data_2IAD
# 
_entry.id   2IAD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IAD         
WWPDB D_1000178238 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IAD 
_pdbx_database_status.recvd_initial_deposition_date   1998-03-13 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scott, C.A.'    1 
'Peterson, P.A.' 2 
'Teyton, L.'     3 
'Wilson, I.A.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Crystal structures of two I-Ad-peptide complexes reveal that high affinity can be achieved without large anchor residues.' 
Immunity       8   319  329 1998 IUNIEH US 1074-7613 2048 ? 9529149 '10.1016/S1074-7613(00)80537-3' 
1       'Engineering Protein for X-Ray Crystallography: The Murine Major Histocompatibility Complex Class II Molecule I-Ad' 
'Protein Sci.' 7   413  ?   1998 PRCIEI US 0961-8368 0795 ? ?       ?                               
2       'Role of Chain Pairing for the Production of Functional Soluble Ia Major Histocompatibility Complex Class II Molecules' 
J.Exp.Med.     183 2087 ?   1996 JEMEAV US 0022-1007 0774 ? ?       ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scott, C.A.'    1  
primary 'Peterson, P.A.' 2  
primary 'Teyton, L.'     3  
primary 'Wilson, I.A.'   4  
1       'Scott, C.A.'    5  
1       'Garcia, K.C.'   6  
1       'Stura, E.A.'    7  
1       'Peterson, P.A.' 8  
1       'Wilson, I.A.'   9  
1       'Teyton, L.'     10 
2       'Scott, C.A.'    11 
2       'Garcia, K.C.'   12 
2       'Carbone, F.R.'  13 
2       'Wilson, I.A.'   14 
2       'Teyton, L.'     15 
# 
_cell.entry_id           2IAD 
_cell.length_a           127.200 
_cell.length_b           100.200 
_cell.length_c           53.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2IAD 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'MHC CLASS II I-AD' 22091.631 1   ? ? 
'RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LINKED INFLUENZA HEMAGGLUTININ PEPTIDE' ? 
2 polymer man 'MHC CLASS II I-AD' 23617.074 1   ? ? 
'RESIDUES 126P - 138P OF CHAIN B ARE COVALENTLY LINKED INFLUENZA HEMAGGLUTININ PEPTIDE' ? 
3 water   nat water               18.015    114 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWEPEISSADLVPR
;
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWEPEISSADLVPR
;
A ? 
2 'polypeptide(L)' no no 
;GHATQGVTAASSHEGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTELGRPDAEYWNSQPE
ILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSST
QLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
;
;GHATQGVTAASSHEGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTELGRPDAEYWNSQPE
ILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSST
QLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   GLU n 
1 6   ALA n 
1 7   ASP n 
1 8   HIS n 
1 9   VAL n 
1 10  GLY n 
1 11  PHE n 
1 12  TYR n 
1 13  GLY n 
1 14  THR n 
1 15  THR n 
1 16  VAL n 
1 17  TYR n 
1 18  GLN n 
1 19  SER n 
1 20  PRO n 
1 21  GLY n 
1 22  ASP n 
1 23  ILE n 
1 24  GLY n 
1 25  GLN n 
1 26  TYR n 
1 27  THR n 
1 28  HIS n 
1 29  GLU n 
1 30  PHE n 
1 31  ASP n 
1 32  GLY n 
1 33  ASP n 
1 34  GLU n 
1 35  LEU n 
1 36  PHE n 
1 37  TYR n 
1 38  VAL n 
1 39  ASP n 
1 40  LEU n 
1 41  ASP n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  THR n 
1 46  VAL n 
1 47  TRP n 
1 48  ARG n 
1 49  LEU n 
1 50  PRO n 
1 51  GLU n 
1 52  PHE n 
1 53  GLY n 
1 54  GLN n 
1 55  LEU n 
1 56  ILE n 
1 57  LEU n 
1 58  PHE n 
1 59  GLU n 
1 60  PRO n 
1 61  GLN n 
1 62  GLY n 
1 63  GLY n 
1 64  LEU n 
1 65  GLN n 
1 66  ASN n 
1 67  ILE n 
1 68  ALA n 
1 69  ALA n 
1 70  GLU n 
1 71  LYS n 
1 72  HIS n 
1 73  ASN n 
1 74  LEU n 
1 75  GLY n 
1 76  ILE n 
1 77  LEU n 
1 78  THR n 
1 79  LYS n 
1 80  ARG n 
1 81  SER n 
1 82  ASN n 
1 83  PHE n 
1 84  THR n 
1 85  PRO n 
1 86  ALA n 
1 87  THR n 
1 88  ASN n 
1 89  GLU n 
1 90  ALA n 
1 91  PRO n 
1 92  GLN n 
1 93  ALA n 
1 94  THR n 
1 95  VAL n 
1 96  PHE n 
1 97  PRO n 
1 98  LYS n 
1 99  SER n 
1 100 PRO n 
1 101 VAL n 
1 102 LEU n 
1 103 LEU n 
1 104 GLY n 
1 105 GLN n 
1 106 PRO n 
1 107 ASN n 
1 108 THR n 
1 109 LEU n 
1 110 ILE n 
1 111 CYS n 
1 112 PHE n 
1 113 VAL n 
1 114 ASP n 
1 115 ASN n 
1 116 ILE n 
1 117 PHE n 
1 118 PRO n 
1 119 PRO n 
1 120 VAL n 
1 121 ILE n 
1 122 ASN n 
1 123 ILE n 
1 124 THR n 
1 125 TRP n 
1 126 LEU n 
1 127 ARG n 
1 128 ASN n 
1 129 SER n 
1 130 LYS n 
1 131 SER n 
1 132 VAL n 
1 133 THR n 
1 134 ASP n 
1 135 GLY n 
1 136 VAL n 
1 137 TYR n 
1 138 GLU n 
1 139 THR n 
1 140 SER n 
1 141 PHE n 
1 142 LEU n 
1 143 VAL n 
1 144 ASN n 
1 145 ARG n 
1 146 ASP n 
1 147 HIS n 
1 148 SER n 
1 149 PHE n 
1 150 HIS n 
1 151 LYS n 
1 152 LEU n 
1 153 SER n 
1 154 TYR n 
1 155 LEU n 
1 156 THR n 
1 157 PHE n 
1 158 ILE n 
1 159 PRO n 
1 160 SER n 
1 161 ASP n 
1 162 ASP n 
1 163 ASP n 
1 164 ILE n 
1 165 TYR n 
1 166 ASP n 
1 167 CYS n 
1 168 LYS n 
1 169 VAL n 
1 170 GLU n 
1 171 HIS n 
1 172 TRP n 
1 173 GLY n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 PRO n 
1 178 VAL n 
1 179 LEU n 
1 180 LYS n 
1 181 HIS n 
1 182 TRP n 
1 183 GLU n 
1 184 PRO n 
1 185 GLU n 
1 186 ILE n 
1 187 SER n 
1 188 SER n 
1 189 ALA n 
1 190 ASP n 
1 191 LEU n 
1 192 VAL n 
1 193 PRO n 
1 194 ARG n 
2 1   GLY n 
2 2   HIS n 
2 3   ALA n 
2 4   THR n 
2 5   GLN n 
2 6   GLY n 
2 7   VAL n 
2 8   THR n 
2 9   ALA n 
2 10  ALA n 
2 11  SER n 
2 12  SER n 
2 13  HIS n 
2 14  GLU n 
2 15  GLY n 
2 16  ASN n 
2 17  SER n 
2 18  GLU n 
2 19  ARG n 
2 20  HIS n 
2 21  PHE n 
2 22  VAL n 
2 23  VAL n 
2 24  GLN n 
2 25  PHE n 
2 26  LYS n 
2 27  GLY n 
2 28  GLU n 
2 29  CYS n 
2 30  TYR n 
2 31  TYR n 
2 32  THR n 
2 33  ASN n 
2 34  GLY n 
2 35  THR n 
2 36  GLN n 
2 37  ARG n 
2 38  ILE n 
2 39  ARG n 
2 40  LEU n 
2 41  VAL n 
2 42  THR n 
2 43  ARG n 
2 44  TYR n 
2 45  ILE n 
2 46  TYR n 
2 47  ASN n 
2 48  ARG n 
2 49  GLU n 
2 50  GLU n 
2 51  TYR n 
2 52  VAL n 
2 53  ARG n 
2 54  TYR n 
2 55  ASP n 
2 56  SER n 
2 57  ASP n 
2 58  VAL n 
2 59  GLY n 
2 60  GLU n 
2 61  TYR n 
2 62  ARG n 
2 63  ALA n 
2 64  VAL n 
2 65  THR n 
2 66  GLU n 
2 67  LEU n 
2 68  GLY n 
2 69  ARG n 
2 70  PRO n 
2 71  ASP n 
2 72  ALA n 
2 73  GLU n 
2 74  TYR n 
2 75  TRP n 
2 76  ASN n 
2 77  SER n 
2 78  GLN n 
2 79  PRO n 
2 80  GLU n 
2 81  ILE n 
2 82  LEU n 
2 83  GLU n 
2 84  ARG n 
2 85  THR n 
2 86  ARG n 
2 87  ALA n 
2 88  GLU n 
2 89  VAL n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  CYS n 
2 94  ARG n 
2 95  HIS n 
2 96  ASN n 
2 97  TYR n 
2 98  GLU n 
2 99  GLY n 
2 100 PRO n 
2 101 GLU n 
2 102 THR n 
2 103 SER n 
2 104 THR n 
2 105 SER n 
2 106 LEU n 
2 107 ARG n 
2 108 ARG n 
2 109 LEU n 
2 110 GLU n 
2 111 GLN n 
2 112 PRO n 
2 113 ASN n 
2 114 VAL n 
2 115 ALA n 
2 116 ILE n 
2 117 SER n 
2 118 LEU n 
2 119 SER n 
2 120 ARG n 
2 121 THR n 
2 122 GLU n 
2 123 ALA n 
2 124 LEU n 
2 125 ASN n 
2 126 HIS n 
2 127 HIS n 
2 128 ASN n 
2 129 THR n 
2 130 LEU n 
2 131 VAL n 
2 132 CYS n 
2 133 SER n 
2 134 VAL n 
2 135 THR n 
2 136 ASP n 
2 137 PHE n 
2 138 TYR n 
2 139 PRO n 
2 140 ALA n 
2 141 LYS n 
2 142 ILE n 
2 143 LYS n 
2 144 VAL n 
2 145 ARG n 
2 146 TRP n 
2 147 PHE n 
2 148 ARG n 
2 149 ASN n 
2 150 GLY n 
2 151 GLN n 
2 152 GLU n 
2 153 GLU n 
2 154 THR n 
2 155 VAL n 
2 156 GLY n 
2 157 VAL n 
2 158 SER n 
2 159 SER n 
2 160 THR n 
2 161 GLN n 
2 162 LEU n 
2 163 ILE n 
2 164 ARG n 
2 165 ASN n 
2 166 GLY n 
2 167 ASP n 
2 168 TRP n 
2 169 THR n 
2 170 PHE n 
2 171 GLN n 
2 172 VAL n 
2 173 LEU n 
2 174 VAL n 
2 175 MET n 
2 176 LEU n 
2 177 GLU n 
2 178 MET n 
2 179 THR n 
2 180 PRO n 
2 181 HIS n 
2 182 GLN n 
2 183 GLY n 
2 184 GLU n 
2 185 VAL n 
2 186 TYR n 
2 187 THR n 
2 188 CYS n 
2 189 HIS n 
2 190 VAL n 
2 191 GLU n 
2 192 HIS n 
2 193 PRO n 
2 194 SER n 
2 195 LEU n 
2 196 LYS n 
2 197 SER n 
2 198 PRO n 
2 199 ILE n 
2 200 THR n 
2 201 VAL n 
2 202 GLU n 
2 203 TRP n 
2 204 SER n 
2 205 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? BALB-C ? ? ? 'RESIDUES 126P - 138P OF CHAIN B' 'Mus musculus' 10090 ? S2 ? TAIL ? ? ? 
'fruit fly' 'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? S2 ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? BALB/C ? ? ? 'RESIDUES 126P - 138P OF CHAIN B' 'Mus musculus' 10090 ? S2 ? TAIL ? ? ? 
'fruit fly' 'Drosophila melanogaster' 7227 Drosophila ? ? ? ? ? ? ? S2 ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP HA2D_MOUSE 1 P04228 1 
;MPCSRALILGVLALNTMLSLCGGEDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLIL
FEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVY
ETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFI
IQGLRSGGTSRHPGPL
;
? 
2 UNP HB2D_MOUSE 2 P01921 1 
;MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTEL
GRPDAEYWNSQPEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWF
RNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIF
LGLGLFIRHRSQKGPRGPPPAGLLQ
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IAD A 1  ? 182 ? P04228 24 ? 209 ? -2 178 
2 2 2IAD B 15 ? 203 ? P01921 28 ? 216 ? 1  188 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2IAD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.76 
_exptl_crystal.density_percent_sol   67 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '19% PEG 8000 0.2 M TRIS, PH 7.4' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-04 
_diffrn_detector.details                '58 CM LONG, PT-COATED, FUSED SILICA, VERTICAL FOCUS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'CYLINDRICALLY BENT TRIANGULAR SI(111) ASYMMETRIC CUT, HORIZONTAL FOCUS' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2IAD 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             24.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   22555 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89. 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   88. 
_reflns_shell.Rmerge_I_obs           0.259 
_reflns_shell.pdbx_Rsym_value        0.259 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2. 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IAD 
_refine.ls_number_reflns_obs                     22555 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               1000000. 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    89. 
_refine.ls_R_factor_obs                          0.253 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.253 
_refine.ls_R_factor_R_free                       0.308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  2241 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1DLH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3129 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             114 
_refine_hist.number_atoms_total               3243 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        24.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      29.7  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.51 
_refine_ls_shell.number_reflns_R_work             2540 
_refine_ls_shell.R_factor_R_work                  0.356 
_refine_ls_shell.percent_reflns_obs               88. 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             280 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2IAD 
_struct.title                     'CLASS II MHC I-AD IN COMPLEX WITH AN INFLUENZA HEMAGGLUTININ PEPTIDE 126-138' 
_struct.pdbx_descriptor           'MHC CLASS II I-AD' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IAD 
_struct_keywords.pdbx_keywords   'MHC II' 
_struct_keywords.text            'MHC II, CLASS II MHC I-AD' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 60  ? SER A 81  ? PRO A 56 SER A 77 1 ? 22 
HELX_P HELX_P2 2 GLU B 66  ? SER B 77  ? GLU B 52 SER B 63 5 ? 12 
HELX_P HELX_P3 3 PRO B 79  ? THR B 91  ? PRO B 65 THR B 77 1 ? 13 
HELX_P HELX_P4 4 CYS B 93  ? GLU B 98  ? CYS B 79 GLU B 84 1 ? 6  
HELX_P HELX_P5 5 PRO B 100 ? SER B 103 ? PRO B 86 SER B 89 1 ? 4  
HELX_P HELX_P6 6 SER B 105 ? ARG B 107 ? SER B 91 ARG B 93 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 107 A CYS 163 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? B CYS 29  SG ? ? ? 1_555 B CYS 93  SG ? ? B CYS 15  B CYS 79  1_555 ? ? ? ? ? ? ? 1.980 ? 
disulf3 disulf ? ? B CYS 132 SG ? ? ? 1_555 B CYS 188 SG ? ? B CYS 117 B CYS 173 1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 117 A . ? PHE 113 A PRO 118 A ? PRO 114 A 1 -0.03 
2 TYR 138 B . ? TYR 123 B PRO 139 B ? PRO 124 B 1 -1.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 4 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 10  ? TYR A 12  ? GLY A 6   TYR A 8   
A 2 THR A 27  ? PHE A 30  ? THR A 23  PHE A 26  
A 3 ASP A 33  ? ASP A 39  ? ASP A 29  ASP A 35  
A 4 LYS A 44  ? TRP A 47  ? LYS A 40  TRP A 43  
B 1 THR A 15  ? GLN A 18  ? THR A 11  GLN A 14  
B 2 ILE A 23  ? TYR A 26  ? ILE A 19  TYR A 22  
C 1 GLN A 92  ? PRO A 97  ? GLN A 88  PRO A 93  
C 2 PRO A 106 ? ASP A 114 ? PRO A 102 ASP A 110 
C 3 LYS A 151 ? ILE A 158 ? LYS A 147 ILE A 154 
C 4 VAL A 136 ? GLU A 138 ? VAL A 132 GLU A 134 
D 1 ASN A 122 ? ARG A 127 ? ASN A 118 ARG A 123 
D 2 ILE A 164 ? GLU A 170 ? ILE A 160 GLU A 166 
D 3 VAL A 178 ? SER A 187 ? VAL A 174 SER A 179 
E 1 VAL B 23  ? THR B 32  ? VAL B 9   THR B 18  
E 2 ARG B 37  ? TYR B 46  ? ARG B 23  TYR B 32  
E 3 GLU B 49  ? ASP B 55  ? GLU B 35  ASP B 41  
E 4 TYR B 61  ? ALA B 63  ? TYR B 47  ALA B 49  
F 1 ASN B 113 ? LEU B 118 ? ASN B 98  LEU B 103 
F 2 LEU B 130 ? PHE B 137 ? LEU B 115 PHE B 122 
F 3 PHE B 170 ? LEU B 176 ? PHE B 155 LEU B 161 
F 4 VAL B 157 ? SER B 159 ? VAL B 142 SER B 144 
G 1 TYR B 186 ? GLU B 191 ? TYR B 171 GLU B 176 
G 2 LYS B 143 ? ARG B 148 ? LYS B 128 ARG B 133 
G 3 GLN B 151 ? GLU B 153 ? GLN B 136 GLU B 138 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 11  ? O PHE A 7   N GLU A 29  ? N GLU A 25  
A 2 3 O HIS A 28  ? O HIS A 24  N PHE A 36  ? N PHE A 32  
A 3 4 O TYR A 37  ? O TYR A 33  N VAL A 46  ? N VAL A 42  
B 1 2 O VAL A 16  ? O VAL A 12  N GLN A 25  ? N GLN A 21  
C 1 2 O GLN A 92  ? O GLN A 88  N ASP A 114 ? N ASP A 110 
C 2 3 O ASN A 107 ? O ASN A 103 N PHE A 157 ? N PHE A 153 
C 3 4 O TYR A 154 ? O TYR A 150 N TYR A 137 ? N TYR A 133 
D 1 2 O ASN A 122 ? O ASN A 118 N GLU A 170 ? N GLU A 166 
D 2 3 O TYR A 165 ? O TYR A 161 N TRP A 182 ? N TRP A 178 
E 1 2 O GLN B 24  ? O GLN B 10  N ILE B 45  ? N ILE B 31  
E 2 3 O THR B 42  ? O THR B 28  N TYR B 54  ? N TYR B 40  
E 3 4 O ARG B 53  ? O ARG B 39  N ARG B 62  ? N ARG B 48  
F 1 2 O ASN B 113 ? O ASN B 98  N THR B 135 ? N THR B 120 
F 2 3 O LEU B 130 ? O LEU B 115 N LEU B 176 ? N LEU B 161 
F 3 4 O MET B 175 ? O MET B 160 N SER B 158 ? N SER B 143 
G 1 2 O THR B 187 ? O THR B 172 N PHE B 147 ? N PHE B 132 
G 2 3 O TRP B 146 ? O TRP B 131 N GLU B 153 ? N GLU B 138 
# 
_database_PDB_matrix.entry_id          2IAD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IAD 
_atom_sites.fract_transf_matrix[1][1]   0.007862 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001429 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009980 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019141 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 4   A 24.327 -14.147 11.744  1.00 34.49  ? 1    ILE A N   1 
ATOM   2    C CA  . ILE A 1 4   A 23.031 -14.793 12.087  1.00 35.31  ? 1    ILE A CA  1 
ATOM   3    C C   . ILE A 1 4   A 21.848 -13.840 11.991  1.00 37.73  ? 1    ILE A C   1 
ATOM   4    O O   . ILE A 1 4   A 21.998 -12.658 11.682  1.00 38.42  ? 1    ILE A O   1 
ATOM   5    C CB  . ILE A 1 4   A 23.053 -15.327 13.503  1.00 40.78  ? 1    ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 4   A 23.087 -14.148 14.481  1.00 40.32  ? 1    ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 4   A 24.254 -16.235 13.684  1.00 50.19  ? 1    ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 4   A 23.169 -14.540 15.922  1.00 44.99  ? 1    ILE A CD1 1 
ATOM   9    N N   . GLU A 1 5   B 20.663 -14.373 12.270  1.00 40.81  ? 1    GLU A N   1 
ATOM   10   C CA  . GLU A 1 5   B 19.442 -13.589 12.223  1.00 40.66  ? 1    GLU A CA  1 
ATOM   11   C C   . GLU A 1 5   B 19.449 -12.607 13.383  1.00 41.24  ? 1    GLU A C   1 
ATOM   12   O O   . GLU A 1 5   B 19.521 -12.998 14.547  1.00 42.81  ? 1    GLU A O   1 
ATOM   13   C CB  . GLU A 1 5   B 18.219 -14.497 12.333  1.00 43.07  ? 1    GLU A CB  1 
ATOM   14   C CG  . GLU A 1 5   B 16.905 -13.753 12.557  1.00 48.45  ? 1    GLU A CG  1 
ATOM   15   C CD  . GLU A 1 5   B 15.958 -14.509 13.477  1.00 46.85  ? 1    GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 5   B 16.202 -15.714 13.697  1.00 51.97  ? 1    GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 5   B 14.979 -13.906 13.977  1.00 41.92  ? 1    GLU A OE2 1 
ATOM   18   N N   . ALA A 1 6   ? 19.379 -11.323 13.076  1.00 37.03  ? 2    ALA A N   1 
ATOM   19   C CA  . ALA A 1 6   ? 19.388 -10.339 14.140  1.00 32.62  ? 2    ALA A CA  1 
ATOM   20   C C   . ALA A 1 6   ? 18.669 -9.102  13.655  1.00 31.82  ? 2    ALA A C   1 
ATOM   21   O O   . ALA A 1 6   ? 18.640 -8.842  12.457  1.00 30.92  ? 2    ALA A O   1 
ATOM   22   C CB  . ALA A 1 6   ? 20.809 -10.003 14.510  1.00 31.09  ? 2    ALA A CB  1 
ATOM   23   N N   . ASP A 1 7   ? 18.086 -8.361  14.586  1.00 32.63  ? 3    ASP A N   1 
ATOM   24   C CA  . ASP A 1 7   ? 17.383 -7.144  14.229  1.00 31.10  ? 3    ASP A CA  1 
ATOM   25   C C   . ASP A 1 7   ? 18.382 -6.012  14.254  1.00 26.06  ? 3    ASP A C   1 
ATOM   26   O O   . ASP A 1 7   ? 18.228 -5.001  13.548  1.00 25.32  ? 3    ASP A O   1 
ATOM   27   C CB  . ASP A 1 7   ? 16.220 -6.883  15.194  1.00 32.70  ? 3    ASP A CB  1 
ATOM   28   C CG  . ASP A 1 7   ? 15.073 -7.853  14.988  1.00 35.60  ? 3    ASP A CG  1 
ATOM   29   O OD1 . ASP A 1 7   ? 14.884 -8.375  13.863  1.00 37.20  ? 3    ASP A OD1 1 
ATOM   30   O OD2 . ASP A 1 7   ? 14.363 -8.095  15.976  1.00 40.07  ? 3    ASP A OD2 1 
ATOM   31   N N   . HIS A 1 8   ? 19.425 -6.177  15.062  1.00 22.52  ? 4    HIS A N   1 
ATOM   32   C CA  . HIS A 1 8   ? 20.463 -5.169  15.141  1.00 20.61  ? 4    HIS A CA  1 
ATOM   33   C C   . HIS A 1 8   ? 21.740 -5.860  15.510  1.00 20.72  ? 4    HIS A C   1 
ATOM   34   O O   . HIS A 1 8   ? 21.706 -6.928  16.142  1.00 18.38  ? 4    HIS A O   1 
ATOM   35   C CB  . HIS A 1 8   ? 20.136 -4.169  16.222  1.00 19.28  ? 4    HIS A CB  1 
ATOM   36   C CG  . HIS A 1 8   ? 18.875 -3.432  15.963  1.00 14.73  ? 4    HIS A CG  1 
ATOM   37   N ND1 . HIS A 1 8   ? 18.832 -2.330  15.142  1.00 20.67  ? 4    HIS A ND1 1 
ATOM   38   C CD2 . HIS A 1 8   ? 17.600 -3.679  16.337  1.00 17.75  ? 4    HIS A CD2 1 
ATOM   39   C CE1 . HIS A 1 8   ? 17.583 -1.921  15.028  1.00 16.49  ? 4    HIS A CE1 1 
ATOM   40   N NE2 . HIS A 1 8   ? 16.814 -2.723  15.741  1.00 20.89  ? 4    HIS A NE2 1 
ATOM   41   N N   . VAL A 1 9   ? 22.861 -5.252  15.151  1.00 20.48  ? 5    VAL A N   1 
ATOM   42   C CA  . VAL A 1 9   ? 24.145 -5.851  15.504  1.00 22.03  ? 5    VAL A CA  1 
ATOM   43   C C   . VAL A 1 9   ? 25.087 -4.720  15.820  1.00 19.91  ? 5    VAL A C   1 
ATOM   44   O O   . VAL A 1 9   ? 25.216 -3.774  15.035  1.00 19.16  ? 5    VAL A O   1 
ATOM   45   C CB  . VAL A 1 9   ? 24.734 -6.662  14.327  1.00 25.52  ? 5    VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 9   ? 24.534 -5.873  13.037  1.00 29.04  ? 5    VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 9   ? 26.188 -6.959  14.559  1.00 22.59  ? 5    VAL A CG2 1 
ATOM   48   N N   . GLY A 1 10  ? 25.731 -4.812  16.977  1.00 18.08  ? 6    GLY A N   1 
ATOM   49   C CA  . GLY A 1 10  ? 26.683 -3.798  17.379  1.00 19.49  ? 6    GLY A CA  1 
ATOM   50   C C   . GLY A 1 10  ? 28.065 -4.414  17.365  1.00 21.31  ? 6    GLY A C   1 
ATOM   51   O O   . GLY A 1 10  ? 28.246 -5.533  17.850  1.00 21.61  ? 6    GLY A O   1 
ATOM   52   N N   . PHE A 1 11  ? 29.032 -3.716  16.782  1.00 22.16  ? 7    PHE A N   1 
ATOM   53   C CA  . PHE A 1 11  ? 30.426 -4.198  16.763  1.00 27.03  ? 7    PHE A CA  1 
ATOM   54   C C   . PHE A 1 11  ? 31.111 -3.429  17.879  1.00 26.84  ? 7    PHE A C   1 
ATOM   55   O O   . PHE A 1 11  ? 31.537 -2.274  17.694  1.00 25.45  ? 7    PHE A O   1 
ATOM   56   C CB  . PHE A 1 11  ? 31.089 -3.909  15.407  1.00 20.38  ? 7    PHE A CB  1 
ATOM   57   C CG  . PHE A 1 11  ? 30.648 -4.844  14.311  1.00 22.97  ? 7    PHE A CG  1 
ATOM   58   C CD1 . PHE A 1 11  ? 30.106 -6.099  14.613  1.00 18.98  ? 7    PHE A CD1 1 
ATOM   59   C CD2 . PHE A 1 11  ? 30.754 -4.463  12.970  1.00 26.49  ? 7    PHE A CD2 1 
ATOM   60   C CE1 . PHE A 1 11  ? 29.676 -6.955  13.599  1.00 21.56  ? 7    PHE A CE1 1 
ATOM   61   C CE2 . PHE A 1 11  ? 30.327 -5.310  11.945  1.00 21.91  ? 7    PHE A CE2 1 
ATOM   62   C CZ  . PHE A 1 11  ? 29.786 -6.558  12.257  1.00 21.57  ? 7    PHE A CZ  1 
ATOM   63   N N   . TYR A 1 12  ? 31.222 -4.089  19.036  1.00 29.17  ? 8    TYR A N   1 
ATOM   64   C CA  . TYR A 1 12  ? 31.769 -3.468  20.245  1.00 28.86  ? 8    TYR A CA  1 
ATOM   65   C C   . TYR A 1 12  ? 33.117 -3.853  20.830  1.00 26.70  ? 8    TYR A C   1 
ATOM   66   O O   . TYR A 1 12  ? 33.202 -4.229  22.006  1.00 35.08  ? 8    TYR A O   1 
ATOM   67   C CB  . TYR A 1 12  ? 30.754 -3.583  21.380  1.00 25.57  ? 8    TYR A CB  1 
ATOM   68   C CG  . TYR A 1 12  ? 29.387 -3.041  21.055  1.00 23.49  ? 8    TYR A CG  1 
ATOM   69   C CD1 . TYR A 1 12  ? 29.225 -1.744  20.560  1.00 19.50  ? 8    TYR A CD1 1 
ATOM   70   C CD2 . TYR A 1 12  ? 28.246 -3.815  21.268  1.00 24.39  ? 8    TYR A CD2 1 
ATOM   71   C CE1 . TYR A 1 12  ? 27.969 -1.232  20.288  1.00 23.82  ? 8    TYR A CE1 1 
ATOM   72   C CE2 . TYR A 1 12  ? 26.977 -3.315  20.998  1.00 27.04  ? 8    TYR A CE2 1 
ATOM   73   C CZ  . TYR A 1 12  ? 26.845 -2.018  20.507  1.00 25.63  ? 8    TYR A CZ  1 
ATOM   74   O OH  . TYR A 1 12  ? 25.600 -1.497  20.235  1.00 25.07  ? 8    TYR A OH  1 
ATOM   75   N N   . GLY A 1 13  ? 34.193 -3.734  20.076  1.00 25.00  ? 9    GLY A N   1 
ATOM   76   C CA  . GLY A 1 13  ? 35.493 -4.007  20.656  1.00 26.73  ? 9    GLY A CA  1 
ATOM   77   C C   . GLY A 1 13  ? 36.523 -4.234  19.584  1.00 27.24  ? 9    GLY A C   1 
ATOM   78   O O   . GLY A 1 13  ? 37.685 -4.542  19.867  1.00 25.80  ? 9    GLY A O   1 
ATOM   79   N N   . THR A 1 14  ? 36.064 -4.054  18.351  1.00 23.02  ? 10   THR A N   1 
ATOM   80   C CA  . THR A 1 14  ? 36.850 -4.264  17.144  1.00 17.35  ? 10   THR A CA  1 
ATOM   81   C C   . THR A 1 14  ? 38.257 -3.686  17.167  1.00 16.14  ? 10   THR A C   1 
ATOM   82   O O   . THR A 1 14  ? 38.447 -2.477  17.245  1.00 16.06  ? 10   THR A O   1 
ATOM   83   C CB  . THR A 1 14  ? 36.073 -3.713  15.952  1.00 16.26  ? 10   THR A CB  1 
ATOM   84   O OG1 . THR A 1 14  ? 34.776 -3.298  16.407  1.00 22.29  ? 10   THR A OG1 1 
ATOM   85   C CG2 . THR A 1 14  ? 35.897 -4.769  14.892  1.00 20.81  ? 10   THR A CG2 1 
ATOM   86   N N   . THR A 1 15  ? 39.255 -4.560  17.089  1.00 15.12  ? 11   THR A N   1 
ATOM   87   C CA  . THR A 1 15  ? 40.643 -4.115  17.106  1.00 16.72  ? 11   THR A CA  1 
ATOM   88   C C   . THR A 1 15  ? 41.427 -4.639  15.900  1.00 18.86  ? 11   THR A C   1 
ATOM   89   O O   . THR A 1 15  ? 41.124 -5.701  15.362  1.00 21.99  ? 11   THR A O   1 
ATOM   90   C CB  . THR A 1 15  ? 41.343 -4.586  18.396  1.00 18.22  ? 11   THR A CB  1 
ATOM   91   O OG1 . THR A 1 15  ? 40.371 -4.714  19.438  1.00 24.21  ? 11   THR A OG1 1 
ATOM   92   C CG2 . THR A 1 15  ? 42.412 -3.600  18.830  1.00 17.29  ? 11   THR A CG2 1 
ATOM   93   N N   . VAL A 1 16  ? 42.441 -3.889  15.484  1.00 17.73  ? 12   VAL A N   1 
ATOM   94   C CA  . VAL A 1 16  ? 43.271 -4.282  14.350  1.00 18.97  ? 12   VAL A CA  1 
ATOM   95   C C   . VAL A 1 16  ? 44.735 -3.957  14.639  1.00 16.68  ? 12   VAL A C   1 
ATOM   96   O O   . VAL A 1 16  ? 45.043 -2.880  15.153  1.00 15.51  ? 12   VAL A O   1 
ATOM   97   C CB  . VAL A 1 16  ? 42.853 -3.527  13.056  1.00 15.92  ? 12   VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 16  ? 43.863 -3.761  11.973  1.00 11.90  ? 12   VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 16  ? 41.492 -3.988  12.599  1.00 20.39  ? 12   VAL A CG2 1 
ATOM   100  N N   . TYR A 1 17  ? 45.638 -4.876  14.315  1.00 15.89  ? 13   TYR A N   1 
ATOM   101  C CA  . TYR A 1 17  ? 47.056 -4.609  14.529  1.00 21.11  ? 13   TYR A CA  1 
ATOM   102  C C   . TYR A 1 17  ? 47.895 -5.171  13.399  1.00 20.60  ? 13   TYR A C   1 
ATOM   103  O O   . TYR A 1 17  ? 47.657 -6.279  12.939  1.00 24.19  ? 13   TYR A O   1 
ATOM   104  C CB  . TYR A 1 17  ? 47.553 -5.181  15.859  1.00 21.41  ? 13   TYR A CB  1 
ATOM   105  C CG  . TYR A 1 17  ? 48.783 -4.457  16.378  1.00 18.45  ? 13   TYR A CG  1 
ATOM   106  C CD1 . TYR A 1 17  ? 48.696 -3.145  16.841  1.00 24.47  ? 13   TYR A CD1 1 
ATOM   107  C CD2 . TYR A 1 17  ? 50.038 -5.063  16.358  1.00 18.36  ? 13   TYR A CD2 1 
ATOM   108  C CE1 . TYR A 1 17  ? 49.823 -2.452  17.267  1.00 22.02  ? 13   TYR A CE1 1 
ATOM   109  C CE2 . TYR A 1 17  ? 51.172 -4.381  16.781  1.00 19.62  ? 13   TYR A CE2 1 
ATOM   110  C CZ  . TYR A 1 17  ? 51.056 -3.074  17.231  1.00 23.40  ? 13   TYR A CZ  1 
ATOM   111  O OH  . TYR A 1 17  ? 52.174 -2.379  17.630  1.00 30.35  ? 13   TYR A OH  1 
ATOM   112  N N   . GLN A 1 18  ? 48.870 -4.387  12.952  1.00 20.43  ? 14   GLN A N   1 
ATOM   113  C CA  . GLN A 1 18  ? 49.753 -4.796  11.873  1.00 21.67  ? 14   GLN A CA  1 
ATOM   114  C C   . GLN A 1 18  ? 51.157 -4.603  12.401  1.00 25.34  ? 14   GLN A C   1 
ATOM   115  O O   . GLN A 1 18  ? 51.474 -3.566  12.982  1.00 23.95  ? 14   GLN A O   1 
ATOM   116  C CB  . GLN A 1 18  ? 49.475 -3.953  10.631  1.00 15.91  ? 14   GLN A CB  1 
ATOM   117  C CG  . GLN A 1 18  ? 47.989 -3.920  10.277  1.00 14.79  ? 14   GLN A CG  1 
ATOM   118  C CD  . GLN A 1 18  ? 47.658 -2.979  9.130   1.00 19.59  ? 14   GLN A CD  1 
ATOM   119  O OE1 . GLN A 1 18  ? 46.879 -2.046  9.286   1.00 19.64  ? 14   GLN A OE1 1 
ATOM   120  N NE2 . GLN A 1 18  ? 48.245 -3.228  7.969   1.00 29.85  ? 14   GLN A NE2 1 
ATOM   121  N N   . SER A 1 19  ? 51.991 -5.618  12.208  1.00 36.39  ? 15   SER A N   1 
ATOM   122  C CA  . SER A 1 19  ? 53.354 -5.611  12.739  1.00 45.74  ? 15   SER A CA  1 
ATOM   123  C C   . SER A 1 19  ? 54.358 -4.630  12.170  1.00 45.79  ? 15   SER A C   1 
ATOM   124  O O   . SER A 1 19  ? 54.878 -3.778  12.899  1.00 51.11  ? 15   SER A O   1 
ATOM   125  C CB  . SER A 1 19  ? 53.963 -7.016  12.665  1.00 49.39  ? 15   SER A CB  1 
ATOM   126  O OG  . SER A 1 19  ? 52.965 -8.025  12.660  1.00 63.88  ? 15   SER A OG  1 
ATOM   127  N N   . PRO A 1 20  ? 54.678 -4.748  10.874  1.00 43.38  ? 16   PRO A N   1 
ATOM   128  C CA  . PRO A 1 20  ? 55.656 -3.763  10.403  1.00 36.30  ? 16   PRO A CA  1 
ATOM   129  C C   . PRO A 1 20  ? 55.056 -2.370  10.527  1.00 32.95  ? 16   PRO A C   1 
ATOM   130  O O   . PRO A 1 20  ? 54.083 -2.045  9.850   1.00 33.28  ? 16   PRO A O   1 
ATOM   131  C CB  . PRO A 1 20  ? 55.939 -4.177  8.956   1.00 36.55  ? 16   PRO A CB  1 
ATOM   132  C CG  . PRO A 1 20  ? 54.805 -5.084  8.567   1.00 41.98  ? 16   PRO A CG  1 
ATOM   133  C CD  . PRO A 1 20  ? 54.216 -5.669  9.817   1.00 38.87  ? 16   PRO A CD  1 
ATOM   134  N N   . GLY A 1 21  ? 55.619 -1.569  11.427  1.00 31.85  ? 17   GLY A N   1 
ATOM   135  C CA  . GLY A 1 21  ? 55.130 -0.216  11.638  1.00 29.97  ? 17   GLY A CA  1 
ATOM   136  C C   . GLY A 1 21  ? 54.302 -0.046  12.903  1.00 27.86  ? 17   GLY A C   1 
ATOM   137  O O   . GLY A 1 21  ? 53.969 1.072   13.285  1.00 25.11  ? 17   GLY A O   1 
ATOM   138  N N   . ASP A 1 22  ? 53.971 -1.158  13.554  1.00 27.46  ? 18   ASP A N   1 
ATOM   139  C CA  . ASP A 1 22  ? 53.192 -1.131  14.787  1.00 32.02  ? 18   ASP A CA  1 
ATOM   140  C C   . ASP A 1 22  ? 51.920 -0.329  14.573  1.00 29.93  ? 18   ASP A C   1 
ATOM   141  O O   . ASP A 1 22  ? 51.558 0.539   15.367  1.00 29.78  ? 18   ASP A O   1 
ATOM   142  C CB  . ASP A 1 22  ? 54.013 -0.534  15.928  1.00 35.66  ? 18   ASP A CB  1 
ATOM   143  C CG  . ASP A 1 22  ? 54.868 -1.576  16.615  1.00 44.80  ? 18   ASP A CG  1 
ATOM   144  O OD1 . ASP A 1 22  ? 54.836 -2.742  16.156  1.00 46.61  ? 18   ASP A OD1 1 
ATOM   145  O OD2 . ASP A 1 22  ? 55.563 -1.238  17.600  1.00 48.06  ? 18   ASP A OD2 1 
ATOM   146  N N   . ILE A 1 23  ? 51.242 -0.660  13.484  1.00 26.47  ? 19   ILE A N   1 
ATOM   147  C CA  . ILE A 1 23  ? 49.991 -0.037  13.093  1.00 23.74  ? 19   ILE A CA  1 
ATOM   148  C C   . ILE A 1 23  ? 48.748 -0.682  13.697  1.00 23.34  ? 19   ILE A C   1 
ATOM   149  O O   . ILE A 1 23  ? 48.442 -1.835  13.420  1.00 24.38  ? 19   ILE A O   1 
ATOM   150  C CB  . ILE A 1 23  ? 49.897 -0.082  11.567  1.00 22.73  ? 19   ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 23  ? 51.257 0.288   10.969  1.00 19.17  ? 19   ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 23  ? 48.770 0.817   11.084  1.00 19.29  ? 19   ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 23  ? 51.527 -0.350  9.630   1.00 20.60  ? 19   ILE A CD1 1 
ATOM   154  N N   . GLY A 1 24  ? 48.017 0.073   14.506  1.00 21.82  ? 20   GLY A N   1 
ATOM   155  C CA  . GLY A 1 24  ? 46.830 -0.480  15.125  1.00 21.84  ? 20   GLY A CA  1 
ATOM   156  C C   . GLY A 1 24  ? 45.642 0.460   15.106  1.00 22.66  ? 20   GLY A C   1 
ATOM   157  O O   . GLY A 1 24  ? 45.797 1.677   15.079  1.00 26.02  ? 20   GLY A O   1 
ATOM   158  N N   . GLN A 1 25  ? 44.443 -0.108  15.133  1.00 20.22  ? 21   GLN A N   1 
ATOM   159  C CA  . GLN A 1 25  ? 43.239 0.700   15.108  1.00 15.35  ? 21   GLN A CA  1 
ATOM   160  C C   . GLN A 1 25  ? 42.164 0.120   16.013  1.00 16.03  ? 21   GLN A C   1 
ATOM   161  O O   . GLN A 1 25  ? 42.117 -1.089  16.236  1.00 17.75  ? 21   GLN A O   1 
ATOM   162  C CB  . GLN A 1 25  ? 42.740 0.790   13.676  1.00 14.79  ? 21   GLN A CB  1 
ATOM   163  C CG  . GLN A 1 25  ? 41.314 1.205   13.535  1.00 21.96  ? 21   GLN A CG  1 
ATOM   164  C CD  . GLN A 1 25  ? 40.760 0.776   12.214  1.00 20.47  ? 21   GLN A CD  1 
ATOM   165  O OE1 . GLN A 1 25  ? 40.025 -0.203  12.126  1.00 21.85  ? 21   GLN A OE1 1 
ATOM   166  N NE2 . GLN A 1 25  ? 41.122 1.500   11.161  1.00 27.93  ? 21   GLN A NE2 1 
ATOM   167  N N   . TYR A 1 26  ? 41.306 0.993   16.537  1.00 18.04  ? 22   TYR A N   1 
ATOM   168  C CA  . TYR A 1 26  ? 40.223 0.583   17.441  1.00 16.67  ? 22   TYR A CA  1 
ATOM   169  C C   . TYR A 1 26  ? 38.941 1.370   17.173  1.00 10.76  ? 22   TYR A C   1 
ATOM   170  O O   . TYR A 1 26  ? 38.942 2.601   17.218  1.00 12.00  ? 22   TYR A O   1 
ATOM   171  C CB  . TYR A 1 26  ? 40.643 0.781   18.914  1.00 16.81  ? 22   TYR A CB  1 
ATOM   172  C CG  . TYR A 1 26  ? 39.606 0.288   19.915  1.00 19.27  ? 22   TYR A CG  1 
ATOM   173  C CD1 . TYR A 1 26  ? 38.578 1.127   20.365  1.00 17.67  ? 22   TYR A CD1 1 
ATOM   174  C CD2 . TYR A 1 26  ? 39.614 -1.033  20.361  1.00 17.35  ? 22   TYR A CD2 1 
ATOM   175  C CE1 . TYR A 1 26  ? 37.581 0.657   21.227  1.00 19.25  ? 22   TYR A CE1 1 
ATOM   176  C CE2 . TYR A 1 26  ? 38.620 -1.515  21.223  1.00 18.26  ? 22   TYR A CE2 1 
ATOM   177  C CZ  . TYR A 1 26  ? 37.605 -0.669  21.652  1.00 20.16  ? 22   TYR A CZ  1 
ATOM   178  O OH  . TYR A 1 26  ? 36.618 -1.154  22.494  1.00 17.19  ? 22   TYR A OH  1 
ATOM   179  N N   . THR A 1 27  ? 37.852 0.654   16.903  1.00 8.28   ? 23   THR A N   1 
ATOM   180  C CA  . THR A 1 27  ? 36.565 1.287   16.624  1.00 10.36  ? 23   THR A CA  1 
ATOM   181  C C   . THR A 1 27  ? 35.352 0.530   17.169  1.00 12.91  ? 23   THR A C   1 
ATOM   182  O O   . THR A 1 27  ? 35.456 -0.553  17.753  1.00 7.12   ? 23   THR A O   1 
ATOM   183  C CB  . THR A 1 27  ? 36.321 1.434   15.124  1.00 10.61  ? 23   THR A CB  1 
ATOM   184  O OG1 . THR A 1 27  ? 36.046 0.139   14.573  1.00 16.18  ? 23   THR A OG1 1 
ATOM   185  C CG2 . THR A 1 27  ? 37.523 2.045   14.429  1.00 11.15  ? 23   THR A CG2 1 
ATOM   186  N N   . HIS A 1 28  ? 34.192 1.136   16.953  1.00 16.36  ? 24   HIS A N   1 
ATOM   187  C CA  . HIS A 1 28  ? 32.914 0.581   17.366  1.00 16.43  ? 24   HIS A CA  1 
ATOM   188  C C   . HIS A 1 28  ? 31.943 0.909   16.233  1.00 13.08  ? 24   HIS A C   1 
ATOM   189  O O   . HIS A 1 28  ? 32.017 1.987   15.646  1.00 11.26  ? 24   HIS A O   1 
ATOM   190  C CB  . HIS A 1 28  ? 32.420 1.259   18.651  1.00 21.09  ? 24   HIS A CB  1 
ATOM   191  C CG  . HIS A 1 28  ? 32.785 0.541   19.915  1.00 20.87  ? 24   HIS A CG  1 
ATOM   192  N ND1 . HIS A 1 28  ? 34.082 0.205   20.238  1.00 20.69  ? 24   HIS A ND1 1 
ATOM   193  C CD2 . HIS A 1 28  ? 32.030 0.174   20.978  1.00 18.08  ? 24   HIS A CD2 1 
ATOM   194  C CE1 . HIS A 1 28  ? 34.110 -0.333  21.444  1.00 20.75  ? 24   HIS A CE1 1 
ATOM   195  N NE2 . HIS A 1 28  ? 32.876 -0.363  21.915  1.00 17.32  ? 24   HIS A NE2 1 
ATOM   196  N N   . GLU A 1 29  ? 31.040 -0.015  15.929  1.00 12.49  ? 25   GLU A N   1 
ATOM   197  C CA  . GLU A 1 29  ? 30.042 0.209   14.890  1.00 13.32  ? 25   GLU A CA  1 
ATOM   198  C C   . GLU A 1 29  ? 28.680 -0.240  15.389  1.00 13.73  ? 25   GLU A C   1 
ATOM   199  O O   . GLU A 1 29  ? 28.576 -1.014  16.335  1.00 13.89  ? 25   GLU A O   1 
ATOM   200  C CB  . GLU A 1 29  ? 30.361 -0.600  13.627  1.00 14.29  ? 25   GLU A CB  1 
ATOM   201  C CG  . GLU A 1 29  ? 31.599 -0.173  12.868  1.00 14.27  ? 25   GLU A CG  1 
ATOM   202  C CD  . GLU A 1 29  ? 32.053 -1.221  11.865  1.00 13.97  ? 25   GLU A CD  1 
ATOM   203  O OE1 . GLU A 1 29  ? 31.191 -1.779  11.157  1.00 14.77  ? 25   GLU A OE1 1 
ATOM   204  O OE2 . GLU A 1 29  ? 33.277 -1.484  11.789  1.00 20.59  ? 25   GLU A OE2 1 
ATOM   205  N N   . PHE A 1 30  ? 27.630 0.274   14.769  1.00 15.22  ? 26   PHE A N   1 
ATOM   206  C CA  . PHE A 1 30  ? 26.296 -0.177  15.116  1.00 16.49  ? 26   PHE A CA  1 
ATOM   207  C C   . PHE A 1 30  ? 25.450 -0.271  13.855  1.00 14.60  ? 26   PHE A C   1 
ATOM   208  O O   . PHE A 1 30  ? 25.118 0.738   13.235  1.00 18.61  ? 26   PHE A O   1 
ATOM   209  C CB  . PHE A 1 30  ? 25.599 0.727   16.131  1.00 13.20  ? 26   PHE A CB  1 
ATOM   210  C CG  . PHE A 1 30  ? 24.263 0.196   16.551  1.00 7.59   ? 26   PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 30  ? 24.176 -0.819  17.494  1.00 7.20   ? 26   PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 30  ? 23.096 0.652   15.949  1.00 9.77   ? 26   PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 30  ? 22.942 -1.381  17.829  1.00 9.24   ? 26   PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 30  ? 21.858 0.096   16.278  1.00 9.92   ? 26   PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 30  ? 21.783 -0.920  17.217  1.00 9.57   ? 26   PHE A CZ  1 
ATOM   216  N N   . ASP A 1 31  ? 25.119 -1.501  13.483  1.00 17.24  ? 27   ASP A N   1 
ATOM   217  C CA  . ASP A 1 31  ? 24.313 -1.767  12.303  1.00 19.72  ? 27   ASP A CA  1 
ATOM   218  C C   . ASP A 1 31  ? 25.025 -1.358  11.006  1.00 14.96  ? 27   ASP A C   1 
ATOM   219  O O   . ASP A 1 31  ? 24.409 -0.824  10.088  1.00 20.10  ? 27   ASP A O   1 
ATOM   220  C CB  . ASP A 1 31  ? 22.952 -1.066  12.431  1.00 12.64  ? 27   ASP A CB  1 
ATOM   221  C CG  . ASP A 1 31  ? 21.950 -1.888  13.222  1.00 14.93  ? 27   ASP A CG  1 
ATOM   222  O OD1 . ASP A 1 31  ? 22.368 -2.852  13.908  1.00 19.68  ? 27   ASP A OD1 1 
ATOM   223  O OD2 . ASP A 1 31  ? 20.743 -1.577  13.159  1.00 13.28  ? 27   ASP A OD2 1 
ATOM   224  N N   . GLY A 1 32  ? 26.328 -1.621  10.952  1.00 16.56  ? 28   GLY A N   1 
ATOM   225  C CA  . GLY A 1 32  ? 27.119 -1.317  9.771   1.00 12.48  ? 28   GLY A CA  1 
ATOM   226  C C   . GLY A 1 32  ? 27.699 0.081   9.669   1.00 16.43  ? 28   GLY A C   1 
ATOM   227  O O   . GLY A 1 32  ? 28.451 0.383   8.735   1.00 17.07  ? 28   GLY A O   1 
ATOM   228  N N   . ASP A 1 33  ? 27.360 0.937   10.625  1.00 14.57  ? 29   ASP A N   1 
ATOM   229  C CA  . ASP A 1 33  ? 27.837 2.313   10.617  1.00 15.39  ? 29   ASP A CA  1 
ATOM   230  C C   . ASP A 1 33  ? 28.877 2.532   11.717  1.00 16.33  ? 29   ASP A C   1 
ATOM   231  O O   . ASP A 1 33  ? 28.752 1.970   12.810  1.00 13.38  ? 29   ASP A O   1 
ATOM   232  C CB  . ASP A 1 33  ? 26.644 3.266   10.807  1.00 15.11  ? 29   ASP A CB  1 
ATOM   233  C CG  . ASP A 1 33  ? 25.815 3.442   9.535   1.00 14.44  ? 29   ASP A CG  1 
ATOM   234  O OD1 . ASP A 1 33  ? 26.375 3.325   8.418   1.00 15.08  ? 29   ASP A OD1 1 
ATOM   235  O OD2 . ASP A 1 33  ? 24.597 3.704   9.656   1.00 12.62  ? 29   ASP A OD2 1 
ATOM   236  N N   . GLU A 1 34  ? 29.891 3.352   11.435  1.00 16.23  ? 30   GLU A N   1 
ATOM   237  C CA  . GLU A 1 34  ? 30.962 3.635   12.402  1.00 18.48  ? 30   GLU A CA  1 
ATOM   238  C C   . GLU A 1 34  ? 30.566 4.603   13.524  1.00 22.47  ? 30   GLU A C   1 
ATOM   239  O O   . GLU A 1 34  ? 30.187 5.749   13.268  1.00 24.96  ? 30   GLU A O   1 
ATOM   240  C CB  . GLU A 1 34  ? 32.181 4.191   11.672  1.00 20.98  ? 30   GLU A CB  1 
ATOM   241  C CG  . GLU A 1 34  ? 33.359 4.544   12.564  1.00 22.33  ? 30   GLU A CG  1 
ATOM   242  C CD  . GLU A 1 34  ? 34.333 5.488   11.875  1.00 30.03  ? 30   GLU A CD  1 
ATOM   243  O OE1 . GLU A 1 34  ? 34.300 5.570   10.626  1.00 33.79  ? 30   GLU A OE1 1 
ATOM   244  O OE2 . GLU A 1 34  ? 35.125 6.152   12.577  1.00 34.30  ? 30   GLU A OE2 1 
ATOM   245  N N   . LEU A 1 35  ? 30.679 4.140   14.768  1.00 18.95  ? 31   LEU A N   1 
ATOM   246  C CA  . LEU A 1 35  ? 30.330 4.944   15.944  1.00 17.23  ? 31   LEU A CA  1 
ATOM   247  C C   . LEU A 1 35  ? 31.405 5.965   16.327  1.00 13.32  ? 31   LEU A C   1 
ATOM   248  O O   . LEU A 1 35  ? 31.119 7.140   16.557  1.00 11.79  ? 31   LEU A O   1 
ATOM   249  C CB  . LEU A 1 35  ? 30.069 4.028   17.153  1.00 17.37  ? 31   LEU A CB  1 
ATOM   250  C CG  . LEU A 1 35  ? 28.732 3.291   17.313  1.00 12.64  ? 31   LEU A CG  1 
ATOM   251  C CD1 . LEU A 1 35  ? 28.805 2.497   18.597  1.00 12.19  ? 31   LEU A CD1 1 
ATOM   252  C CD2 . LEU A 1 35  ? 27.548 4.232   17.368  1.00 8.52   ? 31   LEU A CD2 1 
ATOM   253  N N   . PHE A 1 36  ? 32.637 5.491   16.425  1.00 12.41  ? 32   PHE A N   1 
ATOM   254  C CA  . PHE A 1 36  ? 33.772 6.332   16.774  1.00 15.59  ? 32   PHE A CA  1 
ATOM   255  C C   . PHE A 1 36  ? 35.057 5.526   16.520  1.00 16.57  ? 32   PHE A C   1 
ATOM   256  O O   . PHE A 1 36  ? 35.006 4.369   16.087  1.00 10.91  ? 32   PHE A O   1 
ATOM   257  C CB  . PHE A 1 36  ? 33.684 6.760   18.257  1.00 9.49   ? 32   PHE A CB  1 
ATOM   258  C CG  . PHE A 1 36  ? 33.875 5.626   19.229  1.00 15.67  ? 32   PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 36  ? 35.155 5.166   19.540  1.00 18.75  ? 32   PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 36  ? 32.776 4.970   19.782  1.00 18.49  ? 32   PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 36  ? 35.340 4.063   20.371  1.00 21.31  ? 32   PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 36  ? 32.947 3.864   20.617  1.00 14.55  ? 32   PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 36  ? 34.232 3.409   20.913  1.00 18.88  ? 32   PHE A CZ  1 
ATOM   264  N N   . TYR A 1 37  ? 36.198 6.156   16.780  1.00 18.43  ? 33   TYR A N   1 
ATOM   265  C CA  . TYR A 1 37  ? 37.503 5.485   16.745  1.00 20.60  ? 33   TYR A CA  1 
ATOM   266  C C   . TYR A 1 37  ? 38.353 6.181   17.792  1.00 18.10  ? 33   TYR A C   1 
ATOM   267  O O   . TYR A 1 37  ? 38.093 7.326   18.133  1.00 17.27  ? 33   TYR A O   1 
ATOM   268  C CB  . TYR A 1 37  ? 38.088 5.694   15.335  1.00 16.52  ? 33   TYR A CB  1 
ATOM   269  C CG  . TYR A 1 37  ? 38.591 7.098   15.046  1.00 15.96  ? 33   TYR A CG  1 
ATOM   270  C CD1 . TYR A 1 37  ? 37.731 8.082   14.544  1.00 11.87  ? 33   TYR A CD1 1 
ATOM   271  C CD2 . TYR A 1 37  ? 39.930 7.443   15.258  1.00 15.79  ? 33   TYR A CD2 1 
ATOM   272  C CE1 . TYR A 1 37  ? 38.195 9.371   14.265  1.00 18.23  ? 33   TYR A CE1 1 
ATOM   273  C CE2 . TYR A 1 37  ? 40.402 8.731   14.983  1.00 16.84  ? 33   TYR A CE2 1 
ATOM   274  C CZ  . TYR A 1 37  ? 39.531 9.686   14.490  1.00 18.83  ? 33   TYR A CZ  1 
ATOM   275  O OH  . TYR A 1 37  ? 39.993 10.958  14.250  1.00 25.93  ? 33   TYR A OH  1 
ATOM   276  N N   . VAL A 1 38  ? 39.367 5.499   18.300  1.00 23.47  ? 34   VAL A N   1 
ATOM   277  C CA  . VAL A 1 38  ? 40.217 6.094   19.324  1.00 25.52  ? 34   VAL A CA  1 
ATOM   278  C C   . VAL A 1 38  ? 41.567 6.556   18.802  1.00 26.00  ? 34   VAL A C   1 
ATOM   279  O O   . VAL A 1 38  ? 42.327 5.756   18.264  1.00 29.84  ? 34   VAL A O   1 
ATOM   280  C CB  . VAL A 1 38  ? 40.468 5.100   20.487  1.00 23.23  ? 34   VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 38  ? 41.105 5.819   21.652  1.00 19.86  ? 34   VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 38  ? 39.164 4.457   20.928  1.00 23.22  ? 34   VAL A CG2 1 
ATOM   283  N N   . ASP A 1 39  ? 41.854 7.845   18.960  1.00 28.01  ? 35   ASP A N   1 
ATOM   284  C CA  . ASP A 1 39  ? 43.138 8.405   18.553  1.00 30.75  ? 35   ASP A CA  1 
ATOM   285  C C   . ASP A 1 39  ? 44.146 7.787   19.505  1.00 32.34  ? 35   ASP A C   1 
ATOM   286  O O   . ASP A 1 39  ? 44.291 8.242   20.633  1.00 35.69  ? 35   ASP A O   1 
ATOM   287  C CB  . ASP A 1 39  ? 43.134 9.913   18.750  1.00 31.93  ? 35   ASP A CB  1 
ATOM   288  C CG  . ASP A 1 39  ? 43.896 10.645  17.672  1.00 31.31  ? 35   ASP A CG  1 
ATOM   289  O OD1 . ASP A 1 39  ? 45.022 10.218  17.339  1.00 38.74  ? 35   ASP A OD1 1 
ATOM   290  O OD2 . ASP A 1 39  ? 43.363 11.655  17.164  1.00 28.19  ? 35   ASP A OD2 1 
ATOM   291  N N   . LEU A 1 40  ? 44.830 6.744   19.059  1.00 35.93  ? 36   LEU A N   1 
ATOM   292  C CA  . LEU A 1 40  ? 45.797 6.056   19.907  1.00 37.55  ? 36   LEU A CA  1 
ATOM   293  C C   . LEU A 1 40  ? 47.011 6.936   20.149  1.00 38.91  ? 36   LEU A C   1 
ATOM   294  O O   . LEU A 1 40  ? 47.933 6.585   20.892  1.00 39.07  ? 36   LEU A O   1 
ATOM   295  C CB  . LEU A 1 40  ? 46.181 4.732   19.245  1.00 39.79  ? 36   LEU A CB  1 
ATOM   296  C CG  . LEU A 1 40  ? 44.939 3.971   18.742  1.00 39.24  ? 36   LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 40  ? 45.368 2.714   18.034  1.00 38.59  ? 36   LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 40  ? 44.004 3.634   19.909  1.00 39.92  ? 36   LEU A CD2 1 
ATOM   299  N N   . ASP A 1 41  ? 46.969 8.107   19.526  1.00 38.75  ? 37   ASP A N   1 
ATOM   300  C CA  . ASP A 1 41  ? 48.028 9.087   19.631  1.00 38.70  ? 37   ASP A CA  1 
ATOM   301  C C   . ASP A 1 41  ? 47.640 10.188  20.613  1.00 39.92  ? 37   ASP A C   1 
ATOM   302  O O   . ASP A 1 41  ? 48.394 10.517  21.530  1.00 40.60  ? 37   ASP A O   1 
ATOM   303  C CB  . ASP A 1 41  ? 48.295 9.677   18.257  1.00 35.62  ? 37   ASP A CB  1 
ATOM   304  C CG  . ASP A 1 41  ? 49.675 9.364   17.766  1.00 39.96  ? 37   ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 41  ? 49.958 8.175   17.493  1.00 36.30  ? 37   ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 41  ? 50.482 10.312  17.662  1.00 46.99  ? 37   ASP A OD2 1 
ATOM   307  N N   . LYS A 1 42  ? 46.463 10.767  20.411  1.00 40.98  ? 38   LYS A N   1 
ATOM   308  C CA  . LYS A 1 42  ? 45.989 11.811  21.305  1.00 40.56  ? 38   LYS A CA  1 
ATOM   309  C C   . LYS A 1 42  ? 45.347 11.131  22.508  1.00 39.30  ? 38   LYS A C   1 
ATOM   310  O O   . LYS A 1 42  ? 45.264 11.702  23.593  1.00 37.11  ? 38   LYS A O   1 
ATOM   311  C CB  . LYS A 1 42  ? 44.965 12.700  20.597  1.00 39.61  ? 38   LYS A CB  1 
ATOM   312  C CG  . LYS A 1 42  ? 45.547 13.535  19.465  1.00 41.78  ? 38   LYS A CG  1 
ATOM   313  C CD  . LYS A 1 42  ? 44.442 14.194  18.638  1.00 46.48  ? 38   LYS A CD  1 
ATOM   314  C CE  . LYS A 1 42  ? 44.748 15.655  18.342  1.00 47.34  ? 38   LYS A CE  1 
ATOM   315  N NZ  . LYS A 1 42  ? 46.157 15.816  17.898  1.00 45.02  ? 38   LYS A NZ  1 
ATOM   316  N N   . LYS A 1 43  ? 44.912 9.894   22.297  1.00 39.92  ? 39   LYS A N   1 
ATOM   317  C CA  . LYS A 1 43  ? 44.260 9.103   23.332  1.00 41.87  ? 39   LYS A CA  1 
ATOM   318  C C   . LYS A 1 43  ? 42.876 9.693   23.592  1.00 40.24  ? 39   LYS A C   1 
ATOM   319  O O   . LYS A 1 43  ? 42.458 9.867   24.740  1.00 36.04  ? 39   LYS A O   1 
ATOM   320  C CB  . LYS A 1 43  ? 45.103 9.108   24.615  1.00 47.35  ? 39   LYS A CB  1 
ATOM   321  C CG  . LYS A 1 43  ? 46.348 8.233   24.540  1.00 52.32  ? 39   LYS A CG  1 
ATOM   322  C CD  . LYS A 1 43  ? 46.578 7.451   25.829  1.00 58.75  ? 39   LYS A CD  1 
ATOM   323  C CE  . LYS A 1 43  ? 47.929 6.735   25.810  1.00 65.19  ? 39   LYS A CE  1 
ATOM   324  N NZ  . LYS A 1 43  ? 48.176 5.924   27.039  1.00 70.00  ? 39   LYS A NZ  1 
ATOM   325  N N   . LYS A 1 44  ? 42.169 9.994   22.505  1.00 35.87  ? 40   LYS A N   1 
ATOM   326  C CA  . LYS A 1 44  ? 40.841 10.581  22.583  1.00 32.28  ? 40   LYS A CA  1 
ATOM   327  C C   . LYS A 1 44  ? 39.809 9.831   21.765  1.00 28.07  ? 40   LYS A C   1 
ATOM   328  O O   . LYS A 1 44  ? 40.044 9.486   20.611  1.00 28.89  ? 40   LYS A O   1 
ATOM   329  C CB  . LYS A 1 44  ? 40.880 12.034  22.107  1.00 39.09  ? 40   LYS A CB  1 
ATOM   330  C CG  . LYS A 1 44  ? 40.098 12.995  22.990  1.00 50.11  ? 40   LYS A CG  1 
ATOM   331  C CD  . LYS A 1 44  ? 40.998 13.639  24.054  1.00 54.81  ? 40   LYS A CD  1 
ATOM   332  C CE  . LYS A 1 44  ? 40.899 12.930  25.408  1.00 53.94  ? 40   LYS A CE  1 
ATOM   333  N NZ  . LYS A 1 44  ? 39.648 12.121  25.548  1.00 55.09  ? 40   LYS A NZ  1 
ATOM   334  N N   . THR A 1 45  ? 38.653 9.596   22.368  1.00 23.63  ? 41   THR A N   1 
ATOM   335  C CA  . THR A 1 45  ? 37.575 8.904   21.689  1.00 24.33  ? 41   THR A CA  1 
ATOM   336  C C   . THR A 1 45  ? 36.893 9.895   20.761  1.00 27.90  ? 41   THR A C   1 
ATOM   337  O O   . THR A 1 45  ? 36.215 10.813  21.232  1.00 32.20  ? 41   THR A O   1 
ATOM   338  C CB  . THR A 1 45  ? 36.533 8.364   22.687  1.00 19.48  ? 41   THR A CB  1 
ATOM   339  O OG1 . THR A 1 45  ? 37.149 7.406   23.552  1.00 23.51  ? 41   THR A OG1 1 
ATOM   340  C CG2 . THR A 1 45  ? 35.398 7.693   21.953  1.00 18.56  ? 41   THR A CG2 1 
ATOM   341  N N   . VAL A 1 46  ? 37.070 9.696   19.452  1.00 25.10  ? 42   VAL A N   1 
ATOM   342  C CA  . VAL A 1 46  ? 36.492 10.567  18.423  1.00 22.53  ? 42   VAL A CA  1 
ATOM   343  C C   . VAL A 1 46  ? 35.226 9.985   17.768  1.00 22.78  ? 42   VAL A C   1 
ATOM   344  O O   . VAL A 1 46  ? 35.262 8.943   17.128  1.00 26.77  ? 42   VAL A O   1 
ATOM   345  C CB  . VAL A 1 46  ? 37.534 10.861  17.340  1.00 22.47  ? 42   VAL A CB  1 
ATOM   346  C CG1 . VAL A 1 46  ? 37.054 11.976  16.437  1.00 27.10  ? 42   VAL A CG1 1 
ATOM   347  C CG2 . VAL A 1 46  ? 38.839 11.250  17.995  1.00 27.22  ? 42   VAL A CG2 1 
ATOM   348  N N   . TRP A 1 47  ? 34.110 10.685  17.919  1.00 24.40  ? 43   TRP A N   1 
ATOM   349  C CA  . TRP A 1 47  ? 32.824 10.242  17.396  1.00 22.96  ? 43   TRP A CA  1 
ATOM   350  C C   . TRP A 1 47  ? 32.524 10.633  15.954  1.00 24.09  ? 43   TRP A C   1 
ATOM   351  O O   . TRP A 1 47  ? 32.837 11.736  15.519  1.00 24.57  ? 43   TRP A O   1 
ATOM   352  C CB  . TRP A 1 47  ? 31.711 10.760  18.313  1.00 24.22  ? 43   TRP A CB  1 
ATOM   353  C CG  . TRP A 1 47  ? 31.772 10.147  19.679  1.00 23.96  ? 43   TRP A CG  1 
ATOM   354  C CD1 . TRP A 1 47  ? 32.544 10.555  20.724  1.00 24.62  ? 43   TRP A CD1 1 
ATOM   355  C CD2 . TRP A 1 47  ? 31.068 8.981   20.130  1.00 25.03  ? 43   TRP A CD2 1 
ATOM   356  N NE1 . TRP A 1 47  ? 32.369 9.716   21.797  1.00 24.16  ? 43   TRP A NE1 1 
ATOM   357  C CE2 . TRP A 1 47  ? 31.470 8.743   21.460  1.00 22.24  ? 43   TRP A CE2 1 
ATOM   358  C CE3 . TRP A 1 47  ? 30.138 8.115   19.537  1.00 27.33  ? 43   TRP A CE3 1 
ATOM   359  C CZ2 . TRP A 1 47  ? 30.973 7.673   22.210  1.00 26.24  ? 43   TRP A CZ2 1 
ATOM   360  C CZ3 . TRP A 1 47  ? 29.644 7.051   20.283  1.00 21.71  ? 43   TRP A CZ3 1 
ATOM   361  C CH2 . TRP A 1 47  ? 30.063 6.841   21.605  1.00 23.57  ? 43   TRP A CH2 1 
ATOM   362  N N   . ARG A 1 48  ? 31.911 9.707   15.219  1.00 26.96  ? 44   ARG A N   1 
ATOM   363  C CA  . ARG A 1 48  ? 31.546 9.937   13.826  1.00 26.83  ? 44   ARG A CA  1 
ATOM   364  C C   . ARG A 1 48  ? 30.431 10.976  13.843  1.00 27.28  ? 44   ARG A C   1 
ATOM   365  O O   . ARG A 1 48  ? 30.471 11.958  13.105  1.00 32.17  ? 44   ARG A O   1 
ATOM   366  C CB  . ARG A 1 48  ? 31.065 8.628   13.181  1.00 24.86  ? 44   ARG A CB  1 
ATOM   367  C CG  . ARG A 1 48  ? 30.728 8.720   11.682  1.00 21.68  ? 44   ARG A CG  1 
ATOM   368  C CD  . ARG A 1 48  ? 31.988 8.876   10.848  1.00 27.34  ? 44   ARG A CD  1 
ATOM   369  N NE  . ARG A 1 48  ? 31.749 8.824   9.405   1.00 27.79  ? 44   ARG A NE  1 
ATOM   370  C CZ  . ARG A 1 48  ? 31.402 9.868   8.655   1.00 27.56  ? 44   ARG A CZ  1 
ATOM   371  N NH1 . ARG A 1 48  ? 31.234 11.064  9.201   1.00 34.28  ? 44   ARG A NH1 1 
ATOM   372  N NH2 . ARG A 1 48  ? 31.246 9.721   7.350   1.00 29.46  ? 44   ARG A NH2 1 
ATOM   373  N N   . LEU A 1 49  ? 29.435 10.741  14.692  1.00 28.08  ? 45   LEU A N   1 
ATOM   374  C CA  . LEU A 1 49  ? 28.308 11.658  14.872  1.00 27.91  ? 45   LEU A CA  1 
ATOM   375  C C   . LEU A 1 49  ? 28.644 12.290  16.225  1.00 29.66  ? 45   LEU A C   1 
ATOM   376  O O   . LEU A 1 49  ? 28.393 11.708  17.276  1.00 34.26  ? 45   LEU A O   1 
ATOM   377  C CB  . LEU A 1 49  ? 26.997 10.876  14.960  1.00 24.62  ? 45   LEU A CB  1 
ATOM   378  C CG  . LEU A 1 49  ? 25.986 10.825  13.807  1.00 24.88  ? 45   LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 49  ? 26.616 11.174  12.470  1.00 22.22  ? 45   LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 49  ? 25.403 9.421   13.770  1.00 27.01  ? 45   LEU A CD2 1 
ATOM   381  N N   . PRO A 1 50  ? 29.203 13.501  16.211  1.00 30.35  ? 46   PRO A N   1 
ATOM   382  C CA  . PRO A 1 50  ? 29.616 14.195  17.439  1.00 26.39  ? 46   PRO A CA  1 
ATOM   383  C C   . PRO A 1 50  ? 28.490 14.456  18.419  1.00 26.30  ? 46   PRO A C   1 
ATOM   384  O O   . PRO A 1 50  ? 28.717 14.817  19.575  1.00 25.15  ? 46   PRO A O   1 
ATOM   385  C CB  . PRO A 1 50  ? 30.261 15.482  16.930  1.00 30.17  ? 46   PRO A CB  1 
ATOM   386  C CG  . PRO A 1 50  ? 29.688 15.680  15.552  1.00 35.57  ? 46   PRO A CG  1 
ATOM   387  C CD  . PRO A 1 50  ? 29.464 14.299  15.001  1.00 32.55  ? 46   PRO A CD  1 
ATOM   388  N N   . GLU A 1 51  ? 27.266 14.275  17.962  1.00 26.98  ? 47   GLU A N   1 
ATOM   389  C CA  . GLU A 1 51  ? 26.140 14.496  18.838  1.00 27.61  ? 47   GLU A CA  1 
ATOM   390  C C   . GLU A 1 51  ? 26.045 13.312  19.795  1.00 27.25  ? 47   GLU A C   1 
ATOM   391  O O   . GLU A 1 51  ? 25.524 13.446  20.901  1.00 27.94  ? 47   GLU A O   1 
ATOM   392  C CB  . GLU A 1 51  ? 24.860 14.632  18.011  1.00 35.66  ? 47   GLU A CB  1 
ATOM   393  C CG  . GLU A 1 51  ? 24.727 13.602  16.884  1.00 40.06  ? 47   GLU A CG  1 
ATOM   394  C CD  . GLU A 1 51  ? 24.865 14.211  15.504  1.00 40.02  ? 47   GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 51  ? 25.973 14.697  15.183  1.00 42.33  ? 47   GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 51  ? 23.868 14.198  14.744  1.00 40.30  ? 47   GLU A OE2 1 
ATOM   397  N N   . PHE A 1 52  ? 26.581 12.165  19.369  1.00 24.11  ? 48   PHE A N   1 
ATOM   398  C CA  . PHE A 1 52  ? 26.564 10.928  20.161  1.00 23.19  ? 48   PHE A CA  1 
ATOM   399  C C   . PHE A 1 52  ? 27.466 10.920  21.395  1.00 27.55  ? 48   PHE A C   1 
ATOM   400  O O   . PHE A 1 52  ? 27.068 10.435  22.456  1.00 22.48  ? 48   PHE A O   1 
ATOM   401  C CB  . PHE A 1 52  ? 26.961 9.736   19.292  1.00 14.50  ? 48   PHE A CB  1 
ATOM   402  C CG  . PHE A 1 52  ? 25.868 9.247   18.388  1.00 13.52  ? 48   PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 52  ? 24.724 10.007  18.174  1.00 5.86   ? 48   PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 52  ? 25.992 8.023   17.734  1.00 9.35   ? 48   PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 52  ? 23.721 9.559   17.326  1.00 12.05  ? 48   PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 52  ? 24.988 7.568   16.881  1.00 6.61   ? 48   PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 52  ? 23.851 8.336   16.676  1.00 4.40   ? 48   PHE A CZ  1 
ATOM   408  N N   . GLY A 1 53  ? 28.688 11.426  21.241  1.00 29.91  ? 49   GLY A N   1 
ATOM   409  C CA  . GLY A 1 53  ? 29.628 11.445  22.350  1.00 32.62  ? 49   GLY A CA  1 
ATOM   410  C C   . GLY A 1 53  ? 29.188 12.420  23.417  1.00 34.25  ? 49   GLY A C   1 
ATOM   411  O O   . GLY A 1 53  ? 29.720 12.437  24.530  1.00 35.31  ? 49   GLY A O   1 
ATOM   412  N N   . GLN A 1 54  ? 28.202 13.232  23.061  1.00 31.61  ? 50   GLN A N   1 
ATOM   413  C CA  . GLN A 1 54  ? 27.661 14.231  23.957  1.00 31.82  ? 50   GLN A CA  1 
ATOM   414  C C   . GLN A 1 54  ? 26.701 13.592  24.945  1.00 30.71  ? 50   GLN A C   1 
ATOM   415  O O   . GLN A 1 54  ? 26.459 14.123  26.033  1.00 26.93  ? 50   GLN A O   1 
ATOM   416  C CB  . GLN A 1 54  ? 26.919 15.282  23.145  1.00 35.44  ? 50   GLN A CB  1 
ATOM   417  C CG  . GLN A 1 54  ? 27.705 16.539  22.899  1.00 41.66  ? 50   GLN A CG  1 
ATOM   418  C CD  . GLN A 1 54  ? 26.874 17.589  22.202  1.00 52.05  ? 50   GLN A CD  1 
ATOM   419  O OE1 . GLN A 1 54  ? 25.712 17.815  22.552  1.00 57.38  ? 50   GLN A OE1 1 
ATOM   420  N NE2 . GLN A 1 54  ? 27.462 18.241  21.206  1.00 59.28  ? 50   GLN A NE2 1 
ATOM   421  N N   . LEU A 1 55  ? 26.159 12.445  24.555  1.00 27.28  ? 51   LEU A N   1 
ATOM   422  C CA  . LEU A 1 55  ? 25.198 11.733  25.376  1.00 29.34  ? 51   LEU A CA  1 
ATOM   423  C C   . LEU A 1 55  ? 25.737 10.443  25.974  1.00 30.20  ? 51   LEU A C   1 
ATOM   424  O O   . LEU A 1 55  ? 25.100 9.841   26.835  1.00 33.92  ? 51   LEU A O   1 
ATOM   425  C CB  . LEU A 1 55  ? 23.949 11.415  24.553  1.00 28.57  ? 51   LEU A CB  1 
ATOM   426  C CG  . LEU A 1 55  ? 23.009 12.580  24.233  1.00 32.01  ? 51   LEU A CG  1 
ATOM   427  C CD1 . LEU A 1 55  ? 23.781 13.704  23.554  1.00 28.29  ? 51   LEU A CD1 1 
ATOM   428  C CD2 . LEU A 1 55  ? 21.869 12.080  23.341  1.00 26.02  ? 51   LEU A CD2 1 
ATOM   429  N N   . ILE A 1 56  ? 26.896 10.005  25.505  1.00 27.56  ? 52   ILE A N   1 
ATOM   430  C CA  . ILE A 1 56  ? 27.498 8.785   26.018  1.00 25.71  ? 52   ILE A CA  1 
ATOM   431  C C   . ILE A 1 56  ? 28.996 8.916   25.881  1.00 24.78  ? 52   ILE A C   1 
ATOM   432  O O   . ILE A 1 56  ? 29.483 9.783   25.156  1.00 27.32  ? 52   ILE A O   1 
ATOM   433  C CB  . ILE A 1 56  ? 27.032 7.534   25.233  1.00 30.56  ? 52   ILE A CB  1 
ATOM   434  C CG1 . ILE A 1 56  ? 27.394 7.670   23.754  1.00 29.31  ? 52   ILE A CG1 1 
ATOM   435  C CG2 . ILE A 1 56  ? 25.521 7.353   25.382  1.00 30.55  ? 52   ILE A CG2 1 
ATOM   436  C CD1 . ILE A 1 56  ? 26.899 6.511   22.917  1.00 27.83  ? 52   ILE A CD1 1 
ATOM   437  N N   . LEU A 1 57  ? 29.742 8.069   26.574  1.00 20.61  ? 53   LEU A N   1 
ATOM   438  C CA  . LEU A 1 57  ? 31.179 8.171   26.463  1.00 22.77  ? 53   LEU A CA  1 
ATOM   439  C C   . LEU A 1 57  ? 31.951 6.884   26.595  1.00 23.44  ? 53   LEU A C   1 
ATOM   440  O O   . LEU A 1 57  ? 31.590 5.981   27.362  1.00 25.41  ? 53   LEU A O   1 
ATOM   441  C CB  . LEU A 1 57  ? 31.722 9.176   27.473  1.00 23.03  ? 53   LEU A CB  1 
ATOM   442  C CG  . LEU A 1 57  ? 32.472 8.576   28.652  1.00 17.22  ? 53   LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 57  ? 33.874 9.155   28.769  1.00 18.33  ? 53   LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 57  ? 31.651 8.846   29.882  1.00 20.60  ? 53   LEU A CD2 1 
ATOM   445  N N   . PHE A 1 58  ? 33.038 6.826   25.839  1.00 20.80  ? 54   PHE A N   1 
ATOM   446  C CA  . PHE A 1 58  ? 33.903 5.672   25.845  1.00 21.76  ? 54   PHE A CA  1 
ATOM   447  C C   . PHE A 1 58  ? 35.273 6.067   26.362  1.00 24.09  ? 54   PHE A C   1 
ATOM   448  O O   . PHE A 1 58  ? 35.852 7.076   25.945  1.00 16.66  ? 54   PHE A O   1 
ATOM   449  C CB  . PHE A 1 58  ? 34.027 5.081   24.440  1.00 22.35  ? 54   PHE A CB  1 
ATOM   450  C CG  . PHE A 1 58  ? 34.939 3.897   24.369  1.00 17.14  ? 54   PHE A CG  1 
ATOM   451  C CD1 . PHE A 1 58  ? 34.576 2.693   24.954  1.00 16.31  ? 54   PHE A CD1 1 
ATOM   452  C CD2 . PHE A 1 58  ? 36.181 4.000   23.761  1.00 21.66  ? 54   PHE A CD2 1 
ATOM   453  C CE1 . PHE A 1 58  ? 35.440 1.606   24.938  1.00 18.55  ? 54   PHE A CE1 1 
ATOM   454  C CE2 . PHE A 1 58  ? 37.054 2.917   23.740  1.00 23.15  ? 54   PHE A CE2 1 
ATOM   455  C CZ  . PHE A 1 58  ? 36.682 1.719   24.331  1.00 19.48  ? 54   PHE A CZ  1 
ATOM   456  N N   . GLU A 1 59  ? 35.777 5.252   27.283  1.00 29.35  ? 55   GLU A N   1 
ATOM   457  C CA  . GLU A 1 59  ? 37.074 5.466   27.894  1.00 29.68  ? 55   GLU A CA  1 
ATOM   458  C C   . GLU A 1 59  ? 38.163 4.841   27.027  1.00 28.36  ? 55   GLU A C   1 
ATOM   459  O O   . GLU A 1 59  ? 38.284 3.618   26.931  1.00 27.75  ? 55   GLU A O   1 
ATOM   460  C CB  . GLU A 1 59  ? 37.066 4.870   29.297  1.00 29.30  ? 55   GLU A CB  1 
ATOM   461  C CG  . GLU A 1 59  ? 36.181 5.656   30.253  1.00 26.08  ? 55   GLU A CG  1 
ATOM   462  C CD  . GLU A 1 59  ? 36.759 7.023   30.572  1.00 26.38  ? 55   GLU A CD  1 
ATOM   463  O OE1 . GLU A 1 59  ? 37.863 7.329   30.068  1.00 20.26  ? 55   GLU A OE1 1 
ATOM   464  O OE2 . GLU A 1 59  ? 36.114 7.787   31.329  1.00 28.88  ? 55   GLU A OE2 1 
ATOM   465  N N   . PRO A 1 60  ? 38.978 5.690   26.391  1.00 28.57  ? 56   PRO A N   1 
ATOM   466  C CA  . PRO A 1 60  ? 40.077 5.292   25.502  1.00 32.89  ? 56   PRO A CA  1 
ATOM   467  C C   . PRO A 1 60  ? 40.987 4.166   25.978  1.00 32.45  ? 56   PRO A C   1 
ATOM   468  O O   . PRO A 1 60  ? 41.513 3.409   25.159  1.00 30.38  ? 56   PRO A O   1 
ATOM   469  C CB  . PRO A 1 60  ? 40.845 6.595   25.272  1.00 33.47  ? 56   PRO A CB  1 
ATOM   470  C CG  . PRO A 1 60  ? 39.828 7.672   25.485  1.00 31.55  ? 56   PRO A CG  1 
ATOM   471  C CD  . PRO A 1 60  ? 38.878 7.155   26.528  1.00 27.55  ? 56   PRO A CD  1 
ATOM   472  N N   . GLN A 1 61  ? 41.186 4.060   27.290  1.00 33.81  ? 57   GLN A N   1 
ATOM   473  C CA  . GLN A 1 61  ? 42.050 3.020   27.834  1.00 35.05  ? 57   GLN A CA  1 
ATOM   474  C C   . GLN A 1 61  ? 41.484 1.657   27.459  1.00 32.27  ? 57   GLN A C   1 
ATOM   475  O O   . GLN A 1 61  ? 42.223 0.674   27.346  1.00 36.21  ? 57   GLN A O   1 
ATOM   476  C CB  . GLN A 1 61  ? 42.176 3.168   29.361  1.00 42.33  ? 57   GLN A CB  1 
ATOM   477  C CG  . GLN A 1 61  ? 41.969 1.885   30.175  1.00 50.24  ? 57   GLN A CG  1 
ATOM   478  C CD  . GLN A 1 61  ? 40.641 1.873   30.939  1.00 54.30  ? 57   GLN A CD  1 
ATOM   479  O OE1 . GLN A 1 61  ? 39.996 0.827   31.083  1.00 51.44  ? 57   GLN A OE1 1 
ATOM   480  N NE2 . GLN A 1 61  ? 40.231 3.043   31.430  1.00 53.76  ? 57   GLN A NE2 1 
ATOM   481  N N   . GLY A 1 62  ? 40.170 1.605   27.266  1.00 25.42  ? 58   GLY A N   1 
ATOM   482  C CA  . GLY A 1 62  ? 39.543 0.359   26.883  1.00 21.15  ? 58   GLY A CA  1 
ATOM   483  C C   . GLY A 1 62  ? 40.081 -0.081  25.534  1.00 22.36  ? 58   GLY A C   1 
ATOM   484  O O   . GLY A 1 62  ? 40.351 -1.260  25.312  1.00 20.45  ? 58   GLY A O   1 
ATOM   485  N N   . GLY A 1 63  ? 40.234 0.882   24.629  1.00 23.38  ? 59   GLY A N   1 
ATOM   486  C CA  . GLY A 1 63  ? 40.757 0.591   23.306  1.00 19.14  ? 59   GLY A CA  1 
ATOM   487  C C   . GLY A 1 63  ? 42.235 0.263   23.391  1.00 18.24  ? 59   GLY A C   1 
ATOM   488  O O   . GLY A 1 63  ? 42.659 -0.809  22.972  1.00 20.89  ? 59   GLY A O   1 
ATOM   489  N N   . LEU A 1 64  ? 43.024 1.181   23.936  1.00 13.46  ? 60   LEU A N   1 
ATOM   490  C CA  . LEU A 1 64  ? 44.455 0.953   24.082  1.00 23.13  ? 60   LEU A CA  1 
ATOM   491  C C   . LEU A 1 64  ? 44.738 -0.424  24.691  1.00 26.57  ? 60   LEU A C   1 
ATOM   492  O O   . LEU A 1 64  ? 45.672 -1.123  24.273  1.00 29.80  ? 60   LEU A O   1 
ATOM   493  C CB  . LEU A 1 64  ? 45.078 2.027   24.975  1.00 24.22  ? 60   LEU A CB  1 
ATOM   494  C CG  . LEU A 1 64  ? 44.983 3.467   24.486  1.00 26.39  ? 60   LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 64  ? 44.873 4.392   25.684  1.00 30.02  ? 60   LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 64  ? 46.204 3.807   23.657  1.00 29.74  ? 60   LEU A CD2 1 
ATOM   497  N N   . GLN A 1 65  ? 43.934 -0.809  25.679  1.00 23.14  ? 61   GLN A N   1 
ATOM   498  C CA  . GLN A 1 65  ? 44.112 -2.098  26.331  1.00 24.45  ? 61   GLN A CA  1 
ATOM   499  C C   . GLN A 1 65  ? 43.944 -3.232  25.314  1.00 25.02  ? 61   GLN A C   1 
ATOM   500  O O   . GLN A 1 65  ? 44.651 -4.249  25.361  1.00 19.25  ? 61   GLN A O   1 
ATOM   501  C CB  . GLN A 1 65  ? 43.099 -2.250  27.471  1.00 29.99  ? 61   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 65  ? 43.614 -1.776  28.832  1.00 36.26  ? 61   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 65  ? 42.578 -1.907  29.937  1.00 37.26  ? 61   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 65  ? 41.809 -0.985  30.191  1.00 38.67  ? 61   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 65  ? 42.555 -3.058  30.597  1.00 37.49  ? 61   GLN A NE2 1 
ATOM   506  N N   . ASN A 1 66  ? 43.013 -3.033  24.385  1.00 22.20  ? 62   ASN A N   1 
ATOM   507  C CA  . ASN A 1 66  ? 42.723 -4.009  23.347  1.00 16.15  ? 62   ASN A CA  1 
ATOM   508  C C   . ASN A 1 66  ? 43.802 -3.979  22.280  1.00 18.12  ? 62   ASN A C   1 
ATOM   509  O O   . ASN A 1 66  ? 44.052 -4.984  21.612  1.00 22.29  ? 62   ASN A O   1 
ATOM   510  C CB  . ASN A 1 66  ? 41.365 -3.709  22.712  1.00 19.42  ? 62   ASN A CB  1 
ATOM   511  C CG  . ASN A 1 66  ? 40.330 -4.777  23.010  1.00 18.14  ? 62   ASN A CG  1 
ATOM   512  O OD1 . ASN A 1 66  ? 40.516 -5.612  23.900  1.00 17.39  ? 62   ASN A OD1 1 
ATOM   513  N ND2 . ASN A 1 66  ? 39.234 -4.761  22.260  1.00 17.16  ? 62   ASN A ND2 1 
ATOM   514  N N   . ILE A 1 67  ? 44.441 -2.828  22.107  1.00 19.17  ? 63   ILE A N   1 
ATOM   515  C CA  . ILE A 1 67  ? 45.506 -2.720  21.110  1.00 17.66  ? 63   ILE A CA  1 
ATOM   516  C C   . ILE A 1 67  ? 46.683 -3.530  21.618  1.00 15.69  ? 63   ILE A C   1 
ATOM   517  O O   . ILE A 1 67  ? 47.340 -4.247  20.864  1.00 14.81  ? 63   ILE A O   1 
ATOM   518  C CB  . ILE A 1 67  ? 45.978 -1.262  20.917  1.00 18.11  ? 63   ILE A CB  1 
ATOM   519  C CG1 . ILE A 1 67  ? 44.922 -0.446  20.154  1.00 14.45  ? 63   ILE A CG1 1 
ATOM   520  C CG2 . ILE A 1 67  ? 47.322 -1.250  20.195  1.00 20.11  ? 63   ILE A CG2 1 
ATOM   521  C CD1 . ILE A 1 67  ? 44.382 -1.094  18.892  1.00 16.00  ? 63   ILE A CD1 1 
ATOM   522  N N   . ALA A 1 68  ? 46.933 -3.406  22.917  1.00 16.46  ? 64   ALA A N   1 
ATOM   523  C CA  . ALA A 1 68  ? 48.029 -4.109  23.569  1.00 19.08  ? 64   ALA A CA  1 
ATOM   524  C C   . ALA A 1 68  ? 47.860 -5.626  23.472  1.00 21.34  ? 64   ALA A C   1 
ATOM   525  O O   . ALA A 1 68  ? 48.837 -6.364  23.335  1.00 25.02  ? 64   ALA A O   1 
ATOM   526  C CB  . ALA A 1 68  ? 48.111 -3.686  25.021  1.00 13.74  ? 64   ALA A CB  1 
ATOM   527  N N   . ALA A 1 69  ? 46.610 -6.077  23.551  1.00 23.61  ? 65   ALA A N   1 
ATOM   528  C CA  . ALA A 1 69  ? 46.274 -7.494  23.472  1.00 18.91  ? 65   ALA A CA  1 
ATOM   529  C C   . ALA A 1 69  ? 46.600 -8.036  22.087  1.00 20.01  ? 65   ALA A C   1 
ATOM   530  O O   . ALA A 1 69  ? 47.271 -9.058  21.952  1.00 21.15  ? 65   ALA A O   1 
ATOM   531  C CB  . ALA A 1 69  ? 44.791 -7.691  23.776  1.00 9.82   ? 65   ALA A CB  1 
ATOM   532  N N   . GLU A 1 70  ? 46.128 -7.338  21.059  1.00 22.95  ? 66   GLU A N   1 
ATOM   533  C CA  . GLU A 1 70  ? 46.361 -7.753  19.680  1.00 25.43  ? 66   GLU A CA  1 
ATOM   534  C C   . GLU A 1 70  ? 47.821 -7.636  19.255  1.00 24.78  ? 66   GLU A C   1 
ATOM   535  O O   . GLU A 1 70  ? 48.285 -8.397  18.406  1.00 21.00  ? 66   GLU A O   1 
ATOM   536  C CB  . GLU A 1 70  ? 45.469 -6.948  18.740  1.00 25.62  ? 66   GLU A CB  1 
ATOM   537  C CG  . GLU A 1 70  ? 44.010 -7.390  18.793  1.00 28.92  ? 66   GLU A CG  1 
ATOM   538  C CD  . GLU A 1 70  ? 43.817 -8.823  18.320  1.00 32.82  ? 66   GLU A CD  1 
ATOM   539  O OE1 . GLU A 1 70  ? 43.895 -9.755  19.151  1.00 29.49  ? 66   GLU A OE1 1 
ATOM   540  O OE2 . GLU A 1 70  ? 43.586 -9.022  17.112  1.00 35.41  ? 66   GLU A OE2 1 
ATOM   541  N N   . LYS A 1 71  ? 48.541 -6.688  19.847  1.00 25.83  ? 67   LYS A N   1 
ATOM   542  C CA  . LYS A 1 71  ? 49.956 -6.493  19.539  1.00 26.77  ? 67   LYS A CA  1 
ATOM   543  C C   . LYS A 1 71  ? 50.725 -7.720  20.023  1.00 28.26  ? 67   LYS A C   1 
ATOM   544  O O   . LYS A 1 71  ? 51.615 -8.231  19.336  1.00 29.76  ? 67   LYS A O   1 
ATOM   545  C CB  . LYS A 1 71  ? 50.470 -5.241  20.249  1.00 28.94  ? 67   LYS A CB  1 
ATOM   546  C CG  . LYS A 1 71  ? 51.985 -5.051  20.203  1.00 37.23  ? 67   LYS A CG  1 
ATOM   547  C CD  . LYS A 1 71  ? 52.415 -3.695  20.794  1.00 40.88  ? 67   LYS A CD  1 
ATOM   548  C CE  . LYS A 1 71  ? 51.546 -3.269  21.992  1.00 44.14  ? 67   LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 71  ? 50.877 -1.939  21.813  1.00 37.26  ? 67   LYS A NZ  1 
ATOM   550  N N   . HIS A 1 72  ? 50.359 -8.181  21.218  1.00 28.98  ? 68   HIS A N   1 
ATOM   551  C CA  . HIS A 1 72  ? 50.961 -9.345  21.860  1.00 22.49  ? 68   HIS A CA  1 
ATOM   552  C C   . HIS A 1 72  ? 50.593 -10.561 21.031  1.00 23.29  ? 68   HIS A C   1 
ATOM   553  O O   . HIS A 1 72  ? 51.467 -11.273 20.532  1.00 25.49  ? 68   HIS A O   1 
ATOM   554  C CB  . HIS A 1 72  ? 50.410 -9.468  23.292  1.00 25.61  ? 68   HIS A CB  1 
ATOM   555  C CG  . HIS A 1 72  ? 50.800 -10.729 24.007  1.00 27.20  ? 68   HIS A CG  1 
ATOM   556  N ND1 . HIS A 1 72  ? 52.105 -11.014 24.347  1.00 28.39  ? 68   HIS A ND1 1 
ATOM   557  C CD2 . HIS A 1 72  ? 50.065 -11.794 24.408  1.00 23.91  ? 68   HIS A CD2 1 
ATOM   558  C CE1 . HIS A 1 72  ? 52.160 -12.201 24.928  1.00 23.06  ? 68   HIS A CE1 1 
ATOM   559  N NE2 . HIS A 1 72  ? 50.936 -12.694 24.977  1.00 22.69  ? 68   HIS A NE2 1 
ATOM   560  N N   . ASN A 1 73  ? 49.292 -10.783 20.873  1.00 21.83  ? 69   ASN A N   1 
ATOM   561  C CA  . ASN A 1 73  ? 48.785 -11.893 20.074  1.00 23.75  ? 69   ASN A CA  1 
ATOM   562  C C   . ASN A 1 73  ? 49.379 -11.935 18.671  1.00 25.65  ? 69   ASN A C   1 
ATOM   563  O O   . ASN A 1 73  ? 49.594 -13.014 18.113  1.00 28.68  ? 69   ASN A O   1 
ATOM   564  C CB  . ASN A 1 73  ? 47.268 -11.812 19.964  1.00 23.42  ? 69   ASN A CB  1 
ATOM   565  C CG  . ASN A 1 73  ? 46.575 -12.192 21.250  1.00 23.08  ? 69   ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 73  ? 47.196 -12.718 22.177  1.00 20.52  ? 69   ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 73  ? 45.280 -11.929 21.315  1.00 21.81  ? 69   ASN A ND2 1 
ATOM   568  N N   . LEU A 1 74  ? 49.630 -10.764 18.095  1.00 25.22  ? 70   LEU A N   1 
ATOM   569  C CA  . LEU A 1 74  ? 50.199 -10.707 16.759  1.00 19.58  ? 70   LEU A CA  1 
ATOM   570  C C   . LEU A 1 74  ? 51.503 -11.466 16.776  1.00 20.30  ? 70   LEU A C   1 
ATOM   571  O O   . LEU A 1 74  ? 51.679 -12.403 16.011  1.00 24.71  ? 70   LEU A O   1 
ATOM   572  C CB  . LEU A 1 74  ? 50.451 -9.264  16.334  1.00 17.49  ? 70   LEU A CB  1 
ATOM   573  C CG  . LEU A 1 74  ? 50.956 -9.024  14.904  1.00 24.63  ? 70   LEU A CG  1 
ATOM   574  C CD1 . LEU A 1 74  ? 50.462 -10.085 13.926  1.00 22.08  ? 70   LEU A CD1 1 
ATOM   575  C CD2 . LEU A 1 74  ? 50.466 -7.662  14.463  1.00 34.05  ? 70   LEU A CD2 1 
ATOM   576  N N   . GLY A 1 75  ? 52.410 -11.062 17.664  1.00 24.31  ? 71   GLY A N   1 
ATOM   577  C CA  . GLY A 1 75  ? 53.698 -11.723 17.769  1.00 19.87  ? 71   GLY A CA  1 
ATOM   578  C C   . GLY A 1 75  ? 53.570 -13.232 17.892  1.00 26.39  ? 71   GLY A C   1 
ATOM   579  O O   . GLY A 1 75  ? 54.216 -13.973 17.146  1.00 25.79  ? 71   GLY A O   1 
ATOM   580  N N   . ILE A 1 76  ? 52.731 -13.690 18.824  1.00 24.89  ? 72   ILE A N   1 
ATOM   581  C CA  . ILE A 1 76  ? 52.531 -15.124 19.049  1.00 24.09  ? 72   ILE A CA  1 
ATOM   582  C C   . ILE A 1 76  ? 51.989 -15.870 17.835  1.00 24.42  ? 72   ILE A C   1 
ATOM   583  O O   . ILE A 1 76  ? 52.505 -16.922 17.466  1.00 22.99  ? 72   ILE A O   1 
ATOM   584  C CB  . ILE A 1 76  ? 51.577 -15.385 20.244  1.00 22.18  ? 72   ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 76  ? 52.297 -15.060 21.560  1.00 21.94  ? 72   ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 76  ? 51.125 -16.845 20.243  1.00 11.21  ? 72   ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 76  ? 51.387 -14.942 22.759  1.00 14.56  ? 72   ILE A CD1 1 
ATOM   588  N N   . LEU A 1 77  ? 50.942 -15.330 17.224  1.00 26.68  ? 73   LEU A N   1 
ATOM   589  C CA  . LEU A 1 77  ? 50.345 -15.959 16.057  1.00 26.81  ? 73   LEU A CA  1 
ATOM   590  C C   . LEU A 1 77  ? 51.307 -16.038 14.877  1.00 28.91  ? 73   LEU A C   1 
ATOM   591  O O   . LEU A 1 77  ? 51.362 -17.053 14.193  1.00 34.10  ? 73   LEU A O   1 
ATOM   592  C CB  . LEU A 1 77  ? 49.088 -15.203 15.645  1.00 24.03  ? 73   LEU A CB  1 
ATOM   593  C CG  . LEU A 1 77  ? 47.770 -15.816 16.118  1.00 20.98  ? 73   LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 77  ? 47.541 -17.134 15.402  1.00 18.18  ? 73   LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 77  ? 47.805 -16.020 17.619  1.00 17.97  ? 73   LEU A CD2 1 
ATOM   596  N N   . THR A 1 78  ? 52.067 -14.974 14.638  1.00 33.14  ? 74   THR A N   1 
ATOM   597  C CA  . THR A 1 78  ? 53.022 -14.951 13.524  1.00 36.21  ? 74   THR A CA  1 
ATOM   598  C C   . THR A 1 78  ? 53.936 -16.166 13.558  1.00 33.05  ? 74   THR A C   1 
ATOM   599  O O   . THR A 1 78  ? 54.132 -16.842 12.549  1.00 32.49  ? 74   THR A O   1 
ATOM   600  C CB  . THR A 1 78  ? 53.924 -13.688 13.556  1.00 41.01  ? 74   THR A CB  1 
ATOM   601  O OG1 . THR A 1 78  ? 53.126 -12.510 13.371  1.00 41.97  ? 74   THR A OG1 1 
ATOM   602  C CG2 . THR A 1 78  ? 54.965 -13.759 12.445  1.00 41.34  ? 74   THR A CG2 1 
ATOM   603  N N   . LYS A 1 79  ? 54.494 -16.430 14.733  1.00 33.05  ? 75   LYS A N   1 
ATOM   604  C CA  . LYS A 1 79  ? 55.392 -17.558 14.928  1.00 35.02  ? 75   LYS A CA  1 
ATOM   605  C C   . LYS A 1 79  ? 54.653 -18.887 14.797  1.00 33.70  ? 75   LYS A C   1 
ATOM   606  O O   . LYS A 1 79  ? 55.173 -19.843 14.228  1.00 35.56  ? 75   LYS A O   1 
ATOM   607  C CB  . LYS A 1 79  ? 56.055 -17.466 16.310  1.00 37.63  ? 75   LYS A CB  1 
ATOM   608  C CG  . LYS A 1 79  ? 57.184 -16.435 16.403  1.00 45.19  ? 75   LYS A CG  1 
ATOM   609  C CD  . LYS A 1 79  ? 56.693 -15.004 16.116  1.00 52.35  ? 75   LYS A CD  1 
ATOM   610  C CE  . LYS A 1 79  ? 57.827 -13.971 16.172  1.00 50.62  ? 75   LYS A CE  1 
ATOM   611  N NZ  . LYS A 1 79  ? 57.469 -12.789 17.006  1.00 48.59  ? 75   LYS A NZ  1 
ATOM   612  N N   . ARG A 1 80  ? 53.436 -18.945 15.323  1.00 29.56  ? 76   ARG A N   1 
ATOM   613  C CA  . ARG A 1 80  ? 52.638 -20.161 15.267  1.00 22.73  ? 76   ARG A CA  1 
ATOM   614  C C   . ARG A 1 80  ? 52.286 -20.519 13.836  1.00 29.86  ? 76   ARG A C   1 
ATOM   615  O O   . ARG A 1 80  ? 52.050 -21.683 13.523  1.00 33.68  ? 76   ARG A O   1 
ATOM   616  C CB  . ARG A 1 80  ? 51.351 -19.979 16.060  1.00 15.26  ? 76   ARG A CB  1 
ATOM   617  C CG  . ARG A 1 80  ? 50.741 -21.272 16.531  1.00 10.30  ? 76   ARG A CG  1 
ATOM   618  C CD  . ARG A 1 80  ? 49.355 -21.046 17.117  1.00 20.08  ? 76   ARG A CD  1 
ATOM   619  N NE  . ARG A 1 80  ? 49.393 -20.426 18.443  1.00 16.03  ? 76   ARG A NE  1 
ATOM   620  C CZ  . ARG A 1 80  ? 48.323 -19.962 19.078  1.00 22.99  ? 76   ARG A CZ  1 
ATOM   621  N NH1 . ARG A 1 80  ? 47.129 -20.044 18.506  1.00 18.94  ? 76   ARG A NH1 1 
ATOM   622  N NH2 . ARG A 1 80  ? 48.446 -19.415 20.285  1.00 27.07  ? 76   ARG A NH2 1 
ATOM   623  N N   . SER A 1 81  ? 52.246 -19.510 12.972  1.00 31.25  ? 77   SER A N   1 
ATOM   624  C CA  . SER A 1 81  ? 51.907 -19.697 11.569  1.00 29.25  ? 77   SER A CA  1 
ATOM   625  C C   . SER A 1 81  ? 53.114 -20.095 10.737  1.00 32.40  ? 77   SER A C   1 
ATOM   626  O O   . SER A 1 81  ? 52.972 -20.605 9.622   1.00 32.31  ? 77   SER A O   1 
ATOM   627  C CB  . SER A 1 81  ? 51.344 -18.396 11.013  1.00 29.75  ? 77   SER A CB  1 
ATOM   628  O OG  . SER A 1 81  ? 49.985 -18.251 11.376  1.00 46.23  ? 77   SER A OG  1 
ATOM   629  N N   . ASN A 1 82  ? 54.292 -19.866 11.310  1.00 34.25  ? 78   ASN A N   1 
ATOM   630  C CA  . ASN A 1 82  ? 55.582 -20.105 10.671  1.00 32.81  ? 78   ASN A CA  1 
ATOM   631  C C   . ASN A 1 82  ? 55.768 -18.898 9.770   1.00 30.22  ? 78   ASN A C   1 
ATOM   632  O O   . ASN A 1 82  ? 56.195 -18.988 8.626   1.00 29.34  ? 78   ASN A O   1 
ATOM   633  C CB  . ASN A 1 82  ? 55.624 -21.401 9.853   1.00 35.17  ? 78   ASN A CB  1 
ATOM   634  C CG  . ASN A 1 82  ? 57.055 -21.887 9.613   1.00 40.78  ? 78   ASN A CG  1 
ATOM   635  O OD1 . ASN A 1 82  ? 57.934 -21.715 10.461  1.00 44.70  ? 78   ASN A OD1 1 
ATOM   636  N ND2 . ASN A 1 82  ? 57.293 -22.488 8.453   1.00 47.67  ? 78   ASN A ND2 1 
ATOM   637  N N   . PHE A 1 83  ? 55.376 -17.760 10.318  1.00 31.57  ? 79   PHE A N   1 
ATOM   638  C CA  . PHE A 1 83  ? 55.509 -16.481 9.655   1.00 33.60  ? 79   PHE A CA  1 
ATOM   639  C C   . PHE A 1 83  ? 54.819 -16.317 8.314   1.00 30.22  ? 79   PHE A C   1 
ATOM   640  O O   . PHE A 1 83  ? 55.386 -15.755 7.384   1.00 33.05  ? 79   PHE A O   1 
ATOM   641  C CB  . PHE A 1 83  ? 57.000 -16.151 9.566   1.00 35.17  ? 79   PHE A CB  1 
ATOM   642  C CG  . PHE A 1 83  ? 57.694 -16.241 10.898  1.00 33.90  ? 79   PHE A CG  1 
ATOM   643  C CD1 . PHE A 1 83  ? 58.062 -17.479 11.420  1.00 33.25  ? 79   PHE A CD1 1 
ATOM   644  C CD2 . PHE A 1 83  ? 57.870 -15.105 11.680  1.00 28.75  ? 79   PHE A CD2 1 
ATOM   645  C CE1 . PHE A 1 83  ? 58.583 -17.583 12.698  1.00 31.50  ? 79   PHE A CE1 1 
ATOM   646  C CE2 . PHE A 1 83  ? 58.390 -15.201 12.958  1.00 28.88  ? 79   PHE A CE2 1 
ATOM   647  C CZ  . PHE A 1 83  ? 58.745 -16.444 13.471  1.00 28.58  ? 79   PHE A CZ  1 
ATOM   648  N N   . THR A 1 84  ? 53.584 -16.802 8.226   1.00 30.25  ? 80   THR A N   1 
ATOM   649  C CA  . THR A 1 84  ? 52.795 -16.668 7.009   1.00 25.03  ? 80   THR A CA  1 
ATOM   650  C C   . THR A 1 84  ? 52.375 -15.200 6.929   1.00 29.31  ? 80   THR A C   1 
ATOM   651  O O   . THR A 1 84  ? 51.767 -14.669 7.865   1.00 30.71  ? 80   THR A O   1 
ATOM   652  C CB  . THR A 1 84  ? 51.536 -17.527 7.064   1.00 20.16  ? 80   THR A CB  1 
ATOM   653  O OG1 . THR A 1 84  ? 51.872 -18.841 7.525   1.00 15.87  ? 80   THR A OG1 1 
ATOM   654  C CG2 . THR A 1 84  ? 50.893 -17.601 5.694   1.00 11.69  ? 80   THR A CG2 1 
ATOM   655  N N   . PRO A 1 85  ? 52.706 -14.517 5.819   1.00 27.83  ? 81   PRO A N   1 
ATOM   656  C CA  . PRO A 1 85  ? 52.343 -13.109 5.673   1.00 25.67  ? 81   PRO A CA  1 
ATOM   657  C C   . PRO A 1 85  ? 50.963 -12.903 5.061   1.00 27.22  ? 81   PRO A C   1 
ATOM   658  O O   . PRO A 1 85  ? 50.332 -13.846 4.585   1.00 28.86  ? 81   PRO A O   1 
ATOM   659  C CB  . PRO A 1 85  ? 53.456 -12.547 4.792   1.00 25.88  ? 81   PRO A CB  1 
ATOM   660  C CG  . PRO A 1 85  ? 54.002 -13.742 4.029   1.00 19.02  ? 81   PRO A CG  1 
ATOM   661  C CD  . PRO A 1 85  ? 53.442 -15.008 4.641   1.00 28.15  ? 81   PRO A CD  1 
ATOM   662  N N   . ALA A 1 86  ? 50.503 -11.658 5.083   1.00 27.22  ? 82   ALA A N   1 
ATOM   663  C CA  . ALA A 1 86  ? 49.198 -11.304 4.547   1.00 26.02  ? 82   ALA A CA  1 
ATOM   664  C C   . ALA A 1 86  ? 49.227 -11.336 3.027   1.00 26.96  ? 82   ALA A C   1 
ATOM   665  O O   . ALA A 1 86  ? 50.275 -11.140 2.423   1.00 33.76  ? 82   ALA A O   1 
ATOM   666  C CB  . ALA A 1 86  ? 48.819 -9.920  5.023   1.00 24.29  ? 82   ALA A CB  1 
ATOM   667  N N   . THR A 1 87  ? 48.085 -11.591 2.401   1.00 27.75  ? 83   THR A N   1 
ATOM   668  C CA  . THR A 1 87  ? 48.038 -11.601 0.942   1.00 29.64  ? 83   THR A CA  1 
ATOM   669  C C   . THR A 1 87  ? 47.299 -10.361 0.427   1.00 29.07  ? 83   THR A C   1 
ATOM   670  O O   . THR A 1 87  ? 46.122 -10.147 0.741   1.00 29.59  ? 83   THR A O   1 
ATOM   671  C CB  . THR A 1 87  ? 47.328 -12.856 0.387   1.00 30.76  ? 83   THR A CB  1 
ATOM   672  O OG1 . THR A 1 87  ? 48.037 -14.038 0.783   1.00 30.63  ? 83   THR A OG1 1 
ATOM   673  C CG2 . THR A 1 87  ? 47.280 -12.797 -1.137  1.00 33.56  ? 83   THR A CG2 1 
ATOM   674  N N   . ASN A 1 88  ? 48.003 -9.548  -0.355  1.00 27.45  ? 84   ASN A N   1 
ATOM   675  C CA  . ASN A 1 88  ? 47.434 -8.336  -0.923  1.00 26.43  ? 84   ASN A CA  1 
ATOM   676  C C   . ASN A 1 88  ? 46.278 -8.649  -1.856  1.00 26.17  ? 84   ASN A C   1 
ATOM   677  O O   . ASN A 1 88  ? 46.376 -9.500  -2.740  1.00 32.42  ? 84   ASN A O   1 
ATOM   678  C CB  . ASN A 1 88  ? 48.496 -7.557  -1.692  1.00 26.27  ? 84   ASN A CB  1 
ATOM   679  C CG  . ASN A 1 88  ? 49.640 -7.102  -0.808  1.00 33.09  ? 84   ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 88  ? 50.711 -6.734  -1.304  1.00 30.99  ? 84   ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 88  ? 49.422 -7.124  0.510   1.00 31.16  ? 84   ASN A ND2 1 
ATOM   682  N N   . GLU A 1 89  ? 45.176 -7.951  -1.649  1.00 25.76  ? 85   GLU A N   1 
ATOM   683  C CA  . GLU A 1 89  ? 44.001 -8.130  -2.473  1.00 24.08  ? 85   GLU A CA  1 
ATOM   684  C C   . GLU A 1 89  ? 43.880 -6.861  -3.299  1.00 25.15  ? 85   GLU A C   1 
ATOM   685  O O   . GLU A 1 89  ? 44.538 -5.856  -3.006  1.00 22.24  ? 85   GLU A O   1 
ATOM   686  C CB  . GLU A 1 89  ? 42.773 -8.324  -1.588  1.00 26.24  ? 85   GLU A CB  1 
ATOM   687  C CG  . GLU A 1 89  ? 42.892 -9.525  -0.663  1.00 30.56  ? 85   GLU A CG  1 
ATOM   688  C CD  . GLU A 1 89  ? 42.547 -10.823 -1.362  1.00 29.14  ? 85   GLU A CD  1 
ATOM   689  O OE1 . GLU A 1 89  ? 41.585 -10.813 -2.160  1.00 27.90  ? 85   GLU A OE1 1 
ATOM   690  O OE2 . GLU A 1 89  ? 43.233 -11.844 -1.115  1.00 26.51  ? 85   GLU A OE2 1 
ATOM   691  N N   . ALA A 1 90  ? 43.061 -6.910  -4.343  1.00 23.25  ? 86   ALA A N   1 
ATOM   692  C CA  . ALA A 1 90  ? 42.874 -5.746  -5.192  1.00 21.58  ? 86   ALA A CA  1 
ATOM   693  C C   . ALA A 1 90  ? 41.571 -5.071  -4.785  1.00 17.92  ? 86   ALA A C   1 
ATOM   694  O O   . ALA A 1 90  ? 40.498 -5.673  -4.855  1.00 16.87  ? 86   ALA A O   1 
ATOM   695  C CB  . ALA A 1 90  ? 42.835 -6.167  -6.672  1.00 22.82  ? 86   ALA A CB  1 
ATOM   696  N N   . PRO A 1 91  ? 41.655 -3.814  -4.329  1.00 19.22  ? 87   PRO A N   1 
ATOM   697  C CA  . PRO A 1 91  ? 40.453 -3.080  -3.911  1.00 19.38  ? 87   PRO A CA  1 
ATOM   698  C C   . PRO A 1 91  ? 39.533 -2.717  -5.072  1.00 25.39  ? 87   PRO A C   1 
ATOM   699  O O   . PRO A 1 91  ? 39.933 -2.776  -6.231  1.00 31.51  ? 87   PRO A O   1 
ATOM   700  C CB  . PRO A 1 91  ? 41.003 -1.833  -3.218  1.00 15.01  ? 87   PRO A CB  1 
ATOM   701  C CG  . PRO A 1 91  ? 42.416 -1.679  -3.728  1.00 11.82  ? 87   PRO A CG  1 
ATOM   702  C CD  . PRO A 1 91  ? 42.895 -3.028  -4.171  1.00 12.43  ? 87   PRO A CD  1 
ATOM   703  N N   . GLN A 1 92  ? 38.293 -2.360  -4.756  1.00 29.56  ? 88   GLN A N   1 
ATOM   704  C CA  . GLN A 1 92  ? 37.330 -1.949  -5.770  1.00 30.57  ? 88   GLN A CA  1 
ATOM   705  C C   . GLN A 1 92  ? 36.797 -0.600  -5.308  1.00 29.96  ? 88   GLN A C   1 
ATOM   706  O O   . GLN A 1 92  ? 36.416 -0.451  -4.149  1.00 33.79  ? 88   GLN A O   1 
ATOM   707  C CB  . GLN A 1 92  ? 36.168 -2.946  -5.881  1.00 31.95  ? 88   GLN A CB  1 
ATOM   708  C CG  . GLN A 1 92  ? 36.504 -4.390  -5.524  1.00 39.66  ? 88   GLN A CG  1 
ATOM   709  C CD  . GLN A 1 92  ? 35.292 -5.168  -5.013  1.00 42.47  ? 88   GLN A CD  1 
ATOM   710  O OE1 . GLN A 1 92  ? 35.304 -5.706  -3.905  1.00 44.42  ? 88   GLN A OE1 1 
ATOM   711  N NE2 . GLN A 1 92  ? 34.241 -5.226  -5.822  1.00 47.32  ? 88   GLN A NE2 1 
ATOM   712  N N   . ALA A 1 93  ? 36.784 0.383   -6.202  1.00 24.94  ? 89   ALA A N   1 
ATOM   713  C CA  . ALA A 1 93  ? 36.289 1.706   -5.853  1.00 20.40  ? 89   ALA A CA  1 
ATOM   714  C C   . ALA A 1 93  ? 35.086 2.073   -6.702  1.00 20.29  ? 89   ALA A C   1 
ATOM   715  O O   . ALA A 1 93  ? 34.958 1.617   -7.835  1.00 21.32  ? 89   ALA A O   1 
ATOM   716  C CB  . ALA A 1 93  ? 37.379 2.738   -6.035  1.00 21.76  ? 89   ALA A CB  1 
ATOM   717  N N   . THR A 1 94  ? 34.219 2.912   -6.140  1.00 21.71  ? 90   THR A N   1 
ATOM   718  C CA  . THR A 1 94  ? 32.998 3.375   -6.795  1.00 20.08  ? 90   THR A CA  1 
ATOM   719  C C   . THR A 1 94  ? 32.719 4.792   -6.308  1.00 21.06  ? 90   THR A C   1 
ATOM   720  O O   . THR A 1 94  ? 32.675 5.024   -5.104  1.00 24.66  ? 90   THR A O   1 
ATOM   721  C CB  . THR A 1 94  ? 31.785 2.498   -6.409  1.00 21.56  ? 90   THR A CB  1 
ATOM   722  O OG1 . THR A 1 94  ? 31.900 1.202   -7.016  1.00 21.89  ? 90   THR A OG1 1 
ATOM   723  C CG2 . THR A 1 94  ? 30.501 3.151   -6.855  1.00 18.47  ? 90   THR A CG2 1 
ATOM   724  N N   . VAL A 1 95  ? 32.532 5.735   -7.230  1.00 19.60  ? 91   VAL A N   1 
ATOM   725  C CA  . VAL A 1 95  ? 32.254 7.123   -6.860  1.00 13.83  ? 91   VAL A CA  1 
ATOM   726  C C   . VAL A 1 95  ? 30.781 7.444   -7.089  1.00 15.82  ? 91   VAL A C   1 
ATOM   727  O O   . VAL A 1 95  ? 30.203 7.079   -8.113  1.00 18.36  ? 91   VAL A O   1 
ATOM   728  C CB  . VAL A 1 95  ? 33.122 8.117   -7.674  1.00 10.82  ? 91   VAL A CB  1 
ATOM   729  C CG1 . VAL A 1 95  ? 32.690 9.548   -7.385  1.00 5.82   ? 91   VAL A CG1 1 
ATOM   730  C CG2 . VAL A 1 95  ? 34.588 7.935   -7.329  1.00 3.87   ? 91   VAL A CG2 1 
ATOM   731  N N   . PHE A 1 96  ? 30.166 8.114   -6.123  1.00 20.73  ? 92   PHE A N   1 
ATOM   732  C CA  . PHE A 1 96  ? 28.759 8.472   -6.227  1.00 18.66  ? 92   PHE A CA  1 
ATOM   733  C C   . PHE A 1 96  ? 28.430 9.672   -5.353  1.00 18.08  ? 92   PHE A C   1 
ATOM   734  O O   . PHE A 1 96  ? 29.088 9.902   -4.336  1.00 18.54  ? 92   PHE A O   1 
ATOM   735  C CB  . PHE A 1 96  ? 27.872 7.273   -5.846  1.00 22.81  ? 92   PHE A CB  1 
ATOM   736  C CG  . PHE A 1 96  ? 27.978 6.847   -4.396  1.00 27.28  ? 92   PHE A CG  1 
ATOM   737  C CD1 . PHE A 1 96  ? 28.989 5.982   -3.980  1.00 24.55  ? 92   PHE A CD1 1 
ATOM   738  C CD2 . PHE A 1 96  ? 27.034 7.274   -3.454  1.00 26.10  ? 92   PHE A CD2 1 
ATOM   739  C CE1 . PHE A 1 96  ? 29.060 5.544   -2.646  1.00 22.07  ? 92   PHE A CE1 1 
ATOM   740  C CE2 . PHE A 1 96  ? 27.098 6.843   -2.119  1.00 23.15  ? 92   PHE A CE2 1 
ATOM   741  C CZ  . PHE A 1 96  ? 28.115 5.974   -1.716  1.00 17.85  ? 92   PHE A CZ  1 
ATOM   742  N N   . PRO A 1 97  ? 27.435 10.479  -5.765  1.00 18.76  ? 93   PRO A N   1 
ATOM   743  C CA  . PRO A 1 97  ? 27.003 11.669  -5.026  1.00 20.48  ? 93   PRO A CA  1 
ATOM   744  C C   . PRO A 1 97  ? 25.977 11.360  -3.936  1.00 20.51  ? 93   PRO A C   1 
ATOM   745  O O   . PRO A 1 97  ? 25.095 10.522  -4.111  1.00 19.46  ? 93   PRO A O   1 
ATOM   746  C CB  . PRO A 1 97  ? 26.436 12.582  -6.110  1.00 20.78  ? 93   PRO A CB  1 
ATOM   747  C CG  . PRO A 1 97  ? 26.021 11.659  -7.218  1.00 18.93  ? 93   PRO A CG  1 
ATOM   748  C CD  . PRO A 1 97  ? 26.681 10.315  -7.022  1.00 21.44  ? 93   PRO A CD  1 
ATOM   749  N N   . LYS A 1 98  ? 26.105 12.049  -2.807  1.00 23.24  ? 94   LYS A N   1 
ATOM   750  C CA  . LYS A 1 98  ? 25.209 11.844  -1.678  1.00 23.76  ? 94   LYS A CA  1 
ATOM   751  C C   . LYS A 1 98  ? 23.770 12.163  -2.055  1.00 23.38  ? 94   LYS A C   1 
ATOM   752  O O   . LYS A 1 98  ? 22.834 11.523  -1.582  1.00 28.09  ? 94   LYS A O   1 
ATOM   753  C CB  . LYS A 1 98  ? 25.656 12.724  -0.507  1.00 25.03  ? 94   LYS A CB  1 
ATOM   754  C CG  . LYS A 1 98  ? 25.123 12.314  0.854   1.00 21.81  ? 94   LYS A CG  1 
ATOM   755  C CD  . LYS A 1 98  ? 25.710 13.204  1.957   1.00 22.83  ? 94   LYS A CD  1 
ATOM   756  C CE  . LYS A 1 98  ? 24.635 13.695  2.927   1.00 14.48  ? 94   LYS A CE  1 
ATOM   757  N NZ  . LYS A 1 98  ? 24.023 12.556  3.656   1.00 11.95  ? 94   LYS A NZ  1 
ATOM   758  N N   . SER A 1 99  ? 23.599 13.157  -2.914  1.00 24.96  ? 95   SER A N   1 
ATOM   759  C CA  . SER A 1 99  ? 22.271 13.568  -3.349  1.00 23.47  ? 95   SER A CA  1 
ATOM   760  C C   . SER A 1 99  ? 22.251 13.828  -4.850  1.00 22.21  ? 95   SER A C   1 
ATOM   761  O O   . SER A 1 99  ? 23.292 13.822  -5.505  1.00 22.95  ? 95   SER A O   1 
ATOM   762  C CB  . SER A 1 99  ? 21.856 14.842  -2.612  1.00 23.80  ? 95   SER A CB  1 
ATOM   763  O OG  . SER A 1 99  ? 22.960 15.425  -1.940  1.00 32.42  ? 95   SER A OG  1 
ATOM   764  N N   . PRO A 1 100 ? 21.056 14.035  -5.420  1.00 22.93  ? 96   PRO A N   1 
ATOM   765  C CA  . PRO A 1 100 ? 20.951 14.305  -6.856  1.00 21.89  ? 96   PRO A CA  1 
ATOM   766  C C   . PRO A 1 100 ? 21.822 15.489  -7.243  1.00 24.47  ? 96   PRO A C   1 
ATOM   767  O O   . PRO A 1 100 ? 21.674 16.580  -6.689  1.00 25.37  ? 96   PRO A O   1 
ATOM   768  C CB  . PRO A 1 100 ? 19.470 14.618  -7.068  1.00 24.48  ? 96   PRO A CB  1 
ATOM   769  C CG  . PRO A 1 100 ? 18.905 14.845  -5.679  1.00 28.39  ? 96   PRO A CG  1 
ATOM   770  C CD  . PRO A 1 100 ? 19.735 13.996  -4.770  1.00 21.30  ? 96   PRO A CD  1 
ATOM   771  N N   . VAL A 1 101 ? 22.733 15.266  -8.185  1.00 24.55  ? 97   VAL A N   1 
ATOM   772  C CA  . VAL A 1 101 ? 23.618 16.320  -8.650  1.00 25.30  ? 97   VAL A CA  1 
ATOM   773  C C   . VAL A 1 101 ? 22.789 17.371  -9.385  1.00 25.16  ? 97   VAL A C   1 
ATOM   774  O O   . VAL A 1 101 ? 22.077 17.072  -10.341 1.00 26.66  ? 97   VAL A O   1 
ATOM   775  C CB  . VAL A 1 101 ? 24.704 15.766  -9.610  1.00 23.60  ? 97   VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 101 ? 25.739 16.824  -9.883  1.00 28.95  ? 97   VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 101 ? 25.371 14.547  -9.012  1.00 23.93  ? 97   VAL A CG2 1 
ATOM   778  N N   . LEU A 1 102 ? 22.864 18.602  -8.912  1.00 21.95  ? 98   LEU A N   1 
ATOM   779  C CA  . LEU A 1 102 ? 22.141 19.682  -9.535  1.00 20.18  ? 98   LEU A CA  1 
ATOM   780  C C   . LEU A 1 102 ? 23.168 20.773  -9.748  1.00 21.99  ? 98   LEU A C   1 
ATOM   781  O O   . LEU A 1 102 ? 23.806 21.219  -8.803  1.00 21.60  ? 98   LEU A O   1 
ATOM   782  C CB  . LEU A 1 102 ? 21.009 20.151  -8.625  1.00 22.28  ? 98   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 102 ? 19.614 20.123  -9.266  1.00 26.90  ? 98   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 102 ? 19.495 18.983  -10.286 1.00 23.28  ? 98   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 102 ? 18.575 19.971  -8.169  1.00 28.64  ? 98   LEU A CD2 1 
ATOM   786  N N   . LEU A 1 103 ? 23.344 21.180  -11.001 1.00 24.91  ? 99   LEU A N   1 
ATOM   787  C CA  . LEU A 1 103 ? 24.321 22.202  -11.353 1.00 26.49  ? 99   LEU A CA  1 
ATOM   788  C C   . LEU A 1 103 ? 24.291 23.404  -10.432 1.00 26.24  ? 99   LEU A C   1 
ATOM   789  O O   . LEU A 1 103 ? 23.258 24.053  -10.290 1.00 27.82  ? 99   LEU A O   1 
ATOM   790  C CB  . LEU A 1 103 ? 24.101 22.661  -12.794 1.00 26.15  ? 99   LEU A CB  1 
ATOM   791  C CG  . LEU A 1 103 ? 24.972 21.921  -13.807 1.00 25.35  ? 99   LEU A CG  1 
ATOM   792  C CD1 . LEU A 1 103 ? 24.569 22.290  -15.211 1.00 23.21  ? 99   LEU A CD1 1 
ATOM   793  C CD2 . LEU A 1 103 ? 26.420 22.265  -13.553 1.00 22.67  ? 99   LEU A CD2 1 
ATOM   794  N N   . GLY A 1 104 ? 25.428 23.696  -9.802  1.00 27.86  ? 100  GLY A N   1 
ATOM   795  C CA  . GLY A 1 104 ? 25.474 24.789  -8.849  1.00 25.56  ? 100  GLY A CA  1 
ATOM   796  C C   . GLY A 1 104 ? 24.975 24.580  -7.429  1.00 26.59  ? 100  GLY A C   1 
ATOM   797  O O   . GLY A 1 104 ? 25.126 25.472  -6.601  1.00 27.16  ? 100  GLY A O   1 
ATOM   798  N N   . GLN A 1 105 ? 24.388 23.428  -7.125  1.00 24.75  ? 101  GLN A N   1 
ATOM   799  C CA  . GLN A 1 105 ? 23.908 23.191  -5.766  1.00 22.40  ? 101  GLN A CA  1 
ATOM   800  C C   . GLN A 1 105 ? 24.938 22.370  -4.995  1.00 24.78  ? 101  GLN A C   1 
ATOM   801  O O   . GLN A 1 105 ? 25.328 21.290  -5.438  1.00 26.09  ? 101  GLN A O   1 
ATOM   802  C CB  . GLN A 1 105 ? 22.565 22.463  -5.786  1.00 25.58  ? 101  GLN A CB  1 
ATOM   803  C CG  . GLN A 1 105 ? 22.085 22.005  -4.403  1.00 35.84  ? 101  GLN A CG  1 
ATOM   804  C CD  . GLN A 1 105 ? 20.652 21.495  -4.410  1.00 42.75  ? 101  GLN A CD  1 
ATOM   805  O OE1 . GLN A 1 105 ? 20.396 20.331  -4.745  1.00 44.26  ? 101  GLN A OE1 1 
ATOM   806  N NE2 . GLN A 1 105 ? 19.710 22.360  -4.032  1.00 42.65  ? 101  GLN A NE2 1 
ATOM   807  N N   . PRO A 1 106 ? 25.403 22.879  -3.842  1.00 22.06  ? 102  PRO A N   1 
ATOM   808  C CA  . PRO A 1 106 ? 26.397 22.219  -2.982  1.00 18.23  ? 102  PRO A CA  1 
ATOM   809  C C   . PRO A 1 106 ? 26.090 20.760  -2.758  1.00 17.06  ? 102  PRO A C   1 
ATOM   810  O O   . PRO A 1 106 ? 24.974 20.406  -2.402  1.00 22.81  ? 102  PRO A O   1 
ATOM   811  C CB  . PRO A 1 106 ? 26.333 23.004  -1.689  1.00 19.35  ? 102  PRO A CB  1 
ATOM   812  C CG  . PRO A 1 106 ? 25.944 24.363  -2.126  1.00 21.79  ? 102  PRO A CG  1 
ATOM   813  C CD  . PRO A 1 106 ? 24.983 24.171  -3.272  1.00 21.35  ? 102  PRO A CD  1 
ATOM   814  N N   . ASN A 1 107 ? 27.089 19.912  -2.934  1.00 19.12  ? 103  ASN A N   1 
ATOM   815  C CA  . ASN A 1 107 ? 26.882 18.475  -2.779  1.00 20.08  ? 103  ASN A CA  1 
ATOM   816  C C   . ASN A 1 107 ? 28.135 17.819  -2.223  1.00 17.03  ? 103  ASN A C   1 
ATOM   817  O O   . ASN A 1 107 ? 29.132 18.489  -1.989  1.00 19.05  ? 103  ASN A O   1 
ATOM   818  C CB  . ASN A 1 107 ? 26.528 17.874  -4.151  1.00 17.70  ? 103  ASN A CB  1 
ATOM   819  C CG  . ASN A 1 107 ? 25.808 16.548  -4.054  1.00 18.01  ? 103  ASN A CG  1 
ATOM   820  O OD1 . ASN A 1 107 ? 25.170 16.124  -5.007  1.00 25.95  ? 103  ASN A OD1 1 
ATOM   821  N ND2 . ASN A 1 107 ? 25.910 15.884  -2.911  1.00 24.16  ? 103  ASN A ND2 1 
ATOM   822  N N   . THR A 1 108 ? 28.071 16.510  -2.002  1.00 20.70  ? 104  THR A N   1 
ATOM   823  C CA  . THR A 1 108 ? 29.271 15.730  -1.650  1.00 20.94  ? 104  THR A CA  1 
ATOM   824  C C   . THR A 1 108 ? 29.514 14.486  -2.491  1.00 19.50  ? 104  THR A C   1 
ATOM   825  O O   . THR A 1 108 ? 28.616 13.663  -2.674  1.00 19.17  ? 104  THR A O   1 
ATOM   826  C CB  . THR A 1 108 ? 29.058 15.258  -0.188  1.00 16.51  ? 104  THR A CB  1 
ATOM   827  O OG1 . THR A 1 108 ? 29.011 16.386  0.693   1.00 14.00  ? 104  THR A OG1 1 
ATOM   828  C CG2 . THR A 1 108 ? 30.195 14.349  0.239   1.00 14.90  ? 104  THR A CG2 1 
ATOM   829  N N   . LEU A 1 109 ? 30.730 14.347  -2.999  1.00 18.10  ? 105  LEU A N   1 
ATOM   830  C CA  . LEU A 1 109 ? 31.080 13.176  -3.788  1.00 16.75  ? 105  LEU A CA  1 
ATOM   831  C C   . LEU A 1 109 ? 31.551 12.103  -2.818  1.00 15.79  ? 105  LEU A C   1 
ATOM   832  O O   . LEU A 1 109 ? 32.265 12.395  -1.853  1.00 12.90  ? 105  LEU A O   1 
ATOM   833  C CB  . LEU A 1 109 ? 32.218 13.496  -4.763  1.00 17.84  ? 105  LEU A CB  1 
ATOM   834  C CG  . LEU A 1 109 ? 32.100 12.980  -6.199  1.00 20.41  ? 105  LEU A CG  1 
ATOM   835  C CD1 . LEU A 1 109 ? 30.756 13.373  -6.789  1.00 21.97  ? 105  LEU A CD1 1 
ATOM   836  C CD2 . LEU A 1 109 ? 33.224 13.572  -7.038  1.00 19.22  ? 105  LEU A CD2 1 
ATOM   837  N N   . ILE A 1 110 ? 31.156 10.860  -3.068  1.00 13.35  ? 106  ILE A N   1 
ATOM   838  C CA  . ILE A 1 110 ? 31.592 9.779   -2.196  1.00 15.23  ? 106  ILE A CA  1 
ATOM   839  C C   . ILE A 1 110 ? 32.344 8.670   -2.938  1.00 14.43  ? 106  ILE A C   1 
ATOM   840  O O   . ILE A 1 110 ? 31.925 8.215   -4.006  1.00 9.85   ? 106  ILE A O   1 
ATOM   841  C CB  . ILE A 1 110 ? 30.408 9.165   -1.417  1.00 14.40  ? 106  ILE A CB  1 
ATOM   842  C CG1 . ILE A 1 110 ? 29.561 10.280  -0.795  1.00 10.71  ? 106  ILE A CG1 1 
ATOM   843  C CG2 . ILE A 1 110 ? 30.940 8.241   -0.315  1.00 12.22  ? 106  ILE A CG2 1 
ATOM   844  C CD1 . ILE A 1 110 ? 28.135 9.876   -0.492  1.00 15.93  ? 106  ILE A CD1 1 
ATOM   845  N N   . CYS A 1 111 ? 33.463 8.243   -2.355  1.00 15.89  ? 107  CYS A N   1 
ATOM   846  C CA  . CYS A 1 111 ? 34.261 7.179   -2.939  1.00 11.89  ? 107  CYS A CA  1 
ATOM   847  C C   . CYS A 1 111 ? 34.327 5.987   -1.996  1.00 12.19  ? 107  CYS A C   1 
ATOM   848  O O   . CYS A 1 111 ? 35.018 6.011   -0.976  1.00 12.78  ? 107  CYS A O   1 
ATOM   849  C CB  . CYS A 1 111 ? 35.669 7.680   -3.225  1.00 14.21  ? 107  CYS A CB  1 
ATOM   850  S SG  . CYS A 1 111 ? 36.644 6.647   -4.371  1.00 17.89  ? 107  CYS A SG  1 
ATOM   851  N N   . PHE A 1 112 ? 33.591 4.943   -2.355  1.00 16.95  ? 108  PHE A N   1 
ATOM   852  C CA  . PHE A 1 112 ? 33.537 3.702   -1.596  1.00 15.39  ? 108  PHE A CA  1 
ATOM   853  C C   . PHE A 1 112 ? 34.568 2.734   -2.169  1.00 17.10  ? 108  PHE A C   1 
ATOM   854  O O   . PHE A 1 112 ? 34.465 2.319   -3.324  1.00 11.94  ? 108  PHE A O   1 
ATOM   855  C CB  . PHE A 1 112 ? 32.141 3.086   -1.728  1.00 17.27  ? 108  PHE A CB  1 
ATOM   856  C CG  . PHE A 1 112 ? 32.008 1.714   -1.113  1.00 15.30  ? 108  PHE A CG  1 
ATOM   857  C CD1 . PHE A 1 112 ? 32.122 1.539   0.256   1.00 18.68  ? 108  PHE A CD1 1 
ATOM   858  C CD2 . PHE A 1 112 ? 31.733 0.608   -1.900  1.00 18.48  ? 108  PHE A CD2 1 
ATOM   859  C CE1 . PHE A 1 112 ? 31.960 0.293   0.826   1.00 13.49  ? 108  PHE A CE1 1 
ATOM   860  C CE2 . PHE A 1 112 ? 31.569 -0.649  -1.333  1.00 15.40  ? 108  PHE A CE2 1 
ATOM   861  C CZ  . PHE A 1 112 ? 31.683 -0.801  0.031   1.00 17.54  ? 108  PHE A CZ  1 
ATOM   862  N N   . VAL A 1 113 ? 35.562 2.382   -1.362  1.00 18.42  ? 109  VAL A N   1 
ATOM   863  C CA  . VAL A 1 113 ? 36.600 1.447   -1.782  1.00 16.14  ? 109  VAL A CA  1 
ATOM   864  C C   . VAL A 1 113 ? 36.416 0.158   -0.966  1.00 15.98  ? 109  VAL A C   1 
ATOM   865  O O   . VAL A 1 113 ? 36.389 0.195   0.262   1.00 12.64  ? 109  VAL A O   1 
ATOM   866  C CB  . VAL A 1 113 ? 38.001 2.061   -1.537  1.00 18.32  ? 109  VAL A CB  1 
ATOM   867  C CG1 . VAL A 1 113 ? 39.093 1.081   -1.919  1.00 15.13  ? 109  VAL A CG1 1 
ATOM   868  C CG2 . VAL A 1 113 ? 38.135 3.349   -2.333  1.00 11.36  ? 109  VAL A CG2 1 
ATOM   869  N N   . ASP A 1 114 ? 36.277 -0.973  -1.657  1.00 17.82  ? 110  ASP A N   1 
ATOM   870  C CA  . ASP A 1 114 ? 36.063 -2.268  -1.007  1.00 18.42  ? 110  ASP A CA  1 
ATOM   871  C C   . ASP A 1 114 ? 37.200 -3.272  -1.223  1.00 16.83  ? 110  ASP A C   1 
ATOM   872  O O   . ASP A 1 114 ? 38.144 -3.010  -1.954  1.00 21.02  ? 110  ASP A O   1 
ATOM   873  C CB  . ASP A 1 114 ? 34.753 -2.880  -1.521  1.00 19.83  ? 110  ASP A CB  1 
ATOM   874  C CG  . ASP A 1 114 ? 34.002 -3.665  -0.454  1.00 18.08  ? 110  ASP A CG  1 
ATOM   875  O OD1 . ASP A 1 114 ? 34.630 -4.169  0.505   1.00 16.69  ? 110  ASP A OD1 1 
ATOM   876  O OD2 . ASP A 1 114 ? 32.767 -3.779  -0.585  1.00 20.33  ? 110  ASP A OD2 1 
ATOM   877  N N   . ASN A 1 115 ? 37.078 -4.431  -0.582  1.00 19.07  ? 111  ASN A N   1 
ATOM   878  C CA  . ASN A 1 115 ? 38.054 -5.514  -0.671  1.00 20.86  ? 111  ASN A CA  1 
ATOM   879  C C   . ASN A 1 115 ? 39.467 -5.059  -0.327  1.00 23.70  ? 111  ASN A C   1 
ATOM   880  O O   . ASN A 1 115 ? 40.437 -5.438  -0.988  1.00 27.50  ? 111  ASN A O   1 
ATOM   881  C CB  . ASN A 1 115 ? 38.034 -6.143  -2.070  1.00 21.99  ? 111  ASN A CB  1 
ATOM   882  C CG  . ASN A 1 115 ? 38.560 -7.580  -2.079  1.00 26.34  ? 111  ASN A CG  1 
ATOM   883  O OD1 . ASN A 1 115 ? 38.246 -8.378  -1.190  1.00 26.02  ? 111  ASN A OD1 1 
ATOM   884  N ND2 . ASN A 1 115 ? 39.363 -7.912  -3.093  1.00 20.79  ? 111  ASN A ND2 1 
ATOM   885  N N   . ILE A 1 116 ? 39.577 -4.261  0.728   1.00 22.28  ? 112  ILE A N   1 
ATOM   886  C CA  . ILE A 1 116 ? 40.863 -3.747  1.165   1.00 19.78  ? 112  ILE A CA  1 
ATOM   887  C C   . ILE A 1 116 ? 41.576 -4.655  2.161   1.00 22.60  ? 112  ILE A C   1 
ATOM   888  O O   . ILE A 1 116 ? 41.084 -4.898  3.260   1.00 23.98  ? 112  ILE A O   1 
ATOM   889  C CB  . ILE A 1 116 ? 40.715 -2.366  1.832   1.00 19.28  ? 112  ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 116 ? 40.031 -1.394  0.870   1.00 18.94  ? 112  ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 116 ? 42.075 -1.838  2.275   1.00 14.55  ? 112  ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 116 ? 39.662 -0.050  1.485   1.00 12.76  ? 112  ILE A CD1 1 
ATOM   893  N N   . PHE A 1 117 ? 42.738 -5.152  1.752   1.00 25.31  ? 113  PHE A N   1 
ATOM   894  C CA  . PHE A 1 117 ? 43.582 -5.987  2.598   1.00 29.11  ? 113  PHE A CA  1 
ATOM   895  C C   . PHE A 1 117 ? 44.971 -6.127  1.973   1.00 29.68  ? 113  PHE A C   1 
ATOM   896  O O   . PHE A 1 117 ? 45.100 -6.487  0.804   1.00 31.06  ? 113  PHE A O   1 
ATOM   897  C CB  . PHE A 1 117 ? 42.972 -7.371  2.854   1.00 27.36  ? 113  PHE A CB  1 
ATOM   898  C CG  . PHE A 1 117 ? 43.625 -8.099  4.005   1.00 23.65  ? 113  PHE A CG  1 
ATOM   899  C CD1 . PHE A 1 117 ? 44.824 -8.776  3.818   1.00 24.29  ? 113  PHE A CD1 1 
ATOM   900  C CD2 . PHE A 1 117 ? 43.099 -8.030  5.288   1.00 22.34  ? 113  PHE A CD2 1 
ATOM   901  C CE1 . PHE A 1 117 ? 45.497 -9.348  4.881   1.00 16.07  ? 113  PHE A CE1 1 
ATOM   902  C CE2 . PHE A 1 117 ? 43.769 -8.603  6.359   1.00 19.43  ? 113  PHE A CE2 1 
ATOM   903  C CZ  . PHE A 1 117 ? 44.974 -9.265  6.150   1.00 17.84  ? 113  PHE A CZ  1 
ATOM   904  N N   . PRO A 1 118 ? 46.028 -5.857  2.748   1.00 30.13  ? 114  PRO A N   1 
ATOM   905  C CA  . PRO A 1 118 ? 45.928 -5.437  4.152   1.00 28.41  ? 114  PRO A CA  1 
ATOM   906  C C   . PRO A 1 118 ? 45.304 -4.068  4.383   1.00 26.66  ? 114  PRO A C   1 
ATOM   907  O O   . PRO A 1 118 ? 45.216 -3.241  3.473   1.00 26.53  ? 114  PRO A O   1 
ATOM   908  C CB  . PRO A 1 118 ? 47.365 -5.477  4.654   1.00 27.38  ? 114  PRO A CB  1 
ATOM   909  C CG  . PRO A 1 118 ? 48.192 -5.289  3.439   1.00 31.40  ? 114  PRO A CG  1 
ATOM   910  C CD  . PRO A 1 118 ? 47.434 -5.931  2.298   1.00 30.06  ? 114  PRO A CD  1 
ATOM   911  N N   . PRO A 1 119 ? 44.880 -3.800  5.621   1.00 24.44  ? 115  PRO A N   1 
ATOM   912  C CA  . PRO A 1 119 ? 44.269 -2.500  5.918   1.00 22.75  ? 115  PRO A CA  1 
ATOM   913  C C   . PRO A 1 119 ? 45.252 -1.325  5.841   1.00 25.55  ? 115  PRO A C   1 
ATOM   914  O O   . PRO A 1 119 ? 45.503 -0.653  6.846   1.00 23.33  ? 115  PRO A O   1 
ATOM   915  C CB  . PRO A 1 119 ? 43.690 -2.685  7.315   1.00 23.20  ? 115  PRO A CB  1 
ATOM   916  C CG  . PRO A 1 119 ? 44.519 -3.789  7.926   1.00 19.67  ? 115  PRO A CG  1 
ATOM   917  C CD  . PRO A 1 119 ? 44.938 -4.677  6.800   1.00 18.54  ? 115  PRO A CD  1 
ATOM   918  N N   . VAL A 1 120 ? 45.814 -1.099  4.650   1.00 24.34  ? 116  VAL A N   1 
ATOM   919  C CA  . VAL A 1 120 ? 46.743 0.008   4.402   1.00 18.72  ? 116  VAL A CA  1 
ATOM   920  C C   . VAL A 1 120 ? 46.394 0.523   3.014   1.00 22.12  ? 116  VAL A C   1 
ATOM   921  O O   . VAL A 1 120 ? 46.414 -0.237  2.043   1.00 22.74  ? 116  VAL A O   1 
ATOM   922  C CB  . VAL A 1 120 ? 48.218 -0.442  4.399   1.00 20.24  ? 116  VAL A CB  1 
ATOM   923  C CG1 . VAL A 1 120 ? 49.113 0.716   3.946   1.00 12.21  ? 116  VAL A CG1 1 
ATOM   924  C CG2 . VAL A 1 120 ? 48.625 -0.903  5.790   1.00 15.62  ? 116  VAL A CG2 1 
ATOM   925  N N   . ILE A 1 121 ? 46.071 1.809   2.914   1.00 21.83  ? 117  ILE A N   1 
ATOM   926  C CA  . ILE A 1 121 ? 45.672 2.373   1.630   1.00 19.32  ? 117  ILE A CA  1 
ATOM   927  C C   . ILE A 1 121 ? 45.755 3.897   1.594   1.00 21.51  ? 117  ILE A C   1 
ATOM   928  O O   . ILE A 1 121 ? 45.827 4.557   2.632   1.00 21.33  ? 117  ILE A O   1 
ATOM   929  C CB  . ILE A 1 121 ? 44.217 1.924   1.272   1.00 19.93  ? 117  ILE A CB  1 
ATOM   930  C CG1 . ILE A 1 121 ? 44.044 1.821   -0.247  1.00 20.53  ? 117  ILE A CG1 1 
ATOM   931  C CG2 . ILE A 1 121 ? 43.203 2.891   1.883   1.00 18.53  ? 117  ILE A CG2 1 
ATOM   932  C CD1 . ILE A 1 121 ? 42.679 1.300   -0.677  1.00 18.76  ? 117  ILE A CD1 1 
ATOM   933  N N   . ASN A 1 122 ? 45.731 4.432   0.374   1.00 25.01  ? 118  ASN A N   1 
ATOM   934  C CA  . ASN A 1 122 ? 45.816 5.865   0.102   1.00 25.21  ? 118  ASN A CA  1 
ATOM   935  C C   . ASN A 1 122 ? 44.642 6.319   -0.766  1.00 25.04  ? 118  ASN A C   1 
ATOM   936  O O   . ASN A 1 122 ? 44.624 6.055   -1.971  1.00 24.98  ? 118  ASN A O   1 
ATOM   937  C CB  . ASN A 1 122 ? 47.113 6.165   -0.659  1.00 33.30  ? 118  ASN A CB  1 
ATOM   938  C CG  . ASN A 1 122 ? 48.143 6.864   0.191   1.00 34.27  ? 118  ASN A CG  1 
ATOM   939  O OD1 . ASN A 1 122 ? 49.324 6.929   -0.163  1.00 36.25  ? 118  ASN A OD1 1 
ATOM   940  N ND2 . ASN A 1 122 ? 47.704 7.395   1.323   1.00 44.54  ? 118  ASN A ND2 1 
ATOM   941  N N   . ILE A 1 123 ? 43.669 7.001   -0.172  1.00 22.08  ? 119  ILE A N   1 
ATOM   942  C CA  . ILE A 1 123 ? 42.534 7.482   -0.952  1.00 20.47  ? 119  ILE A CA  1 
ATOM   943  C C   . ILE A 1 123 ? 42.632 8.997   -1.103  1.00 23.86  ? 119  ILE A C   1 
ATOM   944  O O   . ILE A 1 123 ? 42.669 9.726   -0.119  1.00 30.29  ? 119  ILE A O   1 
ATOM   945  C CB  . ILE A 1 123 ? 41.189 7.096   -0.303  1.00 17.72  ? 119  ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 123 ? 41.044 5.565   -0.282  1.00 9.93   ? 119  ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 123 ? 40.040 7.734   -1.081  1.00 12.66  ? 119  ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 123 ? 39.847 5.050   0.523   1.00 6.45   ? 119  ILE A CD1 1 
ATOM   949  N N   . THR A 1 124 ? 42.696 9.461   -2.347  1.00 28.08  ? 120  THR A N   1 
ATOM   950  C CA  . THR A 1 124 ? 42.824 10.885  -2.636  1.00 27.15  ? 120  THR A CA  1 
ATOM   951  C C   . THR A 1 124 ? 41.933 11.358  -3.795  1.00 22.17  ? 120  THR A C   1 
ATOM   952  O O   . THR A 1 124 ? 41.477 10.559  -4.610  1.00 23.43  ? 120  THR A O   1 
ATOM   953  C CB  . THR A 1 124 ? 44.296 11.226  -2.929  1.00 27.65  ? 120  THR A CB  1 
ATOM   954  O OG1 . THR A 1 124 ? 44.877 10.193  -3.734  1.00 36.09  ? 120  THR A OG1 1 
ATOM   955  C CG2 . THR A 1 124 ? 45.074 11.320  -1.628  1.00 24.49  ? 120  THR A CG2 1 
ATOM   956  N N   . TRP A 1 125 ? 41.698 12.663  -3.859  1.00 18.66  ? 121  TRP A N   1 
ATOM   957  C CA  . TRP A 1 125 ? 40.835 13.255  -4.880  1.00 24.81  ? 121  TRP A CA  1 
ATOM   958  C C   . TRP A 1 125 ? 41.541 14.197  -5.848  1.00 25.58  ? 121  TRP A C   1 
ATOM   959  O O   . TRP A 1 125 ? 42.429 14.948  -5.450  1.00 26.67  ? 121  TRP A O   1 
ATOM   960  C CB  . TRP A 1 125 ? 39.705 14.036  -4.205  1.00 23.17  ? 121  TRP A CB  1 
ATOM   961  C CG  . TRP A 1 125 ? 38.767 13.186  -3.418  1.00 22.17  ? 121  TRP A CG  1 
ATOM   962  C CD1 . TRP A 1 125 ? 38.831 12.919  -2.084  1.00 18.97  ? 121  TRP A CD1 1 
ATOM   963  C CD2 . TRP A 1 125 ? 37.600 12.508  -3.911  1.00 22.85  ? 121  TRP A CD2 1 
ATOM   964  N NE1 . TRP A 1 125 ? 37.776 12.119  -1.712  1.00 22.85  ? 121  TRP A NE1 1 
ATOM   965  C CE2 . TRP A 1 125 ? 37.005 11.852  -2.813  1.00 19.08  ? 121  TRP A CE2 1 
ATOM   966  C CE3 . TRP A 1 125 ? 37.000 12.393  -5.176  1.00 20.95  ? 121  TRP A CE3 1 
ATOM   967  C CZ2 . TRP A 1 125 ? 35.837 11.089  -2.937  1.00 17.39  ? 121  TRP A CZ2 1 
ATOM   968  C CZ3 . TRP A 1 125 ? 35.834 11.631  -5.300  1.00 14.72  ? 121  TRP A CZ3 1 
ATOM   969  C CH2 . TRP A 1 125 ? 35.268 10.992  -4.186  1.00 17.01  ? 121  TRP A CH2 1 
ATOM   970  N N   . LEU A 1 126 ? 41.122 14.169  -7.113  1.00 26.63  ? 122  LEU A N   1 
ATOM   971  C CA  . LEU A 1 126 ? 41.694 15.047  -8.132  1.00 24.28  ? 122  LEU A CA  1 
ATOM   972  C C   . LEU A 1 126 ? 40.573 15.723  -8.916  1.00 26.74  ? 122  LEU A C   1 
ATOM   973  O O   . LEU A 1 126 ? 39.625 15.068  -9.342  1.00 28.23  ? 122  LEU A O   1 
ATOM   974  C CB  . LEU A 1 126 ? 42.561 14.262  -9.113  1.00 20.21  ? 122  LEU A CB  1 
ATOM   975  C CG  . LEU A 1 126 ? 43.802 13.521  -8.635  1.00 20.65  ? 122  LEU A CG  1 
ATOM   976  C CD1 . LEU A 1 126 ? 44.410 12.797  -9.810  1.00 21.18  ? 122  LEU A CD1 1 
ATOM   977  C CD2 . LEU A 1 126 ? 44.803 14.488  -8.068  1.00 26.89  ? 122  LEU A CD2 1 
ATOM   978  N N   . ARG A 1 127 ? 40.677 17.035  -9.091  1.00 28.94  ? 123  ARG A N   1 
ATOM   979  C CA  . ARG A 1 127 ? 39.691 17.784  -9.856  1.00 30.84  ? 123  ARG A CA  1 
ATOM   980  C C   . ARG A 1 127 ? 40.433 18.283  -11.071 1.00 31.76  ? 123  ARG A C   1 
ATOM   981  O O   . ARG A 1 127 ? 41.515 18.845  -10.939 1.00 35.16  ? 123  ARG A O   1 
ATOM   982  C CB  . ARG A 1 127 ? 39.164 18.990  -9.081  1.00 26.42  ? 123  ARG A CB  1 
ATOM   983  C CG  . ARG A 1 127 ? 38.369 19.948  -9.971  1.00 35.73  ? 123  ARG A CG  1 
ATOM   984  C CD  . ARG A 1 127 ? 38.099 21.283  -9.302  1.00 36.02  ? 123  ARG A CD  1 
ATOM   985  N NE  . ARG A 1 127 ? 37.383 21.095  -8.048  1.00 48.24  ? 123  ARG A NE  1 
ATOM   986  C CZ  . ARG A 1 127 ? 37.809 21.532  -6.867  1.00 51.79  ? 123  ARG A CZ  1 
ATOM   987  N NH1 . ARG A 1 127 ? 38.959 22.192  -6.773  1.00 53.37  ? 123  ARG A NH1 1 
ATOM   988  N NH2 . ARG A 1 127 ? 37.089 21.298  -5.776  1.00 55.82  ? 123  ARG A NH2 1 
ATOM   989  N N   . ASN A 1 128 ? 39.859 18.093  -12.251 1.00 33.32  ? 124  ASN A N   1 
ATOM   990  C CA  . ASN A 1 128 ? 40.519 18.532  -13.469 1.00 33.21  ? 124  ASN A CA  1 
ATOM   991  C C   . ASN A 1 128 ? 41.997 18.143  -13.410 1.00 31.48  ? 124  ASN A C   1 
ATOM   992  O O   . ASN A 1 128 ? 42.876 18.918  -13.781 1.00 30.45  ? 124  ASN A O   1 
ATOM   993  C CB  . ASN A 1 128 ? 40.364 20.042  -13.635 1.00 36.16  ? 124  ASN A CB  1 
ATOM   994  C CG  . ASN A 1 128 ? 38.966 20.429  -14.059 1.00 43.48  ? 124  ASN A CG  1 
ATOM   995  O OD1 . ASN A 1 128 ? 38.451 19.931  -15.061 1.00 52.70  ? 124  ASN A OD1 1 
ATOM   996  N ND2 . ASN A 1 128 ? 38.337 21.315  -13.297 1.00 49.64  ? 124  ASN A ND2 1 
ATOM   997  N N   . SER A 1 129 ? 42.242 16.939  -12.898 1.00 27.84  ? 125  SER A N   1 
ATOM   998  C CA  . SER A 1 129 ? 43.573 16.349  -12.790 1.00 27.79  ? 125  SER A CA  1 
ATOM   999  C C   . SER A 1 129 ? 44.606 16.922  -11.812 1.00 27.60  ? 125  SER A C   1 
ATOM   1000 O O   . SER A 1 129 ? 45.803 16.710  -11.984 1.00 30.83  ? 125  SER A O   1 
ATOM   1001 C CB  . SER A 1 129 ? 44.191 16.243  -14.190 1.00 30.00  ? 125  SER A CB  1 
ATOM   1002 O OG  . SER A 1 129 ? 43.351 15.483  -15.048 1.00 34.21  ? 125  SER A OG  1 
ATOM   1003 N N   . LYS A 1 130 ? 44.164 17.638  -10.787 1.00 25.60  ? 126  LYS A N   1 
ATOM   1004 C CA  . LYS A 1 130 ? 45.095 18.159  -9.793  1.00 27.41  ? 126  LYS A CA  1 
ATOM   1005 C C   . LYS A 1 130 ? 44.499 17.900  -8.413  1.00 27.60  ? 126  LYS A C   1 
ATOM   1006 O O   . LYS A 1 130 ? 43.291 18.014  -8.221  1.00 29.62  ? 126  LYS A O   1 
ATOM   1007 C CB  . LYS A 1 130 ? 45.351 19.653  -10.006 1.00 32.44  ? 126  LYS A CB  1 
ATOM   1008 C CG  . LYS A 1 130 ? 44.166 20.433  -10.531 1.00 42.34  ? 126  LYS A CG  1 
ATOM   1009 C CD  . LYS A 1 130 ? 43.183 20.759  -9.409  1.00 48.77  ? 126  LYS A CD  1 
ATOM   1010 C CE  . LYS A 1 130 ? 42.291 21.939  -9.774  1.00 48.08  ? 126  LYS A CE  1 
ATOM   1011 N NZ  . LYS A 1 130 ? 40.928 21.511  -10.186 1.00 53.94  ? 126  LYS A NZ  1 
ATOM   1012 N N   . SER A 1 131 ? 45.344 17.543  -7.452  1.00 28.95  ? 127  SER A N   1 
ATOM   1013 C CA  . SER A 1 131 ? 44.872 17.233  -6.104  1.00 31.40  ? 127  SER A CA  1 
ATOM   1014 C C   . SER A 1 131 ? 44.043 18.322  -5.474  1.00 32.81  ? 127  SER A C   1 
ATOM   1015 O O   . SER A 1 131 ? 44.400 19.504  -5.518  1.00 34.13  ? 127  SER A O   1 
ATOM   1016 C CB  . SER A 1 131 ? 46.042 16.915  -5.180  1.00 25.45  ? 127  SER A CB  1 
ATOM   1017 O OG  . SER A 1 131 ? 47.140 17.744  -5.474  1.00 33.32  ? 127  SER A OG  1 
ATOM   1018 N N   . VAL A 1 132 ? 42.926 17.912  -4.889  1.00 36.40  ? 128  VAL A N   1 
ATOM   1019 C CA  . VAL A 1 132 ? 42.045 18.837  -4.213  1.00 40.02  ? 128  VAL A CA  1 
ATOM   1020 C C   . VAL A 1 132 ? 41.890 18.383  -2.773  1.00 43.94  ? 128  VAL A C   1 
ATOM   1021 O O   . VAL A 1 132 ? 41.150 17.453  -2.466  1.00 45.37  ? 128  VAL A O   1 
ATOM   1022 C CB  . VAL A 1 132 ? 40.644 18.920  -4.898  1.00 42.00  ? 128  VAL A CB  1 
ATOM   1023 C CG1 . VAL A 1 132 ? 40.296 17.591  -5.544  1.00 41.07  ? 128  VAL A CG1 1 
ATOM   1024 C CG2 . VAL A 1 132 ? 39.568 19.320  -3.886  1.00 39.36  ? 128  VAL A CG2 1 
ATOM   1025 N N   . THR A 1 133 ? 42.645 19.034  -1.897  1.00 49.64  ? 129  THR A N   1 
ATOM   1026 C CA  . THR A 1 133 ? 42.592 18.786  -0.464  1.00 50.29  ? 129  THR A CA  1 
ATOM   1027 C C   . THR A 1 133 ? 41.630 19.868  0.009   1.00 52.53  ? 129  THR A C   1 
ATOM   1028 O O   . THR A 1 133 ? 41.986 21.041  0.142   1.00 55.92  ? 129  THR A O   1 
ATOM   1029 C CB  . THR A 1 133 ? 43.963 19.000  0.190   1.00 48.38  ? 129  THR A CB  1 
ATOM   1030 O OG1 . THR A 1 133 ? 44.535 20.224  -0.287  1.00 44.02  ? 129  THR A OG1 1 
ATOM   1031 C CG2 . THR A 1 133 ? 44.895 17.847  -0.151  1.00 46.89  ? 129  THR A CG2 1 
ATOM   1032 N N   . ASP A 1 134 ? 40.395 19.453  0.248   1.00 55.57  ? 130  ASP A N   1 
ATOM   1033 C CA  . ASP A 1 134 ? 39.288 20.471  0.303   1.00 56.09  ? 130  ASP A CA  1 
ATOM   1034 C C   . ASP A 1 134 ? 38.246 19.706  1.097   1.00 55.72  ? 130  ASP A C   1 
ATOM   1035 O O   . ASP A 1 134 ? 37.954 18.556  0.786   1.00 59.24  ? 130  ASP A O   1 
ATOM   1036 C CB  . ASP A 1 134 ? 38.685 21.031  -1.008  1.00 61.31  ? 130  ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 134 ? 37.277 21.608  -0.846  1.00 63.58  ? 130  ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 134 ? 36.757 21.644  0.281   1.00 69.22  ? 130  ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 134 ? 36.686 22.038  -1.866  1.00 65.14  ? 130  ASP A OD2 1 
ATOM   1040 N N   . GLY A 1 135 ? 37.690 20.346  2.122   1.00 53.70  ? 131  GLY A N   1 
ATOM   1041 C CA  . GLY A 1 135 ? 36.649 19.612  2.879   1.00 48.34  ? 131  GLY A CA  1 
ATOM   1042 C C   . GLY A 1 135 ? 36.559 18.134  2.548   1.00 45.00  ? 131  GLY A C   1 
ATOM   1043 O O   . GLY A 1 135 ? 35.535 17.637  2.058   1.00 40.15  ? 131  GLY A O   1 
ATOM   1044 N N   . VAL A 1 136 ? 37.669 17.453  2.813   1.00 40.18  ? 132  VAL A N   1 
ATOM   1045 C CA  . VAL A 1 136 ? 37.827 16.036  2.571   1.00 35.68  ? 132  VAL A CA  1 
ATOM   1046 C C   . VAL A 1 136 ? 37.771 15.300  3.898   1.00 32.53  ? 132  VAL A C   1 
ATOM   1047 O O   . VAL A 1 136 ? 38.379 15.725  4.882   1.00 35.14  ? 132  VAL A O   1 
ATOM   1048 C CB  . VAL A 1 136 ? 39.189 15.774  1.900   1.00 35.43  ? 132  VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 136 ? 39.649 14.345  2.146   1.00 34.59  ? 132  VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 136 ? 39.079 16.050  0.430   1.00 30.30  ? 132  VAL A CG2 1 
ATOM   1051 N N   . TYR A 1 137 ? 37.039 14.198  3.929   1.00 27.90  ? 133  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 137 ? 36.957 13.407  5.137   1.00 26.59  ? 133  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 137 ? 37.180 11.968  4.718   1.00 24.67  ? 133  TYR A C   1 
ATOM   1054 O O   . TYR A 1 137 ? 37.036 11.635  3.550   1.00 26.59  ? 133  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 137 ? 35.596 13.581  5.787   1.00 30.66  ? 133  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 137 ? 35.441 12.793  7.055   1.00 39.13  ? 133  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 137 ? 35.967 13.260  8.264   1.00 38.23  ? 133  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 137 ? 34.758 11.576  7.054   1.00 41.42  ? 133  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 137 ? 35.810 12.539  9.436   1.00 33.76  ? 133  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 137 ? 34.593 10.846  8.222   1.00 38.52  ? 133  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 137 ? 35.121 11.336  9.409   1.00 39.32  ? 133  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 137 ? 34.932 10.644  10.581  1.00 40.88  ? 133  TYR A OH  1 
ATOM   1063 N N   . GLU A 1 138 ? 37.564 11.120  5.658   1.00 25.78  ? 134  GLU A N   1 
ATOM   1064 C CA  . GLU A 1 138 ? 37.808 9.717   5.347   1.00 22.77  ? 134  GLU A CA  1 
ATOM   1065 C C   . GLU A 1 138 ? 37.414 8.869   6.537   1.00 19.08  ? 134  GLU A C   1 
ATOM   1066 O O   . GLU A 1 138 ? 37.832 9.153   7.651   1.00 18.93  ? 134  GLU A O   1 
ATOM   1067 C CB  . GLU A 1 138 ? 39.293 9.508   5.049   1.00 28.49  ? 134  GLU A CB  1 
ATOM   1068 C CG  . GLU A 1 138 ? 39.625 8.206   4.340   1.00 28.63  ? 134  GLU A CG  1 
ATOM   1069 C CD  . GLU A 1 138 ? 40.971 8.257   3.650   1.00 26.49  ? 134  GLU A CD  1 
ATOM   1070 O OE1 . GLU A 1 138 ? 41.255 9.258   2.955   1.00 26.90  ? 134  GLU A OE1 1 
ATOM   1071 O OE2 . GLU A 1 138 ? 41.744 7.295   3.808   1.00 36.12  ? 134  GLU A OE2 1 
ATOM   1072 N N   . THR A 1 139 ? 36.613 7.834   6.313   1.00 17.25  ? 135  THR A N   1 
ATOM   1073 C CA  . THR A 1 139 ? 36.216 6.956   7.413   1.00 16.08  ? 135  THR A CA  1 
ATOM   1074 C C   . THR A 1 139 ? 37.401 6.138   7.912   1.00 19.95  ? 135  THR A C   1 
ATOM   1075 O O   . THR A 1 139 ? 38.479 6.116   7.303   1.00 21.99  ? 135  THR A O   1 
ATOM   1076 C CB  . THR A 1 139 ? 35.143 5.932   7.005   1.00 14.96  ? 135  THR A CB  1 
ATOM   1077 O OG1 . THR A 1 139 ? 35.747 4.915   6.193   1.00 13.04  ? 135  THR A OG1 1 
ATOM   1078 C CG2 . THR A 1 139 ? 33.997 6.603   6.256   1.00 11.15  ? 135  THR A CG2 1 
ATOM   1079 N N   . SER A 1 140 ? 37.197 5.471   9.040   1.00 20.85  ? 136  SER A N   1 
ATOM   1080 C CA  . SER A 1 140 ? 38.178 4.478   9.499   1.00 21.74  ? 136  SER A CA  1 
ATOM   1081 C C   . SER A 1 140 ? 38.087 3.252   8.614   1.00 24.66  ? 136  SER A C   1 
ATOM   1082 O O   . SER A 1 140 ? 37.256 3.210   7.708   1.00 25.67  ? 136  SER A O   1 
ATOM   1083 C CB  . SER A 1 140 ? 37.837 4.091   10.941  1.00 19.91  ? 136  SER A CB  1 
ATOM   1084 O OG  . SER A 1 140 ? 37.960 5.200   11.821  1.00 23.33  ? 136  SER A OG  1 
ATOM   1085 N N   . PHE A 1 141 ? 38.932 2.259   8.855   1.00 23.33  ? 137  PHE A N   1 
ATOM   1086 C CA  . PHE A 1 141 ? 38.753 1.006   8.133   1.00 25.58  ? 137  PHE A CA  1 
ATOM   1087 C C   . PHE A 1 141 ? 37.545 0.245   8.650   1.00 23.55  ? 137  PHE A C   1 
ATOM   1088 O O   . PHE A 1 141 ? 37.578 -0.334  9.729   1.00 18.22  ? 137  PHE A O   1 
ATOM   1089 C CB  . PHE A 1 141 ? 40.031 0.162   8.257   1.00 28.02  ? 137  PHE A CB  1 
ATOM   1090 C CG  . PHE A 1 141 ? 41.058 0.499   7.219   1.00 23.84  ? 137  PHE A CG  1 
ATOM   1091 C CD1 . PHE A 1 141 ? 40.864 0.129   5.892   1.00 24.92  ? 137  PHE A CD1 1 
ATOM   1092 C CD2 . PHE A 1 141 ? 42.186 1.242   7.549   1.00 26.52  ? 137  PHE A CD2 1 
ATOM   1093 C CE1 . PHE A 1 141 ? 41.760 0.511   4.904   1.00 27.98  ? 137  PHE A CE1 1 
ATOM   1094 C CE2 . PHE A 1 141 ? 43.099 1.634   6.562   1.00 32.98  ? 137  PHE A CE2 1 
ATOM   1095 C CZ  . PHE A 1 141 ? 42.885 1.263   5.235   1.00 27.16  ? 137  PHE A CZ  1 
ATOM   1096 N N   . LEU A 1 142 ? 36.462 0.284   7.882   1.00 24.39  ? 138  LEU A N   1 
ATOM   1097 C CA  . LEU A 1 142 ? 35.252 -0.408  8.273   1.00 22.26  ? 138  LEU A CA  1 
ATOM   1098 C C   . LEU A 1 142 ? 35.400 -1.875  7.966   1.00 22.77  ? 138  LEU A C   1 
ATOM   1099 O O   . LEU A 1 142 ? 35.841 -2.267  6.890   1.00 23.63  ? 138  LEU A O   1 
ATOM   1100 C CB  . LEU A 1 142 ? 34.043 0.177   7.551   1.00 20.77  ? 138  LEU A CB  1 
ATOM   1101 C CG  . LEU A 1 142 ? 33.857 1.670   7.839   1.00 17.58  ? 138  LEU A CG  1 
ATOM   1102 C CD1 . LEU A 1 142 ? 32.571 2.108   7.201   1.00 20.41  ? 138  LEU A CD1 1 
ATOM   1103 C CD2 . LEU A 1 142 ? 33.835 1.956   9.337   1.00 12.27  ? 138  LEU A CD2 1 
ATOM   1104 N N   . VAL A 1 143 ? 35.010 -2.681  8.936   1.00 26.57  ? 139  VAL A N   1 
ATOM   1105 C CA  . VAL A 1 143 ? 35.114 -4.118  8.855   1.00 23.24  ? 139  VAL A CA  1 
ATOM   1106 C C   . VAL A 1 143 ? 34.157 -4.793  7.868   1.00 25.70  ? 139  VAL A C   1 
ATOM   1107 O O   . VAL A 1 143 ? 33.026 -4.344  7.665   1.00 27.78  ? 139  VAL A O   1 
ATOM   1108 C CB  . VAL A 1 143 ? 34.951 -4.695  10.281  1.00 22.21  ? 139  VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 143 ? 33.873 -5.757  10.323  1.00 24.13  ? 139  VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 143 ? 36.287 -5.221  10.759  1.00 21.78  ? 139  VAL A CG2 1 
ATOM   1111 N N   . ASN A 1 144 ? 34.646 -5.860  7.234   1.00 24.57  ? 140  ASN A N   1 
ATOM   1112 C CA  . ASN A 1 144 ? 33.859 -6.651  6.288   1.00 22.96  ? 140  ASN A CA  1 
ATOM   1113 C C   . ASN A 1 144 ? 33.778 -8.080  6.822   1.00 24.26  ? 140  ASN A C   1 
ATOM   1114 O O   . ASN A 1 144 ? 34.692 -8.567  7.491   1.00 22.75  ? 140  ASN A O   1 
ATOM   1115 C CB  . ASN A 1 144 ? 34.504 -6.671  4.901   1.00 18.85  ? 140  ASN A CB  1 
ATOM   1116 C CG  . ASN A 1 144 ? 34.296 -5.382  4.139   1.00 18.84  ? 140  ASN A CG  1 
ATOM   1117 O OD1 . ASN A 1 144 ? 33.250 -4.743  4.247   1.00 21.44  ? 140  ASN A OD1 1 
ATOM   1118 N ND2 . ASN A 1 144 ? 35.298 -4.992  3.353   1.00 24.88  ? 140  ASN A ND2 1 
ATOM   1119 N N   . ARG A 1 145 ? 32.679 -8.746  6.508   1.00 25.33  ? 141  ARG A N   1 
ATOM   1120 C CA  . ARG A 1 145 ? 32.424 -10.106 6.957   1.00 26.74  ? 141  ARG A CA  1 
ATOM   1121 C C   . ARG A 1 145 ? 33.469 -11.132 6.521   1.00 29.15  ? 141  ARG A C   1 
ATOM   1122 O O   . ARG A 1 145 ? 33.671 -12.143 7.196   1.00 26.66  ? 141  ARG A O   1 
ATOM   1123 C CB  . ARG A 1 145 ? 31.035 -10.512 6.470   1.00 34.18  ? 141  ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 145 ? 30.711 -11.973 6.578   1.00 43.31  ? 141  ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 145 ? 29.675 -12.345 5.532   1.00 53.64  ? 141  ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 145 ? 30.269 -13.120 4.447   1.00 65.28  ? 141  ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 145 ? 31.063 -12.612 3.506   1.00 68.84  ? 141  ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 145 ? 31.354 -11.315 3.503   1.00 70.85  ? 141  ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 145 ? 31.565 -13.404 2.566   1.00 68.77  ? 141  ARG A NH2 1 
ATOM   1130 N N   . ASP A 1 146 ? 34.130 -10.876 5.393   1.00 30.11  ? 142  ASP A N   1 
ATOM   1131 C CA  . ASP A 1 146 ? 35.150 -11.792 4.890   1.00 26.51  ? 142  ASP A CA  1 
ATOM   1132 C C   . ASP A 1 146 ? 36.556 -11.430 5.373   1.00 24.27  ? 142  ASP A C   1 
ATOM   1133 O O   . ASP A 1 146 ? 37.556 -11.948 4.881   1.00 28.32  ? 142  ASP A O   1 
ATOM   1134 C CB  . ASP A 1 146 ? 35.098 -11.843 3.359   1.00 26.74  ? 142  ASP A CB  1 
ATOM   1135 C CG  . ASP A 1 146 ? 35.569 -10.562 2.708   1.00 31.16  ? 142  ASP A CG  1 
ATOM   1136 O OD1 . ASP A 1 146 ? 35.570 -9.499  3.366   1.00 34.69  ? 142  ASP A OD1 1 
ATOM   1137 O OD2 . ASP A 1 146 ? 35.941 -10.619 1.517   1.00 37.89  ? 142  ASP A OD2 1 
ATOM   1138 N N   . HIS A 1 147 ? 36.596 -10.528 6.347   1.00 22.77  ? 143  HIS A N   1 
ATOM   1139 C CA  . HIS A 1 147 ? 37.809 -10.050 7.001   1.00 19.37  ? 143  HIS A CA  1 
ATOM   1140 C C   . HIS A 1 147 ? 38.689 -9.130  6.195   1.00 22.76  ? 143  HIS A C   1 
ATOM   1141 O O   . HIS A 1 147 ? 39.887 -8.983  6.454   1.00 24.97  ? 143  HIS A O   1 
ATOM   1142 C CB  . HIS A 1 147 ? 38.583 -11.238 7.558   1.00 13.26  ? 143  HIS A CB  1 
ATOM   1143 C CG  . HIS A 1 147 ? 37.762 -12.088 8.470   1.00 8.77   ? 143  HIS A CG  1 
ATOM   1144 N ND1 . HIS A 1 147 ? 36.588 -11.637 9.045   1.00 16.96  ? 143  HIS A ND1 1 
ATOM   1145 C CD2 . HIS A 1 147 ? 37.907 -13.366 8.883   1.00 11.10  ? 143  HIS A CD2 1 
ATOM   1146 C CE1 . HIS A 1 147 ? 36.051 -12.600 9.768   1.00 15.81  ? 143  HIS A CE1 1 
ATOM   1147 N NE2 . HIS A 1 147 ? 36.833 -13.665 9.688   1.00 16.82  ? 143  HIS A NE2 1 
ATOM   1148 N N   . SER A 1 148 ? 38.063 -8.508  5.206   1.00 25.15  ? 144  SER A N   1 
ATOM   1149 C CA  . SER A 1 148 ? 38.710 -7.518  4.375   1.00 23.08  ? 144  SER A CA  1 
ATOM   1150 C C   . SER A 1 148 ? 38.060 -6.239  4.926   1.00 23.59  ? 144  SER A C   1 
ATOM   1151 O O   . SER A 1 148 ? 37.195 -6.313  5.796   1.00 18.78  ? 144  SER A O   1 
ATOM   1152 C CB  . SER A 1 148 ? 38.354 -7.738  2.900   1.00 19.56  ? 144  SER A CB  1 
ATOM   1153 O OG  . SER A 1 148 ? 37.160 -7.060  2.548   1.00 21.30  ? 144  SER A OG  1 
ATOM   1154 N N   . PHE A 1 149 ? 38.471 -5.073  4.454   1.00 24.08  ? 145  PHE A N   1 
ATOM   1155 C CA  . PHE A 1 149 ? 37.874 -3.846  4.958   1.00 25.81  ? 145  PHE A CA  1 
ATOM   1156 C C   . PHE A 1 149 ? 37.352 -3.027  3.792   1.00 26.29  ? 145  PHE A C   1 
ATOM   1157 O O   . PHE A 1 149 ? 37.583 -3.367  2.632   1.00 31.78  ? 145  PHE A O   1 
ATOM   1158 C CB  . PHE A 1 149 ? 38.915 -3.014  5.720   1.00 24.54  ? 145  PHE A CB  1 
ATOM   1159 C CG  . PHE A 1 149 ? 39.591 -3.750  6.839   1.00 21.72  ? 145  PHE A CG  1 
ATOM   1160 C CD1 . PHE A 1 149 ? 40.614 -4.651  6.578   1.00 18.98  ? 145  PHE A CD1 1 
ATOM   1161 C CD2 . PHE A 1 149 ? 39.211 -3.531  8.161   1.00 21.51  ? 145  PHE A CD2 1 
ATOM   1162 C CE1 . PHE A 1 149 ? 41.251 -5.319  7.616   1.00 19.64  ? 145  PHE A CE1 1 
ATOM   1163 C CE2 . PHE A 1 149 ? 39.843 -4.196  9.208   1.00 18.19  ? 145  PHE A CE2 1 
ATOM   1164 C CZ  . PHE A 1 149 ? 40.863 -5.090  8.936   1.00 19.45  ? 145  PHE A CZ  1 
ATOM   1165 N N   . HIS A 1 150 ? 36.627 -1.963  4.103   1.00 21.32  ? 146  HIS A N   1 
ATOM   1166 C CA  . HIS A 1 150 ? 36.142 -1.063  3.075   1.00 21.48  ? 146  HIS A CA  1 
ATOM   1167 C C   . HIS A 1 150 ? 36.304 0.315   3.675   1.00 20.40  ? 146  HIS A C   1 
ATOM   1168 O O   . HIS A 1 150 ? 36.427 0.448   4.899   1.00 17.66  ? 146  HIS A O   1 
ATOM   1169 C CB  . HIS A 1 150 ? 34.690 -1.369  2.660   1.00 20.88  ? 146  HIS A CB  1 
ATOM   1170 C CG  . HIS A 1 150 ? 33.655 -1.092  3.709   1.00 26.32  ? 146  HIS A CG  1 
ATOM   1171 N ND1 . HIS A 1 150 ? 32.959 -2.100  4.346   1.00 25.96  ? 146  HIS A ND1 1 
ATOM   1172 C CD2 . HIS A 1 150 ? 33.117 0.070   4.152   1.00 27.76  ? 146  HIS A CD2 1 
ATOM   1173 C CE1 . HIS A 1 150 ? 32.038 -1.572  5.131   1.00 28.60  ? 146  HIS A CE1 1 
ATOM   1174 N NE2 . HIS A 1 150 ? 32.112 -0.256  5.032   1.00 27.81  ? 146  HIS A NE2 1 
ATOM   1175 N N   . LYS A 1 151 ? 36.344 1.334   2.824   1.00 20.59  ? 147  LYS A N   1 
ATOM   1176 C CA  . LYS A 1 151 ? 36.540 2.694   3.302   1.00 20.73  ? 147  LYS A CA  1 
ATOM   1177 C C   . LYS A 1 151 ? 35.781 3.718   2.486   1.00 16.58  ? 147  LYS A C   1 
ATOM   1178 O O   . LYS A 1 151 ? 35.518 3.511   1.308   1.00 18.31  ? 147  LYS A O   1 
ATOM   1179 C CB  . LYS A 1 151 ? 38.032 3.041   3.269   1.00 27.82  ? 147  LYS A CB  1 
ATOM   1180 C CG  . LYS A 1 151 ? 38.587 3.617   4.560   1.00 20.96  ? 147  LYS A CG  1 
ATOM   1181 C CD  . LYS A 1 151 ? 39.619 4.675   4.253   1.00 21.37  ? 147  LYS A CD  1 
ATOM   1182 C CE  . LYS A 1 151 ? 40.844 4.493   5.107   1.00 20.06  ? 147  LYS A CE  1 
ATOM   1183 N NZ  . LYS A 1 151 ? 40.688 5.301   6.340   1.00 26.76  ? 147  LYS A NZ  1 
ATOM   1184 N N   . LEU A 1 152 ? 35.433 4.827   3.132   1.00 17.77  ? 148  LEU A N   1 
ATOM   1185 C CA  . LEU A 1 152 ? 34.719 5.905   2.473   1.00 14.80  ? 148  LEU A CA  1 
ATOM   1186 C C   . LEU A 1 152 ? 35.476 7.222   2.595   1.00 15.51  ? 148  LEU A C   1 
ATOM   1187 O O   . LEU A 1 152 ? 35.961 7.589   3.669   1.00 12.01  ? 148  LEU A O   1 
ATOM   1188 C CB  . LEU A 1 152 ? 33.315 6.095   3.060   1.00 15.04  ? 148  LEU A CB  1 
ATOM   1189 C CG  . LEU A 1 152 ? 32.214 5.040   2.911   1.00 13.50  ? 148  LEU A CG  1 
ATOM   1190 C CD1 . LEU A 1 152 ? 31.738 4.933   1.477   1.00 16.37  ? 148  LEU A CD1 1 
ATOM   1191 C CD2 . LEU A 1 152 ? 32.747 3.717   3.407   1.00 18.59  ? 148  LEU A CD2 1 
ATOM   1192 N N   . SER A 1 153 ? 35.586 7.911   1.464   1.00 16.08  ? 149  SER A N   1 
ATOM   1193 C CA  . SER A 1 153 ? 36.223 9.207   1.396   1.00 14.26  ? 149  SER A CA  1 
ATOM   1194 C C   . SER A 1 153 ? 35.172 10.181  0.869   1.00 16.25  ? 149  SER A C   1 
ATOM   1195 O O   . SER A 1 153 ? 34.327 9.812   0.045   1.00 16.57  ? 149  SER A O   1 
ATOM   1196 C CB  . SER A 1 153 ? 37.412 9.180   0.452   1.00 11.11  ? 149  SER A CB  1 
ATOM   1197 O OG  . SER A 1 153 ? 38.190 10.349  0.636   1.00 21.24  ? 149  SER A OG  1 
ATOM   1198 N N   . TYR A 1 154 ? 35.226 11.419  1.353   1.00 19.32  ? 150  TYR A N   1 
ATOM   1199 C CA  . TYR A 1 154 ? 34.279 12.454  0.951   1.00 19.12  ? 150  TYR A CA  1 
ATOM   1200 C C   . TYR A 1 154 ? 34.955 13.707  0.392   1.00 17.47  ? 150  TYR A C   1 
ATOM   1201 O O   . TYR A 1 154 ? 36.066 14.064  0.789   1.00 17.88  ? 150  TYR A O   1 
ATOM   1202 C CB  . TYR A 1 154 ? 33.390 12.832  2.141   1.00 16.49  ? 150  TYR A CB  1 
ATOM   1203 C CG  . TYR A 1 154 ? 32.655 11.652  2.725   1.00 17.03  ? 150  TYR A CG  1 
ATOM   1204 C CD1 . TYR A 1 154 ? 33.320 10.716  3.517   1.00 22.06  ? 150  TYR A CD1 1 
ATOM   1205 C CD2 . TYR A 1 154 ? 31.304 11.446  2.456   1.00 16.93  ? 150  TYR A CD2 1 
ATOM   1206 C CE1 . TYR A 1 154 ? 32.656 9.595   4.024   1.00 20.85  ? 150  TYR A CE1 1 
ATOM   1207 C CE2 . TYR A 1 154 ? 30.631 10.329  2.957   1.00 17.16  ? 150  TYR A CE2 1 
ATOM   1208 C CZ  . TYR A 1 154 ? 31.315 9.410   3.735   1.00 15.77  ? 150  TYR A CZ  1 
ATOM   1209 O OH  . TYR A 1 154 ? 30.670 8.293   4.205   1.00 18.99  ? 150  TYR A OH  1 
ATOM   1210 N N   . LEU A 1 155 ? 34.256 14.361  -0.532  1.00 16.47  ? 151  LEU A N   1 
ATOM   1211 C CA  . LEU A 1 155 ? 34.719 15.577  -1.187  1.00 12.87  ? 151  LEU A CA  1 
ATOM   1212 C C   . LEU A 1 155 ? 33.505 16.484  -1.363  1.00 17.77  ? 151  LEU A C   1 
ATOM   1213 O O   . LEU A 1 155 ? 32.520 16.118  -2.024  1.00 15.47  ? 151  LEU A O   1 
ATOM   1214 C CB  . LEU A 1 155 ? 35.295 15.247  -2.564  1.00 17.33  ? 151  LEU A CB  1 
ATOM   1215 C CG  . LEU A 1 155 ? 36.483 16.033  -3.130  1.00 22.38  ? 151  LEU A CG  1 
ATOM   1216 C CD1 . LEU A 1 155 ? 36.344 16.086  -4.648  1.00 20.46  ? 151  LEU A CD1 1 
ATOM   1217 C CD2 . LEU A 1 155 ? 36.559 17.438  -2.539  1.00 17.78  ? 151  LEU A CD2 1 
ATOM   1218 N N   . THR A 1 156 ? 33.560 17.661  -0.760  1.00 17.49  ? 152  THR A N   1 
ATOM   1219 C CA  . THR A 1 156 ? 32.455 18.590  -0.888  1.00 21.69  ? 152  THR A CA  1 
ATOM   1220 C C   . THR A 1 156 ? 32.701 19.290  -2.211  1.00 22.07  ? 152  THR A C   1 
ATOM   1221 O O   . THR A 1 156 ? 33.846 19.500  -2.613  1.00 19.76  ? 152  THR A O   1 
ATOM   1222 C CB  . THR A 1 156 ? 32.443 19.631  0.264   1.00 23.25  ? 152  THR A CB  1 
ATOM   1223 O OG1 . THR A 1 156 ? 33.756 19.726  0.828   1.00 27.94  ? 152  THR A OG1 1 
ATOM   1224 C CG2 . THR A 1 156 ? 31.465 19.216  1.358   1.00 21.50  ? 152  THR A CG2 1 
ATOM   1225 N N   . PHE A 1 157 ? 31.633 19.651  -2.897  1.00 19.91  ? 153  PHE A N   1 
ATOM   1226 C CA  . PHE A 1 157 ? 31.796 20.309  -4.168  1.00 20.75  ? 153  PHE A CA  1 
ATOM   1227 C C   . PHE A 1 157 ? 30.470 20.872  -4.636  1.00 22.88  ? 153  PHE A C   1 
ATOM   1228 O O   . PHE A 1 157 ? 29.412 20.464  -4.167  1.00 19.34  ? 153  PHE A O   1 
ATOM   1229 C CB  . PHE A 1 157 ? 32.348 19.308  -5.197  1.00 16.52  ? 153  PHE A CB  1 
ATOM   1230 C CG  . PHE A 1 157 ? 31.297 18.409  -5.809  1.00 20.98  ? 153  PHE A CG  1 
ATOM   1231 C CD1 . PHE A 1 157 ? 30.634 17.451  -5.039  1.00 17.36  ? 153  PHE A CD1 1 
ATOM   1232 C CD2 . PHE A 1 157 ? 30.964 18.531  -7.156  1.00 15.60  ? 153  PHE A CD2 1 
ATOM   1233 C CE1 . PHE A 1 157 ? 29.657 16.635  -5.604  1.00 17.03  ? 153  PHE A CE1 1 
ATOM   1234 C CE2 . PHE A 1 157 ? 29.991 17.723  -7.728  1.00 16.18  ? 153  PHE A CE2 1 
ATOM   1235 C CZ  . PHE A 1 157 ? 29.334 16.774  -6.956  1.00 15.96  ? 153  PHE A CZ  1 
ATOM   1236 N N   . ILE A 1 158 ? 30.546 21.850  -5.479  1.00 28.76  ? 154  ILE A N   1 
ATOM   1237 C CA  . ILE A 1 158 ? 29.333 22.386  -6.113  1.00 34.25  ? 154  ILE A CA  1 
ATOM   1238 C C   . ILE A 1 158 ? 29.313 22.001  -7.597  1.00 34.61  ? 154  ILE A C   1 
ATOM   1239 O O   . ILE A 1 158 ? 30.194 22.458  -8.349  1.00 32.34  ? 154  ILE A O   1 
ATOM   1240 C CB  . ILE A 1 158 ? 29.302 23.907  -5.966  1.00 36.64  ? 154  ILE A CB  1 
ATOM   1241 C CG1 . ILE A 1 158 ? 29.303 24.369  -4.510  1.00 20.00  ? 154  ILE A CG1 1 
ATOM   1242 C CG2 . ILE A 1 158 ? 28.063 24.542  -6.604  1.00 39.65  ? 154  ILE A CG2 1 
ATOM   1243 C CD1 . ILE A 1 158 ? 29.262 25.891  -4.366  1.00 20.00  ? 154  ILE A CD1 1 
ATOM   1244 N N   . PRO A 1 159 ? 28.459 21.051  -7.949  1.00 32.72  ? 155  PRO A N   1 
ATOM   1245 C CA  . PRO A 1 159 ? 28.351 20.516  -9.309  1.00 31.27  ? 155  PRO A CA  1 
ATOM   1246 C C   . PRO A 1 159 ? 28.693 21.514  -10.405 1.00 30.79  ? 155  PRO A C   1 
ATOM   1247 O O   . PRO A 1 159 ? 28.282 22.674  -10.359 1.00 28.83  ? 155  PRO A O   1 
ATOM   1248 C CB  . PRO A 1 159 ? 26.903 20.033  -9.398  1.00 26.50  ? 155  PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 159 ? 26.357 20.082  -7.989  1.00 20.63  ? 155  PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 159 ? 27.461 20.441  -7.057  1.00 25.00  ? 155  PRO A CD  1 
ATOM   1251 N N   . SER A 1 160 ? 29.459 21.052  -11.385 1.00 31.49  ? 156  SER A N   1 
ATOM   1252 C CA  . SER A 1 160 ? 29.848 21.892  -12.505 1.00 33.02  ? 156  SER A CA  1 
ATOM   1253 C C   . SER A 1 160 ? 30.255 21.029  -13.668 1.00 32.24  ? 156  SER A C   1 
ATOM   1254 O O   . SER A 1 160 ? 31.034 20.092  -13.512 1.00 36.64  ? 156  SER A O   1 
ATOM   1255 C CB  . SER A 1 160 ? 31.014 22.795  -12.137 1.00 36.43  ? 156  SER A CB  1 
ATOM   1256 O OG  . SER A 1 160 ? 31.400 23.562  -13.263 1.00 39.58  ? 156  SER A OG  1 
ATOM   1257 N N   . ASP A 1 161 ? 29.733 21.351  -14.840 1.00 31.99  ? 157  ASP A N   1 
ATOM   1258 C CA  . ASP A 1 161 ? 30.054 20.575  -16.021 1.00 32.91  ? 157  ASP A CA  1 
ATOM   1259 C C   . ASP A 1 161 ? 31.512 20.733  -16.435 1.00 30.54  ? 157  ASP A C   1 
ATOM   1260 O O   . ASP A 1 161 ? 32.086 19.803  -16.981 1.00 34.02  ? 157  ASP A O   1 
ATOM   1261 C CB  . ASP A 1 161 ? 29.122 20.955  -17.179 1.00 28.19  ? 157  ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 161 ? 27.722 20.361  -17.021 1.00 33.91  ? 157  ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 161 ? 27.517 19.497  -16.130 1.00 30.02  ? 157  ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 161 ? 26.819 20.761  -17.789 1.00 38.67  ? 157  ASP A OD2 1 
ATOM   1265 N N   . ASP A 1 162 ? 32.122 21.883  -16.155 1.00 31.27  ? 158  ASP A N   1 
ATOM   1266 C CA  . ASP A 1 162 ? 33.514 22.086  -16.548 1.00 33.60  ? 158  ASP A CA  1 
ATOM   1267 C C   . ASP A 1 162 ? 34.621 21.507  -15.659 1.00 32.03  ? 158  ASP A C   1 
ATOM   1268 O O   . ASP A 1 162 ? 35.765 21.943  -15.752 1.00 31.73  ? 158  ASP A O   1 
ATOM   1269 C CB  . ASP A 1 162 ? 33.828 23.575  -16.828 1.00 38.46  ? 158  ASP A CB  1 
ATOM   1270 C CG  . ASP A 1 162 ? 32.919 24.541  -16.083 1.00 42.88  ? 158  ASP A CG  1 
ATOM   1271 O OD1 . ASP A 1 162 ? 31.691 24.523  -16.333 1.00 46.81  ? 158  ASP A OD1 1 
ATOM   1272 O OD2 . ASP A 1 162 ? 33.444 25.336  -15.263 1.00 38.03  ? 158  ASP A OD2 1 
ATOM   1273 N N   . ASP A 1 163 ? 34.305 20.550  -14.791 1.00 30.64  ? 159  ASP A N   1 
ATOM   1274 C CA  . ASP A 1 163 ? 35.365 19.922  -13.994 1.00 32.32  ? 159  ASP A CA  1 
ATOM   1275 C C   . ASP A 1 163 ? 35.233 18.401  -14.014 1.00 29.10  ? 159  ASP A C   1 
ATOM   1276 O O   . ASP A 1 163 ? 34.142 17.855  -14.186 1.00 30.71  ? 159  ASP A O   1 
ATOM   1277 C CB  . ASP A 1 163 ? 35.420 20.425  -12.532 1.00 34.66  ? 159  ASP A CB  1 
ATOM   1278 C CG  . ASP A 1 163 ? 34.115 21.010  -12.044 1.00 40.37  ? 159  ASP A CG  1 
ATOM   1279 O OD1 . ASP A 1 163 ? 33.099 20.284  -12.008 1.00 46.38  ? 159  ASP A OD1 1 
ATOM   1280 O OD2 . ASP A 1 163 ? 34.112 22.203  -11.679 1.00 41.58  ? 159  ASP A OD2 1 
ATOM   1281 N N   . ILE A 1 164 ? 36.364 17.725  -13.856 1.00 28.92  ? 160  ILE A N   1 
ATOM   1282 C CA  . ILE A 1 164 ? 36.419 16.264  -13.856 1.00 29.35  ? 160  ILE A CA  1 
ATOM   1283 C C   . ILE A 1 164 ? 37.014 15.781  -12.536 1.00 29.62  ? 160  ILE A C   1 
ATOM   1284 O O   . ILE A 1 164 ? 38.061 16.274  -12.108 1.00 32.38  ? 160  ILE A O   1 
ATOM   1285 C CB  . ILE A 1 164 ? 37.313 15.756  -15.000 1.00 29.14  ? 160  ILE A CB  1 
ATOM   1286 C CG1 . ILE A 1 164 ? 36.524 15.751  -16.306 1.00 26.29  ? 160  ILE A CG1 1 
ATOM   1287 C CG2 . ILE A 1 164 ? 37.878 14.384  -14.653 1.00 30.29  ? 160  ILE A CG2 1 
ATOM   1288 C CD1 . ILE A 1 164 ? 37.330 16.209  -17.489 1.00 22.79  ? 160  ILE A CD1 1 
ATOM   1289 N N   . TYR A 1 165 ? 36.371 14.806  -11.900 1.00 26.24  ? 161  TYR A N   1 
ATOM   1290 C CA  . TYR A 1 165 ? 36.872 14.317  -10.619 1.00 24.08  ? 161  TYR A CA  1 
ATOM   1291 C C   . TYR A 1 165 ? 37.359 12.877  -10.656 1.00 21.84  ? 161  TYR A C   1 
ATOM   1292 O O   . TYR A 1 165 ? 36.766 12.017  -11.307 1.00 26.59  ? 161  TYR A O   1 
ATOM   1293 C CB  . TYR A 1 165 ? 35.793 14.455  -9.544  1.00 20.33  ? 161  TYR A CB  1 
ATOM   1294 C CG  . TYR A 1 165 ? 35.471 15.885  -9.168  1.00 23.35  ? 161  TYR A CG  1 
ATOM   1295 C CD1 . TYR A 1 165 ? 36.197 16.545  -8.176  1.00 21.54  ? 161  TYR A CD1 1 
ATOM   1296 C CD2 . TYR A 1 165 ? 34.409 16.565  -9.772  1.00 20.41  ? 161  TYR A CD2 1 
ATOM   1297 C CE1 . TYR A 1 165 ? 35.872 17.849  -7.787  1.00 25.13  ? 161  TYR A CE1 1 
ATOM   1298 C CE2 . TYR A 1 165 ? 34.078 17.864  -9.395  1.00 23.21  ? 161  TYR A CE2 1 
ATOM   1299 C CZ  . TYR A 1 165 ? 34.811 18.501  -8.400  1.00 29.46  ? 161  TYR A CZ  1 
ATOM   1300 O OH  . TYR A 1 165 ? 34.477 19.785  -8.015  1.00 32.95  ? 161  TYR A OH  1 
ATOM   1301 N N   . ASP A 1 166 ? 38.452 12.621  -9.952  1.00 17.71  ? 162  ASP A N   1 
ATOM   1302 C CA  . ASP A 1 166 ? 39.014 11.280  -9.877  1.00 17.49  ? 162  ASP A CA  1 
ATOM   1303 C C   . ASP A 1 166 ? 39.236 10.964  -8.416  1.00 16.93  ? 162  ASP A C   1 
ATOM   1304 O O   . ASP A 1 166 ? 39.515 11.843  -7.605  1.00 20.25  ? 162  ASP A O   1 
ATOM   1305 C CB  . ASP A 1 166 ? 40.391 11.184  -10.553 1.00 18.11  ? 162  ASP A CB  1 
ATOM   1306 C CG  . ASP A 1 166 ? 40.338 11.348  -12.053 1.00 14.92  ? 162  ASP A CG  1 
ATOM   1307 O OD1 . ASP A 1 166 ? 39.821 10.439  -12.735 1.00 15.96  ? 162  ASP A OD1 1 
ATOM   1308 O OD2 . ASP A 1 166 ? 40.834 12.390  -12.544 1.00 11.05  ? 162  ASP A OD2 1 
ATOM   1309 N N   . CYS A 1 167 ? 39.119 9.693   -8.092  1.00 21.61  ? 163  CYS A N   1 
ATOM   1310 C CA  . CYS A 1 167 ? 39.387 9.234   -6.751  1.00 23.93  ? 163  CYS A CA  1 
ATOM   1311 C C   . CYS A 1 167 ? 40.623 8.339   -6.950  1.00 22.65  ? 163  CYS A C   1 
ATOM   1312 O O   . CYS A 1 167 ? 40.531 7.281   -7.562  1.00 21.39  ? 163  CYS A O   1 
ATOM   1313 C CB  . CYS A 1 167 ? 38.190 8.434   -6.234  1.00 25.36  ? 163  CYS A CB  1 
ATOM   1314 S SG  . CYS A 1 167 ? 38.355 7.719   -4.562  1.00 21.82  ? 163  CYS A SG  1 
ATOM   1315 N N   . LYS A 1 168 ? 41.781 8.796   -6.485  1.00 21.34  ? 164  LYS A N   1 
ATOM   1316 C CA  . LYS A 1 168 ? 43.013 8.027   -6.608  1.00 23.31  ? 164  LYS A CA  1 
ATOM   1317 C C   . LYS A 1 168 ? 43.088 6.998   -5.492  1.00 24.97  ? 164  LYS A C   1 
ATOM   1318 O O   . LYS A 1 168 ? 43.067 7.341   -4.311  1.00 23.41  ? 164  LYS A O   1 
ATOM   1319 C CB  . LYS A 1 168 ? 44.239 8.940   -6.498  1.00 28.06  ? 164  LYS A CB  1 
ATOM   1320 C CG  . LYS A 1 168 ? 44.738 9.515   -7.807  1.00 26.91  ? 164  LYS A CG  1 
ATOM   1321 C CD  . LYS A 1 168 ? 46.245 9.361   -7.932  1.00 30.77  ? 164  LYS A CD  1 
ATOM   1322 C CE  . LYS A 1 168 ? 46.670 9.338   -9.399  1.00 33.92  ? 164  LYS A CE  1 
ATOM   1323 N NZ  . LYS A 1 168 ? 48.014 9.938   -9.630  1.00 28.80  ? 164  LYS A NZ  1 
ATOM   1324 N N   . VAL A 1 169 ? 43.182 5.732   -5.866  1.00 26.45  ? 165  VAL A N   1 
ATOM   1325 C CA  . VAL A 1 169 ? 43.283 4.672   -4.878  1.00 27.98  ? 165  VAL A CA  1 
ATOM   1326 C C   . VAL A 1 169 ? 44.592 3.933   -5.084  1.00 28.54  ? 165  VAL A C   1 
ATOM   1327 O O   . VAL A 1 169 ? 44.826 3.364   -6.146  1.00 24.97  ? 165  VAL A O   1 
ATOM   1328 C CB  . VAL A 1 169 ? 42.146 3.653   -5.012  1.00 28.61  ? 165  VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 169 ? 42.348 2.534   -4.010  1.00 18.32  ? 165  VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 169 ? 40.803 4.340   -4.818  1.00 24.00  ? 165  VAL A CG2 1 
ATOM   1331 N N   . GLU A 1 170 ? 45.442 3.949   -4.063  1.00 27.46  ? 166  GLU A N   1 
ATOM   1332 C CA  . GLU A 1 170 ? 46.724 3.272   -4.126  1.00 25.72  ? 166  GLU A CA  1 
ATOM   1333 C C   . GLU A 1 170 ? 46.766 2.203   -3.043  1.00 23.09  ? 166  GLU A C   1 
ATOM   1334 O O   . GLU A 1 170 ? 46.421 2.467   -1.899  1.00 24.86  ? 166  GLU A O   1 
ATOM   1335 C CB  . GLU A 1 170 ? 47.855 4.281   -3.929  1.00 27.98  ? 166  GLU A CB  1 
ATOM   1336 C CG  . GLU A 1 170 ? 47.883 5.387   -4.977  1.00 41.20  ? 166  GLU A CG  1 
ATOM   1337 C CD  . GLU A 1 170 ? 48.745 6.581   -4.570  1.00 51.18  ? 166  GLU A CD  1 
ATOM   1338 O OE1 . GLU A 1 170 ? 49.990 6.479   -4.665  1.00 56.42  ? 166  GLU A OE1 1 
ATOM   1339 O OE2 . GLU A 1 170 ? 48.182 7.623   -4.160  1.00 55.79  ? 166  GLU A OE2 1 
ATOM   1340 N N   . HIS A 1 171 ? 47.167 0.993   -3.423  1.00 23.96  ? 167  HIS A N   1 
ATOM   1341 C CA  . HIS A 1 171 ? 47.267 -0.144  -2.508  1.00 23.58  ? 167  HIS A CA  1 
ATOM   1342 C C   . HIS A 1 171 ? 48.429 -1.024  -2.979  1.00 26.00  ? 167  HIS A C   1 
ATOM   1343 O O   . HIS A 1 171 ? 48.879 -0.881  -4.110  1.00 24.16  ? 167  HIS A O   1 
ATOM   1344 C CB  . HIS A 1 171 ? 45.958 -0.942  -2.531  1.00 24.40  ? 167  HIS A CB  1 
ATOM   1345 C CG  . HIS A 1 171 ? 45.894 -2.038  -1.512  1.00 29.12  ? 167  HIS A CG  1 
ATOM   1346 N ND1 . HIS A 1 171 ? 45.841 -1.795  -0.155  1.00 31.80  ? 167  HIS A ND1 1 
ATOM   1347 C CD2 . HIS A 1 171 ? 45.864 -3.386  -1.651  1.00 28.60  ? 167  HIS A CD2 1 
ATOM   1348 C CE1 . HIS A 1 171 ? 45.781 -2.943  0.496   1.00 31.14  ? 167  HIS A CE1 1 
ATOM   1349 N NE2 . HIS A 1 171 ? 45.793 -3.924  -0.390  1.00 31.39  ? 167  HIS A NE2 1 
ATOM   1350 N N   . TRP A 1 172 ? 48.932 -1.917  -2.123  1.00 29.36  ? 168  TRP A N   1 
ATOM   1351 C CA  . TRP A 1 172 ? 50.031 -2.800  -2.532  1.00 27.53  ? 168  TRP A CA  1 
ATOM   1352 C C   . TRP A 1 172 ? 49.501 -3.807  -3.544  1.00 28.49  ? 168  TRP A C   1 
ATOM   1353 O O   . TRP A 1 172 ? 50.227 -4.248  -4.434  1.00 26.15  ? 168  TRP A O   1 
ATOM   1354 C CB  . TRP A 1 172 ? 50.625 -3.538  -1.335  1.00 23.52  ? 168  TRP A CB  1 
ATOM   1355 C CG  . TRP A 1 172 ? 51.297 -2.631  -0.375  1.00 26.61  ? 168  TRP A CG  1 
ATOM   1356 C CD1 . TRP A 1 172 ? 52.014 -1.508  -0.672  1.00 30.39  ? 168  TRP A CD1 1 
ATOM   1357 C CD2 . TRP A 1 172 ? 51.312 -2.753  1.049   1.00 26.89  ? 168  TRP A CD2 1 
ATOM   1358 N NE1 . TRP A 1 172 ? 52.476 -0.920  0.484   1.00 26.78  ? 168  TRP A NE1 1 
ATOM   1359 C CE2 . TRP A 1 172 ? 52.059 -1.667  1.555   1.00 30.18  ? 168  TRP A CE2 1 
ATOM   1360 C CE3 . TRP A 1 172 ? 50.767 -3.675  1.949   1.00 26.55  ? 168  TRP A CE3 1 
ATOM   1361 C CZ2 . TRP A 1 172 ? 52.274 -1.480  2.924   1.00 28.03  ? 168  TRP A CZ2 1 
ATOM   1362 C CZ3 . TRP A 1 172 ? 50.981 -3.487  3.305   1.00 25.87  ? 168  TRP A CZ3 1 
ATOM   1363 C CH2 . TRP A 1 172 ? 51.728 -2.398  3.779   1.00 21.14  ? 168  TRP A CH2 1 
ATOM   1364 N N   . GLY A 1 173 ? 48.230 -4.170  -3.394  1.00 28.02  ? 169  GLY A N   1 
ATOM   1365 C CA  . GLY A 1 173 ? 47.607 -5.087  -4.330  1.00 31.71  ? 169  GLY A CA  1 
ATOM   1366 C C   . GLY A 1 173 ? 47.336 -4.289  -5.592  1.00 34.91  ? 169  GLY A C   1 
ATOM   1367 O O   . GLY A 1 173 ? 46.689 -4.761  -6.529  1.00 27.19  ? 169  GLY A O   1 
ATOM   1368 N N   . LEU A 1 174 ? 47.840 -3.055  -5.584  1.00 38.94  ? 170  LEU A N   1 
ATOM   1369 C CA  . LEU A 1 174 ? 47.708 -2.129  -6.697  1.00 43.20  ? 170  LEU A CA  1 
ATOM   1370 C C   . LEU A 1 174 ? 49.018 -2.023  -7.480  1.00 45.41  ? 170  LEU A C   1 
ATOM   1371 O O   . LEU A 1 174 ? 50.097 -1.798  -6.927  1.00 43.99  ? 170  LEU A O   1 
ATOM   1372 C CB  . LEU A 1 174 ? 47.299 -0.742  -6.199  1.00 44.04  ? 170  LEU A CB  1 
ATOM   1373 C CG  . LEU A 1 174 ? 45.893 -0.232  -6.511  1.00 41.95  ? 170  LEU A CG  1 
ATOM   1374 C CD1 . LEU A 1 174 ? 46.034 1.061   -7.292  1.00 45.02  ? 170  LEU A CD1 1 
ATOM   1375 C CD2 . LEU A 1 174 ? 45.088 -1.269  -7.290  1.00 36.91  ? 170  LEU A CD2 1 
ATOM   1376 N N   . GLU A 1 175 ? 48.881 -2.196  -8.785  1.00 48.77  ? 171  GLU A N   1 
ATOM   1377 C CA  . GLU A 1 175 ? 49.964 -2.148  -9.754  1.00 47.44  ? 171  GLU A CA  1 
ATOM   1378 C C   . GLU A 1 175 ? 50.317 -0.690  -10.038 1.00 45.15  ? 171  GLU A C   1 
ATOM   1379 O O   . GLU A 1 175 ? 51.476 -0.284  -9.973  1.00 44.25  ? 171  GLU A O   1 
ATOM   1380 C CB  . GLU A 1 175 ? 49.469 -2.820  -11.030 1.00 51.55  ? 171  GLU A CB  1 
ATOM   1381 C CG  . GLU A 1 175 ? 48.017 -2.426  -11.395 1.00 57.62  ? 171  GLU A CG  1 
ATOM   1382 C CD  . GLU A 1 175 ? 46.936 -3.204  -10.628 1.00 60.18  ? 171  GLU A CD  1 
ATOM   1383 O OE1 . GLU A 1 175 ? 46.723 -2.941  -9.425  1.00 63.85  ? 171  GLU A OE1 1 
ATOM   1384 O OE2 . GLU A 1 175 ? 46.284 -4.078  -11.238 1.00 63.53  ? 171  GLU A OE2 1 
ATOM   1385 N N   . GLU A 1 176 ? 49.280 0.078   -10.353 1.00 42.82  ? 172  GLU A N   1 
ATOM   1386 C CA  . GLU A 1 176 ? 49.378 1.495   -10.659 1.00 42.66  ? 172  GLU A CA  1 
ATOM   1387 C C   . GLU A 1 176 ? 48.141 2.131   -10.028 1.00 38.88  ? 172  GLU A C   1 
ATOM   1388 O O   . GLU A 1 176 ? 47.104 1.480   -9.904  1.00 41.37  ? 172  GLU A O   1 
ATOM   1389 C CB  . GLU A 1 176 ? 49.325 1.696   -12.169 1.00 51.81  ? 172  GLU A CB  1 
ATOM   1390 C CG  . GLU A 1 176 ? 47.965 1.321   -12.765 1.00 60.57  ? 172  GLU A CG  1 
ATOM   1391 C CD  . GLU A 1 176 ? 47.959 1.326   -14.280 1.00 65.48  ? 172  GLU A CD  1 
ATOM   1392 O OE1 . GLU A 1 176 ? 48.932 0.811   -14.876 1.00 65.75  ? 172  GLU A OE1 1 
ATOM   1393 O OE2 . GLU A 1 176 ? 46.979 1.844   -14.867 1.00 67.66  ? 172  GLU A OE2 1 
ATOM   1394 N N   . PRO A 1 177 ? 48.229 3.410   -9.629  1.00 33.24  ? 173  PRO A N   1 
ATOM   1395 C CA  . PRO A 1 177 ? 47.069 4.064   -9.021  1.00 29.72  ? 173  PRO A CA  1 
ATOM   1396 C C   . PRO A 1 177 ? 45.812 3.878   -9.846  1.00 29.92  ? 173  PRO A C   1 
ATOM   1397 O O   . PRO A 1 177 ? 45.826 4.020   -11.064 1.00 31.52  ? 173  PRO A O   1 
ATOM   1398 C CB  . PRO A 1 177 ? 47.477 5.529   -8.944  1.00 27.14  ? 173  PRO A CB  1 
ATOM   1399 C CG  . PRO A 1 177 ? 48.956 5.489   -8.855  1.00 31.93  ? 173  PRO A CG  1 
ATOM   1400 C CD  . PRO A 1 177 ? 49.386 4.316   -9.704  1.00 36.70  ? 173  PRO A CD  1 
ATOM   1401 N N   . VAL A 1 178 ? 44.725 3.537   -9.172  1.00 27.16  ? 174  VAL A N   1 
ATOM   1402 C CA  . VAL A 1 178 ? 43.458 3.353   -9.840  1.00 24.72  ? 174  VAL A CA  1 
ATOM   1403 C C   . VAL A 1 178 ? 42.789 4.722   -9.795  1.00 24.71  ? 174  VAL A C   1 
ATOM   1404 O O   . VAL A 1 178 ? 42.832 5.393   -8.768  1.00 29.49  ? 174  VAL A O   1 
ATOM   1405 C CB  . VAL A 1 178 ? 42.621 2.291   -9.100  1.00 23.13  ? 174  VAL A CB  1 
ATOM   1406 C CG1 . VAL A 1 178 ? 41.189 2.300   -9.586  1.00 14.30  ? 174  VAL A CG1 1 
ATOM   1407 C CG2 . VAL A 1 178 ? 43.255 0.923   -9.310  1.00 21.69  ? 174  VAL A CG2 1 
ATOM   1408 N N   . LEU A 1 179 ? 42.206 5.152   -10.909 1.00 22.58  ? 175  LEU A N   1 
ATOM   1409 C CA  . LEU A 1 179 ? 41.543 6.453   -10.967 1.00 25.11  ? 175  LEU A CA  1 
ATOM   1410 C C   . LEU A 1 179 ? 40.079 6.291   -11.360 1.00 25.99  ? 175  LEU A C   1 
ATOM   1411 O O   . LEU A 1 179 ? 39.771 6.023   -12.521 1.00 30.34  ? 175  LEU A O   1 
ATOM   1412 C CB  . LEU A 1 179 ? 42.236 7.363   -11.989 1.00 26.63  ? 175  LEU A CB  1 
ATOM   1413 C CG  . LEU A 1 179 ? 43.564 8.051   -11.672 1.00 17.50  ? 175  LEU A CG  1 
ATOM   1414 C CD1 . LEU A 1 179 ? 44.054 8.737   -12.928 1.00 17.43  ? 175  LEU A CD1 1 
ATOM   1415 C CD2 . LEU A 1 179 ? 43.387 9.066   -10.577 1.00 14.05  ? 175  LEU A CD2 1 
ATOM   1416 N N   . LYS A 1 180 ? 39.181 6.445   -10.392 1.00 23.87  ? 176  LYS A N   1 
ATOM   1417 C CA  . LYS A 1 180 ? 37.759 6.310   -10.654 1.00 21.38  ? 176  LYS A CA  1 
ATOM   1418 C C   . LYS A 1 180 ? 37.235 7.685   -11.023 1.00 23.33  ? 176  LYS A C   1 
ATOM   1419 O O   . LYS A 1 180 ? 37.339 8.638   -10.251 1.00 29.37  ? 176  LYS A O   1 
ATOM   1420 C CB  . LYS A 1 180 ? 37.035 5.762   -9.421  1.00 21.58  ? 176  LYS A CB  1 
ATOM   1421 C CG  . LYS A 1 180 ? 36.123 4.546   -9.677  1.00 31.45  ? 176  LYS A CG  1 
ATOM   1422 C CD  . LYS A 1 180 ? 36.556 3.683   -10.874 1.00 38.70  ? 176  LYS A CD  1 
ATOM   1423 C CE  . LYS A 1 180 ? 37.604 2.644   -10.490 1.00 41.74  ? 176  LYS A CE  1 
ATOM   1424 N NZ  . LYS A 1 180 ? 38.616 3.246   -9.576  1.00 45.17  ? 176  LYS A NZ  1 
ATOM   1425 N N   . HIS A 1 181 ? 36.670 7.768   -12.219 1.00 23.57  ? 177  HIS A N   1 
ATOM   1426 C CA  . HIS A 1 181 ? 36.143 9.004   -12.782 1.00 22.10  ? 177  HIS A CA  1 
ATOM   1427 C C   . HIS A 1 181 ? 34.718 9.403   -12.374 1.00 21.61  ? 177  HIS A C   1 
ATOM   1428 O O   . HIS A 1 181 ? 33.909 8.562   -11.967 1.00 23.10  ? 177  HIS A O   1 
ATOM   1429 C CB  . HIS A 1 181 ? 36.207 8.886   -14.307 1.00 19.31  ? 177  HIS A CB  1 
ATOM   1430 C CG  . HIS A 1 181 ? 36.257 10.197  -15.015 1.00 20.30  ? 177  HIS A CG  1 
ATOM   1431 N ND1 . HIS A 1 181 ? 35.140 10.792  -15.570 1.00 13.96  ? 177  HIS A ND1 1 
ATOM   1432 C CD2 . HIS A 1 181 ? 37.292 11.027  -15.293 1.00 24.47  ? 177  HIS A CD2 1 
ATOM   1433 C CE1 . HIS A 1 181 ? 35.487 11.924  -16.150 1.00 14.62  ? 177  HIS A CE1 1 
ATOM   1434 N NE2 . HIS A 1 181 ? 36.792 12.091  -15.998 1.00 25.14  ? 177  HIS A NE2 1 
ATOM   1435 N N   . TRP A 1 182 ? 34.436 10.702  -12.484 1.00 16.70  ? 178  TRP A N   1 
ATOM   1436 C CA  . TRP A 1 182 ? 33.118 11.276  -12.220 1.00 12.45  ? 178  TRP A CA  1 
ATOM   1437 C C   . TRP A 1 182 ? 33.081 12.688  -12.779 1.00 13.22  ? 178  TRP A C   1 
ATOM   1438 O O   . TRP A 1 182 ? 33.994 13.489  -12.558 1.00 8.56   ? 178  TRP A O   1 
ATOM   1439 C CB  . TRP A 1 182 ? 32.775 11.320  -10.724 1.00 9.48   ? 178  TRP A CB  1 
ATOM   1440 C CG  . TRP A 1 182 ? 31.294 11.617  -10.488 1.00 14.36  ? 178  TRP A CG  1 
ATOM   1441 C CD1 . TRP A 1 182 ? 30.270 10.706  -10.434 1.00 11.95  ? 178  TRP A CD1 1 
ATOM   1442 C CD2 . TRP A 1 182 ? 30.683 12.914  -10.330 1.00 8.75   ? 178  TRP A CD2 1 
ATOM   1443 N NE1 . TRP A 1 182 ? 29.065 11.361  -10.254 1.00 18.05  ? 178  TRP A NE1 1 
ATOM   1444 C CE2 . TRP A 1 182 ? 29.290 12.701  -10.183 1.00 10.07  ? 178  TRP A CE2 1 
ATOM   1445 C CE3 . TRP A 1 182 ? 31.181 14.223  -10.293 1.00 4.88   ? 178  TRP A CE3 1 
ATOM   1446 C CZ2 . TRP A 1 182 ? 28.389 13.764  -10.011 1.00 9.01   ? 178  TRP A CZ2 1 
ATOM   1447 C CZ3 . TRP A 1 182 ? 30.278 15.277  -10.122 1.00 5.21   ? 178  TRP A CZ3 1 
ATOM   1448 C CH2 . TRP A 1 182 ? 28.900 15.034  -9.980  1.00 9.02   ? 178  TRP A CH2 1 
ATOM   1449 N N   . SER A 1 187 ? 32.023 12.988  -13.516 1.00 17.18  ? 179  SER A N   1 
ATOM   1450 C CA  . SER A 1 187 ? 31.858 14.308  -14.104 1.00 20.23  ? 179  SER A CA  1 
ATOM   1451 C C   . SER A 1 187 ? 30.372 14.622  -14.150 1.00 20.15  ? 179  SER A C   1 
ATOM   1452 O O   . SER A 1 187 ? 29.549 13.713  -14.264 1.00 17.52  ? 179  SER A O   1 
ATOM   1453 C CB  . SER A 1 187 ? 32.465 14.331  -15.508 1.00 20.69  ? 179  SER A CB  1 
ATOM   1454 O OG  . SER A 1 187 ? 32.006 15.440  -16.260 1.00 20.00  ? 179  SER A OG  1 
ATOM   1455 N N   . SER A 1 188 ? 30.034 15.903  -14.038 1.00 26.21  ? 180  SER A N   1 
ATOM   1456 C CA  . SER A 1 188 ? 28.643 16.343  -14.053 1.00 33.26  ? 180  SER A CA  1 
ATOM   1457 C C   . SER A 1 188 ? 28.062 16.144  -15.448 1.00 36.43  ? 180  SER A C   1 
ATOM   1458 O O   . SER A 1 188 ? 26.879 15.827  -15.605 1.00 37.74  ? 180  SER A O   1 
ATOM   1459 C CB  . SER A 1 188 ? 28.552 17.805  -13.609 1.00 30.32  ? 180  SER A CB  1 
ATOM   1460 O OG  . SER A 1 188 ? 28.380 17.849  -12.206 1.00 38.20  ? 180  SER A OG  1 
ATOM   1461 N N   . ALA A 1 189 ? 28.890 16.367  -16.464 1.00 39.91  ? 181  ALA A N   1 
ATOM   1462 C CA  . ALA A 1 189 ? 28.489 16.091  -17.829 1.00 40.89  ? 181  ALA A CA  1 
ATOM   1463 C C   . ALA A 1 189 ? 28.856 14.618  -17.602 1.00 45.33  ? 181  ALA A C   1 
ATOM   1464 O O   . ALA A 1 189 ? 29.700 14.337  -16.753 1.00 52.67  ? 181  ALA A O   1 
ATOM   1465 C CB  . ALA A 1 189 ? 29.452 16.746  -18.807 1.00 32.62  ? 181  ALA A CB  1 
ATOM   1466 N N   . ASP A 1 190 ? 28.243 13.660  -18.273 1.00 43.93  ? 182  ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 28.621 12.259  -18.015 1.00 46.06  ? 182  ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 29.962 11.980  -18.617 1.00 46.69  ? 182  ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 30.024 11.527  -19.753 1.00 48.50  ? 182  ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 27.584 11.261  -18.577 1.00 51.80  ? 182  ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 26.416 11.935  -19.232 1.00 59.02  ? 182  ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 26.349 13.180  -19.207 1.00 67.66  ? 182  ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 25.555 11.225  -19.790 1.00 57.19  ? 182  ASP A OD2 1 
ATOM   1474 N N   . LEU A 1 191 ? 31.046 12.219  -17.873 1.00 40.48  ? 183  LEU A N   1 
ATOM   1475 C CA  . LEU A 1 191 ? 32.335 12.001  -18.468 1.00 30.34  ? 183  LEU A CA  1 
ATOM   1476 C C   . LEU A 1 191 ? 32.990 10.719  -18.340 1.00 31.12  ? 183  LEU A C   1 
ATOM   1477 O O   . LEU A 1 191 ? 33.702 10.443  -17.378 1.00 34.44  ? 183  LEU A O   1 
ATOM   1478 C CB  . LEU A 1 191 ? 33.349 13.068  -18.122 1.00 29.00  ? 183  LEU A CB  1 
ATOM   1479 C CG  . LEU A 1 191 ? 33.604 13.722  -19.484 1.00 25.65  ? 183  LEU A CG  1 
ATOM   1480 C CD1 . LEU A 1 191 ? 32.800 14.995  -19.640 1.00 25.17  ? 183  LEU A CD1 1 
ATOM   1481 C CD2 . LEU A 1 191 ? 35.072 13.993  -19.658 1.00 22.43  ? 183  LEU A CD2 1 
ATOM   1482 N N   . VAL A 1 192 ? 32.702 9.955   -19.387 1.00 45.57  ? 184  VAL A N   1 
ATOM   1483 C CA  . VAL A 1 192 ? 33.211 8.659   -19.704 1.00 54.01  ? 184  VAL A CA  1 
ATOM   1484 C C   . VAL A 1 192 ? 34.704 9.142   -19.607 1.00 58.11  ? 184  VAL A C   1 
ATOM   1485 O O   . VAL A 1 192 ? 34.965 10.286  -20.012 1.00 58.79  ? 184  VAL A O   1 
ATOM   1486 C CB  . VAL A 1 192 ? 32.679 8.395   -21.201 1.00 61.09  ? 184  VAL A CB  1 
ATOM   1487 C CG1 . VAL A 1 192 ? 32.597 6.895   -21.558 1.00 64.26  ? 184  VAL A CG1 1 
ATOM   1488 C CG2 . VAL A 1 192 ? 31.276 9.100   -21.388 1.00 69.61  ? 184  VAL A CG2 1 
ATOM   1489 N N   . PRO A 1 193 ? 35.675 8.342   -19.044 1.00 59.03  ? 185  PRO A N   1 
ATOM   1490 C CA  . PRO A 1 193 ? 37.130 8.463   -18.750 1.00 58.38  ? 185  PRO A CA  1 
ATOM   1491 C C   . PRO A 1 193 ? 37.834 9.774   -19.125 1.00 63.26  ? 185  PRO A C   1 
ATOM   1492 O O   . PRO A 1 193 ? 38.957 10.057  -18.763 1.00 68.91  ? 185  PRO A O   1 
ATOM   1493 C CB  . PRO A 1 193 ? 37.646 7.078   -19.278 1.00 59.56  ? 185  PRO A CB  1 
ATOM   1494 C CG  . PRO A 1 193 ? 36.429 6.214   -19.454 1.00 60.42  ? 185  PRO A CG  1 
ATOM   1495 C CD  . PRO A 1 193 ? 35.293 6.956   -18.832 1.00 58.88  ? 185  PRO A CD  1 
ATOM   1496 N N   . ARG A 1 194 ? 37.437 10.789  -19.836 1.00 64.38  ? 186  ARG A N   1 
ATOM   1497 C CA  . ARG A 1 194 ? 38.439 12.021  -19.737 1.00 69.72  ? 186  ARG A CA  1 
ATOM   1498 C C   . ARG A 1 194 ? 39.369 11.775  -20.948 1.00 71.93  ? 186  ARG A C   1 
ATOM   1499 O O   . ARG A 1 194 ? 39.079 10.860  -21.712 1.00 71.56  ? 186  ARG A O   1 
ATOM   1500 C CB  . ARG A 1 194 ? 38.993 12.195  -18.330 1.00 71.19  ? 186  ARG A CB  1 
ATOM   1501 C CG  . ARG A 1 194 ? 40.372 11.636  -18.116 1.00 75.19  ? 186  ARG A CG  1 
ATOM   1502 C CD  . ARG A 1 194 ? 40.992 12.098  -16.797 1.00 78.08  ? 186  ARG A CD  1 
ATOM   1503 N NE  . ARG A 1 194 ? 42.446 12.208  -16.895 1.00 78.34  ? 186  ARG A NE  1 
ATOM   1504 C CZ  . ARG A 1 194 ? 43.307 11.348  -16.340 1.00 79.68  ? 186  ARG A CZ  1 
ATOM   1505 N NH1 . ARG A 1 194 ? 42.880 10.307  -15.612 1.00 79.91  ? 186  ARG A NH1 1 
ATOM   1506 N NH2 . ARG A 1 194 ? 44.637 11.445  -16.464 1.00 80.20  ? 186  ARG A NH2 1 
ATOM   1507 O OXT . ARG A 1 194 ? 40.407 12.474  -21.152 1.00 78.04  ? 186  ARG A OXT 1 
ATOM   1508 N N   . GLY B 2 1   S 31.074 7.703   35.373  1.00 52.71  ? 2    GLY B N   1 
ATOM   1509 C CA  . GLY B 2 1   S 31.839 8.393   34.298  1.00 54.24  ? 2    GLY B CA  1 
ATOM   1510 C C   . GLY B 2 1   S 32.114 7.593   33.033  1.00 55.19  ? 2    GLY B C   1 
ATOM   1511 O O   . GLY B 2 1   S 32.801 8.108   32.158  1.00 60.74  ? 2    GLY B O   1 
ATOM   1512 N N   . HIS B 2 2   P 31.576 6.370   32.919  1.00 55.98  ? 126  HIS B N   1 
ATOM   1513 C CA  . HIS B 2 2   P 31.813 5.485   31.751  1.00 54.53  ? 126  HIS B CA  1 
ATOM   1514 C C   . HIS B 2 2   P 30.541 4.740   31.280  1.00 51.14  ? 126  HIS B C   1 
ATOM   1515 O O   . HIS B 2 2   P 30.123 3.749   31.878  1.00 53.49  ? 126  HIS B O   1 
ATOM   1516 C CB  . HIS B 2 2   P 32.919 4.468   32.111  1.00 61.39  ? 126  HIS B CB  1 
ATOM   1517 C CG  . HIS B 2 2   P 33.879 4.960   33.146  1.00 66.55  ? 126  HIS B CG  1 
ATOM   1518 N ND1 . HIS B 2 2   P 34.265 6.285   33.219  1.00 67.28  ? 126  HIS B ND1 1 
ATOM   1519 C CD2 . HIS B 2 2   P 34.494 4.341   34.185  1.00 66.94  ? 126  HIS B CD2 1 
ATOM   1520 C CE1 . HIS B 2 2   P 35.062 6.457   34.251  1.00 71.90  ? 126  HIS B CE1 1 
ATOM   1521 N NE2 . HIS B 2 2   P 35.221 5.290   34.858  1.00 70.19  ? 126  HIS B NE2 1 
ATOM   1522 N N   . ALA B 2 3   P 29.950 5.210   30.180  1.00 46.93  ? 127  ALA B N   1 
ATOM   1523 C CA  . ALA B 2 3   P 28.718 4.654   29.624  1.00 37.56  ? 127  ALA B CA  1 
ATOM   1524 C C   . ALA B 2 3   P 28.852 3.504   28.621  1.00 35.73  ? 127  ALA B C   1 
ATOM   1525 O O   . ALA B 2 3   P 28.351 2.410   28.865  1.00 36.01  ? 127  ALA B O   1 
ATOM   1526 C CB  . ALA B 2 3   P 27.909 5.787   28.995  1.00 34.17  ? 127  ALA B CB  1 
ATOM   1527 N N   . THR B 2 4   P 29.507 3.742   27.491  1.00 33.51  ? 128  THR B N   1 
ATOM   1528 C CA  . THR B 2 4   P 29.626 2.692   26.482  1.00 29.96  ? 128  THR B CA  1 
ATOM   1529 C C   . THR B 2 4   P 30.836 1.809   26.707  1.00 30.47  ? 128  THR B C   1 
ATOM   1530 O O   . THR B 2 4   P 31.968 2.285   26.793  1.00 27.19  ? 128  THR B O   1 
ATOM   1531 C CB  . THR B 2 4   P 29.635 3.294   25.044  1.00 28.72  ? 128  THR B CB  1 
ATOM   1532 O OG1 . THR B 2 4   P 29.021 2.369   24.141  1.00 40.84  ? 128  THR B OG1 1 
ATOM   1533 C CG2 . THR B 2 4   P 31.042 3.600   24.576  1.00 22.60  ? 128  THR B CG2 1 
ATOM   1534 N N   . GLN B 2 5   P 30.573 0.510   26.801  1.00 33.37  ? 129  GLN B N   1 
ATOM   1535 C CA  . GLN B 2 5   P 31.597 -0.493  27.049  1.00 32.82  ? 129  GLN B CA  1 
ATOM   1536 C C   . GLN B 2 5   P 32.053 -1.236  25.805  1.00 35.28  ? 129  GLN B C   1 
ATOM   1537 O O   . GLN B 2 5   P 31.274 -1.454  24.874  1.00 38.65  ? 129  GLN B O   1 
ATOM   1538 C CB  . GLN B 2 5   P 31.072 -1.508  28.064  1.00 35.71  ? 129  GLN B CB  1 
ATOM   1539 C CG  . GLN B 2 5   P 30.418 -0.874  29.258  1.00 35.10  ? 129  GLN B CG  1 
ATOM   1540 C CD  . GLN B 2 5   P 31.431 -0.290  30.206  1.00 38.14  ? 129  GLN B CD  1 
ATOM   1541 O OE1 . GLN B 2 5   P 32.175 -1.021  30.853  1.00 46.11  ? 129  GLN B OE1 1 
ATOM   1542 N NE2 . GLN B 2 5   P 31.471 1.030   30.294  1.00 44.19  ? 129  GLN B NE2 1 
ATOM   1543 N N   . GLY B 2 6   P 33.322 -1.635  25.808  1.00 31.31  ? 130  GLY B N   1 
ATOM   1544 C CA  . GLY B 2 6   P 33.886 -2.376  24.696  1.00 34.42  ? 130  GLY B CA  1 
ATOM   1545 C C   . GLY B 2 6   P 34.308 -3.764  25.142  1.00 38.51  ? 130  GLY B C   1 
ATOM   1546 O O   . GLY B 2 6   P 34.809 -3.951  26.251  1.00 40.24  ? 130  GLY B O   1 
ATOM   1547 N N   . VAL B 2 7   P 34.109 -4.744  24.268  1.00 40.63  ? 131  VAL B N   1 
ATOM   1548 C CA  . VAL B 2 7   P 34.454 -6.138  24.548  1.00 37.82  ? 131  VAL B CA  1 
ATOM   1549 C C   . VAL B 2 7   P 35.962 -6.338  24.595  1.00 34.64  ? 131  VAL B C   1 
ATOM   1550 O O   . VAL B 2 7   P 36.681 -5.877  23.708  1.00 34.98  ? 131  VAL B O   1 
ATOM   1551 C CB  . VAL B 2 7   P 33.847 -7.065  23.479  1.00 39.48  ? 131  VAL B CB  1 
ATOM   1552 C CG1 . VAL B 2 7   P 34.468 -8.438  23.564  1.00 40.19  ? 131  VAL B CG1 1 
ATOM   1553 C CG2 . VAL B 2 7   P 32.343 -7.148  23.673  1.00 41.55  ? 131  VAL B CG2 1 
ATOM   1554 N N   . THR B 2 8   P 36.430 -7.050  25.617  1.00 30.45  ? 132  THR B N   1 
ATOM   1555 C CA  . THR B 2 8   P 37.862 -7.275  25.798  1.00 31.27  ? 132  THR B CA  1 
ATOM   1556 C C   . THR B 2 8   P 38.474 -8.464  25.035  1.00 31.23  ? 132  THR B C   1 
ATOM   1557 O O   . THR B 2 8   P 37.898 -9.560  24.976  1.00 27.91  ? 132  THR B O   1 
ATOM   1558 C CB  . THR B 2 8   P 38.222 -7.357  27.335  1.00 27.64  ? 132  THR B CB  1 
ATOM   1559 O OG1 . THR B 2 8   P 39.294 -8.287  27.544  1.00 19.44  ? 132  THR B OG1 1 
ATOM   1560 C CG2 . THR B 2 8   P 37.008 -7.764  28.168  1.00 24.91  ? 132  THR B CG2 1 
ATOM   1561 N N   . ALA B 2 9   P 39.644 -8.198  24.441  1.00 32.02  ? 133  ALA B N   1 
ATOM   1562 C CA  . ALA B 2 9   P 40.433 -9.149  23.648  1.00 28.98  ? 133  ALA B CA  1 
ATOM   1563 C C   . ALA B 2 9   P 41.299 -10.006 24.551  1.00 27.66  ? 133  ALA B C   1 
ATOM   1564 O O   . ALA B 2 9   P 42.139 -9.482  25.277  1.00 28.55  ? 133  ALA B O   1 
ATOM   1565 C CB  . ALA B 2 9   P 41.323 -8.386  22.678  1.00 25.09  ? 133  ALA B CB  1 
ATOM   1566 N N   . ALA B 2 10  P 41.120 -11.321 24.498  1.00 27.93  ? 134  ALA B N   1 
ATOM   1567 C CA  . ALA B 2 10  P 41.896 -12.218 25.352  1.00 28.09  ? 134  ALA B CA  1 
ATOM   1568 C C   . ALA B 2 10  P 43.310 -12.400 24.815  1.00 26.38  ? 134  ALA B C   1 
ATOM   1569 O O   . ALA B 2 10  P 43.485 -12.569 23.608  1.00 29.92  ? 134  ALA B O   1 
ATOM   1570 C CB  . ALA B 2 10  P 41.192 -13.574 25.452  1.00 30.57  ? 134  ALA B CB  1 
ATOM   1571 N N   . SER B 2 11  P 44.319 -12.359 25.692  1.00 24.12  ? 135  SER B N   1 
ATOM   1572 C CA  . SER B 2 11  P 45.715 -12.544 25.266  1.00 20.59  ? 135  SER B CA  1 
ATOM   1573 C C   . SER B 2 11  P 46.110 -14.008 25.371  1.00 19.84  ? 135  SER B C   1 
ATOM   1574 O O   . SER B 2 11  P 45.713 -14.705 26.299  1.00 21.20  ? 135  SER B O   1 
ATOM   1575 C CB  . SER B 2 11  P 46.692 -11.714 26.110  1.00 19.97  ? 135  SER B CB  1 
ATOM   1576 O OG  . SER B 2 11  P 46.105 -10.520 26.585  1.00 16.54  ? 135  SER B OG  1 
ATOM   1577 N N   . SER B 2 12  P 46.907 -14.473 24.419  1.00 25.57  ? 136  SER B N   1 
ATOM   1578 C CA  . SER B 2 12  P 47.327 -15.866 24.413  1.00 28.98  ? 136  SER B CA  1 
ATOM   1579 C C   . SER B 2 12  P 48.552 -16.108 25.283  1.00 32.89  ? 136  SER B C   1 
ATOM   1580 O O   . SER B 2 12  P 49.067 -15.196 25.930  1.00 34.60  ? 136  SER B O   1 
ATOM   1581 C CB  . SER B 2 12  P 47.574 -16.347 22.979  1.00 28.26  ? 136  SER B CB  1 
ATOM   1582 O OG  . SER B 2 12  P 48.791 -15.832 22.475  1.00 32.44  ? 136  SER B OG  1 
ATOM   1583 N N   . HIS B 2 13  P 49.017 -17.351 25.277  1.00 36.43  ? 137  HIS B N   1 
ATOM   1584 C CA  . HIS B 2 13  P 50.143 -17.782 26.092  1.00 40.80  ? 137  HIS B CA  1 
ATOM   1585 C C   . HIS B 2 13  P 51.521 -17.927 25.412  1.00 46.01  ? 137  HIS B C   1 
ATOM   1586 O O   . HIS B 2 13  P 51.643 -17.851 24.191  1.00 46.46  ? 137  HIS B O   1 
ATOM   1587 C CB  . HIS B 2 13  P 49.740 -19.109 26.744  1.00 41.18  ? 137  HIS B CB  1 
ATOM   1588 C CG  . HIS B 2 13  P 50.751 -19.656 27.697  1.00 46.16  ? 137  HIS B CG  1 
ATOM   1589 N ND1 . HIS B 2 13  P 51.855 -20.369 27.283  1.00 43.58  ? 137  HIS B ND1 1 
ATOM   1590 C CD2 . HIS B 2 13  P 50.840 -19.575 29.047  1.00 46.03  ? 137  HIS B CD2 1 
ATOM   1591 C CE1 . HIS B 2 13  P 52.582 -20.701 28.334  1.00 45.72  ? 137  HIS B CE1 1 
ATOM   1592 N NE2 . HIS B 2 13  P 51.986 -20.230 29.417  1.00 48.11  ? 137  HIS B NE2 1 
ATOM   1593 N N   . GLU B 2 14  P 52.544 -18.118 26.249  1.00 55.53  ? 138  GLU B N   1 
ATOM   1594 C CA  . GLU B 2 14  P 53.949 -18.346 25.876  1.00 63.81  ? 138  GLU B CA  1 
ATOM   1595 C C   . GLU B 2 14  P 54.949 -17.195 25.949  1.00 68.32  ? 138  GLU B C   1 
ATOM   1596 O O   . GLU B 2 14  P 54.612 -16.058 25.554  1.00 71.97  ? 138  GLU B O   1 
ATOM   1597 C CB  . GLU B 2 14  P 54.044 -19.008 24.501  1.00 65.87  ? 138  GLU B CB  1 
ATOM   1598 C CG  . GLU B 2 14  P 54.238 -20.516 24.593  1.00 72.48  ? 138  GLU B CG  1 
ATOM   1599 C CD  . GLU B 2 14  P 55.032 -21.090 23.431  1.00 76.49  ? 138  GLU B CD  1 
ATOM   1600 O OE1 . GLU B 2 14  P 55.804 -20.336 22.796  1.00 78.29  ? 138  GLU B OE1 1 
ATOM   1601 O OE2 . GLU B 2 14  P 54.882 -22.301 23.155  1.00 77.11  ? 138  GLU B OE2 1 
ATOM   1602 N N   . ARG B 2 19  ? 58.323 -9.073  5.961   1.00 29.65  ? 5    ARG B N   1 
ATOM   1603 C CA  . ARG B 2 19  ? 56.907 -9.536  5.777   1.00 33.91  ? 5    ARG B CA  1 
ATOM   1604 C C   . ARG B 2 19  ? 55.848 -8.705  6.498   1.00 35.10  ? 5    ARG B C   1 
ATOM   1605 O O   . ARG B 2 19  ? 56.116 -8.108  7.546   1.00 35.59  ? 5    ARG B O   1 
ATOM   1606 N N   . HIS B 2 20  ? 54.641 -8.671  5.933   1.00 30.69  ? 6    HIS B N   1 
ATOM   1607 C CA  . HIS B 2 20  ? 53.532 -7.921  6.512   1.00 26.13  ? 6    HIS B CA  1 
ATOM   1608 C C   . HIS B 2 20  ? 52.495 -8.873  7.095   1.00 25.96  ? 6    HIS B C   1 
ATOM   1609 O O   . HIS B 2 20  ? 52.010 -9.778  6.411   1.00 23.15  ? 6    HIS B O   1 
ATOM   1610 C CB  . HIS B 2 20  ? 52.878 -7.035  5.448   1.00 28.88  ? 6    HIS B CB  1 
ATOM   1611 C CG  . HIS B 2 20  ? 51.823 -6.115  5.984   1.00 30.10  ? 6    HIS B CG  1 
ATOM   1612 N ND1 . HIS B 2 20  ? 52.120 -4.930  6.623   1.00 32.10  ? 6    HIS B ND1 1 
ATOM   1613 C CD2 . HIS B 2 20  ? 50.470 -6.195  5.953   1.00 25.37  ? 6    HIS B CD2 1 
ATOM   1614 C CE1 . HIS B 2 20  ? 50.997 -4.319  6.961   1.00 29.97  ? 6    HIS B CE1 1 
ATOM   1615 N NE2 . HIS B 2 20  ? 49.983 -5.068  6.566   1.00 24.01  ? 6    HIS B NE2 1 
ATOM   1616 N N   . PHE B 2 21  ? 52.171 -8.661  8.369   1.00 26.78  ? 7    PHE B N   1 
ATOM   1617 C CA  . PHE B 2 21  ? 51.198 -9.482  9.083   1.00 25.13  ? 7    PHE B CA  1 
ATOM   1618 C C   . PHE B 2 21  ? 50.147 -8.596  9.734   1.00 24.23  ? 7    PHE B C   1 
ATOM   1619 O O   . PHE B 2 21  ? 50.406 -7.439  10.064  1.00 22.18  ? 7    PHE B O   1 
ATOM   1620 C CB  . PHE B 2 21  ? 51.890 -10.325 10.159  1.00 24.19  ? 7    PHE B CB  1 
ATOM   1621 C CG  . PHE B 2 21  ? 53.146 -10.985 9.690   1.00 27.39  ? 7    PHE B CG  1 
ATOM   1622 C CD1 . PHE B 2 21  ? 53.097 -12.186 8.984   1.00 27.52  ? 7    PHE B CD1 1 
ATOM   1623 C CD2 . PHE B 2 21  ? 54.383 -10.385 9.913   1.00 24.70  ? 7    PHE B CD2 1 
ATOM   1624 C CE1 . PHE B 2 21  ? 54.270 -12.779 8.503   1.00 27.50  ? 7    PHE B CE1 1 
ATOM   1625 C CE2 . PHE B 2 21  ? 55.554 -10.969 9.439   1.00 21.65  ? 7    PHE B CE2 1 
ATOM   1626 C CZ  . PHE B 2 21  ? 55.498 -12.167 8.730   1.00 22.22  ? 7    PHE B CZ  1 
ATOM   1627 N N   . VAL B 2 22  ? 48.960 -9.160  9.920   1.00 24.54  ? 8    VAL B N   1 
ATOM   1628 C CA  . VAL B 2 22  ? 47.840 -8.447  10.517  1.00 22.86  ? 8    VAL B CA  1 
ATOM   1629 C C   . VAL B 2 22  ? 47.068 -9.422  11.401  1.00 24.43  ? 8    VAL B C   1 
ATOM   1630 O O   . VAL B 2 22  ? 47.186 -10.637 11.248  1.00 24.36  ? 8    VAL B O   1 
ATOM   1631 C CB  . VAL B 2 22  ? 46.863 -7.915  9.412   1.00 19.84  ? 8    VAL B CB  1 
ATOM   1632 C CG1 . VAL B 2 22  ? 45.719 -7.108  10.031  1.00 12.16  ? 8    VAL B CG1 1 
ATOM   1633 C CG2 . VAL B 2 22  ? 47.616 -7.075  8.417   1.00 16.11  ? 8    VAL B CG2 1 
ATOM   1634 N N   . VAL B 2 23  ? 46.306 -8.874  12.340  1.00 24.71  ? 9    VAL B N   1 
ATOM   1635 C CA  . VAL B 2 23  ? 45.444 -9.654  13.221  1.00 21.03  ? 9    VAL B CA  1 
ATOM   1636 C C   . VAL B 2 23  ? 44.282 -8.728  13.523  1.00 21.35  ? 9    VAL B C   1 
ATOM   1637 O O   . VAL B 2 23  ? 44.437 -7.507  13.574  1.00 26.13  ? 9    VAL B O   1 
ATOM   1638 C CB  . VAL B 2 23  ? 46.104 -10.049 14.569  1.00 14.08  ? 9    VAL B CB  1 
ATOM   1639 C CG1 . VAL B 2 23  ? 47.257 -10.988 14.334  1.00 13.12  ? 9    VAL B CG1 1 
ATOM   1640 C CG2 . VAL B 2 23  ? 46.543 -8.812  15.318  1.00 14.04  ? 9    VAL B CG2 1 
ATOM   1641 N N   . GLN B 2 24  ? 43.112 -9.311  13.700  1.00 19.20  ? 10   GLN B N   1 
ATOM   1642 C CA  . GLN B 2 24  ? 41.937 -8.538  14.014  1.00 15.34  ? 10   GLN B CA  1 
ATOM   1643 C C   . GLN B 2 24  ? 41.211 -9.258  15.137  1.00 18.21  ? 10   GLN B C   1 
ATOM   1644 O O   . GLN B 2 24  ? 41.221 -10.493 15.204  1.00 16.83  ? 10   GLN B O   1 
ATOM   1645 C CB  . GLN B 2 24  ? 41.041 -8.436  12.782  1.00 19.76  ? 10   GLN B CB  1 
ATOM   1646 C CG  . GLN B 2 24  ? 41.801 -8.324  11.453  1.00 21.73  ? 10   GLN B CG  1 
ATOM   1647 C CD  . GLN B 2 24  ? 40.876 -8.440  10.245  1.00 22.10  ? 10   GLN B CD  1 
ATOM   1648 O OE1 . GLN B 2 24  ? 39.820 -7.806  10.200  1.00 16.31  ? 10   GLN B OE1 1 
ATOM   1649 N NE2 . GLN B 2 24  ? 41.268 -9.258  9.262   1.00 22.28  ? 10   GLN B NE2 1 
ATOM   1650 N N   . PHE B 2 25  ? 40.636 -8.484  16.053  1.00 16.84  ? 11   PHE B N   1 
ATOM   1651 C CA  . PHE B 2 25  ? 39.855 -9.050  17.147  1.00 16.48  ? 11   PHE B CA  1 
ATOM   1652 C C   . PHE B 2 25  ? 38.497 -8.440  16.910  1.00 14.63  ? 11   PHE B C   1 
ATOM   1653 O O   . PHE B 2 25  ? 38.378 -7.231  16.714  1.00 17.54  ? 11   PHE B O   1 
ATOM   1654 C CB  . PHE B 2 25  ? 40.369 -8.629  18.532  1.00 19.08  ? 11   PHE B CB  1 
ATOM   1655 C CG  . PHE B 2 25  ? 39.383 -8.904  19.642  1.00 18.02  ? 11   PHE B CG  1 
ATOM   1656 C CD1 . PHE B 2 25  ? 39.074 -10.216 20.011  1.00 21.61  ? 11   PHE B CD1 1 
ATOM   1657 C CD2 . PHE B 2 25  ? 38.718 -7.865  20.275  1.00 16.44  ? 11   PHE B CD2 1 
ATOM   1658 C CE1 . PHE B 2 25  ? 38.108 -10.486 20.995  1.00 16.14  ? 11   PHE B CE1 1 
ATOM   1659 C CE2 . PHE B 2 25  ? 37.754 -8.125  21.257  1.00 18.31  ? 11   PHE B CE2 1 
ATOM   1660 C CZ  . PHE B 2 25  ? 37.451 -9.438  21.615  1.00 11.73  ? 11   PHE B CZ  1 
ATOM   1661 N N   . LYS B 2 26  ? 37.465 -9.263  16.901  1.00 15.05  ? 12   LYS B N   1 
ATOM   1662 C CA  . LYS B 2 26  ? 36.150 -8.727  16.650  1.00 17.81  ? 12   LYS B CA  1 
ATOM   1663 C C   . LYS B 2 26  ? 35.158 -9.122  17.715  1.00 18.50  ? 12   LYS B C   1 
ATOM   1664 O O   . LYS B 2 26  ? 34.944 -10.301 17.973  1.00 22.76  ? 12   LYS B O   1 
ATOM   1665 C CB  . LYS B 2 26  ? 35.653 -9.192  15.282  1.00 19.44  ? 12   LYS B CB  1 
ATOM   1666 C CG  . LYS B 2 26  ? 36.238 -8.420  14.102  1.00 20.02  ? 12   LYS B CG  1 
ATOM   1667 C CD  . LYS B 2 26  ? 35.969 -9.176  12.808  1.00 19.22  ? 12   LYS B CD  1 
ATOM   1668 C CE  . LYS B 2 26  ? 36.382 -8.402  11.575  1.00 17.12  ? 12   LYS B CE  1 
ATOM   1669 N NZ  . LYS B 2 26  ? 35.622 -8.906  10.396  1.00 17.03  ? 12   LYS B NZ  1 
ATOM   1670 N N   . GLY B 2 27  ? 34.555 -8.122  18.341  1.00 18.47  ? 13   GLY B N   1 
ATOM   1671 C CA  . GLY B 2 27  ? 33.555 -8.392  19.351  1.00 20.74  ? 13   GLY B CA  1 
ATOM   1672 C C   . GLY B 2 27  ? 32.233 -7.966  18.750  1.00 20.13  ? 13   GLY B C   1 
ATOM   1673 O O   . GLY B 2 27  ? 32.000 -6.761  18.576  1.00 19.67  ? 13   GLY B O   1 
ATOM   1674 N N   . GLU B 2 28  ? 31.364 -8.920  18.428  1.00 14.53  ? 14   GLU B N   1 
ATOM   1675 C CA  . GLU B 2 28  ? 30.091 -8.547  17.820  1.00 20.59  ? 14   GLU B CA  1 
ATOM   1676 C C   . GLU B 2 28  ? 28.872 -8.979  18.592  1.00 22.28  ? 14   GLU B C   1 
ATOM   1677 O O   . GLU B 2 28  ? 28.787 -10.098 19.052  1.00 21.91  ? 14   GLU B O   1 
ATOM   1678 C CB  . GLU B 2 28  ? 29.978 -9.135  16.424  1.00 25.16  ? 14   GLU B CB  1 
ATOM   1679 C CG  . GLU B 2 28  ? 31.101 -10.047 16.041  1.00 22.50  ? 14   GLU B CG  1 
ATOM   1680 C CD  . GLU B 2 28  ? 30.998 -10.470 14.603  1.00 23.47  ? 14   GLU B CD  1 
ATOM   1681 O OE1 . GLU B 2 28  ? 30.170 -11.363 14.306  1.00 22.58  ? 14   GLU B OE1 1 
ATOM   1682 O OE2 . GLU B 2 28  ? 31.741 -9.908  13.770  1.00 27.61  ? 14   GLU B OE2 1 
ATOM   1683 N N   . CYS B 2 29  ? 27.897 -8.101  18.715  1.00 23.62  ? 15   CYS B N   1 
ATOM   1684 C CA  . CYS B 2 29  ? 26.715 -8.520  19.409  1.00 27.33  ? 15   CYS B CA  1 
ATOM   1685 C C   . CYS B 2 29  ? 25.471 -8.252  18.616  1.00 25.88  ? 15   CYS B C   1 
ATOM   1686 O O   . CYS B 2 29  ? 25.221 -7.115  18.220  1.00 24.68  ? 15   CYS B O   1 
ATOM   1687 C CB  . CYS B 2 29  ? 26.671 -7.903  20.813  1.00 31.70  ? 15   CYS B CB  1 
ATOM   1688 S SG  . CYS B 2 29  ? 26.931 -9.156  22.102  1.00 49.72  ? 15   CYS B SG  1 
ATOM   1689 N N   . TYR B 2 30  ? 24.715 -9.335  18.395  1.00 24.53  ? 16   TYR B N   1 
ATOM   1690 C CA  . TYR B 2 30  ? 23.458 -9.336  17.648  1.00 26.03  ? 16   TYR B CA  1 
ATOM   1691 C C   . TYR B 2 30  ? 22.260 -9.285  18.602  1.00 25.00  ? 16   TYR B C   1 
ATOM   1692 O O   . TYR B 2 30  ? 22.234 -9.975  19.619  1.00 22.09  ? 16   TYR B O   1 
ATOM   1693 C CB  . TYR B 2 30  ? 23.338 -10.607 16.786  1.00 28.97  ? 16   TYR B CB  1 
ATOM   1694 C CG  . TYR B 2 30  ? 24.530 -10.885 15.896  1.00 28.62  ? 16   TYR B CG  1 
ATOM   1695 C CD1 . TYR B 2 30  ? 25.681 -11.499 16.401  1.00 31.79  ? 16   TYR B CD1 1 
ATOM   1696 C CD2 . TYR B 2 30  ? 24.544 -10.456 14.566  1.00 29.24  ? 16   TYR B CD2 1 
ATOM   1697 C CE1 . TYR B 2 30  ? 26.823 -11.666 15.606  1.00 27.84  ? 16   TYR B CE1 1 
ATOM   1698 C CE2 . TYR B 2 30  ? 25.679 -10.620 13.762  1.00 25.78  ? 16   TYR B CE2 1 
ATOM   1699 C CZ  . TYR B 2 30  ? 26.813 -11.216 14.290  1.00 26.05  ? 16   TYR B CZ  1 
ATOM   1700 O OH  . TYR B 2 30  ? 27.943 -11.310 13.519  1.00 20.16  ? 16   TYR B OH  1 
ATOM   1701 N N   . TYR B 2 31  ? 21.261 -8.478  18.269  1.00 24.47  ? 17   TYR B N   1 
ATOM   1702 C CA  . TYR B 2 31  ? 20.085 -8.380  19.111  1.00 23.02  ? 17   TYR B CA  1 
ATOM   1703 C C   . TYR B 2 31  ? 18.871 -8.590  18.254  1.00 26.10  ? 17   TYR B C   1 
ATOM   1704 O O   . TYR B 2 31  ? 18.846 -8.180  17.096  1.00 29.68  ? 17   TYR B O   1 
ATOM   1705 C CB  . TYR B 2 31  ? 19.988 -7.000  19.755  1.00 21.20  ? 17   TYR B CB  1 
ATOM   1706 C CG  . TYR B 2 31  ? 21.268 -6.510  20.386  1.00 25.43  ? 17   TYR B CG  1 
ATOM   1707 C CD1 . TYR B 2 31  ? 22.313 -6.025  19.600  1.00 18.69  ? 17   TYR B CD1 1 
ATOM   1708 C CD2 . TYR B 2 31  ? 21.428 -6.504  21.778  1.00 25.00  ? 17   TYR B CD2 1 
ATOM   1709 C CE1 . TYR B 2 31  ? 23.486 -5.545  20.181  1.00 22.22  ? 17   TYR B CE1 1 
ATOM   1710 C CE2 . TYR B 2 31  ? 22.596 -6.025  22.365  1.00 21.55  ? 17   TYR B CE2 1 
ATOM   1711 C CZ  . TYR B 2 31  ? 23.617 -5.548  21.563  1.00 19.90  ? 17   TYR B CZ  1 
ATOM   1712 O OH  . TYR B 2 31  ? 24.761 -5.059  22.143  1.00 30.82  ? 17   TYR B OH  1 
ATOM   1713 N N   . THR B 2 32  ? 17.864 -9.242  18.813  1.00 27.40  ? 18   THR B N   1 
ATOM   1714 C CA  . THR B 2 32  ? 16.639 -9.455  18.068  1.00 30.20  ? 18   THR B CA  1 
ATOM   1715 C C   . THR B 2 32  ? 15.464 -9.382  19.031  1.00 31.16  ? 18   THR B C   1 
ATOM   1716 O O   . THR B 2 32  ? 15.478 -9.985  20.105  1.00 28.90  ? 18   THR B O   1 
ATOM   1717 C CB  . THR B 2 32  ? 16.648 -10.800 17.283  1.00 27.17  ? 18   THR B CB  1 
ATOM   1718 O OG1 . THR B 2 32  ? 15.554 -11.611 17.713  1.00 32.10  ? 18   THR B OG1 1 
ATOM   1719 C CG2 . THR B 2 32  ? 17.957 -11.549 17.480  1.00 25.77  ? 18   THR B CG2 1 
ATOM   1720 N N   . ASN B 2 33  ? 14.459 -8.605  18.636  1.00 33.85  ? 19   ASN B N   1 
ATOM   1721 C CA  . ASN B 2 33  ? 13.268 -8.379  19.438  1.00 35.25  ? 19   ASN B CA  1 
ATOM   1722 C C   . ASN B 2 33  ? 13.694 -7.682  20.704  1.00 35.15  ? 19   ASN B C   1 
ATOM   1723 O O   . ASN B 2 33  ? 13.360 -8.107  21.806  1.00 38.90  ? 19   ASN B O   1 
ATOM   1724 C CB  . ASN B 2 33  ? 12.563 -9.692  19.782  1.00 38.35  ? 19   ASN B CB  1 
ATOM   1725 C CG  . ASN B 2 33  ? 11.522 -10.064 18.757  1.00 41.67  ? 19   ASN B CG  1 
ATOM   1726 O OD1 . ASN B 2 33  ? 11.742 -9.886  17.560  1.00 48.11  ? 19   ASN B OD1 1 
ATOM   1727 N ND2 . ASN B 2 33  ? 10.380 -10.582 19.213  1.00 38.93  ? 19   ASN B ND2 1 
ATOM   1728 N N   . GLY B 2 34  ? 14.449 -6.605  20.533  1.00 37.06  ? 20   GLY B N   1 
ATOM   1729 C CA  . GLY B 2 34  ? 14.917 -5.837  21.666  1.00 37.69  ? 20   GLY B CA  1 
ATOM   1730 C C   . GLY B 2 34  ? 16.119 -6.467  22.328  1.00 38.34  ? 20   GLY B C   1 
ATOM   1731 O O   . GLY B 2 34  ? 17.094 -6.830  21.674  1.00 37.72  ? 20   GLY B O   1 
ATOM   1732 N N   . THR B 2 35  ? 16.041 -6.596  23.641  1.00 40.05  ? 21   THR B N   1 
ATOM   1733 C CA  . THR B 2 35  ? 17.122 -7.172  24.414  1.00 41.11  ? 21   THR B CA  1 
ATOM   1734 C C   . THR B 2 35  ? 16.702 -8.578  24.869  1.00 43.43  ? 21   THR B C   1 
ATOM   1735 O O   . THR B 2 35  ? 17.391 -9.236  25.657  1.00 43.90  ? 21   THR B O   1 
ATOM   1736 C CB  . THR B 2 35  ? 17.460 -6.229  25.605  1.00 38.65  ? 21   THR B CB  1 
ATOM   1737 O OG1 . THR B 2 35  ? 18.876 -6.038  25.665  1.00 36.46  ? 21   THR B OG1 1 
ATOM   1738 C CG2 . THR B 2 35  ? 16.944 -6.773  26.928  1.00 41.15  ? 21   THR B CG2 1 
ATOM   1739 N N   . GLN B 2 36  ? 15.570 -9.034  24.332  1.00 42.20  ? 22   GLN B N   1 
ATOM   1740 C CA  . GLN B 2 36  ? 15.020 -10.349 24.643  1.00 40.81  ? 22   GLN B CA  1 
ATOM   1741 C C   . GLN B 2 36  ? 15.940 -11.464 24.186  1.00 39.25  ? 22   GLN B C   1 
ATOM   1742 O O   . GLN B 2 36  ? 16.059 -12.488 24.846  1.00 41.27  ? 22   GLN B O   1 
ATOM   1743 C CB  . GLN B 2 36  ? 13.659 -10.523 23.974  1.00 42.76  ? 22   GLN B CB  1 
ATOM   1744 C CG  . GLN B 2 36  ? 12.576 -10.999 24.925  1.00 51.67  ? 22   GLN B CG  1 
ATOM   1745 C CD  . GLN B 2 36  ? 11.392 -10.051 24.979  1.00 56.96  ? 22   GLN B CD  1 
ATOM   1746 O OE1 . GLN B 2 36  ? 10.359 -10.298 24.352  1.00 59.77  ? 22   GLN B OE1 1 
ATOM   1747 N NE2 . GLN B 2 36  ? 11.535 -8.956  25.727  1.00 58.88  ? 22   GLN B NE2 1 
ATOM   1748 N N   . ARG B 2 37  ? 16.584 -11.258 23.047  1.00 38.73  ? 23   ARG B N   1 
ATOM   1749 C CA  . ARG B 2 37  ? 17.496 -12.241 22.488  1.00 38.99  ? 23   ARG B CA  1 
ATOM   1750 C C   . ARG B 2 37  ? 18.822 -11.555 22.144  1.00 36.14  ? 23   ARG B C   1 
ATOM   1751 O O   . ARG B 2 37  ? 18.886 -10.726 21.238  1.00 36.25  ? 23   ARG B O   1 
ATOM   1752 C CB  . ARG B 2 37  ? 16.864 -12.849 21.240  1.00 44.04  ? 23   ARG B CB  1 
ATOM   1753 C CG  . ARG B 2 37  ? 17.524 -14.103 20.711  1.00 48.14  ? 23   ARG B CG  1 
ATOM   1754 C CD  . ARG B 2 37  ? 16.691 -14.639 19.555  1.00 52.73  ? 23   ARG B CD  1 
ATOM   1755 N NE  . ARG B 2 37  ? 17.489 -15.357 18.566  1.00 56.14  ? 23   ARG B NE  1 
ATOM   1756 C CZ  . ARG B 2 37  ? 17.261 -15.330 17.256  1.00 55.25  ? 23   ARG B CZ  1 
ATOM   1757 N NH1 . ARG B 2 37  ? 16.257 -14.617 16.767  1.00 55.17  ? 23   ARG B NH1 1 
ATOM   1758 N NH2 . ARG B 2 37  ? 18.031 -16.029 16.433  1.00 58.02  ? 23   ARG B NH2 1 
ATOM   1759 N N   . ILE B 2 38  ? 19.866 -11.899 22.888  1.00 33.16  ? 24   ILE B N   1 
ATOM   1760 C CA  . ILE B 2 38  ? 21.197 -11.308 22.690  1.00 29.78  ? 24   ILE B CA  1 
ATOM   1761 C C   . ILE B 2 38  ? 22.246 -12.420 22.577  1.00 29.02  ? 24   ILE B C   1 
ATOM   1762 O O   . ILE B 2 38  ? 22.351 -13.271 23.461  1.00 29.73  ? 24   ILE B O   1 
ATOM   1763 C CB  . ILE B 2 38  ? 21.534 -10.387 23.863  1.00 28.53  ? 24   ILE B CB  1 
ATOM   1764 C CG1 . ILE B 2 38  ? 20.538 -9.240  24.031  1.00 20.00  ? 24   ILE B CG1 1 
ATOM   1765 C CG2 . ILE B 2 38  ? 22.909 -9.730  23.729  1.00 19.42  ? 24   ILE B CG2 1 
ATOM   1766 C CD1 . ILE B 2 38  ? 20.883 -8.316  25.200  1.00 20.00  ? 24   ILE B CD1 1 
ATOM   1767 N N   . ARG B 2 39  ? 23.015 -12.384 21.491  1.00 28.99  ? 25   ARG B N   1 
ATOM   1768 C CA  . ARG B 2 39  ? 24.065 -13.372 21.246  1.00 24.75  ? 25   ARG B CA  1 
ATOM   1769 C C   . ARG B 2 39  ? 25.406 -12.675 21.085  1.00 24.71  ? 25   ARG B C   1 
ATOM   1770 O O   . ARG B 2 39  ? 25.519 -11.687 20.364  1.00 24.32  ? 25   ARG B O   1 
ATOM   1771 C CB  . ARG B 2 39  ? 23.754 -14.179 19.988  1.00 19.93  ? 25   ARG B CB  1 
ATOM   1772 C CG  . ARG B 2 39  ? 24.772 -15.262 19.674  1.00 25.18  ? 25   ARG B CG  1 
ATOM   1773 C CD  . ARG B 2 39  ? 24.251 -16.181 18.580  1.00 30.25  ? 25   ARG B CD  1 
ATOM   1774 N NE  . ARG B 2 39  ? 25.250 -17.139 18.105  1.00 34.20  ? 25   ARG B NE  1 
ATOM   1775 C CZ  . ARG B 2 39  ? 25.084 -17.917 17.038  1.00 32.00  ? 25   ARG B CZ  1 
ATOM   1776 N NH1 . ARG B 2 39  ? 23.960 -17.851 16.335  1.00 29.38  ? 25   ARG B NH1 1 
ATOM   1777 N NH2 . ARG B 2 39  ? 26.032 -18.777 16.686  1.00 25.73  ? 25   ARG B NH2 1 
ATOM   1778 N N   . LEU B 2 40  ? 26.421 -13.199 21.762  1.00 25.19  ? 26   LEU B N   1 
ATOM   1779 C CA  . LEU B 2 40  ? 27.755 -12.619 21.703  1.00 25.98  ? 26   LEU B CA  1 
ATOM   1780 C C   . LEU B 2 40  ? 28.759 -13.508 20.990  1.00 28.19  ? 26   LEU B C   1 
ATOM   1781 O O   . LEU B 2 40  ? 29.037 -14.641 21.414  1.00 26.25  ? 26   LEU B O   1 
ATOM   1782 C CB  . LEU B 2 40  ? 28.267 -12.329 23.111  1.00 21.12  ? 26   LEU B CB  1 
ATOM   1783 C CG  . LEU B 2 40  ? 29.468 -11.403 23.335  1.00 24.85  ? 26   LEU B CG  1 
ATOM   1784 C CD1 . LEU B 2 40  ? 30.460 -12.117 24.273  1.00 17.73  ? 26   LEU B CD1 1 
ATOM   1785 C CD2 . LEU B 2 40  ? 30.130 -11.007 22.017  1.00 15.89  ? 26   LEU B CD2 1 
ATOM   1786 N N   . VAL B 2 41  ? 29.306 -12.976 19.903  1.00 25.88  ? 27   VAL B N   1 
ATOM   1787 C CA  . VAL B 2 41  ? 30.305 -13.685 19.129  1.00 24.85  ? 27   VAL B CA  1 
ATOM   1788 C C   . VAL B 2 41  ? 31.575 -12.852 19.086  1.00 25.99  ? 27   VAL B C   1 
ATOM   1789 O O   . VAL B 2 41  ? 31.549 -11.656 18.769  1.00 26.14  ? 27   VAL B O   1 
ATOM   1790 C CB  . VAL B 2 41  ? 29.838 -13.941 17.679  1.00 20.66  ? 27   VAL B CB  1 
ATOM   1791 C CG1 . VAL B 2 41  ? 30.900 -14.720 16.917  1.00 17.44  ? 27   VAL B CG1 1 
ATOM   1792 C CG2 . VAL B 2 41  ? 28.529 -14.701 17.688  1.00 21.12  ? 27   VAL B CG2 1 
ATOM   1793 N N   . THR B 2 42  ? 32.682 -13.490 19.441  1.00 24.05  ? 28   THR B N   1 
ATOM   1794 C CA  . THR B 2 42  ? 33.978 -12.840 19.414  1.00 23.53  ? 28   THR B CA  1 
ATOM   1795 C C   . THR B 2 42  ? 34.875 -13.712 18.536  1.00 22.49  ? 28   THR B C   1 
ATOM   1796 O O   . THR B 2 42  ? 34.835 -14.943 18.615  1.00 19.56  ? 28   THR B O   1 
ATOM   1797 C CB  . THR B 2 42  ? 34.586 -12.711 20.824  1.00 16.44  ? 28   THR B CB  1 
ATOM   1798 O OG1 . THR B 2 42  ? 34.930 -14.003 21.316  1.00 23.11  ? 28   THR B OG1 1 
ATOM   1799 C CG2 . THR B 2 42  ? 33.601 -12.093 21.770  1.00 21.15  ? 28   THR B CG2 1 
ATOM   1800 N N   . ARG B 2 43  ? 35.669 -13.069 17.684  1.00 22.50  ? 29   ARG B N   1 
ATOM   1801 C CA  . ARG B 2 43  ? 36.558 -13.787 16.787  1.00 17.34  ? 29   ARG B CA  1 
ATOM   1802 C C   . ARG B 2 43  ? 37.979 -13.278 16.852  1.00 17.69  ? 29   ARG B C   1 
ATOM   1803 O O   . ARG B 2 43  ? 38.225 -12.100 17.097  1.00 19.35  ? 29   ARG B O   1 
ATOM   1804 C CB  . ARG B 2 43  ? 36.077 -13.668 15.339  1.00 18.32  ? 29   ARG B CB  1 
ATOM   1805 C CG  . ARG B 2 43  ? 34.666 -13.107 15.141  1.00 13.91  ? 29   ARG B CG  1 
ATOM   1806 C CD  . ARG B 2 43  ? 34.239 -13.315 13.694  1.00 8.03   ? 29   ARG B CD  1 
ATOM   1807 N NE  . ARG B 2 43  ? 32.793 -13.273 13.518  1.00 6.64   ? 29   ARG B NE  1 
ATOM   1808 C CZ  . ARG B 2 43  ? 32.054 -14.318 13.161  1.00 7.47   ? 29   ARG B CZ  1 
ATOM   1809 N NH1 . ARG B 2 43  ? 32.614 -15.500 12.950  1.00 13.43  ? 29   ARG B NH1 1 
ATOM   1810 N NH2 . ARG B 2 43  ? 30.752 -14.185 13.009  1.00 12.10  ? 29   ARG B NH2 1 
ATOM   1811 N N   . TYR B 2 44  ? 38.918 -14.182 16.630  1.00 21.08  ? 30   TYR B N   1 
ATOM   1812 C CA  . TYR B 2 44  ? 40.327 -13.832 16.610  1.00 23.66  ? 30   TYR B CA  1 
ATOM   1813 C C   . TYR B 2 44  ? 40.795 -14.197 15.199  1.00 24.24  ? 30   TYR B C   1 
ATOM   1814 O O   . TYR B 2 44  ? 40.738 -15.362 14.788  1.00 20.74  ? 30   TYR B O   1 
ATOM   1815 C CB  . TYR B 2 44  ? 41.072 -14.607 17.697  1.00 23.56  ? 30   TYR B CB  1 
ATOM   1816 C CG  . TYR B 2 44  ? 40.647 -14.163 19.081  1.00 30.71  ? 30   TYR B CG  1 
ATOM   1817 C CD1 . TYR B 2 44  ? 39.398 -14.516 19.591  1.00 30.10  ? 30   TYR B CD1 1 
ATOM   1818 C CD2 . TYR B 2 44  ? 41.463 -13.335 19.853  1.00 33.06  ? 30   TYR B CD2 1 
ATOM   1819 C CE1 . TYR B 2 44  ? 38.967 -14.051 20.832  1.00 31.00  ? 30   TYR B CE1 1 
ATOM   1820 C CE2 . TYR B 2 44  ? 41.039 -12.864 21.099  1.00 32.60  ? 30   TYR B CE2 1 
ATOM   1821 C CZ  . TYR B 2 44  ? 39.788 -13.226 21.577  1.00 32.14  ? 30   TYR B CZ  1 
ATOM   1822 O OH  . TYR B 2 44  ? 39.353 -12.759 22.794  1.00 30.37  ? 30   TYR B OH  1 
ATOM   1823 N N   . ILE B 2 45  ? 41.223 -13.180 14.453  1.00 22.04  ? 31   ILE B N   1 
ATOM   1824 C CA  . ILE B 2 45  ? 41.640 -13.364 13.075  1.00 19.65  ? 31   ILE B CA  1 
ATOM   1825 C C   . ILE B 2 45  ? 43.109 -13.081 12.846  1.00 20.09  ? 31   ILE B C   1 
ATOM   1826 O O   . ILE B 2 45  ? 43.641 -12.086 13.325  1.00 21.91  ? 31   ILE B O   1 
ATOM   1827 C CB  . ILE B 2 45  ? 40.799 -12.460 12.135  1.00 19.10  ? 31   ILE B CB  1 
ATOM   1828 C CG1 . ILE B 2 45  ? 39.356 -12.964 12.091  1.00 25.70  ? 31   ILE B CG1 1 
ATOM   1829 C CG2 . ILE B 2 45  ? 41.361 -12.465 10.725  1.00 15.48  ? 31   ILE B CG2 1 
ATOM   1830 C CD1 . ILE B 2 45  ? 38.349 -12.006 12.702  1.00 26.38  ? 31   ILE B CD1 1 
ATOM   1831 N N   . TYR B 2 46  ? 43.762 -13.983 12.119  1.00 20.10  ? 32   TYR B N   1 
ATOM   1832 C CA  . TYR B 2 46  ? 45.168 -13.825 11.781  1.00 19.17  ? 32   TYR B CA  1 
ATOM   1833 C C   . TYR B 2 46  ? 45.201 -13.601 10.272  1.00 19.73  ? 32   TYR B C   1 
ATOM   1834 O O   . TYR B 2 46  ? 44.922 -14.518 9.491   1.00 16.75  ? 32   TYR B O   1 
ATOM   1835 C CB  . TYR B 2 46  ? 45.974 -15.075 12.143  1.00 14.35  ? 32   TYR B CB  1 
ATOM   1836 C CG  . TYR B 2 46  ? 47.431 -14.934 11.779  1.00 12.78  ? 32   TYR B CG  1 
ATOM   1837 C CD1 . TYR B 2 46  ? 48.220 -13.944 12.367  1.00 12.51  ? 32   TYR B CD1 1 
ATOM   1838 C CD2 . TYR B 2 46  ? 48.015 -15.755 10.807  1.00 12.07  ? 32   TYR B CD2 1 
ATOM   1839 C CE1 . TYR B 2 46  ? 49.555 -13.771 11.994  1.00 20.09  ? 32   TYR B CE1 1 
ATOM   1840 C CE2 . TYR B 2 46  ? 49.347 -15.592 10.424  1.00 12.96  ? 32   TYR B CE2 1 
ATOM   1841 C CZ  . TYR B 2 46  ? 50.115 -14.597 11.021  1.00 18.18  ? 32   TYR B CZ  1 
ATOM   1842 O OH  . TYR B 2 46  ? 51.437 -14.425 10.657  1.00 16.66  ? 32   TYR B OH  1 
ATOM   1843 N N   . ASN B 2 47  ? 45.546 -12.378 9.874   1.00 22.33  ? 33   ASN B N   1 
ATOM   1844 C CA  . ASN B 2 47  ? 45.570 -11.991 8.465   1.00 21.79  ? 33   ASN B CA  1 
ATOM   1845 C C   . ASN B 2 47  ? 44.109 -11.925 8.042   1.00 19.16  ? 33   ASN B C   1 
ATOM   1846 O O   . ASN B 2 47  ? 43.436 -10.913 8.240   1.00 21.37  ? 33   ASN B O   1 
ATOM   1847 C CB  . ASN B 2 47  ? 46.321 -13.031 7.629   1.00 24.07  ? 33   ASN B CB  1 
ATOM   1848 C CG  . ASN B 2 47  ? 47.819 -12.811 7.643   1.00 27.05  ? 33   ASN B CG  1 
ATOM   1849 O OD1 . ASN B 2 47  ? 48.284 -11.691 7.851   1.00 28.17  ? 33   ASN B OD1 1 
ATOM   1850 N ND2 . ASN B 2 47  ? 48.580 -13.878 7.427   1.00 24.28  ? 33   ASN B ND2 1 
ATOM   1851 N N   . ARG B 2 48  ? 43.615 -13.019 7.483   1.00 20.71  ? 34   ARG B N   1 
ATOM   1852 C CA  . ARG B 2 48  ? 42.225 -13.103 7.054   1.00 22.06  ? 34   ARG B CA  1 
ATOM   1853 C C   . ARG B 2 48  ? 41.656 -14.451 7.497   1.00 21.94  ? 34   ARG B C   1 
ATOM   1854 O O   . ARG B 2 48  ? 40.601 -14.882 7.028   1.00 24.85  ? 34   ARG B O   1 
ATOM   1855 C CB  . ARG B 2 48  ? 42.124 -12.958 5.525   1.00 20.87  ? 34   ARG B CB  1 
ATOM   1856 C CG  . ARG B 2 48  ? 41.369 -11.698 5.060   1.00 25.17  ? 34   ARG B CG  1 
ATOM   1857 C CD  . ARG B 2 48  ? 41.566 -11.411 3.570   1.00 25.62  ? 34   ARG B CD  1 
ATOM   1858 N NE  . ARG B 2 48  ? 40.324 -11.049 2.889   1.00 29.83  ? 34   ARG B NE  1 
ATOM   1859 C CZ  . ARG B 2 48  ? 39.844 -11.677 1.815   1.00 39.21  ? 34   ARG B CZ  1 
ATOM   1860 N NH1 . ARG B 2 48  ? 40.499 -12.704 1.292   1.00 43.00  ? 34   ARG B NH1 1 
ATOM   1861 N NH2 . ARG B 2 48  ? 38.702 -11.285 1.258   1.00 38.44  ? 34   ARG B NH2 1 
ATOM   1862 N N   . GLU B 2 49  ? 42.354 -15.111 8.414   1.00 17.06  ? 35   GLU B N   1 
ATOM   1863 C CA  . GLU B 2 49  ? 41.917 -16.407 8.892   1.00 20.26  ? 35   GLU B CA  1 
ATOM   1864 C C   . GLU B 2 49  ? 41.467 -16.418 10.348  1.00 24.02  ? 35   GLU B C   1 
ATOM   1865 O O   . GLU B 2 49  ? 42.271 -16.199 11.261  1.00 26.51  ? 35   GLU B O   1 
ATOM   1866 C CB  . GLU B 2 49  ? 43.041 -17.426 8.705   1.00 25.66  ? 35   GLU B CB  1 
ATOM   1867 C CG  . GLU B 2 49  ? 42.630 -18.880 8.928   1.00 23.09  ? 35   GLU B CG  1 
ATOM   1868 C CD  . GLU B 2 49  ? 43.820 -19.768 9.214   1.00 19.64  ? 35   GLU B CD  1 
ATOM   1869 O OE1 . GLU B 2 49  ? 44.849 -19.589 8.535   1.00 25.41  ? 35   GLU B OE1 1 
ATOM   1870 O OE2 . GLU B 2 49  ? 43.729 -20.638 10.111  1.00 22.37  ? 35   GLU B OE2 1 
ATOM   1871 N N   . GLU B 2 50  ? 40.180 -16.675 10.563  1.00 21.85  ? 36   GLU B N   1 
ATOM   1872 C CA  . GLU B 2 50  ? 39.652 -16.750 11.915  1.00 25.30  ? 36   GLU B CA  1 
ATOM   1873 C C   . GLU B 2 50  ? 40.078 -18.087 12.506  1.00 22.85  ? 36   GLU B C   1 
ATOM   1874 O O   . GLU B 2 50  ? 39.892 -19.123 11.878  1.00 26.99  ? 36   GLU B O   1 
ATOM   1875 C CB  . GLU B 2 50  ? 38.126 -16.655 11.900  1.00 23.73  ? 36   GLU B CB  1 
ATOM   1876 C CG  . GLU B 2 50  ? 37.546 -16.346 13.265  1.00 22.07  ? 36   GLU B CG  1 
ATOM   1877 C CD  . GLU B 2 50  ? 36.053 -16.540 13.333  1.00 15.84  ? 36   GLU B CD  1 
ATOM   1878 O OE1 . GLU B 2 50  ? 35.365 -16.218 12.348  1.00 19.68  ? 36   GLU B OE1 1 
ATOM   1879 O OE2 . GLU B 2 50  ? 35.566 -17.008 14.378  1.00 18.70  ? 36   GLU B OE2 1 
ATOM   1880 N N   . TYR B 2 51  ? 40.652 -18.081 13.704  1.00 25.15  ? 37   TYR B N   1 
ATOM   1881 C CA  . TYR B 2 51  ? 41.161 -19.337 14.260  1.00 26.84  ? 37   TYR B CA  1 
ATOM   1882 C C   . TYR B 2 51  ? 40.455 -19.730 15.564  1.00 28.57  ? 37   TYR B C   1 
ATOM   1883 O O   . TYR B 2 51  ? 40.213 -20.907 15.800  1.00 30.39  ? 37   TYR B O   1 
ATOM   1884 C CB  . TYR B 2 51  ? 42.673 -19.322 14.468  1.00 25.69  ? 37   TYR B CB  1 
ATOM   1885 C CG  . TYR B 2 51  ? 43.192 -18.054 15.082  1.00 23.68  ? 37   TYR B CG  1 
ATOM   1886 C CD1 . TYR B 2 51  ? 43.432 -16.928 14.302  1.00 26.65  ? 37   TYR B CD1 1 
ATOM   1887 C CD2 . TYR B 2 51  ? 43.450 -17.978 16.451  1.00 25.23  ? 37   TYR B CD2 1 
ATOM   1888 C CE1 . TYR B 2 51  ? 43.917 -15.754 14.872  1.00 30.91  ? 37   TYR B CE1 1 
ATOM   1889 C CE2 . TYR B 2 51  ? 43.931 -16.819 17.033  1.00 24.90  ? 37   TYR B CE2 1 
ATOM   1890 C CZ  . TYR B 2 51  ? 44.164 -15.709 16.241  1.00 28.05  ? 37   TYR B CZ  1 
ATOM   1891 O OH  . TYR B 2 51  ? 44.642 -14.554 16.811  1.00 26.54  ? 37   TYR B OH  1 
ATOM   1892 N N   . VAL B 2 52  ? 40.134 -18.757 16.413  1.00 31.49  ? 38   VAL B N   1 
ATOM   1893 C CA  . VAL B 2 52  ? 39.439 -19.042 17.670  1.00 29.51  ? 38   VAL B CA  1 
ATOM   1894 C C   . VAL B 2 52  ? 38.207 -18.167 17.767  1.00 27.13  ? 38   VAL B C   1 
ATOM   1895 O O   . VAL B 2 52  ? 38.222 -17.018 17.330  1.00 29.56  ? 38   VAL B O   1 
ATOM   1896 C CB  . VAL B 2 52  ? 40.313 -18.751 18.933  1.00 30.23  ? 38   VAL B CB  1 
ATOM   1897 C CG1 . VAL B 2 52  ? 39.749 -19.506 20.144  1.00 32.24  ? 38   VAL B CG1 1 
ATOM   1898 C CG2 . VAL B 2 52  ? 41.734 -19.171 18.710  1.00 35.13  ? 38   VAL B CG2 1 
ATOM   1899 N N   . ARG B 2 53  ? 37.146 -18.702 18.360  1.00 24.84  ? 39   ARG B N   1 
ATOM   1900 C CA  . ARG B 2 53  ? 35.921 -17.933 18.515  1.00 23.18  ? 39   ARG B CA  1 
ATOM   1901 C C   . ARG B 2 53  ? 35.179 -18.287 19.790  1.00 23.61  ? 39   ARG B C   1 
ATOM   1902 O O   . ARG B 2 53  ? 35.324 -19.391 20.325  1.00 22.54  ? 39   ARG B O   1 
ATOM   1903 C CB  . ARG B 2 53  ? 34.996 -18.166 17.322  1.00 20.30  ? 39   ARG B CB  1 
ATOM   1904 C CG  . ARG B 2 53  ? 33.519 -17.968 17.632  1.00 21.65  ? 39   ARG B CG  1 
ATOM   1905 C CD  . ARG B 2 53  ? 32.665 -18.444 16.482  1.00 22.79  ? 39   ARG B CD  1 
ATOM   1906 N NE  . ARG B 2 53  ? 33.220 -18.008 15.205  1.00 23.23  ? 39   ARG B NE  1 
ATOM   1907 C CZ  . ARG B 2 53  ? 33.160 -18.706 14.076  1.00 21.49  ? 39   ARG B CZ  1 
ATOM   1908 N NH1 . ARG B 2 53  ? 32.570 -19.882 14.050  1.00 19.74  ? 39   ARG B NH1 1 
ATOM   1909 N NH2 . ARG B 2 53  ? 33.691 -18.221 12.964  1.00 31.06  ? 39   ARG B NH2 1 
ATOM   1910 N N   . TYR B 2 54  ? 34.398 -17.331 20.287  1.00 23.27  ? 40   TYR B N   1 
ATOM   1911 C CA  . TYR B 2 54  ? 33.578 -17.561 21.472  1.00 22.14  ? 40   TYR B CA  1 
ATOM   1912 C C   . TYR B 2 54  ? 32.130 -17.293 21.061  1.00 19.20  ? 40   TYR B C   1 
ATOM   1913 O O   . TYR B 2 54  ? 31.771 -16.160 20.760  1.00 23.87  ? 40   TYR B O   1 
ATOM   1914 C CB  . TYR B 2 54  ? 33.955 -16.629 22.632  1.00 16.64  ? 40   TYR B CB  1 
ATOM   1915 C CG  . TYR B 2 54  ? 32.940 -16.741 23.732  1.00 12.16  ? 40   TYR B CG  1 
ATOM   1916 C CD1 . TYR B 2 54  ? 32.918 -17.860 24.558  1.00 18.39  ? 40   TYR B CD1 1 
ATOM   1917 C CD2 . TYR B 2 54  ? 31.900 -15.820 23.846  1.00 16.09  ? 40   TYR B CD2 1 
ATOM   1918 C CE1 . TYR B 2 54  ? 31.878 -18.071 25.462  1.00 18.91  ? 40   TYR B CE1 1 
ATOM   1919 C CE2 . TYR B 2 54  ? 30.855 -16.019 24.744  1.00 16.81  ? 40   TYR B CE2 1 
ATOM   1920 C CZ  . TYR B 2 54  ? 30.850 -17.149 25.547  1.00 18.61  ? 40   TYR B CZ  1 
ATOM   1921 O OH  . TYR B 2 54  ? 29.816 -17.360 26.428  1.00 19.93  ? 40   TYR B OH  1 
ATOM   1922 N N   . ASP B 2 55  ? 31.303 -18.332 21.053  1.00 19.92  ? 41   ASP B N   1 
ATOM   1923 C CA  . ASP B 2 55  ? 29.905 -18.195 20.654  1.00 21.60  ? 41   ASP B CA  1 
ATOM   1924 C C   . ASP B 2 55  ? 28.937 -18.432 21.802  1.00 22.24  ? 41   ASP B C   1 
ATOM   1925 O O   . ASP B 2 55  ? 29.018 -19.445 22.491  1.00 24.36  ? 41   ASP B O   1 
ATOM   1926 C CB  . ASP B 2 55  ? 29.604 -19.184 19.531  1.00 23.09  ? 41   ASP B CB  1 
ATOM   1927 C CG  . ASP B 2 55  ? 28.306 -18.888 18.812  1.00 19.23  ? 41   ASP B CG  1 
ATOM   1928 O OD1 . ASP B 2 55  ? 27.623 -17.906 19.158  1.00 25.29  ? 41   ASP B OD1 1 
ATOM   1929 O OD2 . ASP B 2 55  ? 27.970 -19.651 17.887  1.00 26.02  ? 41   ASP B OD2 1 
ATOM   1930 N N   . SER B 2 56  ? 28.018 -17.490 21.991  1.00 25.65  ? 42   SER B N   1 
ATOM   1931 C CA  . SER B 2 56  ? 27.002 -17.567 23.042  1.00 26.28  ? 42   SER B CA  1 
ATOM   1932 C C   . SER B 2 56  ? 26.324 -18.935 23.076  1.00 26.61  ? 42   SER B C   1 
ATOM   1933 O O   . SER B 2 56  ? 26.260 -19.592 24.110  1.00 24.93  ? 42   SER B O   1 
ATOM   1934 C CB  . SER B 2 56  ? 25.919 -16.507 22.805  1.00 27.43  ? 42   SER B CB  1 
ATOM   1935 O OG  . SER B 2 56  ? 26.277 -15.257 23.350  1.00 23.20  ? 42   SER B OG  1 
ATOM   1936 N N   . ASP B 2 57  ? 25.799 -19.347 21.931  1.00 26.74  ? 43   ASP B N   1 
ATOM   1937 C CA  . ASP B 2 57  ? 25.105 -20.618 21.828  1.00 27.23  ? 43   ASP B CA  1 
ATOM   1938 C C   . ASP B 2 57  ? 26.022 -21.799 22.053  1.00 28.11  ? 43   ASP B C   1 
ATOM   1939 O O   . ASP B 2 57  ? 25.579 -22.941 22.034  1.00 31.96  ? 43   ASP B O   1 
ATOM   1940 C CB  . ASP B 2 57  ? 24.457 -20.765 20.448  1.00 30.63  ? 43   ASP B CB  1 
ATOM   1941 C CG  . ASP B 2 57  ? 23.679 -19.536 20.026  1.00 30.80  ? 43   ASP B CG  1 
ATOM   1942 O OD1 . ASP B 2 57  ? 23.688 -18.524 20.768  1.00 33.41  ? 43   ASP B OD1 1 
ATOM   1943 O OD2 . ASP B 2 57  ? 23.055 -19.591 18.945  1.00 31.68  ? 43   ASP B OD2 1 
ATOM   1944 N N   . VAL B 2 58  ? 27.302 -21.539 22.255  1.00 30.06  ? 44   VAL B N   1 
ATOM   1945 C CA  . VAL B 2 58  ? 28.225 -22.636 22.459  1.00 32.46  ? 44   VAL B CA  1 
ATOM   1946 C C   . VAL B 2 58  ? 28.679 -22.751 23.909  1.00 35.60  ? 44   VAL B C   1 
ATOM   1947 O O   . VAL B 2 58  ? 28.859 -23.861 24.416  1.00 37.12  ? 44   VAL B O   1 
ATOM   1948 C CB  . VAL B 2 58  ? 29.453 -22.502 21.537  1.00 34.30  ? 44   VAL B CB  1 
ATOM   1949 C CG1 . VAL B 2 58  ? 30.424 -23.641 21.810  1.00 32.31  ? 44   VAL B CG1 1 
ATOM   1950 C CG2 . VAL B 2 58  ? 29.016 -22.527 20.086  1.00 31.81  ? 44   VAL B CG2 1 
ATOM   1951 N N   . GLY B 2 59  ? 28.895 -21.614 24.568  1.00 31.99  ? 45   GLY B N   1 
ATOM   1952 C CA  . GLY B 2 59  ? 29.310 -21.650 25.958  1.00 26.77  ? 45   GLY B CA  1 
ATOM   1953 C C   . GLY B 2 59  ? 30.796 -21.522 26.245  1.00 25.30  ? 45   GLY B C   1 
ATOM   1954 O O   . GLY B 2 59  ? 31.187 -21.272 27.388  1.00 22.34  ? 45   GLY B O   1 
ATOM   1955 N N   . GLU B 2 60  ? 31.635 -21.702 25.234  1.00 23.25  ? 46   GLU B N   1 
ATOM   1956 C CA  . GLU B 2 60  ? 33.074 -21.568 25.443  1.00 21.87  ? 46   GLU B CA  1 
ATOM   1957 C C   . GLU B 2 60  ? 33.818 -21.291 24.153  1.00 19.67  ? 46   GLU B C   1 
ATOM   1958 O O   . GLU B 2 60  ? 33.220 -21.220 23.081  1.00 22.41  ? 46   GLU B O   1 
ATOM   1959 C CB  . GLU B 2 60  ? 33.640 -22.824 26.085  1.00 20.41  ? 46   GLU B CB  1 
ATOM   1960 C CG  . GLU B 2 60  ? 33.517 -24.043 25.222  1.00 24.93  ? 46   GLU B CG  1 
ATOM   1961 C CD  . GLU B 2 60  ? 33.748 -25.312 26.005  1.00 29.18  ? 46   GLU B CD  1 
ATOM   1962 O OE1 . GLU B 2 60  ? 33.622 -25.270 27.252  1.00 38.15  ? 46   GLU B OE1 1 
ATOM   1963 O OE2 . GLU B 2 60  ? 34.053 -26.345 25.378  1.00 26.52  ? 46   GLU B OE2 1 
ATOM   1964 N N   . TYR B 2 61  ? 35.131 -21.129 24.267  1.00 19.03  ? 47   TYR B N   1 
ATOM   1965 C CA  . TYR B 2 61  ? 35.995 -21.102 23.078  1.00 16.86  ? 47   TYR B CA  1 
ATOM   1966 C C   . TYR B 2 61  ? 36.140 -22.367 22.266  1.00 21.21  ? 47   TYR B C   1 
ATOM   1967 O O   . TYR B 2 61  ? 36.233 -23.469 22.818  1.00 18.03  ? 47   TYR B O   1 
ATOM   1968 C CB  . TYR B 2 61  ? 37.383 -20.617 23.496  1.00 16.40  ? 47   TYR B CB  1 
ATOM   1969 C CG  . TYR B 2 61  ? 37.406 -19.194 24.000  1.00 18.43  ? 47   TYR B CG  1 
ATOM   1970 C CD1 . TYR B 2 61  ? 37.559 -18.123 23.120  1.00 22.62  ? 47   TYR B CD1 1 
ATOM   1971 C CD2 . TYR B 2 61  ? 37.276 -18.915 25.359  1.00 17.29  ? 47   TYR B CD2 1 
ATOM   1972 C CE1 . TYR B 2 61  ? 37.582 -16.812 23.579  1.00 14.97  ? 47   TYR B CE1 1 
ATOM   1973 C CE2 . TYR B 2 61  ? 37.301 -17.618 25.829  1.00 16.95  ? 47   TYR B CE2 1 
ATOM   1974 C CZ  . TYR B 2 61  ? 37.456 -16.566 24.936  1.00 21.28  ? 47   TYR B CZ  1 
ATOM   1975 O OH  . TYR B 2 61  ? 37.509 -15.270 25.406  1.00 20.79  ? 47   TYR B OH  1 
ATOM   1976 N N   . ARG B 2 62  ? 36.150 -22.189 20.946  1.00 24.88  ? 48   ARG B N   1 
ATOM   1977 C CA  . ARG B 2 62  ? 36.298 -23.277 19.980  1.00 19.33  ? 48   ARG B CA  1 
ATOM   1978 C C   . ARG B 2 62  ? 37.255 -22.787 18.909  1.00 19.27  ? 48   ARG B C   1 
ATOM   1979 O O   . ARG B 2 62  ? 37.236 -21.618 18.553  1.00 22.82  ? 48   ARG B O   1 
ATOM   1980 C CB  . ARG B 2 62  ? 34.958 -23.606 19.312  1.00 16.36  ? 48   ARG B CB  1 
ATOM   1981 C CG  . ARG B 2 62  ? 33.924 -24.279 20.206  1.00 21.41  ? 48   ARG B CG  1 
ATOM   1982 C CD  . ARG B 2 62  ? 34.085 -25.786 20.173  1.00 24.15  ? 48   ARG B CD  1 
ATOM   1983 N NE  . ARG B 2 62  ? 33.256 -26.495 21.151  1.00 26.74  ? 48   ARG B NE  1 
ATOM   1984 C CZ  . ARG B 2 62  ? 32.109 -27.095 20.851  1.00 28.61  ? 48   ARG B CZ  1 
ATOM   1985 N NH1 . ARG B 2 62  ? 31.659 -27.060 19.609  1.00 33.12  ? 48   ARG B NH1 1 
ATOM   1986 N NH2 . ARG B 2 62  ? 31.424 -27.754 21.777  1.00 30.21  ? 48   ARG B NH2 1 
ATOM   1987 N N   . ALA B 2 63  ? 38.106 -23.668 18.404  1.00 18.42  ? 49   ALA B N   1 
ATOM   1988 C CA  . ALA B 2 63  ? 39.015 -23.283 17.338  1.00 16.44  ? 49   ALA B CA  1 
ATOM   1989 C C   . ALA B 2 63  ? 38.200 -23.422 16.061  1.00 17.80  ? 49   ALA B C   1 
ATOM   1990 O O   . ALA B 2 63  ? 37.413 -24.365 15.926  1.00 20.01  ? 49   ALA B O   1 
ATOM   1991 C CB  . ALA B 2 63  ? 40.217 -24.218 17.295  1.00 13.41  ? 49   ALA B CB  1 
ATOM   1992 N N   . VAL B 2 64  ? 38.347 -22.482 15.135  1.00 17.02  ? 50   VAL B N   1 
ATOM   1993 C CA  . VAL B 2 64  ? 37.619 -22.582 13.877  1.00 17.92  ? 50   VAL B CA  1 
ATOM   1994 C C   . VAL B 2 64  ? 38.557 -23.192 12.816  1.00 18.04  ? 50   VAL B C   1 
ATOM   1995 O O   . VAL B 2 64  ? 38.107 -23.794 11.836  1.00 11.30  ? 50   VAL B O   1 
ATOM   1996 C CB  . VAL B 2 64  ? 37.024 -21.194 13.466  1.00 17.92  ? 50   VAL B CB  1 
ATOM   1997 C CG1 . VAL B 2 64  ? 37.383 -20.155 14.505  1.00 19.88  ? 50   VAL B CG1 1 
ATOM   1998 C CG2 . VAL B 2 64  ? 37.481 -20.785 12.089  1.00 22.50  ? 50   VAL B CG2 1 
ATOM   1999 N N   . THR B 2 65  ? 39.863 -23.050 13.059  1.00 19.90  ? 51   THR B N   1 
ATOM   2000 C CA  . THR B 2 65  ? 40.931 -23.599 12.216  1.00 19.19  ? 51   THR B CA  1 
ATOM   2001 C C   . THR B 2 65  ? 41.934 -24.264 13.178  1.00 21.83  ? 51   THR B C   1 
ATOM   2002 O O   . THR B 2 65  ? 41.827 -24.096 14.394  1.00 23.26  ? 51   THR B O   1 
ATOM   2003 C CB  . THR B 2 65  ? 41.652 -22.498 11.408  1.00 17.79  ? 51   THR B CB  1 
ATOM   2004 O OG1 . THR B 2 65  ? 42.314 -21.597 12.303  1.00 20.06  ? 51   THR B OG1 1 
ATOM   2005 C CG2 . THR B 2 65  ? 40.664 -21.718 10.569  1.00 17.30  ? 51   THR B CG2 1 
ATOM   2006 N N   . GLU B 2 66  ? 42.907 -25.005 12.649  1.00 22.90  ? 52   GLU B N   1 
ATOM   2007 C CA  . GLU B 2 66  ? 43.894 -25.696 13.489  1.00 20.15  ? 52   GLU B CA  1 
ATOM   2008 C C   . GLU B 2 66  ? 44.760 -24.832 14.407  1.00 15.79  ? 52   GLU B C   1 
ATOM   2009 O O   . GLU B 2 66  ? 45.150 -25.280 15.480  1.00 20.73  ? 52   GLU B O   1 
ATOM   2010 C CB  . GLU B 2 66  ? 44.807 -26.581 12.630  1.00 18.31  ? 52   GLU B CB  1 
ATOM   2011 C CG  . GLU B 2 66  ? 44.098 -27.792 12.006  1.00 21.59  ? 52   GLU B CG  1 
ATOM   2012 C CD  . GLU B 2 66  ? 43.555 -28.780 13.033  1.00 21.60  ? 52   GLU B CD  1 
ATOM   2013 O OE1 . GLU B 2 66  ? 44.198 -28.964 14.087  1.00 24.38  ? 52   GLU B OE1 1 
ATOM   2014 O OE2 . GLU B 2 66  ? 42.485 -29.376 12.784  1.00 21.20  ? 52   GLU B OE2 1 
ATOM   2015 N N   . LEU B 2 67  ? 45.064 -23.602 14.022  1.00 17.18  ? 53   LEU B N   1 
ATOM   2016 C CA  . LEU B 2 67  ? 45.903 -22.782 14.890  1.00 18.19  ? 53   LEU B CA  1 
ATOM   2017 C C   . LEU B 2 67  ? 45.155 -22.075 16.002  1.00 18.77  ? 53   LEU B C   1 
ATOM   2018 O O   . LEU B 2 67  ? 45.753 -21.338 16.779  1.00 21.56  ? 53   LEU B O   1 
ATOM   2019 C CB  . LEU B 2 67  ? 46.690 -21.758 14.077  1.00 23.31  ? 53   LEU B CB  1 
ATOM   2020 C CG  . LEU B 2 67  ? 45.925 -20.559 13.544  1.00 24.41  ? 53   LEU B CG  1 
ATOM   2021 C CD1 . LEU B 2 67  ? 46.901 -19.424 13.214  1.00 20.57  ? 53   LEU B CD1 1 
ATOM   2022 C CD2 . LEU B 2 67  ? 45.141 -21.002 12.323  1.00 24.69  ? 53   LEU B CD2 1 
ATOM   2023 N N   . GLY B 2 68  ? 43.847 -22.291 16.075  1.00 18.49  ? 54   GLY B N   1 
ATOM   2024 C CA  . GLY B 2 68  ? 43.067 -21.676 17.129  1.00 19.15  ? 54   GLY B CA  1 
ATOM   2025 C C   . GLY B 2 68  ? 42.952 -22.638 18.302  1.00 21.94  ? 54   GLY B C   1 
ATOM   2026 O O   . GLY B 2 68  ? 42.390 -22.310 19.348  1.00 19.06  ? 54   GLY B O   1 
ATOM   2027 N N   . ARG B 2 69  ? 43.498 -23.837 18.124  1.00 21.64  ? 55   ARG B N   1 
ATOM   2028 C CA  . ARG B 2 69  ? 43.450 -24.864 19.157  1.00 22.72  ? 55   ARG B CA  1 
ATOM   2029 C C   . ARG B 2 69  ? 44.167 -24.470 20.450  1.00 25.84  ? 55   ARG B C   1 
ATOM   2030 O O   . ARG B 2 69  ? 43.580 -24.530 21.533  1.00 29.30  ? 55   ARG B O   1 
ATOM   2031 C CB  . ARG B 2 69  ? 44.029 -26.175 18.618  1.00 20.84  ? 55   ARG B CB  1 
ATOM   2032 C CG  . ARG B 2 69  ? 43.057 -26.996 17.775  1.00 21.73  ? 55   ARG B CG  1 
ATOM   2033 C CD  . ARG B 2 69  ? 43.664 -28.340 17.402  1.00 19.84  ? 55   ARG B CD  1 
ATOM   2034 N NE  . ARG B 2 69  ? 42.798 -29.133 16.538  1.00 20.12  ? 55   ARG B NE  1 
ATOM   2035 C CZ  . ARG B 2 69  ? 41.670 -29.712 16.941  1.00 26.41  ? 55   ARG B CZ  1 
ATOM   2036 N NH1 . ARG B 2 69  ? 41.273 -29.587 18.200  1.00 25.39  ? 55   ARG B NH1 1 
ATOM   2037 N NH2 . ARG B 2 69  ? 40.937 -30.412 16.083  1.00 27.27  ? 55   ARG B NH2 1 
ATOM   2038 N N   . PRO B 2 70  ? 45.448 -24.068 20.360  1.00 25.98  ? 56   PRO B N   1 
ATOM   2039 C CA  . PRO B 2 70  ? 46.170 -23.682 21.579  1.00 23.95  ? 56   PRO B CA  1 
ATOM   2040 C C   . PRO B 2 70  ? 45.430 -22.666 22.460  1.00 27.14  ? 56   PRO B C   1 
ATOM   2041 O O   . PRO B 2 70  ? 45.460 -22.758 23.690  1.00 32.72  ? 56   PRO B O   1 
ATOM   2042 C CB  . PRO B 2 70  ? 47.498 -23.128 21.051  1.00 20.19  ? 56   PRO B CB  1 
ATOM   2043 C CG  . PRO B 2 70  ? 47.688 -23.811 19.730  1.00 11.85  ? 56   PRO B CG  1 
ATOM   2044 C CD  . PRO B 2 70  ? 46.301 -23.956 19.158  1.00 21.76  ? 56   PRO B CD  1 
ATOM   2045 N N   . ASP B 2 71  ? 44.763 -21.701 21.835  1.00 25.17  ? 57   ASP B N   1 
ATOM   2046 C CA  . ASP B 2 71  ? 44.045 -20.678 22.586  1.00 23.46  ? 57   ASP B CA  1 
ATOM   2047 C C   . ASP B 2 71  ? 42.717 -21.178 23.181  1.00 23.27  ? 57   ASP B C   1 
ATOM   2048 O O   . ASP B 2 71  ? 42.381 -20.860 24.316  1.00 27.03  ? 57   ASP B O   1 
ATOM   2049 C CB  . ASP B 2 71  ? 43.798 -19.447 21.698  1.00 25.37  ? 57   ASP B CB  1 
ATOM   2050 C CG  . ASP B 2 71  ? 45.038 -19.021 20.898  1.00 25.25  ? 57   ASP B CG  1 
ATOM   2051 O OD1 . ASP B 2 71  ? 46.064 -18.627 21.497  1.00 25.76  ? 57   ASP B OD1 1 
ATOM   2052 O OD2 . ASP B 2 71  ? 44.977 -19.067 19.653  1.00 30.26  ? 57   ASP B OD2 1 
ATOM   2053 N N   . ALA B 2 72  ? 41.963 -21.956 22.417  1.00 23.87  ? 58   ALA B N   1 
ATOM   2054 C CA  . ALA B 2 72  ? 40.692 -22.492 22.889  1.00 22.31  ? 58   ALA B CA  1 
ATOM   2055 C C   . ALA B 2 72  ? 40.934 -23.307 24.147  1.00 28.09  ? 58   ALA B C   1 
ATOM   2056 O O   . ALA B 2 72  ? 40.206 -23.203 25.132  1.00 30.35  ? 58   ALA B O   1 
ATOM   2057 C CB  . ALA B 2 72  ? 40.081 -23.384 21.819  1.00 21.09  ? 58   ALA B CB  1 
ATOM   2058 N N   . GLU B 2 73  ? 41.975 -24.116 24.109  1.00 30.29  ? 59   GLU B N   1 
ATOM   2059 C CA  . GLU B 2 73  ? 42.372 -25.049 25.166  1.00 31.84  ? 59   GLU B CA  1 
ATOM   2060 C C   . GLU B 2 73  ? 42.667 -24.228 26.413  1.00 29.76  ? 59   GLU B C   1 
ATOM   2061 O O   . GLU B 2 73  ? 42.111 -24.504 27.505  1.00 28.37  ? 59   GLU B O   1 
ATOM   2062 C CB  . GLU B 2 73  ? 43.616 -25.824 24.726  1.00 42.64  ? 59   GLU B CB  1 
ATOM   2063 C CG  . GLU B 2 73  ? 43.400 -26.641 23.452  1.00 49.40  ? 59   GLU B CG  1 
ATOM   2064 C CD  . GLU B 2 73  ? 42.289 -27.684 23.597  1.00 20.00  ? 59   GLU B CD  1 
ATOM   2065 O OE1 . GLU B 2 73  ? 41.653 -27.798 24.713  1.00 20.00  ? 59   GLU B OE1 1 
ATOM   2066 O OE2 . GLU B 2 73  ? 41.990 -28.449 22.602  1.00 20.00  ? 59   GLU B OE2 1 
ATOM   2067 N N   . TYR B 2 74  ? 43.603 -23.311 26.300  1.00 27.74  ? 60   TYR B N   1 
ATOM   2068 C CA  . TYR B 2 74  ? 44.083 -22.475 27.381  1.00 29.49  ? 60   TYR B CA  1 
ATOM   2069 C C   . TYR B 2 74  ? 43.019 -21.566 28.002  1.00 35.40  ? 60   TYR B C   1 
ATOM   2070 O O   . TYR B 2 74  ? 42.807 -21.583 29.217  1.00 39.88  ? 60   TYR B O   1 
ATOM   2071 C CB  . TYR B 2 74  ? 45.255 -21.647 26.845  1.00 29.13  ? 60   TYR B CB  1 
ATOM   2072 C CG  . TYR B 2 74  ? 45.807 -20.588 27.777  1.00 31.29  ? 60   TYR B CG  1 
ATOM   2073 C CD1 . TYR B 2 74  ? 46.071 -20.868 29.119  1.00 34.68  ? 60   TYR B CD1 1 
ATOM   2074 C CD2 . TYR B 2 74  ? 46.098 -19.309 27.304  1.00 28.21  ? 60   TYR B CD2 1 
ATOM   2075 C CE1 . TYR B 2 74  ? 46.616 -19.896 29.963  1.00 33.82  ? 60   TYR B CE1 1 
ATOM   2076 C CE2 . TYR B 2 74  ? 46.640 -18.336 28.137  1.00 25.69  ? 60   TYR B CE2 1 
ATOM   2077 C CZ  . TYR B 2 74  ? 46.897 -18.634 29.461  1.00 29.95  ? 60   TYR B CZ  1 
ATOM   2078 O OH  . TYR B 2 74  ? 47.430 -17.666 30.283  1.00 32.59  ? 60   TYR B OH  1 
ATOM   2079 N N   . TRP B 2 75  ? 42.353 -20.773 27.168  1.00 33.72  ? 61   TRP B N   1 
ATOM   2080 C CA  . TRP B 2 75  ? 41.345 -19.840 27.649  1.00 30.32  ? 61   TRP B CA  1 
ATOM   2081 C C   . TRP B 2 75  ? 40.176 -20.536 28.320  1.00 29.20  ? 61   TRP B C   1 
ATOM   2082 O O   . TRP B 2 75  ? 39.528 -19.968 29.201  1.00 32.40  ? 61   TRP B O   1 
ATOM   2083 C CB  . TRP B 2 75  ? 40.873 -18.956 26.493  1.00 27.66  ? 61   TRP B CB  1 
ATOM   2084 C CG  . TRP B 2 75  ? 41.992 -18.134 25.905  1.00 24.14  ? 61   TRP B CG  1 
ATOM   2085 C CD1 . TRP B 2 75  ? 43.211 -17.889 26.474  1.00 24.43  ? 61   TRP B CD1 1 
ATOM   2086 C CD2 . TRP B 2 75  ? 41.996 -17.451 24.642  1.00 22.71  ? 61   TRP B CD2 1 
ATOM   2087 N NE1 . TRP B 2 75  ? 43.973 -17.096 25.646  1.00 25.53  ? 61   TRP B NE1 1 
ATOM   2088 C CE2 . TRP B 2 75  ? 43.251 -16.813 24.516  1.00 23.12  ? 61   TRP B CE2 1 
ATOM   2089 C CE3 . TRP B 2 75  ? 41.062 -17.316 23.604  1.00 21.13  ? 61   TRP B CE3 1 
ATOM   2090 C CZ2 . TRP B 2 75  ? 43.595 -16.050 23.395  1.00 13.66  ? 61   TRP B CZ2 1 
ATOM   2091 C CZ3 . TRP B 2 75  ? 41.406 -16.557 22.491  1.00 16.20  ? 61   TRP B CZ3 1 
ATOM   2092 C CH2 . TRP B 2 75  ? 42.661 -15.935 22.399  1.00 15.85  ? 61   TRP B CH2 1 
ATOM   2093 N N   . ASN B 2 76  ? 39.907 -21.768 27.906  1.00 28.32  ? 62   ASN B N   1 
ATOM   2094 C CA  . ASN B 2 76  ? 38.832 -22.544 28.506  1.00 30.14  ? 62   ASN B CA  1 
ATOM   2095 C C   . ASN B 2 76  ? 39.410 -23.135 29.804  1.00 30.57  ? 62   ASN B C   1 
ATOM   2096 O O   . ASN B 2 76  ? 38.672 -23.575 30.684  1.00 29.65  ? 62   ASN B O   1 
ATOM   2097 C CB  . ASN B 2 76  ? 38.379 -23.668 27.561  1.00 30.90  ? 62   ASN B CB  1 
ATOM   2098 C CG  . ASN B 2 76  ? 37.467 -23.175 26.435  1.00 29.14  ? 62   ASN B CG  1 
ATOM   2099 O OD1 . ASN B 2 76  ? 36.744 -22.187 26.576  1.00 24.53  ? 62   ASN B OD1 1 
ATOM   2100 N ND2 . ASN B 2 76  ? 37.500 -23.876 25.311  1.00 28.34  ? 62   ASN B ND2 1 
ATOM   2101 N N   . SER B 2 77  ? 40.738 -23.129 29.905  1.00 28.79  ? 63   SER B N   1 
ATOM   2102 C CA  . SER B 2 77  ? 41.453 -23.635 31.077  1.00 29.85  ? 63   SER B CA  1 
ATOM   2103 C C   . SER B 2 77  ? 41.342 -22.602 32.177  1.00 29.55  ? 63   SER B C   1 
ATOM   2104 O O   . SER B 2 77  ? 41.120 -22.925 33.342  1.00 28.31  ? 63   SER B O   1 
ATOM   2105 C CB  . SER B 2 77  ? 42.943 -23.826 30.762  1.00 33.27  ? 63   SER B CB  1 
ATOM   2106 O OG  . SER B 2 77  ? 43.240 -25.142 30.330  1.00 46.32  ? 63   SER B OG  1 
ATOM   2107 N N   . GLN B 2 78  ? 41.527 -21.352 31.771  1.00 31.59  ? 64   GLN B N   1 
ATOM   2108 C CA  . GLN B 2 78  ? 41.482 -20.200 32.652  1.00 32.78  ? 64   GLN B CA  1 
ATOM   2109 C C   . GLN B 2 78  ? 40.050 -19.787 32.918  1.00 35.81  ? 64   GLN B C   1 
ATOM   2110 O O   . GLN B 2 78  ? 39.402 -19.191 32.056  1.00 34.84  ? 64   GLN B O   1 
ATOM   2111 C CB  . GLN B 2 78  ? 42.227 -19.043 32.004  1.00 40.62  ? 64   GLN B CB  1 
ATOM   2112 C CG  . GLN B 2 78  ? 43.688 -19.335 31.732  1.00 46.59  ? 64   GLN B CG  1 
ATOM   2113 C CD  . GLN B 2 78  ? 44.551 -19.036 32.928  1.00 49.85  ? 64   GLN B CD  1 
ATOM   2114 O OE1 . GLN B 2 78  ? 44.156 -18.282 33.817  1.00 59.67  ? 64   GLN B OE1 1 
ATOM   2115 N NE2 . GLN B 2 78  ? 45.736 -19.623 32.963  1.00 53.19  ? 64   GLN B NE2 1 
ATOM   2116 N N   . PRO B 2 79  ? 39.542 -20.086 34.126  1.00 37.17  ? 65   PRO B N   1 
ATOM   2117 C CA  . PRO B 2 79  ? 38.173 -19.766 34.555  1.00 38.25  ? 65   PRO B CA  1 
ATOM   2118 C C   . PRO B 2 79  ? 37.848 -18.271 34.521  1.00 40.35  ? 65   PRO B C   1 
ATOM   2119 O O   . PRO B 2 79  ? 36.709 -17.874 34.268  1.00 41.44  ? 65   PRO B O   1 
ATOM   2120 C CB  . PRO B 2 79  ? 38.092 -20.340 35.969  1.00 36.57  ? 65   PRO B CB  1 
ATOM   2121 C CG  . PRO B 2 79  ? 39.213 -21.334 36.049  1.00 37.18  ? 65   PRO B CG  1 
ATOM   2122 C CD  . PRO B 2 79  ? 40.295 -20.774 35.187  1.00 35.29  ? 65   PRO B CD  1 
ATOM   2123 N N   . GLU B 2 80  ? 38.849 -17.444 34.783  1.00 41.40  ? 66   GLU B N   1 
ATOM   2124 C CA  . GLU B 2 80  ? 38.642 -16.009 34.759  1.00 42.51  ? 66   GLU B CA  1 
ATOM   2125 C C   . GLU B 2 80  ? 38.251 -15.616 33.341  1.00 38.62  ? 66   GLU B C   1 
ATOM   2126 O O   . GLU B 2 80  ? 37.110 -15.241 33.086  1.00 41.57  ? 66   GLU B O   1 
ATOM   2127 C CB  . GLU B 2 80  ? 39.923 -15.290 35.176  1.00 48.78  ? 66   GLU B CB  1 
ATOM   2128 C CG  . GLU B 2 80  ? 39.708 -14.243 36.247  1.00 58.86  ? 66   GLU B CG  1 
ATOM   2129 C CD  . GLU B 2 80  ? 40.987 -13.893 36.975  1.00 65.77  ? 66   GLU B CD  1 
ATOM   2130 O OE1 . GLU B 2 80  ? 41.791 -14.817 37.232  1.00 68.30  ? 66   GLU B OE1 1 
ATOM   2131 O OE2 . GLU B 2 80  ? 41.187 -12.697 37.288  1.00 70.70  ? 66   GLU B OE2 1 
ATOM   2132 N N   . ILE B 2 81  ? 39.210 -15.716 32.424  1.00 37.30  ? 67   ILE B N   1 
ATOM   2133 C CA  . ILE B 2 81  ? 39.001 -15.393 31.017  1.00 31.04  ? 67   ILE B CA  1 
ATOM   2134 C C   . ILE B 2 81  ? 37.638 -15.898 30.564  1.00 30.07  ? 67   ILE B C   1 
ATOM   2135 O O   . ILE B 2 81  ? 36.828 -15.144 30.020  1.00 26.90  ? 67   ILE B O   1 
ATOM   2136 C CB  . ILE B 2 81  ? 40.079 -16.052 30.144  1.00 32.04  ? 67   ILE B CB  1 
ATOM   2137 C CG1 . ILE B 2 81  ? 41.436 -15.410 30.424  1.00 32.42  ? 67   ILE B CG1 1 
ATOM   2138 C CG2 . ILE B 2 81  ? 39.738 -15.888 28.669  1.00 35.28  ? 67   ILE B CG2 1 
ATOM   2139 C CD1 . ILE B 2 81  ? 42.095 -15.898 31.675  1.00 33.77  ? 67   ILE B CD1 1 
ATOM   2140 N N   . LEU B 2 82  ? 37.392 -17.181 30.800  1.00 27.31  ? 68   LEU B N   1 
ATOM   2141 C CA  . LEU B 2 82  ? 36.125 -17.793 30.425  1.00 26.77  ? 68   LEU B CA  1 
ATOM   2142 C C   . LEU B 2 82  ? 34.945 -17.040 31.032  1.00 26.87  ? 68   LEU B C   1 
ATOM   2143 O O   . LEU B 2 82  ? 33.946 -16.801 30.351  1.00 28.67  ? 68   LEU B O   1 
ATOM   2144 C CB  . LEU B 2 82  ? 36.098 -19.256 30.870  1.00 22.59  ? 68   LEU B CB  1 
ATOM   2145 C CG  . LEU B 2 82  ? 35.069 -20.184 30.222  1.00 26.45  ? 68   LEU B CG  1 
ATOM   2146 C CD1 . LEU B 2 82  ? 34.851 -19.798 28.759  1.00 20.31  ? 68   LEU B CD1 1 
ATOM   2147 C CD2 . LEU B 2 82  ? 35.552 -21.633 30.338  1.00 23.97  ? 68   LEU B CD2 1 
ATOM   2148 N N   . GLU B 2 83  ? 35.054 -16.657 32.303  1.00 25.30  ? 69   GLU B N   1 
ATOM   2149 C CA  . GLU B 2 83  ? 33.964 -15.937 32.951  1.00 28.33  ? 69   GLU B CA  1 
ATOM   2150 C C   . GLU B 2 83  ? 33.866 -14.485 32.529  1.00 25.18  ? 69   GLU B C   1 
ATOM   2151 O O   . GLU B 2 83  ? 32.766 -13.950 32.415  1.00 27.35  ? 69   GLU B O   1 
ATOM   2152 C CB  . GLU B 2 83  ? 34.073 -16.015 34.473  1.00 35.30  ? 69   GLU B CB  1 
ATOM   2153 C CG  . GLU B 2 83  ? 32.817 -16.585 35.139  1.00 43.75  ? 69   GLU B CG  1 
ATOM   2154 C CD  . GLU B 2 83  ? 31.725 -15.541 35.372  1.00 48.74  ? 69   GLU B CD  1 
ATOM   2155 O OE1 . GLU B 2 83  ? 32.056 -14.361 35.642  1.00 46.94  ? 69   GLU B OE1 1 
ATOM   2156 O OE2 . GLU B 2 83  ? 30.531 -15.910 35.292  1.00 52.38  ? 69   GLU B OE2 1 
ATOM   2157 N N   . ARG B 2 84  ? 34.998 -13.827 32.307  1.00 22.60  ? 70   ARG B N   1 
ATOM   2158 C CA  . ARG B 2 84  ? 34.934 -12.438 31.875  1.00 21.86  ? 70   ARG B CA  1 
ATOM   2159 C C   . ARG B 2 84  ? 34.158 -12.456 30.569  1.00 25.27  ? 70   ARG B C   1 
ATOM   2160 O O   . ARG B 2 84  ? 33.108 -11.828 30.451  1.00 25.53  ? 70   ARG B O   1 
ATOM   2161 C CB  . ARG B 2 84  ? 36.332 -11.870 31.648  1.00 18.13  ? 70   ARG B CB  1 
ATOM   2162 C CG  . ARG B 2 84  ? 36.353 -10.386 31.343  1.00 15.47  ? 70   ARG B CG  1 
ATOM   2163 C CD  . ARG B 2 84  ? 37.757 -9.918  31.011  1.00 20.54  ? 70   ARG B CD  1 
ATOM   2164 N NE  . ARG B 2 84  ? 38.371 -10.738 29.970  1.00 28.73  ? 70   ARG B NE  1 
ATOM   2165 C CZ  . ARG B 2 84  ? 39.652 -11.093 29.960  1.00 33.10  ? 70   ARG B CZ  1 
ATOM   2166 N NH1 . ARG B 2 84  ? 40.452 -10.696 30.940  1.00 35.30  ? 70   ARG B NH1 1 
ATOM   2167 N NH2 . ARG B 2 84  ? 40.134 -11.846 28.975  1.00 31.50  ? 70   ARG B NH2 1 
ATOM   2168 N N   . THR B 2 85  ? 34.675 -13.223 29.611  1.00 29.39  ? 71   THR B N   1 
ATOM   2169 C CA  . THR B 2 85  ? 34.079 -13.386 28.285  1.00 28.83  ? 71   THR B CA  1 
ATOM   2170 C C   . THR B 2 85  ? 32.583 -13.716 28.317  1.00 33.75  ? 71   THR B C   1 
ATOM   2171 O O   . THR B 2 85  ? 31.752 -12.939 27.838  1.00 35.32  ? 71   THR B O   1 
ATOM   2172 C CB  . THR B 2 85  ? 34.800 -14.501 27.513  1.00 24.38  ? 71   THR B CB  1 
ATOM   2173 O OG1 . THR B 2 85  ? 36.191 -14.178 27.405  1.00 24.96  ? 71   THR B OG1 1 
ATOM   2174 C CG2 . THR B 2 85  ? 34.206 -14.663 26.126  1.00 22.79  ? 71   THR B CG2 1 
ATOM   2175 N N   . ARG B 2 86  ? 32.251 -14.873 28.884  1.00 34.73  ? 72   ARG B N   1 
ATOM   2176 C CA  . ARG B 2 86  ? 30.869 -15.335 28.982  1.00 37.10  ? 72   ARG B CA  1 
ATOM   2177 C C   . ARG B 2 86  ? 29.880 -14.295 29.514  1.00 36.57  ? 72   ARG B C   1 
ATOM   2178 O O   . ARG B 2 86  ? 28.713 -14.282 29.120  1.00 39.72  ? 72   ARG B O   1 
ATOM   2179 C CB  . ARG B 2 86  ? 30.813 -16.588 29.864  1.00 38.01  ? 72   ARG B CB  1 
ATOM   2180 C CG  . ARG B 2 86  ? 29.800 -17.637 29.414  1.00 41.82  ? 72   ARG B CG  1 
ATOM   2181 C CD  . ARG B 2 86  ? 30.278 -19.059 29.713  1.00 42.36  ? 72   ARG B CD  1 
ATOM   2182 N NE  . ARG B 2 86  ? 31.018 -19.143 30.971  1.00 44.15  ? 72   ARG B NE  1 
ATOM   2183 C CZ  . ARG B 2 86  ? 31.661 -20.228 31.396  1.00 47.28  ? 72   ARG B CZ  1 
ATOM   2184 N NH1 . ARG B 2 86  ? 31.663 -21.337 30.665  1.00 48.99  ? 72   ARG B NH1 1 
ATOM   2185 N NH2 . ARG B 2 86  ? 32.306 -20.204 32.556  1.00 47.78  ? 72   ARG B NH2 1 
ATOM   2186 N N   . ALA B 2 87  ? 30.347 -13.420 30.400  1.00 34.98  ? 73   ALA B N   1 
ATOM   2187 C CA  . ALA B 2 87  ? 29.487 -12.404 31.003  1.00 34.46  ? 73   ALA B CA  1 
ATOM   2188 C C   . ALA B 2 87  ? 29.330 -11.122 30.189  1.00 33.28  ? 73   ALA B C   1 
ATOM   2189 O O   . ALA B 2 87  ? 28.359 -10.386 30.367  1.00 29.18  ? 73   ALA B O   1 
ATOM   2190 C CB  . ALA B 2 87  ? 30.000 -12.064 32.403  1.00 34.92  ? 73   ALA B CB  1 
ATOM   2191 N N   . GLU B 2 88  ? 30.279 -10.855 29.298  1.00 34.78  ? 74   GLU B N   1 
ATOM   2192 C CA  . GLU B 2 88  ? 30.230 -9.648  28.481  1.00 31.81  ? 74   GLU B CA  1 
ATOM   2193 C C   . GLU B 2 88  ? 28.857 -9.482  27.859  1.00 28.61  ? 74   GLU B C   1 
ATOM   2194 O O   . GLU B 2 88  ? 28.417 -8.368  27.585  1.00 31.80  ? 74   GLU B O   1 
ATOM   2195 C CB  . GLU B 2 88  ? 31.297 -9.697  27.376  1.00 38.34  ? 74   GLU B CB  1 
ATOM   2196 C CG  . GLU B 2 88  ? 32.678 -10.179 27.843  1.00 43.78  ? 74   GLU B CG  1 
ATOM   2197 C CD  . GLU B 2 88  ? 33.838 -9.554  27.072  1.00 43.43  ? 74   GLU B CD  1 
ATOM   2198 O OE1 . GLU B 2 88  ? 34.174 -8.379  27.354  1.00 40.89  ? 74   GLU B OE1 1 
ATOM   2199 O OE2 . GLU B 2 88  ? 34.412 -10.244 26.193  1.00 42.10  ? 74   GLU B OE2 1 
ATOM   2200 N N   . VAL B 2 89  ? 28.175 -10.597 27.650  1.00 25.89  ? 75   VAL B N   1 
ATOM   2201 C CA  . VAL B 2 89  ? 26.855 -10.565 27.046  1.00 28.98  ? 75   VAL B CA  1 
ATOM   2202 C C   . VAL B 2 89  ? 25.898 -9.594  27.758  1.00 32.04  ? 75   VAL B C   1 
ATOM   2203 O O   . VAL B 2 89  ? 25.075 -8.938  27.107  1.00 34.06  ? 75   VAL B O   1 
ATOM   2204 C CB  . VAL B 2 89  ? 26.252 -11.982 27.005  1.00 28.44  ? 75   VAL B CB  1 
ATOM   2205 C CG1 . VAL B 2 89  ? 25.760 -12.381 28.384  1.00 31.34  ? 75   VAL B CG1 1 
ATOM   2206 C CG2 . VAL B 2 89  ? 25.136 -12.037 25.980  1.00 26.94  ? 75   VAL B CG2 1 
ATOM   2207 N N   . ASP B 2 90  ? 26.004 -9.494  29.082  1.00 28.77  ? 76   ASP B N   1 
ATOM   2208 C CA  . ASP B 2 90  ? 25.151 -8.578  29.835  1.00 28.12  ? 76   ASP B CA  1 
ATOM   2209 C C   . ASP B 2 90  ? 25.852 -7.241  30.035  1.00 28.18  ? 76   ASP B C   1 
ATOM   2210 O O   . ASP B 2 90  ? 25.292 -6.178  29.753  1.00 29.13  ? 76   ASP B O   1 
ATOM   2211 C CB  . ASP B 2 90  ? 24.814 -9.149  31.210  1.00 29.89  ? 76   ASP B CB  1 
ATOM   2212 C CG  . ASP B 2 90  ? 23.807 -10.266 31.146  1.00 35.88  ? 76   ASP B CG  1 
ATOM   2213 O OD1 . ASP B 2 90  ? 22.600 -9.973  31.000  1.00 39.85  ? 76   ASP B OD1 1 
ATOM   2214 O OD2 . ASP B 2 90  ? 24.226 -11.440 31.244  1.00 42.02  ? 76   ASP B OD2 1 
ATOM   2215 N N   . THR B 2 91  ? 27.084 -7.313  30.524  1.00 22.52  ? 77   THR B N   1 
ATOM   2216 C CA  . THR B 2 91  ? 27.887 -6.132  30.808  1.00 26.37  ? 77   THR B CA  1 
ATOM   2217 C C   . THR B 2 91  ? 28.197 -5.245  29.602  1.00 29.36  ? 77   THR B C   1 
ATOM   2218 O O   . THR B 2 91  ? 28.350 -4.025  29.741  1.00 27.51  ? 77   THR B O   1 
ATOM   2219 C CB  . THR B 2 91  ? 29.211 -6.542  31.483  1.00 27.35  ? 77   THR B CB  1 
ATOM   2220 O OG1 . THR B 2 91  ? 30.077 -7.135  30.510  1.00 35.01  ? 77   THR B OG1 1 
ATOM   2221 C CG2 . THR B 2 91  ? 28.950 -7.556  32.600  1.00 23.96  ? 77   THR B CG2 1 
ATOM   2222 N N   . ALA B 2 92  ? 28.280 -5.850  28.419  1.00 30.90  ? 78   ALA B N   1 
ATOM   2223 C CA  . ALA B 2 92  ? 28.581 -5.088  27.207  1.00 25.24  ? 78   ALA B CA  1 
ATOM   2224 C C   . ALA B 2 92  ? 27.423 -5.028  26.214  1.00 22.37  ? 78   ALA B C   1 
ATOM   2225 O O   . ALA B 2 92  ? 26.985 -3.945  25.820  1.00 24.65  ? 78   ALA B O   1 
ATOM   2226 C CB  . ALA B 2 92  ? 29.823 -5.654  26.524  1.00 23.21  ? 78   ALA B CB  1 
ATOM   2227 N N   . CYS B 2 93  ? 26.910 -6.175  25.803  1.00 23.13  ? 79   CYS B N   1 
ATOM   2228 C CA  . CYS B 2 93  ? 25.830 -6.145  24.842  1.00 27.36  ? 79   CYS B CA  1 
ATOM   2229 C C   . CYS B 2 93  ? 24.511 -5.643  25.392  1.00 26.03  ? 79   CYS B C   1 
ATOM   2230 O O   . CYS B 2 93  ? 23.933 -4.708  24.849  1.00 25.79  ? 79   CYS B O   1 
ATOM   2231 C CB  . CYS B 2 93  ? 25.692 -7.517  24.235  1.00 32.75  ? 79   CYS B CB  1 
ATOM   2232 S SG  . CYS B 2 93  ? 27.327 -8.130  23.748  1.00 39.98  ? 79   CYS B SG  1 
ATOM   2233 N N   . ARG B 2 94  ? 24.025 -6.254  26.465  1.00 23.83  ? 80   ARG B N   1 
ATOM   2234 C CA  . ARG B 2 94  ? 22.776 -5.780  27.047  1.00 23.49  ? 80   ARG B CA  1 
ATOM   2235 C C   . ARG B 2 94  ? 22.954 -4.347  27.513  1.00 21.29  ? 80   ARG B C   1 
ATOM   2236 O O   . ARG B 2 94  ? 22.106 -3.493  27.263  1.00 25.10  ? 80   ARG B O   1 
ATOM   2237 C CB  . ARG B 2 94  ? 22.330 -6.629  28.245  1.00 26.33  ? 80   ARG B CB  1 
ATOM   2238 C CG  . ARG B 2 94  ? 20.827 -6.520  28.520  1.00 27.13  ? 80   ARG B CG  1 
ATOM   2239 C CD  . ARG B 2 94  ? 20.381 -7.344  29.718  1.00 29.21  ? 80   ARG B CD  1 
ATOM   2240 N NE  . ARG B 2 94  ? 20.750 -8.748  29.569  1.00 39.21  ? 80   ARG B NE  1 
ATOM   2241 C CZ  . ARG B 2 94  ? 19.954 -9.686  29.065  1.00 44.08  ? 80   ARG B CZ  1 
ATOM   2242 N NH1 . ARG B 2 94  ? 18.733 -9.375  28.648  1.00 45.16  ? 80   ARG B NH1 1 
ATOM   2243 N NH2 . ARG B 2 94  ? 20.388 -10.934 28.954  1.00 46.66  ? 80   ARG B NH2 1 
ATOM   2244 N N   . HIS B 2 95  ? 24.069 -4.074  28.178  1.00 21.71  ? 81   HIS B N   1 
ATOM   2245 C CA  . HIS B 2 95  ? 24.320 -2.732  28.681  1.00 21.32  ? 81   HIS B CA  1 
ATOM   2246 C C   . HIS B 2 95  ? 24.247 -1.673  27.600  1.00 18.00  ? 81   HIS B C   1 
ATOM   2247 O O   . HIS B 2 95  ? 23.436 -0.757  27.672  1.00 11.70  ? 81   HIS B O   1 
ATOM   2248 C CB  . HIS B 2 95  ? 25.691 -2.636  29.338  1.00 29.22  ? 81   HIS B CB  1 
ATOM   2249 C CG  . HIS B 2 95  ? 26.103 -1.227  29.628  1.00 36.11  ? 81   HIS B CG  1 
ATOM   2250 N ND1 . HIS B 2 95  ? 25.222 -0.281  30.109  1.00 38.88  ? 81   HIS B ND1 1 
ATOM   2251 C CD2 . HIS B 2 95  ? 27.292 -0.596  29.492  1.00 39.99  ? 81   HIS B CD2 1 
ATOM   2252 C CE1 . HIS B 2 95  ? 25.853 0.869   30.260  1.00 38.16  ? 81   HIS B CE1 1 
ATOM   2253 N NE2 . HIS B 2 95  ? 27.110 0.706   29.893  1.00 38.45  ? 81   HIS B NE2 1 
ATOM   2254 N N   . ASN B 2 96  ? 25.124 -1.807  26.611  1.00 20.94  ? 82   ASN B N   1 
ATOM   2255 C CA  . ASN B 2 96  ? 25.203 -0.876  25.493  1.00 17.92  ? 82   ASN B CA  1 
ATOM   2256 C C   . ASN B 2 96  ? 23.859 -0.639  24.806  1.00 12.00  ? 82   ASN B C   1 
ATOM   2257 O O   . ASN B 2 96  ? 23.483 0.502   24.537  1.00 10.27  ? 82   ASN B O   1 
ATOM   2258 C CB  . ASN B 2 96  ? 26.239 -1.387  24.484  1.00 18.64  ? 82   ASN B CB  1 
ATOM   2259 C CG  . ASN B 2 96  ? 27.659 -1.214  24.981  1.00 21.19  ? 82   ASN B CG  1 
ATOM   2260 O OD1 . ASN B 2 96  ? 27.873 -0.804  26.122  1.00 25.82  ? 82   ASN B OD1 1 
ATOM   2261 N ND2 . ASN B 2 96  ? 28.639 -1.521  24.130  1.00 15.84  ? 82   ASN B ND2 1 
ATOM   2262 N N   . TYR B 2 97  ? 23.139 -1.718  24.523  1.00 11.25  ? 83   TYR B N   1 
ATOM   2263 C CA  . TYR B 2 97  ? 21.838 -1.612  23.869  1.00 18.41  ? 83   TYR B CA  1 
ATOM   2264 C C   . TYR B 2 97  ? 20.859 -0.805  24.710  1.00 22.16  ? 83   TYR B C   1 
ATOM   2265 O O   . TYR B 2 97  ? 20.212 0.114   24.216  1.00 25.62  ? 83   TYR B O   1 
ATOM   2266 C CB  . TYR B 2 97  ? 21.256 -3.003  23.611  1.00 17.60  ? 83   TYR B CB  1 
ATOM   2267 C CG  . TYR B 2 97  ? 20.112 -3.012  22.620  1.00 23.87  ? 83   TYR B CG  1 
ATOM   2268 C CD1 . TYR B 2 97  ? 18.812 -2.687  23.016  1.00 29.06  ? 83   TYR B CD1 1 
ATOM   2269 C CD2 . TYR B 2 97  ? 20.328 -3.340  21.282  1.00 21.87  ? 83   TYR B CD2 1 
ATOM   2270 C CE1 . TYR B 2 97  ? 17.753 -2.689  22.095  1.00 29.83  ? 83   TYR B CE1 1 
ATOM   2271 C CE2 . TYR B 2 97  ? 19.283 -3.346  20.357  1.00 23.18  ? 83   TYR B CE2 1 
ATOM   2272 C CZ  . TYR B 2 97  ? 18.004 -3.020  20.766  1.00 27.36  ? 83   TYR B CZ  1 
ATOM   2273 O OH  . TYR B 2 97  ? 16.983 -3.021  19.847  1.00 26.90  ? 83   TYR B OH  1 
ATOM   2274 N N   . GLU B 2 98  ? 20.742 -1.170  25.981  1.00 26.40  ? 84   GLU B N   1 
ATOM   2275 C CA  . GLU B 2 98  ? 19.850 -0.478  26.901  1.00 32.02  ? 84   GLU B CA  1 
ATOM   2276 C C   . GLU B 2 98  ? 20.276 0.985   26.981  1.00 30.69  ? 84   GLU B C   1 
ATOM   2277 O O   . GLU B 2 98  ? 19.570 1.882   26.518  1.00 28.13  ? 84   GLU B O   1 
ATOM   2278 C CB  . GLU B 2 98  ? 19.939 -1.117  28.294  1.00 36.14  ? 84   GLU B CB  1 
ATOM   2279 C CG  . GLU B 2 98  ? 18.742 -1.989  28.685  1.00 42.93  ? 84   GLU B CG  1 
ATOM   2280 C CD  . GLU B 2 98  ? 18.877 -3.428  28.215  1.00 42.00  ? 84   GLU B CD  1 
ATOM   2281 O OE1 . GLU B 2 98  ? 19.484 -3.642  27.141  1.00 44.97  ? 84   GLU B OE1 1 
ATOM   2282 O OE2 . GLU B 2 98  ? 18.375 -4.337  28.916  1.00 35.55  ? 84   GLU B OE2 1 
ATOM   2283 N N   . GLY B 2 99  ? 21.449 1.204   27.567  1.00 31.41  ? 85   GLY B N   1 
ATOM   2284 C CA  . GLY B 2 99  ? 21.983 2.542   27.718  1.00 24.36  ? 85   GLY B CA  1 
ATOM   2285 C C   . GLY B 2 99  ? 22.225 3.290   26.420  1.00 25.99  ? 85   GLY B C   1 
ATOM   2286 O O   . GLY B 2 99  ? 21.304 3.900   25.877  1.00 25.17  ? 85   GLY B O   1 
ATOM   2287 N N   . PRO B 2 100 ? 23.460 3.242   25.887  1.00 26.25  ? 86   PRO B N   1 
ATOM   2288 C CA  . PRO B 2 100 ? 23.904 3.902   24.651  1.00 24.28  ? 86   PRO B CA  1 
ATOM   2289 C C   . PRO B 2 100 ? 22.958 3.886   23.438  1.00 24.12  ? 86   PRO B C   1 
ATOM   2290 O O   . PRO B 2 100 ? 22.273 4.872   23.168  1.00 27.70  ? 86   PRO B O   1 
ATOM   2291 C CB  . PRO B 2 100 ? 25.244 3.224   24.349  1.00 23.12  ? 86   PRO B CB  1 
ATOM   2292 C CG  . PRO B 2 100 ? 25.746 2.803   25.682  1.00 18.85  ? 86   PRO B CG  1 
ATOM   2293 C CD  . PRO B 2 100 ? 24.543 2.449   26.498  1.00 21.19  ? 86   PRO B CD  1 
ATOM   2294 N N   . GLU B 2 101 ? 22.929 2.768   22.716  1.00 24.39  ? 87   GLU B N   1 
ATOM   2295 C CA  . GLU B 2 101 ? 22.115 2.614   21.509  1.00 18.75  ? 87   GLU B CA  1 
ATOM   2296 C C   . GLU B 2 101 ? 20.676 3.158   21.554  1.00 20.50  ? 87   GLU B C   1 
ATOM   2297 O O   . GLU B 2 101 ? 20.190 3.759   20.594  1.00 15.36  ? 87   GLU B O   1 
ATOM   2298 C CB  . GLU B 2 101 ? 22.122 1.136   21.104  1.00 16.39  ? 87   GLU B CB  1 
ATOM   2299 C CG  . GLU B 2 101 ? 23.527 0.533   21.023  1.00 17.17  ? 87   GLU B CG  1 
ATOM   2300 C CD  . GLU B 2 101 ? 24.494 1.371   20.178  1.00 26.46  ? 87   GLU B CD  1 
ATOM   2301 O OE1 . GLU B 2 101 ? 24.100 2.473   19.735  1.00 22.96  ? 87   GLU B OE1 1 
ATOM   2302 O OE2 . GLU B 2 101 ? 25.649 0.930   19.953  1.00 26.29  ? 87   GLU B OE2 1 
ATOM   2303 N N   . THR B 2 102 ? 19.999 2.967   22.677  1.00 21.12  ? 88   THR B N   1 
ATOM   2304 C CA  . THR B 2 102 ? 18.618 3.414   22.813  1.00 24.37  ? 88   THR B CA  1 
ATOM   2305 C C   . THR B 2 102 ? 18.458 4.941   22.863  1.00 29.21  ? 88   THR B C   1 
ATOM   2306 O O   . THR B 2 102 ? 17.359 5.466   22.641  1.00 32.50  ? 88   THR B O   1 
ATOM   2307 C CB  . THR B 2 102 ? 17.964 2.786   24.084  1.00 27.16  ? 88   THR B CB  1 
ATOM   2308 O OG1 . THR B 2 102 ? 18.011 1.355   23.995  1.00 25.57  ? 88   THR B OG1 1 
ATOM   2309 C CG2 . THR B 2 102 ? 16.503 3.214   24.213  1.00 29.08  ? 88   THR B CG2 1 
ATOM   2310 N N   . SER B 2 103 ? 19.547 5.654   23.144  1.00 26.65  ? 89   SER B N   1 
ATOM   2311 C CA  . SER B 2 103 ? 19.512 7.118   23.238  1.00 26.54  ? 89   SER B CA  1 
ATOM   2312 C C   . SER B 2 103 ? 20.322 7.752   22.129  1.00 22.03  ? 89   SER B C   1 
ATOM   2313 O O   . SER B 2 103 ? 20.406 8.973   22.021  1.00 21.46  ? 89   SER B O   1 
ATOM   2314 C CB  . SER B 2 103 ? 20.095 7.573   24.588  1.00 29.86  ? 89   SER B CB  1 
ATOM   2315 O OG  . SER B 2 103 ? 21.232 6.804   24.970  1.00 37.94  ? 89   SER B OG  1 
ATOM   2316 N N   . THR B 2 104 ? 20.900 6.889   21.303  1.00 21.84  ? 90   THR B N   1 
ATOM   2317 C CA  . THR B 2 104 ? 21.779 7.283   20.220  1.00 16.95  ? 90   THR B CA  1 
ATOM   2318 C C   . THR B 2 104 ? 21.325 6.766   18.847  1.00 16.82  ? 90   THR B C   1 
ATOM   2319 O O   . THR B 2 104 ? 20.598 7.458   18.136  1.00 20.25  ? 90   THR B O   1 
ATOM   2320 C CB  . THR B 2 104 ? 23.230 6.827   20.617  1.00 15.96  ? 90   THR B CB  1 
ATOM   2321 O OG1 . THR B 2 104 ? 23.963 7.967   21.071  1.00 22.46  ? 90   THR B OG1 1 
ATOM   2322 C CG2 . THR B 2 104 ? 23.977 6.166   19.496  1.00 27.50  ? 90   THR B CG2 1 
ATOM   2323 N N   . SER B 2 105 ? 21.715 5.548   18.491  1.00 18.69  ? 91   SER B N   1 
ATOM   2324 C CA  . SER B 2 105 ? 21.369 4.965   17.201  1.00 19.53  ? 91   SER B CA  1 
ATOM   2325 C C   . SER B 2 105 ? 19.907 4.594   17.065  1.00 23.58  ? 91   SER B C   1 
ATOM   2326 O O   . SER B 2 105 ? 19.298 4.792   16.008  1.00 25.09  ? 91   SER B O   1 
ATOM   2327 C CB  . SER B 2 105 ? 22.220 3.723   16.943  1.00 15.53  ? 91   SER B CB  1 
ATOM   2328 O OG  . SER B 2 105 ? 23.451 3.797   17.634  1.00 9.24   ? 91   SER B OG  1 
ATOM   2329 N N   . LEU B 2 106 ? 19.342 4.050   18.135  1.00 26.05  ? 92   LEU B N   1 
ATOM   2330 C CA  . LEU B 2 106 ? 17.950 3.626   18.117  1.00 26.50  ? 92   LEU B CA  1 
ATOM   2331 C C   . LEU B 2 106 ? 16.934 4.771   18.087  1.00 25.86  ? 92   LEU B C   1 
ATOM   2332 O O   . LEU B 2 106 ? 15.741 4.537   17.926  1.00 29.07  ? 92   LEU B O   1 
ATOM   2333 C CB  . LEU B 2 106 ? 17.682 2.700   19.307  1.00 24.89  ? 92   LEU B CB  1 
ATOM   2334 C CG  . LEU B 2 106 ? 17.807 1.191   19.041  1.00 21.87  ? 92   LEU B CG  1 
ATOM   2335 C CD1 . LEU B 2 106 ? 19.020 0.883   18.172  1.00 22.19  ? 92   LEU B CD1 1 
ATOM   2336 C CD2 . LEU B 2 106 ? 17.916 0.473   20.361  1.00 19.28  ? 92   LEU B CD2 1 
ATOM   2337 N N   . ARG B 2 107 ? 17.402 6.007   18.222  1.00 27.80  ? 93   ARG B N   1 
ATOM   2338 C CA  . ARG B 2 107 ? 16.502 7.159   18.202  1.00 29.53  ? 93   ARG B CA  1 
ATOM   2339 C C   . ARG B 2 107 ? 16.797 8.086   17.015  1.00 27.23  ? 93   ARG B C   1 
ATOM   2340 O O   . ARG B 2 107 ? 16.140 9.111   16.830  1.00 25.17  ? 93   ARG B O   1 
ATOM   2341 C CB  . ARG B 2 107 ? 16.601 7.940   19.528  1.00 35.12  ? 93   ARG B CB  1 
ATOM   2342 C CG  . ARG B 2 107 ? 15.469 7.636   20.525  1.00 44.92  ? 93   ARG B CG  1 
ATOM   2343 C CD  . ARG B 2 107 ? 15.408 8.644   21.680  1.00 50.85  ? 93   ARG B CD  1 
ATOM   2344 N NE  . ARG B 2 107 ? 14.249 9.538   21.588  1.00 57.39  ? 93   ARG B NE  1 
ATOM   2345 C CZ  . ARG B 2 107 ? 14.326 10.869  21.525  1.00 58.46  ? 93   ARG B CZ  1 
ATOM   2346 N NH1 . ARG B 2 107 ? 15.511 11.474  21.543  1.00 59.41  ? 93   ARG B NH1 1 
ATOM   2347 N NH2 . ARG B 2 107 ? 13.221 11.602  21.438  1.00 53.88  ? 93   ARG B NH2 1 
ATOM   2348 N N   . ARG B 2 108 ? 17.787 7.721   16.208  1.00 27.51  ? 94   ARG B N   1 
ATOM   2349 C CA  . ARG B 2 108 ? 18.149 8.519   15.042  1.00 25.05  ? 94   ARG B CA  1 
ATOM   2350 C C   . ARG B 2 108 ? 17.066 8.447   13.968  1.00 26.72  ? 94   ARG B C   1 
ATOM   2351 O O   . ARG B 2 108 ? 16.619 7.358   13.601  1.00 25.69  ? 94   ARG B O   1 
ATOM   2352 C CB  . ARG B 2 108 ? 19.461 8.014   14.456  1.00 28.56  ? 94   ARG B CB  1 
ATOM   2353 C CG  . ARG B 2 108 ? 19.977 8.852   13.313  1.00 25.18  ? 94   ARG B CG  1 
ATOM   2354 C CD  . ARG B 2 108 ? 21.098 9.753   13.785  1.00 28.64  ? 94   ARG B CD  1 
ATOM   2355 N NE  . ARG B 2 108 ? 21.658 10.538  12.690  1.00 31.99  ? 94   ARG B NE  1 
ATOM   2356 C CZ  . ARG B 2 108 ? 22.181 10.011  11.591  1.00 26.30  ? 94   ARG B CZ  1 
ATOM   2357 N NH1 . ARG B 2 108 ? 22.213 8.691   11.440  1.00 25.14  ? 94   ARG B NH1 1 
ATOM   2358 N NH2 . ARG B 2 108 ? 22.670 10.802  10.646  1.00 22.69  ? 94   ARG B NH2 1 
ATOM   2359 N N   . LEU B 2 109 A 16.648 9.613   13.474  1.00 29.36  ? 94   LEU B N   1 
ATOM   2360 C CA  . LEU B 2 109 A 15.623 9.716   12.427  1.00 27.01  ? 94   LEU B CA  1 
ATOM   2361 C C   . LEU B 2 109 A 16.075 10.733  11.390  1.00 29.48  ? 94   LEU B C   1 
ATOM   2362 O O   . LEU B 2 109 A 16.276 11.897  11.721  1.00 34.11  ? 94   LEU B O   1 
ATOM   2363 C CB  . LEU B 2 109 A 14.300 10.206  13.012  1.00 22.50  ? 94   LEU B CB  1 
ATOM   2364 C CG  . LEU B 2 109 A 13.131 9.253   13.222  1.00 18.93  ? 94   LEU B CG  1 
ATOM   2365 C CD1 . LEU B 2 109 A 13.510 7.817   12.911  1.00 15.06  ? 94   LEU B CD1 1 
ATOM   2366 C CD2 . LEU B 2 109 A 12.692 9.396   14.658  1.00 19.86  ? 94   LEU B CD2 1 
ATOM   2367 N N   . GLU B 2 110 ? 16.238 10.299  10.145  1.00 28.11  ? 95   GLU B N   1 
ATOM   2368 C CA  . GLU B 2 110 ? 16.653 11.198  9.072   1.00 27.76  ? 95   GLU B CA  1 
ATOM   2369 C C   . GLU B 2 110 ? 15.568 11.180  8.011   1.00 29.57  ? 95   GLU B C   1 
ATOM   2370 O O   . GLU B 2 110 ? 15.366 10.162  7.346   1.00 30.46  ? 95   GLU B O   1 
ATOM   2371 C CB  . GLU B 2 110 ? 17.969 10.730  8.451   1.00 33.19  ? 95   GLU B CB  1 
ATOM   2372 C CG  . GLU B 2 110 ? 19.200 11.105  9.248   1.00 35.60  ? 95   GLU B CG  1 
ATOM   2373 C CD  . GLU B 2 110 ? 19.124 12.509  9.820   1.00 40.36  ? 95   GLU B CD  1 
ATOM   2374 O OE1 . GLU B 2 110 ? 18.966 13.470  9.035   1.00 46.98  ? 95   GLU B OE1 1 
ATOM   2375 O OE2 . GLU B 2 110 ? 19.226 12.651  11.057  1.00 37.73  ? 95   GLU B OE2 1 
ATOM   2376 N N   . GLN B 2 111 ? 14.873 12.303  7.859   1.00 26.22  ? 96   GLN B N   1 
ATOM   2377 C CA  . GLN B 2 111 ? 13.794 12.417  6.889   1.00 27.62  ? 96   GLN B CA  1 
ATOM   2378 C C   . GLN B 2 111 ? 14.317 12.402  5.443   1.00 24.99  ? 96   GLN B C   1 
ATOM   2379 O O   . GLN B 2 111 ? 15.147 13.225  5.060   1.00 23.27  ? 96   GLN B O   1 
ATOM   2380 C CB  . GLN B 2 111 ? 12.994 13.693  7.177   1.00 28.52  ? 96   GLN B CB  1 
ATOM   2381 C CG  . GLN B 2 111 ? 12.120 14.161  6.037   1.00 42.09  ? 96   GLN B CG  1 
ATOM   2382 C CD  . GLN B 2 111 ? 12.015 15.677  5.965   1.00 50.53  ? 96   GLN B CD  1 
ATOM   2383 O OE1 . GLN B 2 111 ? 11.381 16.306  6.817   1.00 57.75  ? 96   GLN B OE1 1 
ATOM   2384 N NE2 . GLN B 2 111 ? 12.639 16.271  4.947   1.00 48.80  ? 96   GLN B NE2 1 
ATOM   2385 N N   . PRO B 2 112 ? 13.825 11.460  4.621   1.00 25.13  ? 97   PRO B N   1 
ATOM   2386 C CA  . PRO B 2 112 ? 14.252 11.345  3.221   1.00 28.91  ? 97   PRO B CA  1 
ATOM   2387 C C   . PRO B 2 112 ? 13.856 12.512  2.325   1.00 31.51  ? 97   PRO B C   1 
ATOM   2388 O O   . PRO B 2 112 ? 12.884 13.226  2.581   1.00 29.51  ? 97   PRO B O   1 
ATOM   2389 C CB  . PRO B 2 112 ? 13.605 10.042  2.749   1.00 24.62  ? 97   PRO B CB  1 
ATOM   2390 C CG  . PRO B 2 112 ? 12.393 9.916   3.590   1.00 19.82  ? 97   PRO B CG  1 
ATOM   2391 C CD  . PRO B 2 112 ? 12.816 10.439  4.955   1.00 26.37  ? 97   PRO B CD  1 
ATOM   2392 N N   . ASN B 2 113 ? 14.627 12.694  1.263   1.00 33.79  ? 98   ASN B N   1 
ATOM   2393 C CA  . ASN B 2 113 ? 14.355 13.744  0.305   1.00 34.88  ? 98   ASN B CA  1 
ATOM   2394 C C   . ASN B 2 113 ? 14.152 13.049  -1.027  1.00 34.57  ? 98   ASN B C   1 
ATOM   2395 O O   . ASN B 2 113 ? 15.045 12.363  -1.526  1.00 35.42  ? 98   ASN B O   1 
ATOM   2396 C CB  . ASN B 2 113 ? 15.524 14.728  0.250   1.00 36.15  ? 98   ASN B CB  1 
ATOM   2397 C CG  . ASN B 2 113 ? 15.588 15.615  1.484   1.00 35.66  ? 98   ASN B CG  1 
ATOM   2398 O OD1 . ASN B 2 113 ? 14.883 16.616  1.584   1.00 38.12  ? 98   ASN B OD1 1 
ATOM   2399 N ND2 . ASN B 2 113 ? 16.429 15.240  2.435   1.00 39.67  ? 98   ASN B ND2 1 
ATOM   2400 N N   . VAL B 2 114 ? 12.958 13.210  -1.585  1.00 35.58  ? 99   VAL B N   1 
ATOM   2401 C CA  . VAL B 2 114 ? 12.614 12.577  -2.851  1.00 38.25  ? 99   VAL B CA  1 
ATOM   2402 C C   . VAL B 2 114 ? 12.596 13.547  -4.028  1.00 39.45  ? 99   VAL B C   1 
ATOM   2403 O O   . VAL B 2 114 ? 12.198 14.707  -3.897  1.00 41.30  ? 99   VAL B O   1 
ATOM   2404 C CB  . VAL B 2 114 ? 11.244 11.869  -2.755  1.00 36.11  ? 99   VAL B CB  1 
ATOM   2405 C CG1 . VAL B 2 114 ? 11.298 10.785  -1.692  1.00 38.34  ? 99   VAL B CG1 1 
ATOM   2406 C CG2 . VAL B 2 114 ? 10.162 12.869  -2.416  1.00 36.67  ? 99   VAL B CG2 1 
ATOM   2407 N N   . ALA B 2 115 ? 13.036 13.051  -5.179  1.00 39.20  ? 100  ALA B N   1 
ATOM   2408 C CA  . ALA B 2 115 ? 13.097 13.831  -6.409  1.00 39.18  ? 100  ALA B CA  1 
ATOM   2409 C C   . ALA B 2 115 ? 12.777 12.872  -7.552  1.00 40.55  ? 100  ALA B C   1 
ATOM   2410 O O   . ALA B 2 115 ? 13.110 11.690  -7.493  1.00 39.02  ? 100  ALA B O   1 
ATOM   2411 C CB  . ALA B 2 115 ? 14.489 14.417  -6.587  1.00 36.60  ? 100  ALA B CB  1 
ATOM   2412 N N   . ILE B 2 116 ? 12.120 13.370  -8.589  1.00 42.26  ? 101  ILE B N   1 
ATOM   2413 C CA  . ILE B 2 116 ? 11.772 12.505  -9.708  1.00 47.86  ? 101  ILE B CA  1 
ATOM   2414 C C   . ILE B 2 116 ? 12.458 12.944  -10.998 1.00 48.81  ? 101  ILE B C   1 
ATOM   2415 O O   . ILE B 2 116 ? 12.482 14.133  -11.331 1.00 49.29  ? 101  ILE B O   1 
ATOM   2416 C CB  . ILE B 2 116 ? 10.225 12.452  -9.935  1.00 48.16  ? 101  ILE B CB  1 
ATOM   2417 C CG1 . ILE B 2 116 ? 9.624  13.862  -9.818  1.00 52.23  ? 101  ILE B CG1 1 
ATOM   2418 C CG2 . ILE B 2 116 ? 9.592  11.463  -8.956  1.00 46.53  ? 101  ILE B CG2 1 
ATOM   2419 C CD1 . ILE B 2 116 ? 9.142  14.262  -8.425  1.00 55.78  ? 101  ILE B CD1 1 
ATOM   2420 N N   . SER B 2 117 ? 13.016 11.987  -11.733 1.00 47.36  ? 102  SER B N   1 
ATOM   2421 C CA  . SER B 2 117 ? 13.694 12.320  -12.986 1.00 50.61  ? 102  SER B CA  1 
ATOM   2422 C C   . SER B 2 117 ? 13.299 11.412  -14.161 1.00 52.34  ? 102  SER B C   1 
ATOM   2423 O O   . SER B 2 117 ? 12.987 10.241  -13.957 1.00 50.75  ? 102  SER B O   1 
ATOM   2424 C CB  . SER B 2 117 ? 15.205 12.265  -12.773 1.00 52.31  ? 102  SER B CB  1 
ATOM   2425 O OG  . SER B 2 117 ? 15.602 13.295  -11.895 1.00 54.69  ? 102  SER B OG  1 
ATOM   2426 N N   . LEU B 2 118 ? 13.296 11.963  -15.371 1.00 56.34  ? 103  LEU B N   1 
ATOM   2427 C CA  . LEU B 2 118 ? 12.954 11.169  -16.566 1.00 59.70  ? 103  LEU B CA  1 
ATOM   2428 C C   . LEU B 2 118 ? 14.177 10.349  -16.961 1.00 64.21  ? 103  LEU B C   1 
ATOM   2429 O O   . LEU B 2 118 ? 15.221 10.933  -17.212 1.00 63.76  ? 103  LEU B O   1 
ATOM   2430 C CB  . LEU B 2 118 ? 12.568 12.085  -17.736 1.00 60.14  ? 103  LEU B CB  1 
ATOM   2431 C CG  . LEU B 2 118 ? 11.710 11.482  -18.869 1.00 59.75  ? 103  LEU B CG  1 
ATOM   2432 C CD1 . LEU B 2 118 ? 10.616 10.575  -18.325 1.00 60.55  ? 103  LEU B CD1 1 
ATOM   2433 C CD2 . LEU B 2 118 ? 11.087 12.622  -19.632 1.00 56.57  ? 103  LEU B CD2 1 
ATOM   2434 N N   . SER B 2 119 ? 14.075 9.035   -17.062 1.00 69.31  ? 104  SER B N   1 
ATOM   2435 C CA  . SER B 2 119 ? 15.278 8.281   -17.353 1.00 74.53  ? 104  SER B CA  1 
ATOM   2436 C C   . SER B 2 119 ? 15.293 7.478   -18.622 1.00 77.96  ? 104  SER B C   1 
ATOM   2437 O O   . SER B 2 119 ? 14.421 7.596   -19.479 1.00 75.91  ? 104  SER B O   1 
ATOM   2438 C CB  . SER B 2 119 ? 15.667 7.396   -16.153 1.00 75.89  ? 104  SER B CB  1 
ATOM   2439 O OG  . SER B 2 119 ? 16.685 6.482   -16.511 1.00 79.23  ? 104  SER B OG  1 
ATOM   2440 N N   . ARG B 2 120 ? 16.328 6.631   -18.653 1.00 84.50  ? 105  ARG B N   1 
ATOM   2441 C CA  . ARG B 2 120 ? 16.710 5.743   -19.737 1.00 90.34  ? 105  ARG B CA  1 
ATOM   2442 C C   . ARG B 2 120 ? 17.078 6.588   -20.957 1.00 94.25  ? 105  ARG B C   1 
ATOM   2443 O O   . ARG B 2 120 ? 17.009 6.126   -22.101 1.00 94.70  ? 105  ARG B O   1 
ATOM   2444 C CB  . ARG B 2 120 ? 15.682 4.645   -20.013 1.00 90.01  ? 105  ARG B CB  1 
ATOM   2445 C CG  . ARG B 2 120 ? 15.863 3.430   -19.095 1.00 92.01  ? 105  ARG B CG  1 
ATOM   2446 C CD  . ARG B 2 120 ? 16.452 3.829   -17.737 1.00 96.41  ? 105  ARG B CD  1 
ATOM   2447 N NE  . ARG B 2 120 ? 15.669 3.265   -16.642 1.00 100.00 ? 105  ARG B NE  1 
ATOM   2448 C CZ  . ARG B 2 120 ? 16.109 3.106   -15.398 1.00 100.00 ? 105  ARG B CZ  1 
ATOM   2449 N NH1 . ARG B 2 120 ? 17.340 3.471   -15.077 1.00 99.45  ? 105  ARG B NH1 1 
ATOM   2450 N NH2 . ARG B 2 120 ? 15.318 2.577   -14.473 1.00 100.00 ? 105  ARG B NH2 1 
ATOM   2451 N N   . THR B 2 121 ? 17.517 7.811   -20.611 1.00 98.06  ? 106  THR B N   1 
ATOM   2452 C CA  . THR B 2 121 ? 17.699 9.046   -21.429 1.00 99.01  ? 106  THR B CA  1 
ATOM   2453 C C   . THR B 2 121 ? 17.058 9.791   -22.648 1.00 99.83  ? 106  THR B C   1 
ATOM   2454 O O   . THR B 2 121 ? 17.299 10.994  -22.808 1.00 100.00 ? 106  THR B O   1 
ATOM   2455 C CB  . THR B 2 121 ? 19.218 8.858   -21.687 1.00 100.00 ? 106  THR B CB  1 
ATOM   2456 O OG1 . THR B 2 121 ? 19.416 8.074   -22.867 1.00 100.00 ? 106  THR B OG1 1 
ATOM   2457 C CG2 . THR B 2 121 ? 19.852 8.129   -20.498 1.00 99.17  ? 106  THR B CG2 1 
ATOM   2458 N N   . GLU B 2 122 ? 16.261 9.169   -23.520 1.00 100.00 ? 107  GLU B N   1 
ATOM   2459 C CA  . GLU B 2 122 ? 15.724 10.051  -24.575 1.00 100.00 ? 107  GLU B CA  1 
ATOM   2460 C C   . GLU B 2 122 ? 14.201 10.145  -24.751 1.00 100.00 ? 107  GLU B C   1 
ATOM   2461 O O   . GLU B 2 122 ? 13.431 9.774   -23.866 1.00 100.00 ? 107  GLU B O   1 
ATOM   2462 C CB  . GLU B 2 122 ? 16.372 9.768   -25.924 1.00 100.00 ? 107  GLU B CB  1 
ATOM   2463 C CG  . GLU B 2 122 ? 17.885 9.541   -25.918 1.00 100.00 ? 107  GLU B CG  1 
ATOM   2464 C CD  . GLU B 2 122 ? 18.745 10.683  -25.338 1.00 100.00 ? 107  GLU B CD  1 
ATOM   2465 O OE1 . GLU B 2 122 ? 18.430 11.890  -25.466 1.00 100.00 ? 107  GLU B OE1 1 
ATOM   2466 O OE2 . GLU B 2 122 ? 19.789 10.334  -24.747 1.00 100.00 ? 107  GLU B OE2 1 
ATOM   2467 N N   . ALA B 2 123 ? 13.732 10.647  -25.887 1.00 99.64  ? 108  ALA B N   1 
ATOM   2468 C CA  . ALA B 2 123 ? 12.287 10.807  -25.978 1.00 100.00 ? 108  ALA B CA  1 
ATOM   2469 C C   . ALA B 2 123 ? 11.331 9.923   -26.756 1.00 100.00 ? 108  ALA B C   1 
ATOM   2470 O O   . ALA B 2 123 ? 11.018 10.156  -27.921 1.00 100.00 ? 108  ALA B O   1 
ATOM   2471 C CB  . ALA B 2 123 ? 11.954 12.285  -26.263 1.00 98.92  ? 108  ALA B CB  1 
ATOM   2472 N N   . LEU B 2 124 ? 10.874 8.903   -26.045 1.00 100.00 ? 109  LEU B N   1 
ATOM   2473 C CA  . LEU B 2 124 ? 9.835  7.963   -26.408 1.00 99.89  ? 109  LEU B CA  1 
ATOM   2474 C C   . LEU B 2 124 ? 9.619  6.924   -27.520 1.00 100.00 ? 109  LEU B C   1 
ATOM   2475 O O   . LEU B 2 124 ? 8.621  6.972   -28.238 1.00 100.00 ? 109  LEU B O   1 
ATOM   2476 C CB  . LEU B 2 124 ? 8.526  8.740   -26.262 1.00 99.56  ? 109  LEU B CB  1 
ATOM   2477 C CG  . LEU B 2 124 ? 7.866  8.294   -24.955 1.00 99.43  ? 109  LEU B CG  1 
ATOM   2478 C CD1 . LEU B 2 124 ? 7.579  6.792   -25.017 1.00 97.56  ? 109  LEU B CD1 1 
ATOM   2479 C CD2 . LEU B 2 124 ? 8.790  8.622   -23.794 1.00 99.78  ? 109  LEU B CD2 1 
ATOM   2480 N N   . ASN B 2 125 ? 10.504 6.028   -27.629 1.00 100.00 ? 110  ASN B N   1 
ATOM   2481 C CA  . ASN B 2 125 ? 10.283 4.837   -28.462 1.00 100.00 ? 110  ASN B CA  1 
ATOM   2482 C C   . ASN B 2 125 ? 10.281 3.580   -27.588 1.00 100.00 ? 110  ASN B C   1 
ATOM   2483 O O   . ASN B 2 125 ? 9.767  2.560   -27.785 1.00 100.00 ? 110  ASN B O   1 
ATOM   2484 C CB  . ASN B 2 125 ? 11.390 4.720   -29.511 1.00 99.97  ? 110  ASN B CB  1 
ATOM   2485 C CG  . ASN B 2 125 ? 11.452 5.924   -30.450 1.00 100.00 ? 110  ASN B CG  1 
ATOM   2486 O OD1 . ASN B 2 125 ? 10.482 6.209   -31.150 1.00 20.00  ? 110  ASN B OD1 1 
ATOM   2487 N ND2 . ASN B 2 125 ? 12.548 6.658   -30.510 1.00 20.00  ? 110  ASN B ND2 1 
ATOM   2488 N N   . HIS B 2 126 ? 10.941 3.922   -26.422 1.00 100.00 ? 111  HIS B N   1 
ATOM   2489 C CA  . HIS B 2 126 ? 11.042 2.986   -25.318 1.00 98.87  ? 111  HIS B CA  1 
ATOM   2490 C C   . HIS B 2 126 ? 11.333 3.844   -24.117 1.00 97.91  ? 111  HIS B C   1 
ATOM   2491 O O   . HIS B 2 126 ? 12.112 3.433   -23.255 1.00 99.82  ? 111  HIS B O   1 
ATOM   2492 C CB  . HIS B 2 126 ? 12.193 1.995   -25.483 1.00 99.26  ? 111  HIS B CB  1 
ATOM   2493 C CG  . HIS B 2 126 ? 11.752 0.560   -25.499 1.00 100.00 ? 111  HIS B CG  1 
ATOM   2494 N ND1 . HIS B 2 126 ? 12.245 -0.344  -26.411 1.00 100.00 ? 111  HIS B ND1 1 
ATOM   2495 C CD2 . HIS B 2 126 ? 10.834 -0.106  -24.753 1.00 100.00 ? 111  HIS B CD2 1 
ATOM   2496 C CE1 . HIS B 2 126 ? 11.641 -1.516  -26.230 1.00 100.00 ? 111  HIS B CE1 1 
ATOM   2497 N NE2 . HIS B 2 126 ? 10.788 -1.394  -25.235 1.00 100.00 ? 111  HIS B NE2 1 
ATOM   2498 N N   . HIS B 2 127 ? 10.739 5.035   -24.030 1.00 95.67  ? 112  HIS B N   1 
ATOM   2499 C CA  . HIS B 2 127 ? 11.087 5.825   -22.876 1.00 91.72  ? 112  HIS B CA  1 
ATOM   2500 C C   . HIS B 2 127 ? 10.139 6.186   -21.805 1.00 87.59  ? 112  HIS B C   1 
ATOM   2501 O O   . HIS B 2 127 ? 9.355  7.105   -21.833 1.00 85.52  ? 112  HIS B O   1 
ATOM   2502 C CB  . HIS B 2 127 ? 11.988 6.921   -23.311 1.00 95.05  ? 112  HIS B CB  1 
ATOM   2503 C CG  . HIS B 2 127 ? 13.379 6.462   -23.217 1.00 98.51  ? 112  HIS B CG  1 
ATOM   2504 N ND1 . HIS B 2 127 ? 14.081 5.945   -24.298 1.00 99.99  ? 112  HIS B ND1 1 
ATOM   2505 C CD2 . HIS B 2 127 ? 14.106 6.121   -22.129 1.00 99.27  ? 112  HIS B CD2 1 
ATOM   2506 C CE1 . HIS B 2 127 ? 15.141 5.303   -23.871 1.00 100.00 ? 112  HIS B CE1 1 
ATOM   2507 N NE2 . HIS B 2 127 ? 15.183 5.391   -22.543 1.00 100.00 ? 112  HIS B NE2 1 
ATOM   2508 N N   . ASN B 2 128 ? 10.386 5.345   -20.821 1.00 84.64  ? 113  ASN B N   1 
ATOM   2509 C CA  . ASN B 2 128 ? 9.690  5.066   -19.598 1.00 81.88  ? 113  ASN B CA  1 
ATOM   2510 C C   . ASN B 2 128 ? 10.281 5.343   -18.242 1.00 78.91  ? 113  ASN B C   1 
ATOM   2511 O O   . ASN B 2 128 ? 9.537  5.535   -17.273 1.00 84.16  ? 113  ASN B O   1 
ATOM   2512 C CB  . ASN B 2 128 ? 9.600  3.567   -19.622 1.00 82.80  ? 113  ASN B CB  1 
ATOM   2513 C CG  . ASN B 2 128 ? 10.900 2.973   -20.151 1.00 81.87  ? 113  ASN B CG  1 
ATOM   2514 O OD1 . ASN B 2 128 ? 11.888 3.705   -20.260 1.00 81.63  ? 113  ASN B OD1 1 
ATOM   2515 N ND2 . ASN B 2 128 ? 10.905 1.707   -20.507 1.00 81.48  ? 113  ASN B ND2 1 
ATOM   2516 N N   . THR B 2 129 ? 11.591 5.360   -18.111 1.00 70.59  ? 114  THR B N   1 
ATOM   2517 C CA  . THR B 2 129 ? 11.977 5.343   -16.739 1.00 61.05  ? 114  THR B CA  1 
ATOM   2518 C C   . THR B 2 129 ? 12.097 6.517   -15.845 1.00 55.91  ? 114  THR B C   1 
ATOM   2519 O O   . THR B 2 129 ? 13.028 7.305   -15.880 1.00 55.66  ? 114  THR B O   1 
ATOM   2520 C CB  . THR B 2 129 ? 13.180 4.392   -16.583 1.00 60.67  ? 114  THR B CB  1 
ATOM   2521 O OG1 . THR B 2 129 ? 13.375 3.673   -17.803 1.00 61.70  ? 114  THR B OG1 1 
ATOM   2522 C CG2 . THR B 2 129 ? 12.885 3.352   -15.514 1.00 59.43  ? 114  THR B CG2 1 
ATOM   2523 N N   . LEU B 2 130 ? 11.073 6.552   -15.001 1.00 52.64  ? 115  LEU B N   1 
ATOM   2524 C CA  . LEU B 2 130 ? 10.903 7.531   -13.966 1.00 50.73  ? 115  LEU B CA  1 
ATOM   2525 C C   . LEU B 2 130 ? 11.708 6.997   -12.799 1.00 49.14  ? 115  LEU B C   1 
ATOM   2526 O O   . LEU B 2 130 ? 11.477 5.891   -12.291 1.00 49.61  ? 115  LEU B O   1 
ATOM   2527 C CB  . LEU B 2 130 ? 9.436  7.638   -13.571 1.00 48.61  ? 115  LEU B CB  1 
ATOM   2528 C CG  . LEU B 2 130 ? 8.828  8.941   -14.086 1.00 46.20  ? 115  LEU B CG  1 
ATOM   2529 C CD1 . LEU B 2 130 ? 9.310  9.185   -15.499 1.00 47.89  ? 115  LEU B CD1 1 
ATOM   2530 C CD2 . LEU B 2 130 ? 7.317  8.876   -14.042 1.00 48.73  ? 115  LEU B CD2 1 
ATOM   2531 N N   . VAL B 2 131 ? 12.679 7.797   -12.399 1.00 43.18  ? 116  VAL B N   1 
ATOM   2532 C CA  . VAL B 2 131 ? 13.554 7.450   -11.320 1.00 38.08  ? 116  VAL B CA  1 
ATOM   2533 C C   . VAL B 2 131 ? 13.212 8.372   -10.185 1.00 34.32  ? 116  VAL B C   1 
ATOM   2534 O O   . VAL B 2 131 ? 13.156 9.587   -10.365 1.00 36.39  ? 116  VAL B O   1 
ATOM   2535 C CB  . VAL B 2 131 ? 15.007 7.673   -11.734 1.00 40.31  ? 116  VAL B CB  1 
ATOM   2536 C CG1 . VAL B 2 131 ? 15.875 7.891   -10.507 1.00 40.67  ? 116  VAL B CG1 1 
ATOM   2537 C CG2 . VAL B 2 131 ? 15.482 6.501   -12.559 1.00 38.29  ? 116  VAL B CG2 1 
ATOM   2538 N N   . CYS B 2 132 ? 12.947 7.791   -9.027  1.00 30.45  ? 117  CYS B N   1 
ATOM   2539 C CA  . CYS B 2 132 ? 12.653 8.584   -7.854  1.00 29.92  ? 117  CYS B CA  1 
ATOM   2540 C C   . CYS B 2 132 ? 13.874 8.381   -6.981  1.00 29.05  ? 117  CYS B C   1 
ATOM   2541 O O   . CYS B 2 132 ? 14.283 7.248   -6.736  1.00 25.96  ? 117  CYS B O   1 
ATOM   2542 C CB  . CYS B 2 132 ? 11.399 8.076   -7.146  1.00 28.00  ? 117  CYS B CB  1 
ATOM   2543 S SG  . CYS B 2 132 ? 10.815 9.168   -5.809  1.00 24.17  ? 117  CYS B SG  1 
ATOM   2544 N N   . SER B 2 133 ? 14.478 9.474   -6.538  1.00 28.99  ? 118  SER B N   1 
ATOM   2545 C CA  . SER B 2 133 ? 15.653 9.359   -5.700  1.00 34.04  ? 118  SER B CA  1 
ATOM   2546 C C   . SER B 2 133 ? 15.348 9.711   -4.245  1.00 33.38  ? 118  SER B C   1 
ATOM   2547 O O   . SER B 2 133 ? 15.130 10.873  -3.904  1.00 34.82  ? 118  SER B O   1 
ATOM   2548 C CB  . SER B 2 133 ? 16.772 10.250  -6.245  1.00 36.81  ? 118  SER B CB  1 
ATOM   2549 O OG  . SER B 2 133 ? 16.960 11.402  -5.440  1.00 44.72  ? 118  SER B OG  1 
ATOM   2550 N N   . VAL B 2 134 ? 15.306 8.694   -3.393  1.00 29.46  ? 119  VAL B N   1 
ATOM   2551 C CA  . VAL B 2 134 ? 15.058 8.917   -1.982  1.00 27.04  ? 119  VAL B CA  1 
ATOM   2552 C C   . VAL B 2 134 ? 16.431 8.856   -1.330  1.00 25.06  ? 119  VAL B C   1 
ATOM   2553 O O   . VAL B 2 134 ? 17.053 7.793   -1.259  1.00 25.45  ? 119  VAL B O   1 
ATOM   2554 C CB  . VAL B 2 134 ? 14.122 7.835   -1.397  1.00 28.90  ? 119  VAL B CB  1 
ATOM   2555 C CG1 . VAL B 2 134 ? 13.385 8.377   -0.163  1.00 25.77  ? 119  VAL B CG1 1 
ATOM   2556 C CG2 . VAL B 2 134 ? 13.116 7.412   -2.450  1.00 27.84  ? 119  VAL B CG2 1 
ATOM   2557 N N   . THR B 2 135 ? 16.903 10.009  -0.864  1.00 22.61  ? 120  THR B N   1 
ATOM   2558 C CA  . THR B 2 135 ? 18.225 10.098  -0.259  1.00 21.66  ? 120  THR B CA  1 
ATOM   2559 C C   . THR B 2 135 ? 18.273 10.699  1.134   1.00 23.35  ? 120  THR B C   1 
ATOM   2560 O O   . THR B 2 135 ? 17.333 11.355  1.593   1.00 22.91  ? 120  THR B O   1 
ATOM   2561 C CB  . THR B 2 135 ? 19.157 10.971  -1.106  1.00 23.33  ? 120  THR B CB  1 
ATOM   2562 O OG1 . THR B 2 135 ? 18.696 12.327  -1.043  1.00 24.58  ? 120  THR B OG1 1 
ATOM   2563 C CG2 . THR B 2 135 ? 19.185 10.509  -2.562  1.00 18.59  ? 120  THR B CG2 1 
ATOM   2564 N N   . ASP B 2 136 ? 19.405 10.471  1.789   1.00 23.54  ? 121  ASP B N   1 
ATOM   2565 C CA  . ASP B 2 136 ? 19.676 11.017  3.107   1.00 21.38  ? 121  ASP B CA  1 
ATOM   2566 C C   . ASP B 2 136 ? 18.710 10.621  4.214   1.00 20.49  ? 121  ASP B C   1 
ATOM   2567 O O   . ASP B 2 136 ? 18.381 11.445  5.072   1.00 19.38  ? 121  ASP B O   1 
ATOM   2568 C CB  . ASP B 2 136 ? 19.751 12.545  3.002   1.00 22.69  ? 121  ASP B CB  1 
ATOM   2569 C CG  . ASP B 2 136 ? 20.886 13.011  2.102   1.00 14.66  ? 121  ASP B CG  1 
ATOM   2570 O OD1 . ASP B 2 136 ? 21.795 12.202  1.835   1.00 20.50  ? 121  ASP B OD1 1 
ATOM   2571 O OD2 . ASP B 2 136 ? 20.870 14.179  1.663   1.00 13.33  ? 121  ASP B OD2 1 
ATOM   2572 N N   . PHE B 2 137 ? 18.269 9.367   4.213   1.00 17.07  ? 122  PHE B N   1 
ATOM   2573 C CA  . PHE B 2 137 ? 17.367 8.919   5.256   1.00 17.44  ? 122  PHE B CA  1 
ATOM   2574 C C   . PHE B 2 137 ? 18.017 7.931   6.215   1.00 19.44  ? 122  PHE B C   1 
ATOM   2575 O O   . PHE B 2 137 ? 19.051 7.328   5.908   1.00 15.95  ? 122  PHE B O   1 
ATOM   2576 C CB  . PHE B 2 137 ? 16.075 8.321   4.649   1.00 16.92  ? 122  PHE B CB  1 
ATOM   2577 C CG  . PHE B 2 137 ? 16.283 7.088   3.795   1.00 9.90   ? 122  PHE B CG  1 
ATOM   2578 C CD1 . PHE B 2 137 ? 16.603 7.197   2.443   1.00 15.05  ? 122  PHE B CD1 1 
ATOM   2579 C CD2 . PHE B 2 137 ? 16.108 5.820   4.336   1.00 8.24   ? 122  PHE B CD2 1 
ATOM   2580 C CE1 . PHE B 2 137 ? 16.741 6.056   1.643   1.00 12.71  ? 122  PHE B CE1 1 
ATOM   2581 C CE2 . PHE B 2 137 ? 16.241 4.679   3.558   1.00 3.98   ? 122  PHE B CE2 1 
ATOM   2582 C CZ  . PHE B 2 137 ? 16.558 4.792   2.207   1.00 11.78  ? 122  PHE B CZ  1 
ATOM   2583 N N   . TYR B 2 138 ? 17.422 7.818   7.400   1.00 22.43  ? 123  TYR B N   1 
ATOM   2584 C CA  . TYR B 2 138 ? 17.865 6.888   8.448   1.00 22.73  ? 123  TYR B CA  1 
ATOM   2585 C C   . TYR B 2 138 ? 16.658 6.663   9.359   1.00 20.86  ? 123  TYR B C   1 
ATOM   2586 O O   . TYR B 2 138 ? 15.964 7.611   9.714   1.00 24.95  ? 123  TYR B O   1 
ATOM   2587 C CB  . TYR B 2 138 ? 19.031 7.455   9.260   1.00 19.01  ? 123  TYR B CB  1 
ATOM   2588 C CG  . TYR B 2 138 ? 19.683 6.422   10.169  1.00 18.02  ? 123  TYR B CG  1 
ATOM   2589 C CD1 . TYR B 2 138 ? 19.069 6.009   11.355  1.00 23.13  ? 123  TYR B CD1 1 
ATOM   2590 C CD2 . TYR B 2 138 ? 20.896 5.836   9.828   1.00 12.81  ? 123  TYR B CD2 1 
ATOM   2591 C CE1 . TYR B 2 138 ? 19.650 5.031   12.175  1.00 15.90  ? 123  TYR B CE1 1 
ATOM   2592 C CE2 . TYR B 2 138 ? 21.482 4.864   10.634  1.00 16.74  ? 123  TYR B CE2 1 
ATOM   2593 C CZ  . TYR B 2 138 ? 20.855 4.461   11.807  1.00 15.96  ? 123  TYR B CZ  1 
ATOM   2594 O OH  . TYR B 2 138 ? 21.434 3.473   12.585  1.00 10.21  ? 123  TYR B OH  1 
ATOM   2595 N N   . PRO B 2 139 ? 16.393 5.412   9.756   1.00 22.81  ? 124  PRO B N   1 
ATOM   2596 C CA  . PRO B 2 139 ? 17.092 4.163   9.424   1.00 19.62  ? 124  PRO B CA  1 
ATOM   2597 C C   . PRO B 2 139 ? 16.810 3.626   8.026   1.00 20.63  ? 124  PRO B C   1 
ATOM   2598 O O   . PRO B 2 139 ? 16.164 4.286   7.215   1.00 22.72  ? 124  PRO B O   1 
ATOM   2599 C CB  . PRO B 2 139 ? 16.629 3.199   10.508  1.00 25.07  ? 124  PRO B CB  1 
ATOM   2600 C CG  . PRO B 2 139 ? 15.270 3.698   10.900  1.00 22.81  ? 124  PRO B CG  1 
ATOM   2601 C CD  . PRO B 2 139 ? 15.225 5.183   10.628  1.00 21.09  ? 124  PRO B CD  1 
ATOM   2602 N N   . ALA B 2 140 ? 17.291 2.416   7.757   1.00 20.77  ? 125  ALA B N   1 
ATOM   2603 C CA  . ALA B 2 140 ? 17.113 1.773   6.455   1.00 24.29  ? 125  ALA B CA  1 
ATOM   2604 C C   . ALA B 2 140 ? 15.678 1.305   6.135   1.00 26.92  ? 125  ALA B C   1 
ATOM   2605 O O   . ALA B 2 140 ? 15.394 0.869   5.015   1.00 30.31  ? 125  ALA B O   1 
ATOM   2606 C CB  . ALA B 2 140 ? 18.086 0.586   6.333   1.00 14.30  ? 125  ALA B CB  1 
ATOM   2607 N N   . LYS B 2 141 ? 14.780 1.385   7.113   1.00 29.59  ? 126  LYS B N   1 
ATOM   2608 C CA  . LYS B 2 141 ? 13.392 0.964   6.918   1.00 28.62  ? 126  LYS B CA  1 
ATOM   2609 C C   . LYS B 2 141 ? 12.658 1.929   6.001   1.00 25.73  ? 126  LYS B C   1 
ATOM   2610 O O   . LYS B 2 141 ? 12.638 3.128   6.258   1.00 24.30  ? 126  LYS B O   1 
ATOM   2611 C CB  . LYS B 2 141 ? 12.672 0.900   8.262   1.00 30.15  ? 126  LYS B CB  1 
ATOM   2612 C CG  . LYS B 2 141 ? 11.274 0.319   8.176   1.00 35.55  ? 126  LYS B CG  1 
ATOM   2613 C CD  . LYS B 2 141 ? 10.378 0.820   9.305   1.00 41.49  ? 126  LYS B CD  1 
ATOM   2614 C CE  . LYS B 2 141 ? 9.204  -0.126  9.541   1.00 41.41  ? 126  LYS B CE  1 
ATOM   2615 N NZ  . LYS B 2 141 ? 9.123  -0.618  10.950  1.00 47.42  ? 126  LYS B NZ  1 
ATOM   2616 N N   . ILE B 2 142 ? 12.033 1.421   4.944   1.00 24.06  ? 127  ILE B N   1 
ATOM   2617 C CA  . ILE B 2 142 ? 11.340 2.319   4.038   1.00 22.79  ? 127  ILE B CA  1 
ATOM   2618 C C   . ILE B 2 142 ? 10.409 1.611   3.069   1.00 24.84  ? 127  ILE B C   1 
ATOM   2619 O O   . ILE B 2 142 ? 10.570 0.423   2.784   1.00 25.88  ? 127  ILE B O   1 
ATOM   2620 C CB  . ILE B 2 142 ? 12.371 3.141   3.229   1.00 22.73  ? 127  ILE B CB  1 
ATOM   2621 C CG1 . ILE B 2 142 ? 11.780 4.496   2.860   1.00 15.75  ? 127  ILE B CG1 1 
ATOM   2622 C CG2 . ILE B 2 142 ? 12.843 2.338   2.008   1.00 25.52  ? 127  ILE B CG2 1 
ATOM   2623 C CD1 . ILE B 2 142 ? 12.648 5.305   1.954   1.00 16.78  ? 127  ILE B CD1 1 
ATOM   2624 N N   . LYS B 2 143 ? 9.425  2.347   2.569   1.00 24.82  ? 128  LYS B N   1 
ATOM   2625 C CA  . LYS B 2 143 ? 8.488  1.806   1.596   1.00 25.05  ? 128  LYS B CA  1 
ATOM   2626 C C   . LYS B 2 143 ? 8.210  2.888   0.574   1.00 22.15  ? 128  LYS B C   1 
ATOM   2627 O O   . LYS B 2 143 ? 7.831  4.000   0.925   1.00 21.49  ? 128  LYS B O   1 
ATOM   2628 C CB  . LYS B 2 143 ? 7.176  1.371   2.266   1.00 30.52  ? 128  LYS B CB  1 
ATOM   2629 C CG  . LYS B 2 143 ? 6.090  0.918   1.280   1.00 28.04  ? 128  LYS B CG  1 
ATOM   2630 C CD  . LYS B 2 143 ? 6.426  -0.422  0.624   1.00 32.26  ? 128  LYS B CD  1 
ATOM   2631 C CE  . LYS B 2 143 ? 5.660  -0.621  -0.682  1.00 33.15  ? 128  LYS B CE  1 
ATOM   2632 N NZ  . LYS B 2 143 ? 6.550  -0.481  -1.868  1.00 35.67  ? 128  LYS B NZ  1 
ATOM   2633 N N   . VAL B 2 144 ? 8.433  2.568   -0.694  1.00 22.97  ? 129  VAL B N   1 
ATOM   2634 C CA  . VAL B 2 144 ? 8.184  3.521   -1.766  1.00 20.98  ? 129  VAL B CA  1 
ATOM   2635 C C   . VAL B 2 144 ? 7.159  2.916   -2.721  1.00 19.33  ? 129  VAL B C   1 
ATOM   2636 O O   . VAL B 2 144 ? 7.249  1.743   -3.069  1.00 22.49  ? 129  VAL B O   1 
ATOM   2637 C CB  . VAL B 2 144 ? 9.502  3.878   -2.545  1.00 19.30  ? 129  VAL B CB  1 
ATOM   2638 C CG1 . VAL B 2 144 ? 9.268  5.080   -3.453  1.00 20.01  ? 129  VAL B CG1 1 
ATOM   2639 C CG2 . VAL B 2 144 ? 10.627 4.203   -1.571  1.00 15.28  ? 129  VAL B CG2 1 
ATOM   2640 N N   . ARG B 2 145 ? 6.174  3.712   -3.122  1.00 22.38  ? 130  ARG B N   1 
ATOM   2641 C CA  . ARG B 2 145 ? 5.142  3.254   -4.047  1.00 23.39  ? 130  ARG B CA  1 
ATOM   2642 C C   . ARG B 2 145 ? 5.037  4.248   -5.197  1.00 25.24  ? 130  ARG B C   1 
ATOM   2643 O O   . ARG B 2 145 ? 5.424  5.412   -5.064  1.00 25.00  ? 130  ARG B O   1 
ATOM   2644 C CB  . ARG B 2 145 ? 3.783  3.150   -3.350  1.00 19.63  ? 130  ARG B CB  1 
ATOM   2645 C CG  . ARG B 2 145 ? 3.820  2.484   -1.987  1.00 26.62  ? 130  ARG B CG  1 
ATOM   2646 C CD  . ARG B 2 145 ? 2.425  2.409   -1.357  1.00 28.62  ? 130  ARG B CD  1 
ATOM   2647 N NE  . ARG B 2 145 ? 1.957  1.030   -1.261  1.00 33.31  ? 130  ARG B NE  1 
ATOM   2648 C CZ  . ARG B 2 145 ? 1.786  0.374   -0.118  1.00 37.37  ? 130  ARG B CZ  1 
ATOM   2649 N NH1 . ARG B 2 145 ? 2.048  0.967   1.041   1.00 40.39  ? 130  ARG B NH1 1 
ATOM   2650 N NH2 . ARG B 2 145 ? 1.385  -0.889  -0.138  1.00 38.82  ? 130  ARG B NH2 1 
ATOM   2651 N N   . TRP B 2 146 ? 4.511  3.779   -6.324  1.00 25.76  ? 131  TRP B N   1 
ATOM   2652 C CA  . TRP B 2 146 ? 4.338  4.609   -7.511  1.00 25.08  ? 131  TRP B CA  1 
ATOM   2653 C C   . TRP B 2 146 ? 2.846  4.696   -7.820  1.00 24.63  ? 131  TRP B C   1 
ATOM   2654 O O   . TRP B 2 146 ? 2.128  3.703   -7.700  1.00 22.09  ? 131  TRP B O   1 
ATOM   2655 C CB  . TRP B 2 146 ? 5.065  3.980   -8.704  1.00 27.17  ? 131  TRP B CB  1 
ATOM   2656 C CG  . TRP B 2 146 ? 6.487  4.422   -8.877  1.00 25.03  ? 131  TRP B CG  1 
ATOM   2657 C CD1 . TRP B 2 146 ? 7.617  3.655   -8.729  1.00 21.46  ? 131  TRP B CD1 1 
ATOM   2658 C CD2 . TRP B 2 146 ? 6.935  5.727   -9.263  1.00 23.39  ? 131  TRP B CD2 1 
ATOM   2659 N NE1 . TRP B 2 146 ? 8.738  4.408   -9.001  1.00 22.08  ? 131  TRP B NE1 1 
ATOM   2660 C CE2 . TRP B 2 146 ? 8.348  5.681   -9.331  1.00 24.35  ? 131  TRP B CE2 1 
ATOM   2661 C CE3 . TRP B 2 146 ? 6.281  6.931   -9.559  1.00 17.95  ? 131  TRP B CE3 1 
ATOM   2662 C CZ2 . TRP B 2 146 ? 9.115  6.798   -9.684  1.00 24.07  ? 131  TRP B CZ2 1 
ATOM   2663 C CZ3 . TRP B 2 146 ? 7.041  8.038   -9.911  1.00 15.73  ? 131  TRP B CZ3 1 
ATOM   2664 C CH2 . TRP B 2 146 ? 8.443  7.964   -9.970  1.00 19.75  ? 131  TRP B CH2 1 
ATOM   2665 N N   . PHE B 2 147 ? 2.378  5.881   -8.199  1.00 23.07  ? 132  PHE B N   1 
ATOM   2666 C CA  . PHE B 2 147 ? 0.972  6.051   -8.531  1.00 26.16  ? 132  PHE B CA  1 
ATOM   2667 C C   . PHE B 2 147 ? 0.831  6.676   -9.902  1.00 32.73  ? 132  PHE B C   1 
ATOM   2668 O O   . PHE B 2 147 ? 1.503  7.667   -10.218 1.00 34.56  ? 132  PHE B O   1 
ATOM   2669 C CB  . PHE B 2 147 ? 0.263  6.950   -7.515  1.00 19.31  ? 132  PHE B CB  1 
ATOM   2670 C CG  . PHE B 2 147 ? 0.094  6.325   -6.162  1.00 19.04  ? 132  PHE B CG  1 
ATOM   2671 C CD1 . PHE B 2 147 ? -0.963 5.459   -5.905  1.00 22.40  ? 132  PHE B CD1 1 
ATOM   2672 C CD2 . PHE B 2 147 ? 1.004  6.584   -5.148  1.00 17.61  ? 132  PHE B CD2 1 
ATOM   2673 C CE1 . PHE B 2 147 ? -1.105 4.857   -4.661  1.00 16.94  ? 132  PHE B CE1 1 
ATOM   2674 C CE2 . PHE B 2 147 ? 0.871  5.987   -3.904  1.00 14.36  ? 132  PHE B CE2 1 
ATOM   2675 C CZ  . PHE B 2 147 ? -0.183 5.123   -3.660  1.00 14.81  ? 132  PHE B CZ  1 
ATOM   2676 N N   . ARG B 2 148 ? -0.027 6.079   -10.724 1.00 33.94  ? 133  ARG B N   1 
ATOM   2677 C CA  . ARG B 2 148 ? -0.300 6.608   -12.045 1.00 33.42  ? 133  ARG B CA  1 
ATOM   2678 C C   . ARG B 2 148 ? -1.708 7.172   -11.933 1.00 32.18  ? 133  ARG B C   1 
ATOM   2679 O O   . ARG B 2 148 ? -2.694 6.433   -11.853 1.00 26.00  ? 133  ARG B O   1 
ATOM   2680 C CB  . ARG B 2 148 ? -0.228 5.514   -13.104 1.00 40.53  ? 133  ARG B CB  1 
ATOM   2681 C CG  . ARG B 2 148 ? 0.441  5.980   -14.384 1.00 45.25  ? 133  ARG B CG  1 
ATOM   2682 C CD  . ARG B 2 148 ? 0.134  5.041   -15.538 1.00 53.53  ? 133  ARG B CD  1 
ATOM   2683 N NE  . ARG B 2 148 ? -1.217 4.487   -15.468 1.00 58.11  ? 133  ARG B NE  1 
ATOM   2684 C CZ  . ARG B 2 148 ? -1.714 3.623   -16.350 1.00 64.77  ? 133  ARG B CZ  1 
ATOM   2685 N NH1 . ARG B 2 148 ? -0.969 3.212   -17.366 1.00 65.31  ? 133  ARG B NH1 1 
ATOM   2686 N NH2 . ARG B 2 148 ? -2.954 3.166   -16.220 1.00 67.81  ? 133  ARG B NH2 1 
ATOM   2687 N N   . ASN B 2 149 ? -1.761 8.500   -11.903 1.00 32.65  ? 134  ASN B N   1 
ATOM   2688 C CA  . ASN B 2 149 ? -2.987 9.290   -11.908 1.00 36.05  ? 134  ASN B CA  1 
ATOM   2689 C C   . ASN B 2 149 ? -4.096 8.696   -11.045 1.00 38.14  ? 134  ASN B C   1 
ATOM   2690 O O   . ASN B 2 149 ? -5.183 8.377   -11.536 1.00 44.33  ? 134  ASN B O   1 
ATOM   2691 C CB  . ASN B 2 149 ? -3.538 9.688   -13.295 1.00 40.13  ? 134  ASN B CB  1 
ATOM   2692 C CG  . ASN B 2 149 ? -3.855 8.498   -14.183 1.00 47.20  ? 134  ASN B CG  1 
ATOM   2693 O OD1 . ASN B 2 149 ? -3.871 8.621   -15.410 1.00 43.29  ? 134  ASN B OD1 1 
ATOM   2694 N ND2 . ASN B 2 149 ? -4.114 7.347   -13.574 1.00 55.17  ? 134  ASN B ND2 1 
ATOM   2695 N N   . GLY B 2 150 ? -3.815 8.535   -9.753  1.00 35.51  ? 135  GLY B N   1 
ATOM   2696 C CA  . GLY B 2 150 ? -4.824 8.024   -8.837  1.00 35.58  ? 135  GLY B CA  1 
ATOM   2697 C C   . GLY B 2 150 ? -4.683 6.611   -8.309  1.00 36.03  ? 135  GLY B C   1 
ATOM   2698 O O   . GLY B 2 150 ? -5.054 6.338   -7.164  1.00 32.02  ? 135  GLY B O   1 
ATOM   2699 N N   . GLN B 2 151 ? -4.169 5.709   -9.136  1.00 36.34  ? 136  GLN B N   1 
ATOM   2700 C CA  . GLN B 2 151 ? -3.999 4.324   -8.720  1.00 37.74  ? 136  GLN B CA  1 
ATOM   2701 C C   . GLN B 2 151 ? -2.526 3.964   -8.647  1.00 36.80  ? 136  GLN B C   1 
ATOM   2702 O O   . GLN B 2 151 ? -1.686 4.619   -9.264  1.00 38.47  ? 136  GLN B O   1 
ATOM   2703 C CB  . GLN B 2 151 ? -4.722 3.382   -9.683  1.00 38.59  ? 136  GLN B CB  1 
ATOM   2704 C CG  . GLN B 2 151 ? -6.240 3.421   -9.548  1.00 40.82  ? 136  GLN B CG  1 
ATOM   2705 C CD  . GLN B 2 151 ? -6.911 3.968   -10.790 1.00 43.92  ? 136  GLN B CD  1 
ATOM   2706 O OE1 . GLN B 2 151 ? -6.768 5.148   -11.117 1.00 49.80  ? 136  GLN B OE1 1 
ATOM   2707 N NE2 . GLN B 2 151 ? -7.642 3.114   -11.493 1.00 42.44  ? 136  GLN B NE2 1 
ATOM   2708 N N   . GLU B 2 152 ? -2.222 2.920   -7.884  1.00 34.70  ? 137  GLU B N   1 
ATOM   2709 C CA  . GLU B 2 152 ? -0.851 2.477   -7.696  1.00 32.55  ? 137  GLU B CA  1 
ATOM   2710 C C   . GLU B 2 152 ? -0.330 1.565   -8.793  1.00 34.57  ? 137  GLU B C   1 
ATOM   2711 O O   . GLU B 2 152 ? -1.022 0.654   -9.243  1.00 36.47  ? 137  GLU B O   1 
ATOM   2712 C CB  . GLU B 2 152 ? -0.718 1.767   -6.351  1.00 29.56  ? 137  GLU B CB  1 
ATOM   2713 C CG  . GLU B 2 152 ? 0.657  1.198   -6.094  1.00 29.29  ? 137  GLU B CG  1 
ATOM   2714 C CD  . GLU B 2 152 ? 0.756  0.522   -4.756  1.00 26.23  ? 137  GLU B CD  1 
ATOM   2715 O OE1 . GLU B 2 152 ? -0.260 -0.038  -4.294  1.00 31.08  ? 137  GLU B OE1 1 
ATOM   2716 O OE2 . GLU B 2 152 ? 1.852  0.551   -4.166  1.00 33.42  ? 137  GLU B OE2 1 
ATOM   2717 N N   . GLU B 2 153 ? 0.908  1.816   -9.201  1.00 37.22  ? 138  GLU B N   1 
ATOM   2718 C CA  . GLU B 2 153 ? 1.579  1.033   -10.227 1.00 39.71  ? 138  GLU B CA  1 
ATOM   2719 C C   . GLU B 2 153 ? 2.385  -0.072  -9.543  1.00 41.03  ? 138  GLU B C   1 
ATOM   2720 O O   . GLU B 2 153 ? 3.391  0.206   -8.891  1.00 38.75  ? 138  GLU B O   1 
ATOM   2721 C CB  . GLU B 2 153 ? 2.525  1.934   -11.023 1.00 45.18  ? 138  GLU B CB  1 
ATOM   2722 C CG  . GLU B 2 153 ? 2.389  1.896   -12.553 1.00 54.80  ? 138  GLU B CG  1 
ATOM   2723 C CD  . GLU B 2 153 ? 1.216  1.072   -13.054 1.00 56.17  ? 138  GLU B CD  1 
ATOM   2724 O OE1 . GLU B 2 153 ? 1.230  -0.168  -12.870 1.00 55.02  ? 138  GLU B OE1 1 
ATOM   2725 O OE2 . GLU B 2 153 ? 0.288  1.671   -13.642 1.00 55.16  ? 138  GLU B OE2 1 
ATOM   2726 N N   . THR B 2 154 ? 1.938  -1.316  -9.685  1.00 42.26  ? 139  THR B N   1 
ATOM   2727 C CA  . THR B 2 154 ? 2.627  -2.457  -9.087  1.00 44.77  ? 139  THR B CA  1 
ATOM   2728 C C   . THR B 2 154 ? 3.607  -3.059  -10.100 1.00 46.02  ? 139  THR B C   1 
ATOM   2729 O O   . THR B 2 154 ? 4.763  -3.334  -9.782  1.00 47.63  ? 139  THR B O   1 
ATOM   2730 C CB  . THR B 2 154 ? 1.621  -3.546  -8.644  1.00 47.32  ? 139  THR B CB  1 
ATOM   2731 O OG1 . THR B 2 154 ? 0.608  -2.956  -7.822  1.00 51.44  ? 139  THR B OG1 1 
ATOM   2732 C CG2 . THR B 2 154 ? 2.317  -4.633  -7.849  1.00 50.09  ? 139  THR B CG2 1 
ATOM   2733 N N   . VAL B 2 155 ? 3.135  -3.257  -11.323 1.00 47.51  ? 140  VAL B N   1 
ATOM   2734 C CA  . VAL B 2 155 ? 3.964  -3.812  -12.386 1.00 49.10  ? 140  VAL B CA  1 
ATOM   2735 C C   . VAL B 2 155 ? 4.773  -2.696  -13.042 1.00 49.64  ? 140  VAL B C   1 
ATOM   2736 O O   . VAL B 2 155 ? 4.218  -1.686  -13.477 1.00 52.83  ? 140  VAL B O   1 
ATOM   2737 C CB  . VAL B 2 155 ? 3.092  -4.498  -13.472 1.00 48.54  ? 140  VAL B CB  1 
ATOM   2738 C CG1 . VAL B 2 155 ? 3.864  -4.605  -14.782 1.00 46.04  ? 140  VAL B CG1 1 
ATOM   2739 C CG2 . VAL B 2 155 ? 2.658  -5.878  -12.995 1.00 48.06  ? 140  VAL B CG2 1 
ATOM   2740 N N   . GLY B 2 156 ? 6.085  -2.878  -13.108 1.00 47.55  ? 141  GLY B N   1 
ATOM   2741 C CA  . GLY B 2 156 ? 6.922  -1.869  -13.727 1.00 48.39  ? 141  GLY B CA  1 
ATOM   2742 C C   . GLY B 2 156 ? 7.668  -1.019  -12.723 1.00 46.33  ? 141  GLY B C   1 
ATOM   2743 O O   . GLY B 2 156 ? 8.041  0.112   -13.013 1.00 47.89  ? 141  GLY B O   1 
ATOM   2744 N N   . VAL B 2 157 ? 7.883  -1.568  -11.535 1.00 45.16  ? 142  VAL B N   1 
ATOM   2745 C CA  . VAL B 2 157 ? 8.597  -0.861  -10.479 1.00 41.26  ? 142  VAL B CA  1 
ATOM   2746 C C   . VAL B 2 157 ? 9.924  -1.566  -10.235 1.00 40.34  ? 142  VAL B C   1 
ATOM   2747 O O   . VAL B 2 157 ? 9.957  -2.772  -10.004 1.00 42.72  ? 142  VAL B O   1 
ATOM   2748 C CB  . VAL B 2 157 ? 7.781  -0.849  -9.163  1.00 38.41  ? 142  VAL B CB  1 
ATOM   2749 C CG1 . VAL B 2 157 ? 6.524  -0.006  -9.337  1.00 33.12  ? 142  VAL B CG1 1 
ATOM   2750 C CG2 . VAL B 2 157 ? 7.407  -2.268  -8.767  1.00 36.27  ? 142  VAL B CG2 1 
ATOM   2751 N N   . SER B 2 158 ? 11.018 -0.822  -10.302 1.00 39.91  ? 143  SER B N   1 
ATOM   2752 C CA  . SER B 2 158 ? 12.328 -1.417  -10.083 1.00 43.81  ? 143  SER B CA  1 
ATOM   2753 C C   . SER B 2 158 ? 13.146 -0.611  -9.084  1.00 45.70  ? 143  SER B C   1 
ATOM   2754 O O   . SER B 2 158 ? 13.496 0.538   -9.343  1.00 49.67  ? 143  SER B O   1 
ATOM   2755 C CB  . SER B 2 158 ? 13.092 -1.522  -11.402 1.00 36.70  ? 143  SER B CB  1 
ATOM   2756 O OG  . SER B 2 158 ? 14.120 -2.494  -11.308 1.00 43.91  ? 143  SER B OG  1 
ATOM   2757 N N   . SER B 2 159 ? 13.451 -1.219  -7.943  1.00 45.36  ? 144  SER B N   1 
ATOM   2758 C CA  . SER B 2 159 ? 14.229 -0.545  -6.917  1.00 45.53  ? 144  SER B CA  1 
ATOM   2759 C C   . SER B 2 159 ? 15.694 -0.976  -6.948  1.00 43.94  ? 144  SER B C   1 
ATOM   2760 O O   . SER B 2 159 ? 15.998 -2.164  -7.069  1.00 42.63  ? 144  SER B O   1 
ATOM   2761 C CB  . SER B 2 159 ? 13.634 -0.836  -5.537  1.00 45.62  ? 144  SER B CB  1 
ATOM   2762 O OG  . SER B 2 159 ? 12.219 -0.750  -5.569  1.00 49.49  ? 144  SER B OG  1 
ATOM   2763 N N   . THR B 2 160 ? 16.598 -0.004  -6.860  1.00 42.29  ? 145  THR B N   1 
ATOM   2764 C CA  . THR B 2 160 ? 18.024 -0.300  -6.839  1.00 39.86  ? 145  THR B CA  1 
ATOM   2765 C C   . THR B 2 160 ? 18.320 -0.731  -5.413  1.00 39.03  ? 145  THR B C   1 
ATOM   2766 O O   . THR B 2 160 ? 17.504 -0.510  -4.523  1.00 41.47  ? 145  THR B O   1 
ATOM   2767 C CB  . THR B 2 160 ? 18.875 0.941   -7.158  1.00 37.27  ? 145  THR B CB  1 
ATOM   2768 O OG1 . THR B 2 160 ? 18.684 1.923   -6.132  1.00 43.38  ? 145  THR B OG1 1 
ATOM   2769 C CG2 . THR B 2 160 ? 18.483 1.527   -8.498  1.00 36.88  ? 145  THR B CG2 1 
ATOM   2770 N N   . GLN B 2 161 ? 19.476 -1.346  -5.194  1.00 41.95  ? 146  GLN B N   1 
ATOM   2771 C CA  . GLN B 2 161 ? 19.857 -1.794  -3.858  1.00 43.38  ? 146  GLN B CA  1 
ATOM   2772 C C   . GLN B 2 161 ? 20.007 -0.593  -2.938  1.00 40.52  ? 146  GLN B C   1 
ATOM   2773 O O   . GLN B 2 161 ? 20.213 0.529   -3.399  1.00 40.24  ? 146  GLN B O   1 
ATOM   2774 C CB  . GLN B 2 161 ? 21.187 -2.558  -3.902  1.00 50.94  ? 146  GLN B CB  1 
ATOM   2775 C CG  . GLN B 2 161 ? 21.065 -4.057  -4.167  1.00 58.41  ? 146  GLN B CG  1 
ATOM   2776 C CD  . GLN B 2 161 ? 19.740 -4.645  -3.690  1.00 64.29  ? 146  GLN B CD  1 
ATOM   2777 O OE1 . GLN B 2 161 ? 19.635 -5.138  -2.561  1.00 67.88  ? 146  GLN B OE1 1 
ATOM   2778 N NE2 . GLN B 2 161 ? 18.723 -4.601  -4.552  1.00 61.33  ? 146  GLN B NE2 1 
ATOM   2779 N N   . LEU B 2 162 ? 19.898 -0.829  -1.637  1.00 35.34  ? 147  LEU B N   1 
ATOM   2780 C CA  . LEU B 2 162 ? 20.046 0.244   -0.671  1.00 27.55  ? 147  LEU B CA  1 
ATOM   2781 C C   . LEU B 2 162 ? 21.517 0.624   -0.629  1.00 25.59  ? 147  LEU B C   1 
ATOM   2782 O O   . LEU B 2 162 ? 22.385 -0.230  -0.463  1.00 22.74  ? 147  LEU B O   1 
ATOM   2783 C CB  . LEU B 2 162 ? 19.597 -0.218  0.722   1.00 28.84  ? 147  LEU B CB  1 
ATOM   2784 C CG  . LEU B 2 162 ? 18.555 0.607   1.488   1.00 25.22  ? 147  LEU B CG  1 
ATOM   2785 C CD1 . LEU B 2 162 ? 18.925 0.627   2.956   1.00 27.67  ? 147  LEU B CD1 1 
ATOM   2786 C CD2 . LEU B 2 162 ? 18.486 2.026   0.948   1.00 31.30  ? 147  LEU B CD2 1 
ATOM   2787 N N   . ILE B 2 163 ? 21.793 1.909   -0.794  1.00 24.19  ? 148  ILE B N   1 
ATOM   2788 C CA  . ILE B 2 163 ? 23.158 2.394   -0.755  1.00 20.10  ? 148  ILE B CA  1 
ATOM   2789 C C   . ILE B 2 163 ? 23.392 3.006   0.620   1.00 21.76  ? 148  ILE B C   1 
ATOM   2790 O O   . ILE B 2 163 ? 22.513 3.676   1.163   1.00 23.75  ? 148  ILE B O   1 
ATOM   2791 C CB  . ILE B 2 163 ? 23.400 3.464   -1.844  1.00 17.39  ? 148  ILE B CB  1 
ATOM   2792 C CG1 . ILE B 2 163 ? 23.478 2.803   -3.216  1.00 19.04  ? 148  ILE B CG1 1 
ATOM   2793 C CG2 . ILE B 2 163 ? 24.701 4.181   -1.593  1.00 14.16  ? 148  ILE B CG2 1 
ATOM   2794 C CD1 . ILE B 2 163 ? 22.135 2.504   -3.807  1.00 27.11  ? 148  ILE B CD1 1 
ATOM   2795 N N   . ARG B 2 164 ? 24.568 2.758   1.191   1.00 21.68  ? 149  ARG B N   1 
ATOM   2796 C CA  . ARG B 2 164 ? 24.913 3.306   2.497   1.00 18.26  ? 149  ARG B CA  1 
ATOM   2797 C C   . ARG B 2 164 ? 25.957 4.385   2.269   1.00 16.00  ? 149  ARG B C   1 
ATOM   2798 O O   . ARG B 2 164 ? 27.071 4.085   1.872   1.00 16.00  ? 149  ARG B O   1 
ATOM   2799 C CB  . ARG B 2 164 ? 25.480 2.217   3.405   1.00 12.98  ? 149  ARG B CB  1 
ATOM   2800 C CG  . ARG B 2 164 ? 26.006 2.742   4.722   1.00 13.55  ? 149  ARG B CG  1 
ATOM   2801 C CD  . ARG B 2 164 ? 26.433 1.611   5.625   1.00 19.68  ? 149  ARG B CD  1 
ATOM   2802 N NE  . ARG B 2 164 ? 25.325 1.120   6.431   1.00 20.98  ? 149  ARG B NE  1 
ATOM   2803 C CZ  . ARG B 2 164 ? 25.034 -0.163  6.568   1.00 17.45  ? 149  ARG B CZ  1 
ATOM   2804 N NH1 . ARG B 2 164 ? 25.791 -1.066  5.963   1.00 28.52  ? 149  ARG B NH1 1 
ATOM   2805 N NH2 . ARG B 2 164 ? 24.007 -0.540  7.311   1.00 18.35  ? 149  ARG B NH2 1 
ATOM   2806 N N   . ASN B 2 165 ? 25.584 5.639   2.511   1.00 14.08  ? 150  ASN B N   1 
ATOM   2807 C CA  . ASN B 2 165 ? 26.484 6.766   2.311   1.00 12.68  ? 150  ASN B CA  1 
ATOM   2808 C C   . ASN B 2 165 ? 27.719 6.720   3.225   1.00 19.12  ? 150  ASN B C   1 
ATOM   2809 O O   . ASN B 2 165 ? 28.796 7.197   2.857   1.00 20.61  ? 150  ASN B O   1 
ATOM   2810 C CB  . ASN B 2 165 ? 25.718 8.073   2.524   1.00 7.16   ? 150  ASN B CB  1 
ATOM   2811 C CG  . ASN B 2 165 ? 24.609 8.282   1.497   1.00 20.95  ? 150  ASN B CG  1 
ATOM   2812 O OD1 . ASN B 2 165 ? 24.752 7.926   0.324   1.00 22.41  ? 150  ASN B OD1 1 
ATOM   2813 N ND2 . ASN B 2 165 ? 23.498 8.869   1.935   1.00 27.72  ? 150  ASN B ND2 1 
ATOM   2814 N N   . GLY B 2 166 ? 27.564 6.144   4.415   1.00 20.31  ? 151  GLY B N   1 
ATOM   2815 C CA  . GLY B 2 166 ? 28.681 6.057   5.331   1.00 16.27  ? 151  GLY B CA  1 
ATOM   2816 C C   . GLY B 2 166 ? 28.612 7.131   6.392   1.00 20.42  ? 151  GLY B C   1 
ATOM   2817 O O   . GLY B 2 166 ? 29.338 7.075   7.387   1.00 21.27  ? 151  GLY B O   1 
ATOM   2818 N N   . ASP B 2 167 ? 27.742 8.115   6.178   1.00 21.08  ? 152  ASP B N   1 
ATOM   2819 C CA  . ASP B 2 167 ? 27.571 9.213   7.130   1.00 20.39  ? 152  ASP B CA  1 
ATOM   2820 C C   . ASP B 2 167 ? 26.312 8.990   7.970   1.00 22.59  ? 152  ASP B C   1 
ATOM   2821 O O   . ASP B 2 167 ? 25.689 9.941   8.451   1.00 26.13  ? 152  ASP B O   1 
ATOM   2822 C CB  . ASP B 2 167 ? 27.476 10.546  6.386   1.00 19.08  ? 152  ASP B CB  1 
ATOM   2823 C CG  . ASP B 2 167 ? 26.411 10.540  5.310   1.00 20.60  ? 152  ASP B CG  1 
ATOM   2824 O OD1 . ASP B 2 167 ? 25.741 9.497   5.162   1.00 21.67  ? 152  ASP B OD1 1 
ATOM   2825 O OD2 . ASP B 2 167 ? 26.242 11.573  4.614   1.00 25.44  ? 152  ASP B OD2 1 
ATOM   2826 N N   . TRP B 2 168 ? 25.958 7.719   8.146   1.00 21.51  ? 153  TRP B N   1 
ATOM   2827 C CA  . TRP B 2 168 ? 24.775 7.322   8.893   1.00 21.08  ? 153  TRP B CA  1 
ATOM   2828 C C   . TRP B 2 168 ? 23.511 7.708   8.146   1.00 22.30  ? 153  TRP B C   1 
ATOM   2829 O O   . TRP B 2 168 ? 22.552 8.186   8.744   1.00 26.79  ? 153  TRP B O   1 
ATOM   2830 C CB  . TRP B 2 168 ? 24.769 7.956   10.286  1.00 19.66  ? 153  TRP B CB  1 
ATOM   2831 C CG  . TRP B 2 168 ? 25.691 7.277   11.252  1.00 18.48  ? 153  TRP B CG  1 
ATOM   2832 C CD1 . TRP B 2 168 ? 27.038 7.448   11.356  1.00 11.53  ? 153  TRP B CD1 1 
ATOM   2833 C CD2 . TRP B 2 168 ? 25.334 6.300   12.234  1.00 15.55  ? 153  TRP B CD2 1 
ATOM   2834 N NE1 . TRP B 2 168 ? 27.543 6.640   12.340  1.00 13.11  ? 153  TRP B NE1 1 
ATOM   2835 C CE2 . TRP B 2 168 ? 26.519 5.922   12.894  1.00 15.24  ? 153  TRP B CE2 1 
ATOM   2836 C CE3 . TRP B 2 168 ? 24.128 5.707   12.618  1.00 16.94  ? 153  TRP B CE3 1 
ATOM   2837 C CZ2 . TRP B 2 168 ? 26.530 4.974   13.920  1.00 14.46  ? 153  TRP B CZ2 1 
ATOM   2838 C CZ3 . TRP B 2 168 ? 24.144 4.766   13.637  1.00 14.17  ? 153  TRP B CZ3 1 
ATOM   2839 C CH2 . TRP B 2 168 ? 25.333 4.410   14.274  1.00 10.55  ? 153  TRP B CH2 1 
ATOM   2840 N N   . THR B 2 169 ? 23.521 7.528   6.828   1.00 24.30  ? 154  THR B N   1 
ATOM   2841 C CA  . THR B 2 169 ? 22.345 7.817   6.000   1.00 22.87  ? 154  THR B CA  1 
ATOM   2842 C C   . THR B 2 169 ? 22.320 6.909   4.778   1.00 19.41  ? 154  THR B C   1 
ATOM   2843 O O   . THR B 2 169 ? 23.357 6.446   4.304   1.00 15.75  ? 154  THR B O   1 
ATOM   2844 C CB  . THR B 2 169 ? 22.274 9.301   5.503   1.00 23.18  ? 154  THR B CB  1 
ATOM   2845 O OG1 . THR B 2 169 ? 23.332 9.556   4.573   1.00 24.70  ? 154  THR B OG1 1 
ATOM   2846 C CG2 . THR B 2 169 ? 22.355 10.276  6.671   1.00 14.15  ? 154  THR B CG2 1 
ATOM   2847 N N   . PHE B 2 170 ? 21.121 6.645   4.281   1.00 20.05  ? 155  PHE B N   1 
ATOM   2848 C CA  . PHE B 2 170 ? 20.963 5.794   3.115   1.00 21.92  ? 155  PHE B CA  1 
ATOM   2849 C C   . PHE B 2 170 ? 20.346 6.562   1.957   1.00 21.17  ? 155  PHE B C   1 
ATOM   2850 O O   . PHE B 2 170 ? 20.002 7.736   2.068   1.00 22.51  ? 155  PHE B O   1 
ATOM   2851 C CB  . PHE B 2 170 ? 20.052 4.600   3.434   1.00 22.88  ? 155  PHE B CB  1 
ATOM   2852 C CG  . PHE B 2 170 ? 20.605 3.663   4.462   1.00 21.85  ? 155  PHE B CG  1 
ATOM   2853 C CD1 . PHE B 2 170 ? 21.432 2.609   4.086   1.00 24.26  ? 155  PHE B CD1 1 
ATOM   2854 C CD2 . PHE B 2 170 ? 20.286 3.822   5.807   1.00 25.81  ? 155  PHE B CD2 1 
ATOM   2855 C CE1 . PHE B 2 170 ? 21.934 1.722   5.035   1.00 24.05  ? 155  PHE B CE1 1 
ATOM   2856 C CE2 . PHE B 2 170 ? 20.781 2.944   6.768   1.00 23.63  ? 155  PHE B CE2 1 
ATOM   2857 C CZ  . PHE B 2 170 ? 21.605 1.893   6.383   1.00 26.68  ? 155  PHE B CZ  1 
ATOM   2858 N N   . GLN B 2 171 ? 20.203 5.860   0.845   1.00 23.99  ? 156  GLN B N   1 
ATOM   2859 C CA  . GLN B 2 171 ? 19.593 6.393   -0.353  1.00 28.59  ? 156  GLN B CA  1 
ATOM   2860 C C   . GLN B 2 171 ? 19.308 5.180   -1.223  1.00 32.82  ? 156  GLN B C   1 
ATOM   2861 O O   . GLN B 2 171 ? 19.952 4.134   -1.072  1.00 33.30  ? 156  GLN B O   1 
ATOM   2862 C CB  . GLN B 2 171 ? 20.535 7.354   -1.074  1.00 24.86  ? 156  GLN B CB  1 
ATOM   2863 C CG  . GLN B 2 171 ? 21.898 6.794   -1.358  1.00 25.69  ? 156  GLN B CG  1 
ATOM   2864 C CD  . GLN B 2 171 ? 22.652 7.659   -2.325  1.00 29.43  ? 156  GLN B CD  1 
ATOM   2865 O OE1 . GLN B 2 171 ? 22.051 8.318   -3.164  1.00 31.99  ? 156  GLN B OE1 1 
ATOM   2866 N NE2 . GLN B 2 171 ? 23.977 7.671   -2.216  1.00 36.63  ? 156  GLN B NE2 1 
ATOM   2867 N N   . VAL B 2 172 ? 18.333 5.319   -2.117  1.00 31.84  ? 157  VAL B N   1 
ATOM   2868 C CA  . VAL B 2 172 ? 17.950 4.238   -3.012  1.00 27.34  ? 157  VAL B CA  1 
ATOM   2869 C C   . VAL B 2 172 ? 17.250 4.867   -4.201  1.00 27.13  ? 157  VAL B C   1 
ATOM   2870 O O   . VAL B 2 172 ? 16.791 6.007   -4.123  1.00 25.16  ? 157  VAL B O   1 
ATOM   2871 C CB  . VAL B 2 172 ? 16.994 3.238   -2.299  1.00 26.22  ? 157  VAL B CB  1 
ATOM   2872 C CG1 . VAL B 2 172 ? 15.630 3.865   -2.100  1.00 21.04  ? 157  VAL B CG1 1 
ATOM   2873 C CG2 . VAL B 2 172 ? 16.887 1.950   -3.097  1.00 22.40  ? 157  VAL B CG2 1 
ATOM   2874 N N   . LEU B 2 173 ? 17.191 4.132   -5.305  1.00 32.34  ? 158  LEU B N   1 
ATOM   2875 C CA  . LEU B 2 173 ? 16.535 4.615   -6.520  1.00 29.74  ? 158  LEU B CA  1 
ATOM   2876 C C   . LEU B 2 173 ? 15.406 3.663   -6.899  1.00 26.19  ? 158  LEU B C   1 
ATOM   2877 O O   . LEU B 2 173 ? 15.642 2.480   -7.147  1.00 20.01  ? 158  LEU B O   1 
ATOM   2878 C CB  . LEU B 2 173 ? 17.542 4.706   -7.678  1.00 30.81  ? 158  LEU B CB  1 
ATOM   2879 C CG  . LEU B 2 173 ? 18.618 5.801   -7.644  1.00 30.63  ? 158  LEU B CG  1 
ATOM   2880 C CD1 . LEU B 2 173 ? 19.282 5.907   -9.008  1.00 29.52  ? 158  LEU B CD1 1 
ATOM   2881 C CD2 . LEU B 2 173 ? 18.006 7.136   -7.259  1.00 31.01  ? 158  LEU B CD2 1 
ATOM   2882 N N   . VAL B 2 174 ? 14.182 4.182   -6.918  1.00 27.27  ? 159  VAL B N   1 
ATOM   2883 C CA  . VAL B 2 174 ? 13.016 3.383   -7.287  1.00 28.97  ? 159  VAL B CA  1 
ATOM   2884 C C   . VAL B 2 174 ? 12.484 3.893   -8.623  1.00 30.20  ? 159  VAL B C   1 
ATOM   2885 O O   . VAL B 2 174 ? 12.021 5.034   -8.748  1.00 29.16  ? 159  VAL B O   1 
ATOM   2886 C CB  . VAL B 2 174 ? 11.897 3.454   -6.219  1.00 26.40  ? 159  VAL B CB  1 
ATOM   2887 C CG1 . VAL B 2 174 ? 11.033 2.200   -6.293  1.00 25.92  ? 159  VAL B CG1 1 
ATOM   2888 C CG2 . VAL B 2 174 ? 12.505 3.587   -4.831  1.00 19.43  ? 159  VAL B CG2 1 
ATOM   2889 N N   . MET B 2 175 ? 12.566 3.030   -9.625  1.00 33.65  ? 160  MET B N   1 
ATOM   2890 C CA  . MET B 2 175 ? 12.138 3.372   -10.966 1.00 35.74  ? 160  MET B CA  1 
ATOM   2891 C C   . MET B 2 175 ? 10.782 2.792   -11.318 1.00 36.07  ? 160  MET B C   1 
ATOM   2892 O O   . MET B 2 175 ? 10.336 1.800   -10.736 1.00 36.05  ? 160  MET B O   1 
ATOM   2893 C CB  . MET B 2 175 ? 13.179 2.878   -11.978 1.00 37.99  ? 160  MET B CB  1 
ATOM   2894 C CG  . MET B 2 175 ? 14.554 3.524   -11.834 1.00 43.56  ? 160  MET B CG  1 
ATOM   2895 S SD  . MET B 2 175 ? 15.658 2.695   -10.662 1.00 49.36  ? 160  MET B SD  1 
ATOM   2896 C CE  . MET B 2 175 ? 15.674 1.014   -11.311 1.00 50.26  ? 160  MET B CE  1 
ATOM   2897 N N   . LEU B 2 176 ? 10.132 3.431   -12.281 1.00 37.02  ? 161  LEU B N   1 
ATOM   2898 C CA  . LEU B 2 176 ? 8.841  2.985   -12.767 1.00 40.05  ? 161  LEU B CA  1 
ATOM   2899 C C   . LEU B 2 176 ? 8.929  2.908   -14.287 1.00 48.00  ? 161  LEU B C   1 
ATOM   2900 O O   . LEU B 2 176 ? 9.367  3.859   -14.948 1.00 48.66  ? 161  LEU B O   1 
ATOM   2901 C CB  . LEU B 2 176 ? 7.732  3.961   -12.362 1.00 28.58  ? 161  LEU B CB  1 
ATOM   2902 C CG  . LEU B 2 176 ? 6.478  3.917   -13.237 1.00 18.18  ? 161  LEU B CG  1 
ATOM   2903 C CD1 . LEU B 2 176 ? 5.811  2.551   -13.117 1.00 17.46  ? 161  LEU B CD1 1 
ATOM   2904 C CD2 . LEU B 2 176 ? 5.540  5.022   -12.830 1.00 10.69  ? 161  LEU B CD2 1 
ATOM   2905 N N   . GLU B 2 177 ? 8.527  1.763   -14.829 1.00 53.10  ? 162  GLU B N   1 
ATOM   2906 C CA  . GLU B 2 177 ? 8.535  1.537   -16.267 1.00 58.75  ? 162  GLU B CA  1 
ATOM   2907 C C   . GLU B 2 177 ? 7.373  2.315   -16.888 1.00 56.52  ? 162  GLU B C   1 
ATOM   2908 O O   . GLU B 2 177 ? 6.299  2.409   -16.288 1.00 55.75  ? 162  GLU B O   1 
ATOM   2909 C CB  . GLU B 2 177 ? 8.380  0.041   -16.539 1.00 68.60  ? 162  GLU B CB  1 
ATOM   2910 C CG  . GLU B 2 177 ? 8.232  -0.311  -18.002 1.00 79.61  ? 162  GLU B CG  1 
ATOM   2911 C CD  . GLU B 2 177 ? 9.171  0.482   -18.879 1.00 84.01  ? 162  GLU B CD  1 
ATOM   2912 O OE1 . GLU B 2 177 ? 10.402 0.390   -18.665 1.00 85.15  ? 162  GLU B OE1 1 
ATOM   2913 O OE2 . GLU B 2 177 ? 8.671  1.192   -19.778 1.00 88.03  ? 162  GLU B OE2 1 
ATOM   2914 N N   . MET B 2 178 ? 7.571  2.863   -18.086 1.00 54.96  ? 163  MET B N   1 
ATOM   2915 C CA  . MET B 2 178 ? 6.506  3.641   -18.714 1.00 56.59  ? 163  MET B CA  1 
ATOM   2916 C C   . MET B 2 178 ? 6.601  4.029   -20.199 1.00 56.36  ? 163  MET B C   1 
ATOM   2917 O O   . MET B 2 178 ? 7.543  3.716   -20.915 1.00 56.62  ? 163  MET B O   1 
ATOM   2918 C CB  . MET B 2 178 ? 6.285  4.924   -17.908 1.00 53.75  ? 163  MET B CB  1 
ATOM   2919 C CG  . MET B 2 178 ? 6.799  6.164   -18.612 1.00 49.41  ? 163  MET B CG  1 
ATOM   2920 S SD  . MET B 2 178 ? 7.345  7.435   -17.509 1.00 54.15  ? 163  MET B SD  1 
ATOM   2921 C CE  . MET B 2 178 ? 6.413  8.824   -18.104 1.00 52.96  ? 163  MET B CE  1 
ATOM   2922 N N   . THR B 2 179 ? 5.559  4.721   -20.631 1.00 56.84  ? 164  THR B N   1 
ATOM   2923 C CA  . THR B 2 179 ? 5.407  5.245   -21.975 1.00 56.30  ? 164  THR B CA  1 
ATOM   2924 C C   . THR B 2 179 ? 4.357  6.259   -21.588 1.00 55.76  ? 164  THR B C   1 
ATOM   2925 O O   . THR B 2 179 ? 3.171  5.949   -21.534 1.00 54.33  ? 164  THR B O   1 
ATOM   2926 C CB  . THR B 2 179 ? 4.832  4.191   -22.912 1.00 59.04  ? 164  THR B CB  1 
ATOM   2927 N N   . PRO B 2 180 ? 4.795  7.485   -21.270 1.00 57.08  ? 165  PRO B N   1 
ATOM   2928 C CA  . PRO B 2 180 ? 3.935  8.597   -20.851 1.00 58.28  ? 165  PRO B CA  1 
ATOM   2929 C C   . PRO B 2 180 ? 2.698  8.924   -21.667 1.00 59.60  ? 165  PRO B C   1 
ATOM   2930 O O   . PRO B 2 180 ? 2.473  8.387   -22.749 1.00 60.17  ? 165  PRO B O   1 
ATOM   2931 C CB  . PRO B 2 180 ? 4.883  9.799   -20.769 1.00 57.88  ? 165  PRO B CB  1 
ATOM   2932 C CG  . PRO B 2 180 ? 6.153  9.369   -21.416 1.00 55.96  ? 165  PRO B CG  1 
ATOM   2933 C CD  . PRO B 2 180 ? 6.215  7.878   -21.329 1.00 56.99  ? 165  PRO B CD  1 
ATOM   2934 N N   . HIS B 2 181 ? 1.900  9.829   -21.112 1.00 60.49  ? 166  HIS B N   1 
ATOM   2935 C CA  . HIS B 2 181 ? 0.668  10.288  -21.732 1.00 59.44  ? 166  HIS B CA  1 
ATOM   2936 C C   . HIS B 2 181 ? 0.321  11.652  -21.143 1.00 59.97  ? 166  HIS B C   1 
ATOM   2937 O O   . HIS B 2 181 ? 0.530  11.888  -19.953 1.00 61.78  ? 166  HIS B O   1 
ATOM   2938 C CB  . HIS B 2 181 ? -0.449 9.302   -21.460 1.00 54.63  ? 166  HIS B CB  1 
ATOM   2939 N N   . GLN B 2 182 ? -0.204 12.548  -21.974 1.00 60.49  ? 167  GLN B N   1 
ATOM   2940 C CA  . GLN B 2 182 ? -0.571 13.885  -21.520 1.00 59.02  ? 167  GLN B CA  1 
ATOM   2941 C C   . GLN B 2 182 ? -1.872 13.838  -20.743 1.00 57.65  ? 167  GLN B C   1 
ATOM   2942 O O   . GLN B 2 182 ? -2.900 13.410  -21.259 1.00 55.97  ? 167  GLN B O   1 
ATOM   2943 C CB  . GLN B 2 182 ? -0.725 14.836  -22.708 1.00 62.62  ? 167  GLN B CB  1 
ATOM   2944 C CG  . GLN B 2 182 ? -0.117 16.225  -22.498 1.00 67.65  ? 167  GLN B CG  1 
ATOM   2945 C CD  . GLN B 2 182 ? -0.647 16.945  -21.261 1.00 70.72  ? 167  GLN B CD  1 
ATOM   2946 O OE1 . GLN B 2 182 ? -0.062 16.854  -20.179 1.00 71.46  ? 167  GLN B OE1 1 
ATOM   2947 N NE2 . GLN B 2 182 ? -1.752 17.671  -21.421 1.00 69.82  ? 167  GLN B NE2 1 
ATOM   2948 N N   . GLY B 2 183 ? -1.816 14.301  -19.501 1.00 59.20  ? 168  GLY B N   1 
ATOM   2949 C CA  . GLY B 2 183 ? -2.982 14.296  -18.641 1.00 58.67  ? 168  GLY B CA  1 
ATOM   2950 C C   . GLY B 2 183 ? -2.692 13.342  -17.502 1.00 57.92  ? 168  GLY B C   1 
ATOM   2951 O O   . GLY B 2 183 ? -3.489 13.186  -16.577 1.00 62.99  ? 168  GLY B O   1 
ATOM   2952 N N   . GLU B 2 184 ? -1.529 12.706  -17.574 1.00 52.73  ? 169  GLU B N   1 
ATOM   2953 C CA  . GLU B 2 184 ? -1.123 11.752  -16.560 1.00 48.82  ? 169  GLU B CA  1 
ATOM   2954 C C   . GLU B 2 184 ? -0.219 12.345  -15.502 1.00 46.54  ? 169  GLU B C   1 
ATOM   2955 O O   . GLU B 2 184 ? 0.662  13.159  -15.787 1.00 44.38  ? 169  GLU B O   1 
ATOM   2956 C CB  . GLU B 2 184 ? -0.433 10.565  -17.213 1.00 48.33  ? 169  GLU B CB  1 
ATOM   2957 C CG  . GLU B 2 184 ? -1.386 9.728   -18.015 1.00 51.13  ? 169  GLU B CG  1 
ATOM   2958 C CD  . GLU B 2 184 ? -0.903 8.316   -18.191 1.00 53.87  ? 169  GLU B CD  1 
ATOM   2959 O OE1 . GLU B 2 184 ? -0.311 7.766   -17.241 1.00 57.09  ? 169  GLU B OE1 1 
ATOM   2960 O OE2 . GLU B 2 184 ? -1.117 7.756   -19.282 1.00 57.28  ? 169  GLU B OE2 1 
ATOM   2961 N N   . VAL B 2 185 ? -0.456 11.924  -14.267 1.00 43.75  ? 170  VAL B N   1 
ATOM   2962 C CA  . VAL B 2 185 ? 0.323  12.388  -13.137 1.00 38.75  ? 170  VAL B CA  1 
ATOM   2963 C C   . VAL B 2 185 ? 0.860  11.167  -12.413 1.00 35.20  ? 170  VAL B C   1 
ATOM   2964 O O   . VAL B 2 185 ? 0.098  10.322  -11.962 1.00 35.69  ? 170  VAL B O   1 
ATOM   2965 C CB  . VAL B 2 185 ? -0.547 13.222  -12.172 1.00 39.75  ? 170  VAL B CB  1 
ATOM   2966 C CG1 . VAL B 2 185 ? 0.314  13.808  -11.058 1.00 37.14  ? 170  VAL B CG1 1 
ATOM   2967 C CG2 . VAL B 2 185 ? -1.252 14.333  -12.942 1.00 36.18  ? 170  VAL B CG2 1 
ATOM   2968 N N   . TYR B 2 186 ? 2.180  11.070  -12.329 1.00 34.70  ? 171  TYR B N   1 
ATOM   2969 C CA  . TYR B 2 186 ? 2.835  9.958   -11.651 1.00 33.87  ? 171  TYR B CA  1 
ATOM   2970 C C   . TYR B 2 186 ? 3.335  10.480  -10.305 1.00 31.58  ? 171  TYR B C   1 
ATOM   2971 O O   . TYR B 2 186 ? 3.994  11.517  -10.247 1.00 30.08  ? 171  TYR B O   1 
ATOM   2972 C CB  . TYR B 2 186 ? 4.012  9.446   -12.496 1.00 34.73  ? 171  TYR B CB  1 
ATOM   2973 C CG  . TYR B 2 186 ? 3.619  8.984   -13.885 1.00 36.40  ? 171  TYR B CG  1 
ATOM   2974 C CD1 . TYR B 2 186 ? 3.173  9.892   -14.846 1.00 36.14  ? 171  TYR B CD1 1 
ATOM   2975 C CD2 . TYR B 2 186 ? 3.673  7.633   -14.232 1.00 39.26  ? 171  TYR B CD2 1 
ATOM   2976 C CE1 . TYR B 2 186 ? 2.788  9.465   -16.121 1.00 38.65  ? 171  TYR B CE1 1 
ATOM   2977 C CE2 . TYR B 2 186 ? 3.291  7.195   -15.503 1.00 38.45  ? 171  TYR B CE2 1 
ATOM   2978 C CZ  . TYR B 2 186 ? 2.849  8.114   -16.442 1.00 40.31  ? 171  TYR B CZ  1 
ATOM   2979 O OH  . TYR B 2 186 ? 2.475  7.677   -17.698 1.00 39.44  ? 171  TYR B OH  1 
ATOM   2980 N N   . THR B 2 187 ? 3.019  9.770   -9.226  1.00 32.13  ? 172  THR B N   1 
ATOM   2981 C CA  . THR B 2 187 ? 3.436  10.194  -7.890  1.00 26.78  ? 172  THR B CA  1 
ATOM   2982 C C   . THR B 2 187 ? 4.378  9.211   -7.189  1.00 23.72  ? 172  THR B C   1 
ATOM   2983 O O   . THR B 2 187 ? 4.206  7.993   -7.283  1.00 15.43  ? 172  THR B O   1 
ATOM   2984 C CB  . THR B 2 187 ? 2.197  10.429  -6.982  1.00 26.65  ? 172  THR B CB  1 
ATOM   2985 O OG1 . THR B 2 187 ? 1.635  11.716  -7.262  1.00 30.11  ? 172  THR B OG1 1 
ATOM   2986 C CG2 . THR B 2 187 ? 2.578  10.375  -5.518  1.00 25.41  ? 172  THR B CG2 1 
ATOM   2987 N N   . CYS B 2 188 ? 5.380  9.756   -6.500  1.00 22.69  ? 173  CYS B N   1 
ATOM   2988 C CA  . CYS B 2 188 ? 6.331  8.948   -5.746  1.00 23.72  ? 173  CYS B CA  1 
ATOM   2989 C C   . CYS B 2 188 ? 5.942  9.050   -4.263  1.00 24.11  ? 173  CYS B C   1 
ATOM   2990 O O   . CYS B 2 188 ? 6.115  10.090  -3.621  1.00 21.07  ? 173  CYS B O   1 
ATOM   2991 C CB  . CYS B 2 188 ? 7.765  9.448   -5.969  1.00 22.56  ? 173  CYS B CB  1 
ATOM   2992 S SG  . CYS B 2 188 ? 9.040  8.336   -5.285  1.00 29.42  ? 173  CYS B SG  1 
ATOM   2993 N N   . HIS B 2 189 ? 5.409  7.959   -3.728  1.00 26.05  ? 174  HIS B N   1 
ATOM   2994 C CA  . HIS B 2 189 ? 4.966  7.923   -2.336  1.00 27.22  ? 174  HIS B CA  1 
ATOM   2995 C C   . HIS B 2 189 ? 5.976  7.221   -1.422  1.00 28.17  ? 174  HIS B C   1 
ATOM   2996 O O   . HIS B 2 189 ? 6.260  6.039   -1.598  1.00 30.34  ? 174  HIS B O   1 
ATOM   2997 C CB  . HIS B 2 189 ? 3.611  7.218   -2.280  1.00 25.02  ? 174  HIS B CB  1 
ATOM   2998 C CG  . HIS B 2 189 ? 3.092  6.992   -0.896  1.00 29.44  ? 174  HIS B CG  1 
ATOM   2999 N ND1 . HIS B 2 189 ? 2.204  7.854   -0.284  1.00 27.14  ? 174  HIS B ND1 1 
ATOM   3000 C CD2 . HIS B 2 189 ? 3.296  5.979   -0.022  1.00 29.31  ? 174  HIS B CD2 1 
ATOM   3001 C CE1 . HIS B 2 189 ? 1.885  7.379   0.905   1.00 32.08  ? 174  HIS B CE1 1 
ATOM   3002 N NE2 . HIS B 2 189 ? 2.534  6.242   1.091   1.00 31.79  ? 174  HIS B NE2 1 
ATOM   3003 N N   . VAL B 2 190 ? 6.514  7.949   -0.443  1.00 25.99  ? 175  VAL B N   1 
ATOM   3004 C CA  . VAL B 2 190 ? 7.494  7.375   0.478   1.00 21.02  ? 175  VAL B CA  1 
ATOM   3005 C C   . VAL B 2 190 ? 6.982  7.282   1.912   1.00 21.91  ? 175  VAL B C   1 
ATOM   3006 O O   . VAL B 2 190 ? 6.499  8.273   2.464   1.00 17.16  ? 175  VAL B O   1 
ATOM   3007 C CB  . VAL B 2 190 ? 8.801  8.200   0.493   1.00 14.27  ? 175  VAL B CB  1 
ATOM   3008 C CG1 . VAL B 2 190 ? 9.673  7.773   1.656   1.00 19.58  ? 175  VAL B CG1 1 
ATOM   3009 C CG2 . VAL B 2 190 ? 9.553  8.010   -0.800  1.00 13.70  ? 175  VAL B CG2 1 
ATOM   3010 N N   . GLU B 2 191 ? 7.096  6.086   2.499   1.00 23.39  ? 176  GLU B N   1 
ATOM   3011 C CA  . GLU B 2 191 ? 6.684  5.810   3.885   1.00 24.09  ? 176  GLU B CA  1 
ATOM   3012 C C   . GLU B 2 191 ? 7.953  5.542   4.708   1.00 25.98  ? 176  GLU B C   1 
ATOM   3013 O O   . GLU B 2 191 ? 8.721  4.639   4.386   1.00 30.12  ? 176  GLU B O   1 
ATOM   3014 C CB  . GLU B 2 191 ? 5.770  4.579   3.942   1.00 24.22  ? 176  GLU B CB  1 
ATOM   3015 C CG  . GLU B 2 191 ? 4.444  4.709   3.170   1.00 27.90  ? 176  GLU B CG  1 
ATOM   3016 C CD  . GLU B 2 191 ? 3.758  3.360   2.937   1.00 26.46  ? 176  GLU B CD  1 
ATOM   3017 O OE1 . GLU B 2 191 ? 3.639  2.569   3.896   1.00 25.93  ? 176  GLU B OE1 1 
ATOM   3018 O OE2 . GLU B 2 191 ? 3.336  3.091   1.795   1.00 24.93  ? 176  GLU B OE2 1 
ATOM   3019 N N   . HIS B 2 192 ? 8.165  6.314   5.772   1.00 27.66  ? 177  HIS B N   1 
ATOM   3020 C CA  . HIS B 2 192 ? 9.364  6.180   6.600   1.00 24.83  ? 177  HIS B CA  1 
ATOM   3021 C C   . HIS B 2 192 ? 9.054  6.618   8.036   1.00 25.50  ? 177  HIS B C   1 
ATOM   3022 O O   . HIS B 2 192 ? 8.192  7.475   8.258   1.00 21.91  ? 177  HIS B O   1 
ATOM   3023 C CB  . HIS B 2 192 ? 10.478 7.048   5.995   1.00 26.28  ? 177  HIS B CB  1 
ATOM   3024 C CG  . HIS B 2 192 ? 11.829 6.836   6.604   1.00 29.98  ? 177  HIS B CG  1 
ATOM   3025 N ND1 . HIS B 2 192 ? 12.292 7.585   7.663   1.00 31.88  ? 177  HIS B ND1 1 
ATOM   3026 C CD2 . HIS B 2 192 ? 12.830 5.984   6.278   1.00 33.64  ? 177  HIS B CD2 1 
ATOM   3027 C CE1 . HIS B 2 192 ? 13.523 7.205   7.963   1.00 34.25  ? 177  HIS B CE1 1 
ATOM   3028 N NE2 . HIS B 2 192 ? 13.872 6.236   7.139   1.00 33.62  ? 177  HIS B NE2 1 
ATOM   3029 N N   . PRO B 2 193 ? 9.759  6.038   9.029   1.00 26.93  ? 178  PRO B N   1 
ATOM   3030 C CA  . PRO B 2 193 ? 9.560  6.357   10.450  1.00 27.88  ? 178  PRO B CA  1 
ATOM   3031 C C   . PRO B 2 193 ? 9.940  7.772   10.899  1.00 28.74  ? 178  PRO B C   1 
ATOM   3032 O O   . PRO B 2 193 ? 9.517  8.217   11.968  1.00 30.14  ? 178  PRO B O   1 
ATOM   3033 C CB  . PRO B 2 193 ? 10.378 5.282   11.183  1.00 27.36  ? 178  PRO B CB  1 
ATOM   3034 C CG  . PRO B 2 193 ? 10.697 4.233   10.134  1.00 26.52  ? 178  PRO B CG  1 
ATOM   3035 C CD  . PRO B 2 193 ? 10.795 5.005   8.859   1.00 26.61  ? 178  PRO B CD  1 
ATOM   3036 N N   . SER B 2 194 ? 10.735 8.467   10.090  1.00 29.78  ? 179  SER B N   1 
ATOM   3037 C CA  . SER B 2 194 ? 11.166 9.835   10.392  1.00 26.86  ? 179  SER B CA  1 
ATOM   3038 C C   . SER B 2 194 ? 10.089 10.859  10.012  1.00 28.16  ? 179  SER B C   1 
ATOM   3039 O O   . SER B 2 194 ? 10.013 11.951  10.582  1.00 24.25  ? 179  SER B O   1 
ATOM   3040 C CB  . SER B 2 194 ? 12.449 10.154  9.623   1.00 24.42  ? 179  SER B CB  1 
ATOM   3041 O OG  . SER B 2 194 ? 12.271 9.942   8.234   1.00 17.66  ? 179  SER B OG  1 
ATOM   3042 N N   . LEU B 2 195 ? 9.265  10.492  9.035   1.00 29.41  ? 180  LEU B N   1 
ATOM   3043 C CA  . LEU B 2 195 ? 8.195  11.351  8.546   1.00 30.07  ? 180  LEU B CA  1 
ATOM   3044 C C   . LEU B 2 195 ? 7.008  11.355  9.508   1.00 29.83  ? 180  LEU B C   1 
ATOM   3045 O O   . LEU B 2 195 ? 6.910  10.510  10.391  1.00 33.58  ? 180  LEU B O   1 
ATOM   3046 C CB  . LEU B 2 195 ? 7.740  10.872  7.159   1.00 22.91  ? 180  LEU B CB  1 
ATOM   3047 C CG  . LEU B 2 195 ? 8.611  11.161  5.927   1.00 15.32  ? 180  LEU B CG  1 
ATOM   3048 C CD1 . LEU B 2 195 ? 9.330  12.462  6.079   1.00 10.39  ? 180  LEU B CD1 1 
ATOM   3049 C CD2 . LEU B 2 195 ? 9.603  10.063  5.732   1.00 19.80  ? 180  LEU B CD2 1 
ATOM   3050 N N   . LYS B 2 196 ? 6.116  12.322  9.341   1.00 31.83  ? 181  LYS B N   1 
ATOM   3051 C CA  . LYS B 2 196 ? 4.926  12.414  10.181  1.00 34.99  ? 181  LYS B CA  1 
ATOM   3052 C C   . LYS B 2 196 ? 3.736  12.011  9.319   1.00 32.90  ? 181  LYS B C   1 
ATOM   3053 O O   . LYS B 2 196 ? 2.647  11.732  9.814   1.00 30.55  ? 181  LYS B O   1 
ATOM   3054 C CB  . LYS B 2 196 ? 4.737  13.842  10.692  1.00 36.47  ? 181  LYS B CB  1 
ATOM   3055 C CG  . LYS B 2 196 ? 5.037  14.018  12.170  1.00 38.69  ? 181  LYS B CG  1 
ATOM   3056 C CD  . LYS B 2 196 ? 5.835  15.291  12.400  1.00 44.48  ? 181  LYS B CD  1 
ATOM   3057 C CE  . LYS B 2 196 ? 5.024  16.522  12.010  1.00 46.44  ? 181  LYS B CE  1 
ATOM   3058 N NZ  . LYS B 2 196 ? 5.662  17.793  12.457  1.00 49.19  ? 181  LYS B NZ  1 
ATOM   3059 N N   . SER B 2 197 ? 3.971  11.992  8.060   1.00 34.60  ? 182  SER B N   1 
ATOM   3060 C CA  . SER B 2 197 ? 3.014  11.616  7.010   1.00 35.78  ? 182  SER B CA  1 
ATOM   3061 C C   . SER B 2 197 ? 3.765  11.178  5.750   1.00 32.74  ? 182  SER B C   1 
ATOM   3062 O O   . SER B 2 197 ? 4.808  11.797  5.480   1.00 32.05  ? 182  SER B O   1 
ATOM   3063 C CB  . SER B 2 197 ? 2.117  12.807  6.669   1.00 40.91  ? 182  SER B CB  1 
ATOM   3064 O OG  . SER B 2 197 ? 2.907  13.893  6.207   1.00 20.00  ? 182  SER B OG  1 
ATOM   3065 N N   . PRO B 2 198 ? 3.341  10.142  5.087   1.00 31.13  ? 183  PRO B N   1 
ATOM   3066 C CA  . PRO B 2 198 ? 4.155  9.796   3.921   1.00 28.27  ? 183  PRO B CA  1 
ATOM   3067 C C   . PRO B 2 198 ? 4.350  11.034  3.057   1.00 24.63  ? 183  PRO B C   1 
ATOM   3068 O O   . PRO B 2 198 ? 3.461  11.882  2.965   1.00 17.03  ? 183  PRO B O   1 
ATOM   3069 C CB  . PRO B 2 198 ? 3.342  8.713   3.218   1.00 25.56  ? 183  PRO B CB  1 
ATOM   3070 C CG  . PRO B 2 198 ? 2.509  8.112   4.295   1.00 28.91  ? 183  PRO B CG  1 
ATOM   3071 C CD  . PRO B 2 198 ? 2.191  9.236   5.250   1.00 29.25  ? 183  PRO B CD  1 
ATOM   3072 N N   . ILE B 2 199 ? 5.522  11.145  2.443   1.00 25.63  ? 184  ILE B N   1 
ATOM   3073 C CA  . ILE B 2 199 ? 5.823  12.292  1.598   1.00 27.59  ? 184  ILE B CA  1 
ATOM   3074 C C   . ILE B 2 199 ? 5.579  11.997  0.114   1.00 26.76  ? 184  ILE B C   1 
ATOM   3075 O O   . ILE B 2 199 ? 5.673  10.852  -0.331  1.00 23.43  ? 184  ILE B O   1 
ATOM   3076 C CB  . ILE B 2 199 ? 7.278  12.768  1.836   1.00 27.58  ? 184  ILE B CB  1 
ATOM   3077 C CG1 . ILE B 2 199 ? 8.254  11.599  1.678   1.00 29.63  ? 184  ILE B CG1 1 
ATOM   3078 C CG2 . ILE B 2 199 ? 7.402  13.348  3.239   1.00 25.47  ? 184  ILE B CG2 1 
ATOM   3079 C CD1 . ILE B 2 199 ? 9.721  12.018  1.618   1.00 22.76  ? 184  ILE B CD1 1 
ATOM   3080 N N   . THR B 2 200 ? 5.278  13.035  -0.655  1.00 27.71  ? 185  THR B N   1 
ATOM   3081 C CA  . THR B 2 200 ? 4.971  12.837  -2.062  1.00 31.24  ? 185  THR B CA  1 
ATOM   3082 C C   . THR B 2 200 ? 5.699  13.764  -3.032  1.00 32.95  ? 185  THR B C   1 
ATOM   3083 O O   . THR B 2 200 ? 6.247  14.789  -2.644  1.00 35.08  ? 185  THR B O   1 
ATOM   3084 C CB  . THR B 2 200 ? 3.435  12.946  -2.259  1.00 27.79  ? 185  THR B CB  1 
ATOM   3085 O OG1 . THR B 2 200 ? 2.895  11.628  -2.386  1.00 29.70  ? 185  THR B OG1 1 
ATOM   3086 C CG2 . THR B 2 200 ? 3.076  13.770  -3.488  1.00 31.53  ? 185  THR B CG2 1 
ATOM   3087 N N   . VAL B 2 201 ? 5.703  13.378  -4.302  1.00 34.45  ? 186  VAL B N   1 
ATOM   3088 C CA  . VAL B 2 201 ? 6.329  14.153  -5.371  1.00 36.36  ? 186  VAL B CA  1 
ATOM   3089 C C   . VAL B 2 201 ? 5.628  13.703  -6.642  1.00 38.91  ? 186  VAL B C   1 
ATOM   3090 O O   . VAL B 2 201 ? 5.280  12.529  -6.758  1.00 37.92  ? 186  VAL B O   1 
ATOM   3091 C CB  . VAL B 2 201 ? 7.834  13.845  -5.494  1.00 36.44  ? 186  VAL B CB  1 
ATOM   3092 C CG1 . VAL B 2 201 ? 8.649  14.900  -4.780  1.00 33.08  ? 186  VAL B CG1 1 
ATOM   3093 C CG2 . VAL B 2 201 ? 8.133  12.477  -4.922  1.00 39.76  ? 186  VAL B CG2 1 
ATOM   3094 N N   . GLU B 2 202 ? 5.439  14.607  -7.600  1.00 41.40  ? 187  GLU B N   1 
ATOM   3095 C CA  . GLU B 2 202 ? 4.733  14.248  -8.830  1.00 43.77  ? 187  GLU B CA  1 
ATOM   3096 C C   . GLU B 2 202 ? 5.360  14.686  -10.150 1.00 46.49  ? 187  GLU B C   1 
ATOM   3097 O O   . GLU B 2 202 ? 5.913  15.783  -10.242 1.00 47.50  ? 187  GLU B O   1 
ATOM   3098 C CB  . GLU B 2 202 ? 3.311  14.809  -8.789  1.00 43.99  ? 187  GLU B CB  1 
ATOM   3099 C CG  . GLU B 2 202 ? 2.771  15.140  -7.404  1.00 45.91  ? 187  GLU B CG  1 
ATOM   3100 C CD  . GLU B 2 202 ? 1.325  14.713  -7.251  1.00 48.30  ? 187  GLU B CD  1 
ATOM   3101 O OE1 . GLU B 2 202 ? 0.584  14.817  -8.251  1.00 54.52  ? 187  GLU B OE1 1 
ATOM   3102 O OE2 . GLU B 2 202 ? 0.926  14.274  -6.150  1.00 52.32  ? 187  GLU B OE2 1 
ATOM   3103 N N   . TRP B 2 203 ? 5.245  13.843  -11.180 1.00 47.12  ? 188  TRP B N   1 
ATOM   3104 C CA  . TRP B 2 203 ? 5.781  14.167  -12.506 1.00 47.83  ? 188  TRP B CA  1 
ATOM   3105 C C   . TRP B 2 203 ? 4.671  14.172  -13.563 1.00 48.43  ? 188  TRP B C   1 
ATOM   3106 O O   . TRP B 2 203 ? 3.747  13.367  -13.532 1.00 46.70  ? 188  TRP B O   1 
ATOM   3107 C CB  . TRP B 2 203 ? 6.891  13.180  -12.915 1.00 47.04  ? 188  TRP B CB  1 
ATOM   3108 C CG  . TRP B 2 203 ? 7.508  13.464  -14.280 1.00 49.09  ? 188  TRP B CG  1 
ATOM   3109 C CD1 . TRP B 2 203 ? 8.594  14.250  -14.562 1.00 49.04  ? 188  TRP B CD1 1 
ATOM   3110 C CD2 . TRP B 2 203 ? 7.025  12.986  -15.536 1.00 52.76  ? 188  TRP B CD2 1 
ATOM   3111 N NE1 . TRP B 2 203 ? 8.805  14.289  -15.928 1.00 51.39  ? 188  TRP B NE1 1 
ATOM   3112 C CE2 . TRP B 2 203 ? 7.860  13.528  -16.540 1.00 53.48  ? 188  TRP B CE2 1 
ATOM   3113 C CE3 . TRP B 2 203 ? 5.962  12.159  -15.906 1.00 55.00  ? 188  TRP B CE3 1 
ATOM   3114 C CZ2 . TRP B 2 203 ? 7.655  13.250  -17.898 1.00 52.20  ? 188  TRP B CZ2 1 
ATOM   3115 C CZ3 . TRP B 2 203 ? 5.761  11.889  -17.249 1.00 55.18  ? 188  TRP B CZ3 1 
ATOM   3116 C CH2 . TRP B 2 203 ? 6.604  12.437  -18.228 1.00 53.36  ? 188  TRP B CH2 1 
ATOM   3117 N N   . SER B 2 204 ? 4.773  15.122  -14.482 1.00 51.84  ? 189  SER B N   1 
ATOM   3118 C CA  . SER B 2 204 ? 3.836  15.273  -15.590 1.00 53.74  ? 189  SER B CA  1 
ATOM   3119 C C   . SER B 2 204 ? 4.707  15.742  -16.764 1.00 56.87  ? 189  SER B C   1 
ATOM   3120 O O   . SER B 2 204 ? 5.905  15.470  -16.775 1.00 53.58  ? 189  SER B O   1 
ATOM   3121 C CB  . SER B 2 204 ? 2.786  16.342  -15.260 1.00 50.90  ? 189  SER B CB  1 
ATOM   3122 O OG  . SER B 2 204 ? 3.401  17.562  -14.864 1.00 52.42  ? 189  SER B OG  1 
ATOM   3123 N N   . SER B 2 205 ? 4.116  16.441  -17.733 1.00 61.80  ? 190  SER B N   1 
ATOM   3124 C CA  . SER B 2 205 ? 4.825  16.985  -18.902 1.00 64.23  ? 190  SER B CA  1 
ATOM   3125 C C   . SER B 2 205 ? 6.201  16.377  -19.238 1.00 67.37  ? 190  SER B C   1 
ATOM   3126 O O   . SER B 2 205 ? 6.442  16.188  -20.444 1.00 71.20  ? 190  SER B O   1 
ATOM   3127 C CB  . SER B 2 205 ? 4.949  18.512  -18.752 1.00 61.34  ? 190  SER B CB  1 
ATOM   3128 O OG  . SER B 2 205 ? 3.658  19.093  -18.635 1.00 61.60  ? 190  SER B OG  1 
ATOM   3129 O OXT . SER B 2 205 ? 7.027  16.101  -18.340 1.00 70.61  ? 190  SER B OXT 1 
HETATM 3130 O O   . HOH C 3 .   ? 30.907 12.769  6.363   1.00 21.85  ? 1003 HOH A O   1 
HETATM 3131 O O   . HOH C 3 .   ? 40.846 14.948  -12.091 1.00 9.33   ? 1004 HOH A O   1 
HETATM 3132 O O   . HOH C 3 .   ? 39.139 -1.235  14.402  1.00 11.79  ? 1009 HOH A O   1 
HETATM 3133 O O   . HOH C 3 .   ? 36.875 1.219   28.105  1.00 27.38  ? 1010 HOH A O   1 
HETATM 3134 O O   . HOH C 3 .   ? 23.367 4.470   7.530   1.00 17.66  ? 1011 HOH A O   1 
HETATM 3135 O O   . HOH C 3 .   ? 50.879 -19.872 22.046  1.00 19.68  ? 1012 HOH A O   1 
HETATM 3136 O O   . HOH C 3 .   ? 45.852 -1.394  11.714  1.00 17.85  ? 1013 HOH A O   1 
HETATM 3137 O O   . HOH C 3 .   ? 32.362 12.840  11.251  1.00 23.86  ? 1016 HOH A O   1 
HETATM 3138 O O   . HOH C 3 .   ? 37.568 -6.964  8.552   1.00 23.58  ? 1017 HOH A O   1 
HETATM 3139 O O   . HOH C 3 .   ? 45.511 1.148   11.434  1.00 8.90   ? 1018 HOH A O   1 
HETATM 3140 O O   . HOH C 3 .   ? 22.359 22.603  -1.527  1.00 29.03  ? 1020 HOH A O   1 
HETATM 3141 O O   . HOH C 3 .   ? 30.521 -3.406  1.980   1.00 26.80  ? 1022 HOH A O   1 
HETATM 3142 O O   . HOH C 3 .   ? 31.116 -6.959  8.824   1.00 14.86  ? 1024 HOH A O   1 
HETATM 3143 O O   . HOH C 3 .   ? 33.473 9.076   24.542  1.00 14.73  ? 1025 HOH A O   1 
HETATM 3144 O O   . HOH C 3 .   ? 45.106 -14.662 20.079  1.00 15.31  ? 1027 HOH A O   1 
HETATM 3145 O O   . HOH C 3 .   ? 27.711 -3.103  12.616  1.00 16.68  ? 1028 HOH A O   1 
HETATM 3146 O O   . HOH C 3 .   ? 21.547 -5.557  11.224  1.00 26.25  ? 1029 HOH A O   1 
HETATM 3147 O O   . HOH C 3 .   ? 34.126 -1.765  14.313  1.00 25.86  ? 1039 HOH A O   1 
HETATM 3148 O O   . HOH C 3 .   ? 26.221 5.207   6.641   1.00 16.18  ? 1043 HOH A O   1 
HETATM 3149 O O   . HOH C 3 .   ? 28.842 3.101   7.407   1.00 17.26  ? 1044 HOH A O   1 
HETATM 3150 O O   . HOH C 3 .   ? 31.036 10.646  -14.520 1.00 21.91  ? 1047 HOH A O   1 
HETATM 3151 O O   . HOH C 3 .   ? 38.795 -0.170  -8.953  1.00 19.72  ? 1050 HOH A O   1 
HETATM 3152 O O   . HOH C 3 .   ? 33.222 -7.155  1.082   1.00 29.81  ? 1052 HOH A O   1 
HETATM 3153 O O   . HOH C 3 .   ? 38.844 9.109   10.565  1.00 16.83  ? 1053 HOH A O   1 
HETATM 3154 O O   . HOH C 3 .   ? 48.618 -1.394  0.891   1.00 17.30  ? 1054 HOH A O   1 
HETATM 3155 O O   . HOH C 3 .   ? 21.826 1.177   9.447   1.00 25.89  ? 1057 HOH A O   1 
HETATM 3156 O O   . HOH C 3 .   ? 54.297 -11.155 21.517  1.00 27.69  ? 1061 HOH A O   1 
HETATM 3157 O O   . HOH C 3 .   ? 42.225 8.324   7.037   1.00 38.10  ? 1063 HOH A O   1 
HETATM 3158 O O   . HOH C 3 .   ? 30.703 -7.292  4.814   1.00 19.69  ? 1069 HOH A O   1 
HETATM 3159 O O   . HOH C 3 .   ? 28.465 24.040  -15.301 1.00 15.88  ? 1075 HOH A O   1 
HETATM 3160 O O   . HOH C 3 .   ? 42.924 9.662   12.251  1.00 26.59  ? 1079 HOH A O   1 
HETATM 3161 O O   . HOH C 3 .   ? 35.790 8.108   10.993  1.00 26.28  ? 1083 HOH A O   1 
HETATM 3162 O O   . HOH C 3 .   ? 41.300 4.673   12.871  1.00 27.34  ? 1084 HOH A O   1 
HETATM 3163 O O   . HOH C 3 .   ? 52.960 -4.002  -12.175 1.00 26.46  ? 1086 HOH A O   1 
HETATM 3164 O O   . HOH C 3 .   ? 26.823 13.334  29.195  1.00 13.12  ? 2001 HOH A O   1 
HETATM 3165 O O   . HOH C 3 .   ? 38.861 11.984  -24.138 1.00 20.47  ? 2002 HOH A O   1 
HETATM 3166 O O   . HOH C 3 .   ? 14.324 -5.059  17.364  1.00 32.01  ? 2006 HOH A O   1 
HETATM 3167 O O   . HOH C 3 .   ? 53.407 -4.142  -5.731  1.00 37.96  ? 2008 HOH A O   1 
HETATM 3168 O O   . HOH C 3 .   ? 35.073 10.521  13.449  1.00 33.43  ? 2011 HOH A O   1 
HETATM 3169 O O   . HOH C 3 .   ? 33.395 -0.408  -4.573  1.00 22.29  ? 2014 HOH A O   1 
HETATM 3170 O O   . HOH C 3 .   ? 45.041 6.458   15.971  1.00 28.75  ? 2016 HOH A O   1 
HETATM 3171 O O   . HOH C 3 .   ? 49.038 10.277  -7.261  1.00 28.06  ? 2017 HOH A O   1 
HETATM 3172 O O   . HOH C 3 .   ? 33.465 22.922  -1.243  1.00 41.61  ? 2025 HOH A O   1 
HETATM 3173 O O   . HOH C 3 .   ? 26.293 19.662  1.122   1.00 24.50  ? 2033 HOH A O   1 
HETATM 3174 O O   . HOH C 3 .   ? 36.832 3.457   -19.765 1.00 35.24  ? 2035 HOH A O   1 
HETATM 3175 O O   . HOH C 3 .   ? 40.567 16.578  -17.234 1.00 43.14  ? 2036 HOH A O   1 
HETATM 3176 O O   . HOH C 3 .   ? 29.100 8.268   15.970  1.00 12.36  ? 2038 HOH A O   1 
HETATM 3177 O O   . HOH C 3 .   ? 59.628 -23.974 7.712   1.00 24.97  ? 2039 HOH A O   1 
HETATM 3178 O O   . HOH C 3 .   ? 48.453 -7.276  27.248  1.00 39.87  ? 2048 HOH A O   1 
HETATM 3179 O O   . HOH C 3 .   ? 30.358 -4.526  5.789   1.00 32.78  ? 2060 HOH A O   1 
HETATM 3180 O O   . HOH C 3 .   ? 43.638 5.786   5.244   1.00 24.22  ? 2063 HOH A O   1 
HETATM 3181 O O   . HOH C 3 .   ? 33.228 13.835  23.100  1.00 24.07  ? 2067 HOH A O   1 
HETATM 3182 O O   . HOH C 3 .   ? 48.165 17.862  -13.952 1.00 30.88  ? 2069 HOH A O   1 
HETATM 3183 O O   . HOH C 3 .   ? 12.794 -17.751 13.322  1.00 28.20  ? 2086 HOH A O   1 
HETATM 3184 O O   . HOH C 3 .   ? 41.615 23.593  1.454   1.00 22.25  ? 2091 HOH A O   1 
HETATM 3185 O O   . HOH C 3 .   ? 44.137 -13.502 -3.915  1.00 34.73  ? 2092 HOH A O   1 
HETATM 3186 O O   . HOH C 3 .   ? 48.924 3.744   -17.065 1.00 99.15  ? 2096 HOH A O   1 
HETATM 3187 O O   . HOH C 3 .   ? 30.959 -0.233  -9.500  1.00 35.00  ? 2097 HOH A O   1 
HETATM 3188 O O   . HOH C 3 .   ? 37.642 10.685  28.940  1.00 29.22  ? 2105 HOH A O   1 
HETATM 3189 O O   . HOH C 3 .   ? 42.568 6.661   28.895  1.00 22.10  ? 2107 HOH A O   1 
HETATM 3190 O O   . HOH C 3 .   ? 50.634 2.975   -0.843  1.00 19.42  ? 2112 HOH A O   1 
HETATM 3191 O O   . HOH C 3 .   ? 46.195 4.616   11.197  1.00 30.44  ? 2116 HOH A O   1 
HETATM 3192 O O   . HOH C 3 .   ? 35.614 -10.108 -3.426  1.00 44.30  ? 2123 HOH A O   1 
HETATM 3193 O O   . HOH C 3 .   ? 46.585 -8.405  -6.246  1.00 33.14  ? 2124 HOH A O   1 
HETATM 3194 O O   . HOH C 3 .   ? 33.964 21.515  3.136   1.00 25.99  ? 2125 HOH A O   1 
HETATM 3195 O O   . HOH C 3 .   ? 39.102 11.554  10.694  1.00 25.13  ? 2126 HOH A O   1 
HETATM 3196 O O   . HOH C 3 .   ? 45.852 -12.724 3.749   1.00 17.56  ? 2130 HOH A O   1 
HETATM 3197 O O   . HOH C 3 .   ? 38.251 -14.699 5.020   1.00 24.69  ? 2138 HOH A O   1 
HETATM 3198 O O   . HOH C 3 .   ? 44.742 8.762   2.664   1.00 30.18  ? 2140 HOH A O   1 
HETATM 3199 O O   . HOH C 3 .   ? 42.101 -9.506  -4.859  1.00 23.83  ? 2141 HOH A O   1 
HETATM 3200 O O   . HOH C 3 .   ? 35.910 -0.935  -9.905  1.00 33.59  ? 2143 HOH A O   1 
HETATM 3201 O O   . HOH C 3 .   ? 48.478 3.302   14.080  1.00 20.16  ? 2144 HOH A O   1 
HETATM 3202 O O   . HOH C 3 .   ? 25.280 17.020  28.502  1.00 33.41  ? 2152 HOH A O   1 
HETATM 3203 O O   . HOH D 3 .   ? 27.530 1.220   -0.224  1.00 19.48  ? 1026 HOH B O   1 
HETATM 3204 O O   . HOH D 3 .   ? 31.215 -26.969 28.393  1.00 35.54  ? 1030 HOH B O   1 
HETATM 3205 O O   . HOH D 3 .   ? 11.843 15.342  2.665   1.00 18.58  ? 1031 HOH B O   1 
HETATM 3206 O O   . HOH D 3 .   ? 28.601 13.503  4.716   1.00 28.47  ? 1032 HOH B O   1 
HETATM 3207 O O   . HOH D 3 .   ? 44.244 -12.265 29.440  1.00 19.79  ? 1033 HOH B O   1 
HETATM 3208 O O   . HOH D 3 .   ? 26.167 13.317  8.649   1.00 21.35  ? 1037 HOH B O   1 
HETATM 3209 O O   . HOH D 3 .   ? 31.981 -10.798 11.118  1.00 10.69  ? 1041 HOH B O   1 
HETATM 3210 O O   . HOH D 3 .   ? 16.113 11.393  -9.967  1.00 24.26  ? 1045 HOH B O   1 
HETATM 3211 O O   . HOH D 3 .   ? 60.074 -9.789  9.507   1.00 38.20  ? 1049 HOH B O   1 
HETATM 3212 O O   . HOH D 3 .   ? 48.686 -24.304 11.963  1.00 24.49  ? 1051 HOH B O   1 
HETATM 3213 O O   . HOH D 3 .   ? 35.674 -24.412 11.583  1.00 21.14  ? 1056 HOH B O   1 
HETATM 3214 O O   . HOH D 3 .   ? 28.119 0.077   2.573   1.00 24.91  ? 1060 HOH B O   1 
HETATM 3215 O O   . HOH D 3 .   ? 24.145 -21.646 17.080  1.00 34.75  ? 1062 HOH B O   1 
HETATM 3216 O O   . HOH D 3 .   ? 38.710 -26.785 25.518  1.00 17.95  ? 1065 HOH B O   1 
HETATM 3217 O O   . HOH D 3 .   ? 32.992 -8.448  10.285  1.00 13.39  ? 1066 HOH B O   1 
HETATM 3218 O O   . HOH D 3 .   ? -0.211 9.742   -9.226  1.00 16.72  ? 1067 HOH B O   1 
HETATM 3219 O O   . HOH D 3 .   ? 29.709 -17.613 11.918  1.00 23.38  ? 1068 HOH B O   1 
HETATM 3220 O O   . HOH D 3 .   ? 21.263 -1.558  8.632   1.00 23.74  ? 1072 HOH B O   1 
HETATM 3221 O O   . HOH D 3 .   ? 23.297 -10.984 35.375  1.00 23.67  ? 1074 HOH B O   1 
HETATM 3222 O O   . HOH D 3 .   ? 3.933  0.986   -6.214  1.00 17.78  ? 1080 HOH B O   1 
HETATM 3223 O O   . HOH D 3 .   ? 38.528 -11.801 -1.356  1.00 17.97  ? 1091 HOH B O   1 
HETATM 3224 O O   . HOH D 3 .   ? 22.545 13.606  11.913  1.00 39.08  ? 1092 HOH B O   1 
HETATM 3225 O O   . HOH D 3 .   ? 8.680  -12.654 18.203  1.00 19.29  ? 2003 HOH B O   1 
HETATM 3226 O O   . HOH D 3 .   ? 37.550 -12.079 27.678  1.00 26.82  ? 2004 HOH B O   1 
HETATM 3227 O O   . HOH D 3 .   ? 45.155 -23.441 10.386  1.00 19.65  ? 2005 HOH B O   1 
HETATM 3228 O O   . HOH D 3 .   ? 55.381 -4.608  5.001   1.00 38.28  ? 2034 HOH B O   1 
HETATM 3229 O O   . HOH D 3 .   ? 16.888 13.519  24.199  1.00 18.36  ? 2041 HOH B O   1 
HETATM 3230 O O   . HOH D 3 .   ? 59.640 -12.115 8.696   1.00 24.08  ? 2050 HOH B O   1 
HETATM 3231 O O   . HOH D 3 .   ? 34.833 -16.550 9.606   1.00 31.27  ? 2054 HOH B O   1 
HETATM 3232 O O   . HOH D 3 .   ? 11.928 0.286   -2.713  1.00 37.33  ? 2065 HOH B O   1 
HETATM 3233 O O   . HOH D 3 .   ? 4.658  15.311  0.496   1.00 30.55  ? 2078 HOH B O   1 
HETATM 3234 O O   . HOH D 3 .   ? 36.863 -12.697 35.622  1.00 29.84  ? 2087 HOH B O   1 
HETATM 3235 O O   . HOH D 3 .   ? 7.208  -6.045  -11.930 1.00 39.23  ? 2106 HOH B O   1 
HETATM 3236 O O   . HOH D 3 .   ? 16.240 -0.220  9.893   1.00 34.81  ? 2109 HOH B O   1 
HETATM 3237 O O   . HOH D 3 .   ? 16.212 4.382   14.313  1.00 33.93  ? 2111 HOH B O   1 
HETATM 3238 O O   . HOH D 3 .   ? 37.017 6.749   35.797  1.00 72.33  ? 2122 HOH B O   1 
HETATM 3239 O O   . HOH D 3 .   ? 12.210 2.391   12.025  1.00 31.96  ? 2127 HOH B O   1 
HETATM 3240 O O   . HOH D 3 .   ? 43.671 -9.356  27.167  1.00 21.43  ? 2132 HOH B O   1 
HETATM 3241 O O   . HOH D 3 .   ? 32.561 -5.289  29.016  1.00 25.44  ? 2145 HOH B O   1 
HETATM 3242 O O   . HOH D 3 .   ? 7.723  11.334  13.377  1.00 33.46  ? 2147 HOH B O   1 
HETATM 3243 O O   . HOH D 3 .   ? 2.061  -3.360  -2.739  1.00 49.46  ? 2151 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   -2  ?   ?   ?   A . n 
A 1 2   ASP 2   -1  ?   ?   ?   A . n 
A 1 3   ASP 3   0   ?   ?   ?   A . n 
A 1 4   ILE 4   1   1   ILE ILE A A n 
A 1 5   GLU 5   1   1   GLU GLU A B n 
A 1 6   ALA 6   2   2   ALA ALA A . n 
A 1 7   ASP 7   3   3   ASP ASP A . n 
A 1 8   HIS 8   4   4   HIS HIS A . n 
A 1 9   VAL 9   5   5   VAL VAL A . n 
A 1 10  GLY 10  6   6   GLY GLY A . n 
A 1 11  PHE 11  7   7   PHE PHE A . n 
A 1 12  TYR 12  8   8   TYR TYR A . n 
A 1 13  GLY 13  9   9   GLY GLY A . n 
A 1 14  THR 14  10  10  THR THR A . n 
A 1 15  THR 15  11  11  THR THR A . n 
A 1 16  VAL 16  12  12  VAL VAL A . n 
A 1 17  TYR 17  13  13  TYR TYR A . n 
A 1 18  GLN 18  14  14  GLN GLN A . n 
A 1 19  SER 19  15  15  SER SER A . n 
A 1 20  PRO 20  16  16  PRO PRO A . n 
A 1 21  GLY 21  17  17  GLY GLY A . n 
A 1 22  ASP 22  18  18  ASP ASP A . n 
A 1 23  ILE 23  19  19  ILE ILE A . n 
A 1 24  GLY 24  20  20  GLY GLY A . n 
A 1 25  GLN 25  21  21  GLN GLN A . n 
A 1 26  TYR 26  22  22  TYR TYR A . n 
A 1 27  THR 27  23  23  THR THR A . n 
A 1 28  HIS 28  24  24  HIS HIS A . n 
A 1 29  GLU 29  25  25  GLU GLU A . n 
A 1 30  PHE 30  26  26  PHE PHE A . n 
A 1 31  ASP 31  27  27  ASP ASP A . n 
A 1 32  GLY 32  28  28  GLY GLY A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  LEU 35  31  31  LEU LEU A . n 
A 1 36  PHE 36  32  32  PHE PHE A . n 
A 1 37  TYR 37  33  33  TYR TYR A . n 
A 1 38  VAL 38  34  34  VAL VAL A . n 
A 1 39  ASP 39  35  35  ASP ASP A . n 
A 1 40  LEU 40  36  36  LEU LEU A . n 
A 1 41  ASP 41  37  37  ASP ASP A . n 
A 1 42  LYS 42  38  38  LYS LYS A . n 
A 1 43  LYS 43  39  39  LYS LYS A . n 
A 1 44  LYS 44  40  40  LYS LYS A . n 
A 1 45  THR 45  41  41  THR THR A . n 
A 1 46  VAL 46  42  42  VAL VAL A . n 
A 1 47  TRP 47  43  43  TRP TRP A . n 
A 1 48  ARG 48  44  44  ARG ARG A . n 
A 1 49  LEU 49  45  45  LEU LEU A . n 
A 1 50  PRO 50  46  46  PRO PRO A . n 
A 1 51  GLU 51  47  47  GLU GLU A . n 
A 1 52  PHE 52  48  48  PHE PHE A . n 
A 1 53  GLY 53  49  49  GLY GLY A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  LEU 55  51  51  LEU LEU A . n 
A 1 56  ILE 56  52  52  ILE ILE A . n 
A 1 57  LEU 57  53  53  LEU LEU A . n 
A 1 58  PHE 58  54  54  PHE PHE A . n 
A 1 59  GLU 59  55  55  GLU GLU A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  GLN 61  57  57  GLN GLN A . n 
A 1 62  GLY 62  58  58  GLY GLY A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  LEU 64  60  60  LEU LEU A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  ASN 66  62  62  ASN ASN A . n 
A 1 67  ILE 67  63  63  ILE ILE A . n 
A 1 68  ALA 68  64  64  ALA ALA A . n 
A 1 69  ALA 69  65  65  ALA ALA A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  LYS 71  67  67  LYS LYS A . n 
A 1 72  HIS 72  68  68  HIS HIS A . n 
A 1 73  ASN 73  69  69  ASN ASN A . n 
A 1 74  LEU 74  70  70  LEU LEU A . n 
A 1 75  GLY 75  71  71  GLY GLY A . n 
A 1 76  ILE 76  72  72  ILE ILE A . n 
A 1 77  LEU 77  73  73  LEU LEU A . n 
A 1 78  THR 78  74  74  THR THR A . n 
A 1 79  LYS 79  75  75  LYS LYS A . n 
A 1 80  ARG 80  76  76  ARG ARG A . n 
A 1 81  SER 81  77  77  SER SER A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  PHE 83  79  79  PHE PHE A . n 
A 1 84  THR 84  80  80  THR THR A . n 
A 1 85  PRO 85  81  81  PRO PRO A . n 
A 1 86  ALA 86  82  82  ALA ALA A . n 
A 1 87  THR 87  83  83  THR THR A . n 
A 1 88  ASN 88  84  84  ASN ASN A . n 
A 1 89  GLU 89  85  85  GLU GLU A . n 
A 1 90  ALA 90  86  86  ALA ALA A . n 
A 1 91  PRO 91  87  87  PRO PRO A . n 
A 1 92  GLN 92  88  88  GLN GLN A . n 
A 1 93  ALA 93  89  89  ALA ALA A . n 
A 1 94  THR 94  90  90  THR THR A . n 
A 1 95  VAL 95  91  91  VAL VAL A . n 
A 1 96  PHE 96  92  92  PHE PHE A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  LYS 98  94  94  LYS LYS A . n 
A 1 99  SER 99  95  95  SER SER A . n 
A 1 100 PRO 100 96  96  PRO PRO A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 LEU 102 98  98  LEU LEU A . n 
A 1 103 LEU 103 99  99  LEU LEU A . n 
A 1 104 GLY 104 100 100 GLY GLY A . n 
A 1 105 GLN 105 101 101 GLN GLN A . n 
A 1 106 PRO 106 102 102 PRO PRO A . n 
A 1 107 ASN 107 103 103 ASN ASN A . n 
A 1 108 THR 108 104 104 THR THR A . n 
A 1 109 LEU 109 105 105 LEU LEU A . n 
A 1 110 ILE 110 106 106 ILE ILE A . n 
A 1 111 CYS 111 107 107 CYS CYS A . n 
A 1 112 PHE 112 108 108 PHE PHE A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 ASP 114 110 110 ASP ASP A . n 
A 1 115 ASN 115 111 111 ASN ASN A . n 
A 1 116 ILE 116 112 112 ILE ILE A . n 
A 1 117 PHE 117 113 113 PHE PHE A . n 
A 1 118 PRO 118 114 114 PRO PRO A . n 
A 1 119 PRO 119 115 115 PRO PRO A . n 
A 1 120 VAL 120 116 116 VAL VAL A . n 
A 1 121 ILE 121 117 117 ILE ILE A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ILE 123 119 119 ILE ILE A . n 
A 1 124 THR 124 120 120 THR THR A . n 
A 1 125 TRP 125 121 121 TRP TRP A . n 
A 1 126 LEU 126 122 122 LEU LEU A . n 
A 1 127 ARG 127 123 123 ARG ARG A . n 
A 1 128 ASN 128 124 124 ASN ASN A . n 
A 1 129 SER 129 125 125 SER SER A . n 
A 1 130 LYS 130 126 126 LYS LYS A . n 
A 1 131 SER 131 127 127 SER SER A . n 
A 1 132 VAL 132 128 128 VAL VAL A . n 
A 1 133 THR 133 129 129 THR THR A . n 
A 1 134 ASP 134 130 130 ASP ASP A . n 
A 1 135 GLY 135 131 131 GLY GLY A . n 
A 1 136 VAL 136 132 132 VAL VAL A . n 
A 1 137 TYR 137 133 133 TYR TYR A . n 
A 1 138 GLU 138 134 134 GLU GLU A . n 
A 1 139 THR 139 135 135 THR THR A . n 
A 1 140 SER 140 136 136 SER SER A . n 
A 1 141 PHE 141 137 137 PHE PHE A . n 
A 1 142 LEU 142 138 138 LEU LEU A . n 
A 1 143 VAL 143 139 139 VAL VAL A . n 
A 1 144 ASN 144 140 140 ASN ASN A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 ASP 146 142 142 ASP ASP A . n 
A 1 147 HIS 147 143 143 HIS HIS A . n 
A 1 148 SER 148 144 144 SER SER A . n 
A 1 149 PHE 149 145 145 PHE PHE A . n 
A 1 150 HIS 150 146 146 HIS HIS A . n 
A 1 151 LYS 151 147 147 LYS LYS A . n 
A 1 152 LEU 152 148 148 LEU LEU A . n 
A 1 153 SER 153 149 149 SER SER A . n 
A 1 154 TYR 154 150 150 TYR TYR A . n 
A 1 155 LEU 155 151 151 LEU LEU A . n 
A 1 156 THR 156 152 152 THR THR A . n 
A 1 157 PHE 157 153 153 PHE PHE A . n 
A 1 158 ILE 158 154 154 ILE ILE A . n 
A 1 159 PRO 159 155 155 PRO PRO A . n 
A 1 160 SER 160 156 156 SER SER A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 ASP 162 158 158 ASP ASP A . n 
A 1 163 ASP 163 159 159 ASP ASP A . n 
A 1 164 ILE 164 160 160 ILE ILE A . n 
A 1 165 TYR 165 161 161 TYR TYR A . n 
A 1 166 ASP 166 162 162 ASP ASP A . n 
A 1 167 CYS 167 163 163 CYS CYS A . n 
A 1 168 LYS 168 164 164 LYS LYS A . n 
A 1 169 VAL 169 165 165 VAL VAL A . n 
A 1 170 GLU 170 166 166 GLU GLU A . n 
A 1 171 HIS 171 167 167 HIS HIS A . n 
A 1 172 TRP 172 168 168 TRP TRP A . n 
A 1 173 GLY 173 169 169 GLY GLY A . n 
A 1 174 LEU 174 170 170 LEU LEU A . n 
A 1 175 GLU 175 171 171 GLU GLU A . n 
A 1 176 GLU 176 172 172 GLU GLU A . n 
A 1 177 PRO 177 173 173 PRO PRO A . n 
A 1 178 VAL 178 174 174 VAL VAL A . n 
A 1 179 LEU 179 175 175 LEU LEU A . n 
A 1 180 LYS 180 176 176 LYS LYS A . n 
A 1 181 HIS 181 177 177 HIS HIS A . n 
A 1 182 TRP 182 178 178 TRP TRP A . n 
A 1 183 GLU 183 178 ?   ?   ?   A A n 
A 1 184 PRO 184 178 ?   ?   ?   A B n 
A 1 185 GLU 185 178 ?   ?   ?   A C n 
A 1 186 ILE 186 178 ?   ?   ?   A D n 
A 1 187 SER 187 179 179 SER SER A . n 
A 1 188 SER 188 180 180 SER SER A . n 
A 1 189 ALA 189 181 181 ALA ALA A . n 
A 1 190 ASP 190 182 182 ASP ASP A . n 
A 1 191 LEU 191 183 183 LEU LEU A . n 
A 1 192 VAL 192 184 184 VAL VAL A . n 
A 1 193 PRO 193 185 185 PRO PRO A . n 
A 1 194 ARG 194 186 186 ARG ARG A . n 
B 2 1   GLY 1   2   2   GLY GLY B S n 
B 2 2   HIS 2   126 126 HIS HIS B P n 
B 2 3   ALA 3   127 127 ALA ALA B P n 
B 2 4   THR 4   128 128 THR THR B P n 
B 2 5   GLN 5   129 129 GLN GLN B P n 
B 2 6   GLY 6   130 130 GLY GLY B P n 
B 2 7   VAL 7   131 131 VAL VAL B P n 
B 2 8   THR 8   132 132 THR THR B P n 
B 2 9   ALA 9   133 133 ALA ALA B P n 
B 2 10  ALA 10  134 134 ALA ALA B P n 
B 2 11  SER 11  135 135 SER SER B P n 
B 2 12  SER 12  136 136 SER SER B P n 
B 2 13  HIS 13  137 137 HIS HIS B P n 
B 2 14  GLU 14  138 138 GLU GLU B P n 
B 2 15  GLY 15  1   ?   ?   ?   B . n 
B 2 16  ASN 16  2   ?   ?   ?   B . n 
B 2 17  SER 17  3   ?   ?   ?   B . n 
B 2 18  GLU 18  4   ?   ?   ?   B P n 
B 2 19  ARG 19  5   5   ARG ARG B . n 
B 2 20  HIS 20  6   6   HIS HIS B . n 
B 2 21  PHE 21  7   7   PHE PHE B . n 
B 2 22  VAL 22  8   8   VAL VAL B . n 
B 2 23  VAL 23  9   9   VAL VAL B . n 
B 2 24  GLN 24  10  10  GLN GLN B . n 
B 2 25  PHE 25  11  11  PHE PHE B . n 
B 2 26  LYS 26  12  12  LYS LYS B . n 
B 2 27  GLY 27  13  13  GLY GLY B . n 
B 2 28  GLU 28  14  14  GLU GLU B . n 
B 2 29  CYS 29  15  15  CYS CYS B . n 
B 2 30  TYR 30  16  16  TYR TYR B . n 
B 2 31  TYR 31  17  17  TYR TYR B . n 
B 2 32  THR 32  18  18  THR THR B . n 
B 2 33  ASN 33  19  19  ASN ASN B . n 
B 2 34  GLY 34  20  20  GLY GLY B . n 
B 2 35  THR 35  21  21  THR THR B . n 
B 2 36  GLN 36  22  22  GLN GLN B . n 
B 2 37  ARG 37  23  23  ARG ARG B . n 
B 2 38  ILE 38  24  24  ILE ILE B . n 
B 2 39  ARG 39  25  25  ARG ARG B . n 
B 2 40  LEU 40  26  26  LEU LEU B . n 
B 2 41  VAL 41  27  27  VAL VAL B . n 
B 2 42  THR 42  28  28  THR THR B . n 
B 2 43  ARG 43  29  29  ARG ARG B . n 
B 2 44  TYR 44  30  30  TYR TYR B . n 
B 2 45  ILE 45  31  31  ILE ILE B . n 
B 2 46  TYR 46  32  32  TYR TYR B . n 
B 2 47  ASN 47  33  33  ASN ASN B . n 
B 2 48  ARG 48  34  34  ARG ARG B . n 
B 2 49  GLU 49  35  35  GLU GLU B . n 
B 2 50  GLU 50  36  36  GLU GLU B . n 
B 2 51  TYR 51  37  37  TYR TYR B . n 
B 2 52  VAL 52  38  38  VAL VAL B . n 
B 2 53  ARG 53  39  39  ARG ARG B . n 
B 2 54  TYR 54  40  40  TYR TYR B . n 
B 2 55  ASP 55  41  41  ASP ASP B . n 
B 2 56  SER 56  42  42  SER SER B . n 
B 2 57  ASP 57  43  43  ASP ASP B . n 
B 2 58  VAL 58  44  44  VAL VAL B . n 
B 2 59  GLY 59  45  45  GLY GLY B . n 
B 2 60  GLU 60  46  46  GLU GLU B . n 
B 2 61  TYR 61  47  47  TYR TYR B . n 
B 2 62  ARG 62  48  48  ARG ARG B . n 
B 2 63  ALA 63  49  49  ALA ALA B . n 
B 2 64  VAL 64  50  50  VAL VAL B . n 
B 2 65  THR 65  51  51  THR THR B . n 
B 2 66  GLU 66  52  52  GLU GLU B . n 
B 2 67  LEU 67  53  53  LEU LEU B . n 
B 2 68  GLY 68  54  54  GLY GLY B . n 
B 2 69  ARG 69  55  55  ARG ARG B . n 
B 2 70  PRO 70  56  56  PRO PRO B . n 
B 2 71  ASP 71  57  57  ASP ASP B . n 
B 2 72  ALA 72  58  58  ALA ALA B . n 
B 2 73  GLU 73  59  59  GLU GLU B . n 
B 2 74  TYR 74  60  60  TYR TYR B . n 
B 2 75  TRP 75  61  61  TRP TRP B . n 
B 2 76  ASN 76  62  62  ASN ASN B . n 
B 2 77  SER 77  63  63  SER SER B . n 
B 2 78  GLN 78  64  64  GLN GLN B . n 
B 2 79  PRO 79  65  65  PRO PRO B . n 
B 2 80  GLU 80  66  66  GLU GLU B . n 
B 2 81  ILE 81  67  67  ILE ILE B . n 
B 2 82  LEU 82  68  68  LEU LEU B . n 
B 2 83  GLU 83  69  69  GLU GLU B . n 
B 2 84  ARG 84  70  70  ARG ARG B . n 
B 2 85  THR 85  71  71  THR THR B . n 
B 2 86  ARG 86  72  72  ARG ARG B . n 
B 2 87  ALA 87  73  73  ALA ALA B . n 
B 2 88  GLU 88  74  74  GLU GLU B . n 
B 2 89  VAL 89  75  75  VAL VAL B . n 
B 2 90  ASP 90  76  76  ASP ASP B . n 
B 2 91  THR 91  77  77  THR THR B . n 
B 2 92  ALA 92  78  78  ALA ALA B . n 
B 2 93  CYS 93  79  79  CYS CYS B . n 
B 2 94  ARG 94  80  80  ARG ARG B . n 
B 2 95  HIS 95  81  81  HIS HIS B . n 
B 2 96  ASN 96  82  82  ASN ASN B . n 
B 2 97  TYR 97  83  83  TYR TYR B . n 
B 2 98  GLU 98  84  84  GLU GLU B . n 
B 2 99  GLY 99  85  85  GLY GLY B . n 
B 2 100 PRO 100 86  86  PRO PRO B . n 
B 2 101 GLU 101 87  87  GLU GLU B . n 
B 2 102 THR 102 88  88  THR THR B . n 
B 2 103 SER 103 89  89  SER SER B . n 
B 2 104 THR 104 90  90  THR THR B . n 
B 2 105 SER 105 91  91  SER SER B . n 
B 2 106 LEU 106 92  92  LEU LEU B . n 
B 2 107 ARG 107 93  93  ARG ARG B . n 
B 2 108 ARG 108 94  94  ARG ARG B . n 
B 2 109 LEU 109 94  94  LEU LEU B A n 
B 2 110 GLU 110 95  95  GLU GLU B . n 
B 2 111 GLN 111 96  96  GLN GLN B . n 
B 2 112 PRO 112 97  97  PRO PRO B . n 
B 2 113 ASN 113 98  98  ASN ASN B . n 
B 2 114 VAL 114 99  99  VAL VAL B . n 
B 2 115 ALA 115 100 100 ALA ALA B . n 
B 2 116 ILE 116 101 101 ILE ILE B . n 
B 2 117 SER 117 102 102 SER SER B . n 
B 2 118 LEU 118 103 103 LEU LEU B . n 
B 2 119 SER 119 104 104 SER SER B . n 
B 2 120 ARG 120 105 105 ARG ARG B . n 
B 2 121 THR 121 106 106 THR THR B . n 
B 2 122 GLU 122 107 107 GLU GLU B . n 
B 2 123 ALA 123 108 108 ALA ALA B . n 
B 2 124 LEU 124 109 109 LEU LEU B . n 
B 2 125 ASN 125 110 110 ASN ASN B . n 
B 2 126 HIS 126 111 111 HIS HIS B . n 
B 2 127 HIS 127 112 112 HIS HIS B . n 
B 2 128 ASN 128 113 113 ASN ASN B . n 
B 2 129 THR 129 114 114 THR THR B . n 
B 2 130 LEU 130 115 115 LEU LEU B . n 
B 2 131 VAL 131 116 116 VAL VAL B . n 
B 2 132 CYS 132 117 117 CYS CYS B . n 
B 2 133 SER 133 118 118 SER SER B . n 
B 2 134 VAL 134 119 119 VAL VAL B . n 
B 2 135 THR 135 120 120 THR THR B . n 
B 2 136 ASP 136 121 121 ASP ASP B . n 
B 2 137 PHE 137 122 122 PHE PHE B . n 
B 2 138 TYR 138 123 123 TYR TYR B . n 
B 2 139 PRO 139 124 124 PRO PRO B . n 
B 2 140 ALA 140 125 125 ALA ALA B . n 
B 2 141 LYS 141 126 126 LYS LYS B . n 
B 2 142 ILE 142 127 127 ILE ILE B . n 
B 2 143 LYS 143 128 128 LYS LYS B . n 
B 2 144 VAL 144 129 129 VAL VAL B . n 
B 2 145 ARG 145 130 130 ARG ARG B . n 
B 2 146 TRP 146 131 131 TRP TRP B . n 
B 2 147 PHE 147 132 132 PHE PHE B . n 
B 2 148 ARG 148 133 133 ARG ARG B . n 
B 2 149 ASN 149 134 134 ASN ASN B . n 
B 2 150 GLY 150 135 135 GLY GLY B . n 
B 2 151 GLN 151 136 136 GLN GLN B . n 
B 2 152 GLU 152 137 137 GLU GLU B . n 
B 2 153 GLU 153 138 138 GLU GLU B . n 
B 2 154 THR 154 139 139 THR THR B . n 
B 2 155 VAL 155 140 140 VAL VAL B . n 
B 2 156 GLY 156 141 141 GLY GLY B . n 
B 2 157 VAL 157 142 142 VAL VAL B . n 
B 2 158 SER 158 143 143 SER SER B . n 
B 2 159 SER 159 144 144 SER SER B . n 
B 2 160 THR 160 145 145 THR THR B . n 
B 2 161 GLN 161 146 146 GLN GLN B . n 
B 2 162 LEU 162 147 147 LEU LEU B . n 
B 2 163 ILE 163 148 148 ILE ILE B . n 
B 2 164 ARG 164 149 149 ARG ARG B . n 
B 2 165 ASN 165 150 150 ASN ASN B . n 
B 2 166 GLY 166 151 151 GLY GLY B . n 
B 2 167 ASP 167 152 152 ASP ASP B . n 
B 2 168 TRP 168 153 153 TRP TRP B . n 
B 2 169 THR 169 154 154 THR THR B . n 
B 2 170 PHE 170 155 155 PHE PHE B . n 
B 2 171 GLN 171 156 156 GLN GLN B . n 
B 2 172 VAL 172 157 157 VAL VAL B . n 
B 2 173 LEU 173 158 158 LEU LEU B . n 
B 2 174 VAL 174 159 159 VAL VAL B . n 
B 2 175 MET 175 160 160 MET MET B . n 
B 2 176 LEU 176 161 161 LEU LEU B . n 
B 2 177 GLU 177 162 162 GLU GLU B . n 
B 2 178 MET 178 163 163 MET MET B . n 
B 2 179 THR 179 164 164 THR THR B . n 
B 2 180 PRO 180 165 165 PRO PRO B . n 
B 2 181 HIS 181 166 166 HIS HIS B . n 
B 2 182 GLN 182 167 167 GLN GLN B . n 
B 2 183 GLY 183 168 168 GLY GLY B . n 
B 2 184 GLU 184 169 169 GLU GLU B . n 
B 2 185 VAL 185 170 170 VAL VAL B . n 
B 2 186 TYR 186 171 171 TYR TYR B . n 
B 2 187 THR 187 172 172 THR THR B . n 
B 2 188 CYS 188 173 173 CYS CYS B . n 
B 2 189 HIS 189 174 174 HIS HIS B . n 
B 2 190 VAL 190 175 175 VAL VAL B . n 
B 2 191 GLU 191 176 176 GLU GLU B . n 
B 2 192 HIS 192 177 177 HIS HIS B . n 
B 2 193 PRO 193 178 178 PRO PRO B . n 
B 2 194 SER 194 179 179 SER SER B . n 
B 2 195 LEU 195 180 180 LEU LEU B . n 
B 2 196 LYS 196 181 181 LYS LYS B . n 
B 2 197 SER 197 182 182 SER SER B . n 
B 2 198 PRO 198 183 183 PRO PRO B . n 
B 2 199 ILE 199 184 184 ILE ILE B . n 
B 2 200 THR 200 185 185 THR THR B . n 
B 2 201 VAL 201 186 186 VAL VAL B . n 
B 2 202 GLU 202 187 187 GLU GLU B . n 
B 2 203 TRP 203 188 188 TRP TRP B . n 
B 2 204 SER 204 189 189 SER SER B . n 
B 2 205 SER 205 190 190 SER SER B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  tetrameric 4 
2 software_defined_assembly            PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D 
2 1   A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 5720  ? 
2 MORE         -22   ? 
2 'SSA (A^2)'  18510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-18 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
X-PLOR    refinement       3.8 ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    105 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NE2 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HIS 
_pdbx_validate_close_contact.auth_seq_id_2    112 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.02 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            N 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             186 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             186 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.591 
_pdbx_validate_rmsd_bond.bond_target_value         1.459 
_pdbx_validate_rmsd_bond.bond_deviation            0.132 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.020 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 N  A ALA 181 ? ? CA A ALA 181 ? ? C   A ALA 181 ? ? 88.70  111.00 -22.30 2.70 N 
2  1 N  A VAL 184 ? ? CA A VAL 184 ? ? C   A VAL 184 ? ? 92.64  111.00 -18.36 2.70 N 
3  1 C  A VAL 184 ? ? N  A PRO 185 ? ? CA  A PRO 185 ? ? 136.20 119.30 16.90  1.50 Y 
4  1 C  A VAL 184 ? ? N  A PRO 185 ? ? CD  A PRO 185 ? ? 115.34 128.40 -13.06 2.10 Y 
5  1 CA A PRO 185 ? ? C  A PRO 185 ? ? N   A ARG 186 ? ? 131.29 117.20 14.09  2.20 Y 
6  1 O  A PRO 185 ? ? C  A PRO 185 ? ? N   A ARG 186 ? ? 105.27 122.70 -17.43 1.60 Y 
7  1 NE A ARG 186 ? ? CZ A ARG 186 ? ? NH2 A ARG 186 ? ? 123.66 120.30 3.36   0.50 N 
8  1 N  B THR 106 ? ? CA B THR 106 ? ? CB  B THR 106 ? ? 96.33  110.30 -13.97 1.90 N 
9  1 N  B THR 106 ? ? CA B THR 106 ? ? C   B THR 106 ? ? 140.40 111.00 29.40  2.70 N 
10 1 N  B LEU 109 ? ? CA B LEU 109 ? ? C   B LEU 109 ? ? 136.16 111.00 25.16  2.70 N 
11 1 N  B THR 164 ? ? CA B THR 164 ? ? C   B THR 164 ? ? 94.47  111.00 -16.53 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 8   ? ? -109.93 58.12   
2  1 ASP A 35  ? ? -67.76  98.78   
3  1 LYS A 39  ? ? 70.92   45.39   
4  1 ASN A 78  ? ? 79.56   40.12   
5  1 PRO A 115 ? ? -68.10  62.09   
6  1 PRO A 155 ? ? -30.40  136.07  
7  1 PRO A 185 ? ? 0.17    -10.53  
8  1 ASN B 33  ? ? 70.87   -94.39  
9  1 PRO B 86  ? ? -41.31  -79.74  
10 1 THR B 90  ? ? -123.95 -86.18  
11 1 SER B 104 ? ? -119.04 -167.76 
12 1 THR B 106 ? ? 33.55   -19.36  
13 1 GLU B 107 ? ? -123.59 -162.95 
14 1 HIS B 111 ? ? -159.41 37.24   
15 1 ASN B 134 ? ? 39.90   59.11   
16 1 THR B 164 ? ? -160.62 92.67   
17 1 PRO B 165 ? ? -48.58  171.77  
18 1 SER B 189 ? ? -144.25 -154.75 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ARG 5   ? CB  ? B ARG 19  CB  
2  1 Y 1 B ARG 5   ? CG  ? B ARG 19  CG  
3  1 Y 1 B ARG 5   ? CD  ? B ARG 19  CD  
4  1 Y 1 B ARG 5   ? NE  ? B ARG 19  NE  
5  1 Y 1 B ARG 5   ? CZ  ? B ARG 19  CZ  
6  1 Y 1 B ARG 5   ? NH1 ? B ARG 19  NH1 
7  1 Y 1 B ARG 5   ? NH2 ? B ARG 19  NH2 
8  1 Y 1 B THR 164 ? OG1 ? B THR 179 OG1 
9  1 Y 1 B THR 164 ? CG2 ? B THR 179 CG2 
10 1 Y 1 B HIS 166 ? CG  ? B HIS 181 CG  
11 1 Y 1 B HIS 166 ? ND1 ? B HIS 181 ND1 
12 1 Y 1 B HIS 166 ? CD2 ? B HIS 181 CD2 
13 1 Y 1 B HIS 166 ? CE1 ? B HIS 181 CE1 
14 1 Y 1 B HIS 166 ? NE2 ? B HIS 181 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU -2  ? A GLU 1   
2  1 Y 1 A ASP -1  ? A ASP 2   
3  1 Y 1 A ASP 0   ? A ASP 3   
4  1 Y 1 A GLU 178 A A GLU 183 
5  1 Y 1 A PRO 178 B A PRO 184 
6  1 Y 1 A GLU 178 C A GLU 185 
7  1 Y 1 A ILE 178 D A ILE 186 
8  1 Y 1 B GLY 1   ? B GLY 15  
9  1 Y 1 B ASN 2   ? B ASN 16  
10 1 Y 1 B SER 3   ? B SER 17  
11 1 Y 1 B GLU 4   P B GLU 18  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  1003 1003 HOH HOH A . 
C 3 HOH 2  1004 1004 HOH HOH A . 
C 3 HOH 3  1009 1009 HOH HOH A . 
C 3 HOH 4  1010 1010 HOH HOH A . 
C 3 HOH 5  1011 1011 HOH HOH A . 
C 3 HOH 6  1012 1012 HOH HOH A . 
C 3 HOH 7  1013 1013 HOH HOH A . 
C 3 HOH 8  1016 1016 HOH HOH A . 
C 3 HOH 9  1017 1017 HOH HOH A . 
C 3 HOH 10 1018 1018 HOH HOH A . 
C 3 HOH 11 1020 1020 HOH HOH A . 
C 3 HOH 12 1022 1022 HOH HOH A . 
C 3 HOH 13 1024 1024 HOH HOH A . 
C 3 HOH 14 1025 1025 HOH HOH A . 
C 3 HOH 15 1027 1027 HOH HOH A . 
C 3 HOH 16 1028 1028 HOH HOH A . 
C 3 HOH 17 1029 1029 HOH HOH A . 
C 3 HOH 18 1039 1039 HOH HOH A . 
C 3 HOH 19 1043 1043 HOH HOH A . 
C 3 HOH 20 1044 1044 HOH HOH A . 
C 3 HOH 21 1047 1047 HOH HOH A . 
C 3 HOH 22 1050 1050 HOH HOH A . 
C 3 HOH 23 1052 1052 HOH HOH A . 
C 3 HOH 24 1053 1053 HOH HOH A . 
C 3 HOH 25 1054 1054 HOH HOH A . 
C 3 HOH 26 1057 1057 HOH HOH A . 
C 3 HOH 27 1061 1061 HOH HOH A . 
C 3 HOH 28 1063 1063 HOH HOH A . 
C 3 HOH 29 1069 1069 HOH HOH A . 
C 3 HOH 30 1075 1075 HOH HOH A . 
C 3 HOH 31 1079 1079 HOH HOH A . 
C 3 HOH 32 1083 1083 HOH HOH A . 
C 3 HOH 33 1084 1084 HOH HOH A . 
C 3 HOH 34 1086 1086 HOH HOH A . 
C 3 HOH 35 2001 2001 HOH HOH A . 
C 3 HOH 36 2002 2002 HOH HOH A . 
C 3 HOH 37 2006 2006 HOH HOH A . 
C 3 HOH 38 2008 2008 HOH HOH A . 
C 3 HOH 39 2011 2011 HOH HOH A . 
C 3 HOH 40 2014 2014 HOH HOH A . 
C 3 HOH 41 2016 2016 HOH HOH A . 
C 3 HOH 42 2017 2017 HOH HOH A . 
C 3 HOH 43 2025 2025 HOH HOH A . 
C 3 HOH 44 2033 2033 HOH HOH A . 
C 3 HOH 45 2035 2035 HOH HOH A . 
C 3 HOH 46 2036 2036 HOH HOH A . 
C 3 HOH 47 2038 2038 HOH HOH A . 
C 3 HOH 48 2039 2039 HOH HOH A . 
C 3 HOH 49 2048 2048 HOH HOH A . 
C 3 HOH 50 2060 2060 HOH HOH A . 
C 3 HOH 51 2063 2063 HOH HOH A . 
C 3 HOH 52 2067 2067 HOH HOH A . 
C 3 HOH 53 2069 2069 HOH HOH A . 
C 3 HOH 54 2086 2086 HOH HOH A . 
C 3 HOH 55 2091 2091 HOH HOH A . 
C 3 HOH 56 2092 2092 HOH HOH A . 
C 3 HOH 57 2096 2096 HOH HOH A . 
C 3 HOH 58 2097 2097 HOH HOH A . 
C 3 HOH 59 2105 2105 HOH HOH A . 
C 3 HOH 60 2107 2107 HOH HOH A . 
C 3 HOH 61 2112 2112 HOH HOH A . 
C 3 HOH 62 2116 2116 HOH HOH A . 
C 3 HOH 63 2123 2123 HOH HOH A . 
C 3 HOH 64 2124 2124 HOH HOH A . 
C 3 HOH 65 2125 2125 HOH HOH A . 
C 3 HOH 66 2126 2126 HOH HOH A . 
C 3 HOH 67 2130 2130 HOH HOH A . 
C 3 HOH 68 2138 2138 HOH HOH A . 
C 3 HOH 69 2140 2140 HOH HOH A . 
C 3 HOH 70 2141 2141 HOH HOH A . 
C 3 HOH 71 2143 2143 HOH HOH A . 
C 3 HOH 72 2144 2144 HOH HOH A . 
C 3 HOH 73 2152 2152 HOH HOH A . 
D 3 HOH 1  1026 1026 HOH HOH B . 
D 3 HOH 2  1030 1030 HOH HOH B . 
D 3 HOH 3  1031 1031 HOH HOH B . 
D 3 HOH 4  1032 1032 HOH HOH B . 
D 3 HOH 5  1033 1033 HOH HOH B . 
D 3 HOH 6  1037 1037 HOH HOH B . 
D 3 HOH 7  1041 1041 HOH HOH B . 
D 3 HOH 8  1045 1045 HOH HOH B . 
D 3 HOH 9  1049 1049 HOH HOH B . 
D 3 HOH 10 1051 1051 HOH HOH B . 
D 3 HOH 11 1056 1056 HOH HOH B . 
D 3 HOH 12 1060 1060 HOH HOH B . 
D 3 HOH 13 1062 1062 HOH HOH B . 
D 3 HOH 14 1065 1065 HOH HOH B . 
D 3 HOH 15 1066 1066 HOH HOH B . 
D 3 HOH 16 1067 1067 HOH HOH B . 
D 3 HOH 17 1068 1068 HOH HOH B . 
D 3 HOH 18 1072 1072 HOH HOH B . 
D 3 HOH 19 1074 1074 HOH HOH B . 
D 3 HOH 20 1080 1080 HOH HOH B . 
D 3 HOH 21 1091 1091 HOH HOH B . 
D 3 HOH 22 1092 1092 HOH HOH B . 
D 3 HOH 23 2003 2003 HOH HOH B . 
D 3 HOH 24 2004 2004 HOH HOH B . 
D 3 HOH 25 2005 2005 HOH HOH B . 
D 3 HOH 26 2034 2034 HOH HOH B . 
D 3 HOH 27 2041 2041 HOH HOH B . 
D 3 HOH 28 2050 2050 HOH HOH B . 
D 3 HOH 29 2054 2054 HOH HOH B . 
D 3 HOH 30 2065 2065 HOH HOH B . 
D 3 HOH 31 2078 2078 HOH HOH B . 
D 3 HOH 32 2087 2087 HOH HOH B . 
D 3 HOH 33 2106 2106 HOH HOH B . 
D 3 HOH 34 2109 2109 HOH HOH B . 
D 3 HOH 35 2111 2111 HOH HOH B . 
D 3 HOH 36 2122 2122 HOH HOH B . 
D 3 HOH 37 2127 2127 HOH HOH B . 
D 3 HOH 38 2132 2132 HOH HOH B . 
D 3 HOH 39 2145 2145 HOH HOH B . 
D 3 HOH 40 2147 2147 HOH HOH B . 
D 3 HOH 41 2151 2151 HOH HOH B . 
#