1 
ATOM   9035 O  O     . GLY F 3 515 ? -9.161  -16.038 -18.620 1.00 22.85 ? 515 GLY B O     1 
ATOM   9036 N  N     . MET F 3 516 ? -10.096 -17.883 -17.744 1.00 22.29 ? 516 MET B N     1 
ATOM   9037 C  CA    . MET F 3 516 ? -9.517  -17.670 -16.425 1.00 22.43 ? 516 MET B CA    1 
ATOM   9038 C  C     . MET F 3 516 ? -8.643  -18.857 -16.034 1.00 21.96 ? 516 MET B C     1 
ATOM   9039 O  O     . MET F 3 516 ? -9.100  -20.002 -16.004 1.00 21.90 ? 516 MET B O     1 
ATOM   9040 C  CB    . MET F 3 516 ? -10.624 -17.433 -15.391 1.00 23.71 ? 516 MET B CB    1 
ATOM   9041 C  CG    . MET F 3 516 ? -11.263 -16.053 -15.522 1.00 25.71 ? 516 MET B CG    1 
ATOM   9042 S  SD    . MET F 3 516 ? -12.504 -15.659 -14.274 1.00 25.66 ? 516 MET B SD    1 
ATOM   9043 C  CE    . MET F 3 516 ? -13.947 -15.458 -15.266 1.00 22.80 ? 516 MET B CE    1 
ATOM   9044 N  N     . LEU F 3 517 ? -7.379  -18.572 -15.742 1.00 21.01 ? 517 LEU B N     1 
ATOM   9045 C  CA    . LEU F 3 517 ? -6.433  -19.613 -15.396 1.00 22.13 ? 517 LEU B CA    1 
ATOM   9046 C  C     . LEU F 3 517 ? -5.864  -19.484 -13.996 1.00 23.56 ? 517 LEU B C     1 
ATOM   9047 O  O     . LEU F 3 517 ? -5.643  -18.383 -13.497 1.00 24.05 ? 517 LEU B O     1 
ATOM   9048 C  CB    . LEU F 3 517 ? -5.277  -19.619 -16.393 1.00 21.69 ? 517 LEU B CB    1 
ATOM   9049 C  CG    . LEU F 3 517 ? -4.224  -20.716 -16.185 1.00 22.84 ? 517 LEU B CG    1 
ATOM   9050 C  CD1   . LEU F 3 517 ? -4.871  -22.068 -16.455 1.00 20.95 ? 517 LEU B CD1   1 
ATOM   9051 C  CD2   . LEU F 3 517 ? -3.029  -20.502 -17.115 1.00 22.37 ? 517 LEU B CD2   1 
ATOM   9052 N  N     . ASP F 3 518 ? -5.589  -20.622 -13.374 1.00 24.28 ? 518 ASP B N     1 
ATOM   9053 C  CA    . ASP F 3 518 ? -5.036  -20.641 -12.020 1.00 25.87 ? 518 ASP B CA    1 
ATOM   9054 C  C     . ASP F 3 518 ? -3.600  -21.133 -12.049 1.00 25.03 ? 518 ASP B C     1 
ATOM   9055 O  O     . ASP F 3 518 ? -3.357  -22.304 -12.310 1.00 25.07 ? 518 ASP B O     1 
ATOM   9056 C  CB    . ASP F 3 518 ? -5.827  -21.591 -11.138 1.00 28.77 ? 518 ASP B CB    1 
ATOM   9057 C  CG    . ASP F 3 518 ? -6.537  -20.891 -10.036 1.00 32.40 ? 518 ASP B CG    1 
ATOM   9058 O  OD1   . ASP F 3 518 ? -6.575  -21.461 -8.934  1.00 38.16 ? 518 ASP B OD1   1 
ATOM   9059 O  OD2   . ASP F 3 518 ? -7.067  -19.781 -10.251 1.00 34.71 ? 518 ASP B OD2   1 
ATOM   9060 N  N     . ILE F 3 519 ? -2.641  -20.258 -11.786 1.00 24.45 ? 519 ILE B N     1 
ATOM   9061 C  CA    . ILE F 3 519 ? -1.257  -20.699 -11.785 1.00 23.83 ? 519 ILE B CA    1 
ATOM   9062 C  C     . ILE F 3 519 ? -0.635  -20.433 -10.426 1.00 24.68 ? 519 ILE B C     1 
ATOM   9063 O  O     . ILE F 3 519 ? -1.203  -19.733 -9.598  1.00 23.92 ? 519 ILE B O     1 
ATOM   9064 C  CB    . ILE F 3 519 ? -0.419  -19.998 -12.879 1.00 22.62 ? 519 ILE B CB    1 
ATOM   9065 C  CG1   . ILE F 3 519 ? -0.148  -18.548 -12.493 1.00 21.54 ? 519 ILE B CG1   1 
ATOM   9066 C  CG2   . ILE F 3 519 ? -1.164  -20.059 -14.202 1.00 22.80 ? 519 ILE B CG2   1 
ATOM   9067 C  CD1   . ILE F 3 519 ? 0.960   -17.926 -13.292 1.00 23.04 ? 519 ILE B CD1   1 
ATOM   9068 N  N     . CYS F 3 520 ? 0.536   -21.002 -10.200 1.00 26.60 ? 520 CYS B N     1 
ATOM   9069 C  CA    . CYS F 3 520 ? 1.223   -20.833 -8.939  1.00 29.26 ? 520 CYS B CA    1 
ATOM   9070 C  C     . CYS F 3 520 ? 2.342   -19.805 -9.000  1.00 29.46 ? 520 CYS B C     1 
ATOM   9071 O  O     . CYS F 3 520 ? 3.073   -19.722 -9.986  1.00 29.72 ? 520 CYS B O     1 
ATOM   9072 C  CB    . CYS F 3 520 ? 1.790   -22.177 -8.490  1.00 31.90 ? 520 CYS B CB    1 
ATOM   9073 S  SG    . CYS F 3 520 ? 2.758   -22.089 -6.972  1.00 38.90 ? 520 CYS B SG    1 
ATOM   9074 N  N     . GLY F 3 521 ? 2.472   -19.024 -7.935  1.00 30.87 ? 521 GLY B N     1 
ATOM   9075 C  CA    . GLY F 3 521 ? 3.523   -18.026 -7.879  1.00 31.76 ? 521 GLY B CA    1 
ATOM   9076 C  C     . GLY F 3 521 ? 4.855   -18.668 -7.556  1.00 32.60 ? 521 GLY B C     1 
ATOM   9077 O  O     . GLY F 3 521 ? 4.923   -19.657 -6.827  1.00 33.89 ? 521 GLY B O     1 
ATOM   9078 N  N     . PHE F 3 522 ? 5.922   -18.127 -8.116  1.00 33.43 ? 522 PHE B N     1 
ATOM   9079 C  CA    . PHE F 3 522 ? 7.256   -18.649 -7.875  1.00 33.75 ? 522 PHE B CA    1 
ATOM   9080 C  C     . PHE F 3 522 ? 7.540   -20.070 -8.348  1.00 33.30 ? 522 PHE B C     1 
ATOM   9081 O  O     . PHE F 3 522 ? 8.190   -20.871 -7.674  1.00 33.08 ? 522 PHE B O     1 
ATOM   9082 C  CB    . PHE F 3 522 ? 7.632   -18.484 -6.415  1.00 36.19 ? 522 PHE B CB    1 
ATOM   9083 C  CG    . PHE F 3 522 ? 8.786   -17.574 -6.214  1.00 38.14 ? 522 PHE B CG    1 
ATOM   9084 C  CD1   . PHE F 3 522 ? 10.086  -18.007 -6.344  1.00 40.01 ? 522 PHE B CD1   1 
ATOM   9085 C  CD2   . PHE F 3 522 ? 8.590   -16.224 -5.936  1.00 39.86 ? 522 PHE B CD2   1 
ATOM   9086 C  CE1   . PHE F 3 522 ? 11.152  -17.116 -6.176  1.00 41.12 ? 522 PHE B CE1   1 
ATOM   9087 C  CE2   . PHE F 3 522 ? 9.712   -15.373 -5.784  1.00 41.07 ? 522 PHE B CE2   1 
ATOM   9088 C  CZ    . PHE F 3 522 ? 10.933  -15.825 -5.913  1.00 40.13 ? 522 PHE B CZ    1 
ATOM   9089 N  N     . ASP F 3 523 ? 7.008   -20.371 -9.526  1.00 33.22 ? 523 ASP B N     1 
ATOM   9090 C  CA    . ASP F 3 523 ? 7.240   -21.633 -10.214 1.00 31.26 ? 523 ASP B CA    1 
ATOM   9091 C  C     . ASP F 3 523 ? 8.211   -21.076 -11.258 1.00 30.83 ? 523 ASP B C     1 
ATOM   9092 O  O     . ASP F 3 523 ? 7.835   -20.199 -12.045 1.00 30.26 ? 523 ASP B O     1 
ATOM   9093 C  CB    . ASP F 3 523 ? 5.959   -22.117 -10.896 1.00 31.49 ? 523 ASP B CB    1 
ATOM   9094 C  CG    . ASP F 3 523 ? 6.196   -23.284 -11.862 1.00 30.99 ? 523 ASP B CG    1 
ATOM   9095 O  OD1   . ASP F 3 523 ? 5.197   -23.834 -12.379 1.00 31.09 ? 523 ASP B OD1   1 
ATOM   9096 O  OD2   . ASP F 3 523 ? 7.364   -23.652 -12.107 1.00 29.50 ? 523 ASP B OD2   1 
ATOM   9097 N  N     . SER F 3 524 ? 9.465   -21.515 -11.238 1.00 29.97 ? 524 SER B N     1 
ATOM   9098 C  CA    . SER F 3 524 ? 10.421  -21.000 -12.215 1.00 29.61 ? 524 SER B CA    1 
ATOM   9099 C  C     . SER F 3 524 ? 9.939   -21.256 -13.642 1.00 28.60 ? 524 SER B C     1 
ATOM   9100 O  O     . SER F 3 524 ? 10.500  -20.722 -14.602 1.00 29.04 ? 524 SER B O     1 
ATOM   9101 C  CB    . SER F 3 524 ? 11.814  -21.606 -11.996 1.00 29.70 ? 524 SER B CB    1 
ATOM   9102 O  OG    . SER F 3 524 ? 11.739  -22.877 -11.387 1.00 31.25 ? 524 SER B OG    1 
ATOM   9103 N  N     . GLY F 3 525 ? 8.889   -22.061 -13.775 1.00 26.25 ? 525 GLY B N     1 
ATOM   9104 C  CA    . GLY F 3 525 ? 8.355   -22.351 -15.087 1.00 24.60 ? 525 GLY B CA    1 
ATOM   9105 C  C     . GLY F 3 525 ? 7.095   -21.553 -15.343 1.00 23.75 ? 525 GLY B C     1 
ATOM   9106 O  O     . GLY F 3 525 ? 6.479   -21.681 -16.400 1.00 23.38 ? 525 GLY B O     1 
ATOM   9107 N  N     . ALA F 3 526 ? 6.714   -20.725 -14.378 1.00 22.72 ? 526 ALA B N     1 
ATOM   9108 C  CA    . ALA F 3 526 ? 5.505   -19.910 -14.487 1.00 22.99 ? 526 ALA B CA    1 
ATOM   9109 C  C     . ALA F 3 526 ? 5.384   -19.190 -15.837 1.00 22.35 ? 526 ALA B C     1 
ATOM   9110 O  O     . ALA F 3 526 ? 4.298   -19.112 -16.422 1.00 20.78 ? 526 ALA B O     1 
ATOM   9111 C  CB    . ALA F 3 526 ? 5.454   -18.888 -13.335 1.00 22.85 ? 526 ALA B CB    1 
ATOM   9112 N  N     . LEU F 3 527 ? 6.509   -18.671 -16.315 1.00 21.78 ? 527 LEU B N     1 
ATOM   9113 C  CA    . LEU F 3 527 ? 6.568   -17.947 -17.573 1.00 22.26 ? 527 LEU B CA    1 
ATOM   9114 C  C     . LEU F 3 527 ? 6.000   -18.722 -18.764 1.00 23.47 ? 527 LEU B C     1 
ATOM   9115 O  O     . LEU F 3 527 ? 5.278   -18.165 -19.590 1.00 24.11 ? 527 LEU B O     1 
ATOM   9116 C  CB    . LEU F 3 527 ? 8.018   -17.548 -17.848 1.00 20.12 ? 527 LEU B CB    1 
ATOM   9117 C  CG    . LEU F 3 527 ? 8.364   -16.053 -17.843 1.00 20.40 ? 527 LEU B CG    1 
ATOM   9118 C  CD1   . LEU F 3 527 ? 7.616   -15.279 -16.770 1.00 18.57 ? 527 LEU B CD1   1 
ATOM   9119 C  CD2   . LEU F 3 527 ? 9.849   -15.930 -17.647 1.00 19.69 ? 527 LEU B CD2   1 
ATOM   9120 N  N     . ASP F 3 528 ? 6.313   -20.007 -18.855 1.00 24.99 ? 528 ASP B N     1 
ATOM   9121 C  CA    . ASP F 3 528 ? 5.826   -20.819 -19.964 1.00 25.79 ? 528 ASP B CA    1 
ATOM   9122 C  C     . ASP F 3 528 ? 4.322   -21.042 -19.874 1.00 25.05 ? 528 ASP B C     1 
ATOM   9123 O  O     . ASP F 3 528 ? 3.631   -21.013 -20.890 1.00 26.30 ? 528 ASP B O     1 
ATOM   9124 C  CB    . ASP F 3 528 ? 6.537   -22.168 -19.980 1.00 28.69 ? 528 ASP B CB    1 
ATOM   9125 C  CG    . ASP F 3 528 ? 7.067   -22.532 -21.353 1.00 32.92 ? 528 ASP B CG    1 
ATOM   9126 O  OD1   . ASP F 3 528 ? 6.875   -23.692 -21.761 1.00 37.61 ? 528 ASP B OD1   1 
ATOM   9127 O  OD2   . ASP F 3 528 ? 7.689   -21.681 -22.035 1.00 35.56 ? 528 ASP B OD2   1 
ATOM   9128 N  N     . VAL F 3 529 ? 3.809   -21.249 -18.664 1.00 22.96 ? 529 VAL B N     1 
ATOM   9129 C  CA    . VAL F 3 529 ? 2.377   -21.477 -18.483 1.00 22.41 ? 529 VAL B CA    1 
ATOM   9130 C  C     . VAL F 3 529 ? 1.573   -20.237 -18.854 1.00 21.89 ? 529 VAL B C     1 
ATOM   9131 O  O     . VAL F 3 529 ? 0.553   -20.333 -19.538 1.00 22.67 ? 529 VAL B O     1 
ATOM   9132 C  CB    . VAL F 3 529 ? 2.018   -21.862 -17.027 1.00 22.86 ? 529 VAL B CB    1 
ATOM   9133 C  CG1   . VAL F 3 529 ? 1.238   -23.155 -17.019 1.00 21.87 ? 529 VAL B CG1   1 
ATOM   9134 C  CG2   . VAL F 3 529 ? 3.275   -21.999 -16.193 1.00 23.45 ? 529 VAL B CG2   1 
ATOM   9135 N  N     . ILE F 3 530 ? 2.032   -19.073 -18.407 1.00 19.78 ? 530 ILE B N     1 
ATOM   9136 C  CA    . ILE F 3 530 ? 1.339   -17.836 -18.720 1.00 18.46 ? 530 ILE B CA    1 
ATOM   9137 C  C     . ILE F 3 530 ? 1.332   -17.627 -20.228 1.00 17.99 ? 530 ILE B C     1 
ATOM   9138 O  O     . ILE F 3 530 ? 0.336   -17.169 -20.810 1.00 16.41 ? 530 ILE B O     1 
ATOM   9139 C  CB    . ILE F 3 530 ? 2.013   -16.626 -18.045 1.00 18.52 ? 530 ILE B CB    1 
ATOM   9140 C  CG1   . ILE F 3 530 ? 1.922   -16.769 -16.521 1.00 18.92 ? 530 ILE B CG1   1 
ATOM   9141 C  CG2   . ILE F 3 530 ? 1.340   -15.346 -18.502 1.00 15.83 ? 530 ILE B CG2   1 
ATOM   9142 C  CD1   . ILE F 3 530 ? 2.720   -15.742 -15.766 1.00 18.86 ? 530 ILE B CD1   1 
ATOM   9143 N  N     . ARG F 3 531 ? 2.447   -17.975 -20.858 1.00 16.54 ? 531 ARG B N     1 
ATOM   9144 C  CA    . ARG F 3 531 ? 2.566   -17.832 -22.294 1.00 17.00 ? 531 ARG B CA    1 
ATOM   9145 C  C     . ARG F 3 531 ? 1.614   -18.754 -23.020 1.00 17.42 ? 531 ARG B C     1 
ATOM   9146 O  O     . ARG F 3 531 ? 0.826   -18.304 -23.839 1.00 16.18 ? 531 ARG B O     1 
ATOM   9147 C  CB    . ARG F 3 531 ? 3.992   -18.116 -22.743 1.00 16.22 ? 531 ARG B CB    1 
ATOM   9148 C  CG    . ARG F 3 531 ? 4.167   -18.049 -24.238 1.00 17.44 ? 531 ARG B CG    1 
ATOM   9149 C  CD    . ARG F 3 531 ? 5.592   -17.685 -24.586 1.00 21.31 ? 531 ARG B CD    1 
ATOM   9150 N  NE    . ARG F 3 531 ? 5.824   -17.721 -26.027 1.00 23.61 ? 531 ARG B NE    1 
ATOM   9151 C  CZ    . ARG F 3 531 ? 5.855   -18.838 -26.742 1.00 23.68 ? 531 ARG B CZ    1 
ATOM   9152 N  NH1   . ARG F 3 531 ? 6.064   -18.781 -28.051 1.00 25.15 ? 531 ARG B NH1   1 
ATOM   9153 N  NH2   . ARG F 3 531 ? 5.685   -20.009 -26.146 1.00 22.31 ? 531 ARG B NH2   1 
ATOM   9154 N  N     . ASN F 3 532 ? 1.690   -20.047 -22.720 1.00 20.17 ? 532 ASN B N     1 
ATOM   9155 C  CA    . ASN F 3 532 ? 0.819   -21.023 -23.371 1.00 22.08 ? 532 ASN B CA    1 
ATOM   9156 C  C     . ASN F 3 532 ? -0.642  -20.617 -23.291 1.00 23.96 ? 532 ASN B C     1 
ATOM   9157 O  O     . ASN F 3 532 ? -1.415  -20.860 -24.217 1.00 25.22 ? 532 ASN B O     1 
ATOM   9158 C  CB    . ASN F 3 532 ? 0.980   -22.407 -22.742 1.00 21.80 ? 532 ASN B CB    1 
ATOM   9159 C  CG    . ASN F 3 532 ? 2.307   -23.043 -23.078 1.00 22.03 ? 532 ASN B CG    1 
ATOM   9160 O  OD1   . ASN F 3 532 ? 2.905   -22.745 -24.110 1.00 21.44 ? 532 ASN B OD1   1 
ATOM   9161 N  ND2   . ASN F 3 532 ? 2.766   -23.939 -22.220 1.00 21.07 ? 532 ASN B ND2   1 
ATOM   9162 N  N     . PHE F 3 533 ? -1.019  -19.994 -22.181 1.00 24.37 ? 533 PHE B N     1 
ATOM   9163 C  CA    . PHE F 3 533 ? -2.389  -19.578 -21.999 1.00 24.53 ? 533 PHE B CA    1 
ATOM   9164 C  C     . PHE F 3 533 ? -2.697  -18.332 -22.823 1.00 26.15 ? 533 PHE B C     1 
ATOM   9165 O  O     . PHE F 3 533 ? -3.757  -18.236 -23.440 1.00 27.69 ? 533 PHE B O     1 
ATOM   9166 C  CB    . PHE F 3 533 ? -2.662  -19.325 -20.517 1.00 23.62 ? 533 PHE B CB    1 
ATOM   9167 C  CG    . PHE F 3 533 ? -4.114  -19.180 -20.191 1.00 22.71 ? 533 PHE B CG    1 
ATOM   9168 C  CD1   . PHE F 3 533 ? -4.658  -17.929 -19.919 1.00 22.01 ? 533 PHE B CD1   1 
ATOM   9169 C  CD2   . PHE F 3 533 ? -4.951  -20.295 -20.209 1.00 21.70 ? 533 PHE B CD2   1 
ATOM   9170 C  CE1   . PHE F 3 533 ? -6.015  -17.788 -19.671 1.00 21.99 ? 533 PHE B CE1   1 
ATOM   9171 C  CE2   . PHE F 3 533 ? -6.304  -20.169 -19.965 1.00 21.33 ? 533 PHE B CE2   1 
ATOM   9172 C  CZ    . PHE F 3 533 ? -6.844  -18.909 -19.695 1.00 21.99 ? 533 PHE B CZ    1 
ATOM   9173 N  N     . THR F 3 534 ? -1.775  -17.376 -22.837 1.00 27.33 ? 534 THR B N     1 
ATOM   9174 C  CA    . THR F 3 534 ? -1.975  -16.148 -23.595 1.00 27.28 ? 534 THR B CA    1 
ATOM   9175 C  C     . THR F 3 534 ? -2.204  -16.495 -25.056 1.00 29.45 ? 534 THR B C     1 
ATOM   9176 O  O     . THR F 3 534 ? -3.080  -15.932 -25.715 1.00 29.75 ? 534 THR B O     1 
ATOM   9177 C  CB    . THR F 3 534 ? -0.742  -15.226 -23.486 1.00 26.46 ? 534 THR B CB    1 
ATOM   9178 O  OG1   . THR F 3 534 ? -0.617  -14.752 -22.141 1.00 25.50 ? 534 THR B OG1   1 
ATOM   9179 C  CG2   . THR F 3 534 ? -0.870  -14.044 -24.416 1.00 26.14 ? 534 THR B CG2   1 
ATOM   9180 N  N     . LEU F 3 535 ? -1.417  -17.443 -25.551 1.00 31.56 ? 535 LEU B N     1 
ATOM   9181 C  CA    . LEU F 3 535 ? -1.495  -17.872 -26.946 1.00 33.75 ? 535 LEU B CA    1 
ATOM   9182 C  C     . LEU F 3 535 ? -2.582  -18.917 -27.257 1.00 35.88 ? 535 LEU B C     1 
ATOM   9183 O  O     . LEU F 3 535 ? -2.541  -19.557 -28.301 1.00 37.12 ? 535 LEU B O     1 
ATOM   9184 C  CB    . LEU F 3 535 ? -0.121  -18.393 -27.393 1.00 32.29 ? 535 LEU B CB    1 
ATOM   9185 C  CG    . LEU F 3 535 ? 1.004   -17.352 -27.346 1.00 31.78 ? 535 LEU B CG    1 
ATOM   9186 C  CD1   . LEU F 3 535 ? 2.336   -17.970 -27.734 1.00 31.15 ? 535 LEU B CD1   1 
ATOM   9187 C  CD2   . LEU F 3 535 ? 0.659   -16.219 -28.280 1.00 32.30 ? 535 LEU B CD2   1 
ATOM   9188 N  N     . ASP F 3 536 ? -3.551  -19.079 -26.359 1.00 37.57 ? 536 ASP B N     1 
ATOM   9189 C  CA    . ASP F 3 536 ? -4.647  -20.033 -26.551 1.00 39.23 ? 536 ASP B CA    1 
ATOM   9190 C  C     . ASP F 3 536 ? -4.163  -21.453 -26.782 1.00 40.49 ? 536 ASP B C     1 
ATOM   9191 O  O     . ASP F 3 536 ? -4.548  -22.088 -27.765 1.00 40.73 ? 536 ASP B O     1 
ATOM   9192 C  CB    . ASP F 3 536 ? -5.523  -19.621 -27.738 1.00 41.03 ? 536 ASP B CB    1 
ATOM   9193 C  CG    . ASP F 3 536 ? -6.458  -18.488 -27.404 1.00 43.12 ? 536 ASP B CG    1 
ATOM   9194 O  OD1   . ASP F 3 536 ? -6.447  -18.023 -26.243 1.00 44.52 ? 536 ASP B OD1   1 
ATOM   9195 O  OD2   . ASP F 3 536 ? -7.216  -18.060 -28.300 1.00 45.17 ? 536 ASP B OD2   1 
ATOM   9196 N  N     . LEU F 3 537 ? -3.334  -21.960 -25.874 1.00 41.97 ? 537 LEU B N     1 
ATOM   9197 C  CA    . LEU F 3 537 ? -2.807  -23.312 -26.002 1.00 42.79 ? 537 LEU B CA    1 
ATOM   9198 C  C     . LEU F 3 537 ? -3.256  -24.154 -24.808 1.00 44.04 ? 537 LEU B C     1 
ATOM   9199 O  O     . LEU F 3 537 ? -3.723  -25.297 -25.035 1.00 44.55 ? 537 LEU B O     1 
ATOM   9200 C  CB    . LEU F 3 537 ? -1.275  -23.268 -26.096 1.00 42.38 ? 537 LEU B CB    1 
ATOM   9201 C  CG    . LEU F 3 537 ? -0.727  -22.302 -27.156 1.00 42.31 ? 537 LEU B CG    1 
ATOM   9202 C  CD1   . LEU F 3 537 ? 0.796   -22.393 -27.244 1.00 41.02 ? 537 LEU B CD1   1 
ATOM   9203 C  CD2   . LEU F 3 537 ? -1.368  -22.628 -28.497 1.00 42.71 ? 537 LEU B CD2   1 
HETATM 9204 C  C     . ACT G 4 .   ? 1.181   -67.847 -42.401 1.00 24.05 ? 601 ACT A C     1 
HETATM 9205 O  O     . ACT G 4 .   ? -0.075  -67.833 -42.375 1.00 23.22 ? 601 ACT A O     1 
HETATM 9206 O  OXT   . ACT G 4 .   ? 2.005   -67.685 -41.385 1.00 26.30 ? 601 ACT A OXT   1 
HETATM 9207 C  CH3   . ACT G 4 .   ? 1.844   -68.078 -43.770 1.00 22.76 ? 601 ACT A CH3   1 
HETATM 9208 MG MG    . MG  H 5 .   ? 1.347   -66.855 -39.786 1.00 40.68 ? 701 MG  A MG    1 
HETATM 9209 C  C     . ACT I 4 .   ? -6.447  -8.170  4.026   1.00 31.50 ? 602 ACT B C     1 
HETATM 9210 O  O     . ACT I 4 .   ? -7.682  -8.157  3.826   1.00 31.56 ? 602 ACT B O     1 
HETATM 9211 O  OXT   . ACT I 4 .   ? -5.483  -8.382  3.140   1.00 31.82 ? 602 ACT B OXT   1 
HETATM 9212 C  CH3   . ACT I 4 .   ? -5.998  -7.926  5.467   1.00 31.04 ? 602 ACT B CH3   1 
HETATM 9213 MG MG    . MG  J 5 .   ? -5.150  -9.555  1.571   1.00 29.70 ? 702 MG  B MG    1 
HETATM 9214 O  O     . HOH K 6 .   ? 33.168  -48.721 -47.542 1.00 13.95 ? 108 HOH C O     1 
HETATM 9215 O  O     . HOH K 6 .   ? 51.232  -41.383 -49.292 1.00 31.80 ? 110 HOH C O     1 
HETATM 9216 O  O     . HOH K 6 .   ? 24.788  -48.700 -41.924 1.00 27.60 ? 274 HOH C O     1 
HETATM 9217 O  O     . HOH K 6 .   ? 49.826  -36.021 -40.392 1.00 37.77 ? 276 HOH C O     1 
HETATM 9218 O  O     . HOH K 6 .   ? 30.857  -48.167 -46.678 1.00 31.73 ? 287 HOH C O     1 
HETATM 9219 O  O     . HOH K 6 .   ? 32.031  -44.470 -43.194 1.00 44.04 ? 422 HOH C O     1 
HETATM 9220 O  O     . HOH K 6 .   ? 32.689  -53.896 -48.913 1.00 34.40 ? 520 HOH C O     1 
HETATM 9221 O  O     . HOH K 6 .   ? 32.415  -58.541 -49.231 1.00 40.38 ? 521 HOH C O     1 
HETATM 9222 O  O     . HOH K 6 .   ? 33.292  -56.598 -50.645 1.00 34.31 ? 522 HOH C O     1 
HETATM 9223 O  O     . HOH K 6 .   ? 34.698  -55.211 -46.604 1.00 23.12 ? 523 HOH C O     1 
HETATM 9224 O  O     . HOH K 6 .   ? 49.900  -43.780 -42.828 1.00 37.03 ? 531 HOH C O     1 
HETATM 9225 O  O     . HOH K 6 .   ? 47.908  -34.798 -41.701 1.00 41.99 ? 532 HOH C O     1 
HETATM 9226 O  O     . HOH L 6 .   ? 30.497  -46.669 -34.946 1.00 11.96 ? 16  HOH D O     1 
HETATM 9227 O  O     . HOH L 6 .   ? 23.749  -51.403 -44.090 1.00 33.41 ? 17  HOH D O     1 
HETATM 9228 O  O     . HOH L 6 .   ? 37.207  -52.915 -43.887 1.00 25.13 ? 18  HOH D O     1 
HETATM 9229 O  O     . HOH L 6 .   ? 24.710  -46.508 -30.492 1.00 12.77 ? 19  HOH D O     1 
HETATM 9230 O  O     . HOH L 6 .   ? 21.184  -49.161 -30.038 1.00 19.57 ? 20  HOH D O     1 
HETATM 9231 O  O     . HOH L 6 .   ? 39.938  -53.007 -44.897 1.00 36.38 ? 21  HOH D O     1 
HETATM 9232 O  O     . HOH L 6 .   ? 39.850  -50.536 -46.242 1.00 38.50 ? 22  HOH D O     1 
HETATM 9233 O  O     . HOH L 6 .   ? 38.861  -50.940 -52.658 1.00 27.62 ? 23  HOH D O     1 
HETATM 9234 O  O     . HOH L 6 .   ? 36.831  -51.893 -34.674 1.00 45.74 ? 24  HOH D O     1 
HETATM 9235 O  O     . HOH L 6 .   ? 54.731  -46.601 -45.033 1.00 39.07 ? 25  HOH D O     1 
HETATM 9236 O  O     . HOH L 6 .   ? 58.747  -42.412 -47.555 1.00 22.34 ? 26  HOH D O     1 
HETATM 9237 O  O     . HOH L 6 .   ? 20.918  -52.182 -43.671 1.00 48.26 ? 27  HOH D O     1 
HETATM 9238 O  O     . HOH L 6 .   ? 32.583  -49.975 -15.691 1.00 42.43 ? 28  HOH D O     1 
HETATM 9239 O  O     . HOH L 6 .   ? 44.171  -40.874 -58.522 1.00 13.06 ? 29  HOH D O     1 
HETATM 9240 O  O     . HOH L 6 .   ? 52.453  -46.021 -43.150 1.00 40.91 ? 30  HOH D O     1 
HETATM 9241 O  O     . HOH L 6 .   ? 51.999  -46.966 -45.542 1.00 32.55 ? 31  HOH D O     1 
HETATM 9242 O  O     . HOH L 6 .   ? 23.930  -36.743 -21.607 1.00 29.31 ? 32  HOH D O     1 
HETATM 9243 O  O     . HOH L 6 .   ? 30.668  -60.826 -35.157 1.00 30.22 ? 33  HOH D O     1 
HETATM 9244 O  O     . HOH L 6 .   ? 25.765  -57.411 -38.687 1.00 26.51 ? 34  HOH D O     1 
HETATM 9245 O  O     . HOH L 6 .   ? 42.738  -55.298 -43.630 1.00 39.01 ? 35  HOH D O     1 
HETATM 9246 O  O     . HOH L 6 .   ? 38.441  -54.444 -46.243 1.00 39.83 ? 36  HOH D O     1 
HETATM 9247 O  O     . HOH L 6 .   ? 31.062  -46.066 -31.024 1.00 48.75 ? 37  HOH D O     1 
HETATM 9248 O  O     . HOH L 6 .   ? 37.343  -46.915 -50.820 1.00 24.61 ? 38  HOH D O     1 
HETATM 9249 O  O     . HOH L 6 .   ? 49.885  -43.998 -48.370 1.00 15.09 ? 39  HOH D O     1 
HETATM 9250 O  O     . HOH L 6 .   ? 36.418  -38.883 -53.739 1.00 27.91 ? 40  HOH D O     1 
HETATM 9251 O  O     . HOH M 6 .   ? 23.428  -21.940 19.841  1.00 43.85 ? 63  HOH E O     1 
HETATM 9252 O  O     . HOH M 6 .   ? 12.094  -28.827 22.572  1.00 31.48 ? 324 HOH E O     1 
HETATM 9253 O  O     . HOH M 6 .   ? 36.345  -42.145 13.083  1.00 34.71 ? 362 HOH E O     1 
HETATM 9254 O  O     . HOH M 6 .   ? 16.077  -27.635 11.151  1.00 23.67 ? 387 HOH E O     1 
HETATM 9255 O  O     . HOH M 6 .   ? 23.276  -31.466 16.073  1.00 29.24 ? 389 HOH E O     1 
HETATM 9256 O  O     . HOH M 6 .   ? 22.941  -27.360 19.251  1.00 22.93 ? 390 HOH E O     1 
HETATM 9257 O  O     . HOH M 6 .   ? 19.753  -29.562 20.736  1.00 26.77 ? 477 HOH E O     1 
HETATM 9258 O  O     . HOH M 6 .   ? 20.107  -20.931 22.491  1.00 27.13 ? 479 HOH E O     1 
HETATM 9259 O  O     . HOH M 6 .   ? 13.783  -27.885 20.666  1.00 44.44 ? 480 HOH E O     1 
HETATM 9260 O  O     . HOH M 6 .   ? 13.949  -25.339 23.870  1.00 33.95 ? 481 HOH E O     1 
HETATM 9261 O  O     . HOH M 6 .   ? 43.638  -39.543 14.893  1.00 33.78 ? 533 HOH E O     1 
HETATM 9262 O  O     . HOH M 6 .   ? 43.925  -45.534 19.556  1.00 30.45 ? 534 HOH E O     1 
HETATM 9263 O  O     . HOH N 6 .   ? 24.484  -28.767 6.441   1.00 27.85 ? 28  HOH F O     1 
HETATM 9264 O  O     . HOH N 6 .   ? 27.035  -26.501 -8.909  1.00 33.15 ? 41  HOH F O     1 
HETATM 9265 O  O     . HOH N 6 .   ? 15.363  -26.000 -5.896  1.00 15.08 ? 61  HOH F O     1 
HETATM 9266 O  O     . HOH N 6 .   ? 26.112  -29.274 3.016   1.00 28.18 ? 62  HOH F O     1 
HETATM 9267 O  O     . HOH N 6 .   ? 28.873  -21.691 19.197  1.00 22.15 ? 388 HOH F O     1 
HETATM 9268 O  O     . HOH N 6 .   ? 44.112  -27.612 28.858  1.00 45.33 ? 391 HOH F O     1 
HETATM 9269 O  O     . HOH N 6 .   ? 25.222  -35.357 -15.067 1.00 53.25 ? 417 HOH F O     1 
HETATM 9270 O  O     . HOH N 6 .   ? 34.229  -33.276 -13.218 1.00 18.10 ? 418 HOH F O     1 
HETATM 9271 O  O     . HOH N 6 .   ? 31.588  -18.466 16.224  1.00 49.47 ? 462 HOH F O     1 
HETATM 9272 O  O     . HOH N 6 .   ? 18.816  -29.469 23.653  1.00 26.71 ? 478 HOH F O     1 
HETATM 9273 O  O     . HOH N 6 .   ? 19.731  -29.593 0.395   1.00 31.58 ? 482 HOH F O     1 
HETATM 9274 O  O     . HOH N 6 .   ? 29.744  -25.184 19.890  1.00 25.33 ? 483 HOH F O     1 
HETATM 9275 O  O     . HOH N 6 .   ? 34.325  -20.147 29.878  1.00 19.56 ? 484 HOH F O     1 
HETATM 9276 O  O     . HOH N 6 .   ? 38.071  -26.767 17.704  1.00 44.01 ? 485 HOH F O     1 
HETATM 9277 O  O     . HOH N 6 .   ? 27.001  -21.850 25.855  1.00 27.03 ? 486 HOH F O     1 
HETATM 9278 O  O     . HOH N 6 .   ? 28.056  -24.361 25.608  1.00 37.27 ? 487 HOH F O     1 
HETATM 9279 O  O     . HOH N 6 .   ? 34.438  -30.025 30.129  1.00 43.04 ? 488 HOH F O     1 
HETATM 9280 O  O     . HOH N 6 .   ? 19.950  -32.858 28.168  1.00 20.72 ? 535 HOH F O     1 
HETATM 9281 O  O     . HOH N 6 .   ? 26.275  -25.805 24.389  1.00 45.43 ? 536 HOH F O     1 
HETATM 9282 O  O     . HOH N 6 .   ? 34.077  -33.173 26.796  1.00 32.91 ? 539 HOH F O     1 
HETATM 9283 O  O     . HOH O 6 .   ? 1.185   -65.426 -38.383 1.00 38.74 ? 702 HOH A O     1 
HETATM 9284 O  O     . HOH O 6 .   ? -0.007  -26.666 -29.077 1.00 12.19 ? 703 HOH A O     1 
HETATM 9285 O  O     . HOH O 6 .   ? 7.548   -54.953 -37.317 1.00 12.18 ? 704 HOH A O     1 
HETATM 9286 O  O     . HOH O 6 .   ? 2.299   -68.403 -11.941 1.00 20.93 ? 705 HOH A O     1 
HETATM 9287 O  O     . HOH O 6 .   ? 34.871  -41.276 -32.944 1.00 23.37 ? 706 HOH A O     1 
HETATM 9288 O  O     . HOH O 6 .   ? 9.686   -32.175 -22.961 1.00 17.33 ? 707 HOH A O     1 
HETATM 9289 O  O     . HOH O 6 .   ? 30.884  -18.646 -25.674 1.00 32.78 ? 708 HOH A O     1 
HETATM 9290 O  O     . HOH O 6 .   ? 28.946  -68.225 -16.648 1.00 26.93 ? 709 HOH A O     1 
HETATM 9291 O  O     . HOH O 6 .   ? 18.416  -50.157 -25.845 1.00 7.28  ? 710 HOH A O     1 
HETATM 9292 O  O     . HOH O 6 .   ? 39.698  -65.002 -36.524 1.00 25.40 ? 711 HOH A O     1 
HETATM 9293 O  O     . HOH O 6 .   ? 22.629  -46.075 -27.372 1.00 22.38 ? 712 HOH A O     1 
HETATM 9294 O  O     . HOH O 6 .   ? -16.395 -65.681 -34.745 1.00 36.02 ? 713 HOH A O     1 
HETATM 9295 O  O     . HOH O 6 .   ? -15.641 -70.958 -41.484 1.00 31.40 ? 714 HOH A O     1 
HETATM 9296 O  O     . HOH O 6 .   ? 33.001  -32.070 -39.790 1.00 19.29 ? 715 HOH A O     1 
HETATM 9297 O  O     . HOH O 6 .   ? -17.283 -69.883 -12.564 1.00 6.49  ? 716 HOH A O     1 
HETATM 9298 O  O     . HOH O 6 .   ? -1.257  -82.023 -38.801 1.00 22.14 ? 717 HOH A O     1 
HETATM 9299 O  O     . HOH O 6 .   ? 17.019  -42.520 -27.112 1.00 19.50 ? 718 HOH A O     1 
HETATM 9300 O  O     . HOH O 6 .   ? 16.956  -46.223 -24.442 1.00 1.00  ? 719 HOH A O     1 
HETATM 9301 O  O     . HOH O 6 .   ? 4.667   -28.650 -23.773 1.00 11.37 ? 720 HOH A O     1 
HETATM 9302 O  O     . HOH O 6 .   ? 37.424  -50.017 -22.858 1.00 32.10 ? 721 HOH A O     1 
HETATM 9303 O  O     . HOH O 6 .   ? 6.186   -47.958 -54.312 1.00 29.01 ? 722 HOH A O     1 
HETATM 9304 O  O     . HOH O 6 .   ? -10.610 -74.497 -38.933 1.00 9.11  ? 723 HOH A O     1 
HETATM 9305 O  O     . HOH O 6 .   ? 13.703  -67.471 -43.487 1.00 15.50 ? 724 HOH A O     1 
HETATM 9306 O  O     . HOH O 6 .   ? -8.513  -64.025 -15.589 1.00 8.25  ? 725 HOH A O     1 
HETATM 9307 O  O     . HOH O 6 .   ? 6.628   -72.408 -15.911 1.00 14.34 ? 726 HOH A O     1 
HETATM 9308 O  O     . HOH O 6 .   ? 0.804   -81.605 -35.794 1.00 50.80 ? 727 HOH A O     1 
HETATM 9309 O  O     . HOH O 6 .   ? 10.741  -48.951 -42.976 1.00 28.64 ? 728 HOH A O     1 
HETATM 9310 O  O     . HOH O 6 .   ? -8.686  -72.242 -43.160 1.00 23.08 ? 729 HOH A O     1 
HETATM 9311 O  O     . HOH O 6 .   ? -5.488  -53.341 -25.541 1.00 19.86 ? 730 HOH A O     1 
HETATM 9312 O  O     . HOH O 6 .   ? 45.876  -53.811 -18.407 1.00 59.31 ? 731 HOH A O     1 
HETATM 9313 O  O     . HOH O 6 .   ? 9.936   -66.206 -10.392 1.00 34.43 ? 732 HOH A O     1 
HETATM 9314 O  O     . HOH O 6 .   ? -7.723  -74.898 -37.781 1.00 28.36 ? 733 HOH A O     1 
HETATM 9315 O  O     . HOH O 6 .   ? 37.483  -69.892 -24.312 1.00 25.24 ? 734 HOH A O     1 
HETATM 9316 O  O     . HOH O 6 .   ? -4.312  -44.021 -28.798 1.00 20.29 ? 735 HOH A O     1 
HETATM 9317 O  O     . HOH O 6 .   ? 17.326  -34.676 -46.107 1.00 32.79 ? 736 HOH A O     1 
HETATM 9318 O  O     . HOH O 6 .   ? 3.562   -60.540 -40.014 1.00 10.58 ? 737 HOH A O     1 
HETATM 9319 O  O     . HOH O 6 .   ? 37.147  -33.028 -12.374 1.00 38.39 ? 738 HOH A O     1 
HETATM 9320 O  O     . HOH O 6 .   ? 20.827  -21.073 -29.998 1.00 26.67 ? 739 HOH A O     1 
HETATM 9321 O  O     . HOH O 6 .   ? 49.446  -34.058 -13.636 1.00 41.91 ? 740 HOH A O     1 
HETATM 9322 O  O     . HOH O 6 .   ? -9.668  -36.325 -34.472 1.00 40.10 ? 741 HOH A O     1 
HETATM 9323 O  O     . HOH O 6 .   ? 17.682  -49.214 -17.428 1.00 40.84 ? 742 HOH A O     1 
HETATM 9324 O  O     . HOH O 6 .   ? 33.707  -68.030 -15.122 1.00 38.00 ? 743 HOH A O     1 
HETATM 9325 O  O     . HOH O 6 .   ? -6.931  -56.672 -16.012 1.00 18.64 ? 744 HOH A O     1 
HETATM 9326 O  O     . HOH O 6 .   ? 19.410  -17.003 -36.275 1.00 18.02 ? 745 HOH A O     1 
HETATM 9327 O  O     . HOH O 6 .   ? 51.859  -56.590 -26.687 1.00 36.88 ? 746 HOH A O     1 
HETATM 9328 O  O     . HOH O 6 .   ? -1.154  -56.108 -29.103 1.00 8.91  ? 747 HOH A O     1 
HETATM 9329 O  O     . HOH O 6 .   ? 20.965  -54.134 -39.444 1.00 32.95 ? 748 HOH A O     1 
HETATM 9330 O  O     . HOH O 6 .   ? -7.759  -53.988 -29.458 1.00 15.84 ? 749 HOH A O     1 
HETATM 9331 O  O     . HOH O 6 .   ? 3.656   -47.236 -50.102 1.00 23.71 ? 750 HOH A O     1 
HETATM 9332 O  O     . HOH O 6 .   ? 23.545  -50.186 -26.605 1.00 13.03 ? 751 HOH A O     1 
HETATM 9333 O  O     . HOH O 6 .   ? 25.340  -49.742 -22.721 1.00 21.92 ? 752 HOH A O     1 
HETATM 9334 O  O     . HOH O 6 .   ? 35.980  -50.343 -25.473 1.00 28.61 ? 753 HOH A O     1 
HETATM 9335 O  O     . HOH O 6 .   ? 32.776  -41.169 -22.272 1.00 25.78 ? 754 HOH A O     1 
HETATM 9336 O  O     . HOH O 6 .   ? -21.697 -68.038 -36.120 1.00 47.75 ? 755 HOH A O     1 
HETATM 9337 O  O     . HOH O 6 .   ? -28.300 -65.675 -37.914 1.00 26.41 ? 756 HOH A O     1 
HETATM 9338 O  O     . HOH O 6 .   ? -29.160 -70.568 -32.552 1.00 32.38 ? 757 HOH A O     1 
HETATM 9339 O  O     . HOH O 6 .   ? -17.862 -67.224 -44.912 1.00 7.76  ? 758 HOH A O     1 
HETATM 9340 O  O     . HOH O 6 .   ? -20.596 -64.153 -46.656 1.00 25.54 ? 759 HOH A O     1 
HETATM 9341 O  O     . HOH O 6 .   ? -10.112 -69.225 -50.102 1.00 35.65 ? 760 HOH A O     1 
HETATM 9342 O  O     . HOH O 6 .   ? -8.143  -74.559 -46.430 1.00 22.80 ? 761 HOH A O     1 
HETATM 9343 O  O     . HOH O 6 .   ? -16.970 -75.639 -34.664 1.00 21.56 ? 762 HOH A O     1 
HETATM 9344 O  O     . HOH O 6 .   ? -18.250 -75.094 -41.266 1.00 32.32 ? 763 HOH A O     1 
HETATM 9345 O  O     . HOH O 6 .   ? -13.354 -65.988 -53.538 1.00 17.41 ? 764 HOH A O     1 
HETATM 9346 O  O     . HOH O 6 .   ? -18.418 -60.993 -29.810 1.00 32.97 ? 765 HOH A O     1 
HETATM 9347 O  O     . HOH O 6 .   ? 0.344   -55.651 -47.291 1.00 25.95 ? 766 HOH A O     1 
HETATM 9348 O  O     . HOH O 6 .   ? -1.293  -63.033 -52.982 1.00 17.93 ? 767 HOH A O     1 
HETATM 9349 O  O     . HOH O 6 .   ? -6.170  -56.667 -51.407 1.00 24.57 ? 768 HOH A O     1 
HETATM 9350 O  O     . HOH O 6 .   ? -3.802  -57.818 -51.289 1.00 18.68 ? 769 HOH A O     1 
HETATM 9351 O  O     . HOH O 6 .   ? -3.977  -52.617 -44.171 1.00 17.22 ? 770 HOH A O     1 
HETATM 9352 O  O     . HOH O 6 .   ? -3.033  -47.886 -35.193 1.00 30.28 ? 771 HOH A O     1 
HETATM 9353 O  O     . HOH O 6 .   ? -8.058  -45.814 -28.908 1.00 11.71 ? 772 HOH A O     1 
HETATM 9354 O  O     . HOH O 6 .   ? 12.902  -47.020 -30.951 1.00 7.47  ? 773 HOH A O     1 
HETATM 9355 O  O     . HOH O 6 .   ? 12.934  -45.510 -38.509 1.00 33.44 ? 774 HOH A O     1 
HETATM 9356 O  O     . HOH O 6 .   ? 10.173  -45.225 -39.975 1.00 11.94 ? 775 HOH A O     1 
HETATM 9357 O  O     . HOH O 6 .   ? 15.911  -58.279 -42.009 1.00 38.46 ? 776 HOH A O     1 
HETATM 9358 O  O     . HOH O 6 .   ? 11.084  -44.984 -57.322 1.00 23.54 ? 777 HOH A O     1 
HETATM 9359 O  O     . HOH O 6 .   ? 17.698  -45.025 -56.739 1.00 26.84 ? 778 HOH A O     1 
HETATM 9360 O  O     . HOH O 6 .   ? 14.300  -49.664 -59.014 1.00 32.19 ? 779 HOH A O     1 
HETATM 9361 O  O     . HOH O 6 .   ? -7.883  -38.681 -29.587 1.00 51.31 ? 780 HOH A O     1 
HETATM 9362 O  O     . HOH O 6 .   ? -1.119  -25.722 -31.850 1.00 25.08 ? 781 HOH A O     1 
HETATM 9363 O  O     . HOH O 6 .   ? -12.645 -39.215 -27.284 1.00 41.02 ? 782 HOH A O     1 
HETATM 9364 O  O     . HOH O 6 .   ? 2.519   -48.928 -20.378 1.00 19.61 ? 783 HOH A O     1 
HETATM 9365 O  O     . HOH O 6 .   ? -0.348  -47.269 -20.623 1.00 33.80 ? 784 HOH A O     1 
HETATM 9366 O  O     . HOH O 6 .   ? 19.594  -39.042 -19.324 1.00 28.03 ? 785 HOH A O     1 
HETATM 9367 O  O     . HOH O 6 .   ? 9.563   -23.769 -33.455 1.00 44.48 ? 786 HOH A O     1 
HETATM 9368 O  O     . HOH O 6 .   ? 8.355   -28.786 -44.594 1.00 24.89 ? 787 HOH A O     1 
HETATM 9369 O  O     . HOH O 6 .   ? 17.223  -30.281 -50.028 1.00 35.57 ? 788 HOH A O     1 
HETATM 9370 O  O     . HOH O 6 .   ? 26.556  -33.164 -42.509 1.00 19.90 ? 789 HOH A O     1 
HETATM 9371 O  O     . HOH O 6 .   ? 15.308  -28.313 -54.256 1.00 27.84 ? 790 HOH A O     1 
HETATM 9372 O  O     . HOH O 6 .   ? 2.650   -36.531 -50.339 1.00 35.81 ? 791 HOH A O     1 
HETATM 9373 O  O     . HOH O 6 .   ? 16.282  -19.094 -38.589 1.00 17.40 ? 792 HOH A O     1 
HETATM 9374 O  O     . HOH O 6 .   ? 19.195  -19.746 -25.561 1.00 19.99 ? 793 HOH A O     1 
HETATM 9375 O  O     . HOH O 6 .   ? 23.555  -20.706 -23.612 1.00 23.46 ? 794 HOH A O     1 
HETATM 9376 O  O     . HOH O 6 .   ? 24.789  -20.474 -26.906 1.00 26.29 ? 795 HOH A O     1 
HETATM 9377 O  O     . HOH O 6 .   ? 27.959  -26.868 -17.610 1.00 21.57 ? 796 HOH A O     1 
HETATM 9378 O  O     . HOH O 6 .   ? 36.789  -35.542 -11.516 1.00 30.41 ? 797 HOH A O     1 
HETATM 9379 O  O     . HOH O 6 .   ? 32.278  -22.065 -31.376 1.00 33.48 ? 798 HOH A O     1 
HETATM 9380 O  O     . HOH O 6 .   ? 31.754  -22.733 -35.127 1.00 21.03 ? 799 HOH A O     1 
HETATM 9381 O  O     . HOH O 6 .   ? 29.924  -20.086 -38.937 1.00 11.46 ? 800 HOH A O     1 
HETATM 9382 O  O     . HOH O 6 .   ? 47.267  -19.491 -19.877 1.00 20.43 ? 801 HOH A O     1 
HETATM 9383 O  O     . HOH O 6 .   ? 50.066  -35.393 -29.042 1.00 19.13 ? 802 HOH A O     1 
HETATM 9384 O  O     . HOH O 6 .   ? 54.452  -22.899 -28.578 1.00 27.04 ? 803 HOH A O     1 
HETATM 9385 O  O     . HOH O 6 .   ? 49.401  -29.583 -19.721 1.00 36.00 ? 804 HOH A O     1 
HETATM 9386 O  O     . HOH O 6 .   ? 52.408  -31.394 -20.357 1.00 31.59 ? 805 HOH A O     1 
HETATM 9387 O  O     . HOH O 6 .   ? 41.890  -11.398 -20.440 1.00 24.20 ? 806 HOH A O     1 
HETATM 9388 O  O     . HOH O 6 .   ? 40.098  -11.786 -30.048 1.00 26.19 ? 807 HOH A O     1 
HETATM 9389 O  O     . HOH O 6 .   ? 48.397  -57.975 -14.971 1.00 24.51 ? 808 HOH A O     1 
HETATM 9390 O  O     . HOH O 6 .   ? 41.842  -63.042 -39.715 1.00 36.52 ? 809 HOH A O     1 
HETATM 9391 O  O     . HOH O 6 .   ? 45.582  -65.034 -21.907 1.00 38.71 ? 810 HOH A O     1 
HETATM 9392 O  O     . HOH O 6 .   ? 43.860  -65.910 -16.950 1.00 31.42 ? 811 HOH A O     1 
HETATM 9393 O  O     . HOH O 6 .   ? 36.669  -72.545 -24.999 1.00 47.74 ? 812 HOH A O     1 
HETATM 9394 O  O     . HOH O 6 .   ? 29.101  -77.377 -21.360 1.00 31.57 ? 813 HOH A O     1 
HETATM 9395 O  O     . HOH O 6 .   ? 36.453  -69.540 -12.774 1.00 16.40 ? 814 HOH A O     1 
HETATM 9396 O  O     . HOH O 6 .   ? 29.788  -68.624 -12.551 1.00 49.84 ? 815 HOH A O     1 
HETATM 9397 O  O     . HOH O 6 .   ? 19.980  -70.471 -13.954 1.00 24.77 ? 816 HOH A O     1 
HETATM 9398 O  O     . HOH O 6 .   ? 21.638  -72.294 -15.616 1.00 20.93 ? 817 HOH A O     1 
HETATM 9399 O  O     . HOH O 6 .   ? 24.248  -69.439 -9.577  1.00 21.97 ? 818 HOH A O     1 
HETATM 9400 O  O     . HOH O 6 .   ? 11.401  -59.405 -8.018  1.00 19.93 ? 819 HOH A O     1 
HETATM 9401 O  O     . HOH O 6 .   ? 15.017  -62.105 -9.630  1.00 8.38  ? 820 HOH A O     1 
HETATM 9402 O  O     . HOH O 6 .   ? 13.986  -63.679 -7.897  1.00 26.54 ? 821 HOH A O     1 
HETATM 9403 O  O     . HOH O 6 .   ? 34.167  -79.115 -30.125 1.00 34.92 ? 822 HOH A O     1 
HETATM 9404 O  O     . HOH O 6 .   ? 33.491  -68.119 -44.838 1.00 32.37 ? 823 HOH A O     1 
HETATM 9405 O  O     . HOH O 6 .   ? 30.326  -68.836 -45.201 1.00 31.09 ? 824 HOH A O     1 
HETATM 9406 O  O     . HOH O 6 .   ? 23.002  -78.796 -34.781 1.00 28.73 ? 825 HOH A O     1 
HETATM 9407 O  O     . HOH O 6 .   ? 7.802   -55.118 -4.532  1.00 35.19 ? 826 HOH A O     1 
HETATM 9408 O  O     . HOH O 6 .   ? 5.522   -56.126 -5.675  1.00 29.75 ? 827 HOH A O     1 
HETATM 9409 O  O     . HOH O 6 .   ? -11.253 -59.958 -9.504  1.00 24.59 ? 828 HOH A O     1 
HETATM 9410 O  O     . HOH O 6 .   ? -6.636  -60.866 -8.377  1.00 22.84 ? 829 HOH A O     1 
HETATM 9411 O  O     . HOH O 6 .   ? -6.307  -54.780 -6.304  1.00 27.57 ? 830 HOH A O     1 
HETATM 9412 O  O     . HOH O 6 .   ? 6.318   -73.809 -17.949 1.00 7.48  ? 831 HOH A O     1 
HETATM 9413 O  O     . HOH O 6 .   ? 3.697   -77.290 -18.701 1.00 21.87 ? 832 HOH A O     1 
HETATM 9414 O  O     . HOH O 6 .   ? 13.612  -77.843 -11.444 1.00 17.59 ? 833 HOH A O     1 
HETATM 9415 O  O     . HOH O 6 .   ? 16.154  -78.193 -10.317 1.00 28.84 ? 834 HOH A O     1 
HETATM 9416 O  O     . HOH O 6 .   ? 11.419  -72.828 -13.373 1.00 19.05 ? 835 HOH A O     1 
HETATM 9417 O  O     . HOH O 6 .   ? 6.158   -77.070 -23.164 1.00 9.21  ? 836 HOH A O     1 
HETATM 9418 O  O     . HOH O 6 .   ? 11.316  -82.632 -25.087 1.00 30.59 ? 837 HOH A O     1 
HETATM 9419 O  O     . HOH O 6 .   ? -8.115  -79.122 -30.852 1.00 8.40  ? 838 HOH A O     1 
HETATM 9420 O  O     . HOH O 6 .   ? 20.603  -81.174 -31.141 1.00 25.45 ? 839 HOH A O     1 
HETATM 9421 O  O     . HOH O 6 .   ? -11.036 -77.102 -14.714 1.00 19.99 ? 840 HOH A O     1 
HETATM 9422 O  O     . HOH O 6 .   ? -12.605 -79.854 -14.161 1.00 19.71 ? 841 HOH A O     1 
HETATM 9423 O  O     . HOH O 6 .   ? -4.325  -90.896 -15.851 1.00 35.49 ? 842 HOH A O     1 
HETATM 9424 O  O     . HOH O 6 .   ? -16.694 -65.333 -17.654 1.00 37.12 ? 843 HOH A O     1 
HETATM 9425 O  O     . HOH O 6 .   ? -14.450 -61.414 -18.466 1.00 24.51 ? 844 HOH A O     1 
HETATM 9426 O  O     . HOH O 6 .   ? -12.111 -58.581 -17.050 1.00 30.50 ? 845 HOH A O     1 
HETATM 9427 O  O     . HOH O 6 .   ? -16.621 -64.530 -13.525 1.00 37.83 ? 846 HOH A O     1 
HETATM 9428 O  O     . HOH O 6 .   ? -21.682 -66.568 -15.912 1.00 42.02 ? 847 HOH A O     1 
HETATM 9429 O  O     . HOH O 6 .   ? 2.316   -57.499 -34.957 1.00 2.88  ? 848 HOH A O     1 
HETATM 9430 O  O     . HOH O 6 .   ? 39.533  -21.322 -15.798 1.00 34.72 ? 849 HOH A O     1 
HETATM 9431 O  O     . HOH O 6 .   ? 36.624  -5.230  -24.448 1.00 22.49 ? 850 HOH A O     1 
HETATM 9432 O  O     . HOH O 6 .   ? 17.443  -43.722 -47.326 1.00 22.18 ? 851 HOH A O     1 
HETATM 9433 O  O     . HOH O 6 .   ? 24.454  -48.331 -27.884 1.00 35.12 ? 852 HOH A O     1 
HETATM 9434 O  O     . HOH O 6 .   ? -15.159 -72.419 -43.504 1.00 39.18 ? 853 HOH A O     1 
HETATM 9435 O  O     . HOH O 6 .   ? -16.501 -69.397 -44.595 1.00 20.79 ? 854 HOH A O     1 
HETATM 9436 O  O     . HOH O 6 .   ? -28.226 -64.019 -45.632 1.00 37.07 ? 855 HOH A O     1 
HETATM 9437 O  O     . HOH O 6 .   ? -13.703 -61.619 -48.494 1.00 27.18 ? 856 HOH A O     1 
HETATM 9438 O  O     . HOH O 6 .   ? -9.837  -74.786 -41.708 1.00 25.61 ? 857 HOH A O     1 
HETATM 9439 O  O     . HOH O 6 .   ? -12.968 -66.934 -50.432 1.00 11.22 ? 858 HOH A O     1 
HETATM 9440 O  O     . HOH O 6 .   ? -10.773 -51.704 -35.070 1.00 18.38 ? 859 HOH A O     1 
HETATM 9441 O  O     . HOH O 6 .   ? -1.462  -55.393 -45.406 1.00 24.62 ? 860 HOH A O     1 
HETATM 9442 O  O     . HOH O 6 .   ? -9.385  -46.546 -45.017 1.00 23.56 ? 861 HOH A O     1 
HETATM 9443 O  O     . HOH O 6 .   ? -3.142  -39.358 -45.189 1.00 42.98 ? 862 HOH A O     1 
HETATM 9444 O  O     . HOH O 6 .   ? 3.915   -52.249 -23.961 1.00 19.34 ? 863 HOH A O     1 
HETATM 9445 O  O     . HOH O 6 .   ? -0.641  -56.537 -51.563 1.00 51.25 ? 864 HOH A O     1 
HETATM 9446 O  O     . HOH O 6 .   ? 15.424  -47.554 -52.598 1.00 24.08 ? 865 HOH A O     1 
HETATM 9447 O  O     . HOH O 6 .   ? 14.855  -44.561 -49.739 1.00 25.81 ? 866 HOH A O     1 
HETATM 9448 O  O     . HOH O 6 .   ? 7.987   -47.552 -60.406 1.00 8.12  ? 867 HOH A O     1 
HETATM 9449 O  O     . HOH O 6 .   ? -2.634  -35.556 -48.492 1.00 24.78 ? 868 HOH A O     1 
HETATM 9450 O  O     . HOH O 6 .   ? -7.041  -45.288 -31.428 1.00 19.72 ? 869 HOH A O     1 
HETATM 9451 O  O     . HOH O 6 .   ? -9.797  -35.291 -30.859 1.00 32.29 ? 870 HOH A O     1 
HETATM 9452 O  O     . HOH O 6 .   ? 12.940  -52.225 -37.813 1.00 24.97 ? 871 HOH A O     1 
HETATM 9453 O  O     . HOH O 6 .   ? 24.230  -44.350 -36.380 1.00 31.55 ? 872 HOH A O     1 
HETATM 9454 O  O     . HOH O 6 .   ? 18.124  -42.028 -41.635 1.00 34.42 ? 873 HOH A O     1 
HETATM 9455 O  O     . HOH O 6 .   ? 17.583  -48.272 -41.954 1.00 30.86 ? 874 HOH A O     1 
HETATM 9456 O  O     . HOH O 6 .   ? 14.254  -34.487 -48.643 1.00 33.39 ? 875 HOH A O     1 
HETATM 9457 O  O     . HOH O 6 .   ? -1.040  -25.530 -34.746 1.00 26.92 ? 876 HOH A O     1 
HETATM 9458 O  O     . HOH O 6 .   ? 9.169   -24.186 -23.497 1.00 8.50  ? 877 HOH A O     1 
HETATM 9459 O  O     . HOH O 6 .   ? 9.667   -24.897 -30.924 1.00 49.10 ? 878 HOH A O     1 
HETATM 9460 O  O     . HOH O 6 .   ? 17.899  -24.312 -45.657 1.00 40.73 ? 879 HOH A O     1 
HETATM 9461 O  O     . HOH O 6 .   ? 5.938   -31.128 -50.503 1.00 30.97 ? 880 HOH A O     1 
HETATM 9462 O  O     . HOH O 6 .   ? 10.528  -28.165 -51.505 1.00 24.84 ? 881 HOH A O     1 
HETATM 9463 O  O     . HOH O 6 .   ? 18.023  -18.419 -34.923 1.00 9.36  ? 882 HOH A O     1 
HETATM 9464 O  O     . HOH O 6 .   ? 35.808  -30.165 -41.036 1.00 18.71 ? 883 HOH A O     1 
HETATM 9465 O  O     . HOH O 6 .   ? 33.992  -35.514 -40.279 1.00 16.65 ? 884 HOH A O     1 
HETATM 9466 O  O     . HOH O 6 .   ? 24.306  -37.830 -47.785 1.00 13.42 ? 885 HOH A O     1 
HETATM 9467 O  O     . HOH O 6 .   ? 44.408  -18.643 -20.529 1.00 41.48 ? 886 HOH A O     1 
HETATM 9468 O  O     . HOH O 6 .   ? 45.235  -29.784 -34.876 1.00 37.57 ? 887 HOH A O     1 
HETATM 9469 O  O     . HOH O 6 .   ? 44.814  -19.921 -16.329 1.00 30.53 ? 888 HOH A O     1 
HETATM 9470 O  O     . HOH O 6 .   ? 43.543  -50.914 -18.191 1.00 51.70 ? 889 HOH A O     1 
HETATM 9471 O  O     . HOH O 6 .   ? 27.443  -66.523 -15.072 1.00 34.73 ? 890 HOH A O     1 
HETATM 9472 O  O     . HOH O 6 .   ? 29.749  -62.445 -7.692  1.00 19.71 ? 891 HOH A O     1 
HETATM 9473 O  O     . HOH O 6 .   ? 23.524  -72.513 -24.912 1.00 13.83 ? 892 HOH A O     1 
HETATM 9474 O  O     . HOH O 6 .   ? 26.957  -73.683 -28.057 1.00 23.29 ? 893 HOH A O     1 
HETATM 9475 O  O     . HOH O 6 .   ? 18.618  -71.669 -16.927 1.00 13.86 ? 894 HOH A O     1 
HETATM 9476 O  O     . HOH O 6 .   ? 12.268  -79.230 -13.444 1.00 21.66 ? 895 HOH A O     1 
HETATM 9477 O  O     . HOH O 6 .   ? 20.462  -63.648 -44.337 1.00 13.80 ? 896 HOH A O     1 
HETATM 9478 O  O     . HOH O 6 .   ? 13.468  -73.669 -14.498 1.00 18.54 ? 897 HOH A O     1 
HETATM 9479 O  O     . HOH O 6 .   ? 12.172  -78.597 -30.815 1.00 32.45 ? 898 HOH A O     1 
HETATM 9480 O  O     . HOH O 6 .   ? 19.904  -75.240 -36.271 1.00 33.43 ? 899 HOH A O     1 
HETATM 9481 O  O     . HOH O 6 .   ? 19.689  -76.026 -40.783 1.00 40.41 ? 900 HOH A O     1 
HETATM 9482 O  O     . HOH O 6 .   ? -4.434  -80.427 -29.031 1.00 39.98 ? 901 HOH A O     1 
HETATM 9483 O  O     . HOH O 6 .   ? -22.506 -69.750 -21.120 1.00 45.25 ? 902 HOH A O     1 
HETATM 9484 O  O     . HOH O 6 .   ? -22.008 -74.251 -23.249 1.00 32.23 ? 903 HOH A O     1 
HETATM 9485 O  O     . HOH O 6 .   ? 2.472   -58.429 -41.240 1.00 6.93  ? 904 HOH A O     1 
HETATM 9486 O  O     . HOH O 6 .   ? -18.683 -72.295 -34.973 1.00 20.32 ? 905 HOH A O     1 
HETATM 9487 O  O     . HOH O 6 .   ? -19.413 -69.921 -44.517 1.00 45.35 ? 906 HOH A O     1 
HETATM 9488 O  O     . HOH O 6 .   ? -21.164 -76.128 -36.595 1.00 43.81 ? 907 HOH A O     1 
HETATM 9489 O  O     . HOH O 6 .   ? -26.305 -67.224 -35.305 1.00 50.98 ? 908 HOH A O     1 
HETATM 9490 O  O     . HOH O 6 .   ? -14.184 -48.855 -29.184 1.00 46.86 ? 909 HOH A O     1 
HETATM 9491 O  O     . HOH O 6 .   ? -11.792 -45.206 -29.806 1.00 26.34 ? 910 HOH A O     1 
HETATM 9492 O  O     . HOH O 6 .   ? -5.240  -46.105 -50.520 1.00 35.07 ? 911 HOH A O     1 
HETATM 9493 O  O     . HOH O 6 .   ? 3.659   -54.200 -48.498 1.00 23.81 ? 912 HOH A O     1 
HETATM 9494 O  O     . HOH O 6 .   ? 12.688  -48.146 -38.409 1.00 16.88 ? 913 HOH A O     1 
HETATM 9495 O  O     . HOH O 6 .   ? 8.992   -57.711 -36.761 1.00 38.82 ? 914 HOH A O     1 
HETATM 9496 O  O     . HOH O 6 .   ? -0.042  -65.106 -40.455 1.00 24.46 ? 915 HOH A O     1 
HETATM 9497 O  O     . HOH O 6 .   ? -4.596  -59.615 -52.819 1.00 31.46 ? 916 HOH A O     1 
HETATM 9498 O  O     . HOH O 6 .   ? 13.544  -51.948 -56.163 1.00 29.37 ? 917 HOH A O     1 
HETATM 9499 O  O     . HOH O 6 .   ? 17.279  -52.120 -20.736 1.00 43.32 ? 918 HOH A O     1 
HETATM 9500 O  O     . HOH O 6 .   ? 24.110  -53.545 -25.943 1.00 9.33  ? 919 HOH A O     1 
HETATM 9501 O  O     . HOH O 6 .   ? 24.673  -57.353 -28.969 1.00 11.90 ? 920 HOH A O     1 
HETATM 9502 O  O     . HOH O 6 .   ? 21.649  -38.341 -47.652 1.00 24.99 ? 921 HOH A O     1 
HETATM 9503 O  O     . HOH O 6 .   ? 22.519  -37.131 -50.163 1.00 20.32 ? 922 HOH A O     1 
HETATM 9504 O  O     . HOH O 6 .   ? 9.756   -30.113 -46.579 1.00 38.26 ? 923 HOH A O     1 
HETATM 9505 O  O     . HOH O 6 .   ? 11.377  -28.205 -48.912 1.00 29.72 ? 924 HOH A O     1 
HETATM 9506 O  O     . HOH O 6 .   ? 11.670  -24.559 -45.803 1.00 36.02 ? 925 HOH A O     1 
HETATM 9507 O  O     . HOH O 6 .   ? -8.871  -81.921 -29.370 1.00 27.55 ? 926 HOH A O     1 
HETATM 9508 O  O     . HOH O 6 .   ? 18.111  -19.612 -36.945 1.00 15.85 ? 927 HOH A O     1 
HETATM 9509 O  O     . HOH O 6 .   ? 45.078  -33.419 -14.752 1.00 31.93 ? 928 HOH A O     1 
HETATM 9510 O  O     . HOH O 6 .   ? 42.020  -40.575 -29.229 1.00 20.04 ? 929 HOH A O     1 
HETATM 9511 O  O     . HOH O 6 .   ? 31.813  -27.122 -39.246 1.00 14.03 ? 930 HOH A O     1 
HETATM 9512 O  O     . HOH O 6 .   ? 22.663  -22.441 -38.335 1.00 38.34 ? 931 HOH A O     1 
HETATM 9513 O  O     . HOH O 6 .   ? 44.152  -28.176 -39.613 1.00 36.70 ? 932 HOH A O     1 
HETATM 9514 O  O     . HOH O 6 .   ? 56.017  -39.736 -30.997 1.00 40.67 ? 933 HOH A O     1 
HETATM 9515 O  O     . HOH O 6 .   ? 54.527  -31.927 -24.523 1.00 26.17 ? 934 HOH A O     1 
HETATM 9516 O  O     . HOH O 6 .   ? 55.118  -43.679 -38.734 1.00 46.30 ? 935 HOH A O     1 
HETATM 9517 O  O     . HOH O 6 .   ? 19.080  -69.565 -18.653 1.00 34.32 ? 936 HOH A O     1 
HETATM 9518 O  O     . HOH O 6 .   ? 32.179  -78.959 -25.402 1.00 32.16 ? 937 HOH A O     1 
HETATM 9519 O  O     . HOH O 6 .   ? 29.333  -81.827 -28.488 1.00 17.40 ? 938 HOH A O     1 
HETATM 9520 O  O     . HOH O 6 .   ? 12.978  -66.127 -9.702  1.00 41.50 ? 939 HOH A O     1 
HETATM 9521 O  O     . HOH O 6 .   ? -5.483  -67.807 -9.579  1.00 16.79 ? 940 HOH A O     1 
HETATM 9522 O  O     . HOH O 6 .   ? 6.235   -67.838 -9.530  1.00 23.37 ? 941 HOH A O     1 
HETATM 9523 O  O     . HOH O 6 .   ? 9.241   -81.781 -32.457 1.00 45.02 ? 942 HOH A O     1 
HETATM 9524 O  O     . HOH O 6 .   ? -18.992 -77.363 -25.412 1.00 47.75 ? 943 HOH A O     1 
HETATM 9525 O  O     . HOH O 6 .   ? -11.405 -43.441 -19.810 1.00 43.70 ? 944 HOH A O     1 
HETATM 9526 O  O     . HOH O 6 .   ? 47.985  -45.521 -14.705 1.00 20.83 ? 945 HOH A O     1 
HETATM 9527 O  O     . HOH O 6 .   ? -0.027  -53.920 -29.298 1.00 15.61 ? 946 HOH A O     1 
HETATM 9528 O  O     . HOH O 6 .   ? 3.326   -45.373 -34.878 1.00 7.35  ? 947 HOH A O     1 
HETATM 9529 O  O     . HOH O 6 .   ? -27.956 -70.195 -38.757 1.00 25.16 ? 948 HOH A O     1 
HETATM 9530 O  O     . HOH O 6 .   ? -6.080  -37.632 -39.296 1.00 35.83 ? 949 HOH A O     1 
HETATM 9531 O  O     . HOH O 6 .   ? 1.708   -52.185 -28.234 1.00 14.81 ? 950 HOH A O     1 
HETATM 9532 O  O     . HOH O 6 .   ? 3.796   -46.485 -20.392 1.00 30.28 ? 951 HOH A O     1 
HETATM 9533 O  O     . HOH O 6 .   ? -3.085  -50.192 -22.378 1.00 47.95 ? 952 HOH A O     1 
HETATM 9534 O  O     . HOH O 6 .   ? 13.833  -41.531 -43.053 1.00 41.80 ? 953 HOH A O     1 
HETATM 9535 O  O     . HOH O 6 .   ? 11.059  -42.403 -42.524 1.00 44.08 ? 954 HOH A O     1 
HETATM 9536 O  O     . HOH O 6 .   ? -3.060  -53.783 -48.479 1.00 40.38 ? 955 HOH A O     1 
HETATM 9537 O  O     . HOH O 6 .   ? 4.699   -28.822 -48.316 1.00 25.83 ? 956 HOH A O     1 
HETATM 9538 O  O     . HOH O 6 .   ? 7.081   -28.831 -48.888 1.00 27.05 ? 957 HOH A O     1 
HETATM 9539 O  O     . HOH O 6 .   ? -6.599  -29.225 -48.587 1.00 31.67 ? 958 HOH A O     1 
HETATM 9540 O  O     . HOH O 6 .   ? -9.278  -39.026 -49.220 1.00 20.44 ? 959 HOH A O     1 
HETATM 9541 O  O     . HOH O 6 .   ? -1.416  -34.783 -24.064 1.00 38.80 ? 960 HOH A O     1 
HETATM 9542 O  O     . HOH O 6 .   ? 13.831  -51.108 -31.144 1.00 7.08  ? 961 HOH A O     1 
HETATM 9543 O  O     . HOH O 6 .   ? 7.881   -44.416 -45.425 1.00 37.79 ? 962 HOH A O     1 
HETATM 9544 O  O     . HOH O 6 .   ? 16.017  -25.847 -38.265 1.00 42.21 ? 963 HOH A O     1 
HETATM 9545 O  O     . HOH O 6 .   ? 23.169  -38.752 -53.678 1.00 25.96 ? 964 HOH A O     1 
HETATM 9546 O  O     . HOH O 6 .   ? 26.997  -44.670 -38.387 1.00 44.28 ? 965 HOH A O     1 
HETATM 9547 O  O     . HOH O 6 .   ? 52.483  -18.126 -29.400 1.00 42.48 ? 966 HOH A O     1 
HETATM 9548 O  O     . HOH O 6 .   ? 57.064  -33.162 -20.116 1.00 33.74 ? 967 HOH A O     1 
HETATM 9549 O  O     . HOH O 6 .   ? 46.666  -24.335 -14.454 1.00 32.27 ? 968 HOH A O     1 
HETATM 9550 O  O     . HOH O 6 .   ? 51.942  -55.271 -21.884 1.00 49.19 ? 969 HOH A O     1 
HETATM 9551 O  O     . HOH O 6 .   ? 26.348  -69.627 -11.675 1.00 34.39 ? 970 HOH A O     1 
HETATM 9552 O  O     . HOH O 6 .   ? 18.772  -53.073 -18.708 1.00 28.61 ? 971 HOH A O     1 
HETATM 9553 O  O     . HOH O 6 .   ? 39.031  -73.343 -44.960 1.00 36.40 ? 972 HOH A O     1 
HETATM 9554 O  O     . HOH O 6 .   ? 47.358  -65.525 -29.629 1.00 26.17 ? 973 HOH A O     1 
HETATM 9555 O  O     . HOH O 6 .   ? 33.386  -63.326 -37.942 1.00 28.59 ? 974 HOH A O     1 
HETATM 9556 O  O     . HOH O 6 .   ? 36.777  -34.752 -41.198 1.00 33.57 ? 975 HOH A O     1 
HETATM 9557 O  O     . HOH O 6 .   ? 38.282  -32.659 -41.317 1.00 32.08 ? 976 HOH A O     1 
HETATM 9558 O  O     . HOH O 6 .   ? 13.497  -45.648 -40.734 1.00 39.86 ? 977 HOH A O     1 
HETATM 9559 O  O     . HOH O 6 .   ? -4.035  -41.022 -41.003 1.00 27.22 ? 978 HOH A O     1 
HETATM 9560 O  O     . HOH O 6 .   ? -2.070  -39.476 -40.814 1.00 13.49 ? 979 HOH A O     1 
HETATM 9561 O  O     . HOH O 6 .   ? -2.913  -26.796 -20.805 1.00 30.00 ? 980 HOH A O     1 
HETATM 9562 O  O     . HOH O 6 .   ? 48.081  -16.658 -22.325 1.00 29.73 ? 981 HOH A O     1 
HETATM 9563 O  O     . HOH O 6 .   ? 35.433  -65.830 -40.470 1.00 32.50 ? 982 HOH A O     1 
HETATM 9564 O  O     . HOH O 6 .   ? 7.440   -81.885 -28.418 1.00 28.06 ? 983 HOH A O     1 
HETATM 9565 O  O     . HOH O 6 .   ? 17.288  -80.511 -23.032 1.00 44.11 ? 984 HOH A O     1 
HETATM 9566 O  O     . HOH P 6 .   ? -5.231  -10.707 0.102   1.00 21.91 ? 703 HOH B O     1 
HETATM 9567 O  O     . HOH P 6 .   ? 8.018   -43.714 -11.518 1.00 10.25 ? 704 HOH B O     1 
HETATM 9568 O  O     . HOH P 6 .   ? -15.374 -5.727  -29.355 1.00 12.59 ? 705 HOH B O     1 
HETATM 9569 O  O     . HOH P 6 .   ? 1.376   -21.205 1.627   1.00 4.54  ? 706 HOH B O     1 
HETATM 9570 O  O     . HOH P 6 .   ? -5.121  6.200   -2.407  1.00 37.06 ? 707 HOH B O     1 
HETATM 9571 O  O     . HOH P 6 .   ? 8.902   -22.625 -5.263  1.00 9.22  ? 708 HOH B O     1 
HETATM 9572 O  O     . HOH P 6 .   ? 34.474  -25.667 -3.996  1.00 9.76  ? 709 HOH B O     1 
HETATM 9573 O  O     . HOH P 6 .   ? 10.577  -42.453 -12.667 1.00 26.87 ? 710 HOH B O     1 
HETATM 9574 O  O     . HOH P 6 .   ? -2.987  -15.300 3.418   1.00 16.87 ? 711 HOH B O     1 
HETATM 9575 O  O     . HOH P 6 .   ? 6.885   -3.573  -19.225 1.00 28.30 ? 712 HOH B O     1 
HETATM 9576 O  O     . HOH P 6 .   ? 18.043  -49.702 12.544  1.00 34.49 ? 713 HOH B O     1 
HETATM 9577 O  O     . HOH P 6 .   ? -3.109  -49.037 -8.188  1.00 23.56 ? 714 HOH B O     1 
HETATM 9578 O  O     . HOH P 6 .   ? 15.589  -8.185  -16.182 1.00 10.64 ? 715 HOH B O     1 
HETATM 9579 O  O     . HOH P 6 .   ? -3.423  -15.914 -28.832 1.00 43.25 ? 716 HOH B O     1 
HETATM 9580 O  O     . HOH P 6 .   ? 5.905   -27.607 4.048   1.00 16.32 ? 717 HOH B O     1 
HETATM 9581 O  O     . HOH P 6 .   ? 42.032  -10.570 4.608   1.00 42.39 ? 718 HOH B O     1 
HETATM 9582 O  O     . HOH P 6 .   ? -4.520  -50.034 -6.062  1.00 21.42 ? 719 HOH B O     1 
HETATM 9583 O  O     . HOH P 6 .   ? 22.283  -43.760 14.063  1.00 36.84 ? 720 HOH B O     1 
HETATM 9584 O  O     . HOH P 6 .   ? 44.162  -11.391 -10.833 1.00 28.16 ? 721 HOH B O     1 
HETATM 9585 O  O     . HOH P 6 .   ? 29.728  -34.297 5.728   1.00 37.36 ? 722 HOH B O     1 
HETATM 9586 O  O     . HOH P 6 .   ? -9.261  -34.703 -7.072  1.00 21.97 ? 723 HOH B O     1 
HETATM 9587 O  O     . HOH P 6 .   ? 9.094   -8.076  -25.298 1.00 22.80 ? 724 HOH B O     1 
HETATM 9588 O  O     . HOH P 6 .   ? 16.502  -38.580 -14.140 1.00 35.07 ? 725 HOH B O     1 
HETATM 9589 O  O     . HOH P 6 .   ? 9.401   -24.883 -2.340  1.00 8.58  ? 726 HOH B O     1 
HETATM 9590 O  O     . HOH P 6 .   ? 12.338  -27.897 -7.275  1.00 26.13 ? 727 HOH B O     1 
HETATM 9591 O  O     . HOH P 6 .   ? 24.321  -16.028 -19.635 1.00 15.60 ? 728 HOH B O     1 
HETATM 9592 O  O     . HOH P 6 .   ? -15.366 -0.328  -6.141  1.00 24.33 ? 729 HOH B O     1 
HETATM 9593 O  O     . HOH P 6 .   ? 37.483  -18.086 -12.975 1.00 32.75 ? 730 HOH B O     1 
HETATM 9594 O  O     . HOH P 6 .   ? -7.399  -11.927 -24.331 1.00 29.85 ? 731 HOH B O     1 
HETATM 9595 O  O     . HOH P 6 .   ? 1.077   -18.011 14.182  1.00 29.24 ? 732 HOH B O     1 
HETATM 9596 O  O     . HOH P 6 .   ? -0.830  -29.399 -15.960 1.00 57.38 ? 733 HOH B O     1 
HETATM 9597 O  O     . HOH P 6 .   ? 15.144  -28.582 -17.153 1.00 63.35 ? 734 HOH B O     1 
HETATM 9598 O  O     . HOH P 6 .   ? 5.147   -14.124 -21.567 1.00 21.19 ? 735 HOH B O     1 
HETATM 9599 O  O     . HOH P 6 .   ? -3.050  -13.452 -31.645 1.00 18.75 ? 736 HOH B O     1 
HETATM 9600 O  O     . HOH P 6 .   ? 7.564   -40.590 -15.394 1.00 26.79 ? 737 HOH B O     1 
HETATM 9601 O  O     . HOH P 6 .   ? -5.689  -28.680 12.793  1.00 24.58 ? 738 HOH B O     1 
HETATM 9602 O  O     . HOH P 6 .   ? -7.713  -24.737 -10.868 1.00 26.92 ? 739 HOH B O     1 
HETATM 9603 O  O     . HOH P 6 .   ? 4.012   -7.519  -24.242 1.00 19.89 ? 740 HOH B O     1 
HETATM 9604 O  O     . HOH P 6 .   ? 32.286  -10.674 10.947  1.00 26.13 ? 741 HOH B O     1 
HETATM 9605 O  O     . HOH P 6 .   ? 37.634  -39.102 11.273  1.00 29.19 ? 742 HOH B O     1 
HETATM 9606 O  O     . HOH P 6 .   ? 31.152  -47.736 -10.656 1.00 15.47 ? 743 HOH B O     1 
HETATM 9607 O  O     . HOH P 6 .   ? 7.651   -40.577 12.977  1.00 24.41 ? 744 HOH B O     1 
HETATM 9608 O  O     . HOH P 6 .   ? -5.614  -26.471 -29.736 1.00 43.69 ? 745 HOH B O     1 
HETATM 9609 O  O     . HOH P 6 .   ? 16.486  -33.953 -15.566 1.00 34.94 ? 746 HOH B O     1 
HETATM 9610 O  O     . HOH P 6 .   ? 11.667  -42.426 -17.601 1.00 35.85 ? 747 HOH B O     1 
HETATM 9611 O  O     . HOH P 6 .   ? 1.961   -26.683 -16.122 1.00 30.90 ? 748 HOH B O     1 
HETATM 9612 O  O     . HOH P 6 .   ? 51.285  -59.038 -14.327 1.00 12.20 ? 749 HOH B O     1 
HETATM 9613 O  O     . HOH P 6 .   ? 25.013  -8.010  17.135  1.00 33.30 ? 750 HOH B O     1 
HETATM 9614 O  O     . HOH P 6 .   ? 16.739  -61.045 -5.760  1.00 36.38 ? 751 HOH B O     1 
HETATM 9615 O  O     . HOH P 6 .   ? 16.406  -56.819 -5.812  1.00 29.64 ? 752 HOH B O     1 
HETATM 9616 O  O     . HOH P 6 .   ? 5.213   -52.834 -2.406  1.00 27.27 ? 753 HOH B O     1 
HETATM 9617 O  O     . HOH P 6 .   ? 6.472   -52.012 -6.152  1.00 24.00 ? 754 HOH B O     1 
HETATM 9618 O  O     . HOH P 6 .   ? 8.750   -28.724 -3.054  1.00 16.22 ? 755 HOH B O     1 
HETATM 9619 O  O     . HOH P 6 .   ? -0.873  -25.802 15.155  1.00 52.99 ? 756 HOH B O     1 
HETATM 9620 O  O     . HOH P 6 .   ? -0.522  -31.030 9.496   1.00 28.57 ? 757 HOH B O     1 
HETATM 9621 O  O     . HOH P 6 .   ? 2.287   -33.634 11.626  1.00 20.31 ? 758 HOH B O     1 
HETATM 9622 O  O     . HOH P 6 .   ? -1.360  -36.611 13.626  1.00 18.00 ? 759 HOH B O     1 
HETATM 9623 O  O     . HOH P 6 .   ? -4.967  -28.096 16.793  1.00 30.81 ? 760 HOH B O     1 
HETATM 9624 O  O     . HOH P 6 .   ? 3.486   -21.204 13.901  1.00 25.19 ? 761 HOH B O     1 
HETATM 9625 O  O     . HOH P 6 .   ? 5.966   -30.141 5.475   1.00 21.88 ? 762 HOH B O     1 
HETATM 9626 O  O     . HOH P 6 .   ? 5.152   -38.435 17.359  1.00 29.41 ? 763 HOH B O     1 
HETATM 9627 O  O     . HOH P 6 .   ? -0.393  -49.133 1.764   1.00 20.41 ? 764 HOH B O     1 
HETATM 9628 O  O     . HOH P 6 .   ? 5.040   -49.320 0.799   1.00 21.69 ? 765 HOH B O     1 
HETATM 9629 O  O     . HOH P 6 .   ? 7.154   -48.701 2.794   1.00 17.42 ? 766 HOH B O     1 
HETATM 9630 O  O     . HOH P 6 .   ? 8.632   -50.019 4.886   1.00 29.75 ? 767 HOH B O     1 
HETATM 9631 O  O     . HOH P 6 .   ? 19.035  -37.195 -12.158 1.00 28.72 ? 768 HOH B O     1 
HETATM 9632 O  O     . HOH P 6 .   ? 15.048  -37.369 16.390  1.00 19.24 ? 769 HOH B O     1 
HETATM 9633 O  O     . HOH P 6 .   ? 11.120  -36.159 15.882  1.00 32.40 ? 770 HOH B O     1 
HETATM 9634 O  O     . HOH P 6 .   ? -5.721  -41.280 10.705  1.00 32.80 ? 771 HOH B O     1 
HETATM 9635 O  O     . HOH P 6 .   ? 20.301  -59.682 13.783  1.00 32.00 ? 772 HOH B O     1 
HETATM 9636 O  O     . HOH P 6 .   ? 19.366  -62.633 10.241  1.00 17.67 ? 773 HOH B O     1 
HETATM 9637 O  O     . HOH P 6 .   ? 22.123  -55.810 10.916  1.00 38.19 ? 774 HOH B O     1 
HETATM 9638 O  O     . HOH P 6 .   ? 16.454  -52.130 11.391  1.00 60.54 ? 775 HOH B O     1 
HETATM 9639 O  O     . HOH P 6 .   ? 11.621  -56.966 4.250   1.00 28.14 ? 776 HOH B O     1 
HETATM 9640 O  O     . HOH P 6 .   ? 9.506   -56.612 5.783   1.00 23.51 ? 777 HOH B O     1 
HETATM 9641 O  O     . HOH P 6 .   ? 18.820  -46.928 16.507  1.00 18.54 ? 778 HOH B O     1 
HETATM 9642 O  O     . HOH P 6 .   ? 27.174  -46.043 14.113  1.00 10.40 ? 779 HOH B O     1 
HETATM 9643 O  O     . HOH P 6 .   ? 29.642  -44.475 13.155  1.00 49.36 ? 780 HOH B O     1 
HETATM 9644 O  O     . HOH P 6 .   ? 27.537  -41.778 13.556  1.00 18.48 ? 781 HOH B O     1 
HETATM 9645 O  O     . HOH P 6 .   ? 19.393  -46.240 19.399  1.00 32.78 ? 782 HOH B O     1 
HETATM 9646 O  O     . HOH P 6 .   ? 28.055  -54.301 13.655  1.00 32.17 ? 783 HOH B O     1 
HETATM 9647 O  O     . HOH P 6 .   ? 44.647  -40.046 6.466   1.00 38.45 ? 784 HOH B O     1 
HETATM 9648 O  O     . HOH P 6 .   ? 46.427  -38.110 -0.187  1.00 16.22 ? 785 HOH B O     1 
HETATM 9649 O  O     . HOH P 6 .   ? 37.877  -57.404 18.139  1.00 44.07 ? 786 HOH B O     1 
HETATM 9650 O  O     . HOH P 6 .   ? 49.357  -49.825 -4.283  1.00 36.76 ? 787 HOH B O     1 
HETATM 9651 O  O     . HOH P 6 .   ? 46.496  -58.394 3.509   1.00 42.51 ? 788 HOH B O     1 
HETATM 9652 O  O     . HOH P 6 .   ? 43.260  -9.537  -1.850  1.00 44.02 ? 789 HOH B O     1 
HETATM 9653 O  O     . HOH P 6 .   ? 47.229  -8.378  1.191   1.00 17.37 ? 790 HOH B O     1 
HETATM 9654 O  O     . HOH P 6 .   ? 31.541  -2.354  -3.320  1.00 35.26 ? 791 HOH B O     1 
HETATM 9655 O  O     . HOH P 6 .   ? 37.791  -0.375  -14.181 1.00 28.96 ? 792 HOH B O     1 
HETATM 9656 O  O     . HOH P 6 .   ? -1.736  -2.807  -21.482 1.00 23.01 ? 793 HOH B O     1 
HETATM 9657 O  O     . HOH P 6 .   ? -8.276  2.259   -25.832 1.00 27.96 ? 794 HOH B O     1 
HETATM 9658 O  O     . HOH P 6 .   ? 3.145   2.136   -12.569 1.00 35.66 ? 795 HOH B O     1 
HETATM 9659 O  O     . HOH P 6 .   ? 3.159   2.074   -16.898 1.00 20.07 ? 796 HOH B O     1 
HETATM 9660 O  O     . HOH P 6 .   ? 6.082   -2.012  -17.320 1.00 13.71 ? 797 HOH B O     1 
HETATM 9661 O  O     . HOH P 6 .   ? 15.990  -1.020  -17.290 1.00 37.81 ? 798 HOH B O     1 
HETATM 9662 O  O     . HOH P 6 .   ? 7.534   0.385   -20.437 1.00 32.82 ? 799 HOH B O     1 
HETATM 9663 O  O     . HOH P 6 .   ? 9.758   4.995   -15.321 1.00 41.60 ? 800 HOH B O     1 
HETATM 9664 O  O     . HOH P 6 .   ? 9.127   7.259   -7.172  1.00 24.14 ? 801 HOH B O     1 
HETATM 9665 O  O     . HOH P 6 .   ? -3.652  5.492   -7.602  1.00 25.49 ? 802 HOH B O     1 
HETATM 9666 O  O     . HOH P 6 .   ? -4.417  5.189   -10.075 1.00 19.55 ? 803 HOH B O     1 
HETATM 9667 O  O     . HOH P 6 .   ? -6.871  4.917   -9.439  1.00 25.49 ? 804 HOH B O     1 
HETATM 9668 O  O     . HOH P 6 .   ? -7.468  -14.302 -29.437 1.00 36.09 ? 805 HOH B O     1 
HETATM 9669 O  O     . HOH P 6 .   ? -6.802  -10.518 2.309   1.00 9.41  ? 806 HOH B O     1 
HETATM 9670 O  O     . HOH P 6 .   ? 30.708  -34.572 -5.139  1.00 29.33 ? 807 HOH B O     1 
HETATM 9671 O  O     . HOH P 6 .   ? 19.626  -25.494 -4.156  1.00 24.18 ? 808 HOH B O     1 
HETATM 9672 O  O     . HOH P 6 .   ? 17.237  -29.382 5.166   1.00 28.38 ? 809 HOH B O     1 
HETATM 9673 O  O     . HOH P 6 .   ? 13.740  -34.596 7.024   1.00 38.36 ? 810 HOH B O     1 
HETATM 9674 O  O     . HOH P 6 .   ? 48.314  -35.905 6.601   1.00 36.85 ? 811 HOH B O     1 
HETATM 9675 O  O     . HOH P 6 .   ? 49.584  -35.292 9.114   1.00 32.76 ? 812 HOH B O     1 
HETATM 9676 O  O     . HOH P 6 .   ? -23.158 -7.684  -13.358 1.00 27.82 ? 813 HOH B O     1 
HETATM 9677 O  O     . HOH P 6 .   ? -10.863 -32.100 -20.818 1.00 32.37 ? 814 HOH B O     1 
HETATM 9678 O  O     . HOH P 6 .   ? 14.362  -24.288 -19.006 1.00 51.44 ? 815 HOH B O     1 
HETATM 9679 O  O     . HOH P 6 .   ? 47.363  -30.182 -7.109  1.00 31.86 ? 816 HOH B O     1 
HETATM 9680 O  O     . HOH P 6 .   ? 51.759  -52.136 -14.164 1.00 47.19 ? 817 HOH B O     1 
HETATM 9681 O  O     . HOH P 6 .   ? 11.842  -11.967 12.211  1.00 17.40 ? 818 HOH B O     1 
HETATM 9682 O  O     . HOH P 6 .   ? -20.006 -13.654 -12.408 1.00 38.46 ? 819 HOH B O     1 
HETATM 9683 O  O     . HOH P 6 .   ? -6.911  -22.846 -13.708 1.00 17.51 ? 820 HOH B O     1 
HETATM 9684 O  O     . HOH P 6 .   ? -14.147 -14.264 -8.613  1.00 24.47 ? 821 HOH B O     1 
HETATM 9685 O  O     . HOH P 6 .   ? -4.089  -29.092 -14.028 1.00 26.35 ? 822 HOH B O     1 
HETATM 9686 O  O     . HOH P 6 .   ? -7.066  -31.897 -10.346 1.00 33.35 ? 823 HOH B O     1 
HETATM 9687 O  O     . HOH P 6 .   ? -4.474  -31.389 -15.045 1.00 40.38 ? 824 HOH B O     1 
HETATM 9688 O  O     . HOH P 6 .   ? 11.480  -30.438 -6.256  1.00 17.34 ? 825 HOH B O     1 
HETATM 9689 O  O     . HOH P 6 .   ? -2.690  -18.021 -2.458  1.00 11.09 ? 826 HOH B O     1 
HETATM 9690 O  O     . HOH P 6 .   ? 5.116   -32.648 6.456   1.00 24.32 ? 827 HOH B O     1 
HETATM 9691 O  O     . HOH P 6 .   ? 7.651   -21.391 10.171  1.00 36.59 ? 828 HOH B O     1 
HETATM 9692 O  O     . HOH P 6 .   ? -0.732  -32.577 11.418  1.00 25.28 ? 829 HOH B O     1 
HETATM 9693 O  O     . HOH P 6 .   ? -11.793 -39.203 -10.243 1.00 43.51 ? 830 HOH B O     1 
HETATM 9694 O  O     . HOH P 6 .   ? -13.374 -40.633 -7.716  1.00 39.58 ? 831 HOH B O     1 
HETATM 9695 O  O     . HOH P 6 .   ? 11.332  -35.134 7.594   1.00 46.25 ? 832 HOH B O     1 
HETATM 9696 O  O     . HOH P 6 .   ? 34.446  -43.295 7.293   1.00 42.87 ? 833 HOH B O     1 
HETATM 9697 O  O     . HOH P 6 .   ? 14.905  -40.232 12.906  1.00 24.23 ? 834 HOH B O     1 
HETATM 9698 O  O     . HOH P 6 .   ? 15.756  -35.323 14.322  1.00 38.41 ? 835 HOH B O     1 
HETATM 9699 O  O     . HOH P 6 .   ? 24.923  -53.660 9.793   1.00 25.48 ? 836 HOH B O     1 
HETATM 9700 O  O     . HOH P 6 .   ? 48.449  -47.816 0.088   1.00 41.63 ? 837 HOH B O     1 
HETATM 9701 O  O     . HOH P 6 .   ? 48.325  -43.831 4.453   1.00 23.38 ? 838 HOH B O     1 
HETATM 9702 O  O     . HOH P 6 .   ? 46.901  -45.780 -2.051  1.00 25.28 ? 839 HOH B O     1 
HETATM 9703 O  O     . HOH P 6 .   ? 50.722  -42.251 -1.986  1.00 38.26 ? 840 HOH B O     1 
HETATM 9704 O  O     . HOH P 6 .   ? 44.496  -33.680 16.562  1.00 36.48 ? 841 HOH B O     1 
HETATM 9705 O  O     . HOH P 6 .   ? 50.234  -32.261 9.390   1.00 39.69 ? 842 HOH B O     1 
HETATM 9706 O  O     . HOH P 6 .   ? 32.249  -25.308 -1.522  1.00 24.44 ? 843 HOH B O     1 
HETATM 9707 O  O     . HOH P 6 .   ? 22.772  -25.800 -6.995  1.00 22.92 ? 844 HOH B O     1 
HETATM 9708 O  O     . HOH P 6 .   ? 20.507  -20.902 -1.903  1.00 3.27  ? 845 HOH B O     1 
HETATM 9709 O  O     . HOH P 6 .   ? 34.158  -6.286  -2.209  1.00 12.06 ? 846 HOH B O     1 
HETATM 9710 O  O     . HOH P 6 .   ? 19.619  -5.775  12.033  1.00 42.74 ? 847 HOH B O     1 
HETATM 9711 O  O     . HOH P 6 .   ? 28.551  -7.159  -16.271 1.00 18.15 ? 848 HOH B O     1 
HETATM 9712 O  O     . HOH P 6 .   ? 21.758  -3.425  -14.657 1.00 18.07 ? 849 HOH B O     1 
HETATM 9713 O  O     . HOH P 6 .   ? 22.473  1.629   -14.988 1.00 38.78 ? 850 HOH B O     1 
HETATM 9714 O  O     . HOH P 6 .   ? 27.850  -7.701  -11.986 1.00 12.49 ? 851 HOH B O     1 
HETATM 9715 O  O     . HOH P 6 .   ? 16.067  -18.678 -22.840 1.00 39.99 ? 852 HOH B O     1 
HETATM 9716 O  O     . HOH P 6 .   ? 14.227  -11.968 -18.038 1.00 27.73 ? 853 HOH B O     1 
HETATM 9717 O  O     . HOH P 6 .   ? 0.867   -4.524  -28.083 1.00 9.02  ? 854 HOH B O     1 
HETATM 9718 O  O     . HOH P 6 .   ? 8.541   -6.909  5.804   1.00 27.01 ? 855 HOH B O     1 
HETATM 9719 O  O     . HOH P 6 .   ? -16.171 -1.347  1.348   1.00 25.50 ? 856 HOH B O     1 
HETATM 9720 O  O     . HOH P 6 .   ? -21.900 -15.981 -17.894 1.00 39.10 ? 857 HOH B O     1 
HETATM 9721 O  O     . HOH P 6 .   ? 9.489   -19.088 -29.584 1.00 30.22 ? 858 HOH B O     1 
HETATM 9722 O  O     . HOH P 6 .   ? 7.428   -50.796 -11.158 1.00 15.70 ? 859 HOH B O     1 
HETATM 9723 O  O     . HOH P 6 .   ? 21.228  -16.424 19.791  1.00 30.13 ? 860 HOH B O     1 
HETATM 9724 O  O     . HOH P 6 .   ? -21.619 -4.512  -0.611  1.00 36.91 ? 861 HOH B O     1 
HETATM 9725 O  O     . HOH P 6 .   ? 24.510  -58.409 1.350   1.00 25.78 ? 862 HOH B O     1 
HETATM 9726 O  O     . HOH P 6 .   ? -18.238 -21.455 -11.409 1.00 20.98 ? 863 HOH B O     1 
HETATM 9727 O  O     . HOH P 6 .   ? -15.874 -10.575 5.347   1.00 30.38 ? 864 HOH B O     1 
HETATM 9728 O  O     . HOH P 6 .   ? -7.963  -27.757 -3.745  1.00 34.09 ? 865 HOH B O     1 
HETATM 9729 O  O     . HOH P 6 .   ? -8.836  -36.065 1.781   1.00 26.26 ? 866 HOH B O     1 
HETATM 9730 O  O     . HOH P 6 .   ? -11.995 -40.435 14.889  1.00 24.18 ? 867 HOH B O     1 
HETATM 9731 O  O     . HOH P 6 .   ? -4.569  -38.528 -14.728 1.00 29.43 ? 868 HOH B O     1 
HETATM 9732 O  O     . HOH P 6 .   ? 14.586  -29.578 -7.916  1.00 12.73 ? 869 HOH B O     1 
HETATM 9733 O  O     . HOH P 6 .   ? 17.095  -26.021 -3.681  1.00 33.74 ? 870 HOH B O     1 
HETATM 9734 O  O     . HOH P 6 .   ? 16.130  -42.644 12.717  1.00 33.50 ? 871 HOH B O     1 
HETATM 9735 O  O     . HOH P 6 .   ? 16.481  -54.939 -2.167  1.00 17.06 ? 872 HOH B O     1 
HETATM 9736 O  O     . HOH P 6 .   ? 21.770  -59.796 8.479   1.00 18.33 ? 873 HOH B O     1 
HETATM 9737 O  O     . HOH P 6 .   ? 45.175  -44.373 8.640   1.00 54.05 ? 874 HOH B O     1 
HETATM 9738 O  O     . HOH P 6 .   ? 45.341  -40.815 10.645  1.00 54.64 ? 875 HOH B O     1 
HETATM 9739 O  O     . HOH P 6 .   ? 39.137  -56.010 0.417   1.00 52.70 ? 876 HOH B O     1 
HETATM 9740 O  O     . HOH P 6 .   ? 49.375  -61.340 1.676   1.00 26.08 ? 877 HOH B O     1 
HETATM 9741 O  O     . HOH P 6 .   ? 57.077  -53.558 -5.696  1.00 25.79 ? 878 HOH B O     1 
HETATM 9742 O  O     . HOH P 6 .   ? 45.834  -46.658 0.725   1.00 37.71 ? 879 HOH B O     1 
HETATM 9743 O  O     . HOH P 6 .   ? 20.677  -22.046 -4.124  1.00 23.12 ? 880 HOH B O     1 
HETATM 9744 O  O     . HOH P 6 .   ? 42.134  -0.718  -7.711  1.00 36.57 ? 881 HOH B O     1 
HETATM 9745 O  O     . HOH P 6 .   ? 32.914  -7.442  -11.907 1.00 31.52 ? 882 HOH B O     1 
HETATM 9746 O  O     . HOH P 6 .   ? 13.157  -26.824 -19.085 1.00 29.01 ? 883 HOH B O     1 
HETATM 9747 O  O     . HOH P 6 .   ? 13.657  -16.184 -25.613 1.00 25.84 ? 884 HOH B O     1 
HETATM 9748 O  O     . HOH P 6 .   ? 10.306  4.301   -18.667 1.00 28.62 ? 885 HOH B O     1 
HETATM 9749 O  O     . HOH P 6 .   ? 8.000   5.795   -9.130  1.00 32.76 ? 886 HOH B O     1 
HETATM 9750 O  O     . HOH P 6 .   ? 2.356   4.134   1.956   1.00 19.03 ? 887 HOH B O     1 
HETATM 9751 O  O     . HOH P 6 .   ? 12.264  0.071   4.331   1.00 34.33 ? 888 HOH B O     1 
HETATM 9752 O  O     . HOH P 6 .   ? -21.692 -0.993  -20.867 1.00 10.71 ? 889 HOH B O     1 
HETATM 9753 O  O     . HOH P 6 .   ? -17.800 -12.744 -20.631 1.00 40.59 ? 890 HOH B O     1 
HETATM 9754 O  O     . HOH P 6 .   ? -18.805 -10.337 -20.210 1.00 50.49 ? 891 HOH B O     1 
HETATM 9755 O  O     . HOH P 6 .   ? -17.213 -23.671 -20.303 1.00 23.10 ? 892 HOH B O     1 
HETATM 9756 O  O     . HOH P 6 .   ? -8.566  -24.061 -27.052 1.00 42.97 ? 893 HOH B O     1 
HETATM 9757 O  O     . HOH P 6 .   ? 47.947  -46.988 12.455  1.00 42.52 ? 894 HOH B O     1 
HETATM 9758 O  O     . HOH P 6 .   ? -1.641  -30.714 -2.216  1.00 7.26  ? 895 HOH B O     1 
HETATM 9759 O  O     . HOH P 6 .   ? 12.741  -38.584 -16.055 1.00 39.81 ? 896 HOH B O     1 
HETATM 9760 O  O     . HOH P 6 .   ? 17.333  -48.780 -11.819 1.00 34.84 ? 897 HOH B O     1 
HETATM 9761 O  O     . HOH P 6 .   ? 40.455  -41.361 -15.622 1.00 23.83 ? 898 HOH B O     1 
HETATM 9762 O  O     . HOH P 6 .   ? 7.645   -25.586 12.650  1.00 53.54 ? 899 HOH B O     1 
HETATM 9763 O  O     . HOH P 6 .   ? 20.769  -39.945 -8.022  1.00 24.81 ? 900 HOH B O     1 
HETATM 9764 O  O     . HOH P 6 .   ? 13.521  -42.823 -15.973 1.00 34.92 ? 901 HOH B O     1 
HETATM 9765 O  O     . HOH P 6 .   ? 9.215   -23.453 -20.171 1.00 24.03 ? 902 HOH B O     1 
HETATM 9766 O  O     . HOH P 6 .   ? -7.706  -15.131 10.797  1.00 31.67 ? 903 HOH B O     1 
HETATM 9767 O  O     . HOH P 6 .   ? -8.667  -19.764 7.708   1.00 44.96 ? 904 HOH B O     1 
HETATM 9768 O  O     . HOH P 6 .   ? 21.453  -57.379 13.641  1.00 33.14 ? 905 HOH B O     1 
HETATM 9769 O  O     . HOH P 6 .   ? 31.336  -57.369 13.160  1.00 17.45 ? 906 HOH B O     1 
HETATM 9770 O  O     . HOH P 6 .   ? 41.420  -56.696 18.448  1.00 42.57 ? 907 HOH B O     1 
HETATM 9771 O  O     . HOH P 6 .   ? 46.652  -38.937 7.421   1.00 52.11 ? 908 HOH B O     1 
HETATM 9772 O  O     . HOH P 6 .   ? 28.867  -3.123  7.082   1.00 44.49 ? 909 HOH B O     1 
HETATM 9773 O  O     . HOH P 6 .   ? -7.489  8.497   -12.994 1.00 30.16 ? 910 HOH B O     1 
HETATM 9774 O  O     . HOH P 6 .   ? -5.793  6.590   -12.707 1.00 22.85 ? 911 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   1   1   G   G   C . n 
A 1 2   C   2   2   2   C   C   C . n 
A 1 3   C   3   3   3   C   C   C . n 
A 1 4   U   4   4   4   U   U   C . n 
A 1 5   A   5   5   5   A   A   C . n 
A 1 6   C   6   6   6   C   C   C . n 
A 1 7   C   7   7   7   C   C   C . n 
A 1 8   C   8   8   8   C   C   C . n 
B 2 1   C   1   1   ?   ?   ?   D . n 
B 2 2   G   2   2   2   G   G   D . n 
B 2 3   G   3   3   3   G   G   D . n 
B 2 4   U   4   4   4   U   U   D . n 
B 2 5   A   5   5   5   A   A   D . n 
B 2 6   G   6   6   6   G   G   D . n 
B 2 7   G   7   7   7   G   G   D . n 
B 2 8   C   8   8   8   C   C   D . n 
B 2 9   U   9   9   9   U   U   D . n 
B 2 10  U   10  10  10  U   U   D . n 
B 2 11  U   11  11  11  U   U   D . n 
B 2 12  U   12  12  12  U   U   D . n 
B 2 13  C   13  13  13  C   C   D . n 
B 2 14  A   14  14  14  A   A   D . n 
B 2 15  A   15  15  15  A   A   D . n 
C 1 1   G   1   1   1   G   G   E . n 
C 1 2   C   2   2   2   C   C   E . n 
C 1 3   C   3   3   3   C   C   E . n 
C 1 4   U   4   4   4   U   U   E . n 
C 1 5   A   5   5   5   A   A   E . n 
C 1 6   C   6   6   6   C   C   E . n 
C 1 7   C   7   7   7   C   C   E . n 
C 1 8   C   8   8   8   C   C   E . n 
D 2 1   C   1   1   1   C   C   F . n 
D 2 2   G   2   2   2   G   G   F . n 
D 2 3   G   3   3   3   G   G   F . n 
D 2 4   U   4   4   4   U   U   F . n 
D 2 5   A   5   5   5   A   A   F . n 
D 2 6   G   6   6   6   G   G   F . n 
D 2 7   G   7   7   7   G   G   F . n 
D 2 8   C   8   8   8   C   C   F . n 
D 2 9   U   9   9   9   U   U   F . n 
D 2 10  U   10  10  10  U   U   F . n 
D 2 11  U   11  11  11  U   U   F . n 
D 2 12  U   12  12  12  U   U   F . n 
D 2 13  C   13  13  13  C   C   F . n 
D 2 14  A   14  14  14  A   A   F . n 
D 2 15  A   15  15  15  A   A   F . n 
E 3 1   MET 1   1   ?   ?   ?   A . n 
E 3 2   GLU 2   2   ?   ?   ?   A . n 
E 3 3   ALA 3   3   ?   ?   ?   A . n 
E 3 4   THR 4   4   ?   ?   ?   A . n 
E 3 5   MET 5   5   5   MET MET A . n 
E 3 6   ASP 6   6   6   ASP ASP A . n 
E 3 7   GLN 7   7   7   GLN GLN A . n 
E 3 8   THR 8   8   8   THR THR A . n 
E 3 9   GLN 9   9   9   GLN GLN A . n 
E 3 10  PRO 10  10  10  PRO PRO A . n 
E 3 11  LEU 11  11  11  LEU LEU A . n 
E 3 12  ASN 12  12  12  ASN ASN A . n 
E 3 13  GLU 13  13  13  GLU GLU A . n 
E 3 14  LYS 14  14  14  LYS LYS A . n 
E 3 15  GLN 15  15  15  GLN GLN A . n 
E 3 16  VAL 16  16  16  VAL VAL A . n 
E 3 17  PRO 17  17  17  PRO PRO A . n 
E 3 18  ASN 18  18  18  ASN ASN A . n 
E 3 19  SER 19  19  19  SER SER A . n 
E 3 20  GLU 20  20  20  GLU GLU A . n 
E 3 21  GLY 21  21  21  GLY GLY A . n 
E 3 22  CYS 22  22  22  CYS CYS A . n 
E 3 23  TYR 23  23  23  TYR TYR A . n 
E 3 24  VAL 24  24  24  VAL VAL A . n 
E 3 25  TRP 25  25  25  TRP TRP A . n 
E 3 26  GLN 26  26  26  GLN GLN A . n 
E 3 27  VAL 27  27  27  VAL VAL A . n 
E 3 28  SER 28  28  28  SER SER A . n 
E 3 29  ASP 29  29  29  ASP ASP A . n 
E 3 30  MET 30  30  30  MET MET A . n 
E 3 31  ASN 31  31  31  ASN ASN A . n 
E 3 32  ARG 32  32  32  ARG ARG A . n 
E 3 33  LEU 33  33  33  LEU LEU A . n 
E 3 34  ARG 34  34  34  ARG ARG A . n 
E 3 35  ARG 35  35  35  ARG ARG A . n 
E 3 36  PHE 36  36  36  PHE PHE A . n 
E 3 37  LEU 37  37  37  LEU LEU A . n 
E 3 38  CYS 38  38  38  CYS CYS A . n 
E 3 39  PHE 39  39  39  PHE PHE A . n 
E 3 40  GLY 40  40  40  GLY GLY A . n 
E 3 41  SER 41  41  41  SER SER A . n 
E 3 42  GLU 42  42  42  GLU GLU A . n 
E 3 43  GLY 43  43  43  GLY GLY A . n 
E 3 44  GLY 44  44  44  GLY GLY A . n 
E 3 45  THR 45  45  45  THR THR A . n 
E 3 46  TYR 46  46  46  TYR TYR A . n 
E 3 47  TYR 47  47  47  TYR TYR A . n 
E 3 48  ILE 48  48  48  ILE ILE A . n 
E 3 49  GLU 49  49  49  GLU GLU A . n 
E 3 50  GLU 50  50  50  GLU GLU A . n 
E 3 51  LYS 51  51  51  LYS LYS A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  LEU 53  53  53  LEU LEU A . n 
E 3 54  GLY 54  54  54  GLY GLY A . n 
E 3 55  GLN 55  55  55  GLN GLN A . n 
E 3 56  GLU 56  56  56  GLU GLU A . n 
E 3 57  ASN 57  57  57  ASN ASN A . n 
E 3 58  ALA 58  58  58  ALA ALA A . n 
E 3 59  GLU 59  59  59  GLU GLU A . n 
E 3 60  ALA 60  60  60  ALA ALA A . n 
E 3 61  LEU 61  61  61  LEU LEU A . n 
E 3 62  LEU 62  62  62  LEU LEU A . n 
E 3 63  ARG 63  63  63  ARG ARG A . n 
E 3 64  LEU 64  64  64  LEU LEU A . n 
E 3 65  ILE 65  65  65  ILE ILE A . n 
E 3 66  GLU 66  66  66  GLU GLU A . n 
E 3 67  ASP 67  67  67  ASP ASP A . n 
E 3 68  GLY 68  68  68  GLY GLY A . n 
E 3 69  LYS 69  69  69  LYS LYS A . n 
E 3 70  GLY 70  70  70  GLY GLY A . n 
E 3 71  CYS 71  71  71  CYS CYS A . n 
E 3 72  GLU 72  72  72  GLU GLU A . n 
E 3 73  VAL 73  73  73  VAL VAL A . n 
E 3 74  VAL 74  74  74  VAL VAL A . n 
E 3 75  GLN 75  75  75  GLN GLN A . n 
E 3 76  GLU 76  76  76  GLU GLU A . n 
E 3 77  ILE 77  77  77  ILE ILE A . n 
E 3 78  LYS 78  78  78  LYS LYS A . n 
E 3 79  THR 79  79  79  THR THR A . n 
E 3 80  PHE 80  80  80  PHE PHE A . n 
E 3 81  SER 81  81  81  SER SER A . n 
E 3 82  GLN 82  82  82  GLN GLN A . n 
E 3 83  GLU 83  83  83  GLU GLU A . n 
E 3 84  GLY 84  84  84  GLY GLY A . n 
E 3 85  ARG 85  85  85  ARG ARG A . n 
E 3 86  ALA 86  86  86  ALA ALA A . n 
E 3 87  ALA 87  87  87  ALA ALA A . n 
E 3 88  LYS 88  88  88  LYS LYS A . n 
E 3 89  GLN 89  89  89  GLN GLN A . n 
E 3 90  GLU 90  90  90  GLU GLU A . n 
E 3 91  PRO 91  91  91  PRO PRO A . n 
E 3 92  THR 92  92  92  THR THR A . n 
E 3 93  LEU 93  93  93  LEU LEU A . n 
E 3 94  PHE 94  94  94  PHE PHE A . n 
E 3 95  ALA 95  95  95  ALA ALA A . n 
E 3 96  LEU 96  96  96  LEU LEU A . n 
E 3 97  ALA 97  97  97  ALA ALA A . n 
E 3 98  VAL 98  98  98  VAL VAL A . n 
E 3 99  CYS 99  99  99  CYS CYS A . n 
E 3 100 SER 100 100 100 SER SER A . n 
E 3 101 GLN 101 101 101 GLN GLN A . n 
E 3 102 CYS 102 102 102 CYS CYS A . n 
E 3 103 SER 103 103 103 SER SER A . n 
E 3 104 ASP 104 104 104 ASP ASP A . n 
E 3 105 ILE 105 105 105 ILE ILE A . n 
E 3 106 LYS 106 106 106 LYS LYS A . n 
E 3 107 THR 107 107 107 THR THR A . n 
E 3 108 LYS 108 108 108 LYS LYS A . n 
E 3 109 GLN 109 109 109 GLN GLN A . n 
E 3 110 ALA 110 110 110 ALA ALA A . n 
E 3 111 ALA 111 111 111 ALA ALA A . n 
E 3 112 PHE 112 112 112 PHE PHE A . n 
E 3 113 ARG 113 113 113 ARG ARG A . n 
E 3 114 ALA 114 114 114 ALA ALA A . n 
E 3 115 VAL 115 115 115 VAL VAL A . n 
E 3 116 PRO 116 116 116 PRO PRO A . n 
E 3 117 GLU 117 117 117 GLU GLU A . n 
E 3 118 VAL 118 118 118 VAL VAL A . n 
E 3 119 CYS 119 119 119 CYS CYS A . n 
E 3 120 ARG 120 120 120 ARG ARG A . n 
E 3 121 ILE 121 121 121 ILE ILE A . n 
E 3 122 PRO 122 122 122 PRO PRO A . n 
E 3 123 THR 123 123 123 THR THR A . n 
E 3 124 HIS 124 124 124 HIS HIS A . n 
E 3 125 LEU 125 125 125 LEU LEU A . n 
E 3 126 PHE 126 126 126 PHE PHE A . n 
E 3 127 THR 127 127 127 THR THR A . n 
E 3 128 PHE 128 128 128 PHE PHE A . n 
E 3 129 ILE 129 129 129 ILE ILE A . n 
E 3 130 GLN 130 130 130 GLN GLN A . n 
E 3 131 PHE 131 131 131 PHE PHE A . n 
E 3 132 LYS 132 132 132 LYS LYS A . n 
E 3 133 LYS 133 133 133 LYS LYS A . n 
E 3 134 ASP 134 134 134 ASP ASP A . n 
E 3 135 LEU 135 135 135 LEU LEU A . n 
E 3 136 LYS 136 136 ?   ?   ?   A . n 
E 3 137 GLU 137 137 ?   ?   ?   A . n 
E 3 138 GLY 138 138 ?   ?   ?   A . n 
E 3 139 MET 139 139 ?   ?   ?   A . n 
E 3 140 LYS 140 140 ?   ?   ?   A . n 
E 3 141 CYS 141 141 ?   ?   ?   A . n 
E 3 142 GLY 142 142 ?   ?   ?   A . n 
E 3 143 MET 143 143 ?   ?   ?   A . n 
E 3 144 TRP 144 144 144 TRP TRP A . n 
E 3 145 GLY 145 145 145 GLY GLY A . n 
E 3 146 ARG 146 146 146 ARG ARG A . n 
E 3 147 ALA 147 147 147 ALA ALA A . n 
E 3 148 LEU 148 148 148 LEU LEU A . n 
E 3 149 ARG 149 149 149 ARG ARG A . n 
E 3 150 LYS 150 150 150 LYS LYS A . n 
E 3 151 ALA 151 151 151 ALA ALA A . n 
E 3 152 VAL 152 152 152 VAL VAL A . n 
E 3 153 SER 153 153 153 SER SER A . n 
E 3 154 ASP 154 154 154 ASP ASP A . n 
E 3 155 TRP 155 155 155 TRP TRP A . n 
E 3 156 TYR 156 156 156 TYR TYR A . n 
E 3 157 ASN 157 157 157 ASN ASN A . n 
E 3 158 THR 158 158 158 THR THR A . n 
E 3 159 LYS 159 159 159 LYS LYS A . n 
E 3 160 ASP 160 160 160 ASP ASP A . n 
E 3 161 ALA 161 161 161 ALA ALA A . n 
E 3 162 LEU 162 162 162 LEU LEU A . n 
E 3 163 ASN 163 163 163 ASN ASN A . n 
E 3 164 LEU 164 164 164 LEU LEU A . n 
E 3 165 ALA 165 165 165 ALA ALA A . n 
E 3 166 MET 166 166 166 MET MET A . n 
E 3 167 ALA 167 167 167 ALA ALA A . n 
E 3 168 VAL 168 168 168 VAL VAL A . n 
E 3 169 THR 169 169 169 THR THR A . n 
E 3 170 LYS 170 170 170 LYS LYS A . n 
E 3 171 TYR 171 171 171 TYR TYR A . n 
E 3 172 LYS 172 172 172 LYS LYS A . n 
E 3 173 GLN 173 173 173 GLN GLN A . n 
E 3 174 ARG 174 174 174 ARG ARG A . n 
E 3 175 ASN 175 175 175 ASN ASN A . n 
E 3 176 GLY 176 176 176 GLY GLY A . n 
E 3 177 TRP 177 177 177 TRP TRP A . n 
E 3 178 SER 178 178 178 SER SER A . n 
E 3 179 HIS 179 179 179 HIS HIS A . n 
E 3 180 LYS 180 180 180 LYS LYS A . n 
E 3 181 ASP 181 181 181 ASP ASP A . n 
E 3 182 LEU 182 182 182 LEU LEU A . n 
E 3 183 LEU 183 183 183 LEU LEU A . n 
E 3 184 ARG 184 184 184 ARG ARG A . n 
E 3 185 LEU 185 185 185 LEU LEU A . n 
E 3 186 SER 186 186 186 SER SER A . n 
E 3 187 HIS 187 187 187 HIS HIS A . n 
E 3 188 ILE 188 188 188 ILE ILE A . n 
E 3 189 LYS 189 189 189 LYS LYS A . n 
E 3 190 PRO 190 190 190 PRO PRO A . n 
E 3 191 ALA 191 191 191 ALA ALA A . n 
E 3 192 ASN 192 192 192 ASN ASN A . n 
E 3 193 GLU 193 193 193 GLU GLU A . n 
E 3 194 GLY 194 194 194 GLY GLY A . n 
E 3 195 LEU 195 195 195 LEU LEU A . n 
E 3 196 THR 196 196 196 THR THR A . n 
E 3 197 MET 197 197 197 MET MET A . n 
E 3 198 VAL 198 198 198 VAL VAL A . n 
E 3 199 ALA 199 199 199 ALA ALA A . n 
E 3 200 LYS 200 200 200 LYS LYS A . n 
E 3 201 TYR 201 201 201 TYR TYR A . n 
E 3 202 VAL 202 202 202 VAL VAL A . n 
E 3 203 SER 203 203 203 SER SER A . n 
E 3 204 LYS 204 204 204 LYS LYS A . n 
E 3 205 GLY 205 205 205 GLY GLY A . n 
E 3 206 TRP 206 206 206 TRP TRP A . n 
E 3 207 LYS 207 207 207 LYS LYS A . n 
E 3 208 GLU 208 208 208 GLU GLU A . n 
E 3 209 VAL 209 209 209 VAL VAL A . n 
E 3 210 GLN 210 210 210 GLN GLN A . n 
E 3 211 GLU 211 211 211 GLU GLU A . n 
E 3 212 ALA 212 212 212 ALA ALA A . n 
E 3 213 TYR 213 213 213 TYR TYR A . n 
E 3 214 LYS 214 214 ?   ?   ?   A . n 
E 3 215 GLU 215 215 ?   ?   ?   A . n 
E 3 216 LYS 216 216 ?   ?   ?   A . n 
E 3 217 GLU 217 217 ?   ?   ?   A . n 
E 3 218 LEU 218 218 ?   ?   ?   A . n 
E 3 219 SER 219 219 219 SER SER A . n 
E 3 220 PRO 220 220 220 PRO PRO A . n 
E 3 221 GLU 221 221 221 GLU GLU A . n 
E 3 222 THR 222 222 222 THR THR A . n 
E 3 223 GLU 223 223 223 GLU GLU A . n 
E 3 224 LYS 224 224 224 LYS LYS A . n 
E 3 225 VAL 225 225 225 VAL VAL A . n 
E 3 226 LEU 226 226 226 LEU LEU A . n 
E 3 227 LYS 227 227 227 LYS LYS A . n 
E 3 228 TYR 228 228 228 TYR TYR A . n 
E 3 229 LEU 229 229 229 LEU LEU A . n 
E 3 230 GLU 230 230 230 GLU GLU A . n 
E 3 231 ALA 231 231 231 ALA ALA A . n 
E 3 232 THR 232 232 232 THR THR A . n 
E 3 233 GLU 233 233 233 GLU GLU A . n 
E 3 234 ARG 234 234 234 ARG ARG A . n 
E 3 235 VAL 235 235 235 VAL VAL A . n 
E 3 236 LYS 236 236 236 LYS LYS A . n 
E 3 237 ARG 237 237 237 ARG ARG A . n 
E 3 238 THR 238 238 238 THR THR A . n 
E 3 239 LYS 239 239 239 LYS LYS A . n 
E 3 240 ASP 240 240 240 ASP ASP A . n 
E 3 241 GLU 241 241 241 GLU GLU A . n 
E 3 242 LEU 242 242 242 LEU LEU A . n 
E 3 243 GLU 243 243 243 GLU GLU A . n 
E 3 244 ILE 244 244 244 ILE ILE A . n 
E 3 245 ILE 245 245 245 ILE ILE A . n 
E 3 246 HIS 246 246 246 HIS HIS A . n 
E 3 247 LEU 247 247 247 LEU LEU A . n 
E 3 248 ILE 248 248 248 ILE ILE A . n 
E 3 249 ASP 249 249 249 ASP ASP A . n 
E 3 250 GLU 250 250 250 GLU GLU A . n 
E 3 251 TYR 251 251 251 TYR TYR A . n 
E 3 252 ARG 252 252 252 ARG ARG A . n 
E 3 253 LEU 253 253 253 LEU LEU A . n 
E 3 254 VAL 254 254 254 VAL VAL A . n 
E 3 255 ARG 255 255 255 ARG ARG A . n 
E 3 256 GLU 256 256 256 GLU GLU A . n 
E 3 257 HIS 257 257 257 HIS HIS A . n 
E 3 258 LEU 258 258 258 LEU LEU A . n 
E 3 259 LEU 259 259 259 LEU LEU A . n 
E 3 260 THR 260 260 260 THR THR A . n 
E 3 261 ILE 261 261 261 ILE ILE A . n 
E 3 262 HIS 262 262 262 HIS HIS A . n 
E 3 263 LEU 263 263 263 LEU LEU A . n 
E 3 264 LYS 264 264 264 LYS LYS A . n 
E 3 265 SER 265 265 265 SER SER A . n 
E 3 266 LYS 266 266 266 LYS LYS A . n 
E 3 267 GLU 267 267 267 GLU GLU A . n 
E 3 268 ILE 268 268 268 ILE ILE A . n 
E 3 269 TRP 269 269 269 TRP TRP A . n 
E 3 270 LYS 270 270 270 LYS LYS A . n 
E 3 271 SER 271 271 271 SER SER A . n 
E 3 272 LEU 272 272 272 LEU LEU A . n 
E 3 273 LEU 273 273 273 LEU LEU A . n 
E 3 274 GLN 274 274 274 GLN GLN A . n 
E 3 275 ASP 275 275 275 ASP ASP A . n 
E 3 276 MET 276 276 276 MET MET A . n 
E 3 277 PRO 277 277 277 PRO PRO A . n 
E 3 278 LEU 278 278 278 LEU LEU A . n 
E 3 279 THR 279 279 279 THR THR A . n 
E 3 280 ALA 280 280 280 ALA ALA A . n 
E 3 281 LEU 281 281 281 LEU LEU A . n 
E 3 282 LEU 282 282 282 LEU LEU A . n 
E 3 283 ARG 283 283 283 ARG ARG A . n 
E 3 284 ASN 284 284 284 ASN ASN A . n 
E 3 285 LEU 285 285 285 LEU LEU A . n 
E 3 286 GLY 286 286 286 GLY GLY A . n 
E 3 287 LYS 287 287 287 LYS LYS A . n 
E 3 288 MET 288 288 288 MET MET A . n 
E 3 289 THR 289 289 289 THR THR A . n 
E 3 290 ALA 290 290 290 ALA ALA A . n 
E 3 291 ASP 291 291 291 ASP ASP A . n 
E 3 292 SER 292 292 292 SER SER A . n 
E 3 293 VAL 293 293 293 VAL VAL A . n 
E 3 294 LEU 294 294 294 LEU LEU A . n 
E 3 295 ALA 295 295 295 ALA ALA A . n 
E 3 296 PRO 296 296 296 PRO PRO A . n 
E 3 297 ALA 297 297 297 ALA ALA A . n 
E 3 298 SER 298 298 298 SER SER A . n 
E 3 299 SER 299 299 299 SER SER A . n 
E 3 300 GLU 300 300 300 GLU GLU A . n 
E 3 301 VAL 301 301 301 VAL VAL A . n 
E 3 302 SER 302 302 302 SER SER A . n 
E 3 303 SER 303 303 303 SER SER A . n 
E 3 304 VAL 304 304 304 VAL VAL A . n 
E 3 305 CYS 305 305 305 CYS CYS A . n 
E 3 306 GLU 306 306 306 GLU GLU A . n 
E 3 307 ARG 307 307 307 ARG ARG A . n 
E 3 308 LEU 308 308 308 LEU LEU A . n 
E 3 309 THR 309 309 309 THR THR A . n 
E 3 310 ASN 310 310 310 ASN ASN A . n 
E 3 311 GLU 311 311 311 GLU GLU A . n 
E 3 312 LYS 312 312 312 LYS LYS A . n 
E 3 313 LEU 313 313 313 LEU LEU A . n 
E 3 314 LEU 314 314 314 LEU LEU A . n 
E 3 315 LYS 315 315 315 LYS LYS A . n 
E 3 316 LYS 316 316 316 LYS LYS A . n 
E 3 317 ALA 317 317 317 ALA ALA A . n 
E 3 318 ARG 318 318 318 ARG ARG A . n 
E 3 319 ILE 319 319 319 ILE ILE A . n 
E 3 320 HIS 320 320 320 HIS HIS A . n 
E 3 321 PRO 321 321 321 PRO PRO A . n 
E 3 322 PHE 322 322 322 PHE PHE A . n 
E 3 323 HIS 323 323 323 HIS HIS A . n 
E 3 324 ILE 324 324 324 ILE ILE A . n 
E 3 325 LEU 325 325 325 LEU LEU A . n 
E 3 326 VAL 326 326 326 VAL VAL A . n 
E 3 327 ALA 327 327 327 ALA ALA A . n 
E 3 328 LEU 328 328 328 LEU LEU A . n 
E 3 329 GLU 329 329 329 GLU GLU A . n 
E 3 330 THR 330 330 330 THR THR A . n 
E 3 331 TYR 331 331 331 TYR TYR A . n 
E 3 332 LYS 332 332 332 LYS LYS A . n 
E 3 333 LYS 333 333 333 LYS LYS A . n 
E 3 334 GLY 334 334 334 GLY GLY A . n 
E 3 335 HIS 335 335 335 HIS HIS A . n 
E 3 336 GLY 336 336 336 GLY GLY A . n 
E 3 337 ASN 337 337 337 ASN ASN A . n 
E 3 338 ARG 338 338 338 ARG ARG A . n 
E 3 339 GLY 339 339 339 GLY GLY A . n 
E 3 340 LYS 340 340 340 LYS LYS A . n 
E 3 341 LEU 341 341 341 LEU LEU A . n 
E 3 342 ARG 342 342 342 ARG ARG A . n 
E 3 343 TRP 343 343 343 TRP TRP A . n 
E 3 344 ILE 344 344 344 ILE ILE A . n 
E 3 345 PRO 345 345 345 PRO PRO A . n 
E 3 346 ASP 346 346 346 ASP ASP A . n 
E 3 347 THR 347 347 347 THR THR A . n 
E 3 348 SER 348 348 348 SER SER A . n 
E 3 349 ILE 349 349 349 ILE ILE A . n 
E 3 350 VAL 350 350 350 VAL VAL A . n 
E 3 351 GLU 351 351 351 GLU GLU A . n 
E 3 352 ALA 352 352 352 ALA ALA A . n 
E 3 353 LEU 353 353 353 LEU LEU A . n 
E 3 354 ASP 354 354 354 ASP ASP A . n 
E 3 355 ASN 355 355 355 ASN ASN A . n 
E 3 356 ALA 356 356 356 ALA ALA A . n 
E 3 357 PHE 357 357 357 PHE PHE A . n 
E 3 358 TYR 358 358 358 TYR TYR A . n 
E 3 359 LYS 359 359 359 LYS LYS A . n 
E 3 360 SER 360 360 360 SER SER A . n 
E 3 361 PHE 361 361 361 PHE PHE A . n 
E 3 362 LYS 362 362 362 LYS LYS A . n 
E 3 363 LEU 363 363 363 LEU LEU A . n 
E 3 364 VAL 364 364 364 VAL VAL A . n 
E 3 365 GLU 365 365 365 GLU GLU A . n 
E 3 366 PRO 366 366 366 PRO PRO A . n 
E 3 367 THR 367 367 367 THR THR A . n 
E 3 368 GLY 368 368 368 GLY GLY A . n 
E 3 369 LYS 369 369 369 LYS LYS A . n 
E 3 370 ARG 370 370 370 ARG ARG A . n 
E 3 371 PHE 371 371 371 PHE PHE A . n 
E 3 372 LEU 372 372 372 LEU LEU A . n 
E 3 373 LEU 373 373 373 LEU LEU A . n 
E 3 374 ALA 374 374 374 ALA ALA A . n 
E 3 375 ILE 375 375 375 ILE ILE A . n 
E 3 376 ASP 376 376 376 ASP ASP A . n 
E 3 377 VAL 377 377 377 VAL VAL A . n 
E 3 378 SER 378 378 378 SER SER A . n 
E 3 379 ALA 379 379 379 ALA ALA A . n 
E 3 380 SER 380 380 380 SER SER A . n 
E 3 381 MET 381 381 381 MET MET A . n 
E 3 382 ASN 382 382 382 ASN ASN A . n 
E 3 383 GLN 383 383 383 GLN GLN A . n 
E 3 384 ARG 384 384 384 ARG ARG A . n 
E 3 385 VAL 385 385 385 VAL VAL A . n 
E 3 386 LEU 386 386 386 LEU LEU A . n 
E 3 387 GLY 387 387 387 GLY GLY A . n 
E 3 388 SER 388 388 388 SER SER A . n 
E 3 389 ILE 389 389 389 ILE ILE A . n 
E 3 390 LEU 390 390 390 LEU LEU A . n 
E 3 391 ASN 391 391 391 ASN ASN A . n 
E 3 392 ALA 392 392 392 ALA ALA A . n 
E 3 393 SER 393 393 393 SER SER A . n 
E 3 394 VAL 394 394 394 VAL VAL A . n 
E 3 395 VAL 395 395 395 VAL VAL A . n 
E 3 396 ALA 396 396 396 ALA ALA A . n 
E 3 397 ALA 397 397 397 ALA ALA A . n 
E 3 398 ALA 398 398 398 ALA ALA A . n 
E 3 399 MET 399 399 399 MET MET A . n 
E 3 400 CYS 400 400 400 CYS CYS A . n 
E 3 401 MET 401 401 401 MET MET A . n 
E 3 402 LEU 402 402 402 LEU LEU A . n 
E 3 403 VAL 403 403 403 VAL VAL A . n 
E 3 404 ALA 404 404 404 ALA ALA A . n 
E 3 405 ARG 405 405 405 ARG ARG A . n 
E 3 406 THR 406 406 406 THR THR A . n 
E 3 407 GLU 407 407 407 GLU GLU A . n 
E 3 408 LYS 408 408 408 LYS LYS A . n 
E 3 409 ASP 409 409 409 ASP ASP A . n 
E 3 410 SER 410 410 410 SER SER A . n 
E 3 411 HIS 411 411 411 HIS HIS A . n 
E 3 412 MET 412 412 412 MET MET A . n 
E 3 413 VAL 413 413 413 VAL VAL A . n 
E 3 414 ALA 414 414 414 ALA ALA A . n 
E 3 415 PHE 415 415 415 PHE PHE A . n 
E 3 416 SER 416 416 416 SER SER A . n 
E 3 417 ASP 417 417 417 ASP ASP A . n 
E 3 418 GLU 418 418 418 GLU GLU A . n 
E 3 419 MET 419 419 419 MET MET A . n 
E 3 420 LEU 420 420 420 LEU LEU A . n 
E 3 421 PRO 421 421 421 PRO PRO A . n 
E 3 422 CYS 422 422 422 CYS CYS A . n 
E 3 423 PRO 423 423 423 PRO PRO A . n 
E 3 424 ILE 424 424 424 ILE ILE A . n 
E 3 425 THR 425 425 425 THR THR A . n 
E 3 426 VAL 426 426 426 VAL VAL A . n 
E 3 427 ASN 427 427 427 ASN ASN A . n 
E 3 428 MET 428 428 428 MET MET A . n 
E 3 429 LEU 429 429 429 LEU LEU A . n 
E 3 430 LEU 430 430 430 LEU LEU A . n 
E 3 431 HIS 431 431 431 HIS HIS A . n 
E 3 432 GLU 432 432 432 GLU GLU A . n 
E 3 433 VAL 433 433 433 VAL VAL A . n 
E 3 434 VAL 434 434 434 VAL VAL A . n 
E 3 435 GLU 435 435 435 GLU GLU A . n 
E 3 436 LYS 436 436 436 LYS LYS A . n 
E 3 437 MET 437 437 437 MET MET A . n 
E 3 438 SER 438 438 438 SER SER A . n 
E 3 439 ASP 439 439 439 ASP ASP A . n 
E 3 440 ILE 440 440 440 ILE ILE A . n 
E 3 441 THR 441 441 441 THR THR A . n 
E 3 442 MET 442 442 442 MET MET A . n 
E 3 443 GLY 443 443 443 GLY GLY A . n 
E 3 444 SER 444 444 444 SER SER A . n 
E 3 445 THR 445 445 445 THR THR A . n 
E 3 446 ASP 446 446 446 ASP ASP A . n 
E 3 447 CYS 447 447 447 CYS CYS A . n 
E 3 448 ALA 448 448 448 ALA ALA A . n 
E 3 449 LEU 449 449 449 LEU LEU A . n 
E 3 450 PRO 450 450 450 PRO PRO A . n 
E 3 451 MET 451 451 451 MET MET A . n 
E 3 452 LEU 452 452 452 LEU LEU A . n 
E 3 453 TRP 453 453 453 TRP TRP A . n 
E 3 454 ALA 454 454 454 ALA ALA A . n 
E 3 455 GLN 455 455 455 GLN GLN A . n 
E 3 456 LYS 456 456 456 LYS LYS A . n 
E 3 457 THR 457 457 457 THR THR A . n 
E 3 458 ASN 458 458 458 ASN ASN A . n 
E 3 459 THR 459 459 459 THR THR A . n 
E 3 460 ALA 460 460 460 ALA ALA A . n 
E 3 461 ALA 461 461 461 ALA ALA A . n 
E 3 462 ASP 462 462 462 ASP ASP A . n 
E 3 463 ILE 463 463 463 ILE ILE A . n 
E 3 464 PHE 464 464 464 PHE PHE A . n 
E 3 465 ILE 465 465 465 ILE ILE A . n 
E 3 466 VAL 466 466 466 VAL VAL A . n 
E 3 467 PHE 467 467 467 PHE PHE A . n 
E 3 468 THR 468 468 468 THR THR A . n 
E 3 469 ASP 469 469 469 ASP ASP A . n 
E 3 470 CYS 470 470 470 CYS CYS A . n 
E 3 471 GLU 471 471 471 GLU GLU A . n 
E 3 472 THR 472 472 472 THR THR A . n 
E 3 473 ASN 473 473 473 ASN ASN A . n 
E 3 474 VAL 474 474 474 VAL VAL A . n 
E 3 475 GLU 475 475 475 GLU GLU A . n 
E 3 476 ASP 476 476 476 ASP ASP A . n 
E 3 477 VAL 477 477 477 VAL VAL A . n 
E 3 478 HIS 478 478 478 HIS HIS A . n 
E 3 479 PRO 479 479 479 PRO PRO A . n 
E 3 480 ALA 480 480 480 ALA ALA A . n 
E 3 481 THR 481 481 481 THR THR A . n 
E 3 482 ALA 482 482 482 ALA ALA A . n 
E 3 483 LEU 483 483 483 LEU LEU A . n 
E 3 484 LYS 484 484 484 LYS LYS A . n 
E 3 485 GLN 485 485 485 GLN GLN A . n 
E 3 486 TYR 486 486 486 TYR TYR A . n 
E 3 487 ARG 487 487 487 ARG ARG A . n 
E 3 488 GLU 488 488 488 GLU GLU A . n 
E 3 489 LYS 489 489 489 LYS LYS A . n 
E 3 490 MET 490 490 490 MET MET A . n 
E 3 491 GLY 491 491 491 GLY GLY A . n 
E 3 492 ILE 492 492 492 ILE ILE A . n 
E 3 493 PRO 493 493 493 PRO PRO A . n 
E 3 494 ALA 494 494 494 ALA ALA A . n 
E 3 495 LYS 495 495 495 LYS LYS A . n 
E 3 496 LEU 496 496 496 LEU LEU A . n 
E 3 497 ILE 497 497 497 ILE ILE A . n 
E 3 498 VAL 498 498 498 VAL VAL A . n 
E 3 499 CYS 499 499 499 CYS CYS A . n 
E 3 500 ALA 500 500 500 ALA ALA A . n 
E 3 501 MET 501 501 501 MET MET A . n 
E 3 502 THR 502 502 502 THR THR A . n 
E 3 503 SER 503 503 503 SER SER A . n 
E 3 504 ASN 504 504 504 ASN ASN A . n 
E 3 505 GLY 505 505 505 GLY GLY A . n 
E 3 506 PHE 506 506 506 PHE PHE A . n 
E 3 507 SER 507 507 507 SER SER A . n 
E 3 508 ILE 508 508 508 ILE ILE A . n 
E 3 509 ALA 509 509 509 ALA ALA A . n 
E 3 510 ASP 510 510 510 ASP ASP A . n 
E 3 511 PRO 511 511 511 PRO PRO A . n 
E 3 512 ASP 512 512 512 ASP ASP A . n 
E 3 513 ASP 513 513 513 ASP ASP A . n 
E 3 514 ARG 514 514 514 ARG ARG A . n 
E 3 515 GLY 515 515 515 GLY GLY A . n 
E 3 516 MET 516 516 516 MET MET A . n 
E 3 517 LEU 517 517 517 LEU LEU A . n 
E 3 518 ASP 518 518 518 ASP ASP A . n 
E 3 519 ILE 519 519 519 ILE ILE A . n 
E 3 520 CYS 520 520 520 CYS CYS A . n 
E 3 521 GLY 521 521 521 GLY GLY A . n 
E 3 522 PHE 522 522 522 PHE PHE A . n 
E 3 523 ASP 523 523 523 ASP ASP A . n 
E 3 524 SER 524 524 524 SER SER A . n 
E 3 525 GLY 525 525 525 GLY GLY A . n 
E 3 526 ALA 526 526 526 ALA ALA A . n 
E 3 527 LEU 527 527 527 LEU LEU A . n 
E 3 528 ASP 528 528 528 ASP ASP A . n 
E 3 529 VAL 529 529 529 VAL VAL A . n 
E 3 530 ILE 530 530 530 ILE ILE A . n 
E 3 531 ARG 531 531 531 ARG ARG A . n 
E 3 532 ASN 532 532 532 ASN ASN A . n 
E 3 533 PHE 533 533 533 PHE PHE A . n 
E 3 534 THR 534 534 534 THR THR A . n 
E 3 535 LEU 535 535 535 LEU LEU A . n 
E 3 536 ASP 536 536 536 ASP ASP A . n 
E 3 537 LEU 537 537 537 LEU LEU A . n 
E 3 538 ILE 538 538 ?   ?   ?   A . n 
F 3 1   MET 1   1   ?   ?   ?   B . n 
F 3 2   GLU 2   2   ?   ?   ?   B . n 
F 3 3   ALA 3   3   ?   ?   ?   B . n 
F 3 4   THR 4   4   ?   ?   ?   B . n 
F 3 5   MET 5   5   5   MET MET B . n 
F 3 6   ASP 6   6   6   ASP ASP B . n 
F 3 7   GLN 7   7   7   GLN GLN B . n 
F 3 8   THR 8   8   8   THR THR B . n 
F 3 9   GLN 9   9   9   GLN GLN B . n 
F 3 10  PRO 10  10  10  PRO PRO B . n 
F 3 11  LEU 11  11  11  LEU LEU B . n 
F 3 12  ASN 12  12  12  ASN ASN B . n 
F 3 13  GLU 13  13  13  GLU GLU B . n 
F 3 14  LYS 14  14  14  LYS LYS B . n 
F 3 15  GLN 15  15  15  GLN GLN B . n 
F 3 16  VAL 16  16  16  VAL VAL B . n 
F 3 17  PRO 17  17  17  PRO PRO B . n 
F 3 18  ASN 18  18  18  ASN ASN B . n 
F 3 19  SER 19  19  19  SER SER B . n 
F 3 20  GLU 20  20  20  GLU GLU B . n 
F 3 21  GLY 21  21  21  GLY GLY B . n 
F 3 22  CYS 22  22  22  CYS CYS B . n 
F 3 23  TYR 23  23  23  TYR TYR B . n 
F 3 24  VAL 24  24  24  VAL VAL B . n 
F 3 25  TRP 25  25  25  TRP TRP B . n 
F 3 26  GLN 26  26  26  GLN GLN B . n 
F 3 27  VAL 27  27  27  VAL VAL B . n 
F 3 28  SER 28  28  28  SER SER B . n 
F 3 29  ASP 29  29  29  ASP ASP B . n 
F 3 30  MET 30  30  30  MET MET B . n 
F 3 31  ASN 31  31  31  ASN ASN B . n 
F 3 32  ARG 32  32  32  ARG ARG B . n 
F 3 33  LEU 33  33  33  LEU LEU B . n 
F 3 34  ARG 34  34  34  ARG ARG B . n 
F 3 35  ARG 35  35  35  ARG ARG B . n 
F 3 36  PHE 36  36  36  PHE PHE B . n 
F 3 37  LEU 37  37  37  LEU LEU B . n 
F 3 38  CYS 38  38  38  CYS CYS B . n 
F 3 39  PHE 39  39  39  PHE PHE B . n 
F 3 40  GLY 40  40  40  GLY GLY B . n 
F 3 41  SER 41  41  41  SER SER B . n 
F 3 42  GLU 42  42  42  GLU GLU B . n 
F 3 43  GLY 43  43  43  GLY GLY B . n 
F 3 44  GLY 44  44  44  GLY GLY B . n 
F 3 45  THR 45  45  45  THR THR B . n 
F 3 46  TYR 46  46  46  TYR TYR B . n 
F 3 47  TYR 47  47  47  TYR TYR B . n 
F 3 48  ILE 48  48  48  ILE ILE B . n 
F 3 49  GLU 49  49  49  GLU GLU B . n 
F 3 50  GLU 50  50  50  GLU GLU B . n 
F 3 51  LYS 51  51  51  LYS LYS B . n 
F 3 52  LYS 52  52  52  LYS LYS B . n 
F 3 53  LEU 53  53  53  LEU LEU B . n 
F 3 54  GLY 54  54  54  GLY GLY B . n 
F 3 55  GLN 55  55  55  GLN GLN B . n 
F 3 56  GLU 56  56  56  GLU GLU B . n 
F 3 57  ASN 57  57  57  ASN ASN B . n 
F 3 58  ALA 58  58  58  ALA ALA B . n 
F 3 59  GLU 59  59  59  GLU GLU B . n 
F 3 60  ALA 60  60  60  ALA ALA B . n 
F 3 61  LEU 61  61  61  LEU LEU B . n 
F 3 62  LEU 62  62  62  LEU LEU B . n 
F 3 63  ARG 63  63  63  ARG ARG B . n 
F 3 64  LEU 64  64  64  LEU LEU B . n 
F 3 65  ILE 65  65  65  ILE ILE B . n 
F 3 66  GLU 66  66  66  GLU GLU B . n 
F 3 67  ASP 67  67  67  ASP ASP B . n 
F 3 68  GLY 68  68  68  GLY GLY B . n 
F 3 69  LYS 69  69  69  LYS LYS B . n 
F 3 70  GLY 70  70  70  GLY GLY B . n 
F 3 71  CYS 71  71  71  CYS CYS B . n 
F 3 72  GLU 72  72  72  GLU GLU B . n 
F 3 73  VAL 73  73  73  VAL VAL B . n 
F 3 74  VAL 74  74  74  VAL VAL B . n 
F 3 75  GLN 75  75  75  GLN GLN B . n 
F 3 76  GLU 76  76  76  GLU GLU B . n 
F 3 77  ILE 77  77  77  ILE ILE B . n 
F 3 78  LYS 78  78  78  LYS LYS B . n 
F 3 79  THR 79  79  79  THR THR B . n 
F 3 80  PHE 80  80  80  PHE PHE B . n 
F 3 81  SER 81  81  81  SER SER B . n 
F 3 82  GLN 82  82  82  GLN GLN B . n 
F 3 83  GLU 83  83  83  GLU GLU B . n 
F 3 84  GLY 84  84  84  GLY GLY B . n 
F 3 85  ARG 85  85  85  ARG ARG B . n 
F 3 86  ALA 86  86  86  ALA ALA B . n 
F 3 87  ALA 87  87  87  ALA ALA B . n 
F 3 88  LYS 88  88  88  LYS LYS B . n 
F 3 89  GLN 89  89  89  GLN GLN B . n 
F 3 90  GLU 90  90  90  GLU GLU B . n 
F 3 91  PRO 91  91  91  PRO PRO B . n 
F 3 92  THR 92  92  92  THR THR B . n 
F 3 93  LEU 93  93  93  LEU LEU B . n 
F 3 94  PHE 94  94  94  PHE PHE B . n 
F 3 95  ALA 95  95  95  ALA ALA B . n 
F 3 96  LEU 96  96  96  LEU LEU B . n 
F 3 97  ALA 97  97  97  ALA ALA B . n 
F 3 98  VAL 98  98  98  VAL VAL B . n 
F 3 99  CYS 99  99  99  CYS CYS B . n 
F 3 100 SER 100 100 100 SER SER B . n 
F 3 101 GLN 101 101 101 GLN GLN B . n 
F 3 102 CYS 102 102 102 CYS CYS B . n 
F 3 103 SER 103 103 103 SER SER B . n 
F 3 104 ASP 104 104 104 ASP ASP B . n 
F 3 105 ILE 105 105 105 ILE ILE B . n 
F 3 106 LYS 106 106 106 LYS LYS B . n 
F 3 107 THR 107 107 107 THR THR B . n 
F 3 108 LYS 108 108 108 LYS LYS B . n 
F 3 109 GLN 109 109 109 GLN GLN B . n 
F 3 110 ALA 110 110 110 ALA ALA B . n 
F 3 111 ALA 111 111 111 ALA ALA B . n 
F 3 112 PHE 112 112 112 PHE PHE B . n 
F 3 113 ARG 113 113 113 ARG ARG B . n 
F 3 114 ALA 114 114 114 ALA ALA B . n 
F 3 115 VAL 115 115 115 VAL VAL B . n 
F 3 116 PRO 116 116 116 PRO PRO B . n 
F 3 117 GLU 117 117 117 GLU GLU B . n 
F 3 118 VAL 118 118 118 VAL VAL B . n 
F 3 119 CYS 119 119 119 CYS CYS B . n 
F 3 120 ARG 120 120 120 ARG ARG B . n 
F 3 121 ILE 121 121 121 ILE ILE B . n 
F 3 122 PRO 122 122 122 PRO PRO B . n 
F 3 123 THR 123 123 123 THR THR B . n 
F 3 124 HIS 124 124 124 HIS HIS B . n 
F 3 125 LEU 125 125 125 LEU LEU B . n 
F 3 126 PHE 126 126 126 PHE PHE B . n 
F 3 127 THR 127 127 127 THR THR B . n 
F 3 128 PHE 128 128 128 PHE PHE B . n 
F 3 129 ILE 129 129 129 ILE ILE B . n 
F 3 130 GLN 130 130 130 GLN GLN B . n 
F 3 131 PHE 131 131 131 PHE PHE B . n 
F 3 132 LYS 132 132 132 LYS LYS B . n 
F 3 133 LYS 133 133 133 LYS LYS B . n 
F 3 134 ASP 134 134 134 ASP ASP B . n 
F 3 135 LEU 135 135 135 LEU LEU B . n 
F 3 136 LYS 136 136 136 LYS LYS B . n 
F 3 137 GLU 137 137 ?   ?   ?   B . n 
F 3 138 GLY 138 138 ?   ?   ?   B . n 
F 3 139 MET 139 139 ?   ?   ?   B . n 
F 3 140 LYS 140 140 ?   ?   ?   B . n 
F 3 141 CYS 141 141 ?   ?   ?   B . n 
F 3 142 GLY 142 142 ?   ?   ?   B . n 
F 3 143 MET 143 143 ?   ?   ?   B . n 
F 3 144 TRP 144 144 144 TRP TRP B . n 
F 3 145 GLY 145 145 145 GLY GLY B . n 
F 3 146 ARG 146 146 146 ARG ARG B . n 
F 3 147 ALA 147 147 147 ALA ALA B . n 
F 3 148 LEU 148 148 148 LEU LEU B . n 
F 3 149 ARG 149 149 149 ARG ARG B . n 
F 3 150 LYS 150 150 150 LYS LYS B . n 
F 3 151 ALA 151 151 151 ALA ALA B . n 
F 3 152 VAL 152 152 152 VAL VAL B . n 
F 3 153 SER 153 153 153 SER SER B . n 
F 3 154 ASP 154 154 154 ASP ASP B . n 
F 3 155 TRP 155 155 155 TRP TRP B . n 
F 3 156 TYR 156 156 156 TYR TYR B . n 
F 3 157 ASN 157 157 157 ASN ASN B . n 
F 3 158 THR 158 158 158 THR THR B . n 
F 3 159 LYS 159 159 159 LYS LYS B . n 
F 3 160 ASP 160 160 160 ASP ASP B . n 
F 3 161 ALA 161 161 161 ALA ALA B . n 
F 3 162 LEU 162 162 162 LEU LEU B . n 
F 3 163 ASN 163 163 163 ASN ASN B . n 
F 3 164 LEU 164 164 164 LEU LEU B . n 
F 3 165 ALA 165 165 165 ALA ALA B . n 
F 3 166 MET 166 166 166 MET MET B . n 
F 3 167 ALA 167 167 167 ALA ALA B . n 
F 3 168 VAL 168 168 168 VAL VAL B . n 
F 3 169 THR 169 169 169 THR THR B . n 
F 3 170 LYS 170 170 170 LYS LYS B . n 
F 3 171 TYR 171 171 171 TYR TYR B . n 
F 3 172 LYS 172 172 172 LYS LYS B . n 
F 3 173 GLN 173 173 173 GLN GLN B . n 
F 3 174 ARG 174 174 174 ARG ARG B . n 
F 3 175 ASN 175 175 175 ASN ASN B . n 
F 3 176 GLY 176 176 176 GLY GLY B . n 
F 3 177 TRP 177 177 177 TRP TRP B . n 
F 3 178 SER 178 178 178 SER SER B . n 
F 3 179 HIS 179 179 179 HIS HIS B . n 
F 3 180 LYS 180 180 180 LYS LYS B . n 
F 3 181 ASP 181 181 181 ASP ASP B . n 
F 3 182 LEU 182 182 182 LEU LEU B . n 
F 3 183 LEU 183 183 183 LEU LEU B . n 
F 3 184 ARG 184 184 184 ARG ARG B . n 
F 3 185 LEU 185 185 185 LEU LEU B . n 
F 3 186 SER 186 186 186 SER SER B . n 
F 3 187 HIS 187 187 187 HIS HIS B . n 
F 3 188 ILE 188 188 188 ILE ILE B . n 
F 3 189 LYS 189 189 189 LYS LYS B . n 
F 3 190 PRO 190 190 190 PRO PRO B . n 
F 3 191 ALA 191 191 191 ALA ALA B . n 
F 3 192 ASN 192 192 192 ASN ASN B . n 
F 3 193 GLU 193 193 193 GLU GLU B . n 
F 3 194 GLY 194 194 194 GLY GLY B . n 
F 3 195 LEU 195 195 195 LEU LEU B . n 
F 3 196 THR 196 196 196 THR THR B . n 
F 3 197 MET 197 197 197 MET MET B . n 
F 3 198 VAL 198 198 198 VAL VAL B . n 
F 3 199 ALA 199 199 199 ALA ALA B . n 
F 3 200 LYS 200 200 200 LYS LYS B . n 
F 3 201 TYR 201 201 201 TYR TYR B . n 
F 3 202 VAL 202 202 202 VAL VAL B . n 
F 3 203 SER 203 203 203 SER SER B . n 
F 3 204 LYS 204 204 204 LYS LYS B . n 
F 3 205 GLY 205 205 205 GLY GLY B . n 
F 3 206 TRP 206 206 206 TRP TRP B . n 
F 3 207 LYS 207 207 207 LYS LYS B . n 
F 3 208 GLU 208 208 208 GLU GLU B . n 
F 3 209 VAL 209 209 209 VAL VAL B . n 
F 3 210 GLN 210 210 210 GLN GLN B . n 
F 3 211 GLU 211 211 211 GLU GLU B . n 
F 3 212 ALA 212 212 212 ALA ALA B . n 
F 3 213 TYR 213 213 213 TYR TYR B . n 
F 3 214 LYS 214 214 214 LYS LYS B . n 
F 3 215 GLU 215 215 215 GLU GLU B . n 
F 3 216 LYS 216 216 216 LYS LYS B . n 
F 3 217 GLU 217 217 217 GLU GLU B . n 
F 3 218 LEU 218 218 218 LEU LEU B . n 
F 3 219 SER 219 219 219 SER SER B . n 
F 3 220 PRO 220 220 220 PRO PRO B . n 
F 3 221 GLU 221 221 221 GLU GLU B . n 
F 3 222 THR 222 222 222 THR THR B . n 
F 3 223 GLU 223 223 223 GLU GLU B . n 
F 3 224 LYS 224 224 224 LYS LYS B . n 
F 3 225 VAL 225 225 225 VAL VAL B . n 
F 3 226 LEU 226 226 226 LEU LEU B . n 
F 3 227 LYS 227 227 227 LYS LYS B . n 
F 3 228 TYR 228 228 228 TYR TYR B . n 
F 3 229 LEU 229 229 229 LEU LEU B . n 
F 3 230 GLU 230 230 230 GLU GLU B . n 
F 3 231 ALA 231 231 231 ALA ALA B . n 
F 3 232 THR 232 232 232 THR THR B . n 
F 3 233 GLU 233 233 233 GLU GLU B . n 
F 3 234 ARG 234 234 234 ARG ARG B . n 
F 3 235 VAL 235 235 235 VAL VAL B . n 
F 3 236 LYS 236 236 236 LYS LYS B . n 
F 3 237 ARG 237 237 237 ARG ARG B . n 
F 3 238 THR 238 238 238 THR THR B . n 
F 3 239 LYS 239 239 239 LYS LYS B . n 
F 3 240 ASP 240 240 240 ASP ASP B . n 
F 3 241 GLU 241 241 241 GLU GLU B . n 
F 3 242 LEU 242 242 242 LEU LEU B . n 
F 3 243 GLU 243 243 243 GLU GLU B . n 
F 3 244 ILE 244 244 244 ILE ILE B . n 
F 3 245 ILE 245 245 245 ILE ILE B . n 
F 3 246 HIS 246 246 246 HIS HIS B . n 
F 3 247 LEU 247 247 247 LEU LEU B . n 
F 3 248 ILE 248 248 248 ILE ILE B . n 
F 3 249 ASP 249 249 249 ASP ASP B . n 
F 3 250 GLU 250 250 250 GLU GLU B . n 
F 3 251 TYR 251 251 251 TYR TYR B . n 
F 3 252 ARG 252 252 252 ARG ARG B . n 
F 3 253 LEU 253 253 253 LEU LEU B . n 
F 3 254 VAL 254 254 254 VAL VAL B . n 
F 3 255 ARG 255 255 255 ARG ARG B . n 
F 3 256 GLU 256 256 256 GLU GLU B . n 
F 3 257 HIS 257 257 257 HIS HIS B . n 
F 3 258 LEU 258 258 258 LEU LEU B . n 
F 3 259 LEU 259 259 259 LEU LEU B . n 
F 3 260 THR 260 260 260 THR THR B . n 
F 3 261 ILE 261 261 261 ILE ILE B . n 
F 3 262 HIS 262 262 262 HIS HIS B . n 
F 3 263 LEU 263 263 263 LEU LEU B . n 
F 3 264 LYS 264 264 264 LYS LYS B . n 
F 3 265 SER 265 265 265 SER SER B . n 
F 3 266 LYS 266 266 266 LYS LYS B . n 
F 3 267 GLU 267 267 267 GLU GLU B . n 
F 3 268 ILE 268 268 268 ILE ILE B . n 
F 3 269 TRP 269 269 269 TRP TRP B . n 
F 3 270 LYS 270 270 270 LYS LYS B . n 
F 3 271 SER 271 271 271 SER SER B . n 
F 3 272 LEU 272 272 272 LEU LEU B . n 
F 3 273 LEU 273 273 273 LEU LEU B . n 
F 3 274 GLN 274 274 274 GLN GLN B . n 
F 3 275 ASP 275 275 275 ASP ASP B . n 
F 3 276 MET 276 276 276 MET MET B . n 
F 3 277 PRO 277 277 277 PRO PRO B . n 
F 3 278 LEU 278 278 278 LEU LEU B . n 
F 3 279 THR 279 279 279 THR THR B . n 
F 3 280 ALA 280 280 280 ALA ALA B . n 
F 3 281 LEU 281 281 281 LEU LEU B . n 
F 3 282 LEU 282 282 282 LEU LEU B . n 
F 3 283 ARG 283 283 283 ARG ARG B . n 
F 3 284 ASN 284 284 284 ASN ASN B . n 
F 3 285 LEU 285 285 285 LEU LEU B . n 
F 3 286 GLY 286 286 286 GLY GLY B . n 
F 3 287 LYS 287 287 287 LYS LYS B . n 
F 3 288 MET 288 288 288 MET MET B . n 
F 3 289 THR 289 289 289 THR THR B . n 
F 3 290 ALA 290 290 290 ALA ALA B . n 
F 3 291 ASP 291 291 291 ASP ASP B . n 
F 3 292 SER 292 292 292 SER SER B . n 
F 3 293 VAL 293 293 293 VAL VAL B . n 
F 3 294 LEU 294 294 294 LEU LEU B . n 
F 3 295 ALA 295 295 295 ALA ALA B . n 
F 3 296 PRO 296 296 296 PRO PRO B . n 
F 3 297 ALA 297 297 297 ALA ALA B . n 
F 3 298 SER 298 298 298 SER SER B . n 
F 3 299 SER 299 299 299 SER SER B . n 
F 3 300 GLU 300 300 300 GLU GLU B . n 
F 3 301 VAL 301 301 301 VAL VAL B . n 
F 3 302 SER 302 302 302 SER SER B . n 
F 3 303 SER 303 303 303 SER SER B . n 
F 3 304 VAL 304 304 304 VAL VAL B . n 
F 3 305 CYS 305 305 305 CYS CYS B . n 
F 3 306 GLU 306 306 306 GLU GLU B . n 
F 3 307 ARG 307 307 307 ARG ARG B . n 
F 3 308 LEU 308 308 308 LEU LEU B . n 
F 3 309 THR 309 309 309 THR THR B . n 
F 3 310 ASN 310 310 310 ASN ASN B . n 
F 3 311 GLU 311 311 311 GLU GLU B . n 
F 3 312 LYS 312 312 312 LYS LYS B . n 
F 3 313 LEU 313 313 313 LEU LEU B . n 
F 3 314 LEU 314 314 314 LEU LEU B . n 
F 3 315 LYS 315 315 315 LYS LYS B . n 
F 3 316 LYS 316 316 316 LYS LYS B . n 
F 3 317 ALA 317 317 317 ALA ALA B . n 
F 3 318 ARG 318 318 318 ARG ARG B . n 
F 3 319 ILE 319 319 319 ILE ILE B . n 
F 3 320 HIS 320 320 320 HIS HIS B . n 
F 3 321 PRO 321 321 321 PRO PRO B . n 
F 3 322 PHE 322 322 322 PHE PHE B . n 
F 3 323 HIS 323 323 323 HIS HIS B . n 
F 3 324 ILE 324 324 324 ILE ILE B . n 
F 3 325 LEU 325 325 325 LEU LEU B . n 
F 3 326 VAL 326 326 326 VAL VAL B . n 
F 3 327 ALA 327 327 327 ALA ALA B . n 
F 3 328 LEU 328 328 328 LEU LEU B . n 
F 3 329 GLU 329 329 329 GLU GLU B . n 
F 3 330 THR 330 330 330 THR THR B . n 
F 3 331 TYR 331 331 331 TYR TYR B . n 
F 3 332 LYS 332 332 332 LYS LYS B . n 
F 3 333 LYS 333 333 333 LYS LYS B . n 
F 3 334 GLY 334 334 334 GLY GLY B . n 
F 3 335 HIS 335 335 335 HIS HIS B . n 
F 3 336 GLY 336 336 336 GLY GLY B . n 
F 3 337 ASN 337 337 337 ASN ASN B . n 
F 3 338 ARG 338 338 338 ARG ARG B . n 
F 3 339 GLY 339 339 339 GLY GLY B . n 
F 3 340 LYS 340 340 340 LYS LYS B . n 
F 3 341 LEU 341 341 341 LEU LEU B . n 
F 3 342 ARG 342 342 342 ARG ARG B . n 
F 3 343 TRP 343 343 343 TRP TRP B . n 
F 3 344 ILE 344 344 344 ILE ILE B . n 
F 3 345 PRO 345 345 345 PRO PRO B . n 
F 3 346 ASP 346 346 346 ASP ASP B . n 
F 3 347 THR 347 347 347 THR THR B . n 
F 3 348 SER 348 348 348 SER SER B . n 
F 3 349 ILE 349 349 349 ILE ILE B . n 
F 3 350 VAL 350 350 350 VAL VAL B . n 
F 3 351 GLU 351 351 351 GLU GLU B . n 
F 3 352 ALA 352 352 352 ALA ALA B . n 
F 3 353 LEU 353 353 353 LEU LEU B . n 
F 3 354 ASP 354 354 354 ASP ASP B . n 
F 3 355 ASN 355 355 355 ASN ASN B . n 
F 3 356 ALA 356 356 356 ALA ALA B . n 
F 3 357 PHE 357 357 357 PHE PHE B . n 
F 3 358 TYR 358 358 358 TYR TYR B . n 
F 3 359 LYS 359 359 359 LYS LYS B . n 
F 3 360 SER 360 360 360 SER SER B . n 
F 3 361 PHE 361 361 361 PHE PHE B . n 
F 3 362 LYS 362 362 362 LYS LYS B . n 
F 3 363 LEU 363 363 363 LEU LEU B . n 
F 3 364 VAL 364 364 364 VAL VAL B . n 
F 3 365 GLU 365 365 365 GLU GLU B . n 
F 3 366 PRO 366 366 366 PRO PRO B . n 
F 3 367 THR 367 367 367 THR THR B . n 
F 3 368 GLY 368 368 368 GLY GLY B . n 
F 3 369 LYS 369 369 369 LYS LYS B . n 
F 3 370 ARG 370 370 370 ARG ARG B . n 
F 3 371 PHE 371 371 371 PHE PHE B . n 
F 3 372 LEU 372 372 372 LEU LEU B . n 
F 3 373 LEU 373 373 373 LEU LEU B . n 
F 3 374 ALA 374 374 374 ALA ALA B . n 
F 3 375 ILE 375 375 375 ILE ILE B . n 
F 3 376 ASP 376 376 376 ASP ASP B . n 
F 3 377 VAL 377 377 377 VAL VAL B . n 
F 3 378 SER 378 378 378 SER SER B . n 
F 3 379 ALA 379 379 379 ALA ALA B . n 
F 3 380 SER 380 380 380 SER SER B . n 
F 3 381 MET 381 381 381 MET MET B . n 
F 3 382 ASN 382 382 382 ASN ASN B . n 
F 3 383 GLN 383 383 383 GLN GLN B . n 
F 3 384 ARG 384 384 384 ARG ARG B . n 
F 3 385 VAL 385 385 385 VAL VAL B . n 
F 3 386 LEU 386 386 386 LEU LEU B . n 
F 3 387 GLY 387 387 387 GLY GLY B . n 
F 3 388 SER 388 388 388 SER SER B . n 
F 3 389 ILE 389 389 389 ILE ILE B . n 
F 3 390 LEU 390 390 390 LEU LEU B . n 
F 3 391 ASN 391 391 391 ASN ASN B . n 
F 3 392 ALA 392 392 392 ALA ALA B . n 
F 3 393 SER 393 393 393 SER SER B . n 
F 3 394 VAL 394 394 394 VAL VAL B . n 
F 3 395 VAL 395 395 395 VAL VAL B . n 
F 3 396 ALA 396 396 396 ALA ALA B . n 
F 3 397 ALA 397 397 397 ALA ALA B . n 
F 3 398 ALA 398 398 398 ALA ALA B . n 
F 3 399 MET 399 399 399 MET MET B . n 
F 3 400 CYS 400 400 400 CYS CYS B . n 
F 3 401 MET 401 401 401 MET MET B . n 
F 3 402 LEU 402 402 402 LEU LEU B . n 
F 3 403 VAL 403 403 403 VAL VAL B . n 
F 3 404 ALA 404 404 404 ALA ALA B . n 
F 3 405 ARG 405 405 405 ARG ARG B . n 
F 3 406 THR 406 406 406 THR THR B . n 
F 3 407 GLU 407 407 407 GLU GLU B . n 
F 3 408 LYS 408 408 408 LYS LYS B . n 
F 3 409 ASP 409 409 409 ASP ASP B . n 
F 3 410 SER 410 410 410 SER SER B . n 
F 3 411 HIS 411 411 411 HIS HIS B . n 
F 3 412 MET 412 412 412 MET MET B . n 
F 3 413 VAL 413 413 413 VAL VAL B . n 
F 3 414 ALA 414 414 414 ALA ALA B . n 
F 3 415 PHE 415 415 415 PHE PHE B . n 
F 3 416 SER 416 416 416 SER SER B . n 
F 3 417 ASP 417 417 417 ASP ASP B . n 
F 3 418 GLU 418 418 418 GLU GLU B . n 
F 3 419 MET 419 419 419 MET MET B . n 
F 3 420 LEU 420 420 420 LEU LEU B . n 
F 3 421 PRO 421 421 421 PRO PRO B . n 
F 3 422 CYS 422 422 422 CYS CYS B . n 
F 3 423 PRO 423 423 423 PRO PRO B . n 
F 3 424 ILE 424 424 424 ILE ILE B . n 
F 3 425 THR 425 425 425 THR THR B . n 
F 3 426 VAL 426 426 426 VAL VAL B . n 
F 3 427 ASN 427 427 427 ASN ASN B . n 
F 3 428 MET 428 428 428 MET MET B . n 
F 3 429 LEU 429 429 429 LEU LEU B . n 
F 3 430 LEU 430 430 430 LEU LEU B . n 
F 3 431 HIS 431 431 431 HIS HIS B . n 
F 3 432 GLU 432 432 432 GLU GLU B . n 
F 3 433 VAL 433 433 433 VAL VAL B . n 
F 3 434 VAL 434 434 434 VAL VAL B . n 
F 3 435 GLU 435 435 435 GLU GLU B . n 
F 3 436 LYS 436 436 436 LYS LYS B . n 
F 3 437 MET 437 437 437 MET MET B . n 
F 3 438 SER 438 438 438 SER SER B . n 
F 3 439 ASP 439 439 439 ASP ASP B . n 
F 3 440 ILE 440 440 440 ILE ILE B . n 
F 3 441 THR 441 441 441 THR THR B . n 
F 3 442 MET 442 442 442 MET MET B . n 
F 3 443 GLY 443 443 443 GLY GLY B . n 
F 3 444 SER 444 444 444 SER SER B . n 
F 3 445 THR 445 445 445 THR THR B . n 
F 3 446 ASP 446 446 446 ASP ASP B . n 
F 3 447 CYS 447 447 447 CYS CYS B . n 
F 3 448 ALA 448 448 448 ALA ALA B . n 
F 3 449 LEU 449 449 449 LEU LEU B . n 
F 3 450 PRO 450 450 450 PRO PRO B . n 
F 3 451 MET 451 451 451 MET MET B . n 
F 3 452 LEU 452 452 452 LEU LEU B . n 
F 3 453 TRP 453 453 453 TRP TRP B . n 
F 3 454 ALA 454 454 454 ALA ALA B . n 
F 3 455 GLN 455 455 455 GLN GLN B . n 
F 3 456 LYS 456 456 456 LYS LYS B . n 
F 3 457 THR 457 457 457 THR THR B . n 
F 3 458 ASN 458 458 458 ASN ASN B . n 
F 3 459 THR 459 459 459 THR THR B . n 
F 3 460 ALA 460 460 460 ALA ALA B . n 
F 3 461 ALA 461 461 461 ALA ALA B . n 
F 3 462 ASP 462 462 462 ASP ASP B . n 
F 3 463 ILE 463 463 463 ILE ILE B . n 
F 3 464 PHE 464 464 464 PHE PHE B . n 
F 3 465 ILE 465 465 465 ILE ILE B . n 
F 3 466 VAL 466 466 466 VAL VAL B . n 
F 3 467 PHE 467 467 467 PHE PHE B . n 
F 3 468 THR 468 468 468 THR THR B . n 
F 3 469 ASP 469 469 469 ASP ASP B . n 
F 3 470 CYS 470 470 470 CYS CYS B . n 
F 3 471 GLU 471 471 471 GLU GLU B . n 
F 3 472 THR 472 472 472 THR THR B . n 
F 3 473 ASN 473 473 473 ASN ASN B . n 
F 3 474 VAL 474 474 474 VAL VAL B . n 
F 3 475 GLU 475 475 475 GLU GLU B . n 
F 3 476 ASP 476 476 476 ASP ASP B . n 
F 3 477 VAL 477 477 477 VAL VAL B . n 
F 3 478 HIS 478 478 478 HIS HIS B . n 
F 3 479 PRO 479 479 479 PRO PRO B . n 
F 3 480 ALA 480 480 480 ALA ALA B . n 
F 3 481 THR 481 481 481 THR THR B . n 
F 3 482 ALA 482 482 482 ALA ALA B . n 
F 3 483 LEU 483 483 483 LEU LEU B . n 
F 3 484 LYS 484 484 484 LYS LYS B . n 
F 3 485 GLN 485 485 485 GLN GLN B . n 
F 3 486 TYR 486 486 486 TYR TYR B . n 
F 3 487 ARG 487 487 487 ARG ARG B . n 
F 3 488 GLU 488 488 488 GLU GLU B . n 
F 3 489 LYS 489 489 489 LYS LYS B . n 
F 3 490 MET 490 490 490 MET MET B . n 
F 3 491 GLY 491 491 491 GLY GLY B . n 
F 3 492 ILE 492 492 492 ILE ILE B . n 
F 3 493 PRO 493 493 493 PRO PRO B . n 
F 3 494 ALA 494 494 494 ALA ALA B . n 
F 3 495 LYS 495 495 495 LYS LYS B . n 
F 3 496 LEU 496 496 496 LEU LEU B . n 
F 3 497 ILE 497 497 497 ILE ILE B . n 
F 3 498 VAL 498 498 498 VAL VAL B . n 
F 3 499 CYS 499 499 499 CYS CYS B . n 
F 3 500 ALA 500 500 500 ALA ALA B . n 
F 3 501 MET 501 501 501 MET MET B . n 
F 3 502 THR 502 502 502 THR THR B . n 
F 3 503 SER 503 503 503 SER SER B . n 
F 3 504 ASN 504 504 504 ASN ASN B . n 
F 3 505 GLY 505 505 505 GLY GLY B . n 
F 3 506 PHE 506 506 506 PHE PHE B . n 
F 3 507 SER 507 507 507 SER SER B . n 
F 3 508 ILE 508 508 508 ILE ILE B . n 
F 3 509 ALA 509 509 509 ALA ALA B . n 
F 3 510 ASP 510 510 510 ASP ASP B . n 
F 3 511 PRO 511 511 511 PRO PRO B . n 
F 3 512 ASP 512 512 512 ASP ASP B . n 
F 3 513 ASP 513 513 513 ASP ASP B . n 
F 3 514 ARG 514 514 514 ARG ARG B . n 
F 3 515 GLY 515 515 515 GLY GLY B . n 
F 3 516 MET 516 516 516 MET MET B . n 
F 3 517 LEU 517 517 517 LEU LEU B . n 
F 3 518 ASP 518 518 518 ASP ASP B . n 
F 3 519 ILE 519 519 519 ILE ILE B . n 
F 3 520 CYS 520 520 520 CYS CYS B . n 
F 3 521 GLY 521 521 521 GLY GLY B . n 
F 3 522 PHE 522 522 522 PHE PHE B . n 
F 3 523 ASP 523 523 523 ASP ASP B . n 
F 3 524 SER 524 524 524 SER SER B . n 
F 3 525 GLY 525 525 525 GLY GLY B . n 
F 3 526 ALA 526 526 526 ALA ALA B . n 
F 3 527 LEU 527 527 527 LEU LEU B . n 
F 3 528 ASP 528 528 528 ASP ASP B . n 
F 3 529 VAL 529 529 529 VAL VAL B . n 
F 3 530 ILE 530 530 530 ILE ILE B . n 
F 3 531 ARG 531 531 531 ARG ARG B . n 
F 3 532 ASN 532 532 532 ASN ASN B . n 
F 3 533 PHE 533 533 533 PHE PHE B . n 
F 3 534 THR 534 534 534 THR THR B . n 
F 3 535 LEU 535 535 535 LEU LEU B . n 
F 3 536 ASP 536 536 536 ASP ASP B . n 
F 3 537 LEU 537 537 537 LEU LEU B . n 
F 3 538 ILE 538 538 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,K,L,O 
2 1 C,D,F,I,J,M,N,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG  ? E SER 380 ? A SER 380 ? 1_555 87.3  ? 
2  OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? G ACT .   ? A ACT 601 ? 1_555 47.7  ? 
3  OG  ? E SER 380 ? A SER 380 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? G ACT .   ? A ACT 601 ? 1_555 115.6 ? 
4  OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 915 ? 1_555 106.8 ? 
5  OG  ? E SER 380 ? A SER 380 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 915 ? 1_555 81.7  ? 
6  O   ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 915 ? 1_555 74.0  ? 
7  OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG  ? E SER 378 ? A SER 378 ? 1_555 103.0 ? 
8  OG  ? E SER 380 ? A SER 380 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG  ? E SER 378 ? A SER 378 ? 1_555 107.0 ? 
9  O   ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG  ? E SER 378 ? A SER 378 ? 1_555 123.9 ? 
10 O   ? O HOH .   ? A HOH 915 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG  ? E SER 378 ? A SER 378 ? 1_555 149.3 ? 
11 OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG1 ? E THR 445 ? A THR 445 ? 1_555 115.2 ? 
12 OG  ? E SER 380 ? A SER 380 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG1 ? E THR 445 ? A THR 445 ? 1_555 148.7 ? 
13 O   ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG1 ? E THR 445 ? A THR 445 ? 1_555 72.5  ? 
14 O   ? O HOH .   ? A HOH 915 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG1 ? E THR 445 ? A THR 445 ? 1_555 71.5  ? 
15 OG  ? E SER 378 ? A SER 378 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 OG1 ? E THR 445 ? A THR 445 ? 1_555 89.4  ? 
16 OXT ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 156.6 ? 
17 OG  ? E SER 380 ? A SER 380 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 69.5  ? 
18 O   ? G ACT .   ? A ACT 601 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 140.2 ? 
19 O   ? O HOH .   ? A HOH 915 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 67.6  ? 
20 OG  ? E SER 378 ? A SER 378 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 87.5  ? 
21 OG1 ? E THR 445 ? A THR 445 ? 1_555 MG ? H MG . ? A MG 701 ? 1_555 O   ? O HOH .   ? A HOH 702 ? 1_555 85.3  ? 
22 OXT ? I ACT .   ? B ACT 602 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 806 ? 1_555 81.8  ? 
23 OXT ? I ACT .   ? B ACT 602 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG  ? F SER 380 ? B SER 380 ? 1_555 87.2  ? 
24 O   ? P HOH .   ? B HOH 806 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG  ? F SER 380 ? B SER 380 ? 1_555 92.2  ? 
25 OXT ? I ACT .   ? B ACT 602 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG  ? F SER 378 ? B SER 378 ? 1_555 82.4  ? 
26 O   ? P HOH .   ? B HOH 806 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG  ? F SER 378 ? B SER 378 ? 1_555 149.1 ? 
27 OG  ? F SER 380 ? B SER 380 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG  ? F SER 378 ? B SER 378 ? 1_555 113.3 ? 
28 OXT ? I ACT .   ? B ACT 602 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG1 ? F THR 445 ? B THR 445 ? 1_555 79.8  ? 
29 O   ? P HOH .   ? B HOH 806 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG1 ? F THR 445 ? B THR 445 ? 1_555 67.7  ? 
30 OG  ? F SER 380 ? B SER 380 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG1 ? F THR 445 ? B THR 445 ? 1_555 157.3 ? 
31 OG  ? F SER 378 ? B SER 378 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 OG1 ? F THR 445 ? B THR 445 ? 1_555 83.5  ? 
32 OXT ? I ACT .   ? B ACT 602 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 703 ? 1_555 167.8 ? 
33 O   ? P HOH .   ? B HOH 806 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 703 ? 1_555 87.6  ? 
34 OG  ? F SER 380 ? B SER 380 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 703 ? 1_555 99.4  ? 
35 OG  ? F SER 378 ? B SER 378 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 703 ? 1_555 104.0 ? 
36 OG1 ? F THR 445 ? B THR 445 ? 1_555 MG ? J MG . ? B MG 702 ? 1_555 O   ? P HOH .   ? B HOH 703 ? 1_555 90.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-10-17 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
CNS      refinement        . ? 2 
HKL-2000 'data reduction'  . ? 3 
HKL-2000 'data scaling'    . ? 4 
CNS      phasing           . ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 42  ? ? OE1 A GLU 42  ? ? 1.106 1.252 -0.146 0.011 N 
2 1 CD A GLU 42  ? ? OE2 A GLU 42  ? ? 1.145 1.252 -0.107 0.011 N 
3 1 CD B GLU 42  ? ? OE1 B GLU 42  ? ? 1.101 1.252 -0.151 0.011 N 
4 1 CD B GLU 42  ? ? OE2 B GLU 42  ? ? 1.148 1.252 -0.104 0.011 N 
5 1 CG B GLU 208 ? ? CD  B GLU 208 ? ? 1.417 1.515 -0.098 0.015 N 
6 1 CD B GLU 208 ? ? OE1 B GLU 208 ? ? 1.178 1.252 -0.074 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N1  D U   11  ? ? "C1'" D U   11  ? ? "C2'" D U   11  ? ? 125.64 114.00 11.64  1.30 N 
2  1 N1  F U   10  ? ? "C1'" F U   10  ? ? "C2'" F U   10  ? ? 122.24 114.00 8.24   1.30 N 
3  1 N1  F U   11  ? ? "C1'" F U   11  ? ? "C2'" F U   11  ? ? 122.93 114.00 8.93   1.30 N 
4  1 CG  A ARG 34  ? ? CD    A ARG 34  ? ? NE    A ARG 34  ? ? 96.35  111.80 -15.45 2.10 N 
5  1 CD  A ARG 34  ? ? NE    A ARG 34  ? ? CZ    A ARG 34  ? ? 136.66 123.60 13.06  1.40 N 
6  1 NE  A ARG 34  ? ? CZ    A ARG 34  ? ? NH1   A ARG 34  ? ? 127.15 120.30 6.85   0.50 N 
7  1 NE  A ARG 34  ? ? CZ    A ARG 34  ? ? NH2   A ARG 34  ? ? 112.07 120.30 -8.23  0.50 N 
8  1 OE1 A GLU 42  ? ? CD    A GLU 42  ? ? OE2   A GLU 42  ? ? 104.01 123.30 -19.29 1.20 N 
9  1 CG  A GLU 42  ? ? CD    A GLU 42  ? ? OE2   A GLU 42  ? ? 131.32 118.30 13.02  2.00 N 
10 1 CD  A ARG 63  ? ? NE    A ARG 63  ? ? CZ    A ARG 63  ? ? 132.11 123.60 8.51   1.40 N 
11 1 NE  A ARG 63  ? ? CZ    A ARG 63  ? ? NH1   A ARG 63  ? ? 113.98 120.30 -6.32  0.50 N 
12 1 NE  A ARG 63  ? ? CZ    A ARG 63  ? ? NH2   A ARG 63  ? ? 126.35 120.30 6.05   0.50 N 
13 1 CD  A ARG 85  ? ? NE    A ARG 85  ? ? CZ    A ARG 85  ? ? 132.56 123.60 8.96   1.40 N 
14 1 NE  A ARG 85  ? ? CZ    A ARG 85  ? ? NH1   A ARG 85  ? ? 113.78 120.30 -6.52  0.50 N 
15 1 NE  A ARG 85  ? ? CZ    A ARG 85  ? ? NH2   A ARG 85  ? ? 127.19 120.30 6.89   0.50 N 
16 1 CD  A ARG 113 ? ? NE    A ARG 113 ? ? CZ    A ARG 113 ? ? 132.43 123.60 8.83   1.40 N 
17 1 NE  A ARG 113 ? ? CZ    A ARG 113 ? ? NH1   A ARG 113 ? ? 113.98 120.30 -6.32  0.50 N 
18 1 NE  A ARG 113 ? ? CZ    A ARG 113 ? ? NH2   A ARG 113 ? ? 126.01 120.30 5.71   0.50 N 
19 1 CD  A ARG 146 ? ? NE    A ARG 146 ? ? CZ    A ARG 146 ? ? 136.27 123.60 12.67  1.40 N 
20 1 NE  A ARG 146 ? ? CZ    A ARG 146 ? ? NH1   A ARG 146 ? ? 130.61 120.30 10.31  0.50 N 
21 1 NE  A ARG 146 ? ? CZ    A ARG 146 ? ? NH2   A ARG 146 ? ? 111.12 120.30 -9.18  0.50 N 
22 1 NE  A ARG 149 ? ? CZ    A ARG 149 ? ? NH1   A ARG 149 ? ? 114.69 120.30 -5.61  0.50 N 
23 1 NE  A ARG 149 ? ? CZ    A ARG 149 ? ? NH2   A ARG 149 ? ? 125.15 120.30 4.85   0.50 N 
24 1 CD  A ARG 174 ? ? NE    A ARG 174 ? ? CZ    A ARG 174 ? ? 134.31 123.60 10.71  1.40 N 
25 1 NE  A ARG 174 ? ? CZ    A ARG 174 ? ? NH1   A ARG 174 ? ? 127.64 120.30 7.34   0.50 N 
26 1 NE  A ARG 174 ? ? CZ    A ARG 174 ? ? NH2   A ARG 174 ? ? 112.34 120.30 -7.96  0.50 N 
27 1 NE  A ARG 252 ? ? CZ    A ARG 252 ? ? NH1   A ARG 252 ? ? 127.34 120.30 7.04   0.50 N 
28 1 NE  A ARG 252 ? ? CZ    A ARG 252 ? ? NH2   A ARG 252 ? ? 113.55 120.30 -6.75  0.50 N 
29 1 CA  A GLU 300 ? ? CB    A GLU 300 ? ? CG    A GLU 300 ? ? 127.18 113.40 13.78  2.20 N 
30 1 CD  A ARG 318 ? ? NE    A ARG 318 ? ? CZ    A ARG 318 ? ? 135.19 123.60 11.59  1.40 N 
31 1 NE  A ARG 318 ? ? CZ    A ARG 318 ? ? NH1   A ARG 318 ? ? 126.85 120.30 6.55   0.50 N 
32 1 NE  A ARG 318 ? ? CZ    A ARG 318 ? ? NH2   A ARG 318 ? ? 114.04 120.30 -6.26  0.50 N 
33 1 CD  A ARG 338 ? ? NE    A ARG 338 ? ? CZ    A ARG 338 ? ? 132.12 123.60 8.52   1.40 N 
34 1 NE  A ARG 338 ? ? CZ    A ARG 338 ? ? NH1   A ARG 338 ? ? 126.76 120.30 6.46   0.50 N 
35 1 NE  A ARG 338 ? ? CZ    A ARG 338 ? ? NH2   A ARG 338 ? ? 113.99 120.30 -6.31  0.50 N 
36 1 CD  A ARG 342 ? ? NE    A ARG 342 ? ? CZ    A ARG 342 ? ? 133.96 123.60 10.36  1.40 N 
37 1 NE  A ARG 342 ? ? CZ    A ARG 342 ? ? NH1   A ARG 342 ? ? 127.14 120.30 6.84   0.50 N 
38 1 NE  A ARG 342 ? ? CZ    A ARG 342 ? ? NH2   A ARG 342 ? ? 113.46 120.30 -6.84  0.50 N 
39 1 CD  A ARG 384 ? ? NE    A ARG 384 ? ? CZ    A ARG 384 ? ? 133.39 123.60 9.79   1.40 N 
40 1 NE  A ARG 384 ? ? CZ    A ARG 384 ? ? NH1   A ARG 384 ? ? 113.20 120.30 -7.10  0.50 N 
41 1 NE  A ARG 384 ? ? CZ    A ARG 384 ? ? NH2   A ARG 384 ? ? 127.28 120.30 6.98   0.50 N 
42 1 CD  A ARG 487 ? ? NE    A ARG 487 ? ? CZ    A ARG 487 ? ? 132.96 123.60 9.36   1.40 N 
43 1 NE  A ARG 487 ? ? CZ    A ARG 487 ? ? NH1   A ARG 487 ? ? 126.17 120.30 5.87   0.50 N 
44 1 NE  A ARG 487 ? ? CZ    A ARG 487 ? ? NH2   A ARG 487 ? ? 113.64 120.30 -6.66  0.50 N 
45 1 CB  B ASN 18  ? ? CA    B ASN 18  ? ? C     B ASN 18  ? ? 97.95  110.40 -12.45 2.00 N 
46 1 CD  B ARG 34  ? ? NE    B ARG 34  ? ? CZ    B ARG 34  ? ? 135.33 123.60 11.73  1.40 N 
47 1 NE  B ARG 34  ? ? CZ    B ARG 34  ? ? NH1   B ARG 34  ? ? 112.94 120.30 -7.36  0.50 N 
48 1 NE  B ARG 34  ? ? CZ    B ARG 34  ? ? NH2   B ARG 34  ? ? 127.68 120.30 7.38   0.50 N 
49 1 OE1 B GLU 42  ? ? CD    B GLU 42  ? ? OE2   B GLU 42  ? ? 103.94 123.30 -19.36 1.20 N 
50 1 CG  B GLU 42  ? ? CD    B GLU 42  ? ? OE2   B GLU 42  ? ? 131.29 118.30 12.99  2.00 N 
51 1 CD  B ARG 63  ? ? NE    B ARG 63  ? ? CZ    B ARG 63  ? ? 132.61 123.60 9.01   1.40 N 
52 1 NE  B ARG 63  ? ? CZ    B ARG 63  ? ? NH1   B ARG 63  ? ? 126.29 120.30 5.99   0.50 N 
53 1 NE  B ARG 63  ? ? CZ    B ARG 63  ? ? NH2   B ARG 63  ? ? 113.91 120.30 -6.39  0.50 N 
54 1 CD  B ARG 85  ? ? NE    B ARG 85  ? ? CZ    B ARG 85  ? ? 132.97 123.60 9.37   1.40 N 
55 1 NE  B ARG 85  ? ? CZ    B ARG 85  ? ? NH1   B ARG 85  ? ? 126.80 120.30 6.50   0.50 N 
56 1 NE  B ARG 85  ? ? CZ    B ARG 85  ? ? NH2   B ARG 85  ? ? 114.33 120.30 -5.97  0.50 N 
57 1 CD  B ARG 113 ? ? NE    B ARG 113 ? ? CZ    B ARG 113 ? ? 132.31 123.60 8.71   1.40 N 
58 1 NE  B ARG 113 ? ? CZ    B ARG 113 ? ? NH1   B ARG 113 ? ? 126.46 120.30 6.16   0.50 N 
59 1 NE  B ARG 113 ? ? CZ    B ARG 113 ? ? NH2   B ARG 113 ? ? 113.99 120.30 -6.31  0.50 N 
60 1 CG  B ARG 146 ? ? CD    B ARG 146 ? ? NE    B ARG 146 ? ? 91.39  111.80 -20.41 2.10 N 
61 1 CD  B ARG 146 ? ? NE    B ARG 146 ? ? CZ    B ARG 146 ? ? 135.58 123.60 11.98  1.40 N 
62 1 NE  B ARG 146 ? ? CZ    B ARG 146 ? ? NH1   B ARG 146 ? ? 110.84 120.30 -9.46  0.50 N 
63 1 NE  B ARG 146 ? ? CZ    B ARG 146 ? ? NH2   B ARG 146 ? ? 127.43 120.30 7.13   0.50 N 
64 1 CD  B ARG 149 ? ? NE    B ARG 149 ? ? CZ    B ARG 149 ? ? 132.50 123.60 8.90   1.40 N 
65 1 NE  B ARG 149 ? ? CZ    B ARG 149 ? ? NH1   B ARG 149 ? ? 125.34 120.30 5.04   0.50 N 
66 1 NE  B ARG 149 ? ? CZ    B ARG 149 ? ? NH2   B ARG 149 ? ? 114.62 120.30 -5.68  0.50 N 
67 1 CD  B ARG 174 ? ? NE    B ARG 174 ? ? CZ    B ARG 174 ? ? 133.04 123.60 9.44   1.40 N 
68 1 NE  B ARG 174 ? ? CZ    B ARG 174 ? ? NH1   B ARG 174 ? ? 113.48 120.30 -6.82  0.50 N 
69 1 NE  B ARG 174 ? ? CZ    B ARG 174 ? ? NH2   B ARG 174 ? ? 126.69 120.30 6.39   0.50 N 
70 1 CA  B GLU 208 ? ? CB    B GLU 208 ? ? CG    B GLU 208 ? ? 99.66  113.40 -13.74 2.20 N 
71 1 NE  B ARG 252 ? ? CZ    B ARG 252 ? ? NH1   B ARG 252 ? ? 115.51 120.30 -4.79  0.50 N 
72 1 NE  B ARG 252 ? ? CZ    B ARG 252 ? ? NH2   B ARG 252 ? ? 124.65 120.30 4.35   0.50 N 
73 1 CA  B GLU 300 ? ? CB    B GLU 300 ? ? CG    B GLU 300 ? ? 126.92 113.40 13.52  2.20 N 
74 1 CG  B ARG 318 ? ? CD    B ARG 318 ? ? NE    B ARG 318 ? ? 93.71  111.80 -18.09 2.10 N 
75 1 CD  B ARG 318 ? ? NE    B ARG 318 ? ? CZ    B ARG 318 ? ? 138.59 123.60 14.99  1.40 N 
76 1 NE  B ARG 318 ? ? CZ    B ARG 318 ? ? NH1   B ARG 318 ? ? 110.75 120.30 -9.55  0.50 N 
77 1 NE  B ARG 318 ? ? CZ    B ARG 318 ? ? NH2   B ARG 318 ? ? 129.20 120.30 8.90   0.50 N 
78 1 CD  B ARG 338 ? ? NE    B ARG 338 ? ? CZ    B ARG 338 ? ? 132.82 123.60 9.22   1.40 N 
79 1 NE  B ARG 338 ? ? CZ    B ARG 338 ? ? NH1   B ARG 338 ? ? 113.87 120.30 -6.43  0.50 N 
80 1 NE  B ARG 338 ? ? CZ    B ARG 338 ? ? NH2   B ARG 338 ? ? 126.29 120.30 5.99   0.50 N 
81 1 CD  B ARG 342 ? ? NE    B ARG 342 ? ? CZ    B ARG 342 ? ? 133.69 123.60 10.09  1.40 N 
82 1 NE  B ARG 342 ? ? CZ    B ARG 342 ? ? NH1   B ARG 342 ? ? 113.23 120.30 -7.07  0.50 N 
83 1 NE  B ARG 342 ? ? CZ    B ARG 342 ? ? NH2   B ARG 342 ? ? 127.05 120.30 6.75   0.50 N 
84 1 CD  B ARG 384 ? ? NE    B ARG 384 ? ? CZ    B ARG 384 ? ? 132.90 123.60 9.30   1.40 N 
85 1 NE  B ARG 384 ? ? CZ    B ARG 384 ? ? NH1   B ARG 384 ? ? 127.21 120.30 6.91   0.50 N 
86 1 NE  B ARG 384 ? ? CZ    B ARG 384 ? ? NH2   B ARG 384 ? ? 113.45 120.30 -6.85  0.50 N 
87 1 CD  B ARG 487 ? ? NE    B ARG 487 ? ? CZ    B ARG 487 ? ? 132.57 123.60 8.97   1.40 N 
88 1 NE  B ARG 487 ? ? CZ    B ARG 487 ? ? NH1   B ARG 487 ? ? 114.31 120.30 -5.99  0.50 N 
89 1 NE  B ARG 487 ? ? CZ    B ARG 487 ? ? NH2   B ARG 487 ? ? 125.07 120.30 4.77   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 18  ? ? -76.91  -154.82 
2  1 SER A 41  ? ? -140.38 16.51   
3  1 LYS A 69  ? ? -62.13  9.25    
4  1 SER A 100 ? ? -66.58  2.57    
5  1 CYS A 102 ? ? -38.21  162.02  
6  1 ARG A 146 ? ? -41.59  -72.88  
7  1 ASN A 175 ? ? 49.15   19.87   
8  1 GLN A 274 ? ? -26.08  -62.73  
9  1 LEU A 294 ? ? -116.47 58.56   
10 1 ALA A 297 ? ? 79.19   -20.72  
11 1 LYS A 340 ? ? -147.08 31.94   
12 1 MET A 381 ? ? -65.04  8.15    
13 1 SER A 388 ? ? -101.23 -166.92 
14 1 SER A 416 ? ? -132.04 -101.04 
15 1 MET A 442 ? ? 167.36  174.66  
16 1 CYS A 447 ? ? -68.00  9.64    
17 1 ASN A 473 ? ? -152.06 16.58   
18 1 PRO A 493 ? ? -77.22  26.98   
19 1 ALA A 494 ? ? -27.19  128.58  
20 1 ASN B 18  ? ? -73.93  -157.48 
21 1 SER B 41  ? ? -140.01 15.70   
22 1 LYS B 69  ? ? -62.82  9.60    
23 1 SER B 100 ? ? -66.48  2.86    
24 1 CYS B 102 ? ? -37.99  162.43  
25 1 ARG B 146 ? ? -40.76  -72.91  
26 1 ASN B 175 ? ? 50.02   19.97   
27 1 GLU B 215 ? ? -143.61 32.54   
28 1 GLU B 217 ? ? -51.56  107.93  
29 1 LEU B 263 ? ? -75.05  21.07   
30 1 GLN B 274 ? ? -25.41  -63.04  
31 1 LEU B 294 ? ? -115.97 58.90   
32 1 ALA B 297 ? ? 79.47   -22.27  
33 1 SER B 298 ? ? -49.01  159.59  
34 1 LYS B 340 ? ? -146.79 31.98   
35 1 MET B 381 ? ? -66.14  7.11    
36 1 SER B 388 ? ? -101.50 -168.28 
37 1 SER B 416 ? ? -132.41 -101.25 
38 1 MET B 442 ? ? 167.58  175.32  
39 1 CYS B 447 ? ? -68.44  10.26   
40 1 ASN B 473 ? ? -152.48 16.09   
41 1 PRO B 493 ? ? -77.01  27.78   
42 1 ALA B 494 ? ? -28.48  127.24  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 D G 2 ? P   ? B G 2 P   
2 1 Y 1 D G 2 ? OP1 ? B G 2 OP1 
3 1 Y 1 D G 2 ? OP2 ? B G 2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 D C   1   ? B C   1   
2  1 Y 1 A MET 1   ? E MET 1   
3  1 Y 1 A GLU 2   ? E GLU 2   
4  1 Y 1 A ALA 3   ? E ALA 3   
5  1 Y 1 A THR 4   ? E THR 4   
6  1 Y 1 A LYS 136 ? E LYS 136 
7  1 Y 1 A GLU 137 ? E GLU 137 
8  1 Y 1 A GLY 138 ? E GLY 138 
9  1 Y 1 A MET 139 ? E MET 139 
10 1 Y 1 A LYS 140 ? E LYS 140 
11 1 Y 1 A CYS 141 ? E CYS 141 
12 1 Y 1 A GLY 142 ? E GLY 142 
13 1 Y 1 A MET 143 ? E MET 143 
14 1 Y 1 A LYS 214 ? E LYS 214 
15 1 Y 1 A GLU 215 ? E GLU 215 
16 1 Y 1 A LYS 216 ? E LYS 216 
17 1 Y 1 A GLU 217 ? E GLU 217 
18 1 Y 1 A LEU 218 ? E LEU 218 
19 1 Y 1 A ILE 538 ? E ILE 538 
20 1 Y 1 B MET 1   ? F MET 1   
21 1 Y 1 B GLU 2   ? F GLU 2   
22 1 Y 1 B ALA 3   ? F ALA 3   
23 1 Y 1 B THR 4   ? F THR 4   
24 1 Y 1 B GLU 137 ? F GLU 137 
25 1 Y 1 B GLY 138 ? F GLY 138 
26 1 Y 1 B MET 139 ? F MET 139 
27 1 Y 1 B LYS 140 ? F LYS 140 
28 1 Y 1 B CYS 141 ? F CYS 141 
29 1 Y 1 B GLY 142 ? F GLY 142 
30 1 Y 1 B MET 143 ? F MET 143 
31 1 Y 1 B ILE 538 ? F ILE 538 
# 
_ndb_struct_conf_na.entry_id   2I91 
_ndb_struct_conf_na.feature    'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A G 1 1_555 B C 8 1_555 0.479  0.193  -0.521 8.277  2.345   7.889  1  C_G1:C8_D C 1 ? D 8 ? 19 1 
1 A C 2 1_555 B G 7 1_555 0.513  0.201  -0.843 10.622 -10.390 8.731  2  C_C2:G7_D C 2 ? D 7 ? ?  1 
1 A C 3 1_555 B G 6 1_555 0.464  -0.338 0.079  0.967  -7.150  -3.931 3  C_C3:G6_D C 3 ? D 6 ? 19 1 
1 A U 4 1_555 B A 5 1_555 -0.435 -0.116 -0.011 2.906  -13.327 7.326  4  C_U4:A5_D C 4 ? D 5 ? 20 1 
1 A A 5 1_555 B U 4 1_555 -0.485 0.004  0.087  -0.641 -8.363  0.102  5  C_A5:U4_D C 5 ? D 4 ? 20 1 
1 A C 6 1_555 B G 3 1_555 0.736  -0.216 0.006  7.169  -11.903 -3.093 6  C_C6:G3_D C 6 ? D 3 ? 19 1 
1 A C 7 1_555 B G 2 1_555 1.305  -0.086 0.057  7.509  -18.746 -3.195 7  C_C7:G2_D C 7 ? D 2 ? 19 1 
1 C G 1 1_555 D C 8 1_555 0.388  0.445  0.096  4.607  -0.405  16.218 8  E_G1:C8_F E 1 ? F 8 ? ?  1 
1 C C 2 1_555 D G 7 1_555 0.703  -0.125 0.221  -4.281 4.064   9.702  9  E_C2:G7_F E 2 ? F 7 ? 19 1 
1 C C 3 1_555 D G 6 1_555 0.182  -0.055 -0.516 4.840  -7.186  -0.319 10 E_C3:G6_F E 3 ? F 6 ? 19 1 
1 C U 4 1_555 D A 5 1_555 -0.034 0.067  0.064  6.986  -7.373  9.010  11 E_U4:A5_F E 4 ? F 5 ? 20 1 
1 C A 5 1_555 D U 4 1_555 0.308  -0.066 -0.331 -1.765 -7.244  0.013  12 E_A5:U4_F E 5 ? F 4 ? 20 1 
1 C C 6 1_555 D G 3 1_555 0.909  -0.273 0.085  7.358  -17.166 -5.050 13 E_C6:G3_F E 6 ? F 3 ? 19 1 
1 C C 7 1_555 D G 2 1_555 0.705  0.016  -0.348 8.152  -14.474 -3.041 14 E_C7:G2_F E 7 ? F 2 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A G 1 1_555 B C 8 1_555 A C 2 1_555 B G 7 1_555 -0.026 -1.970 3.514 3.784  -4.880 28.224 -2.730 0.999  3.759 -9.859 -7.645  
28.878 1  CC_G1C2:G7C8_DD C 1 ? D 8 ? C 2 ? D 7 ? 
1 A C 2 1_555 B G 7 1_555 A C 3 1_555 B G 6 1_555 -1.137 -1.954 3.769 -6.453 5.918  29.115 -5.075 0.702  3.480 11.449 12.485  
30.376 2  CC_C2C3:G6G7_DD C 2 ? D 7 ? C 3 ? D 6 ? 
1 A C 3 1_555 B G 6 1_555 A U 4 1_555 B A 5 1_555 0.691  -1.558 3.089 3.147  10.951 25.363 -5.521 -0.786 2.299 23.488 -6.751  
27.767 3  CC_C3U4:A5G6_DD C 3 ? D 6 ? C 4 ? D 5 ? 
1 A U 4 1_555 B A 5 1_555 A A 5 1_555 B U 4 1_555 -0.631 -1.239 3.393 -7.300 7.378  32.257 -3.341 -0.116 3.108 12.870 12.734  
33.843 4  CC_U4A5:U4A5_DD C 4 ? D 5 ? C 5 ? D 4 ? 
1 A A 5 1_555 B U 4 1_555 A C 6 1_555 B G 3 1_555 -0.572 -1.788 3.000 -2.080 -0.742 37.098 -2.713 0.641  3.061 -1.165 3.266   
37.162 5  CC_A5C6:G3U4_DD C 5 ? D 4 ? C 6 ? D 3 ? 
1 A C 6 1_555 B G 3 1_555 A C 7 1_555 B G 2 1_555 0.336  -1.638 3.216 4.595  1.144  40.444 -2.479 0.016  3.188 1.648  -6.619  
40.708 6  CC_C6C7:G2G3_DD C 6 ? D 3 ? C 7 ? D 2 ? 
1 C G 1 1_555 D C 8 1_555 C C 2 1_555 D G 7 1_555 -0.370 -2.382 3.509 -1.620 3.551  31.012 -5.118 0.369  3.237 6.608  3.016   
31.250 7  EE_G1C2:G7C8_FF E 1 ? F 8 ? E 2 ? F 7 ? 
1 C C 2 1_555 D G 7 1_555 C C 3 1_555 D G 6 1_555 -1.414 -2.188 2.980 4.968  -0.603 20.507 -5.756 5.669  2.629 -1.663 -13.693 
21.102 8  EE_C2C3:G6G7_FF E 2 ? F 7 ? E 3 ? F 6 ? 
1 C C 3 1_555 D G 6 1_555 C U 4 1_555 D A 5 1_555 0.465  -1.368 3.233 -3.728 9.403  32.291 -3.759 -1.357 2.673 16.412 6.506   
33.798 9  EE_C3U4:A5G6_FF E 3 ? F 6 ? E 4 ? F 5 ? 
1 C U 4 1_555 D A 5 1_555 C A 5 1_555 D U 4 1_555 -1.053 -1.184 3.366 -0.616 9.884  33.284 -3.476 1.674  2.924 16.799 1.047   
34.686 10 EE_U4A5:U4A5_FF E 4 ? F 5 ? E 5 ? F 4 ? 
1 C A 5 1_555 D U 4 1_555 C C 6 1_555 D G 3 1_555 -0.157 -1.791 2.987 -4.854 3.283  38.016 -3.084 -0.301 2.826 5.003  7.398   
38.449 11 EE_A5C6:G3U4_FF E 5 ? F 4 ? E 6 ? F 3 ? 
1 C C 6 1_555 D G 3 1_555 C C 7 1_555 D G 2 1_555 -0.371 -1.526 3.252 4.867  0.977  31.419 -2.960 1.548  3.113 1.791  -8.918  
31.799 12 EE_C6C7:G2G3_FF E 6 ? F 3 ? E 7 ? F 2 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ACETATE ION'   ACT 
5 'MAGNESIUM ION' MG  
6 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ACT 1   601 601 ACT ACT A . 
H 5 MG  1   701 701 MG  MG  A . 
I 4 ACT 1   602 602 ACT ACT B . 
J 5 MG  1   702 702 MG  MG  B . 
K 6 HOH 1   108 108 HOH HOH C . 
K 6 HOH 2   110 110 HOH HOH C . 
K 6 HOH 3   274 274 HOH HOH C . 
K 6 HOH 4   276 276 HOH HOH C . 
K 6 HOH 5   287 287 HOH HOH C . 
K 6 HOH 6   422 422 HOH HOH C . 
K 6 HOH 7   520 520 HOH HOH C . 
K 6 HOH 8   521 521 HOH HOH C . 
K 6 HOH 9   522 522 HOH HOH C . 
K 6 HOH 10  523 523 HOH HOH C . 
K 6 HOH 11  531 531 HOH HOH C . 
K 6 HOH 12  532 532 HOH HOH C . 
L 6 HOH 1   16  11  HOH HOH D . 
L 6 HOH 2   17  24  HOH HOH D . 
L 6 HOH 3   18  67  HOH HOH D . 
L 6 HOH 4   19  84  HOH HOH D . 
L 6 HOH 5   20  104 HOH HOH D . 
L 6 HOH 6   21  105 HOH HOH D . 
L 6 HOH 7   22  106 HOH HOH D . 
L 6 HOH 8   23  107 HOH HOH D . 
L 6 HOH 9   24  109 HOH HOH D . 
L 6 HOH 10  25  111 HOH HOH D . 
L 6 HOH 11  26  112 HOH HOH D . 
L 6 HOH 12  27  135 HOH HOH D . 
L 6 HOH 13  28  174 HOH HOH D . 
L 6 HOH 14  29  277 HOH HOH D . 
L 6 HOH 15  30  285 HOH HOH D . 
L 6 HOH 16  31  286 HOH HOH D . 
L 6 HOH 17  32  416 HOH HOH D . 
L 6 HOH 18  33  429 HOH HOH D . 
L 6 HOH 19  34  430 HOH HOH D . 
L 6 HOH 20  35  440 HOH HOH D . 
L 6 HOH 21  36  524 HOH HOH D . 
L 6 HOH 22  37  527 HOH HOH D . 
L 6 HOH 23  38  529 HOH HOH D . 
L 6 HOH 24  39  530 HOH HOH D . 
L 6 HOH 25  40  538 HOH HOH D . 
M 6 HOH 1   63  63  HOH HOH E . 
M 6 HOH 2   324 324 HOH HOH E . 
M 6 HOH 3   362 362 HOH HOH E . 
M 6 HOH 4   387 387 HOH HOH E . 
M 6 HOH 5   389 389 HOH HOH E . 
M 6 HOH 6   390 390 HOH HOH E . 
M 6 HOH 7   477 477 HOH HOH E . 
M 6 HOH 8   479 479 HOH HOH E . 
M 6 HOH 9   480 480 HOH HOH E . 
M 6 HOH 10  481 481 HOH HOH E . 
M 6 HOH 11  533 533 HOH HOH E . 
M 6 HOH 12  534 534 HOH HOH E . 
N 6 HOH 1   28  28  HOH HOH F . 
N 6 HOH 2   41  41  HOH HOH F . 
N 6 HOH 3   61  61  HOH HOH F . 
N 6 HOH 4   62  62  HOH HOH F . 
N 6 HOH 5   388 388 HOH HOH F . 
N 6 HOH 6   391 391 HOH HOH F . 
N 6 HOH 7   417 417 HOH HOH F . 
N 6 HOH 8   418 418 HOH HOH F . 
N 6 HOH 9   462 462 HOH HOH F . 
N 6 HOH 10  478 478 HOH HOH F . 
N 6 HOH 11  482 482 HOH HOH F . 
N 6 HOH 12  483 483 HOH HOH F . 
N 6 HOH 13  484 484 HOH HOH F . 
N 6 HOH 14  485 485 HOH HOH F . 
N 6 HOH 15  486 486 HOH HOH F . 
N 6 HOH 16  487 487 HOH HOH F . 
N 6 HOH 17  488 488 HOH HOH F . 
N 6 HOH 18  535 535 HOH HOH F . 
N 6 HOH 19  536 536 HOH HOH F . 
N 6 HOH 20  539 539 HOH HOH F . 
O 6 HOH 1   702 2   HOH HOH A . 
O 6 HOH 2   703 7   HOH HOH A . 
O 6 HOH 3   704 8   HOH HOH A . 
O 6 HOH 4   705 10  HOH HOH A . 
O 6 HOH 5   706 12  HOH HOH A . 
O 6 HOH 6   707 13  HOH HOH A . 
O 6 HOH 7   708 15  HOH HOH A . 
O 6 HOH 8   709 16  HOH HOH A . 
O 6 HOH 9   710 17  HOH HOH A . 
O 6 HOH 10  711 18  HOH HOH A . 
O 6 HOH 11  712 19  HOH HOH A . 
O 6 HOH 12  713 21  HOH HOH A . 
O 6 HOH 13  714 23  HOH HOH A . 
O 6 HOH 14  715 25  HOH HOH A . 
O 6 HOH 15  716 27  HOH HOH A . 
O 6 HOH 16  717 30  HOH HOH A . 
O 6 HOH 17  718 31  HOH HOH A . 
O 6 HOH 18  719 32  HOH HOH A . 
O 6 HOH 19  720 34  HOH HOH A . 
O 6 HOH 20  721 37  HOH HOH A . 
O 6 HOH 21  722 39  HOH HOH A . 
O 6 HOH 22  723 42  HOH HOH A . 
O 6 HOH 23  724 43  HOH HOH A . 
O 6 HOH 24  725 45  HOH HOH A . 
O 6 HOH 25  726 46  HOH HOH A . 
O 6 HOH 26  727 47  HOH HOH A . 
O 6 HOH 27  728 50  HOH HOH A . 
O 6 HOH 28  729 55  HOH HOH A . 
O 6 HOH 29  730 56  HOH HOH A . 
O 6 HOH 30  731 58  HOH HOH A . 
O 6 HOH 31  732 60  HOH HOH A . 
O 6 HOH 32  733 64  HOH HOH A . 
O 6 HOH 33  734 68  HOH HOH A . 
O 6 HOH 34  735 70  HOH HOH A . 
O 6 HOH 35  736 76  HOH HOH A . 
O 6 HOH 36  737 78  HOH HOH A . 
O 6 HOH 37  738 79  HOH HOH A . 
O 6 HOH 38  739 80  HOH HOH A . 
O 6 HOH 39  740 82  HOH HOH A . 
O 6 HOH 40  741 85  HOH HOH A . 
O 6 HOH 41  742 88  HOH HOH A . 
O 6 HOH 42  743 89  HOH HOH A . 
O 6 HOH 43  744 90  HOH HOH A . 
O 6 HOH 44  745 91  HOH HOH A . 
O 6 HOH 45  746 92  HOH HOH A . 
O 6 HOH 46  747 94  HOH HOH A . 
O 6 HOH 47  748 95  HOH HOH A . 
O 6 HOH 48  749 98  HOH HOH A . 
O 6 HOH 49  750 99  HOH HOH A . 
O 6 HOH 50  751 100 HOH HOH A . 
O 6 HOH 51  752 101 HOH HOH A . 
O 6 HOH 52  753 102 HOH HOH A . 
O 6 HOH 53  754 103 HOH HOH A . 
O 6 HOH 54  755 113 HOH HOH A . 
O 6 HOH 55  756 114 HOH HOH A . 
O 6 HOH 56  757 115 HOH HOH A . 
O 6 HOH 57  758 116 HOH HOH A . 
O 6 HOH 58  759 117 HOH HOH A . 
O 6 HOH 59  760 118 HOH HOH A . 
O 6 HOH 60  761 119 HOH HOH A . 
O 6 HOH 61  762 120 HOH HOH A . 
O 6 HOH 62  763 121 HOH HOH A . 
O 6 HOH 63  764 122 HOH HOH A . 
O 6 HOH 64  765 123 HOH HOH A . 
O 6 HOH 65  766 124 HOH HOH A . 
O 6 HOH 66  767 125 HOH HOH A . 
O 6 HOH 67  768 126 HOH HOH A . 
O 6 HOH 68  769 127 HOH HOH A . 
O 6 HOH 69  770 128 HOH HOH A . 
O 6 HOH 70  771 129 HOH HOH A . 
O 6 HOH 71  772 130 HOH HOH A . 
O 6 HOH 72  773 131 HOH HOH A . 
O 6 HOH 73  774 132 HOH HOH A . 
O 6 HOH 74  775 133 HOH HOH A . 
O 6 HOH 75  776 134 HOH HOH A . 
O 6 HOH 76  777 136 HOH HOH A . 
O 6 HOH 77  778 137 HOH HOH A . 
O 6 HOH 78  779 139 HOH HOH A . 
O 6 HOH 79  780 140 HOH HOH A . 
O 6 HOH 80  781 142 HOH HOH A . 
O 6 HOH 81  782 143 HOH HOH A . 
O 6 HOH 82  783 144 HOH HOH A . 
O 6 HOH 83  784 145 HOH HOH A . 
O 6 HOH 84  785 148 HOH HOH A . 
O 6 HOH 85  786 149 HOH HOH A . 
O 6 HOH 86  787 150 HOH HOH A . 
O 6 HOH 87  788 151 HOH HOH A . 
O 6 HOH 88  789 153 HOH HOH A . 
O 6 HOH 89  790 154 HOH HOH A . 
O 6 HOH 90  791 155 HOH HOH A . 
O 6 HOH 91  792 156 HOH HOH A . 
O 6 HOH 92  793 157 HOH HOH A . 
O 6 HOH 93  794 158 HOH HOH A . 
O 6 HOH 94  795 159 HOH HOH A . 
O 6 HOH 95  796 160 HOH HOH A . 
O 6 HOH 96  797 161 HOH HOH A . 
O 6 HOH 97  798 162 HOH HOH A . 
O 6 HOH 98  799 163 HOH HOH A . 
O 6 HOH 99  800 164 HOH HOH A . 
O 6 HOH 100 801 165 HOH HOH A . 
O 6 HOH 101 802 166 HOH HOH A . 
O 6 HOH 102 803 167 HOH HOH A . 
O 6 HOH 103 804 168 HOH HOH A . 
O 6 HOH 104 805 169 HOH HOH A . 
O 6 HOH 105 806 170 HOH HOH A . 
O 6 HOH 106 807 171 HOH HOH A . 
O 6 HOH 107 808 172 HOH HOH A . 
O 6 HOH 108 809 175 HOH HOH A . 
O 6 HOH 109 810 176 HOH HOH A . 
O 6 HOH 110 811 177 HOH HOH A . 
O 6 HOH 111 812 179 HOH HOH A . 
O 6 HOH 112 813 180 HOH HOH A . 
O 6 HOH 113 814 181 HOH HOH A . 
O 6 HOH 114 815 182 HOH HOH A . 
O 6 HOH 115 816 183 HOH HOH A . 
O 6 HOH 116 817 184 HOH HOH A . 
O 6 HOH 117 818 185 HOH HOH A . 
O 6 HOH 118 819 186 HOH HOH A . 
O 6 HOH 119 820 187 HOH HOH A . 
O 6 HOH 120 821 189 HOH HOH A . 
O 6 HOH 121 822 191 HOH HOH A . 
O 6 HOH 122 823 192 HOH HOH A . 
O 6 HOH 123 824 193 HOH HOH A . 
O 6 HOH 124 825 194 HOH HOH A . 
O 6 HOH 125 826 197 HOH HOH A . 
O 6 HOH 126 827 198 HOH HOH A . 
O 6 HOH 127 828 199 HOH HOH A . 
O 6 HOH 128 829 200 HOH HOH A . 
O 6 HOH 129 830 201 HOH HOH A . 
O 6 HOH 130 831 202 HOH HOH A . 
O 6 HOH 131 832 203 HOH HOH A . 
O 6 HOH 132 833 204 HOH HOH A . 
O 6 HOH 133 834 205 HOH HOH A . 
O 6 HOH 134 835 206 HOH HOH A . 
O 6 HOH 135 836 207 HOH HOH A . 
O 6 HOH 136 837 208 HOH HOH A . 
O 6 HOH 137 838 209 HOH HOH A . 
O 6 HOH 138 839 210 HOH HOH A . 
O 6 HOH 139 840 211 HOH HOH A . 
O 6 HOH 140 841 212 HOH HOH A . 
O 6 HOH 141 842 213 HOH HOH A . 
O 6 HOH 142 843 214 HOH HOH A . 
O 6 HOH 143 844 215 HOH HOH A . 
O 6 HOH 144 845 216 HOH HOH A . 
O 6 HOH 145 846 217 HOH HOH A . 
O 6 HOH 146 847 218 HOH HOH A . 
O 6 HOH 147 848 219 HOH HOH A . 
O 6 HOH 148 849 256 HOH HOH A . 
O 6 HOH 149 850 259 HOH HOH A . 
O 6 HOH 150 851 275 HOH HOH A . 
O 6 HOH 151 852 288 HOH HOH A . 
O 6 HOH 152 853 289 HOH HOH A . 
O 6 HOH 153 854 290 HOH HOH A . 
O 6 HOH 154 855 291 HOH HOH A . 
O 6 HOH 155 856 292 HOH HOH A . 
O 6 HOH 156 857 293 HOH HOH A . 
O 6 HOH 157 858 294 HOH HOH A . 
O 6 HOH 158 859 295 HOH HOH A . 
O 6 HOH 159 860 296 HOH HOH A . 
O 6 HOH 160 861 297 HOH HOH A . 
O 6 HOH 161 862 298 HOH HOH A . 
O 6 HOH 162 863 299 HOH HOH A . 
O 6 HOH 163 864 300 HOH HOH A . 
O 6 HOH 164 865 301 HOH HOH A . 
O 6 HOH 165 866 302 HOH HOH A . 
O 6 HOH 166 867 303 HOH HOH A . 
O 6 HOH 167 868 304 HOH HOH A . 
O 6 HOH 168 869 305 HOH HOH A . 
O 6 HOH 169 870 306 HOH HOH A . 
O 6 HOH 170 871 308 HOH HOH A . 
O 6 HOH 171 872 309 HOH HOH A . 
O 6 HOH 172 873 310 HOH HOH A . 
O 6 HOH 173 874 311 HOH HOH A . 
O 6 HOH 174 875 312 HOH HOH A . 
O 6 HOH 175 876 313 HOH HOH A . 
O 6 HOH 176 877 314 HOH HOH A . 
O 6 HOH 177 878 315 HOH HOH A . 
O 6 HOH 178 879 316 HOH HOH A . 
O 6 HOH 179 880 317 HOH HOH A . 
O 6 HOH 180 881 318 HOH HOH A . 
O 6 HOH 181 882 319 HOH HOH A . 
O 6 HOH 182 883 321 HOH HOH A . 
O 6 HOH 183 884 322 HOH HOH A . 
O 6 HOH 184 885 323 HOH HOH A . 
O 6 HOH 185 886 325 HOH HOH A . 
O 6 HOH 186 887 326 HOH HOH A . 
O 6 HOH 187 888 327 HOH HOH A . 
O 6 HOH 188 889 330 HOH HOH A . 
O 6 HOH 189 890 331 HOH HOH A . 
O 6 HOH 190 891 332 HOH HOH A . 
O 6 HOH 191 892 333 HOH HOH A . 
O 6 HOH 192 893 334 HOH HOH A . 
O 6 HOH 193 894 335 HOH HOH A . 
O 6 HOH 194 895 336 HOH HOH A . 
O 6 HOH 195 896 338 HOH HOH A . 
O 6 HOH 196 897 339 HOH HOH A . 
O 6 HOH 197 898 340 HOH HOH A . 
O 6 HOH 198 899 341 HOH HOH A . 
O 6 HOH 199 900 342 HOH HOH A . 
O 6 HOH 200 901 343 HOH HOH A . 
O 6 HOH 201 902 344 HOH HOH A . 
O 6 HOH 202 903 345 HOH HOH A . 
O 6 HOH 203 904 346 HOH HOH A . 
O 6 HOH 204 905 392 HOH HOH A . 
O 6 HOH 205 906 393 HOH HOH A . 
O 6 HOH 206 907 394 HOH HOH A . 
O 6 HOH 207 908 395 HOH HOH A . 
O 6 HOH 208 909 396 HOH HOH A . 
O 6 HOH 209 910 397 HOH HOH A . 
O 6 HOH 210 911 398 HOH HOH A . 
O 6 HOH 211 912 399 HOH HOH A . 
O 6 HOH 212 913 400 HOH HOH A . 
O 6 HOH 213 914 401 HOH HOH A . 
O 6 HOH 214 915 402 HOH HOH A . 
O 6 HOH 215 916 403 HOH HOH A . 
O 6 HOH 216 917 404 HOH HOH A . 
O 6 HOH 217 918 405 HOH HOH A . 
O 6 HOH 218 919 406 HOH HOH A . 
O 6 HOH 219 920 407 HOH HOH A . 
O 6 HOH 220 921 409 HOH HOH A . 
O 6 HOH 221 922 410 HOH HOH A . 
O 6 HOH 222 923 411 HOH HOH A . 
O 6 HOH 223 924 412 HOH HOH A . 
O 6 HOH 224 925 413 HOH HOH A . 
O 6 HOH 225 926 414 HOH HOH A . 
O 6 HOH 226 927 415 HOH HOH A . 
O 6 HOH 227 928 419 HOH HOH A . 
O 6 HOH 228 929 420 HOH HOH A . 
O 6 HOH 229 930 421 HOH HOH A . 
O 6 HOH 230 931 423 HOH HOH A . 
O 6 HOH 231 932 424 HOH HOH A . 
O 6 HOH 232 933 425 HOH HOH A . 
O 6 HOH 233 934 426 HOH HOH A . 
O 6 HOH 234 935 427 HOH HOH A . 
O 6 HOH 235 936 428 HOH HOH A . 
O 6 HOH 236 937 431 HOH HOH A . 
O 6 HOH 237 938 432 HOH HOH A . 
O 6 HOH 238 939 433 HOH HOH A . 
O 6 HOH 239 940 435 HOH HOH A . 
O 6 HOH 240 941 436 HOH HOH A . 
O 6 HOH 241 942 437 HOH HOH A . 
O 6 HOH 242 943 439 HOH HOH A . 
O 6 HOH 243 944 448 HOH HOH A . 
O 6 HOH 244 945 461 HOH HOH A . 
O 6 HOH 245 946 490 HOH HOH A . 
O 6 HOH 246 947 492 HOH HOH A . 
O 6 HOH 247 948 493 HOH HOH A . 
O 6 HOH 248 949 494 HOH HOH A . 
O 6 HOH 249 950 495 HOH HOH A . 
O 6 HOH 250 951 496 HOH HOH A . 
O 6 HOH 251 952 497 HOH HOH A . 
O 6 HOH 252 953 498 HOH HOH A . 
O 6 HOH 253 954 499 HOH HOH A . 
O 6 HOH 254 955 500 HOH HOH A . 
O 6 HOH 255 956 501 HOH HOH A . 
O 6 HOH 256 957 502 HOH HOH A . 
O 6 HOH 257 958 503 HOH HOH A . 
O 6 HOH 258 959 504 HOH HOH A . 
O 6 HOH 259 960 505 HOH HOH A . 
O 6 HOH 260 961 508 HOH HOH A . 
O 6 HOH 261 962 509 HOH HOH A . 
O 6 HOH 262 963 510 HOH HOH A . 
O 6 HOH 263 964 511 HOH HOH A . 
O 6 HOH 264 965 512 HOH HOH A . 
O 6 HOH 265 966 513 HOH HOH A . 
O 6 HOH 266 967 514 HOH HOH A . 
O 6 HOH 267 968 515 HOH HOH A . 
O 6 HOH 268 969 516 HOH HOH A . 
O 6 HOH 269 970 518 HOH HOH A . 
O 6 HOH 270 971 519 HOH HOH A . 
O 6 HOH 271 972 525 HOH HOH A . 
O 6 HOH 272 973 526 HOH HOH A . 
O 6 HOH 273 974 528 HOH HOH A . 
O 6 HOH 274 975 540 HOH HOH A . 
O 6 HOH 275 976 541 HOH HOH A . 
O 6 HOH 276 977 543 HOH HOH A . 
O 6 HOH 277 978 544 HOH HOH A . 
O 6 HOH 278 979 545 HOH HOH A . 
O 6 HOH 279 980 547 HOH HOH A . 
O 6 HOH 280 981 549 HOH HOH A . 
O 6 HOH 281 982 550 HOH HOH A . 
O 6 HOH 282 983 551 HOH HOH A . 
O 6 HOH 283 984 552 HOH HOH A . 
P 6 HOH 1   703 1   HOH HOH B . 
P 6 HOH 2   704 3   HOH HOH B . 
P 6 HOH 3   705 4   HOH HOH B . 
P 6 HOH 4   706 5   HOH HOH B . 
P 6 HOH 5   707 6   HOH HOH B . 
P 6 HOH 6   708 9   HOH HOH B . 
P 6 HOH 7   709 14  HOH HOH B . 
P 6 HOH 8   710 20  HOH HOH B . 
P 6 HOH 9   711 22  HOH HOH B . 
P 6 HOH 10  712 26  HOH HOH B . 
P 6 HOH 11  713 29  HOH HOH B . 
P 6 HOH 12  714 33  HOH HOH B . 
P 6 HOH 13  715 35  HOH HOH B . 
P 6 HOH 14  716 36  HOH HOH B . 
P 6 HOH 15  717 38  HOH HOH B . 
P 6 HOH 16  718 40  HOH HOH B . 
P 6 HOH 17  719 44  HOH HOH B . 
P 6 HOH 18  720 48  HOH HOH B . 
P 6 HOH 19  721 49  HOH HOH B . 
P 6 HOH 20  722 51  HOH HOH B . 
P 6 HOH 21  723 52  HOH HOH B . 
P 6 HOH 22  724 53  HOH HOH B . 
P 6 HOH 23  725 54  HOH HOH B . 
P 6 HOH 24  726 57  HOH HOH B . 
P 6 HOH 25  727 59  HOH HOH B . 
P 6 HOH 26  728 65  HOH HOH B . 
P 6 HOH 27  729 66  HOH HOH B . 
P 6 HOH 28  730 69  HOH HOH B . 
P 6 HOH 29  731 71  HOH HOH B . 
P 6 HOH 30  732 72  HOH HOH B . 
P 6 HOH 31  733 73  HOH HOH B . 
P 6 HOH 32  734 74  HOH HOH B . 
P 6 HOH 33  735 75  HOH HOH B . 
P 6 HOH 34  736 77  HOH HOH B . 
P 6 HOH 35  737 81  HOH HOH B . 
P 6 HOH 36  738 83  HOH HOH B . 
P 6 HOH 37  739 86  HOH HOH B . 
P 6 HOH 38  740 87  HOH HOH B . 
P 6 HOH 39  741 93  HOH HOH B . 
P 6 HOH 40  742 96  HOH HOH B . 
P 6 HOH 41  743 97  HOH HOH B . 
P 6 HOH 42  744 138 HOH HOH B . 
P 6 HOH 43  745 141 HOH HOH B . 
P 6 HOH 44  746 146 HOH HOH B . 
P 6 HOH 45  747 147 HOH HOH B . 
P 6 HOH 46  748 152 HOH HOH B . 
P 6 HOH 47  749 173 HOH HOH B . 
P 6 HOH 48  750 178 HOH HOH B . 
P 6 HOH 49  751 188 HOH HOH B . 
P 6 HOH 50  752 190 HOH HOH B . 
P 6 HOH 51  753 195 HOH HOH B . 
P 6 HOH 52  754 196 HOH HOH B . 
P 6 HOH 53  755 220 HOH HOH B . 
P 6 HOH 54  756 221 HOH HOH B . 
P 6 HOH 55  757 222 HOH HOH B . 
P 6 HOH 56  758 223 HOH HOH B . 
P 6 HOH 57  759 224 HOH HOH B . 
P 6 HOH 58  760 225 HOH HOH B . 
P 6 HOH 59  761 226 HOH HOH B . 
P 6 HOH 60  762 227 HOH HOH B . 
P 6 HOH 61  763 228 HOH HOH B . 
P 6 HOH 62  764 229 HOH HOH B . 
P 6 HOH 63  765 230 HOH HOH B . 
P 6 HOH 64  766 231 HOH HOH B . 
P 6 HOH 65  767 232 HOH HOH B . 
P 6 HOH 66  768 233 HOH HOH B . 
P 6 HOH 67  769 234 HOH HOH B . 
P 6 HOH 68  770 235 HOH HOH B . 
P 6 HOH 69  771 236 HOH HOH B . 
P 6 HOH 70  772 237 HOH HOH B . 
P 6 HOH 71  773 238 HOH HOH B . 
P 6 HOH 72  774 239 HOH HOH B . 
P 6 HOH 73  775 240 HOH HOH B . 
P 6 HOH 74  776 241 HOH HOH B . 
P 6 HOH 75  777 242 HOH HOH B . 
P 6 HOH 76  778 243 HOH HOH B . 
P 6 HOH 77  779 244 HOH HOH B . 
P 6 HOH 78  780 245 HOH HOH B . 
P 6 HOH 79  781 246 HOH HOH B . 
P 6 HOH 80  782 247 HOH HOH B . 
P 6 HOH 81  783 248 HOH HOH B . 
P 6 HOH 82  784 249 HOH HOH B . 
P 6 HOH 83  785 250 HOH HOH B . 
P 6 HOH 84  786 251 HOH HOH B . 
P 6 HOH 85  787 252 HOH HOH B . 
P 6 HOH 86  788 253 HOH HOH B . 
P 6 HOH 87  789 254 HOH HOH B . 
P 6 HOH 88  790 255 HOH HOH B . 
P 6 HOH 89  791 257 HOH HOH B . 
P 6 HOH 90  792 258 HOH HOH B . 
P 6 HOH 91  793 260 HOH HOH B . 
P 6 HOH 92  794 261 HOH HOH B . 
P 6 HOH 93  795 262 HOH HOH B . 
P 6 HOH 94  796 263 HOH HOH B . 
P 6 HOH 95  797 264 HOH HOH B . 
P 6 HOH 96  798 265 HOH HOH B . 
P 6 HOH 97  799 266 HOH HOH B . 
P 6 HOH 98  800 267 HOH HOH B . 
P 6 HOH 99  801 268 HOH HOH B . 
P 6 HOH 100 802 269 HOH HOH B . 
P 6 HOH 101 803 270 HOH HOH B . 
P 6 HOH 102 804 271 HOH HOH B . 
P 6 HOH 103 805 272 HOH HOH B . 
P 6 HOH 104 806 273 HOH HOH B . 
P 6 HOH 105 807 278 HOH HOH B . 
P 6 HOH 106 808 279 HOH HOH B . 
P 6 HOH 107 809 280 HOH HOH B . 
P 6 HOH 108 810 281 HOH HOH B . 
P 6 HOH 109 811 282 HOH HOH B . 
P 6 HOH 110 812 283 HOH HOH B . 
P 6 HOH 111 813 284 HOH HOH B . 
P 6 HOH 112 814 307 HOH HOH B . 
P 6 HOH 113 815 320 HOH HOH B . 
P 6 HOH 114 816 328 HOH HOH B . 
P 6 HOH 115 817 329 HOH HOH B . 
P 6 HOH 116 818 337 HOH HOH B . 
P 6 HOH 117 819 347 HOH HOH B . 
P 6 HOH 118 820 348 HOH HOH B . 
P 6 HOH 119 821 349 HOH HOH B . 
P 6 HOH 120 822 350 HOH HOH B . 
P 6 HOH 121 823 351 HOH HOH B . 
P 6 HOH 122 824 352 HOH HOH B . 
P 6 HOH 123 825 353 HOH HOH B . 
P 6 HOH 124 826 354 HOH HOH B . 
P 6 HOH 125 827 355 HOH HOH B . 
P 6 HOH 126 828 356 HOH HOH B . 
P 6 HOH 127 829 357 HOH HOH B . 
P 6 HOH 128 830 358 HOH HOH B . 
P 6 HOH 129 831 359 HOH HOH B . 
P 6 HOH 130 832 360