data_2I9W
# 
_entry.id   2I9W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2I9W         
RCSB  RCSB039320   
WWPDB D_1000039320 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          368209 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        2I9W 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-06 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Joint Center for Structural Genomics (JCSG)' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of hypothetical protein (YP_265345.1) from Psychrobacter Arcticum 273-4 at 1.75 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Joint Center for Structural Genomics (JCSG)' 
_citation_author.ordinal       1 
# 
_cell.entry_id           2I9W 
_cell.length_a           41.490 
_cell.length_b           54.690 
_cell.length_c           83.880 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2I9W 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hypothetical protein' 21009.363 1   ? ? ? ? 
2 non-polymer syn 'ZINC ION'             65.409    2   ? ? ? ? 
3 non-polymer syn 'CHLORIDE ION'         35.453    1   ? ? ? ? 
4 water       nat water                  18.015    127 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;G(MSE)LFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQEVEDSDAIRADTAEHL(MSE)RTRYSAFVLVKPEYI
VKTTLPAQQDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWY
FLDPTVS(MSE)SVTQKQPCICGSGEKFKRCCG(MSE)YI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMLFSIQTCPCQINPALNAVSTPLLYQDCCQPYHDGLYNQEVEDSDAIRADTAEHLMRTRYSAFVLVKPEYIVKTTLPAQ
QDLLDIKAIENWAKETDWAGLEVVAHTPKLSKRHAQVEFKAYFKTPDGLQAHHELSTFVKIKNKANSDASWYFLDPTVSM
SVTQKQPCICGSGEKFKRCCGMYI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         368209 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MSE n 
1 3   LEU n 
1 4   PHE n 
1 5   SER n 
1 6   ILE n 
1 7   GLN n 
1 8   THR n 
1 9   CYS n 
1 10  PRO n 
1 11  CYS n 
1 12  GLN n 
1 13  ILE n 
1 14  ASN n 
1 15  PRO n 
1 16  ALA n 
1 17  LEU n 
1 18  ASN n 
1 19  ALA n 
1 20  VAL n 
1 21  SER n 
1 22  THR n 
1 23  PRO n 
1 24  LEU n 
1 25  LEU n 
1 26  TYR n 
1 27  GLN n 
1 28  ASP n 
1 29  CYS n 
1 30  CYS n 
1 31  GLN n 
1 32  PRO n 
1 33  TYR n 
1 34  HIS n 
1 35  ASP n 
1 36  GLY n 
1 37  LEU n 
1 38  TYR n 
1 39  ASN n 
1 40  GLN n 
1 41  GLU n 
1 42  VAL n 
1 43  GLU n 
1 44  ASP n 
1 45  SER n 
1 46  ASP n 
1 47  ALA n 
1 48  ILE n 
1 49  ARG n 
1 50  ALA n 
1 51  ASP n 
1 52  THR n 
1 53  ALA n 
1 54  GLU n 
1 55  HIS n 
1 56  LEU n 
1 57  MSE n 
1 58  ARG n 
1 59  THR n 
1 60  ARG n 
1 61  TYR n 
1 62  SER n 
1 63  ALA n 
1 64  PHE n 
1 65  VAL n 
1 66  LEU n 
1 67  VAL n 
1 68  LYS n 
1 69  PRO n 
1 70  GLU n 
1 71  TYR n 
1 72  ILE n 
1 73  VAL n 
1 74  LYS n 
1 75  THR n 
1 76  THR n 
1 77  LEU n 
1 78  PRO n 
1 79  ALA n 
1 80  GLN n 
1 81  GLN n 
1 82  ASP n 
1 83  LEU n 
1 84  LEU n 
1 85  ASP n 
1 86  ILE n 
1 87  LYS n 
1 88  ALA n 
1 89  ILE n 
1 90  GLU n 
1 91  ASN n 
1 92  TRP n 
1 93  ALA n 
1 94  LYS n 
1 95  GLU n 
1 96  THR n 
1 97  ASP n 
1 98  TRP n 
1 99  ALA n 
1 100 GLY n 
1 101 LEU n 
1 102 GLU n 
1 103 VAL n 
1 104 VAL n 
1 105 ALA n 
1 106 HIS n 
1 107 THR n 
1 108 PRO n 
1 109 LYS n 
1 110 LEU n 
1 111 SER n 
1 112 LYS n 
1 113 ARG n 
1 114 HIS n 
1 115 ALA n 
1 116 GLN n 
1 117 VAL n 
1 118 GLU n 
1 119 PHE n 
1 120 LYS n 
1 121 ALA n 
1 122 TYR n 
1 123 PHE n 
1 124 LYS n 
1 125 THR n 
1 126 PRO n 
1 127 ASP n 
1 128 GLY n 
1 129 LEU n 
1 130 GLN n 
1 131 ALA n 
1 132 HIS n 
1 133 HIS n 
1 134 GLU n 
1 135 LEU n 
1 136 SER n 
1 137 THR n 
1 138 PHE n 
1 139 VAL n 
1 140 LYS n 
1 141 ILE n 
1 142 LYS n 
1 143 ASN n 
1 144 LYS n 
1 145 ALA n 
1 146 ASN n 
1 147 SER n 
1 148 ASP n 
1 149 ALA n 
1 150 SER n 
1 151 TRP n 
1 152 TYR n 
1 153 PHE n 
1 154 LEU n 
1 155 ASP n 
1 156 PRO n 
1 157 THR n 
1 158 VAL n 
1 159 SER n 
1 160 MSE n 
1 161 SER n 
1 162 VAL n 
1 163 THR n 
1 164 GLN n 
1 165 LYS n 
1 166 GLN n 
1 167 PRO n 
1 168 CYS n 
1 169 ILE n 
1 170 CYS n 
1 171 GLY n 
1 172 SER n 
1 173 GLY n 
1 174 GLU n 
1 175 LYS n 
1 176 PHE n 
1 177 LYS n 
1 178 ARG n 
1 179 CYS n 
1 180 CYS n 
1 181 GLY n 
1 182 MSE n 
1 183 TYR n 
1 184 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Psychrobacter 
_entity_src_gen.pdbx_gene_src_gene                 YP_265345.1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Psychrobacter arcticus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     334543 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q4FPZ7_PSYAR 
_struct_ref.pdbx_db_accession          Q4FPZ7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2I9W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 184 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q4FPZ7 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  183 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       183 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2I9W GLY A 1   ? UNP Q4FPZ7 ?   ?   'LEADER SEQUENCE'  0   1 
1 2I9W MSE A 2   ? UNP Q4FPZ7 MET 1   'MODIFIED RESIDUE' 1   2 
1 2I9W MSE A 57  ? UNP Q4FPZ7 MET 56  'MODIFIED RESIDUE' 56  3 
1 2I9W MSE A 160 ? UNP Q4FPZ7 MET 159 'MODIFIED RESIDUE' 159 4 
1 2I9W MSE A 182 ? UNP Q4FPZ7 MET 181 'MODIFIED RESIDUE' 181 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'       ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2I9W 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   44.52 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.description           ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP, NANODROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'0.2M MgCl2, 20.0% PEG-8000, 0.1M TRIS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, NANODROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.details                'Adjustable focusing mirrors in K-B geometry' 
_diffrn_detector.pdbx_collection_date   2006-08-11 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) Double Crystal Monochrometer' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.94926 1.0 
2 0.97939 1.0 
3 0.97925 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_wavelength_list        0.94926,0.97939,0.97925 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     2I9W 
_reflns.d_resolution_high            1.750 
_reflns.d_resolution_low             29.501 
_reflns.number_obs                   19754 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_netI_over_sigmaI        9.190 
_reflns.percent_possible_obs         93.900 
_reflns.B_iso_Wilson_estimate        27.791 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.75 1.81 5713 ? ? 0.361 2.2  ? ? ? ? 3015 83.80 1 1 
1.81 1.89 6838 ? ? 0.303 2.7  ? ? ? ? 3605 88.00 2 1 
1.89 1.97 5933 ? ? 0.229 3.5  ? ? ? ? 3130 90.20 3 1 
1.97 2.07 6339 ? ? 0.172 4.4  ? ? ? ? 3340 93.60 4 1 
2.07 2.20 6776 ? ? 0.121 6.2  ? ? ? ? 3590 95.50 5 1 
2.20 2.37 6831 ? ? 0.097 7.6  ? ? ? ? 3618 96.80 6 1 
2.37 2.61 6949 ? ? 0.07  9.8  ? ? ? ? 3664 97.10 7 1 
2.61 2.99 6896 ? ? 0.059 13.1 ? ? ? ? 3662 97.60 8 1 
2.99 ?    6813 ? ? 0.043 17.6 ? ? ? ? 3650 98.30 9 1 
# 
_refine.entry_id                                 2I9W 
_refine.ls_d_res_high                            1.750 
_refine.ls_d_res_low                             29.501 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.230 
_refine.ls_number_reflns_obs                     19707 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;(1) HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.
 (2) ZN200 IS COORDINATED TO THE SIDE CHAINS OF
 CYS 8, 10, 28 AND 29. ZN201 IS COORDINATED TO THE
 SIDE CHAINS OF CYS 167, 169, 178 AND 179. ZN IS
 MODELED BASED ON ELECTRON DENSITY AND GEOMETRY,
 AND IS SUPPORTED BY X-RAY FLOURESCENCE EXPERIMENTS.
 (3) A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE
 INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY
 OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75
 TO ACCOUNT FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL
 S-MET INCORPORATION.
 (4) ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY.
 (5) THE RESIDUES IN THE DISORDERED REGIONS OF A40-45
 WERE NOT MODELLED.
 (6) THERE ARE UNMODELED DENSITIES NEAR A132 AND A56.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.192 
_refine.ls_R_factor_R_free                       0.238 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1007 
_refine.B_iso_mean                               20.135 
_refine.aniso_B[1][1]                            1.600 
_refine.aniso_B[2][2]                            -0.260 
_refine.aniso_B[3][3]                            -1.340 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.pdbx_overall_ESU_R                       0.119 
_refine.pdbx_overall_ESU_R_Free                  0.121 
_refine.overall_SU_ML                            0.083 
_refine.overall_SU_B                             4.648 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_obs                          0.19392 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      0.194 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1370 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             127 
_refine_hist.number_atoms_total               1500 
_refine_hist.d_res_high                       1.750 
_refine_hist.d_res_low                        29.501 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1429 0.015  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           940  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1950 1.522  1.943  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2307 0.903  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   180  5.811  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   59   37.610 24.068 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   230  13.377 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    7.590  15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           220  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1586 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       284  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            249  0.235  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              905  0.189  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          680  0.181  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            699  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    79   0.131  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   18   0.289  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     34   0.269  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 7    0.125  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              967  2.096  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           352  0.505  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1454 2.978  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              593  4.796  8.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             493  6.423  11.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.751 
_refine_ls_shell.d_res_low                        1.797 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.880 
_refine_ls_shell.number_reflns_R_work             1350 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.R_factor_R_free                  0.287 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1418 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2I9W 
_struct.title                     
'Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 A resolution' 
_struct.pdbx_descriptor           
'Crystal structure of hypothetical protein (YP_265345.1) from PSYCHROBACTER ARCTICUM 273-4 at 1.75 A resolution' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;Cystatin-like fold, sec-c motif fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, metal binding protein
;
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.entry_id        2I9W 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT 
OF A MONOMER AS A BIOLOGICALLY SIGNIFICANT 
OLIGOMERIZATION STATE.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MSE A 2   ? GLN A 7   ? MSE A 1   GLN A 6   5 ? 6  
HELX_P HELX_P2 2 CYS A 9   ? ILE A 13  ? CYS A 8   ILE A 12  5 ? 5  
HELX_P HELX_P3 3 LEU A 25  ? CYS A 29  ? LEU A 24  CYS A 28  5 ? 5  
HELX_P HELX_P4 4 CYS A 30  ? GLN A 40  ? CYS A 29  GLN A 39  1 ? 11 
HELX_P HELX_P5 5 THR A 52  ? VAL A 67  ? THR A 51  VAL A 66  1 ? 16 
HELX_P HELX_P6 6 LYS A 68  ? THR A 75  ? LYS A 67  THR A 74  1 ? 8  
HELX_P HELX_P7 7 LEU A 77  ? LEU A 84  ? LEU A 76  LEU A 83  5 ? 8  
HELX_P HELX_P8 8 ASP A 85  ? THR A 96  ? ASP A 84  THR A 95  1 ? 12 
HELX_P HELX_P9 9 LYS A 175 ? TYR A 183 ? LYS A 174 TYR A 182 5 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A MSE 2   C  ? ? ? 1_555 A LEU 3   N  ? ? A MSE 1   A LEU 2   1_555 ? ? ? ? ? ? ? 1.335 ? 
covale2 covale ? ? A LEU 56  C  ? ? ? 1_555 A MSE 57  N  ? ? A LEU 55  A MSE 56  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3 covale ? ? A MSE 57  C  ? ? ? 1_555 A ARG 58  N  ? ? A MSE 56  A ARG 57  1_555 ? ? ? ? ? ? ? 1.343 ? 
covale4 covale ? ? A SER 159 C  ? ? ? 1_555 A MSE 160 N  ? ? A SER 158 A MSE 159 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale5 covale ? ? A MSE 160 C  ? ? ? 1_555 A SER 161 N  ? ? A MSE 159 A SER 160 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale6 covale ? ? A GLY 181 C  ? ? ? 1_555 A MSE 182 N  ? ? A GLY 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale7 covale ? ? A MSE 182 C  ? ? ? 1_555 A TYR 183 N  ? ? A MSE 181 A TYR 182 1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc1 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A CYS 9   SG ? ? A ZN  200 A CYS 8   1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc2 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A CYS 11  SG ? ? A ZN  200 A CYS 10  1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc3 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A CYS 30  SG ? ? A ZN  200 A CYS 29  1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc4 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A CYS 29  SG ? ? A ZN  200 A CYS 28  1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc5 metalc ? ? C ZN  .   ZN ? ? ? 1_555 A CYS 179 SG ? ? A ZN  201 A CYS 178 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc6 metalc ? ? C ZN  .   ZN ? ? ? 1_555 A CYS 168 SG ? ? A ZN  201 A CYS 167 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc7 metalc ? ? C ZN  .   ZN ? ? ? 1_555 A CYS 180 SG ? ? A ZN  201 A CYS 179 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc8 metalc ? ? C ZN  .   ZN ? ? ? 1_555 A CYS 170 SG ? ? A ZN  201 A CYS 169 1_555 ? ? ? ? ? ? ? 2.368 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 97  ? THR A 107 ? ASP A 96  THR A 106 
A 2 HIS A 114 ? THR A 125 ? HIS A 113 THR A 124 
A 3 GLY A 128 ? LYS A 142 ? GLY A 127 LYS A 141 
A 4 ALA A 149 ? PHE A 153 ? ALA A 148 PHE A 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 107 ? N THR A 106 O GLN A 116 ? O GLN A 115 
A 2 3 N PHE A 123 ? N PHE A 122 O GLN A 130 ? O GLN A 129 
A 3 4 N VAL A 139 ? N VAL A 138 O TYR A 152 ? O TYR A 151 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 200' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 9   ? CYS A 8   . ? 1_555 ? 
2  AC1 4 CYS A 11  ? CYS A 10  . ? 1_555 ? 
3  AC1 4 CYS A 29  ? CYS A 28  . ? 1_555 ? 
4  AC1 4 CYS A 30  ? CYS A 29  . ? 1_555 ? 
5  AC2 4 CYS A 168 ? CYS A 167 . ? 1_555 ? 
6  AC2 4 CYS A 170 ? CYS A 169 . ? 1_555 ? 
7  AC2 4 CYS A 179 ? CYS A 178 . ? 1_555 ? 
8  AC2 4 CYS A 180 ? CYS A 179 . ? 1_555 ? 
9  AC3 2 SER A 161 ? SER A 160 . ? 1_555 ? 
10 AC3 2 LYS A 175 ? LYS A 174 . ? 4_565 ? 
# 
_atom_sites.entry_id                    2I9W 
_atom_sites.fract_transf_matrix[1][1]   0.02410 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01829 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.01192 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
SE 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . MSE A 1 2   ? 22.428 4.869  21.045 1.00 31.26 ? 1   MSE A N   1 
HETATM 2    C  CA  . MSE A 1 2   ? 21.374 3.987  20.470 1.00 28.10 ? 1   MSE A CA  1 
HETATM 3    C  C   . MSE A 1 2   ? 20.251 3.712  21.447 1.00 29.74 ? 1   MSE A C   1 
HETATM 4    O  O   . MSE A 1 2   ? 19.069 3.731  21.055 1.00 31.57 ? 1   MSE A O   1 
HETATM 5    C  CB  . MSE A 1 2   ? 21.968 2.673  19.972 1.00 30.80 ? 1   MSE A CB  1 
HETATM 6    C  CG  . MSE A 1 2   ? 22.866 1.895  20.929 1.00 29.73 ? 1   MSE A CG  1 
HETATM 7    SE SE  . MSE A 1 2   ? 23.680 0.340  19.970 0.75 21.51 ? 1   MSE A SE  1 
HETATM 8    C  CE  . MSE A 1 2   ? 22.174 0.087  18.735 1.00 30.50 ? 1   MSE A CE  1 
ATOM   9    N  N   . LEU A 1 3   ? 20.604 3.502  22.717 1.00 30.30 ? 2   LEU A N   1 
ATOM   10   C  CA  . LEU A 1 3   ? 19.594 3.193  23.740 1.00 31.62 ? 2   LEU A CA  1 
ATOM   11   C  C   . LEU A 1 3   ? 18.788 4.448  24.182 1.00 31.30 ? 2   LEU A C   1 
ATOM   12   O  O   . LEU A 1 3   ? 17.911 4.356  25.052 1.00 31.13 ? 2   LEU A O   1 
ATOM   13   C  CB  . LEU A 1 3   ? 20.234 2.467  24.925 1.00 34.77 ? 2   LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 3   ? 20.633 1.000  24.656 1.00 38.14 ? 2   LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 3   ? 21.620 0.456  25.709 1.00 46.66 ? 2   LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 3   ? 19.398 0.104  24.587 1.00 39.54 ? 2   LEU A CD2 1 
ATOM   17   N  N   . PHE A 1 4   ? 19.050 5.610  23.569 1.00 30.86 ? 3   PHE A N   1 
ATOM   18   C  CA  . PHE A 1 4   ? 18.182 6.779  23.787 1.00 31.67 ? 3   PHE A CA  1 
ATOM   19   C  C   . PHE A 1 4   ? 16.801 6.547  23.258 1.00 29.92 ? 3   PHE A C   1 
ATOM   20   O  O   . PHE A 1 4   ? 15.866 7.169  23.751 1.00 27.18 ? 3   PHE A O   1 
ATOM   21   C  CB  . PHE A 1 4   ? 18.729 8.087  23.190 1.00 31.96 ? 3   PHE A CB  1 
ATOM   22   C  CG  . PHE A 1 4   ? 19.638 8.815  24.112 1.00 33.15 ? 3   PHE A CG  1 
ATOM   23   C  CD1 . PHE A 1 4   ? 19.176 9.258  25.345 1.00 38.79 ? 3   PHE A CD1 1 
ATOM   24   C  CD2 . PHE A 1 4   ? 20.966 9.037  23.768 1.00 37.54 ? 3   PHE A CD2 1 
ATOM   25   C  CE1 . PHE A 1 4   ? 20.016 9.910  26.224 1.00 43.04 ? 3   PHE A CE1 1 
ATOM   26   C  CE2 . PHE A 1 4   ? 21.823 9.691  24.638 1.00 39.06 ? 3   PHE A CE2 1 
ATOM   27   C  CZ  . PHE A 1 4   ? 21.346 10.130 25.880 1.00 42.40 ? 3   PHE A CZ  1 
ATOM   28   N  N   . SER A 1 5   ? 16.676 5.637  22.281 1.00 28.19 ? 4   SER A N   1 
ATOM   29   C  CA  . SER A 1 5   ? 15.372 5.189  21.793 1.00 26.10 ? 4   SER A CA  1 
ATOM   30   C  C   . SER A 1 5   ? 14.424 4.844  22.891 1.00 27.24 ? 4   SER A C   1 
ATOM   31   O  O   . SER A 1 5   ? 13.260 5.140  22.785 1.00 26.66 ? 4   SER A O   1 
ATOM   32   C  CB  . SER A 1 5   ? 15.535 3.969  20.899 1.00 26.97 ? 4   SER A CB  1 
ATOM   33   O  OG  . SER A 1 5   ? 16.177 4.331  19.709 1.00 33.36 ? 4   SER A OG  1 
ATOM   34   N  N   . ILE A 1 6   ? 14.920 4.197  23.947 1.00 26.83 ? 5   ILE A N   1 
ATOM   35   C  CA  . ILE A 1 6   ? 14.060 3.735  25.014 1.00 28.04 ? 5   ILE A CA  1 
ATOM   36   C  C   . ILE A 1 6   ? 14.098 4.605  26.283 1.00 28.87 ? 5   ILE A C   1 
ATOM   37   O  O   . ILE A 1 6   ? 13.541 4.243  27.326 1.00 31.44 ? 5   ILE A O   1 
ATOM   38   C  CB  . ILE A 1 6   ? 14.287 2.200  25.288 1.00 27.05 ? 5   ILE A CB  1 
ATOM   39   C  CG1 . ILE A 1 6   ? 15.630 1.911  25.954 1.00 29.96 ? 5   ILE A CG1 1 
ATOM   40   C  CG2 . ILE A 1 6   ? 14.116 1.403  23.968 1.00 29.30 ? 5   ILE A CG2 1 
ATOM   41   C  CD1 . ILE A 1 6   ? 15.692 0.463  26.517 1.00 24.19 ? 5   ILE A CD1 1 
ATOM   42   N  N   . GLN A 1 7   ? 14.672 5.797  26.168 1.00 30.65 ? 6   GLN A N   1 
ATOM   43   C  CA  . GLN A 1 7   ? 14.544 6.792  27.230 1.00 30.96 ? 6   GLN A CA  1 
ATOM   44   C  C   . GLN A 1 7   ? 13.641 7.913  26.788 1.00 28.25 ? 6   GLN A C   1 
ATOM   45   O  O   . GLN A 1 7   ? 13.312 8.011  25.606 1.00 22.67 ? 6   GLN A O   1 
ATOM   46   C  CB  . GLN A 1 7   ? 15.898 7.346  27.637 1.00 34.55 ? 6   GLN A CB  1 
ATOM   47   C  CG  . GLN A 1 7   ? 16.759 6.316  28.354 1.00 41.03 ? 6   GLN A CG  1 
ATOM   48   C  CD  . GLN A 1 7   ? 16.270 5.965  29.761 1.00 44.10 ? 6   GLN A CD  1 
ATOM   49   O  OE1 . GLN A 1 7   ? 15.801 6.831  30.510 1.00 44.39 ? 6   GLN A OE1 1 
ATOM   50   N  NE2 . GLN A 1 7   ? 16.409 4.699  30.128 1.00 46.09 ? 6   GLN A NE2 1 
ATOM   51   N  N   . THR A 1 8   ? 13.204 8.704  27.769 1.00 25.50 ? 7   THR A N   1 
ATOM   52   C  CA  . THR A 1 8   ? 12.318 9.815  27.535 1.00 24.35 ? 7   THR A CA  1 
ATOM   53   C  C   . THR A 1 8   ? 12.867 10.659 26.373 1.00 21.44 ? 7   THR A C   1 
ATOM   54   O  O   . THR A 1 8   ? 14.066 11.022 26.303 1.00 20.05 ? 7   THR A O   1 
ATOM   55   C  CB  . THR A 1 8   ? 12.076 10.641 28.838 1.00 24.50 ? 7   THR A CB  1 
ATOM   56   O  OG1 . THR A 1 8   ? 11.621 9.774  29.901 1.00 22.99 ? 7   THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 8   ? 11.092 11.749 28.626 1.00 22.79 ? 7   THR A CG2 1 
ATOM   58   N  N   . CYS A 1 9   ? 11.993 10.953 25.442 1.00 17.50 ? 8   CYS A N   1 
ATOM   59   C  CA  . CYS A 1 9   ? 12.355 11.843 24.342 1.00 19.10 ? 8   CYS A CA  1 
ATOM   60   C  C   . CYS A 1 9   ? 12.868 13.178 24.911 1.00 17.81 ? 8   CYS A C   1 
ATOM   61   O  O   . CYS A 1 9   ? 12.289 13.715 25.856 1.00 19.14 ? 8   CYS A O   1 
ATOM   62   C  CB  . CYS A 1 9   ? 11.191 12.101 23.420 1.00 17.42 ? 8   CYS A CB  1 
ATOM   63   S  SG  . CYS A 1 9   ? 11.741 12.880 21.886 1.00 18.79 ? 8   CYS A SG  1 
ATOM   64   N  N   . PRO A 1 10  ? 13.958 13.728 24.361 1.00 19.89 ? 9   PRO A N   1 
ATOM   65   C  CA  . PRO A 1 10  ? 14.386 14.985 24.973 1.00 18.94 ? 9   PRO A CA  1 
ATOM   66   C  C   . PRO A 1 10  ? 13.302 16.045 25.059 1.00 20.93 ? 9   PRO A C   1 
ATOM   67   O  O   . PRO A 1 10  ? 13.248 16.749 26.057 1.00 23.12 ? 9   PRO A O   1 
ATOM   68   C  CB  . PRO A 1 10  ? 15.564 15.421 24.116 1.00 20.25 ? 9   PRO A CB  1 
ATOM   69   C  CG  . PRO A 1 10  ? 16.107 14.174 23.555 1.00 19.59 ? 9   PRO A CG  1 
ATOM   70   C  CD  . PRO A 1 10  ? 14.919 13.264 23.348 1.00 20.22 ? 9   PRO A CD  1 
ATOM   71   N  N   . CYS A 1 11  ? 12.430 16.143 24.057 1.00 17.74 ? 10  CYS A N   1 
ATOM   72   C  CA  . CYS A 1 11  ? 11.399 17.200 24.044 1.00 18.89 ? 10  CYS A CA  1 
ATOM   73   C  C   . CYS A 1 11  ? 10.325 17.025 25.092 1.00 20.63 ? 10  CYS A C   1 
ATOM   74   O  O   . CYS A 1 11  ? 9.518  17.941 25.304 1.00 21.43 ? 10  CYS A O   1 
ATOM   75   C  CB  . CYS A 1 11  ? 10.739 17.351 22.670 1.00 17.85 ? 10  CYS A CB  1 
ATOM   76   S  SG  . CYS A 1 11  ? 9.403  16.233 22.381 1.00 20.58 ? 10  CYS A SG  1 
ATOM   77   N  N   . GLN A 1 12  ? 10.302 15.847 25.716 1.00 19.47 ? 11  GLN A N   1 
ATOM   78   C  CA  . GLN A 1 12  ? 9.333  15.497 26.740 1.00 23.03 ? 11  GLN A CA  1 
ATOM   79   C  C   . GLN A 1 12  ? 9.852  15.771 28.147 1.00 20.93 ? 11  GLN A C   1 
ATOM   80   O  O   . GLN A 1 12  ? 9.109  15.591 29.109 1.00 22.82 ? 11  GLN A O   1 
ATOM   81   C  CB  . GLN A 1 12  ? 8.964  14.021 26.646 1.00 23.68 ? 11  GLN A CB  1 
ATOM   82   C  CG  . GLN A 1 12  ? 8.354  13.643 25.334 1.00 24.12 ? 11  GLN A CG  1 
ATOM   83   C  CD  . GLN A 1 12  ? 6.893  13.948 25.256 1.00 35.96 ? 11  GLN A CD  1 
ATOM   84   O  OE1 . GLN A 1 12  ? 6.106  13.470 26.076 1.00 34.11 ? 11  GLN A OE1 1 
ATOM   85   N  NE2 . GLN A 1 12  ? 6.501  14.720 24.246 1.00 34.65 ? 11  GLN A NE2 1 
ATOM   86   N  N   . ILE A 1 13  ? 11.112 16.182 28.263 1.00 19.88 ? 12  ILE A N   1 
ATOM   87   C  CA  . ILE A 1 13  ? 11.676 16.600 29.540 1.00 21.91 ? 12  ILE A CA  1 
ATOM   88   C  C   . ILE A 1 13  ? 11.323 18.070 29.819 1.00 22.29 ? 12  ILE A C   1 
ATOM   89   O  O   . ILE A 1 13  ? 11.762 18.970 29.130 1.00 21.44 ? 12  ILE A O   1 
ATOM   90   C  CB  . ILE A 1 13  ? 13.202 16.321 29.548 1.00 20.95 ? 12  ILE A CB  1 
ATOM   91   C  CG1 . ILE A 1 13  ? 13.387 14.789 29.511 1.00 27.06 ? 12  ILE A CG1 1 
ATOM   92   C  CG2 . ILE A 1 13  ? 13.846 16.890 30.843 1.00 25.16 ? 12  ILE A CG2 1 
ATOM   93   C  CD1 . ILE A 1 13  ? 14.674 14.337 29.018 1.00 27.87 ? 12  ILE A CD1 1 
ATOM   94   N  N   . ASN A 1 14  ? 10.486 18.303 30.819 1.00 21.71 ? 13  ASN A N   1 
ATOM   95   C  CA  . ASN A 1 14  ? 10.007 19.656 31.071 1.00 22.18 ? 13  ASN A CA  1 
ATOM   96   C  C   . ASN A 1 14  ? 10.142 19.978 32.574 1.00 21.90 ? 13  ASN A C   1 
ATOM   97   O  O   . ASN A 1 14  ? 9.319  19.542 33.383 1.00 18.97 ? 13  ASN A O   1 
ATOM   98   C  CB  . ASN A 1 14  ? 8.565  19.823 30.591 1.00 21.08 ? 13  ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 14  ? 8.008  21.198 30.878 1.00 24.69 ? 13  ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 14  ? 8.669  22.069 31.493 1.00 20.81 ? 13  ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 14  ? 6.791  21.413 30.437 1.00 25.31 ? 13  ASN A ND2 1 
ATOM   102  N  N   . PRO A 1 15  ? 11.191 20.729 32.949 1.00 20.49 ? 14  PRO A N   1 
ATOM   103  C  CA  . PRO A 1 15  ? 11.351 20.985 34.380 1.00 18.75 ? 14  PRO A CA  1 
ATOM   104  C  C   . PRO A 1 15  ? 10.235 21.818 35.033 1.00 19.87 ? 14  PRO A C   1 
ATOM   105  O  O   . PRO A 1 15  ? 10.137 21.846 36.266 1.00 21.61 ? 14  PRO A O   1 
ATOM   106  C  CB  . PRO A 1 15  ? 12.728 21.687 34.470 1.00 20.48 ? 14  PRO A CB  1 
ATOM   107  C  CG  . PRO A 1 15  ? 13.086 22.071 33.113 1.00 24.19 ? 14  PRO A CG  1 
ATOM   108  C  CD  . PRO A 1 15  ? 12.268 21.337 32.148 1.00 21.69 ? 14  PRO A CD  1 
ATOM   109  N  N   . ALA A 1 16  ? 9.386  22.434 34.216 1.00 19.64 ? 15  ALA A N   1 
ATOM   110  C  CA  . ALA A 1 16  ? 8.322  23.307 34.694 1.00 21.00 ? 15  ALA A CA  1 
ATOM   111  C  C   . ALA A 1 16  ? 7.040  22.547 34.982 1.00 24.17 ? 15  ALA A C   1 
ATOM   112  O  O   . ALA A 1 16  ? 6.084  23.139 35.487 1.00 25.54 ? 15  ALA A O   1 
ATOM   113  C  CB  . ALA A 1 16  ? 8.059  24.437 33.687 1.00 20.02 ? 15  ALA A CB  1 
ATOM   114  N  N   . LEU A 1 17  ? 7.029  21.236 34.726 1.00 23.43 ? 16  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 17  ? 5.823  20.432 34.881 1.00 25.19 ? 16  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 17  ? 6.133  19.081 35.534 1.00 23.54 ? 16  LEU A C   1 
ATOM   117  O  O   . LEU A 1 17  ? 7.063  18.385 35.136 1.00 22.79 ? 16  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 17  ? 5.171  20.215 33.514 1.00 26.47 ? 16  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 17  ? 3.848  19.426 33.426 1.00 27.31 ? 16  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 17  ? 2.653  20.169 33.964 1.00 33.56 ? 16  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 17  ? 3.615  19.060 32.004 1.00 29.05 ? 16  LEU A CD2 1 
ATOM   122  N  N   . ASN A 1 18  ? 5.342  18.741 36.540 1.00 21.40 ? 17  ASN A N   1 
ATOM   123  C  CA  . ASN A 1 18  ? 5.321  17.406 37.127 1.00 19.27 ? 17  ASN A CA  1 
ATOM   124  C  C   . ASN A 1 18  ? 3.977  16.849 36.683 1.00 21.90 ? 17  ASN A C   1 
ATOM   125  O  O   . ASN A 1 18  ? 2.930  17.239 37.188 1.00 23.23 ? 17  ASN A O   1 
ATOM   126  C  CB  . ASN A 1 18  ? 5.487  17.468 38.637 1.00 19.10 ? 17  ASN A CB  1 
ATOM   127  C  CG  . ASN A 1 18  ? 5.562  16.093 39.283 1.00 16.01 ? 17  ASN A CG  1 
ATOM   128  O  OD1 . ASN A 1 18  ? 4.543  15.450 39.471 1.00 18.64 ? 17  ASN A OD1 1 
ATOM   129  N  ND2 . ASN A 1 18  ? 6.757  15.690 39.732 1.00 18.83 ? 17  ASN A ND2 1 
ATOM   130  N  N   . ALA A 1 19  ? 4.010  16.004 35.662 1.00 25.01 ? 18  ALA A N   1 
ATOM   131  C  CA  . ALA A 1 19  ? 2.793  15.545 34.997 1.00 26.24 ? 18  ALA A CA  1 
ATOM   132  C  C   . ALA A 1 19  ? 2.337  14.186 35.518 1.00 23.41 ? 18  ALA A C   1 
ATOM   133  O  O   . ALA A 1 19  ? 3.116  13.453 36.150 1.00 20.48 ? 18  ALA A O   1 
ATOM   134  C  CB  . ALA A 1 19  ? 3.027  15.467 33.487 1.00 26.64 ? 18  ALA A CB  1 
ATOM   135  N  N   . VAL A 1 20  ? 1.086  13.849 35.196 1.00 23.98 ? 19  VAL A N   1 
ATOM   136  C  CA  . VAL A 1 20  ? 0.506  12.519 35.473 1.00 21.59 ? 19  VAL A CA  1 
ATOM   137  C  C   . VAL A 1 20  ? 0.838  11.596 34.291 1.00 21.15 ? 19  VAL A C   1 
ATOM   138  O  O   . VAL A 1 20  ? 1.277  10.465 34.490 1.00 21.85 ? 19  VAL A O   1 
ATOM   139  C  CB  . VAL A 1 20  ? -1.049 12.563 35.698 1.00 22.00 ? 19  VAL A CB  1 
ATOM   140  C  CG1 . VAL A 1 20  ? -1.659 11.134 35.834 1.00 17.92 ? 19  VAL A CG1 1 
ATOM   141  C  CG2 . VAL A 1 20  ? -1.397 13.334 36.945 1.00 18.84 ? 19  VAL A CG2 1 
ATOM   142  N  N   . SER A 1 21  ? 0.610  12.073 33.069 1.00 21.12 ? 20  SER A N   1 
ATOM   143  C  CA  . SER A 1 21  ? 0.876  11.271 31.884 1.00 22.86 ? 20  SER A CA  1 
ATOM   144  C  C   . SER A 1 21  ? 2.368  11.061 31.775 1.00 22.07 ? 20  SER A C   1 
ATOM   145  O  O   . SER A 1 21  ? 3.139  11.997 31.947 1.00 24.75 ? 20  SER A O   1 
ATOM   146  C  CB  . SER A 1 21  ? 0.331  11.921 30.610 1.00 22.97 ? 20  SER A CB  1 
ATOM   147  O  OG  . SER A 1 21  ? -1.073 11.730 30.498 1.00 30.06 ? 20  SER A OG  1 
ATOM   148  N  N   . THR A 1 22  ? 2.757  9.826  31.482 1.00 20.74 ? 21  THR A N   1 
ATOM   149  C  CA  . THR A 1 22  ? 4.161  9.480  31.346 1.00 21.66 ? 21  THR A CA  1 
ATOM   150  C  C   . THR A 1 22  ? 4.757  10.093 30.089 1.00 21.49 ? 21  THR A C   1 
ATOM   151  O  O   . THR A 1 22  ? 4.185  9.978  28.994 1.00 21.16 ? 21  THR A O   1 
ATOM   152  C  CB  . THR A 1 22  ? 4.340  7.978  31.292 1.00 21.68 ? 21  THR A CB  1 
ATOM   153  O  OG1 . THR A 1 22  ? 3.596  7.375  32.357 1.00 22.04 ? 21  THR A OG1 1 
ATOM   154  C  CG2 . THR A 1 22  ? 5.823  7.610  31.412 1.00 26.19 ? 21  THR A CG2 1 
ATOM   155  N  N   . PRO A 1 23  ? 5.903  10.767 30.223 1.00 21.51 ? 22  PRO A N   1 
ATOM   156  C  CA  . PRO A 1 23  ? 6.533  11.317 29.027 1.00 23.50 ? 22  PRO A CA  1 
ATOM   157  C  C   . PRO A 1 23  ? 6.874  10.253 27.986 1.00 25.27 ? 22  PRO A C   1 
ATOM   158  O  O   . PRO A 1 23  ? 7.321  9.162  28.326 1.00 24.93 ? 22  PRO A O   1 
ATOM   159  C  CB  . PRO A 1 23  ? 7.828  11.947 29.552 1.00 24.78 ? 22  PRO A CB  1 
ATOM   160  C  CG  . PRO A 1 23  ? 7.715  11.994 31.023 1.00 26.52 ? 22  PRO A CG  1 
ATOM   161  C  CD  . PRO A 1 23  ? 6.663  11.052 31.460 1.00 22.38 ? 22  PRO A CD  1 
ATOM   162  N  N   . LEU A 1 24  ? 6.696  10.582 26.711 1.00 26.18 ? 23  LEU A N   1 
ATOM   163  C  CA  . LEU A 1 24  ? 6.954  9.601  25.650 1.00 23.35 ? 23  LEU A CA  1 
ATOM   164  C  C   . LEU A 1 24  ? 8.431  9.308  25.488 1.00 20.97 ? 23  LEU A C   1 
ATOM   165  O  O   . LEU A 1 24  ? 9.283  10.157 25.785 1.00 21.83 ? 23  LEU A O   1 
ATOM   166  C  CB  . LEU A 1 24  ? 6.371  10.066 24.315 1.00 25.11 ? 23  LEU A CB  1 
ATOM   167  C  CG  . LEU A 1 24  ? 4.929  10.538 24.216 1.00 26.75 ? 23  LEU A CG  1 
ATOM   168  C  CD1 . LEU A 1 24  ? 4.569  10.986 22.765 1.00 26.85 ? 23  LEU A CD1 1 
ATOM   169  C  CD2 . LEU A 1 24  ? 3.992  9.425  24.678 1.00 26.19 ? 23  LEU A CD2 1 
ATOM   170  N  N   . LEU A 1 25  ? 8.725  8.082  25.057 1.00 22.65 ? 24  LEU A N   1 
ATOM   171  C  CA  . LEU A 1 25  ? 10.082 7.686  24.673 1.00 20.97 ? 24  LEU A CA  1 
ATOM   172  C  C   . LEU A 1 25  ? 10.478 8.282  23.337 1.00 19.20 ? 24  LEU A C   1 
ATOM   173  O  O   . LEU A 1 25  ? 9.640  8.556  22.462 1.00 19.10 ? 24  LEU A O   1 
ATOM   174  C  CB  . LEU A 1 25  ? 10.235 6.177  24.587 1.00 20.85 ? 24  LEU A CB  1 
ATOM   175  C  CG  . LEU A 1 25  ? 9.966  5.366  25.877 1.00 23.69 ? 24  LEU A CG  1 
ATOM   176  C  CD1 . LEU A 1 25  ? 10.316 3.871  25.672 1.00 27.30 ? 24  LEU A CD1 1 
ATOM   177  C  CD2 . LEU A 1 25  ? 10.713 5.976  27.073 1.00 23.40 ? 24  LEU A CD2 1 
ATOM   178  N  N   . TYR A 1 26  ? 11.783 8.489  23.173 1.00 21.45 ? 25  TYR A N   1 
ATOM   179  C  CA  . TYR A 1 26  ? 12.311 8.986  21.888 1.00 21.38 ? 25  TYR A CA  1 
ATOM   180  C  C   . TYR A 1 26  ? 11.758 8.207  20.651 1.00 24.59 ? 25  TYR A C   1 
ATOM   181  O  O   . TYR A 1 26  ? 11.192 8.818  19.712 1.00 20.04 ? 25  TYR A O   1 
ATOM   182  C  CB  . TYR A 1 26  ? 13.834 8.967  21.952 1.00 21.38 ? 25  TYR A CB  1 
ATOM   183  C  CG  . TYR A 1 26  ? 14.533 9.433  20.688 1.00 18.85 ? 25  TYR A CG  1 
ATOM   184  C  CD1 . TYR A 1 26  ? 14.206 10.637 20.063 1.00 16.88 ? 25  TYR A CD1 1 
ATOM   185  C  CD2 . TYR A 1 26  ? 15.538 8.663  20.105 1.00 19.38 ? 25  TYR A CD2 1 
ATOM   186  C  CE1 . TYR A 1 26  ? 14.894 11.062 18.911 1.00 17.33 ? 25  TYR A CE1 1 
ATOM   187  C  CE2 . TYR A 1 26  ? 16.222 9.082  18.940 1.00 20.48 ? 25  TYR A CE2 1 
ATOM   188  C  CZ  . TYR A 1 26  ? 15.876 10.266 18.340 1.00 20.96 ? 25  TYR A CZ  1 
ATOM   189  O  OH  . TYR A 1 26  ? 16.538 10.677 17.199 1.00 17.60 ? 25  TYR A OH  1 
ATOM   190  N  N   . GLN A 1 27  ? 11.849 6.875  20.678 1.00 21.12 ? 26  GLN A N   1 
ATOM   191  C  CA  . GLN A 1 27  ? 11.335 6.055  19.574 1.00 23.28 ? 26  GLN A CA  1 
ATOM   192  C  C   . GLN A 1 27  ? 9.869  6.316  19.229 1.00 19.89 ? 26  GLN A C   1 
ATOM   193  O  O   . GLN A 1 27  ? 9.431  6.068  18.099 1.00 21.26 ? 26  GLN A O   1 
ATOM   194  C  CB  . GLN A 1 27  ? 11.532 4.562  19.855 1.00 24.11 ? 26  GLN A CB  1 
ATOM   195  C  CG  . GLN A 1 27  ? 10.778 4.010  21.046 1.00 26.42 ? 26  GLN A CG  1 
ATOM   196  C  CD  . GLN A 1 27  ? 11.115 2.526  21.341 1.00 27.02 ? 26  GLN A CD  1 
ATOM   197  O  OE1 . GLN A 1 27  ? 12.003 1.934  20.739 1.00 38.35 ? 26  GLN A OE1 1 
ATOM   198  N  NE2 . GLN A 1 27  ? 10.414 1.961  22.292 1.00 32.73 ? 26  GLN A NE2 1 
ATOM   199  N  N   . ASP A 1 28  ? 9.119  6.802  20.209 1.00 21.06 ? 27  ASP A N   1 
ATOM   200  C  CA  . ASP A 1 28  ? 7.688  7.002  20.087 1.00 21.44 ? 27  ASP A CA  1 
ATOM   201  C  C   . ASP A 1 28  ? 7.332  8.452  19.856 1.00 22.53 ? 27  ASP A C   1 
ATOM   202  O  O   . ASP A 1 28  ? 6.155  8.780  19.825 1.00 20.45 ? 27  ASP A O   1 
ATOM   203  C  CB  . ASP A 1 28  ? 6.989  6.527  21.377 1.00 21.88 ? 27  ASP A CB  1 
ATOM   204  C  CG  . ASP A 1 28  ? 7.088  5.049  21.568 1.00 22.69 ? 27  ASP A CG  1 
ATOM   205  O  OD1 . ASP A 1 28  ? 6.955  4.347  20.547 1.00 22.70 ? 27  ASP A OD1 1 
ATOM   206  O  OD2 . ASP A 1 28  ? 7.319  4.621  22.711 1.00 24.54 ? 27  ASP A OD2 1 
ATOM   207  N  N   . CYS A 1 29  ? 8.339  9.322  19.752 1.00 20.60 ? 28  CYS A N   1 
ATOM   208  C  CA  . CYS A 1 29  ? 8.131  10.774 19.664 1.00 19.96 ? 28  CYS A CA  1 
ATOM   209  C  C   . CYS A 1 29  ? 8.942  11.370 18.487 1.00 19.63 ? 28  CYS A C   1 
ATOM   210  O  O   . CYS A 1 29  ? 8.484  11.310 17.346 1.00 18.81 ? 28  CYS A O   1 
ATOM   211  C  CB  . CYS A 1 29  ? 8.447  11.453 21.019 1.00 19.13 ? 28  CYS A CB  1 
ATOM   212  S  SG  . CYS A 1 29  ? 8.006  13.216 21.124 1.00 19.96 ? 28  CYS A SG  1 
ATOM   213  N  N   . CYS A 1 30  ? 10.170 11.876 18.742 1.00 16.32 ? 29  CYS A N   1 
ATOM   214  C  CA  . CYS A 1 30  ? 10.921 12.595 17.720 1.00 17.07 ? 29  CYS A CA  1 
ATOM   215  C  C   . CYS A 1 30  ? 11.703 11.676 16.761 1.00 15.33 ? 29  CYS A C   1 
ATOM   216  O  O   . CYS A 1 30  ? 12.030 12.081 15.635 1.00 14.75 ? 29  CYS A O   1 
ATOM   217  C  CB  . CYS A 1 30  ? 11.866 13.568 18.429 1.00 18.76 ? 29  CYS A CB  1 
ATOM   218  S  SG  . CYS A 1 30  ? 11.047 15.066 19.140 1.00 18.18 ? 29  CYS A SG  1 
ATOM   219  N  N   . GLN A 1 31  ? 12.041 10.450 17.204 1.00 17.92 ? 30  GLN A N   1 
ATOM   220  C  CA  . GLN A 1 31  ? 12.967 9.622  16.425 1.00 18.03 ? 30  GLN A CA  1 
ATOM   221  C  C   . GLN A 1 31  ? 12.466 9.364  14.992 1.00 18.87 ? 30  GLN A C   1 
ATOM   222  O  O   . GLN A 1 31  ? 13.229 9.441  14.070 1.00 18.35 ? 30  GLN A O   1 
ATOM   223  C  CB  . GLN A 1 31  ? 13.275 8.303  17.137 1.00 19.74 ? 30  GLN A CB  1 
ATOM   224  C  CG  . GLN A 1 31  ? 14.314 7.520  16.414 1.00 21.58 ? 30  GLN A CG  1 
ATOM   225  C  CD  . GLN A 1 31  ? 14.681 6.248  17.147 1.00 24.26 ? 30  GLN A CD  1 
ATOM   226  O  OE1 . GLN A 1 31  ? 14.154 5.944  18.215 1.00 28.73 ? 30  GLN A OE1 1 
ATOM   227  N  NE2 . GLN A 1 31  ? 15.596 5.511  16.574 1.00 30.04 ? 30  GLN A NE2 1 
ATOM   228  N  N   . PRO A 1 32  ? 11.158 9.070  14.798 1.00 17.77 ? 31  PRO A N   1 
ATOM   229  C  CA  . PRO A 1 32  ? 10.697 8.878  13.414 1.00 19.08 ? 31  PRO A CA  1 
ATOM   230  C  C   . PRO A 1 32  ? 10.973 10.051 12.436 1.00 17.82 ? 31  PRO A C   1 
ATOM   231  O  O   . PRO A 1 32  ? 11.205 9.840  11.239 1.00 17.28 ? 31  PRO A O   1 
ATOM   232  C  CB  . PRO A 1 32  ? 9.179  8.645  13.589 1.00 20.39 ? 31  PRO A CB  1 
ATOM   233  C  CG  . PRO A 1 32  ? 9.058  8.124  14.985 1.00 21.80 ? 31  PRO A CG  1 
ATOM   234  C  CD  . PRO A 1 32  ? 10.076 8.874  15.779 1.00 19.08 ? 31  PRO A CD  1 
ATOM   235  N  N   . TYR A 1 33  ? 10.948 11.266 12.970 1.00 17.08 ? 32  TYR A N   1 
ATOM   236  C  CA  . TYR A 1 33  ? 11.116 12.470 12.203 1.00 18.43 ? 32  TYR A CA  1 
ATOM   237  C  C   . TYR A 1 33  ? 12.586 12.615 11.900 1.00 17.74 ? 32  TYR A C   1 
ATOM   238  O  O   . TYR A 1 33  ? 12.951 12.961 10.792 1.00 16.57 ? 32  TYR A O   1 
ATOM   239  C  CB  . TYR A 1 33  ? 10.519 13.670 12.963 1.00 18.25 ? 32  TYR A CB  1 
ATOM   240  C  CG  . TYR A 1 33  ? 9.052  13.464 13.127 1.00 17.95 ? 32  TYR A CG  1 
ATOM   241  C  CD1 . TYR A 1 33  ? 8.183  13.757 12.086 1.00 22.35 ? 32  TYR A CD1 1 
ATOM   242  C  CD2 . TYR A 1 33  ? 8.537  12.873 14.253 1.00 18.02 ? 32  TYR A CD2 1 
ATOM   243  C  CE1 . TYR A 1 33  ? 6.851  13.500 12.186 1.00 22.31 ? 32  TYR A CE1 1 
ATOM   244  C  CE2 . TYR A 1 33  ? 7.193  12.572 14.359 1.00 23.77 ? 32  TYR A CE2 1 
ATOM   245  C  CZ  . TYR A 1 33  ? 6.358  12.890 13.309 1.00 25.98 ? 32  TYR A CZ  1 
ATOM   246  O  OH  . TYR A 1 33  ? 5.008  12.647 13.384 1.00 29.21 ? 32  TYR A OH  1 
ATOM   247  N  N   . HIS A 1 34  ? 13.442 12.400 12.888 1.00 17.51 ? 33  HIS A N   1 
ATOM   248  C  CA  . HIS A 1 34  ? 14.874 12.527 12.632 1.00 16.28 ? 33  HIS A CA  1 
ATOM   249  C  C   . HIS A 1 34  ? 15.259 11.453 11.569 1.00 16.49 ? 33  HIS A C   1 
ATOM   250  O  O   . HIS A 1 34  ? 15.886 11.730 10.558 1.00 20.59 ? 33  HIS A O   1 
ATOM   251  C  CB  . HIS A 1 34  ? 15.671 12.280 13.892 1.00 18.02 ? 33  HIS A CB  1 
ATOM   252  C  CG  . HIS A 1 34  ? 15.498 13.335 14.938 1.00 14.90 ? 33  HIS A CG  1 
ATOM   253  N  ND1 . HIS A 1 34  ? 15.781 13.127 16.272 1.00 15.91 ? 33  HIS A ND1 1 
ATOM   254  C  CD2 . HIS A 1 34  ? 14.983 14.577 14.857 1.00 12.47 ? 33  HIS A CD2 1 
ATOM   255  C  CE1 . HIS A 1 34  ? 15.526 14.237 16.942 1.00 23.03 ? 33  HIS A CE1 1 
ATOM   256  N  NE2 . HIS A 1 34  ? 15.040 15.134 16.100 1.00 16.30 ? 33  HIS A NE2 1 
ATOM   257  N  N   . ASP A 1 35  ? 14.867 10.219 11.828 1.00 18.93 ? 34  ASP A N   1 
ATOM   258  C  CA  . ASP A 1 35  ? 15.225 9.115  10.908 1.00 20.23 ? 34  ASP A CA  1 
ATOM   259  C  C   . ASP A 1 35  ? 14.646 9.323  9.509  1.00 22.03 ? 34  ASP A C   1 
ATOM   260  O  O   . ASP A 1 35  ? 15.256 8.955  8.502  1.00 23.82 ? 34  ASP A O   1 
ATOM   261  C  CB  . ASP A 1 35  ? 14.765 7.784  11.524 1.00 21.82 ? 34  ASP A CB  1 
ATOM   262  C  CG  . ASP A 1 35  ? 15.633 7.343  12.699 1.00 25.97 ? 34  ASP A CG  1 
ATOM   263  O  OD1 . ASP A 1 35  ? 16.665 7.989  13.001 1.00 25.76 ? 34  ASP A OD1 1 
ATOM   264  O  OD2 . ASP A 1 35  ? 15.265 6.342  13.346 1.00 25.24 ? 34  ASP A OD2 1 
ATOM   265  N  N   . GLY A 1 36  ? 13.462 9.912  9.455  1.00 24.25 ? 35  GLY A N   1 
ATOM   266  C  CA  . GLY A 1 36  ? 12.743 10.131 8.211  1.00 24.21 ? 35  GLY A CA  1 
ATOM   267  C  C   . GLY A 1 36  ? 13.448 11.073 7.261  1.00 26.60 ? 35  GLY A C   1 
ATOM   268  O  O   . GLY A 1 36  ? 13.590 10.776 6.076  1.00 26.98 ? 35  GLY A O   1 
ATOM   269  N  N   . LEU A 1 37  ? 13.889 12.207 7.796  1.00 26.56 ? 36  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 37  ? 14.600 13.219 7.018  1.00 30.87 ? 36  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 37  ? 15.977 12.690 6.634  1.00 31.99 ? 36  LEU A C   1 
ATOM   272  O  O   . LEU A 1 37  ? 16.478 12.996 5.543  1.00 33.53 ? 36  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 37  ? 14.724 14.529 7.801  1.00 31.44 ? 36  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 37  ? 14.559 15.840 7.031  1.00 36.05 ? 36  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 37  ? 13.324 15.802 6.149  1.00 38.10 ? 36  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 37  ? 14.467 17.012 8.002  1.00 32.59 ? 36  LEU A CD2 1 
ATOM   277  N  N   . TYR A 1 38  ? 16.563 11.867 7.505  1.00 30.11 ? 37  TYR A N   1 
ATOM   278  C  CA  . TYR A 1 38  ? 17.877 11.291 7.225  1.00 33.81 ? 37  TYR A CA  1 
ATOM   279  C  C   . TYR A 1 38  ? 17.825 10.308 6.044  1.00 35.04 ? 37  TYR A C   1 
ATOM   280  O  O   . TYR A 1 38  ? 18.746 10.275 5.226  1.00 36.11 ? 37  TYR A O   1 
ATOM   281  C  CB  . TYR A 1 38  ? 18.457 10.613 8.476  1.00 35.96 ? 37  TYR A CB  1 
ATOM   282  C  CG  . TYR A 1 38  ? 19.759 9.904  8.212  1.00 39.33 ? 37  TYR A CG  1 
ATOM   283  C  CD1 . TYR A 1 38  ? 20.973 10.579 8.335  1.00 46.11 ? 37  TYR A CD1 1 
ATOM   284  C  CD2 . TYR A 1 38  ? 19.782 8.568  7.795  1.00 42.68 ? 37  TYR A CD2 1 
ATOM   285  C  CE1 . TYR A 1 38  ? 22.186 9.930  8.069  1.00 47.72 ? 37  TYR A CE1 1 
ATOM   286  C  CE2 . TYR A 1 38  ? 20.995 7.912  7.516  1.00 44.95 ? 37  TYR A CE2 1 
ATOM   287  C  CZ  . TYR A 1 38  ? 22.187 8.597  7.665  1.00 43.29 ? 37  TYR A CZ  1 
ATOM   288  O  OH  . TYR A 1 38  ? 23.389 7.977  7.407  1.00 42.80 ? 37  TYR A OH  1 
ATOM   289  N  N   . ASN A 1 39  ? 16.753 9.528  5.946  1.00 36.21 ? 38  ASN A N   1 
ATOM   290  C  CA  . ASN A 1 39  ? 16.651 8.492  4.910  1.00 39.07 ? 38  ASN A CA  1 
ATOM   291  C  C   . ASN A 1 39  ? 15.784 8.826  3.705  1.00 40.96 ? 38  ASN A C   1 
ATOM   292  O  O   . ASN A 1 39  ? 15.768 8.072  2.739  1.00 41.48 ? 38  ASN A O   1 
ATOM   293  C  CB  . ASN A 1 39  ? 16.100 7.216  5.528  1.00 39.77 ? 38  ASN A CB  1 
ATOM   294  C  CG  . ASN A 1 39  ? 17.101 6.536  6.410  1.00 42.84 ? 38  ASN A CG  1 
ATOM   295  O  OD1 . ASN A 1 39  ? 16.905 6.428  7.626  1.00 46.00 ? 38  ASN A OD1 1 
ATOM   296  N  ND2 . ASN A 1 39  ? 18.195 6.076  5.810  1.00 43.48 ? 38  ASN A ND2 1 
ATOM   297  N  N   . GLN A 1 40  ? 15.028 9.917  3.764  1.00 43.64 ? 39  GLN A N   1 
ATOM   298  C  CA  . GLN A 1 40  ? 14.034 10.193 2.733  1.00 45.57 ? 39  GLN A CA  1 
ATOM   299  C  C   . GLN A 1 40  ? 14.178 11.631 2.254  1.00 46.70 ? 39  GLN A C   1 
ATOM   300  O  O   . GLN A 1 40  ? 13.972 12.566 3.031  1.00 49.33 ? 39  GLN A O   1 
ATOM   301  C  CB  . GLN A 1 40  ? 12.614 9.928  3.273  1.00 45.94 ? 39  GLN A CB  1 
ATOM   302  C  CG  . GLN A 1 40  ? 12.468 8.680  4.157  1.00 48.02 ? 39  GLN A CG  1 
ATOM   303  N  N   . ALA A 1 47  ? 6.963  10.647 2.710  1.00 41.56 ? 46  ALA A N   1 
ATOM   304  C  CA  . ALA A 1 47  ? 7.926  11.321 3.585  1.00 39.41 ? 46  ALA A CA  1 
ATOM   305  C  C   . ALA A 1 47  ? 7.280  11.734 4.901  1.00 37.80 ? 46  ALA A C   1 
ATOM   306  O  O   . ALA A 1 47  ? 6.375  12.593 4.912  1.00 40.59 ? 46  ALA A O   1 
ATOM   307  C  CB  . ALA A 1 47  ? 8.506  12.539 2.890  1.00 39.50 ? 46  ALA A CB  1 
ATOM   308  N  N   . ILE A 1 48  ? 7.749  11.125 5.994  1.00 32.21 ? 47  ILE A N   1 
ATOM   309  C  CA  . ILE A 1 48  ? 7.338  11.485 7.355  1.00 31.42 ? 47  ILE A CA  1 
ATOM   310  C  C   . ILE A 1 48  ? 7.871  12.883 7.671  1.00 30.59 ? 47  ILE A C   1 
ATOM   311  O  O   . ILE A 1 48  ? 9.069  13.102 7.585  1.00 33.11 ? 47  ILE A O   1 
ATOM   312  C  CB  . ILE A 1 48  ? 7.856  10.464 8.411  1.00 32.27 ? 47  ILE A CB  1 
ATOM   313  C  CG1 . ILE A 1 48  ? 7.435  10.880 9.813  1.00 29.38 ? 47  ILE A CG1 1 
ATOM   314  C  CG2 . ILE A 1 48  ? 9.363  10.340 8.360  1.00 39.37 ? 47  ILE A CG2 1 
ATOM   315  C  CD1 . ILE A 1 48  ? 7.809  9.891  10.873 1.00 34.66 ? 47  ILE A CD1 1 
ATOM   316  N  N   . ARG A 1 49  ? 6.975  13.831 7.964  1.00 29.45 ? 48  ARG A N   1 
ATOM   317  C  CA  . ARG A 1 49  ? 7.366  15.218 8.296  1.00 28.98 ? 48  ARG A CA  1 
ATOM   318  C  C   . ARG A 1 49  ? 6.501  15.776 9.405  1.00 25.08 ? 48  ARG A C   1 
ATOM   319  O  O   . ARG A 1 49  ? 5.366  15.402 9.524  1.00 23.93 ? 48  ARG A O   1 
ATOM   320  C  CB  . ARG A 1 49  ? 7.283  16.139 7.058  1.00 29.41 ? 48  ARG A CB  1 
ATOM   321  C  CG  . ARG A 1 49  ? 5.927  16.157 6.351  1.00 34.57 ? 48  ARG A CG  1 
ATOM   322  C  CD  . ARG A 1 49  ? 6.062  16.594 4.859  1.00 33.33 ? 48  ARG A CD  1 
ATOM   323  N  N   . ALA A 1 50  ? 7.061  16.664 10.215 1.00 23.31 ? 49  ALA A N   1 
ATOM   324  C  CA  . ALA A 1 50  ? 6.324  17.315 11.300 1.00 23.75 ? 49  ALA A CA  1 
ATOM   325  C  C   . ALA A 1 50  ? 5.072  17.942 10.753 1.00 23.39 ? 49  ALA A C   1 
ATOM   326  O  O   . ALA A 1 50  ? 5.105  18.598 9.712  1.00 24.65 ? 49  ALA A O   1 
ATOM   327  C  CB  . ALA A 1 50  ? 7.201  18.359 12.001 1.00 23.23 ? 49  ALA A CB  1 
ATOM   328  N  N   . ASP A 1 51  ? 3.939  17.723 11.427 1.00 24.98 ? 50  ASP A N   1 
ATOM   329  C  CA  . ASP A 1 51  ? 2.653  18.208 10.925 1.00 25.86 ? 50  ASP A CA  1 
ATOM   330  C  C   . ASP A 1 51  ? 2.389  19.691 11.251 1.00 26.15 ? 50  ASP A C   1 
ATOM   331  O  O   . ASP A 1 51  ? 1.684  20.394 10.504 1.00 26.38 ? 50  ASP A O   1 
ATOM   332  C  CB  . ASP A 1 51  ? 1.530  17.315 11.475 1.00 30.44 ? 50  ASP A CB  1 
ATOM   333  C  CG  . ASP A 1 51  ? 0.176  17.573 10.794 1.00 33.13 ? 50  ASP A CG  1 
ATOM   334  N  N   . THR A 1 52  ? 3.003  20.193 12.322 1.00 22.80 ? 51  THR A N   1 
ATOM   335  C  CA  . THR A 1 52  ? 2.761  21.554 12.768 1.00 22.95 ? 51  THR A CA  1 
ATOM   336  C  C   . THR A 1 52  ? 4.106  22.200 13.106 1.00 20.10 ? 51  THR A C   1 
ATOM   337  O  O   . THR A 1 52  ? 5.084  21.474 13.316 1.00 20.51 ? 51  THR A O   1 
ATOM   338  C  CB  . THR A 1 52  ? 1.850  21.571 14.012 1.00 22.84 ? 51  THR A CB  1 
ATOM   339  O  OG1 . THR A 1 52  ? 2.603  21.198 15.158 1.00 25.22 ? 51  THR A OG1 1 
ATOM   340  C  CG2 . THR A 1 52  ? 0.610  20.648 13.848 1.00 22.94 ? 51  THR A CG2 1 
ATOM   341  N  N   . ALA A 1 53  ? 4.149  23.535 13.204 1.00 18.79 ? 52  ALA A N   1 
ATOM   342  C  CA  . ALA A 1 53  ? 5.365  24.247 13.657 1.00 20.39 ? 52  ALA A CA  1 
ATOM   343  C  C   . ALA A 1 53  ? 5.815  23.856 15.092 1.00 18.99 ? 52  ALA A C   1 
ATOM   344  O  O   . ALA A 1 53  ? 7.011  23.715 15.371 1.00 18.61 ? 52  ALA A O   1 
ATOM   345  C  CB  . ALA A 1 53  ? 5.151  25.767 13.532 1.00 22.61 ? 52  ALA A CB  1 
ATOM   346  N  N   . GLU A 1 54  ? 4.845  23.638 15.979 1.00 19.24 ? 53  GLU A N   1 
ATOM   347  C  CA  . GLU A 1 54  ? 5.156  23.224 17.346 1.00 23.37 ? 53  GLU A CA  1 
ATOM   348  C  C   . GLU A 1 54  ? 5.879  21.864 17.327 1.00 20.13 ? 53  GLU A C   1 
ATOM   349  O  O   . GLU A 1 54  ? 6.917  21.688 17.975 1.00 20.61 ? 53  GLU A O   1 
ATOM   350  C  CB  . GLU A 1 54  ? 3.929  23.181 18.271 1.00 25.87 ? 53  GLU A CB  1 
ATOM   351  C  CG  . GLU A 1 54  ? 4.370  22.599 19.635 1.00 28.94 ? 53  GLU A CG  1 
ATOM   352  C  CD  . GLU A 1 54  ? 3.260  22.349 20.580 1.00 35.52 ? 53  GLU A CD  1 
ATOM   353  O  OE1 . GLU A 1 54  ? 2.181  22.949 20.397 1.00 40.21 ? 53  GLU A OE1 1 
ATOM   354  O  OE2 . GLU A 1 54  ? 3.499  21.557 21.524 1.00 47.02 ? 53  GLU A OE2 1 
ATOM   355  N  N   . HIS A 1 55  ? 5.362  20.938 16.534 1.00 19.81 ? 54  HIS A N   1 
ATOM   356  C  CA  A HIS A 1 55  ? 5.963  19.604 16.362 0.38 20.31 ? 54  HIS A CA  1 
ATOM   357  C  CA  C HIS A 1 55  ? 5.980  19.647 16.405 0.62 20.25 ? 54  HIS A CA  1 
ATOM   358  C  C   . HIS A 1 55  ? 7.354  19.777 15.767 1.00 20.54 ? 54  HIS A C   1 
ATOM   359  O  O   . HIS A 1 55  ? 8.314  19.166 16.236 1.00 19.40 ? 54  HIS A O   1 
ATOM   360  C  CB  A HIS A 1 55  ? 5.160  18.675 15.422 0.38 22.47 ? 54  HIS A CB  1 
ATOM   361  C  CB  C HIS A 1 55  ? 5.053  18.752 15.619 0.62 22.76 ? 54  HIS A CB  1 
ATOM   362  C  CG  A HIS A 1 55  ? 3.774  18.310 15.884 0.38 21.44 ? 54  HIS A CG  1 
ATOM   363  C  CG  C HIS A 1 55  ? 5.442  17.323 15.646 0.62 20.98 ? 54  HIS A CG  1 
ATOM   364  N  ND1 A HIS A 1 55  ? 3.366  18.344 17.199 0.38 28.96 ? 54  HIS A ND1 1 
ATOM   365  N  ND1 C HIS A 1 55  ? 4.809  16.372 14.879 0.62 36.51 ? 54  HIS A ND1 1 
ATOM   366  C  CD2 A HIS A 1 55  ? 2.718  17.834 15.179 0.38 22.05 ? 54  HIS A CD2 1 
ATOM   367  C  CD2 C HIS A 1 55  ? 6.408  16.675 16.341 0.62 17.85 ? 54  HIS A CD2 1 
ATOM   368  C  CE1 A HIS A 1 55  ? 2.108  17.941 17.279 0.38 28.61 ? 54  HIS A CE1 1 
ATOM   369  C  CE1 C HIS A 1 55  ? 5.351  15.193 15.123 0.62 30.44 ? 54  HIS A CE1 1 
ATOM   370  N  NE2 A HIS A 1 55  ? 1.691  17.624 16.066 0.38 22.53 ? 54  HIS A NE2 1 
ATOM   371  N  NE2 C HIS A 1 55  ? 6.331  15.352 15.994 0.62 29.17 ? 54  HIS A NE2 1 
ATOM   372  N  N   . LEU A 1 56  ? 7.496  20.620 14.729 1.00 19.11 ? 55  LEU A N   1 
ATOM   373  C  CA  . LEU A 1 56  ? 8.838  20.833 14.189 1.00 19.53 ? 55  LEU A CA  1 
ATOM   374  C  C   . LEU A 1 56  ? 9.849  21.361 15.226 1.00 20.11 ? 55  LEU A C   1 
ATOM   375  O  O   . LEU A 1 56  ? 10.966 20.844 15.344 1.00 20.62 ? 55  LEU A O   1 
ATOM   376  C  CB  . LEU A 1 56  ? 8.823  21.739 12.945 1.00 17.87 ? 55  LEU A CB  1 
ATOM   377  C  CG  . LEU A 1 56  ? 10.168 21.844 12.180 1.00 20.68 ? 55  LEU A CG  1 
ATOM   378  C  CD1 . LEU A 1 56  ? 10.524 20.476 11.501 1.00 26.69 ? 55  LEU A CD1 1 
ATOM   379  C  CD2 . LEU A 1 56  ? 10.185 23.002 11.187 1.00 22.11 ? 55  LEU A CD2 1 
HETATM 380  N  N   . MSE A 1 57  ? 9.420  22.348 16.008 1.00 21.25 ? 56  MSE A N   1 
HETATM 381  C  CA  A MSE A 1 57  ? 10.304 22.940 16.991 0.50 20.40 ? 56  MSE A CA  1 
HETATM 382  C  CA  B MSE A 1 57  ? 10.253 22.962 17.011 0.50 20.78 ? 56  MSE A CA  1 
HETATM 383  C  C   . MSE A 1 57  ? 10.734 21.907 18.019 1.00 21.04 ? 56  MSE A C   1 
HETATM 384  O  O   . MSE A 1 57  ? 11.906 21.892 18.416 1.00 20.48 ? 56  MSE A O   1 
HETATM 385  C  CB  A MSE A 1 57  ? 9.668  24.152 17.661 0.50 20.69 ? 56  MSE A CB  1 
HETATM 386  C  CB  B MSE A 1 57  ? 9.446  24.088 17.659 0.50 21.76 ? 56  MSE A CB  1 
HETATM 387  C  CG  A MSE A 1 57  ? 10.628 25.002 18.507 0.50 20.15 ? 56  MSE A CG  1 
HETATM 388  C  CG  B MSE A 1 57  ? 10.172 24.939 18.661 0.50 24.06 ? 56  MSE A CG  1 
HETATM 389  SE SE  A MSE A 1 57  ? 12.232 25.563 17.577 0.37 14.25 ? 56  MSE A SE  1 
HETATM 390  SE SE  B MSE A 1 57  ? 10.344 24.080 20.387 0.38 32.02 ? 56  MSE A SE  1 
HETATM 391  C  CE  A MSE A 1 57  ? 12.192 27.442 17.862 0.50 38.66 ? 56  MSE A CE  1 
HETATM 392  C  CE  B MSE A 1 57  ? 8.598  23.266 20.560 0.50 31.22 ? 56  MSE A CE  1 
ATOM   393  N  N   . ARG A 1 58  ? 9.818  21.024 18.450 1.00 20.07 ? 57  ARG A N   1 
ATOM   394  C  CA  A ARG A 1 58  ? 10.185 19.934 19.376 0.50 18.64 ? 57  ARG A CA  1 
ATOM   395  C  CA  B ARG A 1 58  ? 10.187 19.945 19.384 0.50 20.42 ? 57  ARG A CA  1 
ATOM   396  C  C   . ARG A 1 58  ? 11.238 19.035 18.779 1.00 20.24 ? 57  ARG A C   1 
ATOM   397  O  O   . ARG A 1 58  ? 12.235 18.696 19.431 1.00 18.72 ? 57  ARG A O   1 
ATOM   398  C  CB  A ARG A 1 58  ? 8.967  19.094 19.751 0.50 19.44 ? 57  ARG A CB  1 
ATOM   399  C  CB  B ARG A 1 58  ? 8.957  19.137 19.819 0.50 20.92 ? 57  ARG A CB  1 
ATOM   400  C  CG  A ARG A 1 58  ? 8.087  19.774 20.733 0.50 15.82 ? 57  ARG A CG  1 
ATOM   401  C  CG  B ARG A 1 58  ? 7.991  19.957 20.632 0.50 20.95 ? 57  ARG A CG  1 
ATOM   402  C  CD  A ARG A 1 58  ? 6.763  19.043 20.862 0.50 19.18 ? 57  ARG A CD  1 
ATOM   403  C  CD  B ARG A 1 58  ? 7.045  19.118 21.481 0.50 25.27 ? 57  ARG A CD  1 
ATOM   404  N  NE  A ARG A 1 58  ? 5.895  19.630 21.879 0.50 17.73 ? 57  ARG A NE  1 
ATOM   405  N  NE  B ARG A 1 58  ? 5.802  18.771 20.806 0.50 30.61 ? 57  ARG A NE  1 
ATOM   406  C  CZ  A ARG A 1 58  ? 6.024  19.448 23.195 0.50 20.91 ? 57  ARG A CZ  1 
ATOM   407  C  CZ  B ARG A 1 58  ? 5.575  17.634 20.151 0.50 28.48 ? 57  ARG A CZ  1 
ATOM   408  N  NH1 A ARG A 1 58  ? 6.998  18.696 23.714 0.50 21.77 ? 57  ARG A NH1 1 
ATOM   409  N  NH1 B ARG A 1 58  ? 6.541  16.713 20.025 0.50 26.02 ? 57  ARG A NH1 1 
ATOM   410  N  NH2 A ARG A 1 58  ? 5.152  20.028 24.009 0.50 27.11 ? 57  ARG A NH2 1 
ATOM   411  N  NH2 B ARG A 1 58  ? 4.363  17.427 19.608 0.50 26.49 ? 57  ARG A NH2 1 
ATOM   412  N  N   . THR A 1 59  ? 11.016 18.626 17.535 1.00 17.71 ? 58  THR A N   1 
ATOM   413  C  CA  . THR A 1 59  ? 12.028 17.772 16.843 1.00 18.56 ? 58  THR A CA  1 
ATOM   414  C  C   . THR A 1 59  ? 13.372 18.486 16.709 1.00 19.10 ? 58  THR A C   1 
ATOM   415  O  O   . THR A 1 59  ? 14.409 17.843 16.793 1.00 18.11 ? 58  THR A O   1 
ATOM   416  C  CB  . THR A 1 59  ? 11.542 17.244 15.441 1.00 19.68 ? 58  THR A CB  1 
ATOM   417  O  OG1 . THR A 1 59  ? 11.364 18.363 14.530 1.00 18.34 ? 58  THR A OG1 1 
ATOM   418  C  CG2 . THR A 1 59  ? 10.252 16.398 15.595 1.00 19.84 ? 58  THR A CG2 1 
ATOM   419  N  N   . ARG A 1 60  ? 13.370 19.797 16.491 1.00 18.85 ? 59  ARG A N   1 
ATOM   420  C  CA  . ARG A 1 60  ? 14.655 20.526 16.443 1.00 20.40 ? 59  ARG A CA  1 
ATOM   421  C  C   . ARG A 1 60  ? 15.385 20.542 17.801 1.00 18.57 ? 59  ARG A C   1 
ATOM   422  O  O   . ARG A 1 60  ? 16.562 20.291 17.891 1.00 20.06 ? 59  ARG A O   1 
ATOM   423  C  CB  . ARG A 1 60  ? 14.469 21.925 15.858 1.00 19.32 ? 59  ARG A CB  1 
ATOM   424  C  CG  . ARG A 1 60  ? 14.038 21.972 14.372 1.00 19.69 ? 59  ARG A CG  1 
ATOM   425  C  CD  . ARG A 1 60  ? 13.733 23.431 13.942 1.00 19.19 ? 59  ARG A CD  1 
ATOM   426  N  NE  . ARG A 1 60  ? 14.821 24.379 14.264 1.00 20.41 ? 59  ARG A NE  1 
ATOM   427  C  CZ  . ARG A 1 60  ? 15.918 24.571 13.538 1.00 19.83 ? 59  ARG A CZ  1 
ATOM   428  N  NH1 . ARG A 1 60  ? 16.106 23.895 12.407 1.00 21.59 ? 59  ARG A NH1 1 
ATOM   429  N  NH2 . ARG A 1 60  ? 16.824 25.456 13.949 1.00 21.79 ? 59  ARG A NH2 1 
ATOM   430  N  N   . TYR A 1 61  ? 14.647 20.850 18.861 1.00 20.03 ? 60  TYR A N   1 
ATOM   431  C  CA  . TYR A 1 61  ? 15.185 20.779 20.218 1.00 18.49 ? 60  TYR A CA  1 
ATOM   432  C  C   . TYR A 1 61  ? 15.831 19.404 20.495 1.00 18.77 ? 60  TYR A C   1 
ATOM   433  O  O   . TYR A 1 61  ? 16.959 19.309 20.940 1.00 19.30 ? 60  TYR A O   1 
ATOM   434  C  CB  . TYR A 1 61  ? 14.079 21.061 21.249 1.00 19.56 ? 60  TYR A CB  1 
ATOM   435  C  CG  . TYR A 1 61  ? 14.603 20.815 22.628 1.00 20.02 ? 60  TYR A CG  1 
ATOM   436  C  CD1 . TYR A 1 61  ? 15.382 21.743 23.246 1.00 21.45 ? 60  TYR A CD1 1 
ATOM   437  C  CD2 . TYR A 1 61  ? 14.366 19.607 23.273 1.00 19.81 ? 60  TYR A CD2 1 
ATOM   438  C  CE1 . TYR A 1 61  ? 15.953 21.505 24.512 1.00 23.03 ? 60  TYR A CE1 1 
ATOM   439  C  CE2 . TYR A 1 61  ? 14.920 19.338 24.512 1.00 22.10 ? 60  TYR A CE2 1 
ATOM   440  C  CZ  . TYR A 1 61  ? 15.730 20.300 25.137 1.00 20.56 ? 60  TYR A CZ  1 
ATOM   441  O  OH  . TYR A 1 61  ? 16.273 20.068 26.385 1.00 20.77 ? 60  TYR A OH  1 
ATOM   442  N  N   . SER A 1 62  ? 15.103 18.345 20.177 1.00 20.42 ? 61  SER A N   1 
ATOM   443  C  CA  . SER A 1 62  ? 15.619 16.970 20.381 1.00 17.62 ? 61  SER A CA  1 
ATOM   444  C  C   . SER A 1 62  ? 16.858 16.712 19.515 1.00 17.87 ? 61  SER A C   1 
ATOM   445  O  O   . SER A 1 62  ? 17.774 16.003 19.945 1.00 19.37 ? 61  SER A O   1 
ATOM   446  C  CB  . SER A 1 62  ? 14.516 15.965 20.051 1.00 18.62 ? 61  SER A CB  1 
ATOM   447  O  OG  . SER A 1 62  ? 13.464 16.156 20.968 1.00 21.86 ? 61  SER A OG  1 
ATOM   448  N  N   . ALA A 1 63  ? 16.922 17.343 18.341 1.00 18.09 ? 62  ALA A N   1 
ATOM   449  C  CA  . ALA A 1 63  ? 18.116 17.229 17.478 1.00 20.17 ? 62  ALA A CA  1 
ATOM   450  C  C   . ALA A 1 63  ? 19.298 17.990 18.105 1.00 21.78 ? 62  ALA A C   1 
ATOM   451  O  O   . ALA A 1 63  ? 20.415 17.582 17.943 1.00 23.20 ? 62  ALA A O   1 
ATOM   452  C  CB  . ALA A 1 63  ? 17.798 17.732 16.046 1.00 19.35 ? 62  ALA A CB  1 
ATOM   453  N  N   . PHE A 1 64  ? 19.045 19.083 18.823 1.00 17.93 ? 63  PHE A N   1 
ATOM   454  C  CA  . PHE A 1 64  ? 20.123 19.776 19.578 1.00 20.14 ? 63  PHE A CA  1 
ATOM   455  C  C   . PHE A 1 64  ? 20.659 18.842 20.661 1.00 19.10 ? 63  PHE A C   1 
ATOM   456  O  O   . PHE A 1 64  ? 21.862 18.560 20.755 1.00 19.97 ? 63  PHE A O   1 
ATOM   457  C  CB  . PHE A 1 64  ? 19.606 21.076 20.204 1.00 19.10 ? 63  PHE A CB  1 
ATOM   458  C  CG  . PHE A 1 64  ? 19.328 22.170 19.190 1.00 22.60 ? 63  PHE A CG  1 
ATOM   459  C  CD1 . PHE A 1 64  ? 20.259 22.419 18.191 1.00 30.99 ? 63  PHE A CD1 1 
ATOM   460  C  CD2 . PHE A 1 64  ? 18.209 22.958 19.262 1.00 37.79 ? 63  PHE A CD2 1 
ATOM   461  C  CE1 . PHE A 1 64  ? 20.056 23.419 17.256 1.00 35.97 ? 63  PHE A CE1 1 
ATOM   462  C  CE2 . PHE A 1 64  ? 18.002 23.964 18.303 1.00 31.95 ? 63  PHE A CE2 1 
ATOM   463  C  CZ  . PHE A 1 64  ? 18.932 24.156 17.310 1.00 32.77 ? 63  PHE A CZ  1 
ATOM   464  N  N   . VAL A 1 65  ? 19.737 18.302 21.459 1.00 19.43 ? 64  VAL A N   1 
ATOM   465  C  CA  . VAL A 1 65  ? 20.124 17.473 22.600 1.00 21.43 ? 64  VAL A CA  1 
ATOM   466  C  C   . VAL A 1 65  ? 20.913 16.240 22.152 1.00 20.24 ? 64  VAL A C   1 
ATOM   467  O  O   . VAL A 1 65  ? 21.964 15.917 22.759 1.00 21.65 ? 64  VAL A O   1 
ATOM   468  C  CB  . VAL A 1 65  ? 18.877 17.041 23.411 1.00 20.74 ? 64  VAL A CB  1 
ATOM   469  C  CG1 . VAL A 1 65  ? 19.312 16.050 24.563 1.00 19.98 ? 64  VAL A CG1 1 
ATOM   470  C  CG2 . VAL A 1 65  ? 18.161 18.239 23.940 1.00 20.00 ? 64  VAL A CG2 1 
ATOM   471  N  N   . LEU A 1 66  ? 20.433 15.578 21.091 1.00 18.22 ? 65  LEU A N   1 
ATOM   472  C  CA  . LEU A 1 66  ? 21.014 14.326 20.605 1.00 20.11 ? 65  LEU A CA  1 
ATOM   473  C  C   . LEU A 1 66  ? 22.136 14.520 19.581 1.00 21.11 ? 65  LEU A C   1 
ATOM   474  O  O   . LEU A 1 66  ? 22.776 13.557 19.169 1.00 24.32 ? 65  LEU A O   1 
ATOM   475  C  CB  . LEU A 1 66  ? 19.927 13.405 20.045 1.00 24.53 ? 65  LEU A CB  1 
ATOM   476  C  CG  . LEU A 1 66  ? 18.806 13.001 21.046 1.00 20.96 ? 65  LEU A CG  1 
ATOM   477  C  CD1 . LEU A 1 66  ? 17.664 12.237 20.338 1.00 19.98 ? 65  LEU A CD1 1 
ATOM   478  C  CD2 . LEU A 1 66  ? 19.310 12.178 22.276 1.00 23.63 ? 65  LEU A CD2 1 
ATOM   479  N  N   . VAL A 1 67  ? 22.395 15.775 19.218 1.00 20.00 ? 66  VAL A N   1 
ATOM   480  C  CA  . VAL A 1 67  ? 23.527 16.196 18.325 1.00 21.40 ? 66  VAL A CA  1 
ATOM   481  C  C   . VAL A 1 67  ? 23.346 15.623 16.911 1.00 21.06 ? 66  VAL A C   1 
ATOM   482  O  O   . VAL A 1 67  ? 24.128 14.796 16.424 1.00 21.65 ? 66  VAL A O   1 
ATOM   483  C  CB  . VAL A 1 67  ? 24.969 15.955 18.886 1.00 22.10 ? 66  VAL A CB  1 
ATOM   484  C  CG1 . VAL A 1 67  ? 25.980 16.703 18.006 1.00 18.62 ? 66  VAL A CG1 1 
ATOM   485  C  CG2 . VAL A 1 67  ? 25.095 16.411 20.341 1.00 20.19 ? 66  VAL A CG2 1 
ATOM   486  N  N   . LYS A 1 68  ? 22.267 16.076 16.289 1.00 21.05 ? 67  LYS A N   1 
ATOM   487  C  CA  . LYS A 1 68  ? 21.876 15.720 14.922 1.00 21.25 ? 67  LYS A CA  1 
ATOM   488  C  C   . LYS A 1 68  ? 21.833 17.006 14.088 1.00 19.68 ? 67  LYS A C   1 
ATOM   489  O  O   . LYS A 1 68  ? 20.757 17.550 13.751 1.00 20.89 ? 67  LYS A O   1 
ATOM   490  C  CB  . LYS A 1 68  ? 20.541 15.008 14.944 1.00 21.74 ? 67  LYS A CB  1 
ATOM   491  C  CG  . LYS A 1 68  ? 20.657 13.722 15.773 1.00 28.02 ? 67  LYS A CG  1 
ATOM   492  C  CD  . LYS A 1 68  ? 19.485 12.845 15.624 1.00 27.94 ? 67  LYS A CD  1 
ATOM   493  C  CE  . LYS A 1 68  ? 19.663 11.605 16.480 1.00 33.43 ? 67  LYS A CE  1 
ATOM   494  N  NZ  . LYS A 1 68  ? 20.246 10.503 15.697 1.00 36.15 ? 67  LYS A NZ  1 
ATOM   495  N  N   . PRO A 1 69  ? 23.031 17.558 13.791 1.00 21.43 ? 68  PRO A N   1 
ATOM   496  C  CA  . PRO A 1 69  ? 23.045 18.870 13.175 1.00 25.63 ? 68  PRO A CA  1 
ATOM   497  C  C   . PRO A 1 69  ? 22.524 18.861 11.731 1.00 26.09 ? 68  PRO A C   1 
ATOM   498  O  O   . PRO A 1 69  ? 22.054 19.887 11.262 1.00 22.16 ? 68  PRO A O   1 
ATOM   499  C  CB  . PRO A 1 69  ? 24.509 19.274 13.260 1.00 25.57 ? 68  PRO A CB  1 
ATOM   500  C  CG  . PRO A 1 69  ? 25.262 17.945 13.271 1.00 23.44 ? 68  PRO A CG  1 
ATOM   501  C  CD  . PRO A 1 69  ? 24.386 17.009 14.005 1.00 22.84 ? 68  PRO A CD  1 
ATOM   502  N  N   . GLU A 1 70  ? 22.605 17.715 11.044 1.00 23.50 ? 69  GLU A N   1 
ATOM   503  C  CA  . GLU A 1 70  ? 22.003 17.581 9.721  1.00 24.37 ? 69  GLU A CA  1 
ATOM   504  C  C   . GLU A 1 70  ? 20.511 17.905 9.762  1.00 21.60 ? 69  GLU A C   1 
ATOM   505  O  O   . GLU A 1 70  ? 19.972 18.646 8.873  1.00 21.26 ? 69  GLU A O   1 
ATOM   506  C  CB  . GLU A 1 70  ? 22.227 16.194 9.134  1.00 27.23 ? 69  GLU A CB  1 
ATOM   507  C  CG  . GLU A 1 70  ? 21.519 14.978 9.856  1.00 41.42 ? 69  GLU A CG  1 
ATOM   508  C  CD  . GLU A 1 70  ? 22.003 14.645 11.307 1.00 44.86 ? 69  GLU A CD  1 
ATOM   509  O  OE1 . GLU A 1 70  ? 23.202 14.854 11.692 1.00 32.73 ? 69  GLU A OE1 1 
ATOM   510  O  OE2 . GLU A 1 70  ? 21.141 14.138 12.044 1.00 47.82 ? 69  GLU A OE2 1 
ATOM   511  N  N   . TYR A 1 71  ? 19.830 17.388 10.786 1.00 18.88 ? 70  TYR A N   1 
ATOM   512  C  CA  . TYR A 1 71  ? 18.398 17.668 10.958 1.00 18.50 ? 70  TYR A CA  1 
ATOM   513  C  C   . TYR A 1 71  ? 18.139 19.180 11.146 1.00 19.34 ? 70  TYR A C   1 
ATOM   514  O  O   . TYR A 1 71  ? 17.208 19.735 10.581 1.00 18.01 ? 70  TYR A O   1 
ATOM   515  C  CB  . TYR A 1 71  ? 17.806 16.861 12.130 1.00 20.01 ? 70  TYR A CB  1 
ATOM   516  C  CG  . TYR A 1 71  ? 16.316 16.942 12.204 1.00 21.69 ? 70  TYR A CG  1 
ATOM   517  C  CD1 . TYR A 1 71  ? 15.529 16.130 11.407 1.00 17.91 ? 70  TYR A CD1 1 
ATOM   518  C  CD2 . TYR A 1 71  ? 15.679 17.850 13.052 1.00 18.08 ? 70  TYR A CD2 1 
ATOM   519  C  CE1 . TYR A 1 71  ? 14.167 16.236 11.435 1.00 19.14 ? 70  TYR A CE1 1 
ATOM   520  C  CE2 . TYR A 1 71  ? 14.294 17.956 13.103 1.00 22.81 ? 70  TYR A CE2 1 
ATOM   521  C  CZ  . TYR A 1 71  ? 13.536 17.123 12.292 1.00 17.44 ? 70  TYR A CZ  1 
ATOM   522  O  OH  . TYR A 1 71  ? 12.161 17.180 12.267 1.00 20.08 ? 70  TYR A OH  1 
ATOM   523  N  N   . ILE A 1 72  ? 18.982 19.847 11.898 1.00 21.16 ? 71  ILE A N   1 
ATOM   524  C  CA  . ILE A 1 72  ? 18.844 21.276 12.166 1.00 21.34 ? 71  ILE A CA  1 
ATOM   525  C  C   . ILE A 1 72  ? 18.999 22.075 10.843 1.00 20.95 ? 71  ILE A C   1 
ATOM   526  O  O   . ILE A 1 72  ? 18.209 22.961 10.534 1.00 20.13 ? 71  ILE A O   1 
ATOM   527  C  CB  . ILE A 1 72  ? 19.887 21.757 13.250 1.00 22.31 ? 71  ILE A CB  1 
ATOM   528  C  CG1 . ILE A 1 72  ? 19.642 21.043 14.573 1.00 22.65 ? 71  ILE A CG1 1 
ATOM   529  C  CG2 . ILE A 1 72  ? 19.840 23.267 13.457 1.00 21.52 ? 71  ILE A CG2 1 
ATOM   530  C  CD1 . ILE A 1 72  ? 18.222 21.292 15.163 1.00 27.98 ? 71  ILE A CD1 1 
ATOM   531  N  N   . VAL A 1 73  ? 20.009 21.726 10.060 1.00 20.17 ? 72  VAL A N   1 
ATOM   532  C  CA  . VAL A 1 73  ? 20.161 22.372 8.745  1.00 19.79 ? 72  VAL A CA  1 
ATOM   533  C  C   . VAL A 1 73  ? 18.952 22.124 7.824  1.00 19.61 ? 72  VAL A C   1 
ATOM   534  O  O   . VAL A 1 73  ? 18.382 23.077 7.263  1.00 20.78 ? 72  VAL A O   1 
ATOM   535  C  CB  . VAL A 1 73  ? 21.435 21.933 8.020  1.00 21.32 ? 72  VAL A CB  1 
ATOM   536  C  CG1 . VAL A 1 73  ? 21.494 22.592 6.615  1.00 18.76 ? 72  VAL A CG1 1 
ATOM   537  C  CG2 . VAL A 1 73  ? 22.669 22.277 8.859  1.00 17.85 ? 72  VAL A CG2 1 
ATOM   538  N  N   . LYS A 1 74  ? 18.525 20.865 7.685  1.00 19.32 ? 73  LYS A N   1 
ATOM   539  C  CA  . LYS A 1 74  ? 17.554 20.509 6.668  1.00 19.84 ? 73  LYS A CA  1 
ATOM   540  C  C   . LYS A 1 74  ? 16.160 20.977 7.043  1.00 18.40 ? 73  LYS A C   1 
ATOM   541  O  O   . LYS A 1 74  ? 15.307 21.020 6.186  1.00 20.92 ? 73  LYS A O   1 
ATOM   542  C  CB  . LYS A 1 74  ? 17.520 18.996 6.393  1.00 23.49 ? 73  LYS A CB  1 
ATOM   543  C  CG  . LYS A 1 74  ? 18.839 18.407 5.847  1.00 23.73 ? 73  LYS A CG  1 
ATOM   544  C  CD  . LYS A 1 74  ? 19.100 18.833 4.422  1.00 38.20 ? 73  LYS A CD  1 
ATOM   545  N  N   . THR A 1 75  ? 15.929 21.325 8.309  1.00 19.33 ? 74  THR A N   1 
ATOM   546  C  CA  . THR A 1 75  ? 14.642 21.887 8.678  1.00 19.03 ? 74  THR A CA  1 
ATOM   547  C  C   . THR A 1 75  ? 14.694 23.425 8.753  1.00 17.91 ? 74  THR A C   1 
ATOM   548  O  O   . THR A 1 75  ? 13.724 24.031 9.233  1.00 19.59 ? 74  THR A O   1 
ATOM   549  C  CB  . THR A 1 75  ? 14.087 21.318 10.019 1.00 17.11 ? 74  THR A CB  1 
ATOM   550  O  OG1 . THR A 1 75  ? 15.018 21.530 11.085 1.00 19.76 ? 74  THR A OG1 1 
ATOM   551  C  CG2 . THR A 1 75  ? 13.779 19.793 9.882  1.00 19.03 ? 74  THR A CG2 1 
ATOM   552  N  N   . THR A 1 76  ? 15.808 24.035 8.336  1.00 17.73 ? 75  THR A N   1 
ATOM   553  C  CA  . THR A 1 76  ? 15.888 25.485 8.169  1.00 17.78 ? 75  THR A CA  1 
ATOM   554  C  C   . THR A 1 76  ? 15.450 25.858 6.759  1.00 17.50 ? 75  THR A C   1 
ATOM   555  O  O   . THR A 1 76  ? 15.678 25.083 5.815  1.00 20.38 ? 75  THR A O   1 
ATOM   556  C  CB  . THR A 1 76  ? 17.310 25.967 8.436  1.00 17.86 ? 75  THR A CB  1 
ATOM   557  O  OG1 . THR A 1 76  ? 17.682 25.559 9.738  1.00 21.58 ? 75  THR A OG1 1 
ATOM   558  C  CG2 . THR A 1 76  ? 17.430 27.511 8.382  1.00 17.90 ? 75  THR A CG2 1 
ATOM   559  N  N   . LEU A 1 77  ? 14.810 27.012 6.633  1.00 18.93 ? 76  LEU A N   1 
ATOM   560  C  CA  . LEU A 1 77  ? 14.412 27.562 5.328  1.00 19.72 ? 76  LEU A CA  1 
ATOM   561  C  C   . LEU A 1 77  ? 15.476 27.253 4.300  1.00 20.00 ? 76  LEU A C   1 
ATOM   562  O  O   . LEU A 1 77  ? 16.641 27.583 4.532  1.00 19.02 ? 76  LEU A O   1 
ATOM   563  C  CB  . LEU A 1 77  ? 14.224 29.088 5.411  1.00 23.93 ? 76  LEU A CB  1 
ATOM   564  C  CG  . LEU A 1 77  ? 13.595 29.659 4.125  1.00 26.16 ? 76  LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1 77  ? 12.109 29.296 4.059  1.00 29.10 ? 76  LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1 77  ? 13.781 31.163 4.051  1.00 27.56 ? 76  LEU A CD2 1 
ATOM   567  N  N   . PRO A 1 78  ? 15.109 26.565 3.188  1.00 20.38 ? 77  PRO A N   1 
ATOM   568  C  CA  . PRO A 1 78  ? 16.144 26.124 2.221  1.00 20.50 ? 77  PRO A CA  1 
ATOM   569  C  C   . PRO A 1 78  ? 17.131 27.242 1.742  1.00 19.01 ? 77  PRO A C   1 
ATOM   570  O  O   . PRO A 1 78  ? 18.321 26.997 1.641  1.00 19.41 ? 77  PRO A O   1 
ATOM   571  C  CB  . PRO A 1 78  ? 15.314 25.522 1.078  1.00 21.51 ? 77  PRO A CB  1 
ATOM   572  C  CG  . PRO A 1 78  ? 14.037 25.048 1.750  1.00 20.77 ? 77  PRO A CG  1 
ATOM   573  C  CD  . PRO A 1 78  ? 13.769 26.095 2.783  1.00 21.74 ? 77  PRO A CD  1 
ATOM   574  N  N   . ALA A 1 79  ? 16.622 28.451 1.509  1.00 18.51 ? 78  ALA A N   1 
ATOM   575  C  CA  . ALA A 1 79  ? 17.436 29.601 1.090  1.00 20.01 ? 78  ALA A CA  1 
ATOM   576  C  C   . ALA A 1 79  ? 18.495 30.027 2.090  1.00 20.66 ? 78  ALA A C   1 
ATOM   577  O  O   . ALA A 1 79  ? 19.399 30.773 1.719  1.00 20.60 ? 78  ALA A O   1 
ATOM   578  C  CB  . ALA A 1 79  ? 16.531 30.804 0.763  1.00 19.85 ? 78  ALA A CB  1 
ATOM   579  N  N   . GLN A 1 80  ? 18.364 29.594 3.347  1.00 19.40 ? 79  GLN A N   1 
ATOM   580  C  CA  . GLN A 1 80  ? 19.317 29.942 4.411  1.00 20.74 ? 79  GLN A CA  1 
ATOM   581  C  C   . GLN A 1 80  ? 20.318 28.840 4.701  1.00 21.03 ? 79  GLN A C   1 
ATOM   582  O  O   . GLN A 1 80  ? 21.269 29.050 5.444  1.00 23.69 ? 79  GLN A O   1 
ATOM   583  C  CB  . GLN A 1 80  ? 18.565 30.252 5.713  1.00 20.97 ? 79  GLN A CB  1 
ATOM   584  C  CG  . GLN A 1 80  ? 17.734 31.501 5.674  1.00 22.16 ? 79  GLN A CG  1 
ATOM   585  C  CD  . GLN A 1 80  ? 17.033 31.790 6.983  1.00 22.61 ? 79  GLN A CD  1 
ATOM   586  O  OE1 . GLN A 1 80  ? 16.404 30.911 7.564  1.00 21.71 ? 79  GLN A OE1 1 
ATOM   587  N  NE2 . GLN A 1 80  ? 17.146 33.024 7.465  1.00 23.57 ? 79  GLN A NE2 1 
ATOM   588  N  N   . GLN A 1 81  ? 20.080 27.642 4.165  1.00 22.48 ? 80  GLN A N   1 
ATOM   589  C  CA  . GLN A 1 81  ? 20.823 26.479 4.596  1.00 19.51 ? 80  GLN A CA  1 
ATOM   590  C  C   . GLN A 1 81  ? 22.317 26.599 4.318  1.00 22.10 ? 80  GLN A C   1 
ATOM   591  O  O   . GLN A 1 81  ? 23.105 26.255 5.175  1.00 21.58 ? 80  GLN A O   1 
ATOM   592  C  CB  . GLN A 1 81  ? 20.282 25.209 3.952  1.00 19.34 ? 80  GLN A CB  1 
ATOM   593  C  CG  . GLN A 1 81  ? 18.945 24.814 4.542  1.00 17.94 ? 80  GLN A CG  1 
ATOM   594  C  CD  . GLN A 1 81  ? 18.367 23.555 3.911  1.00 19.85 ? 80  GLN A CD  1 
ATOM   595  O  OE1 . GLN A 1 81  ? 19.037 22.892 3.149  1.00 23.76 ? 80  GLN A OE1 1 
ATOM   596  N  NE2 . GLN A 1 81  ? 17.108 23.266 4.189  1.00 20.01 ? 80  GLN A NE2 1 
ATOM   597  N  N   . ASP A 1 82  ? 22.676 27.103 3.143  1.00 22.04 ? 81  ASP A N   1 
ATOM   598  C  CA  . ASP A 1 82  ? 24.086 27.360 2.795  1.00 24.22 ? 81  ASP A CA  1 
ATOM   599  C  C   . ASP A 1 82  ? 24.753 28.455 3.634  1.00 23.08 ? 81  ASP A C   1 
ATOM   600  O  O   . ASP A 1 82  ? 25.965 28.632 3.564  1.00 27.06 ? 81  ASP A O   1 
ATOM   601  C  CB  . ASP A 1 82  ? 24.229 27.699 1.306  1.00 26.84 ? 81  ASP A CB  1 
ATOM   602  C  CG  . ASP A 1 82  ? 24.017 26.498 0.400  1.00 37.77 ? 81  ASP A CG  1 
ATOM   603  O  OD1 . ASP A 1 82  ? 23.826 25.362 0.915  1.00 47.18 ? 81  ASP A OD1 1 
ATOM   604  O  OD2 . ASP A 1 82  ? 24.046 26.696 -0.840 1.00 49.85 ? 81  ASP A OD2 1 
ATOM   605  N  N   . LEU A 1 83  ? 23.986 29.188 4.409  1.00 22.20 ? 82  LEU A N   1 
ATOM   606  C  CA  . LEU A 1 83  ? 24.516 30.190 5.320  1.00 20.96 ? 82  LEU A CA  1 
ATOM   607  C  C   . LEU A 1 83  ? 24.836 29.628 6.693  1.00 24.23 ? 82  LEU A C   1 
ATOM   608  O  O   . LEU A 1 83  ? 25.438 30.322 7.493  1.00 27.00 ? 82  LEU A O   1 
ATOM   609  C  CB  . LEU A 1 83  ? 23.517 31.349 5.465  1.00 22.87 ? 82  LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 83  ? 23.198 32.134 4.169  1.00 23.21 ? 82  LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 83  ? 22.251 33.290 4.489  1.00 25.69 ? 82  LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 83  ? 24.415 32.625 3.451  1.00 20.61 ? 82  LEU A CD2 1 
ATOM   613  N  N   . LEU A 1 84  ? 24.426 28.385 6.978  1.00 23.01 ? 83  LEU A N   1 
ATOM   614  C  CA  . LEU A 1 84  ? 24.680 27.760 8.287  1.00 24.27 ? 83  LEU A CA  1 
ATOM   615  C  C   . LEU A 1 84  ? 26.037 27.061 8.279  1.00 23.75 ? 83  LEU A C   1 
ATOM   616  O  O   . LEU A 1 84  ? 26.509 26.688 7.226  1.00 23.74 ? 83  LEU A O   1 
ATOM   617  C  CB  . LEU A 1 84  ? 23.585 26.744 8.611  1.00 22.28 ? 83  LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 84  ? 22.154 27.260 8.591  1.00 26.79 ? 83  LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 84  ? 21.177 26.090 8.708  1.00 23.89 ? 83  LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 84  ? 22.001 28.311 9.710  1.00 28.66 ? 83  LEU A CD2 1 
ATOM   621  N  N   . ASP A 1 85  ? 26.664 26.940 9.450  1.00 24.53 ? 84  ASP A N   1 
ATOM   622  C  CA  . ASP A 1 85  ? 27.957 26.301 9.619  1.00 25.81 ? 84  ASP A CA  1 
ATOM   623  C  C   . ASP A 1 85  ? 27.671 25.087 10.483 1.00 23.57 ? 84  ASP A C   1 
ATOM   624  O  O   . ASP A 1 85  ? 27.485 25.194 11.690 1.00 22.04 ? 84  ASP A O   1 
ATOM   625  C  CB  . ASP A 1 85  ? 28.952 27.262 10.286 1.00 25.68 ? 84  ASP A CB  1 
ATOM   626  C  CG  . ASP A 1 85  ? 30.299 26.629 10.586 1.00 31.48 ? 84  ASP A CG  1 
ATOM   627  O  OD1 . ASP A 1 85  ? 30.429 25.387 10.660 1.00 32.45 ? 84  ASP A OD1 1 
ATOM   628  O  OD2 . ASP A 1 85  ? 31.248 27.406 10.757 1.00 42.42 ? 84  ASP A OD2 1 
ATOM   629  N  N   . ILE A 1 86  ? 27.612 23.927 9.851  1.00 23.49 ? 85  ILE A N   1 
ATOM   630  C  CA  . ILE A 1 86  ? 27.104 22.722 10.502 1.00 25.19 ? 85  ILE A CA  1 
ATOM   631  C  C   . ILE A 1 86  ? 28.050 22.297 11.634 1.00 25.20 ? 85  ILE A C   1 
ATOM   632  O  O   . ILE A 1 86  ? 27.637 21.808 12.674 1.00 25.57 ? 85  ILE A O   1 
ATOM   633  C  CB  . ILE A 1 86  ? 26.900 21.588 9.455  1.00 24.87 ? 85  ILE A CB  1 
ATOM   634  C  CG1 . ILE A 1 86  ? 26.176 20.397 10.072 1.00 26.93 ? 85  ILE A CG1 1 
ATOM   635  C  CG2 . ILE A 1 86  ? 28.211 21.163 8.871  1.00 28.70 ? 85  ILE A CG2 1 
ATOM   636  C  CD1 . ILE A 1 86  ? 25.419 19.581 9.070  1.00 27.87 ? 85  ILE A CD1 1 
ATOM   637  N  N   . LYS A 1 87  ? 29.339 22.518 11.444 1.00 22.13 ? 86  LYS A N   1 
ATOM   638  C  CA  . LYS A 1 87  ? 30.298 22.216 12.496 1.00 21.68 ? 86  LYS A CA  1 
ATOM   639  C  C   . LYS A 1 87  ? 30.080 23.062 13.754 1.00 21.58 ? 86  LYS A C   1 
ATOM   640  O  O   . LYS A 1 87  ? 30.219 22.559 14.865 1.00 22.89 ? 86  LYS A O   1 
ATOM   641  C  CB  . LYS A 1 87  ? 31.707 22.392 11.958 1.00 24.48 ? 86  LYS A CB  1 
ATOM   642  C  CG  . LYS A 1 87  ? 32.424 21.060 11.750 1.00 30.81 ? 86  LYS A CG  1 
ATOM   643  C  CD  . LYS A 1 87  ? 31.720 20.130 10.745 1.00 34.82 ? 86  LYS A CD  1 
ATOM   644  C  CE  . LYS A 1 87  ? 32.664 18.987 10.309 1.00 33.04 ? 86  LYS A CE  1 
ATOM   645  N  N   . ALA A 1 88  ? 29.684 24.321 13.573 1.00 23.07 ? 87  ALA A N   1 
ATOM   646  C  CA  . ALA A 1 88  ? 29.515 25.243 14.705 1.00 20.76 ? 87  ALA A CA  1 
ATOM   647  C  C   . ALA A 1 88  ? 28.255 24.878 15.437 1.00 19.41 ? 87  ALA A C   1 
ATOM   648  O  O   . ALA A 1 88  ? 28.217 24.894 16.655 1.00 18.53 ? 87  ALA A O   1 
ATOM   649  C  CB  . ALA A 1 88  ? 29.527 26.738 14.241 1.00 19.23 ? 87  ALA A CB  1 
ATOM   650  N  N   . ILE A 1 89  ? 27.220 24.511 14.683 1.00 18.27 ? 88  ILE A N   1 
ATOM   651  C  CA  . ILE A 1 89  ? 25.983 23.979 15.252 1.00 18.90 ? 88  ILE A CA  1 
ATOM   652  C  C   . ILE A 1 89  ? 26.267 22.699 16.039 1.00 20.59 ? 88  ILE A C   1 
ATOM   653  O  O   . ILE A 1 89  ? 25.836 22.558 17.195 1.00 20.85 ? 88  ILE A O   1 
ATOM   654  C  CB  . ILE A 1 89  ? 24.930 23.720 14.140 1.00 18.90 ? 88  ILE A CB  1 
ATOM   655  C  CG1 . ILE A 1 89  ? 24.596 25.024 13.416 1.00 19.92 ? 88  ILE A CG1 1 
ATOM   656  C  CG2 . ILE A 1 89  ? 23.660 23.043 14.742 1.00 19.74 ? 88  ILE A CG2 1 
ATOM   657  C  CD1 . ILE A 1 89  ? 23.703 24.915 12.163 1.00 16.36 ? 88  ILE A CD1 1 
ATOM   658  N  N   . GLU A 1 90  ? 27.016 21.778 15.428 1.00 19.55 ? 89  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 90  ? 27.364 20.514 16.068 1.00 23.28 ? 89  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 90  ? 28.051 20.749 17.402 1.00 24.47 ? 89  GLU A C   1 
ATOM   661  O  O   . GLU A 1 90  ? 27.651 20.197 18.400 1.00 24.35 ? 89  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 90  ? 28.278 19.708 15.143 1.00 26.94 ? 89  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 90  ? 28.613 18.296 15.624 1.00 26.60 ? 89  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 90  ? 29.239 17.489 14.520 1.00 27.94 ? 89  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 90  ? 30.251 17.947 13.949 1.00 31.97 ? 89  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 90  ? 28.726 16.400 14.210 1.00 46.23 ? 89  GLU A OE2 1 
ATOM   667  N  N   . ASN A 1 91  ? 29.109 21.552 17.415 1.00 22.75 ? 90  ASN A N   1 
ATOM   668  C  CA  . ASN A 1 91  ? 29.802 21.869 18.672 1.00 24.69 ? 90  ASN A CA  1 
ATOM   669  C  C   . ASN A 1 91  ? 28.945 22.511 19.781 1.00 23.77 ? 90  ASN A C   1 
ATOM   670  O  O   . ASN A 1 91  ? 29.036 22.114 20.941 1.00 23.49 ? 90  ASN A O   1 
ATOM   671  C  CB  . ASN A 1 91  ? 31.015 22.737 18.385 1.00 26.83 ? 90  ASN A CB  1 
ATOM   672  C  CG  . ASN A 1 91  ? 32.111 21.962 17.691 1.00 29.93 ? 90  ASN A CG  1 
ATOM   673  O  OD1 . ASN A 1 91  ? 32.004 20.739 17.527 1.00 31.38 ? 90  ASN A OD1 1 
ATOM   674  N  ND2 . ASN A 1 91  ? 33.150 22.663 17.247 1.00 41.07 ? 90  ASN A ND2 1 
ATOM   675  N  N   . TRP A 1 92  ? 28.104 23.474 19.401 1.00 23.34 ? 91  TRP A N   1 
ATOM   676  C  CA  . TRP A 1 92  ? 27.281 24.226 20.337 1.00 23.03 ? 91  TRP A CA  1 
ATOM   677  C  C   . TRP A 1 92  ? 26.228 23.295 20.944 1.00 22.78 ? 91  TRP A C   1 
ATOM   678  O  O   . TRP A 1 92  ? 25.940 23.349 22.159 1.00 24.37 ? 91  TRP A O   1 
ATOM   679  C  CB  . TRP A 1 92  ? 26.633 25.385 19.592 1.00 23.54 ? 91  TRP A CB  1 
ATOM   680  C  CG  . TRP A 1 92  ? 25.613 26.145 20.372 1.00 28.84 ? 91  TRP A CG  1 
ATOM   681  C  CD1 . TRP A 1 92  ? 25.844 27.156 21.273 1.00 32.82 ? 91  TRP A CD1 1 
ATOM   682  C  CD2 . TRP A 1 92  ? 24.199 25.966 20.322 1.00 30.75 ? 91  TRP A CD2 1 
ATOM   683  N  NE1 . TRP A 1 92  ? 24.648 27.618 21.768 1.00 35.40 ? 91  TRP A NE1 1 
ATOM   684  C  CE2 . TRP A 1 92  ? 23.628 26.899 21.205 1.00 30.60 ? 91  TRP A CE2 1 
ATOM   685  C  CE3 . TRP A 1 92  ? 23.354 25.123 19.590 1.00 31.24 ? 91  TRP A CE3 1 
ATOM   686  C  CZ2 . TRP A 1 92  ? 22.254 26.997 21.387 1.00 33.29 ? 91  TRP A CZ2 1 
ATOM   687  C  CZ3 . TRP A 1 92  ? 21.995 25.223 19.776 1.00 32.66 ? 91  TRP A CZ3 1 
ATOM   688  C  CH2 . TRP A 1 92  ? 21.464 26.155 20.659 1.00 31.20 ? 91  TRP A CH2 1 
ATOM   689  N  N   . ALA A 1 93  ? 25.704 22.419 20.100 1.00 22.50 ? 92  ALA A N   1 
ATOM   690  C  CA  . ALA A 1 93  ? 24.689 21.439 20.522 1.00 21.98 ? 92  ALA A CA  1 
ATOM   691  C  C   . ALA A 1 93  ? 25.282 20.470 21.549 1.00 23.40 ? 92  ALA A C   1 
ATOM   692  O  O   . ALA A 1 93  ? 24.632 20.140 22.548 1.00 23.90 ? 92  ALA A O   1 
ATOM   693  C  CB  . ALA A 1 93  ? 24.124 20.643 19.297 1.00 18.02 ? 92  ALA A CB  1 
ATOM   694  N  N   . LYS A 1 94  ? 26.525 20.043 21.296 1.00 25.04 ? 93  LYS A N   1 
ATOM   695  C  CA  . LYS A 1 94  ? 27.246 19.076 22.113 1.00 26.49 ? 93  LYS A CA  1 
ATOM   696  C  C   . LYS A 1 94  ? 27.666 19.698 23.447 1.00 25.39 ? 93  LYS A C   1 
ATOM   697  O  O   . LYS A 1 94  ? 27.598 19.061 24.485 1.00 26.55 ? 93  LYS A O   1 
ATOM   698  C  CB  . LYS A 1 94  ? 28.480 18.588 21.342 1.00 27.11 ? 93  LYS A CB  1 
ATOM   699  C  CG  . LYS A 1 94  ? 29.084 17.305 21.803 1.00 31.20 ? 93  LYS A CG  1 
ATOM   700  C  CD  . LYS A 1 94  ? 30.414 17.047 21.095 1.00 30.77 ? 93  LYS A CD  1 
ATOM   701  N  N   . GLU A 1 95  ? 28.107 20.948 23.423 1.00 26.33 ? 94  GLU A N   1 
ATOM   702  C  CA  . GLU A 1 95  ? 28.659 21.567 24.622 1.00 29.16 ? 94  GLU A CA  1 
ATOM   703  C  C   . GLU A 1 95  ? 27.597 22.163 25.570 1.00 28.30 ? 94  GLU A C   1 
ATOM   704  O  O   . GLU A 1 95  ? 27.857 22.320 26.765 1.00 29.48 ? 94  GLU A O   1 
ATOM   705  C  CB  . GLU A 1 95  ? 29.709 22.606 24.230 1.00 29.69 ? 94  GLU A CB  1 
ATOM   706  C  CG  . GLU A 1 95  ? 30.882 21.996 23.484 1.00 39.77 ? 94  GLU A CG  1 
ATOM   707  C  CD  . GLU A 1 95  ? 31.736 21.066 24.359 1.00 49.57 ? 94  GLU A CD  1 
ATOM   708  O  OE1 . GLU A 1 95  ? 32.352 21.569 25.333 1.00 60.85 ? 94  GLU A OE1 1 
ATOM   709  O  OE2 . GLU A 1 95  ? 31.796 19.837 24.067 1.00 50.00 ? 94  GLU A OE2 1 
ATOM   710  N  N   . THR A 1 96  ? 26.402 22.459 25.069 1.00 25.26 ? 95  THR A N   1 
ATOM   711  C  CA  . THR A 1 96  ? 25.355 22.991 25.915 1.00 25.19 ? 95  THR A CA  1 
ATOM   712  C  C   . THR A 1 96  ? 24.814 21.841 26.745 1.00 25.71 ? 95  THR A C   1 
ATOM   713  O  O   . THR A 1 96  ? 24.580 20.743 26.201 1.00 24.93 ? 95  THR A O   1 
ATOM   714  C  CB  . THR A 1 96  ? 24.225 23.645 25.065 1.00 26.53 ? 95  THR A CB  1 
ATOM   715  O  OG1 . THR A 1 96  ? 24.780 24.729 24.293 1.00 24.71 ? 95  THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 96  ? 23.080 24.166 25.934 1.00 21.76 ? 95  THR A CG2 1 
ATOM   717  N  N   . ASP A 1 97  ? 24.648 22.074 28.048 1.00 21.93 ? 96  ASP A N   1 
ATOM   718  C  CA  . ASP A 1 97  ? 24.147 21.050 28.956 1.00 22.83 ? 96  ASP A CA  1 
ATOM   719  C  C   . ASP A 1 97  ? 22.629 21.159 29.023 1.00 21.92 ? 96  ASP A C   1 
ATOM   720  O  O   . ASP A 1 97  ? 22.058 21.652 29.976 1.00 22.38 ? 96  ASP A O   1 
ATOM   721  C  CB  . ASP A 1 97  ? 24.806 21.198 30.329 1.00 23.13 ? 96  ASP A CB  1 
ATOM   722  C  CG  . ASP A 1 97  ? 24.636 19.968 31.212 1.00 24.50 ? 96  ASP A CG  1 
ATOM   723  O  OD1 . ASP A 1 97  ? 23.780 19.091 30.930 1.00 30.25 ? 96  ASP A OD1 1 
ATOM   724  O  OD2 . ASP A 1 97  ? 25.353 19.913 32.229 1.00 36.05 ? 96  ASP A OD2 1 
ATOM   725  N  N   . TRP A 1 98  ? 21.970 20.638 27.996 1.00 23.92 ? 97  TRP A N   1 
ATOM   726  C  CA  . TRP A 1 98  ? 20.517 20.742 27.865 1.00 23.07 ? 97  TRP A CA  1 
ATOM   727  C  C   . TRP A 1 98  ? 19.771 20.095 29.052 1.00 21.87 ? 97  TRP A C   1 
ATOM   728  O  O   . TRP A 1 98  ? 20.160 19.030 29.558 1.00 21.16 ? 97  TRP A O   1 
ATOM   729  C  CB  . TRP A 1 98  ? 20.098 20.103 26.550 1.00 22.49 ? 97  TRP A CB  1 
ATOM   730  C  CG  . TRP A 1 98  ? 20.735 20.723 25.336 1.00 21.65 ? 97  TRP A CG  1 
ATOM   731  C  CD1 . TRP A 1 98  ? 21.769 20.201 24.572 1.00 25.39 ? 97  TRP A CD1 1 
ATOM   732  C  CD2 . TRP A 1 98  ? 20.424 21.995 24.766 1.00 19.75 ? 97  TRP A CD2 1 
ATOM   733  N  NE1 . TRP A 1 98  ? 22.106 21.087 23.562 1.00 21.59 ? 97  TRP A NE1 1 
ATOM   734  C  CE2 . TRP A 1 98  ? 21.284 22.183 23.653 1.00 23.44 ? 97  TRP A CE2 1 
ATOM   735  C  CE3 . TRP A 1 98  ? 19.502 23.003 25.089 1.00 24.77 ? 97  TRP A CE3 1 
ATOM   736  C  CZ2 . TRP A 1 98  ? 21.242 23.317 22.877 1.00 25.36 ? 97  TRP A CZ2 1 
ATOM   737  C  CZ3 . TRP A 1 98  ? 19.449 24.130 24.293 1.00 25.46 ? 97  TRP A CZ3 1 
ATOM   738  C  CH2 . TRP A 1 98  ? 20.322 24.275 23.200 1.00 29.88 ? 97  TRP A CH2 1 
ATOM   739  N  N   . ALA A 1 99  ? 18.707 20.740 29.509 1.00 22.53 ? 98  ALA A N   1 
ATOM   740  C  CA  . ALA A 1 99  ? 17.945 20.287 30.680 1.00 21.25 ? 98  ALA A CA  1 
ATOM   741  C  C   . ALA A 1 99  ? 16.437 20.243 30.501 1.00 22.42 ? 98  ALA A C   1 
ATOM   742  O  O   . ALA A 1 99  ? 15.716 19.976 31.467 1.00 20.55 ? 98  ALA A O   1 
ATOM   743  C  CB  . ALA A 1 99  ? 18.277 21.172 31.897 1.00 22.03 ? 98  ALA A CB  1 
ATOM   744  N  N   . GLY A 1 100 ? 15.947 20.466 29.291 1.00 20.15 ? 99  GLY A N   1 
ATOM   745  C  CA  . GLY A 1 100 ? 14.532 20.367 29.032 1.00 17.36 ? 99  GLY A CA  1 
ATOM   746  C  C   . GLY A 1 100 ? 13.935 21.461 28.156 1.00 19.23 ? 99  GLY A C   1 
ATOM   747  O  O   . GLY A 1 100 ? 14.586 22.442 27.804 1.00 17.45 ? 99  GLY A O   1 
ATOM   748  N  N   . LEU A 1 101 ? 12.661 21.284 27.858 1.00 16.68 ? 100 LEU A N   1 
ATOM   749  C  CA  . LEU A 1 101 ? 11.846 22.130 26.986 1.00 18.81 ? 100 LEU A CA  1 
ATOM   750  C  C   . LEU A 1 101 ? 10.472 22.398 27.580 1.00 20.62 ? 100 LEU A C   1 
ATOM   751  O  O   . LEU A 1 101 ? 9.807  21.478 28.069 1.00 20.31 ? 100 LEU A O   1 
ATOM   752  C  CB  . LEU A 1 101 ? 11.671 21.466 25.607 1.00 21.26 ? 100 LEU A CB  1 
ATOM   753  C  CG  . LEU A 1 101 ? 10.853 22.272 24.578 1.00 19.45 ? 100 LEU A CG  1 
ATOM   754  C  CD1 . LEU A 1 101 ? 11.651 23.546 24.177 1.00 16.34 ? 100 LEU A CD1 1 
ATOM   755  C  CD2 . LEU A 1 101 ? 10.421 21.380 23.355 1.00 22.65 ? 100 LEU A CD2 1 
ATOM   756  N  N   . GLU A 1 102 ? 10.076 23.665 27.564 1.00 18.89 ? 101 GLU A N   1 
ATOM   757  C  CA  . GLU A 1 102 ? 8.728  24.077 27.903 1.00 19.74 ? 101 GLU A CA  1 
ATOM   758  C  C   . GLU A 1 102 ? 8.150  24.851 26.727 1.00 21.27 ? 101 GLU A C   1 
ATOM   759  O  O   . GLU A 1 102 ? 8.631  25.938 26.388 1.00 21.83 ? 101 GLU A O   1 
ATOM   760  C  CB  . GLU A 1 102 ? 8.769  24.972 29.125 1.00 19.23 ? 101 GLU A CB  1 
ATOM   761  C  CG  . GLU A 1 102 ? 7.426  25.547 29.511 1.00 20.51 ? 101 GLU A CG  1 
ATOM   762  C  CD  . GLU A 1 102 ? 7.487  26.484 30.728 1.00 23.94 ? 101 GLU A CD  1 
ATOM   763  O  OE1 . GLU A 1 102 ? 8.601  26.875 31.179 1.00 22.23 ? 101 GLU A OE1 1 
ATOM   764  O  OE2 . GLU A 1 102 ? 6.400  26.789 31.249 1.00 29.31 ? 101 GLU A OE2 1 
ATOM   765  N  N   . VAL A 1 103 ? 7.079  24.331 26.128 1.00 22.15 ? 102 VAL A N   1 
ATOM   766  C  CA  . VAL A 1 103 ? 6.410  25.047 25.054 1.00 22.53 ? 102 VAL A CA  1 
ATOM   767  C  C   . VAL A 1 103 ? 5.380  25.956 25.749 1.00 22.90 ? 102 VAL A C   1 
ATOM   768  O  O   . VAL A 1 103 ? 4.454  25.479 26.453 1.00 24.17 ? 102 VAL A O   1 
ATOM   769  C  CB  . VAL A 1 103 ? 5.791  24.103 23.950 1.00 22.22 ? 102 VAL A CB  1 
ATOM   770  C  CG1 . VAL A 1 103 ? 5.013  24.945 22.932 1.00 22.83 ? 102 VAL A CG1 1 
ATOM   771  C  CG2 . VAL A 1 103 ? 6.848  23.256 23.247 1.00 24.29 ? 102 VAL A CG2 1 
ATOM   772  N  N   . VAL A 1 104 ? 5.595  27.261 25.600 1.00 19.72 ? 103 VAL A N   1 
ATOM   773  C  CA  . VAL A 1 104 ? 4.722  28.272 26.202 1.00 19.33 ? 103 VAL A CA  1 
ATOM   774  C  C   . VAL A 1 104 ? 3.467  28.476 25.354 1.00 19.09 ? 103 VAL A C   1 
ATOM   775  O  O   . VAL A 1 104 ? 2.333  28.541 25.893 1.00 19.71 ? 103 VAL A O   1 
ATOM   776  C  CB  . VAL A 1 104 ? 5.472  29.585 26.424 1.00 18.68 ? 103 VAL A CB  1 
ATOM   777  C  CG1 . VAL A 1 104 ? 4.514  30.694 26.951 1.00 18.38 ? 103 VAL A CG1 1 
ATOM   778  C  CG2 . VAL A 1 104 ? 6.678  29.363 27.346 1.00 17.39 ? 103 VAL A CG2 1 
ATOM   779  N  N   . ALA A 1 105 ? 3.612  28.570 24.037 1.00 17.90 ? 104 ALA A N   1 
ATOM   780  C  CA  . ALA A 1 105 ? 2.463  28.917 23.185 1.00 19.74 ? 104 ALA A CA  1 
ATOM   781  C  C   . ALA A 1 105 ? 2.770  28.537 21.762 1.00 21.12 ? 104 ALA A C   1 
ATOM   782  O  O   . ALA A 1 105 ? 3.929  28.540 21.351 1.00 23.35 ? 104 ALA A O   1 
ATOM   783  C  CB  . ALA A 1 105 ? 2.140  30.422 23.269 1.00 18.85 ? 104 ALA A CB  1 
ATOM   784  N  N   . HIS A 1 106 ? 1.718  28.180 21.040 1.00 20.61 ? 105 HIS A N   1 
ATOM   785  C  CA  . HIS A 1 106 ? 1.784  27.822 19.623 1.00 19.87 ? 105 HIS A CA  1 
ATOM   786  C  C   . HIS A 1 106 ? 0.727  28.636 18.897 1.00 20.13 ? 105 HIS A C   1 
ATOM   787  O  O   . HIS A 1 106 ? -0.457 28.667 19.317 1.00 22.05 ? 105 HIS A O   1 
ATOM   788  C  CB  . HIS A 1 106 ? 1.528  26.326 19.475 1.00 19.70 ? 105 HIS A CB  1 
ATOM   789  C  CG  . HIS A 1 106 ? 1.530  25.842 18.070 1.00 18.19 ? 105 HIS A CG  1 
ATOM   790  N  ND1 . HIS A 1 106 ? 0.687  24.846 17.630 1.00 22.64 ? 105 HIS A ND1 1 
ATOM   791  C  CD2 . HIS A 1 106 ? 2.234  26.252 16.987 1.00 24.43 ? 105 HIS A CD2 1 
ATOM   792  C  CE1 . HIS A 1 106 ? 0.890  24.649 16.342 1.00 20.14 ? 105 HIS A CE1 1 
ATOM   793  N  NE2 . HIS A 1 106 ? 1.820  25.489 15.925 1.00 23.75 ? 105 HIS A NE2 1 
ATOM   794  N  N   . THR A 1 107 ? 1.156  29.315 17.827 1.00 20.30 ? 106 THR A N   1 
ATOM   795  C  CA  . THR A 1 107 ? 0.318  30.197 17.049 1.00 20.57 ? 106 THR A CA  1 
ATOM   796  C  C   . THR A 1 107 ? 0.316  29.629 15.630 1.00 18.44 ? 106 THR A C   1 
ATOM   797  O  O   . THR A 1 107 ? 1.102  30.060 14.814 1.00 19.78 ? 106 THR A O   1 
ATOM   798  C  CB  . THR A 1 107 ? 0.916  31.629 17.050 1.00 20.89 ? 106 THR A CB  1 
ATOM   799  O  OG1 . THR A 1 107 ? 0.939  32.161 18.394 1.00 25.33 ? 106 THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 107 ? 0.101  32.567 16.133 1.00 23.97 ? 106 THR A CG2 1 
ATOM   801  N  N   . PRO A 1 108 ? -0.542 28.634 15.347 1.00 19.19 ? 107 PRO A N   1 
ATOM   802  C  CA  . PRO A 1 108 ? -0.455 27.966 14.047 1.00 21.44 ? 107 PRO A CA  1 
ATOM   803  C  C   . PRO A 1 108 ? -0.866 28.842 12.837 1.00 21.76 ? 107 PRO A C   1 
ATOM   804  O  O   . PRO A 1 108 ? -0.488 28.548 11.705 1.00 24.90 ? 107 PRO A O   1 
ATOM   805  C  CB  . PRO A 1 108 ? -1.402 26.759 14.194 1.00 21.12 ? 107 PRO A CB  1 
ATOM   806  C  CG  . PRO A 1 108 ? -2.227 27.032 15.333 1.00 22.89 ? 107 PRO A CG  1 
ATOM   807  C  CD  . PRO A 1 108 ? -1.571 28.041 16.212 1.00 20.51 ? 107 PRO A CD  1 
ATOM   808  N  N   . LYS A 1 109 ? -1.631 29.888 13.096 1.00 22.02 ? 108 LYS A N   1 
ATOM   809  C  CA  . LYS A 1 109 ? -2.179 30.731 12.036 1.00 20.36 ? 108 LYS A CA  1 
ATOM   810  C  C   . LYS A 1 109 ? -1.698 32.162 12.204 1.00 20.18 ? 108 LYS A C   1 
ATOM   811  O  O   . LYS A 1 109 ? -2.511 33.093 12.217 1.00 23.20 ? 108 LYS A O   1 
ATOM   812  C  CB  . LYS A 1 109 ? -3.708 30.666 12.044 1.00 24.53 ? 108 LYS A CB  1 
ATOM   813  C  CG  . LYS A 1 109 ? -4.282 29.358 11.542 1.00 27.53 ? 108 LYS A CG  1 
ATOM   814  C  CD  . LYS A 1 109 ? -5.835 29.441 11.354 1.00 24.41 ? 108 LYS A CD  1 
ATOM   815  N  N   . LEU A 1 110 ? -0.376 32.340 12.323 1.00 18.13 ? 109 LEU A N   1 
ATOM   816  C  CA  . LEU A 1 110 ? 0.187  33.681 12.455 1.00 18.79 ? 109 LEU A CA  1 
ATOM   817  C  C   . LEU A 1 110 ? -0.117 34.471 11.199 1.00 17.30 ? 109 LEU A C   1 
ATOM   818  O  O   . LEU A 1 110 ? -0.591 35.611 11.281 1.00 19.15 ? 109 LEU A O   1 
ATOM   819  C  CB  . LEU A 1 110 ? 1.680  33.625 12.688 1.00 19.50 ? 109 LEU A CB  1 
ATOM   820  C  CG  . LEU A 1 110 ? 2.461  34.935 12.809 1.00 20.58 ? 109 LEU A CG  1 
ATOM   821  C  CD1 . LEU A 1 110 ? 2.077  35.725 14.107 1.00 23.74 ? 109 LEU A CD1 1 
ATOM   822  C  CD2 . LEU A 1 110 ? 3.966  34.611 12.743 1.00 21.14 ? 109 LEU A CD2 1 
ATOM   823  N  N   . SER A 1 111 ? 0.086  33.834 10.039 1.00 17.92 ? 110 SER A N   1 
ATOM   824  C  CA  . SER A 1 111 ? -0.381 34.332 8.726  1.00 19.10 ? 110 SER A CA  1 
ATOM   825  C  C   . SER A 1 111 ? -0.906 33.148 7.928  1.00 20.17 ? 110 SER A C   1 
ATOM   826  O  O   . SER A 1 111 ? -0.926 32.031 8.429  1.00 22.55 ? 110 SER A O   1 
ATOM   827  C  CB  . SER A 1 111 ? 0.755  34.945 7.898  1.00 18.77 ? 110 SER A CB  1 
ATOM   828  O  OG  . SER A 1 111 ? 1.524  33.891 7.345  1.00 18.61 ? 110 SER A OG  1 
ATOM   829  N  N   . LYS A 1 112 ? -1.237 33.399 6.664  1.00 19.26 ? 111 LYS A N   1 
ATOM   830  C  CA  . LYS A 1 112 ? -1.623 32.359 5.728  1.00 20.28 ? 111 LYS A CA  1 
ATOM   831  C  C   . LYS A 1 112 ? -0.577 31.277 5.616  1.00 20.99 ? 111 LYS A C   1 
ATOM   832  O  O   . LYS A 1 112 ? -0.916 30.131 5.397  1.00 23.32 ? 111 LYS A O   1 
ATOM   833  C  CB  . LYS A 1 112 ? -1.865 32.952 4.341  1.00 22.67 ? 111 LYS A CB  1 
ATOM   834  C  CG  . LYS A 1 112 ? -2.343 31.967 3.308  1.00 29.18 ? 111 LYS A CG  1 
ATOM   835  N  N   . ARG A 1 113 ? 0.690  31.633 5.767  1.00 20.12 ? 112 ARG A N   1 
ATOM   836  C  CA  . ARG A 1 113 ? 1.759  30.640 5.592  1.00 20.37 ? 112 ARG A CA  1 
ATOM   837  C  C   . ARG A 1 113 ? 2.769  30.563 6.733  1.00 19.00 ? 112 ARG A C   1 
ATOM   838  O  O   . ARG A 1 113 ? 3.781  29.819 6.626  1.00 18.26 ? 112 ARG A O   1 
ATOM   839  C  CB  . ARG A 1 113 ? 2.455  30.874 4.262  1.00 20.22 ? 112 ARG A CB  1 
ATOM   840  C  CG  . ARG A 1 113 ? 3.096  32.220 4.124  1.00 25.92 ? 112 ARG A CG  1 
ATOM   841  C  CD  . ARG A 1 113 ? 3.448  32.551 2.629  1.00 30.33 ? 112 ARG A CD  1 
ATOM   842  N  NE  . ARG A 1 113 ? 2.487  32.150 1.583  1.00 35.68 ? 112 ARG A NE  1 
ATOM   843  C  CZ  . ARG A 1 113 ? 1.544  32.909 0.997  1.00 39.85 ? 112 ARG A CZ  1 
ATOM   844  N  NH1 . ARG A 1 113 ? 1.271  34.175 1.350  1.00 32.00 ? 112 ARG A NH1 1 
ATOM   845  N  NH2 . ARG A 1 113 ? 0.802  32.358 0.048  1.00 50.56 ? 112 ARG A NH2 1 
ATOM   846  N  N   . HIS A 1 114 ? 2.538  31.305 7.816  1.00 17.91 ? 113 HIS A N   1 
ATOM   847  C  CA  . HIS A 1 114 ? 3.456  31.278 8.963  1.00 17.45 ? 113 HIS A CA  1 
ATOM   848  C  C   . HIS A 1 114 ? 2.827  30.880 10.282 1.00 19.25 ? 113 HIS A C   1 
ATOM   849  O  O   . HIS A 1 114 ? 1.623  31.027 10.495 1.00 19.13 ? 113 HIS A O   1 
ATOM   850  C  CB  . HIS A 1 114 ? 4.057  32.637 9.207  1.00 21.12 ? 113 HIS A CB  1 
ATOM   851  C  CG  . HIS A 1 114 ? 4.843  33.146 8.068  1.00 22.30 ? 113 HIS A CG  1 
ATOM   852  N  ND1 . HIS A 1 114 ? 4.275  33.916 7.081  1.00 21.56 ? 113 HIS A ND1 1 
ATOM   853  C  CD2 . HIS A 1 114 ? 6.149  33.018 7.755  1.00 16.22 ? 113 HIS A CD2 1 
ATOM   854  C  CE1 . HIS A 1 114 ? 5.198  34.219 6.191  1.00 18.31 ? 113 HIS A CE1 1 
ATOM   855  N  NE2 . HIS A 1 114 ? 6.348  33.715 6.588  1.00 17.96 ? 113 HIS A NE2 1 
ATOM   856  N  N   . ALA A 1 115 ? 3.693  30.405 11.172 1.00 18.15 ? 114 ALA A N   1 
ATOM   857  C  CA  . ALA A 1 115 ? 3.303  30.018 12.510 1.00 17.85 ? 114 ALA A CA  1 
ATOM   858  C  C   . ALA A 1 115 ? 4.441  30.455 13.433 1.00 18.19 ? 114 ALA A C   1 
ATOM   859  O  O   . ALA A 1 115 ? 5.594  30.579 13.013 1.00 18.40 ? 114 ALA A O   1 
ATOM   860  C  CB  . ALA A 1 115 ? 3.068  28.506 12.574 1.00 17.65 ? 114 ALA A CB  1 
ATOM   861  N  N   . GLN A 1 116 ? 4.096  30.657 14.687 1.00 17.78 ? 115 GLN A N   1 
ATOM   862  C  CA  . GLN A 1 116 ? 5.044  30.880 15.736 1.00 19.15 ? 115 GLN A CA  1 
ATOM   863  C  C   . GLN A 1 116 ? 4.871  29.855 16.880 1.00 21.00 ? 115 GLN A C   1 
ATOM   864  O  O   . GLN A 1 116 ? 3.822  29.302 17.121 1.00 17.48 ? 115 GLN A O   1 
ATOM   865  C  CB  . GLN A 1 116 ? 4.953  32.315 16.265 1.00 22.39 ? 115 GLN A CB  1 
ATOM   866  C  CG  . GLN A 1 116 ? 5.809  33.286 15.483 1.00 23.85 ? 115 GLN A CG  1 
ATOM   867  C  CD  . GLN A 1 116 ? 5.675  34.742 15.866 1.00 19.86 ? 115 GLN A CD  1 
ATOM   868  O  OE1 . GLN A 1 116 ? 4.786  35.147 16.617 1.00 22.19 ? 115 GLN A OE1 1 
ATOM   869  N  NE2 . GLN A 1 116 ? 6.550  35.566 15.289 1.00 24.70 ? 115 GLN A NE2 1 
ATOM   870  N  N   . VAL A 1 117 ? 5.975  29.647 17.566 1.00 19.82 ? 116 VAL A N   1 
ATOM   871  C  CA  . VAL A 1 117 ? 6.089  28.806 18.760 1.00 20.23 ? 116 VAL A CA  1 
ATOM   872  C  C   . VAL A 1 117 ? 6.973  29.592 19.730 1.00 20.21 ? 116 VAL A C   1 
ATOM   873  O  O   . VAL A 1 117 ? 8.127  29.959 19.397 1.00 21.54 ? 116 VAL A O   1 
ATOM   874  C  CB  . VAL A 1 117 ? 6.795  27.467 18.462 1.00 19.82 ? 116 VAL A CB  1 
ATOM   875  C  CG1 . VAL A 1 117 ? 6.872  26.583 19.725 1.00 21.27 ? 116 VAL A CG1 1 
ATOM   876  C  CG2 . VAL A 1 117 ? 6.110  26.748 17.282 1.00 17.61 ? 116 VAL A CG2 1 
ATOM   877  N  N   . GLU A 1 118 ? 6.446  29.823 20.933 1.00 20.50 ? 117 GLU A N   1 
ATOM   878  C  CA  . GLU A 1 118 ? 7.171  30.458 22.042 1.00 18.47 ? 117 GLU A CA  1 
ATOM   879  C  C   . GLU A 1 118 ? 7.548  29.320 22.984 1.00 16.63 ? 117 GLU A C   1 
ATOM   880  O  O   . GLU A 1 118 ? 6.700  28.508 23.350 1.00 16.77 ? 117 GLU A O   1 
ATOM   881  C  CB  . GLU A 1 118 ? 6.268  31.460 22.773 1.00 18.17 ? 117 GLU A CB  1 
ATOM   882  C  CG  . GLU A 1 118 ? 6.911  32.138 23.963 1.00 19.59 ? 117 GLU A CG  1 
ATOM   883  C  CD  . GLU A 1 118 ? 5.995  33.030 24.768 1.00 21.93 ? 117 GLU A CD  1 
ATOM   884  O  OE1 . GLU A 1 118 ? 4.842  33.294 24.354 1.00 20.79 ? 117 GLU A OE1 1 
ATOM   885  O  OE2 . GLU A 1 118 ? 6.437  33.465 25.861 1.00 26.19 ? 117 GLU A OE2 1 
ATOM   886  N  N   . PHE A 1 119 ? 8.802  29.274 23.393 1.00 20.76 ? 118 PHE A N   1 
ATOM   887  C  CA  . PHE A 1 119 ? 9.269  28.197 24.253 1.00 19.70 ? 118 PHE A CA  1 
ATOM   888  C  C   . PHE A 1 119 ? 10.445 28.603 25.132 1.00 18.77 ? 118 PHE A C   1 
ATOM   889  O  O   . PHE A 1 119 ? 11.090 29.649 24.906 1.00 17.18 ? 118 PHE A O   1 
ATOM   890  C  CB  . PHE A 1 119 ? 9.643  26.995 23.381 1.00 21.26 ? 118 PHE A CB  1 
ATOM   891  C  CG  . PHE A 1 119 ? 10.823 27.251 22.497 1.00 16.40 ? 118 PHE A CG  1 
ATOM   892  C  CD1 . PHE A 1 119 ? 10.651 27.797 21.223 1.00 21.93 ? 118 PHE A CD1 1 
ATOM   893  C  CD2 . PHE A 1 119 ? 12.112 26.982 22.929 1.00 19.16 ? 118 PHE A CD2 1 
ATOM   894  C  CE1 . PHE A 1 119 ? 11.757 28.030 20.423 1.00 25.63 ? 118 PHE A CE1 1 
ATOM   895  C  CE2 . PHE A 1 119 ? 13.249 27.235 22.101 1.00 25.64 ? 118 PHE A CE2 1 
ATOM   896  C  CZ  . PHE A 1 119 ? 13.050 27.733 20.844 1.00 26.84 ? 118 PHE A CZ  1 
ATOM   897  N  N   . LYS A 1 120 ? 10.697 27.805 26.162 1.00 19.34 ? 119 LYS A N   1 
ATOM   898  C  CA  . LYS A 1 120 ? 11.871 27.945 26.992 1.00 20.35 ? 119 LYS A CA  1 
ATOM   899  C  C   . LYS A 1 120 ? 12.695 26.683 26.862 1.00 19.39 ? 119 LYS A C   1 
ATOM   900  O  O   . LYS A 1 120 ? 12.194 25.571 27.104 1.00 19.51 ? 119 LYS A O   1 
ATOM   901  C  CB  . LYS A 1 120 ? 11.480 28.161 28.461 1.00 20.15 ? 119 LYS A CB  1 
ATOM   902  C  CG  . LYS A 1 120 ? 10.785 29.479 28.686 1.00 23.22 ? 119 LYS A CG  1 
ATOM   903  C  CD  . LYS A 1 120 ? 10.389 29.738 30.124 1.00 24.57 ? 119 LYS A CD  1 
ATOM   904  C  CE  . LYS A 1 120 ? 9.682  31.082 30.182 1.00 28.59 ? 119 LYS A CE  1 
ATOM   905  N  NZ  . LYS A 1 120 ? 9.466  31.597 31.556 1.00 31.24 ? 119 LYS A NZ  1 
ATOM   906  N  N   . ALA A 1 121 ? 13.935 26.853 26.442 1.00 18.76 ? 120 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 121 ? 14.891 25.741 26.373 1.00 20.66 ? 120 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 121 ? 15.857 25.841 27.545 1.00 21.55 ? 120 ALA A C   1 
ATOM   909  O  O   . ALA A 1 121 ? 16.585 26.828 27.672 1.00 21.87 ? 120 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 121 ? 15.672 25.773 25.060 1.00 20.61 ? 120 ALA A CB  1 
ATOM   911  N  N   . TYR A 1 122 ? 15.869 24.815 28.409 1.00 20.91 ? 121 TYR A N   1 
ATOM   912  C  CA  . TYR A 1 122 ? 16.568 24.900 29.669 1.00 18.63 ? 121 TYR A CA  1 
ATOM   913  C  C   . TYR A 1 122 ? 17.950 24.335 29.530 1.00 19.60 ? 121 TYR A C   1 
ATOM   914  O  O   . TYR A 1 122 ? 18.176 23.443 28.738 1.00 18.84 ? 121 TYR A O   1 
ATOM   915  C  CB  . TYR A 1 122 ? 15.820 24.137 30.781 1.00 17.14 ? 121 TYR A CB  1 
ATOM   916  C  CG  . TYR A 1 122 ? 14.524 24.802 31.180 1.00 18.73 ? 121 TYR A CG  1 
ATOM   917  C  CD1 . TYR A 1 122 ? 13.369 24.590 30.449 1.00 18.72 ? 121 TYR A CD1 1 
ATOM   918  C  CD2 . TYR A 1 122 ? 14.449 25.614 32.311 1.00 19.04 ? 121 TYR A CD2 1 
ATOM   919  C  CE1 . TYR A 1 122 ? 12.139 25.190 30.811 1.00 21.87 ? 121 TYR A CE1 1 
ATOM   920  C  CE2 . TYR A 1 122 ? 13.230 26.245 32.666 1.00 26.05 ? 121 TYR A CE2 1 
ATOM   921  C  CZ  . TYR A 1 122 ? 12.088 26.017 31.900 1.00 24.58 ? 121 TYR A CZ  1 
ATOM   922  O  OH  . TYR A 1 122 ? 10.887 26.596 32.267 1.00 23.07 ? 121 TYR A OH  1 
ATOM   923  N  N   . PHE A 1 123 ? 18.899 24.862 30.288 1.00 21.88 ? 122 PHE A N   1 
ATOM   924  C  CA  . PHE A 1 123 ? 20.223 24.270 30.285 1.00 23.96 ? 122 PHE A CA  1 
ATOM   925  C  C   . PHE A 1 123 ? 20.898 24.488 31.623 1.00 26.56 ? 122 PHE A C   1 
ATOM   926  O  O   . PHE A 1 123 ? 20.475 25.324 32.409 1.00 24.55 ? 122 PHE A O   1 
ATOM   927  C  CB  . PHE A 1 123 ? 21.066 24.810 29.115 1.00 25.97 ? 122 PHE A CB  1 
ATOM   928  C  CG  . PHE A 1 123 ? 21.257 26.309 29.139 1.00 22.60 ? 122 PHE A CG  1 
ATOM   929  C  CD1 . PHE A 1 123 ? 20.292 27.150 28.564 1.00 22.12 ? 122 PHE A CD1 1 
ATOM   930  C  CD2 . PHE A 1 123 ? 22.372 26.866 29.727 1.00 32.97 ? 122 PHE A CD2 1 
ATOM   931  C  CE1 . PHE A 1 123 ? 20.436 28.504 28.601 1.00 29.05 ? 122 PHE A CE1 1 
ATOM   932  C  CE2 . PHE A 1 123 ? 22.531 28.235 29.751 1.00 34.08 ? 122 PHE A CE2 1 
ATOM   933  C  CZ  . PHE A 1 123 ? 21.561 29.051 29.175 1.00 27.43 ? 122 PHE A CZ  1 
ATOM   934  N  N   . LYS A 1 124 ? 21.920 23.687 31.900 1.00 28.20 ? 123 LYS A N   1 
ATOM   935  C  CA  . LYS A 1 124 ? 22.647 23.787 33.171 1.00 30.11 ? 123 LYS A CA  1 
ATOM   936  C  C   . LYS A 1 124 ? 23.980 24.509 32.991 1.00 33.73 ? 123 LYS A C   1 
ATOM   937  O  O   . LYS A 1 124 ? 24.690 24.323 31.993 1.00 33.87 ? 123 LYS A O   1 
ATOM   938  C  CB  . LYS A 1 124 ? 22.852 22.405 33.786 1.00 28.11 ? 123 LYS A CB  1 
ATOM   939  C  CG  . LYS A 1 124 ? 21.575 21.791 34.344 1.00 28.96 ? 123 LYS A CG  1 
ATOM   940  N  N   . THR A 1 125 ? 24.292 25.359 33.961 1.00 40.85 ? 124 THR A N   1 
ATOM   941  C  CA  . THR A 1 125 ? 25.561 26.099 34.010 1.00 45.86 ? 124 THR A CA  1 
ATOM   942  C  C   . THR A 1 125 ? 26.123 25.940 35.436 1.00 48.00 ? 124 THR A C   1 
ATOM   943  O  O   . THR A 1 125 ? 25.390 25.494 36.343 1.00 48.18 ? 124 THR A O   1 
ATOM   944  C  CB  . THR A 1 125 ? 25.359 27.615 33.644 1.00 46.90 ? 124 THR A CB  1 
ATOM   945  O  OG1 . THR A 1 125 ? 24.383 28.203 34.526 1.00 52.08 ? 124 THR A OG1 1 
ATOM   946  C  CG2 . THR A 1 125 ? 24.903 27.771 32.169 1.00 41.89 ? 124 THR A CG2 1 
ATOM   947  N  N   . PRO A 1 126 ? 27.418 26.281 35.643 1.00 50.68 ? 125 PRO A N   1 
ATOM   948  C  CA  . PRO A 1 126 ? 27.933 26.377 37.013 1.00 51.53 ? 125 PRO A CA  1 
ATOM   949  C  C   . PRO A 1 126 ? 26.911 27.058 37.925 1.00 52.73 ? 125 PRO A C   1 
ATOM   950  O  O   . PRO A 1 126 ? 26.631 26.577 39.033 1.00 53.38 ? 125 PRO A O   1 
ATOM   951  C  CB  . PRO A 1 126 ? 29.181 27.250 36.852 1.00 51.98 ? 125 PRO A CB  1 
ATOM   952  C  CG  . PRO A 1 126 ? 29.689 26.937 35.489 1.00 52.44 ? 125 PRO A CG  1 
ATOM   953  C  CD  . PRO A 1 126 ? 28.465 26.591 34.645 1.00 52.15 ? 125 PRO A CD  1 
ATOM   954  N  N   . ASP A 1 127 ? 26.304 28.128 37.405 1.00 51.45 ? 126 ASP A N   1 
ATOM   955  C  CA  . ASP A 1 127 ? 25.400 28.970 38.179 1.00 49.68 ? 126 ASP A CA  1 
ATOM   956  C  C   . ASP A 1 127 ? 24.028 28.327 38.520 1.00 49.08 ? 126 ASP A C   1 
ATOM   957  O  O   . ASP A 1 127 ? 23.421 28.697 39.539 1.00 52.13 ? 126 ASP A O   1 
ATOM   958  C  CB  . ASP A 1 127 ? 25.213 30.324 37.473 1.00 52.44 ? 126 ASP A CB  1 
ATOM   959  C  CG  . ASP A 1 127 ? 26.498 30.836 36.833 1.00 57.59 ? 126 ASP A CG  1 
ATOM   960  O  OD1 . ASP A 1 127 ? 26.893 30.272 35.786 1.00 66.49 ? 126 ASP A OD1 1 
ATOM   961  O  OD2 . ASP A 1 127 ? 27.111 31.791 37.372 1.00 66.95 ? 126 ASP A OD2 1 
ATOM   962  N  N   . GLY A 1 128 ? 23.536 27.392 37.700 1.00 42.86 ? 127 GLY A N   1 
ATOM   963  C  CA  . GLY A 1 128 ? 22.297 26.674 38.025 1.00 40.04 ? 127 GLY A CA  1 
ATOM   964  C  C   . GLY A 1 128 ? 21.467 26.422 36.774 1.00 33.76 ? 127 GLY A C   1 
ATOM   965  O  O   . GLY A 1 128 ? 22.005 26.487 35.680 1.00 32.62 ? 127 GLY A O   1 
ATOM   966  N  N   . LEU A 1 129 ? 20.177 26.139 36.935 1.00 30.11 ? 128 LEU A N   1 
ATOM   967  C  CA  . LEU A 1 129 ? 19.292 25.909 35.781 1.00 30.27 ? 128 LEU A CA  1 
ATOM   968  C  C   . LEU A 1 129 ? 18.890 27.244 35.173 1.00 28.09 ? 128 LEU A C   1 
ATOM   969  O  O   . LEU A 1 129 ? 18.346 28.099 35.872 1.00 26.76 ? 128 LEU A O   1 
ATOM   970  C  CB  . LEU A 1 129 ? 18.024 25.131 36.171 1.00 34.22 ? 128 LEU A CB  1 
ATOM   971  C  CG  . LEU A 1 129 ? 17.555 24.059 35.204 1.00 32.32 ? 128 LEU A CG  1 
ATOM   972  C  CD1 . LEU A 1 129 ? 18.568 22.909 35.232 1.00 30.76 ? 128 LEU A CD1 1 
ATOM   973  C  CD2 . LEU A 1 129 ? 16.165 23.543 35.551 1.00 34.16 ? 128 LEU A CD2 1 
ATOM   974  N  N   . GLN A 1 130 ? 19.173 27.403 33.879 1.00 26.66 ? 129 GLN A N   1 
ATOM   975  C  CA  . GLN A 1 130 ? 18.900 28.615 33.080 1.00 27.31 ? 129 GLN A CA  1 
ATOM   976  C  C   . GLN A 1 130 ? 17.987 28.262 31.898 1.00 24.40 ? 129 GLN A C   1 
ATOM   977  O  O   . GLN A 1 130 ? 17.856 27.088 31.545 1.00 22.63 ? 129 GLN A O   1 
ATOM   978  C  CB  . GLN A 1 130 ? 20.218 29.163 32.526 1.00 28.74 ? 129 GLN A CB  1 
ATOM   979  C  CG  . GLN A 1 130 ? 21.335 29.361 33.579 1.00 35.92 ? 129 GLN A CG  1 
ATOM   980  C  CD  . GLN A 1 130 ? 21.390 30.771 34.155 1.00 34.82 ? 129 GLN A CD  1 
ATOM   981  O  OE1 . GLN A 1 130 ? 20.870 31.706 33.565 1.00 40.51 ? 129 GLN A OE1 1 
ATOM   982  N  NE2 . GLN A 1 130 ? 22.054 30.927 35.291 1.00 39.12 ? 129 GLN A NE2 1 
ATOM   983  N  N   . ALA A 1 131 ? 17.364 29.264 31.293 1.00 24.77 ? 130 ALA A N   1 
ATOM   984  C  CA  . ALA A 1 131 ? 16.518 29.032 30.129 1.00 23.93 ? 130 ALA A CA  1 
ATOM   985  C  C   . ALA A 1 131 ? 16.701 30.089 29.078 1.00 22.15 ? 130 ALA A C   1 
ATOM   986  O  O   . ALA A 1 131 ? 16.950 31.249 29.418 1.00 25.63 ? 130 ALA A O   1 
ATOM   987  C  CB  . ALA A 1 131 ? 15.009 28.948 30.540 1.00 25.11 ? 130 ALA A CB  1 
ATOM   988  N  N   . HIS A 1 132 ? 16.675 29.666 27.822 1.00 21.46 ? 131 HIS A N   1 
ATOM   989  C  CA  . HIS A 1 132 ? 16.565 30.529 26.650 1.00 24.75 ? 131 HIS A CA  1 
ATOM   990  C  C   . HIS A 1 132 ? 15.095 30.705 26.369 1.00 24.00 ? 131 HIS A C   1 
ATOM   991  O  O   . HIS A 1 132 ? 14.443 29.723 26.020 1.00 25.82 ? 131 HIS A O   1 
ATOM   992  C  CB  . HIS A 1 132 ? 17.121 29.847 25.405 1.00 26.54 ? 131 HIS A CB  1 
ATOM   993  C  CG  . HIS A 1 132 ? 18.586 29.586 25.441 1.00 31.96 ? 131 HIS A CG  1 
ATOM   994  N  ND1 . HIS A 1 132 ? 19.521 30.592 25.338 1.00 37.89 ? 131 HIS A ND1 1 
ATOM   995  C  CD2 . HIS A 1 132 ? 19.285 28.427 25.502 1.00 40.87 ? 131 HIS A CD2 1 
ATOM   996  C  CE1 . HIS A 1 132 ? 20.734 30.068 25.376 1.00 45.74 ? 131 HIS A CE1 1 
ATOM   997  N  NE2 . HIS A 1 132 ? 20.620 28.754 25.467 1.00 38.84 ? 131 HIS A NE2 1 
ATOM   998  N  N   . HIS A 1 133 ? 14.578 31.927 26.517 1.00 22.93 ? 132 HIS A N   1 
ATOM   999  C  CA  . HIS A 1 133 ? 13.165 32.212 26.198 1.00 23.27 ? 132 HIS A CA  1 
ATOM   1000 C  C   . HIS A 1 133 ? 13.029 32.772 24.777 1.00 23.89 ? 132 HIS A C   1 
ATOM   1001 O  O   . HIS A 1 133 ? 13.500 33.859 24.468 1.00 24.23 ? 132 HIS A O   1 
ATOM   1002 C  CB  . HIS A 1 133 ? 12.589 33.184 27.218 1.00 24.81 ? 132 HIS A CB  1 
ATOM   1003 C  CG  . HIS A 1 133 ? 11.110 33.381 27.103 1.00 21.88 ? 132 HIS A CG  1 
ATOM   1004 N  ND1 . HIS A 1 133 ? 10.446 34.386 27.770 1.00 29.14 ? 132 HIS A ND1 1 
ATOM   1005 C  CD2 . HIS A 1 133 ? 10.159 32.690 26.423 1.00 19.59 ? 132 HIS A CD2 1 
ATOM   1006 C  CE1 . HIS A 1 133 ? 9.155  34.307 27.511 1.00 27.03 ? 132 HIS A CE1 1 
ATOM   1007 N  NE2 . HIS A 1 133 ? 8.951  33.285 26.701 1.00 18.26 ? 132 HIS A NE2 1 
ATOM   1008 N  N   . GLU A 1 134 ? 12.421 31.993 23.904 1.00 23.04 ? 133 GLU A N   1 
ATOM   1009 C  CA  . GLU A 1 134 ? 12.531 32.224 22.500 1.00 23.12 ? 133 GLU A CA  1 
ATOM   1010 C  C   . GLU A 1 134 ? 11.143 32.330 21.886 1.00 23.12 ? 133 GLU A C   1 
ATOM   1011 O  O   . GLU A 1 134 ? 10.190 31.709 22.351 1.00 20.21 ? 133 GLU A O   1 
ATOM   1012 C  CB  . GLU A 1 134 ? 13.301 31.062 21.868 1.00 28.57 ? 133 GLU A CB  1 
ATOM   1013 C  CG  . GLU A 1 134 ? 14.696 30.774 22.415 1.00 39.14 ? 133 GLU A CG  1 
ATOM   1014 C  CD  . GLU A 1 134 ? 15.757 31.788 21.996 1.00 47.49 ? 133 GLU A CD  1 
ATOM   1015 O  OE1 . GLU A 1 134 ? 15.605 32.436 20.936 1.00 56.39 ? 133 GLU A OE1 1 
ATOM   1016 O  OE2 . GLU A 1 134 ? 16.766 31.921 22.728 1.00 37.54 ? 133 GLU A OE2 1 
ATOM   1017 N  N   . LEU A 1 135 ? 11.013 33.191 20.861 1.00 21.39 ? 134 LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 135 ? 9.848  33.185 19.995 1.00 20.81 ? 134 LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 135 ? 10.326 32.910 18.567 1.00 23.85 ? 134 LEU A C   1 
ATOM   1020 O  O   . LEU A 1 135 ? 10.974 33.766 17.951 1.00 24.24 ? 134 LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 135 ? 9.100  34.518 20.047 1.00 17.90 ? 134 LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 135 ? 7.830  34.661 19.178 1.00 22.32 ? 134 LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 135 ? 6.761  33.637 19.610 1.00 22.42 ? 134 LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 135 ? 7.244  36.102 19.194 1.00 21.27 ? 134 LEU A CD2 1 
ATOM   1025 N  N   . SER A 1 136 ? 10.024 31.722 18.064 1.00 24.37 ? 135 SER A N   1 
ATOM   1026 C  CA  . SER A 1 136 ? 10.507 31.283 16.757 1.00 26.84 ? 135 SER A CA  1 
ATOM   1027 C  C   . SER A 1 136 ? 9.382  31.297 15.716 1.00 21.06 ? 135 SER A C   1 
ATOM   1028 O  O   . SER A 1 136 ? 8.184  30.961 16.018 1.00 22.52 ? 135 SER A O   1 
ATOM   1029 C  CB  . SER A 1 136 ? 11.085 29.894 16.888 1.00 29.99 ? 135 SER A CB  1 
ATOM   1030 O  OG  . SER A 1 136 ? 12.342 29.983 17.553 1.00 29.31 ? 135 SER A OG  1 
ATOM   1031 N  N   . THR A 1 137 ? 9.773  31.644 14.481 1.00 20.22 ? 136 THR A N   1 
ATOM   1032 C  CA  . THR A 1 137 ? 8.879  31.723 13.379 1.00 19.89 ? 136 THR A CA  1 
ATOM   1033 C  C   . THR A 1 137 ? 9.220  30.689 12.327 1.00 18.56 ? 136 THR A C   1 
ATOM   1034 O  O   . THR A 1 137 ? 10.412 30.397 12.057 1.00 21.10 ? 136 THR A O   1 
ATOM   1035 C  CB  . THR A 1 137 ? 8.856  33.118 12.712 1.00 19.44 ? 136 THR A CB  1 
ATOM   1036 O  OG1 . THR A 1 137 ? 8.612  34.110 13.724 1.00 21.61 ? 136 THR A OG1 1 
ATOM   1037 C  CG2 . THR A 1 137 ? 7.737  33.157 11.650 1.00 19.47 ? 136 THR A CG2 1 
ATOM   1038 N  N   . PHE A 1 138 ? 8.153  30.144 11.779 1.00 17.44 ? 137 PHE A N   1 
ATOM   1039 C  CA  . PHE A 1 138 ? 8.216  29.060 10.810 1.00 18.82 ? 137 PHE A CA  1 
ATOM   1040 C  C   . PHE A 1 138 ? 7.373  29.409 9.591  1.00 20.27 ? 137 PHE A C   1 
ATOM   1041 O  O   . PHE A 1 138 ? 6.371  30.120 9.682  1.00 21.68 ? 137 PHE A O   1 
ATOM   1042 C  CB  . PHE A 1 138 ? 7.725  27.763 11.436 1.00 18.22 ? 137 PHE A CB  1 
ATOM   1043 C  CG  . PHE A 1 138 ? 8.473  27.371 12.692 1.00 20.37 ? 137 PHE A CG  1 
ATOM   1044 C  CD1 . PHE A 1 138 ? 8.151  27.956 13.907 1.00 23.85 ? 137 PHE A CD1 1 
ATOM   1045 C  CD2 . PHE A 1 138 ? 9.514  26.474 12.624 1.00 26.92 ? 137 PHE A CD2 1 
ATOM   1046 C  CE1 . PHE A 1 138 ? 8.819  27.630 15.043 1.00 28.34 ? 137 PHE A CE1 1 
ATOM   1047 C  CE2 . PHE A 1 138 ? 10.178 26.130 13.786 1.00 27.21 ? 137 PHE A CE2 1 
ATOM   1048 C  CZ  . PHE A 1 138 ? 9.824  26.756 14.977 1.00 24.97 ? 137 PHE A CZ  1 
ATOM   1049 N  N   . VAL A 1 139 ? 7.780  28.867 8.438  1.00 19.49 ? 138 VAL A N   1 
ATOM   1050 C  CA  . VAL A 1 139 ? 7.052  29.071 7.182  1.00 21.66 ? 138 VAL A CA  1 
ATOM   1051 C  C   . VAL A 1 139 ? 6.742  27.709 6.586  1.00 19.16 ? 138 VAL A C   1 
ATOM   1052 O  O   . VAL A 1 139 ? 7.569  26.796 6.645  1.00 18.70 ? 138 VAL A O   1 
ATOM   1053 C  CB  . VAL A 1 139 ? 7.805  29.982 6.170  1.00 20.13 ? 138 VAL A CB  1 
ATOM   1054 C  CG1 . VAL A 1 139 ? 9.098  29.343 5.668  1.00 23.97 ? 138 VAL A CG1 1 
ATOM   1055 C  CG2 . VAL A 1 139 ? 6.874  30.377 5.006  1.00 19.88 ? 138 VAL A CG2 1 
ATOM   1056 N  N   . LYS A 1 140 ? 5.539  27.602 6.030  1.00 21.78 ? 139 LYS A N   1 
ATOM   1057 C  CA  . LYS A 1 140 ? 5.073  26.440 5.297  1.00 21.49 ? 139 LYS A CA  1 
ATOM   1058 C  C   . LYS A 1 140 ? 5.365  26.645 3.808  1.00 22.13 ? 139 LYS A C   1 
ATOM   1059 O  O   . LYS A 1 140 ? 4.902  27.636 3.195  1.00 20.28 ? 139 LYS A O   1 
ATOM   1060 C  CB  . LYS A 1 140 ? 3.570  26.212 5.552  1.00 28.23 ? 139 LYS A CB  1 
ATOM   1061 C  CG  . LYS A 1 140 ? 3.159  24.742 5.596  1.00 30.85 ? 139 LYS A CG  1 
ATOM   1062 C  CD  . LYS A 1 140 ? 1.657  24.522 5.874  1.00 31.77 ? 139 LYS A CD  1 
ATOM   1063 C  CE  . LYS A 1 140 ? 1.409  23.127 6.508  1.00 35.84 ? 139 LYS A CE  1 
ATOM   1064 N  N   . ILE A 1 141 ? 6.082  25.675 3.244  1.00 19.57 ? 140 ILE A N   1 
ATOM   1065 C  CA  . ILE A 1 141 ? 6.467  25.633 1.838  1.00 18.77 ? 140 ILE A CA  1 
ATOM   1066 C  C   . ILE A 1 141 ? 6.021  24.332 1.172  1.00 23.20 ? 140 ILE A C   1 
ATOM   1067 O  O   . ILE A 1 141 ? 6.272  23.247 1.689  1.00 21.53 ? 140 ILE A O   1 
ATOM   1068 C  CB  . ILE A 1 141 ? 7.980  25.743 1.656  1.00 17.50 ? 140 ILE A CB  1 
ATOM   1069 C  CG1 . ILE A 1 141 ? 8.528  27.049 2.267  1.00 15.90 ? 140 ILE A CG1 1 
ATOM   1070 C  CG2 . ILE A 1 141 ? 8.319  25.633 0.161  1.00 19.96 ? 140 ILE A CG2 1 
ATOM   1071 C  CD1 . ILE A 1 141 ? 10.095 27.010 2.355  1.00 21.69 ? 140 ILE A CD1 1 
ATOM   1072 N  N   . LYS A 1 142 ? 5.369  24.447 0.025  1.00 30.66 ? 141 LYS A N   1 
ATOM   1073 C  CA  . LYS A 1 142 ? 4.937  23.267 -0.752 1.00 36.12 ? 141 LYS A CA  1 
ATOM   1074 C  C   . LYS A 1 142 ? 6.113  22.502 -1.369 1.00 39.60 ? 141 LYS A C   1 
ATOM   1075 O  O   . LYS A 1 142 ? 7.147  23.100 -1.703 1.00 37.42 ? 141 LYS A O   1 
ATOM   1076 C  CB  . LYS A 1 142 ? 3.972  23.687 -1.858 1.00 36.70 ? 141 LYS A CB  1 
ATOM   1077 C  CG  . LYS A 1 142 ? 2.618  24.090 -1.338 1.00 39.44 ? 141 LYS A CG  1 
ATOM   1078 N  N   . ASN A 1 143 ? 5.970  21.179 -1.499 1.00 43.59 ? 142 ASN A N   1 
ATOM   1079 C  CA  . ASN A 1 143 ? 6.944  20.386 -2.256 1.00 47.03 ? 142 ASN A CA  1 
ATOM   1080 C  C   . ASN A 1 143 ? 6.832  20.802 -3.717 1.00 50.12 ? 142 ASN A C   1 
ATOM   1081 O  O   . ASN A 1 143 ? 5.773  21.276 -4.144 1.00 50.13 ? 142 ASN A O   1 
ATOM   1082 C  CB  . ASN A 1 143 ? 6.702  18.883 -2.097 1.00 47.97 ? 142 ASN A CB  1 
ATOM   1083 N  N   . LYS A 1 144 ? 7.929  20.679 -4.464 1.00 53.72 ? 143 LYS A N   1 
ATOM   1084 C  CA  . LYS A 1 144 ? 7.914  20.887 -5.924 1.00 55.78 ? 143 LYS A CA  1 
ATOM   1085 C  C   . LYS A 1 144 ? 7.806  19.508 -6.553 1.00 57.27 ? 143 LYS A C   1 
ATOM   1086 O  O   . LYS A 1 144 ? 8.495  19.189 -7.518 1.00 57.58 ? 143 LYS A O   1 
ATOM   1087 C  CB  . LYS A 1 144 ? 9.184  21.600 -6.397 1.00 55.39 ? 143 LYS A CB  1 
ATOM   1088 N  N   . ALA A 1 145 ? 6.907  18.710 -5.986 1.00 60.09 ? 144 ALA A N   1 
ATOM   1089 C  CA  . ALA A 1 145 ? 6.910  17.252 -6.135 1.00 61.11 ? 144 ALA A CA  1 
ATOM   1090 C  C   . ALA A 1 145 ? 5.485  16.655 -6.091 1.00 60.21 ? 144 ALA A C   1 
ATOM   1091 O  O   . ALA A 1 145 ? 5.189  15.646 -6.738 1.00 61.98 ? 144 ALA A O   1 
ATOM   1092 C  CB  . ALA A 1 145 ? 7.786  16.634 -5.015 1.00 61.63 ? 144 ALA A CB  1 
ATOM   1093 N  N   . ASN A 1 146 ? 4.613  17.312 -5.333 1.00 57.14 ? 145 ASN A N   1 
ATOM   1094 C  CA  . ASN A 1 146 ? 3.303  16.805 -4.974 1.00 53.29 ? 145 ASN A CA  1 
ATOM   1095 C  C   . ASN A 1 146 ? 2.704  17.964 -4.186 1.00 50.49 ? 145 ASN A C   1 
ATOM   1096 O  O   . ASN A 1 146 ? 3.402  18.951 -3.931 1.00 49.76 ? 145 ASN A O   1 
ATOM   1097 C  CB  . ASN A 1 146 ? 3.414  15.540 -4.116 1.00 52.90 ? 145 ASN A CB  1 
ATOM   1098 N  N   . SER A 1 147 ? 1.440  17.868 -3.798 1.00 47.31 ? 146 SER A N   1 
ATOM   1099 C  CA  . SER A 1 147 ? 0.776  18.995 -3.143 1.00 45.52 ? 146 SER A CA  1 
ATOM   1100 C  C   . SER A 1 147 ? 1.153  19.118 -1.646 1.00 43.67 ? 146 SER A C   1 
ATOM   1101 O  O   . SER A 1 147 ? 0.614  19.965 -0.926 1.00 42.77 ? 146 SER A O   1 
ATOM   1102 C  CB  . SER A 1 147 ? -0.733 18.866 -3.296 1.00 44.08 ? 146 SER A CB  1 
ATOM   1103 O  OG  . SER A 1 147 ? -1.381 20.017 -2.779 1.00 53.24 ? 146 SER A OG  1 
ATOM   1104 N  N   . ASP A 1 148 ? 2.060  18.246 -1.201 1.00 41.54 ? 147 ASP A N   1 
ATOM   1105 C  CA  . ASP A 1 148 ? 2.515  18.176 0.185  1.00 39.54 ? 147 ASP A CA  1 
ATOM   1106 C  C   . ASP A 1 148 ? 3.299  19.435 0.543  1.00 35.95 ? 147 ASP A C   1 
ATOM   1107 O  O   . ASP A 1 148 ? 3.982  20.003 -0.305 1.00 35.33 ? 147 ASP A O   1 
ATOM   1108 C  CB  . ASP A 1 148 ? 3.404  16.942 0.359  1.00 38.55 ? 147 ASP A CB  1 
ATOM   1109 C  CG  . ASP A 1 148 ? 4.425  16.787 -0.773 1.00 40.64 ? 147 ASP A CG  1 
ATOM   1110 N  N   . ALA A 1 149 ? 3.182  19.874 1.788  1.00 34.00 ? 148 ALA A N   1 
ATOM   1111 C  CA  . ALA A 1 149 ? 3.970  20.990 2.282  1.00 30.60 ? 148 ALA A CA  1 
ATOM   1112 C  C   . ALA A 1 149 ? 4.692  20.599 3.571  1.00 29.01 ? 148 ALA A C   1 
ATOM   1113 O  O   . ALA A 1 149 ? 4.301  19.653 4.267  1.00 27.23 ? 148 ALA A O   1 
ATOM   1114 C  CB  . ALA A 1 149 ? 3.086  22.230 2.490  1.00 32.50 ? 148 ALA A CB  1 
ATOM   1115 N  N   . SER A 1 150 ? 5.774  21.311 3.867  1.00 26.34 ? 149 SER A N   1 
ATOM   1116 C  CA  . SER A 1 150 ? 6.514  21.100 5.102  1.00 25.91 ? 149 SER A CA  1 
ATOM   1117 C  C   . SER A 1 150 ? 6.741  22.443 5.760  1.00 23.22 ? 149 SER A C   1 
ATOM   1118 O  O   . SER A 1 150 ? 6.739  23.497 5.104  1.00 22.10 ? 149 SER A O   1 
ATOM   1119 C  CB  . SER A 1 150 ? 7.863  20.396 4.805  1.00 28.30 ? 149 SER A CB  1 
ATOM   1120 O  OG  . SER A 1 150 ? 7.636  18.992 4.642  1.00 30.09 ? 149 SER A OG  1 
ATOM   1121 N  N   . TRP A 1 151 ? 6.937  22.402 7.073  1.00 19.00 ? 150 TRP A N   1 
ATOM   1122 C  CA  . TRP A 1 151 ? 7.286  23.578 7.837  1.00 20.36 ? 150 TRP A CA  1 
ATOM   1123 C  C   . TRP A 1 151 ? 8.784  23.722 7.896  1.00 20.20 ? 150 TRP A C   1 
ATOM   1124 O  O   . TRP A 1 151 ? 9.509  22.694 7.969  1.00 20.67 ? 150 TRP A O   1 
ATOM   1125 C  CB  . TRP A 1 151 ? 6.791  23.418 9.264  1.00 21.02 ? 150 TRP A CB  1 
ATOM   1126 C  CG  . TRP A 1 151 ? 5.357  23.583 9.395  1.00 17.02 ? 150 TRP A CG  1 
ATOM   1127 C  CD1 . TRP A 1 151 ? 4.434  22.603 9.525  1.00 18.28 ? 150 TRP A CD1 1 
ATOM   1128 C  CD2 . TRP A 1 151 ? 4.636  24.821 9.392  1.00 18.46 ? 150 TRP A CD2 1 
ATOM   1129 N  NE1 . TRP A 1 151 ? 3.207  23.142 9.648  1.00 23.31 ? 150 TRP A NE1 1 
ATOM   1130 C  CE2 . TRP A 1 151 ? 3.285  24.500 9.506  1.00 18.37 ? 150 TRP A CE2 1 
ATOM   1131 C  CE3 . TRP A 1 151 ? 5.002  26.159 9.251  1.00 22.98 ? 150 TRP A CE3 1 
ATOM   1132 C  CZ2 . TRP A 1 151 ? 2.284  25.480 9.577  1.00 20.25 ? 150 TRP A CZ2 1 
ATOM   1133 C  CZ3 . TRP A 1 151 ? 4.029  27.120 9.318  1.00 20.28 ? 150 TRP A CZ3 1 
ATOM   1134 C  CH2 . TRP A 1 151 ? 2.684  26.787 9.458  1.00 20.66 ? 150 TRP A CH2 1 
ATOM   1135 N  N   . TYR A 1 152 ? 9.236  24.978 7.844  1.00 20.43 ? 151 TYR A N   1 
ATOM   1136 C  CA  . TYR A 1 152 ? 10.651 25.311 7.920  1.00 19.58 ? 151 TYR A CA  1 
ATOM   1137 C  C   . TYR A 1 152 ? 10.895 26.437 8.896  1.00 21.45 ? 151 TYR A C   1 
ATOM   1138 O  O   . TYR A 1 152 ? 10.074 27.358 9.015  1.00 21.23 ? 151 TYR A O   1 
ATOM   1139 C  CB  . TYR A 1 152 ? 11.196 25.712 6.541  1.00 19.65 ? 151 TYR A CB  1 
ATOM   1140 C  CG  . TYR A 1 152 ? 11.233 24.604 5.550  1.00 20.50 ? 151 TYR A CG  1 
ATOM   1141 C  CD1 . TYR A 1 152 ? 10.151 24.353 4.737  1.00 20.32 ? 151 TYR A CD1 1 
ATOM   1142 C  CD2 . TYR A 1 152 ? 12.339 23.805 5.430  1.00 21.49 ? 151 TYR A CD2 1 
ATOM   1143 C  CE1 . TYR A 1 152 ? 10.149 23.327 3.846  1.00 21.50 ? 151 TYR A CE1 1 
ATOM   1144 C  CE2 . TYR A 1 152 ? 12.357 22.785 4.520  1.00 23.91 ? 151 TYR A CE2 1 
ATOM   1145 C  CZ  . TYR A 1 152 ? 11.250 22.553 3.729  1.00 24.38 ? 151 TYR A CZ  1 
ATOM   1146 O  OH  . TYR A 1 152 ? 11.241 21.547 2.840  1.00 25.97 ? 151 TYR A OH  1 
ATOM   1147 N  N   . PHE A 1 153 ? 12.020 26.352 9.594  1.00 22.61 ? 152 PHE A N   1 
ATOM   1148 C  CA  . PHE A 1 153 ? 12.399 27.372 10.570 1.00 20.10 ? 152 PHE A CA  1 
ATOM   1149 C  C   . PHE A 1 153 ? 13.014 28.571 9.876  1.00 20.71 ? 152 PHE A C   1 
ATOM   1150 O  O   . PHE A 1 153 ? 13.917 28.407 9.046  1.00 19.80 ? 152 PHE A O   1 
ATOM   1151 C  CB  . PHE A 1 153 ? 13.401 26.769 11.570 1.00 20.28 ? 152 PHE A CB  1 
ATOM   1152 C  CG  . PHE A 1 153 ? 14.023 27.766 12.485 1.00 20.28 ? 152 PHE A CG  1 
ATOM   1153 C  CD1 . PHE A 1 153 ? 13.284 28.421 13.426 1.00 20.37 ? 152 PHE A CD1 1 
ATOM   1154 C  CD2 . PHE A 1 153 ? 15.381 28.003 12.436 1.00 22.75 ? 152 PHE A CD2 1 
ATOM   1155 C  CE1 . PHE A 1 153 ? 13.891 29.301 14.319 1.00 20.90 ? 152 PHE A CE1 1 
ATOM   1156 C  CE2 . PHE A 1 153 ? 15.992 28.873 13.312 1.00 20.27 ? 152 PHE A CE2 1 
ATOM   1157 C  CZ  . PHE A 1 153 ? 15.249 29.551 14.238 1.00 21.90 ? 152 PHE A CZ  1 
ATOM   1158 N  N   . LEU A 1 154 ? 12.538 29.769 10.220 1.00 18.98 ? 153 LEU A N   1 
ATOM   1159 C  CA  . LEU A 1 154 ? 13.120 31.046 9.723  1.00 21.08 ? 153 LEU A CA  1 
ATOM   1160 C  C   . LEU A 1 154 ? 14.219 31.465 10.700 1.00 22.88 ? 153 LEU A C   1 
ATOM   1161 O  O   . LEU A 1 154 ? 13.937 31.840 11.841 1.00 21.43 ? 153 LEU A O   1 
ATOM   1162 C  CB  . LEU A 1 154 ? 12.038 32.139 9.637  1.00 23.63 ? 153 LEU A CB  1 
ATOM   1163 C  CG  . LEU A 1 154 ? 10.967 31.998 8.572  1.00 25.85 ? 153 LEU A CG  1 
ATOM   1164 C  CD1 . LEU A 1 154 ? 10.062 33.237 8.614  1.00 28.21 ? 153 LEU A CD1 1 
ATOM   1165 C  CD2 . LEU A 1 154 ? 11.523 31.770 7.182  1.00 32.84 ? 153 LEU A CD2 1 
ATOM   1166 N  N   . ASP A 1 155 ? 15.477 31.325 10.288 1.00 24.27 ? 154 ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 155 ? 16.616 31.569 11.205 1.00 24.31 ? 154 ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 155 ? 16.852 33.085 11.250 1.00 23.72 ? 154 ASP A C   1 
ATOM   1169 O  O   . ASP A 1 155 ? 17.159 33.691 10.219 1.00 23.86 ? 154 ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 155 ? 17.853 30.807 10.755 1.00 24.71 ? 154 ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 155 ? 18.931 30.755 11.804 1.00 30.81 ? 154 ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 155 ? 19.254 31.818 12.377 1.00 37.38 ? 154 ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 155 ? 19.472 29.652 12.067 1.00 36.61 ? 154 ASP A OD2 1 
ATOM   1174 N  N   . PRO A 1 156 ? 16.650 33.708 12.436 1.00 23.52 ? 155 PRO A N   1 
ATOM   1175 C  CA  . PRO A 1 156 ? 16.819 35.158 12.511 1.00 27.89 ? 155 PRO A CA  1 
ATOM   1176 C  C   . PRO A 1 156 ? 18.262 35.573 12.768 1.00 27.68 ? 155 PRO A C   1 
ATOM   1177 O  O   . PRO A 1 156 ? 18.543 36.770 12.817 1.00 30.57 ? 155 PRO A O   1 
ATOM   1178 C  CB  . PRO A 1 156 ? 15.950 35.538 13.720 1.00 28.31 ? 155 PRO A CB  1 
ATOM   1179 C  CG  . PRO A 1 156 ? 16.122 34.422 14.612 1.00 23.32 ? 155 PRO A CG  1 
ATOM   1180 C  CD  . PRO A 1 156 ? 16.282 33.163 13.756 1.00 26.54 ? 155 PRO A CD  1 
ATOM   1181 N  N   . THR A 1 157 ? 19.174 34.612 12.924 1.00 26.69 ? 156 THR A N   1 
ATOM   1182 C  CA  . THR A 1 157 ? 20.568 34.919 13.248 1.00 28.85 ? 156 THR A CA  1 
ATOM   1183 C  C   . THR A 1 157 ? 21.507 34.996 12.020 1.00 28.41 ? 156 THR A C   1 
ATOM   1184 O  O   . THR A 1 157 ? 22.559 35.619 12.094 1.00 33.98 ? 156 THR A O   1 
ATOM   1185 C  CB  . THR A 1 157 ? 21.156 33.878 14.243 1.00 30.05 ? 156 THR A CB  1 
ATOM   1186 O  OG1 . THR A 1 157 ? 21.352 32.641 13.551 1.00 27.43 ? 156 THR A OG1 1 
ATOM   1187 C  CG2 . THR A 1 157 ? 20.238 33.644 15.490 1.00 29.67 ? 156 THR A CG2 1 
ATOM   1188 N  N   . VAL A 1 158 ? 21.149 34.395 10.895 1.00 27.84 ? 157 VAL A N   1 
ATOM   1189 C  CA  . VAL A 1 158 ? 22.029 34.398 9.713  1.00 28.27 ? 157 VAL A CA  1 
ATOM   1190 C  C   . VAL A 1 158 ? 22.003 35.754 8.993  1.00 28.73 ? 157 VAL A C   1 
ATOM   1191 O  O   . VAL A 1 158 ? 20.946 36.372 8.831  1.00 28.06 ? 157 VAL A O   1 
ATOM   1192 C  CB  . VAL A 1 158 ? 21.675 33.257 8.714  1.00 30.69 ? 157 VAL A CB  1 
ATOM   1193 C  CG1 . VAL A 1 158 ? 21.908 31.915 9.353  1.00 32.81 ? 157 VAL A CG1 1 
ATOM   1194 C  CG2 . VAL A 1 158 ? 20.269 33.360 8.270  1.00 28.32 ? 157 VAL A CG2 1 
ATOM   1195 N  N   . SER A 1 159 ? 23.177 36.216 8.576  1.00 30.71 ? 158 SER A N   1 
ATOM   1196 C  CA  . SER A 1 159 ? 23.288 37.510 7.878  1.00 30.96 ? 158 SER A CA  1 
ATOM   1197 C  C   . SER A 1 159 ? 22.960 37.314 6.396  1.00 28.42 ? 158 SER A C   1 
ATOM   1198 O  O   . SER A 1 159 ? 23.513 36.450 5.725  1.00 28.97 ? 158 SER A O   1 
ATOM   1199 C  CB  . SER A 1 159 ? 24.665 38.152 8.112  1.00 33.49 ? 158 SER A CB  1 
ATOM   1200 O  OG  . SER A 1 159 ? 25.574 37.955 7.029  1.00 42.72 ? 158 SER A OG  1 
HETATM 1201 N  N   . MSE A 1 160 ? 22.030 38.113 5.893  1.00 27.31 ? 159 MSE A N   1 
HETATM 1202 C  CA  . MSE A 1 160 ? 21.582 37.998 4.501  1.00 25.05 ? 159 MSE A CA  1 
HETATM 1203 C  C   . MSE A 1 160 ? 21.432 39.371 3.936  1.00 24.39 ? 159 MSE A C   1 
HETATM 1204 O  O   . MSE A 1 160 ? 21.174 40.320 4.657  1.00 27.10 ? 159 MSE A O   1 
HETATM 1205 C  CB  . MSE A 1 160 ? 20.231 37.318 4.419  1.00 25.33 ? 159 MSE A CB  1 
HETATM 1206 C  CG  . MSE A 1 160 ? 20.133 36.034 5.169  1.00 28.74 ? 159 MSE A CG  1 
HETATM 1207 SE SE  . MSE A 1 160 ? 18.343 35.304 4.889  0.75 27.58 ? 159 MSE A SE  1 
HETATM 1208 C  CE  . MSE A 1 160 ? 18.683 34.366 3.170  1.00 29.19 ? 159 MSE A CE  1 
ATOM   1209 N  N   . SER A 1 161 ? 21.592 39.477 2.632  1.00 23.41 ? 160 SER A N   1 
ATOM   1210 C  CA  . SER A 1 161 ? 21.429 40.733 1.955  1.00 25.12 ? 160 SER A CA  1 
ATOM   1211 C  C   . SER A 1 161 ? 20.301 40.481 0.955  1.00 25.66 ? 160 SER A C   1 
ATOM   1212 O  O   . SER A 1 161 ? 20.550 40.228 -0.217 1.00 29.92 ? 160 SER A O   1 
ATOM   1213 C  CB  . SER A 1 161 ? 22.758 41.147 1.301  1.00 24.20 ? 160 SER A CB  1 
ATOM   1214 O  OG  . SER A 1 161 ? 23.732 41.575 2.278  1.00 24.53 ? 160 SER A OG  1 
ATOM   1215 N  N   . VAL A 1 162 ? 19.071 40.583 1.462  1.00 22.83 ? 161 VAL A N   1 
ATOM   1216 C  CA  . VAL A 1 162 ? 17.830 40.292 0.747  1.00 22.75 ? 161 VAL A CA  1 
ATOM   1217 C  C   . VAL A 1 162 ? 17.219 41.594 0.268  1.00 22.52 ? 161 VAL A C   1 
ATOM   1218 O  O   . VAL A 1 162 ? 17.275 42.611 0.951  1.00 22.65 ? 161 VAL A O   1 
ATOM   1219 C  CB  . VAL A 1 162 ? 16.814 39.591 1.720  1.00 24.05 ? 161 VAL A CB  1 
ATOM   1220 C  CG1 . VAL A 1 162 ? 15.518 39.165 1.004  1.00 27.41 ? 161 VAL A CG1 1 
ATOM   1221 C  CG2 . VAL A 1 162 ? 17.444 38.396 2.369  1.00 24.13 ? 161 VAL A CG2 1 
ATOM   1222 N  N   . THR A 1 163 ? 16.653 41.571 -0.932 1.00 22.77 ? 162 THR A N   1 
ATOM   1223 C  CA  . THR A 1 163 ? 16.020 42.734 -1.521 1.00 22.63 ? 162 THR A CA  1 
ATOM   1224 C  C   . THR A 1 163 ? 14.534 42.782 -1.118 1.00 23.53 ? 162 THR A C   1 
ATOM   1225 O  O   . THR A 1 163 ? 13.780 41.871 -1.429 1.00 21.55 ? 162 THR A O   1 
ATOM   1226 C  CB  . THR A 1 163 ? 16.157 42.693 -3.040 1.00 24.80 ? 162 THR A CB  1 
ATOM   1227 O  OG1 . THR A 1 163 ? 17.546 42.615 -3.409 1.00 19.21 ? 162 THR A OG1 1 
ATOM   1228 C  CG2 . THR A 1 163 ? 15.502 43.907 -3.629 1.00 15.02 ? 162 THR A CG2 1 
ATOM   1229 N  N   . GLN A 1 164 ? 14.142 43.839 -0.405 1.00 23.29 ? 163 GLN A N   1 
ATOM   1230 C  CA  . GLN A 1 164 ? 12.828 43.922 0.251  1.00 23.23 ? 163 GLN A CA  1 
ATOM   1231 C  C   . GLN A 1 164 ? 11.588 43.778 -0.672 1.00 21.25 ? 163 GLN A C   1 
ATOM   1232 O  O   . GLN A 1 164 ? 10.592 43.158 -0.272 1.00 24.72 ? 163 GLN A O   1 
ATOM   1233 C  CB  . GLN A 1 164 ? 12.718 45.236 1.046  1.00 26.48 ? 163 GLN A CB  1 
ATOM   1234 C  CG  . GLN A 1 164 ? 13.645 45.323 2.260  1.00 29.69 ? 163 GLN A CG  1 
ATOM   1235 C  CD  . GLN A 1 164 ? 13.261 44.373 3.370  1.00 28.45 ? 163 GLN A CD  1 
ATOM   1236 O  OE1 . GLN A 1 164 ? 12.093 44.263 3.739  1.00 35.38 ? 163 GLN A OE1 1 
ATOM   1237 N  NE2 . GLN A 1 164 ? 14.244 43.664 3.902  1.00 39.25 ? 163 GLN A NE2 1 
ATOM   1238 N  N   . LYS A 1 165 ? 11.656 44.321 -1.882 1.00 22.99 ? 164 LYS A N   1 
ATOM   1239 C  CA  . LYS A 1 165 ? 10.501 44.367 -2.799 1.00 24.28 ? 164 LYS A CA  1 
ATOM   1240 C  C   . LYS A 1 165 ? 10.461 43.149 -3.721 1.00 23.60 ? 164 LYS A C   1 
ATOM   1241 O  O   . LYS A 1 165 ? 9.482  42.928 -4.425 1.00 25.36 ? 164 LYS A O   1 
ATOM   1242 C  CB  . LYS A 1 165 ? 10.529 45.640 -3.655 1.00 25.43 ? 164 LYS A CB  1 
ATOM   1243 C  CG  . LYS A 1 165 ? 10.537 46.915 -2.824 1.00 29.96 ? 164 LYS A CG  1 
ATOM   1244 C  CD  . LYS A 1 165 ? 10.503 48.185 -3.699 1.00 29.36 ? 164 LYS A CD  1 
ATOM   1245 C  CE  . LYS A 1 165 ? 10.290 49.423 -2.839 1.00 37.94 ? 164 LYS A CE  1 
ATOM   1246 N  NZ  . LYS A 1 165 ? 10.774 50.661 -3.514 1.00 32.05 ? 164 LYS A NZ  1 
ATOM   1247 N  N   . GLN A 1 166 ? 11.549 42.386 -3.742 1.00 24.45 ? 165 GLN A N   1 
ATOM   1248 C  CA  . GLN A 1 166 ? 11.663 41.201 -4.600 1.00 22.17 ? 165 GLN A CA  1 
ATOM   1249 C  C   . GLN A 1 166 ? 10.973 40.016 -3.933 1.00 21.25 ? 165 GLN A C   1 
ATOM   1250 O  O   . GLN A 1 166 ? 10.693 40.057 -2.756 1.00 21.08 ? 165 GLN A O   1 
ATOM   1251 C  CB  . GLN A 1 166 ? 13.128 40.862 -4.805 1.00 22.34 ? 165 GLN A CB  1 
ATOM   1252 C  CG  . GLN A 1 166 ? 13.776 41.661 -5.857 1.00 26.02 ? 165 GLN A CG  1 
ATOM   1253 C  CD  . GLN A 1 166 ? 13.646 40.964 -7.177 1.00 38.18 ? 165 GLN A CD  1 
ATOM   1254 O  OE1 . GLN A 1 166 ? 12.829 41.360 -8.008 1.00 42.48 ? 165 GLN A OE1 1 
ATOM   1255 N  NE2 . GLN A 1 166 ? 14.400 39.871 -7.358 1.00 22.38 ? 165 GLN A NE2 1 
ATOM   1256 N  N   . PRO A 1 167 ? 10.696 38.953 -4.698 1.00 20.76 ? 166 PRO A N   1 
ATOM   1257 C  CA  . PRO A 1 167 ? 9.987  37.807 -4.164 1.00 20.65 ? 166 PRO A CA  1 
ATOM   1258 C  C   . PRO A 1 167 ? 10.659 37.167 -2.939 1.00 20.73 ? 166 PRO A C   1 
ATOM   1259 O  O   . PRO A 1 167 ? 11.894 37.083 -2.846 1.00 22.70 ? 166 PRO A O   1 
ATOM   1260 C  CB  . PRO A 1 167 ? 9.972  36.817 -5.349 1.00 18.97 ? 166 PRO A CB  1 
ATOM   1261 C  CG  . PRO A 1 167 ? 10.082 37.658 -6.535 1.00 20.38 ? 166 PRO A CG  1 
ATOM   1262 C  CD  . PRO A 1 167 ? 11.012 38.762 -6.118 1.00 22.03 ? 166 PRO A CD  1 
ATOM   1263 N  N   . CYS A 1 168 ? 9.830  36.678 -2.042 1.00 20.44 ? 167 CYS A N   1 
ATOM   1264 C  CA  . CYS A 1 168 ? 10.317 36.190 -0.782 1.00 19.81 ? 167 CYS A CA  1 
ATOM   1265 C  C   . CYS A 1 168 ? 11.231 34.985 -0.994 1.00 20.32 ? 167 CYS A C   1 
ATOM   1266 O  O   . CYS A 1 168 ? 11.017 34.171 -1.904 1.00 22.62 ? 167 CYS A O   1 
ATOM   1267 C  CB  . CYS A 1 168 ? 9.170  35.792 0.141  1.00 23.76 ? 167 CYS A CB  1 
ATOM   1268 S  SG  . CYS A 1 168 ? 9.737  35.576 1.787  1.00 23.58 ? 167 CYS A SG  1 
ATOM   1269 N  N   . ILE A 1 169 ? 12.246 34.897 -0.135 1.00 22.46 ? 168 ILE A N   1 
ATOM   1270 C  CA  . ILE A 1 169 ? 13.184 33.799 -0.101 1.00 24.41 ? 168 ILE A CA  1 
ATOM   1271 C  C   . ILE A 1 169 ? 12.535 32.440 0.168  1.00 22.35 ? 168 ILE A C   1 
ATOM   1272 O  O   . ILE A 1 169 ? 13.159 31.437 -0.114 1.00 22.06 ? 168 ILE A O   1 
ATOM   1273 C  CB  . ILE A 1 169 ? 14.333 34.035 0.915  1.00 28.66 ? 168 ILE A CB  1 
ATOM   1274 C  CG1 . ILE A 1 169 ? 13.805 34.281 2.349  1.00 28.65 ? 168 ILE A CG1 1 
ATOM   1275 C  CG2 . ILE A 1 169 ? 15.168 35.208 0.430  1.00 32.11 ? 168 ILE A CG2 1 
ATOM   1276 C  CD1 . ILE A 1 169 ? 14.908 34.440 3.434  1.00 27.77 ? 168 ILE A CD1 1 
ATOM   1277 N  N   . CYS A 1 170 ? 11.319 32.419 0.703  1.00 22.63 ? 169 CYS A N   1 
ATOM   1278 C  CA  . CYS A 1 170 ? 10.589 31.144 0.891  1.00 24.27 ? 169 CYS A CA  1 
ATOM   1279 C  C   . CYS A 1 170 ? 9.971  30.613 -0.371 1.00 23.17 ? 169 CYS A C   1 
ATOM   1280 O  O   . CYS A 1 170 ? 9.556  29.457 -0.416 1.00 19.73 ? 169 CYS A O   1 
ATOM   1281 C  CB  . CYS A 1 170 ? 9.491  31.258 1.945  1.00 21.39 ? 169 CYS A CB  1 
ATOM   1282 S  SG  . CYS A 1 170 ? 8.034  32.101 1.449  1.00 22.26 ? 169 CYS A SG  1 
ATOM   1283 N  N   . GLY A 1 171 ? 9.872  31.457 -1.396 1.00 21.81 ? 170 GLY A N   1 
ATOM   1284 C  CA  . GLY A 1 171 ? 9.313  31.023 -2.687 1.00 21.25 ? 170 GLY A CA  1 
ATOM   1285 C  C   . GLY A 1 171 ? 7.808  31.229 -2.828 1.00 20.88 ? 170 GLY A C   1 
ATOM   1286 O  O   . GLY A 1 171 ? 7.203  30.794 -3.803 1.00 22.92 ? 170 GLY A O   1 
ATOM   1287 N  N   . SER A 1 172 ? 7.212  31.947 -1.887 1.00 22.51 ? 171 SER A N   1 
ATOM   1288 C  CA  . SER A 1 172 ? 5.761  32.244 -1.929 1.00 22.13 ? 171 SER A CA  1 
ATOM   1289 C  C   . SER A 1 172 ? 5.275  33.063 -3.115 1.00 20.68 ? 171 SER A C   1 
ATOM   1290 O  O   . SER A 1 172 ? 4.067  33.041 -3.435 1.00 22.16 ? 171 SER A O   1 
ATOM   1291 C  CB  . SER A 1 172 ? 5.355  33.024 -0.664 1.00 20.75 ? 171 SER A CB  1 
ATOM   1292 O  OG  . SER A 1 172 ? 5.917  34.335 -0.656 1.00 20.70 ? 171 SER A OG  1 
ATOM   1293 N  N   . GLY A 1 173 ? 6.178  33.853 -3.701 1.00 22.30 ? 172 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 173 ? 5.819  34.859 -4.722 1.00 20.46 ? 172 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 173 ? 5.435  36.224 -4.155 1.00 20.51 ? 172 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 173 ? 5.366  37.189 -4.892 1.00 21.26 ? 172 GLY A O   1 
ATOM   1297 N  N   . GLU A 1 174 ? 5.240  36.319 -2.836 1.00 19.18 ? 173 GLU A N   1 
ATOM   1298 C  CA  . GLU A 1 174 ? 4.893  37.566 -2.168 1.00 23.52 ? 173 GLU A CA  1 
ATOM   1299 C  C   . GLU A 1 174 ? 6.190  38.325 -2.000 1.00 24.18 ? 173 GLU A C   1 
ATOM   1300 O  O   . GLU A 1 174 ? 7.257  37.715 -1.971 1.00 20.04 ? 173 GLU A O   1 
ATOM   1301 C  CB  . GLU A 1 174 ? 4.243  37.314 -0.809 1.00 23.32 ? 173 GLU A CB  1 
ATOM   1302 C  CG  . GLU A 1 174 ? 3.037  36.369 -0.827 1.00 31.07 ? 173 GLU A CG  1 
ATOM   1303 C  CD  . GLU A 1 174 ? 1.797  37.032 -1.387 1.00 32.75 ? 173 GLU A CD  1 
ATOM   1304 O  OE1 . GLU A 1 174 ? 1.611  37.057 -2.619 1.00 30.97 ? 173 GLU A OE1 1 
ATOM   1305 O  OE2 . GLU A 1 174 ? 1.007  37.551 -0.570 1.00 39.45 ? 173 GLU A OE2 1 
ATOM   1306 N  N   . LYS A 1 175 ? 6.112  39.650 -1.907 1.00 21.67 ? 174 LYS A N   1 
ATOM   1307 C  CA  . LYS A 1 175 ? 7.302  40.441 -1.629 1.00 21.32 ? 174 LYS A CA  1 
ATOM   1308 C  C   . LYS A 1 175 ? 7.885  40.009 -0.288 1.00 21.15 ? 174 LYS A C   1 
ATOM   1309 O  O   . LYS A 1 175 ? 7.145  39.829 0.674  1.00 21.64 ? 174 LYS A O   1 
ATOM   1310 C  CB  . LYS A 1 175 ? 6.950  41.930 -1.561 1.00 24.83 ? 174 LYS A CB  1 
ATOM   1311 C  CG  . LYS A 1 175 ? 6.344  42.506 -2.830 1.00 26.57 ? 174 LYS A CG  1 
ATOM   1312 C  CD  . LYS A 1 175 ? 5.750  43.903 -2.541 1.00 25.75 ? 174 LYS A CD  1 
ATOM   1313 C  CE  . LYS A 1 175 ? 4.932  44.460 -3.692 1.00 32.45 ? 174 LYS A CE  1 
ATOM   1314 N  NZ  . LYS A 1 175 ? 4.417  45.834 -3.390 1.00 32.42 ? 174 LYS A NZ  1 
ATOM   1315 N  N   . PHE A 1 176 ? 9.205  39.914 -0.197 1.00 21.48 ? 175 PHE A N   1 
ATOM   1316 C  CA  . PHE A 1 176 ? 9.865  39.597 1.066  1.00 22.36 ? 175 PHE A CA  1 
ATOM   1317 C  C   . PHE A 1 176 ? 9.272  40.410 2.244  1.00 22.37 ? 175 PHE A C   1 
ATOM   1318 O  O   . PHE A 1 176 ? 8.932  39.860 3.280  1.00 23.87 ? 175 PHE A O   1 
ATOM   1319 C  CB  . PHE A 1 176 ? 11.389 39.826 0.918  1.00 21.29 ? 175 PHE A CB  1 
ATOM   1320 C  CG  . PHE A 1 176 ? 12.182 39.524 2.156  1.00 25.52 ? 175 PHE A CG  1 
ATOM   1321 C  CD1 . PHE A 1 176 ? 12.293 38.201 2.619  1.00 24.59 ? 175 PHE A CD1 1 
ATOM   1322 C  CD2 . PHE A 1 176 ? 12.827 40.549 2.862  1.00 24.69 ? 175 PHE A CD2 1 
ATOM   1323 C  CE1 . PHE A 1 176 ? 13.024 37.923 3.775  1.00 24.87 ? 175 PHE A CE1 1 
ATOM   1324 C  CE2 . PHE A 1 176 ? 13.554 40.271 4.018  1.00 25.86 ? 175 PHE A CE2 1 
ATOM   1325 C  CZ  . PHE A 1 176 ? 13.673 38.967 4.458  1.00 24.17 ? 175 PHE A CZ  1 
ATOM   1326 N  N   . LYS A 1 177 ? 9.146  41.722 2.056  1.00 26.02 ? 176 LYS A N   1 
ATOM   1327 C  CA  . LYS A 1 177 ? 8.619  42.618 3.071  1.00 24.74 ? 176 LYS A CA  1 
ATOM   1328 C  C   . LYS A 1 177 ? 7.148  42.363 3.492  1.00 24.71 ? 176 LYS A C   1 
ATOM   1329 O  O   . LYS A 1 177 ? 6.723  42.799 4.571  1.00 24.84 ? 176 LYS A O   1 
ATOM   1330 C  CB  . LYS A 1 177 ? 8.819  44.079 2.615  1.00 24.62 ? 176 LYS A CB  1 
ATOM   1331 C  CG  . LYS A 1 177 ? 7.987  44.496 1.448  1.00 25.46 ? 176 LYS A CG  1 
ATOM   1332 C  CD  . LYS A 1 177 ? 8.297  45.935 1.009  1.00 31.18 ? 176 LYS A CD  1 
ATOM   1333 C  CE  . LYS A 1 177 ? 7.777  46.976 2.007  1.00 37.21 ? 176 LYS A CE  1 
ATOM   1334 N  NZ  . LYS A 1 177 ? 8.153  48.370 1.570  1.00 41.88 ? 176 LYS A NZ  1 
ATOM   1335 N  N   . ARG A 1 178 ? 6.389  41.637 2.671  1.00 22.76 ? 177 ARG A N   1 
ATOM   1336 C  CA  . ARG A 1 178 ? 4.983  41.269 2.966  1.00 22.38 ? 177 ARG A CA  1 
ATOM   1337 C  C   . ARG A 1 178 ? 4.881  39.772 3.273  1.00 24.18 ? 177 ARG A C   1 
ATOM   1338 O  O   . ARG A 1 178 ? 3.775  39.161 3.208  1.00 24.85 ? 177 ARG A O   1 
ATOM   1339 C  CB  . ARG A 1 178 ? 4.068  41.619 1.790  1.00 23.17 ? 177 ARG A CB  1 
ATOM   1340 C  CG  . ARG A 1 178 ? 3.701  43.098 1.695  1.00 26.70 ? 177 ARG A CG  1 
ATOM   1341 C  CD  . ARG A 1 178 ? 2.585  43.529 2.686  1.00 30.77 ? 177 ARG A CD  1 
ATOM   1342 N  NE  . ARG A 1 178 ? 1.246  43.013 2.353  1.00 29.71 ? 177 ARG A NE  1 
ATOM   1343 C  CZ  . ARG A 1 178 ? 0.145  43.261 3.071  1.00 34.56 ? 177 ARG A CZ  1 
ATOM   1344 N  NH1 . ARG A 1 178 ? 0.202  44.022 4.167  1.00 32.10 ? 177 ARG A NH1 1 
ATOM   1345 N  NH2 . ARG A 1 178 ? -1.025 42.734 2.716  1.00 27.53 ? 177 ARG A NH2 1 
ATOM   1346 N  N   . CYS A 1 179 ? 6.029  39.168 3.566  1.00 22.35 ? 178 CYS A N   1 
ATOM   1347 C  CA  . CYS A 1 179 ? 6.094  37.709 3.784  1.00 21.67 ? 178 CYS A CA  1 
ATOM   1348 C  C   . CYS A 1 179 ? 7.056  37.385 4.915  1.00 22.42 ? 178 CYS A C   1 
ATOM   1349 O  O   . CYS A 1 179 ? 6.810  37.812 6.012  1.00 24.11 ? 178 CYS A O   1 
ATOM   1350 C  CB  . CYS A 1 179 ? 6.425  36.930 2.497  1.00 19.71 ? 178 CYS A CB  1 
ATOM   1351 S  SG  . CYS A 1 179 ? 6.047  35.154 2.512  1.00 22.53 ? 178 CYS A SG  1 
ATOM   1352 N  N   . CYS A 1 180 ? 8.153  36.671 4.662  1.00 23.35 ? 179 CYS A N   1 
ATOM   1353 C  CA  . CYS A 1 180 ? 9.039  36.249 5.765  1.00 24.39 ? 179 CYS A CA  1 
ATOM   1354 C  C   . CYS A 1 180 ? 9.774  37.429 6.414  1.00 26.14 ? 179 CYS A C   1 
ATOM   1355 O  O   . CYS A 1 180 ? 10.151 37.365 7.585  1.00 24.43 ? 179 CYS A O   1 
ATOM   1356 C  CB  . CYS A 1 180 ? 9.993  35.157 5.280  1.00 23.25 ? 179 CYS A CB  1 
ATOM   1357 S  SG  . CYS A 1 180 ? 9.139  33.595 4.854  1.00 21.86 ? 179 CYS A SG  1 
ATOM   1358 N  N   . GLY A 1 181 ? 9.922  38.524 5.659  1.00 25.76 ? 180 GLY A N   1 
ATOM   1359 C  CA  . GLY A 1 181 ? 10.507 39.769 6.170  1.00 26.77 ? 180 GLY A CA  1 
ATOM   1360 C  C   . GLY A 1 181 ? 9.668  40.485 7.224  1.00 27.35 ? 180 GLY A C   1 
ATOM   1361 O  O   . GLY A 1 181 ? 10.200 41.346 7.930  1.00 29.71 ? 180 GLY A O   1 
HETATM 1362 N  N   . MSE A 1 182 ? 8.373  40.155 7.329  1.00 25.07 ? 181 MSE A N   1 
HETATM 1363 C  CA  . MSE A 1 182 ? 7.537  40.601 8.437  1.00 25.14 ? 181 MSE A CA  1 
HETATM 1364 C  C   . MSE A 1 182 ? 8.075  40.067 9.766  1.00 28.72 ? 181 MSE A C   1 
HETATM 1365 O  O   . MSE A 1 182 ? 7.857  40.662 10.832 1.00 29.89 ? 181 MSE A O   1 
HETATM 1366 C  CB  . MSE A 1 182 ? 6.090  40.109 8.305  1.00 26.78 ? 181 MSE A CB  1 
HETATM 1367 C  CG  . MSE A 1 182 ? 5.241  40.662 7.174  1.00 26.84 ? 181 MSE A CG  1 
HETATM 1368 SE SE  . MSE A 1 182 ? 4.934  42.567 7.333  0.75 36.86 ? 181 MSE A SE  1 
HETATM 1369 C  CE  . MSE A 1 182 ? 4.855  42.684 9.281  1.00 29.88 ? 181 MSE A CE  1 
ATOM   1370 N  N   . TYR A 1 183 ? 8.763  38.933 9.716  1.00 30.55 ? 182 TYR A N   1 
ATOM   1371 C  CA  . TYR A 1 183 ? 9.074  38.183 10.931 1.00 31.74 ? 182 TYR A CA  1 
ATOM   1372 C  C   . TYR A 1 183 ? 10.560 37.983 11.164 1.00 32.18 ? 182 TYR A C   1 
ATOM   1373 O  O   . TYR A 1 183 ? 10.949 37.810 12.320 1.00 36.23 ? 182 TYR A O   1 
ATOM   1374 C  CB  . TYR A 1 183 ? 8.330  36.853 10.928 1.00 29.16 ? 182 TYR A CB  1 
ATOM   1375 C  CG  . TYR A 1 183 ? 6.855  36.989 10.634 1.00 28.64 ? 182 TYR A CG  1 
ATOM   1376 C  CD1 . TYR A 1 183 ? 6.011  37.600 11.537 1.00 27.18 ? 182 TYR A CD1 1 
ATOM   1377 C  CD2 . TYR A 1 183 ? 6.307  36.525 9.428  1.00 23.93 ? 182 TYR A CD2 1 
ATOM   1378 C  CE1 . TYR A 1 183 ? 4.643  37.746 11.281 1.00 28.19 ? 182 TYR A CE1 1 
ATOM   1379 C  CE2 . TYR A 1 183 ? 4.931  36.670 9.165  1.00 32.12 ? 182 TYR A CE2 1 
ATOM   1380 C  CZ  . TYR A 1 183 ? 4.104  37.262 10.110 1.00 31.20 ? 182 TYR A CZ  1 
ATOM   1381 O  OH  . TYR A 1 183 ? 2.732  37.460 9.879  1.00 32.10 ? 182 TYR A OH  1 
ATOM   1382 N  N   . ILE A 1 184 ? 11.382 37.987 10.108 1.00 35.70 ? 183 ILE A N   1 
ATOM   1383 C  CA  . ILE A 1 184 ? 12.857 38.031 10.240 1.00 36.73 ? 183 ILE A CA  1 
ATOM   1384 C  C   . ILE A 1 184 ? 13.478 39.158 9.430  1.00 41.87 ? 183 ILE A C   1 
ATOM   1385 O  O   . ILE A 1 184 ? 14.693 39.384 9.479  1.00 43.47 ? 183 ILE A O   1 
ATOM   1386 C  CB  . ILE A 1 184 ? 13.560 36.725 9.811  1.00 39.19 ? 183 ILE A CB  1 
ATOM   1387 C  CG1 . ILE A 1 184 ? 13.449 36.504 8.296  1.00 36.08 ? 183 ILE A CG1 1 
ATOM   1388 C  CG2 . ILE A 1 184 ? 13.021 35.554 10.608 1.00 43.54 ? 183 ILE A CG2 1 
ATOM   1389 C  CD1 . ILE A 1 184 ? 14.154 35.270 7.815  1.00 37.14 ? 183 ILE A CD1 1 
ATOM   1390 O  OXT . ILE A 1 184 ? 12.783 39.867 8.700  1.00 43.02 ? 183 ILE A OXT 1 
HETATM 1391 ZN ZN  . ZN  B 2 .   ? 10.062 14.310 21.146 1.00 17.46 ? 200 ZN  A ZN  1 
HETATM 1392 ZN ZN  . ZN  C 2 .   ? 8.218  34.089 2.723  1.00 21.34 ? 201 ZN  A ZN  1 
HETATM 1393 CL CL  . CL  D 3 .   ? 22.665 36.674 1.219  1.00 49.66 ? 202 CL  A CL  1 
HETATM 1394 O  O   . HOH E 4 .   ? 11.813 20.644 38.153 1.00 17.43 ? 203 HOH A O   1 
HETATM 1395 O  O   . HOH E 4 .   ? 13.762 28.741 0.610  1.00 22.38 ? 204 HOH A O   1 
HETATM 1396 O  O   . HOH E 4 .   ? 12.566 32.550 14.068 1.00 16.67 ? 205 HOH A O   1 
HETATM 1397 O  O   . HOH E 4 .   ? 6.640  6.165  24.730 1.00 25.80 ? 206 HOH A O   1 
HETATM 1398 O  O   . HOH E 4 .   ? 11.428 20.832 7.417  1.00 21.70 ? 207 HOH A O   1 
HETATM 1399 O  O   . HOH E 4 .   ? 1.799  25.027 13.051 1.00 19.26 ? 208 HOH A O   1 
HETATM 1400 O  O   . HOH E 4 .   ? 13.950 32.187 16.503 1.00 22.62 ? 209 HOH A O   1 
HETATM 1401 O  O   . HOH E 4 .   ? 15.818 17.540 27.194 1.00 17.17 ? 210 HOH A O   1 
HETATM 1402 O  O   . HOH E 4 .   ? 10.972 14.376 9.194  1.00 23.22 ? 211 HOH A O   1 
HETATM 1403 O  O   . HOH E 4 .   ? 18.841 26.658 12.089 1.00 21.71 ? 212 HOH A O   1 
HETATM 1404 O  O   . HOH E 4 .   ? -0.415 29.268 8.983  1.00 26.61 ? 213 HOH A O   1 
HETATM 1405 O  O   . HOH E 4 .   ? 18.690 10.126 12.728 1.00 34.78 ? 214 HOH A O   1 
HETATM 1406 O  O   . HOH E 4 .   ? 23.877 17.563 23.545 1.00 22.99 ? 215 HOH A O   1 
HETATM 1407 O  O   . HOH E 4 .   ? -2.842 31.163 15.456 1.00 30.47 ? 216 HOH A O   1 
HETATM 1408 O  O   . HOH E 4 .   ? 5.656  29.919 1.548  1.00 22.61 ? 217 HOH A O   1 
HETATM 1409 O  O   . HOH E 4 .   ? 8.386  19.434 27.162 1.00 24.45 ? 218 HOH A O   1 
HETATM 1410 O  O   . HOH E 4 .   ? 10.301 16.776 10.106 1.00 19.91 ? 219 HOH A O   1 
HETATM 1411 O  O   . HOH E 4 .   ? 1.082  20.666 17.512 1.00 37.31 ? 220 HOH A O   1 
HETATM 1412 O  O   . HOH E 4 .   ? 6.417  9.825  16.734 1.00 29.51 ? 221 HOH A O   1 
HETATM 1413 O  O   . HOH E 4 .   ? 16.365 34.072 27.207 1.00 42.68 ? 222 HOH A O   1 
HETATM 1414 O  O   . HOH E 4 .   ? 18.214 36.035 9.094  1.00 28.95 ? 223 HOH A O   1 
HETATM 1415 O  O   . HOH E 4 .   ? 15.776 46.324 -0.490 1.00 32.79 ? 224 HOH A O   1 
HETATM 1416 O  O   . HOH E 4 .   ? 7.283  16.712 33.025 1.00 26.43 ? 225 HOH A O   1 
HETATM 1417 O  O   . HOH E 4 .   ? 3.554  31.545 19.794 1.00 25.78 ? 226 HOH A O   1 
HETATM 1418 O  O   . HOH E 4 .   ? 6.152  21.668 26.470 1.00 26.93 ? 227 HOH A O   1 
HETATM 1419 O  O   . HOH E 4 .   ? 23.243 11.025 14.672 1.00 40.39 ? 228 HOH A O   1 
HETATM 1420 O  O   . HOH E 4 .   ? 15.923 9.793  24.892 1.00 23.49 ? 229 HOH A O   1 
HETATM 1421 O  O   . HOH E 4 .   ? 11.336 5.152  16.054 1.00 27.88 ? 230 HOH A O   1 
HETATM 1422 O  O   . HOH E 4 .   ? 7.615  28.529 -5.319 1.00 34.93 ? 231 HOH A O   1 
HETATM 1423 O  O   . HOH E 4 .   ? 1.934  9.015  28.223 1.00 28.06 ? 232 HOH A O   1 
HETATM 1424 O  O   . HOH E 4 .   ? 16.349 18.318 33.330 1.00 33.60 ? 233 HOH A O   1 
HETATM 1425 O  O   . HOH E 4 .   ? 20.823 27.594 0.791  1.00 27.90 ? 234 HOH A O   1 
HETATM 1426 O  O   . HOH E 4 .   ? 18.112 3.573  27.533 1.00 34.82 ? 235 HOH A O   1 
HETATM 1427 O  O   . HOH E 4 .   ? 7.136  19.697 8.291  1.00 24.77 ? 236 HOH A O   1 
HETATM 1428 O  O   . HOH E 4 .   ? 4.652  21.311 38.651 1.00 42.28 ? 237 HOH A O   1 
HETATM 1429 O  O   . HOH E 4 .   ? 10.815 7.442  10.053 1.00 30.66 ? 238 HOH A O   1 
HETATM 1430 O  O   . HOH E 4 .   ? 3.349  19.593 7.193  1.00 37.30 ? 239 HOH A O   1 
HETATM 1431 O  O   . HOH E 4 .   ? 11.043 43.424 5.993  1.00 41.45 ? 240 HOH A O   1 
HETATM 1432 O  O   . HOH E 4 .   ? 17.073 33.674 24.324 1.00 58.73 ? 241 HOH A O   1 
HETATM 1433 O  O   . HOH E 4 .   ? 18.952 45.966 -0.976 1.00 33.93 ? 242 HOH A O   1 
HETATM 1434 O  O   . HOH E 4 .   ? 9.132  8.347  29.944 1.00 29.83 ? 243 HOH A O   1 
HETATM 1435 O  O   . HOH E 4 .   ? 2.525  33.644 25.632 1.00 39.20 ? 244 HOH A O   1 
HETATM 1436 O  O   . HOH E 4 .   ? 11.424 11.311 32.285 1.00 34.20 ? 245 HOH A O   1 
HETATM 1437 O  O   . HOH E 4 .   ? -0.467 14.811 31.981 1.00 39.56 ? 246 HOH A O   1 
HETATM 1438 O  O   . HOH E 4 .   ? 9.777  18.724 8.193  1.00 23.07 ? 247 HOH A O   1 
HETATM 1439 O  O   . HOH E 4 .   ? -1.415 26.286 10.503 1.00 31.53 ? 248 HOH A O   1 
HETATM 1440 O  O   A HOH E 4 .   ? 17.934 13.765 10.255 0.50 25.20 ? 249 HOH A O   1 
HETATM 1441 O  O   B HOH E 4 .   ? 18.797 13.106 11.593 0.50 16.79 ? 249 HOH A O   1 
HETATM 1442 O  O   . HOH E 4 .   ? 30.108 26.245 18.326 1.00 30.89 ? 250 HOH A O   1 
HETATM 1443 O  O   . HOH E 4 .   ? -0.462 23.945 12.000 1.00 23.52 ? 251 HOH A O   1 
HETATM 1444 O  O   . HOH E 4 .   ? 2.645  34.556 17.978 1.00 30.51 ? 252 HOH A O   1 
HETATM 1445 O  O   . HOH E 4 .   ? -3.331 34.075 14.818 1.00 44.96 ? 253 HOH A O   1 
HETATM 1446 O  O   . HOH E 4 .   ? 6.737  37.149 -7.307 1.00 28.50 ? 254 HOH A O   1 
HETATM 1447 O  O   . HOH E 4 .   ? 6.445  38.608 15.459 1.00 37.88 ? 255 HOH A O   1 
HETATM 1448 O  O   . HOH E 4 .   ? -5.704 29.429 15.511 1.00 54.94 ? 256 HOH A O   1 
HETATM 1449 O  O   . HOH E 4 .   ? 1.927  8.799  36.286 1.00 28.06 ? 257 HOH A O   1 
HETATM 1450 O  O   . HOH E 4 .   ? 4.351  4.983  33.405 1.00 38.28 ? 258 HOH A O   1 
HETATM 1451 O  O   . HOH E 4 .   ? 8.642  44.176 6.389  1.00 33.61 ? 259 HOH A O   1 
HETATM 1452 O  O   . HOH E 4 .   ? 4.482  8.678  35.400 1.00 42.92 ? 260 HOH A O   1 
HETATM 1453 O  O   . HOH E 4 .   ? 1.668  15.417 29.915 1.00 43.82 ? 261 HOH A O   1 
HETATM 1454 O  O   . HOH E 4 .   ? -0.004 22.359 9.865  1.00 33.54 ? 262 HOH A O   1 
HETATM 1455 O  O   . HOH E 4 .   ? 2.538  35.801 -6.955 1.00 30.58 ? 263 HOH A O   1 
HETATM 1456 O  O   . HOH E 4 .   ? 22.896 27.609 25.023 1.00 46.86 ? 264 HOH A O   1 
HETATM 1457 O  O   . HOH E 4 .   ? -2.259 23.089 13.835 1.00 33.36 ? 265 HOH A O   1 
HETATM 1458 O  O   . HOH E 4 .   ? 9.936  17.656 5.571  1.00 30.18 ? 266 HOH A O   1 
HETATM 1459 O  O   . HOH E 4 .   ? 9.628  0.326  24.886 1.00 41.58 ? 267 HOH A O   1 
HETATM 1460 O  O   . HOH E 4 .   ? 9.145  37.748 15.871 1.00 49.31 ? 268 HOH A O   1 
HETATM 1461 O  O   . HOH E 4 .   ? 12.565 5.777  13.709 1.00 49.18 ? 269 HOH A O   1 
HETATM 1462 O  O   . HOH E 4 .   ? 13.747 46.675 -2.296 1.00 42.62 ? 270 HOH A O   1 
HETATM 1463 O  O   . HOH E 4 .   ? 11.642 35.132 14.006 1.00 35.44 ? 271 HOH A O   1 
HETATM 1464 O  O   . HOH E 4 .   ? 15.977 11.871 27.734 1.00 35.40 ? 272 HOH A O   1 
HETATM 1465 O  O   . HOH E 4 .   ? 20.673 8.848  18.927 1.00 43.73 ? 273 HOH A O   1 
HETATM 1466 O  O   . HOH E 4 .   ? 7.719  14.647 17.917 1.00 34.31 ? 274 HOH A O   1 
HETATM 1467 O  O   . HOH E 4 .   ? 0.717  33.379 22.389 1.00 30.21 ? 275 HOH A O   1 
HETATM 1468 O  O   . HOH E 4 .   ? 22.294 10.376 12.502 1.00 45.12 ? 276 HOH A O   1 
HETATM 1469 O  O   . HOH E 4 .   ? 19.252 44.783 -3.283 1.00 33.00 ? 277 HOH A O   1 
HETATM 1470 O  O   . HOH E 4 .   ? 9.828  15.165 4.647  1.00 34.55 ? 278 HOH A O   1 
HETATM 1471 O  O   . HOH E 4 .   ? 20.509 39.596 8.000  1.00 51.26 ? 279 HOH A O   1 
HETATM 1472 O  O   . HOH E 4 .   ? 2.115  31.616 -2.378 1.00 37.47 ? 280 HOH A O   1 
HETATM 1473 O  O   . HOH E 4 .   ? 22.831 10.582 18.431 1.00 46.83 ? 281 HOH A O   1 
HETATM 1474 O  O   . HOH E 4 .   ? 13.898 34.751 17.611 1.00 31.39 ? 282 HOH A O   1 
HETATM 1475 O  O   . HOH E 4 .   ? -2.444 26.515 19.602 1.00 32.36 ? 283 HOH A O   1 
HETATM 1476 O  O   . HOH E 4 .   ? 4.015  37.822 17.017 1.00 36.42 ? 284 HOH A O   1 
HETATM 1477 O  O   . HOH E 4 .   ? 2.166  35.019 -4.392 1.00 28.56 ? 285 HOH A O   1 
HETATM 1478 O  O   . HOH E 4 .   ? -0.659 32.424 20.442 1.00 40.13 ? 286 HOH A O   1 
HETATM 1479 O  O   . HOH E 4 .   ? 25.198 24.676 29.438 1.00 36.05 ? 287 HOH A O   1 
HETATM 1480 O  O   . HOH E 4 .   ? 12.907 33.162 -3.827 1.00 34.93 ? 288 HOH A O   1 
HETATM 1481 O  O   . HOH E 4 .   ? 2.903  35.765 3.268  1.00 44.09 ? 289 HOH A O   1 
HETATM 1482 O  O   . HOH E 4 .   ? 3.461  33.381 21.721 1.00 30.01 ? 290 HOH A O   1 
HETATM 1483 O  O   . HOH E 4 .   ? 2.023  27.778 2.682  1.00 41.89 ? 291 HOH A O   1 
HETATM 1484 O  O   . HOH E 4 .   ? 26.514 13.516 16.594 1.00 49.13 ? 292 HOH A O   1 
HETATM 1485 O  O   . HOH E 4 .   ? 6.771  40.643 13.532 1.00 45.44 ? 293 HOH A O   1 
HETATM 1486 O  O   . HOH E 4 .   ? 27.994 23.926 29.893 1.00 49.92 ? 294 HOH A O   1 
HETATM 1487 O  O   . HOH E 4 .   ? 5.922  6.334  27.511 1.00 45.10 ? 295 HOH A O   1 
HETATM 1488 O  O   . HOH E 4 .   ? 5.537  27.391 34.028 1.00 40.82 ? 296 HOH A O   1 
HETATM 1489 O  O   . HOH E 4 .   ? 5.185  45.222 4.568  1.00 45.90 ? 297 HOH A O   1 
HETATM 1490 O  O   . HOH E 4 .   ? 9.178  15.725 31.912 1.00 26.25 ? 298 HOH A O   1 
HETATM 1491 O  O   . HOH E 4 .   ? 5.281  35.130 27.475 1.00 48.60 ? 299 HOH A O   1 
HETATM 1492 O  O   . HOH E 4 .   ? 3.856  13.882 30.171 1.00 53.43 ? 300 HOH A O   1 
HETATM 1493 O  O   . HOH E 4 .   ? 15.610 21.022 3.138  1.00 33.42 ? 301 HOH A O   1 
HETATM 1494 O  O   . HOH E 4 .   ? 18.458 20.235 2.465  1.00 46.15 ? 302 HOH A O   1 
HETATM 1495 O  O   . HOH E 4 .   ? 1.889  27.799 28.451 1.00 52.88 ? 303 HOH A O   1 
HETATM 1496 O  O   . HOH E 4 .   ? 1.633  37.786 2.260  1.00 35.99 ? 304 HOH A O   1 
HETATM 1497 O  O   . HOH E 4 .   ? 14.881 35.800 25.512 1.00 44.32 ? 305 HOH A O   1 
HETATM 1498 O  O   . HOH E 4 .   ? -3.136 30.786 18.226 1.00 42.44 ? 306 HOH A O   1 
HETATM 1499 O  O   . HOH E 4 .   ? 27.825 13.269 19.178 1.00 50.32 ? 307 HOH A O   1 
HETATM 1500 O  O   . HOH E 4 .   ? -3.499 33.514 17.767 1.00 37.61 ? 308 HOH A O   1 
HETATM 1501 O  O   . HOH E 4 .   ? 3.169  15.004 17.665 1.00 50.05 ? 309 HOH A O   1 
HETATM 1502 O  O   . HOH E 4 .   ? 15.457 14.628 3.535  1.00 49.96 ? 310 HOH A O   1 
HETATM 1503 O  O   . HOH E 4 .   ? 10.529 13.929 32.961 1.00 31.67 ? 311 HOH A O   1 
HETATM 1504 O  O   . HOH E 4 .   ? 9.436  10.121 34.211 1.00 42.12 ? 312 HOH A O   1 
HETATM 1505 O  O   . HOH E 4 .   ? 22.744 28.689 12.843 1.00 37.69 ? 313 HOH A O   1 
HETATM 1506 O  O   . HOH E 4 .   ? 13.702 34.140 20.158 1.00 33.27 ? 314 HOH A O   1 
HETATM 1507 O  O   . HOH E 4 .   ? 11.212 12.195 5.593  1.00 50.47 ? 315 HOH A O   1 
HETATM 1508 O  O   . HOH E 4 .   ? 2.021  32.781 28.129 1.00 61.60 ? 316 HOH A O   1 
HETATM 1509 O  O   . HOH E 4 .   ? -0.809 16.686 34.083 1.00 44.68 ? 317 HOH A O   1 
HETATM 1510 O  O   . HOH E 4 .   ? 7.614  44.815 9.339  1.00 45.04 ? 318 HOH A O   1 
HETATM 1511 O  O   . HOH E 4 .   ? 0.019  36.303 17.758 1.00 39.18 ? 319 HOH A O   1 
HETATM 1512 O  O   . HOH E 4 .   ? 4.639  4.750  18.676 1.00 50.60 ? 320 HOH A O   1 
HETATM 1513 O  O   . HOH E 4 .   ? 17.478 31.350 17.042 1.00 47.93 ? 321 HOH A O   1 
HETATM 1514 O  O   . HOH E 4 .   ? 21.086 11.600 4.925  1.00 44.86 ? 322 HOH A O   1 
HETATM 1515 O  O   . HOH E 4 .   ? 18.669 30.084 15.148 1.00 45.96 ? 323 HOH A O   1 
HETATM 1516 O  O   . HOH E 4 .   ? 4.778  11.855 34.419 1.00 31.21 ? 324 HOH A O   1 
HETATM 1517 O  O   . HOH E 4 .   ? 5.230  16.775 30.991 1.00 43.15 ? 325 HOH A O   1 
HETATM 1518 O  O   . HOH E 4 .   ? 18.645 14.639 8.083  1.00 53.27 ? 326 HOH A O   1 
HETATM 1519 O  O   . HOH E 4 .   ? 11.926 27.451 -0.717 1.00 40.00 ? 327 HOH A O   1 
HETATM 1520 O  O   . HOH E 4 .   ? 7.829  33.682 30.886 1.00 50.71 ? 328 HOH A O   1 
HETATM 1521 O  O   . HOH E 4 .   ? 5.923  30.041 31.180 1.00 42.73 ? 329 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   MSE 2   1   1   MSE MSE A . n 
A 1 3   LEU 3   2   2   LEU LEU A . n 
A 1 4   PHE 4   3   3   PHE PHE A . n 
A 1 5   SER 5   4   4   SER SER A . n 
A 1 6   ILE 6   5   5   ILE ILE A . n 
A 1 7   GLN 7   6   6   GLN GLN A . n 
A 1 8   THR 8   7   7   THR THR A . n 
A 1 9   CYS 9   8   8   CYS CYS A . n 
A 1 10  PRO 10  9   9   PRO PRO A . n 
A 1 11  CYS 11  10  10  CYS CYS A . n 
A 1 12  GLN 12  11  11  GLN GLN A . n 
A 1 13  ILE 13  12  12  ILE ILE A . n 
A 1 14  ASN 14  13  13  ASN ASN A . n 
A 1 15  PRO 15  14  14  PRO PRO A . n 
A 1 16  ALA 16  15  15  ALA ALA A . n 
A 1 17  LEU 17  16  16  LEU LEU A . n 
A 1 18  ASN 18  17  17  ASN ASN A . n 
A 1 19  ALA 19  18  18  ALA ALA A . n 
A 1 20  VAL 20  19  19  VAL VAL A . n 
A 1 21  SER 21  20  20  SER SER A . n 
A 1 22  THR 22  21  21  THR THR A . n 
A 1 23  PRO 23  22  22  PRO PRO A . n 
A 1 24  LEU 24  23  23  LEU LEU A . n 
A 1 25  LEU 25  24  24  LEU LEU A . n 
A 1 26  TYR 26  25  25  TYR TYR A . n 
A 1 27  GLN 27  26  26  GLN GLN A . n 
A 1 28  ASP 28  27  27  ASP ASP A . n 
A 1 29  CYS 29  28  28  CYS CYS A . n 
A 1 30  CYS 30  29  29  CYS CYS A . n 
A 1 31  GLN 31  30  30  GLN GLN A . n 
A 1 32  PRO 32  31  31  PRO PRO A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  HIS 34  33  33  HIS HIS A . n 
A 1 35  ASP 35  34  34  ASP ASP A . n 
A 1 36  GLY 36  35  35  GLY GLY A . n 
A 1 37  LEU 37  36  36  LEU LEU A . n 
A 1 38  TYR 38  37  37  TYR TYR A . n 
A 1 39  ASN 39  38  38  ASN ASN A . n 
A 1 40  GLN 40  39  39  GLN GLN A . n 
A 1 41  GLU 41  40  ?   ?   ?   A . n 
A 1 42  VAL 42  41  ?   ?   ?   A . n 
A 1 43  GLU 43  42  ?   ?   ?   A . n 
A 1 44  ASP 44  43  ?   ?   ?   A . n 
A 1 45  SER 45  44  ?   ?   ?   A . n 
A 1 46  ASP 46  45  ?   ?   ?   A . n 
A 1 47  ALA 47  46  46  ALA ALA A . n 
A 1 48  ILE 48  47  47  ILE ILE A . n 
A 1 49  ARG 49  48  48  ARG ARG A . n 
A 1 50  ALA 50  49  49  ALA ALA A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  THR 52  51  51  THR THR A . n 
A 1 53  ALA 53  52  52  ALA ALA A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  HIS 55  54  54  HIS HIS A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  MSE 57  56  56  MSE MSE A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  THR 59  58  58  THR THR A . n 
A 1 60  ARG 60  59  59  ARG ARG A . n 
A 1 61  TYR 61  60  60  TYR TYR A . n 
A 1 62  SER 62  61  61  SER SER A . n 
A 1 63  ALA 63  62  62  ALA ALA A . n 
A 1 64  PHE 64  63  63  PHE PHE A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  LEU 66  65  65  LEU LEU A . n 
A 1 67  VAL 67  66  66  VAL VAL A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  PRO 69  68  68  PRO PRO A . n 
A 1 70  GLU 70  69  69  GLU GLU A . n 
A 1 71  TYR 71  70  70  TYR TYR A . n 
A 1 72  ILE 72  71  71  ILE ILE A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LYS 74  73  73  LYS LYS A . n 
A 1 75  THR 75  74  74  THR THR A . n 
A 1 76  THR 76  75  75  THR THR A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  PRO 78  77  77  PRO PRO A . n 
A 1 79  ALA 79  78  78  ALA ALA A . n 
A 1 80  GLN 80  79  79  GLN GLN A . n 
A 1 81  GLN 81  80  80  GLN GLN A . n 
A 1 82  ASP 82  81  81  ASP ASP A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  LEU 84  83  83  LEU LEU A . n 
A 1 85  ASP 85  84  84  ASP ASP A . n 
A 1 86  ILE 86  85  85  ILE ILE A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  ALA 88  87  87  ALA ALA A . n 
A 1 89  ILE 89  88  88  ILE ILE A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  TRP 92  91  91  TRP TRP A . n 
A 1 93  ALA 93  92  92  ALA ALA A . n 
A 1 94  LYS 94  93  93  LYS LYS A . n 
A 1 95  GLU 95  94  94  GLU GLU A . n 
A 1 96  THR 96  95  95  THR THR A . n 
A 1 97  ASP 97  96  96  ASP ASP A . n 
A 1 98  TRP 98  97  97  TRP TRP A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 GLU 102 101 101 GLU GLU A . n 
A 1 103 VAL 103 102 102 VAL VAL A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ALA 105 104 104 ALA ALA A . n 
A 1 106 HIS 106 105 105 HIS HIS A . n 
A 1 107 THR 107 106 106 THR THR A . n 
A 1 108 PRO 108 107 107 PRO PRO A . n 
A 1 109 LYS 109 108 108 LYS LYS A . n 
A 1 110 LEU 110 109 109 LEU LEU A . n 
A 1 111 SER 111 110 110 SER SER A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 ARG 113 112 112 ARG ARG A . n 
A 1 114 HIS 114 113 113 HIS HIS A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 GLN 116 115 115 GLN GLN A . n 
A 1 117 VAL 117 116 116 VAL VAL A . n 
A 1 118 GLU 118 117 117 GLU GLU A . n 
A 1 119 PHE 119 118 118 PHE PHE A . n 
A 1 120 LYS 120 119 119 LYS LYS A . n 
A 1 121 ALA 121 120 120 ALA ALA A . n 
A 1 122 TYR 122 121 121 TYR TYR A . n 
A 1 123 PHE 123 122 122 PHE PHE A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 THR 125 124 124 THR THR A . n 
A 1 126 PRO 126 125 125 PRO PRO A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 GLY 128 127 127 GLY GLY A . n 
A 1 129 LEU 129 128 128 LEU LEU A . n 
A 1 130 GLN 130 129 129 GLN GLN A . n 
A 1 131 ALA 131 130 130 ALA ALA A . n 
A 1 132 HIS 132 131 131 HIS HIS A . n 
A 1 133 HIS 133 132 132 HIS HIS A . n 
A 1 134 GLU 134 133 133 GLU GLU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 SER 136 135 135 SER SER A . n 
A 1 137 THR 137 136 136 THR THR A . n 
A 1 138 PHE 138 137 137 PHE PHE A . n 
A 1 139 VAL 139 138 138 VAL VAL A . n 
A 1 140 LYS 140 139 139 LYS LYS A . n 
A 1 141 ILE 141 140 140 ILE ILE A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 ASN 143 142 142 ASN ASN A . n 
A 1 144 LYS 144 143 143 LYS LYS A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ASN 146 145 145 ASN ASN A . n 
A 1 147 SER 147 146 146 SER SER A . n 
A 1 148 ASP 148 147 147 ASP ASP A . n 
A 1 149 ALA 149 148 148 ALA ALA A . n 
A 1 150 SER 150 149 149 SER SER A . n 
A 1 151 TRP 151 150 150 TRP TRP A . n 
A 1 152 TYR 152 151 151 TYR TYR A . n 
A 1 153 PHE 153 152 152 PHE PHE A . n 
A 1 154 LEU 154 153 153 LEU LEU A . n 
A 1 155 ASP 155 154 154 ASP ASP A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 THR 157 156 156 THR THR A . n 
A 1 158 VAL 158 157 157 VAL VAL A . n 
A 1 159 SER 159 158 158 SER SER A . n 
A 1 160 MSE 160 159 159 MSE MSE A . n 
A 1 161 SER 161 160 160 SER SER A . n 
A 1 162 VAL 162 161 161 VAL VAL A . n 
A 1 163 THR 163 162 162 THR THR A . n 
A 1 164 GLN 164 163 163 GLN GLN A . n 
A 1 165 LYS 165 164 164 LYS LYS A . n 
A 1 166 GLN 166 165 165 GLN GLN A . n 
A 1 167 PRO 167 166 166 PRO PRO A . n 
A 1 168 CYS 168 167 167 CYS CYS A . n 
A 1 169 ILE 169 168 168 ILE ILE A . n 
A 1 170 CYS 170 169 169 CYS CYS A . n 
A 1 171 GLY 171 170 170 GLY GLY A . n 
A 1 172 SER 172 171 171 SER SER A . n 
A 1 173 GLY 173 172 172 GLY GLY A . n 
A 1 174 GLU 174 173 173 GLU GLU A . n 
A 1 175 LYS 175 174 174 LYS LYS A . n 
A 1 176 PHE 176 175 175 PHE PHE A . n 
A 1 177 LYS 177 176 176 LYS LYS A . n 
A 1 178 ARG 178 177 177 ARG ARG A . n 
A 1 179 CYS 179 178 178 CYS CYS A . n 
A 1 180 CYS 180 179 179 CYS CYS A . n 
A 1 181 GLY 181 180 180 GLY GLY A . n 
A 1 182 MSE 182 181 181 MSE MSE A . n 
A 1 183 TYR 183 182 182 TYR TYR A . n 
A 1 184 ILE 184 183 183 ILE ILE A . n 
# 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Joint Center for Structural Genomics' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     JCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   200 200 ZN  ZN  A . 
C 2 ZN  1   201 201 ZN  ZN  A . 
D 3 CL  1   202 1   CL  CL  A . 
E 4 HOH 1   203 2   HOH HOH A . 
E 4 HOH 2   204 3   HOH HOH A . 
E 4 HOH 3   205 4   HOH HOH A . 
E 4 HOH 4   206 5   HOH HOH A . 
E 4 HOH 5   207 6   HOH HOH A . 
E 4 HOH 6   208 7   HOH HOH A . 
E 4 HOH 7   209 8   HOH HOH A . 
E 4 HOH 8   210 9   HOH HOH A . 
E 4 HOH 9   211 10  HOH HOH A . 
E 4 HOH 10  212 11  HOH HOH A . 
E 4 HOH 11  213 12  HOH HOH A . 
E 4 HOH 12  214 13  HOH HOH A . 
E 4 HOH 13  215 14  HOH HOH A . 
E 4 HOH 14  216 15  HOH HOH A . 
E 4 HOH 15  217 16  HOH HOH A . 
E 4 HOH 16  218 17  HOH HOH A . 
E 4 HOH 17  219 18  HOH HOH A . 
E 4 HOH 18  220 19  HOH HOH A . 
E 4 HOH 19  221 20  HOH HOH A . 
E 4 HOH 20  222 21  HOH HOH A . 
E 4 HOH 21  223 22  HOH HOH A . 
E 4 HOH 22  224 23  HOH HOH A . 
E 4 HOH 23  225 24  HOH HOH A . 
E 4 HOH 24  226 25  HOH HOH A . 
E 4 HOH 25  227 26  HOH HOH A . 
E 4 HOH 26  228 27  HOH HOH A . 
E 4 HOH 27  229 28  HOH HOH A . 
E 4 HOH 28  230 29  HOH HOH A . 
E 4 HOH 29  231 30  HOH HOH A . 
E 4 HOH 30  232 31  HOH HOH A . 
E 4 HOH 31  233 32  HOH HOH A . 
E 4 HOH 32  234 33  HOH HOH A . 
E 4 HOH 33  235 34  HOH HOH A . 
E 4 HOH 34  236 35  HOH HOH A . 
E 4 HOH 35  237 36  HOH HOH A . 
E 4 HOH 36  238 37  HOH HOH A . 
E 4 HOH 37  239 38  HOH HOH A . 
E 4 HOH 38  240 39  HOH HOH A . 
E 4 HOH 39  241 40  HOH HOH A . 
E 4 HOH 40  242 41  HOH HOH A . 
E 4 HOH 41  243 42  HOH HOH A . 
E 4 HOH 42  244 43  HOH HOH A . 
E 4 HOH 43  245 44  HOH HOH A . 
E 4 HOH 44  246 45  HOH HOH A . 
E 4 HOH 45  247 46  HOH HOH A . 
E 4 HOH 46  248 47  HOH HOH A . 
E 4 HOH 47  249 48  HOH HOH A . 
E 4 HOH 48  250 49  HOH HOH A . 
E 4 HOH 49  251 50  HOH HOH A . 
E 4 HOH 50  252 51  HOH HOH A . 
E 4 HOH 51  253 52  HOH HOH A . 
E 4 HOH 52  254 53  HOH HOH A . 
E 4 HOH 53  255 54  HOH HOH A . 
E 4 HOH 54  256 55  HOH HOH A . 
E 4 HOH 55  257 56  HOH HOH A . 
E 4 HOH 56  258 57  HOH HOH A . 
E 4 HOH 57  259 58  HOH HOH A . 
E 4 HOH 58  260 59  HOH HOH A . 
E 4 HOH 59  261 60  HOH HOH A . 
E 4 HOH 60  262 61  HOH HOH A . 
E 4 HOH 61  263 62  HOH HOH A . 
E 4 HOH 62  264 63  HOH HOH A . 
E 4 HOH 63  265 64  HOH HOH A . 
E 4 HOH 64  266 65  HOH HOH A . 
E 4 HOH 65  267 66  HOH HOH A . 
E 4 HOH 66  268 67  HOH HOH A . 
E 4 HOH 67  269 68  HOH HOH A . 
E 4 HOH 68  270 69  HOH HOH A . 
E 4 HOH 69  271 70  HOH HOH A . 
E 4 HOH 70  272 71  HOH HOH A . 
E 4 HOH 71  273 72  HOH HOH A . 
E 4 HOH 72  274 73  HOH HOH A . 
E 4 HOH 73  275 74  HOH HOH A . 
E 4 HOH 74  276 75  HOH HOH A . 
E 4 HOH 75  277 76  HOH HOH A . 
E 4 HOH 76  278 77  HOH HOH A . 
E 4 HOH 77  279 78  HOH HOH A . 
E 4 HOH 78  280 79  HOH HOH A . 
E 4 HOH 79  281 80  HOH HOH A . 
E 4 HOH 80  282 81  HOH HOH A . 
E 4 HOH 81  283 82  HOH HOH A . 
E 4 HOH 82  284 83  HOH HOH A . 
E 4 HOH 83  285 84  HOH HOH A . 
E 4 HOH 84  286 85  HOH HOH A . 
E 4 HOH 85  287 86  HOH HOH A . 
E 4 HOH 86  288 87  HOH HOH A . 
E 4 HOH 87  289 88  HOH HOH A . 
E 4 HOH 88  290 89  HOH HOH A . 
E 4 HOH 89  291 90  HOH HOH A . 
E 4 HOH 90  292 91  HOH HOH A . 
E 4 HOH 91  293 92  HOH HOH A . 
E 4 HOH 92  294 93  HOH HOH A . 
E 4 HOH 93  295 94  HOH HOH A . 
E 4 HOH 94  296 95  HOH HOH A . 
E 4 HOH 95  297 96  HOH HOH A . 
E 4 HOH 96  298 97  HOH HOH A . 
E 4 HOH 97  299 98  HOH HOH A . 
E 4 HOH 98  300 99  HOH HOH A . 
E 4 HOH 99  301 100 HOH HOH A . 
E 4 HOH 100 302 101 HOH HOH A . 
E 4 HOH 101 303 102 HOH HOH A . 
E 4 HOH 102 304 103 HOH HOH A . 
E 4 HOH 103 305 104 HOH HOH A . 
E 4 HOH 104 306 105 HOH HOH A . 
E 4 HOH 105 307 106 HOH HOH A . 
E 4 HOH 106 308 107 HOH HOH A . 
E 4 HOH 107 309 108 HOH HOH A . 
E 4 HOH 108 310 109 HOH HOH A . 
E 4 HOH 109 311 110 HOH HOH A . 
E 4 HOH 110 312 111 HOH HOH A . 
E 4 HOH 111 313 112 HOH HOH A . 
E 4 HOH 112 314 113 HOH HOH A . 
E 4 HOH 113 315 114 HOH HOH A . 
E 4 HOH 114 316 115 HOH HOH A . 
E 4 HOH 115 317 116 HOH HOH A . 
E 4 HOH 116 318 117 HOH HOH A . 
E 4 HOH 117 319 118 HOH HOH A . 
E 4 HOH 118 320 119 HOH HOH A . 
E 4 HOH 119 321 120 HOH HOH A . 
E 4 HOH 120 322 121 HOH HOH A . 
E 4 HOH 121 323 122 HOH HOH A . 
E 4 HOH 122 324 123 HOH HOH A . 
E 4 HOH 123 325 124 HOH HOH A . 
E 4 HOH 124 326 125 HOH HOH A . 
E 4 HOH 125 327 126 HOH HOH A . 
E 4 HOH 126 328 127 HOH HOH A . 
E 4 HOH 127 329 128 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 2   A MSE 1   ? MET SELENOMETHIONINE 
2 A MSE 57  A MSE 56  ? MET SELENOMETHIONINE 
3 A MSE 160 A MSE 159 ? MET SELENOMETHIONINE 
4 A MSE 182 A MSE 181 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 9   ? A CYS 8   ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 11  ? A CYS 10  ? 1_555 122.1 ? 
2  SG ? A CYS 9   ? A CYS 8   ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 30  ? A CYS 29  ? 1_555 99.6  ? 
3  SG ? A CYS 11  ? A CYS 10  ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 30  ? A CYS 29  ? 1_555 107.3 ? 
4  SG ? A CYS 9   ? A CYS 8   ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 29  ? A CYS 28  ? 1_555 110.6 ? 
5  SG ? A CYS 11  ? A CYS 10  ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 29  ? A CYS 28  ? 1_555 98.1  ? 
6  SG ? A CYS 30  ? A CYS 29  ? 1_555 ZN ? B ZN . ? A ZN 200 ? 1_555 SG ? A CYS 29  ? A CYS 28  ? 1_555 120.7 ? 
7  SG ? A CYS 179 ? A CYS 178 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 168 ? A CYS 167 ? 1_555 105.6 ? 
8  SG ? A CYS 179 ? A CYS 178 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 180 ? A CYS 179 ? 1_555 121.1 ? 
9  SG ? A CYS 168 ? A CYS 167 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 180 ? A CYS 179 ? 1_555 104.0 ? 
10 SG ? A CYS 179 ? A CYS 178 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 170 ? A CYS 169 ? 1_555 104.6 ? 
11 SG ? A CYS 168 ? A CYS 167 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 170 ? A CYS 169 ? 1_555 111.8 ? 
12 SG ? A CYS 180 ? A CYS 179 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 SG ? A CYS 170 ? A CYS 169 ? 1_555 109.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance'  
2 3 'Structure model' Advisory                     
3 3 'Structure model' 'Version format compliance'  
4 4 'Structure model' 'Refinement description'     
5 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software                           
2 5 'Structure model' pdbx_struct_assembly_auth_evidence 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 11.8959 11.0248 22.1427 -0.0468 -0.0294 -0.0195 -0.0608 -0.0285 0.0255 0.7903 3.2400 3.0368  -0.3320 -0.2126 0.3876  
0.1472  -0.0837 -0.0635 0.0039 -0.1117 -0.2089 0.1111  0.2460  -0.1805 'X-RAY DIFFRACTION' 
2 ? refined 14.6595 23.6128 16.2532 -0.1175 -0.0676 -0.0286 -0.0064 -0.0072 0.0207 1.1208 2.2314 3.1129  -0.2910 0.5634  -0.3807 
0.0897  -0.0886 -0.0012 0.0164 0.0223  -0.2232 -0.0065 -0.0951 0.0708  'X-RAY DIFFRACTION' 
3 ? refined 11.5322 28.4246 17.2520 -0.1549 -0.0413 -0.0551 0.0155  0.0079  0.0135 2.3253 3.3019 13.6996 0.6989  4.4883  -0.2022 
0.0529  0.0097  -0.0626 0.1600 -0.0098 -0.1044 0.0529  -0.3371 0.3062  'X-RAY DIFFRACTION' 
4 ? refined 10.5745 35.1568 3.5860  0.0722  -0.0821 -0.0789 0.0175  -0.0015 0.0152 1.5283 1.6295 4.8341  -0.3660 -0.0553 -1.6871 
-0.0293 -0.0305 0.0598  0.0605 0.0431  -0.0006 -0.0723 -0.6592 0.0035  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2   A 40  ALL A 1   A 39  'X-RAY DIFFRACTION' ? 
2 2 A 47  A 124 ALL A 46  A 123 'X-RAY DIFFRACTION' ? 
3 3 A 128 A 144 ALL A 127 A 143 'X-RAY DIFFRACTION' ? 
4 4 A 146 A 184 ALL A 145 A 183 'X-RAY DIFFRACTION' ? 
# 
_phasing.method   MAD 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
MolProbity  3beta29  ?                package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building'  
http://kinemage.biochem.duke.edu/molprobity/                       ?          ? 1 
SHELX       .        ?                package 'George Sheldrick'           gsheldr@shelx.uni-ac.gwdg.de         phasing           
http://shelx.uni-ac.gwdg.de/SHELX/                                 Fortran_77 ? 2 
REFMAC      5.2.0019 ?                program 'Murshudov, G.N.'            ccp4@dl.ac.uk                        refinement        
http://www.ccp4.ac.uk/main.html                                    Fortran_77 ? 3 
XSCALE      .        ?                package 'Wolfgang Kabsch'            ?                                    'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 4 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB                          sw-help@rcsb.rutgers.edu             'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 5 
XDS         .        ?                ?       ?                            ?                                    'data reduction'  
?                                                                  ?          ? 6 
SHELXD      .        ?                ?       ?                            ?                                    phasing           
?                                                                  ?          ? 7 
SHARP       .        ?                ?       ?                            ?                                    phasing           
?                                                                  ?          ? 8 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;
BIOMOLECULE: 1
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR
INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S).
SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT
OF A MONOMER AS A BIOLOGICALLY SIGNIFICANT
OLIGOMERIZATION STATE.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.08 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.78 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 28  ? ? -130.85 -94.35  
2 1 VAL A 66  ? ? 64.83   63.65   
3 1 LYS A 67  ? ? -119.75 71.83   
4 1 LEU A 76  ? ? -36.72  122.93  
5 1 LYS A 143 ? ? -97.55  44.90   
6 1 ALA A 144 ? ? -148.57 -31.22  
7 1 CYS A 178 ? ? -141.43 -116.63 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 39  ? CD  ? A GLN 40  CD  
2  1 Y 1 A GLN 39  ? OE1 ? A GLN 40  OE1 
3  1 Y 1 A GLN 39  ? NE2 ? A GLN 40  NE2 
4  1 Y 1 A ARG 48  ? NE  ? A ARG 49  NE  
5  1 Y 1 A ARG 48  ? CZ  ? A ARG 49  CZ  
6  1 Y 1 A ARG 48  ? NH1 ? A ARG 49  NH1 
7  1 Y 1 A ARG 48  ? NH2 ? A ARG 49  NH2 
8  1 Y 1 A ASP 50  ? OD1 ? A ASP 51  OD1 
9  1 Y 1 A ASP 50  ? OD2 ? A ASP 51  OD2 
10 1 Y 1 A LYS 73  ? CE  ? A LYS 74  CE  
11 1 Y 1 A LYS 73  ? NZ  ? A LYS 74  NZ  
12 1 Y 1 A LYS 86  ? NZ  ? A LYS 87  NZ  
13 1 Y 1 A LYS 93  ? CE  ? A LYS 94  CE  
14 1 Y 1 A LYS 93  ? NZ  ? A LYS 94  NZ  
15 1 Y 1 A LYS 108 ? CE  ? A LYS 109 CE  
16 1 Y 1 A LYS 108 ? NZ  ? A LYS 109 NZ  
17 1 Y 1 A LYS 111 ? CD  ? A LYS 112 CD  
18 1 Y 1 A LYS 111 ? CE  ? A LYS 112 CE  
19 1 Y 1 A LYS 111 ? NZ  ? A LYS 112 NZ  
20 1 Y 1 A LYS 123 ? CD  ? A LYS 124 CD  
21 1 Y 1 A LYS 123 ? CE  ? A LYS 124 CE  
22 1 Y 1 A LYS 123 ? NZ  ? A LYS 124 NZ  
23 1 Y 1 A LYS 139 ? NZ  ? A LYS 140 NZ  
24 1 Y 1 A LYS 141 ? CD  ? A LYS 142 CD  
25 1 Y 1 A LYS 141 ? CE  ? A LYS 142 CE  
26 1 Y 1 A LYS 141 ? NZ  ? A LYS 142 NZ  
27 1 Y 1 A ASN 142 ? CG  ? A ASN 143 CG  
28 1 Y 1 A ASN 142 ? OD1 ? A ASN 143 OD1 
29 1 Y 1 A ASN 142 ? ND2 ? A ASN 143 ND2 
30 1 Y 1 A LYS 143 ? CG  ? A LYS 144 CG  
31 1 Y 1 A LYS 143 ? CD  ? A LYS 144 CD  
32 1 Y 1 A LYS 143 ? CE  ? A LYS 144 CE  
33 1 Y 1 A LYS 143 ? NZ  ? A LYS 144 NZ  
34 1 Y 1 A ASN 145 ? CG  ? A ASN 146 CG  
35 1 Y 1 A ASN 145 ? OD1 ? A ASN 146 OD1 
36 1 Y 1 A ASN 145 ? ND2 ? A ASN 146 ND2 
37 1 Y 1 A ASP 147 ? OD1 ? A ASP 148 OD1 
38 1 Y 1 A ASP 147 ? OD2 ? A ASP 148 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 0  ? A GLY 1  
2 1 Y 1 A GLU 40 ? A GLU 41 
3 1 Y 1 A VAL 41 ? A VAL 42 
4 1 Y 1 A GLU 42 ? A GLU 43 
5 1 Y 1 A ASP 43 ? A ASP 44 
6 1 Y 1 A SER 44 ? A SER 45 
7 1 Y 1 A ASP 45 ? A ASP 46 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 'CHLORIDE ION' CL  
4 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#