data_2IAG
# 
_entry.id   2IAG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IAG         
RCSB  RCSB039339   
WWPDB D_1000039339 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IAG 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chiang, C.-W.' 1 
'Yeh, H.-C.'    2 
'Wang, L.-H.'   3 
'Chan, N.-L.'   4 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the Human Prostacyclin Synthase' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            364 
_citation.page_first                266 
_citation.page_last                 274 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17020766 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.09.039 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chiang, C.-W.' 1 
primary 'Yeh, H.-C.'    2 
primary 'Wang, L.-H.'   3 
primary 'Chan, N.-L.'   4 
# 
_cell.entry_id           2IAG 
_cell.length_a           67.733 
_cell.length_b           105.596 
_cell.length_c           73.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.01 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IAG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Prostacyclin synthase'           55355.395 2   5.3.99.4 ? 'residues 23-500' ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2   ?        ? ?                 ? 
3 non-polymer syn 'SODIUM ION'                      22.990    1   ?        ? ?                 ? 
4 water       nat water                             18.015    435 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Prostaglandin I2 synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIF
LMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYG
IEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLH
LEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLD
SVLSESLRLTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYK
DGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRPHH
HH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIF
LMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYG
IEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLH
LEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLD
SVLSESLRLTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYK
DGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRPHH
HH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   THR n 
1 3   ARG n 
1 4   ARG n 
1 5   PRO n 
1 6   GLY n 
1 7   GLU n 
1 8   PRO n 
1 9   PRO n 
1 10  LEU n 
1 11  ASP n 
1 12  LEU n 
1 13  GLY n 
1 14  SER n 
1 15  ILE n 
1 16  PRO n 
1 17  TRP n 
1 18  LEU n 
1 19  GLY n 
1 20  TYR n 
1 21  ALA n 
1 22  LEU n 
1 23  ASP n 
1 24  PHE n 
1 25  GLY n 
1 26  LYS n 
1 27  ASP n 
1 28  ALA n 
1 29  ALA n 
1 30  SER n 
1 31  PHE n 
1 32  LEU n 
1 33  THR n 
1 34  ARG n 
1 35  MET n 
1 36  LYS n 
1 37  GLU n 
1 38  LYS n 
1 39  HIS n 
1 40  GLY n 
1 41  ASP n 
1 42  ILE n 
1 43  PHE n 
1 44  THR n 
1 45  ILE n 
1 46  LEU n 
1 47  VAL n 
1 48  GLY n 
1 49  GLY n 
1 50  ARG n 
1 51  TYR n 
1 52  VAL n 
1 53  THR n 
1 54  VAL n 
1 55  LEU n 
1 56  LEU n 
1 57  ASP n 
1 58  PRO n 
1 59  HIS n 
1 60  SER n 
1 61  TYR n 
1 62  ASP n 
1 63  ALA n 
1 64  VAL n 
1 65  VAL n 
1 66  TRP n 
1 67  GLU n 
1 68  PRO n 
1 69  ARG n 
1 70  THR n 
1 71  ARG n 
1 72  LEU n 
1 73  ASP n 
1 74  PHE n 
1 75  HIS n 
1 76  ALA n 
1 77  TYR n 
1 78  ALA n 
1 79  ILE n 
1 80  PHE n 
1 81  LEU n 
1 82  MET n 
1 83  GLU n 
1 84  ARG n 
1 85  ILE n 
1 86  PHE n 
1 87  ASP n 
1 88  VAL n 
1 89  GLN n 
1 90  LEU n 
1 91  PRO n 
1 92  HIS n 
1 93  TYR n 
1 94  SER n 
1 95  PRO n 
1 96  SER n 
1 97  ASP n 
1 98  GLU n 
1 99  LYS n 
1 100 ALA n 
1 101 ARG n 
1 102 MET n 
1 103 LYS n 
1 104 LEU n 
1 105 THR n 
1 106 LEU n 
1 107 LEU n 
1 108 HIS n 
1 109 ARG n 
1 110 GLU n 
1 111 LEU n 
1 112 GLN n 
1 113 ALA n 
1 114 LEU n 
1 115 THR n 
1 116 GLU n 
1 117 ALA n 
1 118 MET n 
1 119 TYR n 
1 120 THR n 
1 121 ASN n 
1 122 LEU n 
1 123 HIS n 
1 124 ALA n 
1 125 VAL n 
1 126 LEU n 
1 127 LEU n 
1 128 GLY n 
1 129 ASP n 
1 130 ALA n 
1 131 THR n 
1 132 GLU n 
1 133 ALA n 
1 134 GLY n 
1 135 SER n 
1 136 GLY n 
1 137 TRP n 
1 138 HIS n 
1 139 GLU n 
1 140 MET n 
1 141 GLY n 
1 142 LEU n 
1 143 LEU n 
1 144 ASP n 
1 145 PHE n 
1 146 SER n 
1 147 TYR n 
1 148 SER n 
1 149 PHE n 
1 150 LEU n 
1 151 LEU n 
1 152 ARG n 
1 153 ALA n 
1 154 GLY n 
1 155 TYR n 
1 156 LEU n 
1 157 THR n 
1 158 LEU n 
1 159 TYR n 
1 160 GLY n 
1 161 ILE n 
1 162 GLU n 
1 163 ALA n 
1 164 LEU n 
1 165 PRO n 
1 166 ARG n 
1 167 THR n 
1 168 HIS n 
1 169 GLU n 
1 170 SER n 
1 171 GLN n 
1 172 ALA n 
1 173 GLN n 
1 174 ASP n 
1 175 ARG n 
1 176 VAL n 
1 177 HIS n 
1 178 SER n 
1 179 ALA n 
1 180 ASP n 
1 181 VAL n 
1 182 PHE n 
1 183 HIS n 
1 184 THR n 
1 185 PHE n 
1 186 ARG n 
1 187 GLN n 
1 188 LEU n 
1 189 ASP n 
1 190 ARG n 
1 191 LEU n 
1 192 LEU n 
1 193 PRO n 
1 194 LYS n 
1 195 LEU n 
1 196 ALA n 
1 197 ARG n 
1 198 GLY n 
1 199 SER n 
1 200 LEU n 
1 201 SER n 
1 202 VAL n 
1 203 GLY n 
1 204 ASP n 
1 205 LYS n 
1 206 ASP n 
1 207 HIS n 
1 208 MET n 
1 209 CYS n 
1 210 SER n 
1 211 VAL n 
1 212 LYS n 
1 213 SER n 
1 214 ARG n 
1 215 LEU n 
1 216 TRP n 
1 217 LYS n 
1 218 LEU n 
1 219 LEU n 
1 220 SER n 
1 221 PRO n 
1 222 ALA n 
1 223 ARG n 
1 224 LEU n 
1 225 ALA n 
1 226 ARG n 
1 227 ARG n 
1 228 ALA n 
1 229 HIS n 
1 230 ARG n 
1 231 SER n 
1 232 LYS n 
1 233 TRP n 
1 234 LEU n 
1 235 GLU n 
1 236 SER n 
1 237 TYR n 
1 238 LEU n 
1 239 LEU n 
1 240 HIS n 
1 241 LEU n 
1 242 GLU n 
1 243 GLU n 
1 244 MET n 
1 245 GLY n 
1 246 VAL n 
1 247 SER n 
1 248 GLU n 
1 249 GLU n 
1 250 MET n 
1 251 GLN n 
1 252 ALA n 
1 253 ARG n 
1 254 ALA n 
1 255 LEU n 
1 256 VAL n 
1 257 LEU n 
1 258 GLN n 
1 259 LEU n 
1 260 TRP n 
1 261 ALA n 
1 262 THR n 
1 263 GLN n 
1 264 GLY n 
1 265 ASN n 
1 266 MET n 
1 267 GLY n 
1 268 PRO n 
1 269 ALA n 
1 270 ALA n 
1 271 PHE n 
1 272 TRP n 
1 273 LEU n 
1 274 LEU n 
1 275 LEU n 
1 276 PHE n 
1 277 LEU n 
1 278 LEU n 
1 279 LYS n 
1 280 ASN n 
1 281 PRO n 
1 282 GLU n 
1 283 ALA n 
1 284 LEU n 
1 285 ALA n 
1 286 ALA n 
1 287 VAL n 
1 288 ARG n 
1 289 GLY n 
1 290 GLU n 
1 291 LEU n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 LEU n 
1 296 TRP n 
1 297 GLN n 
1 298 ALA n 
1 299 GLU n 
1 300 GLN n 
1 301 PRO n 
1 302 VAL n 
1 303 SER n 
1 304 GLN n 
1 305 THR n 
1 306 THR n 
1 307 THR n 
1 308 LEU n 
1 309 PRO n 
1 310 GLN n 
1 311 LYS n 
1 312 VAL n 
1 313 LEU n 
1 314 ASP n 
1 315 SER n 
1 316 THR n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 ASP n 
1 321 SER n 
1 322 VAL n 
1 323 LEU n 
1 324 SER n 
1 325 GLU n 
1 326 SER n 
1 327 LEU n 
1 328 ARG n 
1 329 LEU n 
1 330 THR n 
1 331 ALA n 
1 332 ALA n 
1 333 PRO n 
1 334 PHE n 
1 335 ILE n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 VAL n 
1 340 VAL n 
1 341 VAL n 
1 342 ASP n 
1 343 LEU n 
1 344 ALA n 
1 345 MET n 
1 346 PRO n 
1 347 MET n 
1 348 ALA n 
1 349 ASP n 
1 350 GLY n 
1 351 ARG n 
1 352 GLU n 
1 353 PHE n 
1 354 ASN n 
1 355 LEU n 
1 356 ARG n 
1 357 ARG n 
1 358 GLY n 
1 359 ASP n 
1 360 ARG n 
1 361 LEU n 
1 362 LEU n 
1 363 LEU n 
1 364 PHE n 
1 365 PRO n 
1 366 PHE n 
1 367 LEU n 
1 368 SER n 
1 369 PRO n 
1 370 GLN n 
1 371 ARG n 
1 372 ASP n 
1 373 PRO n 
1 374 GLU n 
1 375 ILE n 
1 376 TYR n 
1 377 THR n 
1 378 ASP n 
1 379 PRO n 
1 380 GLU n 
1 381 VAL n 
1 382 PHE n 
1 383 LYS n 
1 384 TYR n 
1 385 ASN n 
1 386 ARG n 
1 387 PHE n 
1 388 LEU n 
1 389 ASN n 
1 390 PRO n 
1 391 ASP n 
1 392 GLY n 
1 393 SER n 
1 394 GLU n 
1 395 LYS n 
1 396 LYS n 
1 397 ASP n 
1 398 PHE n 
1 399 TYR n 
1 400 LYS n 
1 401 ASP n 
1 402 GLY n 
1 403 LYS n 
1 404 ARG n 
1 405 LEU n 
1 406 LYS n 
1 407 ASN n 
1 408 TYR n 
1 409 ASN n 
1 410 MET n 
1 411 PRO n 
1 412 TRP n 
1 413 GLY n 
1 414 ALA n 
1 415 GLY n 
1 416 HIS n 
1 417 ASN n 
1 418 HIS n 
1 419 CYS n 
1 420 LEU n 
1 421 GLY n 
1 422 ARG n 
1 423 SER n 
1 424 TYR n 
1 425 ALA n 
1 426 VAL n 
1 427 ASN n 
1 428 SER n 
1 429 ILE n 
1 430 LYS n 
1 431 GLN n 
1 432 PHE n 
1 433 VAL n 
1 434 PHE n 
1 435 LEU n 
1 436 VAL n 
1 437 LEU n 
1 438 VAL n 
1 439 HIS n 
1 440 LEU n 
1 441 ASP n 
1 442 LEU n 
1 443 GLU n 
1 444 LEU n 
1 445 ILE n 
1 446 ASN n 
1 447 ALA n 
1 448 ASP n 
1 449 VAL n 
1 450 GLU n 
1 451 ILE n 
1 452 PRO n 
1 453 GLU n 
1 454 PHE n 
1 455 ASP n 
1 456 LEU n 
1 457 SER n 
1 458 ARG n 
1 459 TYR n 
1 460 GLY n 
1 461 PHE n 
1 462 GLY n 
1 463 LEU n 
1 464 MET n 
1 465 GLN n 
1 466 PRO n 
1 467 GLU n 
1 468 HIS n 
1 469 ASP n 
1 470 VAL n 
1 471 PRO n 
1 472 VAL n 
1 473 ARG n 
1 474 TYR n 
1 475 ARG n 
1 476 ILE n 
1 477 ARG n 
1 478 PRO n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTGIS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3), B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCW 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Plasmid pCW was a gift from Dr. Amy Roth, University of Oregon.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTGIS_HUMAN 
_struct_ref.pdbx_db_accession          Q16647 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIF
LMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYG
IEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLH
LEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLD
SVLSESLRLTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYK
DGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
;
_struct_ref.pdbx_align_begin           23 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IAG A 1 ? 478 ? Q16647 23 ? 500 ? 23 500 
2 1 2IAG B 1 ? 478 ? Q16647 23 ? 500 ? 23 500 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IAG HIS A 479 ? UNP Q16647 ? ? 'EXPRESSION TAG' 501 1 
1 2IAG HIS A 480 ? UNP Q16647 ? ? 'EXPRESSION TAG' 502 2 
1 2IAG HIS A 481 ? UNP Q16647 ? ? 'EXPRESSION TAG' 503 3 
1 2IAG HIS A 482 ? UNP Q16647 ? ? 'EXPRESSION TAG' 504 4 
2 2IAG HIS B 479 ? UNP Q16647 ? ? 'EXPRESSION TAG' 501 5 
2 2IAG HIS B 480 ? UNP Q16647 ? ? 'EXPRESSION TAG' 502 6 
2 2IAG HIS B 481 ? UNP Q16647 ? ? 'EXPRESSION TAG' 503 7 
2 2IAG HIS B 482 ? UNP Q16647 ? ? 'EXPRESSION TAG' 504 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
NA  non-polymer         . 'SODIUM ION'                      ?    'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2IAG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;The native recombinant PGIS (25 mg/ml in the buffer containing 20 mM Tris, pH 8.0 and 150 mM NaCl) was 
found to crystallize spontaneously into needle clusters in the Eppendorf tube when stored at 4 C for 
about a week. A combination of microseeding technique and the hanging-drop vapor-diffusion method was 
then used to improve crystal quality. Specifically, seed stock was prepared by crushing these initial 
PGIS needle clusters with the Seed Bead Kit (Hampton Research). Following four 10-fold serial dilutions 
of the seed stock using the gel filtration buffer, 1 micro-l of diluted seeds was added into a 10 
micro-l drop of freshly concentrated PGIS sample, and equilibrated at 4 C against 450 micro-l of the 
gel filtration buffer. High quality single crystals of PGIS were most often obtained using 100- or 
1000-fold diluted seed stock, and reached suitable size (~ 0.05,0.05 ~ 0.1 mm3) within one week., 
VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315' 2006-06-29 ? 
2 CCD 'ADSC QUANTUM 4'   2006-05-15 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.980127 1.0 
2 0.9537   1.0 
3 0.9793   1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSRRC BEAMLINE BL13B1'    NSRRC    BL13B1 ? 0.980127         
2 SYNCHROTRON 'SPRING-8 BEAMLINE BL12B2' SPring-8 BL12B2 ? '0.9537, 0.9793' 
# 
_reflns.entry_id                     2IAG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   51322 
_reflns.number_all                   56459 
_reflns.percent_possible_obs         90.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.063 
_reflns.pdbx_netI_over_sigmaI        12.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   93.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.35 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2IAG 
_refine.ls_number_reflns_obs                     48702 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.15 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    90.96 
_refine.ls_R_factor_obs                          0.20407 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2009 
_refine.ls_R_factor_R_free                       0.26313 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2601 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               26.948 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.322 
_refine.pdbx_overall_ESU_R_Free                  0.243 
_refine.overall_SU_ML                            0.155 
_refine.overall_SU_B                             5.798 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7611 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         87 
_refine_hist.number_atoms_solvent             435 
_refine_hist.number_atoms_total               8133 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        20.15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 7915  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.380  2.001  ? 10757 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.177  5.000  ? 935   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.256 22.433 ? 374   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.588 15.000 ? 1325  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.433 15.000 ? 74    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.095  0.200  ? 1144  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 6066  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.205  0.200  ? 3657  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 5280  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.160  0.200  ? 480   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.192  0.200  ? 84    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.154  0.200  ? 25    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.642  1.500  ? 4689  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.213  2.000  ? 7541  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.961  3.000  ? 3373  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.987  4.500  ? 3216  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.151 
_refine_ls_shell.d_res_low                        2.206 
_refine_ls_shell.number_reflns_R_work             3616 
_refine_ls_shell.R_factor_R_work                  0.215 
_refine_ls_shell.percent_reflns_obs               93.29 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             195 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IAG 
_struct.title                     'Crystal structure of human prostacyclin synthase' 
_struct.pdbx_descriptor           'Prostacyclin synthase (E.C.5.3.99.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IAG 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'prostacyclin synthase, Class III cytochorme P450, hemoprotein, CYP8A1, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'There are two prostacyclin synthase molecules in the asymmetric unit, but the enzyme should function as a monomer.' ? 
2 ?                                                                                                                    ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 20  ? ASP A 27  ? TYR A 42  ASP A 49  1 ? 8  
HELX_P HELX_P2  2  ASP A 27  ? GLY A 40  ? ASP A 49  GLY A 62  1 ? 14 
HELX_P HELX_P3  3  ASP A 57  ? SER A 60  ? ASP A 79  SER A 82  5 ? 4  
HELX_P HELX_P4  4  TYR A 61  ? TRP A 66  ? TYR A 83  TRP A 88  1 ? 6  
HELX_P HELX_P5  5  PHE A 74  ? ASP A 87  ? PHE A 96  ASP A 109 1 ? 14 
HELX_P HELX_P6  6  SER A 94  ? THR A 105 ? SER A 116 THR A 127 1 ? 12 
HELX_P HELX_P7  7  LEU A 107 ? GLY A 134 ? LEU A 129 GLY A 156 1 ? 28 
HELX_P HELX_P8  8  LEU A 142 ? GLY A 160 ? LEU A 164 GLY A 182 1 ? 19 
HELX_P HELX_P9  9  THR A 167 ? LEU A 191 ? THR A 189 LEU A 213 1 ? 25 
HELX_P HELX_P10 10 LEU A 191 ? GLY A 198 ? LEU A 213 GLY A 220 1 ? 8  
HELX_P HELX_P11 11 SER A 201 ? LEU A 219 ? SER A 223 LEU A 241 1 ? 19 
HELX_P HELX_P12 12 SER A 220 ? ALA A 225 ? SER A 242 ALA A 247 1 ? 6  
HELX_P HELX_P13 13 SER A 231 ? MET A 244 ? SER A 253 MET A 266 1 ? 14 
HELX_P HELX_P14 14 SER A 247 ? GLY A 264 ? SER A 269 GLY A 286 1 ? 18 
HELX_P HELX_P15 15 ASN A 265 ? ASN A 280 ? ASN A 287 ASN A 302 1 ? 16 
HELX_P HELX_P16 16 ASN A 280 ? TRP A 296 ? ASN A 302 TRP A 318 1 ? 17 
HELX_P HELX_P17 17 PRO A 309 ? SER A 315 ? PRO A 331 SER A 337 1 ? 7  
HELX_P HELX_P18 18 THR A 316 ? ALA A 331 ? THR A 338 ALA A 353 1 ? 16 
HELX_P HELX_P19 19 GLY A 421 ? HIS A 439 ? GLY A 443 HIS A 461 1 ? 19 
HELX_P HELX_P20 20 ASP A 455 ? TYR A 459 ? ASP A 477 TYR A 481 5 ? 5  
HELX_P HELX_P21 21 TYR B 20  ? ASP B 27  ? TYR B 42  ASP B 49  1 ? 8  
HELX_P HELX_P22 22 ASP B 27  ? GLY B 40  ? ASP B 49  GLY B 62  1 ? 14 
HELX_P HELX_P23 23 ASP B 57  ? HIS B 59  ? ASP B 79  HIS B 81  5 ? 3  
HELX_P HELX_P24 24 SER B 60  ? TRP B 66  ? SER B 82  TRP B 88  1 ? 7  
HELX_P HELX_P25 25 PHE B 74  ? ASP B 87  ? PHE B 96  ASP B 109 1 ? 14 
HELX_P HELX_P26 26 SER B 94  ? THR B 105 ? SER B 116 THR B 127 1 ? 12 
HELX_P HELX_P27 27 LEU B 107 ? GLY B 134 ? LEU B 129 GLY B 156 1 ? 28 
HELX_P HELX_P28 28 LEU B 142 ? GLY B 160 ? LEU B 164 GLY B 182 1 ? 19 
HELX_P HELX_P29 29 THR B 167 ? GLY B 198 ? THR B 189 GLY B 220 1 ? 32 
HELX_P HELX_P30 30 SER B 201 ? LEU B 219 ? SER B 223 LEU B 241 1 ? 19 
HELX_P HELX_P31 31 SER B 220 ? ARG B 226 ? SER B 242 ARG B 248 1 ? 7  
HELX_P HELX_P32 32 SER B 231 ? MET B 244 ? SER B 253 MET B 266 1 ? 14 
HELX_P HELX_P33 33 SER B 247 ? GLY B 264 ? SER B 269 GLY B 286 1 ? 18 
HELX_P HELX_P34 34 ASN B 265 ? LYS B 279 ? ASN B 287 LYS B 301 1 ? 15 
HELX_P HELX_P35 35 ASN B 280 ? TRP B 296 ? ASN B 302 TRP B 318 1 ? 17 
HELX_P HELX_P36 36 GLN B 310 ? SER B 315 ? GLN B 332 SER B 337 1 ? 6  
HELX_P HELX_P37 37 THR B 316 ? ALA B 331 ? THR B 338 ALA B 353 1 ? 16 
HELX_P HELX_P38 38 ALA B 414 ? HIS B 418 ? ALA B 436 HIS B 440 5 ? 5  
HELX_P HELX_P39 39 GLY B 421 ? HIS B 439 ? GLY B 443 HIS B 461 1 ? 19 
HELX_P HELX_P40 40 ASP B 455 ? TYR B 459 ? ASP B 477 TYR B 481 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C HEM . FE ? ? ? 1_555 A CYS 419 SG ? ? A HEM 600 A CYS 441 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc2 metalc ? ? E HEM . FE ? ? ? 1_555 B CYS 419 SG ? ? B HEM 600 B CYS 441 1_555 ? ? ? ? ? ? ? 2.465 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 368 A . ? SER 390 A PRO 369 A ? PRO 391 A 1 11.39 
2 SER 368 B . ? SER 390 B PRO 369 B ? PRO 391 B 1 10.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 6 ? 
G ? 3 ? 
H ? 2 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 10  ? ASP A 11  ? LEU A 32  ASP A 33  
A 2 ILE A 42  ? VAL A 47  ? ILE A 64  VAL A 69  
A 3 ARG A 50  ? LEU A 55  ? ARG A 72  LEU A 77  
A 4 ARG A 360 ? LEU A 363 ? ARG A 382 LEU A 385 
A 5 ILE A 335 ? VAL A 339 ? ILE A 357 VAL A 361 
A 6 LEU A 72  ? ASP A 73  ? LEU A 94  ASP A 95  
B 1 HIS A 138 ? GLY A 141 ? HIS A 160 GLY A 163 
B 2 PRO A 471 ? ILE A 476 ? PRO A 493 ILE A 498 
B 3 LEU A 440 ? LEU A 444 ? LEU A 462 LEU A 466 
C 1 LEU A 343 ? PRO A 346 ? LEU A 365 PRO A 368 
C 2 GLU A 352 ? LEU A 355 ? GLU A 374 LEU A 377 
D 1 TYR A 399 ? LYS A 400 ? TYR A 421 LYS A 422 
D 2 LYS A 403 ? ARG A 404 ? LYS A 425 ARG A 426 
E 1 GLY A 413 ? ALA A 414 ? GLY A 435 ALA A 436 
E 2 ASN A 417 ? HIS A 418 ? ASN A 439 HIS A 440 
F 1 LEU B 10  ? ASP B 11  ? LEU B 32  ASP B 33  
F 2 ILE B 42  ? VAL B 47  ? ILE B 64  VAL B 69  
F 3 ARG B 50  ? LEU B 55  ? ARG B 72  LEU B 77  
F 4 ARG B 360 ? LEU B 363 ? ARG B 382 LEU B 385 
F 5 ILE B 335 ? VAL B 339 ? ILE B 357 VAL B 361 
F 6 LEU B 72  ? ASP B 73  ? LEU B 94  ASP B 95  
G 1 HIS B 138 ? GLY B 141 ? HIS B 160 GLY B 163 
G 2 PRO B 471 ? ILE B 476 ? PRO B 493 ILE B 498 
G 3 LEU B 440 ? LEU B 444 ? LEU B 462 LEU B 466 
H 1 LEU B 343 ? PRO B 346 ? LEU B 365 PRO B 368 
H 2 GLU B 352 ? LEU B 355 ? GLU B 374 LEU B 377 
I 1 TYR B 399 ? LYS B 400 ? TYR B 421 LYS B 422 
I 2 LYS B 403 ? ARG B 404 ? LYS B 425 ARG B 426 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 11  ? N ASP A 33  O THR A 44  ? O THR A 66  
A 2 3 N ILE A 45  ? N ILE A 67  O VAL A 52  ? O VAL A 74  
A 3 4 N THR A 53  ? N THR A 75  O ARG A 360 ? O ARG A 382 
A 4 5 O LEU A 361 ? O LEU A 383 N ARG A 337 ? N ARG A 359 
A 5 6 O GLU A 338 ? O GLU A 360 N ASP A 73  ? N ASP A 95  
B 1 2 N MET A 140 ? N MET A 162 O VAL A 472 ? O VAL A 494 
B 2 3 O ARG A 473 ? O ARG A 495 N GLU A 443 ? N GLU A 465 
C 1 2 N MET A 345 ? N MET A 367 O PHE A 353 ? O PHE A 375 
D 1 2 N LYS A 400 ? N LYS A 422 O LYS A 403 ? O LYS A 425 
E 1 2 N ALA A 414 ? N ALA A 436 O ASN A 417 ? O ASN A 439 
F 1 2 N ASP B 11  ? N ASP B 33  O THR B 44  ? O THR B 66  
F 2 3 N PHE B 43  ? N PHE B 65  O VAL B 54  ? O VAL B 76  
F 3 4 N THR B 53  ? N THR B 75  O ARG B 360 ? O ARG B 382 
F 4 5 O LEU B 361 ? O LEU B 383 N ARG B 337 ? N ARG B 359 
F 5 6 O GLU B 338 ? O GLU B 360 N ASP B 73  ? N ASP B 95  
G 1 2 N MET B 140 ? N MET B 162 O VAL B 472 ? O VAL B 494 
G 2 3 O ARG B 475 ? O ARG B 497 N ASP B 441 ? N ASP B 463 
H 1 2 N MET B 345 ? N MET B 367 O PHE B 353 ? O PHE B 375 
I 1 2 N LYS B 400 ? N LYS B 422 O LYS B 403 ? O LYS B 425 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 600' 
AC2 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE HEM B 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 MET A 102 ? MET A 124 . ? 1_555 ? 
2  AC1 17 GLN A 258 ? GLN A 280 . ? 1_555 ? 
3  AC1 17 ALA A 261 ? ALA A 283 . ? 1_555 ? 
4  AC1 17 THR A 262 ? THR A 284 . ? 1_555 ? 
5  AC1 17 ASN A 265 ? ASN A 287 . ? 1_555 ? 
6  AC1 17 PRO A 411 ? PRO A 433 . ? 1_555 ? 
7  AC1 17 TRP A 412 ? TRP A 434 . ? 1_555 ? 
8  AC1 17 GLY A 413 ? GLY A 435 . ? 1_555 ? 
9  AC1 17 ASN A 417 ? ASN A 439 . ? 1_555 ? 
10 AC1 17 CYS A 419 ? CYS A 441 . ? 1_555 ? 
11 AC1 17 LEU A 420 ? LEU A 442 . ? 1_555 ? 
12 AC1 17 GLY A 421 ? GLY A 443 . ? 1_555 ? 
13 AC1 17 TYR A 424 ? TYR A 446 . ? 1_555 ? 
14 AC1 17 ALA A 425 ? ALA A 447 . ? 1_555 ? 
15 AC1 17 LEU A 463 ? LEU A 485 . ? 1_555 ? 
16 AC1 17 HOH F .   ? HOH A 807 . ? 1_555 ? 
17 AC1 17 HOH F .   ? HOH A 812 . ? 1_555 ? 
18 AC2 19 LYS B 99  ? LYS B 121 . ? 1_555 ? 
19 AC2 19 MET B 102 ? MET B 124 . ? 1_555 ? 
20 AC2 19 LEU B 106 ? LEU B 128 . ? 1_555 ? 
21 AC2 19 ALA B 261 ? ALA B 283 . ? 1_555 ? 
22 AC2 19 THR B 262 ? THR B 284 . ? 1_555 ? 
23 AC2 19 ASN B 265 ? ASN B 287 . ? 1_555 ? 
24 AC2 19 MET B 266 ? MET B 288 . ? 1_555 ? 
25 AC2 19 PRO B 333 ? PRO B 355 . ? 1_555 ? 
26 AC2 19 PRO B 411 ? PRO B 433 . ? 1_555 ? 
27 AC2 19 TRP B 412 ? TRP B 434 . ? 1_555 ? 
28 AC2 19 GLY B 413 ? GLY B 435 . ? 1_555 ? 
29 AC2 19 ASN B 417 ? ASN B 439 . ? 1_555 ? 
30 AC2 19 CYS B 419 ? CYS B 441 . ? 1_555 ? 
31 AC2 19 LEU B 420 ? LEU B 442 . ? 1_555 ? 
32 AC2 19 GLY B 421 ? GLY B 443 . ? 1_555 ? 
33 AC2 19 ALA B 425 ? ALA B 447 . ? 1_555 ? 
34 AC2 19 LEU B 463 ? LEU B 485 . ? 1_555 ? 
35 AC2 19 HOH G .   ? HOH B 919 . ? 1_555 ? 
36 AC2 19 HOH G .   ? HOH B 921 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IAG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IAG 
_atom_sites.fract_transf_matrix[1][1]   0.014764 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000518 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013531 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 1   ? 83.117 49.952 10.588  1.00 40.88 ? 23  ARG A N   1 
ATOM   2    C  CA  . ARG A 1 1   ? 82.951 48.837 11.561  1.00 40.48 ? 23  ARG A CA  1 
ATOM   3    C  C   . ARG A 1 1   ? 83.070 47.468 10.878  1.00 40.07 ? 23  ARG A C   1 
ATOM   4    O  O   . ARG A 1 1   ? 82.105 46.935 10.319  1.00 39.90 ? 23  ARG A O   1 
ATOM   5    C  CB  . ARG A 1 1   ? 81.637 48.970 12.349  1.00 40.26 ? 23  ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 1   ? 81.548 48.073 13.601  1.00 40.89 ? 23  ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 1   ? 82.229 48.684 14.831  1.00 40.72 ? 23  ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 1   ? 82.540 47.688 15.858  1.00 40.20 ? 23  ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 1   ? 83.057 47.969 17.052  1.00 40.12 ? 23  ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 1   ? 83.318 49.224 17.406  1.00 40.56 ? 23  ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 1   ? 83.311 46.991 17.905  1.00 40.15 ? 23  ARG A NH2 1 
ATOM   12   N  N   . THR A 1 2   ? 84.281 46.928 10.916  1.00 39.71 ? 24  THR A N   1 
ATOM   13   C  CA  . THR A 1 2   ? 84.547 45.565 10.502  1.00 39.62 ? 24  THR A CA  1 
ATOM   14   C  C   . THR A 1 2   ? 85.117 44.817 11.707  1.00 39.80 ? 24  THR A C   1 
ATOM   15   O  O   . THR A 1 2   ? 85.851 45.403 12.514  1.00 39.64 ? 24  THR A O   1 
ATOM   16   C  CB  . THR A 1 2   ? 85.560 45.511 9.316   1.00 39.57 ? 24  THR A CB  1 
ATOM   17   O  OG1 . THR A 1 2   ? 85.058 46.284 8.221   1.00 39.21 ? 24  THR A OG1 1 
ATOM   18   C  CG2 . THR A 1 2   ? 85.772 44.074 8.845   1.00 38.40 ? 24  THR A CG2 1 
ATOM   19   N  N   . ARG A 1 3   ? 84.778 43.532 11.828  1.00 39.81 ? 25  ARG A N   1 
ATOM   20   C  CA  . ARG A 1 3   ? 85.272 42.719 12.936  1.00 40.44 ? 25  ARG A CA  1 
ATOM   21   C  C   . ARG A 1 3   ? 86.780 42.597 12.883  1.00 40.42 ? 25  ARG A C   1 
ATOM   22   O  O   . ARG A 1 3   ? 87.345 42.278 11.843  1.00 40.22 ? 25  ARG A O   1 
ATOM   23   C  CB  . ARG A 1 3   ? 84.658 41.316 12.948  1.00 40.47 ? 25  ARG A CB  1 
ATOM   24   C  CG  . ARG A 1 3   ? 83.181 41.280 13.311  1.00 41.28 ? 25  ARG A CG  1 
ATOM   25   C  CD  . ARG A 1 3   ? 82.626 39.879 13.327  1.00 41.88 ? 25  ARG A CD  1 
ATOM   26   N  NE  . ARG A 1 3   ? 83.161 39.077 14.427  1.00 43.27 ? 25  ARG A NE  1 
ATOM   27   C  CZ  . ARG A 1 3   ? 83.791 37.915 14.276  1.00 44.36 ? 25  ARG A CZ  1 
ATOM   28   N  NH1 . ARG A 1 3   ? 83.969 37.395 13.068  1.00 43.89 ? 25  ARG A NH1 1 
ATOM   29   N  NH2 . ARG A 1 3   ? 84.229 37.259 15.341  1.00 44.94 ? 25  ARG A NH2 1 
ATOM   30   N  N   . ARG A 1 4   ? 87.409 42.882 14.021  1.00 40.65 ? 26  ARG A N   1 
ATOM   31   C  CA  . ARG A 1 4   ? 88.824 42.601 14.239  1.00 40.54 ? 26  ARG A CA  1 
ATOM   32   C  C   . ARG A 1 4   ? 88.962 41.170 14.757  1.00 40.50 ? 26  ARG A C   1 
ATOM   33   O  O   . ARG A 1 4   ? 87.985 40.592 15.238  1.00 39.80 ? 26  ARG A O   1 
ATOM   34   C  CB  . ARG A 1 4   ? 89.420 43.584 15.241  1.00 40.44 ? 26  ARG A CB  1 
ATOM   35   C  CG  . ARG A 1 4   ? 89.484 45.020 14.745  1.00 40.96 ? 26  ARG A CG  1 
ATOM   36   C  CD  . ARG A 1 4   ? 89.594 45.968 15.921  1.00 41.57 ? 26  ARG A CD  1 
ATOM   37   N  NE  . ARG A 1 4   ? 89.787 47.359 15.533  1.00 41.77 ? 26  ARG A NE  1 
ATOM   38   C  CZ  . ARG A 1 4   ? 90.322 48.275 16.333  1.00 42.89 ? 26  ARG A CZ  1 
ATOM   39   N  NH1 . ARG A 1 4   ? 90.718 47.940 17.557  1.00 43.17 ? 26  ARG A NH1 1 
ATOM   40   N  NH2 . ARG A 1 4   ? 90.471 49.522 15.910  1.00 43.67 ? 26  ARG A NH2 1 
ATOM   41   N  N   . PRO A 1 5   ? 90.170 40.580 14.631  1.00 40.72 ? 27  PRO A N   1 
ATOM   42   C  CA  . PRO A 1 5   ? 90.340 39.226 15.159  1.00 40.72 ? 27  PRO A CA  1 
ATOM   43   C  C   . PRO A 1 5   ? 90.036 39.184 16.650  1.00 40.55 ? 27  PRO A C   1 
ATOM   44   O  O   . PRO A 1 5   ? 90.459 40.072 17.394  1.00 40.31 ? 27  PRO A O   1 
ATOM   45   C  CB  . PRO A 1 5   ? 91.818 38.920 14.881  1.00 40.82 ? 27  PRO A CB  1 
ATOM   46   C  CG  . PRO A 1 5   ? 92.172 39.810 13.714  1.00 40.68 ? 27  PRO A CG  1 
ATOM   47   C  CD  . PRO A 1 5   ? 91.403 41.078 13.985  1.00 40.62 ? 27  PRO A CD  1 
ATOM   48   N  N   . GLY A 1 6   ? 89.275 38.176 17.067  1.00 40.32 ? 28  GLY A N   1 
ATOM   49   C  CA  . GLY A 1 6   ? 88.946 37.995 18.479  1.00 40.28 ? 28  GLY A CA  1 
ATOM   50   C  C   . GLY A 1 6   ? 87.722 38.769 18.958  1.00 40.30 ? 28  GLY A C   1 
ATOM   51   O  O   . GLY A 1 6   ? 87.289 38.590 20.091  1.00 40.49 ? 28  GLY A O   1 
ATOM   52   N  N   . GLU A 1 7   ? 87.152 39.618 18.105  1.00 39.95 ? 29  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 7   ? 85.969 40.383 18.488  1.00 40.09 ? 29  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 7   ? 84.732 39.497 18.404  1.00 40.05 ? 29  GLU A C   1 
ATOM   55   O  O   . GLU A 1 7   ? 84.760 38.494 17.689  1.00 40.18 ? 29  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 7   ? 85.808 41.646 17.626  1.00 40.34 ? 29  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 7   ? 86.856 42.743 17.912  1.00 40.55 ? 29  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 7   ? 86.523 44.079 17.259  1.00 41.19 ? 29  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 7   ? 85.843 44.098 16.204  1.00 40.87 ? 29  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 7   ? 86.948 45.116 17.804  1.00 41.61 ? 29  GLU A OE2 1 
ATOM   61   N  N   . PRO A 1 8   ? 83.664 39.838 19.172  1.00 39.88 ? 30  PRO A N   1 
ATOM   62   C  CA  . PRO A 1 8   ? 82.349 39.189 19.080  1.00 39.65 ? 30  PRO A CA  1 
ATOM   63   C  C   . PRO A 1 8   ? 81.702 39.277 17.689  1.00 39.19 ? 30  PRO A C   1 
ATOM   64   O  O   . PRO A 1 8   ? 82.098 40.122 16.889  1.00 38.61 ? 30  PRO A O   1 
ATOM   65   C  CB  . PRO A 1 8   ? 81.496 39.985 20.089  1.00 39.33 ? 30  PRO A CB  1 
ATOM   66   C  CG  . PRO A 1 8   ? 82.473 40.509 21.067  1.00 39.72 ? 30  PRO A CG  1 
ATOM   67   C  CD  . PRO A 1 8   ? 83.668 40.871 20.231  1.00 39.80 ? 30  PRO A CD  1 
ATOM   68   N  N   . PRO A 1 9   ? 80.725 38.386 17.405  1.00 39.14 ? 31  PRO A N   1 
ATOM   69   C  CA  . PRO A 1 9   ? 79.787 38.574 16.301  1.00 39.38 ? 31  PRO A CA  1 
ATOM   70   C  C   . PRO A 1 9   ? 79.312 40.015 16.242  1.00 39.88 ? 31  PRO A C   1 
ATOM   71   O  O   . PRO A 1 9   ? 78.944 40.580 17.278  1.00 40.37 ? 31  PRO A O   1 
ATOM   72   C  CB  . PRO A 1 9   ? 78.623 37.666 16.681  1.00 38.93 ? 31  PRO A CB  1 
ATOM   73   C  CG  . PRO A 1 9   ? 79.260 36.545 17.422  1.00 39.11 ? 31  PRO A CG  1 
ATOM   74   C  CD  . PRO A 1 9   ? 80.489 37.107 18.104  1.00 39.15 ? 31  PRO A CD  1 
ATOM   75   N  N   . LEU A 1 10  ? 79.327 40.598 15.046  1.00 40.21 ? 32  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 10  ? 78.929 41.992 14.840  1.00 40.65 ? 32  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 10  ? 77.715 42.094 13.933  1.00 40.73 ? 32  LEU A C   1 
ATOM   78   O  O   . LEU A 1 10  ? 77.721 41.554 12.842  1.00 41.31 ? 32  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 10  ? 80.093 42.794 14.252  1.00 40.39 ? 32  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 10  ? 79.852 44.202 13.695  1.00 41.17 ? 32  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 10  ? 79.348 45.174 14.765  1.00 40.53 ? 32  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 10  ? 81.127 44.722 13.057  1.00 41.35 ? 32  LEU A CD2 1 
ATOM   83   N  N   . ASP A 1 11  ? 76.694 42.810 14.385  1.00 41.19 ? 33  ASP A N   1 
ATOM   84   C  CA  . ASP A 1 11  ? 75.408 42.877 13.689  1.00 41.40 ? 33  ASP A CA  1 
ATOM   85   C  C   . ASP A 1 11  ? 74.910 44.323 13.613  1.00 42.13 ? 33  ASP A C   1 
ATOM   86   O  O   . ASP A 1 11  ? 74.369 44.863 14.592  1.00 42.26 ? 33  ASP A O   1 
ATOM   87   C  CB  . ASP A 1 11  ? 74.395 41.983 14.415  1.00 41.19 ? 33  ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 11  ? 73.039 41.960 13.748  1.00 39.80 ? 33  ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 11  ? 72.633 42.971 13.159  1.00 37.96 ? 33  ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 11  ? 72.364 40.920 13.826  1.00 40.11 ? 33  ASP A OD2 1 
ATOM   91   N  N   . LEU A 1 12  ? 75.084 44.938 12.443  1.00 42.72 ? 34  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 12  ? 74.804 46.370 12.256  1.00 43.22 ? 34  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 12  ? 73.342 46.721 11.959  1.00 43.38 ? 34  LEU A C   1 
ATOM   94   O  O   . LEU A 1 12  ? 72.964 47.893 11.988  1.00 43.42 ? 34  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 12  ? 75.708 46.967 11.170  1.00 42.91 ? 34  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 12  ? 77.222 46.865 11.342  1.00 43.11 ? 34  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 12  ? 77.937 47.222 10.036  1.00 42.73 ? 34  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 12  ? 77.715 47.733 12.503  1.00 42.55 ? 34  LEU A CD2 1 
ATOM   99   N  N   . GLY A 1 13  ? 72.522 45.721 11.674  1.00 43.93 ? 35  GLY A N   1 
ATOM   100  C  CA  . GLY A 1 13  ? 71.110 45.975 11.394  1.00 44.86 ? 35  GLY A CA  1 
ATOM   101  C  C   . GLY A 1 13  ? 70.836 46.497 9.998   1.00 46.00 ? 35  GLY A C   1 
ATOM   102  O  O   . GLY A 1 13  ? 71.639 46.293 9.075   1.00 45.93 ? 35  GLY A O   1 
ATOM   103  N  N   . SER A 1 14  ? 69.701 47.180 9.852   1.00 46.86 ? 36  SER A N   1 
ATOM   104  C  CA  . SER A 1 14  ? 69.198 47.612 8.547   1.00 47.92 ? 36  SER A CA  1 
ATOM   105  C  C   . SER A 1 14  ? 69.300 49.125 8.339   1.00 48.27 ? 36  SER A C   1 
ATOM   106  O  O   . SER A 1 14  ? 69.616 49.590 7.233   1.00 48.44 ? 36  SER A O   1 
ATOM   107  C  CB  . SER A 1 14  ? 67.739 47.167 8.361   1.00 48.12 ? 36  SER A CB  1 
ATOM   108  O  OG  . SER A 1 14  ? 67.552 45.800 8.720   1.00 49.60 ? 36  SER A OG  1 
ATOM   109  N  N   . ILE A 1 15  ? 69.021 49.881 9.400   1.00 48.45 ? 37  ILE A N   1 
ATOM   110  C  CA  . ILE A 1 15  ? 69.029 51.341 9.345   1.00 48.55 ? 37  ILE A CA  1 
ATOM   111  C  C   . ILE A 1 15  ? 70.407 51.914 9.712   1.00 48.53 ? 37  ILE A C   1 
ATOM   112  O  O   . ILE A 1 15  ? 70.987 51.547 10.741  1.00 48.06 ? 37  ILE A O   1 
ATOM   113  C  CB  . ILE A 1 15  ? 67.888 51.961 10.199  1.00 48.50 ? 37  ILE A CB  1 
ATOM   114  C  CG1 . ILE A 1 15  ? 66.532 51.645 9.556   1.00 48.98 ? 37  ILE A CG1 1 
ATOM   115  C  CG2 . ILE A 1 15  ? 68.064 53.468 10.340  1.00 48.80 ? 37  ILE A CG2 1 
ATOM   116  C  CD1 . ILE A 1 15  ? 65.320 52.142 10.332  1.00 49.45 ? 37  ILE A CD1 1 
ATOM   117  N  N   . PRO A 1 16  ? 70.942 52.796 8.840   1.00 48.57 ? 38  PRO A N   1 
ATOM   118  C  CA  . PRO A 1 16  ? 72.249 53.428 9.041   1.00 48.25 ? 38  PRO A CA  1 
ATOM   119  C  C   . PRO A 1 16  ? 72.260 54.344 10.264  1.00 47.87 ? 38  PRO A C   1 
ATOM   120  O  O   . PRO A 1 16  ? 71.310 55.106 10.482  1.00 47.83 ? 38  PRO A O   1 
ATOM   121  C  CB  . PRO A 1 16  ? 72.446 54.249 7.750   1.00 48.41 ? 38  PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 16  ? 71.502 53.637 6.748   1.00 48.46 ? 38  PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 16  ? 70.318 53.235 7.575   1.00 48.54 ? 38  PRO A CD  1 
ATOM   124  N  N   . TRP A 1 17  ? 73.340 54.259 11.039  1.00 47.36 ? 39  TRP A N   1 
ATOM   125  C  CA  . TRP A 1 17  ? 73.528 55.015 12.288  1.00 46.74 ? 39  TRP A CA  1 
ATOM   126  C  C   . TRP A 1 17  ? 72.572 54.636 13.429  1.00 46.08 ? 39  TRP A C   1 
ATOM   127  O  O   . TRP A 1 17  ? 73.019 54.402 14.545  1.00 46.04 ? 39  TRP A O   1 
ATOM   128  C  CB  . TRP A 1 17  ? 73.528 56.539 12.060  1.00 47.02 ? 39  TRP A CB  1 
ATOM   129  C  CG  . TRP A 1 17  ? 74.163 57.302 13.205  1.00 47.12 ? 39  TRP A CG  1 
ATOM   130  C  CD1 . TRP A 1 17  ? 75.488 57.624 13.341  1.00 47.92 ? 39  TRP A CD1 1 
ATOM   131  C  CD2 . TRP A 1 17  ? 73.509 57.809 14.378  1.00 47.47 ? 39  TRP A CD2 1 
ATOM   132  N  NE1 . TRP A 1 17  ? 75.696 58.312 14.516  1.00 47.72 ? 39  TRP A NE1 1 
ATOM   133  C  CE2 . TRP A 1 17  ? 74.500 58.442 15.171  1.00 47.52 ? 39  TRP A CE2 1 
ATOM   134  C  CE3 . TRP A 1 17  ? 72.183 57.799 14.834  1.00 47.48 ? 39  TRP A CE3 1 
ATOM   135  C  CZ2 . TRP A 1 17  ? 74.207 59.054 16.397  1.00 47.69 ? 39  TRP A CZ2 1 
ATOM   136  C  CZ3 . TRP A 1 17  ? 71.890 58.412 16.059  1.00 47.50 ? 39  TRP A CZ3 1 
ATOM   137  C  CH2 . TRP A 1 17  ? 72.898 59.030 16.822  1.00 47.48 ? 39  TRP A CH2 1 
ATOM   138  N  N   . LEU A 1 18  ? 71.270 54.596 13.158  1.00 45.25 ? 40  LEU A N   1 
ATOM   139  C  CA  . LEU A 1 18  ? 70.296 54.240 14.185  1.00 44.74 ? 40  LEU A CA  1 
ATOM   140  C  C   . LEU A 1 18  ? 70.403 52.772 14.593  1.00 44.07 ? 40  LEU A C   1 
ATOM   141  O  O   . LEU A 1 18  ? 70.416 52.464 15.781  1.00 44.25 ? 40  LEU A O   1 
ATOM   142  C  CB  . LEU A 1 18  ? 68.862 54.582 13.756  1.00 44.80 ? 40  LEU A CB  1 
ATOM   143  C  CG  . LEU A 1 18  ? 68.399 56.040 13.877  1.00 44.89 ? 40  LEU A CG  1 
ATOM   144  C  CD1 . LEU A 1 18  ? 66.902 56.154 13.597  1.00 45.40 ? 40  LEU A CD1 1 
ATOM   145  C  CD2 . LEU A 1 18  ? 68.719 56.623 15.241  1.00 45.66 ? 40  LEU A CD2 1 
ATOM   146  N  N   . GLY A 1 19  ? 70.491 51.879 13.607  1.00 42.95 ? 41  GLY A N   1 
ATOM   147  C  CA  . GLY A 1 19  ? 70.622 50.449 13.866  1.00 41.42 ? 41  GLY A CA  1 
ATOM   148  C  C   . GLY A 1 19  ? 69.358 49.917 14.503  1.00 40.36 ? 41  GLY A C   1 
ATOM   149  O  O   . GLY A 1 19  ? 68.262 50.126 13.980  1.00 40.20 ? 41  GLY A O   1 
ATOM   150  N  N   . TYR A 1 20  ? 69.499 49.265 15.655  1.00 39.20 ? 42  TYR A N   1 
ATOM   151  C  CA  . TYR A 1 20  ? 68.334 48.691 16.337  1.00 37.96 ? 42  TYR A CA  1 
ATOM   152  C  C   . TYR A 1 20  ? 67.799 49.565 17.482  1.00 37.32 ? 42  TYR A C   1 
ATOM   153  O  O   . TYR A 1 20  ? 67.207 49.057 18.443  1.00 37.32 ? 42  TYR A O   1 
ATOM   154  C  CB  . TYR A 1 20  ? 68.653 47.298 16.855  1.00 37.85 ? 42  TYR A CB  1 
ATOM   155  C  CG  . TYR A 1 20  ? 69.028 46.259 15.817  1.00 37.59 ? 42  TYR A CG  1 
ATOM   156  C  CD1 . TYR A 1 20  ? 70.353 45.870 15.652  1.00 37.90 ? 42  TYR A CD1 1 
ATOM   157  C  CD2 . TYR A 1 20  ? 68.055 45.624 15.041  1.00 37.34 ? 42  TYR A CD2 1 
ATOM   158  C  CE1 . TYR A 1 20  ? 70.707 44.890 14.725  1.00 37.78 ? 42  TYR A CE1 1 
ATOM   159  C  CE2 . TYR A 1 20  ? 68.401 44.644 14.113  1.00 36.57 ? 42  TYR A CE2 1 
ATOM   160  C  CZ  . TYR A 1 20  ? 69.722 44.279 13.959  1.00 37.85 ? 42  TYR A CZ  1 
ATOM   161  O  OH  . TYR A 1 20  ? 70.077 43.303 13.036  1.00 38.50 ? 42  TYR A OH  1 
ATOM   162  N  N   . ALA A 1 21  ? 67.997 50.876 17.361  1.00 36.33 ? 43  ALA A N   1 
ATOM   163  C  CA  . ALA A 1 21  ? 67.515 51.862 18.327  1.00 35.75 ? 43  ALA A CA  1 
ATOM   164  C  C   . ALA A 1 21  ? 66.037 51.735 18.645  1.00 35.41 ? 43  ALA A C   1 
ATOM   165  O  O   . ALA A 1 21  ? 65.637 51.841 19.804  1.00 35.19 ? 43  ALA A O   1 
ATOM   166  C  CB  . ALA A 1 21  ? 67.795 53.267 17.830  1.00 35.84 ? 43  ALA A CB  1 
ATOM   167  N  N   . LEU A 1 22  ? 65.226 51.539 17.608  1.00 34.86 ? 44  LEU A N   1 
ATOM   168  C  CA  . LEU A 1 22  ? 63.784 51.465 17.777  1.00 34.04 ? 44  LEU A CA  1 
ATOM   169  C  C   . LEU A 1 22  ? 63.361 50.182 18.504  1.00 33.74 ? 44  LEU A C   1 
ATOM   170  O  O   . LEU A 1 22  ? 62.554 50.237 19.431  1.00 33.93 ? 44  LEU A O   1 
ATOM   171  C  CB  . LEU A 1 22  ? 63.081 51.591 16.425  1.00 33.86 ? 44  LEU A CB  1 
ATOM   172  C  CG  . LEU A 1 22  ? 61.550 51.509 16.367  1.00 34.16 ? 44  LEU A CG  1 
ATOM   173  C  CD1 . LEU A 1 22  ? 60.856 52.439 17.380  1.00 34.67 ? 44  LEU A CD1 1 
ATOM   174  C  CD2 . LEU A 1 22  ? 61.067 51.794 14.952  1.00 34.33 ? 44  LEU A CD2 1 
ATOM   175  N  N   . ASP A 1 23  ? 63.915 49.050 18.076  1.00 33.34 ? 45  ASP A N   1 
ATOM   176  C  CA  . ASP A 1 23  ? 63.559 47.724 18.607  1.00 33.19 ? 45  ASP A CA  1 
ATOM   177  C  C   . ASP A 1 23  ? 63.951 47.611 20.067  1.00 32.19 ? 45  ASP A C   1 
ATOM   178  O  O   . ASP A 1 23  ? 63.132 47.245 20.892  1.00 32.00 ? 45  ASP A O   1 
ATOM   179  C  CB  . ASP A 1 23  ? 64.236 46.619 17.799  1.00 33.32 ? 45  ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 23  ? 63.888 46.679 16.332  1.00 35.87 ? 45  ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 23  ? 64.817 46.853 15.511  1.00 38.54 ? 45  ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 23  ? 62.686 46.569 15.997  1.00 36.92 ? 45  ASP A OD2 1 
ATOM   183  N  N   . PHE A 1 24  ? 65.210 47.944 20.360  1.00 31.80 ? 46  PHE A N   1 
ATOM   184  C  CA  . PHE A 1 24  ? 65.747 48.015 21.722  1.00 31.08 ? 46  PHE A CA  1 
ATOM   185  C  C   . PHE A 1 24  ? 64.913 48.909 22.656  1.00 30.61 ? 46  PHE A C   1 
ATOM   186  O  O   . PHE A 1 24  ? 64.533 48.478 23.742  1.00 31.04 ? 46  PHE A O   1 
ATOM   187  C  CB  . PHE A 1 24  ? 67.205 48.481 21.674  1.00 30.97 ? 46  PHE A CB  1 
ATOM   188  C  CG  . PHE A 1 24  ? 67.937 48.360 22.980  1.00 30.73 ? 46  PHE A CG  1 
ATOM   189  C  CD1 . PHE A 1 24  ? 67.984 49.430 23.872  1.00 30.23 ? 46  PHE A CD1 1 
ATOM   190  C  CD2 . PHE A 1 24  ? 68.604 47.183 23.304  1.00 30.45 ? 46  PHE A CD2 1 
ATOM   191  C  CE1 . PHE A 1 24  ? 68.667 49.312 25.076  1.00 31.00 ? 46  PHE A CE1 1 
ATOM   192  C  CE2 . PHE A 1 24  ? 69.301 47.059 24.498  1.00 31.28 ? 46  PHE A CE2 1 
ATOM   193  C  CZ  . PHE A 1 24  ? 69.335 48.126 25.388  1.00 30.60 ? 46  PHE A CZ  1 
ATOM   194  N  N   . GLY A 1 25  ? 64.615 50.137 22.227  1.00 29.89 ? 47  GLY A N   1 
ATOM   195  C  CA  . GLY A 1 25  ? 63.820 51.079 23.034  1.00 28.43 ? 47  GLY A CA  1 
ATOM   196  C  C   . GLY A 1 25  ? 62.394 50.648 23.356  1.00 27.91 ? 47  GLY A C   1 
ATOM   197  O  O   . GLY A 1 25  ? 61.911 50.860 24.490  1.00 28.08 ? 47  GLY A O   1 
ATOM   198  N  N   . LYS A 1 26  ? 61.726 50.048 22.370  1.00 26.52 ? 48  LYS A N   1 
ATOM   199  C  CA  . LYS A 1 26  ? 60.319 49.592 22.456  1.00 25.86 ? 48  LYS A CA  1 
ATOM   200  C  C   . LYS A 1 26  ? 60.114 48.397 23.393  1.00 24.75 ? 48  LYS A C   1 
ATOM   201  O  O   . LYS A 1 26  ? 59.181 48.370 24.188  1.00 24.34 ? 48  LYS A O   1 
ATOM   202  C  CB  . LYS A 1 26  ? 59.840 49.191 21.040  1.00 26.35 ? 48  LYS A CB  1 
ATOM   203  C  CG  . LYS A 1 26  ? 58.398 48.721 20.906  1.00 27.86 ? 48  LYS A CG  1 
ATOM   204  C  CD  . LYS A 1 26  ? 58.143 48.001 19.542  1.00 30.73 ? 48  LYS A CD  1 
ATOM   205  C  CE  . LYS A 1 26  ? 58.096 46.431 19.694  1.00 30.84 ? 48  LYS A CE  1 
ATOM   206  N  NZ  . LYS A 1 26  ? 56.963 45.930 20.601  1.00 29.52 ? 48  LYS A NZ  1 
ATOM   207  N  N   . ASP A 1 27  ? 60.952 47.379 23.240  1.00 23.93 ? 49  ASP A N   1 
ATOM   208  C  CA  . ASP A 1 27  ? 60.887 46.190 24.086  1.00 23.54 ? 49  ASP A CA  1 
ATOM   209  C  C   . ASP A 1 27  ? 62.242 45.519 24.091  1.00 22.22 ? 49  ASP A C   1 
ATOM   210  O  O   . ASP A 1 27  ? 62.458 44.589 23.324  1.00 22.24 ? 49  ASP A O   1 
ATOM   211  C  CB  . ASP A 1 27  ? 59.826 45.209 23.559  1.00 23.43 ? 49  ASP A CB  1 
ATOM   212  C  CG  . ASP A 1 27  ? 59.667 43.958 24.446  1.00 24.90 ? 49  ASP A CG  1 
ATOM   213  O  OD1 . ASP A 1 27  ? 60.539 43.655 25.301  1.00 25.27 ? 49  ASP A OD1 1 
ATOM   214  O  OD2 . ASP A 1 27  ? 58.668 43.252 24.251  1.00 26.40 ? 49  ASP A OD2 1 
ATOM   215  N  N   . ALA A 1 28  ? 63.143 45.978 24.958  1.00 20.95 ? 50  ALA A N   1 
ATOM   216  C  CA  . ALA A 1 28  ? 64.522 45.474 24.956  1.00 20.81 ? 50  ALA A CA  1 
ATOM   217  C  C   . ALA A 1 28  ? 64.657 43.983 25.251  1.00 20.39 ? 50  ALA A C   1 
ATOM   218  O  O   . ALA A 1 28  ? 65.533 43.337 24.707  1.00 20.29 ? 50  ALA A O   1 
ATOM   219  C  CB  . ALA A 1 28  ? 65.428 46.304 25.877  1.00 20.79 ? 50  ALA A CB  1 
ATOM   220  N  N   . ALA A 1 29  ? 63.793 43.440 26.105  1.00 20.30 ? 51  ALA A N   1 
ATOM   221  C  CA  . ALA A 1 29  ? 63.871 42.019 26.456  1.00 20.35 ? 51  ALA A CA  1 
ATOM   222  C  C   . ALA A 1 29  ? 63.500 41.102 25.275  1.00 20.61 ? 51  ALA A C   1 
ATOM   223  O  O   . ALA A 1 29  ? 64.195 40.124 25.016  1.00 19.76 ? 51  ALA A O   1 
ATOM   224  C  CB  . ALA A 1 29  ? 63.002 41.709 27.673  1.00 19.78 ? 51  ALA A CB  1 
ATOM   225  N  N   . SER A 1 30  ? 62.416 41.428 24.570  1.00 21.40 ? 52  SER A N   1 
ATOM   226  C  CA  . SER A 1 30  ? 62.046 40.677 23.363  1.00 22.49 ? 52  SER A CA  1 
ATOM   227  C  C   . SER A 1 30  ? 63.118 40.770 22.288  1.00 22.97 ? 52  SER A C   1 
ATOM   228  O  O   . SER A 1 30  ? 63.506 39.753 21.706  1.00 22.34 ? 52  SER A O   1 
ATOM   229  C  CB  . SER A 1 30  ? 60.698 41.113 22.810  1.00 22.33 ? 52  SER A CB  1 
ATOM   230  O  OG  . SER A 1 30  ? 59.669 40.879 23.761  1.00 22.26 ? 52  SER A OG  1 
ATOM   231  N  N   . PHE A 1 31  ? 63.608 41.985 22.044  1.00 23.92 ? 53  PHE A N   1 
ATOM   232  C  CA  . PHE A 1 31  ? 64.621 42.202 21.009  1.00 24.31 ? 53  PHE A CA  1 
ATOM   233  C  C   . PHE A 1 31  ? 65.870 41.386 21.315  1.00 24.56 ? 53  PHE A C   1 
ATOM   234  O  O   . PHE A 1 31  ? 66.283 40.552 20.503  1.00 24.69 ? 53  PHE A O   1 
ATOM   235  C  CB  . PHE A 1 31  ? 64.958 43.699 20.857  1.00 25.03 ? 53  PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 31  ? 66.233 43.963 20.078  1.00 25.97 ? 53  PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 31  ? 66.292 43.721 18.704  1.00 26.33 ? 53  PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 31  ? 67.358 44.451 20.716  1.00 27.13 ? 53  PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 31  ? 67.448 43.963 17.988  1.00 27.24 ? 53  PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 31  ? 68.529 44.699 20.000  1.00 28.78 ? 53  PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 31  ? 68.575 44.442 18.633  1.00 26.22 ? 53  PHE A CZ  1 
ATOM   242  N  N   . LEU A 1 32  ? 66.446 41.603 22.499  1.00 24.49 ? 54  LEU A N   1 
ATOM   243  C  CA  . LEU A 1 32  ? 67.654 40.898 22.930  1.00 24.30 ? 54  LEU A CA  1 
ATOM   244  C  C   . LEU A 1 32  ? 67.522 39.375 22.992  1.00 24.51 ? 54  LEU A C   1 
ATOM   245  O  O   . LEU A 1 32  ? 68.519 38.665 22.831  1.00 22.88 ? 54  LEU A O   1 
ATOM   246  C  CB  . LEU A 1 32  ? 68.154 41.428 24.280  1.00 24.03 ? 54  LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 32  ? 68.787 42.826 24.305  1.00 24.61 ? 54  LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 32  ? 69.262 43.173 25.736  1.00 24.22 ? 54  LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 32  ? 69.927 42.947 23.288  1.00 22.12 ? 54  LEU A CD2 1 
ATOM   250  N  N   . THR A 1 33  ? 66.305 38.883 23.239  1.00 25.41 ? 55  THR A N   1 
ATOM   251  C  CA  . THR A 1 33  ? 66.042 37.441 23.217  1.00 26.22 ? 55  THR A CA  1 
ATOM   252  C  C   . THR A 1 33  ? 66.287 36.903 21.788  1.00 26.72 ? 55  THR A C   1 
ATOM   253  O  O   . THR A 1 33  ? 66.998 35.909 21.603  1.00 26.22 ? 55  THR A O   1 
ATOM   254  C  CB  . THR A 1 33  ? 64.626 37.089 23.726  1.00 26.04 ? 55  THR A CB  1 
ATOM   255  O  OG1 . THR A 1 33  ? 64.496 37.455 25.102  1.00 26.05 ? 55  THR A OG1 1 
ATOM   256  C  CG2 . THR A 1 33  ? 64.346 35.585 23.611  1.00 27.47 ? 55  THR A CG2 1 
ATOM   257  N  N   . ARG A 1 34  ? 65.726 37.594 20.800  1.00 27.66 ? 56  ARG A N   1 
ATOM   258  C  CA  . ARG A 1 34  ? 65.888 37.239 19.382  1.00 28.57 ? 56  ARG A CA  1 
ATOM   259  C  C   . ARG A 1 34  ? 67.354 37.230 18.991  1.00 28.87 ? 56  ARG A C   1 
ATOM   260  O  O   . ARG A 1 34  ? 67.813 36.304 18.336  1.00 29.58 ? 56  ARG A O   1 
ATOM   261  C  CB  . ARG A 1 34  ? 65.077 38.183 18.474  1.00 28.59 ? 56  ARG A CB  1 
ATOM   262  C  CG  . ARG A 1 34  ? 63.590 38.162 18.787  1.00 29.37 ? 56  ARG A CG  1 
ATOM   263  C  CD  . ARG A 1 34  ? 62.722 38.771 17.700  1.00 32.51 ? 56  ARG A CD  1 
ATOM   264  N  NE  . ARG A 1 34  ? 62.909 40.216 17.525  1.00 35.50 ? 56  ARG A NE  1 
ATOM   265  C  CZ  . ARG A 1 34  ? 62.201 41.161 18.145  1.00 36.08 ? 56  ARG A CZ  1 
ATOM   266  N  NH1 . ARG A 1 34  ? 61.255 40.845 19.021  1.00 36.85 ? 56  ARG A NH1 1 
ATOM   267  N  NH2 . ARG A 1 34  ? 62.457 42.438 17.906  1.00 36.29 ? 56  ARG A NH2 1 
ATOM   268  N  N   . MET A 1 35  ? 68.092 38.245 19.428  1.00 28.69 ? 57  MET A N   1 
ATOM   269  C  CA  . MET A 1 35  ? 69.522 38.339 19.152  1.00 28.39 ? 57  MET A CA  1 
ATOM   270  C  C   . MET A 1 35  ? 70.379 37.250 19.819  1.00 29.32 ? 57  MET A C   1 
ATOM   271  O  O   . MET A 1 35  ? 71.415 36.842 19.258  1.00 29.06 ? 57  MET A O   1 
ATOM   272  C  CB  . MET A 1 35  ? 70.033 39.732 19.521  1.00 27.99 ? 57  MET A CB  1 
ATOM   273  C  CG  . MET A 1 35  ? 69.430 40.857 18.678  1.00 26.54 ? 57  MET A CG  1 
ATOM   274  S  SD  . MET A 1 35  ? 70.190 41.001 17.029  1.00 21.69 ? 57  MET A SD  1 
ATOM   275  C  CE  . MET A 1 35  ? 68.751 41.281 16.057  1.00 15.70 ? 57  MET A CE  1 
ATOM   276  N  N   . LYS A 1 36  ? 69.971 36.798 21.007  1.00 29.15 ? 58  LYS A N   1 
ATOM   277  C  CA  . LYS A 1 36  ? 70.576 35.624 21.634  1.00 30.38 ? 58  LYS A CA  1 
ATOM   278  C  C   . LYS A 1 36  ? 70.412 34.364 20.778  1.00 31.08 ? 58  LYS A C   1 
ATOM   279  O  O   . LYS A 1 36  ? 71.346 33.565 20.645  1.00 31.10 ? 58  LYS A O   1 
ATOM   280  C  CB  . LYS A 1 36  ? 70.009 35.369 23.031  1.00 30.29 ? 58  LYS A CB  1 
ATOM   281  C  CG  . LYS A 1 36  ? 70.706 34.205 23.751  1.00 30.09 ? 58  LYS A CG  1 
ATOM   282  C  CD  . LYS A 1 36  ? 70.166 33.951 25.154  1.00 30.49 ? 58  LYS A CD  1 
ATOM   283  C  CE  . LYS A 1 36  ? 70.727 32.645 25.712  1.00 32.04 ? 58  LYS A CE  1 
ATOM   284  N  NZ  . LYS A 1 36  ? 70.255 32.328 27.108  1.00 32.61 ? 58  LYS A NZ  1 
ATOM   285  N  N   . GLU A 1 37  ? 69.218 34.201 20.221  1.00 32.29 ? 59  GLU A N   1 
ATOM   286  C  CA  . GLU A 1 37  ? 68.887 33.090 19.338  1.00 33.95 ? 59  GLU A CA  1 
ATOM   287  C  C   . GLU A 1 37  ? 69.696 33.137 18.052  1.00 34.08 ? 59  GLU A C   1 
ATOM   288  O  O   . GLU A 1 37  ? 70.157 32.103 17.580  1.00 34.34 ? 59  GLU A O   1 
ATOM   289  C  CB  . GLU A 1 37  ? 67.388 33.091 19.021  1.00 34.24 ? 59  GLU A CB  1 
ATOM   290  C  CG  . GLU A 1 37  ? 66.565 32.257 19.996  1.00 37.63 ? 59  GLU A CG  1 
ATOM   291  C  CD  . GLU A 1 37  ? 65.213 32.861 20.328  1.00 40.68 ? 59  GLU A CD  1 
ATOM   292  O  OE1 . GLU A 1 37  ? 64.778 32.676 21.493  1.00 43.22 ? 59  GLU A OE1 1 
ATOM   293  O  OE2 . GLU A 1 37  ? 64.586 33.511 19.447  1.00 41.16 ? 59  GLU A OE2 1 
ATOM   294  N  N   . LYS A 1 38  ? 69.861 34.341 17.498  1.00 34.24 ? 60  LYS A N   1 
ATOM   295  C  CA  . LYS A 1 38  ? 70.658 34.563 16.293  1.00 34.14 ? 60  LYS A CA  1 
ATOM   296  C  C   . LYS A 1 38  ? 72.167 34.365 16.468  1.00 34.09 ? 60  LYS A C   1 
ATOM   297  O  O   . LYS A 1 38  ? 72.809 33.747 15.620  1.00 34.24 ? 60  LYS A O   1 
ATOM   298  C  CB  . LYS A 1 38  ? 70.426 35.970 15.770  1.00 34.44 ? 60  LYS A CB  1 
ATOM   299  C  CG  . LYS A 1 38  ? 69.338 36.094 14.745  1.00 35.72 ? 60  LYS A CG  1 
ATOM   300  C  CD  . LYS A 1 38  ? 69.430 37.439 14.036  1.00 37.89 ? 60  LYS A CD  1 
ATOM   301  C  CE  . LYS A 1 38  ? 70.624 37.502 13.095  1.00 39.20 ? 60  LYS A CE  1 
ATOM   302  N  NZ  . LYS A 1 38  ? 70.682 38.828 12.414  1.00 41.17 ? 60  LYS A NZ  1 
ATOM   303  N  N   . HIS A 1 39  ? 72.725 34.889 17.558  1.00 33.78 ? 61  HIS A N   1 
ATOM   304  C  CA  . HIS A 1 39  ? 74.174 35.079 17.673  1.00 33.83 ? 61  HIS A CA  1 
ATOM   305  C  C   . HIS A 1 39  ? 74.859 34.310 18.812  1.00 33.87 ? 61  HIS A C   1 
ATOM   306  O  O   . HIS A 1 39  ? 76.103 34.263 18.876  1.00 33.73 ? 61  HIS A O   1 
ATOM   307  C  CB  . HIS A 1 39  ? 74.492 36.584 17.818  1.00 33.93 ? 61  HIS A CB  1 
ATOM   308  C  CG  . HIS A 1 39  ? 73.982 37.436 16.689  1.00 34.00 ? 61  HIS A CG  1 
ATOM   309  N  ND1 . HIS A 1 39  ? 74.581 37.468 15.447  1.00 34.20 ? 61  HIS A ND1 1 
ATOM   310  C  CD2 . HIS A 1 39  ? 72.949 38.308 16.627  1.00 33.46 ? 61  HIS A CD2 1 
ATOM   311  C  CE1 . HIS A 1 39  ? 73.930 38.309 14.665  1.00 34.05 ? 61  HIS A CE1 1 
ATOM   312  N  NE2 . HIS A 1 39  ? 72.931 38.829 15.356  1.00 34.45 ? 61  HIS A NE2 1 
ATOM   313  N  N   . GLY A 1 40  ? 74.066 33.743 19.721  1.00 33.71 ? 62  GLY A N   1 
ATOM   314  C  CA  . GLY A 1 40  ? 74.607 33.160 20.954  1.00 33.76 ? 62  GLY A CA  1 
ATOM   315  C  C   . GLY A 1 40  ? 74.739 34.162 22.094  1.00 34.34 ? 62  GLY A C   1 
ATOM   316  O  O   . GLY A 1 40  ? 74.116 35.221 22.067  1.00 34.50 ? 62  GLY A O   1 
ATOM   317  N  N   . ASP A 1 41  ? 75.583 33.828 23.073  1.00 35.06 ? 63  ASP A N   1 
ATOM   318  C  CA  . ASP A 1 41  ? 75.721 34.554 24.351  1.00 35.92 ? 63  ASP A CA  1 
ATOM   319  C  C   . ASP A 1 41  ? 76.535 35.872 24.336  1.00 35.94 ? 63  ASP A C   1 
ATOM   320  O  O   . ASP A 1 41  ? 76.628 36.562 25.355  1.00 35.45 ? 63  ASP A O   1 
ATOM   321  C  CB  . ASP A 1 41  ? 76.308 33.613 25.405  1.00 36.48 ? 63  ASP A CB  1 
ATOM   322  C  CG  . ASP A 1 41  ? 75.268 32.685 26.018  1.00 38.36 ? 63  ASP A CG  1 
ATOM   323  O  OD1 . ASP A 1 41  ? 74.124 32.638 25.519  1.00 39.35 ? 63  ASP A OD1 1 
ATOM   324  O  OD2 . ASP A 1 41  ? 75.599 31.999 27.017  1.00 41.45 ? 63  ASP A OD2 1 
ATOM   325  N  N   . ILE A 1 42  ? 77.130 36.208 23.195  1.00 36.14 ? 64  ILE A N   1 
ATOM   326  C  CA  . ILE A 1 42  ? 77.800 37.506 23.022  1.00 36.18 ? 64  ILE A CA  1 
ATOM   327  C  C   . ILE A 1 42  ? 77.671 37.978 21.589  1.00 36.57 ? 64  ILE A C   1 
ATOM   328  O  O   . ILE A 1 42  ? 77.867 37.198 20.640  1.00 37.57 ? 64  ILE A O   1 
ATOM   329  C  CB  . ILE A 1 42  ? 79.282 37.517 23.494  1.00 36.25 ? 64  ILE A CB  1 
ATOM   330  C  CG1 . ILE A 1 42  ? 79.849 38.937 23.441  1.00 35.83 ? 64  ILE A CG1 1 
ATOM   331  C  CG2 . ILE A 1 42  ? 80.152 36.551 22.676  1.00 36.09 ? 64  ILE A CG2 1 
ATOM   332  C  CD1 . ILE A 1 42  ? 80.923 39.205 24.452  1.00 35.86 ? 64  ILE A CD1 1 
ATOM   333  N  N   . PHE A 1 43  ? 77.284 39.244 21.449  1.00 36.36 ? 65  PHE A N   1 
ATOM   334  C  CA  . PHE A 1 43  ? 77.164 39.915 20.156  1.00 35.83 ? 65  PHE A CA  1 
ATOM   335  C  C   . PHE A 1 43  ? 77.410 41.415 20.306  1.00 35.70 ? 65  PHE A C   1 
ATOM   336  O  O   . PHE A 1 43  ? 77.231 41.979 21.386  1.00 35.73 ? 65  PHE A O   1 
ATOM   337  C  CB  . PHE A 1 43  ? 75.814 39.634 19.473  1.00 35.13 ? 65  PHE A CB  1 
ATOM   338  C  CG  . PHE A 1 43  ? 74.612 39.784 20.374  1.00 36.38 ? 65  PHE A CG  1 
ATOM   339  C  CD1 . PHE A 1 43  ? 74.222 38.746 21.227  1.00 35.75 ? 65  PHE A CD1 1 
ATOM   340  C  CD2 . PHE A 1 43  ? 73.844 40.950 20.347  1.00 35.54 ? 65  PHE A CD2 1 
ATOM   341  C  CE1 . PHE A 1 43  ? 73.107 38.878 22.050  1.00 35.98 ? 65  PHE A CE1 1 
ATOM   342  C  CE2 . PHE A 1 43  ? 72.733 41.091 21.162  1.00 35.98 ? 65  PHE A CE2 1 
ATOM   343  C  CZ  . PHE A 1 43  ? 72.358 40.056 22.020  1.00 35.57 ? 65  PHE A CZ  1 
ATOM   344  N  N   . THR A 1 44  ? 77.857 42.040 19.221  1.00 35.15 ? 66  THR A N   1 
ATOM   345  C  CA  . THR A 1 44  ? 77.972 43.491 19.147  1.00 34.65 ? 66  THR A CA  1 
ATOM   346  C  C   . THR A 1 44  ? 76.876 43.998 18.216  1.00 34.27 ? 66  THR A C   1 
ATOM   347  O  O   . THR A 1 44  ? 76.744 43.525 17.094  1.00 34.29 ? 66  THR A O   1 
ATOM   348  C  CB  . THR A 1 44  ? 79.374 43.923 18.662  1.00 34.40 ? 66  THR A CB  1 
ATOM   349  O  OG1 . THR A 1 44  ? 80.365 43.374 19.537  1.00 34.51 ? 66  THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 44  ? 79.515 45.452 18.650  1.00 34.46 ? 66  THR A CG2 1 
ATOM   351  N  N   . ILE A 1 45  ? 76.060 44.929 18.704  1.00 33.97 ? 67  ILE A N   1 
ATOM   352  C  CA  . ILE A 1 45  ? 74.989 45.514 17.892  1.00 33.61 ? 67  ILE A CA  1 
ATOM   353  C  C   . ILE A 1 45  ? 75.127 47.029 17.865  1.00 33.82 ? 67  ILE A C   1 
ATOM   354  O  O   . ILE A 1 45  ? 75.695 47.628 18.796  1.00 33.72 ? 67  ILE A O   1 
ATOM   355  C  CB  . ILE A 1 45  ? 73.569 45.147 18.408  1.00 33.62 ? 67  ILE A CB  1 
ATOM   356  C  CG1 . ILE A 1 45  ? 73.443 45.397 19.926  1.00 33.95 ? 67  ILE A CG1 1 
ATOM   357  C  CG2 . ILE A 1 45  ? 73.235 43.704 18.076  1.00 33.58 ? 67  ILE A CG2 1 
ATOM   358  C  CD1 . ILE A 1 45  ? 72.011 45.577 20.405  1.00 33.97 ? 67  ILE A CD1 1 
ATOM   359  N  N   . LEU A 1 46  ? 74.606 47.639 16.803  1.00 33.72 ? 68  LEU A N   1 
ATOM   360  C  CA  . LEU A 1 46  ? 74.535 49.092 16.706  1.00 34.26 ? 68  LEU A CA  1 
ATOM   361  C  C   . LEU A 1 46  ? 73.131 49.572 17.068  1.00 34.20 ? 68  LEU A C   1 
ATOM   362  O  O   . LEU A 1 46  ? 72.144 49.114 16.497  1.00 34.28 ? 68  LEU A O   1 
ATOM   363  C  CB  . LEU A 1 46  ? 74.929 49.578 15.296  1.00 34.16 ? 68  LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 46  ? 74.684 51.054 14.920  1.00 33.97 ? 68  LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 46  ? 75.836 51.953 15.351  1.00 32.15 ? 68  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 46  ? 74.427 51.215 13.436  1.00 33.46 ? 68  LEU A CD2 1 
ATOM   367  N  N   . VAL A 1 47  ? 73.057 50.484 18.035  1.00 34.59 ? 69  VAL A N   1 
ATOM   368  C  CA  . VAL A 1 47  ? 71.789 51.134 18.413  1.00 34.72 ? 69  VAL A CA  1 
ATOM   369  C  C   . VAL A 1 47  ? 72.014 52.626 18.711  1.00 34.90 ? 69  VAL A C   1 
ATOM   370  O  O   . VAL A 1 47  ? 72.890 52.989 19.504  1.00 34.28 ? 69  VAL A O   1 
ATOM   371  C  CB  . VAL A 1 47  ? 70.991 50.358 19.561  1.00 35.21 ? 69  VAL A CB  1 
ATOM   372  C  CG1 . VAL A 1 47  ? 71.851 49.290 20.260  1.00 34.44 ? 69  VAL A CG1 1 
ATOM   373  C  CG2 . VAL A 1 47  ? 70.355 51.304 20.568  1.00 34.44 ? 69  VAL A CG2 1 
ATOM   374  N  N   . GLY A 1 48  ? 71.241 53.472 18.032  1.00 34.91 ? 70  GLY A N   1 
ATOM   375  C  CA  . GLY A 1 48  ? 71.376 54.932 18.132  1.00 35.90 ? 70  GLY A CA  1 
ATOM   376  C  C   . GLY A 1 48  ? 72.811 55.454 18.106  1.00 36.23 ? 70  GLY A C   1 
ATOM   377  O  O   . GLY A 1 48  ? 73.204 56.226 18.985  1.00 35.81 ? 70  GLY A O   1 
ATOM   378  N  N   . GLY A 1 49  ? 73.592 55.006 17.117  1.00 36.38 ? 71  GLY A N   1 
ATOM   379  C  CA  . GLY A 1 49  ? 74.971 55.475 16.902  1.00 36.87 ? 71  GLY A CA  1 
ATOM   380  C  C   . GLY A 1 49  ? 76.074 54.829 17.728  1.00 37.45 ? 71  GLY A C   1 
ATOM   381  O  O   . GLY A 1 49  ? 77.269 55.119 17.535  1.00 37.40 ? 71  GLY A O   1 
ATOM   382  N  N   . ARG A 1 50  ? 75.689 53.962 18.658  1.00 37.12 ? 72  ARG A N   1 
ATOM   383  C  CA  . ARG A 1 50  ? 76.670 53.303 19.519  1.00 37.03 ? 72  ARG A CA  1 
ATOM   384  C  C   . ARG A 1 50  ? 76.792 51.813 19.181  1.00 36.44 ? 72  ARG A C   1 
ATOM   385  O  O   . ARG A 1 50  ? 75.818 51.187 18.767  1.00 36.23 ? 72  ARG A O   1 
ATOM   386  C  CB  . ARG A 1 50  ? 76.318 53.484 21.013  1.00 36.96 ? 72  ARG A CB  1 
ATOM   387  C  CG  . ARG A 1 50  ? 76.297 54.935 21.539  1.00 37.97 ? 72  ARG A CG  1 
ATOM   388  C  CD  . ARG A 1 50  ? 77.678 55.643 21.525  1.00 37.94 ? 72  ARG A CD  1 
ATOM   389  N  NE  . ARG A 1 50  ? 78.730 54.926 22.253  1.00 38.31 ? 72  ARG A NE  1 
ATOM   390  C  CZ  . ARG A 1 50  ? 78.887 54.938 23.578  1.00 40.14 ? 72  ARG A CZ  1 
ATOM   391  N  NH1 . ARG A 1 50  ? 78.054 55.628 24.358  1.00 40.67 ? 72  ARG A NH1 1 
ATOM   392  N  NH2 . ARG A 1 50  ? 79.883 54.253 24.131  1.00 39.60 ? 72  ARG A NH2 1 
ATOM   393  N  N   . TYR A 1 51  ? 77.989 51.264 19.371  1.00 36.08 ? 73  TYR A N   1 
ATOM   394  C  CA  . TYR A 1 51  ? 78.212 49.827 19.261  1.00 35.84 ? 73  TYR A CA  1 
ATOM   395  C  C   . TYR A 1 51  ? 78.199 49.204 20.648  1.00 34.78 ? 73  TYR A C   1 
ATOM   396  O  O   . TYR A 1 51  ? 79.117 49.386 21.448  1.00 34.98 ? 73  TYR A O   1 
ATOM   397  C  CB  . TYR A 1 51  ? 79.505 49.514 18.492  1.00 36.39 ? 73  TYR A CB  1 
ATOM   398  C  CG  . TYR A 1 51  ? 79.536 50.204 17.146  1.00 38.17 ? 73  TYR A CG  1 
ATOM   399  C  CD1 . TYR A 1 51  ? 78.904 49.642 16.043  1.00 38.72 ? 73  TYR A CD1 1 
ATOM   400  C  CD2 . TYR A 1 51  ? 80.161 51.445 16.990  1.00 39.77 ? 73  TYR A CD2 1 
ATOM   401  C  CE1 . TYR A 1 51  ? 78.906 50.292 14.814  1.00 40.57 ? 73  TYR A CE1 1 
ATOM   402  C  CE2 . TYR A 1 51  ? 80.165 52.103 15.768  1.00 40.10 ? 73  TYR A CE2 1 
ATOM   403  C  CZ  . TYR A 1 51  ? 79.538 51.519 14.683  1.00 40.51 ? 73  TYR A CZ  1 
ATOM   404  O  OH  . TYR A 1 51  ? 79.540 52.158 13.460  1.00 40.09 ? 73  TYR A OH  1 
ATOM   405  N  N   . VAL A 1 52  ? 77.124 48.477 20.915  1.00 33.76 ? 74  VAL A N   1 
ATOM   406  C  CA  . VAL A 1 52  ? 76.864 47.876 22.215  1.00 32.04 ? 74  VAL A CA  1 
ATOM   407  C  C   . VAL A 1 52  ? 77.211 46.389 22.157  1.00 31.37 ? 74  VAL A C   1 
ATOM   408  O  O   . VAL A 1 52  ? 76.609 45.644 21.403  1.00 30.32 ? 74  VAL A O   1 
ATOM   409  C  CB  . VAL A 1 52  ? 75.362 48.072 22.625  1.00 32.10 ? 74  VAL A CB  1 
ATOM   410  C  CG1 . VAL A 1 52  ? 75.085 47.545 24.047  1.00 30.10 ? 74  VAL A CG1 1 
ATOM   411  C  CG2 . VAL A 1 52  ? 74.949 49.538 22.501  1.00 31.00 ? 74  VAL A CG2 1 
ATOM   412  N  N   . THR A 1 53  ? 78.193 45.969 22.947  1.00 31.27 ? 75  THR A N   1 
ATOM   413  C  CA  . THR A 1 53  ? 78.475 44.542 23.092  1.00 31.72 ? 75  THR A CA  1 
ATOM   414  C  C   . THR A 1 53  ? 77.609 43.956 24.220  1.00 31.57 ? 75  THR A C   1 
ATOM   415  O  O   . THR A 1 53  ? 77.784 44.283 25.390  1.00 31.90 ? 75  THR A O   1 
ATOM   416  C  CB  . THR A 1 53  ? 79.993 44.254 23.301  1.00 31.66 ? 75  THR A CB  1 
ATOM   417  O  OG1 . THR A 1 53  ? 80.713 44.673 22.133  1.00 32.99 ? 75  THR A OG1 1 
ATOM   418  C  CG2 . THR A 1 53  ? 80.244 42.776 23.515  1.00 31.19 ? 75  THR A CG2 1 
ATOM   419  N  N   . VAL A 1 54  ? 76.657 43.109 23.842  1.00 31.49 ? 76  VAL A N   1 
ATOM   420  C  CA  . VAL A 1 54  ? 75.774 42.448 24.797  1.00 30.66 ? 76  VAL A CA  1 
ATOM   421  C  C   . VAL A 1 54  ? 76.378 41.118 25.297  1.00 30.49 ? 76  VAL A C   1 
ATOM   422  O  O   . VAL A 1 54  ? 76.692 40.234 24.494  1.00 30.89 ? 76  VAL A O   1 
ATOM   423  C  CB  . VAL A 1 54  ? 74.369 42.229 24.179  1.00 30.98 ? 76  VAL A CB  1 
ATOM   424  C  CG1 . VAL A 1 54  ? 73.389 41.653 25.220  1.00 30.39 ? 76  VAL A CG1 1 
ATOM   425  C  CG2 . VAL A 1 54  ? 73.820 43.542 23.585  1.00 30.05 ? 76  VAL A CG2 1 
ATOM   426  N  N   . LEU A 1 55  ? 76.577 41.002 26.608  1.00 29.40 ? 77  LEU A N   1 
ATOM   427  C  CA  . LEU A 1 55  ? 77.016 39.747 27.223  1.00 29.66 ? 77  LEU A CA  1 
ATOM   428  C  C   . LEU A 1 55  ? 75.839 39.107 27.960  1.00 29.42 ? 77  LEU A C   1 
ATOM   429  O  O   . LEU A 1 55  ? 75.274 39.713 28.873  1.00 29.30 ? 77  LEU A O   1 
ATOM   430  C  CB  . LEU A 1 55  ? 78.171 39.983 28.196  1.00 29.26 ? 77  LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 55  ? 79.313 38.995 28.445  1.00 30.16 ? 77  LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 55  ? 79.821 39.137 29.882  1.00 29.32 ? 77  LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 55  ? 78.959 37.546 28.139  1.00 31.73 ? 77  LEU A CD2 1 
ATOM   434  N  N   . LEU A 1 56  ? 75.491 37.883 27.556  1.00 29.47 ? 78  LEU A N   1 
ATOM   435  C  CA  . LEU A 1 56  ? 74.324 37.158 28.073  1.00 29.50 ? 78  LEU A CA  1 
ATOM   436  C  C   . LEU A 1 56  ? 74.678 35.820 28.726  1.00 29.70 ? 78  LEU A C   1 
ATOM   437  O  O   . LEU A 1 56  ? 73.785 35.041 29.099  1.00 30.12 ? 78  LEU A O   1 
ATOM   438  C  CB  . LEU A 1 56  ? 73.321 36.930 26.945  1.00 29.35 ? 78  LEU A CB  1 
ATOM   439  C  CG  . LEU A 1 56  ? 72.100 37.835 26.756  1.00 29.74 ? 78  LEU A CG  1 
ATOM   440  C  CD1 . LEU A 1 56  ? 72.250 39.240 27.314  1.00 28.65 ? 78  LEU A CD1 1 
ATOM   441  C  CD2 . LEU A 1 56  ? 71.727 37.862 25.301  1.00 30.03 ? 78  LEU A CD2 1 
ATOM   442  N  N   . ASP A 1 57  ? 75.974 35.546 28.851  1.00 29.27 ? 79  ASP A N   1 
ATOM   443  C  CA  . ASP A 1 57  ? 76.440 34.342 29.541  1.00 28.95 ? 79  ASP A CA  1 
ATOM   444  C  C   . ASP A 1 57  ? 76.665 34.668 31.004  1.00 28.16 ? 79  ASP A C   1 
ATOM   445  O  O   . ASP A 1 57  ? 77.608 35.377 31.340  1.00 28.66 ? 79  ASP A O   1 
ATOM   446  C  CB  . ASP A 1 57  ? 77.713 33.781 28.875  1.00 28.86 ? 79  ASP A CB  1 
ATOM   447  C  CG  . ASP A 1 57  ? 78.382 32.669 29.690  1.00 30.16 ? 79  ASP A CG  1 
ATOM   448  O  OD1 . ASP A 1 57  ? 77.696 31.943 30.456  1.00 31.36 ? 79  ASP A OD1 1 
ATOM   449  O  OD2 . ASP A 1 57  ? 79.621 32.527 29.568  1.00 31.79 ? 79  ASP A OD2 1 
ATOM   450  N  N   . PRO A 1 58  ? 75.790 34.162 31.891  1.00 27.73 ? 80  PRO A N   1 
ATOM   451  C  CA  . PRO A 1 58  ? 75.936 34.493 33.311  1.00 27.38 ? 80  PRO A CA  1 
ATOM   452  C  C   . PRO A 1 58  ? 77.231 33.974 33.980  1.00 27.50 ? 80  PRO A C   1 
ATOM   453  O  O   . PRO A 1 58  ? 77.681 34.552 34.974  1.00 26.87 ? 80  PRO A O   1 
ATOM   454  C  CB  . PRO A 1 58  ? 74.702 33.837 33.952  1.00 28.03 ? 80  PRO A CB  1 
ATOM   455  C  CG  . PRO A 1 58  ? 74.273 32.790 32.979  1.00 27.92 ? 80  PRO A CG  1 
ATOM   456  C  CD  . PRO A 1 58  ? 74.637 33.278 31.632  1.00 26.78 ? 80  PRO A CD  1 
ATOM   457  N  N   . HIS A 1 59  ? 77.811 32.890 33.454  1.00 27.32 ? 81  HIS A N   1 
ATOM   458  C  CA  . HIS A 1 59  ? 79.073 32.360 33.970  1.00 27.61 ? 81  HIS A CA  1 
ATOM   459  C  C   . HIS A 1 59  ? 80.229 33.345 33.764  1.00 28.50 ? 81  HIS A C   1 
ATOM   460  O  O   . HIS A 1 59  ? 81.221 33.330 34.514  1.00 28.68 ? 81  HIS A O   1 
ATOM   461  C  CB  . HIS A 1 59  ? 79.418 31.024 33.304  1.00 26.99 ? 81  HIS A CB  1 
ATOM   462  C  CG  . HIS A 1 59  ? 78.629 29.856 33.826  1.00 25.82 ? 81  HIS A CG  1 
ATOM   463  N  ND1 . HIS A 1 59  ? 78.684 29.446 35.143  1.00 23.63 ? 81  HIS A ND1 1 
ATOM   464  C  CD2 . HIS A 1 59  ? 77.797 28.992 33.198  1.00 23.69 ? 81  HIS A CD2 1 
ATOM   465  C  CE1 . HIS A 1 59  ? 77.906 28.393 35.307  1.00 23.08 ? 81  HIS A CE1 1 
ATOM   466  N  NE2 . HIS A 1 59  ? 77.367 28.088 34.140  1.00 25.30 ? 81  HIS A NE2 1 
ATOM   467  N  N   . SER A 1 60  ? 80.081 34.212 32.765  1.00 29.31 ? 82  SER A N   1 
ATOM   468  C  CA  . SER A 1 60  ? 81.136 35.156 32.384  1.00 30.61 ? 82  SER A CA  1 
ATOM   469  C  C   . SER A 1 60  ? 80.941 36.602 32.879  1.00 30.94 ? 82  SER A C   1 
ATOM   470  O  O   . SER A 1 60  ? 81.662 37.500 32.447  1.00 30.90 ? 82  SER A O   1 
ATOM   471  C  CB  . SER A 1 60  ? 81.306 35.144 30.861  1.00 30.64 ? 82  SER A CB  1 
ATOM   472  O  OG  . SER A 1 60  ? 81.906 33.929 30.432  1.00 32.01 ? 82  SER A OG  1 
ATOM   473  N  N   . TYR A 1 61  ? 79.967 36.831 33.764  1.00 31.20 ? 83  TYR A N   1 
ATOM   474  C  CA  . TYR A 1 61  ? 79.679 38.183 34.243  1.00 31.59 ? 83  TYR A CA  1 
ATOM   475  C  C   . TYR A 1 61  ? 80.766 38.704 35.201  1.00 32.92 ? 83  TYR A C   1 
ATOM   476  O  O   . TYR A 1 61  ? 81.055 39.910 35.221  1.00 32.52 ? 83  TYR A O   1 
ATOM   477  C  CB  . TYR A 1 61  ? 78.284 38.272 34.898  1.00 30.51 ? 83  TYR A CB  1 
ATOM   478  C  CG  . TYR A 1 61  ? 77.076 38.227 33.968  1.00 28.53 ? 83  TYR A CG  1 
ATOM   479  C  CD1 . TYR A 1 61  ? 77.198 38.372 32.592  1.00 25.58 ? 83  TYR A CD1 1 
ATOM   480  C  CD2 . TYR A 1 61  ? 75.789 38.069 34.496  1.00 28.86 ? 83  TYR A CD2 1 
ATOM   481  C  CE1 . TYR A 1 61  ? 76.076 38.339 31.758  1.00 25.00 ? 83  TYR A CE1 1 
ATOM   482  C  CE2 . TYR A 1 61  ? 74.666 38.048 33.690  1.00 25.67 ? 83  TYR A CE2 1 
ATOM   483  C  CZ  . TYR A 1 61  ? 74.807 38.180 32.320  1.00 25.50 ? 83  TYR A CZ  1 
ATOM   484  O  OH  . TYR A 1 61  ? 73.681 38.147 31.542  1.00 23.85 ? 83  TYR A OH  1 
ATOM   485  N  N   . ASP A 1 62  ? 81.371 37.799 35.979  1.00 34.56 ? 84  ASP A N   1 
ATOM   486  C  CA  . ASP A 1 62  ? 82.450 38.166 36.924  1.00 36.21 ? 84  ASP A CA  1 
ATOM   487  C  C   . ASP A 1 62  ? 83.749 38.682 36.272  1.00 36.94 ? 84  ASP A C   1 
ATOM   488  O  O   . ASP A 1 62  ? 84.557 39.344 36.927  1.00 37.69 ? 84  ASP A O   1 
ATOM   489  C  CB  . ASP A 1 62  ? 82.792 36.995 37.852  1.00 36.53 ? 84  ASP A CB  1 
ATOM   490  C  CG  . ASP A 1 62  ? 81.830 36.861 39.015  1.00 37.93 ? 84  ASP A CG  1 
ATOM   491  O  OD1 . ASP A 1 62  ? 81.655 35.718 39.487  1.00 38.94 ? 84  ASP A OD1 1 
ATOM   492  O  OD2 . ASP A 1 62  ? 81.261 37.885 39.464  1.00 38.73 ? 84  ASP A OD2 1 
ATOM   493  N  N   . ALA A 1 63  ? 83.955 38.374 35.000  1.00 37.46 ? 85  ALA A N   1 
ATOM   494  C  CA  . ALA A 1 63  ? 85.154 38.813 34.292  1.00 38.38 ? 85  ALA A CA  1 
ATOM   495  C  C   . ALA A 1 63  ? 85.022 40.272 33.851  1.00 38.93 ? 85  ALA A C   1 
ATOM   496  O  O   . ALA A 1 63  ? 85.962 40.850 33.295  1.00 39.58 ? 85  ALA A O   1 
ATOM   497  C  CB  . ALA A 1 63  ? 85.426 37.909 33.086  1.00 37.99 ? 85  ALA A CB  1 
ATOM   498  N  N   . VAL A 1 64  ? 83.859 40.859 34.128  1.00 38.89 ? 86  VAL A N   1 
ATOM   499  C  CA  . VAL A 1 64  ? 83.456 42.144 33.566  1.00 39.12 ? 86  VAL A CA  1 
ATOM   500  C  C   . VAL A 1 64  ? 83.110 43.153 34.653  1.00 39.05 ? 86  VAL A C   1 
ATOM   501  O  O   . VAL A 1 64  ? 83.554 44.303 34.602  1.00 39.10 ? 86  VAL A O   1 
ATOM   502  C  CB  . VAL A 1 64  ? 82.229 41.954 32.650  1.00 38.91 ? 86  VAL A CB  1 
ATOM   503  C  CG1 . VAL A 1 64  ? 81.570 43.277 32.315  1.00 39.91 ? 86  VAL A CG1 1 
ATOM   504  C  CG2 . VAL A 1 64  ? 82.627 41.219 31.402  1.00 39.75 ? 86  VAL A CG2 1 
ATOM   505  N  N   . VAL A 1 65  ? 82.320 42.710 35.630  1.00 39.07 ? 87  VAL A N   1 
ATOM   506  C  CA  . VAL A 1 65  ? 81.716 43.608 36.609  1.00 39.20 ? 87  VAL A CA  1 
ATOM   507  C  C   . VAL A 1 65  ? 82.718 44.192 37.603  1.00 39.97 ? 87  VAL A C   1 
ATOM   508  O  O   . VAL A 1 65  ? 82.523 45.302 38.089  1.00 40.04 ? 87  VAL A O   1 
ATOM   509  C  CB  . VAL A 1 65  ? 80.477 42.968 37.342  1.00 39.09 ? 87  VAL A CB  1 
ATOM   510  C  CG1 . VAL A 1 65  ? 79.341 42.737 36.374  1.00 38.33 ? 87  VAL A CG1 1 
ATOM   511  C  CG2 . VAL A 1 65  ? 80.830 41.671 38.078  1.00 37.75 ? 87  VAL A CG2 1 
ATOM   512  N  N   . TRP A 1 66  ? 83.790 43.452 37.887  1.00 40.78 ? 88  TRP A N   1 
ATOM   513  C  CA  . TRP A 1 66  ? 84.789 43.868 38.878  1.00 41.81 ? 88  TRP A CA  1 
ATOM   514  C  C   . TRP A 1 66  ? 85.963 44.640 38.282  1.00 42.65 ? 88  TRP A C   1 
ATOM   515  O  O   . TRP A 1 66  ? 86.862 45.077 39.010  1.00 42.88 ? 88  TRP A O   1 
ATOM   516  C  CB  . TRP A 1 66  ? 85.321 42.652 39.631  1.00 41.71 ? 88  TRP A CB  1 
ATOM   517  C  CG  . TRP A 1 66  ? 84.251 41.863 40.293  1.00 41.29 ? 88  TRP A CG  1 
ATOM   518  C  CD1 . TRP A 1 66  ? 83.771 40.649 39.903  1.00 40.50 ? 88  TRP A CD1 1 
ATOM   519  C  CD2 . TRP A 1 66  ? 83.510 42.238 41.460  1.00 40.36 ? 88  TRP A CD2 1 
ATOM   520  N  NE1 . TRP A 1 66  ? 82.784 40.237 40.764  1.00 39.57 ? 88  TRP A NE1 1 
ATOM   521  C  CE2 . TRP A 1 66  ? 82.607 41.192 41.731  1.00 40.44 ? 88  TRP A CE2 1 
ATOM   522  C  CE3 . TRP A 1 66  ? 83.528 43.353 42.305  1.00 40.84 ? 88  TRP A CE3 1 
ATOM   523  C  CZ2 . TRP A 1 66  ? 81.725 41.225 42.816  1.00 41.64 ? 88  TRP A CZ2 1 
ATOM   524  C  CZ3 . TRP A 1 66  ? 82.654 43.389 43.380  1.00 41.24 ? 88  TRP A CZ3 1 
ATOM   525  C  CH2 . TRP A 1 66  ? 81.764 42.329 43.626  1.00 41.34 ? 88  TRP A CH2 1 
ATOM   526  N  N   . GLU A 1 67  ? 85.949 44.795 36.962  1.00 43.23 ? 89  GLU A N   1 
ATOM   527  C  CA  . GLU A 1 67  ? 86.974 45.536 36.246  1.00 44.22 ? 89  GLU A CA  1 
ATOM   528  C  C   . GLU A 1 67  ? 87.042 47.006 36.676  1.00 44.69 ? 89  GLU A C   1 
ATOM   529  O  O   . GLU A 1 67  ? 85.999 47.618 36.949  1.00 44.53 ? 89  GLU A O   1 
ATOM   530  C  CB  . GLU A 1 67  ? 86.764 45.414 34.731  1.00 44.00 ? 89  GLU A CB  1 
ATOM   531  C  CG  . GLU A 1 67  ? 87.024 44.009 34.193  1.00 45.77 ? 89  GLU A CG  1 
ATOM   532  C  CD  . GLU A 1 67  ? 88.340 43.405 34.708  1.00 48.41 ? 89  GLU A CD  1 
ATOM   533  O  OE1 . GLU A 1 67  ? 88.291 42.401 35.470  1.00 48.98 ? 89  GLU A OE1 1 
ATOM   534  O  OE2 . GLU A 1 67  ? 89.414 43.948 34.365  1.00 47.81 ? 89  GLU A OE2 1 
ATOM   535  N  N   . PRO A 1 68  ? 88.274 47.565 36.742  1.00 45.15 ? 90  PRO A N   1 
ATOM   536  C  CA  . PRO A 1 68  ? 88.541 48.955 37.133  1.00 45.47 ? 90  PRO A CA  1 
ATOM   537  C  C   . PRO A 1 68  ? 87.957 49.947 36.132  1.00 45.65 ? 90  PRO A C   1 
ATOM   538  O  O   . PRO A 1 68  ? 87.770 49.599 34.964  1.00 45.63 ? 90  PRO A O   1 
ATOM   539  C  CB  . PRO A 1 68  ? 90.075 49.049 37.095  1.00 45.72 ? 90  PRO A CB  1 
ATOM   540  C  CG  . PRO A 1 68  ? 90.572 47.640 37.091  1.00 45.51 ? 90  PRO A CG  1 
ATOM   541  C  CD  . PRO A 1 68  ? 89.518 46.846 36.400  1.00 45.26 ? 90  PRO A CD  1 
ATOM   542  N  N   . ARG A 1 69  ? 87.685 51.170 36.594  1.00 46.02 ? 91  ARG A N   1 
ATOM   543  C  CA  . ARG A 1 69  ? 87.155 52.237 35.745  1.00 46.32 ? 91  ARG A CA  1 
ATOM   544  C  C   . ARG A 1 69  ? 88.074 52.551 34.563  1.00 46.28 ? 91  ARG A C   1 
ATOM   545  O  O   . ARG A 1 69  ? 87.609 52.963 33.501  1.00 46.30 ? 91  ARG A O   1 
ATOM   546  C  CB  . ARG A 1 69  ? 86.908 53.515 36.553  1.00 46.46 ? 91  ARG A CB  1 
ATOM   547  C  CG  . ARG A 1 69  ? 85.638 53.511 37.405  1.00 47.56 ? 91  ARG A CG  1 
ATOM   548  C  CD  . ARG A 1 69  ? 85.019 54.912 37.488  1.00 49.22 ? 91  ARG A CD  1 
ATOM   549  N  NE  . ARG A 1 69  ? 85.866 55.881 38.190  1.00 51.01 ? 91  ARG A NE  1 
ATOM   550  C  CZ  . ARG A 1 69  ? 85.940 57.179 37.892  1.00 51.55 ? 91  ARG A CZ  1 
ATOM   551  N  NH1 . ARG A 1 69  ? 85.231 57.682 36.887  1.00 51.57 ? 91  ARG A NH1 1 
ATOM   552  N  NH2 . ARG A 1 69  ? 86.740 57.976 38.591  1.00 51.81 ? 91  ARG A NH2 1 
ATOM   553  N  N   . THR A 1 70  ? 89.377 52.356 34.763  1.00 46.24 ? 92  THR A N   1 
ATOM   554  C  CA  . THR A 1 70  ? 90.384 52.636 33.738  1.00 46.10 ? 92  THR A CA  1 
ATOM   555  C  C   . THR A 1 70  ? 90.333 51.631 32.587  1.00 45.82 ? 92  THR A C   1 
ATOM   556  O  O   . THR A 1 70  ? 91.000 51.821 31.567  1.00 46.33 ? 92  THR A O   1 
ATOM   557  C  CB  . THR A 1 70  ? 91.819 52.694 34.336  1.00 46.41 ? 92  THR A CB  1 
ATOM   558  O  OG1 . THR A 1 70  ? 92.114 51.471 35.024  1.00 46.12 ? 92  THR A OG1 1 
ATOM   559  C  CG2 . THR A 1 70  ? 91.955 53.875 35.305  1.00 46.23 ? 92  THR A CG2 1 
ATOM   560  N  N   . ARG A 1 71  ? 89.534 50.575 32.757  1.00 44.89 ? 93  ARG A N   1 
ATOM   561  C  CA  . ARG A 1 71  ? 89.258 49.609 31.693  1.00 43.91 ? 93  ARG A CA  1 
ATOM   562  C  C   . ARG A 1 71  ? 87.773 49.612 31.292  1.00 42.87 ? 93  ARG A C   1 
ATOM   563  O  O   . ARG A 1 71  ? 87.445 49.798 30.119  1.00 42.18 ? 93  ARG A O   1 
ATOM   564  C  CB  . ARG A 1 71  ? 89.721 48.204 32.114  1.00 44.35 ? 93  ARG A CB  1 
ATOM   565  C  CG  . ARG A 1 71  ? 91.246 48.054 32.163  1.00 45.39 ? 93  ARG A CG  1 
ATOM   566  C  CD  . ARG A 1 71  ? 91.717 46.810 32.918  1.00 47.83 ? 93  ARG A CD  1 
ATOM   567  N  NE  . ARG A 1 71  ? 91.289 45.553 32.293  1.00 49.82 ? 93  ARG A NE  1 
ATOM   568  C  CZ  . ARG A 1 71  ? 91.814 45.017 31.188  1.00 50.45 ? 93  ARG A CZ  1 
ATOM   569  N  NH1 . ARG A 1 71  ? 92.804 45.620 30.531  1.00 50.80 ? 93  ARG A NH1 1 
ATOM   570  N  NH2 . ARG A 1 71  ? 91.332 43.868 30.728  1.00 50.87 ? 93  ARG A NH2 1 
ATOM   571  N  N   . LEU A 1 72  ? 86.888 49.408 32.274  1.00 41.74 ? 94  LEU A N   1 
ATOM   572  C  CA  . LEU A 1 72  ? 85.436 49.413 32.045  1.00 40.90 ? 94  LEU A CA  1 
ATOM   573  C  C   . LEU A 1 72  ? 84.753 50.375 33.008  1.00 40.10 ? 94  LEU A C   1 
ATOM   574  O  O   . LEU A 1 72  ? 84.854 50.212 34.226  1.00 39.94 ? 94  LEU A O   1 
ATOM   575  C  CB  . LEU A 1 72  ? 84.851 48.001 32.192  1.00 40.62 ? 94  LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 72  ? 85.169 46.962 31.110  1.00 40.40 ? 94  LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 72  ? 84.829 45.561 31.578  1.00 38.77 ? 94  LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 72  ? 84.430 47.273 29.820  1.00 39.34 ? 94  LEU A CD2 1 
ATOM   579  N  N   . ASP A 1 73  ? 84.062 51.372 32.455  1.00 39.61 ? 95  ASP A N   1 
ATOM   580  C  CA  . ASP A 1 73  ? 83.540 52.499 33.243  1.00 39.32 ? 95  ASP A CA  1 
ATOM   581  C  C   . ASP A 1 73  ? 82.018 52.591 33.290  1.00 39.29 ? 95  ASP A C   1 
ATOM   582  O  O   . ASP A 1 73  ? 81.359 52.656 32.256  1.00 38.85 ? 95  ASP A O   1 
ATOM   583  C  CB  . ASP A 1 73  ? 84.109 53.818 32.707  1.00 39.30 ? 95  ASP A CB  1 
ATOM   584  C  CG  . ASP A 1 73  ? 83.497 55.048 33.375  1.00 38.73 ? 95  ASP A CG  1 
ATOM   585  O  OD1 . ASP A 1 73  ? 83.483 55.108 34.626  1.00 37.08 ? 95  ASP A OD1 1 
ATOM   586  O  OD2 . ASP A 1 73  ? 83.044 55.959 32.639  1.00 38.08 ? 95  ASP A OD2 1 
ATOM   587  N  N   . PHE A 1 74  ? 81.476 52.631 34.506  1.00 40.03 ? 96  PHE A N   1 
ATOM   588  C  CA  . PHE A 1 74  ? 80.031 52.778 34.727  1.00 40.62 ? 96  PHE A CA  1 
ATOM   589  C  C   . PHE A 1 74  ? 79.599 54.233 34.967  1.00 40.39 ? 96  PHE A C   1 
ATOM   590  O  O   . PHE A 1 74  ? 78.418 54.584 34.799  1.00 40.02 ? 96  PHE A O   1 
ATOM   591  C  CB  . PHE A 1 74  ? 79.586 51.904 35.906  1.00 40.94 ? 96  PHE A CB  1 
ATOM   592  C  CG  . PHE A 1 74  ? 80.239 52.265 37.217  1.00 43.18 ? 96  PHE A CG  1 
ATOM   593  C  CD1 . PHE A 1 74  ? 79.672 53.225 38.055  1.00 45.27 ? 96  PHE A CD1 1 
ATOM   594  C  CD2 . PHE A 1 74  ? 81.413 51.636 37.622  1.00 45.08 ? 96  PHE A CD2 1 
ATOM   595  C  CE1 . PHE A 1 74  ? 80.268 53.562 39.275  1.00 45.86 ? 96  PHE A CE1 1 
ATOM   596  C  CE2 . PHE A 1 74  ? 82.017 51.964 38.838  1.00 46.38 ? 96  PHE A CE2 1 
ATOM   597  C  CZ  . PHE A 1 74  ? 81.440 52.930 39.666  1.00 47.01 ? 96  PHE A CZ  1 
ATOM   598  N  N   . HIS A 1 75  ? 80.560 55.068 35.362  1.00 40.05 ? 97  HIS A N   1 
ATOM   599  C  CA  . HIS A 1 75  ? 80.270 56.404 35.880  1.00 39.89 ? 97  HIS A CA  1 
ATOM   600  C  C   . HIS A 1 75  ? 79.809 57.407 34.827  1.00 40.20 ? 97  HIS A C   1 
ATOM   601  O  O   . HIS A 1 75  ? 78.941 58.227 35.119  1.00 40.26 ? 97  HIS A O   1 
ATOM   602  C  CB  . HIS A 1 75  ? 81.454 56.961 36.679  1.00 39.64 ? 97  HIS A CB  1 
ATOM   603  C  CG  . HIS A 1 75  ? 81.088 58.089 37.598  1.00 38.50 ? 97  HIS A CG  1 
ATOM   604  N  ND1 . HIS A 1 75  ? 80.006 58.036 38.449  1.00 37.46 ? 97  HIS A ND1 1 
ATOM   605  C  CD2 . HIS A 1 75  ? 81.675 59.291 37.814  1.00 38.13 ? 97  HIS A CD2 1 
ATOM   606  C  CE1 . HIS A 1 75  ? 79.939 59.155 39.148  1.00 37.22 ? 97  HIS A CE1 1 
ATOM   607  N  NE2 . HIS A 1 75  ? 80.942 59.934 38.784  1.00 37.75 ? 97  HIS A NE2 1 
ATOM   608  N  N   . ALA A 1 76  ? 80.374 57.336 33.617  1.00 40.40 ? 98  ALA A N   1 
ATOM   609  C  CA  . ALA A 1 76  ? 79.979 58.215 32.496  1.00 40.40 ? 98  ALA A CA  1 
ATOM   610  C  C   . ALA A 1 76  ? 78.481 58.182 32.202  1.00 40.48 ? 98  ALA A C   1 
ATOM   611  O  O   . ALA A 1 76  ? 77.857 59.232 32.001  1.00 40.11 ? 98  ALA A O   1 
ATOM   612  C  CB  . ALA A 1 76  ? 80.753 57.869 31.244  1.00 40.63 ? 98  ALA A CB  1 
ATOM   613  N  N   . TYR A 1 77  ? 77.915 56.975 32.171  1.00 40.59 ? 99  TYR A N   1 
ATOM   614  C  CA  . TYR A 1 77  ? 76.482 56.814 31.934  1.00 40.72 ? 99  TYR A CA  1 
ATOM   615  C  C   . TYR A 1 77  ? 75.625 57.266 33.121  1.00 40.25 ? 99  TYR A C   1 
ATOM   616  O  O   . TYR A 1 77  ? 74.592 57.896 32.915  1.00 40.50 ? 99  TYR A O   1 
ATOM   617  C  CB  . TYR A 1 77  ? 76.115 55.394 31.482  1.00 41.49 ? 99  TYR A CB  1 
ATOM   618  C  CG  . TYR A 1 77  ? 74.789 55.341 30.737  1.00 42.79 ? 99  TYR A CG  1 
ATOM   619  C  CD1 . TYR A 1 77  ? 74.529 56.219 29.678  1.00 43.92 ? 99  TYR A CD1 1 
ATOM   620  C  CD2 . TYR A 1 77  ? 73.790 54.430 31.097  1.00 44.42 ? 99  TYR A CD2 1 
ATOM   621  C  CE1 . TYR A 1 77  ? 73.320 56.194 28.991  1.00 44.46 ? 99  TYR A CE1 1 
ATOM   622  C  CE2 . TYR A 1 77  ? 72.563 54.395 30.408  1.00 44.68 ? 99  TYR A CE2 1 
ATOM   623  C  CZ  . TYR A 1 77  ? 72.345 55.281 29.359  1.00 44.92 ? 99  TYR A CZ  1 
ATOM   624  O  OH  . TYR A 1 77  ? 71.156 55.268 28.664  1.00 45.22 ? 99  TYR A OH  1 
ATOM   625  N  N   . ALA A 1 78  ? 76.048 56.969 34.351  1.00 39.64 ? 100 ALA A N   1 
ATOM   626  C  CA  . ALA A 1 78  ? 75.382 57.537 35.535  1.00 38.99 ? 100 ALA A CA  1 
ATOM   627  C  C   . ALA A 1 78  ? 75.397 59.070 35.469  1.00 38.37 ? 100 ALA A C   1 
ATOM   628  O  O   . ALA A 1 78  ? 74.347 59.705 35.549  1.00 38.24 ? 100 ALA A O   1 
ATOM   629  C  CB  . ALA A 1 78  ? 76.020 57.037 36.840  1.00 39.11 ? 100 ALA A CB  1 
ATOM   630  N  N   . ILE A 1 79  ? 76.580 59.656 35.288  1.00 37.67 ? 101 ILE A N   1 
ATOM   631  C  CA  . ILE A 1 79  ? 76.717 61.109 35.131  1.00 37.22 ? 101 ILE A CA  1 
ATOM   632  C  C   . ILE A 1 79  ? 75.696 61.662 34.134  1.00 37.10 ? 101 ILE A C   1 
ATOM   633  O  O   . ILE A 1 79  ? 74.984 62.622 34.435  1.00 36.23 ? 101 ILE A O   1 
ATOM   634  C  CB  . ILE A 1 79  ? 78.160 61.511 34.685  1.00 37.31 ? 101 ILE A CB  1 
ATOM   635  C  CG1 . ILE A 1 79  ? 79.187 61.234 35.792  1.00 37.28 ? 101 ILE A CG1 1 
ATOM   636  C  CG2 . ILE A 1 79  ? 78.220 62.975 34.215  1.00 36.95 ? 101 ILE A CG2 1 
ATOM   637  C  CD1 . ILE A 1 79  ? 79.241 62.269 36.886  1.00 37.91 ? 101 ILE A CD1 1 
ATOM   638  N  N   . PHE A 1 80  ? 75.639 61.038 32.955  1.00 37.46 ? 102 PHE A N   1 
ATOM   639  C  CA  . PHE A 1 80  ? 74.742 61.446 31.867  1.00 37.97 ? 102 PHE A CA  1 
ATOM   640  C  C   . PHE A 1 80  ? 73.287 61.393 32.302  1.00 37.85 ? 102 PHE A C   1 
ATOM   641  O  O   . PHE A 1 80  ? 72.494 62.270 31.953  1.00 38.45 ? 102 PHE A O   1 
ATOM   642  C  CB  . PHE A 1 80  ? 74.964 60.579 30.612  1.00 38.18 ? 102 PHE A CB  1 
ATOM   643  C  CG  . PHE A 1 80  ? 73.874 60.711 29.567  1.00 39.23 ? 102 PHE A CG  1 
ATOM   644  C  CD1 . PHE A 1 80  ? 72.677 59.993 29.686  1.00 39.85 ? 102 PHE A CD1 1 
ATOM   645  C  CD2 . PHE A 1 80  ? 74.048 61.549 28.461  1.00 40.33 ? 102 PHE A CD2 1 
ATOM   646  C  CE1 . PHE A 1 80  ? 71.663 60.114 28.726  1.00 41.24 ? 102 PHE A CE1 1 
ATOM   647  C  CE2 . PHE A 1 80  ? 73.049 61.678 27.486  1.00 40.68 ? 102 PHE A CE2 1 
ATOM   648  C  CZ  . PHE A 1 80  ? 71.853 60.955 27.617  1.00 41.35 ? 102 PHE A CZ  1 
ATOM   649  N  N   . LEU A 1 81  ? 72.947 60.360 33.064  1.00 37.75 ? 103 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 81  ? 71.580 60.135 33.516  1.00 37.34 ? 103 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 81  ? 71.156 61.130 34.589  1.00 36.84 ? 103 LEU A C   1 
ATOM   652  O  O   . LEU A 1 81  ? 70.040 61.644 34.542  1.00 37.22 ? 103 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 81  ? 71.390 58.678 33.972  1.00 37.39 ? 103 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 81  ? 71.325 57.637 32.839  1.00 38.13 ? 103 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 81  ? 71.092 56.219 33.368  1.00 38.47 ? 103 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 81  ? 70.261 57.996 31.789  1.00 38.52 ? 103 LEU A CD2 1 
ATOM   657  N  N   . MET A 1 82  ? 72.050 61.405 35.535  1.00 36.02 ? 104 MET A N   1 
ATOM   658  C  CA  . MET A 1 82  ? 71.863 62.464 36.529  1.00 35.28 ? 104 MET A CA  1 
ATOM   659  C  C   . MET A 1 82  ? 71.442 63.784 35.901  1.00 34.78 ? 104 MET A C   1 
ATOM   660  O  O   . MET A 1 82  ? 70.438 64.369 36.299  1.00 34.13 ? 104 MET A O   1 
ATOM   661  C  CB  . MET A 1 82  ? 73.150 62.694 37.322  1.00 35.16 ? 104 MET A CB  1 
ATOM   662  C  CG  . MET A 1 82  ? 73.344 61.757 38.496  1.00 36.19 ? 104 MET A CG  1 
ATOM   663  S  SD  . MET A 1 82  ? 75.056 61.599 39.060  1.00 37.08 ? 104 MET A SD  1 
ATOM   664  C  CE  . MET A 1 82  ? 75.503 63.277 39.443  1.00 31.33 ? 104 MET A CE  1 
ATOM   665  N  N   . GLU A 1 83  ? 72.224 64.248 34.926  1.00 34.41 ? 105 GLU A N   1 
ATOM   666  C  CA  . GLU A 1 83  ? 71.956 65.505 34.227  1.00 34.48 ? 105 GLU A CA  1 
ATOM   667  C  C   . GLU A 1 83  ? 70.665 65.474 33.400  1.00 33.65 ? 105 GLU A C   1 
ATOM   668  O  O   . GLU A 1 83  ? 69.808 66.336 33.572  1.00 33.90 ? 105 GLU A O   1 
ATOM   669  C  CB  . GLU A 1 83  ? 73.152 65.911 33.350  1.00 35.04 ? 105 GLU A CB  1 
ATOM   670  C  CG  . GLU A 1 83  ? 72.955 67.213 32.543  1.00 38.37 ? 105 GLU A CG  1 
ATOM   671  C  CD  . GLU A 1 83  ? 72.165 67.016 31.235  1.00 42.99 ? 105 GLU A CD  1 
ATOM   672  O  OE1 . GLU A 1 83  ? 72.613 66.243 30.352  1.00 44.82 ? 105 GLU A OE1 1 
ATOM   673  O  OE2 . GLU A 1 83  ? 71.091 67.645 31.086  1.00 44.81 ? 105 GLU A OE2 1 
ATOM   674  N  N   . ARG A 1 84  ? 70.536 64.500 32.503  1.00 32.66 ? 106 ARG A N   1 
ATOM   675  C  CA  . ARG A 1 84  ? 69.416 64.472 31.572  1.00 31.55 ? 106 ARG A CA  1 
ATOM   676  C  C   . ARG A 1 84  ? 68.067 64.238 32.239  1.00 30.77 ? 106 ARG A C   1 
ATOM   677  O  O   . ARG A 1 84  ? 67.054 64.779 31.786  1.00 30.68 ? 106 ARG A O   1 
ATOM   678  C  CB  . ARG A 1 84  ? 69.608 63.439 30.459  1.00 31.95 ? 106 ARG A CB  1 
ATOM   679  C  CG  . ARG A 1 84  ? 68.322 63.288 29.607  1.00 32.55 ? 106 ARG A CG  1 
ATOM   680  C  CD  . ARG A 1 84  ? 68.558 62.673 28.257  1.00 36.03 ? 106 ARG A CD  1 
ATOM   681  N  NE  . ARG A 1 84  ? 69.304 63.567 27.387  1.00 35.07 ? 106 ARG A NE  1 
ATOM   682  C  CZ  . ARG A 1 84  ? 69.650 63.287 26.141  1.00 36.67 ? 106 ARG A CZ  1 
ATOM   683  N  NH1 . ARG A 1 84  ? 69.309 62.130 25.589  1.00 36.30 ? 106 ARG A NH1 1 
ATOM   684  N  NH2 . ARG A 1 84  ? 70.336 64.186 25.442  1.00 38.43 ? 106 ARG A NH2 1 
ATOM   685  N  N   . ILE A 1 85  ? 68.043 63.403 33.277  1.00 29.54 ? 107 ILE A N   1 
ATOM   686  C  CA  . ILE A 1 85  ? 66.793 63.124 33.976  1.00 28.08 ? 107 ILE A CA  1 
ATOM   687  C  C   . ILE A 1 85  ? 66.550 64.112 35.114  1.00 27.32 ? 107 ILE A C   1 
ATOM   688  O  O   . ILE A 1 85  ? 65.453 64.663 35.227  1.00 27.33 ? 107 ILE A O   1 
ATOM   689  C  CB  . ILE A 1 85  ? 66.695 61.649 34.477  1.00 27.95 ? 107 ILE A CB  1 
ATOM   690  C  CG1 . ILE A 1 85  ? 66.853 60.679 33.301  1.00 28.35 ? 107 ILE A CG1 1 
ATOM   691  C  CG2 . ILE A 1 85  ? 65.368 61.402 35.166  1.00 27.11 ? 107 ILE A CG2 1 
ATOM   692  C  CD1 . ILE A 1 85  ? 66.886 59.209 33.692  1.00 25.96 ? 107 ILE A CD1 1 
ATOM   693  N  N   . PHE A 1 86  ? 67.571 64.355 35.933  1.00 26.24 ? 108 PHE A N   1 
ATOM   694  C  CA  . PHE A 1 86  ? 67.364 65.031 37.221  1.00 25.75 ? 108 PHE A CA  1 
ATOM   695  C  C   . PHE A 1 86  ? 67.924 66.434 37.279  1.00 26.23 ? 108 PHE A C   1 
ATOM   696  O  O   . PHE A 1 86  ? 67.759 67.126 38.280  1.00 26.23 ? 108 PHE A O   1 
ATOM   697  C  CB  . PHE A 1 86  ? 67.899 64.178 38.390  1.00 24.38 ? 108 PHE A CB  1 
ATOM   698  C  CG  . PHE A 1 86  ? 67.090 62.942 38.643  1.00 22.65 ? 108 PHE A CG  1 
ATOM   699  C  CD1 . PHE A 1 86  ? 65.917 62.997 39.414  1.00 20.89 ? 108 PHE A CD1 1 
ATOM   700  C  CD2 . PHE A 1 86  ? 67.479 61.716 38.094  1.00 18.14 ? 108 PHE A CD2 1 
ATOM   701  C  CE1 . PHE A 1 86  ? 65.141 61.839 39.631  1.00 18.28 ? 108 PHE A CE1 1 
ATOM   702  C  CE2 . PHE A 1 86  ? 66.722 60.553 38.322  1.00 18.41 ? 108 PHE A CE2 1 
ATOM   703  C  CZ  . PHE A 1 86  ? 65.561 60.611 39.086  1.00 16.77 ? 108 PHE A CZ  1 
ATOM   704  N  N   . ASP A 1 87  ? 68.573 66.842 36.192  1.00 27.54 ? 109 ASP A N   1 
ATOM   705  C  CA  . ASP A 1 87  ? 69.205 68.160 36.070  1.00 28.00 ? 109 ASP A CA  1 
ATOM   706  C  C   . ASP A 1 87  ? 70.254 68.363 37.163  1.00 28.63 ? 109 ASP A C   1 
ATOM   707  O  O   . ASP A 1 87  ? 70.465 69.468 37.648  1.00 28.03 ? 109 ASP A O   1 
ATOM   708  C  CB  . ASP A 1 87  ? 68.154 69.280 36.080  1.00 28.19 ? 109 ASP A CB  1 
ATOM   709  C  CG  . ASP A 1 87  ? 67.004 69.011 35.127  1.00 27.63 ? 109 ASP A CG  1 
ATOM   710  O  OD1 . ASP A 1 87  ? 67.250 68.827 33.921  1.00 26.54 ? 109 ASP A OD1 1 
ATOM   711  O  OD2 . ASP A 1 87  ? 65.849 68.974 35.586  1.00 29.26 ? 109 ASP A OD2 1 
ATOM   712  N  N   . VAL A 1 88  ? 70.917 67.287 37.559  1.00 30.04 ? 110 VAL A N   1 
ATOM   713  C  CA  . VAL A 1 88  ? 72.026 67.451 38.477  1.00 31.58 ? 110 VAL A CA  1 
ATOM   714  C  C   . VAL A 1 88  ? 73.382 67.263 37.804  1.00 33.30 ? 110 VAL A C   1 
ATOM   715  O  O   . VAL A 1 88  ? 73.625 66.325 37.034  1.00 33.50 ? 110 VAL A O   1 
ATOM   716  C  CB  . VAL A 1 88  ? 71.852 66.727 39.874  1.00 31.53 ? 110 VAL A CB  1 
ATOM   717  C  CG1 . VAL A 1 88  ? 70.581 65.897 39.957  1.00 30.68 ? 110 VAL A CG1 1 
ATOM   718  C  CG2 . VAL A 1 88  ? 73.106 65.959 40.306  1.00 30.49 ? 110 VAL A CG2 1 
ATOM   719  N  N   . GLN A 1 89  ? 74.233 68.239 38.054  1.00 35.17 ? 111 GLN A N   1 
ATOM   720  C  CA  . GLN A 1 89  ? 75.621 68.156 37.676  1.00 37.35 ? 111 GLN A CA  1 
ATOM   721  C  C   . GLN A 1 89  ? 76.399 68.563 38.910  1.00 38.18 ? 111 GLN A C   1 
ATOM   722  O  O   . GLN A 1 89  ? 76.126 69.603 39.531  1.00 38.58 ? 111 GLN A O   1 
ATOM   723  C  CB  . GLN A 1 89  ? 75.924 69.038 36.463  1.00 37.52 ? 111 GLN A CB  1 
ATOM   724  C  CG  . GLN A 1 89  ? 75.459 70.482 36.597  1.00 39.63 ? 111 GLN A CG  1 
ATOM   725  C  CD  . GLN A 1 89  ? 76.394 71.452 35.907  1.00 42.30 ? 111 GLN A CD  1 
ATOM   726  O  OE1 . GLN A 1 89  ? 76.470 71.483 34.671  1.00 43.14 ? 111 GLN A OE1 1 
ATOM   727  N  NE2 . GLN A 1 89  ? 77.123 72.249 36.703  1.00 41.82 ? 111 GLN A NE2 1 
ATOM   728  N  N   . LEU A 1 90  ? 77.330 67.694 39.286  1.00 39.51 ? 112 LEU A N   1 
ATOM   729  C  CA  . LEU A 1 90  ? 78.141 67.846 40.484  1.00 40.40 ? 112 LEU A CA  1 
ATOM   730  C  C   . LEU A 1 90  ? 79.620 67.980 40.107  1.00 41.40 ? 112 LEU A C   1 
ATOM   731  O  O   . LEU A 1 90  ? 80.024 67.541 39.021  1.00 41.65 ? 112 LEU A O   1 
ATOM   732  C  CB  . LEU A 1 90  ? 77.938 66.620 41.382  1.00 40.22 ? 112 LEU A CB  1 
ATOM   733  C  CG  . LEU A 1 90  ? 77.089 66.647 42.667  1.00 39.96 ? 112 LEU A CG  1 
ATOM   734  C  CD1 . LEU A 1 90  ? 76.195 67.876 42.838  1.00 38.94 ? 112 LEU A CD1 1 
ATOM   735  C  CD2 . LEU A 1 90  ? 76.285 65.362 42.810  1.00 39.67 ? 112 LEU A CD2 1 
ATOM   736  N  N   . PRO A 1 91  ? 80.434 68.600 40.986  1.00 42.23 ? 113 PRO A N   1 
ATOM   737  C  CA  . PRO A 1 91  ? 81.883 68.540 40.799  1.00 43.22 ? 113 PRO A CA  1 
ATOM   738  C  C   . PRO A 1 91  ? 82.381 67.099 40.659  1.00 44.20 ? 113 PRO A C   1 
ATOM   739  O  O   . PRO A 1 91  ? 81.823 66.187 41.284  1.00 44.30 ? 113 PRO A O   1 
ATOM   740  C  CB  . PRO A 1 91  ? 82.418 69.150 42.093  1.00 43.08 ? 113 PRO A CB  1 
ATOM   741  C  CG  . PRO A 1 91  ? 81.366 70.090 42.505  1.00 42.87 ? 113 PRO A CG  1 
ATOM   742  C  CD  . PRO A 1 91  ? 80.077 69.409 42.165  1.00 42.18 ? 113 PRO A CD  1 
ATOM   743  N  N   . HIS A 1 92  ? 83.406 66.898 39.830  1.00 45.02 ? 114 HIS A N   1 
ATOM   744  C  CA  . HIS A 1 92  ? 84.022 65.583 39.665  1.00 45.81 ? 114 HIS A CA  1 
ATOM   745  C  C   . HIS A 1 92  ? 84.375 65.011 41.028  1.00 45.69 ? 114 HIS A C   1 
ATOM   746  O  O   . HIS A 1 92  ? 84.970 65.693 41.862  1.00 46.25 ? 114 HIS A O   1 
ATOM   747  C  CB  . HIS A 1 92  ? 85.263 65.662 38.768  1.00 46.11 ? 114 HIS A CB  1 
ATOM   748  C  CG  . HIS A 1 92  ? 84.950 65.756 37.304  1.00 48.32 ? 114 HIS A CG  1 
ATOM   749  N  ND1 . HIS A 1 92  ? 85.632 65.028 36.348  1.00 50.68 ? 114 HIS A ND1 1 
ATOM   750  C  CD2 . HIS A 1 92  ? 84.025 66.484 36.631  1.00 49.91 ? 114 HIS A CD2 1 
ATOM   751  C  CE1 . HIS A 1 92  ? 85.145 65.311 35.151  1.00 51.45 ? 114 HIS A CE1 1 
ATOM   752  N  NE2 . HIS A 1 92  ? 84.169 66.192 35.295  1.00 51.22 ? 114 HIS A NE2 1 
ATOM   753  N  N   . TYR A 1 93  ? 83.966 63.768 41.253  1.00 45.53 ? 115 TYR A N   1 
ATOM   754  C  CA  . TYR A 1 93  ? 84.176 63.079 42.517  1.00 45.39 ? 115 TYR A CA  1 
ATOM   755  C  C   . TYR A 1 93  ? 84.484 61.622 42.220  1.00 45.40 ? 115 TYR A C   1 
ATOM   756  O  O   . TYR A 1 93  ? 84.284 61.166 41.092  1.00 45.64 ? 115 TYR A O   1 
ATOM   757  C  CB  . TYR A 1 93  ? 82.926 63.202 43.413  1.00 45.62 ? 115 TYR A CB  1 
ATOM   758  C  CG  . TYR A 1 93  ? 81.681 62.455 42.922  1.00 45.77 ? 115 TYR A CG  1 
ATOM   759  C  CD1 . TYR A 1 93  ? 81.270 61.270 43.539  1.00 45.96 ? 115 TYR A CD1 1 
ATOM   760  C  CD2 . TYR A 1 93  ? 80.910 62.940 41.856  1.00 45.73 ? 115 TYR A CD2 1 
ATOM   761  C  CE1 . TYR A 1 93  ? 80.134 60.580 43.103  1.00 45.16 ? 115 TYR A CE1 1 
ATOM   762  C  CE2 . TYR A 1 93  ? 79.767 62.249 41.409  1.00 45.60 ? 115 TYR A CE2 1 
ATOM   763  C  CZ  . TYR A 1 93  ? 79.386 61.071 42.044  1.00 45.60 ? 115 TYR A CZ  1 
ATOM   764  O  OH  . TYR A 1 93  ? 78.263 60.377 41.628  1.00 44.44 ? 115 TYR A OH  1 
ATOM   765  N  N   . SER A 1 94  ? 84.979 60.895 43.218  1.00 45.41 ? 116 SER A N   1 
ATOM   766  C  CA  . SER A 1 94  ? 85.184 59.459 43.077  1.00 45.44 ? 116 SER A CA  1 
ATOM   767  C  C   . SER A 1 94  ? 83.898 58.684 43.415  1.00 45.72 ? 116 SER A C   1 
ATOM   768  O  O   . SER A 1 94  ? 83.406 58.764 44.543  1.00 45.63 ? 116 SER A O   1 
ATOM   769  C  CB  . SER A 1 94  ? 86.337 58.998 43.965  1.00 45.57 ? 116 SER A CB  1 
ATOM   770  O  OG  . SER A 1 94  ? 86.640 57.628 43.741  1.00 45.27 ? 116 SER A OG  1 
ATOM   771  N  N   . PRO A 1 95  ? 83.341 57.948 42.431  1.00 45.80 ? 117 PRO A N   1 
ATOM   772  C  CA  . PRO A 1 95  ? 82.151 57.120 42.690  1.00 45.97 ? 117 PRO A CA  1 
ATOM   773  C  C   . PRO A 1 95  ? 82.390 55.993 43.697  1.00 45.96 ? 117 PRO A C   1 
ATOM   774  O  O   . PRO A 1 95  ? 81.499 55.693 44.491  1.00 45.94 ? 117 PRO A O   1 
ATOM   775  C  CB  . PRO A 1 95  ? 81.802 56.542 41.311  1.00 45.85 ? 117 PRO A CB  1 
ATOM   776  C  CG  . PRO A 1 95  ? 83.070 56.647 40.508  1.00 46.08 ? 117 PRO A CG  1 
ATOM   777  C  CD  . PRO A 1 95  ? 83.766 57.877 41.018  1.00 45.99 ? 117 PRO A CD  1 
ATOM   778  N  N   . SER A 1 96  ? 83.581 55.390 43.663  1.00 46.07 ? 118 SER A N   1 
ATOM   779  C  CA  . SER A 1 96  ? 83.923 54.266 44.551  1.00 45.90 ? 118 SER A CA  1 
ATOM   780  C  C   . SER A 1 96  ? 84.174 54.694 45.992  1.00 45.53 ? 118 SER A C   1 
ATOM   781  O  O   . SER A 1 96  ? 83.963 53.905 46.915  1.00 46.18 ? 118 SER A O   1 
ATOM   782  C  CB  . SER A 1 96  ? 85.138 53.506 44.022  1.00 46.07 ? 118 SER A CB  1 
ATOM   783  O  OG  . SER A 1 96  ? 86.275 54.355 43.962  1.00 46.51 ? 118 SER A OG  1 
ATOM   784  N  N   . ASP A 1 97  ? 84.648 55.928 46.171  1.00 44.98 ? 119 ASP A N   1 
ATOM   785  C  CA  . ASP A 1 97  ? 84.784 56.559 47.489  1.00 44.37 ? 119 ASP A CA  1 
ATOM   786  C  C   . ASP A 1 97  ? 83.411 56.911 48.098  1.00 43.59 ? 119 ASP A C   1 
ATOM   787  O  O   . ASP A 1 97  ? 83.161 56.678 49.288  1.00 43.35 ? 119 ASP A O   1 
ATOM   788  C  CB  . ASP A 1 97  ? 85.619 57.844 47.382  1.00 44.71 ? 119 ASP A CB  1 
ATOM   789  C  CG  . ASP A 1 97  ? 87.121 57.592 47.183  1.00 46.46 ? 119 ASP A CG  1 
ATOM   790  O  OD1 . ASP A 1 97  ? 87.623 56.455 47.372  1.00 47.82 ? 119 ASP A OD1 1 
ATOM   791  O  OD2 . ASP A 1 97  ? 87.817 58.576 46.846  1.00 48.86 ? 119 ASP A OD2 1 
ATOM   792  N  N   . GLU A 1 98  ? 82.535 57.493 47.277  1.00 42.44 ? 120 GLU A N   1 
ATOM   793  C  CA  . GLU A 1 98  ? 81.217 57.946 47.738  1.00 41.24 ? 120 GLU A CA  1 
ATOM   794  C  C   . GLU A 1 98  ? 80.257 56.782 48.002  1.00 40.37 ? 120 GLU A C   1 
ATOM   795  O  O   . GLU A 1 98  ? 79.446 56.842 48.924  1.00 39.76 ? 120 GLU A O   1 
ATOM   796  C  CB  . GLU A 1 98  ? 80.613 58.960 46.745  1.00 41.21 ? 120 GLU A CB  1 
ATOM   797  C  CG  . GLU A 1 98  ? 79.119 59.319 46.961  1.00 41.48 ? 120 GLU A CG  1 
ATOM   798  C  CD  . GLU A 1 98  ? 78.800 59.867 48.353  1.00 41.88 ? 120 GLU A CD  1 
ATOM   799  O  OE1 . GLU A 1 98  ? 77.595 60.068 48.653  1.00 42.35 ? 120 GLU A OE1 1 
ATOM   800  O  OE2 . GLU A 1 98  ? 79.741 60.094 49.153  1.00 41.21 ? 120 GLU A OE2 1 
ATOM   801  N  N   . LYS A 1 99  ? 80.349 55.729 47.186  1.00 39.68 ? 121 LYS A N   1 
ATOM   802  C  CA  . LYS A 1 99  ? 79.499 54.544 47.360  1.00 38.86 ? 121 LYS A CA  1 
ATOM   803  C  C   . LYS A 1 99  ? 79.858 53.842 48.656  1.00 38.10 ? 121 LYS A C   1 
ATOM   804  O  O   . LYS A 1 99  ? 78.980 53.394 49.392  1.00 37.76 ? 121 LYS A O   1 
ATOM   805  C  CB  . LYS A 1 99  ? 79.608 53.594 46.155  1.00 38.95 ? 121 LYS A CB  1 
ATOM   806  C  CG  . LYS A 1 99  ? 78.808 54.048 44.927  1.00 39.94 ? 121 LYS A CG  1 
ATOM   807  C  CD  . LYS A 1 99  ? 79.157 53.224 43.684  1.00 42.34 ? 121 LYS A CD  1 
ATOM   808  C  CE  . LYS A 1 99  ? 78.356 53.674 42.460  1.00 42.09 ? 121 LYS A CE  1 
ATOM   809  N  NZ  . LYS A 1 99  ? 76.913 53.320 42.560  1.00 42.73 ? 121 LYS A NZ  1 
ATOM   810  N  N   . ALA A 1 100 ? 81.158 53.775 48.933  1.00 37.60 ? 122 ALA A N   1 
ATOM   811  C  CA  . ALA A 1 100 ? 81.680 53.243 50.189  1.00 36.68 ? 122 ALA A CA  1 
ATOM   812  C  C   . ALA A 1 100 ? 81.171 54.056 51.381  1.00 36.25 ? 122 ALA A C   1 
ATOM   813  O  O   . ALA A 1 100 ? 80.696 53.493 52.378  1.00 36.18 ? 122 ALA A O   1 
ATOM   814  C  CB  . ALA A 1 100 ? 83.208 53.238 50.157  1.00 36.65 ? 122 ALA A CB  1 
ATOM   815  N  N   . ARG A 1 101 ? 81.264 55.381 51.264  1.00 35.52 ? 123 ARG A N   1 
ATOM   816  C  CA  . ARG A 1 101 ? 80.758 56.288 52.284  1.00 34.40 ? 123 ARG A CA  1 
ATOM   817  C  C   . ARG A 1 101 ? 79.251 56.049 52.481  1.00 33.75 ? 123 ARG A C   1 
ATOM   818  O  O   . ARG A 1 101 ? 78.822 55.692 53.584  1.00 34.31 ? 123 ARG A O   1 
ATOM   819  C  CB  . ARG A 1 101 ? 81.055 57.741 51.896  1.00 34.74 ? 123 ARG A CB  1 
ATOM   820  C  CG  . ARG A 1 101 ? 80.886 58.772 53.017  1.00 34.59 ? 123 ARG A CG  1 
ATOM   821  C  CD  . ARG A 1 101 ? 80.595 60.183 52.450  1.00 35.37 ? 123 ARG A CD  1 
ATOM   822  N  NE  . ARG A 1 101 ? 79.372 60.190 51.642  1.00 34.71 ? 123 ARG A NE  1 
ATOM   823  C  CZ  . ARG A 1 101 ? 78.140 60.100 52.141  1.00 32.72 ? 123 ARG A CZ  1 
ATOM   824  N  NH1 . ARG A 1 101 ? 77.955 60.027 53.453  1.00 30.57 ? 123 ARG A NH1 1 
ATOM   825  N  NH2 . ARG A 1 101 ? 77.091 60.076 51.324  1.00 32.57 ? 123 ARG A NH2 1 
ATOM   826  N  N   . MET A 1 102 ? 78.462 56.199 51.414  1.00 32.03 ? 124 MET A N   1 
ATOM   827  C  CA  . MET A 1 102 ? 77.010 56.014 51.498  1.00 30.30 ? 124 MET A CA  1 
ATOM   828  C  C   . MET A 1 102 ? 76.621 54.652 52.077  1.00 30.51 ? 124 MET A C   1 
ATOM   829  O  O   . MET A 1 102 ? 75.747 54.574 52.949  1.00 29.93 ? 124 MET A O   1 
ATOM   830  C  CB  . MET A 1 102 ? 76.326 56.254 50.135  1.00 29.55 ? 124 MET A CB  1 
ATOM   831  C  CG  . MET A 1 102 ? 74.778 56.323 50.190  1.00 25.85 ? 124 MET A CG  1 
ATOM   832  S  SD  . MET A 1 102 ? 73.903 57.054 48.782  1.00 15.81 ? 124 MET A SD  1 
ATOM   833  C  CE  . MET A 1 102 ? 74.539 58.720 48.789  1.00 22.10 ? 124 MET A CE  1 
ATOM   834  N  N   . LYS A 1 103 ? 77.276 53.583 51.611  1.00 30.32 ? 125 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 103 ? 76.848 52.234 51.995  1.00 30.12 ? 125 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 103 ? 76.968 51.975 53.494  1.00 29.84 ? 125 LYS A C   1 
ATOM   837  O  O   . LYS A 1 103 ? 76.148 51.255 54.067  1.00 29.99 ? 125 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 103 ? 77.503 51.110 51.163  1.00 30.15 ? 125 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 103 ? 76.614 49.821 51.170  1.00 30.58 ? 125 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 103 ? 77.181 48.647 50.388  1.00 28.79 ? 125 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 103 ? 76.660 47.357 50.993  1.00 28.75 ? 125 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 103 ? 77.123 46.125 50.309  1.00 29.80 ? 125 LYS A NZ  1 
ATOM   843  N  N   . LEU A 1 104 ? 77.953 52.602 54.125  1.00 29.46 ? 126 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 104 ? 78.127 52.497 55.573  1.00 29.49 ? 126 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 104 ? 76.958 53.096 56.356  1.00 28.51 ? 126 LEU A C   1 
ATOM   846  O  O   . LEU A 1 104 ? 76.574 52.564 57.386  1.00 27.57 ? 126 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 104 ? 79.429 53.176 56.018  1.00 30.11 ? 126 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 104 ? 80.764 52.440 55.957  1.00 31.66 ? 126 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 104 ? 81.843 53.332 56.574  1.00 32.18 ? 126 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 104 ? 80.682 51.115 56.703  1.00 33.34 ? 126 LEU A CD2 1 
ATOM   851  N  N   . THR A 1 105 ? 76.413 54.211 55.867  1.00 28.00 ? 127 THR A N   1 
ATOM   852  C  CA  . THR A 1 105 ? 75.260 54.866 56.515  1.00 27.64 ? 127 THR A CA  1 
ATOM   853  C  C   . THR A 1 105 ? 73.956 54.053 56.341  1.00 26.93 ? 127 THR A C   1 
ATOM   854  O  O   . THR A 1 105 ? 72.909 54.400 56.872  1.00 26.63 ? 127 THR A O   1 
ATOM   855  C  CB  . THR A 1 105 ? 75.092 56.322 56.019  1.00 27.88 ? 127 THR A CB  1 
ATOM   856  O  OG1 . THR A 1 105 ? 74.905 56.350 54.590  1.00 29.00 ? 127 THR A OG1 1 
ATOM   857  C  CG2 . THR A 1 105 ? 76.333 57.148 56.364  1.00 28.15 ? 127 THR A CG2 1 
ATOM   858  N  N   . LEU A 1 106 ? 74.056 52.950 55.612  1.00 26.72 ? 128 LEU A N   1 
ATOM   859  C  CA  . LEU A 1 106 ? 72.929 52.096 55.278  1.00 26.90 ? 128 LEU A CA  1 
ATOM   860  C  C   . LEU A 1 106 ? 73.173 50.686 55.806  1.00 26.70 ? 128 LEU A C   1 
ATOM   861  O  O   . LEU A 1 106 ? 72.496 49.743 55.406  1.00 26.57 ? 128 LEU A O   1 
ATOM   862  C  CB  . LEU A 1 106 ? 72.772 52.054 53.750  1.00 26.91 ? 128 LEU A CB  1 
ATOM   863  C  CG  . LEU A 1 106 ? 71.733 52.850 52.946  1.00 27.84 ? 128 LEU A CG  1 
ATOM   864  C  CD1 . LEU A 1 106 ? 71.183 54.094 53.625  1.00 27.11 ? 128 LEU A CD1 1 
ATOM   865  C  CD2 . LEU A 1 106 ? 72.312 53.157 51.547  1.00 26.94 ? 128 LEU A CD2 1 
ATOM   866  N  N   . LEU A 1 107 ? 74.157 50.543 56.691  1.00 27.03 ? 129 LEU A N   1 
ATOM   867  C  CA  . LEU A 1 107 ? 74.520 49.231 57.236  1.00 27.19 ? 129 LEU A CA  1 
ATOM   868  C  C   . LEU A 1 107 ? 74.763 49.252 58.742  1.00 27.53 ? 129 LEU A C   1 
ATOM   869  O  O   . LEU A 1 107 ? 74.878 50.325 59.357  1.00 27.34 ? 129 LEU A O   1 
ATOM   870  C  CB  . LEU A 1 107 ? 75.755 48.675 56.524  1.00 26.93 ? 129 LEU A CB  1 
ATOM   871  C  CG  . LEU A 1 107 ? 75.668 48.137 55.097  1.00 26.65 ? 129 LEU A CG  1 
ATOM   872  C  CD1 . LEU A 1 107 ? 77.087 47.858 54.626  1.00 27.72 ? 129 LEU A CD1 1 
ATOM   873  C  CD2 . LEU A 1 107 ? 74.808 46.872 54.980  1.00 25.00 ? 129 LEU A CD2 1 
ATOM   874  N  N   . HIS A 1 108 ? 74.824 48.053 59.323  1.00 28.01 ? 130 HIS A N   1 
ATOM   875  C  CA  . HIS A 1 108 ? 75.192 47.857 60.734  1.00 28.74 ? 130 HIS A CA  1 
ATOM   876  C  C   . HIS A 1 108 ? 74.276 48.629 61.701  1.00 29.64 ? 130 HIS A C   1 
ATOM   877  O  O   . HIS A 1 108 ? 73.049 48.445 61.633  1.00 29.99 ? 130 HIS A O   1 
ATOM   878  C  CB  . HIS A 1 108 ? 76.699 48.122 60.920  1.00 28.16 ? 130 HIS A CB  1 
ATOM   879  C  CG  . HIS A 1 108 ? 77.529 47.481 59.852  1.00 26.74 ? 130 HIS A CG  1 
ATOM   880  N  ND1 . HIS A 1 108 ? 78.463 48.172 59.113  1.00 24.86 ? 130 HIS A ND1 1 
ATOM   881  C  CD2 . HIS A 1 108 ? 77.512 46.221 59.352  1.00 26.77 ? 130 HIS A CD2 1 
ATOM   882  C  CE1 . HIS A 1 108 ? 79.004 47.363 58.221  1.00 24.75 ? 130 HIS A CE1 1 
ATOM   883  N  NE2 . HIS A 1 108 ? 78.440 46.174 58.339  1.00 24.98 ? 130 HIS A NE2 1 
ATOM   884  N  N   . ARG A 1 109 ? 74.840 49.485 62.567  1.00 29.86 ? 131 ARG A N   1 
ATOM   885  C  CA  . ARG A 1 109 ? 74.046 50.183 63.587  1.00 30.38 ? 131 ARG A CA  1 
ATOM   886  C  C   . ARG A 1 109 ? 73.090 51.215 62.981  1.00 29.86 ? 131 ARG A C   1 
ATOM   887  O  O   . ARG A 1 109 ? 71.991 51.411 63.484  1.00 29.15 ? 131 ARG A O   1 
ATOM   888  C  CB  . ARG A 1 109 ? 74.929 50.829 64.674  1.00 31.07 ? 131 ARG A CB  1 
ATOM   889  C  CG  . ARG A 1 109 ? 75.678 49.827 65.579  1.00 33.70 ? 131 ARG A CG  1 
ATOM   890  C  CD  . ARG A 1 109 ? 76.243 50.473 66.861  1.00 36.53 ? 131 ARG A CD  1 
ATOM   891  N  NE  . ARG A 1 109 ? 75.342 50.286 68.001  1.00 40.03 ? 131 ARG A NE  1 
ATOM   892  C  CZ  . ARG A 1 109 ? 75.634 50.560 69.275  1.00 41.47 ? 131 ARG A CZ  1 
ATOM   893  N  NH1 . ARG A 1 109 ? 76.828 51.040 69.618  1.00 42.36 ? 131 ARG A NH1 1 
ATOM   894  N  NH2 . ARG A 1 109 ? 74.718 50.357 70.220  1.00 40.90 ? 131 ARG A NH2 1 
ATOM   895  N  N   . GLU A 1 110 ? 73.506 51.870 61.904  1.00 29.93 ? 132 GLU A N   1 
ATOM   896  C  CA  . GLU A 1 110 ? 72.619 52.825 61.223  1.00 30.48 ? 132 GLU A CA  1 
ATOM   897  C  C   . GLU A 1 110 ? 71.415 52.117 60.578  1.00 29.67 ? 132 GLU A C   1 
ATOM   898  O  O   . GLU A 1 110 ? 70.282 52.597 60.665  1.00 29.74 ? 132 GLU A O   1 
ATOM   899  C  CB  . GLU A 1 110 ? 73.381 53.688 60.215  1.00 30.63 ? 132 GLU A CB  1 
ATOM   900  C  CG  . GLU A 1 110 ? 74.542 54.504 60.824  1.00 34.09 ? 132 GLU A CG  1 
ATOM   901  C  CD  . GLU A 1 110 ? 74.101 55.560 61.836  1.00 38.18 ? 132 GLU A CD  1 
ATOM   902  O  OE1 . GLU A 1 110 ? 72.896 55.904 61.873  1.00 39.48 ? 132 GLU A OE1 1 
ATOM   903  O  OE2 . GLU A 1 110 ? 74.968 56.056 62.599  1.00 40.40 ? 132 GLU A OE2 1 
ATOM   904  N  N   . LEU A 1 111 ? 71.660 50.965 59.963  1.00 29.06 ? 133 LEU A N   1 
ATOM   905  C  CA  . LEU A 1 111 ? 70.589 50.167 59.378  1.00 28.52 ? 133 LEU A CA  1 
ATOM   906  C  C   . LEU A 1 111 ? 69.560 49.787 60.444  1.00 28.36 ? 133 LEU A C   1 
ATOM   907  O  O   . LEU A 1 111 ? 68.355 49.919 60.221  1.00 27.95 ? 133 LEU A O   1 
ATOM   908  C  CB  . LEU A 1 111 ? 71.160 48.926 58.670  1.00 28.60 ? 133 LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 111 ? 70.206 47.827 58.166  1.00 28.45 ? 133 LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 111 ? 69.231 48.337 57.115  1.00 27.40 ? 133 LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 111 ? 70.995 46.654 57.629  1.00 26.36 ? 133 LEU A CD2 1 
ATOM   912  N  N   . GLN A 1 112 ? 70.045 49.342 61.605  1.00 28.02 ? 134 GLN A N   1 
ATOM   913  C  CA  . GLN A 1 112 ? 69.192 49.007 62.751  1.00 28.06 ? 134 GLN A CA  1 
ATOM   914  C  C   . GLN A 1 112 ? 68.311 50.188 63.179  1.00 27.07 ? 134 GLN A C   1 
ATOM   915  O  O   . GLN A 1 112 ? 67.109 50.012 63.418  1.00 26.67 ? 134 GLN A O   1 
ATOM   916  C  CB  . GLN A 1 112 ? 70.036 48.468 63.927  1.00 28.49 ? 134 GLN A CB  1 
ATOM   917  C  CG  . GLN A 1 112 ? 69.260 48.065 65.196  1.00 32.18 ? 134 GLN A CG  1 
ATOM   918  C  CD  . GLN A 1 112 ? 68.210 46.949 64.999  1.00 37.84 ? 134 GLN A CD  1 
ATOM   919  O  OE1 . GLN A 1 112 ? 67.257 46.829 65.795  1.00 40.11 ? 134 GLN A OE1 1 
ATOM   920  N  NE2 . GLN A 1 112 ? 68.382 46.129 63.957  1.00 39.07 ? 134 GLN A NE2 1 
ATOM   921  N  N   . ALA A 1 113 ? 68.905 51.376 63.273  1.00 26.24 ? 135 ALA A N   1 
ATOM   922  C  CA  . ALA A 1 113 ? 68.140 52.626 63.477  1.00 25.70 ? 135 ALA A CA  1 
ATOM   923  C  C   . ALA A 1 113 ? 67.092 52.849 62.366  1.00 24.85 ? 135 ALA A C   1 
ATOM   924  O  O   . ALA A 1 113 ? 65.942 53.152 62.652  1.00 25.13 ? 135 ALA A O   1 
ATOM   925  C  CB  . ALA A 1 113 ? 69.075 53.843 63.569  1.00 25.19 ? 135 ALA A CB  1 
ATOM   926  N  N   . LEU A 1 114 ? 67.511 52.703 61.114  1.00 23.93 ? 136 LEU A N   1 
ATOM   927  C  CA  . LEU A 1 114 ? 66.623 52.851 59.963  1.00 22.99 ? 136 LEU A CA  1 
ATOM   928  C  C   . LEU A 1 114 ? 65.523 51.812 59.973  1.00 22.79 ? 136 LEU A C   1 
ATOM   929  O  O   . LEU A 1 114 ? 64.368 52.130 59.733  1.00 22.43 ? 136 LEU A O   1 
ATOM   930  C  CB  . LEU A 1 114 ? 67.394 52.722 58.647  1.00 22.49 ? 136 LEU A CB  1 
ATOM   931  C  CG  . LEU A 1 114 ? 68.290 53.878 58.202  1.00 22.20 ? 136 LEU A CG  1 
ATOM   932  C  CD1 . LEU A 1 114 ? 69.053 53.483 56.941  1.00 19.44 ? 136 LEU A CD1 1 
ATOM   933  C  CD2 . LEU A 1 114 ? 67.497 55.144 57.982  1.00 20.40 ? 136 LEU A CD2 1 
ATOM   934  N  N   . THR A 1 115 ? 65.891 50.568 60.240  1.00 23.11 ? 137 THR A N   1 
ATOM   935  C  CA  . THR A 1 115 ? 64.923 49.476 60.273  1.00 24.10 ? 137 THR A CA  1 
ATOM   936  C  C   . THR A 1 115 ? 63.835 49.708 61.309  1.00 23.81 ? 137 THR A C   1 
ATOM   937  O  O   . THR A 1 115 ? 62.655 49.478 61.024  1.00 23.64 ? 137 THR A O   1 
ATOM   938  C  CB  . THR A 1 115 ? 65.603 48.113 60.474  1.00 24.28 ? 137 THR A CB  1 
ATOM   939  O  OG1 . THR A 1 115 ? 66.539 47.903 59.406  1.00 26.44 ? 137 THR A OG1 1 
ATOM   940  C  CG2 . THR A 1 115 ? 64.579 46.995 60.434  1.00 25.25 ? 137 THR A CG2 1 
ATOM   941  N  N   . GLU A 1 116 ? 64.234 50.169 62.495  1.00 23.64 ? 138 GLU A N   1 
ATOM   942  C  CA  . GLU A 1 116 ? 63.288 50.496 63.555  1.00 23.90 ? 138 GLU A CA  1 
ATOM   943  C  C   . GLU A 1 116 ? 62.443 51.710 63.182  1.00 22.86 ? 138 GLU A C   1 
ATOM   944  O  O   . GLU A 1 116 ? 61.236 51.686 63.375  1.00 22.69 ? 138 GLU A O   1 
ATOM   945  C  CB  . GLU A 1 116 ? 64.004 50.779 64.878  1.00 24.16 ? 138 GLU A CB  1 
ATOM   946  C  CG  . GLU A 1 116 ? 64.737 49.597 65.461  1.00 28.04 ? 138 GLU A CG  1 
ATOM   947  C  CD  . GLU A 1 116 ? 65.329 49.916 66.827  1.00 33.70 ? 138 GLU A CD  1 
ATOM   948  O  OE1 . GLU A 1 116 ? 64.667 50.650 67.606  1.00 35.56 ? 138 GLU A OE1 1 
ATOM   949  O  OE2 . GLU A 1 116 ? 66.453 49.437 67.116  1.00 35.72 ? 138 GLU A OE2 1 
ATOM   950  N  N   . ALA A 1 117 ? 63.089 52.761 62.662  1.00 22.05 ? 139 ALA A N   1 
ATOM   951  C  CA  . ALA A 1 117 ? 62.374 53.948 62.191  1.00 21.40 ? 139 ALA A CA  1 
ATOM   952  C  C   . ALA A 1 117 ? 61.394 53.601 61.047  1.00 20.61 ? 139 ALA A C   1 
ATOM   953  O  O   . ALA A 1 117 ? 60.262 54.089 61.021  1.00 19.81 ? 139 ALA A O   1 
ATOM   954  C  CB  . ALA A 1 117 ? 63.342 55.012 61.749  1.00 21.14 ? 139 ALA A CB  1 
ATOM   955  N  N   . MET A 1 118 ? 61.845 52.755 60.119  1.00 19.68 ? 140 MET A N   1 
ATOM   956  C  CA  . MET A 1 118 ? 61.005 52.325 58.991  1.00 18.79 ? 140 MET A CA  1 
ATOM   957  C  C   . MET A 1 118 ? 59.718 51.631 59.433  1.00 19.14 ? 140 MET A C   1 
ATOM   958  O  O   . MET A 1 118 ? 58.652 51.875 58.883  1.00 18.34 ? 140 MET A O   1 
ATOM   959  C  CB  . MET A 1 118 ? 61.776 51.419 58.027  1.00 17.16 ? 140 MET A CB  1 
ATOM   960  C  CG  . MET A 1 118 ? 61.052 51.171 56.658  1.00 15.74 ? 140 MET A CG  1 
ATOM   961  S  SD  . MET A 1 118 ? 60.552 52.659 55.755  1.00 2.94  ? 140 MET A SD  1 
ATOM   962  C  CE  . MET A 1 118 ? 58.855 52.575 56.154  1.00 16.75 ? 140 MET A CE  1 
ATOM   963  N  N   . TYR A 1 119 ? 59.815 50.754 60.425  1.00 20.41 ? 141 TYR A N   1 
ATOM   964  C  CA  . TYR A 1 119 ? 58.622 50.048 60.887  1.00 21.23 ? 141 TYR A CA  1 
ATOM   965  C  C   . TYR A 1 119 ? 57.572 50.975 61.522  1.00 20.81 ? 141 TYR A C   1 
ATOM   966  O  O   . TYR A 1 119 ? 56.367 50.844 61.257  1.00 20.03 ? 141 TYR A O   1 
ATOM   967  C  CB  . TYR A 1 119 ? 59.005 48.901 61.816  1.00 22.99 ? 141 TYR A CB  1 
ATOM   968  C  CG  . TYR A 1 119 ? 57.824 48.082 62.254  1.00 24.00 ? 141 TYR A CG  1 
ATOM   969  C  CD1 . TYR A 1 119 ? 57.179 47.222 61.366  1.00 26.15 ? 141 TYR A CD1 1 
ATOM   970  C  CD2 . TYR A 1 119 ? 57.333 48.183 63.557  1.00 26.76 ? 141 TYR A CD2 1 
ATOM   971  C  CE1 . TYR A 1 119 ? 56.074 46.477 61.773  1.00 28.07 ? 141 TYR A CE1 1 
ATOM   972  C  CE2 . TYR A 1 119 ? 56.237 47.440 63.966  1.00 26.89 ? 141 TYR A CE2 1 
ATOM   973  C  CZ  . TYR A 1 119 ? 55.619 46.593 63.076  1.00 26.77 ? 141 TYR A CZ  1 
ATOM   974  O  OH  . TYR A 1 119 ? 54.542 45.847 63.500  1.00 30.09 ? 141 TYR A OH  1 
ATOM   975  N  N   . THR A 1 120 ? 58.019 51.921 62.345  1.00 20.72 ? 142 THR A N   1 
ATOM   976  C  CA  . THR A 1 120 ? 57.078 52.895 62.930  1.00 20.69 ? 142 THR A CA  1 
ATOM   977  C  C   . THR A 1 120 ? 56.494 53.861 61.873  1.00 20.36 ? 142 THR A C   1 
ATOM   978  O  O   . THR A 1 120 ? 55.315 54.166 61.932  1.00 19.98 ? 142 THR A O   1 
ATOM   979  C  CB  . THR A 1 120 ? 57.556 53.529 64.317  1.00 20.96 ? 142 THR A CB  1 
ATOM   980  O  OG1 . THR A 1 120 ? 57.259 54.933 64.399  1.00 24.32 ? 142 THR A OG1 1 
ATOM   981  C  CG2 . THR A 1 120 ? 59.006 53.317 64.555  1.00 20.42 ? 142 THR A CG2 1 
ATOM   982  N  N   . ASN A 1 121 ? 57.276 54.263 60.861  1.00 20.09 ? 143 ASN A N   1 
ATOM   983  C  CA  . ASN A 1 121 ? 56.710 55.078 59.760  1.00 19.85 ? 143 ASN A CA  1 
ATOM   984  C  C   . ASN A 1 121 ? 55.713 54.318 58.870  1.00 19.80 ? 143 ASN A C   1 
ATOM   985  O  O   . ASN A 1 121 ? 54.663 54.827 58.521  1.00 19.17 ? 143 ASN A O   1 
ATOM   986  C  CB  . ASN A 1 121 ? 57.814 55.779 58.955  1.00 19.81 ? 143 ASN A CB  1 
ATOM   987  C  CG  . ASN A 1 121 ? 58.508 56.854 59.773  1.00 20.20 ? 143 ASN A CG  1 
ATOM   988  O  OD1 . ASN A 1 121 ? 57.845 57.610 60.469  1.00 20.93 ? 143 ASN A OD1 1 
ATOM   989  N  ND2 . ASN A 1 121 ? 59.829 56.896 59.733  1.00 17.88 ? 143 ASN A ND2 1 
ATOM   990  N  N   . LEU A 1 122 ? 56.035 53.075 58.549  1.00 19.95 ? 144 LEU A N   1 
ATOM   991  C  CA  . LEU A 1 122 ? 55.152 52.231 57.768  1.00 20.35 ? 144 LEU A CA  1 
ATOM   992  C  C   . LEU A 1 122 ? 53.831 52.061 58.516  1.00 20.74 ? 144 LEU A C   1 
ATOM   993  O  O   . LEU A 1 122 ? 52.754 52.239 57.940  1.00 19.75 ? 144 LEU A O   1 
ATOM   994  C  CB  . LEU A 1 122 ? 55.836 50.888 57.550  1.00 19.80 ? 144 LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 122 ? 55.978 50.100 56.240  1.00 22.06 ? 144 LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 122 ? 55.880 50.900 54.891  1.00 17.43 ? 144 LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 122 ? 57.258 49.258 56.316  1.00 17.58 ? 144 LEU A CD2 1 
ATOM   998  N  N   . HIS A 1 123 ? 53.936 51.728 59.802  1.00 21.61 ? 145 HIS A N   1 
ATOM   999  C  CA  . HIS A 1 123 ? 52.797 51.606 60.708  1.00 23.06 ? 145 HIS A CA  1 
ATOM   1000 C  C   . HIS A 1 123 ? 52.003 52.904 60.789  1.00 23.22 ? 145 HIS A C   1 
ATOM   1001 O  O   . HIS A 1 123 ? 50.787 52.897 60.562  1.00 22.91 ? 145 HIS A O   1 
ATOM   1002 C  CB  . HIS A 1 123 ? 53.276 51.187 62.105  1.00 23.94 ? 145 HIS A CB  1 
ATOM   1003 C  CG  . HIS A 1 123 ? 52.173 50.816 63.049  1.00 26.15 ? 145 HIS A CG  1 
ATOM   1004 N  ND1 . HIS A 1 123 ? 51.435 51.756 63.739  1.00 28.57 ? 145 HIS A ND1 1 
ATOM   1005 C  CD2 . HIS A 1 123 ? 51.701 49.606 63.440  1.00 28.40 ? 145 HIS A CD2 1 
ATOM   1006 C  CE1 . HIS A 1 123 ? 50.536 51.144 64.491  1.00 28.55 ? 145 HIS A CE1 1 
ATOM   1007 N  NE2 . HIS A 1 123 ? 50.675 49.838 64.326  1.00 29.36 ? 145 HIS A NE2 1 
ATOM   1008 N  N   . ALA A 1 124 ? 52.690 54.007 61.092  1.00 23.20 ? 146 ALA A N   1 
ATOM   1009 C  CA  . ALA A 1 124 ? 52.032 55.307 61.250  1.00 24.39 ? 146 ALA A CA  1 
ATOM   1010 C  C   . ALA A 1 124 ? 51.314 55.749 59.981  1.00 24.58 ? 146 ALA A C   1 
ATOM   1011 O  O   . ALA A 1 124 ? 50.196 56.241 60.046  1.00 25.36 ? 146 ALA A O   1 
ATOM   1012 C  CB  . ALA A 1 124 ? 53.026 56.376 61.697  1.00 23.86 ? 146 ALA A CB  1 
ATOM   1013 N  N   . VAL A 1 125 ? 51.957 55.568 58.830  1.00 24.83 ? 147 VAL A N   1 
ATOM   1014 C  CA  . VAL A 1 125 ? 51.361 55.957 57.551  1.00 24.65 ? 147 VAL A CA  1 
ATOM   1015 C  C   . VAL A 1 125 ? 50.192 55.052 57.162  1.00 24.94 ? 147 VAL A C   1 
ATOM   1016 O  O   . VAL A 1 125 ? 49.122 55.537 56.800  1.00 25.73 ? 147 VAL A O   1 
ATOM   1017 C  CB  . VAL A 1 125 ? 52.438 56.060 56.437  1.00 24.73 ? 147 VAL A CB  1 
ATOM   1018 C  CG1 . VAL A 1 125 ? 51.814 56.275 55.086  1.00 24.44 ? 147 VAL A CG1 1 
ATOM   1019 C  CG2 . VAL A 1 125 ? 53.393 57.228 56.747  1.00 23.96 ? 147 VAL A CG2 1 
ATOM   1020 N  N   . LEU A 1 126 ? 50.403 53.743 57.246  1.00 24.75 ? 148 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 126 ? 49.423 52.750 56.813  1.00 24.47 ? 148 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 126 ? 48.212 52.726 57.748  1.00 24.39 ? 148 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 126 ? 47.067 52.870 57.295  1.00 23.66 ? 148 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 126 ? 50.082 51.366 56.694  1.00 24.02 ? 148 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 126 ? 49.524 50.143 55.934  1.00 26.05 ? 148 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 126 ? 49.334 48.899 56.831  1.00 23.77 ? 148 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 126 ? 48.280 50.433 55.124  1.00 25.29 ? 148 LEU A CD2 1 
ATOM   1028 N  N   . LEU A 1 127 ? 48.457 52.559 59.048  1.00 24.55 ? 149 LEU A N   1 
ATOM   1029 C  CA  . LEU A 1 127 ? 47.355 52.561 60.005  1.00 25.06 ? 149 LEU A CA  1 
ATOM   1030 C  C   . LEU A 1 127 ? 46.787 53.957 60.226  1.00 25.61 ? 149 LEU A C   1 
ATOM   1031 O  O   . LEU A 1 127 ? 45.584 54.107 60.441  1.00 26.73 ? 149 LEU A O   1 
ATOM   1032 C  CB  . LEU A 1 127 ? 47.715 51.837 61.308  1.00 25.34 ? 149 LEU A CB  1 
ATOM   1033 C  CG  . LEU A 1 127 ? 48.084 50.349 61.133  1.00 26.14 ? 149 LEU A CG  1 
ATOM   1034 C  CD1 . LEU A 1 127 ? 48.201 49.654 62.470  1.00 28.44 ? 149 LEU A CD1 1 
ATOM   1035 C  CD2 . LEU A 1 127 ? 47.084 49.589 60.241  1.00 28.43 ? 149 LEU A CD2 1 
ATOM   1036 N  N   . GLY A 1 128 ? 47.625 54.985 60.114  1.00 25.55 ? 150 GLY A N   1 
ATOM   1037 C  CA  . GLY A 1 128 ? 47.140 56.365 60.146  1.00 25.95 ? 150 GLY A CA  1 
ATOM   1038 C  C   . GLY A 1 128 ? 46.158 56.678 59.021  1.00 26.26 ? 150 GLY A C   1 
ATOM   1039 O  O   . GLY A 1 128 ? 45.084 57.211 59.277  1.00 25.69 ? 150 GLY A O   1 
ATOM   1040 N  N   . ASP A 1 129 ? 46.517 56.322 57.780  1.00 26.56 ? 151 ASP A N   1 
ATOM   1041 C  CA  . ASP A 1 129 ? 45.624 56.516 56.626  1.00 27.19 ? 151 ASP A CA  1 
ATOM   1042 C  C   . ASP A 1 129 ? 44.335 55.690 56.714  1.00 27.35 ? 151 ASP A C   1 
ATOM   1043 O  O   . ASP A 1 129 ? 43.279 56.148 56.285  1.00 27.67 ? 151 ASP A O   1 
ATOM   1044 C  CB  . ASP A 1 129 ? 46.333 56.190 55.302  1.00 27.31 ? 151 ASP A CB  1 
ATOM   1045 C  CG  . ASP A 1 129 ? 46.911 57.426 54.595  1.00 27.66 ? 151 ASP A CG  1 
ATOM   1046 O  OD1 . ASP A 1 129 ? 47.202 58.446 55.239  1.00 27.19 ? 151 ASP A OD1 1 
ATOM   1047 O  OD2 . ASP A 1 129 ? 47.106 57.357 53.363  1.00 30.06 ? 151 ASP A OD2 1 
ATOM   1048 N  N   . ALA A 1 130 ? 44.429 54.463 57.225  1.00 27.38 ? 152 ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 130 ? 43.246 53.611 57.337  1.00 27.50 ? 152 ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 130 ? 42.314 54.089 58.444  1.00 27.34 ? 152 ALA A C   1 
ATOM   1051 O  O   . ALA A 1 130 ? 41.099 54.084 58.260  1.00 27.08 ? 152 ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 130 ? 43.618 52.143 57.528  1.00 27.45 ? 152 ALA A CB  1 
ATOM   1053 N  N   . THR A 1 131 ? 42.883 54.507 59.578  1.00 27.60 ? 153 THR A N   1 
ATOM   1054 C  CA  . THR A 1 131 ? 42.086 55.021 60.706  1.00 27.81 ? 153 THR A CA  1 
ATOM   1055 C  C   . THR A 1 131 ? 41.342 56.293 60.286  1.00 27.91 ? 153 THR A C   1 
ATOM   1056 O  O   . THR A 1 131 ? 40.178 56.476 60.643  1.00 27.58 ? 153 THR A O   1 
ATOM   1057 C  CB  . THR A 1 131 ? 42.959 55.278 61.986  1.00 27.57 ? 153 THR A CB  1 
ATOM   1058 O  OG1 . THR A 1 131 ? 43.692 54.093 62.304  1.00 28.06 ? 153 THR A OG1 1 
ATOM   1059 C  CG2 . THR A 1 131 ? 42.095 55.639 63.193  1.00 28.26 ? 153 THR A CG2 1 
ATOM   1060 N  N   . GLU A 1 132 ? 42.016 57.160 59.527  1.00 28.30 ? 154 GLU A N   1 
ATOM   1061 C  CA  . GLU A 1 132 ? 41.403 58.414 59.062  1.00 29.47 ? 154 GLU A CA  1 
ATOM   1062 C  C   . GLU A 1 132 ? 40.225 58.170 58.101  1.00 29.12 ? 154 GLU A C   1 
ATOM   1063 O  O   . GLU A 1 132 ? 39.193 58.885 58.154  1.00 29.24 ? 154 GLU A O   1 
ATOM   1064 C  CB  . GLU A 1 132 ? 42.441 59.323 58.394  1.00 29.93 ? 154 GLU A CB  1 
ATOM   1065 C  CG  . GLU A 1 132 ? 41.898 60.697 58.023  1.00 32.52 ? 154 GLU A CG  1 
ATOM   1066 C  CD  . GLU A 1 132 ? 42.579 61.289 56.813  1.00 36.91 ? 154 GLU A CD  1 
ATOM   1067 O  OE1 . GLU A 1 132 ? 41.864 61.760 55.893  1.00 39.84 ? 154 GLU A OE1 1 
ATOM   1068 O  OE2 . GLU A 1 132 ? 43.829 61.272 56.767  1.00 38.86 ? 154 GLU A OE2 1 
ATOM   1069 N  N   . ALA A 1 133 ? 40.379 57.173 57.229  1.00 27.89 ? 155 ALA A N   1 
ATOM   1070 C  CA  . ALA A 1 133 ? 39.336 56.840 56.266  1.00 27.63 ? 155 ALA A CA  1 
ATOM   1071 C  C   . ALA A 1 133 ? 38.234 55.974 56.896  1.00 27.40 ? 155 ALA A C   1 
ATOM   1072 O  O   . ALA A 1 133 ? 37.113 55.933 56.407  1.00 27.39 ? 155 ALA A O   1 
ATOM   1073 C  CB  . ALA A 1 133 ? 39.941 56.155 55.025  1.00 27.65 ? 155 ALA A CB  1 
ATOM   1074 N  N   . GLY A 1 134 ? 38.560 55.285 57.984  1.00 27.46 ? 156 GLY A N   1 
ATOM   1075 C  CA  . GLY A 1 134 ? 37.558 54.570 58.751  1.00 27.31 ? 156 GLY A CA  1 
ATOM   1076 C  C   . GLY A 1 134 ? 37.537 53.081 58.500  1.00 27.18 ? 156 GLY A C   1 
ATOM   1077 O  O   . GLY A 1 134 ? 38.268 52.564 57.642  1.00 26.51 ? 156 GLY A O   1 
ATOM   1078 N  N   . SER A 1 135 ? 36.653 52.398 59.216  1.00 27.05 ? 157 SER A N   1 
ATOM   1079 C  CA  . SER A 1 135 ? 36.755 50.943 59.372  1.00 27.43 ? 157 SER A CA  1 
ATOM   1080 C  C   . SER A 1 135 ? 36.289 50.068 58.196  1.00 27.49 ? 157 SER A C   1 
ATOM   1081 O  O   . SER A 1 135 ? 36.569 48.866 58.192  1.00 28.29 ? 157 SER A O   1 
ATOM   1082 C  CB  . SER A 1 135 ? 36.094 50.489 60.691  1.00 27.75 ? 157 SER A CB  1 
ATOM   1083 O  OG  . SER A 1 135 ? 34.706 50.766 60.702  1.00 27.36 ? 157 SER A OG  1 
ATOM   1084 N  N   . GLY A 1 136 ? 35.582 50.643 57.223  1.00 27.31 ? 158 GLY A N   1 
ATOM   1085 C  CA  . GLY A 1 136 ? 35.060 49.856 56.092  1.00 27.34 ? 158 GLY A CA  1 
ATOM   1086 C  C   . GLY A 1 136 ? 36.123 49.493 55.046  1.00 27.69 ? 158 GLY A C   1 
ATOM   1087 O  O   . GLY A 1 136 ? 37.296 49.874 55.180  1.00 27.97 ? 158 GLY A O   1 
ATOM   1088 N  N   . TRP A 1 137 ? 35.725 48.743 54.017  1.00 27.00 ? 159 TRP A N   1 
ATOM   1089 C  CA  . TRP A 1 137 ? 36.587 48.502 52.852  1.00 26.95 ? 159 TRP A CA  1 
ATOM   1090 C  C   . TRP A 1 137 ? 36.951 49.816 52.151  1.00 27.30 ? 159 TRP A C   1 
ATOM   1091 O  O   . TRP A 1 137 ? 36.134 50.730 52.067  1.00 27.36 ? 159 TRP A O   1 
ATOM   1092 C  CB  . TRP A 1 137 ? 35.887 47.610 51.815  1.00 25.87 ? 159 TRP A CB  1 
ATOM   1093 C  CG  . TRP A 1 137 ? 35.666 46.171 52.190  1.00 24.99 ? 159 TRP A CG  1 
ATOM   1094 C  CD1 . TRP A 1 137 ? 34.474 45.590 52.520  1.00 23.94 ? 159 TRP A CD1 1 
ATOM   1095 C  CD2 . TRP A 1 137 ? 36.650 45.115 52.225  1.00 24.04 ? 159 TRP A CD2 1 
ATOM   1096 N  NE1 . TRP A 1 137 ? 34.652 44.245 52.771  1.00 25.33 ? 159 TRP A NE1 1 
ATOM   1097 C  CE2 . TRP A 1 137 ? 35.974 43.927 52.602  1.00 23.38 ? 159 TRP A CE2 1 
ATOM   1098 C  CE3 . TRP A 1 137 ? 38.030 45.061 51.985  1.00 21.33 ? 159 TRP A CE3 1 
ATOM   1099 C  CZ2 . TRP A 1 137 ? 36.625 42.707 52.732  1.00 23.42 ? 159 TRP A CZ2 1 
ATOM   1100 C  CZ3 . TRP A 1 137 ? 38.680 43.840 52.103  1.00 22.98 ? 159 TRP A CZ3 1 
ATOM   1101 C  CH2 . TRP A 1 137 ? 37.977 42.679 52.479  1.00 23.94 ? 159 TRP A CH2 1 
ATOM   1102 N  N   . HIS A 1 138 ? 38.177 49.890 51.630  1.00 27.89 ? 160 HIS A N   1 
ATOM   1103 C  CA  . HIS A 1 138 ? 38.609 51.015 50.799  1.00 27.84 ? 160 HIS A CA  1 
ATOM   1104 C  C   . HIS A 1 138 ? 39.179 50.507 49.484  1.00 27.26 ? 160 HIS A C   1 
ATOM   1105 O  O   . HIS A 1 138 ? 39.958 49.554 49.463  1.00 26.90 ? 160 HIS A O   1 
ATOM   1106 C  CB  . HIS A 1 138 ? 39.653 51.872 51.515  1.00 28.17 ? 160 HIS A CB  1 
ATOM   1107 C  CG  . HIS A 1 138 ? 39.235 52.300 52.887  1.00 30.80 ? 160 HIS A CG  1 
ATOM   1108 N  ND1 . HIS A 1 138 ? 39.965 51.996 54.014  1.00 31.78 ? 160 HIS A ND1 1 
ATOM   1109 C  CD2 . HIS A 1 138 ? 38.145 52.980 53.315  1.00 31.99 ? 160 HIS A CD2 1 
ATOM   1110 C  CE1 . HIS A 1 138 ? 39.356 52.491 55.075  1.00 31.98 ? 160 HIS A CE1 1 
ATOM   1111 N  NE2 . HIS A 1 138 ? 38.243 53.083 54.679  1.00 32.64 ? 160 HIS A NE2 1 
ATOM   1112 N  N   . GLU A 1 139 ? 38.796 51.155 48.392  1.00 26.32 ? 161 GLU A N   1 
ATOM   1113 C  CA  . GLU A 1 139 ? 39.197 50.690 47.070  1.00 26.34 ? 161 GLU A CA  1 
ATOM   1114 C  C   . GLU A 1 139 ? 40.368 51.493 46.560  1.00 24.66 ? 161 GLU A C   1 
ATOM   1115 O  O   . GLU A 1 139 ? 40.442 52.696 46.765  1.00 24.75 ? 161 GLU A O   1 
ATOM   1116 C  CB  . GLU A 1 139 ? 38.035 50.698 46.074  1.00 26.47 ? 161 GLU A CB  1 
ATOM   1117 C  CG  . GLU A 1 139 ? 36.946 49.698 46.424  1.00 30.71 ? 161 GLU A CG  1 
ATOM   1118 C  CD  . GLU A 1 139 ? 36.012 49.412 45.255  1.00 35.94 ? 161 GLU A CD  1 
ATOM   1119 O  OE1 . GLU A 1 139 ? 35.814 50.319 44.417  1.00 37.54 ? 161 GLU A OE1 1 
ATOM   1120 O  OE2 . GLU A 1 139 ? 35.467 48.284 45.180  1.00 37.65 ? 161 GLU A OE2 1 
ATOM   1121 N  N   . MET A 1 140 ? 41.260 50.801 45.864  1.00 23.08 ? 162 MET A N   1 
ATOM   1122 C  CA  . MET A 1 140 ? 42.579 51.303 45.583  1.00 21.40 ? 162 MET A CA  1 
ATOM   1123 C  C   . MET A 1 140 ? 43.192 50.484 44.465  1.00 19.97 ? 162 MET A C   1 
ATOM   1124 O  O   . MET A 1 140 ? 42.871 49.312 44.329  1.00 19.85 ? 162 MET A O   1 
ATOM   1125 C  CB  . MET A 1 140 ? 43.406 51.100 46.860  1.00 21.28 ? 162 MET A CB  1 
ATOM   1126 C  CG  . MET A 1 140 ? 44.624 51.883 46.885  1.00 21.96 ? 162 MET A CG  1 
ATOM   1127 S  SD  . MET A 1 140 ? 44.927 52.710 48.432  1.00 18.67 ? 162 MET A SD  1 
ATOM   1128 C  CE  . MET A 1 140 ? 46.169 53.745 47.756  1.00 13.63 ? 162 MET A CE  1 
ATOM   1129 N  N   . GLY A 1 141 ? 44.071 51.087 43.661  1.00 18.69 ? 163 GLY A N   1 
ATOM   1130 C  CA  . GLY A 1 141 ? 44.954 50.297 42.792  1.00 16.75 ? 163 GLY A CA  1 
ATOM   1131 C  C   . GLY A 1 141 ? 46.035 49.682 43.675  1.00 15.80 ? 163 GLY A C   1 
ATOM   1132 O  O   . GLY A 1 141 ? 46.515 50.334 44.606  1.00 14.86 ? 163 GLY A O   1 
ATOM   1133 N  N   . LEU A 1 142 ? 46.391 48.424 43.417  1.00 15.38 ? 164 LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 142 ? 47.413 47.731 44.227  1.00 14.78 ? 164 LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 142 ? 48.810 48.392 44.158  1.00 14.19 ? 164 LEU A C   1 
ATOM   1136 O  O   . LEU A 1 142 ? 49.506 48.425 45.148  1.00 13.92 ? 164 LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 142 ? 47.513 46.244 43.868  1.00 14.35 ? 164 LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 142 ? 48.491 45.398 44.721  1.00 14.37 ? 164 LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 142 ? 48.107 45.379 46.205  1.00 12.55 ? 164 LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 142 ? 48.618 43.969 44.177  1.00 14.74 ? 164 LEU A CD2 1 
ATOM   1141 N  N   . LEU A 1 143 ? 49.213 48.875 42.984  1.00 14.25 ? 165 LEU A N   1 
ATOM   1142 C  CA  . LEU A 1 143 ? 50.430 49.676 42.832  1.00 14.57 ? 165 LEU A CA  1 
ATOM   1143 C  C   . LEU A 1 143 ? 50.361 50.968 43.636  1.00 15.36 ? 165 LEU A C   1 
ATOM   1144 O  O   . LEU A 1 143 ? 51.237 51.252 44.467  1.00 13.80 ? 165 LEU A O   1 
ATOM   1145 C  CB  . LEU A 1 143 ? 50.695 49.996 41.354  1.00 14.45 ? 165 LEU A CB  1 
ATOM   1146 C  CG  . LEU A 1 143 ? 51.995 50.753 41.061  1.00 14.36 ? 165 LEU A CG  1 
ATOM   1147 C  CD1 . LEU A 1 143 ? 53.251 49.904 41.493  1.00 11.12 ? 165 LEU A CD1 1 
ATOM   1148 C  CD2 . LEU A 1 143 ? 52.072 51.145 39.606  1.00 11.65 ? 165 LEU A CD2 1 
ATOM   1149 N  N   . ASP A 1 144 ? 49.309 51.749 43.393  1.00 16.59 ? 166 ASP A N   1 
ATOM   1150 C  CA  . ASP A 1 144 ? 49.084 52.980 44.149  1.00 17.58 ? 166 ASP A CA  1 
ATOM   1151 C  C   . ASP A 1 144 ? 49.189 52.703 45.648  1.00 17.25 ? 166 ASP A C   1 
ATOM   1152 O  O   . ASP A 1 144 ? 49.845 53.451 46.365  1.00 16.77 ? 166 ASP A O   1 
ATOM   1153 C  CB  . ASP A 1 144 ? 47.727 53.614 43.796  1.00 19.09 ? 166 ASP A CB  1 
ATOM   1154 C  CG  . ASP A 1 144 ? 47.772 54.437 42.498  1.00 23.15 ? 166 ASP A CG  1 
ATOM   1155 O  OD1 . ASP A 1 144 ? 48.844 54.531 41.857  1.00 27.86 ? 166 ASP A OD1 1 
ATOM   1156 O  OD2 . ASP A 1 144 ? 46.724 55.008 42.117  1.00 28.75 ? 166 ASP A OD2 1 
ATOM   1157 N  N   . PHE A 1 145 ? 48.572 51.605 46.092  1.00 16.06 ? 167 PHE A N   1 
ATOM   1158 C  CA  . PHE A 1 145 ? 48.645 51.135 47.485  1.00 15.88 ? 167 PHE A CA  1 
ATOM   1159 C  C   . PHE A 1 145 ? 50.073 50.851 47.946  1.00 15.22 ? 167 PHE A C   1 
ATOM   1160 O  O   . PHE A 1 145 ? 50.531 51.402 48.952  1.00 15.09 ? 167 PHE A O   1 
ATOM   1161 C  CB  . PHE A 1 145 ? 47.781 49.876 47.624  1.00 16.00 ? 167 PHE A CB  1 
ATOM   1162 C  CG  . PHE A 1 145 ? 47.794 49.234 48.999  1.00 16.73 ? 167 PHE A CG  1 
ATOM   1163 C  CD1 . PHE A 1 145 ? 46.914 49.667 50.005  1.00 16.91 ? 167 PHE A CD1 1 
ATOM   1164 C  CD2 . PHE A 1 145 ? 48.601 48.128 49.253  1.00 14.89 ? 167 PHE A CD2 1 
ATOM   1165 C  CE1 . PHE A 1 145 ? 46.898 49.037 51.270  1.00 17.41 ? 167 PHE A CE1 1 
ATOM   1166 C  CE2 . PHE A 1 145 ? 48.595 47.490 50.521  1.00 15.65 ? 167 PHE A CE2 1 
ATOM   1167 C  CZ  . PHE A 1 145 ? 47.728 47.949 51.527  1.00 14.81 ? 167 PHE A CZ  1 
ATOM   1168 N  N   . SER A 1 146 ? 50.775 49.992 47.211  1.00 14.26 ? 168 SER A N   1 
ATOM   1169 C  CA  . SER A 1 146 ? 52.106 49.530 47.636  1.00 13.55 ? 168 SER A CA  1 
ATOM   1170 C  C   . SER A 1 146 ? 53.157 50.631 47.564  1.00 13.08 ? 168 SER A C   1 
ATOM   1171 O  O   . SER A 1 146 ? 53.945 50.797 48.494  1.00 13.75 ? 168 SER A O   1 
ATOM   1172 C  CB  . SER A 1 146 ? 52.527 48.317 46.799  1.00 13.06 ? 168 SER A CB  1 
ATOM   1173 O  OG  . SER A 1 146 ? 51.476 47.363 46.849  1.00 14.37 ? 168 SER A OG  1 
ATOM   1174 N  N   . TYR A 1 147 ? 53.135 51.386 46.470  1.00 12.53 ? 169 TYR A N   1 
ATOM   1175 C  CA  . TYR A 1 147 ? 54.084 52.471 46.197  1.00 12.94 ? 169 TYR A CA  1 
ATOM   1176 C  C   . TYR A 1 147 ? 53.884 53.656 47.176  1.00 13.55 ? 169 TYR A C   1 
ATOM   1177 O  O   . TYR A 1 147 ? 54.840 54.141 47.804  1.00 12.35 ? 169 TYR A O   1 
ATOM   1178 C  CB  . TYR A 1 147 ? 53.908 52.907 44.728  1.00 12.68 ? 169 TYR A CB  1 
ATOM   1179 C  CG  . TYR A 1 147 ? 55.150 53.410 44.002  1.00 11.95 ? 169 TYR A CG  1 
ATOM   1180 C  CD1 . TYR A 1 147 ? 56.270 53.852 44.698  1.00 12.52 ? 169 TYR A CD1 1 
ATOM   1181 C  CD2 . TYR A 1 147 ? 55.176 53.481 42.610  1.00 11.15 ? 169 TYR A CD2 1 
ATOM   1182 C  CE1 . TYR A 1 147 ? 57.398 54.319 44.029  1.00 11.39 ? 169 TYR A CE1 1 
ATOM   1183 C  CE2 . TYR A 1 147 ? 56.299 53.938 41.928  1.00 9.66  ? 169 TYR A CE2 1 
ATOM   1184 C  CZ  . TYR A 1 147 ? 57.403 54.362 42.664  1.00 11.89 ? 169 TYR A CZ  1 
ATOM   1185 O  OH  . TYR A 1 147 ? 58.514 54.845 42.043  1.00 14.16 ? 169 TYR A OH  1 
ATOM   1186 N  N   . SER A 1 148 ? 52.630 54.090 47.323  1.00 13.92 ? 170 SER A N   1 
ATOM   1187 C  CA  . SER A 1 148 ? 52.263 55.112 48.310  1.00 15.87 ? 170 SER A CA  1 
ATOM   1188 C  C   . SER A 1 148 ? 52.845 54.868 49.705  1.00 15.61 ? 170 SER A C   1 
ATOM   1189 O  O   . SER A 1 148 ? 53.605 55.684 50.241  1.00 16.43 ? 170 SER A O   1 
ATOM   1190 C  CB  . SER A 1 148 ? 50.741 55.235 48.428  1.00 14.79 ? 170 SER A CB  1 
ATOM   1191 O  OG  . SER A 1 148 ? 50.434 55.962 49.604  1.00 20.97 ? 170 SER A OG  1 
ATOM   1192 N  N   . PHE A 1 149 ? 52.493 53.738 50.300  1.00 16.44 ? 171 PHE A N   1 
ATOM   1193 C  CA  . PHE A 1 149 ? 52.902 53.477 51.672  1.00 16.16 ? 171 PHE A CA  1 
ATOM   1194 C  C   . PHE A 1 149 ? 54.386 53.279 51.844  1.00 16.10 ? 171 PHE A C   1 
ATOM   1195 O  O   . PHE A 1 149 ? 54.960 53.746 52.840  1.00 16.34 ? 171 PHE A O   1 
ATOM   1196 C  CB  . PHE A 1 149 ? 52.118 52.316 52.259  1.00 16.92 ? 171 PHE A CB  1 
ATOM   1197 C  CG  . PHE A 1 149 ? 50.663 52.608 52.409  1.00 17.03 ? 171 PHE A CG  1 
ATOM   1198 C  CD1 . PHE A 1 149 ? 50.219 53.532 53.339  1.00 18.73 ? 171 PHE A CD1 1 
ATOM   1199 C  CD2 . PHE A 1 149 ? 49.734 51.974 51.606  1.00 19.33 ? 171 PHE A CD2 1 
ATOM   1200 C  CE1 . PHE A 1 149 ? 48.862 53.806 53.475  1.00 19.66 ? 171 PHE A CE1 1 
ATOM   1201 C  CE2 . PHE A 1 149 ? 48.393 52.245 51.729  1.00 19.93 ? 171 PHE A CE2 1 
ATOM   1202 C  CZ  . PHE A 1 149 ? 47.951 53.162 52.670  1.00 19.89 ? 171 PHE A CZ  1 
ATOM   1203 N  N   . LEU A 1 150 ? 55.023 52.595 50.896  1.00 15.45 ? 172 LEU A N   1 
ATOM   1204 C  CA  . LEU A 1 150 ? 56.455 52.361 51.022  1.00 14.92 ? 172 LEU A CA  1 
ATOM   1205 C  C   . LEU A 1 150 ? 57.279 53.628 50.778  1.00 14.09 ? 172 LEU A C   1 
ATOM   1206 O  O   . LEU A 1 150 ? 58.161 53.936 51.566  1.00 13.95 ? 172 LEU A O   1 
ATOM   1207 C  CB  . LEU A 1 150 ? 56.930 51.200 50.154  1.00 14.63 ? 172 LEU A CB  1 
ATOM   1208 C  CG  . LEU A 1 150 ? 56.755 49.835 50.833  1.00 14.82 ? 172 LEU A CG  1 
ATOM   1209 C  CD1 . LEU A 1 150 ? 56.720 48.725 49.787  1.00 10.11 ? 172 LEU A CD1 1 
ATOM   1210 C  CD2 . LEU A 1 150 ? 57.852 49.610 51.898  1.00 10.86 ? 172 LEU A CD2 1 
ATOM   1211 N  N   . LEU A 1 151 ? 56.984 54.360 49.713  1.00 13.68 ? 173 LEU A N   1 
ATOM   1212 C  CA  . LEU A 1 151 ? 57.691 55.631 49.470  1.00 13.56 ? 173 LEU A CA  1 
ATOM   1213 C  C   . LEU A 1 151 ? 57.471 56.658 50.595  1.00 13.73 ? 173 LEU A C   1 
ATOM   1214 O  O   . LEU A 1 151 ? 58.427 57.290 51.034  1.00 13.37 ? 173 LEU A O   1 
ATOM   1215 C  CB  . LEU A 1 151 ? 57.351 56.239 48.107  1.00 13.22 ? 173 LEU A CB  1 
ATOM   1216 C  CG  . LEU A 1 151 ? 58.067 57.554 47.710  1.00 13.14 ? 173 LEU A CG  1 
ATOM   1217 C  CD1 . LEU A 1 151 ? 58.179 57.662 46.221  1.00 14.57 ? 173 LEU A CD1 1 
ATOM   1218 C  CD2 . LEU A 1 151 ? 57.393 58.814 48.262  1.00 12.87 ? 173 LEU A CD2 1 
ATOM   1219 N  N   . ARG A 1 152 ? 56.232 56.806 51.065  1.00 13.31 ? 174 ARG A N   1 
ATOM   1220 C  CA  . ARG A 1 152 ? 55.939 57.788 52.115  1.00 13.73 ? 174 ARG A CA  1 
ATOM   1221 C  C   . ARG A 1 152 ? 56.647 57.467 53.437  1.00 14.46 ? 174 ARG A C   1 
ATOM   1222 O  O   . ARG A 1 152 ? 57.253 58.339 54.045  1.00 14.62 ? 174 ARG A O   1 
ATOM   1223 C  CB  . ARG A 1 152 ? 54.434 57.965 52.312  1.00 13.03 ? 174 ARG A CB  1 
ATOM   1224 C  CG  . ARG A 1 152 ? 53.720 58.725 51.177  1.00 11.62 ? 174 ARG A CG  1 
ATOM   1225 C  CD  . ARG A 1 152 ? 52.211 58.506 51.273  1.00 10.04 ? 174 ARG A CD  1 
ATOM   1226 N  NE  . ARG A 1 152 ? 51.597 59.180 52.417  1.00 11.67 ? 174 ARG A NE  1 
ATOM   1227 C  CZ  . ARG A 1 152 ? 50.404 58.874 52.945  1.00 13.22 ? 174 ARG A CZ  1 
ATOM   1228 N  NH1 . ARG A 1 152 ? 49.676 57.880 52.456  1.00 11.39 ? 174 ARG A NH1 1 
ATOM   1229 N  NH2 . ARG A 1 152 ? 49.943 59.562 53.993  1.00 13.91 ? 174 ARG A NH2 1 
ATOM   1230 N  N   . ALA A 1 153 ? 56.591 56.207 53.852  1.00 15.12 ? 175 ALA A N   1 
ATOM   1231 C  CA  . ALA A 1 153 ? 57.331 55.739 55.006  1.00 14.76 ? 175 ALA A CA  1 
ATOM   1232 C  C   . ALA A 1 153 ? 58.849 55.818 54.784  1.00 15.27 ? 175 ALA A C   1 
ATOM   1233 O  O   . ALA A 1 153 ? 59.603 56.207 55.702  1.00 14.75 ? 175 ALA A O   1 
ATOM   1234 C  CB  . ALA A 1 153 ? 56.924 54.325 55.323  1.00 14.72 ? 175 ALA A CB  1 
ATOM   1235 N  N   . GLY A 1 154 ? 59.290 55.438 53.580  1.00 15.01 ? 176 GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 154 ? 60.705 55.478 53.232  1.00 15.50 ? 176 GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 154 ? 61.250 56.900 53.260  1.00 16.21 ? 176 GLY A C   1 
ATOM   1238 O  O   . GLY A 1 154 ? 62.349 57.164 53.750  1.00 15.85 ? 176 GLY A O   1 
ATOM   1239 N  N   . TYR A 1 155 ? 60.473 57.819 52.706  1.00 16.84 ? 177 TYR A N   1 
ATOM   1240 C  CA  . TYR A 1 155 ? 60.802 59.236 52.741  1.00 17.45 ? 177 TYR A CA  1 
ATOM   1241 C  C   . TYR A 1 155 ? 60.899 59.803 54.180  1.00 17.15 ? 177 TYR A C   1 
ATOM   1242 O  O   . TYR A 1 155 ? 61.795 60.578 54.498  1.00 17.27 ? 177 TYR A O   1 
ATOM   1243 C  CB  . TYR A 1 155 ? 59.782 60.022 51.902  1.00 17.68 ? 177 TYR A CB  1 
ATOM   1244 C  CG  . TYR A 1 155 ? 59.814 61.503 52.181  1.00 17.37 ? 177 TYR A CG  1 
ATOM   1245 C  CD1 . TYR A 1 155 ? 60.809 62.304 51.639  1.00 16.24 ? 177 TYR A CD1 1 
ATOM   1246 C  CD2 . TYR A 1 155 ? 58.861 62.094 53.006  1.00 17.80 ? 177 TYR A CD2 1 
ATOM   1247 C  CE1 . TYR A 1 155 ? 60.866 63.656 51.904  1.00 17.29 ? 177 TYR A CE1 1 
ATOM   1248 C  CE2 . TYR A 1 155 ? 58.907 63.452 53.276  1.00 19.23 ? 177 TYR A CE2 1 
ATOM   1249 C  CZ  . TYR A 1 155 ? 59.913 64.228 52.718  1.00 18.76 ? 177 TYR A CZ  1 
ATOM   1250 O  OH  . TYR A 1 155 ? 59.970 65.592 52.982  1.00 19.55 ? 177 TYR A OH  1 
ATOM   1251 N  N   . LEU A 1 156 ? 59.966 59.417 55.040  1.00 17.44 ? 178 LEU A N   1 
ATOM   1252 C  CA  . LEU A 1 156 ? 59.924 59.935 56.395  1.00 17.48 ? 178 LEU A CA  1 
ATOM   1253 C  C   . LEU A 1 156 ? 61.072 59.378 57.223  1.00 18.11 ? 178 LEU A C   1 
ATOM   1254 O  O   . LEU A 1 156 ? 61.576 60.050 58.130  1.00 17.75 ? 178 LEU A O   1 
ATOM   1255 C  CB  . LEU A 1 156 ? 58.583 59.619 57.063  1.00 17.55 ? 178 LEU A CB  1 
ATOM   1256 C  CG  . LEU A 1 156 ? 57.312 60.332 56.560  1.00 16.56 ? 178 LEU A CG  1 
ATOM   1257 C  CD1 . LEU A 1 156 ? 56.116 59.797 57.324  1.00 14.45 ? 178 LEU A CD1 1 
ATOM   1258 C  CD2 . LEU A 1 156 ? 57.418 61.864 56.713  1.00 15.51 ? 178 LEU A CD2 1 
ATOM   1259 N  N   . THR A 1 157 ? 61.482 58.157 56.888  1.00 18.52 ? 179 THR A N   1 
ATOM   1260 C  CA  . THR A 1 157 ? 62.571 57.464 57.567  1.00 18.76 ? 179 THR A CA  1 
ATOM   1261 C  C   . THR A 1 157 ? 63.927 58.076 57.203  1.00 19.04 ? 179 THR A C   1 
ATOM   1262 O  O   . THR A 1 157 ? 64.726 58.404 58.089  1.00 19.17 ? 179 THR A O   1 
ATOM   1263 C  CB  . THR A 1 157 ? 62.528 55.970 57.245  1.00 19.06 ? 179 THR A CB  1 
ATOM   1264 O  OG1 . THR A 1 157 ? 61.243 55.463 57.622  1.00 16.19 ? 179 THR A OG1 1 
ATOM   1265 C  CG2 . THR A 1 157 ? 63.632 55.214 57.993  1.00 18.75 ? 179 THR A CG2 1 
ATOM   1266 N  N   . LEU A 1 158 ? 64.160 58.264 55.910  1.00 18.54 ? 180 LEU A N   1 
ATOM   1267 C  CA  . LEU A 1 158 ? 65.385 58.878 55.440  1.00 19.18 ? 180 LEU A CA  1 
ATOM   1268 C  C   . LEU A 1 158 ? 65.438 60.407 55.594  1.00 19.72 ? 180 LEU A C   1 
ATOM   1269 O  O   . LEU A 1 158 ? 66.483 60.977 55.954  1.00 19.44 ? 180 LEU A O   1 
ATOM   1270 C  CB  . LEU A 1 158 ? 65.643 58.485 53.983  1.00 19.26 ? 180 LEU A CB  1 
ATOM   1271 C  CG  . LEU A 1 158 ? 65.832 56.989 53.738  1.00 18.26 ? 180 LEU A CG  1 
ATOM   1272 C  CD1 . LEU A 1 158 ? 66.184 56.808 52.282  1.00 16.88 ? 180 LEU A CD1 1 
ATOM   1273 C  CD2 . LEU A 1 158 ? 66.945 56.437 54.628  1.00 16.90 ? 180 LEU A CD2 1 
ATOM   1274 N  N   . TYR A 1 159 ? 64.329 61.073 55.289  1.00 20.01 ? 181 TYR A N   1 
ATOM   1275 C  CA  . TYR A 1 159 ? 64.325 62.550 55.280  1.00 20.22 ? 181 TYR A CA  1 
ATOM   1276 C  C   . TYR A 1 159 ? 63.804 63.185 56.578  1.00 20.88 ? 181 TYR A C   1 
ATOM   1277 O  O   . TYR A 1 159 ? 63.854 64.406 56.748  1.00 21.64 ? 181 TYR A O   1 
ATOM   1278 C  CB  . TYR A 1 159 ? 63.568 63.066 54.058  1.00 19.49 ? 181 TYR A CB  1 
ATOM   1279 C  CG  . TYR A 1 159 ? 64.230 62.713 52.733  1.00 18.06 ? 181 TYR A CG  1 
ATOM   1280 C  CD1 . TYR A 1 159 ? 64.106 61.437 52.173  1.00 17.44 ? 181 TYR A CD1 1 
ATOM   1281 C  CD2 . TYR A 1 159 ? 64.976 63.658 52.041  1.00 17.78 ? 181 TYR A CD2 1 
ATOM   1282 C  CE1 . TYR A 1 159 ? 64.710 61.117 50.942  1.00 15.58 ? 181 TYR A CE1 1 
ATOM   1283 C  CE2 . TYR A 1 159 ? 65.570 63.353 50.819  1.00 16.92 ? 181 TYR A CE2 1 
ATOM   1284 C  CZ  . TYR A 1 159 ? 65.438 62.078 50.279  1.00 16.60 ? 181 TYR A CZ  1 
ATOM   1285 O  OH  . TYR A 1 159 ? 66.037 61.791 49.059  1.00 17.62 ? 181 TYR A OH  1 
ATOM   1286 N  N   . GLY A 1 160 ? 63.333 62.362 57.504  1.00 21.46 ? 182 GLY A N   1 
ATOM   1287 C  CA  . GLY A 1 160 ? 62.912 62.874 58.802  1.00 22.38 ? 182 GLY A CA  1 
ATOM   1288 C  C   . GLY A 1 160 ? 61.436 63.190 58.923  1.00 23.63 ? 182 GLY A C   1 
ATOM   1289 O  O   . GLY A 1 160 ? 60.694 63.188 57.929  1.00 24.22 ? 182 GLY A O   1 
ATOM   1290 N  N   . ILE A 1 161 ? 61.011 63.483 60.145  1.00 24.16 ? 183 ILE A N   1 
ATOM   1291 C  CA  . ILE A 1 161 ? 59.603 63.649 60.463  1.00 25.55 ? 183 ILE A CA  1 
ATOM   1292 C  C   . ILE A 1 161 ? 59.280 65.063 60.955  1.00 26.85 ? 183 ILE A C   1 
ATOM   1293 O  O   . ILE A 1 161 ? 60.175 65.836 61.284  1.00 27.29 ? 183 ILE A O   1 
ATOM   1294 C  CB  . ILE A 1 161 ? 59.115 62.592 61.504  1.00 24.97 ? 183 ILE A CB  1 
ATOM   1295 C  CG1 . ILE A 1 161 ? 60.022 62.584 62.743  1.00 24.32 ? 183 ILE A CG1 1 
ATOM   1296 C  CG2 . ILE A 1 161 ? 58.983 61.195 60.851  1.00 24.35 ? 183 ILE A CG2 1 
ATOM   1297 C  CD1 . ILE A 1 161 ? 59.626 61.565 63.830  1.00 24.74 ? 183 ILE A CD1 1 
ATOM   1298 N  N   . GLU A 1 162 ? 57.996 65.388 60.987  1.00 28.69 ? 184 GLU A N   1 
ATOM   1299 C  CA  . GLU A 1 162 ? 57.539 66.693 61.437  1.00 31.10 ? 184 GLU A CA  1 
ATOM   1300 C  C   . GLU A 1 162 ? 58.020 66.999 62.855  1.00 32.02 ? 184 GLU A C   1 
ATOM   1301 O  O   . GLU A 1 162 ? 58.513 68.098 63.110  1.00 32.69 ? 184 GLU A O   1 
ATOM   1302 C  CB  . GLU A 1 162 ? 56.011 66.795 61.344  1.00 31.30 ? 184 GLU A CB  1 
ATOM   1303 C  CG  . GLU A 1 162 ? 55.429 68.163 61.732  1.00 33.57 ? 184 GLU A CG  1 
ATOM   1304 C  CD  . GLU A 1 162 ? 55.946 69.303 60.867  1.00 37.05 ? 184 GLU A CD  1 
ATOM   1305 O  OE1 . GLU A 1 162 ? 56.254 69.075 59.669  1.00 35.73 ? 184 GLU A OE1 1 
ATOM   1306 O  OE2 . GLU A 1 162 ? 56.041 70.438 61.393  1.00 38.76 ? 184 GLU A OE2 1 
ATOM   1307 N  N   . ALA A 1 163 ? 57.899 66.026 63.762  1.00 33.25 ? 185 ALA A N   1 
ATOM   1308 C  CA  . ALA A 1 163 ? 58.305 66.227 65.154  1.00 34.54 ? 185 ALA A CA  1 
ATOM   1309 C  C   . ALA A 1 163 ? 58.785 64.977 65.863  1.00 35.73 ? 185 ALA A C   1 
ATOM   1310 O  O   . ALA A 1 163 ? 58.318 63.854 65.596  1.00 34.96 ? 185 ALA A O   1 
ATOM   1311 C  CB  . ALA A 1 163 ? 57.176 66.873 65.956  1.00 34.92 ? 185 ALA A CB  1 
ATOM   1312 N  N   . LEU A 1 164 ? 59.720 65.188 66.785  1.00 36.97 ? 186 LEU A N   1 
ATOM   1313 C  CA  . LEU A 1 164 ? 60.179 64.122 67.656  1.00 38.47 ? 186 LEU A CA  1 
ATOM   1314 C  C   . LEU A 1 164 ? 60.112 64.455 69.151  1.00 39.58 ? 186 LEU A C   1 
ATOM   1315 O  O   . LEU A 1 164 ? 61.125 64.444 69.833  1.00 40.14 ? 186 LEU A O   1 
ATOM   1316 C  CB  . LEU A 1 164 ? 61.585 63.641 67.271  1.00 38.34 ? 186 LEU A CB  1 
ATOM   1317 C  CG  . LEU A 1 164 ? 61.892 62.133 67.237  1.00 38.43 ? 186 LEU A CG  1 
ATOM   1318 C  CD1 . LEU A 1 164 ? 63.354 61.927 67.633  1.00 38.30 ? 186 LEU A CD1 1 
ATOM   1319 C  CD2 . LEU A 1 164 ? 60.978 61.248 68.099  1.00 37.24 ? 186 LEU A CD2 1 
ATOM   1320 N  N   . PRO A 1 165 ? 58.930 64.856 69.639  1.00 40.66 ? 187 PRO A N   1 
ATOM   1321 C  CA  . PRO A 1 165 ? 58.482 64.184 70.836  1.00 40.94 ? 187 PRO A CA  1 
ATOM   1322 C  C   . PRO A 1 165 ? 57.460 63.164 70.333  1.00 41.29 ? 187 PRO A C   1 
ATOM   1323 O  O   . PRO A 1 165 ? 57.100 62.230 71.071  1.00 42.22 ? 187 PRO A O   1 
ATOM   1324 C  CB  . PRO A 1 165 ? 57.809 65.305 71.631  1.00 41.12 ? 187 PRO A CB  1 
ATOM   1325 C  CG  . PRO A 1 165 ? 57.439 66.398 70.566  1.00 41.12 ? 187 PRO A CG  1 
ATOM   1326 C  CD  . PRO A 1 165 ? 58.015 65.952 69.250  1.00 40.84 ? 187 PRO A CD  1 
ATOM   1327 N  N   . ARG A 1 166 ? 57.030 63.375 69.073  1.00 40.51 ? 188 ARG A N   1 
ATOM   1328 C  CA  . ARG A 1 166 ? 56.056 62.573 68.298  1.00 40.03 ? 188 ARG A CA  1 
ATOM   1329 C  C   . ARG A 1 166 ? 54.595 62.688 68.770  1.00 39.73 ? 188 ARG A C   1 
ATOM   1330 O  O   . ARG A 1 166 ? 54.183 62.003 69.708  1.00 39.54 ? 188 ARG A O   1 
ATOM   1331 C  CB  . ARG A 1 166 ? 56.502 61.115 68.165  1.00 40.49 ? 188 ARG A CB  1 
ATOM   1332 C  CG  . ARG A 1 166 ? 55.779 60.326 67.081  1.00 40.71 ? 188 ARG A CG  1 
ATOM   1333 C  CD  . ARG A 1 166 ? 56.436 60.501 65.732  1.00 41.87 ? 188 ARG A CD  1 
ATOM   1334 N  NE  . ARG A 1 166 ? 57.397 59.442 65.412  1.00 43.80 ? 188 ARG A NE  1 
ATOM   1335 C  CZ  . ARG A 1 166 ? 57.251 58.552 64.427  1.00 43.48 ? 188 ARG A CZ  1 
ATOM   1336 N  NH1 . ARG A 1 166 ? 56.176 58.563 63.657  1.00 41.78 ? 188 ARG A NH1 1 
ATOM   1337 N  NH2 . ARG A 1 166 ? 58.187 57.640 64.214  1.00 45.33 ? 188 ARG A NH2 1 
ATOM   1338 N  N   . THR A 1 167 ? 53.818 63.550 68.106  1.00 39.44 ? 189 THR A N   1 
ATOM   1339 C  CA  . THR A 1 167 ? 52.428 63.831 68.508  1.00 39.04 ? 189 THR A CA  1 
ATOM   1340 C  C   . THR A 1 167 ? 51.380 63.366 67.493  1.00 39.48 ? 189 THR A C   1 
ATOM   1341 O  O   . THR A 1 167 ? 51.706 62.990 66.370  1.00 39.56 ? 189 THR A O   1 
ATOM   1342 C  CB  . THR A 1 167 ? 52.186 65.349 68.784  1.00 39.15 ? 189 THR A CB  1 
ATOM   1343 O  OG1 . THR A 1 167 ? 52.300 66.098 67.567  1.00 38.49 ? 189 THR A OG1 1 
ATOM   1344 C  CG2 . THR A 1 167 ? 53.164 65.893 69.807  1.00 38.12 ? 189 THR A CG2 1 
ATOM   1345 N  N   . HIS A 1 168 ? 50.112 63.413 67.891  1.00 39.46 ? 190 HIS A N   1 
ATOM   1346 C  CA  . HIS A 1 168 ? 49.015 63.108 66.991  1.00 39.60 ? 190 HIS A CA  1 
ATOM   1347 C  C   . HIS A 1 168 ? 48.994 64.090 65.800  1.00 39.21 ? 190 HIS A C   1 
ATOM   1348 O  O   . HIS A 1 168 ? 48.723 63.702 64.647  1.00 39.01 ? 190 HIS A O   1 
ATOM   1349 C  CB  . HIS A 1 168 ? 47.699 63.150 67.768  1.00 40.41 ? 190 HIS A CB  1 
ATOM   1350 C  CG  . HIS A 1 168 ? 46.538 62.598 67.009  1.00 42.08 ? 190 HIS A CG  1 
ATOM   1351 N  ND1 . HIS A 1 168 ? 45.755 63.376 66.182  1.00 44.38 ? 190 HIS A ND1 1 
ATOM   1352 C  CD2 . HIS A 1 168 ? 46.035 61.344 66.938  1.00 43.85 ? 190 HIS A CD2 1 
ATOM   1353 C  CE1 . HIS A 1 168 ? 44.819 62.621 65.632  1.00 45.35 ? 190 HIS A CE1 1 
ATOM   1354 N  NE2 . HIS A 1 168 ? 44.966 61.384 66.076  1.00 45.12 ? 190 HIS A NE2 1 
ATOM   1355 N  N   . GLU A 1 169 ? 49.322 65.349 66.091  1.00 38.27 ? 191 GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 169 ? 49.284 66.445 65.119  1.00 37.50 ? 191 GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 169 ? 50.478 66.460 64.156  1.00 35.90 ? 191 GLU A C   1 
ATOM   1358 O  O   . GLU A 1 169 ? 50.331 66.850 63.002  1.00 34.85 ? 191 GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 169 ? 49.152 67.802 65.827  1.00 38.06 ? 191 GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 169 ? 49.536 67.809 67.329  1.00 40.96 ? 191 GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 169 ? 48.472 67.163 68.212  1.00 43.73 ? 191 GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 169 ? 48.832 66.341 69.081  1.00 45.75 ? 191 GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 169 ? 47.271 67.457 68.019  1.00 45.49 ? 191 GLU A OE2 1 
ATOM   1364 N  N   . SER A 1 170 ? 51.650 66.059 64.646  1.00 34.63 ? 192 SER A N   1 
ATOM   1365 C  CA  . SER A 1 170 ? 52.828 65.926 63.801  1.00 33.75 ? 192 SER A CA  1 
ATOM   1366 C  C   . SER A 1 170 ? 52.713 64.696 62.885  1.00 32.98 ? 192 SER A C   1 
ATOM   1367 O  O   . SER A 1 170 ? 53.067 64.760 61.707  1.00 33.00 ? 192 SER A O   1 
ATOM   1368 C  CB  . SER A 1 170 ? 54.101 65.862 64.644  1.00 33.64 ? 192 SER A CB  1 
ATOM   1369 O  OG  . SER A 1 170 ? 54.233 64.603 65.286  1.00 34.26 ? 192 SER A OG  1 
ATOM   1370 N  N   . GLN A 1 171 ? 52.216 63.586 63.427  1.00 31.93 ? 193 GLN A N   1 
ATOM   1371 C  CA  . GLN A 1 171 ? 52.017 62.378 62.632  1.00 31.54 ? 193 GLN A CA  1 
ATOM   1372 C  C   . GLN A 1 171 ? 50.996 62.607 61.511  1.00 30.50 ? 193 GLN A C   1 
ATOM   1373 O  O   . GLN A 1 171 ? 51.185 62.133 60.386  1.00 29.96 ? 193 GLN A O   1 
ATOM   1374 C  CB  . GLN A 1 171 ? 51.651 61.173 63.513  1.00 31.38 ? 193 GLN A CB  1 
ATOM   1375 C  CG  . GLN A 1 171 ? 52.813 60.717 64.397  1.00 33.57 ? 193 GLN A CG  1 
ATOM   1376 C  CD  . GLN A 1 171 ? 52.627 59.337 65.043  1.00 36.53 ? 193 GLN A CD  1 
ATOM   1377 O  OE1 . GLN A 1 171 ? 53.591 58.583 65.170  1.00 37.12 ? 193 GLN A OE1 1 
ATOM   1378 N  NE2 . GLN A 1 171 ? 51.400 59.012 65.461  1.00 36.09 ? 193 GLN A NE2 1 
ATOM   1379 N  N   . ALA A 1 172 ? 49.937 63.357 61.818  1.00 29.62 ? 194 ALA A N   1 
ATOM   1380 C  CA  . ALA A 1 172 ? 48.907 63.705 60.833  1.00 29.02 ? 194 ALA A CA  1 
ATOM   1381 C  C   . ALA A 1 172 ? 49.470 64.628 59.748  1.00 28.56 ? 194 ALA A C   1 
ATOM   1382 O  O   . ALA A 1 172 ? 49.146 64.482 58.567  1.00 28.68 ? 194 ALA A O   1 
ATOM   1383 C  CB  . ALA A 1 172 ? 47.695 64.335 61.507  1.00 28.80 ? 194 ALA A CB  1 
ATOM   1384 N  N   . GLN A 1 173 ? 50.323 65.568 60.151  1.00 27.93 ? 195 GLN A N   1 
ATOM   1385 C  CA  . GLN A 1 173 ? 50.992 66.433 59.187  1.00 27.35 ? 195 GLN A CA  1 
ATOM   1386 C  C   . GLN A 1 173 ? 51.976 65.661 58.300  1.00 25.95 ? 195 GLN A C   1 
ATOM   1387 O  O   . GLN A 1 173 ? 52.166 66.022 57.146  1.00 25.55 ? 195 GLN A O   1 
ATOM   1388 C  CB  . GLN A 1 173 ? 51.689 67.617 59.870  1.00 27.82 ? 195 GLN A CB  1 
ATOM   1389 C  CG  . GLN A 1 173 ? 52.205 68.697 58.882  1.00 30.71 ? 195 GLN A CG  1 
ATOM   1390 C  CD  . GLN A 1 173 ? 51.136 69.170 57.872  1.00 35.99 ? 195 GLN A CD  1 
ATOM   1391 O  OE1 . GLN A 1 173 ? 51.345 69.116 56.646  1.00 38.22 ? 195 GLN A OE1 1 
ATOM   1392 N  NE2 . GLN A 1 173 ? 49.989 69.625 58.385  1.00 37.97 ? 195 GLN A NE2 1 
ATOM   1393 N  N   . ASP A 1 174 ? 52.587 64.605 58.830  1.00 24.71 ? 196 ASP A N   1 
ATOM   1394 C  CA  . ASP A 1 174 ? 53.517 63.806 58.024  1.00 24.48 ? 196 ASP A CA  1 
ATOM   1395 C  C   . ASP A 1 174 ? 52.801 62.932 57.008  1.00 24.01 ? 196 ASP A C   1 
ATOM   1396 O  O   . ASP A 1 174 ? 53.318 62.659 55.916  1.00 23.42 ? 196 ASP A O   1 
ATOM   1397 C  CB  . ASP A 1 174 ? 54.477 62.997 58.896  1.00 23.93 ? 196 ASP A CB  1 
ATOM   1398 C  CG  . ASP A 1 174 ? 55.718 63.789 59.271  1.00 25.55 ? 196 ASP A CG  1 
ATOM   1399 O  OD1 . ASP A 1 174 ? 56.154 64.659 58.475  1.00 25.10 ? 196 ASP A OD1 1 
ATOM   1400 O  OD2 . ASP A 1 174 ? 56.270 63.528 60.360  1.00 28.57 ? 196 ASP A OD2 1 
ATOM   1401 N  N   . ARG A 1 175 ? 51.589 62.519 57.351  1.00 23.71 ? 197 ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 175 ? 50.784 61.773 56.408  1.00 23.04 ? 197 ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 175 ? 50.439 62.642 55.208  1.00 22.59 ? 197 ARG A C   1 
ATOM   1404 O  O   . ARG A 1 175 ? 50.532 62.193 54.077  1.00 22.38 ? 197 ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 175 ? 49.535 61.214 57.066  1.00 22.66 ? 197 ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 175 ? 49.821 60.030 57.983  1.00 23.94 ? 197 ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 175 ? 48.589 59.178 58.212  1.00 23.53 ? 197 ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 175 ? 47.606 59.880 59.028  1.00 24.89 ? 197 ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 175 ? 46.512 60.468 58.548  1.00 25.81 ? 197 ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 175 ? 46.247 60.440 57.239  1.00 25.87 ? 197 ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 175 ? 45.690 61.094 59.377  1.00 25.65 ? 197 ARG A NH2 1 
ATOM   1412 N  N   . VAL A 1 176 ? 50.063 63.889 55.467  1.00 22.42 ? 198 VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 176 ? 49.684 64.836 54.410  1.00 21.46 ? 198 VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 176 ? 50.904 65.296 53.597  1.00 20.46 ? 198 VAL A C   1 
ATOM   1415 O  O   . VAL A 1 176 ? 50.864 65.266 52.366  1.00 20.65 ? 198 VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 176 ? 48.938 66.059 55.009  1.00 21.95 ? 198 VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 176 ? 48.703 67.168 53.948  1.00 22.94 ? 198 VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 176 ? 47.638 65.617 55.657  1.00 22.84 ? 198 VAL A CG2 1 
ATOM   1419 N  N   . HIS A 1 177 ? 51.962 65.743 54.279  1.00 19.05 ? 199 HIS A N   1 
ATOM   1420 C  CA  . HIS A 1 177 ? 53.205 66.173 53.609  1.00 18.20 ? 199 HIS A CA  1 
ATOM   1421 C  C   . HIS A 1 177 ? 53.765 65.015 52.769  1.00 17.81 ? 199 HIS A C   1 
ATOM   1422 O  O   . HIS A 1 177 ? 54.057 65.183 51.594  1.00 17.93 ? 199 HIS A O   1 
ATOM   1423 C  CB  . HIS A 1 177 ? 54.260 66.658 54.622  1.00 17.68 ? 199 HIS A CB  1 
ATOM   1424 C  CG  . HIS A 1 177 ? 55.659 66.752 54.067  1.00 17.05 ? 199 HIS A CG  1 
ATOM   1425 N  ND1 . HIS A 1 177 ? 56.015 67.649 53.084  1.00 16.09 ? 199 HIS A ND1 1 
ATOM   1426 C  CD2 . HIS A 1 177 ? 56.794 66.080 54.383  1.00 18.54 ? 199 HIS A CD2 1 
ATOM   1427 C  CE1 . HIS A 1 177 ? 57.301 67.517 52.803  1.00 16.85 ? 199 HIS A CE1 1 
ATOM   1428 N  NE2 . HIS A 1 177 ? 57.802 66.574 53.581  1.00 17.04 ? 199 HIS A NE2 1 
ATOM   1429 N  N   . SER A 1 178 ? 53.869 63.836 53.365  1.00 16.90 ? 200 SER A N   1 
ATOM   1430 C  CA  . SER A 1 178 ? 54.392 62.678 52.647  1.00 17.04 ? 200 SER A CA  1 
ATOM   1431 C  C   . SER A 1 178 ? 53.510 62.253 51.454  1.00 17.25 ? 200 SER A C   1 
ATOM   1432 O  O   . SER A 1 178 ? 54.046 61.843 50.422  1.00 16.74 ? 200 SER A O   1 
ATOM   1433 C  CB  . SER A 1 178 ? 54.625 61.520 53.599  1.00 16.70 ? 200 SER A CB  1 
ATOM   1434 O  OG  . SER A 1 178 ? 53.401 60.998 54.065  1.00 18.38 ? 200 SER A OG  1 
ATOM   1435 N  N   . ALA A 1 179 ? 52.179 62.357 51.588  1.00 16.43 ? 201 ALA A N   1 
ATOM   1436 C  CA  . ALA A 1 179 ? 51.296 62.129 50.443  1.00 16.75 ? 201 ALA A CA  1 
ATOM   1437 C  C   . ALA A 1 179 ? 51.574 63.132 49.316  1.00 16.81 ? 201 ALA A C   1 
ATOM   1438 O  O   . ALA A 1 179 ? 51.577 62.772 48.132  1.00 16.51 ? 201 ALA A O   1 
ATOM   1439 C  CB  . ALA A 1 179 ? 49.819 62.176 50.859  1.00 16.69 ? 201 ALA A CB  1 
ATOM   1440 N  N   . ASP A 1 180 ? 51.821 64.389 49.672  1.00 16.75 ? 202 ASP A N   1 
ATOM   1441 C  CA  . ASP A 1 180 ? 52.167 65.387 48.656  1.00 16.72 ? 202 ASP A CA  1 
ATOM   1442 C  C   . ASP A 1 180 ? 53.485 64.975 47.950  1.00 16.66 ? 202 ASP A C   1 
ATOM   1443 O  O   . ASP A 1 180 ? 53.578 64.993 46.726  1.00 16.17 ? 202 ASP A O   1 
ATOM   1444 C  CB  . ASP A 1 180 ? 52.269 66.748 49.319  1.00 17.83 ? 202 ASP A CB  1 
ATOM   1445 C  CG  . ASP A 1 180 ? 52.606 67.865 48.365  1.00 17.68 ? 202 ASP A CG  1 
ATOM   1446 O  OD1 . ASP A 1 180 ? 52.303 67.772 47.176  1.00 20.61 ? 202 ASP A OD1 1 
ATOM   1447 O  OD2 . ASP A 1 180 ? 53.160 68.873 48.835  1.00 21.05 ? 202 ASP A OD2 1 
ATOM   1448 N  N   . VAL A 1 181 ? 54.488 64.561 48.720  1.00 16.19 ? 203 VAL A N   1 
ATOM   1449 C  CA  . VAL A 1 181 ? 55.745 64.122 48.122  1.00 15.86 ? 203 VAL A CA  1 
ATOM   1450 C  C   . VAL A 1 181 ? 55.518 62.933 47.174  1.00 15.66 ? 203 VAL A C   1 
ATOM   1451 O  O   . VAL A 1 181 ? 56.016 62.912 46.051  1.00 14.90 ? 203 VAL A O   1 
ATOM   1452 C  CB  . VAL A 1 181 ? 56.820 63.811 49.207  1.00 16.17 ? 203 VAL A CB  1 
ATOM   1453 C  CG1 . VAL A 1 181 ? 57.982 63.024 48.594  1.00 15.56 ? 203 VAL A CG1 1 
ATOM   1454 C  CG2 . VAL A 1 181 ? 57.290 65.094 49.844  1.00 13.04 ? 203 VAL A CG2 1 
ATOM   1455 N  N   . PHE A 1 182 ? 54.728 61.964 47.616  1.00 15.94 ? 204 PHE A N   1 
ATOM   1456 C  CA  . PHE A 1 182 ? 54.420 60.831 46.766  1.00 16.34 ? 204 PHE A CA  1 
ATOM   1457 C  C   . PHE A 1 182 ? 53.698 61.217 45.462  1.00 16.38 ? 204 PHE A C   1 
ATOM   1458 O  O   . PHE A 1 182 ? 54.067 60.763 44.366  1.00 15.69 ? 204 PHE A O   1 
ATOM   1459 C  CB  . PHE A 1 182 ? 53.613 59.770 47.514  1.00 16.55 ? 204 PHE A CB  1 
ATOM   1460 C  CG  . PHE A 1 182 ? 53.191 58.635 46.627  1.00 17.66 ? 204 PHE A CG  1 
ATOM   1461 C  CD1 . PHE A 1 182 ? 54.120 57.689 46.205  1.00 16.56 ? 204 PHE A CD1 1 
ATOM   1462 C  CD2 . PHE A 1 182 ? 51.883 58.550 46.158  1.00 17.39 ? 204 PHE A CD2 1 
ATOM   1463 C  CE1 . PHE A 1 182 ? 53.736 56.648 45.360  1.00 17.52 ? 204 PHE A CE1 1 
ATOM   1464 C  CE2 . PHE A 1 182 ? 51.492 57.505 45.298  1.00 18.62 ? 204 PHE A CE2 1 
ATOM   1465 C  CZ  . PHE A 1 182 ? 52.418 56.553 44.912  1.00 16.93 ? 204 PHE A CZ  1 
ATOM   1466 N  N   . HIS A 1 183 ? 52.666 62.044 45.568  1.00 16.83 ? 205 HIS A N   1 
ATOM   1467 C  CA  . HIS A 1 183 ? 51.867 62.334 44.382  1.00 17.83 ? 205 HIS A CA  1 
ATOM   1468 C  C   . HIS A 1 183 ? 52.642 63.136 43.343  1.00 17.19 ? 205 HIS A C   1 
ATOM   1469 O  O   . HIS A 1 183 ? 52.504 62.887 42.147  1.00 15.84 ? 205 HIS A O   1 
ATOM   1470 C  CB  . HIS A 1 183 ? 50.528 62.950 44.757  1.00 19.16 ? 205 HIS A CB  1 
ATOM   1471 C  CG  . HIS A 1 183 ? 49.668 62.017 45.560  1.00 23.36 ? 205 HIS A CG  1 
ATOM   1472 N  ND1 . HIS A 1 183 ? 49.017 60.935 44.998  1.00 26.40 ? 205 HIS A ND1 1 
ATOM   1473 C  CD2 . HIS A 1 183 ? 49.401 61.969 46.885  1.00 25.21 ? 205 HIS A CD2 1 
ATOM   1474 C  CE1 . HIS A 1 183 ? 48.350 60.291 45.939  1.00 27.97 ? 205 HIS A CE1 1 
ATOM   1475 N  NE2 . HIS A 1 183 ? 48.577 60.891 47.096  1.00 28.10 ? 205 HIS A NE2 1 
ATOM   1476 N  N   . THR A 1 184 ? 53.471 64.067 43.820  1.00 16.51 ? 206 THR A N   1 
ATOM   1477 C  CA  . THR A 1 184 ? 54.333 64.876 42.954  1.00 16.60 ? 206 THR A CA  1 
ATOM   1478 C  C   . THR A 1 184 ? 55.443 64.017 42.337  1.00 16.22 ? 206 THR A C   1 
ATOM   1479 O  O   . THR A 1 184 ? 55.626 64.020 41.124  1.00 15.92 ? 206 THR A O   1 
ATOM   1480 C  CB  . THR A 1 184 ? 54.958 66.051 43.747  1.00 16.54 ? 206 THR A CB  1 
ATOM   1481 O  OG1 . THR A 1 184 ? 53.930 66.727 44.477  1.00 16.94 ? 206 THR A OG1 1 
ATOM   1482 C  CG2 . THR A 1 184 ? 55.690 67.039 42.814  1.00 17.90 ? 206 THR A CG2 1 
ATOM   1483 N  N   . PHE A 1 185 ? 56.169 63.284 43.177  1.00 16.18 ? 207 PHE A N   1 
ATOM   1484 C  CA  . PHE A 1 185 ? 57.215 62.354 42.721  1.00 15.92 ? 207 PHE A CA  1 
ATOM   1485 C  C   . PHE A 1 185 ? 56.720 61.393 41.642  1.00 15.68 ? 207 PHE A C   1 
ATOM   1486 O  O   . PHE A 1 185 ? 57.448 61.099 40.675  1.00 15.38 ? 207 PHE A O   1 
ATOM   1487 C  CB  . PHE A 1 185 ? 57.791 61.518 43.875  1.00 15.54 ? 207 PHE A CB  1 
ATOM   1488 C  CG  . PHE A 1 185 ? 58.609 60.334 43.397  1.00 15.97 ? 207 PHE A CG  1 
ATOM   1489 C  CD1 . PHE A 1 185 ? 59.930 60.498 43.014  1.00 16.58 ? 207 PHE A CD1 1 
ATOM   1490 C  CD2 . PHE A 1 185 ? 58.041 59.065 43.291  1.00 16.03 ? 207 PHE A CD2 1 
ATOM   1491 C  CE1 . PHE A 1 185 ? 60.676 59.424 42.547  1.00 16.19 ? 207 PHE A CE1 1 
ATOM   1492 C  CE2 . PHE A 1 185 ? 58.790 57.971 42.829  1.00 15.77 ? 207 PHE A CE2 1 
ATOM   1493 C  CZ  . PHE A 1 185 ? 60.099 58.155 42.457  1.00 16.44 ? 207 PHE A CZ  1 
ATOM   1494 N  N   . ARG A 1 186 ? 55.501 60.874 41.814  1.00 15.13 ? 208 ARG A N   1 
ATOM   1495 C  CA  . ARG A 1 186 ? 54.957 59.916 40.833  1.00 15.18 ? 208 ARG A CA  1 
ATOM   1496 C  C   . ARG A 1 186 ? 54.774 60.478 39.431  1.00 14.69 ? 208 ARG A C   1 
ATOM   1497 O  O   . ARG A 1 186 ? 54.927 59.760 38.454  1.00 14.41 ? 208 ARG A O   1 
ATOM   1498 C  CB  . ARG A 1 186 ? 53.664 59.272 41.321  1.00 15.29 ? 208 ARG A CB  1 
ATOM   1499 C  CG  . ARG A 1 186 ? 53.918 58.079 42.229  1.00 18.23 ? 208 ARG A CG  1 
ATOM   1500 C  CD  . ARG A 1 186 ? 54.503 56.915 41.439  1.00 19.48 ? 208 ARG A CD  1 
ATOM   1501 N  NE  . ARG A 1 186 ? 53.501 56.282 40.589  1.00 21.60 ? 208 ARG A NE  1 
ATOM   1502 C  CZ  . ARG A 1 186 ? 53.782 55.562 39.506  1.00 23.90 ? 208 ARG A CZ  1 
ATOM   1503 N  NH1 . ARG A 1 186 ? 55.046 55.410 39.106  1.00 22.42 ? 208 ARG A NH1 1 
ATOM   1504 N  NH2 . ARG A 1 186 ? 52.798 55.014 38.803  1.00 23.21 ? 208 ARG A NH2 1 
ATOM   1505 N  N   . GLN A 1 187 ? 54.468 61.765 39.334  1.00 14.86 ? 209 GLN A N   1 
ATOM   1506 C  CA  . GLN A 1 187 ? 54.351 62.403 38.032  1.00 15.23 ? 209 GLN A CA  1 
ATOM   1507 C  C   . GLN A 1 187 ? 55.682 62.415 37.273  1.00 14.90 ? 209 GLN A C   1 
ATOM   1508 O  O   . GLN A 1 187 ? 55.711 62.242 36.055  1.00 14.31 ? 209 GLN A O   1 
ATOM   1509 C  CB  . GLN A 1 187 ? 53.798 63.815 38.182  1.00 15.94 ? 209 GLN A CB  1 
ATOM   1510 C  CG  . GLN A 1 187 ? 52.363 63.840 38.656  1.00 18.30 ? 209 GLN A CG  1 
ATOM   1511 C  CD  . GLN A 1 187 ? 51.918 65.218 39.044  1.00 21.93 ? 209 GLN A CD  1 
ATOM   1512 O  OE1 . GLN A 1 187 ? 51.648 66.056 38.187  1.00 24.88 ? 209 GLN A OE1 1 
ATOM   1513 N  NE2 . GLN A 1 187 ? 51.841 65.469 40.342  1.00 22.49 ? 209 GLN A NE2 1 
ATOM   1514 N  N   . LEU A 1 188 ? 56.776 62.602 37.996  1.00 14.70 ? 210 LEU A N   1 
ATOM   1515 C  CA  . LEU A 1 188 ? 58.107 62.511 37.399  1.00 15.07 ? 210 LEU A CA  1 
ATOM   1516 C  C   . LEU A 1 188 ? 58.461 61.061 37.067  1.00 15.26 ? 210 LEU A C   1 
ATOM   1517 O  O   . LEU A 1 188 ? 59.007 60.786 36.002  1.00 15.08 ? 210 LEU A O   1 
ATOM   1518 C  CB  . LEU A 1 188 ? 59.148 63.132 38.344  1.00 14.49 ? 210 LEU A CB  1 
ATOM   1519 C  CG  . LEU A 1 188 ? 60.678 62.982 38.184  1.00 15.99 ? 210 LEU A CG  1 
ATOM   1520 C  CD1 . LEU A 1 188 ? 61.179 63.669 36.946  1.00 17.97 ? 210 LEU A CD1 1 
ATOM   1521 C  CD2 . LEU A 1 188 ? 61.437 63.545 39.401  1.00 14.62 ? 210 LEU A CD2 1 
ATOM   1522 N  N   . ASP A 1 189 ? 58.175 60.150 37.998  1.00 15.98 ? 211 ASP A N   1 
ATOM   1523 C  CA  . ASP A 1 189 ? 58.501 58.714 37.853  1.00 17.16 ? 211 ASP A CA  1 
ATOM   1524 C  C   . ASP A 1 189 ? 57.920 58.156 36.558  1.00 18.07 ? 211 ASP A C   1 
ATOM   1525 O  O   . ASP A 1 189 ? 58.647 57.550 35.767  1.00 17.13 ? 211 ASP A O   1 
ATOM   1526 C  CB  . ASP A 1 189 ? 57.989 57.904 39.059  1.00 16.43 ? 211 ASP A CB  1 
ATOM   1527 C  CG  . ASP A 1 189 ? 58.586 56.496 39.139  1.00 17.21 ? 211 ASP A CG  1 
ATOM   1528 O  OD1 . ASP A 1 189 ? 59.777 56.286 38.770  1.00 16.34 ? 211 ASP A OD1 1 
ATOM   1529 O  OD2 . ASP A 1 189 ? 57.855 55.584 39.584  1.00 15.21 ? 211 ASP A OD2 1 
ATOM   1530 N  N   . ARG A 1 190 ? 56.628 58.420 36.328  1.00 19.71 ? 212 ARG A N   1 
ATOM   1531 C  CA  . ARG A 1 190 ? 55.910 57.935 35.141  1.00 21.95 ? 212 ARG A CA  1 
ATOM   1532 C  C   . ARG A 1 190 ? 56.597 58.284 33.818  1.00 22.80 ? 212 ARG A C   1 
ATOM   1533 O  O   . ARG A 1 190 ? 56.493 57.527 32.863  1.00 23.73 ? 212 ARG A O   1 
ATOM   1534 C  CB  . ARG A 1 190 ? 54.456 58.445 35.108  1.00 21.73 ? 212 ARG A CB  1 
ATOM   1535 C  CG  . ARG A 1 190 ? 53.532 57.765 36.109  1.00 23.58 ? 212 ARG A CG  1 
ATOM   1536 C  CD  . ARG A 1 190 ? 52.103 58.304 36.048  1.00 25.51 ? 212 ARG A CD  1 
ATOM   1537 N  NE  . ARG A 1 190 ? 51.308 57.767 37.154  1.00 28.98 ? 212 ARG A NE  1 
ATOM   1538 C  CZ  . ARG A 1 190 ? 50.837 58.470 38.186  1.00 30.12 ? 212 ARG A CZ  1 
ATOM   1539 N  NH1 . ARG A 1 190 ? 51.043 59.789 38.286  1.00 30.46 ? 212 ARG A NH1 1 
ATOM   1540 N  NH2 . ARG A 1 190 ? 50.142 57.841 39.129  1.00 30.83 ? 212 ARG A NH2 1 
ATOM   1541 N  N   . LEU A 1 191 ? 57.287 59.421 33.773  1.00 23.84 ? 213 LEU A N   1 
ATOM   1542 C  CA  . LEU A 1 191 ? 57.873 59.922 32.530  1.00 24.81 ? 213 LEU A CA  1 
ATOM   1543 C  C   . LEU A 1 191 ? 59.380 59.740 32.441  1.00 25.60 ? 213 LEU A C   1 
ATOM   1544 O  O   . LEU A 1 191 ? 60.026 60.286 31.537  1.00 25.70 ? 213 LEU A O   1 
ATOM   1545 C  CB  . LEU A 1 191 ? 57.516 61.398 32.339  1.00 24.73 ? 213 LEU A CB  1 
ATOM   1546 C  CG  . LEU A 1 191 ? 56.300 61.792 31.482  1.00 25.41 ? 213 LEU A CG  1 
ATOM   1547 C  CD1 . LEU A 1 191 ? 55.242 60.679 31.280  1.00 25.52 ? 213 LEU A CD1 1 
ATOM   1548 C  CD2 . LEU A 1 191 ? 55.686 63.010 32.075  1.00 24.55 ? 213 LEU A CD2 1 
ATOM   1549 N  N   . LEU A 1 192 ? 59.933 58.950 33.357  1.00 26.21 ? 214 LEU A N   1 
ATOM   1550 C  CA  . LEU A 1 192 ? 61.376 58.770 33.457  1.00 26.89 ? 214 LEU A CA  1 
ATOM   1551 C  C   . LEU A 1 192 ? 61.981 58.281 32.139  1.00 26.39 ? 214 LEU A C   1 
ATOM   1552 O  O   . LEU A 1 192 ? 62.930 58.885 31.642  1.00 25.88 ? 214 LEU A O   1 
ATOM   1553 C  CB  . LEU A 1 192 ? 61.706 57.800 34.589  1.00 27.88 ? 214 LEU A CB  1 
ATOM   1554 C  CG  . LEU A 1 192 ? 62.975 57.955 35.410  1.00 29.76 ? 214 LEU A CG  1 
ATOM   1555 C  CD1 . LEU A 1 192 ? 62.727 58.965 36.519  1.00 30.85 ? 214 LEU A CD1 1 
ATOM   1556 C  CD2 . LEU A 1 192 ? 63.301 56.581 36.010  1.00 32.11 ? 214 LEU A CD2 1 
ATOM   1557 N  N   . PRO A 1 193 ? 61.423 57.194 31.561  1.00 26.53 ? 215 PRO A N   1 
ATOM   1558 C  CA  . PRO A 1 193 ? 61.908 56.692 30.277  1.00 26.32 ? 215 PRO A CA  1 
ATOM   1559 C  C   . PRO A 1 193 ? 61.966 57.769 29.185  1.00 25.84 ? 215 PRO A C   1 
ATOM   1560 O  O   . PRO A 1 193 ? 62.961 57.870 28.483  1.00 26.01 ? 215 PRO A O   1 
ATOM   1561 C  CB  . PRO A 1 193 ? 60.861 55.638 29.905  1.00 26.15 ? 215 PRO A CB  1 
ATOM   1562 C  CG  . PRO A 1 193 ? 60.335 55.185 31.175  1.00 26.62 ? 215 PRO A CG  1 
ATOM   1563 C  CD  . PRO A 1 193 ? 60.300 56.375 32.061  1.00 26.30 ? 215 PRO A CD  1 
ATOM   1564 N  N   . LYS A 1 194 ? 60.910 58.557 29.046  1.00 26.53 ? 216 LYS A N   1 
ATOM   1565 C  CA  . LYS A 1 194 ? 60.871 59.618 28.033  1.00 27.33 ? 216 LYS A CA  1 
ATOM   1566 C  C   . LYS A 1 194 ? 61.895 60.708 28.358  1.00 27.64 ? 216 LYS A C   1 
ATOM   1567 O  O   . LYS A 1 194 ? 62.556 61.200 27.466  1.00 27.65 ? 216 LYS A O   1 
ATOM   1568 C  CB  . LYS A 1 194 ? 59.473 60.215 27.885  1.00 27.61 ? 216 LYS A CB  1 
ATOM   1569 C  CG  . LYS A 1 194 ? 58.339 59.240 27.552  1.00 28.26 ? 216 LYS A CG  1 
ATOM   1570 C  CD  . LYS A 1 194 ? 57.076 60.018 27.141  1.00 31.21 ? 216 LYS A CD  1 
ATOM   1571 C  CE  . LYS A 1 194 ? 55.808 59.411 27.767  1.00 34.30 ? 216 LYS A CE  1 
ATOM   1572 N  NZ  . LYS A 1 194 ? 54.576 60.278 27.673  1.00 33.05 ? 216 LYS A NZ  1 
ATOM   1573 N  N   . LEU A 1 195 ? 62.039 61.046 29.638  1.00 28.21 ? 217 LEU A N   1 
ATOM   1574 C  CA  . LEU A 1 195 ? 63.115 61.930 30.120  1.00 29.09 ? 217 LEU A CA  1 
ATOM   1575 C  C   . LEU A 1 195 ? 64.478 61.466 29.603  1.00 28.85 ? 217 LEU A C   1 
ATOM   1576 O  O   . LEU A 1 195 ? 65.208 62.221 28.969  1.00 28.86 ? 217 LEU A O   1 
ATOM   1577 C  CB  . LEU A 1 195 ? 63.162 61.946 31.658  1.00 29.03 ? 217 LEU A CB  1 
ATOM   1578 C  CG  . LEU A 1 195 ? 62.739 63.115 32.555  1.00 31.38 ? 217 LEU A CG  1 
ATOM   1579 C  CD1 . LEU A 1 195 ? 62.889 64.453 31.839  1.00 32.66 ? 217 LEU A CD1 1 
ATOM   1580 C  CD2 . LEU A 1 195 ? 61.336 62.950 33.146  1.00 31.82 ? 217 LEU A CD2 1 
ATOM   1581 N  N   . ALA A 1 196 ? 64.803 60.213 29.894  1.00 28.99 ? 218 ALA A N   1 
ATOM   1582 C  CA  . ALA A 1 196 ? 66.075 59.620 29.519  1.00 29.26 ? 218 ALA A CA  1 
ATOM   1583 C  C   . ALA A 1 196 ? 66.311 59.624 28.002  1.00 29.55 ? 218 ALA A C   1 
ATOM   1584 O  O   . ALA A 1 196 ? 67.445 59.803 27.558  1.00 30.16 ? 218 ALA A O   1 
ATOM   1585 C  CB  . ALA A 1 196 ? 66.164 58.201 30.068  1.00 28.80 ? 218 ALA A CB  1 
ATOM   1586 N  N   . ARG A 1 197 ? 65.254 59.415 27.220  1.00 29.78 ? 219 ARG A N   1 
ATOM   1587 C  CA  . ARG A 1 197 ? 65.375 59.355 25.764  1.00 30.77 ? 219 ARG A CA  1 
ATOM   1588 C  C   . ARG A 1 197 ? 65.192 60.708 25.079  1.00 30.62 ? 219 ARG A C   1 
ATOM   1589 O  O   . ARG A 1 197 ? 65.291 60.790 23.847  1.00 30.81 ? 219 ARG A O   1 
ATOM   1590 C  CB  . ARG A 1 197 ? 64.378 58.364 25.150  1.00 30.94 ? 219 ARG A CB  1 
ATOM   1591 C  CG  . ARG A 1 197 ? 64.402 56.969 25.725  1.00 33.84 ? 219 ARG A CG  1 
ATOM   1592 C  CD  . ARG A 1 197 ? 63.533 56.045 24.874  1.00 39.35 ? 219 ARG A CD  1 
ATOM   1593 N  NE  . ARG A 1 197 ? 62.673 55.176 25.684  1.00 43.82 ? 219 ARG A NE  1 
ATOM   1594 C  CZ  . ARG A 1 197 ? 63.045 54.019 26.238  1.00 43.73 ? 219 ARG A CZ  1 
ATOM   1595 N  NH1 . ARG A 1 197 ? 64.277 53.540 26.097  1.00 44.51 ? 219 ARG A NH1 1 
ATOM   1596 N  NH2 . ARG A 1 197 ? 62.168 53.336 26.941  1.00 43.93 ? 219 ARG A NH2 1 
ATOM   1597 N  N   . GLY A 1 198 ? 64.909 61.750 25.860  1.00 30.23 ? 220 GLY A N   1 
ATOM   1598 C  CA  . GLY A 1 198 ? 64.638 63.083 25.314  1.00 30.26 ? 220 GLY A CA  1 
ATOM   1599 C  C   . GLY A 1 198 ? 63.485 63.116 24.327  1.00 30.28 ? 220 GLY A C   1 
ATOM   1600 O  O   . GLY A 1 198 ? 63.539 63.824 23.323  1.00 30.46 ? 220 GLY A O   1 
ATOM   1601 N  N   . SER A 1 199 ? 62.435 62.352 24.616  1.00 30.08 ? 221 SER A N   1 
ATOM   1602 C  CA  . SER A 1 199 ? 61.284 62.256 23.725  1.00 30.31 ? 221 SER A CA  1 
ATOM   1603 C  C   . SER A 1 199 ? 60.036 62.954 24.271  1.00 30.02 ? 221 SER A C   1 
ATOM   1604 O  O   . SER A 1 199 ? 58.919 62.717 23.789  1.00 30.61 ? 221 SER A O   1 
ATOM   1605 C  CB  . SER A 1 199 ? 60.990 60.787 23.399  1.00 30.64 ? 221 SER A CB  1 
ATOM   1606 O  OG  . SER A 1 199 ? 60.954 60.017 24.577  1.00 31.25 ? 221 SER A OG  1 
ATOM   1607 N  N   . LEU A 1 200 ? 60.225 63.827 25.261  1.00 29.09 ? 222 LEU A N   1 
ATOM   1608 C  CA  . LEU A 1 200 ? 59.119 64.610 25.816  1.00 28.40 ? 222 LEU A CA  1 
ATOM   1609 C  C   . LEU A 1 200 ? 58.547 65.587 24.783  1.00 27.83 ? 222 LEU A C   1 
ATOM   1610 O  O   . LEU A 1 200 ? 59.284 66.222 24.027  1.00 28.15 ? 222 LEU A O   1 
ATOM   1611 C  CB  . LEU A 1 200 ? 59.559 65.378 27.076  1.00 27.88 ? 222 LEU A CB  1 
ATOM   1612 C  CG  . LEU A 1 200 ? 60.155 64.615 28.273  1.00 28.04 ? 222 LEU A CG  1 
ATOM   1613 C  CD1 . LEU A 1 200 ? 60.687 65.614 29.322  1.00 27.33 ? 222 LEU A CD1 1 
ATOM   1614 C  CD2 . LEU A 1 200 ? 59.137 63.663 28.904  1.00 26.76 ? 222 LEU A CD2 1 
ATOM   1615 N  N   . SER A 1 201 ? 57.225 65.696 24.761  1.00 27.26 ? 223 SER A N   1 
ATOM   1616 C  CA  . SER A 1 201 ? 56.534 66.721 23.989  1.00 26.23 ? 223 SER A CA  1 
ATOM   1617 C  C   . SER A 1 201 ? 56.675 68.061 24.707  1.00 26.40 ? 223 SER A C   1 
ATOM   1618 O  O   . SER A 1 201 ? 57.132 68.117 25.860  1.00 26.16 ? 223 SER A O   1 
ATOM   1619 C  CB  . SER A 1 201 ? 55.057 66.363 23.867  1.00 26.24 ? 223 SER A CB  1 
ATOM   1620 O  OG  . SER A 1 201 ? 54.454 66.295 25.141  1.00 25.40 ? 223 SER A OG  1 
ATOM   1621 N  N   . VAL A 1 202 ? 56.283 69.137 24.032  1.00 26.16 ? 224 VAL A N   1 
ATOM   1622 C  CA  . VAL A 1 202 ? 56.328 70.479 24.621  1.00 25.99 ? 224 VAL A CA  1 
ATOM   1623 C  C   . VAL A 1 202 ? 55.558 70.549 25.942  1.00 24.86 ? 224 VAL A C   1 
ATOM   1624 O  O   . VAL A 1 202 ? 56.070 71.077 26.921  1.00 25.44 ? 224 VAL A O   1 
ATOM   1625 C  CB  . VAL A 1 202 ? 55.843 71.571 23.619  1.00 26.30 ? 224 VAL A CB  1 
ATOM   1626 C  CG1 . VAL A 1 202 ? 55.163 72.719 24.349  1.00 27.74 ? 224 VAL A CG1 1 
ATOM   1627 C  CG2 . VAL A 1 202 ? 57.012 72.102 22.823  1.00 26.31 ? 224 VAL A CG2 1 
ATOM   1628 N  N   . GLY A 1 203 ? 54.345 70.000 25.961  1.00 24.21 ? 225 GLY A N   1 
ATOM   1629 C  CA  . GLY A 1 203 ? 53.545 69.876 27.180  1.00 23.03 ? 225 GLY A CA  1 
ATOM   1630 C  C   . GLY A 1 203 ? 54.155 69.010 28.270  1.00 22.67 ? 225 GLY A C   1 
ATOM   1631 O  O   . GLY A 1 203 ? 54.115 69.394 29.451  1.00 22.27 ? 225 GLY A O   1 
ATOM   1632 N  N   . ASP A 1 204 ? 54.697 67.842 27.887  1.00 22.29 ? 226 ASP A N   1 
ATOM   1633 C  CA  . ASP A 1 204 ? 55.362 66.906 28.831  1.00 22.39 ? 226 ASP A CA  1 
ATOM   1634 C  C   . ASP A 1 204 ? 56.511 67.647 29.528  1.00 21.54 ? 226 ASP A C   1 
ATOM   1635 O  O   . ASP A 1 204 ? 56.686 67.537 30.733  1.00 21.78 ? 226 ASP A O   1 
ATOM   1636 C  CB  . ASP A 1 204 ? 55.965 65.677 28.119  1.00 22.26 ? 226 ASP A CB  1 
ATOM   1637 C  CG  . ASP A 1 204 ? 54.917 64.640 27.660  1.00 24.85 ? 226 ASP A CG  1 
ATOM   1638 O  OD1 . ASP A 1 204 ? 53.890 64.418 28.346  1.00 24.04 ? 226 ASP A OD1 1 
ATOM   1639 O  OD2 . ASP A 1 204 ? 55.158 64.020 26.590  1.00 27.38 ? 226 ASP A OD2 1 
ATOM   1640 N  N   . LYS A 1 205 ? 57.278 68.384 28.731  1.00 20.97 ? 227 LYS A N   1 
ATOM   1641 C  CA  . LYS A 1 205 ? 58.421 69.184 29.166  1.00 21.55 ? 227 LYS A CA  1 
ATOM   1642 C  C   . LYS A 1 205 ? 57.993 70.213 30.205  1.00 20.88 ? 227 LYS A C   1 
ATOM   1643 O  O   . LYS A 1 205 ? 58.597 70.328 31.269  1.00 21.07 ? 227 LYS A O   1 
ATOM   1644 C  CB  . LYS A 1 205 ? 58.998 69.891 27.937  1.00 21.54 ? 227 LYS A CB  1 
ATOM   1645 C  CG  . LYS A 1 205 ? 60.472 69.742 27.729  1.00 23.33 ? 227 LYS A CG  1 
ATOM   1646 C  CD  . LYS A 1 205 ? 60.847 69.331 26.276  1.00 26.43 ? 227 LYS A CD  1 
ATOM   1647 C  CE  . LYS A 1 205 ? 59.880 69.849 25.225  1.00 28.64 ? 227 LYS A CE  1 
ATOM   1648 N  NZ  . LYS A 1 205 ? 60.198 69.303 23.866  1.00 32.31 ? 227 LYS A NZ  1 
ATOM   1649 N  N   . ASP A 1 206 ? 56.920 70.938 29.912  1.00 20.36 ? 228 ASP A N   1 
ATOM   1650 C  CA  . ASP A 1 206 ? 56.404 71.906 30.861  1.00 20.51 ? 228 ASP A CA  1 
ATOM   1651 C  C   . ASP A 1 206 ? 55.855 71.238 32.120  1.00 20.33 ? 228 ASP A C   1 
ATOM   1652 O  O   . ASP A 1 206 ? 56.037 71.747 33.218  1.00 19.70 ? 228 ASP A O   1 
ATOM   1653 C  CB  . ASP A 1 206 ? 55.334 72.783 30.222  1.00 20.92 ? 228 ASP A CB  1 
ATOM   1654 C  CG  . ASP A 1 206 ? 54.824 73.840 31.173  1.00 22.46 ? 228 ASP A CG  1 
ATOM   1655 O  OD1 . ASP A 1 206 ? 55.567 74.806 31.470  1.00 22.62 ? 228 ASP A OD1 1 
ATOM   1656 O  OD2 . ASP A 1 206 ? 53.689 73.669 31.653  1.00 24.04 ? 228 ASP A OD2 1 
ATOM   1657 N  N   . HIS A 1 207 ? 55.175 70.100 31.963  1.00 20.31 ? 229 HIS A N   1 
ATOM   1658 C  CA  . HIS A 1 207 ? 54.699 69.367 33.133  1.00 20.10 ? 229 HIS A CA  1 
ATOM   1659 C  C   . HIS A 1 207 ? 55.880 68.892 33.982  1.00 19.41 ? 229 HIS A C   1 
ATOM   1660 O  O   . HIS A 1 207 ? 55.883 69.084 35.186  1.00 18.84 ? 229 HIS A O   1 
ATOM   1661 C  CB  . HIS A 1 207 ? 53.755 68.217 32.741  1.00 20.68 ? 229 HIS A CB  1 
ATOM   1662 C  CG  . HIS A 1 207 ? 53.258 67.419 33.904  1.00 23.16 ? 229 HIS A CG  1 
ATOM   1663 N  ND1 . HIS A 1 207 ? 53.259 66.040 33.916  1.00 25.06 ? 229 HIS A ND1 1 
ATOM   1664 C  CD2 . HIS A 1 207 ? 52.766 67.804 35.106  1.00 24.07 ? 229 HIS A CD2 1 
ATOM   1665 C  CE1 . HIS A 1 207 ? 52.779 65.609 35.068  1.00 24.22 ? 229 HIS A CE1 1 
ATOM   1666 N  NE2 . HIS A 1 207 ? 52.483 66.660 35.813  1.00 25.18 ? 229 HIS A NE2 1 
ATOM   1667 N  N   . MET A 1 208 ? 56.899 68.319 33.345  1.00 19.96 ? 230 MET A N   1 
ATOM   1668 C  CA  . MET A 1 208 ? 58.091 67.848 34.070  1.00 20.43 ? 230 MET A CA  1 
ATOM   1669 C  C   . MET A 1 208 ? 58.863 68.940 34.802  1.00 20.80 ? 230 MET A C   1 
ATOM   1670 O  O   . MET A 1 208 ? 59.328 68.732 35.939  1.00 21.16 ? 230 MET A O   1 
ATOM   1671 C  CB  . MET A 1 208 ? 59.020 67.054 33.147  1.00 20.44 ? 230 MET A CB  1 
ATOM   1672 C  CG  . MET A 1 208 ? 58.488 65.646 32.829  1.00 21.83 ? 230 MET A CG  1 
ATOM   1673 S  SD  . MET A 1 208 ? 58.002 64.673 34.283  1.00 23.13 ? 230 MET A SD  1 
ATOM   1674 C  CE  . MET A 1 208 ? 56.303 65.185 34.528  1.00 26.83 ? 230 MET A CE  1 
ATOM   1675 N  N   . CYS A 1 209 ? 58.990 70.099 34.153  1.00 20.34 ? 231 CYS A N   1 
ATOM   1676 C  CA  . CYS A 1 209 ? 59.654 71.244 34.756  1.00 20.86 ? 231 CYS A CA  1 
ATOM   1677 C  C   . CYS A 1 209 ? 58.895 71.776 35.968  1.00 20.37 ? 231 CYS A C   1 
ATOM   1678 O  O   . CYS A 1 209 ? 59.513 72.148 36.962  1.00 20.47 ? 231 CYS A O   1 
ATOM   1679 C  CB  . CYS A 1 209 ? 59.855 72.353 33.723  1.00 20.94 ? 231 CYS A CB  1 
ATOM   1680 S  SG  . CYS A 1 209 ? 61.226 72.018 32.579  1.00 22.70 ? 231 CYS A SG  1 
ATOM   1681 N  N   . SER A 1 210 ? 57.565 71.800 35.889  1.00 19.30 ? 232 SER A N   1 
ATOM   1682 C  CA  . SER A 1 210 ? 56.763 72.207 37.041  1.00 19.53 ? 232 SER A CA  1 
ATOM   1683 C  C   . SER A 1 210 ? 56.824 71.197 38.194  1.00 18.49 ? 232 SER A C   1 
ATOM   1684 O  O   . SER A 1 210 ? 56.845 71.594 39.359  1.00 18.58 ? 232 SER A O   1 
ATOM   1685 C  CB  . SER A 1 210 ? 55.319 72.469 36.644  1.00 19.83 ? 232 SER A CB  1 
ATOM   1686 O  OG  . SER A 1 210 ? 55.280 73.267 35.472  1.00 22.28 ? 232 SER A OG  1 
ATOM   1687 N  N   . VAL A 1 211 ? 56.857 69.905 37.862  1.00 17.20 ? 233 VAL A N   1 
ATOM   1688 C  CA  . VAL A 1 211 ? 56.941 68.845 38.873  1.00 16.69 ? 233 VAL A CA  1 
ATOM   1689 C  C   . VAL A 1 211 ? 58.290 68.909 39.600  1.00 16.56 ? 233 VAL A C   1 
ATOM   1690 O  O   . VAL A 1 211 ? 58.346 68.839 40.818  1.00 16.07 ? 233 VAL A O   1 
ATOM   1691 C  CB  . VAL A 1 211 ? 56.669 67.449 38.228  1.00 16.63 ? 233 VAL A CB  1 
ATOM   1692 C  CG1 . VAL A 1 211 ? 57.100 66.304 39.115  1.00 16.08 ? 233 VAL A CG1 1 
ATOM   1693 C  CG2 . VAL A 1 211 ? 55.187 67.325 37.896  1.00 15.05 ? 233 VAL A CG2 1 
ATOM   1694 N  N   . LYS A 1 212 ? 59.364 69.056 38.832  1.00 16.94 ? 234 LYS A N   1 
ATOM   1695 C  CA  . LYS A 1 212 ? 60.710 69.244 39.370  1.00 17.91 ? 234 LYS A CA  1 
ATOM   1696 C  C   . LYS A 1 212 ? 60.774 70.470 40.266  1.00 17.66 ? 234 LYS A C   1 
ATOM   1697 O  O   . LYS A 1 212 ? 61.226 70.382 41.396  1.00 18.37 ? 234 LYS A O   1 
ATOM   1698 C  CB  . LYS A 1 212 ? 61.728 69.369 38.232  1.00 17.53 ? 234 LYS A CB  1 
ATOM   1699 C  CG  . LYS A 1 212 ? 62.068 68.013 37.603  1.00 20.04 ? 234 LYS A CG  1 
ATOM   1700 C  CD  . LYS A 1 212 ? 62.763 68.190 36.263  1.00 20.90 ? 234 LYS A CD  1 
ATOM   1701 C  CE  . LYS A 1 212 ? 63.155 66.856 35.683  1.00 20.68 ? 234 LYS A CE  1 
ATOM   1702 N  NZ  . LYS A 1 212 ? 63.982 67.057 34.456  1.00 24.86 ? 234 LYS A NZ  1 
ATOM   1703 N  N   . SER A 1 213 ? 60.290 71.601 39.749  1.00 18.17 ? 235 SER A N   1 
ATOM   1704 C  CA  . SER A 1 213 ? 60.215 72.848 40.493  1.00 17.54 ? 235 SER A CA  1 
ATOM   1705 C  C   . SER A 1 213 ? 59.558 72.627 41.860  1.00 17.57 ? 235 SER A C   1 
ATOM   1706 O  O   . SER A 1 213 ? 60.049 73.119 42.873  1.00 16.65 ? 235 SER A O   1 
ATOM   1707 C  CB  . SER A 1 213 ? 59.470 73.911 39.669  1.00 17.64 ? 235 SER A CB  1 
ATOM   1708 O  OG  . SER A 1 213 ? 59.256 75.110 40.413  1.00 18.45 ? 235 SER A OG  1 
ATOM   1709 N  N   . ARG A 1 214 ? 58.458 71.874 41.901  1.00 17.80 ? 236 ARG A N   1 
ATOM   1710 C  CA  . ARG A 1 214 ? 57.809 71.599 43.188  1.00 18.27 ? 236 ARG A CA  1 
ATOM   1711 C  C   . ARG A 1 214 ? 58.675 70.694 44.066  1.00 17.93 ? 236 ARG A C   1 
ATOM   1712 O  O   . ARG A 1 214 ? 58.869 70.965 45.260  1.00 16.74 ? 236 ARG A O   1 
ATOM   1713 C  CB  . ARG A 1 214 ? 56.391 71.030 43.006  1.00 18.80 ? 236 ARG A CB  1 
ATOM   1714 C  CG  . ARG A 1 214 ? 55.591 70.943 44.290  1.00 22.27 ? 236 ARG A CG  1 
ATOM   1715 C  CD  . ARG A 1 214 ? 54.118 70.550 44.037  1.00 29.83 ? 236 ARG A CD  1 
ATOM   1716 N  NE  . ARG A 1 214 ? 53.254 70.520 45.236  1.00 33.39 ? 236 ARG A NE  1 
ATOM   1717 C  CZ  . ARG A 1 214 ? 53.560 71.037 46.431  1.00 37.77 ? 236 ARG A CZ  1 
ATOM   1718 N  NH1 . ARG A 1 214 ? 54.736 71.633 46.643  1.00 38.20 ? 236 ARG A NH1 1 
ATOM   1719 N  NH2 . ARG A 1 214 ? 52.685 70.960 47.431  1.00 38.29 ? 236 ARG A NH2 1 
ATOM   1720 N  N   . LEU A 1 215 ? 59.205 69.623 43.472  1.00 17.11 ? 237 LEU A N   1 
ATOM   1721 C  CA  . LEU A 1 215 ? 59.995 68.660 44.232  1.00 16.97 ? 237 LEU A CA  1 
ATOM   1722 C  C   . LEU A 1 215 ? 61.253 69.296 44.777  1.00 17.40 ? 237 LEU A C   1 
ATOM   1723 O  O   . LEU A 1 215 ? 61.677 68.992 45.896  1.00 16.57 ? 237 LEU A O   1 
ATOM   1724 C  CB  . LEU A 1 215 ? 60.358 67.447 43.374  1.00 16.64 ? 237 LEU A CB  1 
ATOM   1725 C  CG  . LEU A 1 215 ? 59.200 66.458 43.185  1.00 15.95 ? 237 LEU A CG  1 
ATOM   1726 C  CD1 . LEU A 1 215 ? 59.559 65.404 42.145  1.00 16.90 ? 237 LEU A CD1 1 
ATOM   1727 C  CD2 . LEU A 1 215 ? 58.837 65.813 44.494  1.00 16.36 ? 237 LEU A CD2 1 
ATOM   1728 N  N   . TRP A 1 216 ? 61.851 70.187 43.978  1.00 18.13 ? 238 TRP A N   1 
ATOM   1729 C  CA  . TRP A 1 216 ? 63.075 70.876 44.389  1.00 18.16 ? 238 TRP A CA  1 
ATOM   1730 C  C   . TRP A 1 216 ? 62.831 71.797 45.567  1.00 18.90 ? 238 TRP A C   1 
ATOM   1731 O  O   . TRP A 1 216 ? 63.723 72.028 46.389  1.00 19.62 ? 238 TRP A O   1 
ATOM   1732 C  CB  . TRP A 1 216 ? 63.683 71.637 43.220  1.00 18.27 ? 238 TRP A CB  1 
ATOM   1733 C  CG  . TRP A 1 216 ? 64.225 70.728 42.168  1.00 17.12 ? 238 TRP A CG  1 
ATOM   1734 C  CD1 . TRP A 1 216 ? 64.582 69.409 42.326  1.00 16.57 ? 238 TRP A CD1 1 
ATOM   1735 C  CD2 . TRP A 1 216 ? 64.490 71.057 40.806  1.00 17.68 ? 238 TRP A CD2 1 
ATOM   1736 N  NE1 . TRP A 1 216 ? 65.030 68.900 41.141  1.00 17.78 ? 238 TRP A NE1 1 
ATOM   1737 C  CE2 . TRP A 1 216 ? 65.007 69.889 40.191  1.00 17.42 ? 238 TRP A CE2 1 
ATOM   1738 C  CE3 . TRP A 1 216 ? 64.362 72.230 40.043  1.00 16.67 ? 238 TRP A CE3 1 
ATOM   1739 C  CZ2 . TRP A 1 216 ? 65.366 69.850 38.846  1.00 17.86 ? 238 TRP A CZ2 1 
ATOM   1740 C  CZ3 . TRP A 1 216 ? 64.719 72.193 38.707  1.00 16.67 ? 238 TRP A CZ3 1 
ATOM   1741 C  CH2 . TRP A 1 216 ? 65.215 71.015 38.117  1.00 18.74 ? 238 TRP A CH2 1 
ATOM   1742 N  N   . LYS A 1 217 ? 61.615 72.313 45.659  1.00 19.69 ? 239 LYS A N   1 
ATOM   1743 C  CA  . LYS A 1 217 ? 61.239 73.170 46.770  1.00 20.34 ? 239 LYS A CA  1 
ATOM   1744 C  C   . LYS A 1 217 ? 60.873 72.347 48.004  1.00 20.24 ? 239 LYS A C   1 
ATOM   1745 O  O   . LYS A 1 217 ? 61.234 72.719 49.124  1.00 20.23 ? 239 LYS A O   1 
ATOM   1746 C  CB  . LYS A 1 217 ? 60.097 74.098 46.350  1.00 21.07 ? 239 LYS A CB  1 
ATOM   1747 C  CG  . LYS A 1 217 ? 59.595 74.999 47.472  1.00 23.69 ? 239 LYS A CG  1 
ATOM   1748 C  CD  . LYS A 1 217 ? 59.140 76.309 46.924  1.00 28.39 ? 239 LYS A CD  1 
ATOM   1749 C  CE  . LYS A 1 217 ? 59.646 77.440 47.822  1.00 31.10 ? 239 LYS A CE  1 
ATOM   1750 N  NZ  . LYS A 1 217 ? 59.485 78.762 47.150  1.00 32.41 ? 239 LYS A NZ  1 
ATOM   1751 N  N   . LEU A 1 218 ? 60.144 71.242 47.810  1.00 20.15 ? 240 LEU A N   1 
ATOM   1752 C  CA  . LEU A 1 218 ? 59.802 70.330 48.918  1.00 20.54 ? 240 LEU A CA  1 
ATOM   1753 C  C   . LEU A 1 218 ? 61.037 69.762 49.620  1.00 21.03 ? 240 LEU A C   1 
ATOM   1754 O  O   . LEU A 1 218 ? 61.100 69.700 50.836  1.00 21.14 ? 240 LEU A O   1 
ATOM   1755 C  CB  . LEU A 1 218 ? 58.926 69.169 48.429  1.00 20.60 ? 240 LEU A CB  1 
ATOM   1756 C  CG  . LEU A 1 218 ? 57.475 69.491 48.062  1.00 21.26 ? 240 LEU A CG  1 
ATOM   1757 C  CD1 . LEU A 1 218 ? 56.908 68.415 47.144  1.00 21.62 ? 240 LEU A CD1 1 
ATOM   1758 C  CD2 . LEU A 1 218 ? 56.613 69.657 49.334  1.00 22.78 ? 240 LEU A CD2 1 
ATOM   1759 N  N   . LEU A 1 219 ? 62.023 69.348 48.840  1.00 22.06 ? 241 LEU A N   1 
ATOM   1760 C  CA  . LEU A 1 219 ? 63.222 68.709 49.384  1.00 22.85 ? 241 LEU A CA  1 
ATOM   1761 C  C   . LEU A 1 219 ? 64.430 69.661 49.408  1.00 23.05 ? 241 LEU A C   1 
ATOM   1762 O  O   . LEU A 1 219 ? 65.593 69.235 49.246  1.00 23.19 ? 241 LEU A O   1 
ATOM   1763 C  CB  . LEU A 1 219 ? 63.535 67.432 48.589  1.00 22.45 ? 241 LEU A CB  1 
ATOM   1764 C  CG  . LEU A 1 219 ? 62.819 66.151 49.044  1.00 22.89 ? 241 LEU A CG  1 
ATOM   1765 C  CD1 . LEU A 1 219 ? 61.317 66.150 48.811  1.00 21.61 ? 241 LEU A CD1 1 
ATOM   1766 C  CD2 . LEU A 1 219 ? 63.449 64.965 48.332  1.00 22.43 ? 241 LEU A CD2 1 
ATOM   1767 N  N   . SER A 1 220 ? 64.158 70.950 49.598  1.00 23.32 ? 242 SER A N   1 
ATOM   1768 C  CA  . SER A 1 220 ? 65.241 71.934 49.724  1.00 23.98 ? 242 SER A CA  1 
ATOM   1769 C  C   . SER A 1 220 ? 65.912 71.730 51.071  1.00 24.30 ? 242 SER A C   1 
ATOM   1770 O  O   . SER A 1 220 ? 65.234 71.388 52.046  1.00 23.96 ? 242 SER A O   1 
ATOM   1771 C  CB  . SER A 1 220 ? 64.706 73.360 49.625  1.00 24.22 ? 242 SER A CB  1 
ATOM   1772 O  OG  . SER A 1 220 ? 63.784 73.620 50.684  1.00 25.11 ? 242 SER A OG  1 
ATOM   1773 N  N   . PRO A 1 221 ? 67.251 71.891 51.126  1.00 25.16 ? 243 PRO A N   1 
ATOM   1774 C  CA  . PRO A 1 221 ? 67.993 71.866 52.387  1.00 25.93 ? 243 PRO A CA  1 
ATOM   1775 C  C   . PRO A 1 221 ? 67.351 72.715 53.482  1.00 27.11 ? 243 PRO A C   1 
ATOM   1776 O  O   . PRO A 1 221 ? 67.299 72.273 54.639  1.00 27.39 ? 243 PRO A O   1 
ATOM   1777 C  CB  . PRO A 1 221 ? 69.374 72.402 51.990  1.00 25.66 ? 243 PRO A CB  1 
ATOM   1778 C  CG  . PRO A 1 221 ? 69.543 71.912 50.598  1.00 25.55 ? 243 PRO A CG  1 
ATOM   1779 C  CD  . PRO A 1 221 ? 68.161 72.028 49.972  1.00 25.06 ? 243 PRO A CD  1 
ATOM   1780 N  N   . ALA A 1 222 ? 66.839 73.893 53.115  1.00 28.04 ? 244 ALA A N   1 
ATOM   1781 C  CA  . ALA A 1 222 ? 66.091 74.742 54.057  1.00 29.54 ? 244 ALA A CA  1 
ATOM   1782 C  C   . ALA A 1 222 ? 64.853 74.096 54.693  1.00 29.93 ? 244 ALA A C   1 
ATOM   1783 O  O   . ALA A 1 222 ? 64.589 74.326 55.870  1.00 30.77 ? 244 ALA A O   1 
ATOM   1784 C  CB  . ALA A 1 222 ? 65.720 76.096 53.406  1.00 29.55 ? 244 ALA A CB  1 
ATOM   1785 N  N   . ARG A 1 223 ? 64.080 73.320 53.929  1.00 30.73 ? 245 ARG A N   1 
ATOM   1786 C  CA  . ARG A 1 223 ? 62.875 72.681 54.472  1.00 30.98 ? 245 ARG A CA  1 
ATOM   1787 C  C   . ARG A 1 223 ? 63.245 71.472 55.333  1.00 30.81 ? 245 ARG A C   1 
ATOM   1788 O  O   . ARG A 1 223 ? 62.651 71.246 56.386  1.00 31.38 ? 245 ARG A O   1 
ATOM   1789 C  CB  . ARG A 1 223 ? 61.887 72.269 53.367  1.00 31.77 ? 245 ARG A CB  1 
ATOM   1790 C  CG  . ARG A 1 223 ? 61.304 73.410 52.531  1.00 33.49 ? 245 ARG A CG  1 
ATOM   1791 C  CD  . ARG A 1 223 ? 60.063 74.061 53.153  1.00 38.36 ? 245 ARG A CD  1 
ATOM   1792 N  NE  . ARG A 1 223 ? 58.819 73.647 52.492  1.00 42.68 ? 245 ARG A NE  1 
ATOM   1793 C  CZ  . ARG A 1 223 ? 58.171 74.345 51.555  1.00 43.76 ? 245 ARG A CZ  1 
ATOM   1794 N  NH1 . ARG A 1 223 ? 58.632 75.516 51.126  1.00 43.86 ? 245 ARG A NH1 1 
ATOM   1795 N  NH2 . ARG A 1 223 ? 57.045 73.866 51.039  1.00 44.89 ? 245 ARG A NH2 1 
ATOM   1796 N  N   . LEU A 1 224 ? 64.236 70.711 54.878  1.00 30.78 ? 246 LEU A N   1 
ATOM   1797 C  CA  . LEU A 1 224 ? 64.715 69.499 55.551  1.00 30.41 ? 246 LEU A CA  1 
ATOM   1798 C  C   . LEU A 1 224 ? 65.435 69.764 56.869  1.00 30.94 ? 246 LEU A C   1 
ATOM   1799 O  O   . LEU A 1 224 ? 65.507 68.890 57.730  1.00 31.44 ? 246 LEU A O   1 
ATOM   1800 C  CB  . LEU A 1 224 ? 65.639 68.713 54.614  1.00 30.21 ? 246 LEU A CB  1 
ATOM   1801 C  CG  . LEU A 1 224 ? 65.018 68.093 53.351  1.00 28.73 ? 246 LEU A CG  1 
ATOM   1802 C  CD1 . LEU A 1 224 ? 66.072 67.333 52.578  1.00 26.78 ? 246 LEU A CD1 1 
ATOM   1803 C  CD2 . LEU A 1 224 ? 63.862 67.170 53.700  1.00 27.31 ? 246 LEU A CD2 1 
ATOM   1804 N  N   . ALA A 1 225 ? 65.956 70.974 57.023  1.00 31.35 ? 247 ALA A N   1 
ATOM   1805 C  CA  . ALA A 1 225 ? 66.749 71.351 58.188  1.00 31.97 ? 247 ALA A CA  1 
ATOM   1806 C  C   . ALA A 1 225 ? 65.939 71.395 59.470  1.00 32.30 ? 247 ALA A C   1 
ATOM   1807 O  O   . ALA A 1 225 ? 66.494 71.234 60.543  1.00 32.73 ? 247 ALA A O   1 
ATOM   1808 C  CB  . ALA A 1 225 ? 67.452 72.700 57.946  1.00 32.14 ? 247 ALA A CB  1 
ATOM   1809 N  N   . ARG A 1 226 ? 64.629 71.601 59.354  1.00 33.09 ? 248 ARG A N   1 
ATOM   1810 C  CA  . ARG A 1 226 ? 63.729 71.654 60.511  1.00 33.17 ? 248 ARG A CA  1 
ATOM   1811 C  C   . ARG A 1 226 ? 63.148 70.292 60.890  1.00 32.85 ? 248 ARG A C   1 
ATOM   1812 O  O   . ARG A 1 226 ? 62.459 70.158 61.911  1.00 32.85 ? 248 ARG A O   1 
ATOM   1813 C  CB  . ARG A 1 226 ? 62.588 72.660 60.272  1.00 33.77 ? 248 ARG A CB  1 
ATOM   1814 C  CG  . ARG A 1 226 ? 61.453 72.164 59.390  1.00 35.95 ? 248 ARG A CG  1 
ATOM   1815 C  CD  . ARG A 1 226 ? 60.150 72.973 59.598  1.00 39.36 ? 248 ARG A CD  1 
ATOM   1816 N  NE  . ARG A 1 226 ? 59.854 73.852 58.460  1.00 42.26 ? 248 ARG A NE  1 
ATOM   1817 C  CZ  . ARG A 1 226 ? 58.868 73.655 57.583  1.00 42.39 ? 248 ARG A CZ  1 
ATOM   1818 N  NH1 . ARG A 1 226 ? 58.042 72.621 57.709  1.00 43.76 ? 248 ARG A NH1 1 
ATOM   1819 N  NH2 . ARG A 1 226 ? 58.696 74.504 56.582  1.00 41.97 ? 248 ARG A NH2 1 
ATOM   1820 N  N   . ARG A 1 227 ? 63.431 69.278 60.084  1.00 32.08 ? 249 ARG A N   1 
ATOM   1821 C  CA  . ARG A 1 227 ? 62.808 67.968 60.286  1.00 31.24 ? 249 ARG A CA  1 
ATOM   1822 C  C   . ARG A 1 227 ? 63.508 67.211 61.406  1.00 30.86 ? 249 ARG A C   1 
ATOM   1823 O  O   . ARG A 1 227 ? 64.711 67.367 61.616  1.00 30.39 ? 249 ARG A O   1 
ATOM   1824 C  CB  . ARG A 1 227 ? 62.795 67.162 58.973  1.00 31.02 ? 249 ARG A CB  1 
ATOM   1825 C  CG  . ARG A 1 227 ? 62.119 67.907 57.812  1.00 30.30 ? 249 ARG A CG  1 
ATOM   1826 C  CD  . ARG A 1 227 ? 61.817 67.004 56.626  1.00 29.47 ? 249 ARG A CD  1 
ATOM   1827 N  NE  . ARG A 1 227 ? 60.866 65.946 56.957  1.00 26.87 ? 249 ARG A NE  1 
ATOM   1828 C  CZ  . ARG A 1 227 ? 59.549 66.106 57.054  1.00 23.96 ? 249 ARG A CZ  1 
ATOM   1829 N  NH1 . ARG A 1 227 ? 58.983 67.285 56.826  1.00 23.57 ? 249 ARG A NH1 1 
ATOM   1830 N  NH2 . ARG A 1 227 ? 58.794 65.070 57.381  1.00 23.66 ? 249 ARG A NH2 1 
ATOM   1831 N  N   . ALA A 1 228 ? 62.748 66.401 62.129  1.00 30.53 ? 250 ALA A N   1 
ATOM   1832 C  CA  . ALA A 1 228 ? 63.298 65.643 63.246  1.00 30.73 ? 250 ALA A CA  1 
ATOM   1833 C  C   . ALA A 1 228 ? 63.622 64.209 62.842  1.00 30.94 ? 250 ALA A C   1 
ATOM   1834 O  O   . ALA A 1 228 ? 63.019 63.675 61.918  1.00 30.60 ? 250 ALA A O   1 
ATOM   1835 C  CB  . ALA A 1 228 ? 62.334 65.654 64.403  1.00 30.40 ? 250 ALA A CB  1 
ATOM   1836 N  N   . HIS A 1 229 ? 64.560 63.596 63.561  1.00 30.94 ? 251 HIS A N   1 
ATOM   1837 C  CA  . HIS A 1 229 ? 64.992 62.210 63.338  1.00 31.43 ? 251 HIS A CA  1 
ATOM   1838 C  C   . HIS A 1 229 ? 65.484 61.953 61.924  1.00 31.02 ? 251 HIS A C   1 
ATOM   1839 O  O   . HIS A 1 229 ? 65.162 60.933 61.313  1.00 31.83 ? 251 HIS A O   1 
ATOM   1840 C  CB  . HIS A 1 229 ? 63.903 61.197 63.711  1.00 32.19 ? 251 HIS A CB  1 
ATOM   1841 C  CG  . HIS A 1 229 ? 64.425 59.813 63.964  1.00 34.55 ? 251 HIS A CG  1 
ATOM   1842 N  ND1 . HIS A 1 229 ? 63.636 58.803 64.468  1.00 37.31 ? 251 HIS A ND1 1 
ATOM   1843 C  CD2 . HIS A 1 229 ? 65.658 59.274 63.792  1.00 36.47 ? 251 HIS A CD2 1 
ATOM   1844 C  CE1 . HIS A 1 229 ? 64.355 57.699 64.582  1.00 37.38 ? 251 HIS A CE1 1 
ATOM   1845 N  NE2 . HIS A 1 229 ? 65.584 57.958 64.176  1.00 36.42 ? 251 HIS A NE2 1 
ATOM   1846 N  N   . ARG A 1 230 ? 66.278 62.873 61.406  1.00 30.14 ? 252 ARG A N   1 
ATOM   1847 C  CA  . ARG A 1 230 ? 66.836 62.704 60.085  1.00 29.97 ? 252 ARG A CA  1 
ATOM   1848 C  C   . ARG A 1 230 ? 67.867 61.591 60.138  1.00 29.22 ? 252 ARG A C   1 
ATOM   1849 O  O   . ARG A 1 230 ? 68.495 61.361 61.176  1.00 28.56 ? 252 ARG A O   1 
ATOM   1850 C  CB  . ARG A 1 230 ? 67.469 64.000 59.601  1.00 30.14 ? 252 ARG A CB  1 
ATOM   1851 C  CG  . ARG A 1 230 ? 66.605 65.224 59.839  1.00 32.08 ? 252 ARG A CG  1 
ATOM   1852 C  CD  . ARG A 1 230 ? 67.470 66.444 59.808  1.00 35.69 ? 252 ARG A CD  1 
ATOM   1853 N  NE  . ARG A 1 230 ? 67.548 67.021 58.481  1.00 38.61 ? 252 ARG A NE  1 
ATOM   1854 C  CZ  . ARG A 1 230 ? 68.568 67.755 58.044  1.00 40.49 ? 252 ARG A CZ  1 
ATOM   1855 N  NH1 . ARG A 1 230 ? 69.623 67.971 58.818  1.00 41.91 ? 252 ARG A NH1 1 
ATOM   1856 N  NH2 . ARG A 1 230 ? 68.541 68.260 56.819  1.00 40.89 ? 252 ARG A NH2 1 
ATOM   1857 N  N   . SER A 1 231 ? 68.028 60.895 59.020  1.00 28.50 ? 253 SER A N   1 
ATOM   1858 C  CA  . SER A 1 231 ? 68.892 59.733 58.991  1.00 27.41 ? 253 SER A CA  1 
ATOM   1859 C  C   . SER A 1 231 ? 70.327 60.182 58.844  1.00 27.37 ? 253 SER A C   1 
ATOM   1860 O  O   . SER A 1 231 ? 70.598 61.252 58.290  1.00 27.48 ? 253 SER A O   1 
ATOM   1861 C  CB  . SER A 1 231 ? 68.488 58.779 57.860  1.00 27.10 ? 253 SER A CB  1 
ATOM   1862 O  OG  . SER A 1 231 ? 68.760 59.333 56.592  1.00 25.80 ? 253 SER A OG  1 
ATOM   1863 N  N   . LYS A 1 232 ? 71.250 59.362 59.345  1.00 27.02 ? 254 LYS A N   1 
ATOM   1864 C  CA  . LYS A 1 232 ? 72.675 59.608 59.140  1.00 26.77 ? 254 LYS A CA  1 
ATOM   1865 C  C   . LYS A 1 232 ? 72.998 59.543 57.654  1.00 25.64 ? 254 LYS A C   1 
ATOM   1866 O  O   . LYS A 1 232 ? 73.885 60.266 57.161  1.00 24.50 ? 254 LYS A O   1 
ATOM   1867 C  CB  . LYS A 1 232 ? 73.510 58.593 59.928  1.00 27.30 ? 254 LYS A CB  1 
ATOM   1868 C  CG  . LYS A 1 232 ? 75.009 58.642 59.657  1.00 30.41 ? 254 LYS A CG  1 
ATOM   1869 C  CD  . LYS A 1 232 ? 75.698 59.878 60.237  1.00 34.10 ? 254 LYS A CD  1 
ATOM   1870 C  CE  . LYS A 1 232 ? 77.197 59.866 59.879  1.00 37.60 ? 254 LYS A CE  1 
ATOM   1871 N  NZ  . LYS A 1 232 ? 77.920 61.127 60.281  1.00 38.67 ? 254 LYS A NZ  1 
ATOM   1872 N  N   . TRP A 1 233 ? 72.262 58.685 56.937  1.00 24.60 ? 255 TRP A N   1 
ATOM   1873 C  CA  . TRP A 1 233 ? 72.339 58.648 55.469  1.00 23.50 ? 255 TRP A CA  1 
ATOM   1874 C  C   . TRP A 1 233 ? 72.185 60.059 54.895  1.00 23.48 ? 255 TRP A C   1 
ATOM   1875 O  O   . TRP A 1 233 ? 73.005 60.502 54.097  1.00 23.77 ? 255 TRP A O   1 
ATOM   1876 C  CB  . TRP A 1 233 ? 71.293 57.691 54.860  1.00 22.51 ? 255 TRP A CB  1 
ATOM   1877 C  CG  . TRP A 1 233 ? 71.169 57.834 53.365  1.00 21.61 ? 255 TRP A CG  1 
ATOM   1878 C  CD1 . TRP A 1 233 ? 71.922 57.217 52.422  1.00 21.36 ? 255 TRP A CD1 1 
ATOM   1879 C  CD2 . TRP A 1 233 ? 70.247 58.668 52.658  1.00 21.45 ? 255 TRP A CD2 1 
ATOM   1880 N  NE1 . TRP A 1 233 ? 71.526 57.600 51.162  1.00 21.29 ? 255 TRP A NE1 1 
ATOM   1881 C  CE2 . TRP A 1 233 ? 70.494 58.491 51.281  1.00 21.72 ? 255 TRP A CE2 1 
ATOM   1882 C  CE3 . TRP A 1 233 ? 69.221 59.537 53.057  1.00 20.99 ? 255 TRP A CE3 1 
ATOM   1883 C  CZ2 . TRP A 1 233 ? 69.770 59.168 50.296  1.00 21.22 ? 255 TRP A CZ2 1 
ATOM   1884 C  CZ3 . TRP A 1 233 ? 68.501 60.210 52.080  1.00 21.48 ? 255 TRP A CZ3 1 
ATOM   1885 C  CH2 . TRP A 1 233 ? 68.785 60.026 50.713  1.00 20.95 ? 255 TRP A CH2 1 
ATOM   1886 N  N   . LEU A 1 234 ? 71.138 60.759 55.312  1.00 23.82 ? 256 LEU A N   1 
ATOM   1887 C  CA  . LEU A 1 234 ? 70.869 62.097 54.802  1.00 24.74 ? 256 LEU A CA  1 
ATOM   1888 C  C   . LEU A 1 234 ? 71.909 63.119 55.263  1.00 25.85 ? 256 LEU A C   1 
ATOM   1889 O  O   . LEU A 1 234 ? 72.450 63.882 54.455  1.00 25.86 ? 256 LEU A O   1 
ATOM   1890 C  CB  . LEU A 1 234 ? 69.477 62.562 55.239  1.00 24.00 ? 256 LEU A CB  1 
ATOM   1891 C  CG  . LEU A 1 234 ? 69.149 63.996 54.817  1.00 23.69 ? 256 LEU A CG  1 
ATOM   1892 C  CD1 . LEU A 1 234 ? 69.281 64.160 53.275  1.00 21.85 ? 256 LEU A CD1 1 
ATOM   1893 C  CD2 . LEU A 1 234 ? 67.779 64.448 55.347  1.00 22.48 ? 256 LEU A CD2 1 
ATOM   1894 N  N   . GLU A 1 235 ? 72.166 63.134 56.568  1.00 27.09 ? 257 GLU A N   1 
ATOM   1895 C  CA  . GLU A 1 235 ? 73.007 64.175 57.166  1.00 29.24 ? 257 GLU A CA  1 
ATOM   1896 C  C   . GLU A 1 235 ? 74.413 64.143 56.626  1.00 29.68 ? 257 GLU A C   1 
ATOM   1897 O  O   . GLU A 1 235 ? 74.935 65.179 56.231  1.00 30.72 ? 257 GLU A O   1 
ATOM   1898 C  CB  . GLU A 1 235 ? 72.947 64.118 58.689  1.00 29.07 ? 257 GLU A CB  1 
ATOM   1899 C  CG  . GLU A 1 235 ? 71.526 64.429 59.159  1.00 31.23 ? 257 GLU A CG  1 
ATOM   1900 C  CD  . GLU A 1 235 ? 71.389 64.545 60.655  1.00 34.71 ? 257 GLU A CD  1 
ATOM   1901 O  OE1 . GLU A 1 235 ? 72.000 63.723 61.387  1.00 36.95 ? 257 GLU A OE1 1 
ATOM   1902 O  OE2 . GLU A 1 235 ? 70.643 65.447 61.092  1.00 34.47 ? 257 GLU A OE2 1 
ATOM   1903 N  N   . SER A 1 236 ? 74.993 62.947 56.544  1.00 30.87 ? 258 SER A N   1 
ATOM   1904 C  CA  . SER A 1 236 ? 76.307 62.780 55.941  1.00 31.39 ? 258 SER A CA  1 
ATOM   1905 C  C   . SER A 1 236 ? 76.313 63.050 54.437  1.00 31.93 ? 258 SER A C   1 
ATOM   1906 O  O   . SER A 1 236 ? 77.333 63.514 53.906  1.00 31.93 ? 258 SER A O   1 
ATOM   1907 C  CB  . SER A 1 236 ? 76.886 61.406 56.248  1.00 31.48 ? 258 SER A CB  1 
ATOM   1908 O  OG  . SER A 1 236 ? 76.053 60.389 55.749  1.00 32.43 ? 258 SER A OG  1 
ATOM   1909 N  N   . TYR A 1 237 ? 75.196 62.776 53.747  1.00 31.96 ? 259 TYR A N   1 
ATOM   1910 C  CA  . TYR A 1 237 ? 75.108 63.126 52.325  1.00 31.89 ? 259 TYR A CA  1 
ATOM   1911 C  C   . TYR A 1 237 ? 75.125 64.640 52.123  1.00 32.09 ? 259 TYR A C   1 
ATOM   1912 O  O   . TYR A 1 237 ? 75.853 65.135 51.271  1.00 32.11 ? 259 TYR A O   1 
ATOM   1913 C  CB  . TYR A 1 237 ? 73.895 62.488 51.625  1.00 31.71 ? 259 TYR A CB  1 
ATOM   1914 C  CG  . TYR A 1 237 ? 73.871 62.706 50.123  1.00 30.70 ? 259 TYR A CG  1 
ATOM   1915 C  CD1 . TYR A 1 237 ? 74.893 62.213 49.307  1.00 31.42 ? 259 TYR A CD1 1 
ATOM   1916 C  CD2 . TYR A 1 237 ? 72.821 63.395 49.509  1.00 31.62 ? 259 TYR A CD2 1 
ATOM   1917 C  CE1 . TYR A 1 237 ? 74.875 62.407 47.919  1.00 30.23 ? 259 TYR A CE1 1 
ATOM   1918 C  CE2 . TYR A 1 237 ? 72.791 63.595 48.117  1.00 29.14 ? 259 TYR A CE2 1 
ATOM   1919 C  CZ  . TYR A 1 237 ? 73.817 63.097 47.332  1.00 30.93 ? 259 TYR A CZ  1 
ATOM   1920 O  OH  . TYR A 1 237 ? 73.802 63.287 45.959  1.00 31.27 ? 259 TYR A OH  1 
ATOM   1921 N  N   . LEU A 1 238 ? 74.333 65.361 52.913  1.00 32.60 ? 260 LEU A N   1 
ATOM   1922 C  CA  . LEU A 1 238 ? 74.316 66.827 52.901  1.00 33.32 ? 260 LEU A CA  1 
ATOM   1923 C  C   . LEU A 1 238 ? 75.729 67.418 53.082  1.00 34.32 ? 260 LEU A C   1 
ATOM   1924 O  O   . LEU A 1 238 ? 76.163 68.263 52.290  1.00 33.92 ? 260 LEU A O   1 
ATOM   1925 C  CB  . LEU A 1 238 ? 73.375 67.346 54.000  1.00 33.46 ? 260 LEU A CB  1 
ATOM   1926 C  CG  . LEU A 1 238 ? 71.928 67.828 53.757  1.00 33.30 ? 260 LEU A CG  1 
ATOM   1927 C  CD1 . LEU A 1 238 ? 71.405 67.608 52.346  1.00 32.36 ? 260 LEU A CD1 1 
ATOM   1928 C  CD2 . LEU A 1 238 ? 70.997 67.215 54.795  1.00 32.44 ? 260 LEU A CD2 1 
ATOM   1929 N  N   . LEU A 1 239 ? 76.432 66.954 54.120  1.00 35.34 ? 261 LEU A N   1 
ATOM   1930 C  CA  . LEU A 1 239 ? 77.838 67.314 54.374  1.00 36.80 ? 261 LEU A CA  1 
ATOM   1931 C  C   . LEU A 1 239 ? 78.773 67.042 53.202  1.00 37.39 ? 261 LEU A C   1 
ATOM   1932 O  O   . LEU A 1 239 ? 79.620 67.879 52.882  1.00 38.04 ? 261 LEU A O   1 
ATOM   1933 C  CB  . LEU A 1 239 ? 78.361 66.600 55.618  1.00 36.80 ? 261 LEU A CB  1 
ATOM   1934 C  CG  . LEU A 1 239 ? 77.905 67.195 56.949  1.00 38.10 ? 261 LEU A CG  1 
ATOM   1935 C  CD1 . LEU A 1 239 ? 77.991 66.146 58.058  1.00 39.04 ? 261 LEU A CD1 1 
ATOM   1936 C  CD2 . LEU A 1 239 ? 78.713 68.447 57.289  1.00 39.42 ? 261 LEU A CD2 1 
ATOM   1937 N  N   . HIS A 1 240 ? 78.616 65.886 52.559  1.00 38.05 ? 262 HIS A N   1 
ATOM   1938 C  CA  . HIS A 1 240 ? 79.390 65.546 51.355  1.00 38.82 ? 262 HIS A CA  1 
ATOM   1939 C  C   . HIS A 1 240 ? 79.190 66.584 50.237  1.00 38.99 ? 262 HIS A C   1 
ATOM   1940 O  O   . HIS A 1 240 ? 80.158 66.992 49.581  1.00 38.90 ? 262 HIS A O   1 
ATOM   1941 C  CB  . HIS A 1 240 ? 79.042 64.128 50.890  1.00 39.01 ? 262 HIS A CB  1 
ATOM   1942 C  CG  . HIS A 1 240 ? 79.449 63.816 49.479  1.00 40.99 ? 262 HIS A CG  1 
ATOM   1943 N  ND1 . HIS A 1 240 ? 80.767 63.708 49.085  1.00 41.60 ? 262 HIS A ND1 1 
ATOM   1944 C  CD2 . HIS A 1 240 ? 78.705 63.549 48.378  1.00 41.64 ? 262 HIS A CD2 1 
ATOM   1945 C  CE1 . HIS A 1 240 ? 80.819 63.407 47.800  1.00 41.65 ? 262 HIS A CE1 1 
ATOM   1946 N  NE2 . HIS A 1 240 ? 79.582 63.302 47.347  1.00 42.64 ? 262 HIS A NE2 1 
ATOM   1947 N  N   . LEU A 1 241 ? 77.938 67.010 50.046  1.00 38.99 ? 263 LEU A N   1 
ATOM   1948 C  CA  . LEU A 1 241 ? 77.573 68.030 49.049  1.00 39.33 ? 263 LEU A CA  1 
ATOM   1949 C  C   . LEU A 1 241 ? 78.124 69.419 49.397  1.00 39.63 ? 263 LEU A C   1 
ATOM   1950 O  O   . LEU A 1 241 ? 78.693 70.101 48.538  1.00 39.68 ? 263 LEU A O   1 
ATOM   1951 C  CB  . LEU A 1 241 ? 76.047 68.099 48.865  1.00 38.96 ? 263 LEU A CB  1 
ATOM   1952 C  CG  . LEU A 1 241 ? 75.316 66.809 48.473  1.00 38.83 ? 263 LEU A CG  1 
ATOM   1953 C  CD1 . LEU A 1 241 ? 73.802 67.022 48.455  1.00 39.12 ? 263 LEU A CD1 1 
ATOM   1954 C  CD2 . LEU A 1 241 ? 75.809 66.254 47.137  1.00 37.72 ? 263 LEU A CD2 1 
ATOM   1955 N  N   . GLU A 1 242 ? 77.947 69.825 50.651  1.00 39.94 ? 264 GLU A N   1 
ATOM   1956 C  CA  . GLU A 1 242 ? 78.551 71.047 51.177  1.00 41.25 ? 264 GLU A CA  1 
ATOM   1957 C  C   . GLU A 1 242 ? 80.081 71.060 50.966  1.00 41.64 ? 264 GLU A C   1 
ATOM   1958 O  O   . GLU A 1 242 ? 80.632 72.082 50.537  1.00 42.27 ? 264 GLU A O   1 
ATOM   1959 C  CB  . GLU A 1 242 ? 78.165 71.228 52.653  1.00 41.26 ? 264 GLU A CB  1 
ATOM   1960 C  CG  . GLU A 1 242 ? 78.951 72.284 53.430  1.00 42.81 ? 264 GLU A CG  1 
ATOM   1961 C  CD  . GLU A 1 242 ? 78.965 72.021 54.939  1.00 44.23 ? 264 GLU A CD  1 
ATOM   1962 O  OE1 . GLU A 1 242 ? 77.931 71.582 55.495  1.00 45.40 ? 264 GLU A OE1 1 
ATOM   1963 O  OE2 . GLU A 1 242 ? 80.018 72.250 55.575  1.00 44.39 ? 264 GLU A OE2 1 
ATOM   1964 N  N   . GLU A 1 243 ? 80.740 69.926 51.233  1.00 41.73 ? 265 GLU A N   1 
ATOM   1965 C  CA  . GLU A 1 243 ? 82.190 69.765 51.034  1.00 42.26 ? 265 GLU A CA  1 
ATOM   1966 C  C   . GLU A 1 243 ? 82.615 70.119 49.612  1.00 41.76 ? 265 GLU A C   1 
ATOM   1967 O  O   . GLU A 1 243 ? 83.669 70.726 49.403  1.00 41.83 ? 265 GLU A O   1 
ATOM   1968 C  CB  . GLU A 1 243 ? 82.625 68.322 51.357  1.00 42.71 ? 265 GLU A CB  1 
ATOM   1969 C  CG  . GLU A 1 243 ? 84.083 68.147 51.845  1.00 45.24 ? 265 GLU A CG  1 
ATOM   1970 C  CD  . GLU A 1 243 ? 85.141 68.044 50.722  1.00 48.39 ? 265 GLU A CD  1 
ATOM   1971 O  OE1 . GLU A 1 243 ? 84.783 67.819 49.538  1.00 48.99 ? 265 GLU A OE1 1 
ATOM   1972 O  OE2 . GLU A 1 243 ? 86.352 68.181 51.042  1.00 49.58 ? 265 GLU A OE2 1 
ATOM   1973 N  N   . MET A 1 244 ? 81.803 69.729 48.633  1.00 41.11 ? 266 MET A N   1 
ATOM   1974 C  CA  . MET A 1 244 ? 82.113 70.008 47.233  1.00 40.63 ? 266 MET A CA  1 
ATOM   1975 C  C   . MET A 1 244 ? 81.724 71.446 46.835  1.00 40.58 ? 266 MET A C   1 
ATOM   1976 O  O   . MET A 1 244 ? 81.977 71.877 45.710  1.00 40.33 ? 266 MET A O   1 
ATOM   1977 C  CB  . MET A 1 244 ? 81.449 68.977 46.307  1.00 40.44 ? 266 MET A CB  1 
ATOM   1978 C  CG  . MET A 1 244 ? 81.941 67.550 46.501  1.00 40.01 ? 266 MET A CG  1 
ATOM   1979 S  SD  . MET A 1 244 ? 81.397 66.410 45.226  1.00 38.87 ? 266 MET A SD  1 
ATOM   1980 C  CE  . MET A 1 244 ? 79.655 66.320 45.631  1.00 40.95 ? 266 MET A CE  1 
ATOM   1981 N  N   . GLY A 1 245 ? 81.126 72.180 47.770  1.00 40.50 ? 267 GLY A N   1 
ATOM   1982 C  CA  . GLY A 1 245 ? 80.688 73.550 47.513  1.00 41.07 ? 267 GLY A CA  1 
ATOM   1983 C  C   . GLY A 1 245 ? 79.427 73.638 46.667  1.00 41.07 ? 267 GLY A C   1 
ATOM   1984 O  O   . GLY A 1 245 ? 79.214 74.624 45.956  1.00 41.06 ? 267 GLY A O   1 
ATOM   1985 N  N   . VAL A 1 246 ? 78.593 72.600 46.745  1.00 40.95 ? 268 VAL A N   1 
ATOM   1986 C  CA  . VAL A 1 246 ? 77.324 72.565 46.015  1.00 40.47 ? 268 VAL A CA  1 
ATOM   1987 C  C   . VAL A 1 246 ? 76.328 73.488 46.702  1.00 39.87 ? 268 VAL A C   1 
ATOM   1988 O  O   . VAL A 1 246 ? 76.113 73.370 47.907  1.00 40.14 ? 268 VAL A O   1 
ATOM   1989 C  CB  . VAL A 1 246 ? 76.745 71.125 45.939  1.00 40.44 ? 268 VAL A CB  1 
ATOM   1990 C  CG1 . VAL A 1 246 ? 75.589 71.062 44.944  1.00 40.89 ? 268 VAL A CG1 1 
ATOM   1991 C  CG2 . VAL A 1 246 ? 77.821 70.129 45.546  1.00 40.51 ? 268 VAL A CG2 1 
ATOM   1992 N  N   . SER A 1 247 ? 75.740 74.414 45.941  1.00 39.45 ? 269 SER A N   1 
ATOM   1993 C  CA  . SER A 1 247 ? 74.699 75.330 46.459  1.00 38.82 ? 269 SER A CA  1 
ATOM   1994 C  C   . SER A 1 247 ? 73.465 74.569 46.938  1.00 38.27 ? 269 SER A C   1 
ATOM   1995 O  O   . SER A 1 247 ? 73.250 73.427 46.534  1.00 38.44 ? 269 SER A O   1 
ATOM   1996 C  CB  . SER A 1 247 ? 74.275 76.340 45.392  1.00 39.01 ? 269 SER A CB  1 
ATOM   1997 O  OG  . SER A 1 247 ? 73.388 75.752 44.452  1.00 39.27 ? 269 SER A OG  1 
ATOM   1998 N  N   . GLU A 1 248 ? 72.655 75.212 47.780  1.00 37.41 ? 270 GLU A N   1 
ATOM   1999 C  CA  . GLU A 1 248 ? 71.466 74.578 48.366  1.00 36.90 ? 270 GLU A CA  1 
ATOM   2000 C  C   . GLU A 1 248 ? 70.438 74.140 47.326  1.00 35.87 ? 270 GLU A C   1 
ATOM   2001 O  O   . GLU A 1 248 ? 69.750 73.140 47.518  1.00 35.95 ? 270 GLU A O   1 
ATOM   2002 C  CB  . GLU A 1 248 ? 70.798 75.504 49.385  1.00 36.92 ? 270 GLU A CB  1 
ATOM   2003 C  CG  . GLU A 1 248 ? 71.656 75.826 50.596  1.00 38.49 ? 270 GLU A CG  1 
ATOM   2004 C  CD  . GLU A 1 248 ? 70.884 76.487 51.726  1.00 40.30 ? 270 GLU A CD  1 
ATOM   2005 O  OE1 . GLU A 1 248 ? 69.688 76.795 51.554  1.00 41.56 ? 270 GLU A OE1 1 
ATOM   2006 O  OE2 . GLU A 1 248 ? 71.475 76.698 52.805  1.00 42.23 ? 270 GLU A OE2 1 
ATOM   2007 N  N   . GLU A 1 249 ? 70.342 74.899 46.236  1.00 34.63 ? 271 GLU A N   1 
ATOM   2008 C  CA  . GLU A 1 249 ? 69.381 74.644 45.164  1.00 33.55 ? 271 GLU A CA  1 
ATOM   2009 C  C   . GLU A 1 249 ? 69.827 73.498 44.237  1.00 32.39 ? 271 GLU A C   1 
ATOM   2010 O  O   . GLU A 1 249 ? 69.004 72.877 43.556  1.00 32.36 ? 271 GLU A O   1 
ATOM   2011 C  CB  . GLU A 1 249 ? 69.102 75.929 44.368  1.00 33.78 ? 271 GLU A CB  1 
ATOM   2012 C  CG  . GLU A 1 249 ? 68.124 76.907 45.066  1.00 35.75 ? 271 GLU A CG  1 
ATOM   2013 C  CD  . GLU A 1 249 ? 68.760 77.735 46.194  1.00 38.51 ? 271 GLU A CD  1 
ATOM   2014 O  OE1 . GLU A 1 249 ? 69.992 77.979 46.167  1.00 39.77 ? 271 GLU A OE1 1 
ATOM   2015 O  OE2 . GLU A 1 249 ? 68.016 78.166 47.104  1.00 39.26 ? 271 GLU A OE2 1 
ATOM   2016 N  N   . MET A 1 250 ? 71.126 73.224 44.206  1.00 30.70 ? 272 MET A N   1 
ATOM   2017 C  CA  . MET A 1 250 ? 71.592 72.021 43.546  1.00 29.19 ? 272 MET A CA  1 
ATOM   2018 C  C   . MET A 1 250 ? 71.623 70.841 44.527  1.00 28.97 ? 272 MET A C   1 
ATOM   2019 O  O   . MET A 1 250 ? 71.460 69.700 44.113  1.00 28.85 ? 272 MET A O   1 
ATOM   2020 C  CB  . MET A 1 250 ? 72.933 72.244 42.837  1.00 28.73 ? 272 MET A CB  1 
ATOM   2021 C  CG  . MET A 1 250 ? 73.393 71.076 41.970  1.00 24.88 ? 272 MET A CG  1 
ATOM   2022 S  SD  . MET A 1 250 ? 72.427 70.658 40.519  1.00 16.69 ? 272 MET A SD  1 
ATOM   2023 C  CE  . MET A 1 250 ? 72.844 71.967 39.361  1.00 21.56 ? 272 MET A CE  1 
ATOM   2024 N  N   . GLN A 1 251 ? 71.806 71.115 45.820  1.00 28.65 ? 273 GLN A N   1 
ATOM   2025 C  CA  . GLN A 1 251 ? 71.619 70.078 46.839  1.00 28.69 ? 273 GLN A CA  1 
ATOM   2026 C  C   . GLN A 1 251 ? 70.215 69.458 46.750  1.00 27.68 ? 273 GLN A C   1 
ATOM   2027 O  O   . GLN A 1 251 ? 70.065 68.242 46.847  1.00 28.50 ? 273 GLN A O   1 
ATOM   2028 C  CB  . GLN A 1 251 ? 71.856 70.607 48.258  1.00 28.76 ? 273 GLN A CB  1 
ATOM   2029 C  CG  . GLN A 1 251 ? 73.319 70.746 48.674  1.00 29.68 ? 273 GLN A CG  1 
ATOM   2030 C  CD  . GLN A 1 251 ? 73.488 71.531 49.972  1.00 32.01 ? 273 GLN A CD  1 
ATOM   2031 O  OE1 . GLN A 1 251 ? 72.923 71.176 51.007  1.00 32.20 ? 273 GLN A OE1 1 
ATOM   2032 N  NE2 . GLN A 1 251 ? 74.289 72.599 49.922  1.00 32.40 ? 273 GLN A NE2 1 
ATOM   2033 N  N   . ALA A 1 252 ? 69.209 70.310 46.591  1.00 26.56 ? 274 ALA A N   1 
ATOM   2034 C  CA  . ALA A 1 252 ? 67.803 69.908 46.467  1.00 25.34 ? 274 ALA A CA  1 
ATOM   2035 C  C   . ALA A 1 252 ? 67.578 69.026 45.240  1.00 24.63 ? 274 ALA A C   1 
ATOM   2036 O  O   . ALA A 1 252 ? 66.864 68.031 45.308  1.00 24.10 ? 274 ALA A O   1 
ATOM   2037 C  CB  . ALA A 1 252 ? 66.925 71.135 46.397  1.00 25.57 ? 274 ALA A CB  1 
ATOM   2038 N  N   . ARG A 1 253 ? 68.183 69.415 44.120  1.00 23.60 ? 275 ARG A N   1 
ATOM   2039 C  CA  . ARG A 1 253 ? 68.189 68.607 42.913  1.00 22.93 ? 275 ARG A CA  1 
ATOM   2040 C  C   . ARG A 1 253 ? 68.785 67.216 43.123  1.00 22.58 ? 275 ARG A C   1 
ATOM   2041 O  O   . ARG A 1 253 ? 68.240 66.232 42.624  1.00 21.49 ? 275 ARG A O   1 
ATOM   2042 C  CB  . ARG A 1 253 ? 68.935 69.325 41.808  1.00 23.08 ? 275 ARG A CB  1 
ATOM   2043 C  CG  . ARG A 1 253 ? 68.213 70.536 41.340  1.00 22.71 ? 275 ARG A CG  1 
ATOM   2044 C  CD  . ARG A 1 253 ? 68.754 70.966 40.039  1.00 22.29 ? 275 ARG A CD  1 
ATOM   2045 N  NE  . ARG A 1 253 ? 68.130 72.213 39.623  1.00 21.80 ? 275 ARG A NE  1 
ATOM   2046 C  CZ  . ARG A 1 253 ? 68.310 72.763 38.435  1.00 24.21 ? 275 ARG A CZ  1 
ATOM   2047 N  NH1 . ARG A 1 253 ? 69.092 72.159 37.535  1.00 23.93 ? 275 ARG A NH1 1 
ATOM   2048 N  NH2 . ARG A 1 253 ? 67.695 73.909 38.145  1.00 23.84 ? 275 ARG A NH2 1 
ATOM   2049 N  N   . ALA A 1 254 ? 69.894 67.151 43.868  1.00 22.29 ? 276 ALA A N   1 
ATOM   2050 C  CA  . ALA A 1 254 ? 70.554 65.880 44.191  1.00 22.15 ? 276 ALA A CA  1 
ATOM   2051 C  C   . ALA A 1 254 ? 69.734 65.035 45.156  1.00 21.53 ? 276 ALA A C   1 
ATOM   2052 O  O   . ALA A 1 254 ? 69.758 63.807 45.083  1.00 21.68 ? 276 ALA A O   1 
ATOM   2053 C  CB  . ALA A 1 254 ? 71.960 66.131 44.756  1.00 22.45 ? 276 ALA A CB  1 
ATOM   2054 N  N   . LEU A 1 255 ? 69.008 65.695 46.057  1.00 20.71 ? 277 LEU A N   1 
ATOM   2055 C  CA  . LEU A 1 255 ? 68.159 64.996 47.030  1.00 20.64 ? 277 LEU A CA  1 
ATOM   2056 C  C   . LEU A 1 255 ? 66.921 64.381 46.405  1.00 19.95 ? 277 LEU A C   1 
ATOM   2057 O  O   . LEU A 1 255 ? 66.430 63.345 46.886  1.00 20.79 ? 277 LEU A O   1 
ATOM   2058 C  CB  . LEU A 1 255 ? 67.775 65.898 48.202  1.00 20.91 ? 277 LEU A CB  1 
ATOM   2059 C  CG  . LEU A 1 255 ? 68.959 66.370 49.048  1.00 22.45 ? 277 LEU A CG  1 
ATOM   2060 C  CD1 . LEU A 1 255 ? 68.615 67.627 49.895  1.00 24.17 ? 277 LEU A CD1 1 
ATOM   2061 C  CD2 . LEU A 1 255 ? 69.435 65.243 49.921  1.00 20.82 ? 277 LEU A CD2 1 
ATOM   2062 N  N   . VAL A 1 256 ? 66.454 64.990 45.319  1.00 18.54 ? 278 VAL A N   1 
ATOM   2063 C  CA  . VAL A 1 256 ? 65.341 64.465 44.530  1.00 18.25 ? 278 VAL A CA  1 
ATOM   2064 C  C   . VAL A 1 256 ? 65.816 63.268 43.663  1.00 18.37 ? 278 VAL A C   1 
ATOM   2065 O  O   . VAL A 1 256 ? 65.093 62.282 43.483  1.00 18.24 ? 278 VAL A O   1 
ATOM   2066 C  CB  . VAL A 1 256 ? 64.645 65.624 43.711  1.00 17.76 ? 278 VAL A CB  1 
ATOM   2067 C  CG1 . VAL A 1 256 ? 63.684 65.100 42.648  1.00 17.54 ? 278 VAL A CG1 1 
ATOM   2068 C  CG2 . VAL A 1 256 ? 63.940 66.586 44.670  1.00 17.25 ? 278 VAL A CG2 1 
ATOM   2069 N  N   . LEU A 1 257 ? 67.034 63.356 43.143  1.00 18.23 ? 279 LEU A N   1 
ATOM   2070 C  CA  . LEU A 1 257 ? 67.692 62.202 42.547  1.00 18.97 ? 279 LEU A CA  1 
ATOM   2071 C  C   . LEU A 1 257 ? 67.782 61.015 43.530  1.00 18.45 ? 279 LEU A C   1 
ATOM   2072 O  O   . LEU A 1 257 ? 67.409 59.893 43.193  1.00 18.48 ? 279 LEU A O   1 
ATOM   2073 C  CB  . LEU A 1 257 ? 69.080 62.608 42.009  1.00 19.53 ? 279 LEU A CB  1 
ATOM   2074 C  CG  . LEU A 1 257 ? 70.222 61.589 41.819  1.00 21.49 ? 279 LEU A CG  1 
ATOM   2075 C  CD1 . LEU A 1 257 ? 69.980 60.687 40.636  1.00 22.39 ? 279 LEU A CD1 1 
ATOM   2076 C  CD2 . LEU A 1 257 ? 71.551 62.312 41.647  1.00 22.06 ? 279 LEU A CD2 1 
ATOM   2077 N  N   . GLN A 1 258 ? 68.295 61.275 44.735  1.00 18.53 ? 280 GLN A N   1 
ATOM   2078 C  CA  . GLN A 1 258 ? 68.336 60.297 45.806  1.00 18.09 ? 280 GLN A CA  1 
ATOM   2079 C  C   . GLN A 1 258 ? 66.947 59.792 46.178  1.00 18.32 ? 280 GLN A C   1 
ATOM   2080 O  O   . GLN A 1 258 ? 66.802 58.630 46.523  1.00 18.18 ? 280 GLN A O   1 
ATOM   2081 C  CB  . GLN A 1 258 ? 69.057 60.841 47.045  1.00 18.57 ? 280 GLN A CB  1 
ATOM   2082 C  CG  . GLN A 1 258 ? 70.583 61.029 46.888  1.00 20.63 ? 280 GLN A CG  1 
ATOM   2083 C  CD  . GLN A 1 258 ? 71.270 59.862 46.194  1.00 23.67 ? 280 GLN A CD  1 
ATOM   2084 O  OE1 . GLN A 1 258 ? 71.077 58.694 46.557  1.00 23.49 ? 280 GLN A OE1 1 
ATOM   2085 N  NE2 . GLN A 1 258 ? 72.055 60.174 45.168  1.00 25.60 ? 280 GLN A NE2 1 
ATOM   2086 N  N   . LEU A 1 259 ? 65.926 60.650 46.101  1.00 18.46 ? 281 LEU A N   1 
ATOM   2087 C  CA  . LEU A 1 259 ? 64.557 60.202 46.382  1.00 18.34 ? 281 LEU A CA  1 
ATOM   2088 C  C   . LEU A 1 259 ? 64.181 59.102 45.405  1.00 18.19 ? 281 LEU A C   1 
ATOM   2089 O  O   . LEU A 1 259 ? 63.634 58.079 45.802  1.00 17.86 ? 281 LEU A O   1 
ATOM   2090 C  CB  . LEU A 1 259 ? 63.524 61.345 46.349  1.00 17.77 ? 281 LEU A CB  1 
ATOM   2091 C  CG  . LEU A 1 259 ? 62.095 60.953 46.769  1.00 17.77 ? 281 LEU A CG  1 
ATOM   2092 C  CD1 . LEU A 1 259 ? 61.966 60.552 48.264  1.00 16.81 ? 281 LEU A CD1 1 
ATOM   2093 C  CD2 . LEU A 1 259 ? 61.116 62.063 46.476  1.00 19.18 ? 281 LEU A CD2 1 
ATOM   2094 N  N   . TRP A 1 260 ? 64.513 59.293 44.131  1.00 18.98 ? 282 TRP A N   1 
ATOM   2095 C  CA  . TRP A 1 260 ? 64.249 58.254 43.142  1.00 19.34 ? 282 TRP A CA  1 
ATOM   2096 C  C   . TRP A 1 260 ? 65.078 57.002 43.393  1.00 18.93 ? 282 TRP A C   1 
ATOM   2097 O  O   . TRP A 1 260 ? 64.551 55.897 43.341  1.00 18.77 ? 282 TRP A O   1 
ATOM   2098 C  CB  . TRP A 1 260 ? 64.450 58.754 41.717  1.00 20.72 ? 282 TRP A CB  1 
ATOM   2099 C  CG  . TRP A 1 260 ? 64.484 57.619 40.744  1.00 22.27 ? 282 TRP A CG  1 
ATOM   2100 C  CD1 . TRP A 1 260 ? 63.417 56.896 40.285  1.00 24.34 ? 282 TRP A CD1 1 
ATOM   2101 C  CD2 . TRP A 1 260 ? 65.646 57.045 40.145  1.00 23.95 ? 282 TRP A CD2 1 
ATOM   2102 N  NE1 . TRP A 1 260 ? 63.845 55.910 39.436  1.00 25.54 ? 282 TRP A NE1 1 
ATOM   2103 C  CE2 . TRP A 1 260 ? 65.211 55.977 39.331  1.00 24.71 ? 282 TRP A CE2 1 
ATOM   2104 C  CE3 . TRP A 1 260 ? 67.017 57.328 40.219  1.00 24.62 ? 282 TRP A CE3 1 
ATOM   2105 C  CZ2 . TRP A 1 260 ? 66.092 55.207 38.573  1.00 23.98 ? 282 TRP A CZ2 1 
ATOM   2106 C  CZ3 . TRP A 1 260 ? 67.893 56.558 39.477  1.00 24.75 ? 282 TRP A CZ3 1 
ATOM   2107 C  CH2 . TRP A 1 260 ? 67.424 55.506 38.663  1.00 24.40 ? 282 TRP A CH2 1 
ATOM   2108 N  N   . ALA A 1 261 ? 66.367 57.184 43.685  1.00 18.59 ? 283 ALA A N   1 
ATOM   2109 C  CA  . ALA A 1 261 ? 67.296 56.061 43.838  1.00 18.15 ? 283 ALA A CA  1 
ATOM   2110 C  C   . ALA A 1 261 ? 66.960 55.205 45.033  1.00 17.90 ? 283 ALA A C   1 
ATOM   2111 O  O   . ALA A 1 261 ? 67.216 53.988 45.029  1.00 18.55 ? 283 ALA A O   1 
ATOM   2112 C  CB  . ALA A 1 261 ? 68.756 56.567 43.959  1.00 18.29 ? 283 ALA A CB  1 
ATOM   2113 N  N   . THR A 1 262 ? 66.389 55.821 46.064  1.00 16.73 ? 284 THR A N   1 
ATOM   2114 C  CA  . THR A 1 262 ? 66.098 55.076 47.276  1.00 16.05 ? 284 THR A CA  1 
ATOM   2115 C  C   . THR A 1 262 ? 64.659 54.576 47.365  1.00 16.26 ? 284 THR A C   1 
ATOM   2116 O  O   . THR A 1 262 ? 64.386 53.630 48.084  1.00 16.12 ? 284 THR A O   1 
ATOM   2117 C  CB  . THR A 1 262 ? 66.485 55.888 48.551  1.00 16.55 ? 284 THR A CB  1 
ATOM   2118 O  OG1 . THR A 1 262 ? 65.656 57.049 48.659  1.00 14.62 ? 284 THR A OG1 1 
ATOM   2119 C  CG2 . THR A 1 262 ? 67.978 56.298 48.500  1.00 14.59 ? 284 THR A CG2 1 
ATOM   2120 N  N   . GLN A 1 263 ? 63.750 55.192 46.608  1.00 16.62 ? 285 GLN A N   1 
ATOM   2121 C  CA  . GLN A 1 263 ? 62.311 54.891 46.719  1.00 16.73 ? 285 GLN A CA  1 
ATOM   2122 C  C   . GLN A 1 263 ? 61.655 54.361 45.437  1.00 16.39 ? 285 GLN A C   1 
ATOM   2123 O  O   . GLN A 1 263 ? 60.545 53.799 45.497  1.00 17.66 ? 285 GLN A O   1 
ATOM   2124 C  CB  . GLN A 1 263 ? 61.535 56.129 47.199  1.00 16.63 ? 285 GLN A CB  1 
ATOM   2125 C  CG  . GLN A 1 263 ? 62.048 56.827 48.471  1.00 17.79 ? 285 GLN A CG  1 
ATOM   2126 C  CD  . GLN A 1 263 ? 62.161 55.937 49.695  1.00 18.72 ? 285 GLN A CD  1 
ATOM   2127 O  OE1 . GLN A 1 263 ? 61.285 55.141 49.983  1.00 19.76 ? 285 GLN A OE1 1 
ATOM   2128 N  NE2 . GLN A 1 263 ? 63.257 56.086 50.432  1.00 21.34 ? 285 GLN A NE2 1 
ATOM   2129 N  N   . GLY A 1 264 ? 62.329 54.510 44.294  1.00 15.53 ? 286 GLY A N   1 
ATOM   2130 C  CA  . GLY A 1 264 ? 61.751 54.163 42.983  1.00 15.35 ? 286 GLY A CA  1 
ATOM   2131 C  C   . GLY A 1 264 ? 61.606 52.684 42.645  1.00 15.76 ? 286 GLY A C   1 
ATOM   2132 O  O   . GLY A 1 264 ? 61.057 52.333 41.583  1.00 15.23 ? 286 GLY A O   1 
ATOM   2133 N  N   . ASN A 1 265 ? 62.086 51.826 43.548  1.00 15.52 ? 287 ASN A N   1 
ATOM   2134 C  CA  . ASN A 1 265 ? 62.031 50.368 43.380  1.00 16.44 ? 287 ASN A CA  1 
ATOM   2135 C  C   . ASN A 1 265 ? 61.200 49.583 44.408  1.00 15.82 ? 287 ASN A C   1 
ATOM   2136 O  O   . ASN A 1 265 ? 60.577 48.605 44.037  1.00 16.55 ? 287 ASN A O   1 
ATOM   2137 C  CB  . ASN A 1 265 ? 63.446 49.757 43.331  1.00 16.22 ? 287 ASN A CB  1 
ATOM   2138 C  CG  . ASN A 1 265 ? 64.153 49.970 42.004  1.00 16.64 ? 287 ASN A CG  1 
ATOM   2139 O  OD1 . ASN A 1 265 ? 63.537 50.000 40.928  1.00 14.71 ? 287 ASN A OD1 1 
ATOM   2140 N  ND2 . ASN A 1 265 ? 65.479 50.072 42.073  1.00 17.68 ? 287 ASN A ND2 1 
ATOM   2141 N  N   . MET A 1 266 ? 61.206 49.981 45.685  1.00 16.43 ? 288 MET A N   1 
ATOM   2142 C  CA  . MET A 1 266 ? 60.575 49.179 46.769  1.00 15.36 ? 288 MET A CA  1 
ATOM   2143 C  C   . MET A 1 266 ? 59.086 49.049 46.535  1.00 15.19 ? 288 MET A C   1 
ATOM   2144 O  O   . MET A 1 266 ? 58.537 47.965 46.624  1.00 14.58 ? 288 MET A O   1 
ATOM   2145 C  CB  . MET A 1 266 ? 60.760 49.806 48.162  1.00 15.88 ? 288 MET A CB  1 
ATOM   2146 C  CG  . MET A 1 266 ? 62.082 49.576 48.870  1.00 15.62 ? 288 MET A CG  1 
ATOM   2147 S  SD  . MET A 1 266 ? 62.029 50.132 50.599  1.00 6.45  ? 288 MET A SD  1 
ATOM   2148 C  CE  . MET A 1 266 ? 61.535 51.825 50.562  1.00 14.60 ? 288 MET A CE  1 
ATOM   2149 N  N   . GLY A 1 267 ? 58.436 50.175 46.261  1.00 15.10 ? 289 GLY A N   1 
ATOM   2150 C  CA  . GLY A 1 267 ? 57.000 50.205 45.994  1.00 14.50 ? 289 GLY A CA  1 
ATOM   2151 C  C   . GLY A 1 267 ? 56.579 49.249 44.896  1.00 14.44 ? 289 GLY A C   1 
ATOM   2152 O  O   . GLY A 1 267 ? 55.744 48.375 45.132  1.00 14.48 ? 289 GLY A O   1 
ATOM   2153 N  N   . PRO A 1 268 ? 57.130 49.421 43.674  1.00 13.96 ? 290 PRO A N   1 
ATOM   2154 C  CA  . PRO A 1 268 ? 56.885 48.464 42.583  1.00 13.52 ? 290 PRO A CA  1 
ATOM   2155 C  C   . PRO A 1 268 ? 57.225 47.010 42.902  1.00 13.19 ? 290 PRO A C   1 
ATOM   2156 O  O   . PRO A 1 268 ? 56.482 46.123 42.471  1.00 12.35 ? 290 PRO A O   1 
ATOM   2157 C  CB  . PRO A 1 268 ? 57.766 48.994 41.443  1.00 13.56 ? 290 PRO A CB  1 
ATOM   2158 C  CG  . PRO A 1 268 ? 57.823 50.479 41.691  1.00 13.25 ? 290 PRO A CG  1 
ATOM   2159 C  CD  . PRO A 1 268 ? 57.908 50.588 43.207  1.00 14.34 ? 290 PRO A CD  1 
ATOM   2160 N  N   . ALA A 1 269 ? 58.320 46.764 43.640  1.00 12.28 ? 291 ALA A N   1 
ATOM   2161 C  CA  . ALA A 1 269 ? 58.676 45.392 44.038  1.00 12.03 ? 291 ALA A CA  1 
ATOM   2162 C  C   . ALA A 1 269 ? 57.581 44.768 44.876  1.00 12.13 ? 291 ALA A C   1 
ATOM   2163 O  O   . ALA A 1 269 ? 57.151 43.650 44.595  1.00 12.11 ? 291 ALA A O   1 
ATOM   2164 C  CB  . ALA A 1 269 ? 60.023 45.353 44.816  1.00 11.95 ? 291 ALA A CB  1 
ATOM   2165 N  N   . ALA A 1 270 ? 57.134 45.487 45.916  1.00 11.77 ? 292 ALA A N   1 
ATOM   2166 C  CA  . ALA A 1 270 ? 56.069 44.997 46.787  1.00 11.35 ? 292 ALA A CA  1 
ATOM   2167 C  C   . ALA A 1 270 ? 54.738 44.781 46.056  1.00 11.05 ? 292 ALA A C   1 
ATOM   2168 O  O   . ALA A 1 270 ? 53.963 43.898 46.418  1.00 11.10 ? 292 ALA A O   1 
ATOM   2169 C  CB  . ALA A 1 270 ? 55.869 45.947 47.961  1.00 11.34 ? 292 ALA A CB  1 
ATOM   2170 N  N   . PHE A 1 271 ? 54.458 45.618 45.058  1.00 10.96 ? 293 PHE A N   1 
ATOM   2171 C  CA  . PHE A 1 271 ? 53.244 45.486 44.250  1.00 10.39 ? 293 PHE A CA  1 
ATOM   2172 C  C   . PHE A 1 271 ? 53.195 44.117 43.557  1.00 10.48 ? 293 PHE A C   1 
ATOM   2173 O  O   . PHE A 1 271 ? 52.189 43.406 43.636  1.00 9.74  ? 293 PHE A O   1 
ATOM   2174 C  CB  . PHE A 1 271 ? 53.162 46.622 43.209  1.00 10.13 ? 293 PHE A CB  1 
ATOM   2175 C  CG  . PHE A 1 271 ? 52.302 46.288 42.022  1.00 10.69 ? 293 PHE A CG  1 
ATOM   2176 C  CD1 . PHE A 1 271 ? 50.902 46.316 42.118  1.00 11.88 ? 293 PHE A CD1 1 
ATOM   2177 C  CD2 . PHE A 1 271 ? 52.882 45.910 40.812  1.00 9.34  ? 293 PHE A CD2 1 
ATOM   2178 C  CE1 . PHE A 1 271 ? 50.089 45.982 41.001  1.00 9.32  ? 293 PHE A CE1 1 
ATOM   2179 C  CE2 . PHE A 1 271 ? 52.088 45.560 39.720  1.00 10.40 ? 293 PHE A CE2 1 
ATOM   2180 C  CZ  . PHE A 1 271 ? 50.693 45.609 39.813  1.00 11.35 ? 293 PHE A CZ  1 
ATOM   2181 N  N   . TRP A 1 272 ? 54.311 43.747 42.920  1.00 10.90 ? 294 TRP A N   1 
ATOM   2182 C  CA  . TRP A 1 272 ? 54.398 42.518 42.139  1.00 11.55 ? 294 TRP A CA  1 
ATOM   2183 C  C   . TRP A 1 272 ? 54.312 41.325 43.075  1.00 11.84 ? 294 TRP A C   1 
ATOM   2184 O  O   . TRP A 1 272 ? 53.598 40.367 42.786  1.00 12.72 ? 294 TRP A O   1 
ATOM   2185 C  CB  . TRP A 1 272 ? 55.703 42.464 41.319  1.00 11.41 ? 294 TRP A CB  1 
ATOM   2186 C  CG  . TRP A 1 272 ? 55.746 43.427 40.181  1.00 11.57 ? 294 TRP A CG  1 
ATOM   2187 C  CD1 . TRP A 1 272 ? 56.587 44.497 40.037  1.00 10.01 ? 294 TRP A CD1 1 
ATOM   2188 C  CD2 . TRP A 1 272 ? 54.927 43.393 38.996  1.00 12.31 ? 294 TRP A CD2 1 
ATOM   2189 N  NE1 . TRP A 1 272 ? 56.334 45.150 38.844  1.00 10.02 ? 294 TRP A NE1 1 
ATOM   2190 C  CE2 . TRP A 1 272 ? 55.316 44.492 38.190  1.00 11.30 ? 294 TRP A CE2 1 
ATOM   2191 C  CE3 . TRP A 1 272 ? 53.904 42.539 38.539  1.00 9.94  ? 294 TRP A CE3 1 
ATOM   2192 C  CZ2 . TRP A 1 272 ? 54.703 44.774 36.972  1.00 11.12 ? 294 TRP A CZ2 1 
ATOM   2193 C  CZ3 . TRP A 1 272 ? 53.288 42.830 37.325  1.00 11.68 ? 294 TRP A CZ3 1 
ATOM   2194 C  CH2 . TRP A 1 272 ? 53.704 43.934 36.547  1.00 10.61 ? 294 TRP A CH2 1 
ATOM   2195 N  N   . LEU A 1 273 ? 55.025 41.409 44.201  1.00 11.62 ? 295 LEU A N   1 
ATOM   2196 C  CA  . LEU A 1 273 ? 55.032 40.374 45.231  1.00 11.46 ? 295 LEU A CA  1 
ATOM   2197 C  C   . LEU A 1 273 ? 53.627 40.122 45.787  1.00 11.87 ? 295 LEU A C   1 
ATOM   2198 O  O   . LEU A 1 273 ? 53.181 38.981 45.849  1.00 12.17 ? 295 LEU A O   1 
ATOM   2199 C  CB  . LEU A 1 273 ? 56.006 40.737 46.368  1.00 10.94 ? 295 LEU A CB  1 
ATOM   2200 C  CG  . LEU A 1 273 ? 56.305 39.703 47.492  1.00 10.14 ? 295 LEU A CG  1 
ATOM   2201 C  CD1 . LEU A 1 273 ? 57.631 40.044 48.175  1.00 7.65  ? 295 LEU A CD1 1 
ATOM   2202 C  CD2 . LEU A 1 273 ? 55.209 39.671 48.547  1.00 10.03 ? 295 LEU A CD2 1 
ATOM   2203 N  N   . LEU A 1 274 ? 52.943 41.185 46.190  1.00 12.43 ? 296 LEU A N   1 
ATOM   2204 C  CA  . LEU A 1 274 ? 51.571 41.069 46.723  1.00 12.51 ? 296 LEU A CA  1 
ATOM   2205 C  C   . LEU A 1 274 ? 50.595 40.525 45.673  1.00 12.37 ? 296 LEU A C   1 
ATOM   2206 O  O   . LEU A 1 274 ? 49.768 39.670 45.977  1.00 13.12 ? 296 LEU A O   1 
ATOM   2207 C  CB  . LEU A 1 274 ? 51.093 42.417 47.272  1.00 11.94 ? 296 LEU A CB  1 
ATOM   2208 C  CG  . LEU A 1 274 ? 51.637 42.881 48.638  1.00 13.72 ? 296 LEU A CG  1 
ATOM   2209 C  CD1 . LEU A 1 274 ? 51.024 44.237 48.984  1.00 12.81 ? 296 LEU A CD1 1 
ATOM   2210 C  CD2 . LEU A 1 274 ? 51.365 41.826 49.800  1.00 14.48 ? 296 LEU A CD2 1 
ATOM   2211 N  N   . LEU A 1 275 ? 50.723 41.004 44.435  1.00 12.18 ? 297 LEU A N   1 
ATOM   2212 C  CA  . LEU A 1 275 ? 49.919 40.522 43.323  1.00 12.29 ? 297 LEU A CA  1 
ATOM   2213 C  C   . LEU A 1 275 ? 50.156 39.032 43.063  1.00 12.08 ? 297 LEU A C   1 
ATOM   2214 O  O   . LEU A 1 275 ? 49.201 38.290 42.877  1.00 12.23 ? 297 LEU A O   1 
ATOM   2215 C  CB  . LEU A 1 275 ? 50.178 41.361 42.038  1.00 12.33 ? 297 LEU A CB  1 
ATOM   2216 C  CG  . LEU A 1 275 ? 49.431 40.993 40.746  1.00 13.91 ? 297 LEU A CG  1 
ATOM   2217 C  CD1 . LEU A 1 275 ? 47.926 41.173 40.948  1.00 14.72 ? 297 LEU A CD1 1 
ATOM   2218 C  CD2 . LEU A 1 275 ? 49.908 41.815 39.528  1.00 12.66 ? 297 LEU A CD2 1 
ATOM   2219 N  N   . PHE A 1 276 ? 51.418 38.599 43.042  1.00 12.32 ? 298 PHE A N   1 
ATOM   2220 C  CA  . PHE A 1 276 ? 51.742 37.181 42.843  1.00 12.62 ? 298 PHE A CA  1 
ATOM   2221 C  C   . PHE A 1 276 ? 51.145 36.306 43.962  1.00 13.39 ? 298 PHE A C   1 
ATOM   2222 O  O   . PHE A 1 276 ? 50.657 35.204 43.702  1.00 13.89 ? 298 PHE A O   1 
ATOM   2223 C  CB  . PHE A 1 276 ? 53.259 36.957 42.760  1.00 13.18 ? 298 PHE A CB  1 
ATOM   2224 C  CG  . PHE A 1 276 ? 53.898 37.441 41.469  1.00 13.89 ? 298 PHE A CG  1 
ATOM   2225 C  CD1 . PHE A 1 276 ? 53.324 37.152 40.226  1.00 14.25 ? 298 PHE A CD1 1 
ATOM   2226 C  CD2 . PHE A 1 276 ? 55.098 38.145 41.502  1.00 12.41 ? 298 PHE A CD2 1 
ATOM   2227 C  CE1 . PHE A 1 276 ? 53.914 37.598 39.039  1.00 16.07 ? 298 PHE A CE1 1 
ATOM   2228 C  CE2 . PHE A 1 276 ? 55.712 38.582 40.309  1.00 15.23 ? 298 PHE A CE2 1 
ATOM   2229 C  CZ  . PHE A 1 276 ? 55.118 38.316 39.081  1.00 14.94 ? 298 PHE A CZ  1 
ATOM   2230 N  N   . LEU A 1 277 ? 51.176 36.794 45.200  1.00 13.14 ? 299 LEU A N   1 
ATOM   2231 C  CA  . LEU A 1 277 ? 50.558 36.075 46.319  1.00 13.23 ? 299 LEU A CA  1 
ATOM   2232 C  C   . LEU A 1 277 ? 49.035 36.049 46.178  1.00 13.77 ? 299 LEU A C   1 
ATOM   2233 O  O   . LEU A 1 277 ? 48.414 35.030 46.391  1.00 14.69 ? 299 LEU A O   1 
ATOM   2234 C  CB  . LEU A 1 277 ? 50.954 36.700 47.654  1.00 12.54 ? 299 LEU A CB  1 
ATOM   2235 C  CG  . LEU A 1 277 ? 52.438 36.668 48.049  1.00 12.58 ? 299 LEU A CG  1 
ATOM   2236 C  CD1 . LEU A 1 277 ? 52.551 37.273 49.448  1.00 9.99  ? 299 LEU A CD1 1 
ATOM   2237 C  CD2 . LEU A 1 277 ? 53.027 35.202 47.979  1.00 10.95 ? 299 LEU A CD2 1 
ATOM   2238 N  N   . LEU A 1 278 ? 48.444 37.175 45.797  1.00 14.46 ? 300 LEU A N   1 
ATOM   2239 C  CA  . LEU A 1 278 ? 46.996 37.263 45.608  1.00 15.49 ? 300 LEU A CA  1 
ATOM   2240 C  C   . LEU A 1 278 ? 46.518 36.339 44.492  1.00 15.69 ? 300 LEU A C   1 
ATOM   2241 O  O   . LEU A 1 278 ? 45.406 35.843 44.542  1.00 15.27 ? 300 LEU A O   1 
ATOM   2242 C  CB  . LEU A 1 278 ? 46.590 38.699 45.315  1.00 15.25 ? 300 LEU A CB  1 
ATOM   2243 C  CG  . LEU A 1 278 ? 46.001 39.648 46.371  1.00 16.97 ? 300 LEU A CG  1 
ATOM   2244 C  CD1 . LEU A 1 278 ? 45.932 39.167 47.813  1.00 18.79 ? 300 LEU A CD1 1 
ATOM   2245 C  CD2 . LEU A 1 278 ? 46.633 41.004 46.265  1.00 17.50 ? 300 LEU A CD2 1 
ATOM   2246 N  N   . LYS A 1 279 ? 47.374 36.096 43.496  1.00 16.13 ? 301 LYS A N   1 
ATOM   2247 C  CA  . LYS A 1 279 ? 47.039 35.204 42.397  1.00 16.08 ? 301 LYS A CA  1 
ATOM   2248 C  C   . LYS A 1 279 ? 47.374 33.732 42.655  1.00 16.66 ? 301 LYS A C   1 
ATOM   2249 O  O   . LYS A 1 279 ? 46.981 32.863 41.864  1.00 16.14 ? 301 LYS A O   1 
ATOM   2250 C  CB  . LYS A 1 279 ? 47.710 35.657 41.106  1.00 16.12 ? 301 LYS A CB  1 
ATOM   2251 C  CG  . LYS A 1 279 ? 47.193 36.999 40.563  1.00 17.73 ? 301 LYS A CG  1 
ATOM   2252 C  CD  . LYS A 1 279 ? 45.726 36.924 40.128  1.00 19.11 ? 301 LYS A CD  1 
ATOM   2253 C  CE  . LYS A 1 279 ? 45.503 35.870 39.027  1.00 20.75 ? 301 LYS A CE  1 
ATOM   2254 N  NZ  . LYS A 1 279 ? 44.102 35.859 38.533  1.00 21.66 ? 301 LYS A NZ  1 
ATOM   2255 N  N   . ASN A 1 280 ? 48.112 33.453 43.732  1.00 15.97 ? 302 ASN A N   1 
ATOM   2256 C  CA  . ASN A 1 280 ? 48.582 32.102 43.991  1.00 16.78 ? 302 ASN A CA  1 
ATOM   2257 C  C   . ASN A 1 280 ? 48.260 31.697 45.420  1.00 17.06 ? 302 ASN A C   1 
ATOM   2258 O  O   . ASN A 1 280 ? 49.083 31.876 46.302  1.00 17.28 ? 302 ASN A O   1 
ATOM   2259 C  CB  . ASN A 1 280 ? 50.081 32.018 43.710  1.00 16.42 ? 302 ASN A CB  1 
ATOM   2260 C  CG  . ASN A 1 280 ? 50.389 32.124 42.230  1.00 17.05 ? 302 ASN A CG  1 
ATOM   2261 O  OD1 . ASN A 1 280 ? 50.306 31.125 41.506  1.00 16.62 ? 302 ASN A OD1 1 
ATOM   2262 N  ND2 . ASN A 1 280 ? 50.750 33.337 41.766  1.00 15.00 ? 302 ASN A ND2 1 
ATOM   2263 N  N   . PRO A 1 281 ? 47.020 31.225 45.660  1.00 17.67 ? 303 PRO A N   1 
ATOM   2264 C  CA  . PRO A 1 281 ? 46.521 30.862 46.988  1.00 17.99 ? 303 PRO A CA  1 
ATOM   2265 C  C   . PRO A 1 281 ? 47.447 30.012 47.870  1.00 18.08 ? 303 PRO A C   1 
ATOM   2266 O  O   . PRO A 1 281 ? 47.516 30.268 49.062  1.00 18.60 ? 303 PRO A O   1 
ATOM   2267 C  CB  . PRO A 1 281 ? 45.230 30.103 46.672  1.00 18.31 ? 303 PRO A CB  1 
ATOM   2268 C  CG  . PRO A 1 281 ? 44.719 30.804 45.425  1.00 18.65 ? 303 PRO A CG  1 
ATOM   2269 C  CD  . PRO A 1 281 ? 45.975 31.063 44.625  1.00 17.92 ? 303 PRO A CD  1 
ATOM   2270 N  N   . GLU A 1 282 ? 48.108 29.009 47.298  1.00 18.37 ? 304 GLU A N   1 
ATOM   2271 C  CA  . GLU A 1 282 ? 49.058 28.143 48.019  1.00 18.97 ? 304 GLU A CA  1 
ATOM   2272 C  C   . GLU A 1 282 ? 50.290 28.939 48.477  1.00 17.74 ? 304 GLU A C   1 
ATOM   2273 O  O   . GLU A 1 282 ? 50.784 28.732 49.573  1.00 17.67 ? 304 GLU A O   1 
ATOM   2274 C  CB  . GLU A 1 282 ? 49.427 26.881 47.182  1.00 19.40 ? 304 GLU A CB  1 
ATOM   2275 C  CG  . GLU A 1 282 ? 50.911 26.434 47.289  1.00 25.36 ? 304 GLU A CG  1 
ATOM   2276 C  CD  . GLU A 1 282 ? 51.177 24.916 47.135  1.00 31.96 ? 304 GLU A CD  1 
ATOM   2277 O  OE1 . GLU A 1 282 ? 50.601 24.262 46.224  1.00 33.02 ? 304 GLU A OE1 1 
ATOM   2278 O  OE2 . GLU A 1 282 ? 52.013 24.391 47.924  1.00 34.48 ? 304 GLU A OE2 1 
ATOM   2279 N  N   . ALA A 1 283 ? 50.753 29.860 47.632  1.00 16.85 ? 305 ALA A N   1 
ATOM   2280 C  CA  . ALA A 1 283 ? 51.850 30.769 47.959  1.00 15.74 ? 305 ALA A CA  1 
ATOM   2281 C  C   . ALA A 1 283 ? 51.486 31.715 49.095  1.00 14.79 ? 305 ALA A C   1 
ATOM   2282 O  O   . ALA A 1 283 ? 52.266 31.904 50.018  1.00 14.63 ? 305 ALA A O   1 
ATOM   2283 C  CB  . ALA A 1 283 ? 52.263 31.570 46.712  1.00 14.97 ? 305 ALA A CB  1 
ATOM   2284 N  N   . LEU A 1 284 ? 50.302 32.328 49.025  1.00 14.11 ? 306 LEU A N   1 
ATOM   2285 C  CA  . LEU A 1 284 ? 49.864 33.233 50.086  1.00 13.25 ? 306 LEU A CA  1 
ATOM   2286 C  C   . LEU A 1 284 ? 49.711 32.471 51.413  1.00 12.47 ? 306 LEU A C   1 
ATOM   2287 O  O   . LEU A 1 284 ? 50.089 32.995 52.457  1.00 11.72 ? 306 LEU A O   1 
ATOM   2288 C  CB  . LEU A 1 284 ? 48.537 33.877 49.731  1.00 13.11 ? 306 LEU A CB  1 
ATOM   2289 C  CG  . LEU A 1 284 ? 48.183 35.339 50.050  1.00 15.46 ? 306 LEU A CG  1 
ATOM   2290 C  CD1 . LEU A 1 284 ? 46.674 35.566 50.007  1.00 15.71 ? 306 LEU A CD1 1 
ATOM   2291 C  CD2 . LEU A 1 284 ? 48.760 35.890 51.328  1.00 15.33 ? 306 LEU A CD2 1 
ATOM   2292 N  N   . ALA A 1 285 ? 49.100 31.278 51.378  1.00 11.98 ? 307 ALA A N   1 
ATOM   2293 C  CA  . ALA A 1 285 ? 48.873 30.477 52.610  1.00 12.26 ? 307 ALA A CA  1 
ATOM   2294 C  C   . ALA A 1 285 ? 50.182 30.162 53.319  1.00 12.26 ? 307 ALA A C   1 
ATOM   2295 O  O   . ALA A 1 285 ? 50.277 30.254 54.538  1.00 14.49 ? 307 ALA A O   1 
ATOM   2296 C  CB  . ALA A 1 285 ? 48.072 29.148 52.312  1.00 11.82 ? 307 ALA A CB  1 
ATOM   2297 N  N   . ALA A 1 286 ? 51.195 29.810 52.550  1.00 13.16 ? 308 ALA A N   1 
ATOM   2298 C  CA  . ALA A 1 286 ? 52.524 29.500 53.086  1.00 13.37 ? 308 ALA A CA  1 
ATOM   2299 C  C   . ALA A 1 286 ? 53.202 30.748 53.682  1.00 13.92 ? 308 ALA A C   1 
ATOM   2300 O  O   . ALA A 1 286 ? 53.841 30.658 54.721  1.00 14.55 ? 308 ALA A O   1 
ATOM   2301 C  CB  . ALA A 1 286 ? 53.383 28.860 52.002  1.00 12.88 ? 308 ALA A CB  1 
ATOM   2302 N  N   . VAL A 1 287 ? 53.042 31.912 53.050  1.00 14.16 ? 309 VAL A N   1 
ATOM   2303 C  CA  . VAL A 1 287 ? 53.554 33.167 53.626  1.00 14.20 ? 309 VAL A CA  1 
ATOM   2304 C  C   . VAL A 1 287 ? 52.798 33.507 54.929  1.00 14.20 ? 309 VAL A C   1 
ATOM   2305 O  O   . VAL A 1 287 ? 53.413 33.738 55.965  1.00 13.25 ? 309 VAL A O   1 
ATOM   2306 C  CB  . VAL A 1 287 ? 53.518 34.351 52.603  1.00 14.58 ? 309 VAL A CB  1 
ATOM   2307 C  CG1 . VAL A 1 287 ? 53.852 35.703 53.278  1.00 15.04 ? 309 VAL A CG1 1 
ATOM   2308 C  CG2 . VAL A 1 287 ? 54.484 34.108 51.451  1.00 13.03 ? 309 VAL A CG2 1 
ATOM   2309 N  N   . ARG A 1 288 ? 51.462 33.522 54.884  1.00 14.94 ? 310 ARG A N   1 
ATOM   2310 C  CA  . ARG A 1 288 ? 50.659 33.764 56.105  1.00 15.25 ? 310 ARG A CA  1 
ATOM   2311 C  C   . ARG A 1 288 ? 51.061 32.823 57.242  1.00 15.31 ? 310 ARG A C   1 
ATOM   2312 O  O   . ARG A 1 288 ? 51.182 33.254 58.385  1.00 14.90 ? 310 ARG A O   1 
ATOM   2313 C  CB  . ARG A 1 288 ? 49.155 33.570 55.864  1.00 15.98 ? 310 ARG A CB  1 
ATOM   2314 C  CG  . ARG A 1 288 ? 48.586 34.233 54.622  1.00 18.35 ? 310 ARG A CG  1 
ATOM   2315 C  CD  . ARG A 1 288 ? 47.096 34.455 54.778  1.00 24.34 ? 310 ARG A CD  1 
ATOM   2316 N  NE  . ARG A 1 288 ? 46.948 35.820 55.245  1.00 29.02 ? 310 ARG A NE  1 
ATOM   2317 C  CZ  . ARG A 1 288 ? 46.339 36.784 54.585  1.00 26.10 ? 310 ARG A CZ  1 
ATOM   2318 N  NH1 . ARG A 1 288 ? 45.696 36.541 53.448  1.00 23.94 ? 310 ARG A NH1 1 
ATOM   2319 N  NH2 . ARG A 1 288 ? 46.333 37.981 55.122  1.00 28.12 ? 310 ARG A NH2 1 
ATOM   2320 N  N   . GLY A 1 289 ? 51.224 31.539 56.903  1.00 15.33 ? 311 GLY A N   1 
ATOM   2321 C  CA  . GLY A 1 289 ? 51.499 30.490 57.869  1.00 16.00 ? 311 GLY A CA  1 
ATOM   2322 C  C   . GLY A 1 289 ? 52.788 30.763 58.586  1.00 16.55 ? 311 GLY A C   1 
ATOM   2323 O  O   . GLY A 1 289 ? 52.835 30.685 59.808  1.00 17.12 ? 311 GLY A O   1 
ATOM   2324 N  N   . GLU A 1 290 ? 53.822 31.119 57.823  1.00 16.95 ? 312 GLU A N   1 
ATOM   2325 C  CA  . GLU A 1 290 ? 55.144 31.426 58.375  1.00 18.17 ? 312 GLU A CA  1 
ATOM   2326 C  C   . GLU A 1 290 ? 55.122 32.641 59.318  1.00 19.08 ? 312 GLU A C   1 
ATOM   2327 O  O   . GLU A 1 290 ? 55.640 32.586 60.427  1.00 19.43 ? 312 GLU A O   1 
ATOM   2328 C  CB  . GLU A 1 290 ? 56.124 31.659 57.221  1.00 18.13 ? 312 GLU A CB  1 
ATOM   2329 C  CG  . GLU A 1 290 ? 57.472 32.156 57.647  1.00 17.21 ? 312 GLU A CG  1 
ATOM   2330 C  CD  . GLU A 1 290 ? 58.394 32.310 56.485  1.00 17.45 ? 312 GLU A CD  1 
ATOM   2331 O  OE1 . GLU A 1 290 ? 58.334 33.352 55.787  1.00 18.58 ? 312 GLU A OE1 1 
ATOM   2332 O  OE2 . GLU A 1 290 ? 59.179 31.386 56.266  1.00 17.62 ? 312 GLU A OE2 1 
ATOM   2333 N  N   . LEU A 1 291 ? 54.510 33.737 58.875  1.00 20.17 ? 313 LEU A N   1 
ATOM   2334 C  CA  . LEU A 1 291 ? 54.405 34.952 59.689  1.00 20.98 ? 313 LEU A CA  1 
ATOM   2335 C  C   . LEU A 1 291 ? 53.547 34.772 60.953  1.00 22.06 ? 313 LEU A C   1 
ATOM   2336 O  O   . LEU A 1 291 ? 53.796 35.410 61.972  1.00 21.95 ? 313 LEU A O   1 
ATOM   2337 C  CB  . LEU A 1 291 ? 53.851 36.103 58.837  1.00 20.94 ? 313 LEU A CB  1 
ATOM   2338 C  CG  . LEU A 1 291 ? 54.709 36.518 57.616  1.00 20.66 ? 313 LEU A CG  1 
ATOM   2339 C  CD1 . LEU A 1 291 ? 54.045 37.630 56.838  1.00 21.74 ? 313 LEU A CD1 1 
ATOM   2340 C  CD2 . LEU A 1 291 ? 56.140 36.931 58.022  1.00 19.85 ? 313 LEU A CD2 1 
ATOM   2341 N  N   . GLU A 1 292 ? 52.535 33.914 60.862  1.00 23.25 ? 314 GLU A N   1 
ATOM   2342 C  CA  . GLU A 1 292 ? 51.604 33.649 61.959  1.00 25.01 ? 314 GLU A CA  1 
ATOM   2343 C  C   . GLU A 1 292 ? 52.282 32.837 63.062  1.00 26.03 ? 314 GLU A C   1 
ATOM   2344 O  O   . GLU A 1 292 ? 52.154 33.166 64.238  1.00 26.46 ? 314 GLU A O   1 
ATOM   2345 C  CB  . GLU A 1 292 ? 50.362 32.912 61.423  1.00 24.57 ? 314 GLU A CB  1 
ATOM   2346 C  CG  . GLU A 1 292 ? 49.087 33.142 62.216  1.00 26.13 ? 314 GLU A CG  1 
ATOM   2347 C  CD  . GLU A 1 292 ? 48.665 34.602 62.261  1.00 26.38 ? 314 GLU A CD  1 
ATOM   2348 O  OE1 . GLU A 1 292 ? 48.454 35.104 63.369  1.00 27.12 ? 314 GLU A OE1 1 
ATOM   2349 O  OE2 . GLU A 1 292 ? 48.548 35.253 61.200  1.00 27.35 ? 314 GLU A OE2 1 
ATOM   2350 N  N   . SER A 1 293 ? 53.006 31.784 62.686  1.00 27.91 ? 315 SER A N   1 
ATOM   2351 C  CA  . SER A 1 293 ? 53.783 30.989 63.655  1.00 30.04 ? 315 SER A CA  1 
ATOM   2352 C  C   . SER A 1 293 ? 54.769 31.817 64.478  1.00 31.40 ? 315 SER A C   1 
ATOM   2353 O  O   . SER A 1 293 ? 54.939 31.583 65.680  1.00 31.42 ? 315 SER A O   1 
ATOM   2354 C  CB  . SER A 1 293 ? 54.501 29.831 62.969  1.00 30.06 ? 315 SER A CB  1 
ATOM   2355 O  OG  . SER A 1 293 ? 53.543 28.913 62.477  1.00 30.32 ? 315 SER A OG  1 
ATOM   2356 N  N   . ILE A 1 294 ? 55.391 32.795 63.828  1.00 32.71 ? 316 ILE A N   1 
ATOM   2357 C  CA  . ILE A 1 294 ? 56.263 33.747 64.498  1.00 34.34 ? 316 ILE A CA  1 
ATOM   2358 C  C   . ILE A 1 294 ? 55.478 34.683 65.431  1.00 35.58 ? 316 ILE A C   1 
ATOM   2359 O  O   . ILE A 1 294 ? 55.890 34.899 66.562  1.00 35.98 ? 316 ILE A O   1 
ATOM   2360 C  CB  . ILE A 1 294 ? 57.059 34.549 63.469  1.00 34.30 ? 316 ILE A CB  1 
ATOM   2361 C  CG1 . ILE A 1 294 ? 58.080 33.647 62.774  1.00 33.20 ? 316 ILE A CG1 1 
ATOM   2362 C  CG2 . ILE A 1 294 ? 57.721 35.764 64.106  1.00 35.48 ? 316 ILE A CG2 1 
ATOM   2363 C  CD1 . ILE A 1 294 ? 58.524 34.175 61.420  1.00 32.60 ? 316 ILE A CD1 1 
ATOM   2364 N  N   . LEU A 1 295 ? 54.348 35.209 64.952  1.00 37.05 ? 317 LEU A N   1 
ATOM   2365 C  CA  . LEU A 1 295 ? 53.476 36.123 65.705  1.00 38.75 ? 317 LEU A CA  1 
ATOM   2366 C  C   . LEU A 1 295 ? 52.971 35.487 67.000  1.00 39.90 ? 317 LEU A C   1 
ATOM   2367 O  O   . LEU A 1 295 ? 52.797 36.169 68.021  1.00 40.14 ? 317 LEU A O   1 
ATOM   2368 C  CB  . LEU A 1 295 ? 52.261 36.504 64.848  1.00 38.98 ? 317 LEU A CB  1 
ATOM   2369 C  CG  . LEU A 1 295 ? 51.655 37.914 64.745  1.00 39.54 ? 317 LEU A CG  1 
ATOM   2370 C  CD1 . LEU A 1 295 ? 50.124 37.809 64.817  1.00 40.66 ? 317 LEU A CD1 1 
ATOM   2371 C  CD2 . LEU A 1 295 ? 52.166 38.876 65.810  1.00 40.32 ? 317 LEU A CD2 1 
ATOM   2372 N  N   . TRP A 1 296 ? 52.711 34.181 66.924  1.00 40.79 ? 318 TRP A N   1 
ATOM   2373 C  CA  . TRP A 1 296 ? 52.327 33.356 68.060  1.00 42.05 ? 318 TRP A CA  1 
ATOM   2374 C  C   . TRP A 1 296 ? 53.562 32.853 68.831  1.00 42.68 ? 318 TRP A C   1 
ATOM   2375 O  O   . TRP A 1 296 ? 53.438 32.297 69.925  1.00 42.71 ? 318 TRP A O   1 
ATOM   2376 C  CB  . TRP A 1 296 ? 51.473 32.183 67.566  1.00 41.83 ? 318 TRP A CB  1 
ATOM   2377 C  CG  . TRP A 1 296 ? 50.058 32.577 67.224  1.00 42.75 ? 318 TRP A CG  1 
ATOM   2378 C  CD1 . TRP A 1 296 ? 49.575 32.963 65.997  1.00 42.74 ? 318 TRP A CD1 1 
ATOM   2379 C  CD2 . TRP A 1 296 ? 48.949 32.637 68.128  1.00 42.94 ? 318 TRP A CD2 1 
ATOM   2380 N  NE1 . TRP A 1 296 ? 48.230 33.246 66.086  1.00 43.01 ? 318 TRP A NE1 1 
ATOM   2381 C  CE2 . TRP A 1 296 ? 47.820 33.057 67.380  1.00 42.56 ? 318 TRP A CE2 1 
ATOM   2382 C  CE3 . TRP A 1 296 ? 48.796 32.376 69.498  1.00 42.40 ? 318 TRP A CE3 1 
ATOM   2383 C  CZ2 . TRP A 1 296 ? 46.556 33.225 67.959  1.00 42.22 ? 318 TRP A CZ2 1 
ATOM   2384 C  CZ3 . TRP A 1 296 ? 47.538 32.536 70.071  1.00 42.26 ? 318 TRP A CZ3 1 
ATOM   2385 C  CH2 . TRP A 1 296 ? 46.433 32.956 69.300  1.00 42.41 ? 318 TRP A CH2 1 
ATOM   2386 N  N   . GLN A 1 297 ? 54.735 33.058 68.228  1.00 43.84 ? 319 GLN A N   1 
ATOM   2387 C  CA  . GLN A 1 297 ? 56.076 32.834 68.818  1.00 44.62 ? 319 GLN A CA  1 
ATOM   2388 C  C   . GLN A 1 297 ? 56.451 31.368 69.021  1.00 44.99 ? 319 GLN A C   1 
ATOM   2389 O  O   . GLN A 1 297 ? 57.484 30.904 68.518  1.00 45.27 ? 319 GLN A O   1 
ATOM   2390 C  CB  . GLN A 1 297 ? 56.288 33.676 70.093  1.00 45.03 ? 319 GLN A CB  1 
ATOM   2391 C  CG  . GLN A 1 297 ? 56.312 35.193 69.829  1.00 46.27 ? 319 GLN A CG  1 
ATOM   2392 C  CD  . GLN A 1 297 ? 55.859 36.026 71.031  1.00 48.69 ? 319 GLN A CD  1 
ATOM   2393 O  OE1 . GLN A 1 297 ? 56.507 36.027 72.083  1.00 48.88 ? 319 GLN A OE1 1 
ATOM   2394 N  NE2 . GLN A 1 297 ? 54.752 36.753 70.868  1.00 48.20 ? 319 GLN A NE2 1 
ATOM   2395 N  N   . THR A 1 306 ? 55.625 50.114 69.462  1.00 52.80 ? 328 THR A N   1 
ATOM   2396 C  CA  . THR A 1 306 ? 55.305 48.949 68.631  1.00 52.78 ? 328 THR A CA  1 
ATOM   2397 C  C   . THR A 1 306 ? 56.534 48.455 67.857  1.00 52.24 ? 328 THR A C   1 
ATOM   2398 O  O   . THR A 1 306 ? 56.945 49.062 66.863  1.00 52.25 ? 328 THR A O   1 
ATOM   2399 C  CB  . THR A 1 306 ? 54.105 49.214 67.658  1.00 52.92 ? 328 THR A CB  1 
ATOM   2400 O  OG1 . THR A 1 306 ? 54.226 50.511 67.056  1.00 53.46 ? 328 THR A OG1 1 
ATOM   2401 C  CG2 . THR A 1 306 ? 52.773 49.129 68.399  1.00 53.38 ? 328 THR A CG2 1 
ATOM   2402 N  N   . THR A 1 307 ? 57.129 47.367 68.341  1.00 51.61 ? 329 THR A N   1 
ATOM   2403 C  CA  . THR A 1 307 ? 58.270 46.744 67.662  1.00 50.77 ? 329 THR A CA  1 
ATOM   2404 C  C   . THR A 1 307 ? 57.842 45.557 66.794  1.00 49.93 ? 329 THR A C   1 
ATOM   2405 O  O   . THR A 1 307 ? 56.756 44.990 66.963  1.00 49.94 ? 329 THR A O   1 
ATOM   2406 C  CB  . THR A 1 307 ? 59.397 46.305 68.643  1.00 50.83 ? 329 THR A CB  1 
ATOM   2407 O  OG1 . THR A 1 307 ? 58.827 45.760 69.843  1.00 51.26 ? 329 THR A OG1 1 
ATOM   2408 C  CG2 . THR A 1 307 ? 60.301 47.482 68.994  1.00 51.05 ? 329 THR A CG2 1 
ATOM   2409 N  N   . LEU A 1 308 ? 58.707 45.204 65.851  1.00 48.63 ? 330 LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 308 ? 58.475 44.067 64.978  1.00 47.35 ? 330 LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 308 ? 59.230 42.852 65.546  1.00 46.12 ? 330 LEU A C   1 
ATOM   2412 O  O   . LEU A 1 308 ? 60.426 42.955 65.839  1.00 45.88 ? 330 LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 308 ? 58.940 44.417 63.558  1.00 47.06 ? 330 LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 308 ? 58.578 43.582 62.320  1.00 47.82 ? 330 LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 308 ? 59.513 42.412 62.163  1.00 48.68 ? 330 LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 308 ? 57.123 43.135 62.294  1.00 47.95 ? 330 LEU A CD2 1 
ATOM   2417 N  N   . PRO A 1 309 ? 58.528 41.713 65.738  1.00 44.97 ? 331 PRO A N   1 
ATOM   2418 C  CA  . PRO A 1 309 ? 59.214 40.468 66.120  1.00 44.02 ? 331 PRO A CA  1 
ATOM   2419 C  C   . PRO A 1 309 ? 60.410 40.209 65.205  1.00 42.72 ? 331 PRO A C   1 
ATOM   2420 O  O   . PRO A 1 309 ? 60.228 40.004 63.998  1.00 42.50 ? 331 PRO A O   1 
ATOM   2421 C  CB  . PRO A 1 309 ? 58.143 39.379 65.921  1.00 44.16 ? 331 PRO A CB  1 
ATOM   2422 C  CG  . PRO A 1 309 ? 56.939 40.073 65.304  1.00 44.86 ? 331 PRO A CG  1 
ATOM   2423 C  CD  . PRO A 1 309 ? 57.070 41.526 65.629  1.00 45.08 ? 331 PRO A CD  1 
ATOM   2424 N  N   . GLN A 1 310 ? 61.614 40.228 65.780  1.00 41.19 ? 332 GLN A N   1 
ATOM   2425 C  CA  . GLN A 1 310 ? 62.864 40.133 65.010  1.00 39.94 ? 332 GLN A CA  1 
ATOM   2426 C  C   . GLN A 1 310 ? 62.911 38.948 64.066  1.00 38.37 ? 332 GLN A C   1 
ATOM   2427 O  O   . GLN A 1 310 ? 63.656 38.969 63.091  1.00 38.04 ? 332 GLN A O   1 
ATOM   2428 C  CB  . GLN A 1 310 ? 64.091 40.088 65.934  1.00 40.55 ? 332 GLN A CB  1 
ATOM   2429 C  CG  . GLN A 1 310 ? 64.873 41.394 66.014  1.00 41.67 ? 332 GLN A CG  1 
ATOM   2430 C  CD  . GLN A 1 310 ? 65.530 41.770 64.695  1.00 43.23 ? 332 GLN A CD  1 
ATOM   2431 O  OE1 . GLN A 1 310 ? 65.461 42.926 64.264  1.00 44.12 ? 332 GLN A OE1 1 
ATOM   2432 N  NE2 . GLN A 1 310 ? 66.165 40.794 64.042  1.00 42.80 ? 332 GLN A NE2 1 
ATOM   2433 N  N   . LYS A 1 311 ? 62.120 37.920 64.370  1.00 36.91 ? 333 LYS A N   1 
ATOM   2434 C  CA  . LYS A 1 311 ? 62.063 36.710 63.549  1.00 35.61 ? 333 LYS A CA  1 
ATOM   2435 C  C   . LYS A 1 311 ? 61.475 36.966 62.158  1.00 34.09 ? 333 LYS A C   1 
ATOM   2436 O  O   . LYS A 1 311 ? 61.840 36.281 61.200  1.00 34.07 ? 333 LYS A O   1 
ATOM   2437 C  CB  . LYS A 1 311 ? 61.272 35.608 64.252  1.00 35.69 ? 333 LYS A CB  1 
ATOM   2438 C  CG  . LYS A 1 311 ? 62.081 34.753 65.253  1.00 37.37 ? 333 LYS A CG  1 
ATOM   2439 C  CD  . LYS A 1 311 ? 61.156 33.808 66.044  1.00 37.65 ? 333 LYS A CD  1 
ATOM   2440 C  CE  . LYS A 1 311 ? 60.418 34.562 67.156  1.00 39.37 ? 333 LYS A CE  1 
ATOM   2441 N  NZ  . LYS A 1 311 ? 58.995 34.126 67.312  1.00 37.65 ? 333 LYS A NZ  1 
ATOM   2442 N  N   . VAL A 1 312 ? 60.568 37.940 62.051  1.00 32.20 ? 334 VAL A N   1 
ATOM   2443 C  CA  . VAL A 1 312 ? 59.988 38.308 60.755  1.00 30.50 ? 334 VAL A CA  1 
ATOM   2444 C  C   . VAL A 1 312 ? 61.104 38.744 59.828  1.00 29.83 ? 334 VAL A C   1 
ATOM   2445 O  O   . VAL A 1 312 ? 61.069 38.470 58.638  1.00 29.20 ? 334 VAL A O   1 
ATOM   2446 C  CB  . VAL A 1 312 ? 58.918 39.451 60.865  1.00 30.79 ? 334 VAL A CB  1 
ATOM   2447 C  CG1 . VAL A 1 312 ? 58.427 39.919 59.458  1.00 29.43 ? 334 VAL A CG1 1 
ATOM   2448 C  CG2 . VAL A 1 312 ? 57.748 39.012 61.716  1.00 28.97 ? 334 VAL A CG2 1 
ATOM   2449 N  N   . LEU A 1 313 ? 62.106 39.408 60.389  1.00 29.18 ? 335 LEU A N   1 
ATOM   2450 C  CA  . LEU A 1 313 ? 63.208 39.905 59.591  1.00 29.18 ? 335 LEU A CA  1 
ATOM   2451 C  C   . LEU A 1 313 ? 64.209 38.809 59.252  1.00 29.03 ? 335 LEU A C   1 
ATOM   2452 O  O   . LEU A 1 313 ? 64.563 38.636 58.077  1.00 29.72 ? 335 LEU A O   1 
ATOM   2453 C  CB  . LEU A 1 313 ? 63.890 41.077 60.305  1.00 29.28 ? 335 LEU A CB  1 
ATOM   2454 C  CG  . LEU A 1 313 ? 63.594 42.531 59.921  1.00 29.85 ? 335 LEU A CG  1 
ATOM   2455 C  CD1 . LEU A 1 313 ? 62.314 42.750 59.117  1.00 29.55 ? 335 LEU A CD1 1 
ATOM   2456 C  CD2 . LEU A 1 313 ? 63.640 43.403 61.166  1.00 31.18 ? 335 LEU A CD2 1 
ATOM   2457 N  N   . ASP A 1 314 ? 64.661 38.061 60.257  1.00 28.76 ? 336 ASP A N   1 
ATOM   2458 C  CA  . ASP A 1 314 ? 65.787 37.142 60.055  1.00 28.79 ? 336 ASP A CA  1 
ATOM   2459 C  C   . ASP A 1 314 ? 65.437 35.649 59.982  1.00 28.29 ? 336 ASP A C   1 
ATOM   2460 O  O   . ASP A 1 314 ? 66.300 34.815 59.694  1.00 28.67 ? 336 ASP A O   1 
ATOM   2461 C  CB  . ASP A 1 314 ? 66.930 37.414 61.063  1.00 29.02 ? 336 ASP A CB  1 
ATOM   2462 C  CG  . ASP A 1 314 ? 66.487 37.315 62.532  1.00 31.43 ? 336 ASP A CG  1 
ATOM   2463 O  OD1 . ASP A 1 314 ? 65.772 36.353 62.911  1.00 31.81 ? 336 ASP A OD1 1 
ATOM   2464 O  OD2 . ASP A 1 314 ? 66.897 38.204 63.329  1.00 34.59 ? 336 ASP A OD2 1 
ATOM   2465 N  N   . SER A 1 315 ? 64.184 35.306 60.237  1.00 27.20 ? 337 SER A N   1 
ATOM   2466 C  CA  . SER A 1 315 ? 63.774 33.920 60.172  1.00 26.55 ? 337 SER A CA  1 
ATOM   2467 C  C   . SER A 1 315 ? 62.489 33.742 59.368  1.00 25.30 ? 337 SER A C   1 
ATOM   2468 O  O   . SER A 1 315 ? 61.519 33.154 59.850  1.00 24.88 ? 337 SER A O   1 
ATOM   2469 C  CB  . SER A 1 315 ? 63.642 33.340 61.588  1.00 27.78 ? 337 SER A CB  1 
ATOM   2470 O  OG  . SER A 1 315 ? 64.922 33.284 62.223  1.00 30.39 ? 337 SER A OG  1 
ATOM   2471 N  N   . THR A 1 316 ? 62.494 34.238 58.128  1.00 23.77 ? 338 THR A N   1 
ATOM   2472 C  CA  . THR A 1 316 ? 61.343 34.078 57.226  1.00 21.81 ? 338 THR A CA  1 
ATOM   2473 C  C   . THR A 1 316 ? 61.770 33.472 55.898  1.00 20.37 ? 338 THR A C   1 
ATOM   2474 O  O   . THR A 1 316 ? 61.734 34.149 54.867  1.00 19.94 ? 338 THR A O   1 
ATOM   2475 C  CB  . THR A 1 316 ? 60.610 35.423 56.992  1.00 22.14 ? 338 THR A CB  1 
ATOM   2476 O  OG1 . THR A 1 316 ? 61.566 36.470 56.773  1.00 22.80 ? 338 THR A OG1 1 
ATOM   2477 C  CG2 . THR A 1 316 ? 59.758 35.774 58.192  1.00 21.67 ? 338 THR A CG2 1 
ATOM   2478 N  N   . PRO A 1 317 ? 62.212 32.196 55.913  1.00 19.30 ? 339 PRO A N   1 
ATOM   2479 C  CA  . PRO A 1 317 ? 62.681 31.531 54.684  1.00 18.35 ? 339 PRO A CA  1 
ATOM   2480 C  C   . PRO A 1 317 ? 61.667 31.504 53.514  1.00 17.31 ? 339 PRO A C   1 
ATOM   2481 O  O   . PRO A 1 317 ? 62.071 31.688 52.377  1.00 16.97 ? 339 PRO A O   1 
ATOM   2482 C  CB  . PRO A 1 317 ? 63.023 30.112 55.147  1.00 18.46 ? 339 PRO A CB  1 
ATOM   2483 C  CG  . PRO A 1 317 ? 62.508 29.975 56.489  1.00 18.92 ? 339 PRO A CG  1 
ATOM   2484 C  CD  . PRO A 1 317 ? 62.348 31.322 57.085  1.00 19.34 ? 339 PRO A CD  1 
ATOM   2485 N  N   . VAL A 1 318 ? 60.378 31.287 53.793  1.00 16.01 ? 340 VAL A N   1 
ATOM   2486 C  CA  . VAL A 1 318 ? 59.353 31.259 52.737  1.00 15.19 ? 340 VAL A CA  1 
ATOM   2487 C  C   . VAL A 1 318 ? 59.227 32.654 52.138  1.00 14.47 ? 340 VAL A C   1 
ATOM   2488 O  O   . VAL A 1 318 ? 59.278 32.822 50.938  1.00 14.38 ? 340 VAL A O   1 
ATOM   2489 C  CB  . VAL A 1 318 ? 57.954 30.776 53.246  1.00 15.65 ? 340 VAL A CB  1 
ATOM   2490 C  CG1 . VAL A 1 318 ? 56.856 30.932 52.131  1.00 13.96 ? 340 VAL A CG1 1 
ATOM   2491 C  CG2 . VAL A 1 318 ? 58.024 29.351 53.718  1.00 14.89 ? 340 VAL A CG2 1 
ATOM   2492 N  N   . LEU A 1 319 ? 59.085 33.658 52.987  1.00 14.75 ? 341 LEU A N   1 
ATOM   2493 C  CA  . LEU A 1 319 ? 59.055 35.033 52.504  1.00 14.75 ? 341 LEU A CA  1 
ATOM   2494 C  C   . LEU A 1 319 ? 60.315 35.405 51.718  1.00 14.86 ? 341 LEU A C   1 
ATOM   2495 O  O   . LEU A 1 319 ? 60.215 36.163 50.738  1.00 15.42 ? 341 LEU A O   1 
ATOM   2496 C  CB  . LEU A 1 319 ? 58.789 36.023 53.648  1.00 14.10 ? 341 LEU A CB  1 
ATOM   2497 C  CG  . LEU A 1 319 ? 58.603 37.518 53.341  1.00 14.54 ? 341 LEU A CG  1 
ATOM   2498 C  CD1 . LEU A 1 319 ? 57.632 37.822 52.173  1.00 13.73 ? 341 LEU A CD1 1 
ATOM   2499 C  CD2 . LEU A 1 319 ? 58.202 38.271 54.594  1.00 12.08 ? 341 LEU A CD2 1 
ATOM   2500 N  N   . ASP A 1 320 ? 61.488 34.888 52.117  1.00 14.27 ? 342 ASP A N   1 
ATOM   2501 C  CA  . ASP A 1 320 ? 62.742 35.202 51.394  1.00 14.32 ? 342 ASP A CA  1 
ATOM   2502 C  C   . ASP A 1 320 ? 62.706 34.695 49.956  1.00 13.96 ? 342 ASP A C   1 
ATOM   2503 O  O   . ASP A 1 320 ? 63.168 35.367 49.025  1.00 13.40 ? 342 ASP A O   1 
ATOM   2504 C  CB  . ASP A 1 320 ? 63.966 34.601 52.088  1.00 15.20 ? 342 ASP A CB  1 
ATOM   2505 C  CG  . ASP A 1 320 ? 64.360 35.347 53.332  1.00 16.56 ? 342 ASP A CG  1 
ATOM   2506 O  OD1 . ASP A 1 320 ? 64.050 36.544 53.460  1.00 20.20 ? 342 ASP A OD1 1 
ATOM   2507 O  OD2 . ASP A 1 320 ? 64.992 34.725 54.193  1.00 20.71 ? 342 ASP A OD2 1 
ATOM   2508 N  N   . SER A 1 321 ? 62.161 33.490 49.805  1.00 13.62 ? 343 SER A N   1 
ATOM   2509 C  CA  . SER A 1 321 ? 61.988 32.841 48.524  1.00 13.16 ? 343 SER A CA  1 
ATOM   2510 C  C   . SER A 1 321 ? 60.926 33.562 47.681  1.00 13.19 ? 343 SER A C   1 
ATOM   2511 O  O   . SER A 1 321 ? 61.095 33.723 46.466  1.00 13.93 ? 343 SER A O   1 
ATOM   2512 C  CB  . SER A 1 321 ? 61.581 31.391 48.757  1.00 12.62 ? 343 SER A CB  1 
ATOM   2513 O  OG  . SER A 1 321 ? 61.191 30.788 47.548  1.00 14.17 ? 343 SER A OG  1 
ATOM   2514 N  N   . VAL A 1 322 ? 59.832 33.978 48.317  1.00 13.19 ? 344 VAL A N   1 
ATOM   2515 C  CA  . VAL A 1 322 ? 58.793 34.761 47.628  1.00 13.09 ? 344 VAL A CA  1 
ATOM   2516 C  C   . VAL A 1 322 ? 59.354 36.072 47.046  1.00 12.92 ? 344 VAL A C   1 
ATOM   2517 O  O   . VAL A 1 322 ? 59.072 36.399 45.902  1.00 12.65 ? 344 VAL A O   1 
ATOM   2518 C  CB  . VAL A 1 322 ? 57.543 34.993 48.533  1.00 14.25 ? 344 VAL A CB  1 
ATOM   2519 C  CG1 . VAL A 1 322 ? 56.602 36.085 47.956  1.00 13.52 ? 344 VAL A CG1 1 
ATOM   2520 C  CG2 . VAL A 1 322 ? 56.801 33.659 48.736  1.00 12.68 ? 344 VAL A CG2 1 
ATOM   2521 N  N   . LEU A 1 323 ? 60.167 36.788 47.830  1.00 12.75 ? 345 LEU A N   1 
ATOM   2522 C  CA  . LEU A 1 323 ? 60.810 38.011 47.392  1.00 13.03 ? 345 LEU A CA  1 
ATOM   2523 C  C   . LEU A 1 323 ? 61.843 37.764 46.277  1.00 13.51 ? 345 LEU A C   1 
ATOM   2524 O  O   . LEU A 1 323 ? 61.820 38.450 45.258  1.00 13.48 ? 345 LEU A O   1 
ATOM   2525 C  CB  . LEU A 1 323 ? 61.456 38.736 48.587  1.00 13.08 ? 345 LEU A CB  1 
ATOM   2526 C  CG  . LEU A 1 323 ? 62.166 40.073 48.298  1.00 13.30 ? 345 LEU A CG  1 
ATOM   2527 C  CD1 . LEU A 1 323 ? 61.249 41.126 47.587  1.00 11.16 ? 345 LEU A CD1 1 
ATOM   2528 C  CD2 . LEU A 1 323 ? 62.847 40.665 49.563  1.00 14.14 ? 345 LEU A CD2 1 
ATOM   2529 N  N   . SER A 1 324 ? 62.727 36.778 46.468  1.00 13.04 ? 346 SER A N   1 
ATOM   2530 C  CA  . SER A 1 324 ? 63.660 36.355 45.413  1.00 13.67 ? 346 SER A CA  1 
ATOM   2531 C  C   . SER A 1 324 ? 62.925 36.041 44.099  1.00 13.72 ? 346 SER A C   1 
ATOM   2532 O  O   . SER A 1 324 ? 63.390 36.437 43.037  1.00 14.57 ? 346 SER A O   1 
ATOM   2533 C  CB  . SER A 1 324 ? 64.452 35.111 45.836  1.00 13.35 ? 346 SER A CB  1 
ATOM   2534 O  OG  . SER A 1 324 ? 65.320 35.380 46.902  1.00 13.66 ? 346 SER A OG  1 
ATOM   2535 N  N   . GLU A 1 325 ? 61.788 35.348 44.180  1.00 13.62 ? 347 GLU A N   1 
ATOM   2536 C  CA  . GLU A 1 325 ? 61.055 34.880 42.979  1.00 13.52 ? 347 GLU A CA  1 
ATOM   2537 C  C   . GLU A 1 325 ? 60.356 36.031 42.292  1.00 13.64 ? 347 GLU A C   1 
ATOM   2538 O  O   . GLU A 1 325 ? 60.446 36.213 41.073  1.00 13.05 ? 347 GLU A O   1 
ATOM   2539 C  CB  . GLU A 1 325 ? 60.043 33.768 43.343  1.00 14.48 ? 347 GLU A CB  1 
ATOM   2540 C  CG  . GLU A 1 325 ? 59.108 33.281 42.175  1.00 13.81 ? 347 GLU A CG  1 
ATOM   2541 C  CD  . GLU A 1 325 ? 59.844 32.481 41.101  1.00 15.57 ? 347 GLU A CD  1 
ATOM   2542 O  OE1 . GLU A 1 325 ? 61.081 32.504 41.098  1.00 20.24 ? 347 GLU A OE1 1 
ATOM   2543 O  OE2 . GLU A 1 325 ? 59.214 31.811 40.264  1.00 14.13 ? 347 GLU A OE2 1 
ATOM   2544 N  N   . SER A 1 326 ? 59.679 36.831 43.101  1.00 13.67 ? 348 SER A N   1 
ATOM   2545 C  CA  . SER A 1 326 ? 59.100 38.090 42.651  1.00 14.01 ? 348 SER A CA  1 
ATOM   2546 C  C   . SER A 1 326 ? 60.094 38.974 41.900  1.00 13.32 ? 348 SER A C   1 
ATOM   2547 O  O   . SER A 1 326 ? 59.766 39.513 40.841  1.00 12.67 ? 348 SER A O   1 
ATOM   2548 C  CB  . SER A 1 326 ? 58.573 38.843 43.862  1.00 13.93 ? 348 SER A CB  1 
ATOM   2549 O  OG  . SER A 1 326 ? 57.444 39.563 43.479  1.00 19.47 ? 348 SER A OG  1 
ATOM   2550 N  N   . LEU A 1 327 ? 61.312 39.111 42.450  1.00 13.00 ? 349 LEU A N   1 
ATOM   2551 C  CA  . LEU A 1 327 ? 62.358 39.985 41.882  1.00 12.16 ? 349 LEU A CA  1 
ATOM   2552 C  C   . LEU A 1 327 ? 62.994 39.368 40.654  1.00 12.24 ? 349 LEU A C   1 
ATOM   2553 O  O   . LEU A 1 327 ? 63.378 40.078 39.710  1.00 11.71 ? 349 LEU A O   1 
ATOM   2554 C  CB  . LEU A 1 327 ? 63.434 40.321 42.925  1.00 12.01 ? 349 LEU A CB  1 
ATOM   2555 C  CG  . LEU A 1 327 ? 63.048 41.253 44.093  1.00 11.62 ? 349 LEU A CG  1 
ATOM   2556 C  CD1 . LEU A 1 327 ? 64.132 41.281 45.141  1.00 13.33 ? 349 LEU A CD1 1 
ATOM   2557 C  CD2 . LEU A 1 327 ? 62.760 42.692 43.628  1.00 8.63  ? 349 LEU A CD2 1 
ATOM   2558 N  N   . ARG A 1 328 ? 63.084 38.040 40.660  1.00 12.05 ? 350 ARG A N   1 
ATOM   2559 C  CA  . ARG A 1 328 ? 63.551 37.281 39.495  1.00 12.49 ? 350 ARG A CA  1 
ATOM   2560 C  C   . ARG A 1 328 ? 62.750 37.659 38.243  1.00 12.81 ? 350 ARG A C   1 
ATOM   2561 O  O   . ARG A 1 328 ? 63.306 37.864 37.155  1.00 12.99 ? 350 ARG A O   1 
ATOM   2562 C  CB  . ARG A 1 328 ? 63.428 35.768 39.749  1.00 11.67 ? 350 ARG A CB  1 
ATOM   2563 C  CG  . ARG A 1 328 ? 64.041 34.929 38.623  1.00 12.80 ? 350 ARG A CG  1 
ATOM   2564 C  CD  . ARG A 1 328 ? 63.780 33.447 38.801  1.00 11.69 ? 350 ARG A CD  1 
ATOM   2565 N  NE  . ARG A 1 328 ? 62.359 33.122 38.726  1.00 9.62  ? 350 ARG A NE  1 
ATOM   2566 C  CZ  . ARG A 1 328 ? 61.682 32.910 37.599  1.00 10.80 ? 350 ARG A CZ  1 
ATOM   2567 N  NH1 . ARG A 1 328 ? 62.284 33.000 36.410  1.00 13.23 ? 350 ARG A NH1 1 
ATOM   2568 N  NH2 . ARG A 1 328 ? 60.397 32.603 37.660  1.00 8.07  ? 350 ARG A NH2 1 
ATOM   2569 N  N   . LEU A 1 329 ? 61.444 37.792 38.439  1.00 13.17 ? 351 LEU A N   1 
ATOM   2570 C  CA  . LEU A 1 329 ? 60.479 38.018 37.365  1.00 13.09 ? 351 LEU A CA  1 
ATOM   2571 C  C   . LEU A 1 329 ? 60.265 39.484 36.935  1.00 13.18 ? 351 LEU A C   1 
ATOM   2572 O  O   . LEU A 1 329 ? 59.780 39.737 35.819  1.00 14.46 ? 351 LEU A O   1 
ATOM   2573 C  CB  . LEU A 1 329 ? 59.130 37.430 37.809  1.00 12.37 ? 351 LEU A CB  1 
ATOM   2574 C  CG  . LEU A 1 329 ? 58.967 35.915 37.810  1.00 12.52 ? 351 LEU A CG  1 
ATOM   2575 C  CD1 . LEU A 1 329 ? 57.764 35.563 38.663  1.00 12.39 ? 351 LEU A CD1 1 
ATOM   2576 C  CD2 . LEU A 1 329 ? 58.834 35.399 36.394  1.00 10.02 ? 351 LEU A CD2 1 
ATOM   2577 N  N   . THR A 1 330 ? 60.570 40.429 37.823  1.00 13.34 ? 352 THR A N   1 
ATOM   2578 C  CA  . THR A 1 330 ? 60.184 41.849 37.659  1.00 12.99 ? 352 THR A CA  1 
ATOM   2579 C  C   . THR A 1 330 ? 61.307 42.892 37.784  1.00 13.32 ? 352 THR A C   1 
ATOM   2580 O  O   . THR A 1 330 ? 61.099 44.062 37.470  1.00 13.94 ? 352 THR A O   1 
ATOM   2581 C  CB  . THR A 1 330 ? 59.028 42.236 38.619  1.00 13.12 ? 352 THR A CB  1 
ATOM   2582 O  OG1 . THR A 1 330 ? 59.451 42.065 39.975  1.00 13.26 ? 352 THR A OG1 1 
ATOM   2583 C  CG2 . THR A 1 330 ? 57.787 41.353 38.358  1.00 11.54 ? 352 THR A CG2 1 
ATOM   2584 N  N   . ALA A 1 331 ? 62.488 42.490 38.231  1.00 12.79 ? 353 ALA A N   1 
ATOM   2585 C  CA  . ALA A 1 331 ? 63.629 43.418 38.281  1.00 12.89 ? 353 ALA A CA  1 
ATOM   2586 C  C   . ALA A 1 331 ? 64.476 43.312 37.002  1.00 13.45 ? 353 ALA A C   1 
ATOM   2587 O  O   . ALA A 1 331 ? 65.063 42.262 36.737  1.00 13.36 ? 353 ALA A O   1 
ATOM   2588 C  CB  . ALA A 1 331 ? 64.488 43.151 39.502  1.00 11.76 ? 353 ALA A CB  1 
ATOM   2589 N  N   . ALA A 1 332 ? 64.528 44.398 36.227  1.00 13.37 ? 354 ALA A N   1 
ATOM   2590 C  CA  . ALA A 1 332 ? 65.180 44.394 34.906  1.00 14.16 ? 354 ALA A CA  1 
ATOM   2591 C  C   . ALA A 1 332 ? 66.155 45.564 34.684  1.00 14.30 ? 354 ALA A C   1 
ATOM   2592 O  O   . ALA A 1 332 ? 65.998 46.307 33.717  1.00 13.28 ? 354 ALA A O   1 
ATOM   2593 C  CB  . ALA A 1 332 ? 64.119 44.388 33.804  1.00 12.65 ? 354 ALA A CB  1 
ATOM   2594 N  N   . PRO A 1 333 ? 67.119 45.764 35.606  1.00 15.17 ? 355 PRO A N   1 
ATOM   2595 C  CA  . PRO A 1 333 ? 68.118 46.804 35.356  1.00 15.94 ? 355 PRO A CA  1 
ATOM   2596 C  C   . PRO A 1 333 ? 69.181 46.360 34.324  1.00 16.81 ? 355 PRO A C   1 
ATOM   2597 O  O   . PRO A 1 333 ? 69.447 45.155 34.173  1.00 17.06 ? 355 PRO A O   1 
ATOM   2598 C  CB  . PRO A 1 333 ? 68.772 46.967 36.722  1.00 15.96 ? 355 PRO A CB  1 
ATOM   2599 C  CG  . PRO A 1 333 ? 68.668 45.598 37.339  1.00 15.22 ? 355 PRO A CG  1 
ATOM   2600 C  CD  . PRO A 1 333 ? 67.346 45.089 36.902  1.00 15.06 ? 355 PRO A CD  1 
ATOM   2601 N  N   . PHE A 1 334 ? 69.765 47.342 33.634  1.00 17.77 ? 356 PHE A N   1 
ATOM   2602 C  CA  . PHE A 1 334 ? 70.906 47.138 32.747  1.00 18.43 ? 356 PHE A CA  1 
ATOM   2603 C  C   . PHE A 1 334 ? 72.186 47.225 33.565  1.00 19.74 ? 356 PHE A C   1 
ATOM   2604 O  O   . PHE A 1 334 ? 72.309 48.093 34.439  1.00 19.98 ? 356 PHE A O   1 
ATOM   2605 C  CB  . PHE A 1 334 ? 70.961 48.232 31.672  1.00 17.79 ? 356 PHE A CB  1 
ATOM   2606 C  CG  . PHE A 1 334 ? 69.875 48.145 30.619  1.00 17.16 ? 356 PHE A CG  1 
ATOM   2607 C  CD1 . PHE A 1 334 ? 69.223 46.940 30.335  1.00 17.84 ? 356 PHE A CD1 1 
ATOM   2608 C  CD2 . PHE A 1 334 ? 69.545 49.268 29.885  1.00 15.72 ? 356 PHE A CD2 1 
ATOM   2609 C  CE1 . PHE A 1 334 ? 68.225 46.873 29.346  1.00 18.95 ? 356 PHE A CE1 1 
ATOM   2610 C  CE2 . PHE A 1 334 ? 68.561 49.219 28.873  1.00 19.10 ? 356 PHE A CE2 1 
ATOM   2611 C  CZ  . PHE A 1 334 ? 67.900 48.019 28.605  1.00 18.95 ? 356 PHE A CZ  1 
ATOM   2612 N  N   . ILE A 1 335 ? 73.132 46.326 33.295  1.00 20.82 ? 357 ILE A N   1 
ATOM   2613 C  CA  . ILE A 1 335 ? 74.502 46.488 33.783  1.00 22.19 ? 357 ILE A CA  1 
ATOM   2614 C  C   . ILE A 1 335 ? 75.311 46.951 32.578  1.00 23.52 ? 357 ILE A C   1 
ATOM   2615 O  O   . ILE A 1 335 ? 75.439 46.229 31.585  1.00 23.38 ? 357 ILE A O   1 
ATOM   2616 C  CB  . ILE A 1 335 ? 75.069 45.201 34.399  1.00 22.37 ? 357 ILE A CB  1 
ATOM   2617 C  CG1 . ILE A 1 335 ? 74.216 44.795 35.614  1.00 21.96 ? 357 ILE A CG1 1 
ATOM   2618 C  CG2 . ILE A 1 335 ? 76.524 45.416 34.860  1.00 22.21 ? 357 ILE A CG2 1 
ATOM   2619 C  CD1 . ILE A 1 335 ? 74.403 43.396 36.052  1.00 24.59 ? 357 ILE A CD1 1 
ATOM   2620 N  N   . THR A 1 336 ? 75.808 48.177 32.650  1.00 24.33 ? 358 THR A N   1 
ATOM   2621 C  CA  . THR A 1 336 ? 76.262 48.892 31.460  1.00 25.82 ? 358 THR A CA  1 
ATOM   2622 C  C   . THR A 1 336 ? 77.655 49.463 31.725  1.00 26.40 ? 358 THR A C   1 
ATOM   2623 O  O   . THR A 1 336 ? 77.905 50.042 32.787  1.00 25.93 ? 358 THR A O   1 
ATOM   2624 C  CB  . THR A 1 336 ? 75.235 50.016 31.112  1.00 25.90 ? 358 THR A CB  1 
ATOM   2625 O  OG1 . THR A 1 336 ? 74.021 49.424 30.619  1.00 26.66 ? 358 THR A OG1 1 
ATOM   2626 C  CG2 . THR A 1 336 ? 75.755 50.975 30.085  1.00 26.79 ? 358 THR A CG2 1 
ATOM   2627 N  N   . ARG A 1 337 ? 78.563 49.268 30.771  1.00 27.17 ? 359 ARG A N   1 
ATOM   2628 C  CA  . ARG A 1 337 ? 79.946 49.746 30.901  1.00 27.64 ? 359 ARG A CA  1 
ATOM   2629 C  C   . ARG A 1 337 ? 80.436 50.427 29.623  1.00 28.01 ? 359 ARG A C   1 
ATOM   2630 O  O   . ARG A 1 337 ? 80.141 49.984 28.528  1.00 28.14 ? 359 ARG A O   1 
ATOM   2631 C  CB  . ARG A 1 337 ? 80.887 48.590 31.259  1.00 27.70 ? 359 ARG A CB  1 
ATOM   2632 C  CG  . ARG A 1 337 ? 80.643 47.932 32.622  1.00 27.67 ? 359 ARG A CG  1 
ATOM   2633 C  CD  . ARG A 1 337 ? 80.819 48.909 33.784  1.00 26.05 ? 359 ARG A CD  1 
ATOM   2634 N  NE  . ARG A 1 337 ? 80.889 48.206 35.063  1.00 24.77 ? 359 ARG A NE  1 
ATOM   2635 C  CZ  . ARG A 1 337 ? 79.851 47.916 35.844  1.00 25.87 ? 359 ARG A CZ  1 
ATOM   2636 N  NH1 . ARG A 1 337 ? 78.618 48.282 35.505  1.00 24.70 ? 359 ARG A NH1 1 
ATOM   2637 N  NH2 . ARG A 1 337 ? 80.050 47.270 36.990  1.00 25.43 ? 359 ARG A NH2 1 
ATOM   2638 N  N   . GLU A 1 338 ? 81.160 51.526 29.774  1.00 28.73 ? 360 GLU A N   1 
ATOM   2639 C  CA  . GLU A 1 338 ? 81.869 52.120 28.644  1.00 29.88 ? 360 GLU A CA  1 
ATOM   2640 C  C   . GLU A 1 338 ? 83.245 51.473 28.566  1.00 30.01 ? 360 GLU A C   1 
ATOM   2641 O  O   . GLU A 1 338 ? 83.978 51.418 29.565  1.00 30.04 ? 360 GLU A O   1 
ATOM   2642 C  CB  . GLU A 1 338 ? 82.013 53.643 28.797  1.00 29.64 ? 360 GLU A CB  1 
ATOM   2643 C  CG  . GLU A 1 338 ? 80.698 54.417 28.978  1.00 32.14 ? 360 GLU A CG  1 
ATOM   2644 C  CD  . GLU A 1 338 ? 79.671 54.146 27.893  1.00 34.16 ? 360 GLU A CD  1 
ATOM   2645 O  OE1 . GLU A 1 338 ? 79.973 54.375 26.706  1.00 36.71 ? 360 GLU A OE1 1 
ATOM   2646 O  OE2 . GLU A 1 338 ? 78.551 53.704 28.228  1.00 35.64 ? 360 GLU A OE2 1 
ATOM   2647 N  N   . VAL A 1 339 ? 83.571 50.959 27.388  1.00 30.98 ? 361 VAL A N   1 
ATOM   2648 C  CA  . VAL A 1 339 ? 84.890 50.386 27.115  1.00 31.73 ? 361 VAL A CA  1 
ATOM   2649 C  C   . VAL A 1 339 ? 85.896 51.531 26.966  1.00 32.29 ? 361 VAL A C   1 
ATOM   2650 O  O   . VAL A 1 339 ? 85.885 52.248 25.968  1.00 31.99 ? 361 VAL A O   1 
ATOM   2651 C  CB  . VAL A 1 339 ? 84.873 49.471 25.862  1.00 31.70 ? 361 VAL A CB  1 
ATOM   2652 C  CG1 . VAL A 1 339 ? 86.225 48.763 25.680  1.00 30.61 ? 361 VAL A CG1 1 
ATOM   2653 C  CG2 . VAL A 1 339 ? 83.737 48.428 25.970  1.00 32.58 ? 361 VAL A CG2 1 
ATOM   2654 N  N   . VAL A 1 340 ? 86.726 51.700 27.994  1.00 33.69 ? 362 VAL A N   1 
ATOM   2655 C  CA  . VAL A 1 340 ? 87.678 52.811 28.104  1.00 35.20 ? 362 VAL A CA  1 
ATOM   2656 C  C   . VAL A 1 340 ? 88.980 52.528 27.331  1.00 36.34 ? 362 VAL A C   1 
ATOM   2657 O  O   . VAL A 1 340 ? 89.570 53.442 26.754  1.00 36.62 ? 362 VAL A O   1 
ATOM   2658 C  CB  . VAL A 1 340 ? 87.980 53.136 29.600  1.00 35.47 ? 362 VAL A CB  1 
ATOM   2659 C  CG1 . VAL A 1 340 ? 89.137 54.131 29.756  1.00 36.31 ? 362 VAL A CG1 1 
ATOM   2660 C  CG2 . VAL A 1 340 ? 86.726 53.656 30.306  1.00 35.61 ? 362 VAL A CG2 1 
ATOM   2661 N  N   . VAL A 1 341 ? 89.415 51.266 27.317  1.00 37.42 ? 363 VAL A N   1 
ATOM   2662 C  CA  . VAL A 1 341 ? 90.648 50.867 26.614  1.00 38.72 ? 363 VAL A CA  1 
ATOM   2663 C  C   . VAL A 1 341 ? 90.487 49.494 25.970  1.00 39.04 ? 363 VAL A C   1 
ATOM   2664 O  O   . VAL A 1 341 ? 89.778 48.637 26.507  1.00 39.18 ? 363 VAL A O   1 
ATOM   2665 C  CB  . VAL A 1 341 ? 91.884 50.900 27.549  1.00 38.66 ? 363 VAL A CB  1 
ATOM   2666 C  CG1 . VAL A 1 341 ? 92.083 49.557 28.282  1.00 38.79 ? 363 VAL A CG1 1 
ATOM   2667 C  CG2 . VAL A 1 341 ? 93.134 51.281 26.757  1.00 40.41 ? 363 VAL A CG2 1 
ATOM   2668 N  N   . ASP A 1 342 ? 91.125 49.297 24.815  1.00 39.80 ? 364 ASP A N   1 
ATOM   2669 C  CA  . ASP A 1 342 ? 91.036 48.028 24.089  1.00 39.87 ? 364 ASP A CA  1 
ATOM   2670 C  C   . ASP A 1 342 ? 91.440 46.915 25.028  1.00 39.98 ? 364 ASP A C   1 
ATOM   2671 O  O   . ASP A 1 342 ? 92.504 46.976 25.647  1.00 40.04 ? 364 ASP A O   1 
ATOM   2672 C  CB  . ASP A 1 342 ? 91.943 48.022 22.861  1.00 40.11 ? 364 ASP A CB  1 
ATOM   2673 C  CG  . ASP A 1 342 ? 91.298 48.662 21.651  1.00 41.46 ? 364 ASP A CG  1 
ATOM   2674 O  OD1 . ASP A 1 342 ? 90.185 49.219 21.767  1.00 43.28 ? 364 ASP A OD1 1 
ATOM   2675 O  OD2 . ASP A 1 342 ? 91.906 48.608 20.564  1.00 42.38 ? 364 ASP A OD2 1 
ATOM   2676 N  N   . LEU A 1 343 ? 90.584 45.903 25.150  1.00 39.92 ? 365 LEU A N   1 
ATOM   2677 C  CA  . LEU A 1 343 ? 90.808 44.870 26.151  1.00 39.55 ? 365 LEU A CA  1 
ATOM   2678 C  C   . LEU A 1 343 ? 90.327 43.486 25.713  1.00 39.36 ? 365 LEU A C   1 
ATOM   2679 O  O   . LEU A 1 343 ? 89.584 43.342 24.729  1.00 38.59 ? 365 LEU A O   1 
ATOM   2680 C  CB  . LEU A 1 343 ? 90.191 45.303 27.495  1.00 39.54 ? 365 LEU A CB  1 
ATOM   2681 C  CG  . LEU A 1 343 ? 88.672 45.519 27.534  1.00 39.44 ? 365 LEU A CG  1 
ATOM   2682 C  CD1 . LEU A 1 343 ? 87.976 44.237 28.001  1.00 39.22 ? 365 LEU A CD1 1 
ATOM   2683 C  CD2 . LEU A 1 343 ? 88.327 46.666 28.451  1.00 40.06 ? 365 LEU A CD2 1 
ATOM   2684 N  N   . ALA A 1 344 ? 90.784 42.479 26.452  1.00 39.56 ? 366 ALA A N   1 
ATOM   2685 C  CA  . ALA A 1 344 ? 90.447 41.082 26.192  1.00 40.24 ? 366 ALA A CA  1 
ATOM   2686 C  C   . ALA A 1 344 ? 89.551 40.577 27.300  1.00 40.27 ? 366 ALA A C   1 
ATOM   2687 O  O   . ALA A 1 344 ? 89.847 40.771 28.477  1.00 40.91 ? 366 ALA A O   1 
ATOM   2688 C  CB  . ALA A 1 344 ? 91.709 40.238 26.113  1.00 40.13 ? 366 ALA A CB  1 
ATOM   2689 N  N   . MET A 1 345 ? 88.465 39.914 26.925  1.00 40.40 ? 367 MET A N   1 
ATOM   2690 C  CA  . MET A 1 345 ? 87.465 39.476 27.901  1.00 40.27 ? 367 MET A CA  1 
ATOM   2691 C  C   . MET A 1 345 ? 87.369 37.961 27.960  1.00 40.30 ? 367 MET A C   1 
ATOM   2692 O  O   . MET A 1 345 ? 86.892 37.331 27.015  1.00 40.12 ? 367 MET A O   1 
ATOM   2693 C  CB  . MET A 1 345 ? 86.098 40.069 27.563  1.00 40.43 ? 367 MET A CB  1 
ATOM   2694 C  CG  . MET A 1 345 ? 85.049 39.922 28.673  1.00 39.40 ? 367 MET A CG  1 
ATOM   2695 S  SD  . MET A 1 345 ? 83.453 40.433 28.049  1.00 36.08 ? 367 MET A SD  1 
ATOM   2696 C  CE  . MET A 1 345 ? 83.164 39.143 26.861  1.00 38.16 ? 367 MET A CE  1 
ATOM   2697 N  N   . PRO A 1 346 ? 87.783 37.369 29.091  1.00 40.52 ? 368 PRO A N   1 
ATOM   2698 C  CA  . PRO A 1 346 ? 87.780 35.911 29.152  1.00 40.73 ? 368 PRO A CA  1 
ATOM   2699 C  C   . PRO A 1 346 ? 86.378 35.366 29.433  1.00 40.89 ? 368 PRO A C   1 
ATOM   2700 O  O   . PRO A 1 346 ? 85.681 35.858 30.331  1.00 40.97 ? 368 PRO A O   1 
ATOM   2701 C  CB  . PRO A 1 346 ? 88.738 35.602 30.307  1.00 40.82 ? 368 PRO A CB  1 
ATOM   2702 C  CG  . PRO A 1 346 ? 88.677 36.812 31.205  1.00 41.28 ? 368 PRO A CG  1 
ATOM   2703 C  CD  . PRO A 1 346 ? 88.216 37.988 30.357  1.00 40.66 ? 368 PRO A CD  1 
ATOM   2704 N  N   . MET A 1 347 ? 85.958 34.389 28.632  1.00 40.90 ? 369 MET A N   1 
ATOM   2705 C  CA  . MET A 1 347 ? 84.723 33.664 28.891  1.00 40.62 ? 369 MET A CA  1 
ATOM   2706 C  C   . MET A 1 347 ? 85.081 32.465 29.769  1.00 41.90 ? 369 MET A C   1 
ATOM   2707 O  O   . MET A 1 347 ? 86.208 31.964 29.705  1.00 41.61 ? 369 MET A O   1 
ATOM   2708 C  CB  . MET A 1 347 ? 84.057 33.211 27.590  1.00 39.52 ? 369 MET A CB  1 
ATOM   2709 C  CG  . MET A 1 347 ? 83.693 34.329 26.598  1.00 35.94 ? 369 MET A CG  1 
ATOM   2710 S  SD  . MET A 1 347 ? 82.605 35.667 27.190  1.00 27.98 ? 369 MET A SD  1 
ATOM   2711 C  CE  . MET A 1 347 ? 81.412 35.655 25.886  1.00 23.06 ? 369 MET A CE  1 
ATOM   2712 N  N   . ALA A 1 348 ? 84.127 32.013 30.588  1.00 42.85 ? 370 ALA A N   1 
ATOM   2713 C  CA  . ALA A 1 348 ? 84.380 30.925 31.546  1.00 43.90 ? 370 ALA A CA  1 
ATOM   2714 C  C   . ALA A 1 348 ? 84.658 29.560 30.893  1.00 44.23 ? 370 ALA A C   1 
ATOM   2715 O  O   . ALA A 1 348 ? 85.216 28.671 31.539  1.00 44.37 ? 370 ALA A O   1 
ATOM   2716 C  CB  . ALA A 1 348 ? 83.239 30.820 32.560  1.00 43.79 ? 370 ALA A CB  1 
ATOM   2717 N  N   . ASP A 1 349 ? 84.284 29.411 29.621  1.00 44.82 ? 371 ASP A N   1 
ATOM   2718 C  CA  . ASP A 1 349 ? 84.485 28.155 28.884  1.00 45.68 ? 371 ASP A CA  1 
ATOM   2719 C  C   . ASP A 1 349 ? 85.754 28.127 28.006  1.00 46.24 ? 371 ASP A C   1 
ATOM   2720 O  O   . ASP A 1 349 ? 85.828 27.341 27.049  1.00 46.61 ? 371 ASP A O   1 
ATOM   2721 C  CB  . ASP A 1 349 ? 83.261 27.864 28.007  1.00 45.66 ? 371 ASP A CB  1 
ATOM   2722 C  CG  . ASP A 1 349 ? 83.101 28.870 26.883  1.00 45.67 ? 371 ASP A CG  1 
ATOM   2723 O  OD1 . ASP A 1 349 ? 83.614 30.000 27.032  1.00 46.00 ? 371 ASP A OD1 1 
ATOM   2724 O  OD2 . ASP A 1 349 ? 82.469 28.536 25.856  1.00 44.77 ? 371 ASP A OD2 1 
ATOM   2725 N  N   . GLY A 1 350 ? 86.730 28.982 28.308  1.00 46.53 ? 372 GLY A N   1 
ATOM   2726 C  CA  . GLY A 1 350 ? 87.973 29.024 27.530  1.00 47.15 ? 372 GLY A CA  1 
ATOM   2727 C  C   . GLY A 1 350 ? 88.137 30.145 26.511  1.00 47.30 ? 372 GLY A C   1 
ATOM   2728 O  O   . GLY A 1 350 ? 89.238 30.682 26.357  1.00 47.57 ? 372 GLY A O   1 
ATOM   2729 N  N   . ARG A 1 351 ? 87.057 30.497 25.812  1.00 47.30 ? 373 ARG A N   1 
ATOM   2730 C  CA  . ARG A 1 351 ? 87.080 31.567 24.799  1.00 47.24 ? 373 ARG A CA  1 
ATOM   2731 C  C   . ARG A 1 351 ? 87.498 32.912 25.392  1.00 47.13 ? 373 ARG A C   1 
ATOM   2732 O  O   . ARG A 1 351 ? 87.435 33.107 26.601  1.00 46.86 ? 373 ARG A O   1 
ATOM   2733 C  CB  . ARG A 1 351 ? 85.697 31.733 24.160  1.00 47.06 ? 373 ARG A CB  1 
ATOM   2734 C  CG  . ARG A 1 351 ? 85.272 30.618 23.231  1.00 48.08 ? 373 ARG A CG  1 
ATOM   2735 C  CD  . ARG A 1 351 ? 83.846 30.169 23.530  1.00 49.97 ? 373 ARG A CD  1 
ATOM   2736 N  NE  . ARG A 1 351 ? 82.801 31.101 23.095  1.00 50.79 ? 373 ARG A NE  1 
ATOM   2737 C  CZ  . ARG A 1 351 ? 81.694 31.370 23.791  1.00 51.53 ? 373 ARG A CZ  1 
ATOM   2738 N  NH1 . ARG A 1 351 ? 81.486 30.807 24.977  1.00 51.86 ? 373 ARG A NH1 1 
ATOM   2739 N  NH2 . ARG A 1 351 ? 80.791 32.218 23.314  1.00 51.02 ? 373 ARG A NH2 1 
ATOM   2740 N  N   . GLU A 1 352 ? 87.949 33.824 24.532  1.00 47.50 ? 374 GLU A N   1 
ATOM   2741 C  CA  . GLU A 1 352 ? 88.075 35.245 24.886  1.00 47.56 ? 374 GLU A CA  1 
ATOM   2742 C  C   . GLU A 1 352 ? 87.678 36.160 23.726  1.00 47.18 ? 374 GLU A C   1 
ATOM   2743 O  O   . GLU A 1 352 ? 87.731 35.762 22.558  1.00 47.06 ? 374 GLU A O   1 
ATOM   2744 C  CB  . GLU A 1 352 ? 89.460 35.592 25.433  1.00 47.74 ? 374 GLU A CB  1 
ATOM   2745 C  CG  . GLU A 1 352 ? 90.604 35.464 24.453  1.00 49.58 ? 374 GLU A CG  1 
ATOM   2746 C  CD  . GLU A 1 352 ? 91.891 36.067 24.987  1.00 51.78 ? 374 GLU A CD  1 
ATOM   2747 O  OE1 . GLU A 1 352 ? 91.938 36.410 26.192  1.00 52.55 ? 374 GLU A OE1 1 
ATOM   2748 O  OE2 . GLU A 1 352 ? 92.858 36.193 24.198  1.00 52.87 ? 374 GLU A OE2 1 
ATOM   2749 N  N   . PHE A 1 353 ? 87.256 37.376 24.069  1.00 46.74 ? 375 PHE A N   1 
ATOM   2750 C  CA  . PHE A 1 353 ? 86.685 38.311 23.102  1.00 46.08 ? 375 PHE A CA  1 
ATOM   2751 C  C   . PHE A 1 353 ? 87.304 39.701 23.262  1.00 45.60 ? 375 PHE A C   1 
ATOM   2752 O  O   . PHE A 1 353 ? 87.650 40.126 24.372  1.00 45.55 ? 375 PHE A O   1 
ATOM   2753 C  CB  . PHE A 1 353 ? 85.160 38.379 23.245  1.00 46.14 ? 375 PHE A CB  1 
ATOM   2754 C  CG  . PHE A 1 353 ? 84.426 37.221 22.609  1.00 46.30 ? 375 PHE A CG  1 
ATOM   2755 C  CD1 . PHE A 1 353 ? 83.953 37.313 21.304  1.00 47.13 ? 375 PHE A CD1 1 
ATOM   2756 C  CD2 . PHE A 1 353 ? 84.185 36.049 23.321  1.00 45.76 ? 375 PHE A CD2 1 
ATOM   2757 C  CE1 . PHE A 1 353 ? 83.263 36.246 20.706  1.00 47.28 ? 375 PHE A CE1 1 
ATOM   2758 C  CE2 . PHE A 1 353 ? 83.508 34.980 22.735  1.00 45.57 ? 375 PHE A CE2 1 
ATOM   2759 C  CZ  . PHE A 1 353 ? 83.042 35.081 21.425  1.00 46.34 ? 375 PHE A CZ  1 
ATOM   2760 N  N   . ASN A 1 354 ? 87.447 40.405 22.146  1.00 44.96 ? 376 ASN A N   1 
ATOM   2761 C  CA  . ASN A 1 354 ? 88.165 41.675 22.150  1.00 44.35 ? 376 ASN A CA  1 
ATOM   2762 C  C   . ASN A 1 354 ? 87.189 42.833 22.139  1.00 43.59 ? 376 ASN A C   1 
ATOM   2763 O  O   . ASN A 1 354 ? 86.356 42.953 21.233  1.00 43.03 ? 376 ASN A O   1 
ATOM   2764 C  CB  . ASN A 1 354 ? 89.175 41.758 20.988  1.00 44.56 ? 376 ASN A CB  1 
ATOM   2765 C  CG  . ASN A 1 354 ? 90.363 40.814 21.168  1.00 45.09 ? 376 ASN A CG  1 
ATOM   2766 O  OD1 . ASN A 1 354 ? 90.833 40.583 22.287  1.00 45.73 ? 376 ASN A OD1 1 
ATOM   2767 N  ND2 . ASN A 1 354 ? 90.854 40.265 20.061  1.00 46.03 ? 376 ASN A ND2 1 
ATOM   2768 N  N   . LEU A 1 355 ? 87.281 43.657 23.176  1.00 42.78 ? 377 LEU A N   1 
ATOM   2769 C  CA  . LEU A 1 355 ? 86.413 44.818 23.316  1.00 42.32 ? 377 LEU A CA  1 
ATOM   2770 C  C   . LEU A 1 355 ? 87.141 46.069 22.827  1.00 42.27 ? 377 LEU A C   1 
ATOM   2771 O  O   . LEU A 1 355 ? 88.280 46.344 23.217  1.00 42.20 ? 377 LEU A O   1 
ATOM   2772 C  CB  . LEU A 1 355 ? 85.917 44.979 24.768  1.00 42.15 ? 377 LEU A CB  1 
ATOM   2773 C  CG  . LEU A 1 355 ? 85.006 43.898 25.388  1.00 40.92 ? 377 LEU A CG  1 
ATOM   2774 C  CD1 . LEU A 1 355 ? 84.657 44.253 26.822  1.00 40.37 ? 377 LEU A CD1 1 
ATOM   2775 C  CD2 . LEU A 1 355 ? 83.723 43.667 24.590  1.00 39.96 ? 377 LEU A CD2 1 
ATOM   2776 N  N   . ARG A 1 356 ? 86.468 46.810 21.955  1.00 42.16 ? 378 ARG A N   1 
ATOM   2777 C  CA  . ARG A 1 356 ? 87.035 47.992 21.336  1.00 42.00 ? 378 ARG A CA  1 
ATOM   2778 C  C   . ARG A 1 356 ? 86.695 49.278 22.105  1.00 41.89 ? 378 ARG A C   1 
ATOM   2779 O  O   . ARG A 1 356 ? 85.515 49.592 22.319  1.00 41.61 ? 378 ARG A O   1 
ATOM   2780 C  CB  . ARG A 1 356 ? 86.523 48.090 19.903  1.00 41.79 ? 378 ARG A CB  1 
ATOM   2781 C  CG  . ARG A 1 356 ? 87.448 48.816 18.969  1.00 41.70 ? 378 ARG A CG  1 
ATOM   2782 C  CD  . ARG A 1 356 ? 86.794 49.012 17.612  1.00 41.98 ? 378 ARG A CD  1 
ATOM   2783 N  NE  . ARG A 1 356 ? 86.573 47.762 16.883  1.00 40.98 ? 378 ARG A NE  1 
ATOM   2784 C  CZ  . ARG A 1 356 ? 86.159 47.702 15.616  1.00 39.83 ? 378 ARG A CZ  1 
ATOM   2785 N  NH1 . ARG A 1 356 ? 85.919 48.817 14.939  1.00 39.10 ? 378 ARG A NH1 1 
ATOM   2786 N  NH2 . ARG A 1 356 ? 85.984 46.528 15.023  1.00 38.33 ? 378 ARG A NH2 1 
ATOM   2787 N  N   . ARG A 1 357 ? 87.731 50.019 22.507  1.00 41.45 ? 379 ARG A N   1 
ATOM   2788 C  CA  . ARG A 1 357 ? 87.569 51.339 23.137  1.00 41.19 ? 379 ARG A CA  1 
ATOM   2789 C  C   . ARG A 1 357 ? 86.477 52.178 22.449  1.00 40.22 ? 379 ARG A C   1 
ATOM   2790 O  O   . ARG A 1 357 ? 86.441 52.272 21.224  1.00 39.95 ? 379 ARG A O   1 
ATOM   2791 C  CB  . ARG A 1 357 ? 88.918 52.085 23.181  1.00 41.63 ? 379 ARG A CB  1 
ATOM   2792 C  CG  . ARG A 1 357 ? 88.812 53.593 22.970  1.00 44.00 ? 379 ARG A CG  1 
ATOM   2793 C  CD  . ARG A 1 357 ? 89.627 54.404 23.973  1.00 47.72 ? 379 ARG A CD  1 
ATOM   2794 N  NE  . ARG A 1 357 ? 91.073 54.229 23.836  1.00 50.49 ? 379 ARG A NE  1 
ATOM   2795 C  CZ  . ARG A 1 357 ? 91.820 54.786 22.882  1.00 52.60 ? 379 ARG A CZ  1 
ATOM   2796 N  NH1 . ARG A 1 357 ? 91.262 55.556 21.951  1.00 52.78 ? 379 ARG A NH1 1 
ATOM   2797 N  NH2 . ARG A 1 357 ? 93.134 54.570 22.860  1.00 52.77 ? 379 ARG A NH2 1 
ATOM   2798 N  N   . GLY A 1 358 ? 85.574 52.758 23.242  1.00 39.16 ? 380 GLY A N   1 
ATOM   2799 C  CA  . GLY A 1 358 ? 84.469 53.554 22.693  1.00 37.61 ? 380 GLY A CA  1 
ATOM   2800 C  C   . GLY A 1 358 ? 83.148 52.809 22.572  1.00 36.73 ? 380 GLY A C   1 
ATOM   2801 O  O   . GLY A 1 358 ? 82.094 53.430 22.385  1.00 37.06 ? 380 GLY A O   1 
ATOM   2802 N  N   . ASP A 1 359 ? 83.199 51.479 22.662  1.00 35.42 ? 381 ASP A N   1 
ATOM   2803 C  CA  . ASP A 1 359 ? 81.992 50.653 22.666  1.00 34.08 ? 381 ASP A CA  1 
ATOM   2804 C  C   . ASP A 1 359 ? 81.318 50.677 24.044  1.00 32.98 ? 381 ASP A C   1 
ATOM   2805 O  O   . ASP A 1 359 ? 81.939 51.015 25.059  1.00 32.22 ? 381 ASP A O   1 
ATOM   2806 C  CB  . ASP A 1 359 ? 82.304 49.191 22.285  1.00 34.15 ? 381 ASP A CB  1 
ATOM   2807 C  CG  . ASP A 1 359 ? 82.690 49.008 20.808  1.00 34.56 ? 381 ASP A CG  1 
ATOM   2808 O  OD1 . ASP A 1 359 ? 82.556 49.944 19.987  1.00 33.50 ? 381 ASP A OD1 1 
ATOM   2809 O  OD2 . ASP A 1 359 ? 83.128 47.885 20.472  1.00 35.31 ? 381 ASP A OD2 1 
ATOM   2810 N  N   . ARG A 1 360 ? 80.047 50.297 24.060  1.00 32.01 ? 382 ARG A N   1 
ATOM   2811 C  CA  . ARG A 1 360 ? 79.287 50.144 25.300  1.00 31.35 ? 382 ARG A CA  1 
ATOM   2812 C  C   . ARG A 1 360 ? 79.044 48.664 25.574  1.00 30.18 ? 382 ARG A C   1 
ATOM   2813 O  O   . ARG A 1 360 ? 78.569 47.939 24.712  1.00 30.32 ? 382 ARG A O   1 
ATOM   2814 C  CB  . ARG A 1 360 ? 77.954 50.897 25.213  1.00 31.43 ? 382 ARG A CB  1 
ATOM   2815 C  CG  . ARG A 1 360 ? 77.059 50.675 26.431  1.00 32.52 ? 382 ARG A CG  1 
ATOM   2816 C  CD  . ARG A 1 360 ? 75.858 51.579 26.424  1.00 34.19 ? 382 ARG A CD  1 
ATOM   2817 N  NE  . ARG A 1 360 ? 76.241 52.982 26.577  1.00 34.73 ? 382 ARG A NE  1 
ATOM   2818 C  CZ  . ARG A 1 360 ? 75.400 53.999 26.440  1.00 35.07 ? 382 ARG A CZ  1 
ATOM   2819 N  NH1 . ARG A 1 360 ? 74.129 53.773 26.154  1.00 32.59 ? 382 ARG A NH1 1 
ATOM   2820 N  NH2 . ARG A 1 360 ? 75.834 55.247 26.581  1.00 37.35 ? 382 ARG A NH2 1 
ATOM   2821 N  N   . LEU A 1 361 ? 79.378 48.212 26.772  1.00 29.14 ? 383 LEU A N   1 
ATOM   2822 C  CA  . LEU A 1 361 ? 79.129 46.825 27.133  1.00 28.27 ? 383 LEU A CA  1 
ATOM   2823 C  C   . LEU A 1 361 ? 77.844 46.713 27.985  1.00 28.03 ? 383 LEU A C   1 
ATOM   2824 O  O   . LEU A 1 361 ? 77.695 47.419 28.984  1.00 27.43 ? 383 LEU A O   1 
ATOM   2825 C  CB  . LEU A 1 361 ? 80.363 46.241 27.833  1.00 28.23 ? 383 LEU A CB  1 
ATOM   2826 C  CG  . LEU A 1 361 ? 80.338 44.871 28.511  1.00 27.60 ? 383 LEU A CG  1 
ATOM   2827 C  CD1 . LEU A 1 361 ? 80.371 43.733 27.524  1.00 27.63 ? 383 LEU A CD1 1 
ATOM   2828 C  CD2 . LEU A 1 361 ? 81.521 44.780 29.431  1.00 29.60 ? 383 LEU A CD2 1 
ATOM   2829 N  N   . LEU A 1 362 ? 76.917 45.844 27.563  1.00 27.11 ? 384 LEU A N   1 
ATOM   2830 C  CA  . LEU A 1 362 ? 75.660 45.632 28.280  1.00 25.87 ? 384 LEU A CA  1 
ATOM   2831 C  C   . LEU A 1 362 ? 75.424 44.184 28.703  1.00 25.69 ? 384 LEU A C   1 
ATOM   2832 O  O   . LEU A 1 362 ? 75.452 43.275 27.864  1.00 25.12 ? 384 LEU A O   1 
ATOM   2833 C  CB  . LEU A 1 362 ? 74.463 46.095 27.442  1.00 25.87 ? 384 LEU A CB  1 
ATOM   2834 C  CG  . LEU A 1 362 ? 73.068 45.842 28.056  1.00 25.58 ? 384 LEU A CG  1 
ATOM   2835 C  CD1 . LEU A 1 362 ? 72.862 46.654 29.305  1.00 25.31 ? 384 LEU A CD1 1 
ATOM   2836 C  CD2 . LEU A 1 362 ? 71.994 46.182 27.084  1.00 25.33 ? 384 LEU A CD2 1 
ATOM   2837 N  N   . LEU A 1 363 ? 75.174 43.997 30.003  1.00 24.58 ? 385 LEU A N   1 
ATOM   2838 C  CA  . LEU A 1 363 ? 74.728 42.726 30.574  1.00 23.39 ? 385 LEU A CA  1 
ATOM   2839 C  C   . LEU A 1 363 ? 73.280 42.911 31.008  1.00 22.50 ? 385 LEU A C   1 
ATOM   2840 O  O   . LEU A 1 363 ? 72.904 43.969 31.539  1.00 21.79 ? 385 LEU A O   1 
ATOM   2841 C  CB  . LEU A 1 363 ? 75.590 42.306 31.777  1.00 22.90 ? 385 LEU A CB  1 
ATOM   2842 C  CG  . LEU A 1 363 ? 77.121 42.488 31.806  1.00 24.99 ? 385 LEU A CG  1 
ATOM   2843 C  CD1 . LEU A 1 363 ? 77.797 41.745 32.976  1.00 22.93 ? 385 LEU A CD1 1 
ATOM   2844 C  CD2 . LEU A 1 363 ? 77.783 42.109 30.523  1.00 23.95 ? 385 LEU A CD2 1 
ATOM   2845 N  N   . PHE A 1 364 ? 72.469 41.885 30.780  1.00 21.29 ? 386 PHE A N   1 
ATOM   2846 C  CA  . PHE A 1 364 ? 71.036 41.967 31.072  1.00 19.67 ? 386 PHE A CA  1 
ATOM   2847 C  C   . PHE A 1 364 ? 70.583 40.731 31.870  1.00 18.76 ? 386 PHE A C   1 
ATOM   2848 O  O   . PHE A 1 364 ? 70.034 39.789 31.310  1.00 18.60 ? 386 PHE A O   1 
ATOM   2849 C  CB  . PHE A 1 364 ? 70.237 42.164 29.773  1.00 19.42 ? 386 PHE A CB  1 
ATOM   2850 C  CG  . PHE A 1 364 ? 68.807 42.626 29.986  1.00 18.51 ? 386 PHE A CG  1 
ATOM   2851 C  CD1 . PHE A 1 364 ? 68.465 43.445 31.066  1.00 16.59 ? 386 PHE A CD1 1 
ATOM   2852 C  CD2 . PHE A 1 364 ? 67.825 42.285 29.079  1.00 17.71 ? 386 PHE A CD2 1 
ATOM   2853 C  CE1 . PHE A 1 364 ? 67.157 43.874 31.265  1.00 14.14 ? 386 PHE A CE1 1 
ATOM   2854 C  CE2 . PHE A 1 364 ? 66.518 42.724 29.247  1.00 18.87 ? 386 PHE A CE2 1 
ATOM   2855 C  CZ  . PHE A 1 364 ? 66.181 43.516 30.354  1.00 16.95 ? 386 PHE A CZ  1 
ATOM   2856 N  N   . PRO A 1 365 ? 70.814 40.744 33.193  1.00 18.27 ? 387 PRO A N   1 
ATOM   2857 C  CA  . PRO A 1 365 ? 70.512 39.582 34.060  1.00 18.38 ? 387 PRO A CA  1 
ATOM   2858 C  C   . PRO A 1 365 ? 69.063 39.099 33.951  1.00 17.83 ? 387 PRO A C   1 
ATOM   2859 O  O   . PRO A 1 365 ? 68.803 37.904 34.053  1.00 17.55 ? 387 PRO A O   1 
ATOM   2860 C  CB  . PRO A 1 365 ? 70.805 40.113 35.464  1.00 18.14 ? 387 PRO A CB  1 
ATOM   2861 C  CG  . PRO A 1 365 ? 71.862 41.146 35.235  1.00 17.46 ? 387 PRO A CG  1 
ATOM   2862 C  CD  . PRO A 1 365 ? 71.421 41.844 33.966  1.00 17.76 ? 387 PRO A CD  1 
ATOM   2863 N  N   . PHE A 1 366 ? 68.147 40.032 33.740  1.00 17.61 ? 388 PHE A N   1 
ATOM   2864 C  CA  . PHE A 1 366 ? 66.741 39.732 33.492  1.00 18.07 ? 388 PHE A CA  1 
ATOM   2865 C  C   . PHE A 1 366 ? 66.542 38.589 32.505  1.00 18.77 ? 388 PHE A C   1 
ATOM   2866 O  O   . PHE A 1 366 ? 65.721 37.695 32.741  1.00 18.49 ? 388 PHE A O   1 
ATOM   2867 C  CB  . PHE A 1 366 ? 66.033 40.991 32.995  1.00 18.13 ? 388 PHE A CB  1 
ATOM   2868 C  CG  . PHE A 1 366 ? 64.545 40.817 32.795  1.00 18.04 ? 388 PHE A CG  1 
ATOM   2869 C  CD1 . PHE A 1 366 ? 64.029 40.581 31.530  1.00 17.72 ? 388 PHE A CD1 1 
ATOM   2870 C  CD2 . PHE A 1 366 ? 63.677 40.852 33.874  1.00 15.92 ? 388 PHE A CD2 1 
ATOM   2871 C  CE1 . PHE A 1 366 ? 62.668 40.416 31.349  1.00 18.33 ? 388 PHE A CE1 1 
ATOM   2872 C  CE2 . PHE A 1 366 ? 62.314 40.686 33.702  1.00 15.89 ? 388 PHE A CE2 1 
ATOM   2873 C  CZ  . PHE A 1 366 ? 61.808 40.472 32.441  1.00 16.59 ? 388 PHE A CZ  1 
ATOM   2874 N  N   . LEU A 1 367 ? 67.323 38.614 31.422  1.00 18.75 ? 389 LEU A N   1 
ATOM   2875 C  CA  . LEU A 1 367 ? 67.259 37.616 30.371  1.00 19.53 ? 389 LEU A CA  1 
ATOM   2876 C  C   . LEU A 1 367 ? 68.035 36.366 30.759  1.00 18.90 ? 389 LEU A C   1 
ATOM   2877 O  O   . LEU A 1 367 ? 67.516 35.260 30.660  1.00 18.84 ? 389 LEU A O   1 
ATOM   2878 C  CB  . LEU A 1 367 ? 67.816 38.185 29.061  1.00 20.27 ? 389 LEU A CB  1 
ATOM   2879 C  CG  . LEU A 1 367 ? 66.988 37.895 27.820  1.00 22.85 ? 389 LEU A CG  1 
ATOM   2880 C  CD1 . LEU A 1 367 ? 65.541 38.366 28.072  1.00 24.19 ? 389 LEU A CD1 1 
ATOM   2881 C  CD2 . LEU A 1 367 ? 67.610 38.646 26.644  1.00 24.38 ? 389 LEU A CD2 1 
ATOM   2882 N  N   . SER A 1 368 ? 69.268 36.541 31.217  1.00 19.03 ? 390 SER A N   1 
ATOM   2883 C  CA  . SER A 1 368 ? 70.000 35.432 31.820  1.00 19.27 ? 390 SER A CA  1 
ATOM   2884 C  C   . SER A 1 368 ? 70.874 35.953 32.939  1.00 18.66 ? 390 SER A C   1 
ATOM   2885 O  O   . SER A 1 368 ? 71.661 36.857 32.711  1.00 19.66 ? 390 SER A O   1 
ATOM   2886 C  CB  . SER A 1 368 ? 70.850 34.698 30.772  1.00 19.78 ? 390 SER A CB  1 
ATOM   2887 O  OG  . SER A 1 368 ? 71.183 33.413 31.250  1.00 20.51 ? 390 SER A OG  1 
ATOM   2888 N  N   . PRO A 1 369 ? 70.806 35.343 34.143  1.00 18.06 ? 391 PRO A N   1 
ATOM   2889 C  CA  . PRO A 1 369 ? 70.166 34.075 34.530  1.00 17.79 ? 391 PRO A CA  1 
ATOM   2890 C  C   . PRO A 1 369 ? 68.656 34.053 34.795  1.00 17.87 ? 391 PRO A C   1 
ATOM   2891 O  O   . PRO A 1 369 ? 68.069 32.959 34.806  1.00 17.66 ? 391 PRO A O   1 
ATOM   2892 C  CB  . PRO A 1 369 ? 70.916 33.683 35.810  1.00 18.32 ? 391 PRO A CB  1 
ATOM   2893 C  CG  . PRO A 1 369 ? 71.382 34.999 36.394  1.00 18.29 ? 391 PRO A CG  1 
ATOM   2894 C  CD  . PRO A 1 369 ? 71.516 35.979 35.264  1.00 17.33 ? 391 PRO A CD  1 
ATOM   2895 N  N   . GLN A 1 370 ? 68.029 35.222 34.973  1.00 16.90 ? 392 GLN A N   1 
ATOM   2896 C  CA  . GLN A 1 370 ? 66.664 35.287 35.571  1.00 16.14 ? 392 GLN A CA  1 
ATOM   2897 C  C   . GLN A 1 370 ? 65.540 34.584 34.808  1.00 16.04 ? 392 GLN A C   1 
ATOM   2898 O  O   . GLN A 1 370 ? 64.778 33.825 35.399  1.00 15.28 ? 392 GLN A O   1 
ATOM   2899 C  CB  . GLN A 1 370 ? 66.276 36.727 35.959  1.00 15.65 ? 392 GLN A CB  1 
ATOM   2900 C  CG  . GLN A 1 370 ? 67.069 37.222 37.182  1.00 16.04 ? 392 GLN A CG  1 
ATOM   2901 C  CD  . GLN A 1 370 ? 66.996 38.739 37.412  1.00 15.83 ? 392 GLN A CD  1 
ATOM   2902 O  OE1 . GLN A 1 370 ? 67.994 39.357 37.754  1.00 17.03 ? 392 GLN A OE1 1 
ATOM   2903 N  NE2 . GLN A 1 370 ? 65.826 39.331 37.202  1.00 16.66 ? 392 GLN A NE2 1 
ATOM   2904 N  N   . ARG A 1 371 ? 65.433 34.815 33.504  1.00 16.46 ? 393 ARG A N   1 
ATOM   2905 C  CA  . ARG A 1 371 ? 64.401 34.149 32.729  1.00 16.71 ? 393 ARG A CA  1 
ATOM   2906 C  C   . ARG A 1 371 ? 64.939 33.090 31.756  1.00 17.85 ? 393 ARG A C   1 
ATOM   2907 O  O   . ARG A 1 371 ? 64.344 32.837 30.700  1.00 18.09 ? 393 ARG A O   1 
ATOM   2908 C  CB  . ARG A 1 371 ? 63.532 35.182 32.028  1.00 16.84 ? 393 ARG A CB  1 
ATOM   2909 C  CG  . ARG A 1 371 ? 62.593 35.887 33.015  1.00 16.41 ? 393 ARG A CG  1 
ATOM   2910 C  CD  . ARG A 1 371 ? 61.856 36.995 32.325  1.00 16.32 ? 393 ARG A CD  1 
ATOM   2911 N  NE  . ARG A 1 371 ? 60.859 37.564 33.202  1.00 14.25 ? 393 ARG A NE  1 
ATOM   2912 C  CZ  . ARG A 1 371 ? 59.584 37.219 33.188  1.00 13.33 ? 393 ARG A CZ  1 
ATOM   2913 N  NH1 . ARG A 1 371 ? 59.138 36.285 32.354  1.00 14.41 ? 393 ARG A NH1 1 
ATOM   2914 N  NH2 . ARG A 1 371 ? 58.758 37.811 34.012  1.00 13.10 ? 393 ARG A NH2 1 
ATOM   2915 N  N   . ASP A 1 372 ? 66.052 32.475 32.141  1.00 18.37 ? 394 ASP A N   1 
ATOM   2916 C  CA  . ASP A 1 372 ? 66.736 31.457 31.352  1.00 19.08 ? 394 ASP A CA  1 
ATOM   2917 C  C   . ASP A 1 372 ? 66.142 30.072 31.661  1.00 19.46 ? 394 ASP A C   1 
ATOM   2918 O  O   . ASP A 1 372 ? 66.319 29.558 32.764  1.00 18.94 ? 394 ASP A O   1 
ATOM   2919 C  CB  . ASP A 1 372 ? 68.215 31.495 31.701  1.00 18.91 ? 394 ASP A CB  1 
ATOM   2920 C  CG  . ASP A 1 372 ? 69.102 30.692 30.729  1.00 20.36 ? 394 ASP A CG  1 
ATOM   2921 O  OD1 . ASP A 1 372 ? 68.705 29.598 30.256  1.00 20.09 ? 394 ASP A OD1 1 
ATOM   2922 O  OD2 . ASP A 1 372 ? 70.233 31.165 30.493  1.00 19.52 ? 394 ASP A OD2 1 
ATOM   2923 N  N   . PRO A 1 373 ? 65.431 29.472 30.683  1.00 20.03 ? 395 PRO A N   1 
ATOM   2924 C  CA  . PRO A 1 373 ? 64.720 28.212 30.902  1.00 20.09 ? 395 PRO A CA  1 
ATOM   2925 C  C   . PRO A 1 373 ? 65.630 27.009 31.174  1.00 20.37 ? 395 PRO A C   1 
ATOM   2926 O  O   . PRO A 1 373 ? 65.127 25.964 31.590  1.00 21.10 ? 395 PRO A O   1 
ATOM   2927 C  CB  . PRO A 1 373 ? 63.950 28.015 29.587  1.00 20.16 ? 395 PRO A CB  1 
ATOM   2928 C  CG  . PRO A 1 373 ? 64.812 28.719 28.546  1.00 19.70 ? 395 PRO A CG  1 
ATOM   2929 C  CD  . PRO A 1 373 ? 65.269 29.952 29.290  1.00 20.27 ? 395 PRO A CD  1 
ATOM   2930 N  N   . GLU A 1 374 ? 66.935 27.152 30.933  1.00 20.20 ? 396 GLU A N   1 
ATOM   2931 C  CA  . GLU A 1 374 ? 67.918 26.115 31.252  1.00 20.01 ? 396 GLU A CA  1 
ATOM   2932 C  C   . GLU A 1 374 ? 68.356 26.227 32.701  1.00 19.72 ? 396 GLU A C   1 
ATOM   2933 O  O   . GLU A 1 374 ? 68.926 25.282 33.264  1.00 20.12 ? 396 GLU A O   1 
ATOM   2934 C  CB  . GLU A 1 374 ? 69.163 26.221 30.346  1.00 20.43 ? 396 GLU A CB  1 
ATOM   2935 C  CG  . GLU A 1 374 ? 68.888 26.047 28.846  1.00 20.59 ? 396 GLU A CG  1 
ATOM   2936 C  CD  . GLU A 1 374 ? 70.157 26.007 27.974  1.00 22.98 ? 396 GLU A CD  1 
ATOM   2937 O  OE1 . GLU A 1 374 ? 71.265 26.422 28.407  1.00 23.21 ? 396 GLU A OE1 1 
ATOM   2938 O  OE2 . GLU A 1 374 ? 70.029 25.544 26.827  1.00 26.69 ? 396 GLU A OE2 1 
ATOM   2939 N  N   . ILE A 1 375 ? 68.121 27.390 33.309  1.00 19.01 ? 397 ILE A N   1 
ATOM   2940 C  CA  . ILE A 1 375 ? 68.454 27.586 34.720  1.00 18.20 ? 397 ILE A CA  1 
ATOM   2941 C  C   . ILE A 1 375 ? 67.239 27.324 35.617  1.00 18.36 ? 397 ILE A C   1 
ATOM   2942 O  O   . ILE A 1 375 ? 67.339 26.612 36.623  1.00 17.68 ? 397 ILE A O   1 
ATOM   2943 C  CB  . ILE A 1 375 ? 69.010 28.995 34.959  1.00 18.36 ? 397 ILE A CB  1 
ATOM   2944 C  CG1 . ILE A 1 375 ? 70.277 29.191 34.135  1.00 17.92 ? 397 ILE A CG1 1 
ATOM   2945 C  CG2 . ILE A 1 375 ? 69.263 29.270 36.449  1.00 18.01 ? 397 ILE A CG2 1 
ATOM   2946 C  CD1 . ILE A 1 375 ? 70.736 30.586 34.131  1.00 15.54 ? 397 ILE A CD1 1 
ATOM   2947 N  N   . TYR A 1 376 ? 66.110 27.910 35.230  1.00 17.88 ? 398 TYR A N   1 
ATOM   2948 C  CA  . TYR A 1 376 ? 64.877 27.858 35.972  1.00 18.29 ? 398 TYR A CA  1 
ATOM   2949 C  C   . TYR A 1 376 ? 63.837 27.220 35.075  1.00 19.03 ? 398 TYR A C   1 
ATOM   2950 O  O   . TYR A 1 376 ? 63.618 27.691 33.972  1.00 19.40 ? 398 TYR A O   1 
ATOM   2951 C  CB  . TYR A 1 376 ? 64.419 29.282 36.365  1.00 17.87 ? 398 TYR A CB  1 
ATOM   2952 C  CG  . TYR A 1 376 ? 65.367 30.017 37.299  1.00 16.43 ? 398 TYR A CG  1 
ATOM   2953 C  CD1 . TYR A 1 376 ? 65.532 29.596 38.617  1.00 16.32 ? 398 TYR A CD1 1 
ATOM   2954 C  CD2 . TYR A 1 376 ? 66.077 31.124 36.869  1.00 15.58 ? 398 TYR A CD2 1 
ATOM   2955 C  CE1 . TYR A 1 376 ? 66.365 30.236 39.473  1.00 16.64 ? 398 TYR A CE1 1 
ATOM   2956 C  CE2 . TYR A 1 376 ? 66.936 31.797 37.727  1.00 16.01 ? 398 TYR A CE2 1 
ATOM   2957 C  CZ  . TYR A 1 376 ? 67.085 31.336 39.035  1.00 17.93 ? 398 TYR A CZ  1 
ATOM   2958 O  OH  . TYR A 1 376 ? 67.929 31.958 39.932  1.00 16.23 ? 398 TYR A OH  1 
ATOM   2959 N  N   . THR A 1 377 ? 63.190 26.158 35.543  1.00 19.60 ? 399 THR A N   1 
ATOM   2960 C  CA  . THR A 1 377 ? 62.186 25.474 34.734  1.00 20.44 ? 399 THR A CA  1 
ATOM   2961 C  C   . THR A 1 377 ? 60.907 26.300 34.737  1.00 20.28 ? 399 THR A C   1 
ATOM   2962 O  O   . THR A 1 377 ? 60.437 26.722 35.811  1.00 20.42 ? 399 THR A O   1 
ATOM   2963 C  CB  . THR A 1 377 ? 61.890 24.045 35.243  1.00 20.98 ? 399 THR A CB  1 
ATOM   2964 O  OG1 . THR A 1 377 ? 63.116 23.390 35.598  1.00 22.80 ? 399 THR A OG1 1 
ATOM   2965 C  CG2 . THR A 1 377 ? 61.201 23.219 34.145  1.00 22.83 ? 399 THR A CG2 1 
ATOM   2966 N  N   . ASP A 1 378 ? 60.339 26.490 33.539  1.00 19.85 ? 400 ASP A N   1 
ATOM   2967 C  CA  . ASP A 1 378 ? 59.206 27.399 33.291  1.00 19.13 ? 400 ASP A CA  1 
ATOM   2968 C  C   . ASP A 1 378 ? 59.505 28.765 33.918  1.00 17.81 ? 400 ASP A C   1 
ATOM   2969 O  O   . ASP A 1 378 ? 58.883 29.138 34.896  1.00 16.91 ? 400 ASP A O   1 
ATOM   2970 C  CB  . ASP A 1 378 ? 57.872 26.830 33.835  1.00 19.75 ? 400 ASP A CB  1 
ATOM   2971 C  CG  . ASP A 1 378 ? 57.684 25.352 33.535  1.00 20.81 ? 400 ASP A CG  1 
ATOM   2972 O  OD1 . ASP A 1 378 ? 57.813 24.925 32.371  1.00 23.48 ? 400 ASP A OD1 1 
ATOM   2973 O  OD2 . ASP A 1 378 ? 57.389 24.600 34.475  1.00 26.13 ? 400 ASP A OD2 1 
ATOM   2974 N  N   . PRO A 1 379 ? 60.489 29.500 33.371  1.00 17.30 ? 401 PRO A N   1 
ATOM   2975 C  CA  . PRO A 1 379 ? 60.958 30.742 34.016  1.00 16.74 ? 401 PRO A CA  1 
ATOM   2976 C  C   . PRO A 1 379 ? 59.931 31.877 34.021  1.00 16.67 ? 401 PRO A C   1 
ATOM   2977 O  O   . PRO A 1 379 ? 60.100 32.873 34.733  1.00 15.77 ? 401 PRO A O   1 
ATOM   2978 C  CB  . PRO A 1 379 ? 62.172 31.138 33.177  1.00 16.94 ? 401 PRO A CB  1 
ATOM   2979 C  CG  . PRO A 1 379 ? 61.965 30.480 31.858  1.00 17.18 ? 401 PRO A CG  1 
ATOM   2980 C  CD  . PRO A 1 379 ? 61.233 29.202 32.130  1.00 17.36 ? 401 PRO A CD  1 
ATOM   2981 N  N   . GLU A 1 380 ? 58.876 31.710 33.236  1.00 16.29 ? 402 GLU A N   1 
ATOM   2982 C  CA  . GLU A 1 380 ? 57.834 32.716 33.095  1.00 17.01 ? 402 GLU A CA  1 
ATOM   2983 C  C   . GLU A 1 380 ? 56.805 32.618 34.226  1.00 16.33 ? 402 GLU A C   1 
ATOM   2984 O  O   . GLU A 1 380 ? 56.051 33.560 34.452  1.00 16.85 ? 402 GLU A O   1 
ATOM   2985 C  CB  . GLU A 1 380 ? 57.179 32.608 31.704  1.00 16.98 ? 402 GLU A CB  1 
ATOM   2986 C  CG  . GLU A 1 380 ? 56.183 31.449 31.516  1.00 19.76 ? 402 GLU A CG  1 
ATOM   2987 C  CD  . GLU A 1 380 ? 56.851 30.124 31.196  1.00 23.21 ? 402 GLU A CD  1 
ATOM   2988 O  OE1 . GLU A 1 380 ? 58.091 30.044 31.276  1.00 22.47 ? 402 GLU A OE1 1 
ATOM   2989 O  OE2 . GLU A 1 380 ? 56.137 29.158 30.837  1.00 25.62 ? 402 GLU A OE2 1 
ATOM   2990 N  N   . VAL A 1 381 ? 56.816 31.481 34.943  1.00 15.93 ? 403 VAL A N   1 
ATOM   2991 C  CA  . VAL A 1 381 ? 55.869 31.156 36.020  1.00 14.63 ? 403 VAL A CA  1 
ATOM   2992 C  C   . VAL A 1 381 ? 56.377 31.651 37.379  1.00 15.06 ? 403 VAL A C   1 
ATOM   2993 O  O   . VAL A 1 381 ? 57.573 31.532 37.669  1.00 15.29 ? 403 VAL A O   1 
ATOM   2994 C  CB  . VAL A 1 381 ? 55.628 29.597 36.093  1.00 15.57 ? 403 VAL A CB  1 
ATOM   2995 C  CG1 . VAL A 1 381 ? 54.684 29.228 37.256  1.00 14.93 ? 403 VAL A CG1 1 
ATOM   2996 C  CG2 . VAL A 1 381 ? 55.057 29.050 34.764  1.00 11.71 ? 403 VAL A CG2 1 
ATOM   2997 N  N   . PHE A 1 382 ? 55.489 32.223 38.195  1.00 14.60 ? 404 PHE A N   1 
ATOM   2998 C  CA  . PHE A 1 382 ? 55.787 32.511 39.604  1.00 15.33 ? 404 PHE A CA  1 
ATOM   2999 C  C   . PHE A 1 382 ? 55.619 31.249 40.429  1.00 15.71 ? 404 PHE A C   1 
ATOM   3000 O  O   . PHE A 1 382 ? 54.496 30.813 40.679  1.00 15.85 ? 404 PHE A O   1 
ATOM   3001 C  CB  . PHE A 1 382 ? 54.888 33.635 40.176  1.00 15.43 ? 404 PHE A CB  1 
ATOM   3002 C  CG  . PHE A 1 382 ? 55.053 33.869 41.677  1.00 15.18 ? 404 PHE A CG  1 
ATOM   3003 C  CD1 . PHE A 1 382 ? 56.088 34.666 42.172  1.00 14.16 ? 404 PHE A CD1 1 
ATOM   3004 C  CD2 . PHE A 1 382 ? 54.149 33.315 42.589  1.00 13.10 ? 404 PHE A CD2 1 
ATOM   3005 C  CE1 . PHE A 1 382 ? 56.240 34.863 43.559  1.00 16.49 ? 404 PHE A CE1 1 
ATOM   3006 C  CE2 . PHE A 1 382 ? 54.286 33.512 43.967  1.00 13.55 ? 404 PHE A CE2 1 
ATOM   3007 C  CZ  . PHE A 1 382 ? 55.327 34.280 44.458  1.00 14.11 ? 404 PHE A CZ  1 
ATOM   3008 N  N   . LYS A 1 383 ? 56.737 30.670 40.860  1.00 15.62 ? 405 LYS A N   1 
ATOM   3009 C  CA  . LYS A 1 383 ? 56.704 29.544 41.788  1.00 15.42 ? 405 LYS A CA  1 
ATOM   3010 C  C   . LYS A 1 383 ? 57.320 30.001 43.102  1.00 14.99 ? 405 LYS A C   1 
ATOM   3011 O  O   . LYS A 1 383 ? 58.527 30.261 43.194  1.00 15.58 ? 405 LYS A O   1 
ATOM   3012 C  CB  . LYS A 1 383 ? 57.452 28.346 41.212  1.00 15.84 ? 405 LYS A CB  1 
ATOM   3013 C  CG  . LYS A 1 383 ? 57.037 27.984 39.797  1.00 17.21 ? 405 LYS A CG  1 
ATOM   3014 C  CD  . LYS A 1 383 ? 58.021 26.956 39.212  1.00 20.89 ? 405 LYS A CD  1 
ATOM   3015 C  CE  . LYS A 1 383 ? 57.455 26.294 37.976  1.00 20.95 ? 405 LYS A CE  1 
ATOM   3016 N  NZ  . LYS A 1 383 ? 58.437 25.347 37.418  1.00 23.24 ? 405 LYS A NZ  1 
ATOM   3017 N  N   . TYR A 1 384 ? 56.478 30.120 44.115  1.00 14.73 ? 406 TYR A N   1 
ATOM   3018 C  CA  . TYR A 1 384 ? 56.851 30.798 45.346  1.00 14.55 ? 406 TYR A CA  1 
ATOM   3019 C  C   . TYR A 1 384 ? 58.024 30.110 46.068  1.00 14.15 ? 406 TYR A C   1 
ATOM   3020 O  O   . TYR A 1 384 ? 58.760 30.762 46.812  1.00 13.47 ? 406 TYR A O   1 
ATOM   3021 C  CB  . TYR A 1 384 ? 55.633 30.924 46.262  1.00 14.89 ? 406 TYR A CB  1 
ATOM   3022 C  CG  . TYR A 1 384 ? 55.355 29.670 47.077  1.00 15.37 ? 406 TYR A CG  1 
ATOM   3023 C  CD1 . TYR A 1 384 ? 54.550 28.640 46.584  1.00 16.29 ? 406 TYR A CD1 1 
ATOM   3024 C  CD2 . TYR A 1 384 ? 55.910 29.520 48.343  1.00 17.42 ? 406 TYR A CD2 1 
ATOM   3025 C  CE1 . TYR A 1 384 ? 54.323 27.499 47.336  1.00 17.38 ? 406 TYR A CE1 1 
ATOM   3026 C  CE2 . TYR A 1 384 ? 55.681 28.383 49.100  1.00 17.50 ? 406 TYR A CE2 1 
ATOM   3027 C  CZ  . TYR A 1 384 ? 54.892 27.394 48.599  1.00 16.57 ? 406 TYR A CZ  1 
ATOM   3028 O  OH  . TYR A 1 384 ? 54.702 26.286 49.382  1.00 20.05 ? 406 TYR A OH  1 
ATOM   3029 N  N   . ASN A 1 385 ? 58.181 28.809 45.830  1.00 14.00 ? 407 ASN A N   1 
ATOM   3030 C  CA  . ASN A 1 385 ? 59.164 27.972 46.534  1.00 14.92 ? 407 ASN A CA  1 
ATOM   3031 C  C   . ASN A 1 385 ? 60.359 27.609 45.643  1.00 14.80 ? 407 ASN A C   1 
ATOM   3032 O  O   . ASN A 1 385 ? 61.092 26.650 45.914  1.00 13.75 ? 407 ASN A O   1 
ATOM   3033 C  CB  . ASN A 1 385 ? 58.489 26.690 47.079  1.00 15.10 ? 407 ASN A CB  1 
ATOM   3034 C  CG  . ASN A 1 385 ? 57.709 25.908 45.997  1.00 17.67 ? 407 ASN A CG  1 
ATOM   3035 O  OD1 . ASN A 1 385 ? 57.511 26.382 44.879  1.00 17.97 ? 407 ASN A OD1 1 
ATOM   3036 N  ND2 . ASN A 1 385 ? 57.269 24.695 46.348  1.00 20.84 ? 407 ASN A ND2 1 
ATOM   3037 N  N   . ARG A 1 386 ? 60.537 28.391 44.581  1.00 14.46 ? 408 ARG A N   1 
ATOM   3038 C  CA  . ARG A 1 386 ? 61.622 28.198 43.647  1.00 14.78 ? 408 ARG A CA  1 
ATOM   3039 C  C   . ARG A 1 386 ? 62.988 28.348 44.327  1.00 15.18 ? 408 ARG A C   1 
ATOM   3040 O  O   . ARG A 1 386 ? 63.940 27.717 43.923  1.00 16.10 ? 408 ARG A O   1 
ATOM   3041 C  CB  . ARG A 1 386 ? 61.501 29.151 42.452  1.00 14.89 ? 408 ARG A CB  1 
ATOM   3042 C  CG  . ARG A 1 386 ? 62.459 28.795 41.325  1.00 14.36 ? 408 ARG A CG  1 
ATOM   3043 C  CD  . ARG A 1 386 ? 62.437 29.772 40.186  1.00 16.25 ? 408 ARG A CD  1 
ATOM   3044 N  NE  . ARG A 1 386 ? 61.138 29.893 39.513  1.00 17.07 ? 408 ARG A NE  1 
ATOM   3045 C  CZ  . ARG A 1 386 ? 60.769 29.217 38.431  1.00 18.63 ? 408 ARG A CZ  1 
ATOM   3046 N  NH1 . ARG A 1 386 ? 61.582 28.314 37.901  1.00 18.02 ? 408 ARG A NH1 1 
ATOM   3047 N  NH2 . ARG A 1 386 ? 59.571 29.441 37.874  1.00 18.58 ? 408 ARG A NH2 1 
ATOM   3048 N  N   . PHE A 1 387 ? 63.068 29.151 45.379  1.00 15.54 ? 409 PHE A N   1 
ATOM   3049 C  CA  . PHE A 1 387 ? 64.314 29.348 46.106  1.00 15.43 ? 409 PHE A CA  1 
ATOM   3050 C  C   . PHE A 1 387 ? 64.319 28.633 47.459  1.00 15.79 ? 409 PHE A C   1 
ATOM   3051 O  O   . PHE A 1 387 ? 64.962 29.069 48.422  1.00 15.91 ? 409 PHE A O   1 
ATOM   3052 C  CB  . PHE A 1 387 ? 64.607 30.854 46.213  1.00 14.94 ? 409 PHE A CB  1 
ATOM   3053 C  CG  . PHE A 1 387 ? 64.886 31.472 44.886  1.00 15.21 ? 409 PHE A CG  1 
ATOM   3054 C  CD1 . PHE A 1 387 ? 66.152 31.350 44.306  1.00 13.36 ? 409 PHE A CD1 1 
ATOM   3055 C  CD2 . PHE A 1 387 ? 63.864 32.087 44.159  1.00 13.58 ? 409 PHE A CD2 1 
ATOM   3056 C  CE1 . PHE A 1 387 ? 66.396 31.868 43.028  1.00 15.24 ? 409 PHE A CE1 1 
ATOM   3057 C  CE2 . PHE A 1 387 ? 64.100 32.609 42.906  1.00 13.68 ? 409 PHE A CE2 1 
ATOM   3058 C  CZ  . PHE A 1 387 ? 65.367 32.512 42.329  1.00 14.76 ? 409 PHE A CZ  1 
ATOM   3059 N  N   . LEU A 1 388 ? 63.583 27.530 47.506  1.00 15.94 ? 410 LEU A N   1 
ATOM   3060 C  CA  . LEU A 1 388 ? 63.494 26.671 48.681  1.00 16.76 ? 410 LEU A CA  1 
ATOM   3061 C  C   . LEU A 1 388 ? 63.797 25.252 48.276  1.00 17.13 ? 410 LEU A C   1 
ATOM   3062 O  O   . LEU A 1 388 ? 63.360 24.806 47.217  1.00 17.25 ? 410 LEU A O   1 
ATOM   3063 C  CB  . LEU A 1 388 ? 62.092 26.692 49.300  1.00 16.03 ? 410 LEU A CB  1 
ATOM   3064 C  CG  . LEU A 1 388 ? 61.529 27.951 49.959  1.00 14.78 ? 410 LEU A CG  1 
ATOM   3065 C  CD1 . LEU A 1 388 ? 60.121 27.667 50.444  1.00 12.83 ? 410 LEU A CD1 1 
ATOM   3066 C  CD2 . LEU A 1 388 ? 62.422 28.486 51.126  1.00 12.52 ? 410 LEU A CD2 1 
ATOM   3067 N  N   . ASN A 1 389 ? 64.540 24.549 49.131  1.00 18.34 ? 411 ASN A N   1 
ATOM   3068 C  CA  . ASN A 1 389 ? 64.728 23.096 49.032  1.00 18.83 ? 411 ASN A CA  1 
ATOM   3069 C  C   . ASN A 1 389 ? 63.497 22.399 49.632  1.00 19.83 ? 411 ASN A C   1 
ATOM   3070 O  O   . ASN A 1 389 ? 62.741 23.036 50.361  1.00 19.26 ? 411 ASN A O   1 
ATOM   3071 C  CB  . ASN A 1 389 ? 65.988 22.715 49.814  1.00 18.56 ? 411 ASN A CB  1 
ATOM   3072 C  CG  . ASN A 1 389 ? 67.278 23.190 49.129  1.00 18.74 ? 411 ASN A CG  1 
ATOM   3073 O  OD1 . ASN A 1 389 ? 67.441 23.053 47.916  1.00 15.53 ? 411 ASN A OD1 1 
ATOM   3074 N  ND2 . ASN A 1 389 ? 68.199 23.746 49.918  1.00 19.41 ? 411 ASN A ND2 1 
ATOM   3075 N  N   . PRO A 1 390 ? 63.285 21.097 49.340  1.00 21.18 ? 412 PRO A N   1 
ATOM   3076 C  CA  . PRO A 1 390 ? 62.121 20.370 49.906  1.00 22.32 ? 412 PRO A CA  1 
ATOM   3077 C  C   . PRO A 1 390 ? 61.949 20.461 51.430  1.00 23.42 ? 412 PRO A C   1 
ATOM   3078 O  O   . PRO A 1 390 ? 60.821 20.407 51.927  1.00 24.26 ? 412 PRO A O   1 
ATOM   3079 C  CB  . PRO A 1 390 ? 62.373 18.916 49.478  1.00 22.04 ? 412 PRO A CB  1 
ATOM   3080 C  CG  . PRO A 1 390 ? 63.136 19.045 48.214  1.00 21.82 ? 412 PRO A CG  1 
ATOM   3081 C  CD  . PRO A 1 390 ? 64.061 20.232 48.429  1.00 21.43 ? 412 PRO A CD  1 
ATOM   3082 N  N   . ASP A 1 391 ? 63.041 20.627 52.166  1.00 24.77 ? 413 ASP A N   1 
ATOM   3083 C  CA  . ASP A 1 391 ? 62.949 20.761 53.623  1.00 26.05 ? 413 ASP A CA  1 
ATOM   3084 C  C   . ASP A 1 391 ? 62.645 22.192 54.094  1.00 26.29 ? 413 ASP A C   1 
ATOM   3085 O  O   . ASP A 1 391 ? 62.576 22.459 55.303  1.00 27.29 ? 413 ASP A O   1 
ATOM   3086 C  CB  . ASP A 1 391 ? 64.207 20.202 54.302  1.00 26.37 ? 413 ASP A CB  1 
ATOM   3087 C  CG  . ASP A 1 391 ? 65.424 21.096 54.123  1.00 28.78 ? 413 ASP A CG  1 
ATOM   3088 O  OD1 . ASP A 1 391 ? 65.419 21.960 53.212  1.00 28.04 ? 413 ASP A OD1 1 
ATOM   3089 O  OD2 . ASP A 1 391 ? 66.390 20.930 54.906  1.00 29.99 ? 413 ASP A OD2 1 
ATOM   3090 N  N   . GLY A 1 392 ? 62.442 23.111 53.152  1.00 25.93 ? 414 GLY A N   1 
ATOM   3091 C  CA  . GLY A 1 392 ? 62.121 24.496 53.513  1.00 25.76 ? 414 GLY A CA  1 
ATOM   3092 C  C   . GLY A 1 392 ? 63.316 25.425 53.720  1.00 25.19 ? 414 GLY A C   1 
ATOM   3093 O  O   . GLY A 1 392 ? 63.148 26.597 54.047  1.00 25.05 ? 414 GLY A O   1 
ATOM   3094 N  N   . SER A 1 393 ? 64.519 24.902 53.532  1.00 24.84 ? 415 SER A N   1 
ATOM   3095 C  CA  . SER A 1 393 ? 65.730 25.713 53.634  1.00 24.49 ? 415 SER A CA  1 
ATOM   3096 C  C   . SER A 1 393 ? 65.983 26.444 52.310  1.00 24.21 ? 415 SER A C   1 
ATOM   3097 O  O   . SER A 1 393 ? 65.528 26.006 51.256  1.00 23.87 ? 415 SER A O   1 
ATOM   3098 C  CB  . SER A 1 393 ? 66.929 24.833 54.002  1.00 24.37 ? 415 SER A CB  1 
ATOM   3099 O  OG  . SER A 1 393 ? 67.175 23.838 53.018  1.00 23.35 ? 415 SER A OG  1 
ATOM   3100 N  N   . GLU A 1 394 ? 66.719 27.550 52.377  1.00 24.55 ? 416 GLU A N   1 
ATOM   3101 C  CA  . GLU A 1 394 ? 67.025 28.375 51.204  1.00 23.93 ? 416 GLU A CA  1 
ATOM   3102 C  C   . GLU A 1 394 ? 67.795 27.579 50.156  1.00 23.93 ? 416 GLU A C   1 
ATOM   3103 O  O   . GLU A 1 394 ? 68.843 27.007 50.456  1.00 23.15 ? 416 GLU A O   1 
ATOM   3104 C  CB  . GLU A 1 394 ? 67.808 29.646 51.593  1.00 23.87 ? 416 GLU A CB  1 
ATOM   3105 C  CG  . GLU A 1 394 ? 68.344 30.427 50.370  1.00 24.01 ? 416 GLU A CG  1 
ATOM   3106 C  CD  . GLU A 1 394 ? 69.018 31.762 50.722  1.00 25.64 ? 416 GLU A CD  1 
ATOM   3107 O  OE1 . GLU A 1 394 ? 68.765 32.329 51.822  1.00 24.11 ? 416 GLU A OE1 1 
ATOM   3108 O  OE2 . GLU A 1 394 ? 69.781 32.257 49.864  1.00 23.86 ? 416 GLU A OE2 1 
ATOM   3109 N  N   . LYS A 1 395 ? 67.257 27.537 48.933  1.00 23.43 ? 417 LYS A N   1 
ATOM   3110 C  CA  . LYS A 1 395 ? 67.941 26.881 47.828  1.00 23.37 ? 417 LYS A CA  1 
ATOM   3111 C  C   . LYS A 1 395 ? 68.938 27.846 47.185  1.00 23.52 ? 417 LYS A C   1 
ATOM   3112 O  O   . LYS A 1 395 ? 68.583 28.959 46.788  1.00 22.71 ? 417 LYS A O   1 
ATOM   3113 C  CB  . LYS A 1 395 ? 66.965 26.337 46.778  1.00 22.82 ? 417 LYS A CB  1 
ATOM   3114 C  CG  . LYS A 1 395 ? 67.692 25.705 45.602  1.00 23.75 ? 417 LYS A CG  1 
ATOM   3115 C  CD  . LYS A 1 395 ? 66.738 25.134 44.563  1.00 24.49 ? 417 LYS A CD  1 
ATOM   3116 C  CE  . LYS A 1 395 ? 67.505 24.349 43.512  1.00 24.07 ? 417 LYS A CE  1 
ATOM   3117 N  NZ  . LYS A 1 395 ? 66.674 24.157 42.269  1.00 26.11 ? 417 LYS A NZ  1 
ATOM   3118 N  N   . LYS A 1 396 ? 70.187 27.403 47.109  1.00 23.79 ? 418 LYS A N   1 
ATOM   3119 C  CA  . LYS A 1 396 ? 71.290 28.243 46.639  1.00 24.43 ? 418 LYS A CA  1 
ATOM   3120 C  C   . LYS A 1 396 ? 72.009 27.640 45.427  1.00 23.83 ? 418 LYS A C   1 
ATOM   3121 O  O   . LYS A 1 396 ? 72.898 28.271 44.873  1.00 24.31 ? 418 LYS A O   1 
ATOM   3122 C  CB  . LYS A 1 396 ? 72.312 28.460 47.765  1.00 24.94 ? 418 LYS A CB  1 
ATOM   3123 C  CG  . LYS A 1 396 ? 71.818 29.203 49.030  1.00 26.08 ? 418 LYS A CG  1 
ATOM   3124 C  CD  . LYS A 1 396 ? 72.919 29.182 50.099  1.00 27.13 ? 418 LYS A CD  1 
ATOM   3125 C  CE  . LYS A 1 396 ? 72.519 29.890 51.402  1.00 28.79 ? 418 LYS A CE  1 
ATOM   3126 N  NZ  . LYS A 1 396 ? 72.731 31.383 51.379  1.00 29.28 ? 418 LYS A NZ  1 
ATOM   3127 N  N   . ASP A 1 397 ? 71.617 26.434 45.020  1.00 23.34 ? 419 ASP A N   1 
ATOM   3128 C  CA  . ASP A 1 397 ? 72.320 25.693 43.955  1.00 23.69 ? 419 ASP A CA  1 
ATOM   3129 C  C   . ASP A 1 397 ? 71.592 25.665 42.598  1.00 22.80 ? 419 ASP A C   1 
ATOM   3130 O  O   . ASP A 1 397 ? 70.580 24.976 42.452  1.00 22.08 ? 419 ASP A O   1 
ATOM   3131 C  CB  . ASP A 1 397 ? 72.671 24.269 44.434  1.00 24.36 ? 419 ASP A CB  1 
ATOM   3132 C  CG  . ASP A 1 397 ? 71.436 23.358 44.594  1.00 27.03 ? 419 ASP A CG  1 
ATOM   3133 O  OD1 . ASP A 1 397 ? 71.468 22.235 44.036  1.00 28.36 ? 419 ASP A OD1 1 
ATOM   3134 O  OD2 . ASP A 1 397 ? 70.443 23.751 45.272  1.00 29.18 ? 419 ASP A OD2 1 
ATOM   3135 N  N   . PHE A 1 398 ? 72.120 26.434 41.630  1.00 21.45 ? 420 PHE A N   1 
ATOM   3136 C  CA  . PHE A 1 398 ? 71.558 26.566 40.291  1.00 20.60 ? 420 PHE A CA  1 
ATOM   3137 C  C   . PHE A 1 398 ? 72.639 26.394 39.204  1.00 20.85 ? 420 PHE A C   1 
ATOM   3138 O  O   . PHE A 1 398 ? 73.806 26.756 39.401  1.00 20.65 ? 420 PHE A O   1 
ATOM   3139 C  CB  . PHE A 1 398 ? 70.808 27.892 40.134  1.00 20.49 ? 420 PHE A CB  1 
ATOM   3140 C  CG  . PHE A 1 398 ? 69.606 28.019 41.042  1.00 19.18 ? 420 PHE A CG  1 
ATOM   3141 C  CD1 . PHE A 1 398 ? 68.351 27.589 40.623  1.00 18.53 ? 420 PHE A CD1 1 
ATOM   3142 C  CD2 . PHE A 1 398 ? 69.738 28.564 42.321  1.00 17.00 ? 420 PHE A CD2 1 
ATOM   3143 C  CE1 . PHE A 1 398 ? 67.243 27.671 41.467  1.00 18.01 ? 420 PHE A CE1 1 
ATOM   3144 C  CE2 . PHE A 1 398 ? 68.637 28.662 43.167  1.00 17.50 ? 420 PHE A CE2 1 
ATOM   3145 C  CZ  . PHE A 1 398 ? 67.383 28.220 42.734  1.00 17.80 ? 420 PHE A CZ  1 
ATOM   3146 N  N   . TYR A 1 399 ? 72.239 25.840 38.062  1.00 20.85 ? 421 TYR A N   1 
ATOM   3147 C  CA  . TYR A 1 399 ? 73.188 25.343 37.043  1.00 20.71 ? 421 TYR A CA  1 
ATOM   3148 C  C   . TYR A 1 399 ? 72.877 25.795 35.628  1.00 21.12 ? 421 TYR A C   1 
ATOM   3149 O  O   . TYR A 1 399 ? 71.707 25.962 35.244  1.00 20.24 ? 421 TYR A O   1 
ATOM   3150 C  CB  . TYR A 1 399 ? 73.279 23.802 37.078  1.00 20.44 ? 421 TYR A CB  1 
ATOM   3151 C  CG  . TYR A 1 399 ? 73.696 23.297 38.431  1.00 20.55 ? 421 TYR A CG  1 
ATOM   3152 C  CD1 . TYR A 1 399 ? 75.021 22.934 38.687  1.00 20.79 ? 421 TYR A CD1 1 
ATOM   3153 C  CD2 . TYR A 1 399 ? 72.780 23.228 39.478  1.00 19.22 ? 421 TYR A CD2 1 
ATOM   3154 C  CE1 . TYR A 1 399 ? 75.418 22.503 39.954  1.00 20.78 ? 421 TYR A CE1 1 
ATOM   3155 C  CE2 . TYR A 1 399 ? 73.170 22.814 40.750  1.00 21.80 ? 421 TYR A CE2 1 
ATOM   3156 C  CZ  . TYR A 1 399 ? 74.490 22.456 40.977  1.00 22.62 ? 421 TYR A CZ  1 
ATOM   3157 O  OH  . TYR A 1 399 ? 74.860 22.042 42.229  1.00 24.65 ? 421 TYR A OH  1 
ATOM   3158 N  N   . LYS A 1 400 ? 73.952 25.971 34.855  1.00 21.18 ? 422 LYS A N   1 
ATOM   3159 C  CA  . LYS A 1 400 ? 73.858 26.210 33.428  1.00 22.18 ? 422 LYS A CA  1 
ATOM   3160 C  C   . LYS A 1 400 ? 75.072 25.606 32.747  1.00 22.76 ? 422 LYS A C   1 
ATOM   3161 O  O   . LYS A 1 400 ? 76.166 25.717 33.274  1.00 23.36 ? 422 LYS A O   1 
ATOM   3162 C  CB  . LYS A 1 400 ? 73.821 27.713 33.125  1.00 21.19 ? 422 LYS A CB  1 
ATOM   3163 C  CG  . LYS A 1 400 ? 73.306 27.971 31.722  1.00 22.13 ? 422 LYS A CG  1 
ATOM   3164 C  CD  . LYS A 1 400 ? 73.649 29.344 31.217  1.00 21.65 ? 422 LYS A CD  1 
ATOM   3165 C  CE  . LYS A 1 400 ? 73.394 29.436 29.749  1.00 19.58 ? 422 LYS A CE  1 
ATOM   3166 N  NZ  . LYS A 1 400 ? 71.954 29.373 29.461  1.00 23.13 ? 422 LYS A NZ  1 
ATOM   3167 N  N   . ASP A 1 401 ? 74.882 24.992 31.579  1.00 24.20 ? 423 ASP A N   1 
ATOM   3168 C  CA  . ASP A 1 401 ? 76.007 24.441 30.795  1.00 25.67 ? 423 ASP A CA  1 
ATOM   3169 C  C   . ASP A 1 401 ? 76.926 23.572 31.677  1.00 25.89 ? 423 ASP A C   1 
ATOM   3170 O  O   . ASP A 1 401 ? 78.157 23.691 31.627  1.00 25.62 ? 423 ASP A O   1 
ATOM   3171 C  CB  . ASP A 1 401 ? 76.832 25.562 30.127  1.00 25.78 ? 423 ASP A CB  1 
ATOM   3172 C  CG  . ASP A 1 401 ? 76.058 26.329 29.057  1.00 27.56 ? 423 ASP A CG  1 
ATOM   3173 O  OD1 . ASP A 1 401 ? 76.311 27.547 28.906  1.00 30.21 ? 423 ASP A OD1 1 
ATOM   3174 O  OD2 . ASP A 1 401 ? 75.223 25.731 28.345  1.00 29.37 ? 423 ASP A OD2 1 
ATOM   3175 N  N   . GLY A 1 402 ? 76.303 22.759 32.531  1.00 26.26 ? 424 GLY A N   1 
ATOM   3176 C  CA  . GLY A 1 402 ? 76.994 21.735 33.310  1.00 27.11 ? 424 GLY A CA  1 
ATOM   3177 C  C   . GLY A 1 402 ? 77.787 22.228 34.490  1.00 27.65 ? 424 GLY A C   1 
ATOM   3178 O  O   . GLY A 1 402 ? 78.568 21.474 35.056  1.00 28.09 ? 424 GLY A O   1 
ATOM   3179 N  N   . LYS A 1 403 ? 77.589 23.496 34.855  1.00 28.77 ? 425 LYS A N   1 
ATOM   3180 C  CA  . LYS A 1 403 ? 78.363 24.161 35.911  1.00 29.33 ? 425 LYS A CA  1 
ATOM   3181 C  C   . LYS A 1 403 ? 77.466 24.952 36.864  1.00 29.20 ? 425 LYS A C   1 
ATOM   3182 O  O   . LYS A 1 403 ? 76.483 25.565 36.438  1.00 29.19 ? 425 LYS A O   1 
ATOM   3183 C  CB  . LYS A 1 403 ? 79.368 25.138 35.294  1.00 30.02 ? 425 LYS A CB  1 
ATOM   3184 C  CG  . LYS A 1 403 ? 80.490 24.499 34.466  1.00 32.41 ? 425 LYS A CG  1 
ATOM   3185 C  CD  . LYS A 1 403 ? 81.544 25.533 34.082  1.00 35.66 ? 425 LYS A CD  1 
ATOM   3186 C  CE  . LYS A 1 403 ? 81.142 26.382 32.880  1.00 37.42 ? 425 LYS A CE  1 
ATOM   3187 N  NZ  . LYS A 1 403 ? 82.173 27.450 32.634  1.00 38.58 ? 425 LYS A NZ  1 
ATOM   3188 N  N   . ARG A 1 404 ? 77.842 24.969 38.140  1.00 29.66 ? 426 ARG A N   1 
ATOM   3189 C  CA  . ARG A 1 404 ? 77.108 25.701 39.167  1.00 30.12 ? 426 ARG A CA  1 
ATOM   3190 C  C   . ARG A 1 404 ? 77.345 27.193 39.068  1.00 30.18 ? 426 ARG A C   1 
ATOM   3191 O  O   . ARG A 1 404 ? 78.498 27.656 39.050  1.00 30.25 ? 426 ARG A O   1 
ATOM   3192 C  CB  . ARG A 1 404 ? 77.482 25.227 40.563  1.00 30.42 ? 426 ARG A CB  1 
ATOM   3193 C  CG  . ARG A 1 404 ? 76.492 25.669 41.618  1.00 31.95 ? 426 ARG A CG  1 
ATOM   3194 C  CD  . ARG A 1 404 ? 77.217 26.032 42.863  1.00 34.88 ? 426 ARG A CD  1 
ATOM   3195 N  NE  . ARG A 1 404 ? 76.308 26.405 43.938  1.00 36.90 ? 426 ARG A NE  1 
ATOM   3196 C  CZ  . ARG A 1 404 ? 75.879 25.560 44.869  1.00 39.63 ? 426 ARG A CZ  1 
ATOM   3197 N  NH1 . ARG A 1 404 ? 76.260 24.283 44.833  1.00 40.11 ? 426 ARG A NH1 1 
ATOM   3198 N  NH2 . ARG A 1 404 ? 75.058 25.983 45.827  1.00 38.73 ? 426 ARG A NH2 1 
ATOM   3199 N  N   . LEU A 1 405 ? 76.232 27.926 39.018  1.00 29.88 ? 427 LEU A N   1 
ATOM   3200 C  CA  . LEU A 1 405 ? 76.227 29.366 38.848  1.00 29.74 ? 427 LEU A CA  1 
ATOM   3201 C  C   . LEU A 1 405 ? 76.548 30.096 40.130  1.00 29.42 ? 427 LEU A C   1 
ATOM   3202 O  O   . LEU A 1 405 ? 75.932 29.847 41.166  1.00 29.56 ? 427 LEU A O   1 
ATOM   3203 C  CB  . LEU A 1 405 ? 74.862 29.830 38.340  1.00 29.95 ? 427 LEU A CB  1 
ATOM   3204 C  CG  . LEU A 1 405 ? 74.559 29.637 36.865  1.00 29.93 ? 427 LEU A CG  1 
ATOM   3205 C  CD1 . LEU A 1 405 ? 73.074 29.789 36.641  1.00 31.29 ? 427 LEU A CD1 1 
ATOM   3206 C  CD2 . LEU A 1 405 ? 75.349 30.636 36.017  1.00 30.10 ? 427 LEU A CD2 1 
ATOM   3207 N  N   . LYS A 1 406 ? 77.512 31.004 40.057  1.00 29.07 ? 428 LYS A N   1 
ATOM   3208 C  CA  . LYS A 1 406 ? 77.744 31.934 41.158  1.00 29.44 ? 428 LYS A CA  1 
ATOM   3209 C  C   . LYS A 1 406 ? 76.638 32.996 41.141  1.00 28.40 ? 428 LYS A C   1 
ATOM   3210 O  O   . LYS A 1 406 ? 76.073 33.330 42.177  1.00 29.54 ? 428 LYS A O   1 
ATOM   3211 C  CB  . LYS A 1 406 ? 79.147 32.569 41.089  1.00 29.44 ? 428 LYS A CB  1 
ATOM   3212 C  CG  . LYS A 1 406 ? 79.396 33.598 42.194  1.00 32.49 ? 428 LYS A CG  1 
ATOM   3213 C  CD  . LYS A 1 406 ? 80.855 34.043 42.278  1.00 36.14 ? 428 LYS A CD  1 
ATOM   3214 C  CE  . LYS A 1 406 ? 80.994 35.328 43.100  1.00 38.76 ? 428 LYS A CE  1 
ATOM   3215 N  NZ  . LYS A 1 406 ? 82.315 36.040 42.896  1.00 40.67 ? 428 LYS A NZ  1 
ATOM   3216 N  N   . ASN A 1 407 ? 76.319 33.499 39.957  1.00 27.46 ? 429 ASN A N   1 
ATOM   3217 C  CA  . ASN A 1 407 ? 75.252 34.497 39.810  1.00 26.76 ? 429 ASN A CA  1 
ATOM   3218 C  C   . ASN A 1 407 ? 74.015 33.892 39.159  1.00 25.14 ? 429 ASN A C   1 
ATOM   3219 O  O   . ASN A 1 407 ? 74.044 33.508 37.990  1.00 24.44 ? 429 ASN A O   1 
ATOM   3220 C  CB  . ASN A 1 407 ? 75.746 35.692 39.004  1.00 27.02 ? 429 ASN A CB  1 
ATOM   3221 C  CG  . ASN A 1 407 ? 77.028 36.256 39.539  1.00 28.40 ? 429 ASN A CG  1 
ATOM   3222 O  OD1 . ASN A 1 407 ? 77.032 36.995 40.520  1.00 30.78 ? 429 ASN A OD1 1 
ATOM   3223 N  ND2 . ASN A 1 407 ? 78.144 35.910 38.892  1.00 31.60 ? 429 ASN A ND2 1 
ATOM   3224 N  N   . TYR A 1 408 ? 72.939 33.794 39.936  1.00 23.83 ? 430 TYR A N   1 
ATOM   3225 C  CA  . TYR A 1 408 ? 71.698 33.163 39.467  1.00 22.36 ? 430 TYR A CA  1 
ATOM   3226 C  C   . TYR A 1 408 ? 70.441 34.060 39.593  1.00 21.05 ? 430 TYR A C   1 
ATOM   3227 O  O   . TYR A 1 408 ? 69.433 33.847 38.902  1.00 20.65 ? 430 TYR A O   1 
ATOM   3228 C  CB  . TYR A 1 408 ? 71.513 31.788 40.122  1.00 22.59 ? 430 TYR A CB  1 
ATOM   3229 C  CG  . TYR A 1 408 ? 71.557 31.801 41.630  1.00 21.75 ? 430 TYR A CG  1 
ATOM   3230 C  CD1 . TYR A 1 408 ? 72.730 31.504 42.311  1.00 21.78 ? 430 TYR A CD1 1 
ATOM   3231 C  CD2 . TYR A 1 408 ? 70.404 32.093 42.383  1.00 21.52 ? 430 TYR A CD2 1 
ATOM   3232 C  CE1 . TYR A 1 408 ? 72.768 31.509 43.714  1.00 21.17 ? 430 TYR A CE1 1 
ATOM   3233 C  CE2 . TYR A 1 408 ? 70.431 32.095 43.772  1.00 21.86 ? 430 TYR A CE2 1 
ATOM   3234 C  CZ  . TYR A 1 408 ? 71.618 31.804 44.433  1.00 22.58 ? 430 TYR A CZ  1 
ATOM   3235 O  OH  . TYR A 1 408 ? 71.655 31.803 45.818  1.00 21.93 ? 430 TYR A OH  1 
ATOM   3236 N  N   . ASN A 1 409 ? 70.536 35.089 40.429  1.00 19.58 ? 431 ASN A N   1 
ATOM   3237 C  CA  . ASN A 1 409 ? 69.482 36.099 40.557  1.00 18.27 ? 431 ASN A CA  1 
ATOM   3238 C  C   . ASN A 1 409 ? 70.124 37.429 40.917  1.00 17.15 ? 431 ASN A C   1 
ATOM   3239 O  O   . ASN A 1 409 ? 70.805 37.552 41.939  1.00 17.15 ? 431 ASN A O   1 
ATOM   3240 C  CB  . ASN A 1 409 ? 68.473 35.662 41.628  1.00 18.16 ? 431 ASN A CB  1 
ATOM   3241 C  CG  . ASN A 1 409 ? 67.153 36.360 41.513  1.00 17.90 ? 431 ASN A CG  1 
ATOM   3242 O  OD1 . ASN A 1 409 ? 66.802 36.911 40.461  1.00 18.48 ? 431 ASN A OD1 1 
ATOM   3243 N  ND2 . ASN A 1 409 ? 66.386 36.339 42.606  1.00 16.30 ? 431 ASN A ND2 1 
ATOM   3244 N  N   . MET A 1 410 ? 69.965 38.426 40.058  1.00 16.13 ? 432 MET A N   1 
ATOM   3245 C  CA  . MET A 1 410 ? 70.793 39.612 40.183  1.00 14.90 ? 432 MET A CA  1 
ATOM   3246 C  C   . MET A 1 410 ? 69.984 40.936 40.149  1.00 15.23 ? 432 MET A C   1 
ATOM   3247 O  O   . MET A 1 410 ? 70.299 41.847 39.361  1.00 14.35 ? 432 MET A O   1 
ATOM   3248 C  CB  . MET A 1 410 ? 71.871 39.582 39.093  1.00 14.83 ? 432 MET A CB  1 
ATOM   3249 C  CG  . MET A 1 410 ? 72.661 38.234 38.940  1.00 13.37 ? 432 MET A CG  1 
ATOM   3250 S  SD  . MET A 1 410 ? 73.787 38.315 37.489  1.00 5.73  ? 432 MET A SD  1 
ATOM   3251 C  CE  . MET A 1 410 ? 74.805 39.661 38.044  1.00 7.07  ? 432 MET A CE  1 
ATOM   3252 N  N   . PRO A 1 411 ? 68.931 41.042 40.993  1.00 15.27 ? 433 PRO A N   1 
ATOM   3253 C  CA  . PRO A 1 411 ? 68.094 42.253 40.960  1.00 16.16 ? 433 PRO A CA  1 
ATOM   3254 C  C   . PRO A 1 411 ? 68.799 43.494 41.507  1.00 16.73 ? 433 PRO A C   1 
ATOM   3255 O  O   . PRO A 1 411 ? 68.370 44.615 41.222  1.00 16.14 ? 433 PRO A O   1 
ATOM   3256 C  CB  . PRO A 1 411 ? 66.884 41.896 41.852  1.00 15.78 ? 433 PRO A CB  1 
ATOM   3257 C  CG  . PRO A 1 411 ? 67.308 40.758 42.673  1.00 16.01 ? 433 PRO A CG  1 
ATOM   3258 C  CD  . PRO A 1 411 ? 68.460 40.059 41.990  1.00 15.14 ? 433 PRO A CD  1 
ATOM   3259 N  N   . TRP A 1 412 ? 69.865 43.285 42.280  1.00 17.09 ? 434 TRP A N   1 
ATOM   3260 C  CA  . TRP A 1 412 ? 70.596 44.361 42.930  1.00 19.21 ? 434 TRP A CA  1 
ATOM   3261 C  C   . TRP A 1 412 ? 71.831 44.815 42.149  1.00 20.91 ? 434 TRP A C   1 
ATOM   3262 O  O   . TRP A 1 412 ? 72.690 45.491 42.711  1.00 21.63 ? 434 TRP A O   1 
ATOM   3263 C  CB  . TRP A 1 412 ? 71.059 43.919 44.326  1.00 18.96 ? 434 TRP A CB  1 
ATOM   3264 C  CG  . TRP A 1 412 ? 70.018 43.173 45.085  1.00 19.02 ? 434 TRP A CG  1 
ATOM   3265 C  CD1 . TRP A 1 412 ? 69.935 41.823 45.248  1.00 18.31 ? 434 TRP A CD1 1 
ATOM   3266 C  CD2 . TRP A 1 412 ? 68.893 43.737 45.774  1.00 18.49 ? 434 TRP A CD2 1 
ATOM   3267 N  NE1 . TRP A 1 412 ? 68.838 41.507 46.010  1.00 19.86 ? 434 TRP A NE1 1 
ATOM   3268 C  CE2 . TRP A 1 412 ? 68.180 42.662 46.350  1.00 18.56 ? 434 TRP A CE2 1 
ATOM   3269 C  CE3 . TRP A 1 412 ? 68.439 45.050 45.989  1.00 17.57 ? 434 TRP A CE3 1 
ATOM   3270 C  CZ2 . TRP A 1 412 ? 67.012 42.850 47.097  1.00 18.99 ? 434 TRP A CZ2 1 
ATOM   3271 C  CZ3 . TRP A 1 412 ? 67.291 45.238 46.744  1.00 17.86 ? 434 TRP A CZ3 1 
ATOM   3272 C  CH2 . TRP A 1 412 ? 66.584 44.140 47.284  1.00 18.40 ? 434 TRP A CH2 1 
ATOM   3273 N  N   . GLY A 1 413 ? 71.938 44.439 40.878  1.00 22.04 ? 435 GLY A N   1 
ATOM   3274 C  CA  . GLY A 1 413 ? 73.100 44.799 40.086  1.00 24.14 ? 435 GLY A CA  1 
ATOM   3275 C  C   . GLY A 1 413 ? 74.263 43.865 40.373  1.00 25.21 ? 435 GLY A C   1 
ATOM   3276 O  O   . GLY A 1 413 ? 74.062 42.752 40.840  1.00 25.02 ? 435 GLY A O   1 
ATOM   3277 N  N   . ALA A 1 414 ? 75.479 44.319 40.074  1.00 27.30 ? 436 ALA A N   1 
ATOM   3278 C  CA  . ALA A 1 414 ? 76.714 43.560 40.369  1.00 28.86 ? 436 ALA A CA  1 
ATOM   3279 C  C   . ALA A 1 414 ? 77.972 44.416 40.243  1.00 30.05 ? 436 ALA A C   1 
ATOM   3280 O  O   . ALA A 1 414 ? 77.941 45.520 39.692  1.00 30.35 ? 436 ALA A O   1 
ATOM   3281 C  CB  . ALA A 1 414 ? 76.832 42.337 39.459  1.00 28.76 ? 436 ALA A CB  1 
ATOM   3282 N  N   . GLY A 1 415 ? 79.088 43.883 40.729  1.00 31.59 ? 437 GLY A N   1 
ATOM   3283 C  CA  . GLY A 1 415 ? 80.343 44.613 40.716  1.00 33.15 ? 437 GLY A CA  1 
ATOM   3284 C  C   . GLY A 1 415 ? 80.272 45.699 41.760  1.00 34.19 ? 437 GLY A C   1 
ATOM   3285 O  O   . GLY A 1 415 ? 79.708 45.499 42.833  1.00 34.45 ? 437 GLY A O   1 
ATOM   3286 N  N   . HIS A 1 416 ? 80.819 46.861 41.429  1.00 35.38 ? 438 HIS A N   1 
ATOM   3287 C  CA  . HIS A 1 416 ? 80.876 47.977 42.370  1.00 36.48 ? 438 HIS A CA  1 
ATOM   3288 C  C   . HIS A 1 416 ? 79.717 48.932 42.156  1.00 36.44 ? 438 HIS A C   1 
ATOM   3289 O  O   . HIS A 1 416 ? 79.563 49.920 42.883  1.00 37.08 ? 438 HIS A O   1 
ATOM   3290 C  CB  . HIS A 1 416 ? 82.218 48.704 42.231  1.00 37.22 ? 438 HIS A CB  1 
ATOM   3291 C  CG  . HIS A 1 416 ? 83.395 47.860 42.613  1.00 38.58 ? 438 HIS A CG  1 
ATOM   3292 N  ND1 . HIS A 1 416 ? 84.392 47.524 41.722  1.00 39.96 ? 438 HIS A ND1 1 
ATOM   3293 C  CD2 . HIS A 1 416 ? 83.720 47.264 43.787  1.00 39.43 ? 438 HIS A CD2 1 
ATOM   3294 C  CE1 . HIS A 1 416 ? 85.288 46.769 42.334  1.00 40.45 ? 438 HIS A CE1 1 
ATOM   3295 N  NE2 . HIS A 1 416 ? 84.904 46.597 43.588  1.00 40.36 ? 438 HIS A NE2 1 
ATOM   3296 N  N   . ASN A 1 417 ? 78.903 48.615 41.154  1.00 36.23 ? 439 ASN A N   1 
ATOM   3297 C  CA  . ASN A 1 417 ? 77.716 49.380 40.809  1.00 35.71 ? 439 ASN A CA  1 
ATOM   3298 C  C   . ASN A 1 417 ? 76.483 48.557 41.177  1.00 34.70 ? 439 ASN A C   1 
ATOM   3299 O  O   . ASN A 1 417 ? 75.703 48.150 40.311  1.00 34.86 ? 439 ASN A O   1 
ATOM   3300 C  CB  . ASN A 1 417 ? 77.738 49.703 39.312  1.00 36.34 ? 439 ASN A CB  1 
ATOM   3301 C  CG  . ASN A 1 417 ? 77.149 51.062 38.998  1.00 37.60 ? 439 ASN A CG  1 
ATOM   3302 O  OD1 . ASN A 1 417 ? 77.206 51.982 39.822  1.00 40.03 ? 439 ASN A OD1 1 
ATOM   3303 N  ND2 . ASN A 1 417 ? 76.591 51.206 37.797  1.00 37.03 ? 439 ASN A ND2 1 
ATOM   3304 N  N   . HIS A 1 418 ? 76.347 48.281 42.469  1.00 32.92 ? 440 HIS A N   1 
ATOM   3305 C  CA  . HIS A 1 418 ? 75.271 47.455 42.992  1.00 31.57 ? 440 HIS A CA  1 
ATOM   3306 C  C   . HIS A 1 418 ? 74.534 48.213 44.090  1.00 29.88 ? 440 HIS A C   1 
ATOM   3307 O  O   . HIS A 1 418 ? 75.046 49.204 44.619  1.00 29.20 ? 440 HIS A O   1 
ATOM   3308 C  CB  . HIS A 1 418 ? 75.828 46.139 43.558  1.00 32.16 ? 440 HIS A CB  1 
ATOM   3309 C  CG  . HIS A 1 418 ? 76.643 46.316 44.800  1.00 34.15 ? 440 HIS A CG  1 
ATOM   3310 N  ND1 . HIS A 1 418 ? 78.012 46.476 44.776  1.00 35.58 ? 440 HIS A ND1 1 
ATOM   3311 C  CD2 . HIS A 1 418 ? 76.279 46.378 46.106  1.00 37.10 ? 440 HIS A CD2 1 
ATOM   3312 C  CE1 . HIS A 1 418 ? 78.457 46.620 46.014  1.00 37.67 ? 440 HIS A CE1 1 
ATOM   3313 N  NE2 . HIS A 1 418 ? 77.426 46.567 46.840  1.00 37.49 ? 440 HIS A NE2 1 
ATOM   3314 N  N   . CYS A 1 419 ? 73.348 47.720 44.443  1.00 27.58 ? 441 CYS A N   1 
ATOM   3315 C  CA  . CYS A 1 419 ? 72.473 48.379 45.406  1.00 25.46 ? 441 CYS A CA  1 
ATOM   3316 C  C   . CYS A 1 419 ? 73.121 48.633 46.768  1.00 25.21 ? 441 CYS A C   1 
ATOM   3317 O  O   . CYS A 1 419 ? 73.548 47.704 47.453  1.00 25.25 ? 441 CYS A O   1 
ATOM   3318 C  CB  . CYS A 1 419 ? 71.185 47.582 45.601  1.00 25.04 ? 441 CYS A CB  1 
ATOM   3319 S  SG  . CYS A 1 419 ? 70.007 48.466 46.599  1.00 19.42 ? 441 CYS A SG  1 
ATOM   3320 N  N   . LEU A 1 420 ? 73.161 49.901 47.153  1.00 24.64 ? 442 LEU A N   1 
ATOM   3321 C  CA  . LEU A 1 420 ? 73.681 50.306 48.456  1.00 24.80 ? 442 LEU A CA  1 
ATOM   3322 C  C   . LEU A 1 420 ? 72.655 50.129 49.568  1.00 24.30 ? 442 LEU A C   1 
ATOM   3323 O  O   . LEU A 1 420 ? 73.030 50.036 50.732  1.00 25.13 ? 442 LEU A O   1 
ATOM   3324 C  CB  . LEU A 1 420 ? 74.167 51.768 48.423  1.00 24.81 ? 442 LEU A CB  1 
ATOM   3325 C  CG  . LEU A 1 420 ? 75.181 52.218 47.355  1.00 25.73 ? 442 LEU A CG  1 
ATOM   3326 C  CD1 . LEU A 1 420 ? 75.712 53.597 47.709  1.00 27.48 ? 442 LEU A CD1 1 
ATOM   3327 C  CD2 . LEU A 1 420 ? 76.345 51.233 47.160  1.00 24.59 ? 442 LEU A CD2 1 
ATOM   3328 N  N   . GLY A 1 421 ? 71.368 50.071 49.220  1.00 23.92 ? 443 GLY A N   1 
ATOM   3329 C  CA  . GLY A 1 421 ? 70.302 49.978 50.234  1.00 23.07 ? 443 GLY A CA  1 
ATOM   3330 C  C   . GLY A 1 421 ? 69.664 48.602 50.394  1.00 22.17 ? 443 GLY A C   1 
ATOM   3331 O  O   . GLY A 1 421 ? 68.621 48.481 51.003  1.00 22.21 ? 443 GLY A O   1 
ATOM   3332 N  N   . ARG A 1 422 ? 70.309 47.568 49.863  1.00 22.11 ? 444 ARG A N   1 
ATOM   3333 C  CA  . ARG A 1 422 ? 69.707 46.226 49.717  1.00 21.91 ? 444 ARG A CA  1 
ATOM   3334 C  C   . ARG A 1 422 ? 69.113 45.626 50.999  1.00 21.58 ? 444 ARG A C   1 
ATOM   3335 O  O   . ARG A 1 422 ? 67.963 45.217 50.999  1.00 21.83 ? 444 ARG A O   1 
ATOM   3336 C  CB  . ARG A 1 422 ? 70.733 45.271 49.086  1.00 22.70 ? 444 ARG A CB  1 
ATOM   3337 C  CG  . ARG A 1 422 ? 70.388 43.767 49.075  1.00 23.31 ? 444 ARG A CG  1 
ATOM   3338 C  CD  . ARG A 1 422 ? 71.574 43.052 48.453  1.00 27.83 ? 444 ARG A CD  1 
ATOM   3339 N  NE  . ARG A 1 422 ? 71.355 41.642 48.173  1.00 32.14 ? 444 ARG A NE  1 
ATOM   3340 C  CZ  . ARG A 1 422 ? 72.092 40.930 47.318  1.00 35.37 ? 444 ARG A CZ  1 
ATOM   3341 N  NH1 . ARG A 1 422 ? 73.101 41.504 46.654  1.00 36.17 ? 444 ARG A NH1 1 
ATOM   3342 N  NH2 . ARG A 1 422 ? 71.812 39.652 47.100  1.00 35.57 ? 444 ARG A NH2 1 
ATOM   3343 N  N   . SER A 1 423 ? 69.890 45.563 52.080  1.00 20.93 ? 445 SER A N   1 
ATOM   3344 C  CA  . SER A 1 423 ? 69.383 45.041 53.343  1.00 20.67 ? 445 SER A CA  1 
ATOM   3345 C  C   . SER A 1 423 ? 68.190 45.839 53.858  1.00 19.86 ? 445 SER A C   1 
ATOM   3346 O  O   . SER A 1 423 ? 67.225 45.266 54.353  1.00 19.32 ? 445 SER A O   1 
ATOM   3347 C  CB  . SER A 1 423 ? 70.479 45.016 54.409  1.00 20.98 ? 445 SER A CB  1 
ATOM   3348 O  OG  . SER A 1 423 ? 71.503 44.120 54.030  1.00 22.31 ? 445 SER A OG  1 
ATOM   3349 N  N   . TYR A 1 424 ? 68.286 47.160 53.742  1.00 19.30 ? 446 TYR A N   1 
ATOM   3350 C  CA  . TYR A 1 424 ? 67.220 48.066 54.142  1.00 19.07 ? 446 TYR A CA  1 
ATOM   3351 C  C   . TYR A 1 424 ? 65.973 47.864 53.289  1.00 18.06 ? 446 TYR A C   1 
ATOM   3352 O  O   . TYR A 1 424 ? 64.859 47.912 53.819  1.00 17.21 ? 446 TYR A O   1 
ATOM   3353 C  CB  . TYR A 1 424 ? 67.693 49.531 54.094  1.00 19.88 ? 446 TYR A CB  1 
ATOM   3354 C  CG  . TYR A 1 424 ? 66.573 50.555 54.210  1.00 21.20 ? 446 TYR A CG  1 
ATOM   3355 C  CD1 . TYR A 1 424 ? 65.813 50.684 55.381  1.00 22.42 ? 446 TYR A CD1 1 
ATOM   3356 C  CD2 . TYR A 1 424 ? 66.262 51.381 53.137  1.00 22.97 ? 446 TYR A CD2 1 
ATOM   3357 C  CE1 . TYR A 1 424 ? 64.784 51.620 55.461  1.00 22.33 ? 446 TYR A CE1 1 
ATOM   3358 C  CE2 . TYR A 1 424 ? 65.246 52.316 53.210  1.00 23.65 ? 446 TYR A CE2 1 
ATOM   3359 C  CZ  . TYR A 1 424 ? 64.508 52.429 54.363  1.00 23.28 ? 446 TYR A CZ  1 
ATOM   3360 O  OH  . TYR A 1 424 ? 63.494 53.359 54.386  1.00 23.94 ? 446 TYR A OH  1 
ATOM   3361 N  N   . ALA A 1 425 ? 66.176 47.640 51.983  1.00 16.79 ? 447 ALA A N   1 
ATOM   3362 C  CA  . ALA A 1 425 ? 65.075 47.380 51.043  1.00 16.26 ? 447 ALA A CA  1 
ATOM   3363 C  C   . ALA A 1 425 ? 64.364 46.067 51.328  1.00 15.87 ? 447 ALA A C   1 
ATOM   3364 O  O   . ALA A 1 425 ? 63.135 46.016 51.299  1.00 15.35 ? 447 ALA A O   1 
ATOM   3365 C  CB  . ALA A 1 425 ? 65.564 47.405 49.589  1.00 15.47 ? 447 ALA A CB  1 
ATOM   3366 N  N   . VAL A 1 426 ? 65.140 45.014 51.597  1.00 15.29 ? 448 VAL A N   1 
ATOM   3367 C  CA  . VAL A 1 426 ? 64.576 43.707 51.948  1.00 15.53 ? 448 VAL A CA  1 
ATOM   3368 C  C   . VAL A 1 426 ? 63.801 43.783 53.265  1.00 15.68 ? 448 VAL A C   1 
ATOM   3369 O  O   . VAL A 1 426 ? 62.647 43.325 53.340  1.00 15.76 ? 448 VAL A O   1 
ATOM   3370 C  CB  . VAL A 1 426 ? 65.658 42.623 52.073  1.00 15.50 ? 448 VAL A CB  1 
ATOM   3371 C  CG1 . VAL A 1 426 ? 65.045 41.292 52.574  1.00 14.80 ? 448 VAL A CG1 1 
ATOM   3372 C  CG2 . VAL A 1 426 ? 66.373 42.447 50.740  1.00 16.11 ? 448 VAL A CG2 1 
ATOM   3373 N  N   . ASN A 1 427 ? 64.435 44.357 54.295  1.00 15.30 ? 449 ASN A N   1 
ATOM   3374 C  CA  . ASN A 1 427 ? 63.787 44.537 55.591  1.00 15.78 ? 449 ASN A CA  1 
ATOM   3375 C  C   . ASN A 1 427 ? 62.462 45.329 55.472  1.00 15.59 ? 449 ASN A C   1 
ATOM   3376 O  O   . ASN A 1 427 ? 61.471 44.981 56.106  1.00 16.34 ? 449 ASN A O   1 
ATOM   3377 C  CB  . ASN A 1 427 ? 64.717 45.274 56.578  1.00 16.03 ? 449 ASN A CB  1 
ATOM   3378 C  CG  . ASN A 1 427 ? 65.919 44.429 57.071  1.00 16.66 ? 449 ASN A CG  1 
ATOM   3379 O  OD1 . ASN A 1 427 ? 66.795 44.962 57.769  1.00 18.82 ? 449 ASN A OD1 1 
ATOM   3380 N  ND2 . ASN A 1 427 ? 65.958 43.139 56.731  1.00 16.36 ? 449 ASN A ND2 1 
ATOM   3381 N  N   . SER A 1 428 ? 62.479 46.411 54.694  1.00 14.60 ? 450 SER A N   1 
ATOM   3382 C  CA  . SER A 1 428 ? 61.319 47.272 54.495  1.00 14.60 ? 450 SER A CA  1 
ATOM   3383 C  C   . SER A 1 428 ? 60.171 46.576 53.788  1.00 14.35 ? 450 SER A C   1 
ATOM   3384 O  O   . SER A 1 428 ? 59.011 46.708 54.183  1.00 13.15 ? 450 SER A O   1 
ATOM   3385 C  CB  . SER A 1 428 ? 61.710 48.505 53.705  1.00 13.94 ? 450 SER A CB  1 
ATOM   3386 O  OG  . SER A 1 428 ? 62.644 49.279 54.424  1.00 17.08 ? 450 SER A OG  1 
ATOM   3387 N  N   . ILE A 1 429 ? 60.503 45.820 52.747  1.00 14.71 ? 451 ILE A N   1 
ATOM   3388 C  CA  . ILE A 1 429 ? 59.491 45.069 52.014  1.00 15.14 ? 451 ILE A CA  1 
ATOM   3389 C  C   . ILE A 1 429 ? 58.831 44.037 52.956  1.00 15.94 ? 451 ILE A C   1 
ATOM   3390 O  O   . ILE A 1 429 ? 57.602 43.952 53.036  1.00 15.23 ? 451 ILE A O   1 
ATOM   3391 C  CB  . ILE A 1 429 ? 60.096 44.468 50.734  1.00 15.40 ? 451 ILE A CB  1 
ATOM   3392 C  CG1 . ILE A 1 429 ? 60.327 45.599 49.715  1.00 13.68 ? 451 ILE A CG1 1 
ATOM   3393 C  CG2 . ILE A 1 429 ? 59.221 43.335 50.197  1.00 15.62 ? 451 ILE A CG2 1 
ATOM   3394 C  CD1 . ILE A 1 429 ? 61.155 45.259 48.511  1.00 12.15 ? 451 ILE A CD1 1 
ATOM   3395 N  N   . LYS A 1 430 ? 59.653 43.313 53.718  1.00 15.88 ? 452 LYS A N   1 
ATOM   3396 C  CA  . LYS A 1 430 ? 59.152 42.333 54.687  1.00 16.13 ? 452 LYS A CA  1 
ATOM   3397 C  C   . LYS A 1 430 ? 58.270 42.979 55.761  1.00 15.70 ? 452 LYS A C   1 
ATOM   3398 O  O   . LYS A 1 430 ? 57.257 42.415 56.158  1.00 16.08 ? 452 LYS A O   1 
ATOM   3399 C  CB  . LYS A 1 430 ? 60.312 41.591 55.371  1.00 15.79 ? 452 LYS A CB  1 
ATOM   3400 C  CG  . LYS A 1 430 ? 61.134 40.729 54.451  1.00 18.73 ? 452 LYS A CG  1 
ATOM   3401 C  CD  . LYS A 1 430 ? 62.184 39.973 55.256  1.00 20.97 ? 452 LYS A CD  1 
ATOM   3402 C  CE  . LYS A 1 430 ? 62.683 38.742 54.552  1.00 19.76 ? 452 LYS A CE  1 
ATOM   3403 N  NZ  . LYS A 1 430 ? 63.446 37.921 55.554  1.00 21.40 ? 452 LYS A NZ  1 
ATOM   3404 N  N   . GLN A 1 431 ? 58.663 44.154 56.241  1.00 14.99 ? 453 GLN A N   1 
ATOM   3405 C  CA  . GLN A 1 431 ? 57.864 44.866 57.252  1.00 14.18 ? 453 GLN A CA  1 
ATOM   3406 C  C   . GLN A 1 431 ? 56.485 45.266 56.697  1.00 13.74 ? 453 GLN A C   1 
ATOM   3407 O  O   . GLN A 1 431 ? 55.464 45.133 57.385  1.00 12.22 ? 453 GLN A O   1 
ATOM   3408 C  CB  . GLN A 1 431 ? 58.603 46.106 57.756  1.00 14.58 ? 453 GLN A CB  1 
ATOM   3409 C  CG  . GLN A 1 431 ? 59.777 45.786 58.665  1.00 16.10 ? 453 GLN A CG  1 
ATOM   3410 C  CD  . GLN A 1 431 ? 60.637 46.999 59.009  1.00 17.96 ? 453 GLN A CD  1 
ATOM   3411 O  OE1 . GLN A 1 431 ? 61.216 47.059 60.089  1.00 22.37 ? 453 GLN A OE1 1 
ATOM   3412 N  NE2 . GLN A 1 431 ? 60.742 47.944 58.095  1.00 14.45 ? 453 GLN A NE2 1 
ATOM   3413 N  N   . PHE A 1 432 ? 56.475 45.753 55.463  1.00 12.54 ? 454 PHE A N   1 
ATOM   3414 C  CA  . PHE A 1 432 ? 55.242 46.115 54.774  1.00 13.27 ? 454 PHE A CA  1 
ATOM   3415 C  C   . PHE A 1 432 ? 54.342 44.894 54.535  1.00 13.69 ? 454 PHE A C   1 
ATOM   3416 O  O   . PHE A 1 432 ? 53.147 44.920 54.830  1.00 14.90 ? 454 PHE A O   1 
ATOM   3417 C  CB  . PHE A 1 432 ? 55.578 46.849 53.454  1.00 13.19 ? 454 PHE A CB  1 
ATOM   3418 C  CG  . PHE A 1 432 ? 54.369 47.292 52.678  1.00 13.02 ? 454 PHE A CG  1 
ATOM   3419 C  CD1 . PHE A 1 432 ? 53.469 48.216 53.227  1.00 13.48 ? 454 PHE A CD1 1 
ATOM   3420 C  CD2 . PHE A 1 432 ? 54.134 46.793 51.410  1.00 12.47 ? 454 PHE A CD2 1 
ATOM   3421 C  CE1 . PHE A 1 432 ? 52.335 48.606 52.531  1.00 13.34 ? 454 PHE A CE1 1 
ATOM   3422 C  CE2 . PHE A 1 432 ? 53.010 47.197 50.685  1.00 12.64 ? 454 PHE A CE2 1 
ATOM   3423 C  CZ  . PHE A 1 432 ? 52.109 48.097 51.248  1.00 11.78 ? 454 PHE A CZ  1 
ATOM   3424 N  N   . VAL A 1 433 ? 54.910 43.815 54.018  1.00 13.86 ? 455 VAL A N   1 
ATOM   3425 C  CA  . VAL A 1 433 ? 54.147 42.597 53.783  1.00 14.22 ? 455 VAL A CA  1 
ATOM   3426 C  C   . VAL A 1 433 ? 53.569 42.068 55.095  1.00 15.32 ? 455 VAL A C   1 
ATOM   3427 O  O   . VAL A 1 433 ? 52.407 41.635 55.151  1.00 14.68 ? 455 VAL A O   1 
ATOM   3428 C  CB  . VAL A 1 433 ? 54.996 41.515 53.122  1.00 14.82 ? 455 VAL A CB  1 
ATOM   3429 C  CG1 . VAL A 1 433 ? 54.181 40.192 52.990  1.00 14.40 ? 455 VAL A CG1 1 
ATOM   3430 C  CG2 . VAL A 1 433 ? 55.496 41.979 51.752  1.00 13.29 ? 455 VAL A CG2 1 
ATOM   3431 N  N   . PHE A 1 434 ? 54.386 42.092 56.149  1.00 15.45 ? 456 PHE A N   1 
ATOM   3432 C  CA  . PHE A 1 434 ? 53.925 41.676 57.461  1.00 16.45 ? 456 PHE A CA  1 
ATOM   3433 C  C   . PHE A 1 434 ? 52.762 42.537 57.922  1.00 16.38 ? 456 PHE A C   1 
ATOM   3434 O  O   . PHE A 1 434 ? 51.755 42.020 58.368  1.00 15.98 ? 456 PHE A O   1 
ATOM   3435 C  CB  . PHE A 1 434 ? 55.052 41.745 58.487  1.00 16.55 ? 456 PHE A CB  1 
ATOM   3436 C  CG  . PHE A 1 434 ? 54.590 41.525 59.895  1.00 19.98 ? 456 PHE A CG  1 
ATOM   3437 C  CD1 . PHE A 1 434 ? 54.646 40.257 60.464  1.00 20.54 ? 456 PHE A CD1 1 
ATOM   3438 C  CD2 . PHE A 1 434 ? 54.092 42.588 60.662  1.00 21.51 ? 456 PHE A CD2 1 
ATOM   3439 C  CE1 . PHE A 1 434 ? 54.218 40.047 61.786  1.00 22.34 ? 456 PHE A CE1 1 
ATOM   3440 C  CE2 . PHE A 1 434 ? 53.662 42.379 61.984  1.00 23.34 ? 456 PHE A CE2 1 
ATOM   3441 C  CZ  . PHE A 1 434 ? 53.730 41.110 62.540  1.00 22.84 ? 456 PHE A CZ  1 
ATOM   3442 N  N   . LEU A 1 435 ? 52.920 43.854 57.847  1.00 16.64 ? 457 LEU A N   1 
ATOM   3443 C  CA  . LEU A 1 435 ? 51.838 44.744 58.235  1.00 17.86 ? 457 LEU A CA  1 
ATOM   3444 C  C   . LEU A 1 435 ? 50.536 44.502 57.449  1.00 17.52 ? 457 LEU A C   1 
ATOM   3445 O  O   . LEU A 1 435 ? 49.460 44.487 58.045  1.00 17.80 ? 457 LEU A O   1 
ATOM   3446 C  CB  . LEU A 1 435 ? 52.266 46.200 58.143  1.00 17.91 ? 457 LEU A CB  1 
ATOM   3447 C  CG  . LEU A 1 435 ? 53.159 46.676 59.295  1.00 19.72 ? 457 LEU A CG  1 
ATOM   3448 C  CD1 . LEU A 1 435 ? 53.706 48.034 58.905  1.00 19.62 ? 457 LEU A CD1 1 
ATOM   3449 C  CD2 . LEU A 1 435 ? 52.392 46.772 60.629  1.00 18.30 ? 457 LEU A CD2 1 
ATOM   3450 N  N   . VAL A 1 436 ? 50.642 44.297 56.133  1.00 17.51 ? 458 VAL A N   1 
ATOM   3451 C  CA  . VAL A 1 436 ? 49.477 44.047 55.284  1.00 17.11 ? 458 VAL A CA  1 
ATOM   3452 C  C   . VAL A 1 436 ? 48.782 42.700 55.620  1.00 18.17 ? 458 VAL A C   1 
ATOM   3453 O  O   . VAL A 1 436 ? 47.567 42.666 55.856  1.00 18.31 ? 458 VAL A O   1 
ATOM   3454 C  CB  . VAL A 1 436 ? 49.831 44.156 53.759  1.00 17.30 ? 458 VAL A CB  1 
ATOM   3455 C  CG1 . VAL A 1 436 ? 48.675 43.693 52.896  1.00 18.22 ? 458 VAL A CG1 1 
ATOM   3456 C  CG2 . VAL A 1 436 ? 50.184 45.578 53.382  1.00 15.39 ? 458 VAL A CG2 1 
ATOM   3457 N  N   . LEU A 1 437 ? 49.540 41.606 55.676  1.00 18.30 ? 459 LEU A N   1 
ATOM   3458 C  CA  . LEU A 1 437 ? 48.959 40.276 55.890  1.00 19.80 ? 459 LEU A CA  1 
ATOM   3459 C  C   . LEU A 1 437 ? 48.427 40.026 57.317  1.00 20.58 ? 459 LEU A C   1 
ATOM   3460 O  O   . LEU A 1 437 ? 47.591 39.137 57.534  1.00 20.63 ? 459 LEU A O   1 
ATOM   3461 C  CB  . LEU A 1 437 ? 49.936 39.172 55.473  1.00 19.52 ? 459 LEU A CB  1 
ATOM   3462 C  CG  . LEU A 1 437 ? 49.919 38.620 54.030  1.00 21.81 ? 459 LEU A CG  1 
ATOM   3463 C  CD1 . LEU A 1 437 ? 49.658 39.641 52.950  1.00 22.92 ? 459 LEU A CD1 1 
ATOM   3464 C  CD2 . LEU A 1 437 ? 51.191 37.878 53.720  1.00 21.14 ? 459 LEU A CD2 1 
ATOM   3465 N  N   . VAL A 1 438 ? 48.900 40.824 58.272  1.00 20.97 ? 460 VAL A N   1 
ATOM   3466 C  CA  . VAL A 1 438 ? 48.534 40.662 59.674  1.00 21.70 ? 460 VAL A CA  1 
ATOM   3467 C  C   . VAL A 1 438 ? 47.448 41.639 60.162  1.00 21.96 ? 460 VAL A C   1 
ATOM   3468 O  O   . VAL A 1 438 ? 46.563 41.246 60.922  1.00 22.70 ? 460 VAL A O   1 
ATOM   3469 C  CB  . VAL A 1 438 ? 49.813 40.657 60.589  1.00 21.55 ? 460 VAL A CB  1 
ATOM   3470 C  CG1 . VAL A 1 438 ? 49.457 40.772 62.064  1.00 22.69 ? 460 VAL A CG1 1 
ATOM   3471 C  CG2 . VAL A 1 438 ? 50.590 39.350 60.372  1.00 21.35 ? 460 VAL A CG2 1 
ATOM   3472 N  N   . HIS A 1 439 ? 47.504 42.892 59.720  1.00 21.74 ? 461 HIS A N   1 
ATOM   3473 C  CA  . HIS A 1 439 ? 46.542 43.919 60.142  1.00 21.95 ? 461 HIS A CA  1 
ATOM   3474 C  C   . HIS A 1 439 ? 45.362 44.103 59.207  1.00 21.28 ? 461 HIS A C   1 
ATOM   3475 O  O   . HIS A 1 439 ? 44.327 44.608 59.616  1.00 20.66 ? 461 HIS A O   1 
ATOM   3476 C  CB  . HIS A 1 439 ? 47.240 45.275 60.281  1.00 22.87 ? 461 HIS A CB  1 
ATOM   3477 C  CG  . HIS A 1 439 ? 48.037 45.423 61.541  1.00 25.70 ? 461 HIS A CG  1 
ATOM   3478 N  ND1 . HIS A 1 439 ? 49.387 45.153 61.605  1.00 27.69 ? 461 HIS A ND1 1 
ATOM   3479 C  CD2 . HIS A 1 439 ? 47.668 45.806 62.788  1.00 28.62 ? 461 HIS A CD2 1 
ATOM   3480 C  CE1 . HIS A 1 439 ? 49.820 45.375 62.834  1.00 29.12 ? 461 HIS A CE1 1 
ATOM   3481 N  NE2 . HIS A 1 439 ? 48.799 45.782 63.571  1.00 30.12 ? 461 HIS A NE2 1 
ATOM   3482 N  N   . LEU A 1 440 ? 45.528 43.714 57.944  1.00 20.87 ? 462 LEU A N   1 
ATOM   3483 C  CA  . LEU A 1 440 ? 44.547 44.034 56.925  1.00 20.47 ? 462 LEU A CA  1 
ATOM   3484 C  C   . LEU A 1 440 ? 43.915 42.796 56.336  1.00 20.31 ? 462 LEU A C   1 
ATOM   3485 O  O   . LEU A 1 440 ? 44.501 41.703 56.379  1.00 19.88 ? 462 LEU A O   1 
ATOM   3486 C  CB  . LEU A 1 440 ? 45.184 44.858 55.777  1.00 20.18 ? 462 LEU A CB  1 
ATOM   3487 C  CG  . LEU A 1 440 ? 45.992 46.136 56.099  1.00 20.91 ? 462 LEU A CG  1 
ATOM   3488 C  CD1 . LEU A 1 440 ? 46.363 46.887 54.838  1.00 19.00 ? 462 LEU A CD1 1 
ATOM   3489 C  CD2 . LEU A 1 440 ? 45.281 47.074 57.055  1.00 19.63 ? 462 LEU A CD2 1 
ATOM   3490 N  N   . ASP A 1 441 ? 42.701 42.983 55.820  1.00 20.07 ? 463 ASP A N   1 
ATOM   3491 C  CA  . ASP A 1 441 ? 42.146 42.135 54.784  1.00 20.94 ? 463 ASP A CA  1 
ATOM   3492 C  C   . ASP A 1 441 ? 42.497 42.807 53.454  1.00 20.68 ? 463 ASP A C   1 
ATOM   3493 O  O   . ASP A 1 441 ? 42.302 44.010 53.291  1.00 20.36 ? 463 ASP A O   1 
ATOM   3494 C  CB  . ASP A 1 441 ? 40.616 42.030 54.924  1.00 21.39 ? 463 ASP A CB  1 
ATOM   3495 C  CG  . ASP A 1 441 ? 40.188 41.144 56.078  1.00 22.77 ? 463 ASP A CG  1 
ATOM   3496 O  OD1 . ASP A 1 441 ? 40.929 40.201 56.426  1.00 24.15 ? 463 ASP A OD1 1 
ATOM   3497 O  OD2 . ASP A 1 441 ? 39.097 41.393 56.643  1.00 25.92 ? 463 ASP A OD2 1 
ATOM   3498 N  N   . LEU A 1 442 ? 43.034 42.037 52.518  1.00 20.69 ? 464 LEU A N   1 
ATOM   3499 C  CA  . LEU A 1 442 ? 43.363 42.567 51.202  1.00 20.57 ? 464 LEU A CA  1 
ATOM   3500 C  C   . LEU A 1 442 ? 42.843 41.654 50.096  1.00 20.80 ? 464 LEU A C   1 
ATOM   3501 O  O   . LEU A 1 442 ? 43.133 40.462 50.064  1.00 20.31 ? 464 LEU A O   1 
ATOM   3502 C  CB  . LEU A 1 442 ? 44.876 42.822 51.049  1.00 20.52 ? 464 LEU A CB  1 
ATOM   3503 C  CG  . LEU A 1 442 ? 45.300 43.316 49.653  1.00 20.74 ? 464 LEU A CG  1 
ATOM   3504 C  CD1 . LEU A 1 442 ? 44.851 44.756 49.444  1.00 20.46 ? 464 LEU A CD1 1 
ATOM   3505 C  CD2 . LEU A 1 442 ? 46.806 43.179 49.435  1.00 21.07 ? 464 LEU A CD2 1 
ATOM   3506 N  N   . GLU A 1 443 ? 42.084 42.234 49.175  1.00 20.86 ? 465 GLU A N   1 
ATOM   3507 C  CA  . GLU A 1 443 ? 41.424 41.437 48.148  1.00 21.51 ? 465 GLU A CA  1 
ATOM   3508 C  C   . GLU A 1 443 ? 41.494 42.081 46.784  1.00 21.00 ? 465 GLU A C   1 
ATOM   3509 O  O   . GLU A 1 443 ? 41.273 43.274 46.654  1.00 20.89 ? 465 GLU A O   1 
ATOM   3510 C  CB  . GLU A 1 443 ? 39.951 41.252 48.520  1.00 21.65 ? 465 GLU A CB  1 
ATOM   3511 C  CG  . GLU A 1 443 ? 39.740 40.365 49.735  1.00 24.01 ? 465 GLU A CG  1 
ATOM   3512 C  CD  . GLU A 1 443 ? 38.286 40.201 50.080  1.00 27.54 ? 465 GLU A CD  1 
ATOM   3513 O  OE1 . GLU A 1 443 ? 37.420 40.643 49.298  1.00 29.93 ? 465 GLU A OE1 1 
ATOM   3514 O  OE2 . GLU A 1 443 ? 38.008 39.628 51.144  1.00 32.44 ? 465 GLU A OE2 1 
ATOM   3515 N  N   . LEU A 1 444 ? 41.785 41.278 45.773  1.00 21.21 ? 466 LEU A N   1 
ATOM   3516 C  CA  . LEU A 1 444 ? 41.495 41.662 44.393  1.00 21.77 ? 466 LEU A CA  1 
ATOM   3517 C  C   . LEU A 1 444 ? 40.004 41.937 44.255  1.00 22.79 ? 466 LEU A C   1 
ATOM   3518 O  O   . LEU A 1 444 ? 39.187 41.214 44.829  1.00 22.44 ? 466 LEU A O   1 
ATOM   3519 C  CB  . LEU A 1 444 ? 41.867 40.529 43.436  1.00 21.68 ? 466 LEU A CB  1 
ATOM   3520 C  CG  . LEU A 1 444 ? 43.351 40.131 43.335  1.00 21.41 ? 466 LEU A CG  1 
ATOM   3521 C  CD1 . LEU A 1 444 ? 43.526 38.811 42.562  1.00 18.13 ? 466 LEU A CD1 1 
ATOM   3522 C  CD2 . LEU A 1 444 ? 44.154 41.256 42.690  1.00 18.38 ? 466 LEU A CD2 1 
ATOM   3523 N  N   . ILE A 1 445 ? 39.652 42.973 43.494  1.00 23.80 ? 467 ILE A N   1 
ATOM   3524 C  CA  . ILE A 1 445 ? 38.245 43.260 43.169  1.00 24.71 ? 467 ILE A CA  1 
ATOM   3525 C  C   . ILE A 1 445 ? 37.633 42.126 42.341  1.00 25.59 ? 467 ILE A C   1 
ATOM   3526 O  O   . ILE A 1 445 ? 36.493 41.712 42.587  1.00 26.49 ? 467 ILE A O   1 
ATOM   3527 C  CB  . ILE A 1 445 ? 38.096 44.608 42.423  1.00 24.56 ? 467 ILE A CB  1 
ATOM   3528 C  CG1 . ILE A 1 445 ? 38.391 45.787 43.365  1.00 24.71 ? 467 ILE A CG1 1 
ATOM   3529 C  CG2 . ILE A 1 445 ? 36.704 44.747 41.799  1.00 25.08 ? 467 ILE A CG2 1 
ATOM   3530 C  CD1 . ILE A 1 445 ? 37.402 45.949 44.498  1.00 23.47 ? 467 ILE A CD1 1 
ATOM   3531 N  N   . ASN A 1 446 ? 38.402 41.647 41.363  1.00 25.74 ? 468 ASN A N   1 
ATOM   3532 C  CA  . ASN A 1 446 ? 38.052 40.510 40.515  1.00 26.10 ? 468 ASN A CA  1 
ATOM   3533 C  C   . ASN A 1 446 ? 39.167 39.510 40.682  1.00 25.92 ? 468 ASN A C   1 
ATOM   3534 O  O   . ASN A 1 446 ? 40.285 39.762 40.253  1.00 25.84 ? 468 ASN A O   1 
ATOM   3535 C  CB  . ASN A 1 446 ? 37.949 40.953 39.038  1.00 26.28 ? 468 ASN A CB  1 
ATOM   3536 C  CG  . ASN A 1 446 ? 37.712 39.781 38.051  1.00 27.95 ? 468 ASN A CG  1 
ATOM   3537 O  OD1 . ASN A 1 446 ? 37.753 39.981 36.830  1.00 32.37 ? 468 ASN A OD1 1 
ATOM   3538 N  ND2 . ASN A 1 446 ? 37.471 38.578 38.566  1.00 27.90 ? 468 ASN A ND2 1 
ATOM   3539 N  N   . ALA A 1 447 ? 38.866 38.378 41.310  1.00 26.57 ? 469 ALA A N   1 
ATOM   3540 C  CA  . ALA A 1 447 ? 39.882 37.364 41.624  1.00 27.32 ? 469 ALA A CA  1 
ATOM   3541 C  C   . ALA A 1 447 ? 40.492 36.688 40.396  1.00 27.61 ? 469 ALA A C   1 
ATOM   3542 O  O   . ALA A 1 447 ? 41.550 36.079 40.500  1.00 28.36 ? 469 ALA A O   1 
ATOM   3543 C  CB  . ALA A 1 447 ? 39.314 36.322 42.589  1.00 27.57 ? 469 ALA A CB  1 
ATOM   3544 N  N   . ASP A 1 448 ? 39.826 36.807 39.248  1.00 27.95 ? 470 ASP A N   1 
ATOM   3545 C  CA  . ASP A 1 448 ? 40.283 36.255 37.980  1.00 28.40 ? 470 ASP A CA  1 
ATOM   3546 C  C   . ASP A 1 448 ? 41.033 37.279 37.121  1.00 28.02 ? 470 ASP A C   1 
ATOM   3547 O  O   . ASP A 1 448 ? 41.361 36.999 35.963  1.00 27.85 ? 470 ASP A O   1 
ATOM   3548 C  CB  . ASP A 1 448 ? 39.102 35.700 37.159  1.00 29.41 ? 470 ASP A CB  1 
ATOM   3549 C  CG  . ASP A 1 448 ? 38.438 34.479 37.801  1.00 32.54 ? 470 ASP A CG  1 
ATOM   3550 O  OD1 . ASP A 1 448 ? 38.700 34.169 38.985  1.00 37.17 ? 470 ASP A OD1 1 
ATOM   3551 O  OD2 . ASP A 1 448 ? 37.630 33.820 37.108  1.00 36.87 ? 470 ASP A OD2 1 
ATOM   3552 N  N   . VAL A 1 449 ? 41.314 38.457 37.672  1.00 27.44 ? 471 VAL A N   1 
ATOM   3553 C  CA  . VAL A 1 449 ? 42.111 39.452 36.944  1.00 26.66 ? 471 VAL A CA  1 
ATOM   3554 C  C   . VAL A 1 449 ? 43.460 38.821 36.537  1.00 26.34 ? 471 VAL A C   1 
ATOM   3555 O  O   . VAL A 1 449 ? 44.065 38.077 37.310  1.00 26.31 ? 471 VAL A O   1 
ATOM   3556 C  CB  . VAL A 1 449 ? 42.290 40.773 37.781  1.00 26.77 ? 471 VAL A CB  1 
ATOM   3557 C  CG1 . VAL A 1 449 ? 43.187 40.565 39.025  1.00 24.74 ? 471 VAL A CG1 1 
ATOM   3558 C  CG2 . VAL A 1 449 ? 42.790 41.925 36.913  1.00 26.40 ? 471 VAL A CG2 1 
ATOM   3559 N  N   . GLU A 1 450 ? 43.906 39.070 35.313  1.00 25.96 ? 472 GLU A N   1 
ATOM   3560 C  CA  . GLU A 1 450 ? 45.209 38.584 34.910  1.00 26.35 ? 472 GLU A CA  1 
ATOM   3561 C  C   . GLU A 1 450 ? 46.271 39.629 35.248  1.00 25.33 ? 472 GLU A C   1 
ATOM   3562 O  O   . GLU A 1 450 ? 45.997 40.829 35.318  1.00 25.06 ? 472 GLU A O   1 
ATOM   3563 C  CB  . GLU A 1 450 ? 45.258 38.215 33.408  1.00 27.41 ? 472 GLU A CB  1 
ATOM   3564 C  CG  . GLU A 1 450 ? 44.349 37.034 32.946  1.00 29.99 ? 472 GLU A CG  1 
ATOM   3565 C  CD  . GLU A 1 450 ? 44.587 35.733 33.697  1.00 35.27 ? 472 GLU A CD  1 
ATOM   3566 O  OE1 . GLU A 1 450 ? 45.764 35.383 33.962  1.00 37.42 ? 472 GLU A OE1 1 
ATOM   3567 O  OE2 . GLU A 1 450 ? 43.588 35.050 34.030  1.00 36.94 ? 472 GLU A OE2 1 
ATOM   3568 N  N   . ILE A 1 451 ? 47.482 39.146 35.467  1.00 24.29 ? 473 ILE A N   1 
ATOM   3569 C  CA  . ILE A 1 451 ? 48.628 39.992 35.732  1.00 23.77 ? 473 ILE A CA  1 
ATOM   3570 C  C   . ILE A 1 451 ? 48.907 40.944 34.551  1.00 22.98 ? 473 ILE A C   1 
ATOM   3571 O  O   . ILE A 1 451 ? 49.092 40.487 33.427  1.00 22.92 ? 473 ILE A O   1 
ATOM   3572 C  CB  . ILE A 1 451 ? 49.851 39.105 36.057  1.00 23.74 ? 473 ILE A CB  1 
ATOM   3573 C  CG1 . ILE A 1 451 ? 49.563 38.301 37.347  1.00 24.17 ? 473 ILE A CG1 1 
ATOM   3574 C  CG2 . ILE A 1 451 ? 51.126 39.954 36.170  1.00 22.86 ? 473 ILE A CG2 1 
ATOM   3575 C  CD1 . ILE A 1 451 ? 50.431 37.077 37.553  1.00 23.99 ? 473 ILE A CD1 1 
ATOM   3576 N  N   . PRO A 1 452 ? 48.954 42.267 34.810  1.00 22.17 ? 474 PRO A N   1 
ATOM   3577 C  CA  . PRO A 1 452 ? 49.141 43.181 33.677  1.00 21.61 ? 474 PRO A CA  1 
ATOM   3578 C  C   . PRO A 1 452 ? 50.523 43.034 33.071  1.00 21.19 ? 474 PRO A C   1 
ATOM   3579 O  O   . PRO A 1 452 ? 51.475 42.622 33.750  1.00 20.71 ? 474 PRO A O   1 
ATOM   3580 C  CB  . PRO A 1 452 ? 49.028 44.578 34.300  1.00 21.79 ? 474 PRO A CB  1 
ATOM   3581 C  CG  . PRO A 1 452 ? 48.557 44.369 35.721  1.00 21.73 ? 474 PRO A CG  1 
ATOM   3582 C  CD  . PRO A 1 452 ? 48.906 42.974 36.102  1.00 22.08 ? 474 PRO A CD  1 
ATOM   3583 N  N   . GLU A 1 453 ? 50.623 43.390 31.796  1.00 20.85 ? 475 GLU A N   1 
ATOM   3584 C  CA  . GLU A 1 453 ? 51.896 43.585 31.135  1.00 19.83 ? 475 GLU A CA  1 
ATOM   3585 C  C   . GLU A 1 453 ? 52.719 44.700 31.807  1.00 19.55 ? 475 GLU A C   1 
ATOM   3586 O  O   . GLU A 1 453 ? 52.169 45.608 32.449  1.00 19.15 ? 475 GLU A O   1 
ATOM   3587 C  CB  . GLU A 1 453 ? 51.649 43.886 29.640  1.00 19.86 ? 475 GLU A CB  1 
ATOM   3588 C  CG  . GLU A 1 453 ? 52.899 43.994 28.773  1.00 19.91 ? 475 GLU A CG  1 
ATOM   3589 C  CD  . GLU A 1 453 ? 53.734 42.716 28.775  1.00 23.41 ? 475 GLU A CD  1 
ATOM   3590 O  OE1 . GLU A 1 453 ? 53.542 41.857 27.871  1.00 25.00 ? 475 GLU A OE1 1 
ATOM   3591 O  OE2 . GLU A 1 453 ? 54.557 42.552 29.694  1.00 22.68 ? 475 GLU A OE2 1 
ATOM   3592 N  N   . PHE A 1 454 ? 54.042 44.611 31.670  1.00 19.14 ? 476 PHE A N   1 
ATOM   3593 C  CA  . PHE A 1 454 ? 54.931 45.706 32.035  1.00 19.15 ? 476 PHE A CA  1 
ATOM   3594 C  C   . PHE A 1 454 ? 54.696 46.877 31.074  1.00 19.99 ? 476 PHE A C   1 
ATOM   3595 O  O   . PHE A 1 454 ? 54.238 46.684 29.950  1.00 19.89 ? 476 PHE A O   1 
ATOM   3596 C  CB  . PHE A 1 454 ? 56.418 45.300 31.892  1.00 18.27 ? 476 PHE A CB  1 
ATOM   3597 C  CG  . PHE A 1 454 ? 56.826 44.060 32.671  1.00 17.82 ? 476 PHE A CG  1 
ATOM   3598 C  CD1 . PHE A 1 454 ? 56.353 43.819 33.963  1.00 16.12 ? 476 PHE A CD1 1 
ATOM   3599 C  CD2 . PHE A 1 454 ? 57.721 43.142 32.108  1.00 18.18 ? 476 PHE A CD2 1 
ATOM   3600 C  CE1 . PHE A 1 454 ? 56.747 42.684 34.678  1.00 16.12 ? 476 PHE A CE1 1 
ATOM   3601 C  CE2 . PHE A 1 454 ? 58.114 41.999 32.804  1.00 17.40 ? 476 PHE A CE2 1 
ATOM   3602 C  CZ  . PHE A 1 454 ? 57.633 41.774 34.099  1.00 18.46 ? 476 PHE A CZ  1 
ATOM   3603 N  N   . ASP A 1 455 ? 55.037 48.082 31.511  1.00 20.51 ? 477 ASP A N   1 
ATOM   3604 C  CA  . ASP A 1 455 ? 55.328 49.166 30.592  1.00 21.04 ? 477 ASP A CA  1 
ATOM   3605 C  C   . ASP A 1 455 ? 56.714 48.815 30.011  1.00 21.26 ? 477 ASP A C   1 
ATOM   3606 O  O   . ASP A 1 455 ? 57.742 49.027 30.658  1.00 20.40 ? 477 ASP A O   1 
ATOM   3607 C  CB  . ASP A 1 455 ? 55.313 50.507 31.356  1.00 21.18 ? 477 ASP A CB  1 
ATOM   3608 C  CG  . ASP A 1 455 ? 55.849 51.688 30.531  1.00 22.53 ? 477 ASP A CG  1 
ATOM   3609 O  OD1 . ASP A 1 455 ? 56.284 51.515 29.371  1.00 23.24 ? 477 ASP A OD1 1 
ATOM   3610 O  OD2 . ASP A 1 455 ? 55.827 52.819 31.061  1.00 25.21 ? 477 ASP A OD2 1 
ATOM   3611 N  N   . LEU A 1 456 ? 56.726 48.229 28.809  1.00 21.62 ? 478 LEU A N   1 
ATOM   3612 C  CA  . LEU A 1 456 ? 57.948 47.640 28.228  1.00 21.87 ? 478 LEU A CA  1 
ATOM   3613 C  C   . LEU A 1 456 ? 59.034 48.665 27.902  1.00 22.42 ? 478 LEU A C   1 
ATOM   3614 O  O   . LEU A 1 456 ? 60.195 48.293 27.703  1.00 23.19 ? 478 LEU A O   1 
ATOM   3615 C  CB  . LEU A 1 456 ? 57.652 46.743 27.011  1.00 21.68 ? 478 LEU A CB  1 
ATOM   3616 C  CG  . LEU A 1 456 ? 56.646 45.579 27.185  1.00 21.54 ? 478 LEU A CG  1 
ATOM   3617 C  CD1 . LEU A 1 456 ? 56.112 45.060 25.841  1.00 22.06 ? 478 LEU A CD1 1 
ATOM   3618 C  CD2 . LEU A 1 456 ? 57.180 44.436 28.014  1.00 20.25 ? 478 LEU A CD2 1 
ATOM   3619 N  N   . SER A 1 457 ? 58.679 49.948 27.908  1.00 22.23 ? 479 SER A N   1 
ATOM   3620 C  CA  . SER A 1 457 ? 59.654 51.031 27.662  1.00 21.74 ? 479 SER A CA  1 
ATOM   3621 C  C   . SER A 1 457 ? 60.609 51.229 28.843  1.00 21.80 ? 479 SER A C   1 
ATOM   3622 O  O   . SER A 1 457 ? 61.658 51.885 28.718  1.00 21.47 ? 479 SER A O   1 
ATOM   3623 C  CB  . SER A 1 457 ? 58.922 52.339 27.320  1.00 21.54 ? 479 SER A CB  1 
ATOM   3624 O  OG  . SER A 1 457 ? 58.127 52.798 28.413  1.00 22.21 ? 479 SER A OG  1 
ATOM   3625 N  N   . ARG A 1 458 ? 60.258 50.624 29.980  1.00 20.92 ? 480 ARG A N   1 
ATOM   3626 C  CA  . ARG A 1 458 ? 61.001 50.793 31.208  1.00 20.47 ? 480 ARG A CA  1 
ATOM   3627 C  C   . ARG A 1 458 ? 62.153 49.833 31.423  1.00 19.69 ? 480 ARG A C   1 
ATOM   3628 O  O   . ARG A 1 458 ? 62.878 49.997 32.399  1.00 19.31 ? 480 ARG A O   1 
ATOM   3629 C  CB  . ARG A 1 458 ? 60.071 50.701 32.422  1.00 20.64 ? 480 ARG A CB  1 
ATOM   3630 C  CG  . ARG A 1 458 ? 59.300 51.947 32.706  1.00 23.37 ? 480 ARG A CG  1 
ATOM   3631 C  CD  . ARG A 1 458 ? 58.959 52.047 34.209  1.00 25.66 ? 480 ARG A CD  1 
ATOM   3632 N  NE  . ARG A 1 458 ? 58.346 53.333 34.436  1.00 29.12 ? 480 ARG A NE  1 
ATOM   3633 C  CZ  . ARG A 1 458 ? 58.823 54.295 35.210  1.00 28.71 ? 480 ARG A CZ  1 
ATOM   3634 N  NH1 . ARG A 1 458 ? 59.919 54.148 35.943  1.00 27.19 ? 480 ARG A NH1 1 
ATOM   3635 N  NH2 . ARG A 1 458 ? 58.141 55.411 35.273  1.00 31.08 ? 480 ARG A NH2 1 
ATOM   3636 N  N   . TYR A 1 459 ? 62.315 48.823 30.561  1.00 19.48 ? 481 TYR A N   1 
ATOM   3637 C  CA  . TYR A 1 459 ? 63.469 47.913 30.696  1.00 18.90 ? 481 TYR A CA  1 
ATOM   3638 C  C   . TYR A 1 459 ? 64.746 48.672 30.966  1.00 19.61 ? 481 TYR A C   1 
ATOM   3639 O  O   . TYR A 1 459 ? 65.002 49.697 30.339  1.00 20.29 ? 481 TYR A O   1 
ATOM   3640 C  CB  . TYR A 1 459 ? 63.650 47.009 29.470  1.00 17.65 ? 481 TYR A CB  1 
ATOM   3641 C  CG  . TYR A 1 459 ? 62.682 45.868 29.436  1.00 15.40 ? 481 TYR A CG  1 
ATOM   3642 C  CD1 . TYR A 1 459 ? 62.613 44.969 30.496  1.00 14.39 ? 481 TYR A CD1 1 
ATOM   3643 C  CD2 . TYR A 1 459 ? 61.827 45.685 28.358  1.00 13.10 ? 481 TYR A CD2 1 
ATOM   3644 C  CE1 . TYR A 1 459 ? 61.697 43.922 30.496  1.00 15.68 ? 481 TYR A CE1 1 
ATOM   3645 C  CE2 . TYR A 1 459 ? 60.910 44.632 28.344  1.00 16.04 ? 481 TYR A CE2 1 
ATOM   3646 C  CZ  . TYR A 1 459 ? 60.856 43.753 29.415  1.00 14.27 ? 481 TYR A CZ  1 
ATOM   3647 O  OH  . TYR A 1 459 ? 59.990 42.682 29.406  1.00 16.14 ? 481 TYR A OH  1 
ATOM   3648 N  N   . GLY A 1 460 ? 65.530 48.174 31.918  1.00 20.22 ? 482 GLY A N   1 
ATOM   3649 C  CA  . GLY A 1 460 ? 66.808 48.778 32.261  1.00 20.99 ? 482 GLY A CA  1 
ATOM   3650 C  C   . GLY A 1 460 ? 66.847 49.766 33.413  1.00 21.70 ? 482 GLY A C   1 
ATOM   3651 O  O   . GLY A 1 460 ? 67.929 50.082 33.908  1.00 22.65 ? 482 GLY A O   1 
ATOM   3652 N  N   . PHE A 1 461 ? 65.697 50.273 33.843  1.00 21.77 ? 483 PHE A N   1 
ATOM   3653 C  CA  . PHE A 1 461 ? 65.682 51.291 34.917  1.00 22.41 ? 483 PHE A CA  1 
ATOM   3654 C  C   . PHE A 1 461 ? 65.696 50.709 36.327  1.00 21.76 ? 483 PHE A C   1 
ATOM   3655 O  O   . PHE A 1 461 ? 66.089 51.388 37.287  1.00 23.30 ? 483 PHE A O   1 
ATOM   3656 C  CB  . PHE A 1 461 ? 64.532 52.304 34.732  1.00 22.80 ? 483 PHE A CB  1 
ATOM   3657 C  CG  . PHE A 1 461 ? 64.777 53.313 33.620  1.00 24.42 ? 483 PHE A CG  1 
ATOM   3658 C  CD1 . PHE A 1 461 ? 64.078 53.229 32.416  1.00 25.03 ? 483 PHE A CD1 1 
ATOM   3659 C  CD2 . PHE A 1 461 ? 65.708 54.346 33.783  1.00 26.10 ? 483 PHE A CD2 1 
ATOM   3660 C  CE1 . PHE A 1 461 ? 64.304 54.139 31.396  1.00 26.34 ? 483 PHE A CE1 1 
ATOM   3661 C  CE2 . PHE A 1 461 ? 65.937 55.276 32.759  1.00 27.23 ? 483 PHE A CE2 1 
ATOM   3662 C  CZ  . PHE A 1 461 ? 65.235 55.165 31.565  1.00 27.13 ? 483 PHE A CZ  1 
ATOM   3663 N  N   . GLY A 1 462 ? 65.319 49.439 36.452  1.00 20.19 ? 484 GLY A N   1 
ATOM   3664 C  CA  . GLY A 1 462 ? 65.235 48.769 37.747  1.00 17.76 ? 484 GLY A CA  1 
ATOM   3665 C  C   . GLY A 1 462 ? 64.001 47.893 37.773  1.00 16.71 ? 484 GLY A C   1 
ATOM   3666 O  O   . GLY A 1 462 ? 63.809 47.058 36.883  1.00 17.21 ? 484 GLY A O   1 
ATOM   3667 N  N   . LEU A 1 463 ? 63.143 48.107 38.764  1.00 15.95 ? 485 LEU A N   1 
ATOM   3668 C  CA  . LEU A 1 463 ? 61.898 47.352 38.889  1.00 14.58 ? 485 LEU A CA  1 
ATOM   3669 C  C   . LEU A 1 463 ? 60.902 47.767 37.831  1.00 14.69 ? 485 LEU A C   1 
ATOM   3670 O  O   . LEU A 1 463 ? 60.640 48.958 37.640  1.00 13.80 ? 485 LEU A O   1 
ATOM   3671 C  CB  . LEU A 1 463 ? 61.258 47.516 40.268  1.00 14.34 ? 485 LEU A CB  1 
ATOM   3672 C  CG  . LEU A 1 463 ? 61.469 46.357 41.264  1.00 12.96 ? 485 LEU A CG  1 
ATOM   3673 C  CD1 . LEU A 1 463 ? 60.797 45.039 40.817  1.00 10.82 ? 485 LEU A CD1 1 
ATOM   3674 C  CD2 . LEU A 1 463 ? 62.925 46.140 41.484  1.00 8.97  ? 485 LEU A CD2 1 
ATOM   3675 N  N   . MET A 1 464 ? 60.345 46.772 37.155  1.00 13.80 ? 486 MET A N   1 
ATOM   3676 C  CA  . MET A 1 464 ? 59.367 47.030 36.118  1.00 13.78 ? 486 MET A CA  1 
ATOM   3677 C  C   . MET A 1 464 ? 58.089 47.593 36.750  1.00 14.16 ? 486 MET A C   1 
ATOM   3678 O  O   . MET A 1 464 ? 57.851 47.396 37.937  1.00 14.06 ? 486 MET A O   1 
ATOM   3679 C  CB  . MET A 1 464 ? 59.134 45.753 35.286  1.00 13.24 ? 486 MET A CB  1 
ATOM   3680 C  CG  . MET A 1 464 ? 60.367 45.358 34.397  1.00 12.09 ? 486 MET A CG  1 
ATOM   3681 S  SD  . MET A 1 464 ? 60.887 46.645 33.216  1.00 4.40  ? 486 MET A SD  1 
ATOM   3682 C  CE  . MET A 1 464 ? 61.846 47.784 34.126  1.00 13.37 ? 486 MET A CE  1 
ATOM   3683 N  N   . GLN A 1 465 ? 57.306 48.326 35.959  1.00 14.22 ? 487 GLN A N   1 
ATOM   3684 C  CA  . GLN A 1 465 ? 56.032 48.861 36.403  1.00 15.34 ? 487 GLN A CA  1 
ATOM   3685 C  C   . GLN A 1 465 ? 54.925 48.348 35.456  1.00 16.32 ? 487 GLN A C   1 
ATOM   3686 O  O   . GLN A 1 465 ? 55.188 48.074 34.280  1.00 15.86 ? 487 GLN A O   1 
ATOM   3687 C  CB  . GLN A 1 465 ? 56.102 50.406 36.488  1.00 15.00 ? 487 GLN A CB  1 
ATOM   3688 C  CG  . GLN A 1 465 ? 57.015 50.876 37.664  1.00 14.90 ? 487 GLN A CG  1 
ATOM   3689 C  CD  . GLN A 1 465 ? 57.019 52.389 37.922  1.00 17.42 ? 487 GLN A CD  1 
ATOM   3690 O  OE1 . GLN A 1 465 ? 57.993 52.939 38.472  1.00 15.86 ? 487 GLN A OE1 1 
ATOM   3691 N  NE2 . GLN A 1 465 ? 55.937 53.063 37.535  1.00 16.78 ? 487 GLN A NE2 1 
ATOM   3692 N  N   . PRO A 1 466 ? 53.700 48.183 35.974  1.00 16.78 ? 488 PRO A N   1 
ATOM   3693 C  CA  . PRO A 1 466 ? 52.648 47.591 35.166  1.00 17.68 ? 488 PRO A CA  1 
ATOM   3694 C  C   . PRO A 1 466 ? 52.039 48.649 34.242  1.00 19.60 ? 488 PRO A C   1 
ATOM   3695 O  O   . PRO A 1 466 ? 51.996 49.835 34.598  1.00 19.25 ? 488 PRO A O   1 
ATOM   3696 C  CB  . PRO A 1 466 ? 51.623 47.121 36.209  1.00 17.54 ? 488 PRO A CB  1 
ATOM   3697 C  CG  . PRO A 1 466 ? 51.832 48.069 37.408  1.00 16.87 ? 488 PRO A CG  1 
ATOM   3698 C  CD  . PRO A 1 466 ? 53.246 48.567 37.327  1.00 16.74 ? 488 PRO A CD  1 
ATOM   3699 N  N   . GLU A 1 467 ? 51.567 48.237 33.071  1.00 20.74 ? 489 GLU A N   1 
ATOM   3700 C  CA  . GLU A 1 467 ? 51.001 49.218 32.147  1.00 22.67 ? 489 GLU A CA  1 
ATOM   3701 C  C   . GLU A 1 467 ? 49.652 49.762 32.633  1.00 22.81 ? 489 GLU A C   1 
ATOM   3702 O  O   . GLU A 1 467 ? 49.228 50.851 32.243  1.00 23.48 ? 489 GLU A O   1 
ATOM   3703 C  CB  . GLU A 1 467 ? 50.926 48.675 30.726  1.00 23.09 ? 489 GLU A CB  1 
ATOM   3704 C  CG  . GLU A 1 467 ? 50.035 47.485 30.540  1.00 26.09 ? 489 GLU A CG  1 
ATOM   3705 C  CD  . GLU A 1 467 ? 49.802 47.169 29.059  1.00 30.73 ? 489 GLU A CD  1 
ATOM   3706 O  OE1 . GLU A 1 467 ? 50.429 47.824 28.197  1.00 32.06 ? 489 GLU A OE1 1 
ATOM   3707 O  OE2 . GLU A 1 467 ? 49.002 46.254 28.757  1.00 31.87 ? 489 GLU A OE2 1 
ATOM   3708 N  N   . HIS A 1 468 ? 48.982 49.000 33.486  1.00 22.67 ? 490 HIS A N   1 
ATOM   3709 C  CA  . HIS A 1 468 ? 47.850 49.521 34.243  1.00 22.18 ? 490 HIS A CA  1 
ATOM   3710 C  C   . HIS A 1 468 ? 47.788 48.863 35.611  1.00 21.01 ? 490 HIS A C   1 
ATOM   3711 O  O   . HIS A 1 468 ? 48.272 47.743 35.799  1.00 21.10 ? 490 HIS A O   1 
ATOM   3712 C  CB  . HIS A 1 468 ? 46.532 49.335 33.484  1.00 23.12 ? 490 HIS A CB  1 
ATOM   3713 C  CG  . HIS A 1 468 ? 46.323 47.943 32.982  1.00 25.68 ? 490 HIS A CG  1 
ATOM   3714 N  ND1 . HIS A 1 468 ? 45.829 46.933 33.781  1.00 28.58 ? 490 HIS A ND1 1 
ATOM   3715 C  CD2 . HIS A 1 468 ? 46.563 47.387 31.770  1.00 27.67 ? 490 HIS A CD2 1 
ATOM   3716 C  CE1 . HIS A 1 468 ? 45.771 45.813 33.079  1.00 30.85 ? 490 HIS A CE1 1 
ATOM   3717 N  NE2 . HIS A 1 468 ? 46.208 46.061 31.856  1.00 30.58 ? 490 HIS A NE2 1 
ATOM   3718 N  N   . ASP A 1 469 ? 47.177 49.558 36.563  1.00 20.06 ? 491 ASP A N   1 
ATOM   3719 C  CA  . ASP A 1 469 ? 47.076 49.067 37.936  1.00 19.20 ? 491 ASP A CA  1 
ATOM   3720 C  C   . ASP A 1 469 ? 46.048 47.939 38.050  1.00 19.12 ? 491 ASP A C   1 
ATOM   3721 O  O   . ASP A 1 469 ? 45.254 47.705 37.126  1.00 19.60 ? 491 ASP A O   1 
ATOM   3722 C  CB  . ASP A 1 469 ? 46.698 50.222 38.863  1.00 18.70 ? 491 ASP A CB  1 
ATOM   3723 C  CG  . ASP A 1 469 ? 47.335 50.109 40.239  1.00 17.19 ? 491 ASP A CG  1 
ATOM   3724 O  OD1 . ASP A 1 469 ? 47.721 48.997 40.653  1.00 18.33 ? 491 ASP A OD1 1 
ATOM   3725 O  OD2 . ASP A 1 469 ? 47.439 51.141 40.914  1.00 15.85 ? 491 ASP A OD2 1 
ATOM   3726 N  N   . VAL A 1 470 ? 46.074 47.259 39.195  1.00 18.25 ? 492 VAL A N   1 
ATOM   3727 C  CA  . VAL A 1 470 ? 45.161 46.196 39.526  1.00 17.12 ? 492 VAL A CA  1 
ATOM   3728 C  C   . VAL A 1 470 ? 44.291 46.669 40.701  1.00 17.28 ? 492 VAL A C   1 
ATOM   3729 O  O   . VAL A 1 470 ? 44.799 46.985 41.797  1.00 16.71 ? 492 VAL A O   1 
ATOM   3730 C  CB  . VAL A 1 470 ? 45.925 44.908 39.894  1.00 17.23 ? 492 VAL A CB  1 
ATOM   3731 C  CG1 . VAL A 1 470 ? 44.968 43.789 40.275  1.00 17.74 ? 492 VAL A CG1 1 
ATOM   3732 C  CG2 . VAL A 1 470 ? 46.813 44.465 38.733  1.00 17.32 ? 492 VAL A CG2 1 
ATOM   3733 N  N   . PRO A 1 471 ? 42.975 46.761 40.464  1.00 16.96 ? 493 PRO A N   1 
ATOM   3734 C  CA  . PRO A 1 471 ? 42.027 47.125 41.504  1.00 16.51 ? 493 PRO A CA  1 
ATOM   3735 C  C   . PRO A 1 471 ? 41.956 46.105 42.636  1.00 16.35 ? 493 PRO A C   1 
ATOM   3736 O  O   . PRO A 1 471 ? 41.755 44.909 42.416  1.00 16.49 ? 493 PRO A O   1 
ATOM   3737 C  CB  . PRO A 1 471 ? 40.684 47.185 40.752  1.00 17.19 ? 493 PRO A CB  1 
ATOM   3738 C  CG  . PRO A 1 471 ? 41.060 47.343 39.315  1.00 17.29 ? 493 PRO A CG  1 
ATOM   3739 C  CD  . PRO A 1 471 ? 42.311 46.546 39.168  1.00 16.29 ? 493 PRO A CD  1 
ATOM   3740 N  N   . VAL A 1 472 ? 42.138 46.605 43.845  1.00 16.09 ? 494 VAL A N   1 
ATOM   3741 C  CA  . VAL A 1 472 ? 42.022 45.818 45.054  1.00 16.18 ? 494 VAL A CA  1 
ATOM   3742 C  C   . VAL A 1 472 ? 41.125 46.599 46.020  1.00 16.62 ? 494 VAL A C   1 
ATOM   3743 O  O   . VAL A 1 472 ? 40.847 47.766 45.803  1.00 15.71 ? 494 VAL A O   1 
ATOM   3744 C  CB  . VAL A 1 472 ? 43.434 45.560 45.697  1.00 15.72 ? 494 VAL A CB  1 
ATOM   3745 C  CG1 . VAL A 1 472 ? 44.262 44.650 44.800  1.00 15.24 ? 494 VAL A CG1 1 
ATOM   3746 C  CG2 . VAL A 1 472 ? 44.172 46.866 45.942  1.00 13.34 ? 494 VAL A CG2 1 
ATOM   3747 N  N   . ARG A 1 473 ? 40.658 45.947 47.072  1.00 17.85 ? 495 ARG A N   1 
ATOM   3748 C  CA  . ARG A 1 473 ? 40.079 46.667 48.205  1.00 19.08 ? 495 ARG A CA  1 
ATOM   3749 C  C   . ARG A 1 473 ? 40.778 46.163 49.455  1.00 19.40 ? 495 ARG A C   1 
ATOM   3750 O  O   . ARG A 1 473 ? 41.212 45.003 49.505  1.00 20.03 ? 495 ARG A O   1 
ATOM   3751 C  CB  . ARG A 1 473 ? 38.548 46.476 48.303  1.00 19.51 ? 495 ARG A CB  1 
ATOM   3752 C  CG  . ARG A 1 473 ? 38.098 45.034 48.534  1.00 21.57 ? 495 ARG A CG  1 
ATOM   3753 C  CD  . ARG A 1 473 ? 36.586 44.936 48.593  1.00 25.36 ? 495 ARG A CD  1 
ATOM   3754 N  NE  . ARG A 1 473 ? 36.164 43.590 48.943  1.00 28.56 ? 495 ARG A NE  1 
ATOM   3755 C  CZ  . ARG A 1 473 ? 34.938 43.254 49.358  1.00 30.87 ? 495 ARG A CZ  1 
ATOM   3756 N  NH1 . ARG A 1 473 ? 33.980 44.170 49.481  1.00 29.85 ? 495 ARG A NH1 1 
ATOM   3757 N  NH2 . ARG A 1 473 ? 34.674 41.988 49.654  1.00 29.90 ? 495 ARG A NH2 1 
ATOM   3758 N  N   . TYR A 1 474 ? 40.931 47.036 50.444  1.00 20.22 ? 496 TYR A N   1 
ATOM   3759 C  CA  . TYR A 1 474 ? 41.478 46.616 51.735  1.00 21.41 ? 496 TYR A CA  1 
ATOM   3760 C  C   . TYR A 1 474 ? 40.708 47.214 52.899  1.00 21.35 ? 496 TYR A C   1 
ATOM   3761 O  O   . TYR A 1 474 ? 40.022 48.225 52.749  1.00 21.53 ? 496 TYR A O   1 
ATOM   3762 C  CB  . TYR A 1 474 ? 42.968 46.983 51.856  1.00 21.97 ? 496 TYR A CB  1 
ATOM   3763 C  CG  . TYR A 1 474 ? 43.218 48.429 52.243  1.00 23.52 ? 496 TYR A CG  1 
ATOM   3764 C  CD1 . TYR A 1 474 ? 43.267 49.430 51.274  1.00 25.46 ? 496 TYR A CD1 1 
ATOM   3765 C  CD2 . TYR A 1 474 ? 43.401 48.791 53.573  1.00 25.48 ? 496 TYR A CD2 1 
ATOM   3766 C  CE1 . TYR A 1 474 ? 43.487 50.755 51.620  1.00 27.16 ? 496 TYR A CE1 1 
ATOM   3767 C  CE2 . TYR A 1 474 ? 43.621 50.110 53.932  1.00 27.81 ? 496 TYR A CE2 1 
ATOM   3768 C  CZ  . TYR A 1 474 ? 43.657 51.092 52.942  1.00 29.05 ? 496 TYR A CZ  1 
ATOM   3769 O  OH  . TYR A 1 474 ? 43.887 52.421 53.285  1.00 30.60 ? 496 TYR A OH  1 
ATOM   3770 N  N   . ARG A 1 475 ? 40.866 46.596 54.060  1.00 21.77 ? 497 ARG A N   1 
ATOM   3771 C  CA  . ARG A 1 475 ? 40.374 47.148 55.301  1.00 22.45 ? 497 ARG A CA  1 
ATOM   3772 C  C   . ARG A 1 475 ? 41.282 46.698 56.443  1.00 22.95 ? 497 ARG A C   1 
ATOM   3773 O  O   . ARG A 1 475 ? 41.954 45.675 56.349  1.00 22.26 ? 497 ARG A O   1 
ATOM   3774 C  CB  . ARG A 1 475 ? 38.922 46.690 55.560  1.00 22.82 ? 497 ARG A CB  1 
ATOM   3775 C  CG  . ARG A 1 475 ? 38.755 45.174 55.672  1.00 23.02 ? 497 ARG A CG  1 
ATOM   3776 C  CD  . ARG A 1 475 ? 37.340 44.734 56.038  1.00 25.08 ? 497 ARG A CD  1 
ATOM   3777 N  NE  . ARG A 1 475 ? 37.287 43.283 56.177  1.00 25.30 ? 497 ARG A NE  1 
ATOM   3778 C  CZ  . ARG A 1 475 ? 36.177 42.543 56.149  1.00 27.85 ? 497 ARG A CZ  1 
ATOM   3779 N  NH1 . ARG A 1 475 ? 34.987 43.104 56.001  1.00 27.77 ? 497 ARG A NH1 1 
ATOM   3780 N  NH2 . ARG A 1 475 ? 36.261 41.225 56.272  1.00 28.46 ? 497 ARG A NH2 1 
ATOM   3781 N  N   . ILE A 1 476 ? 41.297 47.476 57.522  1.00 24.19 ? 498 ILE A N   1 
ATOM   3782 C  CA  . ILE A 1 476 ? 41.774 46.995 58.807  1.00 25.21 ? 498 ILE A CA  1 
ATOM   3783 C  C   . ILE A 1 476 ? 40.892 45.787 59.184  1.00 26.52 ? 498 ILE A C   1 
ATOM   3784 O  O   . ILE A 1 476 ? 39.669 45.885 59.178  1.00 26.56 ? 498 ILE A O   1 
ATOM   3785 C  CB  . ILE A 1 476 ? 41.729 48.121 59.859  1.00 25.26 ? 498 ILE A CB  1 
ATOM   3786 C  CG1 . ILE A 1 476 ? 42.913 49.073 59.635  1.00 24.73 ? 498 ILE A CG1 1 
ATOM   3787 C  CG2 . ILE A 1 476 ? 41.756 47.543 61.282  1.00 24.97 ? 498 ILE A CG2 1 
ATOM   3788 C  CD1 . ILE A 1 476 ? 42.861 50.360 60.428  1.00 28.57 ? 498 ILE A CD1 1 
ATOM   3789 N  N   . ARG A 1 477 ? 41.511 44.639 59.446  1.00 27.91 ? 499 ARG A N   1 
ATOM   3790 C  CA  . ARG A 1 477 ? 40.755 43.412 59.711  1.00 29.65 ? 499 ARG A CA  1 
ATOM   3791 C  C   . ARG A 1 477 ? 39.843 43.602 60.947  1.00 29.98 ? 499 ARG A C   1 
ATOM   3792 O  O   . ARG A 1 477 ? 40.332 44.011 62.006  1.00 29.69 ? 499 ARG A O   1 
ATOM   3793 C  CB  . ARG A 1 477 ? 41.728 42.244 59.890  1.00 30.03 ? 499 ARG A CB  1 
ATOM   3794 C  CG  . ARG A 1 477 ? 41.085 40.873 59.757  1.00 31.68 ? 499 ARG A CG  1 
ATOM   3795 C  CD  . ARG A 1 477 ? 42.099 39.772 59.468  1.00 32.17 ? 499 ARG A CD  1 
ATOM   3796 N  NE  . ARG A 1 477 ? 43.011 39.473 60.572  1.00 34.52 ? 499 ARG A NE  1 
ATOM   3797 C  CZ  . ARG A 1 477 ? 42.637 38.980 61.756  1.00 36.65 ? 499 ARG A CZ  1 
ATOM   3798 N  NH1 . ARG A 1 477 ? 41.353 38.766 62.027  1.00 36.87 ? 499 ARG A NH1 1 
ATOM   3799 N  NH2 . ARG A 1 477 ? 43.550 38.719 62.687  1.00 34.80 ? 499 ARG A NH2 1 
ATOM   3800 N  N   . PRO A 1 478 ? 38.522 43.320 60.806  1.00 31.00 ? 500 PRO A N   1 
ATOM   3801 C  CA  . PRO A 1 478 ? 37.448 43.748 61.743  1.00 32.02 ? 500 PRO A CA  1 
ATOM   3802 C  C   . PRO A 1 478 ? 37.296 43.112 63.145  1.00 33.03 ? 500 PRO A C   1 
ATOM   3803 O  O   . PRO A 1 478 ? 36.552 43.666 63.985  1.00 34.28 ? 500 PRO A O   1 
ATOM   3804 C  CB  . PRO A 1 478 ? 36.154 43.494 60.946  1.00 31.48 ? 500 PRO A CB  1 
ATOM   3805 C  CG  . PRO A 1 478 ? 36.582 43.152 59.563  1.00 31.31 ? 500 PRO A CG  1 
ATOM   3806 C  CD  . PRO A 1 478 ? 37.947 42.573 59.678  1.00 31.11 ? 500 PRO A CD  1 
ATOM   3807 N  N   . HIS A 1 479 ? 37.929 41.979 63.421  1.00 33.14 ? 501 HIS A N   1 
ATOM   3808 C  CA  . HIS A 1 479 ? 37.675 41.339 64.730  1.00 33.38 ? 501 HIS A CA  1 
ATOM   3809 C  C   . HIS A 1 479 ? 38.947 41.010 65.509  1.00 33.31 ? 501 HIS A C   1 
ATOM   3810 O  O   . HIS A 1 479 ? 39.977 41.658 65.307  1.00 33.53 ? 501 HIS A O   1 
ATOM   3811 C  CB  . HIS A 1 479 ? 36.800 40.096 64.553  1.00 33.18 ? 501 HIS A CB  1 
ATOM   3812 C  CG  . HIS A 1 479 ? 35.457 40.389 63.955  1.00 33.07 ? 501 HIS A CG  1 
ATOM   3813 N  ND1 . HIS A 1 479 ? 34.445 41.004 64.660  1.00 33.97 ? 501 HIS A ND1 1 
ATOM   3814 C  CD2 . HIS A 1 479 ? 34.963 40.154 62.716  1.00 32.84 ? 501 HIS A CD2 1 
ATOM   3815 C  CE1 . HIS A 1 479 ? 33.386 41.135 63.880  1.00 35.13 ? 501 HIS A CE1 1 
ATOM   3816 N  NE2 . HIS A 1 479 ? 33.674 40.626 62.695  1.00 33.26 ? 501 HIS A NE2 1 
ATOM   3817 N  N   . ARG B 1 1   ? 46.984 26.858 104.574 1.00 22.72 ? 23  ARG B N   1 
ATOM   3818 C  CA  . ARG B 1 1   ? 47.801 27.908 103.862 1.00 21.60 ? 23  ARG B CA  1 
ATOM   3819 C  C   . ARG B 1 1   ? 47.724 29.226 104.610 1.00 21.12 ? 23  ARG B C   1 
ATOM   3820 O  O   . ARG B 1 1   ? 46.655 29.608 105.077 1.00 20.00 ? 23  ARG B O   1 
ATOM   3821 C  CB  . ARG B 1 1   ? 47.313 28.074 102.409 1.00 21.94 ? 23  ARG B CB  1 
ATOM   3822 C  CG  . ARG B 1 1   ? 47.984 29.179 101.596 1.00 22.37 ? 23  ARG B CG  1 
ATOM   3823 C  CD  . ARG B 1 1   ? 47.791 28.937 100.128 1.00 22.54 ? 23  ARG B CD  1 
ATOM   3824 N  NE  . ARG B 1 1   ? 48.098 30.092 99.279  1.00 23.96 ? 23  ARG B NE  1 
ATOM   3825 C  CZ  . ARG B 1 1   ? 48.473 29.998 98.002  1.00 22.99 ? 23  ARG B CZ  1 
ATOM   3826 N  NH1 . ARG B 1 1   ? 48.628 28.806 97.440  1.00 22.79 ? 23  ARG B NH1 1 
ATOM   3827 N  NH2 . ARG B 1 1   ? 48.716 31.090 97.288  1.00 22.65 ? 23  ARG B NH2 1 
ATOM   3828 N  N   . THR B 1 2   ? 48.870 29.904 104.706 1.00 20.67 ? 24  THR B N   1 
ATOM   3829 C  CA  . THR B 1 2   ? 48.985 31.224 105.300 1.00 20.42 ? 24  THR B CA  1 
ATOM   3830 C  C   . THR B 1 2   ? 49.522 32.247 104.297 1.00 20.26 ? 24  THR B C   1 
ATOM   3831 O  O   . THR B 1 2   ? 50.465 31.977 103.559 1.00 19.91 ? 24  THR B O   1 
ATOM   3832 C  CB  . THR B 1 2   ? 49.881 31.177 106.559 1.00 20.73 ? 24  THR B CB  1 
ATOM   3833 O  OG1 . THR B 1 2   ? 49.318 30.237 107.466 1.00 21.44 ? 24  THR B OG1 1 
ATOM   3834 C  CG2 . THR B 1 2   ? 49.936 32.541 107.257 1.00 20.26 ? 24  THR B CG2 1 
ATOM   3835 N  N   . ARG B 1 3   ? 48.914 33.422 104.291 1.00 19.98 ? 25  ARG B N   1 
ATOM   3836 C  CA  . ARG B 1 3   ? 49.247 34.491 103.355 1.00 20.64 ? 25  ARG B CA  1 
ATOM   3837 C  C   . ARG B 1 3   ? 50.656 35.042 103.660 1.00 20.70 ? 25  ARG B C   1 
ATOM   3838 O  O   . ARG B 1 3   ? 50.958 35.400 104.793 1.00 21.38 ? 25  ARG B O   1 
ATOM   3839 C  CB  . ARG B 1 3   ? 48.167 35.595 103.448 1.00 20.44 ? 25  ARG B CB  1 
ATOM   3840 C  CG  . ARG B 1 3   ? 48.016 36.543 102.250 1.00 21.80 ? 25  ARG B CG  1 
ATOM   3841 C  CD  . ARG B 1 3   ? 47.360 37.875 102.655 1.00 22.50 ? 25  ARG B CD  1 
ATOM   3842 N  NE  . ARG B 1 3   ? 48.174 38.576 103.652 1.00 27.79 ? 25  ARG B NE  1 
ATOM   3843 C  CZ  . ARG B 1 3   ? 49.230 39.338 103.369 1.00 28.68 ? 25  ARG B CZ  1 
ATOM   3844 N  NH1 . ARG B 1 3   ? 49.584 39.557 102.111 1.00 29.42 ? 25  ARG B NH1 1 
ATOM   3845 N  NH2 . ARG B 1 3   ? 49.925 39.895 104.349 1.00 30.73 ? 25  ARG B NH2 1 
ATOM   3846 N  N   . ARG B 1 4   ? 51.516 35.079 102.653 1.00 20.79 ? 26  ARG B N   1 
ATOM   3847 C  CA  . ARG B 1 4   ? 52.848 35.665 102.786 1.00 21.46 ? 26  ARG B CA  1 
ATOM   3848 C  C   . ARG B 1 4   ? 52.783 37.150 102.448 1.00 21.31 ? 26  ARG B C   1 
ATOM   3849 O  O   . ARG B 1 4   ? 51.796 37.595 101.886 1.00 21.66 ? 26  ARG B O   1 
ATOM   3850 C  CB  . ARG B 1 4   ? 53.818 34.979 101.824 1.00 22.12 ? 26  ARG B CB  1 
ATOM   3851 C  CG  . ARG B 1 4   ? 54.047 33.505 102.091 1.00 24.32 ? 26  ARG B CG  1 
ATOM   3852 C  CD  . ARG B 1 4   ? 54.923 32.939 100.989 1.00 28.30 ? 26  ARG B CD  1 
ATOM   3853 N  NE  . ARG B 1 4   ? 55.027 31.485 101.079 1.00 33.17 ? 26  ARG B NE  1 
ATOM   3854 C  CZ  . ARG B 1 4   ? 55.333 30.673 100.067 1.00 33.89 ? 26  ARG B CZ  1 
ATOM   3855 N  NH1 . ARG B 1 4   ? 55.556 31.148 98.838  1.00 34.96 ? 26  ARG B NH1 1 
ATOM   3856 N  NH2 . ARG B 1 4   ? 55.400 29.370 100.288 1.00 34.38 ? 26  ARG B NH2 1 
ATOM   3857 N  N   . PRO B 1 5   ? 53.824 37.931 102.787 1.00 21.34 ? 27  PRO B N   1 
ATOM   3858 C  CA  . PRO B 1 5   ? 53.755 39.338 102.383 1.00 21.32 ? 27  PRO B CA  1 
ATOM   3859 C  C   . PRO B 1 5   ? 53.734 39.510 100.856 1.00 21.24 ? 27  PRO B C   1 
ATOM   3860 O  O   . PRO B 1 5   ? 54.416 38.790 100.148 1.00 21.97 ? 27  PRO B O   1 
ATOM   3861 C  CB  . PRO B 1 5   ? 55.035 39.938 103.004 1.00 21.01 ? 27  PRO B CB  1 
ATOM   3862 C  CG  . PRO B 1 5   ? 55.374 39.013 104.135 1.00 20.34 ? 27  PRO B CG  1 
ATOM   3863 C  CD  . PRO B 1 5   ? 55.054 37.662 103.561 1.00 20.95 ? 27  PRO B CD  1 
ATOM   3864 N  N   . GLY B 1 6   ? 52.912 40.429 100.370 1.00 21.34 ? 28  GLY B N   1 
ATOM   3865 C  CA  . GLY B 1 6   ? 52.809 40.713 98.943  1.00 21.90 ? 28  GLY B CA  1 
ATOM   3866 C  C   . GLY B 1 6   ? 51.727 39.933 98.209  1.00 21.83 ? 28  GLY B C   1 
ATOM   3867 O  O   . GLY B 1 6   ? 51.409 40.255 97.075  1.00 22.49 ? 28  GLY B O   1 
ATOM   3868 N  N   . GLU B 1 7   ? 51.160 38.915 98.862  1.00 21.56 ? 29  GLU B N   1 
ATOM   3869 C  CA  . GLU B 1 7   ? 50.097 38.098 98.285  1.00 20.91 ? 29  GLU B CA  1 
ATOM   3870 C  C   . GLU B 1 7   ? 48.732 38.761 98.476  1.00 21.37 ? 29  GLU B C   1 
ATOM   3871 O  O   . GLU B 1 7   ? 48.575 39.559 99.386  1.00 21.22 ? 29  GLU B O   1 
ATOM   3872 C  CB  . GLU B 1 7   ? 50.108 36.690 98.892  1.00 20.61 ? 29  GLU B CB  1 
ATOM   3873 C  CG  . GLU B 1 7   ? 51.380 35.931 98.631  1.00 18.71 ? 29  GLU B CG  1 
ATOM   3874 C  CD  . GLU B 1 7   ? 51.336 34.497 99.125  1.00 20.30 ? 29  GLU B CD  1 
ATOM   3875 O  OE1 . GLU B 1 7   ? 50.574 34.196 100.089 1.00 18.53 ? 29  GLU B OE1 1 
ATOM   3876 O  OE2 . GLU B 1 7   ? 52.087 33.675 98.547  1.00 18.47 ? 29  GLU B OE2 1 
ATOM   3877 N  N   . PRO B 1 8   ? 47.763 38.480 97.568  1.00 21.61 ? 30  PRO B N   1 
ATOM   3878 C  CA  . PRO B 1 8   ? 46.386 38.969 97.707  1.00 21.75 ? 30  PRO B CA  1 
ATOM   3879 C  C   . PRO B 1 8   ? 45.747 38.462 99.005  1.00 22.29 ? 30  PRO B C   1 
ATOM   3880 O  O   . PRO B 1 8   ? 46.236 37.473 99.565  1.00 22.91 ? 30  PRO B O   1 
ATOM   3881 C  CB  . PRO B 1 8   ? 45.663 38.310 96.525  1.00 20.85 ? 30  PRO B CB  1 
ATOM   3882 C  CG  . PRO B 1 8   ? 46.719 38.023 95.524  1.00 21.78 ? 30  PRO B CG  1 
ATOM   3883 C  CD  . PRO B 1 8   ? 47.943 37.683 96.334  1.00 21.42 ? 30  PRO B CD  1 
ATOM   3884 N  N   . PRO B 1 9   ? 44.640 39.095 99.453  1.00 22.37 ? 31  PRO B N   1 
ATOM   3885 C  CA  . PRO B 1 9   ? 43.839 38.570 100.552 1.00 22.48 ? 31  PRO B CA  1 
ATOM   3886 C  C   . PRO B 1 9   ? 43.546 37.106 100.295 1.00 22.78 ? 31  PRO B C   1 
ATOM   3887 O  O   . PRO B 1 9   ? 43.307 36.722 99.146  1.00 22.41 ? 31  PRO B O   1 
ATOM   3888 C  CB  . PRO B 1 9   ? 42.530 39.353 100.438 1.00 22.88 ? 31  PRO B CB  1 
ATOM   3889 C  CG  . PRO B 1 9   ? 42.886 40.611 99.731  1.00 22.37 ? 31  PRO B CG  1 
ATOM   3890 C  CD  . PRO B 1 9   ? 44.092 40.355 98.913  1.00 22.40 ? 31  PRO B CD  1 
ATOM   3891 N  N   . LEU B 1 10  ? 43.576 36.306 101.355 1.00 22.90 ? 32  LEU B N   1 
ATOM   3892 C  CA  . LEU B 1 10  ? 43.423 34.870 101.263 1.00 23.37 ? 32  LEU B CA  1 
ATOM   3893 C  C   . LEU B 1 10  ? 42.244 34.441 102.131 1.00 24.03 ? 32  LEU B C   1 
ATOM   3894 O  O   . LEU B 1 10  ? 42.195 34.748 103.337 1.00 24.09 ? 32  LEU B O   1 
ATOM   3895 C  CB  . LEU B 1 10  ? 44.715 34.155 101.687 1.00 23.04 ? 32  LEU B CB  1 
ATOM   3896 C  CG  . LEU B 1 10  ? 44.709 32.629 101.884 1.00 23.53 ? 32  LEU B CG  1 
ATOM   3897 C  CD1 . LEU B 1 10  ? 44.635 31.901 100.547 1.00 22.93 ? 32  LEU B CD1 1 
ATOM   3898 C  CD2 . LEU B 1 10  ? 45.938 32.162 102.699 1.00 21.59 ? 32  LEU B CD2 1 
ATOM   3899 N  N   . ASP B 1 11  ? 41.310 33.732 101.502 1.00 24.32 ? 33  ASP B N   1 
ATOM   3900 C  CA  . ASP B 1 11  ? 40.043 33.366 102.113 1.00 25.56 ? 33  ASP B CA  1 
ATOM   3901 C  C   . ASP B 1 11  ? 39.844 31.862 101.976 1.00 26.01 ? 33  ASP B C   1 
ATOM   3902 O  O   . ASP B 1 11  ? 39.603 31.344 100.879 1.00 25.86 ? 33  ASP B O   1 
ATOM   3903 C  CB  . ASP B 1 11  ? 38.911 34.156 101.448 1.00 25.62 ? 33  ASP B CB  1 
ATOM   3904 C  CG  . ASP B 1 11  ? 37.636 34.143 102.249 1.00 26.93 ? 33  ASP B CG  1 
ATOM   3905 O  OD1 . ASP B 1 11  ? 37.374 33.173 103.003 1.00 30.43 ? 33  ASP B OD1 1 
ATOM   3906 O  OD2 . ASP B 1 11  ? 36.873 35.113 102.116 1.00 27.69 ? 33  ASP B OD2 1 
ATOM   3907 N  N   . LEU B 1 12  ? 39.962 31.160 103.097 1.00 26.88 ? 34  LEU B N   1 
ATOM   3908 C  CA  . LEU B 1 12  ? 39.905 29.691 103.089 1.00 28.05 ? 34  LEU B CA  1 
ATOM   3909 C  C   . LEU B 1 12  ? 38.507 29.108 103.250 1.00 28.39 ? 34  LEU B C   1 
ATOM   3910 O  O   . LEU B 1 12  ? 38.298 27.916 103.012 1.00 28.42 ? 34  LEU B O   1 
ATOM   3911 C  CB  . LEU B 1 12  ? 40.837 29.109 104.161 1.00 27.69 ? 34  LEU B CB  1 
ATOM   3912 C  CG  . LEU B 1 12  ? 42.322 29.458 103.990 1.00 28.52 ? 34  LEU B CG  1 
ATOM   3913 C  CD1 . LEU B 1 12  ? 43.141 28.786 105.090 1.00 28.64 ? 34  LEU B CD1 1 
ATOM   3914 C  CD2 . LEU B 1 12  ? 42.841 29.075 102.608 1.00 26.41 ? 34  LEU B CD2 1 
ATOM   3915 N  N   . GLY B 1 13  ? 37.556 29.944 103.652 1.00 29.20 ? 35  GLY B N   1 
ATOM   3916 C  CA  . GLY B 1 13  ? 36.212 29.467 103.937 1.00 31.09 ? 35  GLY B CA  1 
ATOM   3917 C  C   . GLY B 1 13  ? 36.153 28.768 105.285 1.00 32.32 ? 35  GLY B C   1 
ATOM   3918 O  O   . GLY B 1 13  ? 36.948 29.070 106.180 1.00 32.15 ? 35  GLY B O   1 
ATOM   3919 N  N   . SER B 1 14  ? 35.216 27.829 105.412 1.00 33.60 ? 36  SER B N   1 
ATOM   3920 C  CA  . SER B 1 14  ? 34.877 27.184 106.693 1.00 34.88 ? 36  SER B CA  1 
ATOM   3921 C  C   . SER B 1 14  ? 35.134 25.682 106.670 1.00 35.71 ? 36  SER B C   1 
ATOM   3922 O  O   . SER B 1 14  ? 35.442 25.080 107.707 1.00 36.15 ? 36  SER B O   1 
ATOM   3923 C  CB  . SER B 1 14  ? 33.396 27.400 107.016 1.00 34.59 ? 36  SER B CB  1 
ATOM   3924 O  OG  . SER B 1 14  ? 33.107 28.765 107.212 1.00 35.54 ? 36  SER B OG  1 
ATOM   3925 N  N   . ILE B 1 15  ? 34.964 25.085 105.492 1.00 36.55 ? 37  ILE B N   1 
ATOM   3926 C  CA  . ILE B 1 15  ? 35.097 23.643 105.307 1.00 37.12 ? 37  ILE B CA  1 
ATOM   3927 C  C   . ILE B 1 15  ? 36.521 23.355 104.858 1.00 37.68 ? 37  ILE B C   1 
ATOM   3928 O  O   . ILE B 1 15  ? 36.950 23.840 103.801 1.00 37.52 ? 37  ILE B O   1 
ATOM   3929 C  CB  . ILE B 1 15  ? 34.078 23.102 104.254 1.00 37.20 ? 37  ILE B CB  1 
ATOM   3930 C  CG1 . ILE B 1 15  ? 32.634 23.442 104.659 1.00 37.46 ? 37  ILE B CG1 1 
ATOM   3931 C  CG2 . ILE B 1 15  ? 34.250 21.585 104.036 1.00 37.36 ? 37  ILE B CG2 1 
ATOM   3932 C  CD1 . ILE B 1 15  ? 31.585 23.199 103.543 1.00 37.41 ? 37  ILE B CD1 1 
ATOM   3933 N  N   . PRO B 1 16  ? 37.286 22.627 105.693 1.00 38.05 ? 38  PRO B N   1 
ATOM   3934 C  CA  . PRO B 1 16  ? 38.560 22.037 105.322 1.00 38.01 ? 38  PRO B CA  1 
ATOM   3935 C  C   . PRO B 1 16  ? 38.561 21.458 103.914 1.00 37.88 ? 38  PRO B C   1 
ATOM   3936 O  O   . PRO B 1 16  ? 37.626 20.745 103.542 1.00 38.42 ? 38  PRO B O   1 
ATOM   3937 C  CB  . PRO B 1 16  ? 38.733 20.900 106.346 1.00 38.11 ? 38  PRO B CB  1 
ATOM   3938 C  CG  . PRO B 1 16  ? 37.629 21.061 107.354 1.00 37.88 ? 38  PRO B CG  1 
ATOM   3939 C  CD  . PRO B 1 16  ? 36.993 22.385 107.115 1.00 38.26 ? 38  PRO B CD  1 
ATOM   3940 N  N   . TRP B 1 17  ? 39.614 21.770 103.156 1.00 37.40 ? 39  TRP B N   1 
ATOM   3941 C  CA  . TRP B 1 17  ? 39.844 21.268 101.788 1.00 36.85 ? 39  TRP B CA  1 
ATOM   3942 C  C   . TRP B 1 17  ? 38.856 21.765 100.719 1.00 36.62 ? 39  TRP B C   1 
ATOM   3943 O  O   . TRP B 1 17  ? 39.284 22.244 99.667  1.00 36.67 ? 39  TRP B O   1 
ATOM   3944 C  CB  . TRP B 1 17  ? 39.981 19.739 101.746 1.00 36.82 ? 39  TRP B CB  1 
ATOM   3945 C  CG  . TRP B 1 17  ? 40.533 19.209 100.436 1.00 36.62 ? 39  TRP B CG  1 
ATOM   3946 C  CD1 . TRP B 1 17  ? 41.852 19.041 100.110 1.00 36.58 ? 39  TRP B CD1 1 
ATOM   3947 C  CD2 . TRP B 1 17  ? 39.781 18.771 99.291  1.00 36.42 ? 39  TRP B CD2 1 
ATOM   3948 N  NE1 . TRP B 1 17  ? 41.967 18.526 98.837  1.00 36.30 ? 39  TRP B NE1 1 
ATOM   3949 C  CE2 . TRP B 1 17  ? 40.713 18.349 98.314  1.00 35.80 ? 39  TRP B CE2 1 
ATOM   3950 C  CE3 . TRP B 1 17  ? 38.408 18.687 98.999  1.00 36.47 ? 39  TRP B CE3 1 
ATOM   3951 C  CZ2 . TRP B 1 17  ? 40.319 17.862 97.063  1.00 37.07 ? 39  TRP B CZ2 1 
ATOM   3952 C  CZ3 . TRP B 1 17  ? 38.018 18.205 97.754  1.00 35.98 ? 39  TRP B CZ3 1 
ATOM   3953 C  CH2 . TRP B 1 17  ? 38.970 17.797 96.800  1.00 36.76 ? 39  TRP B CH2 1 
ATOM   3954 N  N   . LEU B 1 18  ? 37.553 21.623 100.964 1.00 36.18 ? 40  LEU B N   1 
ATOM   3955 C  CA  . LEU B 1 18  ? 36.546 22.054 99.990  1.00 35.94 ? 40  LEU B CA  1 
ATOM   3956 C  C   . LEU B 1 18  ? 36.564 23.562 99.815  1.00 35.10 ? 40  LEU B C   1 
ATOM   3957 O  O   . LEU B 1 18  ? 36.369 24.057 98.717  1.00 34.87 ? 40  LEU B O   1 
ATOM   3958 C  CB  . LEU B 1 18  ? 35.123 21.638 100.409 1.00 36.30 ? 40  LEU B CB  1 
ATOM   3959 C  CG  . LEU B 1 18  ? 34.520 20.280 100.036 1.00 37.42 ? 40  LEU B CG  1 
ATOM   3960 C  CD1 . LEU B 1 18  ? 33.116 20.183 100.622 1.00 38.90 ? 40  LEU B CD1 1 
ATOM   3961 C  CD2 . LEU B 1 18  ? 34.495 20.039 98.521  1.00 37.81 ? 40  LEU B CD2 1 
ATOM   3962 N  N   . GLY B 1 19  ? 36.782 24.269 100.920 1.00 34.57 ? 41  GLY B N   1 
ATOM   3963 C  CA  . GLY B 1 19  ? 36.645 25.706 100.978 1.00 34.14 ? 41  GLY B CA  1 
ATOM   3964 C  C   . GLY B 1 19  ? 35.299 26.137 100.439 1.00 34.18 ? 41  GLY B C   1 
ATOM   3965 O  O   . GLY B 1 19  ? 34.249 25.893 101.057 1.00 34.39 ? 41  GLY B O   1 
ATOM   3966 N  N   . TYR B 1 20  ? 35.335 26.752 99.261  1.00 33.51 ? 42  TYR B N   1 
ATOM   3967 C  CA  . TYR B 1 20  ? 34.152 27.350 98.663  1.00 32.99 ? 42  TYR B CA  1 
ATOM   3968 C  C   . TYR B 1 20  ? 33.641 26.616 97.437  1.00 32.88 ? 42  TYR B C   1 
ATOM   3969 O  O   . TYR B 1 20  ? 32.822 27.163 96.702  1.00 32.74 ? 42  TYR B O   1 
ATOM   3970 C  CB  . TYR B 1 20  ? 34.429 28.804 98.290  1.00 32.49 ? 42  TYR B CB  1 
ATOM   3971 C  CG  . TYR B 1 20  ? 34.497 29.764 99.454  1.00 32.54 ? 42  TYR B CG  1 
ATOM   3972 C  CD1 . TYR B 1 20  ? 35.697 30.408 99.780  1.00 31.68 ? 42  TYR B CD1 1 
ATOM   3973 C  CD2 . TYR B 1 20  ? 33.363 30.051 100.218 1.00 31.46 ? 42  TYR B CD2 1 
ATOM   3974 C  CE1 . TYR B 1 20  ? 35.762 31.312 100.837 1.00 31.69 ? 42  TYR B CE1 1 
ATOM   3975 C  CE2 . TYR B 1 20  ? 33.422 30.949 101.283 1.00 30.69 ? 42  TYR B CE2 1 
ATOM   3976 C  CZ  . TYR B 1 20  ? 34.620 31.576 101.580 1.00 30.68 ? 42  TYR B CZ  1 
ATOM   3977 O  OH  . TYR B 1 20  ? 34.690 32.457 102.624 1.00 29.78 ? 42  TYR B OH  1 
ATOM   3978 N  N   . ALA B 1 21  ? 34.108 25.386 97.217  1.00 33.25 ? 43  ALA B N   1 
ATOM   3979 C  CA  . ALA B 1 21  ? 33.637 24.564 96.084  1.00 33.77 ? 43  ALA B CA  1 
ATOM   3980 C  C   . ALA B 1 21  ? 32.112 24.558 95.888  1.00 34.08 ? 43  ALA B C   1 
ATOM   3981 O  O   . ALA B 1 21  ? 31.636 24.686 94.758  1.00 34.64 ? 43  ALA B O   1 
ATOM   3982 C  CB  . ALA B 1 21  ? 34.156 23.156 96.186  1.00 33.56 ? 43  ALA B CB  1 
ATOM   3983 N  N   . LEU B 1 22  ? 31.352 24.405 96.973  1.00 34.31 ? 44  LEU B N   1 
ATOM   3984 C  CA  . LEU B 1 22  ? 29.888 24.388 96.878  1.00 34.84 ? 44  LEU B CA  1 
ATOM   3985 C  C   . LEU B 1 22  ? 29.352 25.751 96.425  1.00 34.53 ? 44  LEU B C   1 
ATOM   3986 O  O   . LEU B 1 22  ? 28.615 25.835 95.452  1.00 34.67 ? 44  LEU B O   1 
ATOM   3987 C  CB  . LEU B 1 22  ? 29.238 23.967 98.209  1.00 35.16 ? 44  LEU B CB  1 
ATOM   3988 C  CG  . LEU B 1 22  ? 28.050 22.993 98.119  1.00 36.33 ? 44  LEU B CG  1 
ATOM   3989 C  CD1 . LEU B 1 22  ? 28.541 21.539 98.103  1.00 38.41 ? 44  LEU B CD1 1 
ATOM   3990 C  CD2 . LEU B 1 22  ? 27.049 23.193 99.247  1.00 37.19 ? 44  LEU B CD2 1 
ATOM   3991 N  N   . ASP B 1 23  ? 29.749 26.805 97.133  1.00 34.51 ? 45  ASP B N   1 
ATOM   3992 C  CA  . ASP B 1 23  ? 29.349 28.191 96.829  1.00 34.65 ? 45  ASP B CA  1 
ATOM   3993 C  C   . ASP B 1 23  ? 29.712 28.631 95.417  1.00 33.74 ? 45  ASP B C   1 
ATOM   3994 O  O   . ASP B 1 23  ? 28.888 29.205 94.717  1.00 34.02 ? 45  ASP B O   1 
ATOM   3995 C  CB  . ASP B 1 23  ? 29.976 29.145 97.842  1.00 35.01 ? 45  ASP B CB  1 
ATOM   3996 C  CG  . ASP B 1 23  ? 29.823 28.655 99.263  1.00 37.50 ? 45  ASP B CG  1 
ATOM   3997 O  OD1 . ASP B 1 23  ? 30.509 27.666 99.623  1.00 38.79 ? 45  ASP B OD1 1 
ATOM   3998 O  OD2 . ASP B 1 23  ? 29.008 29.252 100.006 1.00 39.10 ? 45  ASP B OD2 1 
ATOM   3999 N  N   . PHE B 1 24  ? 30.956 28.359 95.027  1.00 33.13 ? 46  PHE B N   1 
ATOM   4000 C  CA  . PHE B 1 24  ? 31.461 28.614 93.680  1.00 32.33 ? 46  PHE B CA  1 
ATOM   4001 C  C   . PHE B 1 24  ? 30.637 27.855 92.639  1.00 31.40 ? 46  PHE B C   1 
ATOM   4002 O  O   . PHE B 1 24  ? 30.151 28.453 91.705  1.00 31.63 ? 46  PHE B O   1 
ATOM   4003 C  CB  . PHE B 1 24  ? 32.945 28.215 93.587  1.00 32.52 ? 46  PHE B CB  1 
ATOM   4004 C  CG  . PHE B 1 24  ? 33.621 28.667 92.317  1.00 33.03 ? 46  PHE B CG  1 
ATOM   4005 C  CD1 . PHE B 1 24  ? 34.230 29.922 92.246  1.00 33.23 ? 46  PHE B CD1 1 
ATOM   4006 C  CD2 . PHE B 1 24  ? 33.642 27.842 91.190  1.00 33.44 ? 46  PHE B CD2 1 
ATOM   4007 C  CE1 . PHE B 1 24  ? 34.850 30.364 91.062  1.00 32.96 ? 46  PHE B CE1 1 
ATOM   4008 C  CE2 . PHE B 1 24  ? 34.259 28.262 90.001  1.00 34.14 ? 46  PHE B CE2 1 
ATOM   4009 C  CZ  . PHE B 1 24  ? 34.868 29.530 89.938  1.00 34.64 ? 46  PHE B CZ  1 
ATOM   4010 N  N   . GLY B 1 25  ? 30.484 26.544 92.819  1.00 30.63 ? 47  GLY B N   1 
ATOM   4011 C  CA  . GLY B 1 25  ? 29.695 25.698 91.921  1.00 29.85 ? 47  GLY B CA  1 
ATOM   4012 C  C   . GLY B 1 25  ? 28.211 26.019 91.768  1.00 29.22 ? 47  GLY B C   1 
ATOM   4013 O  O   . GLY B 1 25  ? 27.700 26.001 90.652  1.00 29.08 ? 47  GLY B O   1 
ATOM   4014 N  N   . LYS B 1 26  ? 27.522 26.297 92.879  1.00 28.78 ? 48  LYS B N   1 
ATOM   4015 C  CA  . LYS B 1 26  ? 26.097 26.719 92.881  1.00 28.43 ? 48  LYS B CA  1 
ATOM   4016 C  C   . LYS B 1 26  ? 25.789 27.928 91.985  1.00 27.05 ? 48  LYS B C   1 
ATOM   4017 O  O   . LYS B 1 26  ? 24.817 27.932 91.224  1.00 26.63 ? 48  LYS B O   1 
ATOM   4018 C  CB  . LYS B 1 26  ? 25.642 27.093 94.303  1.00 29.06 ? 48  LYS B CB  1 
ATOM   4019 C  CG  . LYS B 1 26  ? 24.619 26.168 94.941  1.00 32.42 ? 48  LYS B CG  1 
ATOM   4020 C  CD  . LYS B 1 26  ? 24.186 26.707 96.315  1.00 37.65 ? 48  LYS B CD  1 
ATOM   4021 C  CE  . LYS B 1 26  ? 23.133 27.833 96.184  1.00 41.11 ? 48  LYS B CE  1 
ATOM   4022 N  NZ  . LYS B 1 26  ? 22.933 28.623 97.455  1.00 42.42 ? 48  LYS B NZ  1 
ATOM   4023 N  N   . ASP B 1 27  ? 26.606 28.964 92.127  1.00 25.71 ? 49  ASP B N   1 
ATOM   4024 C  CA  . ASP B 1 27  ? 26.378 30.240 91.459  1.00 24.43 ? 49  ASP B CA  1 
ATOM   4025 C  C   . ASP B 1 27  ? 27.658 31.074 91.509  1.00 23.33 ? 49  ASP B C   1 
ATOM   4026 O  O   . ASP B 1 27  ? 27.834 31.903 92.409  1.00 22.59 ? 49  ASP B O   1 
ATOM   4027 C  CB  . ASP B 1 27  ? 25.216 30.985 92.139  1.00 24.63 ? 49  ASP B CB  1 
ATOM   4028 C  CG  . ASP B 1 27  ? 24.855 32.291 91.442  1.00 25.27 ? 49  ASP B CG  1 
ATOM   4029 O  OD1 . ASP B 1 27  ? 25.660 32.827 90.637  1.00 24.23 ? 49  ASP B OD1 1 
ATOM   4030 O  OD2 . ASP B 1 27  ? 23.763 32.810 91.732  1.00 26.84 ? 49  ASP B OD2 1 
ATOM   4031 N  N   . ALA B 1 28  ? 28.552 30.842 90.545  1.00 22.42 ? 50  ALA B N   1 
ATOM   4032 C  CA  . ALA B 1 28  ? 29.849 31.523 90.514  1.00 21.52 ? 50  ALA B CA  1 
ATOM   4033 C  C   . ALA B 1 28  ? 29.724 33.040 90.443  1.00 21.10 ? 50  ALA B C   1 
ATOM   4034 O  O   . ALA B 1 28  ? 30.548 33.754 91.006  1.00 21.52 ? 50  ALA B O   1 
ATOM   4035 C  CB  . ALA B 1 28  ? 30.723 31.008 89.360  1.00 20.51 ? 50  ALA B CB  1 
ATOM   4036 N  N   . ALA B 1 29  ? 28.721 33.540 89.731  1.00 21.08 ? 51  ALA B N   1 
ATOM   4037 C  CA  . ALA B 1 29  ? 28.582 34.986 89.580  1.00 21.30 ? 51  ALA B CA  1 
ATOM   4038 C  C   . ALA B 1 29  ? 28.222 35.661 90.896  1.00 21.27 ? 51  ALA B C   1 
ATOM   4039 O  O   . ALA B 1 29  ? 28.768 36.714 91.228  1.00 20.98 ? 51  ALA B O   1 
ATOM   4040 C  CB  . ALA B 1 29  ? 27.559 35.335 88.505  1.00 21.33 ? 51  ALA B CB  1 
ATOM   4041 N  N   . SER B 1 30  ? 27.283 35.065 91.623  1.00 21.89 ? 52  SER B N   1 
ATOM   4042 C  CA  . SER B 1 30  ? 26.796 35.650 92.869  1.00 23.08 ? 52  SER B CA  1 
ATOM   4043 C  C   . SER B 1 30  ? 27.849 35.497 93.949  1.00 22.96 ? 52  SER B C   1 
ATOM   4044 O  O   . SER B 1 30  ? 28.095 36.424 94.704  1.00 22.81 ? 52  SER B O   1 
ATOM   4045 C  CB  . SER B 1 30  ? 25.454 35.038 93.279  1.00 23.12 ? 52  SER B CB  1 
ATOM   4046 O  OG  . SER B 1 30  ? 25.068 35.450 94.585  1.00 28.27 ? 52  SER B OG  1 
ATOM   4047 N  N   . PHE B 1 31  ? 28.502 34.340 93.979  1.00 23.55 ? 53  PHE B N   1 
ATOM   4048 C  CA  . PHE B 1 31  ? 29.602 34.091 94.912  1.00 24.25 ? 53  PHE B CA  1 
ATOM   4049 C  C   . PHE B 1 31  ? 30.805 35.033 94.703  1.00 24.33 ? 53  PHE B C   1 
ATOM   4050 O  O   . PHE B 1 31  ? 31.313 35.620 95.662  1.00 24.34 ? 53  PHE B O   1 
ATOM   4051 C  CB  . PHE B 1 31  ? 30.055 32.624 94.834  1.00 24.30 ? 53  PHE B CB  1 
ATOM   4052 C  CG  . PHE B 1 31  ? 31.387 32.376 95.459  1.00 25.91 ? 53  PHE B CG  1 
ATOM   4053 C  CD1 . PHE B 1 31  ? 31.533 32.377 96.852  1.00 27.99 ? 53  PHE B CD1 1 
ATOM   4054 C  CD2 . PHE B 1 31  ? 32.500 32.157 94.677  1.00 26.38 ? 53  PHE B CD2 1 
ATOM   4055 C  CE1 . PHE B 1 31  ? 32.763 32.168 97.435  1.00 26.81 ? 53  PHE B CE1 1 
ATOM   4056 C  CE2 . PHE B 1 31  ? 33.748 31.939 95.260  1.00 27.65 ? 53  PHE B CE2 1 
ATOM   4057 C  CZ  . PHE B 1 31  ? 33.880 31.943 96.632  1.00 28.14 ? 53  PHE B CZ  1 
ATOM   4058 N  N   . LEU B 1 32  ? 31.269 35.172 93.465  1.00 23.62 ? 54  LEU B N   1 
ATOM   4059 C  CA  . LEU B 1 32  ? 32.430 36.024 93.198  1.00 23.72 ? 54  LEU B CA  1 
ATOM   4060 C  C   . LEU B 1 32  ? 32.129 37.514 93.412  1.00 23.87 ? 54  LEU B C   1 
ATOM   4061 O  O   . LEU B 1 32  ? 33.023 38.290 93.757  1.00 23.67 ? 54  LEU B O   1 
ATOM   4062 C  CB  . LEU B 1 32  ? 33.018 35.768 91.797  1.00 23.18 ? 54  LEU B CB  1 
ATOM   4063 C  CG  . LEU B 1 32  ? 33.719 34.421 91.550  1.00 22.92 ? 54  LEU B CG  1 
ATOM   4064 C  CD1 . LEU B 1 32  ? 34.128 34.210 90.067  1.00 21.67 ? 54  LEU B CD1 1 
ATOM   4065 C  CD2 . LEU B 1 32  ? 34.929 34.209 92.479  1.00 22.95 ? 54  LEU B CD2 1 
ATOM   4066 N  N   . THR B 1 33  ? 30.870 37.896 93.211  1.00 23.91 ? 55  THR B N   1 
ATOM   4067 C  CA  . THR B 1 33  ? 30.389 39.251 93.522  1.00 24.46 ? 55  THR B CA  1 
ATOM   4068 C  C   . THR B 1 33  ? 30.514 39.551 95.018  1.00 24.91 ? 55  THR B C   1 
ATOM   4069 O  O   . THR B 1 33  ? 30.923 40.646 95.395  1.00 25.01 ? 55  THR B O   1 
ATOM   4070 C  CB  . THR B 1 33  ? 28.920 39.442 93.055  1.00 24.41 ? 55  THR B CB  1 
ATOM   4071 O  OG1 . THR B 1 33  ? 28.867 39.412 91.627  1.00 23.37 ? 55  THR B OG1 1 
ATOM   4072 C  CG2 . THR B 1 33  ? 28.309 40.767 93.559  1.00 24.74 ? 55  THR B CG2 1 
ATOM   4073 N  N   . ARG B 1 34  ? 30.159 38.574 95.852  1.00 25.78 ? 56  ARG B N   1 
ATOM   4074 C  CA  . ARG B 1 34  ? 30.257 38.691 97.315  1.00 26.62 ? 56  ARG B CA  1 
ATOM   4075 C  C   . ARG B 1 34  ? 31.712 38.755 97.754  1.00 26.41 ? 56  ARG B C   1 
ATOM   4076 O  O   . ARG B 1 34  ? 32.095 39.572 98.605  1.00 26.14 ? 56  ARG B O   1 
ATOM   4077 C  CB  . ARG B 1 34  ? 29.619 37.481 97.996  1.00 27.51 ? 56  ARG B CB  1 
ATOM   4078 C  CG  . ARG B 1 34  ? 28.124 37.347 97.839  1.00 30.01 ? 56  ARG B CG  1 
ATOM   4079 C  CD  . ARG B 1 34  ? 27.558 36.307 98.799  1.00 35.25 ? 56  ARG B CD  1 
ATOM   4080 N  NE  . ARG B 1 34  ? 28.006 34.924 98.558  1.00 38.98 ? 56  ARG B NE  1 
ATOM   4081 C  CZ  . ARG B 1 34  ? 27.338 34.004 97.854  1.00 39.55 ? 56  ARG B CZ  1 
ATOM   4082 N  NH1 . ARG B 1 34  ? 26.172 34.293 97.280  1.00 40.77 ? 56  ARG B NH1 1 
ATOM   4083 N  NH2 . ARG B 1 34  ? 27.838 32.782 97.722  1.00 39.34 ? 56  ARG B NH2 1 
ATOM   4084 N  N   . MET B 1 35  ? 32.513 37.865 97.175  1.00 25.74 ? 57  MET B N   1 
ATOM   4085 C  CA  . MET B 1 35  ? 33.953 37.881 97.365  1.00 25.61 ? 57  MET B CA  1 
ATOM   4086 C  C   . MET B 1 35  ? 34.564 39.221 96.971  1.00 26.10 ? 57  MET B C   1 
ATOM   4087 O  O   . MET B 1 35  ? 35.432 39.729 97.661  1.00 26.68 ? 57  MET B O   1 
ATOM   4088 C  CB  . MET B 1 35  ? 34.606 36.722 96.603  1.00 24.77 ? 57  MET B CB  1 
ATOM   4089 C  CG  . MET B 1 35  ? 34.496 35.358 97.283  1.00 22.46 ? 57  MET B CG  1 
ATOM   4090 S  SD  . MET B 1 35  ? 35.147 35.182 98.992  1.00 12.41 ? 57  MET B SD  1 
ATOM   4091 C  CE  . MET B 1 35  ? 33.644 35.365 99.905  1.00 14.22 ? 57  MET B CE  1 
ATOM   4092 N  N   . LYS B 1 36  ? 34.101 39.793 95.865  1.00 26.87 ? 58  LYS B N   1 
ATOM   4093 C  CA  . LYS B 1 36  ? 34.583 41.086 95.408  1.00 27.12 ? 58  LYS B CA  1 
ATOM   4094 C  C   . LYS B 1 36  ? 34.137 42.182 96.405  1.00 27.33 ? 58  LYS B C   1 
ATOM   4095 O  O   . LYS B 1 36  ? 34.911 43.091 96.733  1.00 26.78 ? 58  LYS B O   1 
ATOM   4096 C  CB  . LYS B 1 36  ? 34.078 41.374 93.986  1.00 27.04 ? 58  LYS B CB  1 
ATOM   4097 C  CG  . LYS B 1 36  ? 34.729 42.577 93.323  1.00 28.39 ? 58  LYS B CG  1 
ATOM   4098 C  CD  . LYS B 1 36  ? 34.071 42.948 91.992  1.00 29.03 ? 58  LYS B CD  1 
ATOM   4099 C  CE  . LYS B 1 36  ? 34.293 44.419 91.671  1.00 31.53 ? 58  LYS B CE  1 
ATOM   4100 N  NZ  . LYS B 1 36  ? 34.353 44.789 90.193  1.00 31.25 ? 58  LYS B NZ  1 
ATOM   4101 N  N   . GLU B 1 37  ? 32.899 42.079 96.888  1.00 27.15 ? 59  GLU B N   1 
ATOM   4102 C  CA  . GLU B 1 37  ? 32.411 42.986 97.934  1.00 28.34 ? 59  GLU B CA  1 
ATOM   4103 C  C   . GLU B 1 37  ? 33.170 42.805 99.260  1.00 27.81 ? 59  GLU B C   1 
ATOM   4104 O  O   . GLU B 1 37  ? 33.274 43.735 100.050 1.00 28.97 ? 59  GLU B O   1 
ATOM   4105 C  CB  . GLU B 1 37  ? 30.904 42.833 98.154  1.00 28.00 ? 59  GLU B CB  1 
ATOM   4106 C  CG  . GLU B 1 37  ? 30.049 43.374 96.997  1.00 30.64 ? 59  GLU B CG  1 
ATOM   4107 C  CD  . GLU B 1 37  ? 28.583 42.941 97.085  1.00 34.07 ? 59  GLU B CD  1 
ATOM   4108 O  OE1 . GLU B 1 37  ? 28.231 42.222 98.048  1.00 37.03 ? 59  GLU B OE1 1 
ATOM   4109 O  OE2 . GLU B 1 37  ? 27.785 43.307 96.185  1.00 34.91 ? 59  GLU B OE2 1 
ATOM   4110 N  N   . LYS B 1 38  ? 33.701 41.613 99.487  1.00 27.21 ? 60  LYS B N   1 
ATOM   4111 C  CA  . LYS B 1 38  ? 34.420 41.319 100.712 1.00 26.37 ? 60  LYS B CA  1 
ATOM   4112 C  C   . LYS B 1 38  ? 35.870 41.812 100.648 1.00 26.20 ? 60  LYS B C   1 
ATOM   4113 O  O   . LYS B 1 38  ? 36.330 42.459 101.592 1.00 26.48 ? 60  LYS B O   1 
ATOM   4114 C  CB  . LYS B 1 38  ? 34.334 39.810 101.017 1.00 26.35 ? 60  LYS B CB  1 
ATOM   4115 C  CG  . LYS B 1 38  ? 34.961 39.372 102.337 1.00 25.68 ? 60  LYS B CG  1 
ATOM   4116 C  CD  . LYS B 1 38  ? 34.655 37.903 102.644 1.00 23.36 ? 60  LYS B CD  1 
ATOM   4117 C  CE  . LYS B 1 38  ? 35.119 37.526 104.051 1.00 24.54 ? 60  LYS B CE  1 
ATOM   4118 N  NZ  . LYS B 1 38  ? 35.087 36.048 104.293 1.00 22.99 ? 60  LYS B NZ  1 
ATOM   4119 N  N   . HIS B 1 39  ? 36.568 41.535 99.534  1.00 25.35 ? 61  HIS B N   1 
ATOM   4120 C  CA  . HIS B 1 39  ? 38.028 41.729 99.443  1.00 25.25 ? 61  HIS B CA  1 
ATOM   4121 C  C   . HIS B 1 39  ? 38.519 42.752 98.421  1.00 25.08 ? 61  HIS B C   1 
ATOM   4122 O  O   . HIS B 1 39  ? 39.700 43.128 98.454  1.00 25.13 ? 61  HIS B O   1 
ATOM   4123 C  CB  . HIS B 1 39  ? 38.739 40.414 99.112  1.00 25.22 ? 61  HIS B CB  1 
ATOM   4124 C  CG  . HIS B 1 39  ? 38.353 39.265 99.985  1.00 25.37 ? 61  HIS B CG  1 
ATOM   4125 N  ND1 . HIS B 1 39  ? 38.919 39.046 101.220 1.00 26.89 ? 61  HIS B ND1 1 
ATOM   4126 C  CD2 . HIS B 1 39  ? 37.482 38.249 99.784  1.00 24.45 ? 61  HIS B CD2 1 
ATOM   4127 C  CE1 . HIS B 1 39  ? 38.398 37.954 101.751 1.00 26.63 ? 61  HIS B CE1 1 
ATOM   4128 N  NE2 . HIS B 1 39  ? 37.529 37.447 100.896 1.00 24.87 ? 61  HIS B NE2 1 
ATOM   4129 N  N   . GLY B 1 40  ? 37.640 43.181 97.512  1.00 24.35 ? 62  GLY B N   1 
ATOM   4130 C  CA  . GLY B 1 40  ? 38.051 43.969 96.340  1.00 24.17 ? 62  GLY B CA  1 
ATOM   4131 C  C   . GLY B 1 40  ? 38.327 43.112 95.093  1.00 24.28 ? 62  GLY B C   1 
ATOM   4132 O  O   . GLY B 1 40  ? 37.861 41.973 94.984  1.00 23.99 ? 62  GLY B O   1 
ATOM   4133 N  N   . ASP B 1 41  ? 39.103 43.671 94.168  1.00 24.45 ? 63  ASP B N   1 
ATOM   4134 C  CA  . ASP B 1 41  ? 39.310 43.132 92.818  1.00 24.89 ? 63  ASP B CA  1 
ATOM   4135 C  C   . ASP B 1 41  ? 40.269 41.970 92.731  1.00 24.76 ? 63  ASP B C   1 
ATOM   4136 O  O   . ASP B 1 41  ? 40.357 41.346 91.682  1.00 25.15 ? 63  ASP B O   1 
ATOM   4137 C  CB  . ASP B 1 41  ? 39.857 44.213 91.883  1.00 25.12 ? 63  ASP B CB  1 
ATOM   4138 C  CG  . ASP B 1 41  ? 38.812 45.215 91.465  1.00 26.36 ? 63  ASP B CG  1 
ATOM   4139 O  OD1 . ASP B 1 41  ? 37.613 44.907 91.528  1.00 28.07 ? 63  ASP B OD1 1 
ATOM   4140 O  OD2 . ASP B 1 41  ? 39.196 46.317 91.038  1.00 28.61 ? 63  ASP B OD2 1 
ATOM   4141 N  N   . ILE B 1 42  ? 41.011 41.691 93.801  1.00 24.38 ? 64  ILE B N   1 
ATOM   4142 C  CA  . ILE B 1 42  ? 41.914 40.540 93.805  1.00 23.80 ? 64  ILE B CA  1 
ATOM   4143 C  C   . ILE B 1 42  ? 41.993 39.841 95.160  1.00 23.85 ? 64  ILE B C   1 
ATOM   4144 O  O   . ILE B 1 42  ? 42.203 40.474 96.199  1.00 23.72 ? 64  ILE B O   1 
ATOM   4145 C  CB  . ILE B 1 42  ? 43.321 40.857 93.215  1.00 23.99 ? 64  ILE B CB  1 
ATOM   4146 C  CG1 . ILE B 1 42  ? 44.056 39.536 92.879  1.00 24.05 ? 64  ILE B CG1 1 
ATOM   4147 C  CG2 . ILE B 1 42  ? 44.123 41.814 94.126  1.00 24.06 ? 64  ILE B CG2 1 
ATOM   4148 C  CD1 . ILE B 1 42  ? 45.469 39.681 92.341  1.00 22.17 ? 64  ILE B CD1 1 
ATOM   4149 N  N   . PHE B 1 43  ? 41.795 38.525 95.124  1.00 23.48 ? 65  PHE B N   1 
ATOM   4150 C  CA  . PHE B 1 43  ? 41.742 37.693 96.322  1.00 23.22 ? 65  PHE B CA  1 
ATOM   4151 C  C   . PHE B 1 43  ? 42.000 36.249 95.911  1.00 23.45 ? 65  PHE B C   1 
ATOM   4152 O  O   . PHE B 1 43  ? 41.741 35.858 94.749  1.00 23.51 ? 65  PHE B O   1 
ATOM   4153 C  CB  . PHE B 1 43  ? 40.363 37.809 96.999  1.00 22.78 ? 65  PHE B CB  1 
ATOM   4154 C  CG  . PHE B 1 43  ? 39.200 37.624 96.049  1.00 21.91 ? 65  PHE B CG  1 
ATOM   4155 C  CD1 . PHE B 1 43  ? 38.689 38.700 95.330  1.00 20.90 ? 65  PHE B CD1 1 
ATOM   4156 C  CD2 . PHE B 1 43  ? 38.638 36.369 95.852  1.00 22.02 ? 65  PHE B CD2 1 
ATOM   4157 C  CE1 . PHE B 1 43  ? 37.646 38.524 94.437  1.00 21.48 ? 65  PHE B CE1 1 
ATOM   4158 C  CE2 . PHE B 1 43  ? 37.590 36.192 94.966  1.00 20.92 ? 65  PHE B CE2 1 
ATOM   4159 C  CZ  . PHE B 1 43  ? 37.097 37.272 94.258  1.00 19.46 ? 65  PHE B CZ  1 
ATOM   4160 N  N   . THR B 1 44  ? 42.476 35.461 96.867  1.00 22.41 ? 66  THR B N   1 
ATOM   4161 C  CA  . THR B 1 44  ? 42.689 34.045 96.682  1.00 21.70 ? 66  THR B CA  1 
ATOM   4162 C  C   . THR B 1 44  ? 41.651 33.234 97.483  1.00 22.34 ? 66  THR B C   1 
ATOM   4163 O  O   . THR B 1 44  ? 41.446 33.463 98.686  1.00 21.85 ? 66  THR B O   1 
ATOM   4164 C  CB  . THR B 1 44  ? 44.125 33.668 97.107  1.00 21.98 ? 66  THR B CB  1 
ATOM   4165 O  OG1 . THR B 1 44  ? 45.061 34.538 96.456  1.00 19.36 ? 66  THR B OG1 1 
ATOM   4166 C  CG2 . THR B 1 44  ? 44.450 32.206 96.796  1.00 20.13 ? 66  THR B CG2 1 
ATOM   4167 N  N   . ILE B 1 45  ? 40.984 32.309 96.799  1.00 22.10 ? 67  ILE B N   1 
ATOM   4168 C  CA  . ILE B 1 45  ? 40.040 31.419 97.452  1.00 23.00 ? 67  ILE B CA  1 
ATOM   4169 C  C   . ILE B 1 45  ? 40.476 29.955 97.395  1.00 23.64 ? 67  ILE B C   1 
ATOM   4170 O  O   . ILE B 1 45  ? 41.136 29.508 96.436  1.00 23.61 ? 67  ILE B O   1 
ATOM   4171 C  CB  . ILE B 1 45  ? 38.590 31.599 96.929  1.00 22.98 ? 67  ILE B CB  1 
ATOM   4172 C  CG1 . ILE B 1 45  ? 38.545 31.547 95.399  1.00 23.27 ? 67  ILE B CG1 1 
ATOM   4173 C  CG2 . ILE B 1 45  ? 37.999 32.911 97.474  1.00 22.37 ? 67  ILE B CG2 1 
ATOM   4174 C  CD1 . ILE B 1 45  ? 37.160 31.440 94.824  1.00 24.26 ? 67  ILE B CD1 1 
ATOM   4175 N  N   . LEU B 1 46  ? 40.143 29.223 98.452  1.00 24.45 ? 68  LEU B N   1 
ATOM   4176 C  CA  . LEU B 1 46  ? 40.315 27.784 98.465  1.00 25.12 ? 68  LEU B CA  1 
ATOM   4177 C  C   . LEU B 1 46  ? 39.068 27.186 97.845  1.00 26.32 ? 68  LEU B C   1 
ATOM   4178 O  O   . LEU B 1 46  ? 37.940 27.541 98.223  1.00 25.63 ? 68  LEU B O   1 
ATOM   4179 C  CB  . LEU B 1 46  ? 40.486 27.266 99.899  1.00 25.28 ? 68  LEU B CB  1 
ATOM   4180 C  CG  . LEU B 1 46  ? 40.554 25.742 100.128 1.00 23.58 ? 68  LEU B CG  1 
ATOM   4181 C  CD1 . LEU B 1 46  ? 41.692 25.123 99.356  1.00 21.29 ? 68  LEU B CD1 1 
ATOM   4182 C  CD2 . LEU B 1 46  ? 40.724 25.446 101.618 1.00 23.23 ? 68  LEU B CD2 1 
ATOM   4183 N  N   . VAL B 1 47  ? 39.278 26.280 96.892  1.00 28.00 ? 69  VAL B N   1 
ATOM   4184 C  CA  . VAL B 1 47  ? 38.181 25.538 96.248  1.00 29.89 ? 69  VAL B CA  1 
ATOM   4185 C  C   . VAL B 1 47  ? 38.671 24.154 95.787  1.00 30.82 ? 69  VAL B C   1 
ATOM   4186 O  O   . VAL B 1 47  ? 39.489 24.043 94.866  1.00 31.49 ? 69  VAL B O   1 
ATOM   4187 C  CB  . VAL B 1 47  ? 37.431 26.386 95.144  1.00 30.12 ? 69  VAL B CB  1 
ATOM   4188 C  CG1 . VAL B 1 47  ? 38.347 27.412 94.495  1.00 31.32 ? 69  VAL B CG1 1 
ATOM   4189 C  CG2 . VAL B 1 47  ? 36.725 25.509 94.095  1.00 31.04 ? 69  VAL B CG2 1 
ATOM   4190 N  N   . GLY B 1 48  ? 38.208 23.112 96.486  1.00 31.36 ? 70  GLY B N   1 
ATOM   4191 C  CA  . GLY B 1 48  ? 38.545 21.720 96.148  1.00 31.73 ? 70  GLY B CA  1 
ATOM   4192 C  C   . GLY B 1 48  ? 40.016 21.386 96.340  1.00 31.91 ? 70  GLY B C   1 
ATOM   4193 O  O   . GLY B 1 48  ? 40.614 20.728 95.501  1.00 32.71 ? 70  GLY B O   1 
ATOM   4194 N  N   . GLY B 1 49  ? 40.596 21.846 97.445  1.00 31.77 ? 71  GLY B N   1 
ATOM   4195 C  CA  . GLY B 1 49  ? 42.022 21.688 97.702  1.00 31.55 ? 71  GLY B CA  1 
ATOM   4196 C  C   . GLY B 1 49  ? 42.929 22.582 96.871  1.00 31.22 ? 71  GLY B C   1 
ATOM   4197 O  O   . GLY B 1 49  ? 44.140 22.589 97.065  1.00 32.18 ? 71  GLY B O   1 
ATOM   4198 N  N   . ARG B 1 50  ? 42.340 23.335 95.951  1.00 30.50 ? 72  ARG B N   1 
ATOM   4199 C  CA  . ARG B 1 50  ? 43.077 24.188 95.029  1.00 29.68 ? 72  ARG B CA  1 
ATOM   4200 C  C   . ARG B 1 50  ? 42.949 25.661 95.404  1.00 28.12 ? 72  ARG B C   1 
ATOM   4201 O  O   . ARG B 1 50  ? 41.906 26.120 95.864  1.00 27.87 ? 72  ARG B O   1 
ATOM   4202 C  CB  . ARG B 1 50  ? 42.572 23.973 93.605  1.00 30.27 ? 72  ARG B CB  1 
ATOM   4203 C  CG  . ARG B 1 50  ? 43.358 22.935 92.817  1.00 32.97 ? 72  ARG B CG  1 
ATOM   4204 C  CD  . ARG B 1 50  ? 43.260 23.250 91.334  1.00 39.13 ? 72  ARG B CD  1 
ATOM   4205 N  NE  . ARG B 1 50  ? 44.566 23.209 90.654  1.00 43.16 ? 72  ARG B NE  1 
ATOM   4206 C  CZ  . ARG B 1 50  ? 45.485 24.177 90.712  1.00 44.43 ? 72  ARG B CZ  1 
ATOM   4207 N  NH1 . ARG B 1 50  ? 45.270 25.278 91.429  1.00 45.03 ? 72  ARG B NH1 1 
ATOM   4208 N  NH2 . ARG B 1 50  ? 46.631 24.043 90.052  1.00 44.85 ? 72  ARG B NH2 1 
ATOM   4209 N  N   . TYR B 1 51  ? 44.020 26.402 95.201  1.00 26.59 ? 73  TYR B N   1 
ATOM   4210 C  CA  . TYR B 1 51  ? 43.986 27.830 95.462  1.00 25.42 ? 73  TYR B CA  1 
ATOM   4211 C  C   . TYR B 1 51  ? 43.841 28.631 94.163  1.00 24.63 ? 73  TYR B C   1 
ATOM   4212 O  O   . TYR B 1 51  ? 44.664 28.542 93.259  1.00 23.97 ? 73  TYR B O   1 
ATOM   4213 C  CB  . TYR B 1 51  ? 45.183 28.236 96.311  1.00 25.22 ? 73  TYR B CB  1 
ATOM   4214 C  CG  . TYR B 1 51  ? 45.163 27.532 97.651  1.00 24.92 ? 73  TYR B CG  1 
ATOM   4215 C  CD1 . TYR B 1 51  ? 44.263 27.921 98.645  1.00 22.87 ? 73  TYR B CD1 1 
ATOM   4216 C  CD2 . TYR B 1 51  ? 46.023 26.459 97.916  1.00 24.92 ? 73  TYR B CD2 1 
ATOM   4217 C  CE1 . TYR B 1 51  ? 44.222 27.289 99.863  1.00 24.66 ? 73  TYR B CE1 1 
ATOM   4218 C  CE2 . TYR B 1 51  ? 45.983 25.801 99.150  1.00 23.22 ? 73  TYR B CE2 1 
ATOM   4219 C  CZ  . TYR B 1 51  ? 45.076 26.218 100.112 1.00 25.31 ? 73  TYR B CZ  1 
ATOM   4220 O  OH  . TYR B 1 51  ? 45.023 25.592 101.346 1.00 26.67 ? 73  TYR B OH  1 
ATOM   4221 N  N   . VAL B 1 52  ? 42.744 29.369 94.077  1.00 24.01 ? 74  VAL B N   1 
ATOM   4222 C  CA  . VAL B 1 52  ? 42.413 30.140 92.898  1.00 23.53 ? 74  VAL B CA  1 
ATOM   4223 C  C   . VAL B 1 52  ? 42.511 31.634 93.205  1.00 22.72 ? 74  VAL B C   1 
ATOM   4224 O  O   . VAL B 1 52  ? 41.766 32.164 94.012  1.00 22.35 ? 74  VAL B O   1 
ATOM   4225 C  CB  . VAL B 1 52  ? 40.993 29.782 92.370  1.00 23.50 ? 74  VAL B CB  1 
ATOM   4226 C  CG1 . VAL B 1 52  ? 40.696 30.535 91.077  1.00 24.41 ? 74  VAL B CG1 1 
ATOM   4227 C  CG2 . VAL B 1 52  ? 40.870 28.273 92.145  1.00 24.57 ? 74  VAL B CG2 1 
ATOM   4228 N  N   . THR B 1 53  ? 43.440 32.317 92.556  1.00 22.34 ? 75  THR B N   1 
ATOM   4229 C  CA  . THR B 1 53  ? 43.507 33.767 92.690  1.00 21.59 ? 75  THR B CA  1 
ATOM   4230 C  C   . THR B 1 53  ? 42.636 34.399 91.615  1.00 21.62 ? 75  THR B C   1 
ATOM   4231 O  O   . THR B 1 53  ? 42.856 34.209 90.416  1.00 22.08 ? 75  THR B O   1 
ATOM   4232 C  CB  . THR B 1 53  ? 44.977 34.276 92.697  1.00 21.63 ? 75  THR B CB  1 
ATOM   4233 O  OG1 . THR B 1 53  ? 45.647 33.723 93.844  1.00 19.42 ? 75  THR B OG1 1 
ATOM   4234 C  CG2 . THR B 1 53  ? 45.039 35.817 92.738  1.00 20.90 ? 75  THR B CG2 1 
ATOM   4235 N  N   . VAL B 1 54  ? 41.617 35.118 92.064  1.00 21.67 ? 76  VAL B N   1 
ATOM   4236 C  CA  . VAL B 1 54  ? 40.654 35.742 91.178  1.00 21.85 ? 76  VAL B CA  1 
ATOM   4237 C  C   . VAL B 1 54  ? 41.011 37.224 90.992  1.00 22.12 ? 76  VAL B C   1 
ATOM   4238 O  O   . VAL B 1 54  ? 41.245 37.942 91.968  1.00 21.84 ? 76  VAL B O   1 
ATOM   4239 C  CB  . VAL B 1 54  ? 39.201 35.553 91.701  1.00 22.04 ? 76  VAL B CB  1 
ATOM   4240 C  CG1 . VAL B 1 54  ? 38.169 36.152 90.726  1.00 20.67 ? 76  VAL B CG1 1 
ATOM   4241 C  CG2 . VAL B 1 54  ? 38.907 34.064 91.948  1.00 21.42 ? 76  VAL B CG2 1 
ATOM   4242 N  N   . LEU B 1 55  ? 41.070 37.650 89.727  1.00 21.95 ? 77  LEU B N   1 
ATOM   4243 C  CA  . LEU B 1 55  ? 41.350 39.045 89.334  1.00 22.05 ? 77  LEU B CA  1 
ATOM   4244 C  C   . LEU B 1 55  ? 40.135 39.581 88.604  1.00 21.70 ? 77  LEU B C   1 
ATOM   4245 O  O   . LEU B 1 55  ? 39.671 38.983 87.635  1.00 21.53 ? 77  LEU B O   1 
ATOM   4246 C  CB  . LEU B 1 55  ? 42.534 39.092 88.365  1.00 22.14 ? 77  LEU B CB  1 
ATOM   4247 C  CG  . LEU B 1 55  ? 43.509 40.260 88.152  1.00 23.21 ? 77  LEU B CG  1 
ATOM   4248 C  CD1 . LEU B 1 55  ? 43.838 40.354 86.679  1.00 21.43 ? 77  LEU B CD1 1 
ATOM   4249 C  CD2 . LEU B 1 55  ? 43.046 41.588 88.692  1.00 23.03 ? 77  LEU B CD2 1 
ATOM   4250 N  N   . LEU B 1 56  ? 39.657 40.733 89.041  1.00 21.94 ? 78  LEU B N   1 
ATOM   4251 C  CA  . LEU B 1 56  ? 38.402 41.283 88.558  1.00 22.68 ? 78  LEU B CA  1 
ATOM   4252 C  C   . LEU B 1 56  ? 38.542 42.729 88.060  1.00 22.82 ? 78  LEU B C   1 
ATOM   4253 O  O   . LEU B 1 56  ? 37.575 43.342 87.655  1.00 23.37 ? 78  LEU B O   1 
ATOM   4254 C  CB  . LEU B 1 56  ? 37.358 41.184 89.670  1.00 22.65 ? 78  LEU B CB  1 
ATOM   4255 C  CG  . LEU B 1 56  ? 36.370 40.005 89.728  1.00 22.93 ? 78  LEU B CG  1 
ATOM   4256 C  CD1 . LEU B 1 56  ? 36.624 38.837 88.743  1.00 22.35 ? 78  LEU B CD1 1 
ATOM   4257 C  CD2 . LEU B 1 56  ? 36.234 39.511 91.144  1.00 22.20 ? 78  LEU B CD2 1 
ATOM   4258 N  N   . ASP B 1 57  ? 39.760 43.251 88.092  1.00 23.45 ? 79  ASP B N   1 
ATOM   4259 C  CA  . ASP B 1 57  ? 40.065 44.574 87.562  1.00 23.98 ? 79  ASP B CA  1 
ATOM   4260 C  C   . ASP B 1 57  ? 40.309 44.523 86.038  1.00 23.85 ? 79  ASP B C   1 
ATOM   4261 O  O   . ASP B 1 57  ? 41.344 44.030 85.591  1.00 24.12 ? 79  ASP B O   1 
ATOM   4262 C  CB  . ASP B 1 57  ? 41.283 45.167 88.276  1.00 23.86 ? 79  ASP B CB  1 
ATOM   4263 C  CG  . ASP B 1 57  ? 41.707 46.513 87.695  1.00 25.36 ? 79  ASP B CG  1 
ATOM   4264 O  OD1 . ASP B 1 57  ? 40.823 47.268 87.223  1.00 26.43 ? 79  ASP B OD1 1 
ATOM   4265 O  OD2 . ASP B 1 57  ? 42.920 46.805 87.703  1.00 25.85 ? 79  ASP B OD2 1 
ATOM   4266 N  N   . PRO B 1 58  ? 39.356 45.039 85.239  1.00 23.97 ? 80  PRO B N   1 
ATOM   4267 C  CA  . PRO B 1 58  ? 39.506 44.942 83.780  1.00 24.14 ? 80  PRO B CA  1 
ATOM   4268 C  C   . PRO B 1 58  ? 40.763 45.652 83.251  1.00 24.12 ? 80  PRO B C   1 
ATOM   4269 O  O   . PRO B 1 58  ? 41.347 45.194 82.274  1.00 23.65 ? 80  PRO B O   1 
ATOM   4270 C  CB  . PRO B 1 58  ? 38.229 45.587 83.237  1.00 23.70 ? 80  PRO B CB  1 
ATOM   4271 C  CG  . PRO B 1 58  ? 37.656 46.357 84.354  1.00 24.13 ? 80  PRO B CG  1 
ATOM   4272 C  CD  . PRO B 1 58  ? 38.114 45.727 85.633  1.00 23.93 ? 80  PRO B CD  1 
ATOM   4273 N  N   . HIS B 1 59  ? 41.165 46.749 83.903  1.00 24.49 ? 81  HIS B N   1 
ATOM   4274 C  CA  . HIS B 1 59  ? 42.430 47.444 83.598  1.00 24.94 ? 81  HIS B CA  1 
ATOM   4275 C  C   . HIS B 1 59  ? 43.664 46.536 83.659  1.00 24.67 ? 81  HIS B C   1 
ATOM   4276 O  O   . HIS B 1 59  ? 44.601 46.710 82.878  1.00 24.60 ? 81  HIS B O   1 
ATOM   4277 C  CB  . HIS B 1 59  ? 42.643 48.655 84.535  1.00 25.10 ? 81  HIS B CB  1 
ATOM   4278 C  CG  . HIS B 1 59  ? 41.713 49.809 84.282  1.00 26.61 ? 81  HIS B CG  1 
ATOM   4279 N  ND1 . HIS B 1 59  ? 41.645 50.471 83.070  1.00 27.18 ? 81  HIS B ND1 1 
ATOM   4280 C  CD2 . HIS B 1 59  ? 40.837 50.437 85.100  1.00 27.87 ? 81  HIS B CD2 1 
ATOM   4281 C  CE1 . HIS B 1 59  ? 40.751 51.439 83.148  1.00 27.03 ? 81  HIS B CE1 1 
ATOM   4282 N  NE2 . HIS B 1 59  ? 40.246 51.443 84.369  1.00 27.30 ? 81  HIS B NE2 1 
ATOM   4283 N  N   . SER B 1 60  ? 43.665 45.577 84.587  1.00 24.85 ? 82  SER B N   1 
ATOM   4284 C  CA  . SER B 1 60  ? 44.821 44.685 84.800  1.00 24.92 ? 82  SER B CA  1 
ATOM   4285 C  C   . SER B 1 60  ? 44.830 43.426 83.918  1.00 25.11 ? 82  SER B C   1 
ATOM   4286 O  O   . SER B 1 60  ? 45.836 42.704 83.869  1.00 24.42 ? 82  SER B O   1 
ATOM   4287 C  CB  . SER B 1 60  ? 44.925 44.271 86.278  1.00 25.31 ? 82  SER B CB  1 
ATOM   4288 O  OG  . SER B 1 60  ? 44.916 45.394 87.139  1.00 24.96 ? 82  SER B OG  1 
ATOM   4289 N  N   . TYR B 1 61  ? 43.719 43.171 83.224  1.00 25.46 ? 83  TYR B N   1 
ATOM   4290 C  CA  . TYR B 1 61  ? 43.557 41.948 82.413  1.00 26.25 ? 83  TYR B CA  1 
ATOM   4291 C  C   . TYR B 1 61  ? 44.625 41.828 81.321  1.00 27.34 ? 83  TYR B C   1 
ATOM   4292 O  O   . TYR B 1 61  ? 45.126 40.740 81.026  1.00 26.80 ? 83  TYR B O   1 
ATOM   4293 C  CB  . TYR B 1 61  ? 42.164 41.890 81.771  1.00 25.53 ? 83  TYR B CB  1 
ATOM   4294 C  CG  . TYR B 1 61  ? 40.995 41.573 82.689  1.00 24.42 ? 83  TYR B CG  1 
ATOM   4295 C  CD1 . TYR B 1 61  ? 41.188 41.159 84.005  1.00 23.06 ? 83  TYR B CD1 1 
ATOM   4296 C  CD2 . TYR B 1 61  ? 39.682 41.682 82.221  1.00 24.12 ? 83  TYR B CD2 1 
ATOM   4297 C  CE1 . TYR B 1 61  ? 40.097 40.869 84.837  1.00 22.73 ? 83  TYR B CE1 1 
ATOM   4298 C  CE2 . TYR B 1 61  ? 38.591 41.398 83.037  1.00 22.43 ? 83  TYR B CE2 1 
ATOM   4299 C  CZ  . TYR B 1 61  ? 38.805 40.992 84.348  1.00 22.84 ? 83  TYR B CZ  1 
ATOM   4300 O  OH  . TYR B 1 61  ? 37.721 40.705 85.160  1.00 23.24 ? 83  TYR B OH  1 
ATOM   4301 N  N   . ASP B 1 62  ? 44.977 42.971 80.743  1.00 29.34 ? 84  ASP B N   1 
ATOM   4302 C  CA  . ASP B 1 62  ? 45.814 43.007 79.562  1.00 31.33 ? 84  ASP B CA  1 
ATOM   4303 C  C   . ASP B 1 62  ? 47.171 42.343 79.742  1.00 31.54 ? 84  ASP B C   1 
ATOM   4304 O  O   . ASP B 1 62  ? 47.493 41.389 79.031  1.00 31.80 ? 84  ASP B O   1 
ATOM   4305 C  CB  . ASP B 1 62  ? 45.988 44.439 79.093  1.00 32.27 ? 84  ASP B CB  1 
ATOM   4306 C  CG  . ASP B 1 62  ? 46.191 44.520 77.610  1.00 35.49 ? 84  ASP B CG  1 
ATOM   4307 O  OD1 . ASP B 1 62  ? 47.311 44.218 77.136  1.00 38.47 ? 84  ASP B OD1 1 
ATOM   4308 O  OD2 . ASP B 1 62  ? 45.213 44.868 76.917  1.00 39.42 ? 84  ASP B OD2 1 
ATOM   4309 N  N   . ALA B 1 63  ? 47.964 42.850 80.688  1.00 31.89 ? 85  ALA B N   1 
ATOM   4310 C  CA  . ALA B 1 63  ? 49.303 42.331 80.910  1.00 32.08 ? 85  ALA B CA  1 
ATOM   4311 C  C   . ALA B 1 63  ? 49.197 40.842 81.165  1.00 31.97 ? 85  ALA B C   1 
ATOM   4312 O  O   . ALA B 1 63  ? 49.857 40.045 80.504  1.00 32.30 ? 85  ALA B O   1 
ATOM   4313 C  CB  . ALA B 1 63  ? 49.956 43.034 82.093  1.00 32.57 ? 85  ALA B CB  1 
ATOM   4314 N  N   . VAL B 1 64  ? 48.301 40.497 82.084  1.00 31.38 ? 86  VAL B N   1 
ATOM   4315 C  CA  . VAL B 1 64  ? 48.086 39.145 82.576  1.00 31.46 ? 86  VAL B CA  1 
ATOM   4316 C  C   . VAL B 1 64  ? 47.798 38.092 81.486  1.00 30.88 ? 86  VAL B C   1 
ATOM   4317 O  O   . VAL B 1 64  ? 48.440 37.050 81.465  1.00 30.81 ? 86  VAL B O   1 
ATOM   4318 C  CB  . VAL B 1 64  ? 47.012 39.178 83.712  1.00 31.71 ? 86  VAL B CB  1 
ATOM   4319 C  CG1 . VAL B 1 64  ? 46.426 37.821 83.999  1.00 32.09 ? 86  VAL B CG1 1 
ATOM   4320 C  CG2 . VAL B 1 64  ? 47.619 39.797 84.978  1.00 32.43 ? 86  VAL B CG2 1 
ATOM   4321 N  N   . VAL B 1 65  ? 46.860 38.357 80.580  1.00 30.38 ? 87  VAL B N   1 
ATOM   4322 C  CA  . VAL B 1 65  ? 46.528 37.366 79.548  1.00 30.07 ? 87  VAL B CA  1 
ATOM   4323 C  C   . VAL B 1 65  ? 47.629 37.128 78.503  1.00 30.48 ? 87  VAL B C   1 
ATOM   4324 O  O   . VAL B 1 65  ? 47.641 36.082 77.846  1.00 30.38 ? 87  VAL B O   1 
ATOM   4325 C  CB  . VAL B 1 65  ? 45.179 37.651 78.835  1.00 30.00 ? 87  VAL B CB  1 
ATOM   4326 C  CG1 . VAL B 1 65  ? 44.011 37.566 79.820  1.00 29.35 ? 87  VAL B CG1 1 
ATOM   4327 C  CG2 . VAL B 1 65  ? 45.199 38.996 78.089  1.00 29.78 ? 87  VAL B CG2 1 
ATOM   4328 N  N   . TRP B 1 66  ? 48.541 38.094 78.352  1.00 30.87 ? 88  TRP B N   1 
ATOM   4329 C  CA  . TRP B 1 66  ? 49.632 37.987 77.375  1.00 31.24 ? 88  TRP B CA  1 
ATOM   4330 C  C   . TRP B 1 66  ? 50.944 37.474 77.965  1.00 31.67 ? 88  TRP B C   1 
ATOM   4331 O  O   . TRP B 1 66  ? 51.949 37.356 77.250  1.00 32.17 ? 88  TRP B O   1 
ATOM   4332 C  CB  . TRP B 1 66  ? 49.874 39.321 76.670  1.00 31.41 ? 88  TRP B CB  1 
ATOM   4333 C  CG  . TRP B 1 66  ? 48.739 39.778 75.824  1.00 31.06 ? 88  TRP B CG  1 
ATOM   4334 C  CD1 . TRP B 1 66  ? 47.918 40.843 76.062  1.00 31.36 ? 88  TRP B CD1 1 
ATOM   4335 C  CD2 . TRP B 1 66  ? 48.287 39.186 74.597  1.00 30.90 ? 88  TRP B CD2 1 
ATOM   4336 N  NE1 . TRP B 1 66  ? 46.985 40.953 75.061  1.00 32.04 ? 88  TRP B NE1 1 
ATOM   4337 C  CE2 . TRP B 1 66  ? 47.189 39.950 74.147  1.00 31.65 ? 88  TRP B CE2 1 
ATOM   4338 C  CE3 . TRP B 1 66  ? 48.705 38.084 73.837  1.00 31.68 ? 88  TRP B CE3 1 
ATOM   4339 C  CZ2 . TRP B 1 66  ? 46.499 39.653 72.964  1.00 32.19 ? 88  TRP B CZ2 1 
ATOM   4340 C  CZ3 . TRP B 1 66  ? 48.014 37.781 72.661  1.00 32.10 ? 88  TRP B CZ3 1 
ATOM   4341 C  CH2 . TRP B 1 66  ? 46.922 38.566 72.239  1.00 31.96 ? 88  TRP B CH2 1 
ATOM   4342 N  N   . GLU B 1 67  ? 50.942 37.176 79.259  1.00 31.60 ? 89  GLU B N   1 
ATOM   4343 C  CA  . GLU B 1 67  ? 52.090 36.559 79.905  1.00 32.26 ? 89  GLU B CA  1 
ATOM   4344 C  C   . GLU B 1 67  ? 52.524 35.284 79.157  1.00 32.58 ? 89  GLU B C   1 
ATOM   4345 O  O   . GLU B 1 67  ? 51.673 34.508 78.734  1.00 32.67 ? 89  GLU B O   1 
ATOM   4346 C  CB  . GLU B 1 67  ? 51.756 36.221 81.358  1.00 32.06 ? 89  GLU B CB  1 
ATOM   4347 C  CG  . GLU B 1 67  ? 51.522 37.429 82.263  1.00 33.99 ? 89  GLU B CG  1 
ATOM   4348 C  CD  . GLU B 1 67  ? 52.783 37.952 82.937  1.00 35.62 ? 89  GLU B CD  1 
ATOM   4349 O  OE1 . GLU B 1 67  ? 53.903 37.607 82.500  1.00 35.54 ? 89  GLU B OE1 1 
ATOM   4350 O  OE2 . GLU B 1 67  ? 52.643 38.732 83.911  1.00 37.54 ? 89  GLU B OE2 1 
ATOM   4351 N  N   . PRO B 1 68  ? 53.852 35.071 78.991  1.00 33.01 ? 90  PRO B N   1 
ATOM   4352 C  CA  . PRO B 1 68  ? 54.354 33.829 78.374  1.00 32.98 ? 90  PRO B CA  1 
ATOM   4353 C  C   . PRO B 1 68  ? 54.048 32.580 79.194  1.00 33.28 ? 90  PRO B C   1 
ATOM   4354 O  O   . PRO B 1 68  ? 53.710 32.683 80.375  1.00 33.35 ? 90  PRO B O   1 
ATOM   4355 C  CB  . PRO B 1 68  ? 55.867 34.048 78.302  1.00 32.89 ? 90  PRO B CB  1 
ATOM   4356 C  CG  . PRO B 1 68  ? 56.169 35.134 79.302  1.00 33.37 ? 90  PRO B CG  1 
ATOM   4357 C  CD  . PRO B 1 68  ? 54.947 35.998 79.355  1.00 32.79 ? 90  PRO B CD  1 
ATOM   4358 N  N   . ARG B 1 69  ? 54.196 31.415 78.566  1.00 33.41 ? 91  ARG B N   1 
ATOM   4359 C  CA  . ARG B 1 69  ? 53.798 30.122 79.138  1.00 33.61 ? 91  ARG B CA  1 
ATOM   4360 C  C   . ARG B 1 69  ? 54.725 29.672 80.250  1.00 32.83 ? 91  ARG B C   1 
ATOM   4361 O  O   . ARG B 1 69  ? 54.369 28.806 81.050  1.00 32.53 ? 91  ARG B O   1 
ATOM   4362 C  CB  . ARG B 1 69  ? 53.770 29.041 78.052  1.00 34.09 ? 91  ARG B CB  1 
ATOM   4363 C  CG  . ARG B 1 69  ? 52.674 29.218 77.015  1.00 36.65 ? 91  ARG B CG  1 
ATOM   4364 C  CD  . ARG B 1 69  ? 52.519 27.978 76.103  1.00 39.64 ? 91  ARG B CD  1 
ATOM   4365 N  NE  . ARG B 1 69  ? 52.035 26.805 76.839  1.00 42.36 ? 91  ARG B NE  1 
ATOM   4366 C  CZ  . ARG B 1 69  ? 52.604 25.602 76.804  1.00 43.53 ? 91  ARG B CZ  1 
ATOM   4367 N  NH1 . ARG B 1 69  ? 53.673 25.384 76.040  1.00 44.27 ? 91  ARG B NH1 1 
ATOM   4368 N  NH2 . ARG B 1 69  ? 52.089 24.608 77.521  1.00 44.25 ? 91  ARG B NH2 1 
ATOM   4369 N  N   . THR B 1 70  ? 55.917 30.265 80.264  1.00 32.34 ? 92  THR B N   1 
ATOM   4370 C  CA  . THR B 1 70  ? 56.947 30.029 81.264  1.00 32.20 ? 92  THR B CA  1 
ATOM   4371 C  C   . THR B 1 70  ? 56.581 30.716 82.594  1.00 31.58 ? 92  THR B C   1 
ATOM   4372 O  O   . THR B 1 70  ? 57.173 30.422 83.642  1.00 31.68 ? 92  THR B O   1 
ATOM   4373 C  CB  . THR B 1 70  ? 58.290 30.599 80.763  1.00 32.34 ? 92  THR B CB  1 
ATOM   4374 O  OG1 . THR B 1 70  ? 58.113 31.987 80.453  1.00 32.84 ? 92  THR B OG1 1 
ATOM   4375 C  CG2 . THR B 1 70  ? 58.751 29.872 79.502  1.00 33.23 ? 92  THR B CG2 1 
ATOM   4376 N  N   . ARG B 1 71  ? 55.613 31.633 82.527  1.00 30.79 ? 93  ARG B N   1 
ATOM   4377 C  CA  . ARG B 1 71  ? 55.073 32.319 83.699  1.00 30.12 ? 93  ARG B CA  1 
ATOM   4378 C  C   . ARG B 1 71  ? 53.639 31.880 83.996  1.00 29.98 ? 93  ARG B C   1 
ATOM   4379 O  O   . ARG B 1 71  ? 53.377 31.302 85.050  1.00 30.04 ? 93  ARG B O   1 
ATOM   4380 C  CB  . ARG B 1 71  ? 55.167 33.841 83.529  1.00 29.86 ? 93  ARG B CB  1 
ATOM   4381 C  CG  . ARG B 1 71  ? 56.544 34.391 83.894  1.00 30.07 ? 93  ARG B CG  1 
ATOM   4382 C  CD  . ARG B 1 71  ? 56.723 35.858 83.534  1.00 29.65 ? 93  ARG B CD  1 
ATOM   4383 N  NE  . ARG B 1 71  ? 55.773 36.771 84.182  1.00 30.32 ? 93  ARG B NE  1 
ATOM   4384 C  CZ  . ARG B 1 71  ? 55.862 37.209 85.442  1.00 30.50 ? 93  ARG B CZ  1 
ATOM   4385 N  NH1 . ARG B 1 71  ? 56.851 36.801 86.233  1.00 29.49 ? 93  ARG B NH1 1 
ATOM   4386 N  NH2 . ARG B 1 71  ? 54.946 38.053 85.917  1.00 29.14 ? 93  ARG B NH2 1 
ATOM   4387 N  N   . LEU B 1 72  ? 52.719 32.142 83.067  1.00 29.21 ? 94  LEU B N   1 
ATOM   4388 C  CA  . LEU B 1 72  ? 51.324 31.759 83.240  1.00 29.42 ? 94  LEU B CA  1 
ATOM   4389 C  C   . LEU B 1 72  ? 50.879 30.855 82.089  1.00 29.96 ? 94  LEU B C   1 
ATOM   4390 O  O   . LEU B 1 72  ? 50.810 31.292 80.938  1.00 29.01 ? 94  LEU B O   1 
ATOM   4391 C  CB  . LEU B 1 72  ? 50.406 32.990 83.336  1.00 28.79 ? 94  LEU B CB  1 
ATOM   4392 C  CG  . LEU B 1 72  ? 50.594 34.007 84.468  1.00 28.40 ? 94  LEU B CG  1 
ATOM   4393 C  CD1 . LEU B 1 72  ? 49.649 35.192 84.257  1.00 26.70 ? 94  LEU B CD1 1 
ATOM   4394 C  CD2 . LEU B 1 72  ? 50.395 33.366 85.855  1.00 27.24 ? 94  LEU B CD2 1 
ATOM   4395 N  N   . ASP B 1 73  ? 50.569 29.606 82.424  1.00 30.84 ? 95  ASP B N   1 
ATOM   4396 C  CA  . ASP B 1 73  ? 50.289 28.547 81.443  1.00 31.95 ? 95  ASP B CA  1 
ATOM   4397 C  C   . ASP B 1 73  ? 48.802 28.442 81.131  1.00 32.36 ? 95  ASP B C   1 
ATOM   4398 O  O   . ASP B 1 73  ? 47.995 28.150 82.011  1.00 32.03 ? 95  ASP B O   1 
ATOM   4399 C  CB  . ASP B 1 73  ? 50.799 27.209 81.991  1.00 32.07 ? 95  ASP B CB  1 
ATOM   4400 C  CG  . ASP B 1 73  ? 50.902 26.108 80.923  1.00 34.28 ? 95  ASP B CG  1 
ATOM   4401 O  OD1 . ASP B 1 73  ? 50.505 26.317 79.756  1.00 36.03 ? 95  ASP B OD1 1 
ATOM   4402 O  OD2 . ASP B 1 73  ? 51.418 25.024 81.268  1.00 36.08 ? 95  ASP B OD2 1 
ATOM   4403 N  N   . PHE B 1 74  ? 48.449 28.669 79.871  1.00 33.63 ? 96  PHE B N   1 
ATOM   4404 C  CA  . PHE B 1 74  ? 47.066 28.503 79.401  1.00 35.16 ? 96  PHE B CA  1 
ATOM   4405 C  C   . PHE B 1 74  ? 46.763 27.072 78.897  1.00 35.96 ? 96  PHE B C   1 
ATOM   4406 O  O   . PHE B 1 74  ? 45.616 26.621 78.925  1.00 36.41 ? 96  PHE B O   1 
ATOM   4407 C  CB  . PHE B 1 74  ? 46.727 29.556 78.332  1.00 35.17 ? 96  PHE B CB  1 
ATOM   4408 C  CG  . PHE B 1 74  ? 47.491 29.390 77.031  1.00 37.26 ? 96  PHE B CG  1 
ATOM   4409 C  CD1 . PHE B 1 74  ? 46.998 28.568 76.010  1.00 39.05 ? 96  PHE B CD1 1 
ATOM   4410 C  CD2 . PHE B 1 74  ? 48.695 30.055 76.820  1.00 38.64 ? 96  PHE B CD2 1 
ATOM   4411 C  CE1 . PHE B 1 74  ? 47.696 28.408 74.812  1.00 38.52 ? 96  PHE B CE1 1 
ATOM   4412 C  CE2 . PHE B 1 74  ? 49.395 29.894 75.627  1.00 39.26 ? 96  PHE B CE2 1 
ATOM   4413 C  CZ  . PHE B 1 74  ? 48.890 29.068 74.621  1.00 38.28 ? 96  PHE B CZ  1 
ATOM   4414 N  N   . HIS B 1 75  ? 47.797 26.357 78.464  1.00 36.90 ? 97  HIS B N   1 
ATOM   4415 C  CA  . HIS B 1 75  ? 47.614 25.095 77.748  1.00 38.13 ? 97  HIS B CA  1 
ATOM   4416 C  C   . HIS B 1 75  ? 47.377 23.880 78.645  1.00 38.86 ? 97  HIS B C   1 
ATOM   4417 O  O   . HIS B 1 75  ? 46.475 23.079 78.380  1.00 38.84 ? 97  HIS B O   1 
ATOM   4418 C  CB  . HIS B 1 75  ? 48.798 24.835 76.818  1.00 38.35 ? 97  HIS B CB  1 
ATOM   4419 C  CG  . HIS B 1 75  ? 48.617 23.650 75.916  1.00 39.63 ? 97  HIS B CG  1 
ATOM   4420 N  ND1 . HIS B 1 75  ? 47.459 23.425 75.202  1.00 40.34 ? 97  HIS B ND1 1 
ATOM   4421 C  CD2 . HIS B 1 75  ? 49.462 22.643 75.589  1.00 40.52 ? 97  HIS B CD2 1 
ATOM   4422 C  CE1 . HIS B 1 75  ? 47.593 22.324 74.483  1.00 40.89 ? 97  HIS B CE1 1 
ATOM   4423 N  NE2 . HIS B 1 75  ? 48.799 21.829 74.700  1.00 41.57 ? 97  HIS B NE2 1 
ATOM   4424 N  N   . ALA B 1 76  ? 48.195 23.731 79.688  1.00 39.36 ? 98  ALA B N   1 
ATOM   4425 C  CA  . ALA B 1 76  ? 48.073 22.594 80.593  1.00 39.67 ? 98  ALA B CA  1 
ATOM   4426 C  C   . ALA B 1 76  ? 46.648 22.425 81.124  1.00 39.70 ? 98  ALA B C   1 
ATOM   4427 O  O   . ALA B 1 76  ? 46.195 21.293 81.308  1.00 39.96 ? 98  ALA B O   1 
ATOM   4428 C  CB  . ALA B 1 76  ? 49.090 22.689 81.742  1.00 40.01 ? 98  ALA B CB  1 
ATOM   4429 N  N   . TYR B 1 77  ? 45.942 23.536 81.355  1.00 39.72 ? 99  TYR B N   1 
ATOM   4430 C  CA  . TYR B 1 77  ? 44.541 23.468 81.786  1.00 39.87 ? 99  TYR B CA  1 
ATOM   4431 C  C   . TYR B 1 77  ? 43.611 22.950 80.695  1.00 39.60 ? 99  TYR B C   1 
ATOM   4432 O  O   . TYR B 1 77  ? 42.829 22.041 80.940  1.00 39.27 ? 99  TYR B O   1 
ATOM   4433 C  CB  . TYR B 1 77  ? 44.026 24.801 82.327  1.00 40.56 ? 99  TYR B CB  1 
ATOM   4434 C  CG  . TYR B 1 77  ? 42.712 24.671 83.099  1.00 41.44 ? 99  TYR B CG  1 
ATOM   4435 C  CD1 . TYR B 1 77  ? 42.557 23.714 84.104  1.00 42.36 ? 99  TYR B CD1 1 
ATOM   4436 C  CD2 . TYR B 1 77  ? 41.623 25.498 82.817  1.00 43.49 ? 99  TYR B CD2 1 
ATOM   4437 C  CE1 . TYR B 1 77  ? 41.354 23.584 84.808  1.00 42.99 ? 99  TYR B CE1 1 
ATOM   4438 C  CE2 . TYR B 1 77  ? 40.413 25.380 83.529  1.00 43.26 ? 99  TYR B CE2 1 
ATOM   4439 C  CZ  . TYR B 1 77  ? 40.294 24.423 84.523  1.00 43.26 ? 99  TYR B CZ  1 
ATOM   4440 O  OH  . TYR B 1 77  ? 39.110 24.299 85.233  1.00 42.85 ? 99  TYR B OH  1 
ATOM   4441 N  N   . ALA B 1 78  ? 43.705 23.529 79.499  1.00 39.46 ? 100 ALA B N   1 
ATOM   4442 C  CA  . ALA B 1 78  ? 43.022 23.002 78.305  1.00 39.19 ? 100 ALA B CA  1 
ATOM   4443 C  C   . ALA B 1 78  ? 43.286 21.499 78.066  1.00 39.00 ? 100 ALA B C   1 
ATOM   4444 O  O   . ALA B 1 78  ? 42.366 20.757 77.753  1.00 39.27 ? 100 ALA B O   1 
ATOM   4445 C  CB  . ALA B 1 78  ? 43.403 23.814 77.073  1.00 38.88 ? 100 ALA B CB  1 
ATOM   4446 N  N   . ILE B 1 79  ? 44.532 21.057 78.211  1.00 38.80 ? 101 ILE B N   1 
ATOM   4447 C  CA  . ILE B 1 79  ? 44.868 19.628 78.120  1.00 38.65 ? 101 ILE B CA  1 
ATOM   4448 C  C   . ILE B 1 79  ? 44.072 18.823 79.147  1.00 38.31 ? 101 ILE B C   1 
ATOM   4449 O  O   . ILE B 1 79  ? 43.365 17.874 78.810  1.00 37.53 ? 101 ILE B O   1 
ATOM   4450 C  CB  . ILE B 1 79  ? 46.379 19.377 78.356  1.00 39.01 ? 101 ILE B CB  1 
ATOM   4451 C  CG1 . ILE B 1 79  ? 47.218 19.972 77.224  1.00 39.15 ? 101 ILE B CG1 1 
ATOM   4452 C  CG2 . ILE B 1 79  ? 46.667 17.876 78.514  1.00 39.40 ? 101 ILE B CG2 1 
ATOM   4453 C  CD1 . ILE B 1 79  ? 48.677 20.179 77.598  1.00 40.88 ? 101 ILE B CD1 1 
ATOM   4454 N  N   . PHE B 1 80  ? 44.194 19.225 80.405  1.00 38.39 ? 102 PHE B N   1 
ATOM   4455 C  CA  . PHE B 1 80  ? 43.460 18.603 81.500  1.00 38.46 ? 102 PHE B CA  1 
ATOM   4456 C  C   . PHE B 1 80  ? 41.951 18.529 81.219  1.00 37.74 ? 102 PHE B C   1 
ATOM   4457 O  O   . PHE B 1 80  ? 41.320 17.509 81.509  1.00 37.38 ? 102 PHE B O   1 
ATOM   4458 C  CB  . PHE B 1 80  ? 43.753 19.327 82.816  1.00 38.81 ? 102 PHE B CB  1 
ATOM   4459 C  CG  . PHE B 1 80  ? 43.041 18.745 83.998  1.00 40.45 ? 102 PHE B CG  1 
ATOM   4460 C  CD1 . PHE B 1 80  ? 41.811 19.258 84.408  1.00 41.69 ? 102 PHE B CD1 1 
ATOM   4461 C  CD2 . PHE B 1 80  ? 43.603 17.690 84.715  1.00 42.40 ? 102 PHE B CD2 1 
ATOM   4462 C  CE1 . PHE B 1 80  ? 41.142 18.726 85.519  1.00 42.76 ? 102 PHE B CE1 1 
ATOM   4463 C  CE2 . PHE B 1 80  ? 42.940 17.145 85.832  1.00 43.11 ? 102 PHE B CE2 1 
ATOM   4464 C  CZ  . PHE B 1 80  ? 41.711 17.666 86.229  1.00 43.28 ? 102 PHE B CZ  1 
ATOM   4465 N  N   . LEU B 1 81  ? 41.396 19.592 80.635  1.00 37.11 ? 103 LEU B N   1 
ATOM   4466 C  CA  . LEU B 1 81  ? 39.984 19.620 80.215  1.00 36.81 ? 103 LEU B CA  1 
ATOM   4467 C  C   . LEU B 1 81  ? 39.644 18.787 78.970  1.00 36.14 ? 103 LEU B C   1 
ATOM   4468 O  O   . LEU B 1 81  ? 38.592 18.149 78.926  1.00 36.31 ? 103 LEU B O   1 
ATOM   4469 C  CB  . LEU B 1 81  ? 39.473 21.058 80.027  1.00 37.28 ? 103 LEU B CB  1 
ATOM   4470 C  CG  . LEU B 1 81  ? 39.519 22.079 81.177  1.00 38.13 ? 103 LEU B CG  1 
ATOM   4471 C  CD1 . LEU B 1 81  ? 39.012 23.449 80.701  1.00 40.55 ? 103 LEU B CD1 1 
ATOM   4472 C  CD2 . LEU B 1 81  ? 38.746 21.628 82.414  1.00 38.66 ? 103 LEU B CD2 1 
ATOM   4473 N  N   . MET B 1 82  ? 40.498 18.803 77.951  1.00 35.36 ? 104 MET B N   1 
ATOM   4474 C  CA  . MET B 1 82  ? 40.287 17.915 76.794  1.00 34.66 ? 104 MET B CA  1 
ATOM   4475 C  C   . MET B 1 82  ? 40.220 16.441 77.240  1.00 34.89 ? 104 MET B C   1 
ATOM   4476 O  O   . MET B 1 82  ? 39.367 15.688 76.766  1.00 34.12 ? 104 MET B O   1 
ATOM   4477 C  CB  . MET B 1 82  ? 41.386 18.078 75.746  1.00 34.59 ? 104 MET B CB  1 
ATOM   4478 C  CG  . MET B 1 82  ? 41.770 19.516 75.448  1.00 33.61 ? 104 MET B CG  1 
ATOM   4479 S  SD  . MET B 1 82  ? 43.134 19.707 74.285  1.00 33.73 ? 104 MET B SD  1 
ATOM   4480 C  CE  . MET B 1 82  ? 43.782 18.055 74.127  1.00 23.20 ? 104 MET B CE  1 
ATOM   4481 N  N   . GLU B 1 83  ? 41.108 16.056 78.165  1.00 34.75 ? 105 GLU B N   1 
ATOM   4482 C  CA  . GLU B 1 83  ? 41.181 14.683 78.700  1.00 35.29 ? 105 GLU B CA  1 
ATOM   4483 C  C   . GLU B 1 83  ? 39.989 14.340 79.581  1.00 34.27 ? 105 GLU B C   1 
ATOM   4484 O  O   . GLU B 1 83  ? 39.289 13.361 79.336  1.00 34.06 ? 105 GLU B O   1 
ATOM   4485 C  CB  . GLU B 1 83  ? 42.474 14.468 79.502  1.00 36.04 ? 105 GLU B CB  1 
ATOM   4486 C  CG  . GLU B 1 83  ? 43.010 13.027 79.492  1.00 40.00 ? 105 GLU B CG  1 
ATOM   4487 C  CD  . GLU B 1 83  ? 42.630 12.179 80.711  1.00 44.43 ? 105 GLU B CD  1 
ATOM   4488 O  OE1 . GLU B 1 83  ? 43.550 11.559 81.292  1.00 46.22 ? 105 GLU B OE1 1 
ATOM   4489 O  OE2 . GLU B 1 83  ? 41.432 12.100 81.081  1.00 46.44 ? 105 GLU B OE2 1 
ATOM   4490 N  N   . ARG B 1 84  ? 39.768 15.141 80.615  1.00 33.24 ? 106 ARG B N   1 
ATOM   4491 C  CA  . ARG B 1 84  ? 38.754 14.810 81.599  1.00 32.21 ? 106 ARG B CA  1 
ATOM   4492 C  C   . ARG B 1 84  ? 37.326 15.020 81.098  1.00 30.71 ? 106 ARG B C   1 
ATOM   4493 O  O   . ARG B 1 84  ? 36.418 14.342 81.564  1.00 30.20 ? 106 ARG B O   1 
ATOM   4494 C  CB  . ARG B 1 84  ? 39.013 15.518 82.937  1.00 32.94 ? 106 ARG B CB  1 
ATOM   4495 C  CG  . ARG B 1 84  ? 38.310 16.851 83.120  1.00 35.31 ? 106 ARG B CG  1 
ATOM   4496 C  CD  . ARG B 1 84  ? 37.985 17.116 84.584  1.00 39.70 ? 106 ARG B CD  1 
ATOM   4497 N  NE  . ARG B 1 84  ? 36.813 16.354 85.036  1.00 42.27 ? 106 ARG B NE  1 
ATOM   4498 C  CZ  . ARG B 1 84  ? 36.486 16.159 86.314  1.00 42.57 ? 106 ARG B CZ  1 
ATOM   4499 N  NH1 . ARG B 1 84  ? 37.242 16.651 87.290  1.00 42.37 ? 106 ARG B NH1 1 
ATOM   4500 N  NH2 . ARG B 1 84  ? 35.405 15.456 86.616  1.00 42.88 ? 106 ARG B NH2 1 
ATOM   4501 N  N   . ILE B 1 85  ? 37.119 15.937 80.150  1.00 29.21 ? 107 ILE B N   1 
ATOM   4502 C  CA  . ILE B 1 85  ? 35.760 16.176 79.667  1.00 27.50 ? 107 ILE B CA  1 
ATOM   4503 C  C   . ILE B 1 85  ? 35.413 15.455 78.360  1.00 26.68 ? 107 ILE B C   1 
ATOM   4504 O  O   . ILE B 1 85  ? 34.282 14.971 78.199  1.00 26.24 ? 107 ILE B O   1 
ATOM   4505 C  CB  . ILE B 1 85  ? 35.368 17.672 79.660  1.00 27.74 ? 107 ILE B CB  1 
ATOM   4506 C  CG1 . ILE B 1 85  ? 35.375 18.215 81.085  1.00 28.00 ? 107 ILE B CG1 1 
ATOM   4507 C  CG2 . ILE B 1 85  ? 33.941 17.876 79.138  1.00 27.17 ? 107 ILE B CG2 1 
ATOM   4508 C  CD1 . ILE B 1 85  ? 36.565 19.073 81.411  1.00 28.78 ? 107 ILE B CD1 1 
ATOM   4509 N  N   . PHE B 1 86  ? 36.383 15.367 77.449  1.00 25.17 ? 108 PHE B N   1 
ATOM   4510 C  CA  . PHE B 1 86  ? 36.133 14.836 76.114  1.00 24.19 ? 108 PHE B CA  1 
ATOM   4511 C  C   . PHE B 1 86  ? 36.909 13.548 75.817  1.00 23.86 ? 108 PHE B C   1 
ATOM   4512 O  O   . PHE B 1 86  ? 36.753 12.934 74.758  1.00 23.10 ? 108 PHE B O   1 
ATOM   4513 C  CB  . PHE B 1 86  ? 36.389 15.922 75.064  1.00 23.59 ? 108 PHE B CB  1 
ATOM   4514 C  CG  . PHE B 1 86  ? 35.263 16.922 74.964  1.00 22.93 ? 108 PHE B CG  1 
ATOM   4515 C  CD1 . PHE B 1 86  ? 34.099 16.608 74.260  1.00 20.98 ? 108 PHE B CD1 1 
ATOM   4516 C  CD2 . PHE B 1 86  ? 35.349 18.159 75.597  1.00 22.86 ? 108 PHE B CD2 1 
ATOM   4517 C  CE1 . PHE B 1 86  ? 33.045 17.518 74.166  1.00 19.07 ? 108 PHE B CE1 1 
ATOM   4518 C  CE2 . PHE B 1 86  ? 34.300 19.084 75.510  1.00 21.68 ? 108 PHE B CE2 1 
ATOM   4519 C  CZ  . PHE B 1 86  ? 33.145 18.755 74.795  1.00 19.67 ? 108 PHE B CZ  1 
ATOM   4520 N  N   . ASP B 1 87  ? 37.742 13.161 76.781  1.00 23.95 ? 109 ASP B N   1 
ATOM   4521 C  CA  . ASP B 1 87  ? 38.473 11.900 76.767  1.00 24.28 ? 109 ASP B CA  1 
ATOM   4522 C  C   . ASP B 1 87  ? 39.459 11.857 75.628  1.00 24.50 ? 109 ASP B C   1 
ATOM   4523 O  O   . ASP B 1 87  ? 39.756 10.790 75.113  1.00 24.66 ? 109 ASP B O   1 
ATOM   4524 C  CB  . ASP B 1 87  ? 37.510 10.697 76.742  1.00 23.84 ? 109 ASP B CB  1 
ATOM   4525 C  CG  . ASP B 1 87  ? 36.395 10.824 77.780  1.00 24.36 ? 109 ASP B CG  1 
ATOM   4526 O  OD1 . ASP B 1 87  ? 36.727 11.062 78.969  1.00 23.28 ? 109 ASP B OD1 1 
ATOM   4527 O  OD2 . ASP B 1 87  ? 35.198 10.707 77.402  1.00 21.44 ? 109 ASP B OD2 1 
ATOM   4528 N  N   . VAL B 1 88  ? 39.952 13.024 75.219  1.00 25.99 ? 110 VAL B N   1 
ATOM   4529 C  CA  . VAL B 1 88  ? 40.989 13.061 74.192  1.00 27.06 ? 110 VAL B CA  1 
ATOM   4530 C  C   . VAL B 1 88  ? 42.380 13.227 74.819  1.00 28.16 ? 110 VAL B C   1 
ATOM   4531 O  O   . VAL B 1 88  ? 42.565 14.008 75.754  1.00 28.07 ? 110 VAL B O   1 
ATOM   4532 C  CB  . VAL B 1 88  ? 40.704 14.052 72.996  1.00 27.30 ? 110 VAL B CB  1 
ATOM   4533 C  CG1 . VAL B 1 88  ? 39.205 14.329 72.833  1.00 27.18 ? 110 VAL B CG1 1 
ATOM   4534 C  CG2 . VAL B 1 88  ? 41.494 15.338 73.083  1.00 27.47 ? 110 VAL B CG2 1 
ATOM   4535 N  N   . GLN B 1 89  ? 43.331 12.457 74.306  1.00 28.75 ? 111 GLN B N   1 
ATOM   4536 C  CA  . GLN B 1 89  ? 44.721 12.579 74.679  1.00 30.48 ? 111 GLN B CA  1 
ATOM   4537 C  C   . GLN B 1 89  ? 45.524 12.579 73.395  1.00 30.32 ? 111 GLN B C   1 
ATOM   4538 O  O   . GLN B 1 89  ? 45.450 11.636 72.610  1.00 30.88 ? 111 GLN B O   1 
ATOM   4539 C  CB  . GLN B 1 89  ? 45.156 11.408 75.571  1.00 31.05 ? 111 GLN B CB  1 
ATOM   4540 C  CG  . GLN B 1 89  ? 44.518 11.403 76.954  1.00 33.52 ? 111 GLN B CG  1 
ATOM   4541 C  CD  . GLN B 1 89  ? 44.918 10.194 77.784  1.00 36.94 ? 111 GLN B CD  1 
ATOM   4542 O  OE1 . GLN B 1 89  ? 44.520 10.072 78.942  1.00 40.13 ? 111 GLN B OE1 1 
ATOM   4543 N  NE2 . GLN B 1 89  ? 45.702 9.292  77.196  1.00 37.93 ? 111 GLN B NE2 1 
ATOM   4544 N  N   . LEU B 1 90  ? 46.261 13.659 73.171  1.00 30.39 ? 112 LEU B N   1 
ATOM   4545 C  CA  . LEU B 1 90  ? 47.092 13.808 71.979  1.00 30.43 ? 112 LEU B CA  1 
ATOM   4546 C  C   . LEU B 1 90  ? 48.572 13.797 72.393  1.00 30.86 ? 112 LEU B C   1 
ATOM   4547 O  O   . LEU B 1 90  ? 48.883 14.066 73.555  1.00 30.49 ? 112 LEU B O   1 
ATOM   4548 C  CB  . LEU B 1 90  ? 46.759 15.138 71.300  1.00 29.77 ? 112 LEU B CB  1 
ATOM   4549 C  CG  . LEU B 1 90  ? 45.489 15.366 70.450  1.00 30.40 ? 112 LEU B CG  1 
ATOM   4550 C  CD1 . LEU B 1 90  ? 44.465 14.233 70.460  1.00 28.22 ? 112 LEU B CD1 1 
ATOM   4551 C  CD2 . LEU B 1 90  ? 44.831 16.733 70.787  1.00 28.06 ? 112 LEU B CD2 1 
ATOM   4552 N  N   . PRO B 1 91  ? 49.485 13.475 71.449  1.00 31.49 ? 113 PRO B N   1 
ATOM   4553 C  CA  . PRO B 1 91  ? 50.922 13.714 71.706  1.00 32.12 ? 113 PRO B CA  1 
ATOM   4554 C  C   . PRO B 1 91  ? 51.228 15.198 71.896  1.00 32.72 ? 113 PRO B C   1 
ATOM   4555 O  O   . PRO B 1 91  ? 50.465 16.056 71.437  1.00 32.40 ? 113 PRO B O   1 
ATOM   4556 C  CB  . PRO B 1 91  ? 51.610 13.226 70.418  1.00 32.16 ? 113 PRO B CB  1 
ATOM   4557 C  CG  . PRO B 1 91  ? 50.600 12.374 69.719  1.00 31.52 ? 113 PRO B CG  1 
ATOM   4558 C  CD  . PRO B 1 91  ? 49.249 12.873 70.123  1.00 30.85 ? 113 PRO B CD  1 
ATOM   4559 N  N   . HIS B 1 92  ? 52.336 15.494 72.576  1.00 33.87 ? 114 HIS B N   1 
ATOM   4560 C  CA  . HIS B 1 92  ? 52.799 16.873 72.757  1.00 34.33 ? 114 HIS B CA  1 
ATOM   4561 C  C   . HIS B 1 92  ? 52.881 17.587 71.417  1.00 34.10 ? 114 HIS B C   1 
ATOM   4562 O  O   . HIS B 1 92  ? 53.350 17.032 70.426  1.00 34.32 ? 114 HIS B O   1 
ATOM   4563 C  CB  . HIS B 1 92  ? 54.173 16.915 73.437  1.00 35.19 ? 114 HIS B CB  1 
ATOM   4564 C  CG  . HIS B 1 92  ? 54.258 16.096 74.690  1.00 37.24 ? 114 HIS B CG  1 
ATOM   4565 N  ND1 . HIS B 1 92  ? 55.195 15.099 74.864  1.00 38.98 ? 114 HIS B ND1 1 
ATOM   4566 C  CD2 . HIS B 1 92  ? 53.523 16.126 75.828  1.00 39.35 ? 114 HIS B CD2 1 
ATOM   4567 C  CE1 . HIS B 1 92  ? 55.036 14.553 76.057  1.00 40.06 ? 114 HIS B CE1 1 
ATOM   4568 N  NE2 . HIS B 1 92  ? 54.026 15.154 76.661  1.00 40.21 ? 114 HIS B NE2 1 
ATOM   4569 N  N   . TYR B 1 93  ? 52.389 18.816 71.390  1.00 33.91 ? 115 TYR B N   1 
ATOM   4570 C  CA  . TYR B 1 93  ? 52.502 19.663 70.217  1.00 33.55 ? 115 TYR B CA  1 
ATOM   4571 C  C   . TYR B 1 93  ? 52.684 21.082 70.706  1.00 33.23 ? 115 TYR B C   1 
ATOM   4572 O  O   . TYR B 1 93  ? 52.404 21.385 71.872  1.00 33.03 ? 115 TYR B O   1 
ATOM   4573 C  CB  . TYR B 1 93  ? 51.253 19.549 69.317  1.00 33.66 ? 115 TYR B CB  1 
ATOM   4574 C  CG  . TYR B 1 93  ? 49.934 19.869 70.003  1.00 32.88 ? 115 TYR B CG  1 
ATOM   4575 C  CD1 . TYR B 1 93  ? 49.400 21.156 69.973  1.00 31.74 ? 115 TYR B CD1 1 
ATOM   4576 C  CD2 . TYR B 1 93  ? 49.215 18.872 70.671  1.00 33.61 ? 115 TYR B CD2 1 
ATOM   4577 C  CE1 . TYR B 1 93  ? 48.185 21.445 70.609  1.00 32.10 ? 115 TYR B CE1 1 
ATOM   4578 C  CE2 . TYR B 1 93  ? 48.010 19.147 71.303  1.00 33.68 ? 115 TYR B CE2 1 
ATOM   4579 C  CZ  . TYR B 1 93  ? 47.501 20.440 71.268  1.00 32.46 ? 115 TYR B CZ  1 
ATOM   4580 O  OH  . TYR B 1 93  ? 46.305 20.707 71.885  1.00 33.70 ? 115 TYR B OH  1 
ATOM   4581 N  N   . SER B 1 94  ? 53.154 21.947 69.821  1.00 33.14 ? 116 SER B N   1 
ATOM   4582 C  CA  . SER B 1 94  ? 53.279 23.354 70.144  1.00 33.10 ? 116 SER B CA  1 
ATOM   4583 C  C   . SER B 1 94  ? 51.895 23.980 70.094  1.00 33.16 ? 116 SER B C   1 
ATOM   4584 O  O   . SER B 1 94  ? 51.244 23.980 69.040  1.00 32.81 ? 116 SER B O   1 
ATOM   4585 C  CB  . SER B 1 94  ? 54.235 24.052 69.177  1.00 33.26 ? 116 SER B CB  1 
ATOM   4586 O  OG  . SER B 1 94  ? 54.211 25.449 69.388  1.00 33.09 ? 116 SER B OG  1 
ATOM   4587 N  N   . PRO B 1 95  ? 51.433 24.500 71.247  1.00 33.42 ? 117 PRO B N   1 
ATOM   4588 C  CA  . PRO B 1 95  ? 50.118 25.115 71.414  1.00 33.11 ? 117 PRO B CA  1 
ATOM   4589 C  C   . PRO B 1 95  ? 49.962 26.324 70.494  1.00 33.06 ? 117 PRO B C   1 
ATOM   4590 O  O   . PRO B 1 95  ? 48.876 26.573 69.964  1.00 33.15 ? 117 PRO B O   1 
ATOM   4591 C  CB  . PRO B 1 95  ? 50.135 25.575 72.876  1.00 33.57 ? 117 PRO B CB  1 
ATOM   4592 C  CG  . PRO B 1 95  ? 51.173 24.739 73.533  1.00 33.33 ? 117 PRO B CG  1 
ATOM   4593 C  CD  . PRO B 1 95  ? 52.214 24.533 72.499  1.00 33.38 ? 117 PRO B CD  1 
ATOM   4594 N  N   . SER B 1 96  ? 51.064 27.040 70.302  1.00 32.56 ? 118 SER B N   1 
ATOM   4595 C  CA  . SER B 1 96  ? 51.109 28.241 69.494  1.00 32.37 ? 118 SER B CA  1 
ATOM   4596 C  C   . SER B 1 96  ? 51.134 27.949 67.995  1.00 32.02 ? 118 SER B C   1 
ATOM   4597 O  O   . SER B 1 96  ? 50.438 28.615 67.237  1.00 32.56 ? 118 SER B O   1 
ATOM   4598 C  CB  . SER B 1 96  ? 52.317 29.101 69.899  1.00 32.49 ? 118 SER B CB  1 
ATOM   4599 O  OG  . SER B 1 96  ? 53.525 28.392 69.713  1.00 32.67 ? 118 SER B OG  1 
ATOM   4600 N  N   . ASP B 1 97  ? 51.945 26.985 67.564  1.00 31.48 ? 119 ASP B N   1 
ATOM   4601 C  CA  . ASP B 1 97  ? 51.951 26.573 66.148  1.00 31.31 ? 119 ASP B CA  1 
ATOM   4602 C  C   . ASP B 1 97  ? 50.578 26.106 65.685  1.00 30.14 ? 119 ASP B C   1 
ATOM   4603 O  O   . ASP B 1 97  ? 50.138 26.460 64.595  1.00 30.13 ? 119 ASP B O   1 
ATOM   4604 C  CB  . ASP B 1 97  ? 52.978 25.481 65.875  1.00 31.44 ? 119 ASP B CB  1 
ATOM   4605 C  CG  . ASP B 1 97  ? 54.408 25.986 65.949  1.00 33.67 ? 119 ASP B CG  1 
ATOM   4606 O  OD1 . ASP B 1 97  ? 54.683 27.155 65.574  1.00 37.39 ? 119 ASP B OD1 1 
ATOM   4607 O  OD2 . ASP B 1 97  ? 55.264 25.198 66.387  1.00 36.78 ? 119 ASP B OD2 1 
ATOM   4608 N  N   . GLU B 1 98  ? 49.922 25.310 66.525  1.00 29.23 ? 120 GLU B N   1 
ATOM   4609 C  CA  . GLU B 1 98  ? 48.579 24.817 66.265  1.00 28.24 ? 120 GLU B CA  1 
ATOM   4610 C  C   . GLU B 1 98  ? 47.542 25.948 66.275  1.00 27.87 ? 120 GLU B C   1 
ATOM   4611 O  O   . GLU B 1 98  ? 46.617 25.962 65.451  1.00 28.06 ? 120 GLU B O   1 
ATOM   4612 C  CB  . GLU B 1 98  ? 48.217 23.721 67.279  1.00 28.52 ? 120 GLU B CB  1 
ATOM   4613 C  CG  . GLU B 1 98  ? 46.796 23.142 67.157  1.00 28.85 ? 120 GLU B CG  1 
ATOM   4614 C  CD  . GLU B 1 98  ? 46.388 22.745 65.730  1.00 28.92 ? 120 GLU B CD  1 
ATOM   4615 O  OE1 . GLU B 1 98  ? 45.175 22.537 65.512  1.00 29.88 ? 120 GLU B OE1 1 
ATOM   4616 O  OE2 . GLU B 1 98  ? 47.251 22.632 64.828  1.00 27.97 ? 120 GLU B OE2 1 
ATOM   4617 N  N   . LYS B 1 99  ? 47.690 26.886 67.203  1.00 26.82 ? 121 LYS B N   1 
ATOM   4618 C  CA  . LYS B 1 99  ? 46.826 28.060 67.238  1.00 26.93 ? 121 LYS B CA  1 
ATOM   4619 C  C   . LYS B 1 99  ? 46.972 28.849 65.918  1.00 26.05 ? 121 LYS B C   1 
ATOM   4620 O  O   . LYS B 1 99  ? 45.986 29.174 65.253  1.00 25.44 ? 121 LYS B O   1 
ATOM   4621 C  CB  . LYS B 1 99  ? 47.153 28.925 68.463  1.00 27.38 ? 121 LYS B CB  1 
ATOM   4622 C  CG  . LYS B 1 99  ? 45.931 29.392 69.257  1.00 29.25 ? 121 LYS B CG  1 
ATOM   4623 C  CD  . LYS B 1 99  ? 45.481 28.355 70.280  1.00 31.16 ? 121 LYS B CD  1 
ATOM   4624 C  CE  . LYS B 1 99  ? 44.317 28.857 71.132  1.00 33.17 ? 121 LYS B CE  1 
ATOM   4625 N  NZ  . LYS B 1 99  ? 43.674 27.769 71.938  1.00 32.36 ? 121 LYS B NZ  1 
ATOM   4626 N  N   . ALA B 1 100 ? 48.216 29.098 65.526  1.00 25.38 ? 122 ALA B N   1 
ATOM   4627 C  CA  . ALA B 1 100 ? 48.524 29.750 64.258  1.00 24.81 ? 122 ALA B CA  1 
ATOM   4628 C  C   . ALA B 1 100 ? 47.934 28.999 63.046  1.00 24.17 ? 122 ALA B C   1 
ATOM   4629 O  O   . ALA B 1 100 ? 47.357 29.629 62.166  1.00 24.07 ? 122 ALA B O   1 
ATOM   4630 C  CB  . ALA B 1 100 ? 50.037 29.918 64.104  1.00 25.00 ? 122 ALA B CB  1 
ATOM   4631 N  N   . ARG B 1 101 ? 48.075 27.670 63.022  1.00 22.53 ? 123 ARG B N   1 
ATOM   4632 C  CA  . ARG B 1 101 ? 47.519 26.836 61.955  1.00 22.15 ? 123 ARG B CA  1 
ATOM   4633 C  C   . ARG B 1 101 ? 45.989 26.886 61.887  1.00 21.38 ? 123 ARG B C   1 
ATOM   4634 O  O   . ARG B 1 101 ? 45.423 27.163 60.818  1.00 20.25 ? 123 ARG B O   1 
ATOM   4635 C  CB  . ARG B 1 101 ? 47.965 25.381 62.081  1.00 22.67 ? 123 ARG B CB  1 
ATOM   4636 C  CG  . ARG B 1 101 ? 47.644 24.524 60.833  1.00 23.59 ? 123 ARG B CG  1 
ATOM   4637 C  CD  . ARG B 1 101 ? 47.381 23.050 61.183  1.00 24.02 ? 123 ARG B CD  1 
ATOM   4638 N  NE  . ARG B 1 101 ? 46.331 22.898 62.198  1.00 27.02 ? 123 ARG B NE  1 
ATOM   4639 C  CZ  . ARG B 1 101 ? 45.019 23.009 61.971  1.00 26.69 ? 123 ARG B CZ  1 
ATOM   4640 N  NH1 . ARG B 1 101 ? 44.559 23.268 60.756  1.00 26.50 ? 123 ARG B NH1 1 
ATOM   4641 N  NH2 . ARG B 1 101 ? 44.163 22.870 62.971  1.00 26.22 ? 123 ARG B NH2 1 
ATOM   4642 N  N   . MET B 1 102 ? 45.317 26.597 63.001  1.00 20.62 ? 124 MET B N   1 
ATOM   4643 C  CA  . MET B 1 102 ? 43.856 26.556 62.949  1.00 20.30 ? 124 MET B CA  1 
ATOM   4644 C  C   . MET B 1 102 ? 43.301 27.945 62.676  1.00 20.40 ? 124 MET B C   1 
ATOM   4645 O  O   . MET B 1 102 ? 42.348 28.076 61.952  1.00 20.54 ? 124 MET B O   1 
ATOM   4646 C  CB  . MET B 1 102 ? 43.206 25.965 64.215  1.00 20.59 ? 124 MET B CB  1 
ATOM   4647 C  CG  . MET B 1 102 ? 41.662 25.676 64.030  1.00 16.37 ? 124 MET B CG  1 
ATOM   4648 S  SD  . MET B 1 102 ? 41.018 24.887 65.467  1.00 16.33 ? 124 MET B SD  1 
ATOM   4649 C  CE  . MET B 1 102 ? 41.434 23.176 65.190  1.00 20.36 ? 124 MET B CE  1 
ATOM   4650 N  N   . LYS B 1 103 ? 43.925 28.971 63.237  1.00 20.81 ? 125 LYS B N   1 
ATOM   4651 C  CA  . LYS B 1 103 ? 43.480 30.356 63.023  1.00 21.36 ? 125 LYS B CA  1 
ATOM   4652 C  C   . LYS B 1 103 ? 43.295 30.690 61.534  1.00 20.96 ? 125 LYS B C   1 
ATOM   4653 O  O   . LYS B 1 103 ? 42.236 31.187 61.127  1.00 20.59 ? 125 LYS B O   1 
ATOM   4654 C  CB  . LYS B 1 103 ? 44.434 31.343 63.720  1.00 21.56 ? 125 LYS B CB  1 
ATOM   4655 C  CG  . LYS B 1 103 ? 44.372 32.802 63.243  1.00 24.94 ? 125 LYS B CG  1 
ATOM   4656 C  CD  . LYS B 1 103 ? 43.025 33.451 63.566  1.00 28.50 ? 125 LYS B CD  1 
ATOM   4657 C  CE  . LYS B 1 103 ? 43.020 34.102 64.950  1.00 30.00 ? 125 LYS B CE  1 
ATOM   4658 N  NZ  . LYS B 1 103 ? 41.910 35.108 65.090  1.00 29.27 ? 125 LYS B NZ  1 
ATOM   4659 N  N   . LEU B 1 104 ? 44.311 30.396 60.724  1.00 20.71 ? 126 LEU B N   1 
ATOM   4660 C  CA  . LEU B 1 104 ? 44.290 30.772 59.305  1.00 20.57 ? 126 LEU B CA  1 
ATOM   4661 C  C   . LEU B 1 104 ? 43.218 30.068 58.474  1.00 20.30 ? 126 LEU B C   1 
ATOM   4662 O  O   . LEU B 1 104 ? 42.769 30.591 57.453  1.00 20.65 ? 126 LEU B O   1 
ATOM   4663 C  CB  . LEU B 1 104 ? 45.682 30.618 58.686  1.00 20.54 ? 126 LEU B CB  1 
ATOM   4664 C  CG  . LEU B 1 104 ? 46.757 31.566 59.240  1.00 19.78 ? 126 LEU B CG  1 
ATOM   4665 C  CD1 . LEU B 1 104 ? 48.098 31.135 58.713  1.00 20.74 ? 126 LEU B CD1 1 
ATOM   4666 C  CD2 . LEU B 1 104 ? 46.490 33.036 58.894  1.00 16.62 ? 126 LEU B CD2 1 
ATOM   4667 N  N   . THR B 1 105 ? 42.779 28.898 58.930  1.00 20.52 ? 127 THR B N   1 
ATOM   4668 C  CA  . THR B 1 105 ? 41.700 28.164 58.244  1.00 20.31 ? 127 THR B CA  1 
ATOM   4669 C  C   . THR B 1 105 ? 40.326 28.804 58.499  1.00 19.89 ? 127 THR B C   1 
ATOM   4670 O  O   . THR B 1 105 ? 39.311 28.334 57.974  1.00 19.97 ? 127 THR B O   1 
ATOM   4671 C  CB  . THR B 1 105 ? 41.646 26.687 58.675  1.00 20.15 ? 127 THR B CB  1 
ATOM   4672 O  OG1 . THR B 1 105 ? 41.239 26.606 60.039  1.00 21.18 ? 127 THR B OG1 1 
ATOM   4673 C  CG2 . THR B 1 105 ? 43.021 26.012 58.534  1.00 21.21 ? 127 THR B CG2 1 
ATOM   4674 N  N   . LEU B 1 106 ? 40.317 29.873 59.296  1.00 18.78 ? 128 LEU B N   1 
ATOM   4675 C  CA  . LEU B 1 106 ? 39.091 30.582 59.708  1.00 18.67 ? 128 LEU B CA  1 
ATOM   4676 C  C   . LEU B 1 106 ? 39.115 32.072 59.308  1.00 18.13 ? 128 LEU B C   1 
ATOM   4677 O  O   . LEU B 1 106 ? 38.325 32.874 59.815  1.00 18.32 ? 128 LEU B O   1 
ATOM   4678 C  CB  . LEU B 1 106 ? 38.915 30.464 61.238  1.00 17.56 ? 128 LEU B CB  1 
ATOM   4679 C  CG  . LEU B 1 106 ? 38.140 29.331 61.944  1.00 18.72 ? 128 LEU B CG  1 
ATOM   4680 C  CD1 . LEU B 1 106 ? 37.570 28.304 61.032  1.00 16.06 ? 128 LEU B CD1 1 
ATOM   4681 C  CD2 . LEU B 1 106 ? 38.957 28.657 63.065  1.00 16.06 ? 128 LEU B CD2 1 
ATOM   4682 N  N   . LEU B 1 107 ? 40.031 32.441 58.420  1.00 17.77 ? 129 LEU B N   1 
ATOM   4683 C  CA  . LEU B 1 107 ? 40.196 33.846 58.029  1.00 17.10 ? 129 LEU B CA  1 
ATOM   4684 C  C   . LEU B 1 107 ? 40.454 33.953 56.542  1.00 16.95 ? 129 LEU B C   1 
ATOM   4685 O  O   . LEU B 1 107 ? 40.621 32.947 55.873  1.00 15.74 ? 129 LEU B O   1 
ATOM   4686 C  CB  . LEU B 1 107 ? 41.334 34.518 58.805  1.00 16.67 ? 129 LEU B CB  1 
ATOM   4687 C  CG  . LEU B 1 107 ? 41.312 34.731 60.326  1.00 17.12 ? 129 LEU B CG  1 
ATOM   4688 C  CD1 . LEU B 1 107 ? 42.688 35.217 60.812  1.00 16.57 ? 129 LEU B CD1 1 
ATOM   4689 C  CD2 . LEU B 1 107 ? 40.208 35.699 60.781  1.00 16.66 ? 129 LEU B CD2 1 
ATOM   4690 N  N   . HIS B 1 108 ? 40.451 35.189 56.041  1.00 18.04 ? 130 HIS B N   1 
ATOM   4691 C  CA  . HIS B 1 108 ? 40.825 35.525 54.655  1.00 19.22 ? 130 HIS B CA  1 
ATOM   4692 C  C   . HIS B 1 108 ? 39.996 34.767 53.617  1.00 19.85 ? 130 HIS B C   1 
ATOM   4693 O  O   . HIS B 1 108 ? 38.775 34.795 53.677  1.00 19.89 ? 130 HIS B O   1 
ATOM   4694 C  CB  . HIS B 1 108 ? 42.341 35.380 54.461  1.00 18.74 ? 130 HIS B CB  1 
ATOM   4695 C  CG  . HIS B 1 108 ? 43.125 35.990 55.574  1.00 20.57 ? 130 HIS B CG  1 
ATOM   4696 N  ND1 . HIS B 1 108 ? 43.841 35.241 56.483  1.00 21.55 ? 130 HIS B ND1 1 
ATOM   4697 C  CD2 . HIS B 1 108 ? 43.238 37.280 55.974  1.00 22.05 ? 130 HIS B CD2 1 
ATOM   4698 C  CE1 . HIS B 1 108 ? 44.382 36.046 57.380  1.00 23.05 ? 130 HIS B CE1 1 
ATOM   4699 N  NE2 . HIS B 1 108 ? 44.025 37.288 57.098  1.00 22.26 ? 130 HIS B NE2 1 
ATOM   4700 N  N   . ARG B 1 109 ? 40.649 34.075 52.687  1.00 21.17 ? 131 ARG B N   1 
ATOM   4701 C  CA  . ARG B 1 109 ? 39.916 33.377 51.624  1.00 22.66 ? 131 ARG B CA  1 
ATOM   4702 C  C   . ARG B 1 109 ? 39.165 32.168 52.180  1.00 22.41 ? 131 ARG B C   1 
ATOM   4703 O  O   . ARG B 1 109 ? 38.076 31.852 51.721  1.00 22.59 ? 131 ARG B O   1 
ATOM   4704 C  CB  . ARG B 1 109 ? 40.863 33.028 50.459  1.00 23.31 ? 131 ARG B CB  1 
ATOM   4705 C  CG  . ARG B 1 109 ? 40.546 31.770 49.629  1.00 27.75 ? 131 ARG B CG  1 
ATOM   4706 C  CD  . ARG B 1 109 ? 41.640 31.558 48.554  1.00 31.53 ? 131 ARG B CD  1 
ATOM   4707 N  NE  . ARG B 1 109 ? 41.591 30.248 47.904  1.00 35.52 ? 131 ARG B NE  1 
ATOM   4708 C  CZ  . ARG B 1 109 ? 42.073 29.120 48.437  1.00 38.57 ? 131 ARG B CZ  1 
ATOM   4709 N  NH1 . ARG B 1 109 ? 42.634 29.132 49.646  1.00 38.08 ? 131 ARG B NH1 1 
ATOM   4710 N  NH2 . ARG B 1 109 ? 41.994 27.969 47.762  1.00 38.07 ? 131 ARG B NH2 1 
ATOM   4711 N  N   . GLU B 1 110 ? 39.716 31.509 53.192  1.00 22.17 ? 132 GLU B N   1 
ATOM   4712 C  CA  . GLU B 1 110 ? 39.005 30.370 53.752  1.00 22.76 ? 132 GLU B CA  1 
ATOM   4713 C  C   . GLU B 1 110 ? 37.753 30.787 54.518  1.00 21.90 ? 132 GLU B C   1 
ATOM   4714 O  O   . GLU B 1 110 ? 36.755 30.082 54.480  1.00 21.83 ? 132 GLU B O   1 
ATOM   4715 C  CB  . GLU B 1 110 ? 39.918 29.485 54.603  1.00 23.01 ? 132 GLU B CB  1 
ATOM   4716 C  CG  . GLU B 1 110 ? 41.182 29.011 53.882  1.00 25.71 ? 132 GLU B CG  1 
ATOM   4717 C  CD  . GLU B 1 110 ? 40.919 28.079 52.716  1.00 29.03 ? 132 GLU B CD  1 
ATOM   4718 O  OE1 . GLU B 1 110 ? 39.755 27.679 52.474  1.00 27.83 ? 132 GLU B OE1 1 
ATOM   4719 O  OE2 . GLU B 1 110 ? 41.910 27.724 52.033  1.00 34.85 ? 132 GLU B OE2 1 
ATOM   4720 N  N   . LEU B 1 111 ? 37.797 31.944 55.179  1.00 21.44 ? 133 LEU B N   1 
ATOM   4721 C  CA  . LEU B 1 111 ? 36.604 32.496 55.836  1.00 21.28 ? 133 LEU B CA  1 
ATOM   4722 C  C   . LEU B 1 111 ? 35.490 32.804 54.831  1.00 21.73 ? 133 LEU B C   1 
ATOM   4723 O  O   . LEU B 1 111 ? 34.332 32.491 55.089  1.00 21.61 ? 133 LEU B O   1 
ATOM   4724 C  CB  . LEU B 1 111 ? 36.941 33.756 56.625  1.00 20.74 ? 133 LEU B CB  1 
ATOM   4725 C  CG  . LEU B 1 111 ? 35.831 34.608 57.275  1.00 20.15 ? 133 LEU B CG  1 
ATOM   4726 C  CD1 . LEU B 1 111 ? 35.094 33.866 58.381  1.00 16.53 ? 133 LEU B CD1 1 
ATOM   4727 C  CD2 . LEU B 1 111 ? 36.446 35.921 57.795  1.00 17.66 ? 133 LEU B CD2 1 
ATOM   4728 N  N   . GLN B 1 112 ? 35.841 33.414 53.698  1.00 22.33 ? 134 GLN B N   1 
ATOM   4729 C  CA  . GLN B 1 112 ? 34.853 33.696 52.659  1.00 23.44 ? 134 GLN B CA  1 
ATOM   4730 C  C   . GLN B 1 112 ? 34.224 32.398 52.179  1.00 22.49 ? 134 GLN B C   1 
ATOM   4731 O  O   . GLN B 1 112 ? 33.013 32.334 52.048  1.00 22.26 ? 134 GLN B O   1 
ATOM   4732 C  CB  . GLN B 1 112 ? 35.444 34.501 51.488  1.00 24.34 ? 134 GLN B CB  1 
ATOM   4733 C  CG  . GLN B 1 112 ? 34.387 34.906 50.424  1.00 28.89 ? 134 GLN B CG  1 
ATOM   4734 C  CD  . GLN B 1 112 ? 33.313 35.858 50.957  1.00 34.94 ? 134 GLN B CD  1 
ATOM   4735 O  OE1 . GLN B 1 112 ? 32.257 35.426 51.465  1.00 37.75 ? 134 GLN B OE1 1 
ATOM   4736 N  NE2 . GLN B 1 112 ? 33.580 37.163 50.854  1.00 36.17 ? 134 GLN B NE2 1 
ATOM   4737 N  N   . ALA B 1 113 ? 35.038 31.356 51.971  1.00 21.93 ? 135 ALA B N   1 
ATOM   4738 C  CA  . ALA B 1 113 ? 34.505 30.027 51.610  1.00 21.45 ? 135 ALA B CA  1 
ATOM   4739 C  C   . ALA B 1 113 ? 33.516 29.454 52.647  1.00 21.44 ? 135 ALA B C   1 
ATOM   4740 O  O   . ALA B 1 113 ? 32.441 28.950 52.273  1.00 20.96 ? 135 ALA B O   1 
ATOM   4741 C  CB  . ALA B 1 113 ? 35.636 29.035 51.307  1.00 21.19 ? 135 ALA B CB  1 
ATOM   4742 N  N   . LEU B 1 114 ? 33.872 29.547 53.935  1.00 20.98 ? 136 LEU B N   1 
ATOM   4743 C  CA  . LEU B 1 114 ? 33.003 29.108 55.038  1.00 21.48 ? 136 LEU B CA  1 
ATOM   4744 C  C   . LEU B 1 114 ? 31.704 29.907 55.114  1.00 21.41 ? 136 LEU B C   1 
ATOM   4745 O  O   . LEU B 1 114 ? 30.641 29.351 55.346  1.00 21.18 ? 136 LEU B O   1 
ATOM   4746 C  CB  . LEU B 1 114 ? 33.704 29.240 56.393  1.00 21.64 ? 136 LEU B CB  1 
ATOM   4747 C  CG  . LEU B 1 114 ? 34.774 28.265 56.892  1.00 22.85 ? 136 LEU B CG  1 
ATOM   4748 C  CD1 . LEU B 1 114 ? 35.249 28.733 58.278  1.00 23.69 ? 136 LEU B CD1 1 
ATOM   4749 C  CD2 . LEU B 1 114 ? 34.249 26.852 56.963  1.00 21.84 ? 136 LEU B CD2 1 
ATOM   4750 N  N   . THR B 1 115 ? 31.823 31.220 54.947  1.00 21.92 ? 137 THR B N   1 
ATOM   4751 C  CA  . THR B 1 115 ? 30.702 32.144 54.983  1.00 22.35 ? 137 THR B CA  1 
ATOM   4752 C  C   . THR B 1 115 ? 29.679 31.839 53.882  1.00 22.14 ? 137 THR B C   1 
ATOM   4753 O  O   . THR B 1 115 ? 28.476 31.834 54.146  1.00 21.98 ? 137 THR B O   1 
ATOM   4754 C  CB  . THR B 1 115 ? 31.204 33.594 54.861  1.00 22.21 ? 137 THR B CB  1 
ATOM   4755 O  OG1 . THR B 1 115 ? 32.028 33.901 55.989  1.00 24.52 ? 137 THR B OG1 1 
ATOM   4756 C  CG2 . THR B 1 115 ? 30.052 34.561 54.841  1.00 23.14 ? 137 THR B CG2 1 
ATOM   4757 N  N   . GLU B 1 116 ? 30.150 31.578 52.658  1.00 22.14 ? 138 GLU B N   1 
ATOM   4758 C  CA  . GLU B 1 116 ? 29.237 31.190 51.581  1.00 21.92 ? 138 GLU B CA  1 
ATOM   4759 C  C   . GLU B 1 116 ? 28.584 29.827 51.856  1.00 20.97 ? 138 GLU B C   1 
ATOM   4760 O  O   . GLU B 1 116 ? 27.399 29.650 51.588  1.00 19.24 ? 138 GLU B O   1 
ATOM   4761 C  CB  . GLU B 1 116 ? 29.918 31.125 50.212  1.00 22.63 ? 138 GLU B CB  1 
ATOM   4762 C  CG  . GLU B 1 116 ? 31.100 32.025 50.016  1.00 26.85 ? 138 GLU B CG  1 
ATOM   4763 C  CD  . GLU B 1 116 ? 31.273 32.443 48.570  1.00 31.58 ? 138 GLU B CD  1 
ATOM   4764 O  OE1 . GLU B 1 116 ? 30.879 31.672 47.665  1.00 34.28 ? 138 GLU B OE1 1 
ATOM   4765 O  OE2 . GLU B 1 116 ? 31.791 33.558 48.345  1.00 34.36 ? 138 GLU B OE2 1 
ATOM   4766 N  N   . ALA B 1 117 ? 29.363 28.862 52.348  1.00 20.16 ? 139 ALA B N   1 
ATOM   4767 C  CA  . ALA B 1 117 ? 28.802 27.542 52.645  1.00 20.27 ? 139 ALA B CA  1 
ATOM   4768 C  C   . ALA B 1 117 ? 27.785 27.641 53.779  1.00 20.03 ? 139 ALA B C   1 
ATOM   4769 O  O   . ALA B 1 117 ? 26.764 26.945 53.775  1.00 20.26 ? 139 ALA B O   1 
ATOM   4770 C  CB  . ALA B 1 117 ? 29.885 26.524 52.975  1.00 20.05 ? 139 ALA B CB  1 
ATOM   4771 N  N   . MET B 1 118 ? 28.049 28.522 54.743  1.00 19.83 ? 140 MET B N   1 
ATOM   4772 C  CA  . MET B 1 118 ? 27.144 28.658 55.882  1.00 18.96 ? 140 MET B CA  1 
ATOM   4773 C  C   . MET B 1 118 ? 25.803 29.215 55.446  1.00 19.60 ? 140 MET B C   1 
ATOM   4774 O  O   . MET B 1 118 ? 24.749 28.751 55.890  1.00 19.27 ? 140 MET B O   1 
ATOM   4775 C  CB  . MET B 1 118 ? 27.731 29.513 57.006  1.00 17.97 ? 140 MET B CB  1 
ATOM   4776 C  CG  . MET B 1 118 ? 26.895 29.443 58.331  1.00 13.59 ? 140 MET B CG  1 
ATOM   4777 S  SD  . MET B 1 118 ? 26.880 27.821 59.084  1.00 2.03  ? 140 MET B SD  1 
ATOM   4778 C  CE  . MET B 1 118 ? 26.076 28.197 60.641  1.00 10.94 ? 140 MET B CE  1 
ATOM   4779 N  N   . TYR B 1 119 ? 25.839 30.213 54.582  1.00 21.03 ? 141 TYR B N   1 
ATOM   4780 C  CA  . TYR B 1 119 ? 24.599 30.836 54.140  1.00 22.77 ? 141 TYR B CA  1 
ATOM   4781 C  C   . TYR B 1 119 ? 23.744 29.811 53.422  1.00 22.43 ? 141 TYR B C   1 
ATOM   4782 O  O   . TYR B 1 119 ? 22.559 29.691 53.708  1.00 22.66 ? 141 TYR B O   1 
ATOM   4783 C  CB  . TYR B 1 119 ? 24.833 32.061 53.243  1.00 24.24 ? 141 TYR B CB  1 
ATOM   4784 C  CG  . TYR B 1 119 ? 23.524 32.676 52.825  1.00 26.93 ? 141 TYR B CG  1 
ATOM   4785 C  CD1 . TYR B 1 119 ? 22.771 33.434 53.721  1.00 29.62 ? 141 TYR B CD1 1 
ATOM   4786 C  CD2 . TYR B 1 119 ? 23.011 32.463 51.545  1.00 29.89 ? 141 TYR B CD2 1 
ATOM   4787 C  CE1 . TYR B 1 119 ? 21.550 33.991 53.338  1.00 32.75 ? 141 TYR B CE1 1 
ATOM   4788 C  CE2 . TYR B 1 119 ? 21.795 33.015 51.154  1.00 31.69 ? 141 TYR B CE2 1 
ATOM   4789 C  CZ  . TYR B 1 119 ? 21.071 33.770 52.051  1.00 32.27 ? 141 TYR B CZ  1 
ATOM   4790 O  OH  . TYR B 1 119 ? 19.874 34.313 51.654  1.00 33.01 ? 141 TYR B OH  1 
ATOM   4791 N  N   . THR B 1 120 ? 24.346 29.067 52.502  1.00 22.71 ? 142 THR B N   1 
ATOM   4792 C  CA  . THR B 1 120 ? 23.599 28.026 51.813  1.00 22.33 ? 142 THR B CA  1 
ATOM   4793 C  C   . THR B 1 120 ? 23.137 26.886 52.733  1.00 21.71 ? 142 THR B C   1 
ATOM   4794 O  O   . THR B 1 120 ? 22.009 26.420 52.585  1.00 20.60 ? 142 THR B O   1 
ATOM   4795 C  CB  . THR B 1 120 ? 24.194 27.601 50.439  1.00 22.83 ? 142 THR B CB  1 
ATOM   4796 O  OG1 . THR B 1 120 ? 24.081 26.179 50.241  1.00 26.04 ? 142 THR B OG1 1 
ATOM   4797 C  CG2 . THR B 1 120 ? 25.579 28.021 50.272  1.00 21.95 ? 142 THR B CG2 1 
ATOM   4798 N  N   . ASN B 1 121 ? 23.954 26.476 53.712  1.00 20.87 ? 143 ASN B N   1 
ATOM   4799 C  CA  . ASN B 1 121 ? 23.473 25.482 54.672  1.00 20.81 ? 143 ASN B CA  1 
ATOM   4800 C  C   . ASN B 1 121 ? 22.365 25.987 55.593  1.00 20.69 ? 143 ASN B C   1 
ATOM   4801 O  O   . ASN B 1 121 ? 21.399 25.270 55.837  1.00 21.04 ? 143 ASN B O   1 
ATOM   4802 C  CB  . ASN B 1 121 ? 24.616 24.833 55.469  1.00 21.05 ? 143 ASN B CB  1 
ATOM   4803 C  CG  . ASN B 1 121 ? 25.468 23.897 54.610  1.00 22.74 ? 143 ASN B CG  1 
ATOM   4804 O  OD1 . ASN B 1 121 ? 24.962 22.934 54.021  1.00 22.84 ? 143 ASN B OD1 1 
ATOM   4805 N  ND2 . ASN B 1 121 ? 26.762 24.181 54.532  1.00 21.35 ? 143 ASN B ND2 1 
ATOM   4806 N  N   . LEU B 1 122 ? 22.484 27.212 56.101  1.00 21.08 ? 144 LEU B N   1 
ATOM   4807 C  CA  . LEU B 1 122 ? 21.432 27.776 56.956  1.00 21.59 ? 144 LEU B CA  1 
ATOM   4808 C  C   . LEU B 1 122 ? 20.103 27.819 56.198  1.00 22.38 ? 144 LEU B C   1 
ATOM   4809 O  O   . LEU B 1 122 ? 19.070 27.381 56.707  1.00 21.76 ? 144 LEU B O   1 
ATOM   4810 C  CB  . LEU B 1 122 ? 21.799 29.178 57.466  1.00 21.19 ? 144 LEU B CB  1 
ATOM   4811 C  CG  . LEU B 1 122 ? 22.807 29.345 58.605  1.00 20.23 ? 144 LEU B CG  1 
ATOM   4812 C  CD1 . LEU B 1 122 ? 23.301 30.799 58.637  1.00 20.60 ? 144 LEU B CD1 1 
ATOM   4813 C  CD2 . LEU B 1 122 ? 22.210 28.950 59.953  1.00 21.72 ? 144 LEU B CD2 1 
ATOM   4814 N  N   . HIS B 1 123 ? 20.161 28.344 54.976  1.00 23.10 ? 145 HIS B N   1 
ATOM   4815 C  CA  . HIS B 1 123 ? 19.000 28.435 54.100  1.00 24.39 ? 145 HIS B CA  1 
ATOM   4816 C  C   . HIS B 1 123 ? 18.422 27.031 53.788  1.00 24.42 ? 145 HIS B C   1 
ATOM   4817 O  O   . HIS B 1 123 ? 17.210 26.812 53.924  1.00 23.77 ? 145 HIS B O   1 
ATOM   4818 C  CB  . HIS B 1 123 ? 19.374 29.200 52.824  1.00 24.96 ? 145 HIS B CB  1 
ATOM   4819 C  CG  . HIS B 1 123 ? 18.235 29.379 51.872  1.00 27.94 ? 145 HIS B CG  1 
ATOM   4820 N  ND1 . HIS B 1 123 ? 17.864 28.406 50.963  1.00 29.90 ? 145 HIS B ND1 1 
ATOM   4821 C  CD2 . HIS B 1 123 ? 17.369 30.406 51.702  1.00 29.58 ? 145 HIS B CD2 1 
ATOM   4822 C  CE1 . HIS B 1 123 ? 16.820 28.830 50.271  1.00 32.09 ? 145 HIS B CE1 1 
ATOM   4823 N  NE2 . HIS B 1 123 ? 16.498 30.039 50.701  1.00 32.27 ? 145 HIS B NE2 1 
ATOM   4824 N  N   . ALA B 1 124 ? 19.297 26.080 53.434  1.00 24.35 ? 146 ALA B N   1 
ATOM   4825 C  CA  . ALA B 1 124 ? 18.879 24.702 53.149  1.00 24.83 ? 146 ALA B CA  1 
ATOM   4826 C  C   . ALA B 1 124 ? 18.154 24.027 54.320  1.00 25.06 ? 146 ALA B C   1 
ATOM   4827 O  O   . ALA B 1 124 ? 17.095 23.438 54.128  1.00 25.45 ? 146 ALA B O   1 
ATOM   4828 C  CB  . ALA B 1 124 ? 20.066 23.852 52.678  1.00 24.45 ? 146 ALA B CB  1 
ATOM   4829 N  N   . VAL B 1 125 ? 18.711 24.132 55.528  1.00 25.38 ? 147 VAL B N   1 
ATOM   4830 C  CA  . VAL B 1 125 ? 18.153 23.476 56.723  1.00 25.33 ? 147 VAL B CA  1 
ATOM   4831 C  C   . VAL B 1 125 ? 16.851 24.144 57.175  1.00 25.89 ? 147 VAL B C   1 
ATOM   4832 O  O   . VAL B 1 125 ? 15.837 23.472 57.377  1.00 25.82 ? 147 VAL B O   1 
ATOM   4833 C  CB  . VAL B 1 125 ? 19.191 23.421 57.913  1.00 25.62 ? 147 VAL B CB  1 
ATOM   4834 C  CG1 . VAL B 1 125 ? 18.588 22.792 59.121  1.00 25.14 ? 147 VAL B CG1 1 
ATOM   4835 C  CG2 . VAL B 1 125 ? 20.432 22.631 57.535  1.00 26.34 ? 147 VAL B CG2 1 
ATOM   4836 N  N   . LEU B 1 126 ? 16.881 25.463 57.328  1.00 25.81 ? 148 LEU B N   1 
ATOM   4837 C  CA  . LEU B 1 126 ? 15.706 26.210 57.769  1.00 26.52 ? 148 LEU B CA  1 
ATOM   4838 C  C   . LEU B 1 126 ? 14.546 26.067 56.771  1.00 26.47 ? 148 LEU B C   1 
ATOM   4839 O  O   . LEU B 1 126 ? 13.487 25.530 57.101  1.00 26.35 ? 148 LEU B O   1 
ATOM   4840 C  CB  . LEU B 1 126 ? 16.050 27.699 57.978  1.00 26.62 ? 148 LEU B CB  1 
ATOM   4841 C  CG  . LEU B 1 126 ? 15.278 28.557 58.995  1.00 27.40 ? 148 LEU B CG  1 
ATOM   4842 C  CD1 . LEU B 1 126 ? 13.945 27.979 59.429  1.00 26.99 ? 148 LEU B CD1 1 
ATOM   4843 C  CD2 . LEU B 1 126 ? 16.122 28.773 60.222  1.00 30.34 ? 148 LEU B CD2 1 
ATOM   4844 N  N   . LEU B 1 127 ? 14.770 26.542 55.555  1.00 26.89 ? 149 LEU B N   1 
ATOM   4845 C  CA  . LEU B 1 127 ? 13.769 26.500 54.497  1.00 27.63 ? 149 LEU B CA  1 
ATOM   4846 C  C   . LEU B 1 127 ? 13.333 25.076 54.139  1.00 27.72 ? 149 LEU B C   1 
ATOM   4847 O  O   . LEU B 1 127 ? 12.173 24.851 53.813  1.00 27.34 ? 149 LEU B O   1 
ATOM   4848 C  CB  . LEU B 1 127 ? 14.308 27.200 53.253  1.00 27.53 ? 149 LEU B CB  1 
ATOM   4849 C  CG  . LEU B 1 127 ? 14.023 28.678 53.012  1.00 28.64 ? 149 LEU B CG  1 
ATOM   4850 C  CD1 . LEU B 1 127 ? 12.742 28.792 52.151  1.00 30.81 ? 149 LEU B CD1 1 
ATOM   4851 C  CD2 . LEU B 1 127 ? 13.940 29.472 54.327  1.00 27.37 ? 149 LEU B CD2 1 
ATOM   4852 N  N   . GLY B 1 128 ? 14.273 24.133 54.201  1.00 27.99 ? 150 GLY B N   1 
ATOM   4853 C  CA  . GLY B 1 128 ? 13.986 22.714 54.001  1.00 28.26 ? 150 GLY B CA  1 
ATOM   4854 C  C   . GLY B 1 128 ? 13.041 22.177 55.059  1.00 28.65 ? 150 GLY B C   1 
ATOM   4855 O  O   . GLY B 1 128 ? 11.980 21.636 54.728  1.00 28.87 ? 150 GLY B O   1 
ATOM   4856 N  N   . ASP B 1 129 ? 13.424 22.331 56.330  1.00 28.59 ? 151 ASP B N   1 
ATOM   4857 C  CA  . ASP B 1 129 ? 12.568 21.956 57.474  1.00 28.54 ? 151 ASP B CA  1 
ATOM   4858 C  C   . ASP B 1 129 ? 11.188 22.616 57.431  1.00 28.76 ? 151 ASP B C   1 
ATOM   4859 O  O   . ASP B 1 129 ? 10.170 21.960 57.687  1.00 29.20 ? 151 ASP B O   1 
ATOM   4860 C  CB  . ASP B 1 129 ? 13.247 22.292 58.813  1.00 28.04 ? 151 ASP B CB  1 
ATOM   4861 C  CG  . ASP B 1 129 ? 14.036 21.123 59.391  1.00 27.25 ? 151 ASP B CG  1 
ATOM   4862 O  OD1 . ASP B 1 129 ? 14.510 20.280 58.610  1.00 25.64 ? 151 ASP B OD1 1 
ATOM   4863 O  OD2 . ASP B 1 129 ? 14.167 21.038 60.640  1.00 27.54 ? 151 ASP B OD2 1 
ATOM   4864 N  N   . ALA B 1 130 ? 11.161 23.913 57.133  1.00 28.69 ? 152 ALA B N   1 
ATOM   4865 C  CA  . ALA B 1 130 ? 9.917  24.675 57.139  1.00 28.99 ? 152 ALA B CA  1 
ATOM   4866 C  C   . ALA B 1 130 ? 8.984  24.235 56.001  1.00 29.30 ? 152 ALA B C   1 
ATOM   4867 O  O   . ALA B 1 130 ? 7.809  23.986 56.247  1.00 28.79 ? 152 ALA B O   1 
ATOM   4868 C  CB  . ALA B 1 130 ? 10.199 26.167 57.071  1.00 29.18 ? 152 ALA B CB  1 
ATOM   4869 N  N   . THR B 1 131 ? 9.524  24.111 54.785  1.00 30.03 ? 153 THR B N   1 
ATOM   4870 C  CA  . THR B 1 131 ? 8.762  23.621 53.633  1.00 31.61 ? 153 THR B CA  1 
ATOM   4871 C  C   . THR B 1 131 ? 8.178  22.229 53.895  1.00 32.54 ? 153 THR B C   1 
ATOM   4872 O  O   . THR B 1 131 ? 6.995  21.992 53.629  1.00 32.42 ? 153 THR B O   1 
ATOM   4873 C  CB  . THR B 1 131 ? 9.604  23.580 52.335  1.00 31.86 ? 153 THR B CB  1 
ATOM   4874 O  OG1 . THR B 1 131 ? 10.080 24.900 52.020  1.00 32.31 ? 153 THR B OG1 1 
ATOM   4875 C  CG2 . THR B 1 131 ? 8.758  23.043 51.153  1.00 32.44 ? 153 THR B CG2 1 
ATOM   4876 N  N   . GLU B 1 132 ? 9.000  21.324 54.433  1.00 33.47 ? 154 GLU B N   1 
ATOM   4877 C  CA  . GLU B 1 132 ? 8.539  19.979 54.766  1.00 34.52 ? 154 GLU B CA  1 
ATOM   4878 C  C   . GLU B 1 132 ? 7.429  20.012 55.812  1.00 34.70 ? 154 GLU B C   1 
ATOM   4879 O  O   . GLU B 1 132 ? 6.573  19.127 55.844  1.00 35.31 ? 154 GLU B O   1 
ATOM   4880 C  CB  . GLU B 1 132 ? 9.686  19.088 55.259  1.00 34.59 ? 154 GLU B CB  1 
ATOM   4881 C  CG  . GLU B 1 132 ? 9.195  17.679 55.650  1.00 36.70 ? 154 GLU B CG  1 
ATOM   4882 C  CD  . GLU B 1 132 ? 10.170 16.891 56.491  1.00 38.73 ? 154 GLU B CD  1 
ATOM   4883 O  OE1 . GLU B 1 132 ? 9.756  16.404 57.574  1.00 39.42 ? 154 GLU B OE1 1 
ATOM   4884 O  OE2 . GLU B 1 132 ? 11.337 16.747 56.065  1.00 38.45 ? 154 GLU B OE2 1 
ATOM   4885 N  N   . ALA B 1 133 ? 7.454  21.025 56.666  1.00 34.84 ? 155 ALA B N   1 
ATOM   4886 C  CA  . ALA B 1 133 ? 6.504  21.128 57.767  1.00 35.40 ? 155 ALA B CA  1 
ATOM   4887 C  C   . ALA B 1 133 ? 5.183  21.813 57.370  1.00 35.78 ? 155 ALA B C   1 
ATOM   4888 O  O   . ALA B 1 133 ? 4.232  21.846 58.151  1.00 35.70 ? 155 ALA B O   1 
ATOM   4889 C  CB  . ALA B 1 133 ? 7.150  21.844 58.944  1.00 34.96 ? 155 ALA B CB  1 
ATOM   4890 N  N   . GLY B 1 134 ? 5.131  22.351 56.156  1.00 36.58 ? 156 GLY B N   1 
ATOM   4891 C  CA  . GLY B 1 134 ? 3.952  23.072 55.676  1.00 37.42 ? 156 GLY B CA  1 
ATOM   4892 C  C   . GLY B 1 134 ? 4.162  24.570 55.733  1.00 38.27 ? 156 GLY B C   1 
ATOM   4893 O  O   . GLY B 1 134 ? 5.063  25.055 56.429  1.00 38.24 ? 156 GLY B O   1 
ATOM   4894 N  N   . SER B 1 135 ? 3.332  25.313 55.005  1.00 38.80 ? 157 SER B N   1 
ATOM   4895 C  CA  . SER B 1 135 ? 3.491  26.766 54.920  1.00 39.42 ? 157 SER B CA  1 
ATOM   4896 C  C   . SER B 1 135 ? 2.724  27.568 55.985  1.00 39.69 ? 157 SER B C   1 
ATOM   4897 O  O   . SER B 1 135 ? 2.488  28.766 55.806  1.00 40.59 ? 157 SER B O   1 
ATOM   4898 C  CB  . SER B 1 135 ? 3.136  27.259 53.508  1.00 39.72 ? 157 SER B CB  1 
ATOM   4899 O  OG  . SER B 1 135 ? 1.826  26.872 53.149  1.00 40.50 ? 157 SER B OG  1 
ATOM   4900 N  N   . GLY B 1 136 ? 2.340  26.929 57.088  1.00 39.24 ? 158 GLY B N   1 
ATOM   4901 C  CA  . GLY B 1 136 ? 1.669  27.650 58.172  1.00 38.89 ? 158 GLY B CA  1 
ATOM   4902 C  C   . GLY B 1 136 ? 2.616  27.895 59.338  1.00 38.52 ? 158 GLY B C   1 
ATOM   4903 O  O   . GLY B 1 136 ? 3.833  27.708 59.198  1.00 38.29 ? 158 GLY B O   1 
ATOM   4904 N  N   . TRP B 1 137 ? 2.052  28.307 60.477  1.00 38.06 ? 159 TRP B N   1 
ATOM   4905 C  CA  . TRP B 1 137 ? 2.786  28.486 61.728  1.00 37.74 ? 159 TRP B CA  1 
ATOM   4906 C  C   . TRP B 1 137 ? 3.188  27.128 62.288  1.00 37.54 ? 159 TRP B C   1 
ATOM   4907 O  O   . TRP B 1 137 ? 2.487  26.130 62.083  1.00 37.69 ? 159 TRP B O   1 
ATOM   4908 C  CB  . TRP B 1 137 ? 1.936  29.212 62.776  1.00 37.85 ? 159 TRP B CB  1 
ATOM   4909 C  CG  . TRP B 1 137 ? 1.560  30.626 62.431  1.00 38.64 ? 159 TRP B CG  1 
ATOM   4910 C  CD1 . TRP B 1 137 ? 0.338  31.063 61.997  1.00 39.09 ? 159 TRP B CD1 1 
ATOM   4911 C  CD2 . TRP B 1 137 ? 2.399  31.795 62.503  1.00 38.54 ? 159 TRP B CD2 1 
ATOM   4912 N  NE1 . TRP B 1 137 ? 0.364  32.424 61.790  1.00 39.54 ? 159 TRP B NE1 1 
ATOM   4913 C  CE2 . TRP B 1 137 ? 1.616  32.897 62.093  1.00 39.35 ? 159 TRP B CE2 1 
ATOM   4914 C  CE3 . TRP B 1 137 ? 3.739  32.016 62.862  1.00 37.65 ? 159 TRP B CE3 1 
ATOM   4915 C  CZ2 . TRP B 1 137 ? 2.130  34.203 62.037  1.00 38.64 ? 159 TRP B CZ2 1 
ATOM   4916 C  CZ3 . TRP B 1 137 ? 4.242  33.310 62.810  1.00 36.78 ? 159 TRP B CZ3 1 
ATOM   4917 C  CH2 . TRP B 1 137 ? 3.444  34.382 62.395  1.00 38.08 ? 159 TRP B CH2 1 
ATOM   4918 N  N   . HIS B 1 138 ? 4.327  27.104 62.981  1.00 36.59 ? 160 HIS B N   1 
ATOM   4919 C  CA  . HIS B 1 138 ? 4.809  25.925 63.693  1.00 35.48 ? 160 HIS B CA  1 
ATOM   4920 C  C   . HIS B 1 138 ? 5.301  26.372 65.055  1.00 35.32 ? 160 HIS B C   1 
ATOM   4921 O  O   . HIS B 1 138 ? 5.991  27.394 65.177  1.00 34.97 ? 160 HIS B O   1 
ATOM   4922 C  CB  . HIS B 1 138 ? 5.955  25.245 62.933  1.00 35.63 ? 160 HIS B CB  1 
ATOM   4923 C  CG  . HIS B 1 138 ? 5.643  24.951 61.498  1.00 34.97 ? 160 HIS B CG  1 
ATOM   4924 N  ND1 . HIS B 1 138 ? 6.360  25.500 60.456  1.00 35.24 ? 160 HIS B ND1 1 
ATOM   4925 C  CD2 . HIS B 1 138 ? 4.691  24.174 60.932  1.00 33.24 ? 160 HIS B CD2 1 
ATOM   4926 C  CE1 . HIS B 1 138 ? 5.863  25.074 59.310  1.00 33.53 ? 160 HIS B CE1 1 
ATOM   4927 N  NE2 . HIS B 1 138 ? 4.845  24.273 59.571  1.00 33.20 ? 160 HIS B NE2 1 
ATOM   4928 N  N   . GLU B 1 139 ? 4.947  25.605 66.077  1.00 35.03 ? 161 GLU B N   1 
ATOM   4929 C  CA  . GLU B 1 139 ? 5.254  25.969 67.451  1.00 34.81 ? 161 GLU B CA  1 
ATOM   4930 C  C   . GLU B 1 139 ? 6.543  25.308 67.896  1.00 34.08 ? 161 GLU B C   1 
ATOM   4931 O  O   . GLU B 1 139 ? 6.783  24.133 67.593  1.00 34.69 ? 161 GLU B O   1 
ATOM   4932 C  CB  . GLU B 1 139 ? 4.106  25.607 68.383  1.00 35.53 ? 161 GLU B CB  1 
ATOM   4933 C  CG  . GLU B 1 139 ? 2.977  26.636 68.400  1.00 37.12 ? 161 GLU B CG  1 
ATOM   4934 C  CD  . GLU B 1 139 ? 2.114  26.532 69.649  1.00 41.82 ? 161 GLU B CD  1 
ATOM   4935 O  OE1 . GLU B 1 139 ? 2.663  26.639 70.784  1.00 42.32 ? 161 GLU B OE1 1 
ATOM   4936 O  OE2 . GLU B 1 139 ? 0.879  26.348 69.492  1.00 43.58 ? 161 GLU B OE2 1 
ATOM   4937 N  N   . MET B 1 140 ? 7.375  26.076 68.603  1.00 32.52 ? 162 MET B N   1 
ATOM   4938 C  CA  . MET B 1 140 ? 8.748  25.679 68.889  1.00 30.85 ? 162 MET B CA  1 
ATOM   4939 C  C   . MET B 1 140 ? 9.313  26.550 70.011  1.00 29.63 ? 162 MET B C   1 
ATOM   4940 O  O   . MET B 1 140 ? 9.041  27.751 70.059  1.00 29.96 ? 162 MET B O   1 
ATOM   4941 C  CB  . MET B 1 140 ? 9.586  25.881 67.611  1.00 31.10 ? 162 MET B CB  1 
ATOM   4942 C  CG  . MET B 1 140 ? 10.941 25.248 67.636  1.00 30.92 ? 162 MET B CG  1 
ATOM   4943 S  SD  . MET B 1 140 ? 11.590 24.867 66.011  1.00 28.91 ? 162 MET B SD  1 
ATOM   4944 C  CE  . MET B 1 140 ? 12.811 23.703 66.536  1.00 27.08 ? 162 MET B CE  1 
ATOM   4945 N  N   . GLY B 1 141 ? 10.080 25.950 70.917  1.00 27.75 ? 163 GLY B N   1 
ATOM   4946 C  CA  . GLY B 1 141 ? 10.913 26.720 71.839  1.00 25.99 ? 163 GLY B CA  1 
ATOM   4947 C  C   . GLY B 1 141 ? 11.989 27.480 71.073  1.00 24.61 ? 163 GLY B C   1 
ATOM   4948 O  O   . GLY B 1 141 ? 12.572 26.949 70.122  1.00 24.37 ? 163 GLY B O   1 
ATOM   4949 N  N   . LEU B 1 142 ? 12.245 28.725 71.478  1.00 23.22 ? 164 LEU B N   1 
ATOM   4950 C  CA  . LEU B 1 142 ? 13.177 29.603 70.758  1.00 21.48 ? 164 LEU B CA  1 
ATOM   4951 C  C   . LEU B 1 142 ? 14.623 29.105 70.821  1.00 20.65 ? 164 LEU B C   1 
ATOM   4952 O  O   . LEU B 1 142 ? 15.390 29.293 69.864  1.00 19.77 ? 164 LEU B O   1 
ATOM   4953 C  CB  . LEU B 1 142 ? 13.080 31.042 71.272  1.00 21.05 ? 164 LEU B CB  1 
ATOM   4954 C  CG  . LEU B 1 142 ? 13.931 32.149 70.602  1.00 21.64 ? 164 LEU B CG  1 
ATOM   4955 C  CD1 . LEU B 1 142 ? 13.763 32.240 69.058  1.00 19.89 ? 164 LEU B CD1 1 
ATOM   4956 C  CD2 . LEU B 1 142 ? 13.601 33.483 71.241  1.00 22.78 ? 164 LEU B CD2 1 
ATOM   4957 N  N   . LEU B 1 143 ? 14.993 28.489 71.947  1.00 20.10 ? 165 LEU B N   1 
ATOM   4958 C  CA  . LEU B 1 143 ? 16.337 27.916 72.094  1.00 19.91 ? 165 LEU B CA  1 
ATOM   4959 C  C   . LEU B 1 143 ? 16.520 26.716 71.165  1.00 19.67 ? 165 LEU B C   1 
ATOM   4960 O  O   . LEU B 1 143 ? 17.524 26.622 70.461  1.00 18.81 ? 165 LEU B O   1 
ATOM   4961 C  CB  . LEU B 1 143 ? 16.697 27.572 73.554  1.00 19.28 ? 165 LEU B CB  1 
ATOM   4962 C  CG  . LEU B 1 143 ? 18.126 26.978 73.659  1.00 20.63 ? 165 LEU B CG  1 
ATOM   4963 C  CD1 . LEU B 1 143 ? 19.227 28.000 73.197  1.00 17.10 ? 165 LEU B CD1 1 
ATOM   4964 C  CD2 . LEU B 1 143 ? 18.444 26.405 75.039  1.00 18.96 ? 165 LEU B CD2 1 
ATOM   4965 N  N   . ASP B 1 144 ? 15.545 25.813 71.190  1.00 19.99 ? 166 ASP B N   1 
ATOM   4966 C  CA  . ASP B 1 144 ? 15.416 24.681 70.255  1.00 20.51 ? 166 ASP B CA  1 
ATOM   4967 C  C   . ASP B 1 144 ? 15.547 25.165 68.826  1.00 19.79 ? 166 ASP B C   1 
ATOM   4968 O  O   . ASP B 1 144 ? 16.330 24.630 68.051  1.00 20.13 ? 166 ASP B O   1 
ATOM   4969 C  CB  . ASP B 1 144 ? 14.016 24.063 70.419  1.00 21.20 ? 166 ASP B CB  1 
ATOM   4970 C  CG  . ASP B 1 144 ? 13.982 22.543 70.181  1.00 25.84 ? 166 ASP B CG  1 
ATOM   4971 O  OD1 . ASP B 1 144 ? 14.512 22.027 69.150  1.00 27.07 ? 166 ASP B OD1 1 
ATOM   4972 O  OD2 . ASP B 1 144 ? 13.375 21.857 71.049  1.00 30.10 ? 166 ASP B OD2 1 
ATOM   4973 N  N   . PHE B 1 145 ? 14.778 26.198 68.489  1.00 18.95 ? 167 PHE B N   1 
ATOM   4974 C  CA  . PHE B 1 145 ? 14.800 26.804 67.166  1.00 18.03 ? 167 PHE B CA  1 
ATOM   4975 C  C   . PHE B 1 145 ? 16.223 27.290 66.845  1.00 17.90 ? 167 PHE B C   1 
ATOM   4976 O  O   . PHE B 1 145 ? 16.839 26.851 65.867  1.00 18.08 ? 167 PHE B O   1 
ATOM   4977 C  CB  . PHE B 1 145 ? 13.759 27.940 67.127  1.00 18.16 ? 167 PHE B CB  1 
ATOM   4978 C  CG  . PHE B 1 145 ? 13.701 28.718 65.825  1.00 18.95 ? 167 PHE B CG  1 
ATOM   4979 C  CD1 . PHE B 1 145 ? 12.889 28.296 64.778  1.00 19.30 ? 167 PHE B CD1 1 
ATOM   4980 C  CD2 . PHE B 1 145 ? 14.400 29.918 65.684  1.00 19.16 ? 167 PHE B CD2 1 
ATOM   4981 C  CE1 . PHE B 1 145 ? 12.809 29.034 63.584  1.00 20.36 ? 167 PHE B CE1 1 
ATOM   4982 C  CE2 . PHE B 1 145 ? 14.334 30.654 64.506  1.00 20.52 ? 167 PHE B CE2 1 
ATOM   4983 C  CZ  . PHE B 1 145 ? 13.530 30.210 63.444  1.00 20.75 ? 167 PHE B CZ  1 
ATOM   4984 N  N   . SER B 1 146 ? 16.752 28.172 67.681  1.00 17.36 ? 168 SER B N   1 
ATOM   4985 C  CA  . SER B 1 146 ? 18.028 28.812 67.388  1.00 17.23 ? 168 SER B CA  1 
ATOM   4986 C  C   . SER B 1 146 ? 19.175 27.816 67.383  1.00 15.93 ? 168 SER B C   1 
ATOM   4987 O  O   . SER B 1 146 ? 20.027 27.851 66.505  1.00 16.13 ? 168 SER B O   1 
ATOM   4988 C  CB  . SER B 1 146 ? 18.317 29.930 68.392  1.00 16.61 ? 168 SER B CB  1 
ATOM   4989 O  OG  . SER B 1 146 ? 17.232 30.857 68.423  1.00 19.98 ? 168 SER B OG  1 
ATOM   4990 N  N   . TYR B 1 147 ? 19.192 26.947 68.372  1.00 15.44 ? 169 TYR B N   1 
ATOM   4991 C  CA  . TYR B 1 147 ? 20.296 26.022 68.559  1.00 16.22 ? 169 TYR B CA  1 
ATOM   4992 C  C   . TYR B 1 147 ? 20.284 25.003 67.418  1.00 15.81 ? 169 TYR B C   1 
ATOM   4993 O  O   . TYR B 1 147 ? 21.326 24.671 66.848  1.00 15.04 ? 169 TYR B O   1 
ATOM   4994 C  CB  . TYR B 1 147 ? 20.191 25.339 69.931  1.00 15.50 ? 169 TYR B CB  1 
ATOM   4995 C  CG  . TYR B 1 147 ? 21.503 24.999 70.636  1.00 16.37 ? 169 TYR B CG  1 
ATOM   4996 C  CD1 . TYR B 1 147 ? 22.696 24.799 69.917  1.00 17.42 ? 169 TYR B CD1 1 
ATOM   4997 C  CD2 . TYR B 1 147 ? 21.543 24.839 72.026  1.00 16.35 ? 169 TYR B CD2 1 
ATOM   4998 C  CE1 . TYR B 1 147 ? 23.891 24.466 70.564  1.00 13.51 ? 169 TYR B CE1 1 
ATOM   4999 C  CE2 . TYR B 1 147 ? 22.747 24.507 72.690  1.00 14.94 ? 169 TYR B CE2 1 
ATOM   5000 C  CZ  . TYR B 1 147 ? 23.908 24.321 71.949  1.00 17.22 ? 169 TYR B CZ  1 
ATOM   5001 O  OH  . TYR B 1 147 ? 25.084 23.977 72.594  1.00 16.12 ? 169 TYR B OH  1 
ATOM   5002 N  N   . SER B 1 148 ? 19.101 24.509 67.078  1.00 16.46 ? 170 SER B N   1 
ATOM   5003 C  CA  . SER B 1 148 ? 19.026 23.448 66.072  1.00 17.35 ? 170 SER B CA  1 
ATOM   5004 C  C   . SER B 1 148 ? 19.485 23.936 64.698  1.00 16.81 ? 170 SER B C   1 
ATOM   5005 O  O   . SER B 1 148 ? 20.255 23.248 64.028  1.00 16.68 ? 170 SER B O   1 
ATOM   5006 C  CB  . SER B 1 148 ? 17.625 22.791 66.014  1.00 17.34 ? 170 SER B CB  1 
ATOM   5007 O  OG  . SER B 1 148 ? 16.615 23.724 65.663  1.00 19.99 ? 170 SER B OG  1 
ATOM   5008 N  N   . PHE B 1 149 ? 19.059 25.136 64.289  1.00 16.70 ? 171 PHE B N   1 
ATOM   5009 C  CA  . PHE B 1 149 ? 19.403 25.594 62.944  1.00 16.43 ? 171 PHE B CA  1 
ATOM   5010 C  C   . PHE B 1 149 ? 20.851 26.007 62.795  1.00 16.32 ? 171 PHE B C   1 
ATOM   5011 O  O   . PHE B 1 149 ? 21.491 25.631 61.822  1.00 17.14 ? 171 PHE B O   1 
ATOM   5012 C  CB  . PHE B 1 149 ? 18.412 26.636 62.406  1.00 16.44 ? 171 PHE B CB  1 
ATOM   5013 C  CG  . PHE B 1 149 ? 17.049 26.072 62.200  1.00 18.67 ? 171 PHE B CG  1 
ATOM   5014 C  CD1 . PHE B 1 149 ? 16.843 25.057 61.268  1.00 20.18 ? 171 PHE B CD1 1 
ATOM   5015 C  CD2 . PHE B 1 149 ? 15.989 26.483 62.987  1.00 18.47 ? 171 PHE B CD2 1 
ATOM   5016 C  CE1 . PHE B 1 149 ? 15.582 24.486 61.102  1.00 21.46 ? 171 PHE B CE1 1 
ATOM   5017 C  CE2 . PHE B 1 149 ? 14.718 25.918 62.826  1.00 21.47 ? 171 PHE B CE2 1 
ATOM   5018 C  CZ  . PHE B 1 149 ? 14.515 24.921 61.876  1.00 20.50 ? 171 PHE B CZ  1 
ATOM   5019 N  N   . LEU B 1 150 ? 21.376 26.754 63.767  1.00 16.00 ? 172 LEU B N   1 
ATOM   5020 C  CA  . LEU B 1 150 ? 22.797 27.138 63.754  1.00 15.66 ? 172 LEU B CA  1 
ATOM   5021 C  C   . LEU B 1 150 ? 23.767 25.950 63.812  1.00 14.69 ? 172 LEU B C   1 
ATOM   5022 O  O   . LEU B 1 150 ? 24.695 25.879 63.023  1.00 14.80 ? 172 LEU B O   1 
ATOM   5023 C  CB  . LEU B 1 150 ? 23.119 28.171 64.862  1.00 15.37 ? 172 LEU B CB  1 
ATOM   5024 C  CG  . LEU B 1 150 ? 22.756 29.598 64.428  1.00 14.95 ? 172 LEU B CG  1 
ATOM   5025 C  CD1 . LEU B 1 150 ? 22.649 30.542 65.597  1.00 12.76 ? 172 LEU B CD1 1 
ATOM   5026 C  CD2 . LEU B 1 150 ? 23.774 30.085 63.437  1.00 11.94 ? 172 LEU B CD2 1 
ATOM   5027 N  N   . LEU B 1 151 ? 23.548 25.034 64.742  1.00 14.85 ? 173 LEU B N   1 
ATOM   5028 C  CA  . LEU B 1 151 ? 24.423 23.874 64.881  1.00 15.35 ? 173 LEU B CA  1 
ATOM   5029 C  C   . LEU B 1 151 ? 24.370 22.955 63.679  1.00 15.35 ? 173 LEU B C   1 
ATOM   5030 O  O   . LEU B 1 151 ? 25.405 22.487 63.205  1.00 16.42 ? 173 LEU B O   1 
ATOM   5031 C  CB  . LEU B 1 151 ? 24.106 23.074 66.154  1.00 15.52 ? 173 LEU B CB  1 
ATOM   5032 C  CG  . LEU B 1 151 ? 25.063 21.893 66.385  1.00 15.25 ? 173 LEU B CG  1 
ATOM   5033 C  CD1 . LEU B 1 151 ? 25.235 21.691 67.849  1.00 16.50 ? 173 LEU B CD1 1 
ATOM   5034 C  CD2 . LEU B 1 151 ? 24.605 20.575 65.710  1.00 15.09 ? 173 LEU B CD2 1 
ATOM   5035 N  N   . ARG B 1 152 ? 23.164 22.672 63.200  1.00 15.26 ? 174 ARG B N   1 
ATOM   5036 C  CA  . ARG B 1 152 ? 23.016 21.802 62.055  1.00 14.94 ? 174 ARG B CA  1 
ATOM   5037 C  C   . ARG B 1 152 ? 23.733 22.385 60.837  1.00 14.21 ? 174 ARG B C   1 
ATOM   5038 O  O   . ARG B 1 152 ? 24.471 21.679 60.184  1.00 14.25 ? 174 ARG B O   1 
ATOM   5039 C  CB  . ARG B 1 152 ? 21.541 21.512 61.770  1.00 14.39 ? 174 ARG B CB  1 
ATOM   5040 C  CG  . ARG B 1 152 ? 20.934 20.531 62.773  1.00 16.43 ? 174 ARG B CG  1 
ATOM   5041 C  CD  . ARG B 1 152 ? 19.419 20.595 62.719  1.00 16.62 ? 174 ARG B CD  1 
ATOM   5042 N  NE  . ARG B 1 152 ? 18.903 19.922 61.520  1.00 18.21 ? 174 ARG B NE  1 
ATOM   5043 C  CZ  . ARG B 1 152 ? 17.672 20.096 61.039  1.00 19.07 ? 174 ARG B CZ  1 
ATOM   5044 N  NH1 . ARG B 1 152 ? 16.843 20.963 61.611  1.00 17.17 ? 174 ARG B NH1 1 
ATOM   5045 N  NH2 . ARG B 1 152 ? 17.275 19.427 59.968  1.00 20.46 ? 174 ARG B NH2 1 
ATOM   5046 N  N   . ALA B 1 153 ? 23.526 23.675 60.558  1.00 14.67 ? 175 ALA B N   1 
ATOM   5047 C  CA  . ALA B 1 153 ? 24.196 24.335 59.434  1.00 14.19 ? 175 ALA B CA  1 
ATOM   5048 C  C   . ALA B 1 153 ? 25.704 24.469 59.618  1.00 14.61 ? 175 ALA B C   1 
ATOM   5049 O  O   . ALA B 1 153 ? 26.473 24.421 58.630  1.00 14.06 ? 175 ALA B O   1 
ATOM   5050 C  CB  . ALA B 1 153 ? 23.578 25.682 59.167  1.00 14.23 ? 175 ALA B CB  1 
ATOM   5051 N  N   . GLY B 1 154 ? 26.122 24.685 60.867  1.00 14.52 ? 176 GLY B N   1 
ATOM   5052 C  CA  . GLY B 1 154 ? 27.541 24.837 61.196  1.00 14.92 ? 176 GLY B CA  1 
ATOM   5053 C  C   . GLY B 1 154 ? 28.271 23.511 61.056  1.00 15.17 ? 176 GLY B C   1 
ATOM   5054 O  O   . GLY B 1 154 ? 29.379 23.447 60.516  1.00 15.09 ? 176 GLY B O   1 
ATOM   5055 N  N   . TYR B 1 155 ? 27.628 22.453 61.536  1.00 15.57 ? 177 TYR B N   1 
ATOM   5056 C  CA  . TYR B 1 155 ? 28.113 21.084 61.336  1.00 15.82 ? 177 TYR B CA  1 
ATOM   5057 C  C   . TYR B 1 155 ? 28.321 20.762 59.865  1.00 15.89 ? 177 TYR B C   1 
ATOM   5058 O  O   . TYR B 1 155 ? 29.383 20.300 59.476  1.00 16.33 ? 177 TYR B O   1 
ATOM   5059 C  CB  . TYR B 1 155 ? 27.124 20.074 61.930  1.00 16.51 ? 177 TYR B CB  1 
ATOM   5060 C  CG  . TYR B 1 155 ? 27.412 18.643 61.517  1.00 16.13 ? 177 TYR B CG  1 
ATOM   5061 C  CD1 . TYR B 1 155 ? 28.532 17.980 62.008  1.00 14.42 ? 177 TYR B CD1 1 
ATOM   5062 C  CD2 . TYR B 1 155 ? 26.562 17.954 60.618  1.00 17.06 ? 177 TYR B CD2 1 
ATOM   5063 C  CE1 . TYR B 1 155 ? 28.809 16.669 61.636  1.00 15.86 ? 177 TYR B CE1 1 
ATOM   5064 C  CE2 . TYR B 1 155 ? 26.833 16.651 60.240  1.00 15.99 ? 177 TYR B CE2 1 
ATOM   5065 C  CZ  . TYR B 1 155 ? 27.967 16.013 60.754  1.00 18.22 ? 177 TYR B CZ  1 
ATOM   5066 O  OH  . TYR B 1 155 ? 28.270 14.711 60.407  1.00 19.58 ? 177 TYR B OH  1 
ATOM   5067 N  N   . LEU B 1 156 ? 27.297 21.005 59.045  1.00 15.87 ? 178 LEU B N   1 
ATOM   5068 C  CA  . LEU B 1 156 ? 27.380 20.706 57.618  1.00 15.44 ? 178 LEU B CA  1 
ATOM   5069 C  C   . LEU B 1 156 ? 28.434 21.557 56.917  1.00 15.24 ? 178 LEU B C   1 
ATOM   5070 O  O   . LEU B 1 156 ? 29.117 21.107 55.970  1.00 14.25 ? 178 LEU B O   1 
ATOM   5071 C  CB  . LEU B 1 156 ? 25.997 20.885 56.954  1.00 16.29 ? 178 LEU B CB  1 
ATOM   5072 C  CG  . LEU B 1 156 ? 24.874 19.893 57.314  1.00 15.14 ? 178 LEU B CG  1 
ATOM   5073 C  CD1 . LEU B 1 156 ? 23.554 20.364 56.695  1.00 14.67 ? 178 LEU B CD1 1 
ATOM   5074 C  CD2 . LEU B 1 156 ? 25.185 18.475 56.838  1.00 12.74 ? 178 LEU B CD2 1 
ATOM   5075 N  N   . THR B 1 157 ? 28.557 22.800 57.368  1.00 15.13 ? 179 THR B N   1 
ATOM   5076 C  CA  . THR B 1 157 ? 29.542 23.730 56.814  1.00 16.21 ? 179 THR B CA  1 
ATOM   5077 C  C   . THR B 1 157 ? 30.987 23.290 57.082  1.00 17.20 ? 179 THR B C   1 
ATOM   5078 O  O   . THR B 1 157 ? 31.801 23.204 56.151  1.00 19.16 ? 179 THR B O   1 
ATOM   5079 C  CB  . THR B 1 157 ? 29.269 25.128 57.347  1.00 15.63 ? 179 THR B CB  1 
ATOM   5080 O  OG1 . THR B 1 157 ? 27.995 25.530 56.845  1.00 16.42 ? 179 THR B OG1 1 
ATOM   5081 C  CG2 . THR B 1 157 ? 30.349 26.158 56.926  1.00 15.34 ? 179 THR B CG2 1 
ATOM   5082 N  N   . LEU B 1 158 ? 31.291 22.996 58.342  1.00 17.38 ? 180 LEU B N   1 
ATOM   5083 C  CA  . LEU B 1 158 ? 32.634 22.557 58.751  1.00 17.33 ? 180 LEU B CA  1 
ATOM   5084 C  C   . LEU B 1 158 ? 32.948 21.106 58.376  1.00 17.49 ? 180 LEU B C   1 
ATOM   5085 O  O   . LEU B 1 158 ? 34.046 20.823 57.902  1.00 17.21 ? 180 LEU B O   1 
ATOM   5086 C  CB  . LEU B 1 158 ? 32.814 22.746 60.266  1.00 17.10 ? 180 LEU B CB  1 
ATOM   5087 C  CG  . LEU B 1 158 ? 32.769 24.176 60.832  1.00 16.09 ? 180 LEU B CG  1 
ATOM   5088 C  CD1 . LEU B 1 158 ? 33.062 24.131 62.317  1.00 15.29 ? 180 LEU B CD1 1 
ATOM   5089 C  CD2 . LEU B 1 158 ? 33.793 25.086 60.138  1.00 17.09 ? 180 LEU B CD2 1 
ATOM   5090 N  N   . TYR B 1 159 ? 31.991 20.198 58.594  1.00 17.89 ? 181 TYR B N   1 
ATOM   5091 C  CA  . TYR B 1 159 ? 32.210 18.750 58.398  1.00 18.03 ? 181 TYR B CA  1 
ATOM   5092 C  C   . TYR B 1 159 ? 31.728 18.215 57.052  1.00 18.88 ? 181 TYR B C   1 
ATOM   5093 O  O   . TYR B 1 159 ? 31.901 17.025 56.728  1.00 19.42 ? 181 TYR B O   1 
ATOM   5094 C  CB  . TYR B 1 159 ? 31.594 17.931 59.539  1.00 17.63 ? 181 TYR B CB  1 
ATOM   5095 C  CG  . TYR B 1 159 ? 32.192 18.207 60.916  1.00 17.03 ? 181 TYR B CG  1 
ATOM   5096 C  CD1 . TYR B 1 159 ? 33.135 17.341 61.483  1.00 16.73 ? 181 TYR B CD1 1 
ATOM   5097 C  CD2 . TYR B 1 159 ? 31.807 19.327 61.649  1.00 17.00 ? 181 TYR B CD2 1 
ATOM   5098 C  CE1 . TYR B 1 159 ? 33.690 17.597 62.768  1.00 15.31 ? 181 TYR B CE1 1 
ATOM   5099 C  CE2 . TYR B 1 159 ? 32.341 19.595 62.925  1.00 17.48 ? 181 TYR B CE2 1 
ATOM   5100 C  CZ  . TYR B 1 159 ? 33.281 18.729 63.478  1.00 16.85 ? 181 TYR B CZ  1 
ATOM   5101 O  OH  . TYR B 1 159 ? 33.788 19.003 64.735  1.00 15.79 ? 181 TYR B OH  1 
ATOM   5102 N  N   . GLY B 1 160 ? 31.129 19.080 56.255  1.00 18.94 ? 182 GLY B N   1 
ATOM   5103 C  CA  . GLY B 1 160 ? 30.721 18.652 54.927  1.00 19.95 ? 182 GLY B CA  1 
ATOM   5104 C  C   . GLY B 1 160 ? 29.294 18.173 54.787  1.00 20.18 ? 182 GLY B C   1 
ATOM   5105 O  O   . GLY B 1 160 ? 28.554 18.035 55.779  1.00 19.93 ? 182 GLY B O   1 
ATOM   5106 N  N   . ILE B 1 161 ? 28.929 17.903 53.532  1.00 21.35 ? 183 ILE B N   1 
ATOM   5107 C  CA  . ILE B 1 161 ? 27.554 17.553 53.134  1.00 21.92 ? 183 ILE B CA  1 
ATOM   5108 C  C   . ILE B 1 161 ? 27.503 16.188 52.430  1.00 23.00 ? 183 ILE B C   1 
ATOM   5109 O  O   . ILE B 1 161 ? 28.544 15.597 52.110  1.00 22.16 ? 183 ILE B O   1 
ATOM   5110 C  CB  . ILE B 1 161 ? 26.879 18.668 52.250  1.00 21.41 ? 183 ILE B CB  1 
ATOM   5111 C  CG1 . ILE B 1 161 ? 27.719 19.019 51.002  1.00 21.53 ? 183 ILE B CG1 1 
ATOM   5112 C  CG2 . ILE B 1 161 ? 26.623 19.903 53.077  1.00 21.89 ? 183 ILE B CG2 1 
ATOM   5113 C  CD1 . ILE B 1 161 ? 26.990 19.893 49.934  1.00 19.48 ? 183 ILE B CD1 1 
ATOM   5114 N  N   . GLU B 1 162 ? 26.283 15.710 52.184  1.00 24.38 ? 184 GLU B N   1 
ATOM   5115 C  CA  . GLU B 1 162 ? 26.049 14.406 51.583  1.00 26.10 ? 184 GLU B CA  1 
ATOM   5116 C  C   . GLU B 1 162 ? 26.627 14.309 50.167  1.00 27.13 ? 184 GLU B C   1 
ATOM   5117 O  O   . GLU B 1 162 ? 27.230 13.298 49.827  1.00 27.43 ? 184 GLU B O   1 
ATOM   5118 C  CB  . GLU B 1 162 ? 24.544 14.039 51.645  1.00 26.30 ? 184 GLU B CB  1 
ATOM   5119 C  CG  . GLU B 1 162 ? 24.141 12.644 51.094  1.00 26.51 ? 184 GLU B CG  1 
ATOM   5120 C  CD  . GLU B 1 162 ? 24.788 11.463 51.820  1.00 28.52 ? 184 GLU B CD  1 
ATOM   5121 O  OE1 . GLU B 1 162 ? 25.088 11.546 53.038  1.00 28.27 ? 184 GLU B OE1 1 
ATOM   5122 O  OE2 . GLU B 1 162 ? 24.993 10.425 51.159  1.00 30.51 ? 184 GLU B OE2 1 
ATOM   5123 N  N   . ALA B 1 163 ? 26.475 15.363 49.363  1.00 28.74 ? 185 ALA B N   1 
ATOM   5124 C  CA  . ALA B 1 163 ? 26.923 15.346 47.968  1.00 30.15 ? 185 ALA B CA  1 
ATOM   5125 C  C   . ALA B 1 163 ? 27.035 16.745 47.383  1.00 31.45 ? 185 ALA B C   1 
ATOM   5126 O  O   . ALA B 1 163 ? 26.224 17.606 47.691  1.00 31.33 ? 185 ALA B O   1 
ATOM   5127 C  CB  . ALA B 1 163 ? 25.976 14.488 47.106  1.00 29.99 ? 185 ALA B CB  1 
ATOM   5128 N  N   . LEU B 1 164 ? 28.038 16.953 46.531  1.00 33.61 ? 186 LEU B N   1 
ATOM   5129 C  CA  . LEU B 1 164 ? 28.261 18.240 45.866  1.00 35.87 ? 186 LEU B CA  1 
ATOM   5130 C  C   . LEU B 1 164 ? 27.908 18.222 44.371  1.00 37.25 ? 186 LEU B C   1 
ATOM   5131 O  O   . LEU B 1 164 ? 28.063 19.241 43.674  1.00 38.31 ? 186 LEU B O   1 
ATOM   5132 C  CB  . LEU B 1 164 ? 29.687 18.763 46.075  1.00 36.28 ? 186 LEU B CB  1 
ATOM   5133 C  CG  . LEU B 1 164 ? 29.893 20.229 46.501  1.00 37.33 ? 186 LEU B CG  1 
ATOM   5134 C  CD1 . LEU B 1 164 ? 31.254 20.739 46.018  1.00 37.81 ? 186 LEU B CD1 1 
ATOM   5135 C  CD2 . LEU B 1 164 ? 28.783 21.189 46.074  1.00 38.10 ? 186 LEU B CD2 1 
ATOM   5136 N  N   . PRO B 1 165 ? 27.489 17.059 43.845  1.00 37.83 ? 187 PRO B N   1 
ATOM   5137 C  CA  . PRO B 1 165 ? 26.298 17.226 43.037  1.00 37.94 ? 187 PRO B CA  1 
ATOM   5138 C  C   . PRO B 1 165 ? 25.358 18.215 43.767  1.00 37.52 ? 187 PRO B C   1 
ATOM   5139 O  O   . PRO B 1 165 ? 25.304 19.381 43.386  1.00 38.64 ? 187 PRO B O   1 
ATOM   5140 C  CB  . PRO B 1 165 ? 25.694 15.815 43.020  1.00 38.36 ? 187 PRO B CB  1 
ATOM   5141 C  CG  . PRO B 1 165 ? 26.892 14.886 43.189  1.00 38.64 ? 187 PRO B CG  1 
ATOM   5142 C  CD  . PRO B 1 165 ? 28.017 15.682 43.806  1.00 37.91 ? 187 PRO B CD  1 
ATOM   5143 N  N   . ARG B 1 166 ? 24.685 17.762 44.829  1.00 36.11 ? 188 ARG B N   1 
ATOM   5144 C  CA  . ARG B 1 166 ? 23.669 18.546 45.601  1.00 35.19 ? 188 ARG B CA  1 
ATOM   5145 C  C   . ARG B 1 166 ? 22.256 18.448 44.982  1.00 33.89 ? 188 ARG B C   1 
ATOM   5146 O  O   . ARG B 1 166 ? 21.890 19.204 44.079  1.00 33.39 ? 188 ARG B O   1 
ATOM   5147 C  CB  . ARG B 1 166 ? 24.075 20.012 45.865  1.00 35.51 ? 188 ARG B CB  1 
ATOM   5148 C  CG  . ARG B 1 166 ? 23.908 20.481 47.345  1.00 36.22 ? 188 ARG B CG  1 
ATOM   5149 C  CD  . ARG B 1 166 ? 23.948 22.015 47.510  1.00 38.26 ? 188 ARG B CD  1 
ATOM   5150 N  NE  . ARG B 1 166 ? 24.811 22.495 48.608  1.00 38.52 ? 188 ARG B NE  1 
ATOM   5151 C  CZ  . ARG B 1 166 ? 24.469 22.559 49.899  1.00 38.29 ? 188 ARG B CZ  1 
ATOM   5152 N  NH1 . ARG B 1 166 ? 23.275 22.158 50.317  1.00 37.13 ? 188 ARG B NH1 1 
ATOM   5153 N  NH2 . ARG B 1 166 ? 25.341 23.013 50.790  1.00 38.90 ? 188 ARG B NH2 1 
ATOM   5154 N  N   . THR B 1 167 ? 21.482 17.500 45.504  1.00 32.39 ? 189 THR B N   1 
ATOM   5155 C  CA  . THR B 1 167 ? 20.194 17.098 44.942  1.00 30.98 ? 189 THR B CA  1 
ATOM   5156 C  C   . THR B 1 167 ? 19.111 17.269 46.019  1.00 30.60 ? 189 THR B C   1 
ATOM   5157 O  O   . THR B 1 167 ? 19.427 17.679 47.136  1.00 30.34 ? 189 THR B O   1 
ATOM   5158 C  CB  . THR B 1 167 ? 20.268 15.628 44.481  1.00 30.97 ? 189 THR B CB  1 
ATOM   5159 O  OG1 . THR B 1 167 ? 20.533 14.781 45.612  1.00 29.55 ? 189 THR B OG1 1 
ATOM   5160 C  CG2 . THR B 1 167 ? 21.389 15.435 43.439  1.00 29.69 ? 189 THR B CG2 1 
ATOM   5161 N  N   . HIS B 1 168 ? 17.846 16.984 45.696  1.00 29.75 ? 190 HIS B N   1 
ATOM   5162 C  CA  . HIS B 1 168 ? 16.786 17.017 46.720  1.00 29.18 ? 190 HIS B CA  1 
ATOM   5163 C  C   . HIS B 1 168 ? 16.910 15.884 47.745  1.00 28.10 ? 190 HIS B C   1 
ATOM   5164 O  O   . HIS B 1 168 ? 16.629 16.078 48.929  1.00 27.18 ? 190 HIS B O   1 
ATOM   5165 C  CB  . HIS B 1 168 ? 15.364 17.141 46.122  1.00 29.75 ? 190 HIS B CB  1 
ATOM   5166 C  CG  . HIS B 1 168 ? 14.768 15.859 45.608  1.00 31.30 ? 190 HIS B CG  1 
ATOM   5167 N  ND1 . HIS B 1 168 ? 14.165 14.930 46.433  1.00 31.93 ? 190 HIS B ND1 1 
ATOM   5168 C  CD2 . HIS B 1 168 ? 14.613 15.391 44.344  1.00 32.81 ? 190 HIS B CD2 1 
ATOM   5169 C  CE1 . HIS B 1 168 ? 13.701 13.928 45.706  1.00 31.39 ? 190 HIS B CE1 1 
ATOM   5170 N  NE2 . HIS B 1 168 ? 13.965 14.179 44.435  1.00 33.34 ? 190 HIS B NE2 1 
ATOM   5171 N  N   . GLU B 1 169 ? 17.378 14.727 47.279  1.00 27.37 ? 191 GLU B N   1 
ATOM   5172 C  CA  . GLU B 1 169 ? 17.626 13.564 48.131  1.00 27.50 ? 191 GLU B CA  1 
ATOM   5173 C  C   . GLU B 1 169 ? 18.818 13.747 49.085  1.00 26.50 ? 191 GLU B C   1 
ATOM   5174 O  O   . GLU B 1 169 ? 18.745 13.363 50.249  1.00 25.68 ? 191 GLU B O   1 
ATOM   5175 C  CB  . GLU B 1 169 ? 17.828 12.296 47.291  1.00 28.22 ? 191 GLU B CB  1 
ATOM   5176 C  CG  . GLU B 1 169 ? 16.649 11.930 46.398  1.00 29.83 ? 191 GLU B CG  1 
ATOM   5177 C  CD  . GLU B 1 169 ? 16.818 12.383 44.958  1.00 34.40 ? 191 GLU B CD  1 
ATOM   5178 O  OE1 . GLU B 1 169 ? 16.206 11.729 44.081  1.00 37.04 ? 191 GLU B OE1 1 
ATOM   5179 O  OE2 . GLU B 1 169 ? 17.560 13.365 44.681  1.00 35.54 ? 191 GLU B OE2 1 
ATOM   5180 N  N   . SER B 1 170 ? 19.899 14.337 48.586  1.00 25.79 ? 192 SER B N   1 
ATOM   5181 C  CA  . SER B 1 170 ? 21.085 14.560 49.413  1.00 25.83 ? 192 SER B CA  1 
ATOM   5182 C  C   . SER B 1 170 ? 20.829 15.629 50.484  1.00 25.35 ? 192 SER B C   1 
ATOM   5183 O  O   . SER B 1 170 ? 21.235 15.456 51.635  1.00 24.98 ? 192 SER B O   1 
ATOM   5184 C  CB  . SER B 1 170 ? 22.295 14.910 48.553  1.00 25.10 ? 192 SER B CB  1 
ATOM   5185 O  OG  . SER B 1 170 ? 22.254 16.265 48.173  1.00 26.25 ? 192 SER B OG  1 
ATOM   5186 N  N   . GLN B 1 171 ? 20.124 16.706 50.105  1.00 25.32 ? 193 GLN B N   1 
ATOM   5187 C  CA  . GLN B 1 171 ? 19.783 17.791 51.039  1.00 25.03 ? 193 GLN B CA  1 
ATOM   5188 C  C   . GLN B 1 171 ? 18.795 17.337 52.108  1.00 24.60 ? 193 GLN B C   1 
ATOM   5189 O  O   . GLN B 1 171 ? 18.889 17.754 53.274  1.00 24.83 ? 193 GLN B O   1 
ATOM   5190 C  CB  . GLN B 1 171 ? 19.242 19.024 50.304  1.00 24.97 ? 193 GLN B CB  1 
ATOM   5191 C  CG  . GLN B 1 171 ? 20.313 19.826 49.577  1.00 27.21 ? 193 GLN B CG  1 
ATOM   5192 C  CD  . GLN B 1 171 ? 19.894 21.252 49.185  1.00 29.69 ? 193 GLN B CD  1 
ATOM   5193 O  OE1 . GLN B 1 171 ? 20.723 22.036 48.754  1.00 32.10 ? 193 GLN B OE1 1 
ATOM   5194 N  NE2 . GLN B 1 171 ? 18.612 21.580 49.322  1.00 31.96 ? 193 GLN B NE2 1 
ATOM   5195 N  N   . ALA B 1 172 ? 17.853 16.486 51.707  1.00 23.55 ? 194 ALA B N   1 
ATOM   5196 C  CA  . ALA B 1 172 ? 16.904 15.871 52.632  1.00 23.14 ? 194 ALA B CA  1 
ATOM   5197 C  C   . ALA B 1 172 ? 17.651 14.959 53.617  1.00 23.04 ? 194 ALA B C   1 
ATOM   5198 O  O   . ALA B 1 172 ? 17.316 14.900 54.799  1.00 21.90 ? 194 ALA B O   1 
ATOM   5199 C  CB  . ALA B 1 172 ? 15.846 15.074 51.862  1.00 22.94 ? 194 ALA B CB  1 
ATOM   5200 N  N   . GLN B 1 173 ? 18.665 14.254 53.115  1.00 23.20 ? 195 GLN B N   1 
ATOM   5201 C  CA  . GLN B 1 173 ? 19.543 13.458 53.973  1.00 24.15 ? 195 GLN B CA  1 
ATOM   5202 C  C   . GLN B 1 173 ? 20.405 14.350 54.889  1.00 23.33 ? 195 GLN B C   1 
ATOM   5203 O  O   . GLN B 1 173 ? 20.583 14.012 56.055  1.00 23.41 ? 195 GLN B O   1 
ATOM   5204 C  CB  . GLN B 1 173 ? 20.392 12.476 53.135  1.00 25.06 ? 195 GLN B CB  1 
ATOM   5205 C  CG  . GLN B 1 173 ? 21.238 11.440 53.934  1.00 28.64 ? 195 GLN B CG  1 
ATOM   5206 C  CD  . GLN B 1 173 ? 20.472 10.697 55.053  1.00 35.35 ? 195 GLN B CD  1 
ATOM   5207 O  OE1 . GLN B 1 173 ? 21.087 10.236 56.023  1.00 37.82 ? 195 GLN B OE1 1 
ATOM   5208 N  NE2 . GLN B 1 173 ? 19.136 10.585 54.926  1.00 36.41 ? 195 GLN B NE2 1 
ATOM   5209 N  N   . ASP B 1 174 ? 20.894 15.487 54.371  1.00 22.57 ? 196 ASP B N   1 
ATOM   5210 C  CA  . ASP B 1 174 ? 21.620 16.498 55.186  1.00 22.71 ? 196 ASP B CA  1 
ATOM   5211 C  C   . ASP B 1 174 ? 20.781 16.926 56.392  1.00 21.85 ? 196 ASP B C   1 
ATOM   5212 O  O   . ASP B 1 174 ? 21.290 17.083 57.502  1.00 21.68 ? 196 ASP B O   1 
ATOM   5213 C  CB  . ASP B 1 174 ? 21.993 17.764 54.376  1.00 22.45 ? 196 ASP B CB  1 
ATOM   5214 C  CG  . ASP B 1 174 ? 23.237 17.601 53.492  1.00 24.24 ? 196 ASP B CG  1 
ATOM   5215 O  OD1 . ASP B 1 174 ? 24.126 16.807 53.855  1.00 23.86 ? 196 ASP B OD1 1 
ATOM   5216 O  OD2 . ASP B 1 174 ? 23.330 18.299 52.417  1.00 25.85 ? 196 ASP B OD2 1 
ATOM   5217 N  N   . ARG B 1 175 ? 19.489 17.113 56.162  1.00 21.32 ? 197 ARG B N   1 
ATOM   5218 C  CA  . ARG B 1 175 ? 18.577 17.568 57.190  1.00 21.02 ? 197 ARG B CA  1 
ATOM   5219 C  C   . ARG B 1 175 ? 18.314 16.513 58.280  1.00 20.42 ? 197 ARG B C   1 
ATOM   5220 O  O   . ARG B 1 175 ? 18.323 16.831 59.462  1.00 19.31 ? 197 ARG B O   1 
ATOM   5221 C  CB  . ARG B 1 175 ? 17.277 18.109 56.553  1.00 21.32 ? 197 ARG B CB  1 
ATOM   5222 C  CG  . ARG B 1 175 ? 17.482 19.493 55.886  1.00 24.08 ? 197 ARG B CG  1 
ATOM   5223 C  CD  . ARG B 1 175 ? 16.234 20.095 55.203  1.00 29.20 ? 197 ARG B CD  1 
ATOM   5224 N  NE  . ARG B 1 175 ? 15.008 19.688 55.867  1.00 34.26 ? 197 ARG B NE  1 
ATOM   5225 C  CZ  . ARG B 1 175 ? 14.103 18.864 55.348  1.00 36.56 ? 197 ARG B CZ  1 
ATOM   5226 N  NH1 . ARG B 1 175 ? 14.248 18.380 54.118  1.00 36.88 ? 197 ARG B NH1 1 
ATOM   5227 N  NH2 . ARG B 1 175 ? 13.039 18.540 56.065  1.00 36.83 ? 197 ARG B NH2 1 
ATOM   5228 N  N   . VAL B 1 176 ? 18.090 15.270 57.864  1.00 19.81 ? 198 VAL B N   1 
ATOM   5229 C  CA  . VAL B 1 176 ? 17.948 14.118 58.772  1.00 19.63 ? 198 VAL B CA  1 
ATOM   5230 C  C   . VAL B 1 176 ? 19.232 13.823 59.581  1.00 18.76 ? 198 VAL B C   1 
ATOM   5231 O  O   . VAL B 1 176 ? 19.177 13.708 60.786  1.00 18.39 ? 198 VAL B O   1 
ATOM   5232 C  CB  . VAL B 1 176 ? 17.585 12.794 57.985  1.00 19.58 ? 198 VAL B CB  1 
ATOM   5233 C  CG1 . VAL B 1 176 ? 17.640 11.599 58.929  1.00 20.65 ? 198 VAL B CG1 1 
ATOM   5234 C  CG2 . VAL B 1 176 ? 16.207 12.890 57.321  1.00 18.80 ? 198 VAL B CG2 1 
ATOM   5235 N  N   . HIS B 1 177 ? 20.367 13.674 58.898  1.00 18.53 ? 199 HIS B N   1 
ATOM   5236 C  CA  . HIS B 1 177 ? 21.643 13.409 59.561  1.00 18.76 ? 199 HIS B CA  1 
ATOM   5237 C  C   . HIS B 1 177 ? 21.971 14.519 60.562  1.00 18.37 ? 199 HIS B C   1 
ATOM   5238 O  O   . HIS B 1 177 ? 22.174 14.255 61.724  1.00 18.28 ? 199 HIS B O   1 
ATOM   5239 C  CB  . HIS B 1 177 ? 22.773 13.220 58.528  1.00 19.51 ? 199 HIS B CB  1 
ATOM   5240 C  CG  . HIS B 1 177 ? 24.148 13.103 59.126  1.00 20.82 ? 199 HIS B CG  1 
ATOM   5241 N  ND1 . HIS B 1 177 ? 24.483 12.151 60.070  1.00 22.23 ? 199 HIS B ND1 1 
ATOM   5242 C  CD2 . HIS B 1 177 ? 25.278 13.812 58.898  1.00 22.42 ? 199 HIS B CD2 1 
ATOM   5243 C  CE1 . HIS B 1 177 ? 25.755 12.285 60.402  1.00 21.70 ? 199 HIS B CE1 1 
ATOM   5244 N  NE2 . HIS B 1 177 ? 26.260 13.288 59.707  1.00 23.28 ? 199 HIS B NE2 1 
ATOM   5245 N  N   . SER B 1 178 ? 21.959 15.768 60.119  1.00 18.34 ? 200 SER B N   1 
ATOM   5246 C  CA  . SER B 1 178 ? 22.282 16.883 61.010  1.00 18.18 ? 200 SER B CA  1 
ATOM   5247 C  C   . SER B 1 178 ? 21.350 16.998 62.220  1.00 18.42 ? 200 SER B C   1 
ATOM   5248 O  O   . SER B 1 178 ? 21.790 17.421 63.294  1.00 17.99 ? 200 SER B O   1 
ATOM   5249 C  CB  . SER B 1 178 ? 22.320 18.200 60.233  1.00 17.94 ? 200 SER B CB  1 
ATOM   5250 O  OG  . SER B 1 178 ? 21.021 18.598 59.834  1.00 17.30 ? 200 SER B OG  1 
ATOM   5251 N  N   . ALA B 1 179 ? 20.071 16.626 62.060  1.00 18.97 ? 201 ALA B N   1 
ATOM   5252 C  CA  . ALA B 1 179 ? 19.132 16.687 63.192  1.00 19.15 ? 201 ALA B CA  1 
ATOM   5253 C  C   . ALA B 1 179 ? 19.489 15.604 64.207  1.00 19.42 ? 201 ALA B C   1 
ATOM   5254 O  O   . ALA B 1 179 ? 19.408 15.813 65.414  1.00 20.54 ? 201 ALA B O   1 
ATOM   5255 C  CB  . ALA B 1 179 ? 17.666 16.547 62.731  1.00 19.24 ? 201 ALA B CB  1 
ATOM   5256 N  N   . ASP B 1 180 ? 19.926 14.463 63.708  1.00 20.34 ? 202 ASP B N   1 
ATOM   5257 C  CA  . ASP B 1 180 ? 20.392 13.357 64.561  1.00 21.29 ? 202 ASP B CA  1 
ATOM   5258 C  C   . ASP B 1 180 ? 21.624 13.787 65.381  1.00 20.61 ? 202 ASP B C   1 
ATOM   5259 O  O   . ASP B 1 180 ? 21.641 13.687 66.602  1.00 21.30 ? 202 ASP B O   1 
ATOM   5260 C  CB  . ASP B 1 180 ? 20.642 12.122 63.681  1.00 21.80 ? 202 ASP B CB  1 
ATOM   5261 C  CG  . ASP B 1 180 ? 21.144 10.918 64.462  1.00 24.43 ? 202 ASP B CG  1 
ATOM   5262 O  OD1 . ASP B 1 180 ? 20.672 10.691 65.594  1.00 27.64 ? 202 ASP B OD1 1 
ATOM   5263 O  OD2 . ASP B 1 180 ? 22.007 10.193 63.921  1.00 25.40 ? 202 ASP B OD2 1 
ATOM   5264 N  N   . VAL B 1 181 ? 22.639 14.309 64.706  1.00 20.61 ? 203 VAL B N   1 
ATOM   5265 C  CA  . VAL B 1 181 ? 23.799 14.936 65.373  1.00 18.96 ? 203 VAL B CA  1 
ATOM   5266 C  C   . VAL B 1 181 ? 23.380 15.990 66.426  1.00 18.43 ? 203 VAL B C   1 
ATOM   5267 O  O   . VAL B 1 181 ? 23.846 15.970 67.560  1.00 17.51 ? 203 VAL B O   1 
ATOM   5268 C  CB  . VAL B 1 181 ? 24.754 15.560 64.308  1.00 19.27 ? 203 VAL B CB  1 
ATOM   5269 C  CG1 . VAL B 1 181 ? 25.834 16.423 64.959  1.00 18.67 ? 203 VAL B CG1 1 
ATOM   5270 C  CG2 . VAL B 1 181 ? 25.369 14.468 63.431  1.00 17.43 ? 203 VAL B CG2 1 
ATOM   5271 N  N   . PHE B 1 182 ? 22.497 16.914 66.052  1.00 18.54 ? 204 PHE B N   1 
ATOM   5272 C  CA  . PHE B 1 182 ? 22.042 17.924 66.997  1.00 18.04 ? 204 PHE B CA  1 
ATOM   5273 C  C   . PHE B 1 182 ? 21.390 17.331 68.249  1.00 18.83 ? 204 PHE B C   1 
ATOM   5274 O  O   . PHE B 1 182 ? 21.721 17.730 69.371  1.00 18.63 ? 204 PHE B O   1 
ATOM   5275 C  CB  . PHE B 1 182 ? 21.078 18.928 66.356  1.00 17.50 ? 204 PHE B CB  1 
ATOM   5276 C  CG  . PHE B 1 182 ? 20.425 19.850 67.361  1.00 16.50 ? 204 PHE B CG  1 
ATOM   5277 C  CD1 . PHE B 1 182 ? 21.163 20.856 67.979  1.00 15.41 ? 204 PHE B CD1 1 
ATOM   5278 C  CD2 . PHE B 1 182 ? 19.083 19.691 67.715  1.00 15.73 ? 204 PHE B CD2 1 
ATOM   5279 C  CE1 . PHE B 1 182 ? 20.572 21.711 68.918  1.00 15.59 ? 204 PHE B CE1 1 
ATOM   5280 C  CE2 . PHE B 1 182 ? 18.473 20.540 68.650  1.00 14.68 ? 204 PHE B CE2 1 
ATOM   5281 C  CZ  . PHE B 1 182 ? 19.220 21.544 69.265  1.00 15.25 ? 204 PHE B CZ  1 
ATOM   5282 N  N   . HIS B 1 183 ? 20.448 16.407 68.064  1.00 19.73 ? 205 HIS B N   1 
ATOM   5283 C  CA  . HIS B 1 183 ? 19.732 15.853 69.208  1.00 20.82 ? 205 HIS B CA  1 
ATOM   5284 C  C   . HIS B 1 183 ? 20.687 15.098 70.123  1.00 20.31 ? 205 HIS B C   1 
ATOM   5285 O  O   . HIS B 1 183 ? 20.673 15.319 71.321  1.00 19.50 ? 205 HIS B O   1 
ATOM   5286 C  CB  . HIS B 1 183 ? 18.469 15.070 68.799  1.00 22.13 ? 205 HIS B CB  1 
ATOM   5287 C  CG  . HIS B 1 183 ? 17.393 15.958 68.243  1.00 26.61 ? 205 HIS B CG  1 
ATOM   5288 N  ND1 . HIS B 1 183 ? 16.652 16.814 69.035  1.00 28.46 ? 205 HIS B ND1 1 
ATOM   5289 C  CD2 . HIS B 1 183 ? 16.989 16.185 66.966  1.00 29.34 ? 205 HIS B CD2 1 
ATOM   5290 C  CE1 . HIS B 1 183 ? 15.821 17.505 68.274  1.00 29.15 ? 205 HIS B CE1 1 
ATOM   5291 N  NE2 . HIS B 1 183 ? 16.006 17.144 67.014  1.00 29.30 ? 205 HIS B NE2 1 
ATOM   5292 N  N   . THR B 1 184 ? 21.575 14.283 69.557  1.00 20.17 ? 206 THR B N   1 
ATOM   5293 C  CA  . THR B 1 184 ? 22.599 13.632 70.369  1.00 19.65 ? 206 THR B CA  1 
ATOM   5294 C  C   . THR B 1 184 ? 23.543 14.654 71.016  1.00 19.01 ? 206 THR B C   1 
ATOM   5295 O  O   . THR B 1 184 ? 23.882 14.537 72.186  1.00 19.14 ? 206 THR B O   1 
ATOM   5296 C  CB  . THR B 1 184 ? 23.422 12.634 69.552  1.00 19.94 ? 206 THR B CB  1 
ATOM   5297 O  OG1 . THR B 1 184 ? 22.534 11.753 68.862  1.00 21.65 ? 206 THR B OG1 1 
ATOM   5298 C  CG2 . THR B 1 184 ? 24.340 11.843 70.454  1.00 18.13 ? 206 THR B CG2 1 
ATOM   5299 N  N   . PHE B 1 185 ? 23.958 15.657 70.255  1.00 18.89 ? 207 PHE B N   1 
ATOM   5300 C  CA  . PHE B 1 185 ? 24.822 16.708 70.801  1.00 18.50 ? 207 PHE B CA  1 
ATOM   5301 C  C   . PHE B 1 185 ? 24.193 17.401 72.024  1.00 18.14 ? 207 PHE B C   1 
ATOM   5302 O  O   . PHE B 1 185 ? 24.886 17.692 73.001  1.00 17.35 ? 207 PHE B O   1 
ATOM   5303 C  CB  . PHE B 1 185 ? 25.197 17.745 69.717  1.00 18.53 ? 207 PHE B CB  1 
ATOM   5304 C  CG  . PHE B 1 185 ? 26.023 18.896 70.239  1.00 18.59 ? 207 PHE B CG  1 
ATOM   5305 C  CD1 . PHE B 1 185 ? 27.421 18.808 70.289  1.00 21.16 ? 207 PHE B CD1 1 
ATOM   5306 C  CD2 . PHE B 1 185 ? 25.404 20.056 70.719  1.00 19.03 ? 207 PHE B CD2 1 
ATOM   5307 C  CE1 . PHE B 1 185 ? 28.201 19.877 70.799  1.00 20.36 ? 207 PHE B CE1 1 
ATOM   5308 C  CE2 . PHE B 1 185 ? 26.166 21.139 71.215  1.00 19.93 ? 207 PHE B CE2 1 
ATOM   5309 C  CZ  . PHE B 1 185 ? 27.564 21.049 71.256  1.00 20.02 ? 207 PHE B CZ  1 
ATOM   5310 N  N   . ARG B 1 186 ? 22.896 17.699 71.957  1.00 18.92 ? 208 ARG B N   1 
ATOM   5311 C  CA  . ARG B 1 186 ? 22.228 18.399 73.071  1.00 19.52 ? 208 ARG B CA  1 
ATOM   5312 C  C   . ARG B 1 186 ? 22.255 17.580 74.338  1.00 19.10 ? 208 ARG B C   1 
ATOM   5313 O  O   . ARG B 1 186 ? 22.288 18.132 75.412  1.00 18.96 ? 208 ARG B O   1 
ATOM   5314 C  CB  . ARG B 1 186 ? 20.789 18.801 72.749  1.00 19.37 ? 208 ARG B CB  1 
ATOM   5315 C  CG  . ARG B 1 186 ? 20.644 20.093 71.952  1.00 23.32 ? 208 ARG B CG  1 
ATOM   5316 C  CD  . ARG B 1 186 ? 21.116 21.346 72.711  1.00 26.05 ? 208 ARG B CD  1 
ATOM   5317 N  NE  . ARG B 1 186 ? 20.118 21.814 73.672  1.00 28.17 ? 208 ARG B NE  1 
ATOM   5318 C  CZ  . ARG B 1 186 ? 20.400 22.336 74.858  1.00 30.22 ? 208 ARG B CZ  1 
ATOM   5319 N  NH1 . ARG B 1 186 ? 21.663 22.465 75.273  1.00 29.63 ? 208 ARG B NH1 1 
ATOM   5320 N  NH2 . ARG B 1 186 ? 19.406 22.724 75.644  1.00 32.09 ? 208 ARG B NH2 1 
ATOM   5321 N  N   . GLN B 1 187 ? 22.233 16.258 74.207  1.00 19.79 ? 209 GLN B N   1 
ATOM   5322 C  CA  . GLN B 1 187 ? 22.324 15.371 75.377  1.00 20.16 ? 209 GLN B CA  1 
ATOM   5323 C  C   . GLN B 1 187 ? 23.691 15.513 76.050  1.00 19.80 ? 209 GLN B C   1 
ATOM   5324 O  O   . GLN B 1 187 ? 23.772 15.624 77.269  1.00 19.59 ? 209 GLN B O   1 
ATOM   5325 C  CB  . GLN B 1 187 ? 22.053 13.904 74.978  1.00 20.79 ? 209 GLN B CB  1 
ATOM   5326 C  CG  . GLN B 1 187 ? 20.600 13.614 74.561  1.00 23.28 ? 209 GLN B CG  1 
ATOM   5327 C  CD  . GLN B 1 187 ? 20.385 12.192 74.079  1.00 26.36 ? 209 GLN B CD  1 
ATOM   5328 O  OE1 . GLN B 1 187 ? 19.972 11.332 74.839  1.00 31.15 ? 209 GLN B OE1 1 
ATOM   5329 N  NE2 . GLN B 1 187 ? 20.678 11.938 72.809  1.00 29.73 ? 209 GLN B NE2 1 
ATOM   5330 N  N   . LEU B 1 188 ? 24.764 15.507 75.254  1.00 19.58 ? 210 LEU B N   1 
ATOM   5331 C  CA  . LEU B 1 188 ? 26.102 15.745 75.789  1.00 19.89 ? 210 LEU B CA  1 
ATOM   5332 C  C   . LEU B 1 188 ? 26.137 17.119 76.437  1.00 20.34 ? 210 LEU B C   1 
ATOM   5333 O  O   . LEU B 1 188 ? 26.514 17.251 77.598  1.00 20.15 ? 210 LEU B O   1 
ATOM   5334 C  CB  . LEU B 1 188 ? 27.182 15.638 74.691  1.00 19.45 ? 210 LEU B CB  1 
ATOM   5335 C  CG  . LEU B 1 188 ? 28.655 15.737 75.115  1.00 19.56 ? 210 LEU B CG  1 
ATOM   5336 C  CD1 . LEU B 1 188 ? 29.551 14.883 74.208  1.00 17.90 ? 210 LEU B CD1 1 
ATOM   5337 C  CD2 . LEU B 1 188 ? 29.123 17.175 75.098  1.00 19.11 ? 210 LEU B CD2 1 
ATOM   5338 N  N   . ASP B 1 189 ? 25.718 18.129 75.674  1.00 21.32 ? 211 ASP B N   1 
ATOM   5339 C  CA  . ASP B 1 189 ? 25.785 19.528 76.088  1.00 22.01 ? 211 ASP B CA  1 
ATOM   5340 C  C   . ASP B 1 189 ? 25.061 19.761 77.413  1.00 22.88 ? 211 ASP B C   1 
ATOM   5341 O  O   . ASP B 1 189 ? 25.529 20.525 78.260  1.00 22.33 ? 211 ASP B O   1 
ATOM   5342 C  CB  . ASP B 1 189 ? 25.199 20.432 75.005  1.00 21.78 ? 211 ASP B CB  1 
ATOM   5343 C  CG  . ASP B 1 189 ? 25.412 21.909 75.294  1.00 22.59 ? 211 ASP B CG  1 
ATOM   5344 O  OD1 . ASP B 1 189 ? 26.556 22.323 75.604  1.00 20.40 ? 211 ASP B OD1 1 
ATOM   5345 O  OD2 . ASP B 1 189 ? 24.433 22.666 75.172  1.00 24.96 ? 211 ASP B OD2 1 
ATOM   5346 N  N   . ARG B 1 190 ? 23.926 19.099 77.598  1.00 24.10 ? 212 ARG B N   1 
ATOM   5347 C  CA  . ARG B 1 190 ? 23.183 19.230 78.845  1.00 25.49 ? 212 ARG B CA  1 
ATOM   5348 C  C   . ARG B 1 190 ? 23.954 18.670 80.047  1.00 25.66 ? 212 ARG B C   1 
ATOM   5349 O  O   . ARG B 1 190 ? 23.880 19.227 81.121  1.00 25.76 ? 212 ARG B O   1 
ATOM   5350 C  CB  . ARG B 1 190 ? 21.806 18.578 78.731  1.00 25.86 ? 212 ARG B CB  1 
ATOM   5351 C  CG  . ARG B 1 190 ? 20.808 19.397 77.909  1.00 29.44 ? 212 ARG B CG  1 
ATOM   5352 C  CD  . ARG B 1 190 ? 19.378 18.915 78.146  1.00 34.67 ? 212 ARG B CD  1 
ATOM   5353 N  NE  . ARG B 1 190 ? 18.403 19.527 77.244  1.00 37.38 ? 212 ARG B NE  1 
ATOM   5354 C  CZ  . ARG B 1 190 ? 17.946 18.954 76.131  1.00 39.19 ? 212 ARG B CZ  1 
ATOM   5355 N  NH1 . ARG B 1 190 ? 18.389 17.749 75.756  1.00 38.71 ? 212 ARG B NH1 1 
ATOM   5356 N  NH2 . ARG B 1 190 ? 17.046 19.590 75.381  1.00 38.73 ? 212 ARG B NH2 1 
ATOM   5357 N  N   . LEU B 1 191 ? 24.719 17.595 79.836  1.00 26.07 ? 213 LEU B N   1 
ATOM   5358 C  CA  . LEU B 1 191 ? 25.403 16.850 80.918  1.00 26.19 ? 213 LEU B CA  1 
ATOM   5359 C  C   . LEU B 1 191 ? 26.809 17.385 81.222  1.00 26.27 ? 213 LEU B C   1 
ATOM   5360 O  O   . LEU B 1 191 ? 27.418 17.022 82.236  1.00 25.40 ? 213 LEU B O   1 
ATOM   5361 C  CB  . LEU B 1 191 ? 25.503 15.363 80.515  1.00 26.11 ? 213 LEU B CB  1 
ATOM   5362 C  CG  . LEU B 1 191 ? 24.633 14.228 81.102  1.00 27.06 ? 213 LEU B CG  1 
ATOM   5363 C  CD1 . LEU B 1 191 ? 23.446 14.665 81.970  1.00 26.23 ? 213 LEU B CD1 1 
ATOM   5364 C  CD2 . LEU B 1 191 ? 24.205 13.220 80.014  1.00 26.42 ? 213 LEU B CD2 1 
ATOM   5365 N  N   . LEU B 1 192 ? 27.312 18.250 80.344  1.00 26.21 ? 214 LEU B N   1 
ATOM   5366 C  CA  . LEU B 1 192 ? 28.710 18.679 80.402  1.00 27.26 ? 214 LEU B CA  1 
ATOM   5367 C  C   . LEU B 1 192 ? 29.125 19.476 81.685  1.00 27.18 ? 214 LEU B C   1 
ATOM   5368 O  O   . LEU B 1 192 ? 30.219 19.244 82.213  1.00 26.63 ? 214 LEU B O   1 
ATOM   5369 C  CB  . LEU B 1 192 ? 29.107 19.381 79.088  1.00 27.52 ? 214 LEU B CB  1 
ATOM   5370 C  CG  . LEU B 1 192 ? 30.565 19.731 78.788  1.00 29.47 ? 214 LEU B CG  1 
ATOM   5371 C  CD1 . LEU B 1 192 ? 30.771 19.787 77.297  1.00 32.58 ? 214 LEU B CD1 1 
ATOM   5372 C  CD2 . LEU B 1 192 ? 30.971 21.075 79.393  1.00 32.57 ? 214 LEU B CD2 1 
ATOM   5373 N  N   . PRO B 1 193 ? 28.269 20.409 82.177  1.00 27.23 ? 215 PRO B N   1 
ATOM   5374 C  CA  . PRO B 1 193 ? 28.546 21.032 83.484  1.00 27.51 ? 215 PRO B CA  1 
ATOM   5375 C  C   . PRO B 1 193 ? 28.726 20.027 84.621  1.00 27.69 ? 215 PRO B C   1 
ATOM   5376 O  O   . PRO B 1 193 ? 29.774 20.003 85.249  1.00 28.15 ? 215 PRO B O   1 
ATOM   5377 C  CB  . PRO B 1 193 ? 27.301 21.897 83.746  1.00 27.34 ? 215 PRO B CB  1 
ATOM   5378 C  CG  . PRO B 1 193 ? 26.760 22.195 82.429  1.00 27.37 ? 215 PRO B CG  1 
ATOM   5379 C  CD  . PRO B 1 193 ? 27.059 20.983 81.558  1.00 27.07 ? 215 PRO B CD  1 
ATOM   5380 N  N   . LYS B 1 194 ? 27.712 19.212 84.876  1.00 28.05 ? 216 LYS B N   1 
ATOM   5381 C  CA  . LYS B 1 194 ? 27.772 18.180 85.905  1.00 28.38 ? 216 LYS B CA  1 
ATOM   5382 C  C   . LYS B 1 194 ? 28.992 17.259 85.746  1.00 27.97 ? 216 LYS B C   1 
ATOM   5383 O  O   . LYS B 1 194 ? 29.555 16.806 86.741  1.00 28.12 ? 216 LYS B O   1 
ATOM   5384 C  CB  . LYS B 1 194 ? 26.485 17.360 85.911  1.00 28.25 ? 216 LYS B CB  1 
ATOM   5385 C  CG  . LYS B 1 194 ? 25.395 17.819 86.880  1.00 32.17 ? 216 LYS B CG  1 
ATOM   5386 C  CD  . LYS B 1 194 ? 24.510 18.915 86.288  1.00 35.04 ? 216 LYS B CD  1 
ATOM   5387 C  CE  . LYS B 1 194 ? 23.343 19.260 87.210  1.00 37.59 ? 216 LYS B CE  1 
ATOM   5388 N  NZ  . LYS B 1 194 ? 22.155 18.376 86.980  1.00 37.98 ? 216 LYS B NZ  1 
ATOM   5389 N  N   . LEU B 1 195 ? 29.402 16.994 84.507  1.00 27.11 ? 217 LEU B N   1 
ATOM   5390 C  CA  . LEU B 1 195 ? 30.579 16.153 84.258  1.00 27.04 ? 217 LEU B CA  1 
ATOM   5391 C  C   . LEU B 1 195 ? 31.869 16.848 84.682  1.00 27.41 ? 217 LEU B C   1 
ATOM   5392 O  O   . LEU B 1 195 ? 32.664 16.284 85.421  1.00 26.68 ? 217 LEU B O   1 
ATOM   5393 C  CB  . LEU B 1 195 ? 30.660 15.707 82.793  1.00 26.29 ? 217 LEU B CB  1 
ATOM   5394 C  CG  . LEU B 1 195 ? 31.874 14.872 82.360  1.00 25.04 ? 217 LEU B CG  1 
ATOM   5395 C  CD1 . LEU B 1 195 ? 31.933 13.515 83.075  1.00 24.78 ? 217 LEU B CD1 1 
ATOM   5396 C  CD2 . LEU B 1 195 ? 31.845 14.672 80.891  1.00 23.51 ? 217 LEU B CD2 1 
ATOM   5397 N  N   . ALA B 1 196 ? 32.055 18.077 84.205  1.00 28.67 ? 218 ALA B N   1 
ATOM   5398 C  CA  . ALA B 1 196 ? 33.198 18.899 84.575  1.00 29.40 ? 218 ALA B CA  1 
ATOM   5399 C  C   . ALA B 1 196 ? 33.289 19.117 86.091  1.00 30.53 ? 218 ALA B C   1 
ATOM   5400 O  O   . ALA B 1 196 ? 34.388 19.148 86.648  1.00 30.44 ? 218 ALA B O   1 
ATOM   5401 C  CB  . ALA B 1 196 ? 33.141 20.231 83.849  1.00 29.16 ? 218 ALA B CB  1 
ATOM   5402 N  N   . ARG B 1 197 ? 32.140 19.268 86.746  1.00 31.74 ? 219 ARG B N   1 
ATOM   5403 C  CA  . ARG B 1 197 ? 32.105 19.516 88.181  1.00 33.63 ? 219 ARG B CA  1 
ATOM   5404 C  C   . ARG B 1 197 ? 32.309 18.229 88.972  1.00 33.91 ? 219 ARG B C   1 
ATOM   5405 O  O   . ARG B 1 197 ? 32.654 18.269 90.144  1.00 35.11 ? 219 ARG B O   1 
ATOM   5406 C  CB  . ARG B 1 197 ? 30.822 20.269 88.604  1.00 33.85 ? 219 ARG B CB  1 
ATOM   5407 C  CG  . ARG B 1 197 ? 30.599 21.589 87.823  1.00 36.48 ? 219 ARG B CG  1 
ATOM   5408 C  CD  . ARG B 1 197 ? 30.140 22.823 88.660  1.00 40.06 ? 219 ARG B CD  1 
ATOM   5409 N  NE  . ARG B 1 197 ? 28.859 22.667 89.366  1.00 43.39 ? 219 ARG B NE  1 
ATOM   5410 C  CZ  . ARG B 1 197 ? 27.666 22.462 88.796  1.00 45.29 ? 219 ARG B CZ  1 
ATOM   5411 N  NH1 . ARG B 1 197 ? 27.543 22.347 87.476  1.00 44.72 ? 219 ARG B NH1 1 
ATOM   5412 N  NH2 . ARG B 1 197 ? 26.582 22.339 89.562  1.00 45.51 ? 219 ARG B NH2 1 
ATOM   5413 N  N   . GLY B 1 198 ? 32.131 17.093 88.306  1.00 34.46 ? 220 GLY B N   1 
ATOM   5414 C  CA  . GLY B 1 198 ? 32.265 15.771 88.914  1.00 34.82 ? 220 GLY B CA  1 
ATOM   5415 C  C   . GLY B 1 198 ? 31.082 15.363 89.773  1.00 34.98 ? 220 GLY B C   1 
ATOM   5416 O  O   . GLY B 1 198 ? 31.256 14.673 90.778  1.00 35.36 ? 220 GLY B O   1 
ATOM   5417 N  N   . SER B 1 199 ? 29.876 15.759 89.374  1.00 34.68 ? 221 SER B N   1 
ATOM   5418 C  CA  . SER B 1 199 ? 28.695 15.573 90.227  1.00 34.77 ? 221 SER B CA  1 
ATOM   5419 C  C   . SER B 1 199 ? 27.590 14.681 89.657  1.00 34.21 ? 221 SER B C   1 
ATOM   5420 O  O   . SER B 1 199 ? 26.470 14.672 90.173  1.00 34.45 ? 221 SER B O   1 
ATOM   5421 C  CB  . SER B 1 199 ? 28.114 16.924 90.615  1.00 34.92 ? 221 SER B CB  1 
ATOM   5422 O  OG  . SER B 1 199 ? 27.761 17.660 89.464  1.00 36.89 ? 221 SER B OG  1 
ATOM   5423 N  N   . LEU B 1 200 ? 27.905 13.920 88.612  1.00 33.13 ? 222 LEU B N   1 
ATOM   5424 C  CA  . LEU B 1 200 ? 26.918 13.037 88.006  1.00 32.25 ? 222 LEU B CA  1 
ATOM   5425 C  C   . LEU B 1 200 ? 26.783 11.719 88.744  1.00 31.56 ? 222 LEU B C   1 
ATOM   5426 O  O   . LEU B 1 200 ? 27.773 11.131 89.190  1.00 31.46 ? 222 LEU B O   1 
ATOM   5427 C  CB  . LEU B 1 200 ? 27.259 12.744 86.545  1.00 31.73 ? 222 LEU B CB  1 
ATOM   5428 C  CG  . LEU B 1 200 ? 27.183 13.908 85.550  1.00 31.70 ? 222 LEU B CG  1 
ATOM   5429 C  CD1 . LEU B 1 200 ? 27.767 13.448 84.233  1.00 30.26 ? 222 LEU B CD1 1 
ATOM   5430 C  CD2 . LEU B 1 200 ? 25.748 14.439 85.377  1.00 29.50 ? 222 LEU B CD2 1 
ATOM   5431 N  N   . SER B 1 201 ? 25.546 11.252 88.840  1.00 30.67 ? 223 SER B N   1 
ATOM   5432 C  CA  . SER B 1 201 ? 25.262 9.910  89.311  1.00 30.25 ? 223 SER B CA  1 
ATOM   5433 C  C   . SER B 1 201 ? 25.956 8.915  88.385  1.00 29.76 ? 223 SER B C   1 
ATOM   5434 O  O   . SER B 1 201 ? 26.300 9.246  87.245  1.00 28.93 ? 223 SER B O   1 
ATOM   5435 C  CB  . SER B 1 201 ? 23.751 9.664  89.304  1.00 30.11 ? 223 SER B CB  1 
ATOM   5436 O  OG  . SER B 1 201 ? 23.260 9.618  87.974  1.00 30.01 ? 223 SER B OG  1 
ATOM   5437 N  N   . VAL B 1 202 ? 26.160 7.703  88.884  1.00 29.37 ? 224 VAL B N   1 
ATOM   5438 C  CA  . VAL B 1 202 ? 26.737 6.630  88.098  1.00 29.51 ? 224 VAL B CA  1 
ATOM   5439 C  C   . VAL B 1 202 ? 25.893 6.421  86.812  1.00 29.73 ? 224 VAL B C   1 
ATOM   5440 O  O   . VAL B 1 202 ? 26.439 6.357  85.707  1.00 29.94 ? 224 VAL B O   1 
ATOM   5441 C  CB  . VAL B 1 202 ? 26.883 5.340  88.961  1.00 29.71 ? 224 VAL B CB  1 
ATOM   5442 C  CG1 . VAL B 1 202 ? 27.518 4.214  88.175  1.00 29.32 ? 224 VAL B CG1 1 
ATOM   5443 C  CG2 . VAL B 1 202 ? 27.715 5.627  90.221  1.00 30.68 ? 224 VAL B CG2 1 
ATOM   5444 N  N   . GLY B 1 203 ? 24.570 6.346  86.965  1.00 29.34 ? 225 GLY B N   1 
ATOM   5445 C  CA  . GLY B 1 203 ? 23.652 6.234  85.832  1.00 29.19 ? 225 GLY B CA  1 
ATOM   5446 C  C   . GLY B 1 203 ? 23.815 7.317  84.776  1.00 29.24 ? 225 GLY B C   1 
ATOM   5447 O  O   . GLY B 1 203 ? 23.883 7.004  83.587  1.00 29.45 ? 225 GLY B O   1 
ATOM   5448 N  N   . ASP B 1 204 ? 23.870 8.583  85.211  1.00 28.81 ? 226 ASP B N   1 
ATOM   5449 C  CA  . ASP B 1 204 ? 24.069 9.733  84.322  1.00 28.87 ? 226 ASP B CA  1 
ATOM   5450 C  C   . ASP B 1 204 ? 25.439 9.730  83.636  1.00 28.30 ? 226 ASP B C   1 
ATOM   5451 O  O   . ASP B 1 204 ? 25.564 10.171 82.494  1.00 27.36 ? 226 ASP B O   1 
ATOM   5452 C  CB  . ASP B 1 204 ? 23.880 11.050 85.079  1.00 29.28 ? 226 ASP B CB  1 
ATOM   5453 C  CG  . ASP B 1 204 ? 22.412 11.403 85.303  1.00 30.88 ? 226 ASP B CG  1 
ATOM   5454 O  OD1 . ASP B 1 204 ? 21.534 10.740 84.727  1.00 34.84 ? 226 ASP B OD1 1 
ATOM   5455 O  OD2 . ASP B 1 204 ? 22.132 12.360 86.050  1.00 32.83 ? 226 ASP B OD2 1 
ATOM   5456 N  N   . LYS B 1 205 ? 26.452 9.245  84.352  1.00 28.12 ? 227 LYS B N   1 
ATOM   5457 C  CA  . LYS B 1 205 ? 27.790 9.075  83.803  1.00 28.25 ? 227 LYS B CA  1 
ATOM   5458 C  C   . LYS B 1 205 ? 27.791 8.045  82.696  1.00 27.91 ? 227 LYS B C   1 
ATOM   5459 O  O   . LYS B 1 205 ? 28.462 8.220  81.684  1.00 27.66 ? 227 LYS B O   1 
ATOM   5460 C  CB  . LYS B 1 205 ? 28.776 8.654  84.881  1.00 28.32 ? 227 LYS B CB  1 
ATOM   5461 C  CG  . LYS B 1 205 ? 29.286 9.786  85.725  1.00 29.02 ? 227 LYS B CG  1 
ATOM   5462 C  CD  . LYS B 1 205 ? 30.394 9.276  86.651  1.00 30.84 ? 227 LYS B CD  1 
ATOM   5463 C  CE  . LYS B 1 205 ? 30.810 10.350 87.637  1.00 31.19 ? 227 LYS B CE  1 
ATOM   5464 N  NZ  . LYS B 1 205 ? 31.678 9.771  88.707  1.00 31.90 ? 227 LYS B NZ  1 
ATOM   5465 N  N   . ASP B 1 206 ? 27.025 6.969  82.889  1.00 27.98 ? 228 ASP B N   1 
ATOM   5466 C  CA  . ASP B 1 206 ? 26.857 5.968  81.855  1.00 27.83 ? 228 ASP B CA  1 
ATOM   5467 C  C   . ASP B 1 206 ? 26.048 6.519  80.676  1.00 26.68 ? 228 ASP B C   1 
ATOM   5468 O  O   . ASP B 1 206 ? 26.286 6.141  79.534  1.00 26.93 ? 228 ASP B O   1 
ATOM   5469 C  CB  . ASP B 1 206 ? 26.173 4.724  82.421  1.00 29.03 ? 228 ASP B CB  1 
ATOM   5470 C  CG  . ASP B 1 206 ? 26.791 3.427  81.907  1.00 31.37 ? 228 ASP B CG  1 
ATOM   5471 O  OD1 . ASP B 1 206 ? 27.917 3.461  81.349  1.00 34.71 ? 228 ASP B OD1 1 
ATOM   5472 O  OD2 . ASP B 1 206 ? 26.157 2.360  82.085  1.00 35.05 ? 228 ASP B OD2 1 
ATOM   5473 N  N   . HIS B 1 207 ? 25.075 7.378  80.954  1.00 25.09 ? 229 HIS B N   1 
ATOM   5474 C  CA  . HIS B 1 207 ? 24.332 8.049  79.883  1.00 24.47 ? 229 HIS B CA  1 
ATOM   5475 C  C   . HIS B 1 207 ? 25.283 8.939  79.066  1.00 23.39 ? 229 HIS B C   1 
ATOM   5476 O  O   . HIS B 1 207 ? 25.238 8.943  77.836  1.00 23.02 ? 229 HIS B O   1 
ATOM   5477 C  CB  . HIS B 1 207 ? 23.148 8.853  80.448  1.00 24.90 ? 229 HIS B CB  1 
ATOM   5478 C  CG  . HIS B 1 207 ? 22.330 9.562  79.407  1.00 27.27 ? 229 HIS B CG  1 
ATOM   5479 N  ND1 . HIS B 1 207 ? 21.608 10.706 79.685  1.00 30.20 ? 229 HIS B ND1 1 
ATOM   5480 C  CD2 . HIS B 1 207 ? 22.120 9.295  78.093  1.00 29.01 ? 229 HIS B CD2 1 
ATOM   5481 C  CE1 . HIS B 1 207 ? 20.995 11.116 78.586  1.00 31.14 ? 229 HIS B CE1 1 
ATOM   5482 N  NE2 . HIS B 1 207 ? 21.291 10.279 77.605  1.00 31.76 ? 229 HIS B NE2 1 
ATOM   5483 N  N   . MET B 1 208 ? 26.180 9.642  79.757  1.00 22.46 ? 230 MET B N   1 
ATOM   5484 C  CA  . MET B 1 208 ? 27.138 10.503 79.090  1.00 21.50 ? 230 MET B CA  1 
ATOM   5485 C  C   . MET B 1 208 ? 28.107 9.710  78.194  1.00 21.50 ? 230 MET B C   1 
ATOM   5486 O  O   . MET B 1 208 ? 28.409 10.143 77.086  1.00 21.55 ? 230 MET B O   1 
ATOM   5487 C  CB  . MET B 1 208 ? 27.874 11.379 80.094  1.00 20.41 ? 230 MET B CB  1 
ATOM   5488 C  CG  . MET B 1 208 ? 28.883 12.357 79.469  1.00 18.79 ? 230 MET B CG  1 
ATOM   5489 S  SD  . MET B 1 208 ? 28.327 13.474 78.148  1.00 10.19 ? 230 MET B SD  1 
ATOM   5490 C  CE  . MET B 1 208 ? 28.964 14.986 78.861  1.00 17.11 ? 230 MET B CE  1 
ATOM   5491 N  N   . CYS B 1 209 ? 28.582 8.561  78.671  1.00 21.57 ? 231 CYS B N   1 
ATOM   5492 C  CA  . CYS B 1 209 ? 29.410 7.677  77.838  1.00 22.28 ? 231 CYS B CA  1 
ATOM   5493 C  C   . CYS B 1 209 ? 28.707 7.266  76.555  1.00 22.22 ? 231 CYS B C   1 
ATOM   5494 O  O   . CYS B 1 209 ? 29.332 7.257  75.491  1.00 22.28 ? 231 CYS B O   1 
ATOM   5495 C  CB  . CYS B 1 209 ? 29.871 6.423  78.594  1.00 21.95 ? 231 CYS B CB  1 
ATOM   5496 S  SG  . CYS B 1 209 ? 31.007 6.736  79.990  1.00 23.88 ? 231 CYS B SG  1 
ATOM   5497 N  N   . SER B 1 210 ? 27.421 6.928  76.656  1.00 22.47 ? 232 SER B N   1 
ATOM   5498 C  CA  . SER B 1 210 ? 26.627 6.477  75.491  1.00 23.38 ? 232 SER B CA  1 
ATOM   5499 C  C   . SER B 1 210 ? 26.495 7.560  74.437  1.00 22.79 ? 232 SER B C   1 
ATOM   5500 O  O   . SER B 1 210 ? 26.557 7.287  73.238  1.00 22.98 ? 232 SER B O   1 
ATOM   5501 C  CB  . SER B 1 210 ? 25.216 6.057  75.906  1.00 22.89 ? 232 SER B CB  1 
ATOM   5502 O  OG  . SER B 1 210 ? 25.262 5.127  76.968  1.00 28.27 ? 232 SER B OG  1 
ATOM   5503 N  N   . VAL B 1 211 ? 26.258 8.776  74.912  1.00 22.25 ? 233 VAL B N   1 
ATOM   5504 C  CA  . VAL B 1 211 ? 26.100 9.948  74.069  1.00 22.04 ? 233 VAL B CA  1 
ATOM   5505 C  C   . VAL B 1 211 ? 27.415 10.231 73.350  1.00 21.58 ? 233 VAL B C   1 
ATOM   5506 O  O   . VAL B 1 211 ? 27.426 10.464 72.153  1.00 21.52 ? 233 VAL B O   1 
ATOM   5507 C  CB  . VAL B 1 211 ? 25.647 11.167 74.920  1.00 21.69 ? 233 VAL B CB  1 
ATOM   5508 C  CG1 . VAL B 1 211 ? 25.638 12.428 74.107  1.00 23.11 ? 233 VAL B CG1 1 
ATOM   5509 C  CG2 . VAL B 1 211 ? 24.265 10.912 75.486  1.00 22.44 ? 233 VAL B CG2 1 
ATOM   5510 N  N   . LYS B 1 212 ? 28.524 10.188 74.092  1.00 22.04 ? 234 LYS B N   1 
ATOM   5511 C  CA  . LYS B 1 212 ? 29.854 10.428 73.529  1.00 21.13 ? 234 LYS B CA  1 
ATOM   5512 C  C   . LYS B 1 212 ? 30.197 9.370  72.491  1.00 21.61 ? 234 LYS B C   1 
ATOM   5513 O  O   . LYS B 1 212 ? 30.712 9.681  71.412  1.00 21.75 ? 234 LYS B O   1 
ATOM   5514 C  CB  . LYS B 1 212 ? 30.907 10.393 74.633  1.00 21.29 ? 234 LYS B CB  1 
ATOM   5515 C  CG  . LYS B 1 212 ? 31.033 11.660 75.473  1.00 21.32 ? 234 LYS B CG  1 
ATOM   5516 C  CD  . LYS B 1 212 ? 32.200 11.489 76.421  1.00 22.41 ? 234 LYS B CD  1 
ATOM   5517 C  CE  . LYS B 1 212 ? 32.370 12.683 77.323  1.00 23.06 ? 234 LYS B CE  1 
ATOM   5518 N  NZ  . LYS B 1 212 ? 33.277 12.396 78.458  1.00 20.92 ? 234 LYS B NZ  1 
ATOM   5519 N  N   . SER B 1 213 ? 29.932 8.114  72.841  1.00 21.31 ? 235 SER B N   1 
ATOM   5520 C  CA  . SER B 1 213 ? 30.168 6.989  71.951  1.00 21.87 ? 235 SER B CA  1 
ATOM   5521 C  C   . SER B 1 213 ? 29.393 7.112  70.646  1.00 21.19 ? 235 SER B C   1 
ATOM   5522 O  O   . SER B 1 213 ? 29.939 6.852  69.592  1.00 20.78 ? 235 SER B O   1 
ATOM   5523 C  CB  . SER B 1 213 ? 29.799 5.692  72.657  1.00 21.48 ? 235 SER B CB  1 
ATOM   5524 O  OG  . SER B 1 213 ? 30.776 5.430  73.634  1.00 23.46 ? 235 SER B OG  1 
ATOM   5525 N  N   . ARG B 1 214 ? 28.127 7.510  70.728  1.00 21.34 ? 236 ARG B N   1 
ATOM   5526 C  CA  . ARG B 1 214 ? 27.322 7.711  69.513  1.00 21.05 ? 236 ARG B CA  1 
ATOM   5527 C  C   . ARG B 1 214 ? 27.929 8.792  68.624  1.00 20.57 ? 236 ARG B C   1 
ATOM   5528 O  O   . ARG B 1 214 ? 28.092 8.595  67.417  1.00 20.67 ? 236 ARG B O   1 
ATOM   5529 C  CB  . ARG B 1 214 ? 25.861 8.022  69.843  1.00 21.66 ? 236 ARG B CB  1 
ATOM   5530 C  CG  . ARG B 1 214 ? 25.000 8.088  68.588  1.00 23.51 ? 236 ARG B CG  1 
ATOM   5531 C  CD  . ARG B 1 214 ? 23.542 7.718  68.836  1.00 27.42 ? 236 ARG B CD  1 
ATOM   5532 N  NE  . ARG B 1 214 ? 22.908 7.414  67.545  1.00 30.02 ? 236 ARG B NE  1 
ATOM   5533 C  CZ  . ARG B 1 214 ? 22.408 8.333  66.727  1.00 30.52 ? 236 ARG B CZ  1 
ATOM   5534 N  NH1 . ARG B 1 214 ? 22.432 9.610  67.087  1.00 33.14 ? 236 ARG B NH1 1 
ATOM   5535 N  NH2 . ARG B 1 214 ? 21.875 7.985  65.559  1.00 30.53 ? 236 ARG B NH2 1 
ATOM   5536 N  N   . LEU B 1 215 ? 28.289 9.922  69.234  1.00 20.18 ? 237 LEU B N   1 
ATOM   5537 C  CA  . LEU B 1 215 ? 28.909 11.029 68.511  1.00 19.52 ? 237 LEU B CA  1 
ATOM   5538 C  C   . LEU B 1 215 ? 30.257 10.659 67.892  1.00 19.51 ? 237 LEU B C   1 
ATOM   5539 O  O   . LEU B 1 215 ? 30.568 11.102 66.788  1.00 18.72 ? 237 LEU B O   1 
ATOM   5540 C  CB  . LEU B 1 215 ? 29.023 12.262 69.422  1.00 19.82 ? 237 LEU B CB  1 
ATOM   5541 C  CG  . LEU B 1 215 ? 27.704 13.060 69.538  1.00 20.08 ? 237 LEU B CG  1 
ATOM   5542 C  CD1 . LEU B 1 215 ? 27.715 14.007 70.729  1.00 20.99 ? 237 LEU B CD1 1 
ATOM   5543 C  CD2 . LEU B 1 215 ? 27.431 13.821 68.226  1.00 17.70 ? 237 LEU B CD2 1 
ATOM   5544 N  N   . TRP B 1 216 ? 31.042 9.831  68.594  1.00 19.31 ? 238 TRP B N   1 
ATOM   5545 C  CA  . TRP B 1 216 ? 32.344 9.400  68.080  1.00 19.67 ? 238 TRP B CA  1 
ATOM   5546 C  C   . TRP B 1 216 ? 32.179 8.478  66.879  1.00 20.13 ? 238 TRP B C   1 
ATOM   5547 O  O   . TRP B 1 216 ? 33.061 8.446  66.019  1.00 20.67 ? 238 TRP B O   1 
ATOM   5548 C  CB  . TRP B 1 216 ? 33.185 8.690  69.146  1.00 19.14 ? 238 TRP B CB  1 
ATOM   5549 C  CG  . TRP B 1 216 ? 33.526 9.526  70.370  1.00 19.53 ? 238 TRP B CG  1 
ATOM   5550 C  CD1 . TRP B 1 216 ? 33.603 10.887 70.445  1.00 19.01 ? 238 TRP B CD1 1 
ATOM   5551 C  CD2 . TRP B 1 216 ? 33.843 9.032  71.678  1.00 19.72 ? 238 TRP B CD2 1 
ATOM   5552 N  NE1 . TRP B 1 216 ? 33.938 11.276 71.719  1.00 20.55 ? 238 TRP B NE1 1 
ATOM   5553 C  CE2 . TRP B 1 216 ? 34.090 10.156 72.499  1.00 20.56 ? 238 TRP B CE2 1 
ATOM   5554 C  CE3 . TRP B 1 216 ? 33.942 7.745  72.235  1.00 18.72 ? 238 TRP B CE3 1 
ATOM   5555 C  CZ2 . TRP B 1 216 ? 34.437 10.036 73.859  1.00 18.56 ? 238 TRP B CZ2 1 
ATOM   5556 C  CZ3 . TRP B 1 216 ? 34.284 7.620  73.584  1.00 19.11 ? 238 TRP B CZ3 1 
ATOM   5557 C  CH2 . TRP B 1 216 ? 34.529 8.763  74.382  1.00 19.34 ? 238 TRP B CH2 1 
ATOM   5558 N  N   . LYS B 1 217 ? 31.081 7.711  66.854  1.00 19.68 ? 239 LYS B N   1 
ATOM   5559 C  CA  . LYS B 1 217 ? 30.704 6.914  65.684  1.00 20.17 ? 239 LYS B CA  1 
ATOM   5560 C  C   . LYS B 1 217 ? 30.244 7.799  64.527  1.00 20.08 ? 239 LYS B C   1 
ATOM   5561 O  O   . LYS B 1 217 ? 30.699 7.631  63.390  1.00 20.92 ? 239 LYS B O   1 
ATOM   5562 C  CB  . LYS B 1 217 ? 29.617 5.877  66.025  1.00 19.67 ? 239 LYS B CB  1 
ATOM   5563 C  CG  . LYS B 1 217 ? 30.106 4.620  66.770  1.00 21.44 ? 239 LYS B CG  1 
ATOM   5564 C  CD  . LYS B 1 217 ? 31.520 4.162  66.362  1.00 23.55 ? 239 LYS B CD  1 
ATOM   5565 C  CE  . LYS B 1 217 ? 31.517 3.111  65.244  1.00 27.40 ? 239 LYS B CE  1 
ATOM   5566 N  NZ  . LYS B 1 217 ? 32.857 2.425  65.117  1.00 27.96 ? 239 LYS B NZ  1 
ATOM   5567 N  N   . LEU B 1 218 ? 29.352 8.740  64.818  1.00 19.62 ? 240 LEU B N   1 
ATOM   5568 C  CA  . LEU B 1 218 ? 28.832 9.643  63.798  1.00 20.52 ? 240 LEU B CA  1 
ATOM   5569 C  C   . LEU B 1 218 ? 29.918 10.509 63.121  1.00 20.68 ? 240 LEU B C   1 
ATOM   5570 O  O   . LEU B 1 218 ? 29.854 10.744 61.907  1.00 20.89 ? 240 LEU B O   1 
ATOM   5571 C  CB  . LEU B 1 218 ? 27.714 10.499 64.402  1.00 20.59 ? 240 LEU B CB  1 
ATOM   5572 C  CG  . LEU B 1 218 ? 26.240 10.087 64.348  1.00 20.79 ? 240 LEU B CG  1 
ATOM   5573 C  CD1 . LEU B 1 218 ? 25.971 8.592  64.082  1.00 21.91 ? 240 LEU B CD1 1 
ATOM   5574 C  CD2 . LEU B 1 218 ? 25.478 10.583 65.581  1.00 18.89 ? 240 LEU B CD2 1 
ATOM   5575 N  N   . LEU B 1 219 ? 30.918 10.954 63.893  1.00 20.81 ? 241 LEU B N   1 
ATOM   5576 C  CA  . LEU B 1 219 ? 31.974 11.853 63.405  1.00 21.63 ? 241 LEU B CA  1 
ATOM   5577 C  C   . LEU B 1 219 ? 33.326 11.163 63.244  1.00 22.72 ? 241 LEU B C   1 
ATOM   5578 O  O   . LEU B 1 219 ? 34.369 11.812 63.302  1.00 22.80 ? 241 LEU B O   1 
ATOM   5579 C  CB  . LEU B 1 219 ? 32.135 13.071 64.337  1.00 21.47 ? 241 LEU B CB  1 
ATOM   5580 C  CG  . LEU B 1 219 ? 31.207 14.273 64.111  1.00 21.57 ? 241 LEU B CG  1 
ATOM   5581 C  CD1 . LEU B 1 219 ? 29.727 13.918 64.217  1.00 20.26 ? 241 LEU B CD1 1 
ATOM   5582 C  CD2 . LEU B 1 219 ? 31.572 15.436 65.053  1.00 21.61 ? 241 LEU B CD2 1 
ATOM   5583 N  N   . SER B 1 220 ? 33.315 9.851  63.045  1.00 23.70 ? 242 SER B N   1 
ATOM   5584 C  CA  . SER B 1 220 ? 34.549 9.116  62.791  1.00 24.47 ? 242 SER B CA  1 
ATOM   5585 C  C   . SER B 1 220 ? 35.163 9.597  61.472  1.00 24.71 ? 242 SER B C   1 
ATOM   5586 O  O   . SER B 1 220 ? 34.430 10.034 60.577  1.00 24.27 ? 242 SER B O   1 
ATOM   5587 C  CB  . SER B 1 220 ? 34.251 7.623  62.716  1.00 25.08 ? 242 SER B CB  1 
ATOM   5588 O  OG  . SER B 1 220 ? 33.295 7.351  61.698  1.00 26.05 ? 242 SER B OG  1 
ATOM   5589 N  N   . PRO B 1 221 ? 36.510 9.553  61.356  1.00 24.70 ? 243 PRO B N   1 
ATOM   5590 C  CA  . PRO B 1 221 ? 37.148 9.915  60.087  1.00 24.37 ? 243 PRO B CA  1 
ATOM   5591 C  C   . PRO B 1 221 ? 36.593 9.129  58.891  1.00 24.40 ? 243 PRO B C   1 
ATOM   5592 O  O   . PRO B 1 221 ? 36.358 9.709  57.843  1.00 23.45 ? 243 PRO B O   1 
ATOM   5593 C  CB  . PRO B 1 221 ? 38.625 9.582  60.336  1.00 23.76 ? 243 PRO B CB  1 
ATOM   5594 C  CG  . PRO B 1 221 ? 38.781 9.778  61.811  1.00 24.03 ? 243 PRO B CG  1 
ATOM   5595 C  CD  . PRO B 1 221 ? 37.514 9.208  62.383  1.00 24.90 ? 243 PRO B CD  1 
ATOM   5596 N  N   . ALA B 1 222 ? 36.382 7.821  59.063  1.00 25.07 ? 244 ALA B N   1 
ATOM   5597 C  CA  . ALA B 1 222 ? 35.837 6.975  58.004  1.00 25.75 ? 244 ALA B CA  1 
ATOM   5598 C  C   . ALA B 1 222 ? 34.518 7.540  57.459  1.00 26.38 ? 244 ALA B C   1 
ATOM   5599 O  O   . ALA B 1 222 ? 34.314 7.596  56.253  1.00 26.48 ? 244 ALA B O   1 
ATOM   5600 C  CB  . ALA B 1 222 ? 35.649 5.515  58.512  1.00 25.37 ? 244 ALA B CB  1 
ATOM   5601 N  N   . ARG B 1 223 ? 33.651 7.979  58.374  1.00 27.08 ? 245 ARG B N   1 
ATOM   5602 C  CA  . ARG B 1 223 ? 32.342 8.540  58.063  1.00 27.61 ? 245 ARG B CA  1 
ATOM   5603 C  C   . ARG B 1 223 ? 32.446 9.894  57.362  1.00 27.11 ? 245 ARG B C   1 
ATOM   5604 O  O   . ARG B 1 223 ? 31.725 10.161 56.409  1.00 27.43 ? 245 ARG B O   1 
ATOM   5605 C  CB  . ARG B 1 223 ? 31.556 8.676  59.369  1.00 28.38 ? 245 ARG B CB  1 
ATOM   5606 C  CG  . ARG B 1 223 ? 30.052 8.649  59.243  1.00 31.98 ? 245 ARG B CG  1 
ATOM   5607 C  CD  . ARG B 1 223 ? 29.523 7.297  58.811  1.00 35.96 ? 245 ARG B CD  1 
ATOM   5608 N  NE  . ARG B 1 223 ? 28.073 7.239  58.989  1.00 40.85 ? 245 ARG B NE  1 
ATOM   5609 C  CZ  . ARG B 1 223 ? 27.454 6.740  60.064  1.00 42.53 ? 245 ARG B CZ  1 
ATOM   5610 N  NH1 . ARG B 1 223 ? 28.149 6.228  61.079  1.00 43.93 ? 245 ARG B NH1 1 
ATOM   5611 N  NH2 . ARG B 1 223 ? 26.128 6.746  60.125  1.00 41.79 ? 245 ARG B NH2 1 
ATOM   5612 N  N   . LEU B 1 224 ? 33.351 10.741 57.837  1.00 26.62 ? 246 LEU B N   1 
ATOM   5613 C  CA  . LEU B 1 224 ? 33.575 12.071 57.261  1.00 26.27 ? 246 LEU B CA  1 
ATOM   5614 C  C   . LEU B 1 224 ? 34.268 12.024 55.894  1.00 26.10 ? 246 LEU B C   1 
ATOM   5615 O  O   . LEU B 1 224 ? 34.118 12.939 55.091  1.00 25.12 ? 246 LEU B O   1 
ATOM   5616 C  CB  . LEU B 1 224 ? 34.372 12.955 58.243  1.00 26.11 ? 246 LEU B CB  1 
ATOM   5617 C  CG  . LEU B 1 224 ? 33.820 13.189 59.664  1.00 24.93 ? 246 LEU B CG  1 
ATOM   5618 C  CD1 . LEU B 1 224 ? 34.804 13.990 60.470  1.00 23.19 ? 246 LEU B CD1 1 
ATOM   5619 C  CD2 . LEU B 1 224 ? 32.440 13.873 59.683  1.00 23.98 ? 246 LEU B CD2 1 
ATOM   5620 N  N   . ALA B 1 225 ? 35.015 10.945 55.637  1.00 26.75 ? 247 ALA B N   1 
ATOM   5621 C  CA  . ALA B 1 225 ? 35.787 10.775 54.389  1.00 26.83 ? 247 ALA B CA  1 
ATOM   5622 C  C   . ALA B 1 225 ? 34.930 10.862 53.123  1.00 27.35 ? 247 ALA B C   1 
ATOM   5623 O  O   . ALA B 1 225 ? 35.350 11.437 52.124  1.00 27.41 ? 247 ALA B O   1 
ATOM   5624 C  CB  . ALA B 1 225 ? 36.560 9.466  54.424  1.00 27.11 ? 247 ALA B CB  1 
ATOM   5625 N  N   . ARG B 1 226 ? 33.721 10.312 53.182  1.00 28.21 ? 248 ARG B N   1 
ATOM   5626 C  CA  . ARG B 1 226 ? 32.815 10.296 52.021  1.00 29.18 ? 248 ARG B CA  1 
ATOM   5627 C  C   . ARG B 1 226 ? 32.005 11.581 51.826  1.00 28.42 ? 248 ARG B C   1 
ATOM   5628 O  O   . ARG B 1 226 ? 31.283 11.717 50.842  1.00 28.75 ? 248 ARG B O   1 
ATOM   5629 C  CB  . ARG B 1 226 ? 31.892 9.065  52.032  1.00 29.55 ? 248 ARG B CB  1 
ATOM   5630 C  CG  . ARG B 1 226 ? 31.342 8.653  53.381  1.00 32.51 ? 248 ARG B CG  1 
ATOM   5631 C  CD  . ARG B 1 226 ? 31.234 7.123  53.480  1.00 38.26 ? 248 ARG B CD  1 
ATOM   5632 N  NE  . ARG B 1 226 ? 31.081 6.668  54.871  1.00 42.68 ? 248 ARG B NE  1 
ATOM   5633 C  CZ  . ARG B 1 226 ? 31.505 5.495  55.351  1.00 44.40 ? 248 ARG B CZ  1 
ATOM   5634 N  NH1 . ARG B 1 226 ? 32.126 4.618  54.559  1.00 45.16 ? 248 ARG B NH1 1 
ATOM   5635 N  NH2 . ARG B 1 226 ? 31.311 5.198  56.638  1.00 44.39 ? 248 ARG B NH2 1 
ATOM   5636 N  N   . ARG B 1 227 ? 32.145 12.528 52.749  1.00 27.48 ? 249 ARG B N   1 
ATOM   5637 C  CA  . ARG B 1 227 ? 31.346 13.743 52.703  1.00 26.25 ? 249 ARG B CA  1 
ATOM   5638 C  C   . ARG B 1 227 ? 31.949 14.732 51.730  1.00 25.68 ? 249 ARG B C   1 
ATOM   5639 O  O   . ARG B 1 227 ? 33.169 14.752 51.534  1.00 25.51 ? 249 ARG B O   1 
ATOM   5640 C  CB  . ARG B 1 227 ? 31.200 14.348 54.097  1.00 25.97 ? 249 ARG B CB  1 
ATOM   5641 C  CG  . ARG B 1 227 ? 30.538 13.398 55.083  1.00 25.66 ? 249 ARG B CG  1 
ATOM   5642 C  CD  . ARG B 1 227 ? 30.268 14.062 56.426  1.00 26.38 ? 249 ARG B CD  1 
ATOM   5643 N  NE  . ARG B 1 227 ? 29.176 15.040 56.375  1.00 24.78 ? 249 ARG B NE  1 
ATOM   5644 C  CZ  . ARG B 1 227 ? 27.886 14.732 56.259  1.00 23.59 ? 249 ARG B CZ  1 
ATOM   5645 N  NH1 . ARG B 1 227 ? 27.491 13.474 56.167  1.00 23.17 ? 249 ARG B NH1 1 
ATOM   5646 N  NH2 . ARG B 1 227 ? 26.980 15.691 56.230  1.00 25.84 ? 249 ARG B NH2 1 
ATOM   5647 N  N   . ALA B 1 228 ? 31.091 15.521 51.094  1.00 24.88 ? 250 ALA B N   1 
ATOM   5648 C  CA  . ALA B 1 228 ? 31.543 16.502 50.117  1.00 24.99 ? 250 ALA B CA  1 
ATOM   5649 C  C   . ALA B 1 228 ? 31.626 17.883 50.731  1.00 25.08 ? 250 ALA B C   1 
ATOM   5650 O  O   . ALA B 1 228 ? 30.905 18.208 51.686  1.00 24.37 ? 250 ALA B O   1 
ATOM   5651 C  CB  . ALA B 1 228 ? 30.622 16.530 48.904  1.00 25.00 ? 250 ALA B CB  1 
ATOM   5652 N  N   . HIS B 1 229 ? 32.518 18.687 50.165  1.00 24.93 ? 251 HIS B N   1 
ATOM   5653 C  CA  . HIS B 1 229 ? 32.620 20.097 50.493  1.00 25.30 ? 251 HIS B CA  1 
ATOM   5654 C  C   . HIS B 1 229 ? 33.015 20.298 51.962  1.00 24.69 ? 251 HIS B C   1 
ATOM   5655 O  O   . HIS B 1 229 ? 32.526 21.192 52.645  1.00 25.11 ? 251 HIS B O   1 
ATOM   5656 C  CB  . HIS B 1 229 ? 31.316 20.818 50.135  1.00 25.34 ? 251 HIS B CB  1 
ATOM   5657 C  CG  . HIS B 1 229 ? 31.453 22.303 50.060  1.00 27.00 ? 251 HIS B CG  1 
ATOM   5658 N  ND1 . HIS B 1 229 ? 30.438 23.158 50.419  1.00 29.17 ? 251 HIS B ND1 1 
ATOM   5659 C  CD2 . HIS B 1 229 ? 32.486 23.086 49.672  1.00 29.27 ? 251 HIS B CD2 1 
ATOM   5660 C  CE1 . HIS B 1 229 ? 30.843 24.407 50.267  1.00 30.99 ? 251 HIS B CE1 1 
ATOM   5661 N  NE2 . HIS B 1 229 ? 32.086 24.392 49.821  1.00 29.66 ? 251 HIS B NE2 1 
ATOM   5662 N  N   . ARG B 1 230 ? 33.914 19.446 52.431  1.00 24.39 ? 252 ARG B N   1 
ATOM   5663 C  CA  . ARG B 1 230 ? 34.545 19.621 53.739  1.00 23.75 ? 252 ARG B CA  1 
ATOM   5664 C  C   . ARG B 1 230 ? 35.288 20.943 53.781  1.00 22.97 ? 252 ARG B C   1 
ATOM   5665 O  O   . ARG B 1 230 ? 35.955 21.311 52.821  1.00 22.82 ? 252 ARG B O   1 
ATOM   5666 C  CB  . ARG B 1 230 ? 35.559 18.527 53.973  1.00 23.85 ? 252 ARG B CB  1 
ATOM   5667 C  CG  . ARG B 1 230 ? 35.034 17.123 54.059  1.00 25.48 ? 252 ARG B CG  1 
ATOM   5668 C  CD  . ARG B 1 230 ? 36.235 16.212 53.897  1.00 27.02 ? 252 ARG B CD  1 
ATOM   5669 N  NE  . ARG B 1 230 ? 36.212 15.099 54.828  1.00 30.12 ? 252 ARG B NE  1 
ATOM   5670 C  CZ  . ARG B 1 230 ? 37.272 14.380 55.166  1.00 28.03 ? 252 ARG B CZ  1 
ATOM   5671 N  NH1 . ARG B 1 230 ? 38.470 14.669 54.672  1.00 30.23 ? 252 ARG B NH1 1 
ATOM   5672 N  NH2 . ARG B 1 230 ? 37.129 13.386 56.015  1.00 30.75 ? 252 ARG B NH2 1 
ATOM   5673 N  N   . SER B 1 231 ? 35.187 21.652 54.898  1.00 22.39 ? 253 SER B N   1 
ATOM   5674 C  CA  . SER B 1 231 ? 35.945 22.889 55.093  1.00 21.01 ? 253 SER B CA  1 
ATOM   5675 C  C   . SER B 1 231 ? 37.463 22.635 55.073  1.00 21.09 ? 253 SER B C   1 
ATOM   5676 O  O   . SER B 1 231 ? 37.922 21.503 55.315  1.00 20.66 ? 253 SER B O   1 
ATOM   5677 C  CB  . SER B 1 231 ? 35.542 23.553 56.415  1.00 21.02 ? 253 SER B CB  1 
ATOM   5678 O  OG  . SER B 1 231 ? 35.919 22.749 57.513  1.00 19.80 ? 253 SER B OG  1 
ATOM   5679 N  N   . LYS B 1 232 ? 38.232 23.680 54.761  1.00 20.18 ? 254 LYS B N   1 
ATOM   5680 C  CA  . LYS B 1 232 ? 39.689 23.634 54.948  1.00 19.85 ? 254 LYS B CA  1 
ATOM   5681 C  C   . LYS B 1 232 ? 40.009 23.394 56.429  1.00 18.91 ? 254 LYS B C   1 
ATOM   5682 O  O   . LYS B 1 232 ? 40.944 22.657 56.765  1.00 18.59 ? 254 LYS B O   1 
ATOM   5683 C  CB  . LYS B 1 232 ? 40.330 24.937 54.449  1.00 19.97 ? 254 LYS B CB  1 
ATOM   5684 C  CG  . LYS B 1 232 ? 41.823 25.110 54.774  1.00 22.47 ? 254 LYS B CG  1 
ATOM   5685 C  CD  . LYS B 1 232 ? 42.730 24.356 53.823  1.00 24.51 ? 254 LYS B CD  1 
ATOM   5686 C  CE  . LYS B 1 232 ? 44.185 24.572 54.218  1.00 27.14 ? 254 LYS B CE  1 
ATOM   5687 N  NZ  . LYS B 1 232 ? 45.154 23.970 53.241  1.00 30.40 ? 254 LYS B NZ  1 
ATOM   5688 N  N   . TRP B 1 233 ? 39.220 24.016 57.310  1.00 17.64 ? 255 TRP B N   1 
ATOM   5689 C  CA  . TRP B 1 233 ? 39.314 23.794 58.756  1.00 16.67 ? 255 TRP B CA  1 
ATOM   5690 C  C   . TRP B 1 233 ? 39.404 22.306 59.121  1.00 16.75 ? 255 TRP B C   1 
ATOM   5691 O  O   . TRP B 1 233 ? 40.321 21.870 59.848  1.00 16.01 ? 255 TRP B O   1 
ATOM   5692 C  CB  . TRP B 1 233 ? 38.133 24.461 59.466  1.00 16.53 ? 255 TRP B CB  1 
ATOM   5693 C  CG  . TRP B 1 233 ? 38.084 24.219 60.951  1.00 16.18 ? 255 TRP B CG  1 
ATOM   5694 C  CD1 . TRP B 1 233 ? 38.731 24.930 61.919  1.00 14.99 ? 255 TRP B CD1 1 
ATOM   5695 C  CD2 . TRP B 1 233 ? 37.370 23.172 61.628  1.00 16.14 ? 255 TRP B CD2 1 
ATOM   5696 N  NE1 . TRP B 1 233 ? 38.446 24.406 63.165  1.00 15.31 ? 255 TRP B NE1 1 
ATOM   5697 C  CE2 . TRP B 1 233 ? 37.610 23.328 63.014  1.00 16.37 ? 255 TRP B CE2 1 
ATOM   5698 C  CE3 . TRP B 1 233 ? 36.544 22.123 61.201  1.00 16.34 ? 255 TRP B CE3 1 
ATOM   5699 C  CZ2 . TRP B 1 233 ? 37.057 22.465 63.972  1.00 14.76 ? 255 TRP B CZ2 1 
ATOM   5700 C  CZ3 . TRP B 1 233 ? 35.992 21.270 62.157  1.00 14.83 ? 255 TRP B CZ3 1 
ATOM   5701 C  CH2 . TRP B 1 233 ? 36.245 21.452 63.516  1.00 14.93 ? 255 TRP B CH2 1 
ATOM   5702 N  N   . LEU B 1 234 ? 38.460 21.520 58.610  1.00 17.21 ? 256 LEU B N   1 
ATOM   5703 C  CA  . LEU B 1 234 ? 38.423 20.089 58.918  1.00 18.13 ? 256 LEU B CA  1 
ATOM   5704 C  C   . LEU B 1 234 ? 39.591 19.317 58.303  1.00 19.22 ? 256 LEU B C   1 
ATOM   5705 O  O   . LEU B 1 234 ? 40.217 18.490 58.975  1.00 18.84 ? 256 LEU B O   1 
ATOM   5706 C  CB  . LEU B 1 234 ? 37.099 19.444 58.483  1.00 17.65 ? 256 LEU B CB  1 
ATOM   5707 C  CG  . LEU B 1 234 ? 37.098 17.909 58.612  1.00 17.14 ? 256 LEU B CG  1 
ATOM   5708 C  CD1 . LEU B 1 234 ? 37.248 17.501 60.065  1.00 15.38 ? 256 LEU B CD1 1 
ATOM   5709 C  CD2 . LEU B 1 234 ? 35.850 17.291 58.024  1.00 16.47 ? 256 LEU B CD2 1 
ATOM   5710 N  N   . GLU B 1 235 ? 39.861 19.580 57.026  1.00 20.60 ? 257 GLU B N   1 
ATOM   5711 C  CA  . GLU B 1 235 ? 40.910 18.875 56.291  1.00 21.96 ? 257 GLU B CA  1 
ATOM   5712 C  C   . GLU B 1 235 ? 42.295 19.086 56.880  1.00 22.58 ? 257 GLU B C   1 
ATOM   5713 O  O   . GLU B 1 235 ? 43.067 18.137 56.998  1.00 22.14 ? 257 GLU B O   1 
ATOM   5714 C  CB  . GLU B 1 235 ? 40.915 19.295 54.823  1.00 22.37 ? 257 GLU B CB  1 
ATOM   5715 C  CG  . GLU B 1 235 ? 39.559 19.126 54.171  1.00 25.85 ? 257 GLU B CG  1 
ATOM   5716 C  CD  . GLU B 1 235 ? 39.644 18.571 52.780  1.00 31.35 ? 257 GLU B CD  1 
ATOM   5717 O  OE1 . GLU B 1 235 ? 40.314 19.201 51.930  1.00 35.27 ? 257 GLU B OE1 1 
ATOM   5718 O  OE2 . GLU B 1 235 ? 39.021 17.518 52.523  1.00 33.32 ? 257 GLU B OE2 1 
ATOM   5719 N  N   . SER B 1 236 ? 42.617 20.334 57.226  1.00 22.97 ? 258 SER B N   1 
ATOM   5720 C  CA  . SER B 1 236 ? 43.922 20.609 57.808  1.00 23.87 ? 258 SER B CA  1 
ATOM   5721 C  C   . SER B 1 236 ? 44.018 20.102 59.245  1.00 23.15 ? 258 SER B C   1 
ATOM   5722 O  O   . SER B 1 236 ? 45.091 19.691 59.683  1.00 23.44 ? 258 SER B O   1 
ATOM   5723 C  CB  . SER B 1 236 ? 44.293 22.083 57.686  1.00 23.85 ? 258 SER B CB  1 
ATOM   5724 O  OG  . SER B 1 236 ? 43.226 22.887 58.136  1.00 28.26 ? 258 SER B OG  1 
ATOM   5725 N  N   . TYR B 1 237 ? 42.900 20.086 59.964  1.00 22.71 ? 259 TYR B N   1 
ATOM   5726 C  CA  . TYR B 1 237 ? 42.897 19.552 61.322  1.00 23.00 ? 259 TYR B CA  1 
ATOM   5727 C  C   . TYR B 1 237 ? 43.116 18.036 61.315  1.00 23.72 ? 259 TYR B C   1 
ATOM   5728 O  O   . TYR B 1 237 ? 43.962 17.527 62.065  1.00 23.58 ? 259 TYR B O   1 
ATOM   5729 C  CB  . TYR B 1 237 ? 41.640 19.965 62.098  1.00 22.52 ? 259 TYR B CB  1 
ATOM   5730 C  CG  . TYR B 1 237 ? 41.624 19.514 63.542  1.00 23.34 ? 259 TYR B CG  1 
ATOM   5731 C  CD1 . TYR B 1 237 ? 42.589 19.963 64.453  1.00 22.70 ? 259 TYR B CD1 1 
ATOM   5732 C  CD2 . TYR B 1 237 ? 40.646 18.636 64.004  1.00 22.24 ? 259 TYR B CD2 1 
ATOM   5733 C  CE1 . TYR B 1 237 ? 42.574 19.541 65.780  1.00 23.69 ? 259 TYR B CE1 1 
ATOM   5734 C  CE2 . TYR B 1 237 ? 40.631 18.214 65.324  1.00 21.88 ? 259 TYR B CE2 1 
ATOM   5735 C  CZ  . TYR B 1 237 ? 41.580 18.668 66.210  1.00 22.22 ? 259 TYR B CZ  1 
ATOM   5736 O  OH  . TYR B 1 237 ? 41.547 18.224 67.528  1.00 22.64 ? 259 TYR B OH  1 
ATOM   5737 N  N   . LEU B 1 238 ? 42.377 17.333 60.456  1.00 24.15 ? 260 LEU B N   1 
ATOM   5738 C  CA  . LEU B 1 238 ? 42.639 15.920 60.132  1.00 25.50 ? 260 LEU B CA  1 
ATOM   5739 C  C   . LEU B 1 238 ? 44.120 15.633 59.773  1.00 26.53 ? 260 LEU B C   1 
ATOM   5740 O  O   . LEU B 1 238 ? 44.742 14.709 60.314  1.00 26.35 ? 260 LEU B O   1 
ATOM   5741 C  CB  . LEU B 1 238 ? 41.720 15.454 58.991  1.00 24.80 ? 260 LEU B CB  1 
ATOM   5742 C  CG  . LEU B 1 238 ? 40.241 15.154 59.308  1.00 26.42 ? 260 LEU B CG  1 
ATOM   5743 C  CD1 . LEU B 1 238 ? 39.428 14.914 58.039  1.00 27.50 ? 260 LEU B CD1 1 
ATOM   5744 C  CD2 . LEU B 1 238 ? 40.118 13.956 60.232  1.00 27.61 ? 260 LEU B CD2 1 
ATOM   5745 N  N   . LEU B 1 239 ? 44.660 16.429 58.853  1.00 27.58 ? 261 LEU B N   1 
ATOM   5746 C  CA  . LEU B 1 239 ? 46.046 16.324 58.434  1.00 28.97 ? 261 LEU B CA  1 
ATOM   5747 C  C   . LEU B 1 239 ? 46.979 16.518 59.616  1.00 29.19 ? 261 LEU B C   1 
ATOM   5748 O  O   . LEU B 1 239 ? 47.888 15.722 59.835  1.00 29.38 ? 261 LEU B O   1 
ATOM   5749 C  CB  . LEU B 1 239 ? 46.334 17.344 57.324  1.00 29.18 ? 261 LEU B CB  1 
ATOM   5750 C  CG  . LEU B 1 239 ? 47.314 17.017 56.180  1.00 31.23 ? 261 LEU B CG  1 
ATOM   5751 C  CD1 . LEU B 1 239 ? 48.570 17.888 56.231  1.00 31.53 ? 261 LEU B CD1 1 
ATOM   5752 C  CD2 . LEU B 1 239 ? 47.668 15.523 56.112  1.00 33.14 ? 261 LEU B CD2 1 
ATOM   5753 N  N   . HIS B 1 240 ? 46.727 17.555 60.406  1.00 29.53 ? 262 HIS B N   1 
ATOM   5754 C  CA  . HIS B 1 240 ? 47.477 17.779 61.636  1.00 29.84 ? 262 HIS B CA  1 
ATOM   5755 C  C   . HIS B 1 240 ? 47.450 16.592 62.626  1.00 30.41 ? 262 HIS B C   1 
ATOM   5756 O  O   . HIS B 1 240 ? 48.471 16.273 63.245  1.00 30.32 ? 262 HIS B O   1 
ATOM   5757 C  CB  . HIS B 1 240 ? 46.975 19.052 62.298  1.00 29.69 ? 262 HIS B CB  1 
ATOM   5758 C  CG  . HIS B 1 240 ? 47.355 19.179 63.735  1.00 30.00 ? 262 HIS B CG  1 
ATOM   5759 N  ND1 . HIS B 1 240 ? 48.649 19.402 64.145  1.00 30.21 ? 262 HIS B ND1 1 
ATOM   5760 C  CD2 . HIS B 1 240 ? 46.603 19.135 64.859  1.00 30.23 ? 262 HIS B CD2 1 
ATOM   5761 C  CE1 . HIS B 1 240 ? 48.678 19.492 65.462  1.00 30.49 ? 262 HIS B CE1 1 
ATOM   5762 N  NE2 . HIS B 1 240 ? 47.448 19.335 65.920  1.00 29.03 ? 262 HIS B NE2 1 
ATOM   5763 N  N   . LEU B 1 241 ? 46.294 15.944 62.774  1.00 30.67 ? 263 LEU B N   1 
ATOM   5764 C  CA  . LEU B 1 241 ? 46.155 14.808 63.701  1.00 31.59 ? 263 LEU B CA  1 
ATOM   5765 C  C   . LEU B 1 241 ? 46.882 13.559 63.190  1.00 32.29 ? 263 LEU B C   1 
ATOM   5766 O  O   . LEU B 1 241 ? 47.611 12.915 63.945  1.00 32.28 ? 263 LEU B O   1 
ATOM   5767 C  CB  . LEU B 1 241 ? 44.680 14.476 63.967  1.00 30.94 ? 263 LEU B CB  1 
ATOM   5768 C  CG  . LEU B 1 241 ? 43.792 15.489 64.703  1.00 30.61 ? 263 LEU B CG  1 
ATOM   5769 C  CD1 . LEU B 1 241 ? 42.339 15.126 64.494  1.00 30.54 ? 263 LEU B CD1 1 
ATOM   5770 C  CD2 . LEU B 1 241 ? 44.103 15.597 66.203  1.00 28.50 ? 263 LEU B CD2 1 
ATOM   5771 N  N   . GLU B 1 242 ? 46.688 13.227 61.914  1.00 33.29 ? 264 GLU B N   1 
ATOM   5772 C  CA  . GLU B 1 242 ? 47.342 12.042 61.333  1.00 34.79 ? 264 GLU B CA  1 
ATOM   5773 C  C   . GLU B 1 242 ? 48.872 12.179 61.228  1.00 34.67 ? 264 GLU B C   1 
ATOM   5774 O  O   . GLU B 1 242 ? 49.583 11.178 61.248  1.00 35.07 ? 264 GLU B O   1 
ATOM   5775 C  CB  . GLU B 1 242 ? 46.681 11.590 60.008  1.00 35.02 ? 264 GLU B CB  1 
ATOM   5776 C  CG  . GLU B 1 242 ? 46.740 12.564 58.843  1.00 37.72 ? 264 GLU B CG  1 
ATOM   5777 C  CD  . GLU B 1 242 ? 45.647 12.315 57.787  1.00 40.67 ? 264 GLU B CD  1 
ATOM   5778 O  OE1 . GLU B 1 242 ? 44.442 12.279 58.140  1.00 42.72 ? 264 GLU B OE1 1 
ATOM   5779 O  OE2 . GLU B 1 242 ? 45.994 12.170 56.593  1.00 42.67 ? 264 GLU B OE2 1 
ATOM   5780 N  N   . GLU B 1 243 ? 49.363 13.418 61.153  1.00 34.81 ? 265 GLU B N   1 
ATOM   5781 C  CA  . GLU B 1 243 ? 50.798 13.701 61.213  1.00 34.86 ? 265 GLU B CA  1 
ATOM   5782 C  C   . GLU B 1 243 ? 51.405 13.441 62.600  1.00 34.07 ? 265 GLU B C   1 
ATOM   5783 O  O   . GLU B 1 243 ? 52.597 13.154 62.715  1.00 33.57 ? 265 GLU B O   1 
ATOM   5784 C  CB  . GLU B 1 243 ? 51.074 15.140 60.810  1.00 35.65 ? 265 GLU B CB  1 
ATOM   5785 C  CG  . GLU B 1 243 ? 51.038 15.398 59.314  1.00 38.60 ? 265 GLU B CG  1 
ATOM   5786 C  CD  . GLU B 1 243 ? 51.372 16.841 58.975  1.00 43.37 ? 265 GLU B CD  1 
ATOM   5787 O  OE1 . GLU B 1 243 ? 51.524 17.662 59.921  1.00 44.55 ? 265 GLU B OE1 1 
ATOM   5788 O  OE2 . GLU B 1 243 ? 51.487 17.149 57.763  1.00 44.72 ? 265 GLU B OE2 1 
ATOM   5789 N  N   . MET B 1 244 ? 50.574 13.557 63.640  1.00 33.15 ? 266 MET B N   1 
ATOM   5790 C  CA  . MET B 1 244 ? 50.956 13.218 65.012  1.00 32.04 ? 266 MET B CA  1 
ATOM   5791 C  C   . MET B 1 244 ? 50.831 11.710 65.304  1.00 32.06 ? 266 MET B C   1 
ATOM   5792 O  O   . MET B 1 244 ? 51.236 11.251 66.368  1.00 32.37 ? 266 MET B O   1 
ATOM   5793 C  CB  . MET B 1 244 ? 50.121 14.024 66.019  1.00 31.37 ? 266 MET B CB  1 
ATOM   5794 C  CG  . MET B 1 244 ? 50.460 15.508 66.080  1.00 29.73 ? 266 MET B CG  1 
ATOM   5795 S  SD  . MET B 1 244 ? 49.829 16.367 67.536  1.00 23.40 ? 266 MET B SD  1 
ATOM   5796 C  CE  . MET B 1 244 ? 48.071 16.308 67.194  1.00 26.90 ? 266 MET B CE  1 
ATOM   5797 N  N   . GLY B 1 245 ? 50.272 10.948 64.367  1.00 31.49 ? 267 GLY B N   1 
ATOM   5798 C  CA  . GLY B 1 245 ? 50.044 9.519  64.581  1.00 31.44 ? 267 GLY B CA  1 
ATOM   5799 C  C   . GLY B 1 245 ? 48.826 9.202  65.441  1.00 31.34 ? 267 GLY B C   1 
ATOM   5800 O  O   . GLY B 1 245 ? 48.755 8.136  66.069  1.00 32.06 ? 267 GLY B O   1 
ATOM   5801 N  N   . VAL B 1 246 ? 47.867 10.126 65.472  1.00 30.48 ? 268 VAL B N   1 
ATOM   5802 C  CA  . VAL B 1 246 ? 46.629 9.940  66.225  1.00 29.76 ? 268 VAL B CA  1 
ATOM   5803 C  C   . VAL B 1 246 ? 45.771 8.865  65.548  1.00 29.31 ? 268 VAL B C   1 
ATOM   5804 O  O   . VAL B 1 246 ? 45.494 8.940  64.345  1.00 29.45 ? 268 VAL B O   1 
ATOM   5805 C  CB  . VAL B 1 246 ? 45.863 11.288 66.417  1.00 29.56 ? 268 VAL B CB  1 
ATOM   5806 C  CG1 . VAL B 1 246 ? 44.624 11.086 67.249  1.00 29.35 ? 268 VAL B CG1 1 
ATOM   5807 C  CG2 . VAL B 1 246 ? 46.766 12.321 67.116  1.00 28.91 ? 268 VAL B CG2 1 
ATOM   5808 N  N   . SER B 1 247 ? 45.405 7.837  66.317  1.00 29.00 ? 269 SER B N   1 
ATOM   5809 C  CA  . SER B 1 247 ? 44.541 6.760  65.832  1.00 28.48 ? 269 SER B CA  1 
ATOM   5810 C  C   . SER B 1 247 ? 43.210 7.350  65.366  1.00 28.61 ? 269 SER B C   1 
ATOM   5811 O  O   . SER B 1 247 ? 42.822 8.432  65.801  1.00 27.99 ? 269 SER B O   1 
ATOM   5812 C  CB  . SER B 1 247 ? 44.282 5.745  66.939  1.00 28.18 ? 269 SER B CB  1 
ATOM   5813 O  OG  . SER B 1 247 ? 43.523 6.325  67.991  1.00 27.65 ? 269 SER B OG  1 
ATOM   5814 N  N   . GLU B 1 248 ? 42.509 6.640  64.491  1.00 29.02 ? 270 GLU B N   1 
ATOM   5815 C  CA  . GLU B 1 248 ? 41.232 7.139  64.008  1.00 29.51 ? 270 GLU B CA  1 
ATOM   5816 C  C   . GLU B 1 248 ? 40.179 7.101  65.119  1.00 28.97 ? 270 GLU B C   1 
ATOM   5817 O  O   . GLU B 1 248 ? 39.200 7.831  65.064  1.00 29.63 ? 270 GLU B O   1 
ATOM   5818 C  CB  . GLU B 1 248 ? 40.795 6.418  62.723  1.00 30.08 ? 270 GLU B CB  1 
ATOM   5819 C  CG  . GLU B 1 248 ? 41.660 6.839  61.512  1.00 32.31 ? 270 GLU B CG  1 
ATOM   5820 C  CD  . GLU B 1 248 ? 41.105 6.419  60.151  1.00 36.40 ? 270 GLU B CD  1 
ATOM   5821 O  OE1 . GLU B 1 248 ? 39.971 5.879  60.073  1.00 38.37 ? 270 GLU B OE1 1 
ATOM   5822 O  OE2 . GLU B 1 248 ? 41.816 6.636  59.144  1.00 37.51 ? 270 GLU B OE2 1 
ATOM   5823 N  N   . GLU B 1 249 ? 40.412 6.279  66.141  1.00 28.04 ? 271 GLU B N   1 
ATOM   5824 C  CA  . GLU B 1 249 ? 39.560 6.242  67.327  1.00 27.39 ? 271 GLU B CA  1 
ATOM   5825 C  C   . GLU B 1 249 ? 39.672 7.535  68.110  1.00 26.17 ? 271 GLU B C   1 
ATOM   5826 O  O   . GLU B 1 249 ? 38.670 8.123  68.515  1.00 25.82 ? 271 GLU B O   1 
ATOM   5827 C  CB  . GLU B 1 249 ? 39.960 5.081  68.245  1.00 27.78 ? 271 GLU B CB  1 
ATOM   5828 C  CG  . GLU B 1 249 ? 39.115 3.844  68.056  1.00 31.11 ? 271 GLU B CG  1 
ATOM   5829 C  CD  . GLU B 1 249 ? 38.813 3.120  69.357  1.00 33.98 ? 271 GLU B CD  1 
ATOM   5830 O  OE1 . GLU B 1 249 ? 38.311 3.757  70.316  1.00 34.42 ? 271 GLU B OE1 1 
ATOM   5831 O  OE2 . GLU B 1 249 ? 39.055 1.895  69.405  1.00 36.71 ? 271 GLU B OE2 1 
ATOM   5832 N  N   . MET B 1 250 ? 40.914 7.960  68.331  1.00 24.99 ? 272 MET B N   1 
ATOM   5833 C  CA  . MET B 1 250 ? 41.178 9.175  69.065  1.00 23.67 ? 272 MET B CA  1 
ATOM   5834 C  C   . MET B 1 250 ? 40.811 10.395 68.227  1.00 23.17 ? 272 MET B C   1 
ATOM   5835 O  O   . MET B 1 250 ? 40.292 11.366 68.758  1.00 23.32 ? 272 MET B O   1 
ATOM   5836 C  CB  . MET B 1 250 ? 42.638 9.222  69.549  1.00 22.96 ? 272 MET B CB  1 
ATOM   5837 C  CG  . MET B 1 250 ? 42.903 10.313 70.568  1.00 20.81 ? 272 MET B CG  1 
ATOM   5838 S  SD  . MET B 1 250 ? 41.860 10.330 72.043  1.00 15.34 ? 272 MET B SD  1 
ATOM   5839 C  CE  . MET B 1 250 ? 42.212 8.719  72.710  1.00 22.49 ? 272 MET B CE  1 
ATOM   5840 N  N   . GLN B 1 251 ? 41.064 10.326 66.919  1.00 22.82 ? 273 GLN B N   1 
ATOM   5841 C  CA  . GLN B 1 251 ? 40.682 11.394 66.001  1.00 22.56 ? 273 GLN B CA  1 
ATOM   5842 C  C   . GLN B 1 251 ? 39.175 11.693 66.144  1.00 21.62 ? 273 GLN B C   1 
ATOM   5843 O  O   . GLN B 1 251 ? 38.782 12.849 66.266  1.00 20.81 ? 273 GLN B O   1 
ATOM   5844 C  CB  . GLN B 1 251 ? 41.053 11.033 64.561  1.00 22.51 ? 273 GLN B CB  1 
ATOM   5845 C  CG  . GLN B 1 251 ? 42.538 11.206 64.233  1.00 23.99 ? 273 GLN B CG  1 
ATOM   5846 C  CD  . GLN B 1 251 ? 42.858 10.957 62.757  1.00 26.68 ? 273 GLN B CD  1 
ATOM   5847 O  OE1 . GLN B 1 251 ? 42.184 11.484 61.867  1.00 26.62 ? 273 GLN B OE1 1 
ATOM   5848 N  NE2 . GLN B 1 251 ? 43.900 10.153 62.496  1.00 24.77 ? 273 GLN B NE2 1 
ATOM   5849 N  N   . ALA B 1 252 ? 38.360 10.635 66.168  1.00 20.66 ? 274 ALA B N   1 
ATOM   5850 C  CA  . ALA B 1 252 ? 36.904 10.744 66.345  1.00 20.02 ? 274 ALA B CA  1 
ATOM   5851 C  C   . ALA B 1 252 ? 36.558 11.571 67.579  1.00 19.50 ? 274 ALA B C   1 
ATOM   5852 O  O   . ALA B 1 252 ? 35.696 12.450 67.514  1.00 19.22 ? 274 ALA B O   1 
ATOM   5853 C  CB  . ALA B 1 252 ? 36.267 9.354  66.440  1.00 19.34 ? 274 ALA B CB  1 
ATOM   5854 N  N   . ARG B 1 253 ? 37.248 11.285 68.690  1.00 18.26 ? 275 ARG B N   1 
ATOM   5855 C  CA  . ARG B 1 253 ? 37.068 12.003 69.938  1.00 17.32 ? 275 ARG B CA  1 
ATOM   5856 C  C   . ARG B 1 253 ? 37.527 13.472 69.824  1.00 16.67 ? 275 ARG B C   1 
ATOM   5857 O  O   . ARG B 1 253 ? 36.888 14.360 70.363  1.00 16.66 ? 275 ARG B O   1 
ATOM   5858 C  CB  . ARG B 1 253 ? 37.806 11.297 71.086  1.00 17.41 ? 275 ARG B CB  1 
ATOM   5859 C  CG  . ARG B 1 253 ? 37.471 9.807  71.314  1.00 16.04 ? 275 ARG B CG  1 
ATOM   5860 C  CD  . ARG B 1 253 ? 37.998 9.383  72.679  1.00 18.50 ? 275 ARG B CD  1 
ATOM   5861 N  NE  . ARG B 1 253 ? 37.697 7.989  73.013  1.00 19.25 ? 275 ARG B NE  1 
ATOM   5862 C  CZ  . ARG B 1 253 ? 38.182 7.347  74.075  1.00 21.12 ? 275 ARG B CZ  1 
ATOM   5863 N  NH1 . ARG B 1 253 ? 39.008 7.964  74.919  1.00 20.46 ? 275 ARG B NH1 1 
ATOM   5864 N  NH2 . ARG B 1 253 ? 37.853 6.075  74.283  1.00 21.90 ? 275 ARG B NH2 1 
ATOM   5865 N  N   . ALA B 1 254 ? 38.644 13.712 69.157  1.00 16.49 ? 276 ALA B N   1 
ATOM   5866 C  CA  . ALA B 1 254 ? 39.111 15.080 68.908  1.00 16.62 ? 276 ALA B CA  1 
ATOM   5867 C  C   . ALA B 1 254 ? 38.118 15.870 68.042  1.00 16.70 ? 276 ALA B C   1 
ATOM   5868 O  O   . ALA B 1 254 ? 37.962 17.076 68.208  1.00 16.24 ? 276 ALA B O   1 
ATOM   5869 C  CB  . ALA B 1 254 ? 40.481 15.066 68.272  1.00 16.24 ? 276 ALA B CB  1 
ATOM   5870 N  N   . LEU B 1 255 ? 37.444 15.177 67.128  1.00 16.94 ? 277 LEU B N   1 
ATOM   5871 C  CA  . LEU B 1 255 ? 36.459 15.805 66.229  1.00 17.20 ? 277 LEU B CA  1 
ATOM   5872 C  C   . LEU B 1 255 ? 35.146 16.154 66.919  1.00 17.72 ? 277 LEU B C   1 
ATOM   5873 O  O   . LEU B 1 255 ? 34.454 17.100 66.514  1.00 18.71 ? 277 LEU B O   1 
ATOM   5874 C  CB  . LEU B 1 255 ? 36.190 14.904 65.026  1.00 17.21 ? 277 LEU B CB  1 
ATOM   5875 C  CG  . LEU B 1 255 ? 37.388 14.733 64.080  1.00 17.56 ? 277 LEU B CG  1 
ATOM   5876 C  CD1 . LEU B 1 255 ? 37.185 13.591 63.093  1.00 18.86 ? 277 LEU B CD1 1 
ATOM   5877 C  CD2 . LEU B 1 255 ? 37.669 16.030 63.333  1.00 17.57 ? 277 LEU B CD2 1 
ATOM   5878 N  N   . VAL B 1 256 ? 34.810 15.395 67.957  1.00 17.19 ? 278 VAL B N   1 
ATOM   5879 C  CA  . VAL B 1 256 ? 33.628 15.657 68.761  1.00 17.05 ? 278 VAL B CA  1 
ATOM   5880 C  C   . VAL B 1 256 ? 33.885 16.776 69.770  1.00 16.87 ? 278 VAL B C   1 
ATOM   5881 O  O   . VAL B 1 256 ? 32.997 17.584 70.020  1.00 15.76 ? 278 VAL B O   1 
ATOM   5882 C  CB  . VAL B 1 256 ? 33.119 14.362 69.423  1.00 16.73 ? 278 VAL B CB  1 
ATOM   5883 C  CG1 . VAL B 1 256 ? 32.048 14.649 70.461  1.00 16.81 ? 278 VAL B CG1 1 
ATOM   5884 C  CG2 . VAL B 1 256 ? 32.609 13.410 68.345  1.00 16.11 ? 278 VAL B CG2 1 
ATOM   5885 N  N   . LEU B 1 257 ? 35.102 16.833 70.315  1.00 16.95 ? 279 LEU B N   1 
ATOM   5886 C  CA  . LEU B 1 257 ? 35.535 17.989 71.094  1.00 18.00 ? 279 LEU B CA  1 
ATOM   5887 C  C   . LEU B 1 257 ? 35.426 19.250 70.240  1.00 18.09 ? 279 LEU B C   1 
ATOM   5888 O  O   . LEU B 1 257 ? 34.867 20.257 70.673  1.00 18.34 ? 279 LEU B O   1 
ATOM   5889 C  CB  . LEU B 1 257 ? 36.982 17.823 71.584  1.00 18.48 ? 279 LEU B CB  1 
ATOM   5890 C  CG  . LEU B 1 257 ? 37.811 19.060 72.016  1.00 19.20 ? 279 LEU B CG  1 
ATOM   5891 C  CD1 . LEU B 1 257 ? 37.193 19.844 73.156  1.00 20.39 ? 279 LEU B CD1 1 
ATOM   5892 C  CD2 . LEU B 1 257 ? 39.213 18.647 72.382  1.00 19.85 ? 279 LEU B CD2 1 
ATOM   5893 N  N   . GLN B 1 258 ? 35.966 19.195 69.029  1.00 18.03 ? 280 GLN B N   1 
ATOM   5894 C  CA  . GLN B 1 258 ? 35.867 20.343 68.123  1.00 18.85 ? 280 GLN B CA  1 
ATOM   5895 C  C   . GLN B 1 258 ? 34.408 20.711 67.816  1.00 18.37 ? 280 GLN B C   1 
ATOM   5896 O  O   . GLN B 1 258 ? 34.081 21.882 67.695  1.00 17.81 ? 280 GLN B O   1 
ATOM   5897 C  CB  . GLN B 1 258 ? 36.676 20.119 66.843  1.00 19.35 ? 280 GLN B CB  1 
ATOM   5898 C  CG  . GLN B 1 258 ? 38.188 20.180 67.030  1.00 20.58 ? 280 GLN B CG  1 
ATOM   5899 C  CD  . GLN B 1 258 ? 38.662 21.440 67.776  1.00 23.58 ? 280 GLN B CD  1 
ATOM   5900 O  OE1 . GLN B 1 258 ? 38.158 22.549 67.558  1.00 23.75 ? 280 GLN B OE1 1 
ATOM   5901 N  NE2 . GLN B 1 258 ? 39.647 21.264 68.650  1.00 24.43 ? 280 GLN B NE2 1 
ATOM   5902 N  N   . LEU B 1 259 ? 33.526 19.716 67.752  1.00 18.20 ? 281 LEU B N   1 
ATOM   5903 C  CA  . LEU B 1 259 ? 32.122 19.984 67.500  1.00 18.49 ? 281 LEU B CA  1 
ATOM   5904 C  C   . LEU B 1 259 ? 31.544 20.842 68.626  1.00 18.55 ? 281 LEU B C   1 
ATOM   5905 O  O   . LEU B 1 259 ? 30.779 21.793 68.386  1.00 18.11 ? 281 LEU B O   1 
ATOM   5906 C  CB  . LEU B 1 259 ? 31.318 18.683 67.349  1.00 18.27 ? 281 LEU B CB  1 
ATOM   5907 C  CG  . LEU B 1 259 ? 29.823 18.915 67.049  1.00 19.70 ? 281 LEU B CG  1 
ATOM   5908 C  CD1 . LEU B 1 259 ? 29.644 19.509 65.637  1.00 18.27 ? 281 LEU B CD1 1 
ATOM   5909 C  CD2 . LEU B 1 259 ? 29.005 17.623 67.193  1.00 20.54 ? 281 LEU B CD2 1 
ATOM   5910 N  N   . TRP B 1 260 ? 31.901 20.500 69.861  1.00 18.37 ? 282 TRP B N   1 
ATOM   5911 C  CA  . TRP B 1 260 ? 31.476 21.301 70.995  1.00 18.07 ? 282 TRP B CA  1 
ATOM   5912 C  C   . TRP B 1 260 ? 32.147 22.683 71.019  1.00 17.53 ? 282 TRP B C   1 
ATOM   5913 O  O   . TRP B 1 260 ? 31.484 23.700 71.276  1.00 16.64 ? 282 TRP B O   1 
ATOM   5914 C  CB  . TRP B 1 260 ? 31.717 20.565 72.312  1.00 19.68 ? 282 TRP B CB  1 
ATOM   5915 C  CG  . TRP B 1 260 ? 31.215 21.377 73.450  1.00 21.07 ? 282 TRP B CG  1 
ATOM   5916 C  CD1 . TRP B 1 260 ? 29.931 21.444 73.907  1.00 22.51 ? 282 TRP B CD1 1 
ATOM   5917 C  CD2 . TRP B 1 260 ? 31.969 22.306 74.225  1.00 22.27 ? 282 TRP B CD2 1 
ATOM   5918 N  NE1 . TRP B 1 260 ? 29.850 22.331 74.945  1.00 23.44 ? 282 TRP B NE1 1 
ATOM   5919 C  CE2 . TRP B 1 260 ? 31.088 22.886 75.149  1.00 22.87 ? 282 TRP B CE2 1 
ATOM   5920 C  CE3 . TRP B 1 260 ? 33.316 22.709 74.223  1.00 23.03 ? 282 TRP B CE3 1 
ATOM   5921 C  CZ2 . TRP B 1 260 ? 31.506 23.835 76.081  1.00 23.21 ? 282 TRP B CZ2 1 
ATOM   5922 C  CZ3 . TRP B 1 260 ? 33.727 23.647 75.152  1.00 22.67 ? 282 TRP B CZ3 1 
ATOM   5923 C  CH2 . TRP B 1 260 ? 32.829 24.196 76.065  1.00 21.86 ? 282 TRP B CH2 1 
ATOM   5924 N  N   . ALA B 1 261 ? 33.447 22.707 70.729  1.00 16.71 ? 283 ALA B N   1 
ATOM   5925 C  CA  . ALA B 1 261 ? 34.264 23.924 70.786  1.00 17.27 ? 283 ALA B CA  1 
ATOM   5926 C  C   . ALA B 1 261 ? 33.789 24.961 69.767  1.00 17.71 ? 283 ALA B C   1 
ATOM   5927 O  O   . ALA B 1 261 ? 33.904 26.160 69.955  1.00 18.86 ? 283 ALA B O   1 
ATOM   5928 C  CB  . ALA B 1 261 ? 35.738 23.571 70.540  1.00 17.16 ? 283 ALA B CB  1 
ATOM   5929 N  N   . THR B 1 262 ? 33.156 24.458 68.729  1.00 18.14 ? 284 THR B N   1 
ATOM   5930 C  CA  . THR B 1 262 ? 32.829 25.191 67.546  1.00 18.20 ? 284 THR B CA  1 
ATOM   5931 C  C   . THR B 1 262 ? 31.296 25.450 67.427  1.00 18.47 ? 284 THR B C   1 
ATOM   5932 O  O   . THR B 1 262 ? 30.861 26.433 66.815  1.00 18.14 ? 284 THR B O   1 
ATOM   5933 C  CB  . THR B 1 262 ? 33.423 24.346 66.420  1.00 18.69 ? 284 THR B CB  1 
ATOM   5934 O  OG1 . THR B 1 262 ? 34.297 25.119 65.607  1.00 22.15 ? 284 THR B OG1 1 
ATOM   5935 C  CG2 . THR B 1 262 ? 32.418 23.524 65.647  1.00 14.64 ? 284 THR B CG2 1 
ATOM   5936 N  N   . GLN B 1 263 ? 30.488 24.591 68.041  1.00 17.88 ? 285 GLN B N   1 
ATOM   5937 C  CA  . GLN B 1 263 ? 29.025 24.710 67.937  1.00 17.66 ? 285 GLN B CA  1 
ATOM   5938 C  C   . GLN B 1 263 ? 28.293 24.961 69.258  1.00 17.43 ? 285 GLN B C   1 
ATOM   5939 O  O   . GLN B 1 263 ? 27.083 25.240 69.248  1.00 17.85 ? 285 GLN B O   1 
ATOM   5940 C  CB  . GLN B 1 263 ? 28.432 23.481 67.238  1.00 18.08 ? 285 GLN B CB  1 
ATOM   5941 C  CG  . GLN B 1 263 ? 29.136 23.091 65.928  1.00 17.98 ? 285 GLN B CG  1 
ATOM   5942 C  CD  . GLN B 1 263 ? 29.037 24.170 64.867  1.00 18.77 ? 285 GLN B CD  1 
ATOM   5943 O  OE1 . GLN B 1 263 ? 28.001 24.809 64.730  1.00 22.06 ? 285 GLN B OE1 1 
ATOM   5944 N  NE2 . GLN B 1 263 ? 30.118 24.388 64.124  1.00 17.42 ? 285 GLN B NE2 1 
ATOM   5945 N  N   . GLY B 1 264 ? 29.010 24.898 70.385  1.00 16.32 ? 286 GLY B N   1 
ATOM   5946 C  CA  . GLY B 1 264 ? 28.382 25.066 71.693  1.00 15.66 ? 286 GLY B CA  1 
ATOM   5947 C  C   . GLY B 1 264 ? 27.915 26.450 72.119  1.00 15.18 ? 286 GLY B C   1 
ATOM   5948 O  O   . GLY B 1 264 ? 27.271 26.586 73.161  1.00 15.01 ? 286 GLY B O   1 
ATOM   5949 N  N   . ASN B 1 265 ? 28.229 27.475 71.325  1.00 15.10 ? 287 ASN B N   1 
ATOM   5950 C  CA  . ASN B 1 265 ? 27.960 28.865 71.694  1.00 14.68 ? 287 ASN B CA  1 
ATOM   5951 C  C   . ASN B 1 265 ? 27.099 29.684 70.712  1.00 14.80 ? 287 ASN B C   1 
ATOM   5952 O  O   . ASN B 1 265 ? 26.422 30.633 71.130  1.00 14.09 ? 287 ASN B O   1 
ATOM   5953 C  CB  . ASN B 1 265 ? 29.270 29.628 71.896  1.00 14.21 ? 287 ASN B CB  1 
ATOM   5954 C  CG  . ASN B 1 265 ? 29.957 29.298 73.205  1.00 15.57 ? 287 ASN B CG  1 
ATOM   5955 O  OD1 . ASN B 1 265 ? 29.326 28.992 74.209  1.00 15.61 ? 287 ASN B OD1 1 
ATOM   5956 N  ND2 . ASN B 1 265 ? 31.273 29.400 73.199  1.00 19.71 ? 287 ASN B ND2 1 
ATOM   5957 N  N   . MET B 1 266 ? 27.166 29.364 69.417  1.00 14.23 ? 288 MET B N   1 
ATOM   5958 C  CA  . MET B 1 266 ? 26.424 30.122 68.408  1.00 14.44 ? 288 MET B CA  1 
ATOM   5959 C  C   . MET B 1 266 ? 24.933 30.066 68.657  1.00 14.91 ? 288 MET B C   1 
ATOM   5960 O  O   . MET B 1 266 ? 24.252 31.103 68.639  1.00 14.90 ? 288 MET B O   1 
ATOM   5961 C  CB  . MET B 1 266 ? 26.737 29.649 66.978  1.00 14.10 ? 288 MET B CB  1 
ATOM   5962 C  CG  . MET B 1 266 ? 28.036 30.229 66.373  1.00 13.90 ? 288 MET B CG  1 
ATOM   5963 S  SD  . MET B 1 266 ? 28.202 29.987 64.582  1.00 6.16  ? 288 MET B SD  1 
ATOM   5964 C  CE  . MET B 1 266 ? 28.379 28.213 64.467  1.00 12.64 ? 288 MET B CE  1 
ATOM   5965 N  N   . GLY B 1 267 ? 24.420 28.852 68.866  1.00 15.31 ? 289 GLY B N   1 
ATOM   5966 C  CA  . GLY B 1 267 ? 22.982 28.640 69.029  1.00 15.76 ? 289 GLY B CA  1 
ATOM   5967 C  C   . GLY B 1 267 ? 22.393 29.342 70.242  1.00 16.21 ? 289 GLY B C   1 
ATOM   5968 O  O   . GLY B 1 267 ? 21.410 30.071 70.110  1.00 16.27 ? 289 GLY B O   1 
ATOM   5969 N  N   . PRO B 1 268 ? 22.969 29.106 71.448  1.00 16.82 ? 290 PRO B N   1 
ATOM   5970 C  CA  . PRO B 1 268 ? 22.616 29.893 72.649  1.00 16.73 ? 290 PRO B CA  1 
ATOM   5971 C  C   . PRO B 1 268 ? 22.760 31.411 72.466  1.00 17.27 ? 290 PRO B C   1 
ATOM   5972 O  O   . PRO B 1 268 ? 21.921 32.168 72.962  1.00 17.54 ? 290 PRO B O   1 
ATOM   5973 C  CB  . PRO B 1 268 ? 23.610 29.386 73.709  1.00 17.26 ? 290 PRO B CB  1 
ATOM   5974 C  CG  . PRO B 1 268 ? 23.958 27.998 73.275  1.00 15.97 ? 290 PRO B CG  1 
ATOM   5975 C  CD  . PRO B 1 268 ? 23.908 28.011 71.766  1.00 16.32 ? 290 PRO B CD  1 
ATOM   5976 N  N   . ALA B 1 269 ? 23.801 31.852 71.762  1.00 17.13 ? 291 ALA B N   1 
ATOM   5977 C  CA  . ALA B 1 269 ? 24.027 33.283 71.545  1.00 17.50 ? 291 ALA B CA  1 
ATOM   5978 C  C   . ALA B 1 269 ? 22.883 33.911 70.761  1.00 17.46 ? 291 ALA B C   1 
ATOM   5979 O  O   . ALA B 1 269 ? 22.343 34.931 71.151  1.00 17.25 ? 291 ALA B O   1 
ATOM   5980 C  CB  . ALA B 1 269 ? 25.358 33.524 70.827  1.00 17.33 ? 291 ALA B CB  1 
ATOM   5981 N  N   . ALA B 1 270 ? 22.526 33.279 69.647  1.00 17.88 ? 292 ALA B N   1 
ATOM   5982 C  CA  . ALA B 1 270 ? 21.397 33.707 68.828  1.00 17.69 ? 292 ALA B CA  1 
ATOM   5983 C  C   . ALA B 1 270 ? 20.052 33.681 69.561  1.00 18.25 ? 292 ALA B C   1 
ATOM   5984 O  O   . ALA B 1 270 ? 19.187 34.500 69.263  1.00 18.01 ? 292 ALA B O   1 
ATOM   5985 C  CB  . ALA B 1 270 ? 21.322 32.842 67.592  1.00 17.74 ? 292 ALA B CB  1 
ATOM   5986 N  N   . PHE B 1 271 ? 19.869 32.713 70.466  1.00 18.40 ? 293 PHE B N   1 
ATOM   5987 C  CA  . PHE B 1 271 ? 18.652 32.602 71.301  1.00 19.09 ? 293 PHE B CA  1 
ATOM   5988 C  C   . PHE B 1 271 ? 18.431 33.880 72.096  1.00 18.68 ? 293 PHE B C   1 
ATOM   5989 O  O   . PHE B 1 271 ? 17.345 34.468 72.062  1.00 18.95 ? 293 PHE B O   1 
ATOM   5990 C  CB  . PHE B 1 271 ? 18.704 31.381 72.260  1.00 18.34 ? 293 PHE B CB  1 
ATOM   5991 C  CG  . PHE B 1 271 ? 17.767 31.492 73.451  1.00 20.14 ? 293 PHE B CG  1 
ATOM   5992 C  CD1 . PHE B 1 271 ? 16.394 31.269 73.305  1.00 21.17 ? 293 PHE B CD1 1 
ATOM   5993 C  CD2 . PHE B 1 271 ? 18.256 31.848 74.714  1.00 19.97 ? 293 PHE B CD2 1 
ATOM   5994 C  CE1 . PHE B 1 271 ? 15.511 31.397 74.403  1.00 21.46 ? 293 PHE B CE1 1 
ATOM   5995 C  CE2 . PHE B 1 271 ? 17.401 31.975 75.802  1.00 21.89 ? 293 PHE B CE2 1 
ATOM   5996 C  CZ  . PHE B 1 271 ? 16.017 31.753 75.649  1.00 22.55 ? 293 PHE B CZ  1 
ATOM   5997 N  N   . TRP B 1 272 ? 19.460 34.312 72.811  1.00 18.58 ? 294 TRP B N   1 
ATOM   5998 C  CA  . TRP B 1 272 ? 19.339 35.508 73.642  1.00 18.18 ? 294 TRP B CA  1 
ATOM   5999 C  C   . TRP B 1 272 ? 19.115 36.747 72.775  1.00 18.41 ? 294 TRP B C   1 
ATOM   6000 O  O   . TRP B 1 272 ? 18.227 37.564 73.061  1.00 18.87 ? 294 TRP B O   1 
ATOM   6001 C  CB  . TRP B 1 272 ? 20.552 35.674 74.546  1.00 18.51 ? 294 TRP B CB  1 
ATOM   6002 C  CG  . TRP B 1 272 ? 20.700 34.603 75.609  1.00 17.59 ? 294 TRP B CG  1 
ATOM   6003 C  CD1 . TRP B 1 272 ? 21.659 33.641 75.661  1.00 18.77 ? 294 TRP B CD1 1 
ATOM   6004 C  CD2 . TRP B 1 272 ? 19.881 34.420 76.783  1.00 17.85 ? 294 TRP B CD2 1 
ATOM   6005 N  NE1 . TRP B 1 272 ? 21.490 32.859 76.782  1.00 19.80 ? 294 TRP B NE1 1 
ATOM   6006 C  CE2 . TRP B 1 272 ? 20.398 33.307 77.479  1.00 18.47 ? 294 TRP B CE2 1 
ATOM   6007 C  CE3 . TRP B 1 272 ? 18.740 35.078 77.297  1.00 18.09 ? 294 TRP B CE3 1 
ATOM   6008 C  CZ2 . TRP B 1 272 ? 19.835 32.838 78.678  1.00 19.54 ? 294 TRP B CZ2 1 
ATOM   6009 C  CZ3 . TRP B 1 272 ? 18.178 34.610 78.495  1.00 19.53 ? 294 TRP B CZ3 1 
ATOM   6010 C  CH2 . TRP B 1 272 ? 18.732 33.505 79.171  1.00 19.21 ? 294 TRP B CH2 1 
ATOM   6011 N  N   . LEU B 1 273 ? 19.881 36.862 71.692  1.00 18.43 ? 295 LEU B N   1 
ATOM   6012 C  CA  . LEU B 1 273 ? 19.746 37.982 70.770  1.00 18.59 ? 295 LEU B CA  1 
ATOM   6013 C  C   . LEU B 1 273 ? 18.292 38.077 70.253  1.00 19.00 ? 295 LEU B C   1 
ATOM   6014 O  O   . LEU B 1 273 ? 17.651 39.111 70.371  1.00 18.42 ? 295 LEU B O   1 
ATOM   6015 C  CB  . LEU B 1 273 ? 20.766 37.863 69.623  1.00 18.39 ? 295 LEU B CB  1 
ATOM   6016 C  CG  . LEU B 1 273 ? 20.877 39.007 68.595  1.00 18.57 ? 295 LEU B CG  1 
ATOM   6017 C  CD1 . LEU B 1 273 ? 22.211 38.968 67.875  1.00 17.76 ? 295 LEU B CD1 1 
ATOM   6018 C  CD2 . LEU B 1 273 ? 19.744 38.961 67.566  1.00 17.34 ? 295 LEU B CD2 1 
ATOM   6019 N  N   . LEU B 1 274 ? 17.776 36.972 69.724  1.00 19.19 ? 296 LEU B N   1 
ATOM   6020 C  CA  . LEU B 1 274 ? 16.434 36.938 69.161  1.00 19.71 ? 296 LEU B CA  1 
ATOM   6021 C  C   . LEU B 1 274 ? 15.377 37.242 70.228  1.00 19.86 ? 296 LEU B C   1 
ATOM   6022 O  O   . LEU B 1 274 ? 14.421 37.977 69.969  1.00 19.17 ? 296 LEU B O   1 
ATOM   6023 C  CB  . LEU B 1 274 ? 16.182 35.574 68.511  1.00 19.99 ? 296 LEU B CB  1 
ATOM   6024 C  CG  . LEU B 1 274 ? 16.179 35.346 66.998  1.00 20.33 ? 296 LEU B CG  1 
ATOM   6025 C  CD1 . LEU B 1 274 ? 16.871 36.403 66.187  1.00 20.78 ? 296 LEU B CD1 1 
ATOM   6026 C  CD2 . LEU B 1 274 ? 16.698 33.968 66.688  1.00 19.06 ? 296 LEU B CD2 1 
ATOM   6027 N  N   . LEU B 1 275 ? 15.580 36.697 71.425  1.00 20.66 ? 297 LEU B N   1 
ATOM   6028 C  CA  . LEU B 1 275 ? 14.676 36.923 72.563  1.00 21.68 ? 297 LEU B CA  1 
ATOM   6029 C  C   . LEU B 1 275 ? 14.672 38.390 72.998  1.00 22.13 ? 297 LEU B C   1 
ATOM   6030 O  O   . LEU B 1 275 ? 13.614 38.961 73.232  1.00 22.16 ? 297 LEU B O   1 
ATOM   6031 C  CB  . LEU B 1 275 ? 15.061 36.025 73.742  1.00 20.87 ? 297 LEU B CB  1 
ATOM   6032 C  CG  . LEU B 1 275 ? 14.279 36.211 75.052  1.00 22.08 ? 297 LEU B CG  1 
ATOM   6033 C  CD1 . LEU B 1 275 ? 12.808 35.837 74.855  1.00 19.90 ? 297 LEU B CD1 1 
ATOM   6034 C  CD2 . LEU B 1 275 ? 14.906 35.418 76.215  1.00 20.25 ? 297 LEU B CD2 1 
ATOM   6035 N  N   . PHE B 1 276 ? 15.867 38.979 73.090  1.00 22.83 ? 298 PHE B N   1 
ATOM   6036 C  CA  . PHE B 1 276 ? 16.024 40.385 73.431  1.00 23.57 ? 298 PHE B CA  1 
ATOM   6037 C  C   . PHE B 1 276 ? 15.341 41.290 72.411  1.00 24.26 ? 298 PHE B C   1 
ATOM   6038 O  O   . PHE B 1 276 ? 14.750 42.304 72.801  1.00 25.29 ? 298 PHE B O   1 
ATOM   6039 C  CB  . PHE B 1 276 ? 17.500 40.773 73.539  1.00 22.93 ? 298 PHE B CB  1 
ATOM   6040 C  CG  . PHE B 1 276 ? 18.196 40.235 74.760  1.00 23.45 ? 298 PHE B CG  1 
ATOM   6041 C  CD1 . PHE B 1 276 ? 17.549 40.167 75.985  1.00 24.72 ? 298 PHE B CD1 1 
ATOM   6042 C  CD2 . PHE B 1 276 ? 19.524 39.824 74.686  1.00 21.72 ? 298 PHE B CD2 1 
ATOM   6043 C  CE1 . PHE B 1 276 ? 18.215 39.671 77.106  1.00 24.32 ? 298 PHE B CE1 1 
ATOM   6044 C  CE2 . PHE B 1 276 ? 20.189 39.341 75.794  1.00 21.28 ? 298 PHE B CE2 1 
ATOM   6045 C  CZ  . PHE B 1 276 ? 19.531 39.257 77.005  1.00 23.01 ? 298 PHE B CZ  1 
ATOM   6046 N  N   . LEU B 1 277 ? 15.444 40.940 71.121  1.00 24.29 ? 299 LEU B N   1 
ATOM   6047 C  CA  . LEU B 1 277 ? 14.767 41.679 70.050  1.00 25.41 ? 299 LEU B CA  1 
ATOM   6048 C  C   . LEU B 1 277 ? 13.244 41.530 70.113  1.00 26.05 ? 299 LEU B C   1 
ATOM   6049 O  O   . LEU B 1 277 ? 12.503 42.502 69.908  1.00 25.43 ? 299 LEU B O   1 
ATOM   6050 C  CB  . LEU B 1 277 ? 15.264 41.247 68.664  1.00 25.69 ? 299 LEU B CB  1 
ATOM   6051 C  CG  . LEU B 1 277 ? 16.730 41.491 68.268  1.00 24.83 ? 299 LEU B CG  1 
ATOM   6052 C  CD1 . LEU B 1 277 ? 16.911 41.074 66.832  1.00 23.06 ? 299 LEU B CD1 1 
ATOM   6053 C  CD2 . LEU B 1 277 ? 17.140 42.948 68.460  1.00 23.47 ? 299 LEU B CD2 1 
ATOM   6054 N  N   . LEU B 1 278 ? 12.792 40.311 70.402  1.00 26.61 ? 300 LEU B N   1 
ATOM   6055 C  CA  . LEU B 1 278 ? 11.363 40.007 70.489  1.00 27.34 ? 300 LEU B CA  1 
ATOM   6056 C  C   . LEU B 1 278 ? 10.704 40.793 71.638  1.00 28.08 ? 300 LEU B C   1 
ATOM   6057 O  O   . LEU B 1 278 ? 9.610  41.342 71.482  1.00 28.34 ? 300 LEU B O   1 
ATOM   6058 C  CB  . LEU B 1 278 ? 11.171 38.492 70.628  1.00 27.58 ? 300 LEU B CB  1 
ATOM   6059 C  CG  . LEU B 1 278 ? 10.950 37.609 69.375  1.00 27.42 ? 300 LEU B CG  1 
ATOM   6060 C  CD1 . LEU B 1 278 ? 11.599 38.082 68.117  1.00 28.02 ? 300 LEU B CD1 1 
ATOM   6061 C  CD2 . LEU B 1 278 ? 11.326 36.155 69.651  1.00 29.18 ? 300 LEU B CD2 1 
ATOM   6062 N  N   . LYS B 1 279 ? 11.419 40.890 72.759  1.00 28.56 ? 301 LYS B N   1 
ATOM   6063 C  CA  . LYS B 1 279 ? 10.982 41.620 73.950  1.00 28.96 ? 301 LYS B CA  1 
ATOM   6064 C  C   . LYS B 1 279 ? 11.187 43.142 73.925  1.00 29.25 ? 301 LYS B C   1 
ATOM   6065 O  O   . LYS B 1 279 ? 10.780 43.819 74.873  1.00 29.34 ? 301 LYS B O   1 
ATOM   6066 C  CB  . LYS B 1 279 ? 11.705 41.070 75.180  1.00 29.10 ? 301 LYS B CB  1 
ATOM   6067 C  CG  . LYS B 1 279 ? 11.193 39.734 75.695  1.00 30.54 ? 301 LYS B CG  1 
ATOM   6068 C  CD  . LYS B 1 279 ? 10.303 39.894 76.926  1.00 33.48 ? 301 LYS B CD  1 
ATOM   6069 C  CE  . LYS B 1 279 ? 8.872  40.098 76.551  1.00 33.75 ? 301 LYS B CE  1 
ATOM   6070 N  NZ  . LYS B 1 279 ? 8.008  40.221 77.753  1.00 36.03 ? 301 LYS B NZ  1 
ATOM   6071 N  N   . ASN B 1 280 ? 11.830 43.673 72.879  1.00 29.26 ? 302 ASN B N   1 
ATOM   6072 C  CA  . ASN B 1 280 ? 12.096 45.120 72.774  1.00 29.38 ? 302 ASN B CA  1 
ATOM   6073 C  C   . ASN B 1 280 ? 11.772 45.700 71.401  1.00 29.47 ? 302 ASN B C   1 
ATOM   6074 O  O   . ASN B 1 280 ? 12.664 45.785 70.542  1.00 29.75 ? 302 ASN B O   1 
ATOM   6075 C  CB  . ASN B 1 280 ? 13.548 45.444 73.127  1.00 29.59 ? 302 ASN B CB  1 
ATOM   6076 C  CG  . ASN B 1 280 ? 13.870 45.200 74.588  1.00 30.66 ? 302 ASN B CG  1 
ATOM   6077 O  OD1 . ASN B 1 280 ? 13.860 46.131 75.393  1.00 32.11 ? 302 ASN B OD1 1 
ATOM   6078 N  ND2 . ASN B 1 280 ? 14.174 43.947 74.939  1.00 29.79 ? 302 ASN B ND2 1 
ATOM   6079 N  N   . PRO B 1 281 ? 10.507 46.127 71.188  1.00 29.61 ? 303 PRO B N   1 
ATOM   6080 C  CA  . PRO B 1 281 ? 10.057 46.560 69.855  1.00 29.66 ? 303 PRO B CA  1 
ATOM   6081 C  C   . PRO B 1 281 ? 10.980 47.530 69.117  1.00 29.11 ? 303 PRO B C   1 
ATOM   6082 O  O   . PRO B 1 281 ? 11.276 47.305 67.949  1.00 29.33 ? 303 PRO B O   1 
ATOM   6083 C  CB  . PRO B 1 281 ? 8.685  47.191 70.128  1.00 29.62 ? 303 PRO B CB  1 
ATOM   6084 C  CG  . PRO B 1 281 ? 8.202  46.487 71.344  1.00 30.27 ? 303 PRO B CG  1 
ATOM   6085 C  CD  . PRO B 1 281 ? 9.419  46.215 72.183  1.00 29.69 ? 303 PRO B CD  1 
ATOM   6086 N  N   . GLU B 1 282 ? 11.430 48.587 69.782  1.00 28.85 ? 304 GLU B N   1 
ATOM   6087 C  CA  . GLU B 1 282 ? 12.252 49.605 69.120  1.00 29.01 ? 304 GLU B CA  1 
ATOM   6088 C  C   . GLU B 1 282 ? 13.561 49.016 68.591  1.00 28.09 ? 304 GLU B C   1 
ATOM   6089 O  O   . GLU B 1 282 ? 14.067 49.455 67.559  1.00 27.53 ? 304 GLU B O   1 
ATOM   6090 C  CB  . GLU B 1 282 ? 12.512 50.815 70.035  1.00 29.35 ? 304 GLU B CB  1 
ATOM   6091 C  CG  . GLU B 1 282 ? 13.480 50.590 71.192  1.00 33.20 ? 304 GLU B CG  1 
ATOM   6092 C  CD  . GLU B 1 282 ? 14.039 51.895 71.808  1.00 38.18 ? 304 GLU B CD  1 
ATOM   6093 O  OE1 . GLU B 1 282 ? 14.050 52.961 71.135  1.00 39.70 ? 304 GLU B OE1 1 
ATOM   6094 O  OE2 . GLU B 1 282 ? 14.482 51.844 72.980  1.00 39.60 ? 304 GLU B OE2 1 
ATOM   6095 N  N   . ALA B 1 283 ? 14.082 48.013 69.311  1.00 27.79 ? 305 ALA B N   1 
ATOM   6096 C  CA  . ALA B 1 283 ? 15.294 47.310 68.943  1.00 27.16 ? 305 ALA B CA  1 
ATOM   6097 C  C   . ALA B 1 283 ? 15.051 46.459 67.691  1.00 26.87 ? 305 ALA B C   1 
ATOM   6098 O  O   . ALA B 1 283 ? 15.740 46.614 66.689  1.00 27.29 ? 305 ALA B O   1 
ATOM   6099 C  CB  . ALA B 1 283 ? 15.793 46.460 70.131  1.00 27.34 ? 305 ALA B CB  1 
ATOM   6100 N  N   . LEU B 1 284 ? 14.051 45.588 67.737  1.00 26.95 ? 306 LEU B N   1 
ATOM   6101 C  CA  . LEU B 1 284 ? 13.680 44.751 66.591  1.00 27.01 ? 306 LEU B CA  1 
ATOM   6102 C  C   . LEU B 1 284 ? 13.422 45.596 65.346  1.00 26.60 ? 306 LEU B C   1 
ATOM   6103 O  O   . LEU B 1 284 ? 13.872 45.250 64.254  1.00 26.06 ? 306 LEU B O   1 
ATOM   6104 C  CB  . LEU B 1 284 ? 12.423 43.928 66.920  1.00 27.56 ? 306 LEU B CB  1 
ATOM   6105 C  CG  . LEU B 1 284 ? 12.205 42.500 66.370  1.00 28.61 ? 306 LEU B CG  1 
ATOM   6106 C  CD1 . LEU B 1 284 ? 10.750 42.298 65.969  1.00 29.17 ? 306 LEU B CD1 1 
ATOM   6107 C  CD2 . LEU B 1 284 ? 13.137 42.096 65.208  1.00 26.71 ? 306 LEU B CD2 1 
ATOM   6108 N  N   . ALA B 1 285 ? 12.708 46.709 65.516  1.00 26.13 ? 307 ALA B N   1 
ATOM   6109 C  CA  . ALA B 1 285 ? 12.404 47.617 64.392  1.00 26.27 ? 307 ALA B CA  1 
ATOM   6110 C  C   . ALA B 1 285 ? 13.652 48.249 63.775  1.00 25.93 ? 307 ALA B C   1 
ATOM   6111 O  O   . ALA B 1 285 ? 13.754 48.364 62.555  1.00 25.59 ? 307 ALA B O   1 
ATOM   6112 C  CB  . ALA B 1 285 ? 11.408 48.714 64.820  1.00 26.47 ? 307 ALA B CB  1 
ATOM   6113 N  N   . ALA B 1 286 ? 14.591 48.659 64.625  1.00 25.74 ? 308 ALA B N   1 
ATOM   6114 C  CA  . ALA B 1 286 ? 15.888 49.180 64.167  1.00 25.37 ? 308 ALA B CA  1 
ATOM   6115 C  C   . ALA B 1 286 ? 16.683 48.141 63.371  1.00 25.28 ? 308 ALA B C   1 
ATOM   6116 O  O   . ALA B 1 286 ? 17.277 48.470 62.338  1.00 25.56 ? 308 ALA B O   1 
ATOM   6117 C  CB  . ALA B 1 286 ? 16.705 49.683 65.343  1.00 25.15 ? 308 ALA B CB  1 
ATOM   6118 N  N   . VAL B 1 287 ? 16.720 46.902 63.862  1.00 24.97 ? 309 VAL B N   1 
ATOM   6119 C  CA  . VAL B 1 287 ? 17.353 45.806 63.123  1.00 24.95 ? 309 VAL B CA  1 
ATOM   6120 C  C   . VAL B 1 287 ? 16.615 45.558 61.804  1.00 25.05 ? 309 VAL B C   1 
ATOM   6121 O  O   . VAL B 1 287 ? 17.247 45.504 60.747  1.00 24.67 ? 309 VAL B O   1 
ATOM   6122 C  CB  . VAL B 1 287 ? 17.426 44.480 63.952  1.00 24.81 ? 309 VAL B CB  1 
ATOM   6123 C  CG1 . VAL B 1 287 ? 17.954 43.324 63.076  1.00 25.82 ? 309 VAL B CG1 1 
ATOM   6124 C  CG2 . VAL B 1 287 ? 18.314 44.654 65.173  1.00 24.12 ? 309 VAL B CG2 1 
ATOM   6125 N  N   . ARG B 1 288 ? 15.284 45.420 61.868  1.00 25.35 ? 310 ARG B N   1 
ATOM   6126 C  CA  . ARG B 1 288 ? 14.455 45.190 60.680  1.00 26.15 ? 310 ARG B CA  1 
ATOM   6127 C  C   . ARG B 1 288 ? 14.652 46.299 59.654  1.00 26.54 ? 310 ARG B C   1 
ATOM   6128 O  O   . ARG B 1 288 ? 14.726 46.043 58.447  1.00 26.62 ? 310 ARG B O   1 
ATOM   6129 C  CB  . ARG B 1 288 ? 12.959 45.104 61.035  1.00 26.52 ? 310 ARG B CB  1 
ATOM   6130 C  CG  . ARG B 1 288 ? 12.525 43.828 61.753  1.00 26.99 ? 310 ARG B CG  1 
ATOM   6131 C  CD  . ARG B 1 288 ? 11.034 43.565 61.560  1.00 28.73 ? 310 ARG B CD  1 
ATOM   6132 N  NE  . ARG B 1 288 ? 10.529 42.438 62.355  1.00 29.78 ? 310 ARG B NE  1 
ATOM   6133 C  CZ  . ARG B 1 288 ? 10.647 41.154 62.015  1.00 29.73 ? 310 ARG B CZ  1 
ATOM   6134 N  NH1 . ARG B 1 288 ? 11.274 40.798 60.895  1.00 29.08 ? 310 ARG B NH1 1 
ATOM   6135 N  NH2 . ARG B 1 288 ? 10.134 40.218 62.797  1.00 28.74 ? 310 ARG B NH2 1 
ATOM   6136 N  N   . GLY B 1 289 ? 14.743 47.527 60.152  1.00 26.59 ? 311 GLY B N   1 
ATOM   6137 C  CA  . GLY B 1 289 ? 14.957 48.693 59.315  1.00 27.60 ? 311 GLY B CA  1 
ATOM   6138 C  C   . GLY B 1 289 ? 16.289 48.683 58.598  1.00 27.78 ? 311 GLY B C   1 
ATOM   6139 O  O   . GLY B 1 289 ? 16.352 49.042 57.431  1.00 27.75 ? 311 GLY B O   1 
ATOM   6140 N  N   . GLU B 1 290 ? 17.350 48.274 59.294  1.00 27.94 ? 312 GLU B N   1 
ATOM   6141 C  CA  . GLU B 1 290 ? 18.672 48.170 58.674  1.00 28.12 ? 312 GLU B CA  1 
ATOM   6142 C  C   . GLU B 1 290 ? 18.781 47.021 57.666  1.00 29.29 ? 312 GLU B C   1 
ATOM   6143 O  O   . GLU B 1 290 ? 19.364 47.192 56.592  1.00 28.85 ? 312 GLU B O   1 
ATOM   6144 C  CB  . GLU B 1 290 ? 19.754 48.083 59.757  1.00 27.94 ? 312 GLU B CB  1 
ATOM   6145 C  CG  . GLU B 1 290 ? 21.015 47.316 59.384  1.00 25.41 ? 312 GLU B CG  1 
ATOM   6146 C  CD  . GLU B 1 290 ? 22.003 47.317 60.530  1.00 23.66 ? 312 GLU B CD  1 
ATOM   6147 O  OE1 . GLU B 1 290 ? 22.092 46.298 61.250  1.00 22.74 ? 312 GLU B OE1 1 
ATOM   6148 O  OE2 . GLU B 1 290 ? 22.670 48.353 60.731  1.00 22.24 ? 312 GLU B OE2 1 
ATOM   6149 N  N   . LEU B 1 291 ? 18.227 45.854 58.003  1.00 30.94 ? 313 LEU B N   1 
ATOM   6150 C  CA  . LEU B 1 291 ? 18.294 44.699 57.110  1.00 33.09 ? 313 LEU B CA  1 
ATOM   6151 C  C   . LEU B 1 291 ? 17.591 44.976 55.781  1.00 34.96 ? 313 LEU B C   1 
ATOM   6152 O  O   . LEU B 1 291 ? 18.055 44.560 54.717  1.00 35.27 ? 313 LEU B O   1 
ATOM   6153 C  CB  . LEU B 1 291 ? 17.705 43.450 57.764  1.00 32.85 ? 313 LEU B CB  1 
ATOM   6154 C  CG  . LEU B 1 291 ? 18.502 42.732 58.857  1.00 33.15 ? 313 LEU B CG  1 
ATOM   6155 C  CD1 . LEU B 1 291 ? 17.728 41.530 59.376  1.00 32.12 ? 313 LEU B CD1 1 
ATOM   6156 C  CD2 . LEU B 1 291 ? 19.914 42.323 58.394  1.00 34.53 ? 313 LEU B CD2 1 
ATOM   6157 N  N   . GLU B 1 292 ? 16.479 45.696 55.841  1.00 36.93 ? 314 GLU B N   1 
ATOM   6158 C  CA  . GLU B 1 292 ? 15.759 46.017 54.620  1.00 38.95 ? 314 GLU B CA  1 
ATOM   6159 C  C   . GLU B 1 292 ? 16.408 47.127 53.794  1.00 39.59 ? 314 GLU B C   1 
ATOM   6160 O  O   . GLU B 1 292 ? 16.467 47.029 52.571  1.00 39.71 ? 314 GLU B O   1 
ATOM   6161 C  CB  . GLU B 1 292 ? 14.285 46.266 54.908  1.00 39.46 ? 314 GLU B CB  1 
ATOM   6162 C  CG  . GLU B 1 292 ? 13.411 45.117 54.383  1.00 41.92 ? 314 GLU B CG  1 
ATOM   6163 C  CD  . GLU B 1 292 ? 12.424 44.595 55.400  1.00 44.86 ? 314 GLU B CD  1 
ATOM   6164 O  OE1 . GLU B 1 292 ? 11.595 45.389 55.904  1.00 45.28 ? 314 GLU B OE1 1 
ATOM   6165 O  OE2 . GLU B 1 292 ? 12.477 43.375 55.683  1.00 46.49 ? 314 GLU B OE2 1 
ATOM   6166 N  N   . SER B 1 293 ? 16.911 48.162 54.463  1.00 40.60 ? 315 SER B N   1 
ATOM   6167 C  CA  . SER B 1 293 ? 17.707 49.208 53.813  1.00 41.60 ? 315 SER B CA  1 
ATOM   6168 C  C   . SER B 1 293 ? 18.817 48.664 52.896  1.00 42.49 ? 315 SER B C   1 
ATOM   6169 O  O   . SER B 1 293 ? 19.092 49.230 51.825  1.00 42.24 ? 315 SER B O   1 
ATOM   6170 C  CB  . SER B 1 293 ? 18.319 50.131 54.862  1.00 41.65 ? 315 SER B CB  1 
ATOM   6171 O  OG  . SER B 1 293 ? 17.317 50.908 55.486  1.00 42.28 ? 315 SER B OG  1 
ATOM   6172 N  N   . ILE B 1 294 ? 19.440 47.567 53.320  1.00 43.47 ? 316 ILE B N   1 
ATOM   6173 C  CA  . ILE B 1 294 ? 20.513 46.932 52.562  1.00 45.14 ? 316 ILE B CA  1 
ATOM   6174 C  C   . ILE B 1 294 ? 19.980 46.082 51.401  1.00 46.35 ? 316 ILE B C   1 
ATOM   6175 O  O   . ILE B 1 294 ? 20.607 46.004 50.336  1.00 46.43 ? 316 ILE B O   1 
ATOM   6176 C  CB  . ILE B 1 294 ? 21.428 46.085 53.491  1.00 45.12 ? 316 ILE B CB  1 
ATOM   6177 C  CG1 . ILE B 1 294 ? 22.176 46.996 54.460  1.00 45.07 ? 316 ILE B CG1 1 
ATOM   6178 C  CG2 . ILE B 1 294 ? 22.412 45.256 52.686  1.00 45.14 ? 316 ILE B CG2 1 
ATOM   6179 C  CD1 . ILE B 1 294 ? 23.153 46.277 55.332  1.00 46.20 ? 316 ILE B CD1 1 
ATOM   6180 N  N   . LEU B 1 295 ? 18.821 45.463 51.612  1.00 48.00 ? 317 LEU B N   1 
ATOM   6181 C  CA  . LEU B 1 295 ? 18.204 44.567 50.632  1.00 49.67 ? 317 LEU B CA  1 
ATOM   6182 C  C   . LEU B 1 295 ? 18.055 45.216 49.248  1.00 50.80 ? 317 LEU B C   1 
ATOM   6183 O  O   . LEU B 1 295 ? 18.377 44.595 48.224  1.00 51.35 ? 317 LEU B O   1 
ATOM   6184 C  CB  . LEU B 1 295 ? 16.842 44.068 51.149  1.00 49.50 ? 317 LEU B CB  1 
ATOM   6185 C  CG  . LEU B 1 295 ? 16.402 42.599 50.981  1.00 49.61 ? 317 LEU B CG  1 
ATOM   6186 C  CD1 . LEU B 1 295 ? 16.312 42.139 49.517  1.00 50.09 ? 317 LEU B CD1 1 
ATOM   6187 C  CD2 . LEU B 1 295 ? 17.292 41.671 51.766  1.00 48.84 ? 317 LEU B CD2 1 
ATOM   6188 N  N   . TRP B 1 296 ? 17.575 46.457 49.223  1.00 52.01 ? 318 TRP B N   1 
ATOM   6189 C  CA  . TRP B 1 296 ? 17.459 47.216 47.973  1.00 53.25 ? 318 TRP B CA  1 
ATOM   6190 C  C   . TRP B 1 296 ? 18.424 48.402 47.944  1.00 53.35 ? 318 TRP B C   1 
ATOM   6191 O  O   . TRP B 1 296 ? 19.625 48.243 48.171  1.00 53.42 ? 318 TRP B O   1 
ATOM   6192 C  CB  . TRP B 1 296 ? 16.011 47.679 47.737  1.00 54.10 ? 318 TRP B CB  1 
ATOM   6193 C  CG  . TRP B 1 296 ? 15.086 47.425 48.908  1.00 55.40 ? 318 TRP B CG  1 
ATOM   6194 C  CD1 . TRP B 1 296 ? 14.941 48.202 50.032  1.00 56.17 ? 318 TRP B CD1 1 
ATOM   6195 C  CD2 . TRP B 1 296 ? 14.184 46.316 49.068  1.00 56.00 ? 318 TRP B CD2 1 
ATOM   6196 N  NE1 . TRP B 1 296 ? 14.006 47.642 50.878  1.00 56.42 ? 318 TRP B NE1 1 
ATOM   6197 C  CE2 . TRP B 1 296 ? 13.527 46.486 50.313  1.00 56.69 ? 318 TRP B CE2 1 
ATOM   6198 C  CE3 . TRP B 1 296 ? 13.862 45.199 48.278  1.00 56.35 ? 318 TRP B CE3 1 
ATOM   6199 C  CZ2 . TRP B 1 296 ? 12.566 45.575 50.790  1.00 56.07 ? 318 TRP B CZ2 1 
ATOM   6200 C  CZ3 . TRP B 1 296 ? 12.902 44.292 48.753  1.00 55.78 ? 318 TRP B CZ3 1 
ATOM   6201 C  CH2 . TRP B 1 296 ? 12.270 44.488 49.998  1.00 55.77 ? 318 TRP B CH2 1 
ATOM   6202 N  N   . PRO B 1 309 ? 25.038 38.133 50.033  1.00 44.73 ? 331 PRO B N   1 
ATOM   6203 C  CA  . PRO B 1 309 ? 24.741 39.563 50.178  1.00 44.63 ? 331 PRO B CA  1 
ATOM   6204 C  C   . PRO B 1 309 ? 25.723 40.289 51.118  1.00 44.35 ? 331 PRO B C   1 
ATOM   6205 O  O   . PRO B 1 309 ? 25.334 40.713 52.212  1.00 44.44 ? 331 PRO B O   1 
ATOM   6206 C  CB  . PRO B 1 309 ? 23.306 39.577 50.740  1.00 44.69 ? 331 PRO B CB  1 
ATOM   6207 C  CG  . PRO B 1 309 ? 22.961 38.124 51.082  1.00 45.15 ? 331 PRO B CG  1 
ATOM   6208 C  CD  . PRO B 1 309 ? 24.207 37.299 50.916  1.00 45.04 ? 331 PRO B CD  1 
ATOM   6209 N  N   . GLN B 1 310 ? 26.971 40.440 50.659  1.00 43.68 ? 332 GLN B N   1 
ATOM   6210 C  CA  . GLN B 1 310 ? 28.120 40.970 51.437  1.00 43.18 ? 332 GLN B CA  1 
ATOM   6211 C  C   . GLN B 1 310 ? 27.826 42.046 52.495  1.00 42.07 ? 332 GLN B C   1 
ATOM   6212 O  O   . GLN B 1 310 ? 28.446 42.059 53.573  1.00 41.03 ? 332 GLN B O   1 
ATOM   6213 C  CB  . GLN B 1 310 ? 29.210 41.501 50.489  1.00 43.45 ? 332 GLN B CB  1 
ATOM   6214 C  CG  . GLN B 1 310 ? 30.060 40.427 49.808  1.00 46.03 ? 332 GLN B CG  1 
ATOM   6215 C  CD  . GLN B 1 310 ? 31.204 41.004 48.964  1.00 48.85 ? 332 GLN B CD  1 
ATOM   6216 O  OE1 . GLN B 1 310 ? 32.180 40.304 48.650  1.00 49.34 ? 332 GLN B OE1 1 
ATOM   6217 N  NE2 . GLN B 1 310 ? 31.087 42.282 48.592  1.00 49.95 ? 332 GLN B NE2 1 
ATOM   6218 N  N   . LYS B 1 311 ? 26.898 42.945 52.168  1.00 41.00 ? 333 LYS B N   1 
ATOM   6219 C  CA  . LYS B 1 311 ? 26.532 44.066 53.039  1.00 40.54 ? 333 LYS B CA  1 
ATOM   6220 C  C   . LYS B 1 311 ? 25.906 43.625 54.366  1.00 39.51 ? 333 LYS B C   1 
ATOM   6221 O  O   . LYS B 1 311 ? 25.988 44.348 55.361  1.00 39.21 ? 333 LYS B O   1 
ATOM   6222 C  CB  . LYS B 1 311 ? 25.583 45.025 52.313  1.00 41.36 ? 333 LYS B CB  1 
ATOM   6223 C  CG  . LYS B 1 311 ? 26.108 45.585 50.984  1.00 42.52 ? 333 LYS B CG  1 
ATOM   6224 C  CD  . LYS B 1 311 ? 25.125 46.588 50.381  1.00 46.14 ? 333 LYS B CD  1 
ATOM   6225 C  CE  . LYS B 1 311 ? 24.087 45.920 49.473  1.00 46.87 ? 333 LYS B CE  1 
ATOM   6226 N  NZ  . LYS B 1 311 ? 23.056 46.877 48.988  1.00 47.18 ? 333 LYS B NZ  1 
ATOM   6227 N  N   . VAL B 1 312 ? 25.290 42.441 54.371  1.00 38.39 ? 334 VAL B N   1 
ATOM   6228 C  CA  . VAL B 1 312 ? 24.771 41.823 55.599  1.00 37.90 ? 334 VAL B CA  1 
ATOM   6229 C  C   . VAL B 1 312 ? 25.922 41.524 56.575  1.00 37.37 ? 334 VAL B C   1 
ATOM   6230 O  O   . VAL B 1 312 ? 25.742 41.525 57.787  1.00 37.07 ? 334 VAL B O   1 
ATOM   6231 C  CB  . VAL B 1 312 ? 23.975 40.520 55.292  1.00 37.85 ? 334 VAL B CB  1 
ATOM   6232 C  CG1 . VAL B 1 312 ? 23.732 39.691 56.550  1.00 37.34 ? 334 VAL B CG1 1 
ATOM   6233 C  CG2 . VAL B 1 312 ? 22.653 40.851 54.607  1.00 37.91 ? 334 VAL B CG2 1 
ATOM   6234 N  N   . LEU B 1 313 ? 27.102 41.269 56.031  1.00 36.64 ? 335 LEU B N   1 
ATOM   6235 C  CA  . LEU B 1 313 ? 28.267 41.008 56.868  1.00 36.36 ? 335 LEU B CA  1 
ATOM   6236 C  C   . LEU B 1 313 ? 28.909 42.310 57.348  1.00 36.07 ? 335 LEU B C   1 
ATOM   6237 O  O   . LEU B 1 313 ? 29.223 42.445 58.535  1.00 36.09 ? 335 LEU B O   1 
ATOM   6238 C  CB  . LEU B 1 313 ? 29.295 40.133 56.138  1.00 36.04 ? 335 LEU B CB  1 
ATOM   6239 C  CG  . LEU B 1 313 ? 28.836 38.803 55.508  1.00 36.65 ? 335 LEU B CG  1 
ATOM   6240 C  CD1 . LEU B 1 313 ? 29.951 38.205 54.628  1.00 36.17 ? 335 LEU B CD1 1 
ATOM   6241 C  CD2 . LEU B 1 313 ? 28.358 37.783 56.543  1.00 35.80 ? 335 LEU B CD2 1 
ATOM   6242 N  N   . ASP B 1 314 ? 29.082 43.278 56.451  1.00 35.77 ? 336 ASP B N   1 
ATOM   6243 C  CA  . ASP B 1 314 ? 29.906 44.435 56.801  1.00 36.05 ? 336 ASP B CA  1 
ATOM   6244 C  C   . ASP B 1 314 ? 29.281 45.817 56.671  1.00 35.52 ? 336 ASP B C   1 
ATOM   6245 O  O   . ASP B 1 314 ? 29.994 46.820 56.612  1.00 35.95 ? 336 ASP B O   1 
ATOM   6246 C  CB  . ASP B 1 314 ? 31.272 44.367 56.106  1.00 36.79 ? 336 ASP B CB  1 
ATOM   6247 C  CG  . ASP B 1 314 ? 31.170 43.984 54.665  1.00 38.09 ? 336 ASP B CG  1 
ATOM   6248 O  OD1 . ASP B 1 314 ? 30.341 44.593 53.951  1.00 41.25 ? 336 ASP B OD1 1 
ATOM   6249 O  OD2 . ASP B 1 314 ? 31.923 43.079 54.247  1.00 39.37 ? 336 ASP B OD2 1 
ATOM   6250 N  N   . SER B 1 315 ? 27.956 45.866 56.639  1.00 34.57 ? 337 SER B N   1 
ATOM   6251 C  CA  . SER B 1 315 ? 27.225 47.127 56.723  1.00 33.94 ? 337 SER B CA  1 
ATOM   6252 C  C   . SER B 1 315 ? 25.951 46.941 57.554  1.00 32.60 ? 337 SER B C   1 
ATOM   6253 O  O   . SER B 1 315 ? 24.859 47.373 57.166  1.00 32.99 ? 337 SER B O   1 
ATOM   6254 C  CB  . SER B 1 315 ? 26.900 47.657 55.324  1.00 34.39 ? 337 SER B CB  1 
ATOM   6255 O  OG  . SER B 1 315 ? 28.092 47.961 54.631  1.00 36.16 ? 337 SER B OG  1 
ATOM   6256 N  N   . THR B 1 316 ? 26.088 46.278 58.699  1.00 30.52 ? 338 THR B N   1 
ATOM   6257 C  CA  . THR B 1 316 ? 24.965 46.170 59.625  1.00 28.06 ? 338 THR B CA  1 
ATOM   6258 C  C   . THR B 1 316 ? 25.403 46.592 61.024  1.00 26.42 ? 338 THR B C   1 
ATOM   6259 O  O   . THR B 1 316 ? 25.420 45.766 61.928  1.00 26.16 ? 338 THR B O   1 
ATOM   6260 C  CB  . THR B 1 316 ? 24.350 44.738 59.671  1.00 28.45 ? 338 THR B CB  1 
ATOM   6261 O  OG1 . THR B 1 316 ? 25.385 43.763 59.856  1.00 27.48 ? 338 THR B OG1 1 
ATOM   6262 C  CG2 . THR B 1 316 ? 23.553 44.432 58.418  1.00 26.88 ? 338 THR B CG2 1 
ATOM   6263 N  N   . PRO B 1 317 ? 25.754 47.882 61.203  1.00 24.83 ? 339 PRO B N   1 
ATOM   6264 C  CA  . PRO B 1 317 ? 26.274 48.336 62.499  1.00 23.59 ? 339 PRO B CA  1 
ATOM   6265 C  C   . PRO B 1 317 ? 25.267 48.164 63.641  1.00 22.16 ? 339 PRO B C   1 
ATOM   6266 O  O   . PRO B 1 317 ? 25.677 47.930 64.781  1.00 21.17 ? 339 PRO B O   1 
ATOM   6267 C  CB  . PRO B 1 317 ? 26.543 49.833 62.277  1.00 23.63 ? 339 PRO B CB  1 
ATOM   6268 C  CG  . PRO B 1 317 ? 25.716 50.213 61.098  1.00 24.89 ? 339 PRO B CG  1 
ATOM   6269 C  CD  . PRO B 1 317 ? 25.690 48.987 60.225  1.00 24.92 ? 339 PRO B CD  1 
ATOM   6270 N  N   . VAL B 1 318 ? 23.970 48.299 63.339  1.00 20.02 ? 340 VAL B N   1 
ATOM   6271 C  CA  . VAL B 1 318 ? 22.943 48.177 64.377  1.00 18.60 ? 340 VAL B CA  1 
ATOM   6272 C  C   . VAL B 1 318 ? 22.909 46.728 64.880  1.00 17.89 ? 340 VAL B C   1 
ATOM   6273 O  O   . VAL B 1 318 ? 22.888 46.486 66.077  1.00 17.85 ? 340 VAL B O   1 
ATOM   6274 C  CB  . VAL B 1 318 ? 21.540 48.699 63.916  1.00 17.90 ? 340 VAL B CB  1 
ATOM   6275 C  CG1 . VAL B 1 318 ? 20.441 48.388 64.941  1.00 15.93 ? 340 VAL B CG1 1 
ATOM   6276 C  CG2 . VAL B 1 318 ? 21.592 50.200 63.654  1.00 18.55 ? 340 VAL B CG2 1 
ATOM   6277 N  N   . LEU B 1 319 ? 22.918 45.779 63.956  1.00 17.92 ? 341 LEU B N   1 
ATOM   6278 C  CA  . LEU B 1 319 ? 22.960 44.366 64.313  1.00 17.81 ? 341 LEU B CA  1 
ATOM   6279 C  C   . LEU B 1 319 ? 24.253 43.979 65.040  1.00 17.71 ? 341 LEU B C   1 
ATOM   6280 O  O   . LEU B 1 319 ? 24.227 43.122 65.929  1.00 17.68 ? 341 LEU B O   1 
ATOM   6281 C  CB  . LEU B 1 319 ? 22.743 43.494 63.076  1.00 17.41 ? 341 LEU B CB  1 
ATOM   6282 C  CG  . LEU B 1 319 ? 22.675 41.973 63.258  1.00 17.11 ? 341 LEU B CG  1 
ATOM   6283 C  CD1 . LEU B 1 319 ? 21.631 41.559 64.326  1.00 15.00 ? 341 LEU B CD1 1 
ATOM   6284 C  CD2 . LEU B 1 319 ? 22.429 41.292 61.905  1.00 14.79 ? 341 LEU B CD2 1 
ATOM   6285 N  N   . ASP B 1 320 ? 25.368 44.600 64.647  1.00 17.44 ? 342 ASP B N   1 
ATOM   6286 C  CA  . ASP B 1 320 ? 26.660 44.454 65.334  1.00 17.46 ? 342 ASP B CA  1 
ATOM   6287 C  C   . ASP B 1 320 ? 26.543 44.847 66.807  1.00 17.02 ? 342 ASP B C   1 
ATOM   6288 O  O   . ASP B 1 320 ? 26.963 44.108 67.691  1.00 16.54 ? 342 ASP B O   1 
ATOM   6289 C  CB  . ASP B 1 320 ? 27.747 45.301 64.638  1.00 17.11 ? 342 ASP B CB  1 
ATOM   6290 C  CG  . ASP B 1 320 ? 28.313 44.624 63.398  1.00 19.34 ? 342 ASP B CG  1 
ATOM   6291 O  OD1 . ASP B 1 320 ? 28.059 43.422 63.204  1.00 23.09 ? 342 ASP B OD1 1 
ATOM   6292 O  OD2 . ASP B 1 320 ? 29.007 45.281 62.598  1.00 20.96 ? 342 ASP B OD2 1 
ATOM   6293 N  N   . SER B 1 321 ? 25.965 46.015 67.071  1.00 16.72 ? 343 SER B N   1 
ATOM   6294 C  CA  . SER B 1 321 ? 25.757 46.448 68.453  1.00 17.00 ? 343 SER B CA  1 
ATOM   6295 C  C   . SER B 1 321 ? 24.773 45.531 69.210  1.00 17.16 ? 343 SER B C   1 
ATOM   6296 O  O   . SER B 1 321 ? 24.972 45.221 70.384  1.00 17.08 ? 343 SER B O   1 
ATOM   6297 C  CB  . SER B 1 321 ? 25.298 47.904 68.470  1.00 16.43 ? 343 SER B CB  1 
ATOM   6298 O  OG  . SER B 1 321 ? 24.802 48.272 69.736  1.00 18.02 ? 343 SER B OG  1 
ATOM   6299 N  N   . VAL B 1 322 ? 23.711 45.099 68.530  1.00 16.69 ? 344 VAL B N   1 
ATOM   6300 C  CA  . VAL B 1 322 ? 22.778 44.138 69.099  1.00 17.17 ? 344 VAL B CA  1 
ATOM   6301 C  C   . VAL B 1 322 ? 23.494 42.855 69.554  1.00 17.27 ? 344 VAL B C   1 
ATOM   6302 O  O   . VAL B 1 322 ? 23.248 42.351 70.665  1.00 17.74 ? 344 VAL B O   1 
ATOM   6303 C  CB  . VAL B 1 322 ? 21.598 43.847 68.116  1.00 17.10 ? 344 VAL B CB  1 
ATOM   6304 C  CG1 . VAL B 1 322 ? 20.881 42.570 68.472  1.00 17.04 ? 344 VAL B CG1 1 
ATOM   6305 C  CG2 . VAL B 1 322 ? 20.623 45.030 68.126  1.00 17.29 ? 344 VAL B CG2 1 
ATOM   6306 N  N   . LEU B 1 323 ? 24.396 42.350 68.719  1.00 17.09 ? 345 LEU B N   1 
ATOM   6307 C  CA  . LEU B 1 323 ? 25.123 41.135 69.052  1.00 17.59 ? 345 LEU B CA  1 
ATOM   6308 C  C   . LEU B 1 323 ? 26.099 41.353 70.204  1.00 17.78 ? 345 LEU B C   1 
ATOM   6309 O  O   . LEU B 1 323 ? 26.149 40.532 71.125  1.00 17.81 ? 345 LEU B O   1 
ATOM   6310 C  CB  . LEU B 1 323 ? 25.860 40.586 67.828  1.00 17.86 ? 345 LEU B CB  1 
ATOM   6311 C  CG  . LEU B 1 323 ? 26.676 39.290 68.020  1.00 17.15 ? 345 LEU B CG  1 
ATOM   6312 C  CD1 . LEU B 1 323 ? 25.858 38.142 68.639  1.00 19.00 ? 345 LEU B CD1 1 
ATOM   6313 C  CD2 . LEU B 1 323 ? 27.254 38.872 66.685  1.00 16.98 ? 345 LEU B CD2 1 
ATOM   6314 N  N   . SER B 1 324 ? 26.884 42.441 70.147  1.00 17.64 ? 346 SER B N   1 
ATOM   6315 C  CA  . SER B 1 324 ? 27.800 42.775 71.235  1.00 17.64 ? 346 SER B CA  1 
ATOM   6316 C  C   . SER B 1 324 ? 27.031 42.948 72.536  1.00 17.76 ? 346 SER B C   1 
ATOM   6317 O  O   . SER B 1 324 ? 27.522 42.562 73.587  1.00 17.98 ? 346 SER B O   1 
ATOM   6318 C  CB  . SER B 1 324 ? 28.588 44.049 70.945  1.00 18.19 ? 346 SER B CB  1 
ATOM   6319 O  OG  . SER B 1 324 ? 29.304 43.931 69.730  1.00 19.88 ? 346 SER B OG  1 
ATOM   6320 N  N   . GLU B 1 325 ? 25.813 43.482 72.448  1.00 17.73 ? 347 GLU B N   1 
ATOM   6321 C  CA  . GLU B 1 325 ? 24.972 43.689 73.631  1.00 18.34 ? 347 GLU B CA  1 
ATOM   6322 C  C   . GLU B 1 325 ? 24.381 42.397 74.198  1.00 18.12 ? 347 GLU B C   1 
ATOM   6323 O  O   . GLU B 1 325 ? 24.311 42.238 75.418  1.00 18.88 ? 347 GLU B O   1 
ATOM   6324 C  CB  . GLU B 1 325 ? 23.904 44.769 73.392  1.00 17.99 ? 347 GLU B CB  1 
ATOM   6325 C  CG  . GLU B 1 325 ? 22.957 45.006 74.572  1.00 19.71 ? 347 GLU B CG  1 
ATOM   6326 C  CD  . GLU B 1 325 ? 23.589 45.751 75.738  1.00 21.67 ? 347 GLU B CD  1 
ATOM   6327 O  OE1 . GLU B 1 325 ? 24.828 45.930 75.754  1.00 22.33 ? 347 GLU B OE1 1 
ATOM   6328 O  OE2 . GLU B 1 325 ? 22.833 46.160 76.647  1.00 21.49 ? 347 GLU B OE2 1 
ATOM   6329 N  N   . SER B 1 326 ? 23.993 41.463 73.339  1.00 18.09 ? 348 SER B N   1 
ATOM   6330 C  CA  . SER B 1 326 ? 23.533 40.150 73.825  1.00 18.18 ? 348 SER B CA  1 
ATOM   6331 C  C   . SER B 1 326 ? 24.675 39.366 74.470  1.00 17.46 ? 348 SER B C   1 
ATOM   6332 O  O   . SER B 1 326 ? 24.500 38.767 75.529  1.00 17.61 ? 348 SER B O   1 
ATOM   6333 C  CB  . SER B 1 326 ? 22.889 39.329 72.703  1.00 18.46 ? 348 SER B CB  1 
ATOM   6334 O  OG  . SER B 1 326 ? 21.954 40.108 71.969  1.00 21.63 ? 348 SER B OG  1 
ATOM   6335 N  N   . LEU B 1 327 ? 25.849 39.383 73.828  1.00 16.14 ? 349 LEU B N   1 
ATOM   6336 C  CA  . LEU B 1 327 ? 27.035 38.733 74.365  1.00 14.69 ? 349 LEU B CA  1 
ATOM   6337 C  C   . LEU B 1 327 ? 27.465 39.298 75.723  1.00 14.81 ? 349 LEU B C   1 
ATOM   6338 O  O   . LEU B 1 327 ? 27.897 38.548 76.604  1.00 14.21 ? 349 LEU B O   1 
ATOM   6339 C  CB  . LEU B 1 327 ? 28.190 38.808 73.353  1.00 14.30 ? 349 LEU B CB  1 
ATOM   6340 C  CG  . LEU B 1 327 ? 27.937 37.954 72.103  1.00 13.28 ? 349 LEU B CG  1 
ATOM   6341 C  CD1 . LEU B 1 327 ? 29.005 38.108 71.034  1.00 10.29 ? 349 LEU B CD1 1 
ATOM   6342 C  CD2 . LEU B 1 327 ? 27.722 36.473 72.477  1.00 13.21 ? 349 LEU B CD2 1 
ATOM   6343 N  N   . ARG B 1 328 ? 27.353 40.617 75.884  1.00 14.07 ? 350 ARG B N   1 
ATOM   6344 C  CA  . ARG B 1 328 ? 27.775 41.274 77.113  1.00 14.57 ? 350 ARG B CA  1 
ATOM   6345 C  C   . ARG B 1 328 ? 26.973 40.741 78.277  1.00 15.36 ? 350 ARG B C   1 
ATOM   6346 O  O   . ARG B 1 328 ? 27.534 40.452 79.331  1.00 16.29 ? 350 ARG B O   1 
ATOM   6347 C  CB  . ARG B 1 328 ? 27.654 42.799 77.022  1.00 14.33 ? 350 ARG B CB  1 
ATOM   6348 C  CG  . ARG B 1 328 ? 28.040 43.548 78.303  1.00 14.27 ? 350 ARG B CG  1 
ATOM   6349 C  CD  . ARG B 1 328 ? 27.625 45.043 78.280  1.00 14.46 ? 350 ARG B CD  1 
ATOM   6350 N  NE  . ARG B 1 328 ? 26.173 45.229 78.208  1.00 13.18 ? 350 ARG B NE  1 
ATOM   6351 C  CZ  . ARG B 1 328 ? 25.333 45.172 79.256  1.00 14.85 ? 350 ARG B CZ  1 
ATOM   6352 N  NH1 . ARG B 1 328 ? 25.786 44.904 80.468  1.00 14.86 ? 350 ARG B NH1 1 
ATOM   6353 N  NH2 . ARG B 1 328 ? 24.019 45.351 79.084  1.00 13.89 ? 350 ARG B NH2 1 
ATOM   6354 N  N   . LEU B 1 329 ? 25.666 40.599 78.069  1.00 15.68 ? 351 LEU B N   1 
ATOM   6355 C  CA  . LEU B 1 329 ? 24.761 40.070 79.085  1.00 16.60 ? 351 LEU B CA  1 
ATOM   6356 C  C   . LEU B 1 329 ? 24.878 38.559 79.297  1.00 16.83 ? 351 LEU B C   1 
ATOM   6357 O  O   . LEU B 1 329 ? 24.581 38.091 80.381  1.00 17.85 ? 351 LEU B O   1 
ATOM   6358 C  CB  . LEU B 1 329 ? 23.324 40.397 78.693  1.00 16.24 ? 351 LEU B CB  1 
ATOM   6359 C  CG  . LEU B 1 329 ? 22.830 41.848 78.779  1.00 18.71 ? 351 LEU B CG  1 
ATOM   6360 C  CD1 . LEU B 1 329 ? 21.576 42.024 77.887  1.00 16.54 ? 351 LEU B CD1 1 
ATOM   6361 C  CD2 . LEU B 1 329 ? 22.498 42.189 80.231  1.00 18.47 ? 351 LEU B CD2 1 
ATOM   6362 N  N   . THR B 1 330 ? 25.285 37.799 78.268  1.00 16.90 ? 352 THR B N   1 
ATOM   6363 C  CA  . THR B 1 330 ? 25.105 36.329 78.296  1.00 16.44 ? 352 THR B CA  1 
ATOM   6364 C  C   . THR B 1 330 ? 26.335 35.430 78.128  1.00 16.49 ? 352 THR B C   1 
ATOM   6365 O  O   . THR B 1 330 ? 26.243 34.203 78.328  1.00 16.76 ? 352 THR B O   1 
ATOM   6366 C  CB  . THR B 1 330 ? 23.990 35.857 77.333  1.00 16.86 ? 352 THR B CB  1 
ATOM   6367 O  OG1 . THR B 1 330 ? 24.346 36.156 75.976  1.00 15.18 ? 352 THR B OG1 1 
ATOM   6368 C  CG2 . THR B 1 330 ? 22.638 36.514 77.685  1.00 14.95 ? 352 THR B CG2 1 
ATOM   6369 N  N   . ALA B 1 331 ? 27.470 36.017 77.763  1.00 16.06 ? 353 ALA B N   1 
ATOM   6370 C  CA  . ALA B 1 331 ? 28.679 35.244 77.636  1.00 16.24 ? 353 ALA B CA  1 
ATOM   6371 C  C   . ALA B 1 331 ? 29.431 35.255 78.954  1.00 16.44 ? 353 ALA B C   1 
ATOM   6372 O  O   . ALA B 1 331 ? 29.826 36.317 79.442  1.00 16.58 ? 353 ALA B O   1 
ATOM   6373 C  CB  . ALA B 1 331 ? 29.555 35.742 76.469  1.00 14.84 ? 353 ALA B CB  1 
ATOM   6374 N  N   . ALA B 1 332 ? 29.641 34.071 79.525  1.00 17.09 ? 354 ALA B N   1 
ATOM   6375 C  CA  . ALA B 1 332 ? 30.298 33.963 80.839  1.00 17.46 ? 354 ALA B CA  1 
ATOM   6376 C  C   . ALA B 1 332 ? 31.406 32.911 80.931  1.00 18.00 ? 354 ALA B C   1 
ATOM   6377 O  O   . ALA B 1 332 ? 31.370 32.058 81.826  1.00 18.02 ? 354 ALA B O   1 
ATOM   6378 C  CB  . ALA B 1 332 ? 29.249 33.727 81.922  1.00 17.37 ? 354 ALA B CB  1 
ATOM   6379 N  N   . PRO B 1 333 ? 32.410 32.967 80.024  1.00 17.94 ? 355 PRO B N   1 
ATOM   6380 C  CA  . PRO B 1 333 ? 33.545 32.044 80.182  1.00 17.11 ? 355 PRO B CA  1 
ATOM   6381 C  C   . PRO B 1 333 ? 34.538 32.472 81.283  1.00 17.40 ? 355 PRO B C   1 
ATOM   6382 O  O   . PRO B 1 333 ? 34.640 33.655 81.608  1.00 16.76 ? 355 PRO B O   1 
ATOM   6383 C  CB  . PRO B 1 333 ? 34.218 32.095 78.803  1.00 16.74 ? 355 PRO B CB  1 
ATOM   6384 C  CG  . PRO B 1 333 ? 33.971 33.482 78.333  1.00 16.91 ? 355 PRO B CG  1 
ATOM   6385 C  CD  . PRO B 1 333 ? 32.567 33.818 78.824  1.00 17.24 ? 355 PRO B CD  1 
ATOM   6386 N  N   . PHE B 1 334 ? 35.247 31.498 81.857  1.00 17.65 ? 356 PHE B N   1 
ATOM   6387 C  CA  . PHE B 1 334 ? 36.372 31.780 82.726  1.00 18.36 ? 356 PHE B CA  1 
ATOM   6388 C  C   . PHE B 1 334 ? 37.613 31.977 81.848  1.00 19.12 ? 356 PHE B C   1 
ATOM   6389 O  O   . PHE B 1 334 ? 37.824 31.241 80.877  1.00 19.50 ? 356 PHE B O   1 
ATOM   6390 C  CB  . PHE B 1 334 ? 36.628 30.631 83.718  1.00 18.09 ? 356 PHE B CB  1 
ATOM   6391 C  CG  . PHE B 1 334 ? 35.524 30.421 84.743  1.00 18.79 ? 356 PHE B CG  1 
ATOM   6392 C  CD1 . PHE B 1 334 ? 34.686 31.472 85.142  1.00 19.56 ? 356 PHE B CD1 1 
ATOM   6393 C  CD2 . PHE B 1 334 ? 35.339 29.172 85.319  1.00 18.40 ? 356 PHE B CD2 1 
ATOM   6394 C  CE1 . PHE B 1 334 ? 33.663 31.259 86.080  1.00 19.52 ? 356 PHE B CE1 1 
ATOM   6395 C  CE2 . PHE B 1 334 ? 34.327 28.951 86.248  1.00 18.17 ? 356 PHE B CE2 1 
ATOM   6396 C  CZ  . PHE B 1 334 ? 33.490 30.004 86.631  1.00 20.49 ? 356 PHE B CZ  1 
ATOM   6397 N  N   . ILE B 1 335 ? 38.422 32.975 82.169  1.00 19.32 ? 357 ILE B N   1 
ATOM   6398 C  CA  . ILE B 1 335 ? 39.743 33.068 81.572  1.00 20.39 ? 357 ILE B CA  1 
ATOM   6399 C  C   . ILE B 1 335 ? 40.684 32.628 82.669  1.00 20.82 ? 357 ILE B C   1 
ATOM   6400 O  O   . ILE B 1 335 ? 40.735 33.255 83.722  1.00 20.88 ? 357 ILE B O   1 
ATOM   6401 C  CB  . ILE B 1 335 ? 40.058 34.487 81.043  1.00 20.00 ? 357 ILE B CB  1 
ATOM   6402 C  CG1 . ILE B 1 335 ? 39.042 34.863 79.968  1.00 20.71 ? 357 ILE B CG1 1 
ATOM   6403 C  CG2 . ILE B 1 335 ? 41.490 34.545 80.482  1.00 20.36 ? 357 ILE B CG2 1 
ATOM   6404 C  CD1 . ILE B 1 335 ? 39.068 36.302 79.575  1.00 24.65 ? 357 ILE B CD1 1 
ATOM   6405 N  N   . THR B 1 336 ? 41.405 31.542 82.413  1.00 21.25 ? 358 THR B N   1 
ATOM   6406 C  CA  . THR B 1 336 ? 42.139 30.816 83.442  1.00 22.44 ? 358 THR B CA  1 
ATOM   6407 C  C   . THR B 1 336 ? 43.595 30.538 83.045  1.00 21.98 ? 358 THR B C   1 
ATOM   6408 O  O   . THR B 1 336 ? 43.897 30.238 81.885  1.00 21.57 ? 358 THR B O   1 
ATOM   6409 C  CB  . THR B 1 336 ? 41.407 29.489 83.776  1.00 23.21 ? 358 THR B CB  1 
ATOM   6410 O  OG1 . THR B 1 336 ? 40.311 29.759 84.667  1.00 26.68 ? 358 THR B OG1 1 
ATOM   6411 C  CG2 . THR B 1 336 ? 42.328 28.509 84.449  1.00 24.43 ? 358 THR B CG2 1 
ATOM   6412 N  N   . ARG B 1 337 ? 44.490 30.671 84.015  1.00 21.82 ? 359 ARG B N   1 
ATOM   6413 C  CA  . ARG B 1 337 ? 45.901 30.381 83.824  1.00 22.43 ? 359 ARG B CA  1 
ATOM   6414 C  C   . ARG B 1 337 ? 46.410 29.588 85.008  1.00 22.75 ? 359 ARG B C   1 
ATOM   6415 O  O   . ARG B 1 337 ? 45.966 29.791 86.140  1.00 22.15 ? 359 ARG B O   1 
ATOM   6416 C  CB  . ARG B 1 337 ? 46.719 31.676 83.702  1.00 22.17 ? 359 ARG B CB  1 
ATOM   6417 C  CG  . ARG B 1 337 ? 46.342 32.561 82.520  1.00 22.64 ? 359 ARG B CG  1 
ATOM   6418 C  CD  . ARG B 1 337 ? 46.814 31.957 81.188  1.00 23.11 ? 359 ARG B CD  1 
ATOM   6419 N  NE  . ARG B 1 337 ? 46.590 32.875 80.076  1.00 24.22 ? 359 ARG B NE  1 
ATOM   6420 C  CZ  . ARG B 1 337 ? 45.464 32.966 79.362  1.00 23.92 ? 359 ARG B CZ  1 
ATOM   6421 N  NH1 . ARG B 1 337 ? 44.415 32.197 79.630  1.00 23.15 ? 359 ARG B NH1 1 
ATOM   6422 N  NH2 . ARG B 1 337 ? 45.394 33.839 78.368  1.00 24.49 ? 359 ARG B NH2 1 
ATOM   6423 N  N   . GLU B 1 338 ? 47.340 28.675 84.738  1.00 23.38 ? 360 GLU B N   1 
ATOM   6424 C  CA  . GLU B 1 338 ? 48.085 27.999 85.791  1.00 23.70 ? 360 GLU B CA  1 
ATOM   6425 C  C   . GLU B 1 338 ? 49.355 28.815 86.040  1.00 23.30 ? 360 GLU B C   1 
ATOM   6426 O  O   . GLU B 1 338 ? 50.033 29.203 85.081  1.00 22.19 ? 360 GLU B O   1 
ATOM   6427 C  CB  . GLU B 1 338 ? 48.451 26.572 85.360  1.00 24.37 ? 360 GLU B CB  1 
ATOM   6428 C  CG  . GLU B 1 338 ? 47.246 25.590 85.239  1.00 28.39 ? 360 GLU B CG  1 
ATOM   6429 C  CD  . GLU B 1 338 ? 46.433 25.473 86.532  1.00 33.34 ? 360 GLU B CD  1 
ATOM   6430 O  OE1 . GLU B 1 338 ? 47.040 25.270 87.610  1.00 36.41 ? 360 GLU B OE1 1 
ATOM   6431 O  OE2 . GLU B 1 338 ? 45.191 25.585 86.475  1.00 35.43 ? 360 GLU B OE2 1 
ATOM   6432 N  N   . VAL B 1 339 ? 49.672 29.071 87.310  1.00 22.49 ? 361 VAL B N   1 
ATOM   6433 C  CA  . VAL B 1 339 ? 50.912 29.762 87.662  1.00 22.99 ? 361 VAL B CA  1 
ATOM   6434 C  C   . VAL B 1 339 ? 52.081 28.767 87.638  1.00 23.01 ? 361 VAL B C   1 
ATOM   6435 O  O   . VAL B 1 339 ? 52.119 27.839 88.440  1.00 23.64 ? 361 VAL B O   1 
ATOM   6436 C  CB  . VAL B 1 339 ? 50.849 30.443 89.070  1.00 22.78 ? 361 VAL B CB  1 
ATOM   6437 C  CG1 . VAL B 1 339 ? 52.189 31.136 89.387  1.00 23.57 ? 361 VAL B CG1 1 
ATOM   6438 C  CG2 . VAL B 1 339 ? 49.696 31.446 89.158  1.00 22.98 ? 361 VAL B CG2 1 
ATOM   6439 N  N   . VAL B 1 340 ? 53.032 28.990 86.735  1.00 23.35 ? 362 VAL B N   1 
ATOM   6440 C  CA  . VAL B 1 340 ? 54.120 28.056 86.465  1.00 24.17 ? 362 VAL B CA  1 
ATOM   6441 C  C   . VAL B 1 340 ? 55.202 28.110 87.539  1.00 24.41 ? 362 VAL B C   1 
ATOM   6442 O  O   . VAL B 1 340 ? 55.764 27.079 87.913  1.00 24.36 ? 362 VAL B O   1 
ATOM   6443 C  CB  . VAL B 1 340 ? 54.764 28.321 85.076  1.00 24.34 ? 362 VAL B CB  1 
ATOM   6444 C  CG1 . VAL B 1 340 ? 55.943 27.396 84.834  1.00 25.21 ? 362 VAL B CG1 1 
ATOM   6445 C  CG2 . VAL B 1 340 ? 53.747 28.157 83.981  1.00 24.40 ? 362 VAL B CG2 1 
ATOM   6446 N  N   . VAL B 1 341 ? 55.470 29.319 88.032  1.00 24.34 ? 363 VAL B N   1 
ATOM   6447 C  CA  . VAL B 1 341 ? 56.529 29.560 88.998  1.00 24.88 ? 363 VAL B CA  1 
ATOM   6448 C  C   . VAL B 1 341 ? 56.080 30.681 89.933  1.00 24.85 ? 363 VAL B C   1 
ATOM   6449 O  O   . VAL B 1 341 ? 55.291 31.519 89.527  1.00 24.70 ? 363 VAL B O   1 
ATOM   6450 C  CB  . VAL B 1 341 ? 57.845 29.975 88.282  1.00 24.70 ? 363 VAL B CB  1 
ATOM   6451 C  CG1 . VAL B 1 341 ? 57.630 31.204 87.390  1.00 24.98 ? 363 VAL B CG1 1 
ATOM   6452 C  CG2 . VAL B 1 341 ? 58.931 30.262 89.290  1.00 26.44 ? 363 VAL B CG2 1 
ATOM   6453 N  N   . ASP B 1 342 ? 56.577 30.688 91.173  1.00 24.80 ? 364 ASP B N   1 
ATOM   6454 C  CA  . ASP B 1 342 ? 56.424 31.836 92.072  1.00 24.69 ? 364 ASP B CA  1 
ATOM   6455 C  C   . ASP B 1 342 ? 56.752 33.128 91.305  1.00 24.08 ? 364 ASP B C   1 
ATOM   6456 O  O   . ASP B 1 342 ? 57.821 33.246 90.722  1.00 23.95 ? 364 ASP B O   1 
ATOM   6457 C  CB  . ASP B 1 342 ? 57.374 31.703 93.267  1.00 25.38 ? 364 ASP B CB  1 
ATOM   6458 C  CG  . ASP B 1 342 ? 56.835 30.796 94.366  1.00 27.47 ? 364 ASP B CG  1 
ATOM   6459 O  OD1 . ASP B 1 342 ? 55.880 30.018 94.133  1.00 28.43 ? 364 ASP B OD1 1 
ATOM   6460 O  OD2 . ASP B 1 342 ? 57.387 30.868 95.487  1.00 30.15 ? 364 ASP B OD2 1 
ATOM   6461 N  N   . LEU B 1 343 ? 55.822 34.076 91.285  1.00 23.59 ? 365 LEU B N   1 
ATOM   6462 C  CA  . LEU B 1 343 ? 55.995 35.303 90.504  1.00 23.04 ? 365 LEU B CA  1 
ATOM   6463 C  C   . LEU B 1 343 ? 55.138 36.450 91.020  1.00 23.14 ? 365 LEU B C   1 
ATOM   6464 O  O   . LEU B 1 343 ? 54.146 36.232 91.735  1.00 22.82 ? 365 LEU B O   1 
ATOM   6465 C  CB  . LEU B 1 343 ? 55.681 35.039 89.020  1.00 22.86 ? 365 LEU B CB  1 
ATOM   6466 C  CG  . LEU B 1 343 ? 54.297 34.467 88.641  1.00 22.55 ? 365 LEU B CG  1 
ATOM   6467 C  CD1 . LEU B 1 343 ? 53.212 35.530 88.683  1.00 19.35 ? 365 LEU B CD1 1 
ATOM   6468 C  CD2 . LEU B 1 343 ? 54.348 33.838 87.243  1.00 24.01 ? 365 LEU B CD2 1 
ATOM   6469 N  N   . ALA B 1 344 ? 55.522 37.663 90.623  1.00 23.50 ? 366 ALA B N   1 
ATOM   6470 C  CA  . ALA B 1 344 ? 54.782 38.886 90.897  1.00 23.93 ? 366 ALA B CA  1 
ATOM   6471 C  C   . ALA B 1 344 ? 53.952 39.264 89.681  1.00 24.48 ? 366 ALA B C   1 
ATOM   6472 O  O   . ALA B 1 344 ? 54.466 39.333 88.571  1.00 24.90 ? 366 ALA B O   1 
ATOM   6473 C  CB  . ALA B 1 344 ? 55.733 40.016 91.248  1.00 23.74 ? 366 ALA B CB  1 
ATOM   6474 N  N   . MET B 1 345 ? 52.666 39.497 89.918  1.00 25.19 ? 367 MET B N   1 
ATOM   6475 C  CA  . MET B 1 345 ? 51.668 39.809 88.896  1.00 25.72 ? 367 MET B CA  1 
ATOM   6476 C  C   . MET B 1 345 ? 51.376 41.306 89.036  1.00 26.25 ? 367 MET B C   1 
ATOM   6477 O  O   . MET B 1 345 ? 50.883 41.744 90.068  1.00 25.17 ? 367 MET B O   1 
ATOM   6478 C  CB  . MET B 1 345 ? 50.390 38.990 89.152  1.00 25.28 ? 367 MET B CB  1 
ATOM   6479 C  CG  . MET B 1 345 ? 49.378 38.915 87.983  1.00 26.42 ? 367 MET B CG  1 
ATOM   6480 S  SD  . MET B 1 345 ? 47.641 38.811 88.517  1.00 23.16 ? 367 MET B SD  1 
ATOM   6481 C  CE  . MET B 1 345 ? 47.522 40.388 89.302  1.00 26.47 ? 367 MET B CE  1 
ATOM   6482 N  N   . PRO B 1 346 ? 51.727 42.102 88.011  1.00 27.25 ? 368 PRO B N   1 
ATOM   6483 C  CA  . PRO B 1 346 ? 51.514 43.549 88.075  1.00 27.35 ? 368 PRO B CA  1 
ATOM   6484 C  C   . PRO B 1 346 ? 50.046 43.909 87.912  1.00 27.15 ? 368 PRO B C   1 
ATOM   6485 O  O   . PRO B 1 346 ? 49.328 43.211 87.209  1.00 27.12 ? 368 PRO B O   1 
ATOM   6486 C  CB  . PRO B 1 346 ? 52.347 44.076 86.900  1.00 27.90 ? 368 PRO B CB  1 
ATOM   6487 C  CG  . PRO B 1 346 ? 52.407 42.951 85.940  1.00 28.03 ? 368 PRO B CG  1 
ATOM   6488 C  CD  . PRO B 1 346 ? 52.370 41.688 86.751  1.00 27.50 ? 368 PRO B CD  1 
ATOM   6489 N  N   . MET B 1 347 ? 49.621 44.960 88.612  1.00 27.16 ? 369 MET B N   1 
ATOM   6490 C  CA  . MET B 1 347 ? 48.307 45.570 88.471  1.00 26.93 ? 369 MET B CA  1 
ATOM   6491 C  C   . MET B 1 347 ? 48.479 46.898 87.712  1.00 28.55 ? 369 MET B C   1 
ATOM   6492 O  O   . MET B 1 347 ? 49.545 47.515 87.772  1.00 28.92 ? 369 MET B O   1 
ATOM   6493 C  CB  . MET B 1 347 ? 47.645 45.811 89.842  1.00 26.34 ? 369 MET B CB  1 
ATOM   6494 C  CG  . MET B 1 347 ? 47.471 44.566 90.730  1.00 23.04 ? 369 MET B CG  1 
ATOM   6495 S  SD  . MET B 1 347 ? 46.254 43.395 90.081  1.00 14.66 ? 369 MET B SD  1 
ATOM   6496 C  CE  . MET B 1 347 ? 44.814 44.039 90.805  1.00 11.88 ? 369 MET B CE  1 
ATOM   6497 N  N   . ALA B 1 348 ? 47.438 47.322 86.993  1.00 29.72 ? 370 ALA B N   1 
ATOM   6498 C  CA  . ALA B 1 348 ? 47.498 48.516 86.139  1.00 31.26 ? 370 ALA B CA  1 
ATOM   6499 C  C   . ALA B 1 348 ? 47.822 49.785 86.917  1.00 32.43 ? 370 ALA B C   1 
ATOM   6500 O  O   . ALA B 1 348 ? 48.516 50.669 86.404  1.00 33.46 ? 370 ALA B O   1 
ATOM   6501 C  CB  . ALA B 1 348 ? 46.202 48.692 85.394  1.00 30.70 ? 370 ALA B CB  1 
ATOM   6502 N  N   . ASP B 1 349 ? 47.325 49.856 88.150  1.00 33.34 ? 371 ASP B N   1 
ATOM   6503 C  CA  . ASP B 1 349 ? 47.523 50.996 89.043  1.00 34.47 ? 371 ASP B CA  1 
ATOM   6504 C  C   . ASP B 1 349 ? 48.904 51.026 89.720  1.00 34.15 ? 371 ASP B C   1 
ATOM   6505 O  O   . ASP B 1 349 ? 49.189 51.935 90.502  1.00 34.78 ? 371 ASP B O   1 
ATOM   6506 C  CB  . ASP B 1 349 ? 46.435 50.978 90.120  1.00 35.01 ? 371 ASP B CB  1 
ATOM   6507 C  CG  . ASP B 1 349 ? 46.539 49.748 91.012  1.00 37.53 ? 371 ASP B CG  1 
ATOM   6508 O  OD1 . ASP B 1 349 ? 47.600 49.570 91.650  1.00 38.07 ? 371 ASP B OD1 1 
ATOM   6509 O  OD2 . ASP B 1 349 ? 45.581 48.947 91.049  1.00 40.33 ? 371 ASP B OD2 1 
ATOM   6510 N  N   . GLY B 1 350 ? 49.747 50.033 89.449  1.00 34.03 ? 372 GLY B N   1 
ATOM   6511 C  CA  . GLY B 1 350 ? 51.116 50.028 89.964  1.00 33.16 ? 372 GLY B CA  1 
ATOM   6512 C  C   . GLY B 1 350 ? 51.450 48.989 91.030  1.00 33.20 ? 372 GLY B C   1 
ATOM   6513 O  O   . GLY B 1 350 ? 52.628 48.700 91.261  1.00 33.13 ? 372 GLY B O   1 
ATOM   6514 N  N   . ARG B 1 351 ? 50.430 48.438 91.689  1.00 32.86 ? 373 ARG B N   1 
ATOM   6515 C  CA  . ARG B 1 351 ? 50.618 47.345 92.658  1.00 32.56 ? 373 ARG B CA  1 
ATOM   6516 C  C   . ARG B 1 351 ? 51.143 46.082 91.946  1.00 31.88 ? 373 ARG B C   1 
ATOM   6517 O  O   . ARG B 1 351 ? 50.945 45.927 90.741  1.00 32.10 ? 373 ARG B O   1 
ATOM   6518 C  CB  . ARG B 1 351 ? 49.290 47.038 93.369  1.00 33.18 ? 373 ARG B CB  1 
ATOM   6519 C  CG  . ARG B 1 351 ? 48.786 48.110 94.333  1.00 33.97 ? 373 ARG B CG  1 
ATOM   6520 C  CD  . ARG B 1 351 ? 47.284 48.369 94.168  1.00 38.37 ? 373 ARG B CD  1 
ATOM   6521 N  NE  . ARG B 1 351 ? 46.419 47.283 94.641  1.00 40.64 ? 373 ARG B NE  1 
ATOM   6522 C  CZ  . ARG B 1 351 ? 45.190 47.040 94.187  1.00 42.04 ? 373 ARG B CZ  1 
ATOM   6523 N  NH1 . ARG B 1 351 ? 44.665 47.780 93.225  1.00 42.48 ? 373 ARG B NH1 1 
ATOM   6524 N  NH2 . ARG B 1 351 ? 44.482 46.036 94.685  1.00 43.96 ? 373 ARG B NH2 1 
ATOM   6525 N  N   . GLU B 1 352 ? 51.868 45.227 92.669  1.00 30.51 ? 374 GLU B N   1 
ATOM   6526 C  CA  . GLU B 1 352 ? 52.191 43.875 92.213  1.00 29.24 ? 374 GLU B CA  1 
ATOM   6527 C  C   . GLU B 1 352 ? 51.740 42.899 93.300  1.00 28.32 ? 374 GLU B C   1 
ATOM   6528 O  O   . GLU B 1 352 ? 51.835 43.207 94.496  1.00 27.65 ? 374 GLU B O   1 
ATOM   6529 C  CB  . GLU B 1 352 ? 53.697 43.682 91.959  1.00 29.82 ? 374 GLU B CB  1 
ATOM   6530 C  CG  . GLU B 1 352 ? 54.214 44.199 90.612  1.00 31.73 ? 374 GLU B CG  1 
ATOM   6531 C  CD  . GLU B 1 352 ? 55.715 44.010 90.426  1.00 34.14 ? 374 GLU B CD  1 
ATOM   6532 O  OE1 . GLU B 1 352 ? 56.127 43.458 89.383  1.00 36.44 ? 374 GLU B OE1 1 
ATOM   6533 O  OE2 . GLU B 1 352 ? 56.498 44.414 91.312  1.00 35.96 ? 374 GLU B OE2 1 
ATOM   6534 N  N   . PHE B 1 353 ? 51.262 41.728 92.886  1.00 26.63 ? 375 PHE B N   1 
ATOM   6535 C  CA  . PHE B 1 353 ? 50.874 40.686 93.822  1.00 25.36 ? 375 PHE B CA  1 
ATOM   6536 C  C   . PHE B 1 353 ? 51.604 39.393 93.536  1.00 24.75 ? 375 PHE B C   1 
ATOM   6537 O  O   . PHE B 1 353 ? 51.751 38.994 92.382  1.00 23.97 ? 375 PHE B O   1 
ATOM   6538 C  CB  . PHE B 1 353 ? 49.359 40.451 93.804  1.00 25.26 ? 375 PHE B CB  1 
ATOM   6539 C  CG  . PHE B 1 353 ? 48.575 41.550 94.448  1.00 24.96 ? 375 PHE B CG  1 
ATOM   6540 C  CD1 . PHE B 1 353 ? 48.413 41.593 95.835  1.00 26.35 ? 375 PHE B CD1 1 
ATOM   6541 C  CD2 . PHE B 1 353 ? 48.020 42.564 93.683  1.00 24.92 ? 375 PHE B CD2 1 
ATOM   6542 C  CE1 . PHE B 1 353 ? 47.690 42.627 96.449  1.00 24.29 ? 375 PHE B CE1 1 
ATOM   6543 C  CE2 . PHE B 1 353 ? 47.295 43.608 94.289  1.00 25.54 ? 375 PHE B CE2 1 
ATOM   6544 C  CZ  . PHE B 1 353 ? 47.130 43.636 95.668  1.00 24.82 ? 375 PHE B CZ  1 
ATOM   6545 N  N   . ASN B 1 354 ? 52.046 38.743 94.608  1.00 24.00 ? 376 ASN B N   1 
ATOM   6546 C  CA  . ASN B 1 354 ? 52.767 37.490 94.522  1.00 23.32 ? 376 ASN B CA  1 
ATOM   6547 C  C   . ASN B 1 354 ? 51.843 36.290 94.420  1.00 22.66 ? 376 ASN B C   1 
ATOM   6548 O  O   . ASN B 1 354 ? 50.951 36.087 95.250  1.00 22.71 ? 376 ASN B O   1 
ATOM   6549 C  CB  . ASN B 1 354 ? 53.719 37.350 95.712  1.00 23.02 ? 376 ASN B CB  1 
ATOM   6550 C  CG  . ASN B 1 354 ? 54.675 38.512 95.812  1.00 22.62 ? 376 ASN B CG  1 
ATOM   6551 O  OD1 . ASN B 1 354 ? 55.032 39.111 94.802  1.00 23.64 ? 376 ASN B OD1 1 
ATOM   6552 N  ND2 . ASN B 1 354 ? 55.087 38.849 97.029  1.00 22.38 ? 376 ASN B ND2 1 
ATOM   6553 N  N   . LEU B 1 355 ? 52.068 35.505 93.379  1.00 21.88 ? 377 LEU B N   1 
ATOM   6554 C  CA  . LEU B 1 355 ? 51.321 34.269 93.146  1.00 21.41 ? 377 LEU B CA  1 
ATOM   6555 C  C   . LEU B 1 355 ? 52.287 33.083 93.277  1.00 21.04 ? 377 LEU B C   1 
ATOM   6556 O  O   . LEU B 1 355 ? 53.452 33.185 92.904  1.00 20.73 ? 377 LEU B O   1 
ATOM   6557 C  CB  . LEU B 1 355 ? 50.659 34.310 91.748  1.00 21.11 ? 377 LEU B CB  1 
ATOM   6558 C  CG  . LEU B 1 355 ? 49.957 35.600 91.272  1.00 20.58 ? 377 LEU B CG  1 
ATOM   6559 C  CD1 . LEU B 1 355 ? 49.384 35.409 89.871  1.00 19.42 ? 377 LEU B CD1 1 
ATOM   6560 C  CD2 . LEU B 1 355 ? 48.836 36.064 92.219  1.00 20.30 ? 377 LEU B CD2 1 
ATOM   6561 N  N   . ARG B 1 356 ? 51.822 31.961 93.809  1.00 21.33 ? 378 ARG B N   1 
ATOM   6562 C  CA  . ARG B 1 356 ? 52.720 30.811 93.998  1.00 21.76 ? 378 ARG B CA  1 
ATOM   6563 C  C   . ARG B 1 356 ? 52.599 29.798 92.866  1.00 22.28 ? 378 ARG B C   1 
ATOM   6564 O  O   . ARG B 1 356 ? 51.527 29.649 92.292  1.00 21.89 ? 378 ARG B O   1 
ATOM   6565 C  CB  . ARG B 1 356 ? 52.430 30.084 95.314  1.00 21.45 ? 378 ARG B CB  1 
ATOM   6566 C  CG  . ARG B 1 356 ? 52.244 30.965 96.499  1.00 20.74 ? 378 ARG B CG  1 
ATOM   6567 C  CD  . ARG B 1 356 ? 52.357 30.163 97.799  1.00 20.58 ? 378 ARG B CD  1 
ATOM   6568 N  NE  . ARG B 1 356 ? 51.845 30.962 98.907  1.00 17.07 ? 378 ARG B NE  1 
ATOM   6569 C  CZ  . ARG B 1 356 ? 51.661 30.529 100.151 1.00 19.82 ? 378 ARG B CZ  1 
ATOM   6570 N  NH1 . ARG B 1 356 ? 51.961 29.270 100.496 1.00 17.75 ? 378 ARG B NH1 1 
ATOM   6571 N  NH2 . ARG B 1 356 ? 51.162 31.367 101.054 1.00 16.78 ? 378 ARG B NH2 1 
ATOM   6572 N  N   . ARG B 1 357 ? 53.698 29.100 92.577  1.00 22.96 ? 379 ARG B N   1 
ATOM   6573 C  CA  . ARG B 1 357 ? 53.684 27.912 91.725  1.00 24.12 ? 379 ARG B CA  1 
ATOM   6574 C  C   . ARG B 1 357 ? 52.516 27.011 92.099  1.00 24.15 ? 379 ARG B C   1 
ATOM   6575 O  O   . ARG B 1 357 ? 52.348 26.640 93.271  1.00 23.77 ? 379 ARG B O   1 
ATOM   6576 C  CB  . ARG B 1 357 ? 54.994 27.116 91.893  1.00 24.60 ? 379 ARG B CB  1 
ATOM   6577 C  CG  . ARG B 1 357 ? 55.078 25.843 91.037  1.00 27.67 ? 379 ARG B CG  1 
ATOM   6578 C  CD  . ARG B 1 357 ? 56.450 25.165 91.134  1.00 32.88 ? 379 ARG B CD  1 
ATOM   6579 N  NE  . ARG B 1 357 ? 56.666 24.534 92.440  1.00 38.58 ? 379 ARG B NE  1 
ATOM   6580 C  CZ  . ARG B 1 357 ? 56.428 23.247 92.711  1.00 40.67 ? 379 ARG B CZ  1 
ATOM   6581 N  NH1 . ARG B 1 357 ? 55.966 22.433 91.762  1.00 40.97 ? 379 ARG B NH1 1 
ATOM   6582 N  NH2 . ARG B 1 357 ? 56.650 22.769 93.937  1.00 40.50 ? 379 ARG B NH2 1 
ATOM   6583 N  N   . GLY B 1 358 ? 51.712 26.642 91.105  1.00 24.50 ? 380 GLY B N   1 
ATOM   6584 C  CA  . GLY B 1 358 ? 50.653 25.663 91.341  1.00 23.79 ? 380 GLY B CA  1 
ATOM   6585 C  C   . GLY B 1 358 ? 49.310 26.296 91.598  1.00 23.65 ? 380 GLY B C   1 
ATOM   6586 O  O   . GLY B 1 358 ? 48.278 25.602 91.572  1.00 23.87 ? 380 GLY B O   1 
ATOM   6587 N  N   . ASP B 1 359 ? 49.308 27.608 91.860  1.00 23.07 ? 381 ASP B N   1 
ATOM   6588 C  CA  . ASP B 1 359 ? 48.056 28.364 92.008  1.00 22.37 ? 381 ASP B CA  1 
ATOM   6589 C  C   . ASP B 1 359 ? 47.349 28.457 90.662  1.00 21.82 ? 381 ASP B C   1 
ATOM   6590 O  O   . ASP B 1 359 ? 48.009 28.444 89.613  1.00 20.91 ? 381 ASP B O   1 
ATOM   6591 C  CB  . ASP B 1 359 ? 48.334 29.786 92.520  1.00 22.57 ? 381 ASP B CB  1 
ATOM   6592 C  CG  . ASP B 1 359 ? 48.754 29.818 93.986  1.00 23.92 ? 381 ASP B CG  1 
ATOM   6593 O  OD1 . ASP B 1 359 ? 48.776 28.746 94.631  1.00 24.97 ? 381 ASP B OD1 1 
ATOM   6594 O  OD2 . ASP B 1 359 ? 49.060 30.926 94.492  1.00 26.02 ? 381 ASP B OD2 1 
ATOM   6595 N  N   . ARG B 1 360 ? 46.016 28.540 90.694  1.00 21.37 ? 382 ARG B N   1 
ATOM   6596 C  CA  . ARG B 1 360 ? 45.225 28.893 89.506  1.00 21.17 ? 382 ARG B CA  1 
ATOM   6597 C  C   . ARG B 1 360 ? 44.912 30.388 89.527  1.00 20.70 ? 382 ARG B C   1 
ATOM   6598 O  O   . ARG B 1 360 ? 44.625 30.953 90.574  1.00 21.38 ? 382 ARG B O   1 
ATOM   6599 C  CB  . ARG B 1 360 ? 43.922 28.075 89.446  1.00 21.40 ? 382 ARG B CB  1 
ATOM   6600 C  CG  . ARG B 1 360 ? 43.010 28.401 88.252  1.00 22.02 ? 382 ARG B CG  1 
ATOM   6601 C  CD  . ARG B 1 360 ? 41.958 27.316 88.031  1.00 25.48 ? 382 ARG B CD  1 
ATOM   6602 N  NE  . ARG B 1 360 ? 42.579 26.022 87.760  1.00 27.44 ? 382 ARG B NE  1 
ATOM   6603 C  CZ  . ARG B 1 360 ? 42.001 24.844 87.969  1.00 29.03 ? 382 ARG B CZ  1 
ATOM   6604 N  NH1 . ARG B 1 360 ? 40.769 24.771 88.460  1.00 29.79 ? 382 ARG B NH1 1 
ATOM   6605 N  NH2 . ARG B 1 360 ? 42.671 23.729 87.699  1.00 30.19 ? 382 ARG B NH2 1 
ATOM   6606 N  N   . LEU B 1 361 ? 44.987 31.028 88.373  1.00 20.26 ? 383 LEU B N   1 
ATOM   6607 C  CA  . LEU B 1 361 ? 44.552 32.411 88.226  1.00 20.19 ? 383 LEU B CA  1 
ATOM   6608 C  C   . LEU B 1 361 ? 43.314 32.454 87.332  1.00 20.02 ? 383 LEU B C   1 
ATOM   6609 O  O   . LEU B 1 361 ? 43.316 31.878 86.261  1.00 19.57 ? 383 LEU B O   1 
ATOM   6610 C  CB  . LEU B 1 361 ? 45.679 33.251 87.626  1.00 20.38 ? 383 LEU B CB  1 
ATOM   6611 C  CG  . LEU B 1 361 ? 45.495 34.761 87.467  1.00 21.98 ? 383 LEU B CG  1 
ATOM   6612 C  CD1 . LEU B 1 361 ? 45.303 35.494 88.831  1.00 20.31 ? 383 LEU B CD1 1 
ATOM   6613 C  CD2 . LEU B 1 361 ? 46.711 35.297 86.735  1.00 23.48 ? 383 LEU B CD2 1 
ATOM   6614 N  N   . LEU B 1 362 ? 42.261 33.121 87.803  1.00 20.27 ? 384 LEU B N   1 
ATOM   6615 C  CA  . LEU B 1 362 ? 40.970 33.179 87.120  1.00 20.54 ? 384 LEU B CA  1 
ATOM   6616 C  C   . LEU B 1 362 ? 40.495 34.627 86.904  1.00 20.07 ? 384 LEU B C   1 
ATOM   6617 O  O   . LEU B 1 362 ? 40.527 35.441 87.827  1.00 20.23 ? 384 LEU B O   1 
ATOM   6618 C  CB  . LEU B 1 362 ? 39.916 32.374 87.914  1.00 20.57 ? 384 LEU B CB  1 
ATOM   6619 C  CG  . LEU B 1 362 ? 38.425 32.700 87.753  1.00 22.48 ? 384 LEU B CG  1 
ATOM   6620 C  CD1 . LEU B 1 362 ? 37.927 32.197 86.424  1.00 25.67 ? 384 LEU B CD1 1 
ATOM   6621 C  CD2 . LEU B 1 362 ? 37.582 32.115 88.882  1.00 26.40 ? 384 LEU B CD2 1 
ATOM   6622 N  N   . LEU B 1 363 ? 40.069 34.930 85.677  1.00 20.05 ? 385 LEU B N   1 
ATOM   6623 C  CA  . LEU B 1 363 ? 39.429 36.209 85.335  1.00 19.93 ? 385 LEU B CA  1 
ATOM   6624 C  C   . LEU B 1 363 ? 37.986 35.931 85.038  1.00 19.15 ? 385 LEU B C   1 
ATOM   6625 O  O   . LEU B 1 363 ? 37.689 34.908 84.417  1.00 19.62 ? 385 LEU B O   1 
ATOM   6626 C  CB  . LEU B 1 363 ? 40.083 36.835 84.096  1.00 19.99 ? 385 LEU B CB  1 
ATOM   6627 C  CG  . LEU B 1 363 ? 41.606 36.972 84.077  1.00 22.29 ? 385 LEU B CG  1 
ATOM   6628 C  CD1 . LEU B 1 363 ? 42.085 37.968 83.012  1.00 22.87 ? 385 LEU B CD1 1 
ATOM   6629 C  CD2 . LEU B 1 363 ? 42.157 37.344 85.434  1.00 21.79 ? 385 LEU B CD2 1 
ATOM   6630 N  N   . PHE B 1 364 ? 37.083 36.805 85.480  1.00 18.30 ? 386 PHE B N   1 
ATOM   6631 C  CA  . PHE B 1 364 ? 35.663 36.654 85.150  1.00 17.82 ? 386 PHE B CA  1 
ATOM   6632 C  C   . PHE B 1 364 ? 35.027 37.886 84.473  1.00 17.57 ? 386 PHE B C   1 
ATOM   6633 O  O   . PHE B 1 364 ? 34.231 38.585 85.091  1.00 17.32 ? 386 PHE B O   1 
ATOM   6634 C  CB  . PHE B 1 364 ? 34.853 36.243 86.383  1.00 18.17 ? 386 PHE B CB  1 
ATOM   6635 C  CG  . PHE B 1 364 ? 33.553 35.552 86.059  1.00 17.73 ? 386 PHE B CG  1 
ATOM   6636 C  CD1 . PHE B 1 364 ? 33.403 34.800 84.892  1.00 17.16 ? 386 PHE B CD1 1 
ATOM   6637 C  CD2 . PHE B 1 364 ? 32.486 35.616 86.955  1.00 18.13 ? 386 PHE B CD2 1 
ATOM   6638 C  CE1 . PHE B 1 364 ? 32.222 34.153 84.617  1.00 16.93 ? 386 PHE B CE1 1 
ATOM   6639 C  CE2 . PHE B 1 364 ? 31.309 34.967 86.698  1.00 17.46 ? 386 PHE B CE2 1 
ATOM   6640 C  CZ  . PHE B 1 364 ? 31.168 34.221 85.526  1.00 17.75 ? 386 PHE B CZ  1 
ATOM   6641 N  N   . PRO B 1 365 ? 35.339 38.119 83.175  1.00 17.44 ? 387 PRO B N   1 
ATOM   6642 C  CA  . PRO B 1 365 ? 34.828 39.281 82.412  1.00 17.29 ? 387 PRO B CA  1 
ATOM   6643 C  C   . PRO B 1 365 ? 33.328 39.538 82.548  1.00 17.06 ? 387 PRO B C   1 
ATOM   6644 O  O   . PRO B 1 365 ? 32.893 40.683 82.519  1.00 16.19 ? 387 PRO B O   1 
ATOM   6645 C  CB  . PRO B 1 365 ? 35.171 38.918 80.965  1.00 17.21 ? 387 PRO B CB  1 
ATOM   6646 C  CG  . PRO B 1 365 ? 36.409 38.104 81.097  1.00 16.99 ? 387 PRO B CG  1 
ATOM   6647 C  CD  . PRO B 1 365 ? 36.234 37.282 82.342  1.00 17.16 ? 387 PRO B CD  1 
ATOM   6648 N  N   . PHE B 1 366 ? 32.552 38.468 82.676  1.00 17.81 ? 388 PHE B N   1 
ATOM   6649 C  CA  . PHE B 1 366 ? 31.116 38.569 82.865  1.00 18.72 ? 388 PHE B CA  1 
ATOM   6650 C  C   . PHE B 1 366 ? 30.794 39.589 83.962  1.00 19.01 ? 388 PHE B C   1 
ATOM   6651 O  O   . PHE B 1 366 ? 29.981 40.510 83.769  1.00 18.17 ? 388 PHE B O   1 
ATOM   6652 C  CB  . PHE B 1 366 ? 30.574 37.194 83.242  1.00 18.82 ? 388 PHE B CB  1 
ATOM   6653 C  CG  . PHE B 1 366 ? 29.108 37.167 83.513  1.00 19.30 ? 388 PHE B CG  1 
ATOM   6654 C  CD1 . PHE B 1 366 ? 28.625 37.194 84.827  1.00 21.11 ? 388 PHE B CD1 1 
ATOM   6655 C  CD2 . PHE B 1 366 ? 28.197 37.106 82.464  1.00 20.20 ? 388 PHE B CD2 1 
ATOM   6656 C  CE1 . PHE B 1 366 ? 27.244 37.136 85.081  1.00 20.26 ? 388 PHE B CE1 1 
ATOM   6657 C  CE2 . PHE B 1 366 ? 26.833 37.071 82.707  1.00 20.49 ? 388 PHE B CE2 1 
ATOM   6658 C  CZ  . PHE B 1 366 ? 26.357 37.080 84.027  1.00 21.50 ? 388 PHE B CZ  1 
ATOM   6659 N  N   . LEU B 1 367 ? 31.450 39.394 85.107  1.00 19.75 ? 389 LEU B N   1 
ATOM   6660 C  CA  . LEU B 1 367 ? 31.330 40.256 86.278  1.00 20.94 ? 389 LEU B CA  1 
ATOM   6661 C  C   . LEU B 1 367 ? 31.884 41.649 86.033  1.00 20.63 ? 389 LEU B C   1 
ATOM   6662 O  O   . LEU B 1 367 ? 31.203 42.655 86.255  1.00 20.83 ? 389 LEU B O   1 
ATOM   6663 C  CB  . LEU B 1 367 ? 32.063 39.622 87.473  1.00 21.41 ? 389 LEU B CB  1 
ATOM   6664 C  CG  . LEU B 1 367 ? 31.186 39.136 88.620  1.00 23.35 ? 389 LEU B CG  1 
ATOM   6665 C  CD1 . LEU B 1 367 ? 29.939 38.445 88.104  1.00 24.55 ? 389 LEU B CD1 1 
ATOM   6666 C  CD2 . LEU B 1 367 ? 31.982 38.227 89.575  1.00 23.16 ? 389 LEU B CD2 1 
ATOM   6667 N  N   . SER B 1 368 ? 33.132 41.698 85.597  1.00 20.38 ? 390 SER B N   1 
ATOM   6668 C  CA  . SER B 1 368 ? 33.739 42.937 85.180  1.00 20.51 ? 390 SER B CA  1 
ATOM   6669 C  C   . SER B 1 368 ? 34.696 42.636 84.057  1.00 20.10 ? 390 SER B C   1 
ATOM   6670 O  O   . SER B 1 368 ? 35.576 41.789 84.226  1.00 20.68 ? 390 SER B O   1 
ATOM   6671 C  CB  . SER B 1 368 ? 34.484 43.603 86.343  1.00 20.53 ? 390 SER B CB  1 
ATOM   6672 O  OG  . SER B 1 368 ? 35.026 44.826 85.916  1.00 19.85 ? 390 SER B OG  1 
ATOM   6673 N  N   . PRO B 1 369 ? 34.597 43.375 82.927  1.00 19.89 ? 391 PRO B N   1 
ATOM   6674 C  CA  . PRO B 1 369 ? 33.839 44.597 82.641  1.00 19.63 ? 391 PRO B CA  1 
ATOM   6675 C  C   . PRO B 1 369 ? 32.365 44.493 82.253  1.00 19.87 ? 391 PRO B C   1 
ATOM   6676 O  O   . PRO B 1 369 ? 31.656 45.500 82.332  1.00 19.51 ? 391 PRO B O   1 
ATOM   6677 C  CB  . PRO B 1 369 ? 34.612 45.184 81.463  1.00 19.60 ? 391 PRO B CB  1 
ATOM   6678 C  CG  . PRO B 1 369 ? 35.041 43.972 80.717  1.00 20.05 ? 391 PRO B CG  1 
ATOM   6679 C  CD  . PRO B 1 369 ? 35.453 43.006 81.781  1.00 19.66 ? 391 PRO B CD  1 
ATOM   6680 N  N   . GLN B 1 370 ? 31.897 43.301 81.882  1.00 20.03 ? 392 GLN B N   1 
ATOM   6681 C  CA  . GLN B 1 370 ? 30.599 43.165 81.200  1.00 20.11 ? 392 GLN B CA  1 
ATOM   6682 C  C   . GLN B 1 370 ? 29.368 43.650 81.989  1.00 21.21 ? 392 GLN B C   1 
ATOM   6683 O  O   . GLN B 1 370 ? 28.497 44.336 81.432  1.00 21.31 ? 392 GLN B O   1 
ATOM   6684 C  CB  . GLN B 1 370 ? 30.431 41.750 80.636  1.00 19.67 ? 392 GLN B CB  1 
ATOM   6685 C  CG  . GLN B 1 370 ? 31.387 41.463 79.426  1.00 17.34 ? 392 GLN B CG  1 
ATOM   6686 C  CD  . GLN B 1 370 ? 31.543 39.974 79.096  1.00 15.41 ? 392 GLN B CD  1 
ATOM   6687 O  OE1 . GLN B 1 370 ? 32.592 39.550 78.609  1.00 13.82 ? 392 GLN B OE1 1 
ATOM   6688 N  NE2 . GLN B 1 370 ? 30.495 39.187 79.334  1.00 11.58 ? 392 GLN B NE2 1 
ATOM   6689 N  N   . ARG B 1 371 ? 29.287 43.302 83.270  1.00 22.31 ? 393 ARG B N   1 
ATOM   6690 C  CA  . ARG B 1 371 ? 28.189 43.786 84.125  1.00 23.43 ? 393 ARG B CA  1 
ATOM   6691 C  C   . ARG B 1 371 ? 28.673 44.753 85.223  1.00 24.10 ? 393 ARG B C   1 
ATOM   6692 O  O   . ARG B 1 371 ? 28.070 44.839 86.301  1.00 24.23 ? 393 ARG B O   1 
ATOM   6693 C  CB  . ARG B 1 371 ? 27.418 42.609 84.733  1.00 23.60 ? 393 ARG B CB  1 
ATOM   6694 C  CG  . ARG B 1 371 ? 26.458 41.946 83.743  1.00 25.61 ? 393 ARG B CG  1 
ATOM   6695 C  CD  . ARG B 1 371 ? 25.975 40.600 84.263  1.00 27.18 ? 393 ARG B CD  1 
ATOM   6696 N  NE  . ARG B 1 371 ? 25.033 39.962 83.347  1.00 25.40 ? 393 ARG B NE  1 
ATOM   6697 C  CZ  . ARG B 1 371 ? 23.716 40.086 83.419  1.00 25.71 ? 393 ARG B CZ  1 
ATOM   6698 N  NH1 . ARG B 1 371 ? 23.159 40.832 84.371  1.00 28.15 ? 393 ARG B NH1 1 
ATOM   6699 N  NH2 . ARG B 1 371 ? 22.951 39.461 82.540  1.00 25.29 ? 393 ARG B NH2 1 
ATOM   6700 N  N   . ASP B 1 372 ? 29.762 45.472 84.938  1.00 24.64 ? 394 ASP B N   1 
ATOM   6701 C  CA  . ASP B 1 372 ? 30.327 46.464 85.854  1.00 25.05 ? 394 ASP B CA  1 
ATOM   6702 C  C   . ASP B 1 372 ? 29.534 47.760 85.702  1.00 25.79 ? 394 ASP B C   1 
ATOM   6703 O  O   . ASP B 1 372 ? 29.568 48.395 84.624  1.00 25.64 ? 394 ASP B O   1 
ATOM   6704 C  CB  . ASP B 1 372 ? 31.822 46.698 85.556  1.00 24.94 ? 394 ASP B CB  1 
ATOM   6705 C  CG  . ASP B 1 372 ? 32.573 47.379 86.720  1.00 24.94 ? 394 ASP B CG  1 
ATOM   6706 O  OD1 . ASP B 1 372 ? 32.059 48.375 87.284  1.00 25.64 ? 394 ASP B OD1 1 
ATOM   6707 O  OD2 . ASP B 1 372 ? 33.684 46.924 87.062  1.00 20.46 ? 394 ASP B OD2 1 
ATOM   6708 N  N   . PRO B 1 373 ? 28.837 48.179 86.782  1.00 26.30 ? 395 PRO B N   1 
ATOM   6709 C  CA  . PRO B 1 373 ? 27.934 49.334 86.691  1.00 26.44 ? 395 PRO B CA  1 
ATOM   6710 C  C   . PRO B 1 373 ? 28.683 50.672 86.661  1.00 26.43 ? 395 PRO B C   1 
ATOM   6711 O  O   . PRO B 1 373 ? 28.087 51.709 86.365  1.00 26.32 ? 395 PRO B O   1 
ATOM   6712 C  CB  . PRO B 1 373 ? 27.053 49.210 87.948  1.00 26.60 ? 395 PRO B CB  1 
ATOM   6713 C  CG  . PRO B 1 373 ? 27.880 48.485 88.933  1.00 26.80 ? 395 PRO B CG  1 
ATOM   6714 C  CD  . PRO B 1 373 ? 28.889 47.623 88.151  1.00 26.50 ? 395 PRO B CD  1 
ATOM   6715 N  N   . GLU B 1 374 ? 29.974 50.634 86.959  1.00 26.48 ? 396 GLU B N   1 
ATOM   6716 C  CA  . GLU B 1 374 ? 30.844 51.777 86.762  1.00 27.32 ? 396 GLU B CA  1 
ATOM   6717 C  C   . GLU B 1 374 ? 31.175 51.924 85.275  1.00 26.75 ? 396 GLU B C   1 
ATOM   6718 O  O   . GLU B 1 374 ? 31.457 53.023 84.805  1.00 27.60 ? 396 GLU B O   1 
ATOM   6719 C  CB  . GLU B 1 374 ? 32.150 51.617 87.557  1.00 27.79 ? 396 GLU B CB  1 
ATOM   6720 C  CG  . GLU B 1 374 ? 32.023 51.743 89.092  1.00 31.40 ? 396 GLU B CG  1 
ATOM   6721 C  CD  . GLU B 1 374 ? 33.380 51.734 89.794  1.00 34.88 ? 396 GLU B CD  1 
ATOM   6722 O  OE1 . GLU B 1 374 ? 34.224 52.599 89.479  1.00 37.60 ? 396 GLU B OE1 1 
ATOM   6723 O  OE2 . GLU B 1 374 ? 33.607 50.867 90.674  1.00 38.11 ? 396 GLU B OE2 1 
ATOM   6724 N  N   . ILE B 1 375 ? 31.162 50.814 84.541  1.00 25.43 ? 397 ILE B N   1 
ATOM   6725 C  CA  . ILE B 1 375 ? 31.503 50.847 83.122  1.00 24.29 ? 397 ILE B CA  1 
ATOM   6726 C  C   . ILE B 1 375 ? 30.272 51.124 82.270  1.00 23.86 ? 397 ILE B C   1 
ATOM   6727 O  O   . ILE B 1 375 ? 30.256 52.083 81.474  1.00 23.12 ? 397 ILE B O   1 
ATOM   6728 C  CB  . ILE B 1 375 ? 32.233 49.548 82.675  1.00 23.68 ? 397 ILE B CB  1 
ATOM   6729 C  CG1 . ILE B 1 375 ? 33.508 49.407 83.499  1.00 23.50 ? 397 ILE B CG1 1 
ATOM   6730 C  CG2 . ILE B 1 375 ? 32.547 49.583 81.173  1.00 23.95 ? 397 ILE B CG2 1 
ATOM   6731 C  CD1 . ILE B 1 375 ? 34.267 48.132 83.302  1.00 24.04 ? 397 ILE B CD1 1 
ATOM   6732 N  N   . TYR B 1 376 ? 29.263 50.269 82.452  1.00 22.95 ? 398 TYR B N   1 
ATOM   6733 C  CA  . TYR B 1 376 ? 28.016 50.338 81.743  1.00 23.10 ? 398 TYR B CA  1 
ATOM   6734 C  C   . TYR B 1 376 ? 26.931 50.876 82.658  1.00 23.86 ? 398 TYR B C   1 
ATOM   6735 O  O   . TYR B 1 376 ? 26.801 50.431 83.800  1.00 24.31 ? 398 TYR B O   1 
ATOM   6736 C  CB  . TYR B 1 376 ? 27.618 48.949 81.209  1.00 22.65 ? 398 TYR B CB  1 
ATOM   6737 C  CG  . TYR B 1 376 ? 28.590 48.367 80.207  1.00 21.78 ? 398 TYR B CG  1 
ATOM   6738 C  CD1 . TYR B 1 376 ? 29.547 47.417 80.593  1.00 21.18 ? 398 TYR B CD1 1 
ATOM   6739 C  CD2 . TYR B 1 376 ? 28.579 48.791 78.868  1.00 20.83 ? 398 TYR B CD2 1 
ATOM   6740 C  CE1 . TYR B 1 376 ? 30.460 46.891 79.661  1.00 19.84 ? 398 TYR B CE1 1 
ATOM   6741 C  CE2 . TYR B 1 376 ? 29.468 48.264 77.935  1.00 19.42 ? 398 TYR B CE2 1 
ATOM   6742 C  CZ  . TYR B 1 376 ? 30.401 47.320 78.332  1.00 19.49 ? 398 TYR B CZ  1 
ATOM   6743 O  OH  . TYR B 1 376 ? 31.261 46.803 77.400  1.00 19.67 ? 398 TYR B OH  1 
ATOM   6744 N  N   . THR B 1 377 ? 26.163 51.838 82.146  1.00 24.68 ? 399 THR B N   1 
ATOM   6745 C  CA  . THR B 1 377 ? 25.012 52.420 82.846  1.00 25.00 ? 399 THR B CA  1 
ATOM   6746 C  C   . THR B 1 377 ? 23.798 51.490 82.759  1.00 25.18 ? 399 THR B C   1 
ATOM   6747 O  O   . THR B 1 377 ? 23.309 51.214 81.656  1.00 25.37 ? 399 THR B O   1 
ATOM   6748 C  CB  . THR B 1 377 ? 24.662 53.806 82.256  1.00 25.18 ? 399 THR B CB  1 
ATOM   6749 O  OG1 . THR B 1 377 ? 25.827 54.643 82.292  1.00 26.73 ? 399 THR B OG1 1 
ATOM   6750 C  CG2 . THR B 1 377 ? 23.527 54.491 83.062  1.00 25.12 ? 399 THR B CG2 1 
ATOM   6751 N  N   . ASP B 1 378 ? 23.309 51.053 83.930  1.00 25.39 ? 400 ASP B N   1 
ATOM   6752 C  CA  . ASP B 1 378 ? 22.254 50.033 84.088  1.00 24.94 ? 400 ASP B CA  1 
ATOM   6753 C  C   . ASP B 1 378 ? 22.639 48.713 83.383  1.00 24.47 ? 400 ASP B C   1 
ATOM   6754 O  O   . ASP B 1 378 ? 21.962 48.282 82.454  1.00 24.19 ? 400 ASP B O   1 
ATOM   6755 C  CB  . ASP B 1 378 ? 20.886 50.534 83.603  1.00 25.46 ? 400 ASP B CB  1 
ATOM   6756 C  CG  . ASP B 1 378 ? 20.526 51.920 84.148  1.00 27.40 ? 400 ASP B CG  1 
ATOM   6757 O  OD1 . ASP B 1 378 ? 20.788 52.191 85.334  1.00 29.69 ? 400 ASP B OD1 1 
ATOM   6758 O  OD2 . ASP B 1 378 ? 19.962 52.730 83.379  1.00 30.96 ? 400 ASP B OD2 1 
ATOM   6759 N  N   . PRO B 1 379 ? 23.733 48.069 83.829  1.00 24.38 ? 401 PRO B N   1 
ATOM   6760 C  CA  . PRO B 1 379 ? 24.263 46.872 83.136  1.00 24.95 ? 401 PRO B CA  1 
ATOM   6761 C  C   . PRO B 1 379 ? 23.335 45.663 82.993  1.00 25.07 ? 401 PRO B C   1 
ATOM   6762 O  O   . PRO B 1 379 ? 23.617 44.792 82.159  1.00 25.43 ? 401 PRO B O   1 
ATOM   6763 C  CB  . PRO B 1 379 ? 25.498 46.496 83.967  1.00 24.55 ? 401 PRO B CB  1 
ATOM   6764 C  CG  . PRO B 1 379 ? 25.316 47.155 85.246  1.00 24.45 ? 401 PRO B CG  1 
ATOM   6765 C  CD  . PRO B 1 379 ? 24.573 48.429 84.981  1.00 23.85 ? 401 PRO B CD  1 
ATOM   6766 N  N   . GLU B 1 380 ? 22.257 45.605 83.783  1.00 25.26 ? 402 GLU B N   1 
ATOM   6767 C  CA  . GLU B 1 380 ? 21.266 44.518 83.688  1.00 25.45 ? 402 GLU B CA  1 
ATOM   6768 C  C   . GLU B 1 380 ? 20.312 44.697 82.523  1.00 25.44 ? 402 GLU B C   1 
ATOM   6769 O  O   . GLU B 1 380 ? 19.569 43.778 82.198  1.00 26.41 ? 402 GLU B O   1 
ATOM   6770 C  CB  . GLU B 1 380 ? 20.450 44.383 84.979  1.00 26.13 ? 402 GLU B CB  1 
ATOM   6771 C  CG  . GLU B 1 380 ? 19.209 45.324 85.071  1.00 27.17 ? 402 GLU B CG  1 
ATOM   6772 C  CD  . GLU B 1 380 ? 19.510 46.675 85.723  1.00 30.60 ? 402 GLU B CD  1 
ATOM   6773 O  OE1 . GLU B 1 380 ? 20.705 47.094 85.749  1.00 28.43 ? 402 GLU B OE1 1 
ATOM   6774 O  OE2 . GLU B 1 380 ? 18.530 47.307 86.225  1.00 31.98 ? 402 GLU B OE2 1 
ATOM   6775 N  N   . VAL B 1 381 ? 20.327 45.879 81.913  1.00 24.37 ? 403 VAL B N   1 
ATOM   6776 C  CA  . VAL B 1 381 ? 19.363 46.242 80.884  1.00 24.67 ? 403 VAL B CA  1 
ATOM   6777 C  C   . VAL B 1 381 ? 19.923 45.912 79.491  1.00 23.79 ? 403 VAL B C   1 
ATOM   6778 O  O   . VAL B 1 381 ? 21.097 46.181 79.206  1.00 24.38 ? 403 VAL B O   1 
ATOM   6779 C  CB  . VAL B 1 381 ? 18.968 47.771 80.989  1.00 24.16 ? 403 VAL B CB  1 
ATOM   6780 C  CG1 . VAL B 1 381 ? 18.072 48.195 79.861  1.00 26.04 ? 403 VAL B CG1 1 
ATOM   6781 C  CG2 . VAL B 1 381 ? 18.248 48.063 82.298  1.00 25.08 ? 403 VAL B CG2 1 
ATOM   6782 N  N   . PHE B 1 382 ? 19.094 45.311 78.645  1.00 23.05 ? 404 PHE B N   1 
ATOM   6783 C  CA  . PHE B 1 382 ? 19.395 45.218 77.219  1.00 22.67 ? 404 PHE B CA  1 
ATOM   6784 C  C   . PHE B 1 382 ? 19.124 46.561 76.522  1.00 22.54 ? 404 PHE B C   1 
ATOM   6785 O  O   . PHE B 1 382 ? 17.980 46.994 76.373  1.00 22.32 ? 404 PHE B O   1 
ATOM   6786 C  CB  . PHE B 1 382 ? 18.642 44.066 76.532  1.00 22.15 ? 404 PHE B CB  1 
ATOM   6787 C  CG  . PHE B 1 382 ? 18.884 43.984 75.035  1.00 21.26 ? 404 PHE B CG  1 
ATOM   6788 C  CD1 . PHE B 1 382 ? 19.966 43.276 74.526  1.00 19.38 ? 404 PHE B CD1 1 
ATOM   6789 C  CD2 . PHE B 1 382 ? 18.031 44.629 74.137  1.00 18.34 ? 404 PHE B CD2 1 
ATOM   6790 C  CE1 . PHE B 1 382 ? 20.199 43.215 73.135  1.00 15.98 ? 404 PHE B CE1 1 
ATOM   6791 C  CE2 . PHE B 1 382 ? 18.252 44.572 72.768  1.00 18.36 ? 404 PHE B CE2 1 
ATOM   6792 C  CZ  . PHE B 1 382 ? 19.350 43.863 72.264  1.00 16.57 ? 404 PHE B CZ  1 
ATOM   6793 N  N   . LYS B 1 383 ? 20.195 47.207 76.088  1.00 22.47 ? 405 LYS B N   1 
ATOM   6794 C  CA  . LYS B 1 383 ? 20.072 48.437 75.332  1.00 22.63 ? 405 LYS B CA  1 
ATOM   6795 C  C   . LYS B 1 383 ? 20.666 48.144 73.969  1.00 22.44 ? 405 LYS B C   1 
ATOM   6796 O  O   . LYS B 1 383 ? 21.880 48.010 73.854  1.00 22.79 ? 405 LYS B O   1 
ATOM   6797 C  CB  . LYS B 1 383 ? 20.842 49.563 76.034  1.00 22.07 ? 405 LYS B CB  1 
ATOM   6798 C  CG  . LYS B 1 383 ? 20.229 50.014 77.342  1.00 24.31 ? 405 LYS B CG  1 
ATOM   6799 C  CD  . LYS B 1 383 ? 21.003 51.191 77.930  1.00 24.55 ? 405 LYS B CD  1 
ATOM   6800 C  CE  . LYS B 1 383 ? 20.449 51.588 79.274  1.00 22.37 ? 405 LYS B CE  1 
ATOM   6801 N  NZ  . LYS B 1 383 ? 21.448 52.422 80.010  1.00 24.69 ? 405 LYS B NZ  1 
ATOM   6802 N  N   . TYR B 1 384 ? 19.828 48.037 72.940  1.00 22.35 ? 406 TYR B N   1 
ATOM   6803 C  CA  . TYR B 1 384 ? 20.283 47.509 71.658  1.00 22.37 ? 406 TYR B CA  1 
ATOM   6804 C  C   . TYR B 1 384 ? 21.414 48.343 71.052  1.00 22.48 ? 406 TYR B C   1 
ATOM   6805 O  O   . TYR B 1 384 ? 22.243 47.820 70.286  1.00 22.26 ? 406 TYR B O   1 
ATOM   6806 C  CB  . TYR B 1 384 ? 19.119 47.373 70.665  1.00 23.34 ? 406 TYR B CB  1 
ATOM   6807 C  CG  . TYR B 1 384 ? 18.707 48.684 70.041  1.00 23.87 ? 406 TYR B CG  1 
ATOM   6808 C  CD1 . TYR B 1 384 ? 17.804 49.534 70.687  1.00 25.61 ? 406 TYR B CD1 1 
ATOM   6809 C  CD2 . TYR B 1 384 ? 19.244 49.095 68.829  1.00 23.69 ? 406 TYR B CD2 1 
ATOM   6810 C  CE1 . TYR B 1 384 ? 17.429 50.758 70.118  1.00 25.15 ? 406 TYR B CE1 1 
ATOM   6811 C  CE2 . TYR B 1 384 ? 18.885 50.325 68.262  1.00 24.84 ? 406 TYR B CE2 1 
ATOM   6812 C  CZ  . TYR B 1 384 ? 17.977 51.144 68.910  1.00 24.84 ? 406 TYR B CZ  1 
ATOM   6813 O  OH  . TYR B 1 384 ? 17.619 52.359 68.351  1.00 25.63 ? 406 TYR B OH  1 
ATOM   6814 N  N   . ASN B 1 385 ? 21.423 49.638 71.398  1.00 22.04 ? 407 ASN B N   1 
ATOM   6815 C  CA  . ASN B 1 385 ? 22.348 50.642 70.849  1.00 21.26 ? 407 ASN B CA  1 
ATOM   6816 C  C   . ASN B 1 385 ? 23.505 51.012 71.791  1.00 20.30 ? 407 ASN B C   1 
ATOM   6817 O  O   . ASN B 1 385 ? 24.174 52.035 71.613  1.00 19.77 ? 407 ASN B O   1 
ATOM   6818 C  CB  . ASN B 1 385 ? 21.572 51.902 70.439  1.00 21.23 ? 407 ASN B CB  1 
ATOM   6819 C  CG  . ASN B 1 385 ? 20.826 52.547 71.612  1.00 23.69 ? 407 ASN B CG  1 
ATOM   6820 O  OD1 . ASN B 1 385 ? 20.638 51.946 72.689  1.00 23.42 ? 407 ASN B OD1 1 
ATOM   6821 N  ND2 . ASN B 1 385 ? 20.385 53.777 71.400  1.00 25.83 ? 407 ASN B ND2 1 
ATOM   6822 N  N   . ARG B 1 386 ? 23.772 50.146 72.758  1.00 19.72 ? 408 ARG B N   1 
ATOM   6823 C  CA  . ARG B 1 386 ? 24.797 50.393 73.759  1.00 19.49 ? 408 ARG B CA  1 
ATOM   6824 C  C   . ARG B 1 386 ? 26.196 50.506 73.148  1.00 19.22 ? 408 ARG B C   1 
ATOM   6825 O  O   . ARG B 1 386 ? 27.068 51.185 73.689  1.00 18.78 ? 408 ARG B O   1 
ATOM   6826 C  CB  . ARG B 1 386 ? 24.760 49.295 74.823  1.00 19.78 ? 408 ARG B CB  1 
ATOM   6827 C  CG  . ARG B 1 386 ? 25.513 49.653 76.093  1.00 19.99 ? 408 ARG B CG  1 
ATOM   6828 C  CD  . ARG B 1 386 ? 25.596 48.498 77.081  1.00 18.60 ? 408 ARG B CD  1 
ATOM   6829 N  NE  . ARG B 1 386 ? 24.350 48.198 77.796  1.00 18.36 ? 408 ARG B NE  1 
ATOM   6830 C  CZ  . ARG B 1 386 ? 23.936 48.832 78.896  1.00 19.87 ? 408 ARG B CZ  1 
ATOM   6831 N  NH1 . ARG B 1 386 ? 24.627 49.860 79.382  1.00 15.97 ? 408 ARG B NH1 1 
ATOM   6832 N  NH2 . ARG B 1 386 ? 22.807 48.463 79.504  1.00 19.72 ? 408 ARG B NH2 1 
ATOM   6833 N  N   . PHE B 1 387 ? 26.394 49.851 72.005  1.00 18.64 ? 409 PHE B N   1 
ATOM   6834 C  CA  . PHE B 1 387 ? 27.678 49.907 71.306  1.00 17.95 ? 409 PHE B CA  1 
ATOM   6835 C  C   . PHE B 1 387 ? 27.579 50.725 70.024  1.00 17.82 ? 409 PHE B C   1 
ATOM   6836 O  O   . PHE B 1 387 ? 28.347 50.531 69.103  1.00 17.27 ? 409 PHE B O   1 
ATOM   6837 C  CB  . PHE B 1 387 ? 28.205 48.488 71.060  1.00 17.13 ? 409 PHE B CB  1 
ATOM   6838 C  CG  . PHE B 1 387 ? 28.486 47.755 72.321  1.00 16.03 ? 409 PHE B CG  1 
ATOM   6839 C  CD1 . PHE B 1 387 ? 27.528 46.897 72.872  1.00 15.46 ? 409 PHE B CD1 1 
ATOM   6840 C  CD2 . PHE B 1 387 ? 29.663 47.980 73.013  1.00 13.48 ? 409 PHE B CD2 1 
ATOM   6841 C  CE1 . PHE B 1 387 ? 27.778 46.235 74.073  1.00 14.38 ? 409 PHE B CE1 1 
ATOM   6842 C  CE2 . PHE B 1 387 ? 29.912 47.329 74.234  1.00 14.41 ? 409 PHE B CE2 1 
ATOM   6843 C  CZ  . PHE B 1 387 ? 28.965 46.446 74.749  1.00 12.70 ? 409 PHE B CZ  1 
ATOM   6844 N  N   . LEU B 1 388 ? 26.616 51.640 69.980  1.00 18.85 ? 410 LEU B N   1 
ATOM   6845 C  CA  . LEU B 1 388 ? 26.540 52.604 68.882  1.00 19.25 ? 410 LEU B CA  1 
ATOM   6846 C  C   . LEU B 1 388 ? 26.775 54.029 69.378  1.00 19.66 ? 410 LEU B C   1 
ATOM   6847 O  O   . LEU B 1 388 ? 26.232 54.444 70.418  1.00 19.56 ? 410 LEU B O   1 
ATOM   6848 C  CB  . LEU B 1 388 ? 25.185 52.545 68.181  1.00 19.42 ? 410 LEU B CB  1 
ATOM   6849 C  CG  . LEU B 1 388 ? 24.778 51.289 67.398  1.00 19.50 ? 410 LEU B CG  1 
ATOM   6850 C  CD1 . LEU B 1 388 ? 23.357 51.485 66.925  1.00 18.33 ? 410 LEU B CD1 1 
ATOM   6851 C  CD2 . LEU B 1 388 ? 25.702 51.020 66.209  1.00 19.46 ? 410 LEU B CD2 1 
ATOM   6852 N  N   . ASN B 1 389 ? 27.587 54.776 68.633  1.00 19.30 ? 411 ASN B N   1 
ATOM   6853 C  CA  . ASN B 1 389 ? 27.650 56.213 68.831  1.00 19.97 ? 411 ASN B CA  1 
ATOM   6854 C  C   . ASN B 1 389 ? 26.385 56.896 68.288  1.00 20.39 ? 411 ASN B C   1 
ATOM   6855 O  O   . ASN B 1 389 ? 25.681 56.325 67.436  1.00 19.27 ? 411 ASN B O   1 
ATOM   6856 C  CB  . ASN B 1 389 ? 28.893 56.790 68.173  1.00 19.91 ? 411 ASN B CB  1 
ATOM   6857 C  CG  . ASN B 1 389 ? 30.160 56.326 68.839  1.00 20.91 ? 411 ASN B CG  1 
ATOM   6858 O  OD1 . ASN B 1 389 ? 30.283 56.345 70.079  1.00 18.80 ? 411 ASN B OD1 1 
ATOM   6859 N  ND2 . ASN B 1 389 ? 31.121 55.910 68.024  1.00 20.11 ? 411 ASN B ND2 1 
ATOM   6860 N  N   . PRO B 1 390 ? 26.082 58.114 68.783  1.00 20.86 ? 412 PRO B N   1 
ATOM   6861 C  CA  . PRO B 1 390 ? 24.853 58.781 68.326  1.00 21.77 ? 412 PRO B CA  1 
ATOM   6862 C  C   . PRO B 1 390 ? 24.707 58.909 66.782  1.00 22.85 ? 412 PRO B C   1 
ATOM   6863 O  O   . PRO B 1 390 ? 23.583 58.935 66.282  1.00 23.59 ? 412 PRO B O   1 
ATOM   6864 C  CB  . PRO B 1 390 ? 24.939 60.156 69.000  1.00 22.04 ? 412 PRO B CB  1 
ATOM   6865 C  CG  . PRO B 1 390 ? 25.774 59.912 70.221  1.00 20.95 ? 412 PRO B CG  1 
ATOM   6866 C  CD  . PRO B 1 390 ? 26.805 58.926 69.782  1.00 20.41 ? 412 PRO B CD  1 
ATOM   6867 N  N   . ASP B 1 391 ? 25.816 58.964 66.046  1.00 23.16 ? 413 ASP B N   1 
ATOM   6868 C  CA  . ASP B 1 391 ? 25.777 59.045 64.581  1.00 24.01 ? 413 ASP B CA  1 
ATOM   6869 C  C   . ASP B 1 391 ? 25.630 57.671 63.902  1.00 24.15 ? 413 ASP B C   1 
ATOM   6870 O  O   . ASP B 1 391 ? 25.558 57.595 62.673  1.00 24.44 ? 413 ASP B O   1 
ATOM   6871 C  CB  . ASP B 1 391 ? 27.017 59.779 64.031  1.00 24.05 ? 413 ASP B CB  1 
ATOM   6872 C  CG  . ASP B 1 391 ? 28.323 58.987 64.220  1.00 25.31 ? 413 ASP B CG  1 
ATOM   6873 O  OD1 . ASP B 1 391 ? 28.308 57.874 64.787  1.00 25.18 ? 413 ASP B OD1 1 
ATOM   6874 O  OD2 . ASP B 1 391 ? 29.386 59.490 63.800  1.00 26.58 ? 413 ASP B OD2 1 
ATOM   6875 N  N   . GLY B 1 392 ? 25.619 56.601 64.699  1.00 23.83 ? 414 GLY B N   1 
ATOM   6876 C  CA  . GLY B 1 392 ? 25.362 55.258 64.189  1.00 23.92 ? 414 GLY B CA  1 
ATOM   6877 C  C   . GLY B 1 392 ? 26.580 54.376 64.009  1.00 24.31 ? 414 GLY B C   1 
ATOM   6878 O  O   . GLY B 1 392 ? 26.434 53.173 63.759  1.00 24.87 ? 414 GLY B O   1 
ATOM   6879 N  N   . SER B 1 393 ? 27.775 54.977 64.104  1.00 24.03 ? 415 SER B N   1 
ATOM   6880 C  CA  . SER B 1 393 ? 29.056 54.262 64.068  1.00 23.27 ? 415 SER B CA  1 
ATOM   6881 C  C   . SER B 1 393 ? 29.277 53.425 65.335  1.00 22.63 ? 415 SER B C   1 
ATOM   6882 O  O   . SER B 1 393 ? 28.606 53.617 66.345  1.00 22.22 ? 415 SER B O   1 
ATOM   6883 C  CB  . SER B 1 393 ? 30.211 55.245 63.906  1.00 23.77 ? 415 SER B CB  1 
ATOM   6884 O  OG  . SER B 1 393 ? 30.246 56.173 64.983  1.00 25.01 ? 415 SER B OG  1 
ATOM   6885 N  N   . GLU B 1 394 ? 30.239 52.513 65.282  1.00 22.16 ? 416 GLU B N   1 
ATOM   6886 C  CA  . GLU B 1 394 ? 30.497 51.613 66.396  1.00 22.15 ? 416 GLU B CA  1 
ATOM   6887 C  C   . GLU B 1 394 ? 31.117 52.343 67.583  1.00 21.40 ? 416 GLU B C   1 
ATOM   6888 O  O   . GLU B 1 394 ? 32.166 52.969 67.452  1.00 20.88 ? 416 GLU B O   1 
ATOM   6889 C  CB  . GLU B 1 394 ? 31.417 50.463 65.953  1.00 22.66 ? 416 GLU B CB  1 
ATOM   6890 C  CG  . GLU B 1 394 ? 31.961 49.610 67.116  1.00 23.48 ? 416 GLU B CG  1 
ATOM   6891 C  CD  . GLU B 1 394 ? 32.928 48.499 66.677  1.00 27.17 ? 416 GLU B CD  1 
ATOM   6892 O  OE1 . GLU B 1 394 ? 33.293 48.432 65.475  1.00 27.08 ? 416 GLU B OE1 1 
ATOM   6893 O  OE2 . GLU B 1 394 ? 33.322 47.690 67.555  1.00 28.34 ? 416 GLU B OE2 1 
ATOM   6894 N  N   . LYS B 1 395 ? 30.483 52.230 68.747  1.00 21.38 ? 417 LYS B N   1 
ATOM   6895 C  CA  . LYS B 1 395 ? 31.054 52.771 69.980  1.00 20.93 ? 417 LYS B CA  1 
ATOM   6896 C  C   . LYS B 1 395 ? 32.134 51.851 70.542  1.00 21.49 ? 417 LYS B C   1 
ATOM   6897 O  O   . LYS B 1 395 ? 31.882 50.671 70.834  1.00 19.87 ? 417 LYS B O   1 
ATOM   6898 C  CB  . LYS B 1 395 ? 29.976 53.040 71.038  1.00 21.63 ? 417 LYS B CB  1 
ATOM   6899 C  CG  . LYS B 1 395 ? 30.553 53.628 72.320  1.00 20.64 ? 417 LYS B CG  1 
ATOM   6900 C  CD  . LYS B 1 395 ? 29.494 54.113 73.312  1.00 20.88 ? 417 LYS B CD  1 
ATOM   6901 C  CE  . LYS B 1 395 ? 30.185 54.614 74.556  1.00 21.39 ? 417 LYS B CE  1 
ATOM   6902 N  NZ  . LYS B 1 395 ? 29.370 54.429 75.807  1.00 21.19 ? 417 LYS B NZ  1 
ATOM   6903 N  N   . LYS B 1 396 ? 33.331 52.417 70.717  1.00 22.21 ? 418 LYS B N   1 
ATOM   6904 C  CA  . LYS B 1 396 ? 34.489 51.658 71.146  1.00 23.70 ? 418 LYS B CA  1 
ATOM   6905 C  C   . LYS B 1 396 ? 35.093 52.178 72.440  1.00 23.72 ? 418 LYS B C   1 
ATOM   6906 O  O   . LYS B 1 396 ? 36.099 51.661 72.898  1.00 24.15 ? 418 LYS B O   1 
ATOM   6907 C  CB  . LYS B 1 396 ? 35.558 51.668 70.047  1.00 23.92 ? 418 LYS B CB  1 
ATOM   6908 C  CG  . LYS B 1 396 ? 35.021 51.320 68.661  1.00 26.30 ? 418 LYS B CG  1 
ATOM   6909 C  CD  . LYS B 1 396 ? 36.128 51.219 67.646  1.00 30.34 ? 418 LYS B CD  1 
ATOM   6910 C  CE  . LYS B 1 396 ? 36.906 49.895 67.784  1.00 33.78 ? 418 LYS B CE  1 
ATOM   6911 N  NZ  . LYS B 1 396 ? 36.198 48.708 67.183  1.00 35.57 ? 418 LYS B NZ  1 
ATOM   6912 N  N   . ASP B 1 397 ? 34.473 53.197 73.027  1.00 24.18 ? 419 ASP B N   1 
ATOM   6913 C  CA  . ASP B 1 397 ? 35.099 53.957 74.111  1.00 24.06 ? 419 ASP B CA  1 
ATOM   6914 C  C   . ASP B 1 397 ? 34.393 53.759 75.428  1.00 23.96 ? 419 ASP B C   1 
ATOM   6915 O  O   . ASP B 1 397 ? 33.355 54.373 75.669  1.00 23.72 ? 419 ASP B O   1 
ATOM   6916 C  CB  . ASP B 1 397 ? 35.117 55.444 73.759  1.00 24.38 ? 419 ASP B CB  1 
ATOM   6917 C  CG  . ASP B 1 397 ? 35.683 55.702 72.387  1.00 25.58 ? 419 ASP B CG  1 
ATOM   6918 O  OD1 . ASP B 1 397 ? 34.982 56.316 71.542  1.00 28.29 ? 419 ASP B OD1 1 
ATOM   6919 O  OD2 . ASP B 1 397 ? 36.831 55.289 72.150  1.00 28.40 ? 419 ASP B OD2 1 
ATOM   6920 N  N   . PHE B 1 398 ? 34.956 52.892 76.278  1.00 23.53 ? 420 PHE B N   1 
ATOM   6921 C  CA  . PHE B 1 398 ? 34.387 52.644 77.612  1.00 22.95 ? 420 PHE B CA  1 
ATOM   6922 C  C   . PHE B 1 398 ? 35.409 52.880 78.697  1.00 22.96 ? 420 PHE B C   1 
ATOM   6923 O  O   . PHE B 1 398 ? 36.597 52.739 78.457  1.00 23.17 ? 420 PHE B O   1 
ATOM   6924 C  CB  . PHE B 1 398 ? 33.745 51.248 77.705  1.00 21.80 ? 420 PHE B CB  1 
ATOM   6925 C  CG  . PHE B 1 398 ? 32.595 51.075 76.775  1.00 20.51 ? 420 PHE B CG  1 
ATOM   6926 C  CD1 . PHE B 1 398 ? 31.305 51.443 77.173  1.00 18.75 ? 420 PHE B CD1 1 
ATOM   6927 C  CD2 . PHE B 1 398 ? 32.796 50.602 75.476  1.00 15.68 ? 420 PHE B CD2 1 
ATOM   6928 C  CE1 . PHE B 1 398 ? 30.228 51.306 76.311  1.00 16.98 ? 420 PHE B CE1 1 
ATOM   6929 C  CE2 . PHE B 1 398 ? 31.720 50.467 74.604  1.00 18.02 ? 420 PHE B CE2 1 
ATOM   6930 C  CZ  . PHE B 1 398 ? 30.428 50.815 75.017  1.00 15.24 ? 420 PHE B CZ  1 
ATOM   6931 N  N   . TYR B 1 399 ? 34.935 53.271 79.879  1.00 24.06 ? 421 TYR B N   1 
ATOM   6932 C  CA  . TYR B 1 399 ? 35.821 53.762 80.942  1.00 25.20 ? 421 TYR B CA  1 
ATOM   6933 C  C   . TYR B 1 399 ? 35.506 53.197 82.316  1.00 26.16 ? 421 TYR B C   1 
ATOM   6934 O  O   . TYR B 1 399 ? 34.345 52.976 82.665  1.00 26.20 ? 421 TYR B O   1 
ATOM   6935 C  CB  . TYR B 1 399 ? 35.761 55.312 81.039  1.00 24.95 ? 421 TYR B CB  1 
ATOM   6936 C  CG  . TYR B 1 399 ? 36.051 56.013 79.735  1.00 23.93 ? 421 TYR B CG  1 
ATOM   6937 C  CD1 . TYR B 1 399 ? 37.298 56.559 79.491  1.00 22.63 ? 421 TYR B CD1 1 
ATOM   6938 C  CD2 . TYR B 1 399 ? 35.077 56.109 78.738  1.00 22.57 ? 421 TYR B CD2 1 
ATOM   6939 C  CE1 . TYR B 1 399 ? 37.580 57.187 78.303  1.00 24.12 ? 421 TYR B CE1 1 
ATOM   6940 C  CE2 . TYR B 1 399 ? 35.346 56.738 77.524  1.00 24.07 ? 421 TYR B CE2 1 
ATOM   6941 C  CZ  . TYR B 1 399 ? 36.598 57.281 77.316  1.00 24.61 ? 421 TYR B CZ  1 
ATOM   6942 O  OH  . TYR B 1 399 ? 36.897 57.902 76.119  1.00 26.33 ? 421 TYR B OH  1 
ATOM   6943 N  N   . LYS B 1 400 ? 36.563 52.985 83.092  1.00 27.21 ? 422 LYS B N   1 
ATOM   6944 C  CA  . LYS B 1 400 ? 36.449 52.811 84.529  1.00 28.34 ? 422 LYS B CA  1 
ATOM   6945 C  C   . LYS B 1 400 ? 37.506 53.713 85.156  1.00 28.83 ? 422 LYS B C   1 
ATOM   6946 O  O   . LYS B 1 400 ? 38.637 53.783 84.668  1.00 28.39 ? 422 LYS B O   1 
ATOM   6947 C  CB  . LYS B 1 400 ? 36.645 51.353 84.961  1.00 28.40 ? 422 LYS B CB  1 
ATOM   6948 C  CG  . LYS B 1 400 ? 36.086 51.091 86.374  1.00 29.23 ? 422 LYS B CG  1 
ATOM   6949 C  CD  . LYS B 1 400 ? 36.439 49.701 86.871  1.00 29.72 ? 422 LYS B CD  1 
ATOM   6950 C  CE  . LYS B 1 400 ? 36.003 49.515 88.312  1.00 29.96 ? 422 LYS B CE  1 
ATOM   6951 N  NZ  . LYS B 1 400 ? 35.561 48.111 88.576  1.00 31.30 ? 422 LYS B NZ  1 
ATOM   6952 N  N   . ASP B 1 401 ? 37.106 54.429 86.205  1.00 30.36 ? 423 ASP B N   1 
ATOM   6953 C  CA  . ASP B 1 401 ? 37.979 55.354 86.924  1.00 31.41 ? 423 ASP B CA  1 
ATOM   6954 C  C   . ASP B 1 401 ? 38.544 56.451 86.012  1.00 31.90 ? 423 ASP B C   1 
ATOM   6955 O  O   . ASP B 1 401 ? 39.702 56.838 86.142  1.00 32.44 ? 423 ASP B O   1 
ATOM   6956 C  CB  . ASP B 1 401 ? 39.135 54.585 87.565  1.00 32.14 ? 423 ASP B CB  1 
ATOM   6957 C  CG  . ASP B 1 401 ? 38.680 53.581 88.596  1.00 32.82 ? 423 ASP B CG  1 
ATOM   6958 O  OD1 . ASP B 1 401 ? 38.213 54.001 89.673  1.00 34.93 ? 423 ASP B OD1 1 
ATOM   6959 O  OD2 . ASP B 1 401 ? 38.833 52.374 88.339  1.00 35.09 ? 423 ASP B OD2 1 
ATOM   6960 N  N   . GLY B 1 402 ? 37.735 56.926 85.072  1.00 32.29 ? 424 GLY B N   1 
ATOM   6961 C  CA  . GLY B 1 402 ? 38.185 57.924 84.100  1.00 32.19 ? 424 GLY B CA  1 
ATOM   6962 C  C   . GLY B 1 402 ? 39.251 57.441 83.125  1.00 32.26 ? 424 GLY B C   1 
ATOM   6963 O  O   . GLY B 1 402 ? 39.758 58.225 82.313  1.00 32.64 ? 424 GLY B O   1 
ATOM   6964 N  N   . LYS B 1 403 ? 39.604 56.158 83.189  1.00 31.33 ? 425 LYS B N   1 
ATOM   6965 C  CA  . LYS B 1 403 ? 40.588 55.601 82.267  1.00 30.29 ? 425 LYS B CA  1 
ATOM   6966 C  C   . LYS B 1 403 ? 39.901 54.739 81.208  1.00 29.40 ? 425 LYS B C   1 
ATOM   6967 O  O   . LYS B 1 403 ? 39.001 53.950 81.520  1.00 28.51 ? 425 LYS B O   1 
ATOM   6968 C  CB  . LYS B 1 403 ? 41.651 54.776 83.002  1.00 30.53 ? 425 LYS B CB  1 
ATOM   6969 C  CG  . LYS B 1 403 ? 42.604 55.568 83.916  1.00 33.45 ? 425 LYS B CG  1 
ATOM   6970 C  CD  . LYS B 1 403 ? 43.860 54.748 84.312  1.00 36.06 ? 425 LYS B CD  1 
ATOM   6971 C  CE  . LYS B 1 403 ? 43.538 53.553 85.229  1.00 38.20 ? 425 LYS B CE  1 
ATOM   6972 N  NZ  . LYS B 1 403 ? 44.759 52.777 85.689  1.00 40.24 ? 425 LYS B NZ  1 
ATOM   6973 N  N   . ARG B 1 404 ? 40.351 54.879 79.967  1.00 28.47 ? 426 ARG B N   1 
ATOM   6974 C  CA  . ARG B 1 404 ? 39.764 54.150 78.853  1.00 28.27 ? 426 ARG B CA  1 
ATOM   6975 C  C   . ARG B 1 404 ? 40.144 52.670 78.933  1.00 27.60 ? 426 ARG B C   1 
ATOM   6976 O  O   . ARG B 1 404 ? 41.304 52.336 79.166  1.00 27.14 ? 426 ARG B O   1 
ATOM   6977 C  CB  . ARG B 1 404 ? 40.215 54.753 77.522  1.00 28.29 ? 426 ARG B CB  1 
ATOM   6978 C  CG  . ARG B 1 404 ? 39.353 54.354 76.330  1.00 30.44 ? 426 ARG B CG  1 
ATOM   6979 C  CD  . ARG B 1 404 ? 39.890 54.955 75.042  1.00 33.78 ? 426 ARG B CD  1 
ATOM   6980 N  NE  . ARG B 1 404 ? 39.235 54.426 73.842  1.00 36.62 ? 426 ARG B NE  1 
ATOM   6981 C  CZ  . ARG B 1 404 ? 39.486 53.229 73.305  1.00 38.58 ? 426 ARG B CZ  1 
ATOM   6982 N  NH1 . ARG B 1 404 ? 40.360 52.399 73.871  1.00 39.02 ? 426 ARG B NH1 1 
ATOM   6983 N  NH2 . ARG B 1 404 ? 38.848 52.850 72.201  1.00 38.65 ? 426 ARG B NH2 1 
ATOM   6984 N  N   . LEU B 1 405 ? 39.164 51.796 78.745  1.00 26.96 ? 427 LEU B N   1 
ATOM   6985 C  CA  . LEU B 1 405 ? 39.408 50.356 78.792  1.00 26.82 ? 427 LEU B CA  1 
ATOM   6986 C  C   . LEU B 1 405 ? 39.786 49.769 77.436  1.00 26.82 ? 427 LEU B C   1 
ATOM   6987 O  O   . LEU B 1 405 ? 39.030 49.892 76.457  1.00 26.73 ? 427 LEU B O   1 
ATOM   6988 C  CB  . LEU B 1 405 ? 38.187 49.623 79.362  1.00 26.59 ? 427 LEU B CB  1 
ATOM   6989 C  CG  . LEU B 1 405 ? 37.823 49.933 80.816  1.00 26.85 ? 427 LEU B CG  1 
ATOM   6990 C  CD1 . LEU B 1 405 ? 36.355 49.655 81.074  1.00 25.53 ? 427 LEU B CD1 1 
ATOM   6991 C  CD2 . LEU B 1 405 ? 38.699 49.152 81.789  1.00 27.60 ? 427 LEU B CD2 1 
ATOM   6992 N  N   . LYS B 1 406 ? 40.960 49.134 77.378  1.00 26.60 ? 428 LYS B N   1 
ATOM   6993 C  CA  . LYS B 1 406 ? 41.311 48.307 76.225  1.00 26.41 ? 428 LYS B CA  1 
ATOM   6994 C  C   . LYS B 1 406 ? 40.350 47.134 76.087  1.00 25.49 ? 428 LYS B C   1 
ATOM   6995 O  O   . LYS B 1 406 ? 39.901 46.831 74.991  1.00 24.90 ? 428 LYS B O   1 
ATOM   6996 C  CB  . LYS B 1 406 ? 42.744 47.775 76.294  1.00 26.96 ? 428 LYS B CB  1 
ATOM   6997 C  CG  . LYS B 1 406 ? 43.269 47.425 74.897  1.00 29.22 ? 428 LYS B CG  1 
ATOM   6998 C  CD  . LYS B 1 406 ? 43.991 46.088 74.847  1.00 32.00 ? 428 LYS B CD  1 
ATOM   6999 C  CE  . LYS B 1 406 ? 44.194 45.638 73.393  1.00 33.85 ? 428 LYS B CE  1 
ATOM   7000 N  NZ  . LYS B 1 406 ? 45.132 44.480 73.281  1.00 35.45 ? 428 LYS B NZ  1 
ATOM   7001 N  N   . ASN B 1 407 ? 40.058 46.475 77.205  1.00 24.93 ? 429 ASN B N   1 
ATOM   7002 C  CA  . ASN B 1 407 ? 39.107 45.354 77.237  1.00 24.84 ? 429 ASN B CA  1 
ATOM   7003 C  C   . ASN B 1 407 ? 37.821 45.765 77.935  1.00 23.68 ? 429 ASN B C   1 
ATOM   7004 O  O   . ASN B 1 407 ? 37.840 46.065 79.119  1.00 24.46 ? 429 ASN B O   1 
ATOM   7005 C  CB  . ASN B 1 407 ? 39.714 44.143 77.956  1.00 25.21 ? 429 ASN B CB  1 
ATOM   7006 C  CG  . ASN B 1 407 ? 40.970 43.623 77.282  1.00 26.89 ? 429 ASN B CG  1 
ATOM   7007 O  OD1 . ASN B 1 407 ? 40.908 42.886 76.292  1.00 29.99 ? 429 ASN B OD1 1 
ATOM   7008 N  ND2 . ASN B 1 407 ? 42.116 44.000 77.816  1.00 27.30 ? 429 ASN B ND2 1 
ATOM   7009 N  N   . TYR B 1 408 ? 36.706 45.792 77.216  1.00 22.49 ? 430 TYR B N   1 
ATOM   7010 C  CA  . TYR B 1 408 ? 35.432 46.209 77.830  1.00 21.23 ? 430 TYR B CA  1 
ATOM   7011 C  C   . TYR B 1 408 ? 34.290 45.237 77.628  1.00 20.29 ? 430 TYR B C   1 
ATOM   7012 O  O   . TYR B 1 408 ? 33.280 45.313 78.305  1.00 20.34 ? 430 TYR B O   1 
ATOM   7013 C  CB  . TYR B 1 408 ? 35.017 47.604 77.352  1.00 20.98 ? 430 TYR B CB  1 
ATOM   7014 C  CG  . TYR B 1 408 ? 35.059 47.774 75.855  1.00 20.68 ? 430 TYR B CG  1 
ATOM   7015 C  CD1 . TYR B 1 408 ? 36.169 48.339 75.241  1.00 22.18 ? 430 TYR B CD1 1 
ATOM   7016 C  CD2 . TYR B 1 408 ? 33.995 47.361 75.050  1.00 20.13 ? 430 TYR B CD2 1 
ATOM   7017 C  CE1 . TYR B 1 408 ? 36.225 48.495 73.861  1.00 22.10 ? 430 TYR B CE1 1 
ATOM   7018 C  CE2 . TYR B 1 408 ? 34.034 47.521 73.679  1.00 19.20 ? 430 TYR B CE2 1 
ATOM   7019 C  CZ  . TYR B 1 408 ? 35.147 48.093 73.097  1.00 19.33 ? 430 TYR B CZ  1 
ATOM   7020 O  OH  . TYR B 1 408 ? 35.212 48.245 71.753  1.00 19.83 ? 430 TYR B OH  1 
ATOM   7021 N  N   . ASN B 1 409 ? 34.444 44.334 76.669  1.00 19.94 ? 431 ASN B N   1 
ATOM   7022 C  CA  . ASN B 1 409 ? 33.447 43.300 76.395  1.00 18.91 ? 431 ASN B CA  1 
ATOM   7023 C  C   . ASN B 1 409 ? 34.242 42.105 75.886  1.00 18.42 ? 431 ASN B C   1 
ATOM   7024 O  O   . ASN B 1 409 ? 34.893 42.180 74.845  1.00 18.33 ? 431 ASN B O   1 
ATOM   7025 C  CB  . ASN B 1 409 ? 32.425 43.800 75.364  1.00 18.95 ? 431 ASN B CB  1 
ATOM   7026 C  CG  . ASN B 1 409 ? 31.194 42.905 75.270  1.00 19.51 ? 431 ASN B CG  1 
ATOM   7027 O  OD1 . ASN B 1 409 ? 30.912 42.122 76.180  1.00 19.33 ? 431 ASN B OD1 1 
ATOM   7028 N  ND2 . ASN B 1 409 ? 30.453 43.019 74.169  1.00 17.27 ? 431 ASN B ND2 1 
ATOM   7029 N  N   . MET B 1 410 ? 34.236 41.012 76.644  1.00 17.62 ? 432 MET B N   1 
ATOM   7030 C  CA  . MET B 1 410 ? 35.181 39.921 76.382  1.00 16.33 ? 432 MET B CA  1 
ATOM   7031 C  C   . MET B 1 410 ? 34.549 38.533 76.196  1.00 15.92 ? 432 MET B C   1 
ATOM   7032 O  O   . MET B 1 410 ? 35.030 37.559 76.779  1.00 15.92 ? 432 MET B O   1 
ATOM   7033 C  CB  . MET B 1 410 ? 36.238 39.889 77.496  1.00 16.40 ? 432 MET B CB  1 
ATOM   7034 C  CG  . MET B 1 410 ? 36.786 41.291 77.876  1.00 15.46 ? 432 MET B CG  1 
ATOM   7035 S  SD  . MET B 1 410 ? 37.922 41.254 79.273  1.00 7.22  ? 432 MET B SD  1 
ATOM   7036 C  CE  . MET B 1 410 ? 39.162 40.191 78.625  1.00 7.28  ? 432 MET B CE  1 
ATOM   7037 N  N   . PRO B 1 411 ? 33.470 38.432 75.384  1.00 15.81 ? 433 PRO B N   1 
ATOM   7038 C  CA  . PRO B 1 411 ? 32.838 37.121 75.117  1.00 15.82 ? 433 PRO B CA  1 
ATOM   7039 C  C   . PRO B 1 411 ? 33.732 36.109 74.400  1.00 15.84 ? 433 PRO B C   1 
ATOM   7040 O  O   . PRO B 1 411 ? 33.513 34.907 74.521  1.00 15.89 ? 433 PRO B O   1 
ATOM   7041 C  CB  . PRO B 1 411 ? 31.640 37.486 74.229  1.00 15.91 ? 433 PRO B CB  1 
ATOM   7042 C  CG  . PRO B 1 411 ? 31.971 38.775 73.635  1.00 15.74 ? 433 PRO B CG  1 
ATOM   7043 C  CD  . PRO B 1 411 ? 32.750 39.512 74.683  1.00 15.93 ? 433 PRO B CD  1 
ATOM   7044 N  N   . TRP B 1 412 ? 34.747 36.601 73.692  1.00 15.99 ? 434 TRP B N   1 
ATOM   7045 C  CA  . TRP B 1 412 ? 35.643 35.775 72.871  1.00 15.75 ? 434 TRP B CA  1 
ATOM   7046 C  C   . TRP B 1 412 ? 36.948 35.375 73.580  1.00 16.85 ? 434 TRP B C   1 
ATOM   7047 O  O   . TRP B 1 412 ? 37.861 34.793 72.963  1.00 17.40 ? 434 TRP B O   1 
ATOM   7048 C  CB  . TRP B 1 412 ? 35.996 36.563 71.606  1.00 15.78 ? 434 TRP B CB  1 
ATOM   7049 C  CG  . TRP B 1 412 ? 34.791 37.172 70.922  1.00 13.46 ? 434 TRP B CG  1 
ATOM   7050 C  CD1 . TRP B 1 412 ? 34.405 38.485 70.943  1.00 12.65 ? 434 TRP B CD1 1 
ATOM   7051 C  CD2 . TRP B 1 412 ? 33.828 36.482 70.130  1.00 13.25 ? 434 TRP B CD2 1 
ATOM   7052 N  NE1 . TRP B 1 412 ? 33.256 38.655 70.207  1.00 13.10 ? 434 TRP B NE1 1 
ATOM   7053 C  CE2 . TRP B 1 412 ? 32.890 37.439 69.683  1.00 12.50 ? 434 TRP B CE2 1 
ATOM   7054 C  CE3 . TRP B 1 412 ? 33.674 35.146 69.734  1.00 14.95 ? 434 TRP B CE3 1 
ATOM   7055 C  CZ2 . TRP B 1 412 ? 31.800 37.099 68.879  1.00 15.59 ? 434 TRP B CZ2 1 
ATOM   7056 C  CZ3 . TRP B 1 412 ? 32.583 34.809 68.924  1.00 14.35 ? 434 TRP B CZ3 1 
ATOM   7057 C  CH2 . TRP B 1 412 ? 31.662 35.779 68.510  1.00 14.78 ? 434 TRP B CH2 1 
ATOM   7058 N  N   . GLY B 1 413 ? 37.057 35.702 74.859  1.00 17.54 ? 435 GLY B N   1 
ATOM   7059 C  CA  . GLY B 1 413 ? 38.310 35.499 75.586  1.00 19.53 ? 435 GLY B CA  1 
ATOM   7060 C  C   . GLY B 1 413 ? 39.311 36.618 75.354  1.00 20.89 ? 435 GLY B C   1 
ATOM   7061 O  O   . GLY B 1 413 ? 38.948 37.702 74.910  1.00 21.33 ? 435 GLY B O   1 
ATOM   7062 N  N   . ALA B 1 414 ? 40.579 36.350 75.651  1.00 22.97 ? 436 ALA B N   1 
ATOM   7063 C  CA  . ALA B 1 414 ? 41.629 37.365 75.561  1.00 24.48 ? 436 ALA B CA  1 
ATOM   7064 C  C   . ALA B 1 414 ? 42.991 36.719 75.620  1.00 25.48 ? 436 ALA B C   1 
ATOM   7065 O  O   . ALA B 1 414 ? 43.166 35.687 76.282  1.00 26.53 ? 436 ALA B O   1 
ATOM   7066 C  CB  . ALA B 1 414 ? 41.493 38.373 76.694  1.00 25.11 ? 436 ALA B CB  1 
ATOM   7067 N  N   . GLY B 1 415 ? 43.955 37.334 74.938  1.00 26.05 ? 437 GLY B N   1 
ATOM   7068 C  CA  . GLY B 1 415 ? 45.332 36.880 74.986  1.00 27.22 ? 437 GLY B CA  1 
ATOM   7069 C  C   . GLY B 1 415 ? 45.533 35.692 74.077  1.00 28.25 ? 437 GLY B C   1 
ATOM   7070 O  O   . GLY B 1 415 ? 44.873 35.577 73.046  1.00 28.36 ? 437 GLY B O   1 
ATOM   7071 N  N   . HIS B 1 416 ? 46.436 34.800 74.465  1.00 29.14 ? 438 HIS B N   1 
ATOM   7072 C  CA  . HIS B 1 416 ? 46.816 33.685 73.599  1.00 30.75 ? 438 HIS B CA  1 
ATOM   7073 C  C   . HIS B 1 416 ? 45.719 32.633 73.386  1.00 30.27 ? 438 HIS B C   1 
ATOM   7074 O  O   . HIS B 1 416 ? 45.818 31.813 72.487  1.00 30.44 ? 438 HIS B O   1 
ATOM   7075 C  CB  . HIS B 1 416 ? 48.143 33.082 74.072  1.00 31.49 ? 438 HIS B CB  1 
ATOM   7076 C  CG  . HIS B 1 416 ? 49.304 34.017 73.897  1.00 34.63 ? 438 HIS B CG  1 
ATOM   7077 N  ND1 . HIS B 1 416 ? 49.991 34.566 74.961  1.00 37.96 ? 438 HIS B ND1 1 
ATOM   7078 C  CD2 . HIS B 1 416 ? 49.853 34.552 72.778  1.00 38.19 ? 438 HIS B CD2 1 
ATOM   7079 C  CE1 . HIS B 1 416 ? 50.931 35.376 74.505  1.00 39.45 ? 438 HIS B CE1 1 
ATOM   7080 N  NE2 . HIS B 1 416 ? 50.870 35.384 73.183  1.00 40.61 ? 438 HIS B NE2 1 
ATOM   7081 N  N   . ASN B 1 417 ? 44.669 32.693 74.201  1.00 30.10 ? 439 ASN B N   1 
ATOM   7082 C  CA  . ASN B 1 417 ? 43.563 31.728 74.179  1.00 30.14 ? 439 ASN B CA  1 
ATOM   7083 C  C   . ASN B 1 417 ? 42.281 32.213 73.496  1.00 28.71 ? 439 ASN B C   1 
ATOM   7084 O  O   . ASN B 1 417 ? 41.253 31.537 73.555  1.00 28.96 ? 439 ASN B O   1 
ATOM   7085 C  CB  . ASN B 1 417 ? 43.196 31.354 75.622  1.00 31.18 ? 439 ASN B CB  1 
ATOM   7086 C  CG  . ASN B 1 417 ? 43.677 30.001 76.009  1.00 33.64 ? 439 ASN B CG  1 
ATOM   7087 O  OD1 . ASN B 1 417 ? 44.035 29.188 75.156  1.00 38.00 ? 439 ASN B OD1 1 
ATOM   7088 N  ND2 . ASN B 1 417 ? 43.681 29.730 77.308  1.00 36.44 ? 439 ASN B ND2 1 
ATOM   7089 N  N   . HIS B 1 418 ? 42.324 33.378 72.870  1.00 27.56 ? 440 HIS B N   1 
ATOM   7090 C  CA  . HIS B 1 418 ? 41.104 33.998 72.366  1.00 26.51 ? 440 HIS B CA  1 
ATOM   7091 C  C   . HIS B 1 418 ? 40.447 33.129 71.288  1.00 24.66 ? 440 HIS B C   1 
ATOM   7092 O  O   . HIS B 1 418 ? 41.099 32.242 70.709  1.00 24.85 ? 440 HIS B O   1 
ATOM   7093 C  CB  . HIS B 1 418 ? 41.382 35.410 71.852  1.00 27.47 ? 440 HIS B CB  1 
ATOM   7094 C  CG  . HIS B 1 418 ? 42.343 35.453 70.703  1.00 30.28 ? 440 HIS B CG  1 
ATOM   7095 N  ND1 . HIS B 1 418 ? 43.635 35.917 70.830  1.00 33.25 ? 440 HIS B ND1 1 
ATOM   7096 C  CD2 . HIS B 1 418 ? 42.202 35.079 69.410  1.00 32.59 ? 440 HIS B CD2 1 
ATOM   7097 C  CE1 . HIS B 1 418 ? 44.246 35.826 69.662  1.00 33.88 ? 440 HIS B CE1 1 
ATOM   7098 N  NE2 . HIS B 1 418 ? 43.399 35.318 68.785  1.00 33.61 ? 440 HIS B NE2 1 
ATOM   7099 N  N   . CYS B 1 419 ? 39.161 33.373 71.037  1.00 22.44 ? 441 CYS B N   1 
ATOM   7100 C  CA  . CYS B 1 419 ? 38.391 32.618 70.053  1.00 20.07 ? 441 CYS B CA  1 
ATOM   7101 C  C   . CYS B 1 419 ? 38.990 32.764 68.648  1.00 20.01 ? 441 CYS B C   1 
ATOM   7102 O  O   . CYS B 1 419 ? 39.199 33.892 68.187  1.00 20.48 ? 441 CYS B O   1 
ATOM   7103 C  CB  . CYS B 1 419 ? 36.930 33.101 70.045  1.00 20.01 ? 441 CYS B CB  1 
ATOM   7104 S  SG  . CYS B 1 419 ? 35.904 32.221 68.859  1.00 16.24 ? 441 CYS B SG  1 
ATOM   7105 N  N   . LEU B 1 420 ? 39.260 31.636 67.989  1.00 18.87 ? 442 LEU B N   1 
ATOM   7106 C  CA  . LEU B 1 420 ? 39.821 31.616 66.610  1.00 18.69 ? 442 LEU B CA  1 
ATOM   7107 C  C   . LEU B 1 420 ? 38.694 31.721 65.578  1.00 17.58 ? 442 LEU B C   1 
ATOM   7108 O  O   . LEU B 1 420 ? 38.925 32.117 64.440  1.00 16.69 ? 442 LEU B O   1 
ATOM   7109 C  CB  . LEU B 1 420 ? 40.633 30.328 66.357  1.00 19.00 ? 442 LEU B CB  1 
ATOM   7110 C  CG  . LEU B 1 420 ? 42.130 30.215 66.761  1.00 20.74 ? 442 LEU B CG  1 
ATOM   7111 C  CD1 . LEU B 1 420 ? 42.470 31.056 67.934  1.00 17.02 ? 442 LEU B CD1 1 
ATOM   7112 C  CD2 . LEU B 1 420 ? 42.568 28.758 67.045  1.00 21.48 ? 442 LEU B CD2 1 
ATOM   7113 N  N   . GLY B 1 421 ? 37.471 31.395 66.004  1.00 16.22 ? 443 GLY B N   1 
ATOM   7114 C  CA  . GLY B 1 421 ? 36.327 31.377 65.099  1.00 16.11 ? 443 GLY B CA  1 
ATOM   7115 C  C   . GLY B 1 421 ? 35.442 32.606 65.131  1.00 16.11 ? 443 GLY B C   1 
ATOM   7116 O  O   . GLY B 1 421 ? 34.316 32.582 64.575  1.00 16.64 ? 443 GLY B O   1 
ATOM   7117 N  N   . ARG B 1 422 ? 35.933 33.675 65.768  1.00 15.04 ? 444 ARG B N   1 
ATOM   7118 C  CA  . ARG B 1 422 ? 35.125 34.877 66.036  1.00 15.02 ? 444 ARG B CA  1 
ATOM   7119 C  C   . ARG B 1 422 ? 34.490 35.507 64.785  1.00 13.70 ? 444 ARG B C   1 
ATOM   7120 O  O   . ARG B 1 422 ? 33.301 35.774 64.777  1.00 12.34 ? 444 ARG B O   1 
ATOM   7121 C  CB  . ARG B 1 422 ? 35.926 35.925 66.816  1.00 15.10 ? 444 ARG B CB  1 
ATOM   7122 C  CG  . ARG B 1 422 ? 35.196 37.259 67.042  1.00 17.18 ? 444 ARG B CG  1 
ATOM   7123 C  CD  . ARG B 1 422 ? 36.222 38.245 67.610  1.00 21.24 ? 444 ARG B CD  1 
ATOM   7124 N  NE  . ARG B 1 422 ? 35.666 39.542 67.987  1.00 23.61 ? 444 ARG B NE  1 
ATOM   7125 C  CZ  . ARG B 1 422 ? 36.283 40.391 68.807  1.00 24.66 ? 444 ARG B CZ  1 
ATOM   7126 N  NH1 . ARG B 1 422 ? 37.448 40.075 69.345  1.00 25.32 ? 444 ARG B NH1 1 
ATOM   7127 N  NH2 . ARG B 1 422 ? 35.730 41.543 69.112  1.00 25.37 ? 444 ARG B NH2 1 
ATOM   7128 N  N   . SER B 1 423 ? 35.295 35.722 63.746  1.00 13.20 ? 445 SER B N   1 
ATOM   7129 C  CA  . SER B 1 423 ? 34.819 36.275 62.485  1.00 13.44 ? 445 SER B CA  1 
ATOM   7130 C  C   . SER B 1 423 ? 33.735 35.407 61.857  1.00 12.65 ? 445 SER B C   1 
ATOM   7131 O  O   . SER B 1 423 ? 32.689 35.908 61.464  1.00 12.76 ? 445 SER B O   1 
ATOM   7132 C  CB  . SER B 1 423 ? 35.984 36.466 61.513  1.00 13.73 ? 445 SER B CB  1 
ATOM   7133 O  OG  . SER B 1 423 ? 36.710 37.625 61.863  1.00 14.66 ? 445 SER B OG  1 
ATOM   7134 N  N   . TYR B 1 424 ? 33.987 34.107 61.793  1.00 12.34 ? 446 TYR B N   1 
ATOM   7135 C  CA  . TYR B 1 424 ? 33.006 33.147 61.300  1.00 13.00 ? 446 TYR B CA  1 
ATOM   7136 C  C   . TYR B 1 424 ? 31.730 33.045 62.171  1.00 13.18 ? 446 TYR B C   1 
ATOM   7137 O  O   . TYR B 1 424 ? 30.616 32.897 61.644  1.00 13.38 ? 446 TYR B O   1 
ATOM   7138 C  CB  . TYR B 1 424 ? 33.667 31.782 61.145  1.00 13.04 ? 446 TYR B CB  1 
ATOM   7139 C  CG  . TYR B 1 424 ? 32.713 30.627 60.949  1.00 15.09 ? 446 TYR B CG  1 
ATOM   7140 C  CD1 . TYR B 1 424 ? 31.923 30.531 59.795  1.00 15.61 ? 446 TYR B CD1 1 
ATOM   7141 C  CD2 . TYR B 1 424 ? 32.608 29.616 61.921  1.00 15.32 ? 446 TYR B CD2 1 
ATOM   7142 C  CE1 . TYR B 1 424 ? 31.061 29.445 59.605  1.00 15.95 ? 446 TYR B CE1 1 
ATOM   7143 C  CE2 . TYR B 1 424 ? 31.734 28.541 61.750  1.00 16.50 ? 446 TYR B CE2 1 
ATOM   7144 C  CZ  . TYR B 1 424 ? 30.974 28.469 60.578  1.00 15.17 ? 446 TYR B CZ  1 
ATOM   7145 O  OH  . TYR B 1 424 ? 30.113 27.438 60.408  1.00 16.34 ? 446 TYR B OH  1 
ATOM   7146 N  N   . ALA B 1 425 ? 31.903 33.097 63.485  1.00 12.88 ? 447 ALA B N   1 
ATOM   7147 C  CA  . ALA B 1 425 ? 30.775 33.045 64.429  1.00 13.40 ? 447 ALA B CA  1 
ATOM   7148 C  C   . ALA B 1 425 ? 29.887 34.264 64.248  1.00 13.50 ? 447 ALA B C   1 
ATOM   7149 O  O   . ALA B 1 425 ? 28.667 34.132 64.143  1.00 13.35 ? 447 ALA B O   1 
ATOM   7150 C  CB  . ALA B 1 425 ? 31.274 32.973 65.850  1.00 13.24 ? 447 ALA B CB  1 
ATOM   7151 N  N   . VAL B 1 426 ? 30.505 35.440 64.171  1.00 13.77 ? 448 VAL B N   1 
ATOM   7152 C  CA  . VAL B 1 426 ? 29.766 36.684 63.939  1.00 14.55 ? 448 VAL B CA  1 
ATOM   7153 C  C   . VAL B 1 426 ? 29.029 36.663 62.598  1.00 14.86 ? 448 VAL B C   1 
ATOM   7154 O  O   . VAL B 1 426 ? 27.849 36.966 62.551  1.00 14.91 ? 448 VAL B O   1 
ATOM   7155 C  CB  . VAL B 1 426 ? 30.672 37.938 64.049  1.00 14.39 ? 448 VAL B CB  1 
ATOM   7156 C  CG1 . VAL B 1 426 ? 29.993 39.169 63.460  1.00 14.05 ? 448 VAL B CG1 1 
ATOM   7157 C  CG2 . VAL B 1 426 ? 31.041 38.197 65.503  1.00 16.23 ? 448 VAL B CG2 1 
ATOM   7158 N  N   . ASN B 1 427 ? 29.729 36.309 61.519  1.00 15.50 ? 449 ASN B N   1 
ATOM   7159 C  CA  . ASN B 1 427 ? 29.107 36.180 60.197  1.00 15.87 ? 449 ASN B CA  1 
ATOM   7160 C  C   . ASN B 1 427 ? 27.877 35.273 60.242  1.00 16.20 ? 449 ASN B C   1 
ATOM   7161 O  O   . ASN B 1 427 ? 26.791 35.659 59.775  1.00 16.90 ? 449 ASN B O   1 
ATOM   7162 C  CB  . ASN B 1 427 ? 30.101 35.634 59.163  1.00 15.13 ? 449 ASN B CB  1 
ATOM   7163 C  CG  . ASN B 1 427 ? 31.109 36.658 58.704  1.00 17.00 ? 449 ASN B CG  1 
ATOM   7164 O  OD1 . ASN B 1 427 ? 31.980 36.351 57.869  1.00 20.22 ? 449 ASN B OD1 1 
ATOM   7165 N  ND2 . ASN B 1 427 ? 31.014 37.882 59.228  1.00 15.14 ? 449 ASN B ND2 1 
ATOM   7166 N  N   . SER B 1 428 ? 28.056 34.083 60.819  1.00 16.42 ? 450 SER B N   1 
ATOM   7167 C  CA  . SER B 1 428 ? 27.000 33.051 60.897  1.00 16.39 ? 450 SER B CA  1 
ATOM   7168 C  C   . SER B 1 428 ? 25.754 33.463 61.667  1.00 16.23 ? 450 SER B C   1 
ATOM   7169 O  O   . SER B 1 428 ? 24.628 33.123 61.260  1.00 16.05 ? 450 SER B O   1 
ATOM   7170 C  CB  . SER B 1 428 ? 27.534 31.771 61.537  1.00 15.99 ? 450 SER B CB  1 
ATOM   7171 O  OG  . SER B 1 428 ? 28.625 31.274 60.799  1.00 15.56 ? 450 SER B OG  1 
ATOM   7172 N  N   . ILE B 1 429 ? 25.953 34.155 62.793  1.00 15.91 ? 451 ILE B N   1 
ATOM   7173 C  CA  . ILE B 1 429 ? 24.837 34.577 63.633  1.00 15.69 ? 451 ILE B CA  1 
ATOM   7174 C  C   . ILE B 1 429 ? 24.033 35.645 62.885  1.00 16.03 ? 451 ILE B C   1 
ATOM   7175 O  O   . ILE B 1 429 ? 22.796 35.630 62.895  1.00 15.85 ? 451 ILE B O   1 
ATOM   7176 C  CB  . ILE B 1 429 ? 25.311 35.101 65.041  1.00 16.10 ? 451 ILE B CB  1 
ATOM   7177 C  CG1 . ILE B 1 429 ? 25.770 33.928 65.941  1.00 16.08 ? 451 ILE B CG1 1 
ATOM   7178 C  CG2 . ILE B 1 429 ? 24.189 35.845 65.734  1.00 13.97 ? 451 ILE B CG2 1 
ATOM   7179 C  CD1 . ILE B 1 429 ? 26.605 34.372 67.229  1.00 18.68 ? 451 ILE B CD1 1 
ATOM   7180 N  N   . LYS B 1 430 ? 24.736 36.545 62.204  1.00 15.69 ? 452 LYS B N   1 
ATOM   7181 C  CA  . LYS B 1 430 ? 24.070 37.603 61.468  1.00 16.71 ? 452 LYS B CA  1 
ATOM   7182 C  C   . LYS B 1 430 ? 23.328 37.067 60.252  1.00 16.61 ? 452 LYS B C   1 
ATOM   7183 O  O   . LYS B 1 430 ? 22.305 37.615 59.863  1.00 15.58 ? 452 LYS B O   1 
ATOM   7184 C  CB  . LYS B 1 430 ? 25.053 38.695 61.042  1.00 16.70 ? 452 LYS B CB  1 
ATOM   7185 C  CG  . LYS B 1 430 ? 25.722 39.392 62.226  1.00 17.36 ? 452 LYS B CG  1 
ATOM   7186 C  CD  . LYS B 1 430 ? 25.991 40.874 61.949  1.00 19.73 ? 452 LYS B CD  1 
ATOM   7187 C  CE  . LYS B 1 430 ? 27.144 41.093 61.024  1.00 19.75 ? 452 LYS B CE  1 
ATOM   7188 N  NZ  . LYS B 1 430 ? 27.432 42.546 60.997  1.00 21.26 ? 452 LYS B NZ  1 
ATOM   7189 N  N   . GLN B 1 431 ? 23.878 36.016 59.647  1.00 16.97 ? 453 GLN B N   1 
ATOM   7190 C  CA  . GLN B 1 431 ? 23.264 35.407 58.488  1.00 17.31 ? 453 GLN B CA  1 
ATOM   7191 C  C   . GLN B 1 431 ? 22.006 34.723 58.945  1.00 17.44 ? 453 GLN B C   1 
ATOM   7192 O  O   . GLN B 1 431 ? 20.979 34.809 58.276  1.00 17.60 ? 453 GLN B O   1 
ATOM   7193 C  CB  . GLN B 1 431 ? 24.202 34.396 57.832  1.00 17.49 ? 453 GLN B CB  1 
ATOM   7194 C  CG  . GLN B 1 431 ? 25.208 34.996 56.888  1.00 18.34 ? 453 GLN B CG  1 
ATOM   7195 C  CD  . GLN B 1 431 ? 26.162 33.962 56.372  1.00 19.93 ? 453 GLN B CD  1 
ATOM   7196 O  OE1 . GLN B 1 431 ? 26.501 33.000 57.076  1.00 20.58 ? 453 GLN B OE1 1 
ATOM   7197 N  NE2 . GLN B 1 431 ? 26.603 34.137 55.132  1.00 19.48 ? 453 GLN B NE2 1 
ATOM   7198 N  N   . PHE B 1 432 ? 22.100 34.038 60.081  1.00 17.72 ? 454 PHE B N   1 
ATOM   7199 C  CA  . PHE B 1 432 ? 20.937 33.433 60.701  1.00 18.78 ? 454 PHE B CA  1 
ATOM   7200 C  C   . PHE B 1 432 ? 19.831 34.444 61.027  1.00 19.00 ? 454 PHE B C   1 
ATOM   7201 O  O   . PHE B 1 432 ? 18.680 34.215 60.683  1.00 19.39 ? 454 PHE B O   1 
ATOM   7202 C  CB  . PHE B 1 432 ? 21.318 32.627 61.941  1.00 18.33 ? 454 PHE B CB  1 
ATOM   7203 C  CG  . PHE B 1 432 ? 20.154 31.963 62.601  1.00 18.89 ? 454 PHE B CG  1 
ATOM   7204 C  CD1 . PHE B 1 432 ? 19.399 31.010 61.917  1.00 18.60 ? 454 PHE B CD1 1 
ATOM   7205 C  CD2 . PHE B 1 432 ? 19.794 32.296 63.910  1.00 18.25 ? 454 PHE B CD2 1 
ATOM   7206 C  CE1 . PHE B 1 432 ? 18.298 30.399 62.536  1.00 19.22 ? 454 PHE B CE1 1 
ATOM   7207 C  CE2 . PHE B 1 432 ? 18.716 31.691 64.529  1.00 18.39 ? 454 PHE B CE2 1 
ATOM   7208 C  CZ  . PHE B 1 432 ? 17.965 30.727 63.835  1.00 18.28 ? 454 PHE B CZ  1 
ATOM   7209 N  N   . VAL B 1 433 ? 20.180 35.545 61.694  1.00 19.45 ? 455 VAL B N   1 
ATOM   7210 C  CA  . VAL B 1 433 ? 19.213 36.578 62.066  1.00 19.18 ? 455 VAL B CA  1 
ATOM   7211 C  C   . VAL B 1 433 ? 18.541 37.152 60.808  1.00 20.29 ? 455 VAL B C   1 
ATOM   7212 O  O   . VAL B 1 433 ? 17.334 37.408 60.798  1.00 19.82 ? 455 VAL B O   1 
ATOM   7213 C  CB  . VAL B 1 433 ? 19.895 37.724 62.887  1.00 19.56 ? 455 VAL B CB  1 
ATOM   7214 C  CG1 . VAL B 1 433 ? 18.987 38.962 62.983  1.00 17.78 ? 455 VAL B CG1 1 
ATOM   7215 C  CG2 . VAL B 1 433 ? 20.284 37.220 64.296  1.00 17.74 ? 455 VAL B CG2 1 
ATOM   7216 N  N   . PHE B 1 434 ? 19.342 37.370 59.765  1.00 19.98 ? 456 PHE B N   1 
ATOM   7217 C  CA  . PHE B 1 434 ? 18.849 37.868 58.494  1.00 21.58 ? 456 PHE B CA  1 
ATOM   7218 C  C   . PHE B 1 434 ? 17.781 36.934 57.886  1.00 21.75 ? 456 PHE B C   1 
ATOM   7219 O  O   . PHE B 1 434 ? 16.688 37.386 57.516  1.00 20.00 ? 456 PHE B O   1 
ATOM   7220 C  CB  . PHE B 1 434 ? 20.015 38.066 57.527  1.00 22.12 ? 456 PHE B CB  1 
ATOM   7221 C  CG  . PHE B 1 434 ? 19.596 38.401 56.131  1.00 24.02 ? 456 PHE B CG  1 
ATOM   7222 C  CD1 . PHE B 1 434 ? 19.366 39.723 55.765  1.00 24.55 ? 456 PHE B CD1 1 
ATOM   7223 C  CD2 . PHE B 1 434 ? 19.449 37.394 55.175  1.00 24.91 ? 456 PHE B CD2 1 
ATOM   7224 C  CE1 . PHE B 1 434 ? 18.981 40.037 54.479  1.00 26.41 ? 456 PHE B CE1 1 
ATOM   7225 C  CE2 . PHE B 1 434 ? 19.052 37.696 53.867  1.00 27.52 ? 456 PHE B CE2 1 
ATOM   7226 C  CZ  . PHE B 1 434 ? 18.822 39.019 53.515  1.00 28.08 ? 456 PHE B CZ  1 
ATOM   7227 N  N   . LEU B 1 435 ? 18.102 35.641 57.795  1.00 22.18 ? 457 LEU B N   1 
ATOM   7228 C  CA  . LEU B 1 435 ? 17.141 34.643 57.308  1.00 23.19 ? 457 LEU B CA  1 
ATOM   7229 C  C   . LEU B 1 435 ? 15.836 34.627 58.111  1.00 23.85 ? 457 LEU B C   1 
ATOM   7230 O  O   . LEU B 1 435 ? 14.750 34.588 57.540  1.00 24.38 ? 457 LEU B O   1 
ATOM   7231 C  CB  . LEU B 1 435 ? 17.774 33.246 57.275  1.00 23.08 ? 457 LEU B CB  1 
ATOM   7232 C  CG  . LEU B 1 435 ? 18.639 33.023 56.031  1.00 24.30 ? 457 LEU B CG  1 
ATOM   7233 C  CD1 . LEU B 1 435 ? 19.749 32.078 56.373  1.00 26.25 ? 457 LEU B CD1 1 
ATOM   7234 C  CD2 . LEU B 1 435 ? 17.829 32.495 54.842  1.00 23.37 ? 457 LEU B CD2 1 
ATOM   7235 N  N   . VAL B 1 436 ? 15.938 34.683 59.430  1.00 24.24 ? 458 VAL B N   1 
ATOM   7236 C  CA  . VAL B 1 436 ? 14.745 34.651 60.258  1.00 25.27 ? 458 VAL B CA  1 
ATOM   7237 C  C   . VAL B 1 436 ? 13.912 35.928 60.142  1.00 25.89 ? 458 VAL B C   1 
ATOM   7238 O  O   . VAL B 1 436 ? 12.676 35.857 60.047  1.00 25.88 ? 458 VAL B O   1 
ATOM   7239 C  CB  . VAL B 1 436 ? 15.082 34.357 61.713  1.00 25.09 ? 458 VAL B CB  1 
ATOM   7240 C  CG1 . VAL B 1 436 ? 13.806 34.331 62.553  1.00 26.51 ? 458 VAL B CG1 1 
ATOM   7241 C  CG2 . VAL B 1 436 ? 15.797 33.018 61.809  1.00 25.17 ? 458 VAL B CG2 1 
ATOM   7242 N  N   . LEU B 1 437 ? 14.577 37.083 60.129  1.00 25.56 ? 459 LEU B N   1 
ATOM   7243 C  CA  . LEU B 1 437 ? 13.865 38.365 60.108  1.00 26.35 ? 459 LEU B CA  1 
ATOM   7244 C  C   . LEU B 1 437 ? 13.269 38.730 58.743  1.00 26.79 ? 459 LEU B C   1 
ATOM   7245 O  O   . LEU B 1 437 ? 12.231 39.395 58.675  1.00 27.43 ? 459 LEU B O   1 
ATOM   7246 C  CB  . LEU B 1 437 ? 14.755 39.491 60.634  1.00 26.44 ? 459 LEU B CB  1 
ATOM   7247 C  CG  . LEU B 1 437 ? 14.576 39.897 62.105  1.00 27.46 ? 459 LEU B CG  1 
ATOM   7248 C  CD1 . LEU B 1 437 ? 14.089 38.772 63.030  1.00 26.69 ? 459 LEU B CD1 1 
ATOM   7249 C  CD2 . LEU B 1 437 ? 15.836 40.535 62.649  1.00 26.75 ? 459 LEU B CD2 1 
ATOM   7250 N  N   . VAL B 1 438 ? 13.905 38.258 57.675  1.00 26.60 ? 460 VAL B N   1 
ATOM   7251 C  CA  . VAL B 1 438 ? 13.565 38.643 56.318  1.00 27.06 ? 460 VAL B CA  1 
ATOM   7252 C  C   . VAL B 1 438 ? 12.736 37.572 55.607  1.00 27.62 ? 460 VAL B C   1 
ATOM   7253 O  O   . VAL B 1 438 ? 11.759 37.896 54.941  1.00 27.81 ? 460 VAL B O   1 
ATOM   7254 C  CB  . VAL B 1 438 ? 14.845 39.016 55.503  1.00 26.99 ? 460 VAL B CB  1 
ATOM   7255 C  CG1 . VAL B 1 438 ? 14.540 39.223 54.033  1.00 26.88 ? 460 VAL B CG1 1 
ATOM   7256 C  CG2 . VAL B 1 438 ? 15.505 40.278 56.083  1.00 27.34 ? 460 VAL B CG2 1 
ATOM   7257 N  N   . HIS B 1 439 ? 13.121 36.306 55.763  1.00 28.11 ? 461 HIS B N   1 
ATOM   7258 C  CA  . HIS B 1 439 ? 12.463 35.174 55.089  1.00 28.59 ? 461 HIS B CA  1 
ATOM   7259 C  C   . HIS B 1 439 ? 11.308 34.578 55.889  1.00 28.02 ? 461 HIS B C   1 
ATOM   7260 O  O   . HIS B 1 439 ? 10.430 33.924 55.324  1.00 28.31 ? 461 HIS B O   1 
ATOM   7261 C  CB  . HIS B 1 439 ? 13.476 34.058 54.801  1.00 29.36 ? 461 HIS B CB  1 
ATOM   7262 C  CG  . HIS B 1 439 ? 14.346 34.305 53.607  1.00 31.90 ? 461 HIS B CG  1 
ATOM   7263 N  ND1 . HIS B 1 439 ? 15.163 35.410 53.488  1.00 36.17 ? 461 HIS B ND1 1 
ATOM   7264 C  CD2 . HIS B 1 439 ? 14.549 33.567 52.491  1.00 33.94 ? 461 HIS B CD2 1 
ATOM   7265 C  CE1 . HIS B 1 439 ? 15.813 35.356 52.339  1.00 36.01 ? 461 HIS B CE1 1 
ATOM   7266 N  NE2 . HIS B 1 439 ? 15.464 34.243 51.718  1.00 36.04 ? 461 HIS B NE2 1 
ATOM   7267 N  N   . LEU B 1 440 ? 11.312 34.778 57.199  1.00 27.55 ? 462 LEU B N   1 
ATOM   7268 C  CA  . LEU B 1 440 ? 10.259 34.227 58.063  1.00 27.33 ? 462 LEU B CA  1 
ATOM   7269 C  C   . LEU B 1 440 ? 9.492  35.288 58.852  1.00 27.26 ? 462 LEU B C   1 
ATOM   7270 O  O   . LEU B 1 440 ? 9.914  36.435 58.945  1.00 26.95 ? 462 LEU B O   1 
ATOM   7271 C  CB  . LEU B 1 440 ? 10.853 33.212 59.060  1.00 27.21 ? 462 LEU B CB  1 
ATOM   7272 C  CG  . LEU B 1 440 ? 11.895 32.174 58.626  1.00 27.31 ? 462 LEU B CG  1 
ATOM   7273 C  CD1 . LEU B 1 440 ? 12.298 31.314 59.843  1.00 25.38 ? 462 LEU B CD1 1 
ATOM   7274 C  CD2 . LEU B 1 440 ? 11.414 31.302 57.453  1.00 27.24 ? 462 LEU B CD2 1 
ATOM   7275 N  N   . ASP B 1 441 ? 8.355  34.886 59.419  1.00 27.63 ? 463 ASP B N   1 
ATOM   7276 C  CA  . ASP B 1 441 ? 7.746  35.625 60.516  1.00 28.31 ? 463 ASP B CA  1 
ATOM   7277 C  C   . ASP B 1 441 ? 8.101  34.840 61.773  1.00 28.66 ? 463 ASP B C   1 
ATOM   7278 O  O   . ASP B 1 441 ? 7.922  33.626 61.821  1.00 29.07 ? 463 ASP B O   1 
ATOM   7279 C  CB  . ASP B 1 441 ? 6.203  35.710 60.382  1.00 28.33 ? 463 ASP B CB  1 
ATOM   7280 C  CG  . ASP B 1 441 ? 5.742  36.374 59.087  1.00 29.48 ? 463 ASP B CG  1 
ATOM   7281 O  OD1 . ASP B 1 441 ? 6.458  37.239 58.547  1.00 29.89 ? 463 ASP B OD1 1 
ATOM   7282 O  OD2 . ASP B 1 441 ? 4.641  36.034 58.605  1.00 30.38 ? 463 ASP B OD2 1 
ATOM   7283 N  N   . LEU B 1 442 ? 8.602  35.532 62.787  1.00 29.29 ? 464 LEU B N   1 
ATOM   7284 C  CA  . LEU B 1 442 ? 8.903  34.913 64.072  1.00 29.74 ? 464 LEU B CA  1 
ATOM   7285 C  C   . LEU B 1 442 ? 8.284  35.776 65.152  1.00 29.90 ? 464 LEU B C   1 
ATOM   7286 O  O   . LEU B 1 442 ? 8.470  36.992 65.158  1.00 30.15 ? 464 LEU B O   1 
ATOM   7287 C  CB  . LEU B 1 442 ? 10.426 34.828 64.282  1.00 29.80 ? 464 LEU B CB  1 
ATOM   7288 C  CG  . LEU B 1 442 ? 10.954 34.169 65.569  1.00 30.14 ? 464 LEU B CG  1 
ATOM   7289 C  CD1 . LEU B 1 442 ? 10.688 32.672 65.585  1.00 31.21 ? 464 LEU B CD1 1 
ATOM   7290 C  CD2 . LEU B 1 442 ? 12.435 34.417 65.744  1.00 30.70 ? 464 LEU B CD2 1 
ATOM   7291 N  N   . GLU B 1 443 ? 7.556  35.159 66.071  1.00 30.32 ? 465 GLU B N   1 
ATOM   7292 C  CA  . GLU B 1 443 ? 7.013  35.907 67.212  1.00 31.78 ? 465 GLU B CA  1 
ATOM   7293 C  C   . GLU B 1 443 ? 6.821  35.059 68.450  1.00 31.95 ? 465 GLU B C   1 
ATOM   7294 O  O   . GLU B 1 443 ? 6.725  33.838 68.363  1.00 32.17 ? 465 GLU B O   1 
ATOM   7295 C  CB  . GLU B 1 443 ? 5.697  36.622 66.850  1.00 32.25 ? 465 GLU B CB  1 
ATOM   7296 C  CG  . GLU B 1 443 ? 4.641  35.724 66.251  1.00 33.70 ? 465 GLU B CG  1 
ATOM   7297 C  CD  . GLU B 1 443 ? 3.408  36.485 65.808  1.00 36.22 ? 465 GLU B CD  1 
ATOM   7298 O  OE1 . GLU B 1 443 ? 2.306  36.074 66.218  1.00 35.87 ? 465 GLU B OE1 1 
ATOM   7299 O  OE2 . GLU B 1 443 ? 3.547  37.482 65.053  1.00 36.31 ? 465 GLU B OE2 1 
ATOM   7300 N  N   . LEU B 1 444 ? 6.787  35.722 69.601  1.00 32.38 ? 466 LEU B N   1 
ATOM   7301 C  CA  . LEU B 1 444 ? 6.439  35.091 70.867  1.00 32.82 ? 466 LEU B CA  1 
ATOM   7302 C  C   . LEU B 1 444 ? 4.986  34.611 70.874  1.00 33.87 ? 466 LEU B C   1 
ATOM   7303 O  O   . LEU B 1 444 ? 4.084  35.328 70.415  1.00 33.89 ? 466 LEU B O   1 
ATOM   7304 C  CB  . LEU B 1 444 ? 6.652  36.076 72.024  1.00 32.56 ? 466 LEU B CB  1 
ATOM   7305 C  CG  . LEU B 1 444 ? 8.034  36.711 72.254  1.00 31.12 ? 466 LEU B CG  1 
ATOM   7306 C  CD1 . LEU B 1 444 ? 7.920  37.942 73.139  1.00 29.61 ? 466 LEU B CD1 1 
ATOM   7307 C  CD2 . LEU B 1 444 ? 8.984  35.709 72.876  1.00 28.52 ? 466 LEU B CD2 1 
ATOM   7308 N  N   . ILE B 1 445 ? 4.767  33.398 71.379  1.00 34.71 ? 467 ILE B N   1 
ATOM   7309 C  CA  . ILE B 1 445 ? 3.415  32.917 71.685  1.00 36.13 ? 467 ILE B CA  1 
ATOM   7310 C  C   . ILE B 1 445 ? 2.754  33.931 72.649  1.00 36.89 ? 467 ILE B C   1 
ATOM   7311 O  O   . ILE B 1 445 ? 1.641  34.415 72.390  1.00 37.17 ? 467 ILE B O   1 
ATOM   7312 C  CB  . ILE B 1 445 ? 3.433  31.460 72.284  1.00 36.07 ? 467 ILE B CB  1 
ATOM   7313 C  CG1 . ILE B 1 445 ? 3.957  30.431 71.268  1.00 36.26 ? 467 ILE B CG1 1 
ATOM   7314 C  CG2 . ILE B 1 445 ? 2.062  31.043 72.841  1.00 36.80 ? 467 ILE B CG2 1 
ATOM   7315 C  CD1 . ILE B 1 445 ? 3.191  30.332 69.966  1.00 37.23 ? 467 ILE B CD1 1 
ATOM   7316 N  N   . ASN B 1 446 ? 3.471  34.266 73.729  1.00 37.25 ? 468 ASN B N   1 
ATOM   7317 C  CA  . ASN B 1 446 ? 3.046  35.272 74.701  1.00 37.77 ? 468 ASN B CA  1 
ATOM   7318 C  C   . ASN B 1 446 ? 4.031  36.439 74.760  1.00 37.96 ? 468 ASN B C   1 
ATOM   7319 O  O   . ASN B 1 446 ? 5.209  36.246 75.054  1.00 38.00 ? 468 ASN B O   1 
ATOM   7320 C  CB  . ASN B 1 446 ? 2.881  34.648 76.094  1.00 37.65 ? 468 ASN B CB  1 
ATOM   7321 C  CG  . ASN B 1 446 ? 2.506  35.676 77.162  1.00 38.73 ? 468 ASN B CG  1 
ATOM   7322 O  OD1 . ASN B 1 446 ? 2.918  35.566 78.317  1.00 40.12 ? 468 ASN B OD1 1 
ATOM   7323 N  ND2 . ASN B 1 446 ? 1.738  36.687 76.775  1.00 38.46 ? 468 ASN B ND2 1 
ATOM   7324 N  N   . ALA B 1 447 ? 3.535  37.646 74.491  1.00 38.20 ? 469 ALA B N   1 
ATOM   7325 C  CA  . ALA B 1 447 ? 4.369  38.849 74.438  1.00 38.27 ? 469 ALA B CA  1 
ATOM   7326 C  C   . ALA B 1 447 ? 4.825  39.318 75.820  1.00 38.41 ? 469 ALA B C   1 
ATOM   7327 O  O   . ALA B 1 447 ? 5.824  40.034 75.943  1.00 38.55 ? 469 ALA B O   1 
ATOM   7328 C  CB  . ALA B 1 447 ? 3.642  39.970 73.701  1.00 38.50 ? 469 ALA B CB  1 
ATOM   7329 N  N   . ASP B 1 448 ? 4.098  38.904 76.854  1.00 38.11 ? 470 ASP B N   1 
ATOM   7330 C  CA  . ASP B 1 448 ? 4.412  39.284 78.229  1.00 37.93 ? 470 ASP B CA  1 
ATOM   7331 C  C   . ASP B 1 448 ? 5.335  38.294 78.935  1.00 37.02 ? 470 ASP B C   1 
ATOM   7332 O  O   . ASP B 1 448 ? 5.662  38.480 80.112  1.00 36.49 ? 470 ASP B O   1 
ATOM   7333 C  CB  . ASP B 1 448 ? 3.121  39.447 79.044  1.00 38.74 ? 470 ASP B CB  1 
ATOM   7334 C  CG  . ASP B 1 448 ? 2.573  40.870 79.006  1.00 41.18 ? 470 ASP B CG  1 
ATOM   7335 O  OD1 . ASP B 1 448 ? 3.375  41.830 78.840  1.00 43.66 ? 470 ASP B OD1 1 
ATOM   7336 O  OD2 . ASP B 1 448 ? 1.333  41.023 79.162  1.00 42.92 ? 470 ASP B OD2 1 
ATOM   7337 N  N   . VAL B 1 449 ? 5.747  37.248 78.215  1.00 36.40 ? 471 VAL B N   1 
ATOM   7338 C  CA  . VAL B 1 449 ? 6.606  36.195 78.773  1.00 35.52 ? 471 VAL B CA  1 
ATOM   7339 C  C   . VAL B 1 449 ? 7.860  36.817 79.405  1.00 35.45 ? 471 VAL B C   1 
ATOM   7340 O  O   . VAL B 1 449 ? 8.463  37.723 78.838  1.00 35.18 ? 471 VAL B O   1 
ATOM   7341 C  CB  . VAL B 1 449 ? 6.948  35.081 77.699  1.00 35.39 ? 471 VAL B CB  1 
ATOM   7342 C  CG1 . VAL B 1 449 ? 7.860  35.610 76.574  1.00 34.74 ? 471 VAL B CG1 1 
ATOM   7343 C  CG2 . VAL B 1 449 ? 7.560  33.846 78.353  1.00 34.54 ? 471 VAL B CG2 1 
ATOM   7344 N  N   . GLU B 1 450 ? 8.225  36.355 80.595  1.00 35.33 ? 472 GLU B N   1 
ATOM   7345 C  CA  . GLU B 1 450 ? 9.436  36.841 81.249  1.00 35.75 ? 472 GLU B CA  1 
ATOM   7346 C  C   . GLU B 1 450 ? 10.693 36.207 80.663  1.00 34.96 ? 472 GLU B C   1 
ATOM   7347 O  O   . GLU B 1 450 ? 10.673 35.054 80.228  1.00 34.99 ? 472 GLU B O   1 
ATOM   7348 C  CB  . GLU B 1 450 ? 9.385  36.591 82.766  1.00 36.34 ? 472 GLU B CB  1 
ATOM   7349 C  CG  . GLU B 1 450 ? 8.200  37.244 83.481  1.00 38.61 ? 472 GLU B CG  1 
ATOM   7350 C  CD  . GLU B 1 450 ? 7.990  38.697 83.069  1.00 42.07 ? 472 GLU B CD  1 
ATOM   7351 O  OE1 . GLU B 1 450 ? 8.935  39.509 83.204  1.00 42.64 ? 472 GLU B OE1 1 
ATOM   7352 O  OE2 . GLU B 1 450 ? 6.876  39.022 82.598  1.00 44.09 ? 472 GLU B OE2 1 
ATOM   7353 N  N   . ILE B 1 451 ? 11.785 36.965 80.663  1.00 34.11 ? 473 ILE B N   1 
ATOM   7354 C  CA  . ILE B 1 451 ? 13.083 36.438 80.247  1.00 33.12 ? 473 ILE B CA  1 
ATOM   7355 C  C   . ILE B 1 451 ? 13.529 35.396 81.270  1.00 32.30 ? 473 ILE B C   1 
ATOM   7356 O  O   . ILE B 1 451 ? 13.672 35.715 82.444  1.00 31.94 ? 473 ILE B O   1 
ATOM   7357 C  CB  . ILE B 1 451 ? 14.129 37.567 80.050  1.00 33.28 ? 473 ILE B CB  1 
ATOM   7358 C  CG1 . ILE B 1 451 ? 13.865 38.288 78.732  1.00 33.15 ? 473 ILE B CG1 1 
ATOM   7359 C  CG2 . ILE B 1 451 ? 15.569 37.020 80.070  1.00 33.22 ? 473 ILE B CG2 1 
ATOM   7360 C  CD1 . ILE B 1 451 ? 14.283 39.741 78.746  1.00 34.84 ? 473 ILE B CD1 1 
ATOM   7361 N  N   . PRO B 1 452 ? 13.744 34.138 80.822  1.00 31.86 ? 474 PRO B N   1 
ATOM   7362 C  CA  . PRO B 1 452 ? 14.077 33.076 81.766  1.00 31.25 ? 474 PRO B CA  1 
ATOM   7363 C  C   . PRO B 1 452 ? 15.394 33.355 82.476  1.00 31.11 ? 474 PRO B C   1 
ATOM   7364 O  O   . PRO B 1 452 ? 16.249 34.080 81.952  1.00 30.65 ? 474 PRO B O   1 
ATOM   7365 C  CB  . PRO B 1 452 ? 14.233 31.840 80.873  1.00 31.58 ? 474 PRO B CB  1 
ATOM   7366 C  CG  . PRO B 1 452 ? 13.604 32.176 79.605  1.00 31.68 ? 474 PRO B CG  1 
ATOM   7367 C  CD  . PRO B 1 452 ? 13.728 33.650 79.434  1.00 31.42 ? 474 PRO B CD  1 
ATOM   7368 N  N   . GLU B 1 453 ? 15.553 32.787 83.667  1.00 30.96 ? 475 GLU B N   1 
ATOM   7369 C  CA  . GLU B 1 453 ? 16.817 32.883 84.404  1.00 30.61 ? 475 GLU B CA  1 
ATOM   7370 C  C   . GLU B 1 453 ? 17.856 31.951 83.760  1.00 29.34 ? 475 GLU B C   1 
ATOM   7371 O  O   . GLU B 1 453 ? 17.492 31.030 83.017  1.00 28.96 ? 475 GLU B O   1 
ATOM   7372 C  CB  . GLU B 1 453 ? 16.595 32.534 85.895  1.00 31.25 ? 475 GLU B CB  1 
ATOM   7373 C  CG  . GLU B 1 453 ? 17.831 32.698 86.811  1.00 34.98 ? 475 GLU B CG  1 
ATOM   7374 C  CD  . GLU B 1 453 ? 18.523 34.052 86.654  1.00 40.25 ? 475 GLU B CD  1 
ATOM   7375 O  OE1 . GLU B 1 453 ? 17.838 35.090 86.853  1.00 42.90 ? 475 GLU B OE1 1 
ATOM   7376 O  OE2 . GLU B 1 453 ? 19.744 34.075 86.341  1.00 40.87 ? 475 GLU B OE2 1 
ATOM   7377 N  N   . PHE B 1 454 ? 19.134 32.204 84.044  1.00 27.89 ? 476 PHE B N   1 
ATOM   7378 C  CA  . PHE B 1 454 ? 20.221 31.320 83.653  1.00 27.21 ? 476 PHE B CA  1 
ATOM   7379 C  C   . PHE B 1 454 ? 20.173 29.971 84.375  1.00 27.17 ? 476 PHE B C   1 
ATOM   7380 O  O   . PHE B 1 454 ? 19.818 29.885 85.561  1.00 26.42 ? 476 PHE B O   1 
ATOM   7381 C  CB  . PHE B 1 454 ? 21.582 31.966 83.953  1.00 26.97 ? 476 PHE B CB  1 
ATOM   7382 C  CG  . PHE B 1 454 ? 21.890 33.204 83.141  1.00 26.24 ? 476 PHE B CG  1 
ATOM   7383 C  CD1 . PHE B 1 454 ? 21.387 33.381 81.861  1.00 25.28 ? 476 PHE B CD1 1 
ATOM   7384 C  CD2 . PHE B 1 454 ? 22.748 34.171 83.653  1.00 27.96 ? 476 PHE B CD2 1 
ATOM   7385 C  CE1 . PHE B 1 454 ? 21.696 34.522 81.112  1.00 25.36 ? 476 PHE B CE1 1 
ATOM   7386 C  CE2 . PHE B 1 454 ? 23.069 35.317 82.913  1.00 26.33 ? 476 PHE B CE2 1 
ATOM   7387 C  CZ  . PHE B 1 454 ? 22.543 35.489 81.639  1.00 26.34 ? 476 PHE B CZ  1 
ATOM   7388 N  N   . ASP B 1 455 ? 20.539 28.922 83.643  1.00 26.69 ? 477 ASP B N   1 
ATOM   7389 C  CA  . ASP B 1 455 ? 20.980 27.671 84.237  1.00 26.56 ? 477 ASP B CA  1 
ATOM   7390 C  C   . ASP B 1 455 ? 22.337 27.935 84.893  1.00 26.16 ? 477 ASP B C   1 
ATOM   7391 O  O   . ASP B 1 455 ? 23.377 27.957 84.218  1.00 25.87 ? 477 ASP B O   1 
ATOM   7392 C  CB  . ASP B 1 455 ? 21.102 26.597 83.156  1.00 27.31 ? 477 ASP B CB  1 
ATOM   7393 C  CG  . ASP B 1 455 ? 21.566 25.255 83.703  1.00 28.73 ? 477 ASP B CG  1 
ATOM   7394 O  OD1 . ASP B 1 455 ? 22.206 25.219 84.785  1.00 30.03 ? 477 ASP B OD1 1 
ATOM   7395 O  OD2 . ASP B 1 455 ? 21.283 24.229 83.042  1.00 30.75 ? 477 ASP B OD2 1 
ATOM   7396 N  N   . LEU B 1 456 ? 22.318 28.133 86.210  1.00 25.52 ? 478 LEU B N   1 
ATOM   7397 C  CA  . LEU B 1 456 ? 23.474 28.628 86.950  1.00 25.16 ? 478 LEU B CA  1 
ATOM   7398 C  C   . LEU B 1 456 ? 24.712 27.742 86.877  1.00 25.03 ? 478 LEU B C   1 
ATOM   7399 O  O   . LEU B 1 456 ? 25.818 28.216 87.090  1.00 25.35 ? 478 LEU B O   1 
ATOM   7400 C  CB  . LEU B 1 456 ? 23.103 28.900 88.417  1.00 25.47 ? 478 LEU B CB  1 
ATOM   7401 C  CG  . LEU B 1 456 ? 22.063 29.980 88.719  1.00 25.71 ? 478 LEU B CG  1 
ATOM   7402 C  CD1 . LEU B 1 456 ? 21.661 29.939 90.207  1.00 26.45 ? 478 LEU B CD1 1 
ATOM   7403 C  CD2 . LEU B 1 456 ? 22.578 31.371 88.322  1.00 25.00 ? 478 LEU B CD2 1 
ATOM   7404 N  N   . SER B 1 457 ? 24.524 26.462 86.563  1.00 24.82 ? 479 SER B N   1 
ATOM   7405 C  CA  . SER B 1 457 ? 25.625 25.501 86.496  1.00 24.71 ? 479 SER B CA  1 
ATOM   7406 C  C   . SER B 1 457 ? 26.565 25.759 85.299  1.00 24.30 ? 479 SER B C   1 
ATOM   7407 O  O   . SER B 1 457 ? 27.624 25.142 85.193  1.00 24.06 ? 479 SER B O   1 
ATOM   7408 C  CB  . SER B 1 457 ? 25.055 24.082 86.423  1.00 25.03 ? 479 SER B CB  1 
ATOM   7409 O  OG  . SER B 1 457 ? 24.319 23.898 85.220  1.00 25.19 ? 479 SER B OG  1 
ATOM   7410 N  N   . ARG B 1 458 ? 26.174 26.683 84.418  1.00 23.74 ? 480 ARG B N   1 
ATOM   7411 C  CA  . ARG B 1 458 ? 26.912 26.929 83.191  1.00 23.96 ? 480 ARG B CA  1 
ATOM   7412 C  C   . ARG B 1 458 ? 27.976 28.024 83.243  1.00 23.37 ? 480 ARG B C   1 
ATOM   7413 O  O   . ARG B 1 458 ? 28.649 28.260 82.234  1.00 24.19 ? 480 ARG B O   1 
ATOM   7414 C  CB  . ARG B 1 458 ? 25.946 27.222 82.045  1.00 24.55 ? 480 ARG B CB  1 
ATOM   7415 C  CG  . ARG B 1 458 ? 25.135 26.027 81.652  1.00 26.63 ? 480 ARG B CG  1 
ATOM   7416 C  CD  . ARG B 1 458 ? 25.094 25.852 80.160  1.00 26.84 ? 480 ARG B CD  1 
ATOM   7417 N  NE  . ARG B 1 458 ? 24.615 24.515 79.914  1.00 30.35 ? 480 ARG B NE  1 
ATOM   7418 C  CZ  . ARG B 1 458 ? 25.272 23.557 79.282  1.00 31.26 ? 480 ARG B CZ  1 
ATOM   7419 N  NH1 . ARG B 1 458 ? 26.455 23.771 78.717  1.00 30.42 ? 480 ARG B NH1 1 
ATOM   7420 N  NH2 . ARG B 1 458 ? 24.688 22.380 79.176  1.00 34.36 ? 480 ARG B NH2 1 
ATOM   7421 N  N   . TYR B 1 459 ? 28.135 28.693 84.386  1.00 22.73 ? 481 TYR B N   1 
ATOM   7422 C  CA  . TYR B 1 459 ? 29.130 29.771 84.503  1.00 21.73 ? 481 TYR B CA  1 
ATOM   7423 C  C   . TYR B 1 459 ? 30.523 29.245 84.196  1.00 21.52 ? 481 TYR B C   1 
ATOM   7424 O  O   . TYR B 1 459 ? 30.934 28.233 84.744  1.00 21.41 ? 481 TYR B O   1 
ATOM   7425 C  CB  . TYR B 1 459 ? 29.109 30.445 85.887  1.00 21.31 ? 481 TYR B CB  1 
ATOM   7426 C  CG  . TYR B 1 459 ? 28.000 31.454 86.057  1.00 20.61 ? 481 TYR B CG  1 
ATOM   7427 C  CD1 . TYR B 1 459 ? 27.825 32.488 85.139  1.00 19.55 ? 481 TYR B CD1 1 
ATOM   7428 C  CD2 . TYR B 1 459 ? 27.113 31.368 87.136  1.00 19.52 ? 481 TYR B CD2 1 
ATOM   7429 C  CE1 . TYR B 1 459 ? 26.791 33.403 85.276  1.00 17.19 ? 481 TYR B CE1 1 
ATOM   7430 C  CE2 . TYR B 1 459 ? 26.091 32.288 87.299  1.00 19.73 ? 481 TYR B CE2 1 
ATOM   7431 C  CZ  . TYR B 1 459 ? 25.938 33.303 86.363  1.00 18.99 ? 481 TYR B CZ  1 
ATOM   7432 O  OH  . TYR B 1 459 ? 24.927 34.195 86.517  1.00 19.60 ? 481 TYR B OH  1 
ATOM   7433 N  N   . GLY B 1 460 ? 31.231 29.936 83.308  1.00 21.51 ? 482 GLY B N   1 
ATOM   7434 C  CA  . GLY B 1 460 ? 32.585 29.543 82.914  1.00 22.29 ? 482 GLY B CA  1 
ATOM   7435 C  C   . GLY B 1 460 ? 32.729 28.683 81.668  1.00 22.88 ? 482 GLY B C   1 
ATOM   7436 O  O   . GLY B 1 460 ? 33.852 28.386 81.240  1.00 23.39 ? 482 GLY B O   1 
ATOM   7437 N  N   . PHE B 1 461 ? 31.611 28.260 81.087  1.00 23.26 ? 483 PHE B N   1 
ATOM   7438 C  CA  . PHE B 1 461 ? 31.656 27.486 79.836  1.00 24.44 ? 483 PHE B CA  1 
ATOM   7439 C  C   . PHE B 1 461 ? 31.483 28.306 78.547  1.00 24.52 ? 483 PHE B C   1 
ATOM   7440 O  O   . PHE B 1 461 ? 31.751 27.815 77.449  1.00 26.22 ? 483 PHE B O   1 
ATOM   7441 C  CB  . PHE B 1 461 ? 30.661 26.330 79.878  1.00 24.36 ? 483 PHE B CB  1 
ATOM   7442 C  CG  . PHE B 1 461 ? 30.998 25.311 80.917  1.00 27.21 ? 483 PHE B CG  1 
ATOM   7443 C  CD1 . PHE B 1 461 ? 30.232 25.197 82.074  1.00 26.87 ? 483 PHE B CD1 1 
ATOM   7444 C  CD2 . PHE B 1 461 ? 32.127 24.506 80.770  1.00 29.58 ? 483 PHE B CD2 1 
ATOM   7445 C  CE1 . PHE B 1 461 ? 30.559 24.260 83.052  1.00 29.36 ? 483 PHE B CE1 1 
ATOM   7446 C  CE2 . PHE B 1 461 ? 32.466 23.557 81.754  1.00 31.63 ? 483 PHE B CE2 1 
ATOM   7447 C  CZ  . PHE B 1 461 ? 31.680 23.442 82.892  1.00 30.51 ? 483 PHE B CZ  1 
ATOM   7448 N  N   . GLY B 1 462 ? 31.049 29.546 78.675  1.00 23.18 ? 484 GLY B N   1 
ATOM   7449 C  CA  . GLY B 1 462 ? 30.867 30.374 77.502  1.00 22.25 ? 484 GLY B CA  1 
ATOM   7450 C  C   . GLY B 1 462 ? 29.507 30.993 77.617  1.00 21.26 ? 484 GLY B C   1 
ATOM   7451 O  O   . GLY B 1 462 ? 29.190 31.607 78.644  1.00 21.62 ? 484 GLY B O   1 
ATOM   7452 N  N   . LEU B 1 463 ? 28.692 30.786 76.587  1.00 20.39 ? 485 LEU B N   1 
ATOM   7453 C  CA  . LEU B 1 463 ? 27.337 31.303 76.546  1.00 19.42 ? 485 LEU B CA  1 
ATOM   7454 C  C   . LEU B 1 463 ? 26.453 30.620 77.575  1.00 19.66 ? 485 LEU B C   1 
ATOM   7455 O  O   . LEU B 1 463 ? 26.457 29.391 77.703  1.00 19.92 ? 485 LEU B O   1 
ATOM   7456 C  CB  . LEU B 1 463 ? 26.727 31.134 75.145  1.00 19.45 ? 485 LEU B CB  1 
ATOM   7457 C  CG  . LEU B 1 463 ? 26.767 32.356 74.237  1.00 19.05 ? 485 LEU B CG  1 
ATOM   7458 C  CD1 . LEU B 1 463 ? 25.950 33.487 74.881  1.00 16.43 ? 485 LEU B CD1 1 
ATOM   7459 C  CD2 . LEU B 1 463 ? 28.216 32.808 73.990  1.00 17.07 ? 485 LEU B CD2 1 
ATOM   7460 N  N   . MET B 1 464 ? 25.709 31.431 78.313  1.00 19.20 ? 486 MET B N   1 
ATOM   7461 C  CA  . MET B 1 464 ? 24.752 30.929 79.287  1.00 18.51 ? 486 MET B CA  1 
ATOM   7462 C  C   . MET B 1 464 ? 23.553 30.368 78.519  1.00 18.86 ? 486 MET B C   1 
ATOM   7463 O  O   . MET B 1 464 ? 23.289 30.769 77.365  1.00 17.54 ? 486 MET B O   1 
ATOM   7464 C  CB  . MET B 1 464 ? 24.325 32.056 80.241  1.00 18.78 ? 486 MET B CB  1 
ATOM   7465 C  CG  . MET B 1 464 ? 25.423 32.535 81.254  1.00 17.05 ? 486 MET B CG  1 
ATOM   7466 S  SD  . MET B 1 464 ? 26.280 31.260 82.162  1.00 9.52  ? 486 MET B SD  1 
ATOM   7467 C  CE  . MET B 1 464 ? 25.066 30.907 83.420  1.00 19.35 ? 486 MET B CE  1 
ATOM   7468 N  N   . GLN B 1 465 ? 22.874 29.407 79.139  1.00 18.93 ? 487 GLN B N   1 
ATOM   7469 C  CA  . GLN B 1 465 ? 21.636 28.839 78.597  1.00 19.80 ? 487 GLN B CA  1 
ATOM   7470 C  C   . GLN B 1 465 ? 20.477 29.081 79.579  1.00 20.52 ? 487 GLN B C   1 
ATOM   7471 O  O   . GLN B 1 465 ? 20.715 29.191 80.767  1.00 19.84 ? 487 GLN B O   1 
ATOM   7472 C  CB  . GLN B 1 465 ? 21.836 27.351 78.268  1.00 20.02 ? 487 GLN B CB  1 
ATOM   7473 C  CG  . GLN B 1 465 ? 22.881 27.115 77.118  1.00 20.80 ? 487 GLN B CG  1 
ATOM   7474 C  CD  . GLN B 1 465 ? 23.143 25.642 76.808  1.00 22.23 ? 487 GLN B CD  1 
ATOM   7475 O  OE1 . GLN B 1 465 ? 22.326 24.787 77.120  1.00 24.01 ? 487 GLN B OE1 1 
ATOM   7476 N  NE2 . GLN B 1 465 ? 24.295 25.346 76.194  1.00 19.78 ? 487 GLN B NE2 1 
ATOM   7477 N  N   . PRO B 1 466 ? 19.225 29.194 79.082  1.00 21.79 ? 488 PRO B N   1 
ATOM   7478 C  CA  . PRO B 1 466 ? 18.123 29.546 79.992  1.00 22.97 ? 488 PRO B CA  1 
ATOM   7479 C  C   . PRO B 1 466 ? 17.641 28.326 80.805  1.00 24.52 ? 488 PRO B C   1 
ATOM   7480 O  O   . PRO B 1 466 ? 17.733 27.200 80.329  1.00 24.16 ? 488 PRO B O   1 
ATOM   7481 C  CB  . PRO B 1 466 ? 17.015 30.000 79.035  1.00 22.88 ? 488 PRO B CB  1 
ATOM   7482 C  CG  . PRO B 1 466 ? 17.253 29.174 77.753  1.00 22.29 ? 488 PRO B CG  1 
ATOM   7483 C  CD  . PRO B 1 466 ? 18.763 28.994 77.688  1.00 21.60 ? 488 PRO B CD  1 
ATOM   7484 N  N   . GLU B 1 467 ? 17.122 28.545 82.012  1.00 26.18 ? 489 GLU B N   1 
ATOM   7485 C  CA  . GLU B 1 467 ? 16.648 27.416 82.817  1.00 27.57 ? 489 GLU B CA  1 
ATOM   7486 C  C   . GLU B 1 467 ? 15.447 26.698 82.199  1.00 28.33 ? 489 GLU B C   1 
ATOM   7487 O  O   . GLU B 1 467 ? 15.179 25.536 82.511  1.00 29.10 ? 489 GLU B O   1 
ATOM   7488 C  CB  . GLU B 1 467 ? 16.406 27.805 84.277  1.00 28.39 ? 489 GLU B CB  1 
ATOM   7489 C  CG  . GLU B 1 467 ? 15.293 28.793 84.567  1.00 29.55 ? 489 GLU B CG  1 
ATOM   7490 C  CD  . GLU B 1 467 ? 15.043 28.938 86.078  1.00 32.67 ? 489 GLU B CD  1 
ATOM   7491 O  OE1 . GLU B 1 467 ? 15.948 28.612 86.881  1.00 32.08 ? 489 GLU B OE1 1 
ATOM   7492 O  OE2 . GLU B 1 467 ? 13.934 29.368 86.465  1.00 33.80 ? 489 GLU B OE2 1 
ATOM   7493 N  N   . HIS B 1 468 ? 14.735 27.399 81.324  1.00 28.53 ? 490 HIS B N   1 
ATOM   7494 C  CA  . HIS B 1 468 ? 13.708 26.801 80.500  1.00 29.18 ? 490 HIS B CA  1 
ATOM   7495 C  C   . HIS B 1 468 ? 13.601 27.588 79.211  1.00 28.78 ? 490 HIS B C   1 
ATOM   7496 O  O   . HIS B 1 468 ? 14.114 28.705 79.106  1.00 28.59 ? 490 HIS B O   1 
ATOM   7497 C  CB  . HIS B 1 468 ? 12.344 26.743 81.213  1.00 29.97 ? 490 HIS B CB  1 
ATOM   7498 C  CG  . HIS B 1 468 ? 11.906 28.047 81.802  1.00 31.58 ? 490 HIS B CG  1 
ATOM   7499 N  ND1 . HIS B 1 468 ? 11.514 29.121 81.030  1.00 33.72 ? 490 HIS B ND1 1 
ATOM   7500 C  CD2 . HIS B 1 468 ? 11.804 28.452 83.092  1.00 33.10 ? 490 HIS B CD2 1 
ATOM   7501 C  CE1 . HIS B 1 468 ? 11.186 30.130 81.819  1.00 33.16 ? 490 HIS B CE1 1 
ATOM   7502 N  NE2 . HIS B 1 468 ? 11.353 29.751 83.074  1.00 33.49 ? 490 HIS B NE2 1 
ATOM   7503 N  N   . ASP B 1 469 ? 12.924 26.995 78.238  1.00 27.98 ? 491 ASP B N   1 
ATOM   7504 C  CA  . ASP B 1 469 ? 12.789 27.592 76.928  1.00 27.73 ? 491 ASP B CA  1 
ATOM   7505 C  C   . ASP B 1 469 ? 11.615 28.573 76.893  1.00 27.72 ? 491 ASP B C   1 
ATOM   7506 O  O   . ASP B 1 469 ? 10.796 28.632 77.813  1.00 27.67 ? 491 ASP B O   1 
ATOM   7507 C  CB  . ASP B 1 469 ? 12.639 26.499 75.863  1.00 27.08 ? 491 ASP B CB  1 
ATOM   7508 C  CG  . ASP B 1 469 ? 13.303 26.863 74.550  1.00 27.19 ? 491 ASP B CG  1 
ATOM   7509 O  OD1 . ASP B 1 469 ? 13.486 28.072 74.266  1.00 27.79 ? 491 ASP B OD1 1 
ATOM   7510 O  OD2 . ASP B 1 469 ? 13.636 25.930 73.786  1.00 24.71 ? 491 ASP B OD2 1 
ATOM   7511 N  N   . VAL B 1 470 ? 11.566 29.336 75.812  1.00 27.71 ? 492 VAL B N   1 
ATOM   7512 C  CA  . VAL B 1 470 ? 10.549 30.342 75.555  1.00 27.33 ? 492 VAL B CA  1 
ATOM   7513 C  C   . VAL B 1 470 ? 9.800  29.897 74.307  1.00 27.25 ? 492 VAL B C   1 
ATOM   7514 O  O   . VAL B 1 470 ? 10.410 29.735 73.244  1.00 27.53 ? 492 VAL B O   1 
ATOM   7515 C  CB  . VAL B 1 470 ? 11.210 31.720 75.284  1.00 27.11 ? 492 VAL B CB  1 
ATOM   7516 C  CG1 . VAL B 1 470 ? 10.183 32.760 74.855  1.00 28.16 ? 492 VAL B CG1 1 
ATOM   7517 C  CG2 . VAL B 1 470 ? 12.011 32.193 76.510  1.00 26.61 ? 492 VAL B CG2 1 
ATOM   7518 N  N   . PRO B 1 471 ? 8.479  29.665 74.428  1.00 27.32 ? 493 PRO B N   1 
ATOM   7519 C  CA  . PRO B 1 471 ? 7.683  29.310 73.254  1.00 26.99 ? 493 PRO B CA  1 
ATOM   7520 C  C   . PRO B 1 471 ? 7.567  30.405 72.188  1.00 27.25 ? 493 PRO B C   1 
ATOM   7521 O  O   . PRO B 1 471 ? 7.294  31.579 72.490  1.00 27.23 ? 493 PRO B O   1 
ATOM   7522 C  CB  . PRO B 1 471 ? 6.307  28.954 73.838  1.00 27.36 ? 493 PRO B CB  1 
ATOM   7523 C  CG  . PRO B 1 471 ? 6.275  29.533 75.213  1.00 27.43 ? 493 PRO B CG  1 
ATOM   7524 C  CD  . PRO B 1 471 ? 7.693  29.655 75.681  1.00 27.37 ? 493 PRO B CD  1 
ATOM   7525 N  N   . VAL B 1 472 ? 7.797  30.011 70.939  1.00 27.08 ? 494 VAL B N   1 
ATOM   7526 C  CA  . VAL B 1 472 ? 7.615  30.904 69.798  1.00 26.57 ? 494 VAL B CA  1 
ATOM   7527 C  C   . VAL B 1 472 ? 6.808  30.222 68.714  1.00 26.52 ? 494 VAL B C   1 
ATOM   7528 O  O   . VAL B 1 472 ? 6.519  29.034 68.788  1.00 26.13 ? 494 VAL B O   1 
ATOM   7529 C  CB  . VAL B 1 472 ? 8.967  31.427 69.189  1.00 26.32 ? 494 VAL B CB  1 
ATOM   7530 C  CG1 . VAL B 1 472 ? 9.656  32.418 70.141  1.00 26.75 ? 494 VAL B CG1 1 
ATOM   7531 C  CG2 . VAL B 1 472 ? 9.896  30.270 68.804  1.00 26.10 ? 494 VAL B CG2 1 
ATOM   7532 N  N   . ARG B 1 473 ? 6.499  31.003 67.691  1.00 27.34 ? 495 ARG B N   1 
ATOM   7533 C  CA  . ARG B 1 473 ? 5.719  30.605 66.550  1.00 28.36 ? 495 ARG B CA  1 
ATOM   7534 C  C   . ARG B 1 473 ? 6.507  31.134 65.351  1.00 28.20 ? 495 ARG B C   1 
ATOM   7535 O  O   . ARG B 1 473 ? 6.933  32.281 65.366  1.00 27.82 ? 495 ARG B O   1 
ATOM   7536 C  CB  . ARG B 1 473 ? 4.394  31.366 66.639  1.00 28.62 ? 495 ARG B CB  1 
ATOM   7537 C  CG  . ARG B 1 473 ? 3.192  30.683 66.096  1.00 31.79 ? 495 ARG B CG  1 
ATOM   7538 C  CD  . ARG B 1 473 ? 1.957  31.346 66.680  1.00 35.78 ? 495 ARG B CD  1 
ATOM   7539 N  NE  . ARG B 1 473 ? 1.632  32.640 66.068  1.00 37.67 ? 495 ARG B NE  1 
ATOM   7540 C  CZ  . ARG B 1 473 ? 0.444  32.923 65.529  1.00 39.27 ? 495 ARG B CZ  1 
ATOM   7541 N  NH1 . ARG B 1 473 ? -0.510 31.993 65.534  1.00 38.74 ? 495 ARG B NH1 1 
ATOM   7542 N  NH2 . ARG B 1 473 ? 0.202  34.126 64.990  1.00 37.73 ? 495 ARG B NH2 1 
ATOM   7543 N  N   . TYR B 1 474 ? 6.713  30.310 64.327  1.00 28.39 ? 496 TYR B N   1 
ATOM   7544 C  CA  . TYR B 1 474 ? 7.339  30.797 63.101  1.00 29.07 ? 496 TYR B CA  1 
ATOM   7545 C  C   . TYR B 1 474 ? 6.720  30.200 61.838  1.00 29.32 ? 496 TYR B C   1 
ATOM   7546 O  O   . TYR B 1 474 ? 6.179  29.095 61.861  1.00 29.05 ? 496 TYR B O   1 
ATOM   7547 C  CB  . TYR B 1 474 ? 8.862  30.538 63.108  1.00 29.54 ? 496 TYR B CB  1 
ATOM   7548 C  CG  . TYR B 1 474 ? 9.236  29.136 62.682  1.00 28.81 ? 496 TYR B CG  1 
ATOM   7549 C  CD1 . TYR B 1 474 ? 9.592  28.860 61.367  1.00 29.85 ? 496 TYR B CD1 1 
ATOM   7550 C  CD2 . TYR B 1 474 ? 9.214  28.087 63.596  1.00 30.35 ? 496 TYR B CD2 1 
ATOM   7551 C  CE1 . TYR B 1 474 ? 9.919  27.569 60.975  1.00 32.32 ? 496 TYR B CE1 1 
ATOM   7552 C  CE2 . TYR B 1 474 ? 9.537  26.802 63.219  1.00 31.68 ? 496 TYR B CE2 1 
ATOM   7553 C  CZ  . TYR B 1 474 ? 9.883  26.547 61.909  1.00 33.12 ? 496 TYR B CZ  1 
ATOM   7554 O  OH  . TYR B 1 474 ? 10.209 25.262 61.547  1.00 35.93 ? 496 TYR B OH  1 
ATOM   7555 N  N   . ARG B 1 475 ? 6.840  30.935 60.734  1.00 29.68 ? 497 ARG B N   1 
ATOM   7556 C  CA  . ARG B 1 475 ? 6.402  30.462 59.423  1.00 30.43 ? 497 ARG B CA  1 
ATOM   7557 C  C   . ARG B 1 475 ? 7.229  31.094 58.316  1.00 30.32 ? 497 ARG B C   1 
ATOM   7558 O  O   . ARG B 1 475 ? 7.744  32.197 58.476  1.00 30.32 ? 497 ARG B O   1 
ATOM   7559 C  CB  . ARG B 1 475 ? 4.919  30.790 59.194  1.00 29.94 ? 497 ARG B CB  1 
ATOM   7560 C  CG  . ARG B 1 475 ? 4.607  32.265 59.225  1.00 31.04 ? 497 ARG B CG  1 
ATOM   7561 C  CD  . ARG B 1 475 ? 3.165  32.541 58.836  1.00 31.55 ? 497 ARG B CD  1 
ATOM   7562 N  NE  . ARG B 1 475 ? 2.888  33.973 58.840  1.00 29.65 ? 497 ARG B NE  1 
ATOM   7563 C  CZ  . ARG B 1 475 ? 1.678  34.503 58.692  1.00 29.88 ? 497 ARG B CZ  1 
ATOM   7564 N  NH1 . ARG B 1 475 ? 0.636  33.708 58.508  1.00 28.29 ? 497 ARG B NH1 1 
ATOM   7565 N  NH2 . ARG B 1 475 ? 1.509  35.822 58.746  1.00 25.84 ? 497 ARG B NH2 1 
ATOM   7566 N  N   . ILE B 1 476 ? 7.332  30.412 57.181  1.00 30.94 ? 498 ILE B N   1 
ATOM   7567 C  CA  . ILE B 1 476 ? 7.851  31.050 55.979  1.00 31.95 ? 498 ILE B CA  1 
ATOM   7568 C  C   . ILE B 1 476 ? 6.931  32.242 55.689  1.00 32.42 ? 498 ILE B C   1 
ATOM   7569 O  O   . ILE B 1 476 ? 5.721  32.154 55.875  1.00 31.89 ? 498 ILE B O   1 
ATOM   7570 C  CB  . ILE B 1 476 ? 7.893  30.084 54.771  1.00 32.43 ? 498 ILE B CB  1 
ATOM   7571 C  CG1 . ILE B 1 476 ? 8.550  28.743 55.165  1.00 34.31 ? 498 ILE B CG1 1 
ATOM   7572 C  CG2 . ILE B 1 476 ? 8.624  30.728 53.583  1.00 31.95 ? 498 ILE B CG2 1 
ATOM   7573 C  CD1 . ILE B 1 476 ? 8.243  27.560 54.209  1.00 34.80 ? 498 ILE B CD1 1 
ATOM   7574 N  N   . ARG B 1 477 ? 7.516  33.361 55.278  1.00 33.12 ? 499 ARG B N   1 
ATOM   7575 C  CA  . ARG B 1 477 ? 6.761  34.566 54.976  1.00 34.10 ? 499 ARG B CA  1 
ATOM   7576 C  C   . ARG B 1 477 ? 5.731  34.286 53.868  1.00 34.53 ? 499 ARG B C   1 
ATOM   7577 O  O   . ARG B 1 477 ? 6.093  33.809 52.793  1.00 34.24 ? 499 ARG B O   1 
ATOM   7578 C  CB  . ARG B 1 477 ? 7.730  35.672 54.544  1.00 34.31 ? 499 ARG B CB  1 
ATOM   7579 C  CG  . ARG B 1 477 ? 7.101  37.038 54.275  1.00 35.63 ? 499 ARG B CG  1 
ATOM   7580 C  CD  . ARG B 1 477 ? 6.827  37.843 55.553  1.00 36.51 ? 499 ARG B CD  1 
ATOM   7581 N  NE  . ARG B 1 477 ? 7.993  37.969 56.439  1.00 37.01 ? 499 ARG B NE  1 
ATOM   7582 C  CZ  . ARG B 1 477 ? 9.006  38.819 56.267  1.00 37.83 ? 499 ARG B CZ  1 
ATOM   7583 N  NH1 . ARG B 1 477 ? 9.046  39.642 55.221  1.00 38.46 ? 499 ARG B NH1 1 
ATOM   7584 N  NH2 . ARG B 1 477 ? 10.002 38.841 57.143  1.00 37.41 ? 499 ARG B NH2 1 
ATOM   7585 N  N   . PRO B 1 478 ? 4.439  34.542 54.138  1.00 35.22 ? 500 PRO B N   1 
ATOM   7586 C  CA  . PRO B 1 478 ? 3.457  34.441 53.032  1.00 35.97 ? 500 PRO B CA  1 
ATOM   7587 C  C   . PRO B 1 478 ? 3.743  35.462 51.917  1.00 36.52 ? 500 PRO B C   1 
ATOM   7588 O  O   . PRO B 1 478 ? 4.248  36.541 52.196  1.00 36.16 ? 500 PRO B O   1 
ATOM   7589 C  CB  . PRO B 1 478 ? 2.113  34.760 53.707  1.00 36.00 ? 500 PRO B CB  1 
ATOM   7590 C  CG  . PRO B 1 478 ? 2.357  34.582 55.205  1.00 36.09 ? 500 PRO B CG  1 
ATOM   7591 C  CD  . PRO B 1 478 ? 3.816  34.900 55.427  1.00 34.98 ? 500 PRO B CD  1 
ATOM   7592 N  N   . HIS B 1 479 ? 3.470  35.096 50.667  1.00 37.79 ? 501 HIS B N   1 
ATOM   7593 C  CA  . HIS B 1 479 ? 3.406  36.047 49.555  1.00 39.56 ? 501 HIS B CA  1 
ATOM   7594 C  C   . HIS B 1 479 ? 2.626  37.292 50.051  1.00 40.74 ? 501 HIS B C   1 
ATOM   7595 O  O   . HIS B 1 479 ? 1.410  37.389 49.861  1.00 41.14 ? 501 HIS B O   1 
ATOM   7596 C  CB  . HIS B 1 479 ? 2.660  35.353 48.399  1.00 39.60 ? 501 HIS B CB  1 
ATOM   7597 C  CG  . HIS B 1 479 ? 3.138  35.729 47.026  1.00 39.85 ? 501 HIS B CG  1 
ATOM   7598 N  ND1 . HIS B 1 479 ? 2.418  36.552 46.184  1.00 39.85 ? 501 HIS B ND1 1 
ATOM   7599 C  CD2 . HIS B 1 479 ? 4.253  35.376 46.341  1.00 39.24 ? 501 HIS B CD2 1 
ATOM   7600 C  CE1 . HIS B 1 479 ? 3.070  36.696 45.045  1.00 39.78 ? 501 HIS B CE1 1 
ATOM   7601 N  NE2 . HIS B 1 479 ? 4.187  35.992 45.114  1.00 38.97 ? 501 HIS B NE2 1 
ATOM   7602 N  N   . HIS B 1 480 ? 3.305  38.216 50.745  1.00 42.26 ? 502 HIS B N   1 
ATOM   7603 C  CA  . HIS B 1 480 ? 2.598  39.281 51.500  1.00 42.32 ? 502 HIS B CA  1 
ATOM   7604 C  C   . HIS B 1 480 ? 2.462  40.559 50.710  1.00 42.56 ? 502 HIS B C   1 
ATOM   7605 O  O   . HIS B 1 480 ? 1.774  40.566 49.690  1.00 43.41 ? 502 HIS B O   1 
ATOM   7606 C  CB  . HIS B 1 480 ? 3.216  39.555 52.885  1.00 42.60 ? 502 HIS B CB  1 
ATOM   7607 C  CG  . HIS B 1 480 ? 2.236  40.127 53.877  1.00 42.91 ? 502 HIS B CG  1 
ATOM   7608 N  ND1 . HIS B 1 480 ? 2.167  41.472 54.173  1.00 42.87 ? 502 HIS B ND1 1 
ATOM   7609 C  CD2 . HIS B 1 480 ? 1.271  39.534 54.621  1.00 42.38 ? 502 HIS B CD2 1 
ATOM   7610 C  CE1 . HIS B 1 480 ? 1.208  41.682 55.058  1.00 41.33 ? 502 HIS B CE1 1 
ATOM   7611 N  NE2 . HIS B 1 480 ? 0.645  40.522 55.342  1.00 41.83 ? 502 HIS B NE2 1 
HETATM 7612 C  CHA . HEM C 2 .   ? 71.705 51.262 43.282  1.00 24.39 ? 600 HEM A CHA 1 
HETATM 7613 C  CHB . HEM C 2 .   ? 68.311 47.790 42.836  1.00 22.29 ? 600 HEM A CHB 1 
HETATM 7614 C  CHC . HEM C 2 .   ? 66.048 49.635 46.703  1.00 22.22 ? 600 HEM A CHC 1 
HETATM 7615 C  CHD . HEM C 2 .   ? 69.768 52.626 47.550  1.00 23.78 ? 600 HEM A CHD 1 
HETATM 7616 C  C1A . HEM C 2 .   ? 70.966 50.196 42.792  1.00 24.09 ? 600 HEM A C1A 1 
HETATM 7617 C  C2A . HEM C 2 .   ? 71.238 49.444 41.581  1.00 24.66 ? 600 HEM A C2A 1 
HETATM 7618 C  C3A . HEM C 2 .   ? 70.306 48.485 41.463  1.00 24.10 ? 600 HEM A C3A 1 
HETATM 7619 C  C4A . HEM C 2 .   ? 69.406 48.593 42.592  1.00 23.17 ? 600 HEM A C4A 1 
HETATM 7620 C  CMA . HEM C 2 .   ? 70.159 47.440 40.330  1.00 22.83 ? 600 HEM A CMA 1 
HETATM 7621 C  CAA . HEM C 2 .   ? 72.422 49.709 40.618  1.00 26.64 ? 600 HEM A CAA 1 
HETATM 7622 C  CBA . HEM C 2 .   ? 72.220 51.051 39.925  1.00 33.70 ? 600 HEM A CBA 1 
HETATM 7623 C  CGA . HEM C 2 .   ? 71.891 50.803 38.477  1.00 38.08 ? 600 HEM A CGA 1 
HETATM 7624 O  O1A . HEM C 2 .   ? 72.624 51.354 37.602  1.00 39.33 ? 600 HEM A O1A 1 
HETATM 7625 O  O2A . HEM C 2 .   ? 70.909 50.047 38.206  1.00 40.11 ? 600 HEM A O2A 1 
HETATM 7626 C  C1B . HEM C 2 .   ? 67.391 47.972 43.855  1.00 22.40 ? 600 HEM A C1B 1 
HETATM 7627 C  C2B . HEM C 2 .   ? 66.212 47.164 44.116  1.00 21.52 ? 600 HEM A C2B 1 
HETATM 7628 C  C3B . HEM C 2 .   ? 65.583 47.682 45.188  1.00 21.43 ? 600 HEM A C3B 1 
HETATM 7629 C  C4B . HEM C 2 .   ? 66.355 48.824 45.630  1.00 21.68 ? 600 HEM A C4B 1 
HETATM 7630 C  CMB . HEM C 2 .   ? 65.831 45.929 43.270  1.00 21.78 ? 600 HEM A CMB 1 
HETATM 7631 C  CAB . HEM C 2 .   ? 64.282 47.239 45.912  1.00 20.97 ? 600 HEM A CAB 1 
HETATM 7632 C  CBB . HEM C 2 .   ? 63.681 46.068 45.716  1.00 20.69 ? 600 HEM A CBB 1 
HETATM 7633 C  C1C . HEM C 2 .   ? 66.881 50.552 47.307  1.00 22.26 ? 600 HEM A C1C 1 
HETATM 7634 C  C2C . HEM C 2 .   ? 66.690 51.177 48.618  1.00 22.15 ? 600 HEM A C2C 1 
HETATM 7635 C  C3C . HEM C 2 .   ? 67.727 51.999 48.839  1.00 22.49 ? 600 HEM A C3C 1 
HETATM 7636 C  C4C . HEM C 2 .   ? 68.598 51.926 47.689  1.00 21.81 ? 600 HEM A C4C 1 
HETATM 7637 C  CMC . HEM C 2 .   ? 65.500 50.908 49.562  1.00 22.04 ? 600 HEM A CMC 1 
HETATM 7638 C  CAC . HEM C 2 .   ? 68.044 52.897 50.063  1.00 24.13 ? 600 HEM A CAC 1 
HETATM 7639 C  CBC . HEM C 2 .   ? 67.102 53.447 50.818  1.00 26.70 ? 600 HEM A CBC 1 
HETATM 7640 C  C1D . HEM C 2 .   ? 70.559 52.656 46.426  1.00 23.93 ? 600 HEM A C1D 1 
HETATM 7641 C  C2D . HEM C 2 .   ? 71.477 53.708 46.092  1.00 24.89 ? 600 HEM A C2D 1 
HETATM 7642 C  C3D . HEM C 2 .   ? 72.112 53.295 44.744  1.00 26.69 ? 600 HEM A C3D 1 
HETATM 7643 C  C4D . HEM C 2 .   ? 71.468 52.026 44.414  1.00 26.15 ? 600 HEM A C4D 1 
HETATM 7644 C  CMD . HEM C 2 .   ? 71.741 54.957 46.965  1.00 25.50 ? 600 HEM A CMD 1 
HETATM 7645 C  CAD . HEM C 2 .   ? 73.163 54.029 43.865  1.00 28.10 ? 600 HEM A CAD 1 
HETATM 7646 C  CBD . HEM C 2 .   ? 74.075 55.020 44.599  1.00 33.81 ? 600 HEM A CBD 1 
HETATM 7647 C  CGD . HEM C 2 .   ? 73.959 56.462 44.135  1.00 35.75 ? 600 HEM A CGD 1 
HETATM 7648 O  O1D . HEM C 2 .   ? 73.847 57.362 45.011  1.00 38.77 ? 600 HEM A O1D 1 
HETATM 7649 O  O2D . HEM C 2 .   ? 74.002 56.746 42.902  1.00 37.41 ? 600 HEM A O2D 1 
HETATM 7650 N  NA  . HEM C 2 .   ? 69.838 49.654 43.372  1.00 23.09 ? 600 HEM A NA  1 
HETATM 7651 N  NB  . HEM C 2 .   ? 67.442 48.975 44.793  1.00 20.68 ? 600 HEM A NB  1 
HETATM 7652 N  NC  . HEM C 2 .   ? 68.062 51.036 46.773  1.00 22.44 ? 600 HEM A NC  1 
HETATM 7653 N  ND  . HEM C 2 .   ? 70.573 51.692 45.427  1.00 24.17 ? 600 HEM A ND  1 
HETATM 7654 FE FE  . HEM C 2 .   ? 69.019 50.258 45.107  1.00 21.42 ? 600 HEM A FE  1 
HETATM 7655 NA NA  . NA  D 3 .   ? 35.966 -0.690 69.135  1.00 15.70 ? 701 NA  B NA  1 
HETATM 7656 C  CHA . HEM E 2 .   ? 38.165 29.631 71.846  1.00 25.60 ? 600 HEM B CHA 1 
HETATM 7657 C  CHB . HEM E 2 .   ? 33.997 31.966 72.629  1.00 22.22 ? 600 HEM B CHB 1 
HETATM 7658 C  CHC . HEM E 2 .   ? 32.163 30.383 68.409  1.00 22.18 ? 600 HEM B CHC 1 
HETATM 7659 C  CHD . HEM E 2 .   ? 36.456 28.368 67.374  1.00 25.77 ? 600 HEM B CHD 1 
HETATM 7660 C  C1A . HEM E 2 .   ? 37.173 30.357 72.472  1.00 24.52 ? 600 HEM B C1A 1 
HETATM 7661 C  C2A . HEM E 2 .   ? 37.223 30.941 73.798  1.00 25.18 ? 600 HEM B C2A 1 
HETATM 7662 C  C3A . HEM E 2 .   ? 36.058 31.584 74.003  1.00 23.28 ? 600 HEM B C3A 1 
HETATM 7663 C  C4A . HEM E 2 .   ? 35.242 31.430 72.820  1.00 22.45 ? 600 HEM B C4A 1 
HETATM 7664 C  CMA . HEM E 2 .   ? 35.624 32.359 75.264  1.00 21.48 ? 600 HEM B CMA 1 
HETATM 7665 C  CAA . HEM E 2 .   ? 38.402 30.817 74.802  1.00 27.11 ? 600 HEM B CAA 1 
HETATM 7666 C  CBA . HEM E 2 .   ? 38.648 29.333 75.087  1.00 33.57 ? 600 HEM B CBA 1 
HETATM 7667 C  CGA . HEM E 2 .   ? 39.454 29.062 76.343  1.00 37.22 ? 600 HEM B CGA 1 
HETATM 7668 O  O1A . HEM E 2 .   ? 40.112 30.001 76.883  1.00 40.53 ? 600 HEM B O1A 1 
HETATM 7669 O  O2A . HEM E 2 .   ? 39.437 27.884 76.806  1.00 37.41 ? 600 HEM B O2A 1 
HETATM 7670 C  C1B . HEM E 2 .   ? 33.167 31.769 71.545  1.00 20.95 ? 600 HEM B C1B 1 
HETATM 7671 C  C2B . HEM E 2 .   ? 31.877 32.386 71.378  1.00 19.76 ? 600 HEM B C2B 1 
HETATM 7672 C  C3B . HEM E 2 .   ? 31.330 31.977 70.231  1.00 19.28 ? 600 HEM B C3B 1 
HETATM 7673 C  C4B . HEM E 2 .   ? 32.279 31.059 69.611  1.00 21.75 ? 600 HEM B C4B 1 
HETATM 7674 C  CMB . HEM E 2 .   ? 31.227 33.377 72.364  1.00 19.82 ? 600 HEM B CMB 1 
HETATM 7675 C  CAB . HEM E 2 .   ? 29.935 32.506 69.820  1.00 19.18 ? 600 HEM B CAB 1 
HETATM 7676 C  CBB . HEM E 2 .   ? 29.308 32.166 68.722  1.00 22.83 ? 600 HEM B CBB 1 
HETATM 7677 C  C1C . HEM E 2 .   ? 33.159 29.704 67.744  1.00 20.88 ? 600 HEM B C1C 1 
HETATM 7678 C  C2C . HEM E 2 .   ? 33.055 29.094 66.429  1.00 22.22 ? 600 HEM B C2C 1 
HETATM 7679 C  C3C . HEM E 2 .   ? 34.224 28.531 66.118  1.00 22.63 ? 600 HEM B C3C 1 
HETATM 7680 C  C4C . HEM E 2 .   ? 35.133 28.755 67.241  1.00 22.62 ? 600 HEM B C4C 1 
HETATM 7681 C  CMC . HEM E 2 .   ? 31.801 29.093 65.526  1.00 22.39 ? 600 HEM B CMC 1 
HETATM 7682 C  CAC . HEM E 2 .   ? 34.425 27.774 64.766  1.00 23.51 ? 600 HEM B CAC 1 
HETATM 7683 C  CBC . HEM E 2 .   ? 35.574 27.685 64.108  1.00 22.93 ? 600 HEM B CBC 1 
HETATM 7684 C  C1D . HEM E 2 .   ? 37.298 28.481 68.480  1.00 27.68 ? 600 HEM B C1D 1 
HETATM 7685 C  C2D . HEM E 2 .   ? 38.623 27.898 68.592  1.00 29.58 ? 600 HEM B C2D 1 
HETATM 7686 C  C3D . HEM E 2 .   ? 39.163 28.300 69.975  1.00 30.98 ? 600 HEM B C3D 1 
HETATM 7687 C  C4D . HEM E 2 .   ? 38.111 29.088 70.573  1.00 27.78 ? 600 HEM B C4D 1 
HETATM 7688 C  CMD . HEM E 2 .   ? 39.335 27.046 67.526  1.00 30.42 ? 600 HEM B CMD 1 
HETATM 7689 C  CAD . HEM E 2 .   ? 40.524 27.940 70.632  1.00 33.04 ? 600 HEM B CAD 1 
HETATM 7690 C  CBD . HEM E 2 .   ? 40.740 26.413 70.640  1.00 39.10 ? 600 HEM B CBD 1 
HETATM 7691 C  CGD . HEM E 2 .   ? 39.740 25.668 71.504  1.00 42.49 ? 600 HEM B CGD 1 
HETATM 7692 O  O1D . HEM E 2 .   ? 38.509 25.677 71.197  1.00 44.02 ? 600 HEM B O1D 1 
HETATM 7693 O  O2D . HEM E 2 .   ? 40.176 25.041 72.510  1.00 44.04 ? 600 HEM B O2D 1 
HETATM 7694 N  NA  . HEM E 2 .   ? 35.945 30.673 71.911  1.00 23.38 ? 600 HEM B NA  1 
HETATM 7695 N  NB  . HEM E 2 .   ? 33.393 30.964 70.448  1.00 20.78 ? 600 HEM B NB  1 
HETATM 7696 N  NC  . HEM E 2 .   ? 34.443 29.481 68.198  1.00 22.92 ? 600 HEM B NC  1 
HETATM 7697 N  ND  . HEM E 2 .   ? 37.042 29.167 69.673  1.00 25.85 ? 600 HEM B ND  1 
HETATM 7698 FE FE  . HEM E 2 .   ? 35.265 30.161 70.053  1.00 22.69 ? 600 HEM B FE  1 
HETATM 7699 O  O   . HOH F 4 .   ? 66.084 38.794 48.511  1.00 25.57 ? 601 HOH A O   1 
HETATM 7700 O  O   . HOH F 4 .   ? 69.421 25.002 37.760  1.00 17.85 ? 602 HOH A O   1 
HETATM 7701 O  O   . HOH F 4 .   ? 60.066 50.947 39.354  1.00 17.88 ? 603 HOH A O   1 
HETATM 7702 O  O   . HOH F 4 .   ? 68.511 52.700 41.759  1.00 31.22 ? 604 HOH A O   1 
HETATM 7703 O  O   . HOH F 4 .   ? 62.442 59.402 60.622  1.00 26.16 ? 605 HOH A O   1 
HETATM 7704 O  O   . HOH F 4 .   ? 62.814 67.945 32.362  1.00 28.91 ? 606 HOH A O   1 
HETATM 7705 O  O   . HOH F 4 .   ? 52.806 33.444 37.198  1.00 23.32 ? 607 HOH A O   1 
HETATM 7706 O  O   . HOH F 4 .   ? 66.375 66.488 40.543  1.00 16.45 ? 608 HOH A O   1 
HETATM 7707 O  O   . HOH F 4 .   ? 75.716 61.043 44.847  1.00 41.43 ? 609 HOH A O   1 
HETATM 7708 O  O   . HOH F 4 .   ? 58.924 52.906 47.352  1.00 21.19 ? 610 HOH A O   1 
HETATM 7709 O  O   . HOH F 4 .   ? 41.821 38.142 46.426  1.00 14.14 ? 611 HOH A O   1 
HETATM 7710 O  O   . HOH F 4 .   ? 62.527 35.883 27.067  1.00 45.56 ? 612 HOH A O   1 
HETATM 7711 O  O   . HOH F 4 .   ? 63.308 48.543 57.242  1.00 16.36 ? 613 HOH A O   1 
HETATM 7712 O  O   . HOH F 4 .   ? 52.303 35.980 33.221  1.00 26.46 ? 614 HOH A O   1 
HETATM 7713 O  O   . HOH F 4 .   ? 59.027 42.100 42.800  1.00 16.83 ? 615 HOH A O   1 
HETATM 7714 O  O   . HOH F 4 .   ? 72.349 54.323 23.068  1.00 39.40 ? 616 HOH A O   1 
HETATM 7715 O  O   . HOH F 4 .   ? 68.998 24.075 40.187  1.00 24.92 ? 617 HOH A O   1 
HETATM 7716 O  O   . HOH F 4 .   ? 72.893 56.575 24.717  1.00 39.19 ? 618 HOH A O   1 
HETATM 7717 O  O   . HOH F 4 .   ? 55.449 38.351 35.217  1.00 44.77 ? 619 HOH A O   1 
HETATM 7718 O  O   . HOH F 4 .   ? 53.810 41.346 33.803  1.00 19.74 ? 620 HOH A O   1 
HETATM 7719 O  O   . HOH F 4 .   ? 71.676 78.629 43.384  1.00 33.98 ? 621 HOH A O   1 
HETATM 7720 O  O   . HOH F 4 .   ? 60.416 77.375 43.449  1.00 21.96 ? 622 HOH A O   1 
HETATM 7721 O  O   . HOH F 4 .   ? 59.350 41.664 26.952  1.00 17.00 ? 623 HOH A O   1 
HETATM 7722 O  O   . HOH F 4 .   ? 62.067 32.520 29.289  1.00 38.47 ? 624 HOH A O   1 
HETATM 7723 O  O   . HOH F 4 .   ? 67.386 75.339 35.246  1.00 42.44 ? 625 HOH A O   1 
HETATM 7724 O  O   . HOH F 4 .   ? 60.048 38.790 20.042  1.00 26.29 ? 626 HOH A O   1 
HETATM 7725 O  O   . HOH F 4 .   ? 66.345 53.130 24.420  1.00 40.12 ? 627 HOH A O   1 
HETATM 7726 O  O   . HOH F 4 .   ? 57.694 73.211 27.315  1.00 26.32 ? 628 HOH A O   1 
HETATM 7727 O  O   . HOH F 4 .   ? 51.121 34.233 38.959  1.00 19.59 ? 629 HOH A O   1 
HETATM 7728 O  O   . HOH F 4 .   ? 70.943 24.585 48.222  1.00 26.29 ? 630 HOH A O   1 
HETATM 7729 O  O   . HOH F 4 .   ? 63.710 51.744 46.133  1.00 20.89 ? 631 HOH A O   1 
HETATM 7730 O  O   . HOH F 4 .   ? 69.556 31.510 47.107  1.00 27.31 ? 632 HOH A O   1 
HETATM 7731 O  O   . HOH F 4 .   ? 68.392 42.715 34.566  1.00 13.39 ? 633 HOH A O   1 
HETATM 7732 O  O   . HOH F 4 .   ? 74.642 45.294 58.084  1.00 34.77 ? 634 HOH A O   1 
HETATM 7733 O  O   . HOH F 4 .   ? 54.064 35.307 35.842  1.00 28.45 ? 635 HOH A O   1 
HETATM 7734 O  O   . HOH F 4 .   ? 61.813 76.390 40.125  1.00 20.27 ? 636 HOH A O   1 
HETATM 7735 O  O   . HOH F 4 .   ? 49.821 35.528 58.989  1.00 27.52 ? 637 HOH A O   1 
HETATM 7736 O  O   . HOH F 4 .   ? 71.717 30.610 21.523  1.00 43.94 ? 638 HOH A O   1 
HETATM 7737 O  O   . HOH F 4 .   ? 56.325 35.876 32.909  1.00 16.07 ? 639 HOH A O   1 
HETATM 7738 O  O   . HOH F 4 .   ? 60.371 39.150 26.388  1.00 26.47 ? 640 HOH A O   1 
HETATM 7739 O  O   . HOH F 4 .   ? 62.543 48.305 26.333  1.00 21.94 ? 641 HOH A O   1 
HETATM 7740 O  O   . HOH F 4 .   ? 66.223 19.410 51.071  1.00 25.05 ? 642 HOH A O   1 
HETATM 7741 O  O   . HOH F 4 .   ? 49.996 59.118 42.472  1.00 20.76 ? 643 HOH A O   1 
HETATM 7742 O  O   . HOH F 4 .   ? 50.545 61.546 40.926  1.00 20.56 ? 644 HOH A O   1 
HETATM 7743 O  O   . HOH F 4 .   ? 46.137 38.151 61.348  1.00 37.20 ? 645 HOH A O   1 
HETATM 7744 O  O   . HOH F 4 .   ? 65.023 31.504 49.541  1.00 17.46 ? 646 HOH A O   1 
HETATM 7745 O  O   . HOH F 4 .   ? 52.530 59.742 60.090  1.00 29.12 ? 647 HOH A O   1 
HETATM 7746 O  O   . HOH F 4 .   ? 81.745 39.603 7.745   1.00 40.17 ? 648 HOH A O   1 
HETATM 7747 O  O   . HOH F 4 .   ? 43.262 34.152 36.753  1.00 43.67 ? 649 HOH A O   1 
HETATM 7748 O  O   . HOH F 4 .   ? 43.330 39.276 52.346  1.00 26.53 ? 650 HOH A O   1 
HETATM 7749 O  O   . HOH F 4 .   ? 60.931 54.276 39.654  1.00 16.49 ? 651 HOH A O   1 
HETATM 7750 O  O   . HOH F 4 .   ? 57.954 55.811 27.871  1.00 31.91 ? 652 HOH A O   1 
HETATM 7751 O  O   . HOH F 4 .   ? 59.093 23.480 48.983  1.00 22.98 ? 653 HOH A O   1 
HETATM 7752 O  O   . HOH F 4 .   ? 51.896 70.999 30.264  1.00 35.31 ? 654 HOH A O   1 
HETATM 7753 O  O   . HOH F 4 .   ? 64.167 52.323 39.704  1.00 26.86 ? 655 HOH A O   1 
HETATM 7754 O  O   . HOH F 4 .   ? 84.424 52.376 19.651  1.00 41.97 ? 656 HOH A O   1 
HETATM 7755 O  O   . HOH F 4 .   ? 74.131 46.373 49.775  1.00 41.57 ? 657 HOH A O   1 
HETATM 7756 O  O   . HOH F 4 .   ? 59.708 25.125 42.529  1.00 46.43 ? 658 HOH A O   1 
HETATM 7757 O  O   . HOH F 4 .   ? 66.037 33.986 49.051  1.00 22.78 ? 659 HOH A O   1 
HETATM 7758 O  O   . HOH F 4 .   ? 72.219 46.184 61.320  1.00 40.49 ? 660 HOH A O   1 
HETATM 7759 O  O   . HOH F 4 .   ? 53.542 30.072 43.406  1.00 21.43 ? 661 HOH A O   1 
HETATM 7760 O  O   . HOH F 4 .   ? 54.527 28.184 55.600  1.00 19.91 ? 662 HOH A O   1 
HETATM 7761 O  O   . HOH F 4 .   ? 55.481 61.741 61.842  1.00 33.49 ? 663 HOH A O   1 
HETATM 7762 O  O   . HOH F 4 .   ? 67.357 36.509 45.606  1.00 32.51 ? 664 HOH A O   1 
HETATM 7763 O  O   . HOH F 4 .   ? 65.349 54.896 64.467  1.00 27.51 ? 665 HOH A O   1 
HETATM 7764 O  O   . HOH F 4 .   ? 61.966 75.161 43.155  1.00 15.81 ? 666 HOH A O   1 
HETATM 7765 O  O   . HOH F 4 .   ? 71.198 48.508 53.268  1.00 18.97 ? 667 HOH A O   1 
HETATM 7766 O  O   . HOH F 4 .   ? 62.287 35.064 20.720  1.00 29.61 ? 668 HOH A O   1 
HETATM 7767 O  O   . HOH F 4 .   ? 46.510 64.139 51.594  1.00 30.65 ? 669 HOH A O   1 
HETATM 7768 O  O   . HOH F 4 .   ? 82.574 42.427 10.487  1.00 47.84 ? 670 HOH A O   1 
HETATM 7769 O  O   . HOH F 4 .   ? 74.639 68.020 57.398  1.00 54.31 ? 671 HOH A O   1 
HETATM 7770 O  O   . HOH F 4 .   ? 67.575 75.785 50.514  1.00 39.27 ? 672 HOH A O   1 
HETATM 7771 O  O   . HOH F 4 .   ? 53.937 28.879 29.484  1.00 23.14 ? 673 HOH A O   1 
HETATM 7772 O  O   . HOH F 4 .   ? 33.019 40.581 67.012  1.00 31.53 ? 674 HOH A O   1 
HETATM 7773 O  O   . HOH F 4 .   ? 62.038 21.989 58.609  1.00 45.92 ? 675 HOH A O   1 
HETATM 7774 O  O   . HOH F 4 .   ? 72.805 32.721 28.181  1.00 38.62 ? 676 HOH A O   1 
HETATM 7775 O  O   . HOH F 4 .   ? 66.544 21.666 46.001  1.00 24.00 ? 677 HOH A O   1 
HETATM 7776 O  O   . HOH F 4 .   ? 54.461 25.991 53.947  1.00 37.94 ? 678 HOH A O   1 
HETATM 7777 O  O   . HOH F 4 .   ? 77.138 74.876 50.025  1.00 23.30 ? 679 HOH A O   1 
HETATM 7778 O  O   . HOH F 4 .   ? 68.464 42.018 37.405  1.00 17.32 ? 680 HOH A O   1 
HETATM 7779 O  O   . HOH F 4 .   ? 40.088 46.143 63.831  1.00 40.85 ? 681 HOH A O   1 
HETATM 7780 O  O   . HOH F 4 .   ? 56.968 49.811 24.598  1.00 40.87 ? 682 HOH A O   1 
HETATM 7781 O  O   . HOH F 4 .   ? 73.037 46.337 52.034  1.00 29.41 ? 683 HOH A O   1 
HETATM 7782 O  O   . HOH F 4 .   ? 64.154 25.552 41.685  1.00 22.07 ? 684 HOH A O   1 
HETATM 7783 O  O   . HOH F 4 .   ? 47.843 36.240 35.576  1.00 40.26 ? 685 HOH A O   1 
HETATM 7784 O  O   . HOH F 4 .   ? 80.540 53.156 20.729  1.00 27.72 ? 686 HOH A O   1 
HETATM 7785 O  O   . HOH F 4 .   ? 61.631 32.925 22.308  1.00 27.04 ? 687 HOH A O   1 
HETATM 7786 O  O   . HOH F 4 .   ? 80.390 51.090 8.015   1.00 45.97 ? 688 HOH A O   1 
HETATM 7787 O  O   . HOH F 4 .   ? 83.895 74.168 48.982  1.00 51.02 ? 689 HOH A O   1 
HETATM 7788 O  O   . HOH F 4 .   ? 43.260 44.335 62.396  1.00 33.38 ? 690 HOH A O   1 
HETATM 7789 O  O   . HOH F 4 .   ? 80.315 29.038 30.371  1.00 43.02 ? 691 HOH A O   1 
HETATM 7790 O  O   . HOH F 4 .   ? 89.494 40.682 10.648  1.00 36.54 ? 692 HOH A O   1 
HETATM 7791 O  O   . HOH F 4 .   ? 44.848 39.885 58.437  1.00 26.45 ? 693 HOH A O   1 
HETATM 7792 O  O   . HOH F 4 .   ? 60.546 30.808 61.159  1.00 30.22 ? 694 HOH A O   1 
HETATM 7793 O  O   . HOH F 4 .   ? 60.825 68.118 67.155  1.00 36.22 ? 695 HOH A O   1 
HETATM 7794 O  O   . HOH F 4 .   ? 74.811 58.909 53.059  1.00 23.81 ? 696 HOH A O   1 
HETATM 7795 O  O   . HOH F 4 .   ? 69.362 52.519 32.525  1.00 34.77 ? 697 HOH A O   1 
HETATM 7796 O  O   . HOH F 4 .   ? 68.162 67.571 29.210  1.00 50.77 ? 698 HOH A O   1 
HETATM 7797 O  O   . HOH F 4 .   ? 68.211 38.880 46.617  1.00 29.47 ? 699 HOH A O   1 
HETATM 7798 O  O   . HOH F 4 .   ? 89.166 39.832 34.123  1.00 45.89 ? 700 HOH A O   1 
HETATM 7799 O  O   . HOH F 4 .   ? 59.949 34.354 30.351  1.00 17.89 ? 701 HOH A O   1 
HETATM 7800 O  O   . HOH F 4 .   ? 42.580 41.201 33.427  1.00 39.76 ? 702 HOH A O   1 
HETATM 7801 O  O   . HOH F 4 .   ? 66.382 67.240 32.105  1.00 34.55 ? 703 HOH A O   1 
HETATM 7802 O  O   . HOH F 4 .   ? 57.876 52.378 23.398  1.00 45.87 ? 704 HOH A O   1 
HETATM 7803 O  O   . HOH F 4 .   ? 47.497 57.380 46.645  1.00 29.17 ? 705 HOH A O   1 
HETATM 7804 O  O   . HOH F 4 .   ? 40.119 38.333 64.516  1.00 58.03 ? 706 HOH A O   1 
HETATM 7805 O  O   . HOH F 4 .   ? 66.829 52.939 21.843  1.00 30.43 ? 707 HOH A O   1 
HETATM 7806 O  O   . HOH F 4 .   ? 42.144 42.268 65.417  1.00 42.37 ? 708 HOH A O   1 
HETATM 7807 O  O   . HOH F 4 .   ? 45.138 43.254 34.755  1.00 39.59 ? 709 HOH A O   1 
HETATM 7808 O  O   . HOH F 4 .   ? 56.829 54.963 32.832  1.00 50.02 ? 710 HOH A O   1 
HETATM 7809 O  O   . HOH F 4 .   ? 52.092 30.511 39.584  1.00 17.35 ? 711 HOH A O   1 
HETATM 7810 O  O   . HOH F 4 .   ? 83.402 75.765 46.762  1.00 38.68 ? 712 HOH A O   1 
HETATM 7811 O  O   . HOH F 4 .   ? 65.212 37.269 49.843  1.00 31.52 ? 713 HOH A O   1 
HETATM 7812 O  O   . HOH F 4 .   ? 39.432 49.618 57.224  1.00 22.82 ? 714 HOH A O   1 
HETATM 7813 O  O   . HOH F 4 .   ? 45.545 32.821 52.388  1.00 20.22 ? 715 HOH A O   1 
HETATM 7814 O  O   . HOH F 4 .   ? 53.400 53.927 64.328  1.00 25.01 ? 716 HOH A O   1 
HETATM 7815 O  O   . HOH F 4 .   ? 62.164 53.042 37.596  1.00 27.13 ? 717 HOH A O   1 
HETATM 7816 O  O   . HOH F 4 .   ? 56.004 67.622 57.637  1.00 26.70 ? 718 HOH A O   1 
HETATM 7817 O  O   . HOH F 4 .   ? 68.419 55.390 27.940  1.00 36.28 ? 719 HOH A O   1 
HETATM 7818 O  O   . HOH F 4 .   ? 60.087 22.484 47.088  1.00 28.55 ? 720 HOH A O   1 
HETATM 7819 O  O   . HOH F 4 .   ? 66.884 51.934 29.788  1.00 38.63 ? 721 HOH A O   1 
HETATM 7820 O  O   . HOH F 4 .   ? 50.043 35.575 34.012  1.00 33.57 ? 722 HOH A O   1 
HETATM 7821 O  O   . HOH F 4 .   ? 61.071 24.443 38.974  1.00 29.14 ? 723 HOH A O   1 
HETATM 7822 O  O   . HOH F 4 .   ? 83.734 41.136 8.242   1.00 45.23 ? 724 HOH A O   1 
HETATM 7823 O  O   . HOH F 4 .   ? 47.727 36.590 57.761  1.00 16.21 ? 725 HOH A O   1 
HETATM 7824 O  O   . HOH F 4 .   ? 78.423 62.398 45.220  1.00 50.28 ? 726 HOH A O   1 
HETATM 7825 O  O   . HOH F 4 .   ? 63.822 22.401 45.439  1.00 32.43 ? 727 HOH A O   1 
HETATM 7826 O  O   . HOH F 4 .   ? 61.590 54.790 65.627  1.00 36.88 ? 728 HOH A O   1 
HETATM 7827 O  O   . HOH F 4 .   ? 36.951 37.881 34.220  1.00 28.57 ? 729 HOH A O   1 
HETATM 7828 O  O   . HOH F 4 .   ? 54.599 48.983 26.831  1.00 27.76 ? 730 HOH A O   1 
HETATM 7829 O  O   . HOH F 4 .   ? 61.145 57.107 64.489  1.00 31.58 ? 731 HOH A O   1 
HETATM 7830 O  O   . HOH F 4 .   ? 72.789 44.152 56.880  1.00 30.61 ? 732 HOH A O   1 
HETATM 7831 O  O   . HOH F 4 .   ? 79.777 38.624 12.939  1.00 22.07 ? 733 HOH A O   1 
HETATM 7832 O  O   . HOH F 4 .   ? 85.116 51.776 15.578  1.00 44.93 ? 734 HOH A O   1 
HETATM 7833 O  O   . HOH F 4 .   ? 64.369 50.093 27.725  1.00 26.15 ? 735 HOH A O   1 
HETATM 7834 O  O   . HOH F 4 .   ? 40.926 51.033 42.027  1.00 32.85 ? 736 HOH A O   1 
HETATM 7835 O  O   . HOH F 4 .   ? 64.899 34.895 56.527  1.00 16.79 ? 737 HOH A O   1 
HETATM 7836 O  O   . HOH F 4 .   ? 72.267 51.209 27.202  1.00 40.48 ? 738 HOH A O   1 
HETATM 7837 O  O   . HOH F 4 .   ? 49.142 60.183 34.771  1.00 33.11 ? 739 HOH A O   1 
HETATM 7838 O  O   . HOH F 4 .   ? 58.663 25.660 53.826  1.00 29.35 ? 740 HOH A O   1 
HETATM 7839 O  O   . HOH F 4 .   ? 60.403 26.968 55.144  1.00 30.45 ? 741 HOH A O   1 
HETATM 7840 O  O   . HOH F 4 .   ? 45.742 34.193 46.834  1.00 34.38 ? 742 HOH A O   1 
HETATM 7841 O  O   . HOH F 4 .   ? 60.812 68.294 52.933  1.00 33.45 ? 743 HOH A O   1 
HETATM 7842 O  O   . HOH F 4 .   ? 53.976 69.116 51.355  1.00 18.40 ? 744 HOH A O   1 
HETATM 7843 O  O   . HOH F 4 .   ? 48.827 33.649 31.946  1.00 23.83 ? 745 HOH A O   1 
HETATM 7844 O  O   . HOH F 4 .   ? 65.446 52.035 44.293  1.00 30.42 ? 746 HOH A O   1 
HETATM 7845 O  O   . HOH F 4 .   ? 45.660 40.122 54.508  1.00 20.77 ? 747 HOH A O   1 
HETATM 7846 O  O   . HOH F 4 .   ? 68.785 43.638 59.200  1.00 33.44 ? 748 HOH A O   1 
HETATM 7847 O  O   . HOH F 4 .   ? 35.091 39.533 52.264  1.00 39.85 ? 749 HOH A O   1 
HETATM 7848 O  O   . HOH F 4 .   ? 61.795 37.128 22.065  1.00 34.87 ? 750 HOH A O   1 
HETATM 7849 O  O   . HOH F 4 .   ? 50.758 26.310 51.018  1.00 23.08 ? 751 HOH A O   1 
HETATM 7850 O  O   . HOH F 4 .   ? 39.940 49.391 43.644  1.00 30.53 ? 752 HOH A O   1 
HETATM 7851 O  O   . HOH F 4 .   ? 45.869 46.848 28.007  1.00 38.21 ? 753 HOH A O   1 
HETATM 7852 O  O   . HOH F 4 .   ? 41.518 45.605 36.192  1.00 27.76 ? 754 HOH A O   1 
HETATM 7853 O  O   . HOH F 4 .   ? 57.743 26.642 30.109  1.00 39.94 ? 755 HOH A O   1 
HETATM 7854 O  O   . HOH F 4 .   ? 37.108 53.615 48.656  1.00 31.61 ? 756 HOH A O   1 
HETATM 7855 O  O   . HOH F 4 .   ? 68.391 41.546 60.959  1.00 39.54 ? 757 HOH A O   1 
HETATM 7856 O  O   . HOH F 4 .   ? 74.153 28.211 42.362  1.00 27.62 ? 758 HOH A O   1 
HETATM 7857 O  O   . HOH F 4 .   ? 53.403 57.587 31.495  1.00 43.04 ? 759 HOH A O   1 
HETATM 7858 O  O   . HOH F 4 .   ? 52.651 47.454 27.538  1.00 28.68 ? 760 HOH A O   1 
HETATM 7859 O  O   . HOH F 4 .   ? 56.517 27.840 57.265  1.00 33.39 ? 761 HOH A O   1 
HETATM 7860 O  O   . HOH F 4 .   ? 52.353 52.644 33.196  1.00 32.05 ? 762 HOH A O   1 
HETATM 7861 O  O   . HOH F 4 .   ? 45.601 31.492 50.399  1.00 22.04 ? 763 HOH A O   1 
HETATM 7862 O  O   . HOH F 4 .   ? 61.483 33.838 25.647  1.00 48.08 ? 764 HOH A O   1 
HETATM 7863 O  O   . HOH F 4 .   ? 61.585 38.580 28.769  1.00 42.97 ? 765 HOH A O   1 
HETATM 7864 O  O   . HOH F 4 .   ? 65.169 74.438 46.305  1.00 43.55 ? 766 HOH A O   1 
HETATM 7865 O  O   . HOH F 4 .   ? 90.298 50.343 19.374  1.00 40.10 ? 767 HOH A O   1 
HETATM 7866 O  O   . HOH F 4 .   ? 53.100 62.161 34.818  1.00 29.89 ? 768 HOH A O   1 
HETATM 7867 O  O   . HOH F 4 .   ? 49.419 27.419 58.748  1.00 27.16 ? 769 HOH A O   1 
HETATM 7868 O  O   . HOH F 4 .   ? 48.607 65.829 50.554  1.00 26.88 ? 770 HOH A O   1 
HETATM 7869 O  O   . HOH F 4 .   ? 86.092 55.268 41.358  1.00 44.03 ? 771 HOH A O   1 
HETATM 7870 O  O   . HOH F 4 .   ? 59.296 29.007 57.407  1.00 30.14 ? 772 HOH A O   1 
HETATM 7871 O  O   . HOH F 4 .   ? 50.992 62.062 36.111  1.00 31.01 ? 773 HOH A O   1 
HETATM 7872 O  O   . HOH F 4 .   ? 50.901 28.506 60.488  1.00 29.73 ? 774 HOH A O   1 
HETATM 7873 O  O   . HOH F 4 .   ? 71.983 50.908 24.831  1.00 36.23 ? 775 HOH A O   1 
HETATM 7874 O  O   . HOH F 4 .   ? 51.388 52.163 36.259  1.00 40.30 ? 776 HOH A O   1 
HETATM 7875 O  O   . HOH F 4 .   ? 53.860 53.744 36.472  1.00 33.09 ? 777 HOH A O   1 
HETATM 7876 O  O   . HOH F 4 .   ? 50.118 67.021 45.971  1.00 26.47 ? 778 HOH A O   1 
HETATM 7877 O  O   . HOH F 4 .   ? 52.093 38.798 32.980  1.00 38.81 ? 779 HOH A O   1 
HETATM 7878 O  O   . HOH F 4 .   ? 76.313 30.934 22.675  1.00 39.24 ? 780 HOH A O   1 
HETATM 7879 O  O   . HOH F 4 .   ? 37.968 39.457 58.300  1.00 27.16 ? 781 HOH A O   1 
HETATM 7880 O  O   . HOH F 4 .   ? 42.941 36.392 45.082  1.00 26.72 ? 782 HOH A O   1 
HETATM 7881 O  O   . HOH F 4 .   ? 75.756 51.908 10.331  1.00 31.49 ? 783 HOH A O   1 
HETATM 7882 O  O   . HOH F 4 .   ? 43.957 45.619 35.766  1.00 35.72 ? 784 HOH A O   1 
HETATM 7883 O  O   . HOH F 4 .   ? 47.649 61.383 64.105  1.00 34.44 ? 785 HOH A O   1 
HETATM 7884 O  O   . HOH F 4 .   ? 66.006 65.264 65.841  1.00 35.08 ? 786 HOH A O   1 
HETATM 7885 O  O   . HOH F 4 .   ? 60.039 50.010 65.481  1.00 35.64 ? 787 HOH A O   1 
HETATM 7886 O  O   . HOH F 4 .   ? 70.201 71.632 34.508  1.00 38.64 ? 788 HOH A O   1 
HETATM 7887 O  O   . HOH F 4 .   ? 41.374 38.824 53.437  1.00 31.37 ? 789 HOH A O   1 
HETATM 7888 O  O   . HOH F 4 .   ? 66.013 58.378 21.835  1.00 35.61 ? 790 HOH A O   1 
HETATM 7889 O  O   . HOH F 4 .   ? 49.041 58.933 48.987  1.00 37.83 ? 791 HOH A O   1 
HETATM 7890 O  O   . HOH F 4 .   ? 34.446 51.091 49.373  1.00 39.07 ? 792 HOH A O   1 
HETATM 7891 O  O   . HOH F 4 .   ? 58.042 48.455 33.302  1.00 18.86 ? 793 HOH A O   1 
HETATM 7892 O  O   . HOH F 4 .   ? 93.135 51.651 23.470  1.00 45.88 ? 794 HOH A O   1 
HETATM 7893 O  O   . HOH F 4 .   ? 41.102 43.072 40.661  1.00 17.16 ? 795 HOH A O   1 
HETATM 7894 O  O   . HOH F 4 .   ? 82.263 76.391 49.572  1.00 53.21 ? 796 HOH A O   1 
HETATM 7895 O  O   . HOH F 4 .   ? 56.367 63.571 63.861  1.00 28.98 ? 797 HOH A O   1 
HETATM 7896 O  O   . HOH F 4 .   ? 64.617 34.321 28.497  1.00 49.83 ? 798 HOH A O   1 
HETATM 7897 O  O   . HOH F 4 .   ? 80.858 48.124 8.799   1.00 49.09 ? 799 HOH A O   1 
HETATM 7898 O  O   . HOH F 4 .   ? 46.953 61.666 53.756  1.00 43.37 ? 800 HOH A O   1 
HETATM 7899 O  O   . HOH F 4 .   ? 59.622 28.585 59.913  1.00 45.19 ? 801 HOH A O   1 
HETATM 7900 O  O   . HOH F 4 .   ? 36.204 38.362 42.518  1.00 30.29 ? 802 HOH A O   1 
HETATM 7901 O  O   . HOH F 4 .   ? 83.532 35.065 34.817  1.00 32.57 ? 803 HOH A O   1 
HETATM 7902 O  O   . HOH F 4 .   ? 39.707 54.484 44.633  1.00 37.61 ? 804 HOH A O   1 
HETATM 7903 O  O   . HOH F 4 .   ? 77.274 33.091 37.129  1.00 33.43 ? 805 HOH A O   1 
HETATM 7904 O  O   . HOH F 4 .   ? 56.404 28.216 59.921  1.00 38.37 ? 806 HOH A O   1 
HETATM 7905 O  O   . HOH F 4 .   ? 70.035 50.276 35.548  1.00 38.12 ? 807 HOH A O   1 
HETATM 7906 O  O   . HOH F 4 .   ? 74.950 47.316 38.035  1.00 31.60 ? 808 HOH A O   1 
HETATM 7907 O  O   . HOH F 4 .   ? 74.689 49.974 34.617  1.00 30.42 ? 809 HOH A O   1 
HETATM 7908 O  O   . HOH F 4 .   ? 65.358 53.603 42.009  1.00 26.19 ? 810 HOH A O   1 
HETATM 7909 O  O   . HOH F 4 .   ? 76.097 48.938 36.323  1.00 25.53 ? 811 HOH A O   1 
HETATM 7910 O  O   . HOH F 4 .   ? 75.874 58.687 45.699  1.00 50.98 ? 812 HOH A O   1 
HETATM 7911 O  O   . HOH G 4 .   ? 19.368 39.397 80.865  1.00 34.68 ? 702 HOH B O   1 
HETATM 7912 O  O   . HOH G 4 .   ? 5.413  35.891 42.605  1.00 22.48 ? 703 HOH B O   1 
HETATM 7913 O  O   . HOH G 4 .   ? 28.694 48.193 67.537  1.00 21.43 ? 704 HOH B O   1 
HETATM 7914 O  O   . HOH G 4 .   ? 30.579 57.614 77.945  1.00 20.75 ? 705 HOH B O   1 
HETATM 7915 O  O   . HOH G 4 .   ? 29.490 12.322 59.837  1.00 13.91 ? 706 HOH B O   1 
HETATM 7916 O  O   . HOH G 4 .   ? 28.479 60.475 67.099  1.00 18.31 ? 707 HOH B O   1 
HETATM 7917 O  O   . HOH G 4 .   ? 27.715 28.394 88.782  1.00 21.96 ? 708 HOH B O   1 
HETATM 7918 O  O   . HOH G 4 .   ? 38.519 27.379 88.887  1.00 34.61 ? 709 HOH B O   1 
HETATM 7919 O  O   . HOH G 4 .   ? 14.192 20.734 66.912  1.00 40.19 ? 710 HOH B O   1 
HETATM 7920 O  O   . HOH G 4 .   ? 43.870 44.472 98.371  1.00 43.06 ? 711 HOH B O   1 
HETATM 7921 O  O   . HOH G 4 .   ? 18.875 36.814 82.355  1.00 43.79 ? 712 HOH B O   1 
HETATM 7922 O  O   . HOH G 4 .   ? 25.377 26.504 67.832  1.00 23.19 ? 713 HOH B O   1 
HETATM 7923 O  O   . HOH G 4 .   ? 29.897 42.385 66.352  1.00 40.37 ? 714 HOH B O   1 
HETATM 7924 O  O   . HOH G 4 .   ? 57.936 37.776 88.749  1.00 19.59 ? 715 HOH B O   1 
HETATM 7925 O  O   . HOH G 4 .   ? 26.128 38.432 95.306  1.00 43.36 ? 716 HOH B O   1 
HETATM 7926 O  O   . HOH G 4 .   ? 46.768 35.170 98.319  1.00 21.03 ? 717 HOH B O   1 
HETATM 7927 O  O   . HOH G 4 .   ? 32.756 48.175 70.285  1.00 20.77 ? 718 HOH B O   1 
HETATM 7928 O  O   . HOH G 4 .   ? 17.072 41.877 80.139  1.00 42.96 ? 719 HOH B O   1 
HETATM 7929 O  O   . HOH G 4 .   ? 35.409 0.014  72.157  1.00 29.23 ? 720 HOH B O   1 
HETATM 7930 O  O   . HOH G 4 .   ? 26.194 27.511 75.718  1.00 16.05 ? 721 HOH B O   1 
HETATM 7931 O  O   . HOH G 4 .   ? 32.549 25.688 86.156  1.00 42.21 ? 722 HOH B O   1 
HETATM 7932 O  O   . HOH G 4 .   ? 25.085 38.763 87.649  1.00 36.70 ? 723 HOH B O   1 
HETATM 7933 O  O   . HOH G 4 .   ? 22.731 21.340 52.898  1.00 27.57 ? 724 HOH B O   1 
HETATM 7934 O  O   . HOH G 4 .   ? 10.658 37.811 61.167  1.00 32.57 ? 725 HOH B O   1 
HETATM 7935 O  O   . HOH G 4 .   ? 32.067 27.631 50.011  1.00 22.78 ? 726 HOH B O   1 
HETATM 7936 O  O   . HOH G 4 .   ? 31.895 10.525 80.021  1.00 18.26 ? 727 HOH B O   1 
HETATM 7937 O  O   . HOH G 4 .   ? 28.303 58.148 79.244  1.00 26.51 ? 728 HOH B O   1 
HETATM 7938 O  O   . HOH G 4 .   ? 35.187 13.727 72.569  1.00 24.06 ? 729 HOH B O   1 
HETATM 7939 O  O   . HOH G 4 .   ? 54.627 34.084 97.392  1.00 35.08 ? 730 HOH B O   1 
HETATM 7940 O  O   . HOH G 4 .   ? 45.855 25.254 106.311 1.00 35.72 ? 731 HOH B O   1 
HETATM 7941 O  O   . HOH G 4 .   ? 41.942 23.431 61.243  1.00 22.74 ? 732 HOH B O   1 
HETATM 7942 O  O   . HOH G 4 .   ? 31.183 55.115 77.717  1.00 19.10 ? 733 HOH B O   1 
HETATM 7943 O  O   . HOH G 4 .   ? 33.930 54.942 69.477  1.00 32.87 ? 734 HOH B O   1 
HETATM 7944 O  O   . HOH G 4 .   ? 29.628 22.099 53.360  1.00 31.08 ? 735 HOH B O   1 
HETATM 7945 O  O   . HOH G 4 .   ? 19.877 23.958 78.122  1.00 30.78 ? 736 HOH B O   1 
HETATM 7946 O  O   . HOH G 4 .   ? 43.507 34.958 51.316  1.00 27.33 ? 737 HOH B O   1 
HETATM 7947 O  O   . HOH G 4 .   ? 7.966  42.331 60.009  1.00 36.27 ? 738 HOH B O   1 
HETATM 7948 O  O   . HOH G 4 .   ? 16.791 47.824 73.724  1.00 23.78 ? 739 HOH B O   1 
HETATM 7949 O  O   . HOH G 4 .   ? 23.595 42.893 86.415  1.00 35.69 ? 740 HOH B O   1 
HETATM 7950 O  O   . HOH G 4 .   ? 33.708 43.011 71.173  1.00 31.27 ? 741 HOH B O   1 
HETATM 7951 O  O   . HOH G 4 .   ? 36.208 3.264  75.154  1.00 29.37 ? 742 HOH B O   1 
HETATM 7952 O  O   . HOH G 4 .   ? -0.763 37.054 56.529  1.00 30.15 ? 743 HOH B O   1 
HETATM 7953 O  O   . HOH G 4 .   ? 27.633 10.530 58.381  1.00 36.80 ? 744 HOH B O   1 
HETATM 7954 O  O   . HOH G 4 .   ? 27.792 24.614 75.195  1.00 30.50 ? 745 HOH B O   1 
HETATM 7955 O  O   . HOH G 4 .   ? 5.965  27.791 57.391  1.00 27.62 ? 746 HOH B O   1 
HETATM 7956 O  O   . HOH G 4 .   ? 42.737 48.848 79.878  1.00 32.23 ? 747 HOH B O   1 
HETATM 7957 O  O   . HOH G 4 .   ? 11.772 19.653 65.751  1.00 40.02 ? 748 HOH B O   1 
HETATM 7958 O  O   . HOH G 4 .   ? 25.417 42.838 94.907  1.00 39.45 ? 749 HOH B O   1 
HETATM 7959 O  O   . HOH G 4 .   ? 31.692 44.858 66.208  1.00 40.28 ? 750 HOH B O   1 
HETATM 7960 O  O   . HOH G 4 .   ? 31.130 44.052 88.551  1.00 34.39 ? 751 HOH B O   1 
HETATM 7961 O  O   . HOH G 4 .   ? 12.729 21.854 62.757  1.00 25.96 ? 752 HOH B O   1 
HETATM 7962 O  O   . HOH G 4 .   ? 41.727 43.073 96.728  1.00 17.70 ? 753 HOH B O   1 
HETATM 7963 O  O   . HOH G 4 .   ? 56.172 35.909 98.634  1.00 35.84 ? 754 HOH B O   1 
HETATM 7964 O  O   . HOH G 4 .   ? 14.631 43.044 77.554  1.00 40.59 ? 755 HOH B O   1 
HETATM 7965 O  O   . HOH G 4 .   ? 33.176 35.880 81.287  1.00 13.91 ? 756 HOH B O   1 
HETATM 7966 O  O   . HOH G 4 .   ? 49.730 42.305 99.429  1.00 34.55 ? 757 HOH B O   1 
HETATM 7967 O  O   . HOH G 4 .   ? 27.539 26.947 78.462  1.00 29.54 ? 758 HOH B O   1 
HETATM 7968 O  O   . HOH G 4 .   ? 37.025 33.352 62.195  1.00 17.48 ? 759 HOH B O   1 
HETATM 7969 O  O   . HOH G 4 .   ? 36.947 26.304 53.916  1.00 28.19 ? 760 HOH B O   1 
HETATM 7970 O  O   . HOH G 4 .   ? 58.682 42.647 89.010  1.00 41.55 ? 761 HOH B O   1 
HETATM 7971 O  O   . HOH G 4 .   ? 36.686 44.523 74.523  1.00 15.65 ? 762 HOH B O   1 
HETATM 7972 O  O   . HOH G 4 .   ? 51.568 24.585 87.350  1.00 42.98 ? 763 HOH B O   1 
HETATM 7973 O  O   . HOH G 4 .   ? 43.986 32.393 55.960  1.00 23.97 ? 764 HOH B O   1 
HETATM 7974 O  O   . HOH G 4 .   ? 32.039 53.566 80.254  1.00 18.67 ? 765 HOH B O   1 
HETATM 7975 O  O   . HOH G 4 .   ? 24.620 37.390 89.970  1.00 46.77 ? 766 HOH B O   1 
HETATM 7976 O  O   . HOH G 4 .   ? 33.466 39.223 59.926  1.00 33.31 ? 767 HOH B O   1 
HETATM 7977 O  O   . HOH G 4 .   ? 8.087  40.185 66.262  1.00 47.55 ? 768 HOH B O   1 
HETATM 7978 O  O   . HOH G 4 .   ? 17.609 35.667 89.457  1.00 40.81 ? 769 HOH B O   1 
HETATM 7979 O  O   . HOH G 4 .   ? 55.584 28.267 96.595  1.00 36.54 ? 770 HOH B O   1 
HETATM 7980 O  O   . HOH G 4 .   ? 46.370 38.324 105.957 1.00 29.49 ? 771 HOH B O   1 
HETATM 7981 O  O   . HOH G 4 .   ? 33.943 27.877 48.078  1.00 29.05 ? 772 HOH B O   1 
HETATM 7982 O  O   . HOH G 4 .   ? 6.733  38.414 69.318  1.00 22.63 ? 773 HOH B O   1 
HETATM 7983 O  O   . HOH G 4 .   ? 31.724 5.317  62.109  1.00 24.89 ? 774 HOH B O   1 
HETATM 7984 O  O   . HOH G 4 .   ? 20.195 58.420 66.144  1.00 47.61 ? 775 HOH B O   1 
HETATM 7985 O  O   . HOH G 4 .   ? 29.790 45.926 68.068  1.00 27.38 ? 776 HOH B O   1 
HETATM 7986 O  O   . HOH G 4 .   ? 22.973 36.688 86.338  1.00 37.93 ? 777 HOH B O   1 
HETATM 7987 O  O   . HOH G 4 .   ? 23.916 36.220 73.154  1.00 32.85 ? 778 HOH B O   1 
HETATM 7988 O  O   . HOH G 4 .   ? -2.300 40.473 56.324  1.00 23.72 ? 779 HOH B O   1 
HETATM 7989 O  O   . HOH G 4 .   ? 42.143 45.128 94.498  1.00 39.21 ? 780 HOH B O   1 
HETATM 7990 O  O   . HOH G 4 .   ? 8.116  38.883 60.234  1.00 39.12 ? 781 HOH B O   1 
HETATM 7991 O  O   . HOH G 4 .   ? 32.403 56.764 71.741  1.00 29.57 ? 782 HOH B O   1 
HETATM 7992 O  O   . HOH G 4 .   ? 18.475 16.072 72.455  1.00 21.72 ? 783 HOH B O   1 
HETATM 7993 O  O   . HOH G 4 .   ? 18.625 57.053 64.418  1.00 44.29 ? 784 HOH B O   1 
HETATM 7994 O  O   . HOH G 4 .   ? 32.485 35.358 104.040 1.00 41.74 ? 785 HOH B O   1 
HETATM 7995 O  O   . HOH G 4 .   ? 62.103 42.607 89.153  1.00 45.44 ? 786 HOH B O   1 
HETATM 7996 O  O   . HOH G 4 .   ? 31.829 37.999 104.878 1.00 43.81 ? 787 HOH B O   1 
HETATM 7997 O  O   . HOH G 4 .   ? 48.215 32.941 99.556  1.00 21.07 ? 788 HOH B O   1 
HETATM 7998 O  O   . HOH G 4 .   ? 39.147 57.723 89.345  1.00 44.86 ? 789 HOH B O   1 
HETATM 7999 O  O   . HOH G 4 .   ? 35.379 27.298 71.637  1.00 38.92 ? 790 HOH B O   1 
HETATM 8000 O  O   . HOH G 4 .   ? 47.267 45.316 82.221  1.00 22.51 ? 791 HOH B O   1 
HETATM 8001 O  O   . HOH G 4 .   ? 34.325 34.634 47.375  1.00 41.24 ? 792 HOH B O   1 
HETATM 8002 O  O   . HOH G 4 .   ? 37.836 26.457 56.728  1.00 22.15 ? 793 HOH B O   1 
HETATM 8003 O  O   . HOH G 4 .   ? 28.123 59.061 82.060  1.00 33.08 ? 794 HOH B O   1 
HETATM 8004 O  O   . HOH G 4 .   ? 44.381 48.394 88.965  1.00 34.72 ? 795 HOH B O   1 
HETATM 8005 O  O   . HOH G 4 .   ? 23.989 7.967  60.308  1.00 39.69 ? 796 HOH B O   1 
HETATM 8006 O  O   . HOH G 4 .   ? 50.410 26.103 94.804  1.00 32.60 ? 797 HOH B O   1 
HETATM 8007 O  O   . HOH G 4 .   ? 15.296 19.361 51.995  1.00 31.66 ? 798 HOH B O   1 
HETATM 8008 O  O   . HOH G 4 .   ? -0.388 28.658 54.991  1.00 25.04 ? 799 HOH B O   1 
HETATM 8009 O  O   . HOH G 4 .   ? 24.046 34.334 89.304  1.00 18.57 ? 800 HOH B O   1 
HETATM 8010 O  O   . HOH G 4 .   ? 41.854 59.359 85.368  1.00 37.21 ? 801 HOH B O   1 
HETATM 8011 O  O   . HOH G 4 .   ? 47.976 33.093 93.827  1.00 28.18 ? 802 HOH B O   1 
HETATM 8012 O  O   . HOH G 4 .   ? 16.100 19.316 65.371  1.00 44.58 ? 803 HOH B O   1 
HETATM 8013 O  O   . HOH G 4 .   ? 27.522 58.081 59.887  1.00 37.11 ? 804 HOH B O   1 
HETATM 8014 O  O   . HOH G 4 .   ? 38.608 42.727 74.773  1.00 29.28 ? 805 HOH B O   1 
HETATM 8015 O  O   . HOH G 4 .   ? 39.653 37.713 57.008  1.00 20.34 ? 806 HOH B O   1 
HETATM 8016 O  O   . HOH G 4 .   ? 38.320 39.450 60.894  1.00 43.96 ? 807 HOH B O   1 
HETATM 8017 O  O   . HOH G 4 .   ? 35.608 17.375 50.288  1.00 33.54 ? 808 HOH B O   1 
HETATM 8018 O  O   . HOH G 4 .   ? 35.119 56.373 84.326  1.00 25.39 ? 809 HOH B O   1 
HETATM 8019 O  O   . HOH G 4 .   ? 39.015 23.784 90.831  1.00 47.39 ? 810 HOH B O   1 
HETATM 8020 O  O   . HOH G 4 .   ? 13.727 14.763 55.764  1.00 51.32 ? 811 HOH B O   1 
HETATM 8021 O  O   . HOH G 4 .   ? 42.481 56.884 79.284  1.00 31.18 ? 812 HOH B O   1 
HETATM 8022 O  O   . HOH G 4 .   ? 42.251 11.072 59.270  1.00 25.78 ? 813 HOH B O   1 
HETATM 8023 O  O   . HOH G 4 .   ? 37.226 51.648 75.392  1.00 23.28 ? 814 HOH B O   1 
HETATM 8024 O  O   . HOH G 4 .   ? 11.279 23.090 71.662  1.00 19.49 ? 815 HOH B O   1 
HETATM 8025 O  O   . HOH G 4 .   ? 33.557 9.002  78.447  1.00 17.98 ? 816 HOH B O   1 
HETATM 8026 O  O   . HOH G 4 .   ? 32.180 7.091  76.134  1.00 22.02 ? 817 HOH B O   1 
HETATM 8027 O  O   . HOH G 4 .   ? 30.130 47.429 63.290  1.00 23.16 ? 818 HOH B O   1 
HETATM 8028 O  O   . HOH G 4 .   ? 30.796 10.184 82.200  1.00 22.20 ? 819 HOH B O   1 
HETATM 8029 O  O   . HOH G 4 .   ? 51.458 43.531 97.302  1.00 21.12 ? 820 HOH B O   1 
HETATM 8030 O  O   . HOH G 4 .   ? 33.220 37.105 78.791  1.00 15.38 ? 821 HOH B O   1 
HETATM 8031 O  O   . HOH G 4 .   ? 40.882 38.808 104.537 1.00 26.82 ? 822 HOH B O   1 
HETATM 8032 O  O   . HOH G 4 .   ? 29.887 28.266 68.685  1.00 16.62 ? 823 HOH B O   1 
HETATM 8033 O  O   . HOH G 4 .   ? 32.353 23.561 53.694  1.00 26.17 ? 824 HOH B O   1 
HETATM 8034 O  O   . HOH G 4 .   ? 36.630 39.097 73.804  1.00 20.72 ? 825 HOH B O   1 
HETATM 8035 O  O   . HOH G 4 .   ? 23.988 17.510 49.849  1.00 20.48 ? 826 HOH B O   1 
HETATM 8036 O  O   . HOH G 4 .   ? 30.136 26.534 75.211  1.00 20.13 ? 827 HOH B O   1 
HETATM 8037 O  O   . HOH G 4 .   ? 34.316 25.779 53.007  1.00 26.99 ? 828 HOH B O   1 
HETATM 8038 O  O   . HOH G 4 .   ? 30.985 45.986 70.138  1.00 24.60 ? 829 HOH B O   1 
HETATM 8039 O  O   . HOH G 4 .   ? 40.530 41.679 102.240 1.00 28.26 ? 830 HOH B O   1 
HETATM 8040 O  O   . HOH G 4 .   ? 12.768 47.990 52.883  1.00 40.81 ? 831 HOH B O   1 
HETATM 8041 O  O   . HOH G 4 .   ? 35.206 12.130 80.663  1.00 22.83 ? 832 HOH B O   1 
HETATM 8042 O  O   . HOH G 4 .   ? 28.655 45.308 59.878  1.00 16.99 ? 833 HOH B O   1 
HETATM 8043 O  O   . HOH G 4 .   ? 4.726  39.132 43.753  1.00 38.70 ? 834 HOH B O   1 
HETATM 8044 O  O   . HOH G 4 .   ? 17.449 16.973 42.857  1.00 26.87 ? 835 HOH B O   1 
HETATM 8045 O  O   . HOH G 4 .   ? 37.005 1.656  72.854  1.00 32.37 ? 836 HOH B O   1 
HETATM 8046 O  O   . HOH G 4 .   ? 55.266 34.555 94.890  1.00 20.23 ? 837 HOH B O   1 
HETATM 8047 O  O   . HOH G 4 .   ? 15.198 45.194 79.619  1.00 34.01 ? 838 HOH B O   1 
HETATM 8048 O  O   . HOH G 4 .   ? 21.866 16.920 84.048  1.00 43.38 ? 839 HOH B O   1 
HETATM 8049 O  O   . HOH G 4 .   ? 46.431 26.842 58.398  1.00 25.13 ? 840 HOH B O   1 
HETATM 8050 O  O   . HOH G 4 .   ? 24.616 12.777 55.367  1.00 27.52 ? 841 HOH B O   1 
HETATM 8051 O  O   . HOH G 4 .   ? 46.438 25.209 93.948  1.00 25.33 ? 842 HOH B O   1 
HETATM 8052 O  O   . HOH G 4 .   ? 31.584 28.047 70.646  1.00 21.95 ? 843 HOH B O   1 
HETATM 8053 O  O   . HOH G 4 .   ? 46.094 16.099 75.186  1.00 41.80 ? 844 HOH B O   1 
HETATM 8054 O  O   . HOH G 4 .   ? 20.006 20.326 53.820  1.00 27.96 ? 845 HOH B O   1 
HETATM 8055 O  O   . HOH G 4 .   ? 17.134 18.365 71.500  1.00 31.30 ? 846 HOH B O   1 
HETATM 8056 O  O   . HOH G 4 .   ? 27.672 22.841 94.312  1.00 45.16 ? 847 HOH B O   1 
HETATM 8057 O  O   . HOH G 4 .   ? 46.158 30.985 55.055  1.00 23.98 ? 848 HOH B O   1 
HETATM 8058 O  O   . HOH G 4 .   ? 17.029 37.056 84.196  1.00 47.13 ? 849 HOH B O   1 
HETATM 8059 O  O   . HOH G 4 .   ? 30.383 39.921 101.037 1.00 25.00 ? 850 HOH B O   1 
HETATM 8060 O  O   . HOH G 4 .   ? 33.832 38.503 56.422  1.00 34.33 ? 851 HOH B O   1 
HETATM 8061 O  O   . HOH G 4 .   ? 43.927 37.806 103.976 1.00 36.12 ? 852 HOH B O   1 
HETATM 8062 O  O   . HOH G 4 .   ? 33.180 29.596 75.105  1.00 29.16 ? 853 HOH B O   1 
HETATM 8063 O  O   . HOH G 4 .   ? 34.859 25.106 86.642  1.00 44.84 ? 854 HOH B O   1 
HETATM 8064 O  O   . HOH G 4 .   ? 29.025 32.547 58.129  1.00 18.65 ? 855 HOH B O   1 
HETATM 8065 O  O   . HOH G 4 .   ? 35.872 48.122 91.355  1.00 25.52 ? 856 HOH B O   1 
HETATM 8066 O  O   . HOH G 4 .   ? 28.252 23.527 51.982  1.00 27.40 ? 857 HOH B O   1 
HETATM 8067 O  O   . HOH G 4 .   ? 17.912 51.039 61.675  1.00 32.27 ? 858 HOH B O   1 
HETATM 8068 O  O   . HOH G 4 .   ? 12.507 42.129 58.410  1.00 41.81 ? 859 HOH B O   1 
HETATM 8069 O  O   . HOH G 4 .   ? 36.614 5.296  71.791  1.00 27.05 ? 860 HOH B O   1 
HETATM 8070 O  O   . HOH G 4 .   ? 27.839 62.871 65.565  1.00 26.31 ? 861 HOH B O   1 
HETATM 8071 O  O   . HOH G 4 .   ? 46.081 49.391 81.513  1.00 39.25 ? 862 HOH B O   1 
HETATM 8072 O  O   . HOH G 4 .   ? 31.481 26.006 72.761  1.00 21.63 ? 863 HOH B O   1 
HETATM 8073 O  O   . HOH G 4 .   ? 12.372 15.967 52.857  1.00 54.37 ? 864 HOH B O   1 
HETATM 8074 O  O   . HOH G 4 .   ? 46.609 24.628 57.656  1.00 27.04 ? 865 HOH B O   1 
HETATM 8075 O  O   . HOH G 4 .   ? 32.267 48.228 89.953  1.00 25.55 ? 866 HOH B O   1 
HETATM 8076 O  O   . HOH G 4 .   ? 35.754 28.431 78.778  1.00 47.19 ? 867 HOH B O   1 
HETATM 8077 O  O   . HOH G 4 .   ? 29.571 34.538 100.690 1.00 38.10 ? 868 HOH B O   1 
HETATM 8078 O  O   . HOH G 4 .   ? 9.193  16.373 52.850  1.00 40.69 ? 869 HOH B O   1 
HETATM 8079 O  O   . HOH G 4 .   ? 12.724 38.024 84.597  1.00 40.87 ? 870 HOH B O   1 
HETATM 8080 O  O   . HOH G 4 .   ? 29.566 62.939 63.722  1.00 24.98 ? 871 HOH B O   1 
HETATM 8081 O  O   . HOH G 4 .   ? 29.559 21.952 92.725  1.00 51.59 ? 872 HOH B O   1 
HETATM 8082 O  O   . HOH G 4 .   ? 40.092 32.090 105.754 1.00 28.72 ? 873 HOH B O   1 
HETATM 8083 O  O   . HOH G 4 .   ? 49.003 34.391 80.159  1.00 45.01 ? 874 HOH B O   1 
HETATM 8084 O  O   . HOH G 4 .   ? 31.799 41.556 70.045  1.00 29.65 ? 875 HOH B O   1 
HETATM 8085 O  O   . HOH G 4 .   ? 10.565 19.452 59.394  1.00 38.78 ? 876 HOH B O   1 
HETATM 8086 O  O   . HOH G 4 .   ? 30.931 42.796 61.988  1.00 48.08 ? 877 HOH B O   1 
HETATM 8087 O  O   . HOH G 4 .   ? 14.565 17.776 63.439  1.00 39.55 ? 878 HOH B O   1 
HETATM 8088 O  O   . HOH G 4 .   ? 43.187 39.599 73.345  1.00 37.08 ? 879 HOH B O   1 
HETATM 8089 O  O   . HOH G 4 .   ? 49.196 34.139 96.140  1.00 22.70 ? 880 HOH B O   1 
HETATM 8090 O  O   . HOH G 4 .   ? 41.219 54.947 86.806  1.00 40.60 ? 881 HOH B O   1 
HETATM 8091 O  O   . HOH G 4 .   ? 37.752 26.708 86.820  1.00 46.05 ? 882 HOH B O   1 
HETATM 8092 O  O   . HOH G 4 .   ? 39.367 10.608 80.151  1.00 35.98 ? 883 HOH B O   1 
HETATM 8093 O  O   . HOH G 4 .   ? 44.109 33.451 49.189  1.00 37.98 ? 884 HOH B O   1 
HETATM 8094 O  O   . HOH G 4 .   ? 24.866 10.337 48.289  1.00 28.92 ? 885 HOH B O   1 
HETATM 8095 O  O   . HOH G 4 .   ? 30.302 40.317 60.002  1.00 29.65 ? 886 HOH B O   1 
HETATM 8096 O  O   . HOH G 4 .   ? 31.925 32.854 75.649  1.00 29.78 ? 887 HOH B O   1 
HETATM 8097 O  O   . HOH G 4 .   ? 39.820 36.229 104.328 1.00 34.59 ? 888 HOH B O   1 
HETATM 8098 O  O   . HOH G 4 .   ? 37.589 43.456 69.764  1.00 44.23 ? 889 HOH B O   1 
HETATM 8099 O  O   . HOH G 4 .   ? 22.089 52.988 75.335  1.00 66.22 ? 890 HOH B O   1 
HETATM 8100 O  O   . HOH G 4 .   ? 43.377 45.572 80.573  1.00 41.93 ? 891 HOH B O   1 
HETATM 8101 O  O   . HOH G 4 .   ? 22.673 10.274 61.527  1.00 26.98 ? 892 HOH B O   1 
HETATM 8102 O  O   . HOH G 4 .   ? 35.390 30.780 47.711  1.00 42.73 ? 893 HOH B O   1 
HETATM 8103 O  O   . HOH G 4 .   ? 8.305  33.438 51.409  1.00 35.75 ? 894 HOH B O   1 
HETATM 8104 O  O   . HOH G 4 .   ? 37.972 46.831 66.392  1.00 65.06 ? 895 HOH B O   1 
HETATM 8105 O  O   . HOH G 4 .   ? 54.436 51.208 91.152  1.00 41.94 ? 896 HOH B O   1 
HETATM 8106 O  O   . HOH G 4 .   ? 22.837 4.554  78.355  1.00 42.47 ? 897 HOH B O   1 
HETATM 8107 O  O   . HOH G 4 .   ? 2.069  34.585 68.359  1.00 31.14 ? 898 HOH B O   1 
HETATM 8108 O  O   . HOH G 4 .   ? 15.325 46.749 77.600  1.00 36.67 ? 899 HOH B O   1 
HETATM 8109 O  O   . HOH G 4 .   ? 12.481 50.091 61.046  1.00 29.03 ? 900 HOH B O   1 
HETATM 8110 O  O   . HOH G 4 .   ? 45.922 27.197 107.791 1.00 50.48 ? 901 HOH B O   1 
HETATM 8111 O  O   . HOH G 4 .   ? 22.749 22.204 81.286  1.00 43.89 ? 902 HOH B O   1 
HETATM 8112 O  O   . HOH G 4 .   ? 39.642 8.081  56.901  1.00 35.08 ? 903 HOH B O   1 
HETATM 8113 O  O   . HOH G 4 .   ? 30.070 26.826 87.190  1.00 31.61 ? 904 HOH B O   1 
HETATM 8114 O  O   . HOH G 4 .   ? 12.191 12.013 43.108  1.00 42.14 ? 905 HOH B O   1 
HETATM 8115 O  O   . HOH G 4 .   ? 10.012 43.431 69.890  1.00 33.55 ? 906 HOH B O   1 
HETATM 8116 O  O   . HOH G 4 .   ? 41.073 46.594 79.753  1.00 38.06 ? 907 HOH B O   1 
HETATM 8117 O  O   . HOH G 4 .   ? 0.833  24.858 59.933  1.00 43.19 ? 908 HOH B O   1 
HETATM 8118 O  O   . HOH G 4 .   ? 55.212 25.985 80.561  1.00 38.40 ? 909 HOH B O   1 
HETATM 8119 O  O   . HOH G 4 .   ? 35.196 22.734 50.753  1.00 35.84 ? 910 HOH B O   1 
HETATM 8120 O  O   . HOH G 4 .   ? 31.339 52.028 62.587  1.00 31.53 ? 911 HOH B O   1 
HETATM 8121 O  O   . HOH G 4 .   ? 39.535 21.702 89.283  1.00 41.81 ? 912 HOH B O   1 
HETATM 8122 O  O   . HOH G 4 .   ? 9.871  32.590 80.654  1.00 27.43 ? 913 HOH B O   1 
HETATM 8123 O  O   . HOH G 4 .   ? 19.251 11.545 87.106  1.00 53.02 ? 914 HOH B O   1 
HETATM 8124 O  O   . HOH G 4 .   ? 21.622 12.299 45.643  1.00 33.00 ? 915 HOH B O   1 
HETATM 8125 O  O   . HOH G 4 .   ? 30.030 41.738 90.166  1.00 37.69 ? 916 HOH B O   1 
HETATM 8126 O  O   . HOH G 4 .   ? 12.420 16.234 50.082  1.00 24.32 ? 917 HOH B O   1 
HETATM 8127 O  O   . HOH G 4 .   ? 42.781 31.865 53.445  1.00 25.71 ? 918 HOH B O   1 
HETATM 8128 O  O   . HOH G 4 .   ? 40.428 32.935 76.688  1.00 22.57 ? 919 HOH B O   1 
HETATM 8129 O  O   . HOH G 4 .   ? 36.072 27.689 76.184  1.00 37.69 ? 920 HOH B O   1 
HETATM 8130 O  O   . HOH G 4 .   ? 41.630 30.356 79.378  1.00 31.45 ? 921 HOH B O   1 
HETATM 8131 O  O   . HOH G 4 .   ? 43.543 19.758 68.967  1.00 25.28 ? 922 HOH B O   1 
HETATM 8132 O  O   . HOH G 4 .   ? 45.980 25.197 74.050  1.00 32.52 ? 923 HOH B O   1 
HETATM 8133 O  O   . HOH G 4 .   ? 42.574 21.429 71.771  1.00 38.32 ? 924 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   23  23  ARG ARG A . n 
A 1 2   THR 2   24  24  THR THR A . n 
A 1 3   ARG 3   25  25  ARG ARG A . n 
A 1 4   ARG 4   26  26  ARG ARG A . n 
A 1 5   PRO 5   27  27  PRO PRO A . n 
A 1 6   GLY 6   28  28  GLY GLY A . n 
A 1 7   GLU 7   29  29  GLU GLU A . n 
A 1 8   PRO 8   30  30  PRO PRO A . n 
A 1 9   PRO 9   31  31  PRO PRO A . n 
A 1 10  LEU 10  32  32  LEU LEU A . n 
A 1 11  ASP 11  33  33  ASP ASP A . n 
A 1 12  LEU 12  34  34  LEU LEU A . n 
A 1 13  GLY 13  35  35  GLY GLY A . n 
A 1 14  SER 14  36  36  SER SER A . n 
A 1 15  ILE 15  37  37  ILE ILE A . n 
A 1 16  PRO 16  38  38  PRO PRO A . n 
A 1 17  TRP 17  39  39  TRP TRP A . n 
A 1 18  LEU 18  40  40  LEU LEU A . n 
A 1 19  GLY 19  41  41  GLY GLY A . n 
A 1 20  TYR 20  42  42  TYR TYR A . n 
A 1 21  ALA 21  43  43  ALA ALA A . n 
A 1 22  LEU 22  44  44  LEU LEU A . n 
A 1 23  ASP 23  45  45  ASP ASP A . n 
A 1 24  PHE 24  46  46  PHE PHE A . n 
A 1 25  GLY 25  47  47  GLY GLY A . n 
A 1 26  LYS 26  48  48  LYS LYS A . n 
A 1 27  ASP 27  49  49  ASP ASP A . n 
A 1 28  ALA 28  50  50  ALA ALA A . n 
A 1 29  ALA 29  51  51  ALA ALA A . n 
A 1 30  SER 30  52  52  SER SER A . n 
A 1 31  PHE 31  53  53  PHE PHE A . n 
A 1 32  LEU 32  54  54  LEU LEU A . n 
A 1 33  THR 33  55  55  THR THR A . n 
A 1 34  ARG 34  56  56  ARG ARG A . n 
A 1 35  MET 35  57  57  MET MET A . n 
A 1 36  LYS 36  58  58  LYS LYS A . n 
A 1 37  GLU 37  59  59  GLU GLU A . n 
A 1 38  LYS 38  60  60  LYS LYS A . n 
A 1 39  HIS 39  61  61  HIS HIS A . n 
A 1 40  GLY 40  62  62  GLY GLY A . n 
A 1 41  ASP 41  63  63  ASP ASP A . n 
A 1 42  ILE 42  64  64  ILE ILE A . n 
A 1 43  PHE 43  65  65  PHE PHE A . n 
A 1 44  THR 44  66  66  THR THR A . n 
A 1 45  ILE 45  67  67  ILE ILE A . n 
A 1 46  LEU 46  68  68  LEU LEU A . n 
A 1 47  VAL 47  69  69  VAL VAL A . n 
A 1 48  GLY 48  70  70  GLY GLY A . n 
A 1 49  GLY 49  71  71  GLY GLY A . n 
A 1 50  ARG 50  72  72  ARG ARG A . n 
A 1 51  TYR 51  73  73  TYR TYR A . n 
A 1 52  VAL 52  74  74  VAL VAL A . n 
A 1 53  THR 53  75  75  THR THR A . n 
A 1 54  VAL 54  76  76  VAL VAL A . n 
A 1 55  LEU 55  77  77  LEU LEU A . n 
A 1 56  LEU 56  78  78  LEU LEU A . n 
A 1 57  ASP 57  79  79  ASP ASP A . n 
A 1 58  PRO 58  80  80  PRO PRO A . n 
A 1 59  HIS 59  81  81  HIS HIS A . n 
A 1 60  SER 60  82  82  SER SER A . n 
A 1 61  TYR 61  83  83  TYR TYR A . n 
A 1 62  ASP 62  84  84  ASP ASP A . n 
A 1 63  ALA 63  85  85  ALA ALA A . n 
A 1 64  VAL 64  86  86  VAL VAL A . n 
A 1 65  VAL 65  87  87  VAL VAL A . n 
A 1 66  TRP 66  88  88  TRP TRP A . n 
A 1 67  GLU 67  89  89  GLU GLU A . n 
A 1 68  PRO 68  90  90  PRO PRO A . n 
A 1 69  ARG 69  91  91  ARG ARG A . n 
A 1 70  THR 70  92  92  THR THR A . n 
A 1 71  ARG 71  93  93  ARG ARG A . n 
A 1 72  LEU 72  94  94  LEU LEU A . n 
A 1 73  ASP 73  95  95  ASP ASP A . n 
A 1 74  PHE 74  96  96  PHE PHE A . n 
A 1 75  HIS 75  97  97  HIS HIS A . n 
A 1 76  ALA 76  98  98  ALA ALA A . n 
A 1 77  TYR 77  99  99  TYR TYR A . n 
A 1 78  ALA 78  100 100 ALA ALA A . n 
A 1 79  ILE 79  101 101 ILE ILE A . n 
A 1 80  PHE 80  102 102 PHE PHE A . n 
A 1 81  LEU 81  103 103 LEU LEU A . n 
A 1 82  MET 82  104 104 MET MET A . n 
A 1 83  GLU 83  105 105 GLU GLU A . n 
A 1 84  ARG 84  106 106 ARG ARG A . n 
A 1 85  ILE 85  107 107 ILE ILE A . n 
A 1 86  PHE 86  108 108 PHE PHE A . n 
A 1 87  ASP 87  109 109 ASP ASP A . n 
A 1 88  VAL 88  110 110 VAL VAL A . n 
A 1 89  GLN 89  111 111 GLN GLN A . n 
A 1 90  LEU 90  112 112 LEU LEU A . n 
A 1 91  PRO 91  113 113 PRO PRO A . n 
A 1 92  HIS 92  114 114 HIS HIS A . n 
A 1 93  TYR 93  115 115 TYR TYR A . n 
A 1 94  SER 94  116 116 SER SER A . n 
A 1 95  PRO 95  117 117 PRO PRO A . n 
A 1 96  SER 96  118 118 SER SER A . n 
A 1 97  ASP 97  119 119 ASP ASP A . n 
A 1 98  GLU 98  120 120 GLU GLU A . n 
A 1 99  LYS 99  121 121 LYS LYS A . n 
A 1 100 ALA 100 122 122 ALA ALA A . n 
A 1 101 ARG 101 123 123 ARG ARG A . n 
A 1 102 MET 102 124 124 MET MET A . n 
A 1 103 LYS 103 125 125 LYS LYS A . n 
A 1 104 LEU 104 126 126 LEU LEU A . n 
A 1 105 THR 105 127 127 THR THR A . n 
A 1 106 LEU 106 128 128 LEU LEU A . n 
A 1 107 LEU 107 129 129 LEU LEU A . n 
A 1 108 HIS 108 130 130 HIS HIS A . n 
A 1 109 ARG 109 131 131 ARG ARG A . n 
A 1 110 GLU 110 132 132 GLU GLU A . n 
A 1 111 LEU 111 133 133 LEU LEU A . n 
A 1 112 GLN 112 134 134 GLN GLN A . n 
A 1 113 ALA 113 135 135 ALA ALA A . n 
A 1 114 LEU 114 136 136 LEU LEU A . n 
A 1 115 THR 115 137 137 THR THR A . n 
A 1 116 GLU 116 138 138 GLU GLU A . n 
A 1 117 ALA 117 139 139 ALA ALA A . n 
A 1 118 MET 118 140 140 MET MET A . n 
A 1 119 TYR 119 141 141 TYR TYR A . n 
A 1 120 THR 120 142 142 THR THR A . n 
A 1 121 ASN 121 143 143 ASN ASN A . n 
A 1 122 LEU 122 144 144 LEU LEU A . n 
A 1 123 HIS 123 145 145 HIS HIS A . n 
A 1 124 ALA 124 146 146 ALA ALA A . n 
A 1 125 VAL 125 147 147 VAL VAL A . n 
A 1 126 LEU 126 148 148 LEU LEU A . n 
A 1 127 LEU 127 149 149 LEU LEU A . n 
A 1 128 GLY 128 150 150 GLY GLY A . n 
A 1 129 ASP 129 151 151 ASP ASP A . n 
A 1 130 ALA 130 152 152 ALA ALA A . n 
A 1 131 THR 131 153 153 THR THR A . n 
A 1 132 GLU 132 154 154 GLU GLU A . n 
A 1 133 ALA 133 155 155 ALA ALA A . n 
A 1 134 GLY 134 156 156 GLY GLY A . n 
A 1 135 SER 135 157 157 SER SER A . n 
A 1 136 GLY 136 158 158 GLY GLY A . n 
A 1 137 TRP 137 159 159 TRP TRP A . n 
A 1 138 HIS 138 160 160 HIS HIS A . n 
A 1 139 GLU 139 161 161 GLU GLU A . n 
A 1 140 MET 140 162 162 MET MET A . n 
A 1 141 GLY 141 163 163 GLY GLY A . n 
A 1 142 LEU 142 164 164 LEU LEU A . n 
A 1 143 LEU 143 165 165 LEU LEU A . n 
A 1 144 ASP 144 166 166 ASP ASP A . n 
A 1 145 PHE 145 167 167 PHE PHE A . n 
A 1 146 SER 146 168 168 SER SER A . n 
A 1 147 TYR 147 169 169 TYR TYR A . n 
A 1 148 SER 148 170 170 SER SER A . n 
A 1 149 PHE 149 171 171 PHE PHE A . n 
A 1 150 LEU 150 172 172 LEU LEU A . n 
A 1 151 LEU 151 173 173 LEU LEU A . n 
A 1 152 ARG 152 174 174 ARG ARG A . n 
A 1 153 ALA 153 175 175 ALA ALA A . n 
A 1 154 GLY 154 176 176 GLY GLY A . n 
A 1 155 TYR 155 177 177 TYR TYR A . n 
A 1 156 LEU 156 178 178 LEU LEU A . n 
A 1 157 THR 157 179 179 THR THR A . n 
A 1 158 LEU 158 180 180 LEU LEU A . n 
A 1 159 TYR 159 181 181 TYR TYR A . n 
A 1 160 GLY 160 182 182 GLY GLY A . n 
A 1 161 ILE 161 183 183 ILE ILE A . n 
A 1 162 GLU 162 184 184 GLU GLU A . n 
A 1 163 ALA 163 185 185 ALA ALA A . n 
A 1 164 LEU 164 186 186 LEU LEU A . n 
A 1 165 PRO 165 187 187 PRO PRO A . n 
A 1 166 ARG 166 188 188 ARG ARG A . n 
A 1 167 THR 167 189 189 THR THR A . n 
A 1 168 HIS 168 190 190 HIS HIS A . n 
A 1 169 GLU 169 191 191 GLU GLU A . n 
A 1 170 SER 170 192 192 SER SER A . n 
A 1 171 GLN 171 193 193 GLN GLN A . n 
A 1 172 ALA 172 194 194 ALA ALA A . n 
A 1 173 GLN 173 195 195 GLN GLN A . n 
A 1 174 ASP 174 196 196 ASP ASP A . n 
A 1 175 ARG 175 197 197 ARG ARG A . n 
A 1 176 VAL 176 198 198 VAL VAL A . n 
A 1 177 HIS 177 199 199 HIS HIS A . n 
A 1 178 SER 178 200 200 SER SER A . n 
A 1 179 ALA 179 201 201 ALA ALA A . n 
A 1 180 ASP 180 202 202 ASP ASP A . n 
A 1 181 VAL 181 203 203 VAL VAL A . n 
A 1 182 PHE 182 204 204 PHE PHE A . n 
A 1 183 HIS 183 205 205 HIS HIS A . n 
A 1 184 THR 184 206 206 THR THR A . n 
A 1 185 PHE 185 207 207 PHE PHE A . n 
A 1 186 ARG 186 208 208 ARG ARG A . n 
A 1 187 GLN 187 209 209 GLN GLN A . n 
A 1 188 LEU 188 210 210 LEU LEU A . n 
A 1 189 ASP 189 211 211 ASP ASP A . n 
A 1 190 ARG 190 212 212 ARG ARG A . n 
A 1 191 LEU 191 213 213 LEU LEU A . n 
A 1 192 LEU 192 214 214 LEU LEU A . n 
A 1 193 PRO 193 215 215 PRO PRO A . n 
A 1 194 LYS 194 216 216 LYS LYS A . n 
A 1 195 LEU 195 217 217 LEU LEU A . n 
A 1 196 ALA 196 218 218 ALA ALA A . n 
A 1 197 ARG 197 219 219 ARG ARG A . n 
A 1 198 GLY 198 220 220 GLY GLY A . n 
A 1 199 SER 199 221 221 SER SER A . n 
A 1 200 LEU 200 222 222 LEU LEU A . n 
A 1 201 SER 201 223 223 SER SER A . n 
A 1 202 VAL 202 224 224 VAL VAL A . n 
A 1 203 GLY 203 225 225 GLY GLY A . n 
A 1 204 ASP 204 226 226 ASP ASP A . n 
A 1 205 LYS 205 227 227 LYS LYS A . n 
A 1 206 ASP 206 228 228 ASP ASP A . n 
A 1 207 HIS 207 229 229 HIS HIS A . n 
A 1 208 MET 208 230 230 MET MET A . n 
A 1 209 CYS 209 231 231 CYS CYS A . n 
A 1 210 SER 210 232 232 SER SER A . n 
A 1 211 VAL 211 233 233 VAL VAL A . n 
A 1 212 LYS 212 234 234 LYS LYS A . n 
A 1 213 SER 213 235 235 SER SER A . n 
A 1 214 ARG 214 236 236 ARG ARG A . n 
A 1 215 LEU 215 237 237 LEU LEU A . n 
A 1 216 TRP 216 238 238 TRP TRP A . n 
A 1 217 LYS 217 239 239 LYS LYS A . n 
A 1 218 LEU 218 240 240 LEU LEU A . n 
A 1 219 LEU 219 241 241 LEU LEU A . n 
A 1 220 SER 220 242 242 SER SER A . n 
A 1 221 PRO 221 243 243 PRO PRO A . n 
A 1 222 ALA 222 244 244 ALA ALA A . n 
A 1 223 ARG 223 245 245 ARG ARG A . n 
A 1 224 LEU 224 246 246 LEU LEU A . n 
A 1 225 ALA 225 247 247 ALA ALA A . n 
A 1 226 ARG 226 248 248 ARG ARG A . n 
A 1 227 ARG 227 249 249 ARG ARG A . n 
A 1 228 ALA 228 250 250 ALA ALA A . n 
A 1 229 HIS 229 251 251 HIS HIS A . n 
A 1 230 ARG 230 252 252 ARG ARG A . n 
A 1 231 SER 231 253 253 SER SER A . n 
A 1 232 LYS 232 254 254 LYS LYS A . n 
A 1 233 TRP 233 255 255 TRP TRP A . n 
A 1 234 LEU 234 256 256 LEU LEU A . n 
A 1 235 GLU 235 257 257 GLU GLU A . n 
A 1 236 SER 236 258 258 SER SER A . n 
A 1 237 TYR 237 259 259 TYR TYR A . n 
A 1 238 LEU 238 260 260 LEU LEU A . n 
A 1 239 LEU 239 261 261 LEU LEU A . n 
A 1 240 HIS 240 262 262 HIS HIS A . n 
A 1 241 LEU 241 263 263 LEU LEU A . n 
A 1 242 GLU 242 264 264 GLU GLU A . n 
A 1 243 GLU 243 265 265 GLU GLU A . n 
A 1 244 MET 244 266 266 MET MET A . n 
A 1 245 GLY 245 267 267 GLY GLY A . n 
A 1 246 VAL 246 268 268 VAL VAL A . n 
A 1 247 SER 247 269 269 SER SER A . n 
A 1 248 GLU 248 270 270 GLU GLU A . n 
A 1 249 GLU 249 271 271 GLU GLU A . n 
A 1 250 MET 250 272 272 MET MET A . n 
A 1 251 GLN 251 273 273 GLN GLN A . n 
A 1 252 ALA 252 274 274 ALA ALA A . n 
A 1 253 ARG 253 275 275 ARG ARG A . n 
A 1 254 ALA 254 276 276 ALA ALA A . n 
A 1 255 LEU 255 277 277 LEU LEU A . n 
A 1 256 VAL 256 278 278 VAL VAL A . n 
A 1 257 LEU 257 279 279 LEU LEU A . n 
A 1 258 GLN 258 280 280 GLN GLN A . n 
A 1 259 LEU 259 281 281 LEU LEU A . n 
A 1 260 TRP 260 282 282 TRP TRP A . n 
A 1 261 ALA 261 283 283 ALA ALA A . n 
A 1 262 THR 262 284 284 THR THR A . n 
A 1 263 GLN 263 285 285 GLN GLN A . n 
A 1 264 GLY 264 286 286 GLY GLY A . n 
A 1 265 ASN 265 287 287 ASN ASN A . n 
A 1 266 MET 266 288 288 MET MET A . n 
A 1 267 GLY 267 289 289 GLY GLY A . n 
A 1 268 PRO 268 290 290 PRO PRO A . n 
A 1 269 ALA 269 291 291 ALA ALA A . n 
A 1 270 ALA 270 292 292 ALA ALA A . n 
A 1 271 PHE 271 293 293 PHE PHE A . n 
A 1 272 TRP 272 294 294 TRP TRP A . n 
A 1 273 LEU 273 295 295 LEU LEU A . n 
A 1 274 LEU 274 296 296 LEU LEU A . n 
A 1 275 LEU 275 297 297 LEU LEU A . n 
A 1 276 PHE 276 298 298 PHE PHE A . n 
A 1 277 LEU 277 299 299 LEU LEU A . n 
A 1 278 LEU 278 300 300 LEU LEU A . n 
A 1 279 LYS 279 301 301 LYS LYS A . n 
A 1 280 ASN 280 302 302 ASN ASN A . n 
A 1 281 PRO 281 303 303 PRO PRO A . n 
A 1 282 GLU 282 304 304 GLU GLU A . n 
A 1 283 ALA 283 305 305 ALA ALA A . n 
A 1 284 LEU 284 306 306 LEU LEU A . n 
A 1 285 ALA 285 307 307 ALA ALA A . n 
A 1 286 ALA 286 308 308 ALA ALA A . n 
A 1 287 VAL 287 309 309 VAL VAL A . n 
A 1 288 ARG 288 310 310 ARG ARG A . n 
A 1 289 GLY 289 311 311 GLY GLY A . n 
A 1 290 GLU 290 312 312 GLU GLU A . n 
A 1 291 LEU 291 313 313 LEU LEU A . n 
A 1 292 GLU 292 314 314 GLU GLU A . n 
A 1 293 SER 293 315 315 SER SER A . n 
A 1 294 ILE 294 316 316 ILE ILE A . n 
A 1 295 LEU 295 317 317 LEU LEU A . n 
A 1 296 TRP 296 318 318 TRP TRP A . n 
A 1 297 GLN 297 319 319 GLN GLN A . n 
A 1 298 ALA 298 320 ?   ?   ?   A . n 
A 1 299 GLU 299 321 ?   ?   ?   A . n 
A 1 300 GLN 300 322 ?   ?   ?   A . n 
A 1 301 PRO 301 323 ?   ?   ?   A . n 
A 1 302 VAL 302 324 ?   ?   ?   A . n 
A 1 303 SER 303 325 ?   ?   ?   A . n 
A 1 304 GLN 304 326 ?   ?   ?   A . n 
A 1 305 THR 305 327 ?   ?   ?   A . n 
A 1 306 THR 306 328 328 THR THR A . n 
A 1 307 THR 307 329 329 THR THR A . n 
A 1 308 LEU 308 330 330 LEU LEU A . n 
A 1 309 PRO 309 331 331 PRO PRO A . n 
A 1 310 GLN 310 332 332 GLN GLN A . n 
A 1 311 LYS 311 333 333 LYS LYS A . n 
A 1 312 VAL 312 334 334 VAL VAL A . n 
A 1 313 LEU 313 335 335 LEU LEU A . n 
A 1 314 ASP 314 336 336 ASP ASP A . n 
A 1 315 SER 315 337 337 SER SER A . n 
A 1 316 THR 316 338 338 THR THR A . n 
A 1 317 PRO 317 339 339 PRO PRO A . n 
A 1 318 VAL 318 340 340 VAL VAL A . n 
A 1 319 LEU 319 341 341 LEU LEU A . n 
A 1 320 ASP 320 342 342 ASP ASP A . n 
A 1 321 SER 321 343 343 SER SER A . n 
A 1 322 VAL 322 344 344 VAL VAL A . n 
A 1 323 LEU 323 345 345 LEU LEU A . n 
A 1 324 SER 324 346 346 SER SER A . n 
A 1 325 GLU 325 347 347 GLU GLU A . n 
A 1 326 SER 326 348 348 SER SER A . n 
A 1 327 LEU 327 349 349 LEU LEU A . n 
A 1 328 ARG 328 350 350 ARG ARG A . n 
A 1 329 LEU 329 351 351 LEU LEU A . n 
A 1 330 THR 330 352 352 THR THR A . n 
A 1 331 ALA 331 353 353 ALA ALA A . n 
A 1 332 ALA 332 354 354 ALA ALA A . n 
A 1 333 PRO 333 355 355 PRO PRO A . n 
A 1 334 PHE 334 356 356 PHE PHE A . n 
A 1 335 ILE 335 357 357 ILE ILE A . n 
A 1 336 THR 336 358 358 THR THR A . n 
A 1 337 ARG 337 359 359 ARG ARG A . n 
A 1 338 GLU 338 360 360 GLU GLU A . n 
A 1 339 VAL 339 361 361 VAL VAL A . n 
A 1 340 VAL 340 362 362 VAL VAL A . n 
A 1 341 VAL 341 363 363 VAL VAL A . n 
A 1 342 ASP 342 364 364 ASP ASP A . n 
A 1 343 LEU 343 365 365 LEU LEU A . n 
A 1 344 ALA 344 366 366 ALA ALA A . n 
A 1 345 MET 345 367 367 MET MET A . n 
A 1 346 PRO 346 368 368 PRO PRO A . n 
A 1 347 MET 347 369 369 MET MET A . n 
A 1 348 ALA 348 370 370 ALA ALA A . n 
A 1 349 ASP 349 371 371 ASP ASP A . n 
A 1 350 GLY 350 372 372 GLY GLY A . n 
A 1 351 ARG 351 373 373 ARG ARG A . n 
A 1 352 GLU 352 374 374 GLU GLU A . n 
A 1 353 PHE 353 375 375 PHE PHE A . n 
A 1 354 ASN 354 376 376 ASN ASN A . n 
A 1 355 LEU 355 377 377 LEU LEU A . n 
A 1 356 ARG 356 378 378 ARG ARG A . n 
A 1 357 ARG 357 379 379 ARG ARG A . n 
A 1 358 GLY 358 380 380 GLY GLY A . n 
A 1 359 ASP 359 381 381 ASP ASP A . n 
A 1 360 ARG 360 382 382 ARG ARG A . n 
A 1 361 LEU 361 383 383 LEU LEU A . n 
A 1 362 LEU 362 384 384 LEU LEU A . n 
A 1 363 LEU 363 385 385 LEU LEU A . n 
A 1 364 PHE 364 386 386 PHE PHE A . n 
A 1 365 PRO 365 387 387 PRO PRO A . n 
A 1 366 PHE 366 388 388 PHE PHE A . n 
A 1 367 LEU 367 389 389 LEU LEU A . n 
A 1 368 SER 368 390 390 SER SER A . n 
A 1 369 PRO 369 391 391 PRO PRO A . n 
A 1 370 GLN 370 392 392 GLN GLN A . n 
A 1 371 ARG 371 393 393 ARG ARG A . n 
A 1 372 ASP 372 394 394 ASP ASP A . n 
A 1 373 PRO 373 395 395 PRO PRO A . n 
A 1 374 GLU 374 396 396 GLU GLU A . n 
A 1 375 ILE 375 397 397 ILE ILE A . n 
A 1 376 TYR 376 398 398 TYR TYR A . n 
A 1 377 THR 377 399 399 THR THR A . n 
A 1 378 ASP 378 400 400 ASP ASP A . n 
A 1 379 PRO 379 401 401 PRO PRO A . n 
A 1 380 GLU 380 402 402 GLU GLU A . n 
A 1 381 VAL 381 403 403 VAL VAL A . n 
A 1 382 PHE 382 404 404 PHE PHE A . n 
A 1 383 LYS 383 405 405 LYS LYS A . n 
A 1 384 TYR 384 406 406 TYR TYR A . n 
A 1 385 ASN 385 407 407 ASN ASN A . n 
A 1 386 ARG 386 408 408 ARG ARG A . n 
A 1 387 PHE 387 409 409 PHE PHE A . n 
A 1 388 LEU 388 410 410 LEU LEU A . n 
A 1 389 ASN 389 411 411 ASN ASN A . n 
A 1 390 PRO 390 412 412 PRO PRO A . n 
A 1 391 ASP 391 413 413 ASP ASP A . n 
A 1 392 GLY 392 414 414 GLY GLY A . n 
A 1 393 SER 393 415 415 SER SER A . n 
A 1 394 GLU 394 416 416 GLU GLU A . n 
A 1 395 LYS 395 417 417 LYS LYS A . n 
A 1 396 LYS 396 418 418 LYS LYS A . n 
A 1 397 ASP 397 419 419 ASP ASP A . n 
A 1 398 PHE 398 420 420 PHE PHE A . n 
A 1 399 TYR 399 421 421 TYR TYR A . n 
A 1 400 LYS 400 422 422 LYS LYS A . n 
A 1 401 ASP 401 423 423 ASP ASP A . n 
A 1 402 GLY 402 424 424 GLY GLY A . n 
A 1 403 LYS 403 425 425 LYS LYS A . n 
A 1 404 ARG 404 426 426 ARG ARG A . n 
A 1 405 LEU 405 427 427 LEU LEU A . n 
A 1 406 LYS 406 428 428 LYS LYS A . n 
A 1 407 ASN 407 429 429 ASN ASN A . n 
A 1 408 TYR 408 430 430 TYR TYR A . n 
A 1 409 ASN 409 431 431 ASN ASN A . n 
A 1 410 MET 410 432 432 MET MET A . n 
A 1 411 PRO 411 433 433 PRO PRO A . n 
A 1 412 TRP 412 434 434 TRP TRP A . n 
A 1 413 GLY 413 435 435 GLY GLY A . n 
A 1 414 ALA 414 436 436 ALA ALA A . n 
A 1 415 GLY 415 437 437 GLY GLY A . n 
A 1 416 HIS 416 438 438 HIS HIS A . n 
A 1 417 ASN 417 439 439 ASN ASN A . n 
A 1 418 HIS 418 440 440 HIS HIS A . n 
A 1 419 CYS 419 441 441 CYS CYS A . n 
A 1 420 LEU 420 442 442 LEU LEU A . n 
A 1 421 GLY 421 443 443 GLY GLY A . n 
A 1 422 ARG 422 444 444 ARG ARG A . n 
A 1 423 SER 423 445 445 SER SER A . n 
A 1 424 TYR 424 446 446 TYR TYR A . n 
A 1 425 ALA 425 447 447 ALA ALA A . n 
A 1 426 VAL 426 448 448 VAL VAL A . n 
A 1 427 ASN 427 449 449 ASN ASN A . n 
A 1 428 SER 428 450 450 SER SER A . n 
A 1 429 ILE 429 451 451 ILE ILE A . n 
A 1 430 LYS 430 452 452 LYS LYS A . n 
A 1 431 GLN 431 453 453 GLN GLN A . n 
A 1 432 PHE 432 454 454 PHE PHE A . n 
A 1 433 VAL 433 455 455 VAL VAL A . n 
A 1 434 PHE 434 456 456 PHE PHE A . n 
A 1 435 LEU 435 457 457 LEU LEU A . n 
A 1 436 VAL 436 458 458 VAL VAL A . n 
A 1 437 LEU 437 459 459 LEU LEU A . n 
A 1 438 VAL 438 460 460 VAL VAL A . n 
A 1 439 HIS 439 461 461 HIS HIS A . n 
A 1 440 LEU 440 462 462 LEU LEU A . n 
A 1 441 ASP 441 463 463 ASP ASP A . n 
A 1 442 LEU 442 464 464 LEU LEU A . n 
A 1 443 GLU 443 465 465 GLU GLU A . n 
A 1 444 LEU 444 466 466 LEU LEU A . n 
A 1 445 ILE 445 467 467 ILE ILE A . n 
A 1 446 ASN 446 468 468 ASN ASN A . n 
A 1 447 ALA 447 469 469 ALA ALA A . n 
A 1 448 ASP 448 470 470 ASP ASP A . n 
A 1 449 VAL 449 471 471 VAL VAL A . n 
A 1 450 GLU 450 472 472 GLU GLU A . n 
A 1 451 ILE 451 473 473 ILE ILE A . n 
A 1 452 PRO 452 474 474 PRO PRO A . n 
A 1 453 GLU 453 475 475 GLU GLU A . n 
A 1 454 PHE 454 476 476 PHE PHE A . n 
A 1 455 ASP 455 477 477 ASP ASP A . n 
A 1 456 LEU 456 478 478 LEU LEU A . n 
A 1 457 SER 457 479 479 SER SER A . n 
A 1 458 ARG 458 480 480 ARG ARG A . n 
A 1 459 TYR 459 481 481 TYR TYR A . n 
A 1 460 GLY 460 482 482 GLY GLY A . n 
A 1 461 PHE 461 483 483 PHE PHE A . n 
A 1 462 GLY 462 484 484 GLY GLY A . n 
A 1 463 LEU 463 485 485 LEU LEU A . n 
A 1 464 MET 464 486 486 MET MET A . n 
A 1 465 GLN 465 487 487 GLN GLN A . n 
A 1 466 PRO 466 488 488 PRO PRO A . n 
A 1 467 GLU 467 489 489 GLU GLU A . n 
A 1 468 HIS 468 490 490 HIS HIS A . n 
A 1 469 ASP 469 491 491 ASP ASP A . n 
A 1 470 VAL 470 492 492 VAL VAL A . n 
A 1 471 PRO 471 493 493 PRO PRO A . n 
A 1 472 VAL 472 494 494 VAL VAL A . n 
A 1 473 ARG 473 495 495 ARG ARG A . n 
A 1 474 TYR 474 496 496 TYR TYR A . n 
A 1 475 ARG 475 497 497 ARG ARG A . n 
A 1 476 ILE 476 498 498 ILE ILE A . n 
A 1 477 ARG 477 499 499 ARG ARG A . n 
A 1 478 PRO 478 500 500 PRO PRO A . n 
A 1 479 HIS 479 501 501 HIS HIS A . n 
A 1 480 HIS 480 502 ?   ?   ?   A . n 
A 1 481 HIS 481 503 ?   ?   ?   A . n 
A 1 482 HIS 482 504 ?   ?   ?   A . n 
B 1 1   ARG 1   23  23  ARG ARG B . n 
B 1 2   THR 2   24  24  THR THR B . n 
B 1 3   ARG 3   25  25  ARG ARG B . n 
B 1 4   ARG 4   26  26  ARG ARG B . n 
B 1 5   PRO 5   27  27  PRO PRO B . n 
B 1 6   GLY 6   28  28  GLY GLY B . n 
B 1 7   GLU 7   29  29  GLU GLU B . n 
B 1 8   PRO 8   30  30  PRO PRO B . n 
B 1 9   PRO 9   31  31  PRO PRO B . n 
B 1 10  LEU 10  32  32  LEU LEU B . n 
B 1 11  ASP 11  33  33  ASP ASP B . n 
B 1 12  LEU 12  34  34  LEU LEU B . n 
B 1 13  GLY 13  35  35  GLY GLY B . n 
B 1 14  SER 14  36  36  SER SER B . n 
B 1 15  ILE 15  37  37  ILE ILE B . n 
B 1 16  PRO 16  38  38  PRO PRO B . n 
B 1 17  TRP 17  39  39  TRP TRP B . n 
B 1 18  LEU 18  40  40  LEU LEU B . n 
B 1 19  GLY 19  41  41  GLY GLY B . n 
B 1 20  TYR 20  42  42  TYR TYR B . n 
B 1 21  ALA 21  43  43  ALA ALA B . n 
B 1 22  LEU 22  44  44  LEU LEU B . n 
B 1 23  ASP 23  45  45  ASP ASP B . n 
B 1 24  PHE 24  46  46  PHE PHE B . n 
B 1 25  GLY 25  47  47  GLY GLY B . n 
B 1 26  LYS 26  48  48  LYS LYS B . n 
B 1 27  ASP 27  49  49  ASP ASP B . n 
B 1 28  ALA 28  50  50  ALA ALA B . n 
B 1 29  ALA 29  51  51  ALA ALA B . n 
B 1 30  SER 30  52  52  SER SER B . n 
B 1 31  PHE 31  53  53  PHE PHE B . n 
B 1 32  LEU 32  54  54  LEU LEU B . n 
B 1 33  THR 33  55  55  THR THR B . n 
B 1 34  ARG 34  56  56  ARG ARG B . n 
B 1 35  MET 35  57  57  MET MET B . n 
B 1 36  LYS 36  58  58  LYS LYS B . n 
B 1 37  GLU 37  59  59  GLU GLU B . n 
B 1 38  LYS 38  60  60  LYS LYS B . n 
B 1 39  HIS 39  61  61  HIS HIS B . n 
B 1 40  GLY 40  62  62  GLY GLY B . n 
B 1 41  ASP 41  63  63  ASP ASP B . n 
B 1 42  ILE 42  64  64  ILE ILE B . n 
B 1 43  PHE 43  65  65  PHE PHE B . n 
B 1 44  THR 44  66  66  THR THR B . n 
B 1 45  ILE 45  67  67  ILE ILE B . n 
B 1 46  LEU 46  68  68  LEU LEU B . n 
B 1 47  VAL 47  69  69  VAL VAL B . n 
B 1 48  GLY 48  70  70  GLY GLY B . n 
B 1 49  GLY 49  71  71  GLY GLY B . n 
B 1 50  ARG 50  72  72  ARG ARG B . n 
B 1 51  TYR 51  73  73  TYR TYR B . n 
B 1 52  VAL 52  74  74  VAL VAL B . n 
B 1 53  THR 53  75  75  THR THR B . n 
B 1 54  VAL 54  76  76  VAL VAL B . n 
B 1 55  LEU 55  77  77  LEU LEU B . n 
B 1 56  LEU 56  78  78  LEU LEU B . n 
B 1 57  ASP 57  79  79  ASP ASP B . n 
B 1 58  PRO 58  80  80  PRO PRO B . n 
B 1 59  HIS 59  81  81  HIS HIS B . n 
B 1 60  SER 60  82  82  SER SER B . n 
B 1 61  TYR 61  83  83  TYR TYR B . n 
B 1 62  ASP 62  84  84  ASP ASP B . n 
B 1 63  ALA 63  85  85  ALA ALA B . n 
B 1 64  VAL 64  86  86  VAL VAL B . n 
B 1 65  VAL 65  87  87  VAL VAL B . n 
B 1 66  TRP 66  88  88  TRP TRP B . n 
B 1 67  GLU 67  89  89  GLU GLU B . n 
B 1 68  PRO 68  90  90  PRO PRO B . n 
B 1 69  ARG 69  91  91  ARG ARG B . n 
B 1 70  THR 70  92  92  THR THR B . n 
B 1 71  ARG 71  93  93  ARG ARG B . n 
B 1 72  LEU 72  94  94  LEU LEU B . n 
B 1 73  ASP 73  95  95  ASP ASP B . n 
B 1 74  PHE 74  96  96  PHE PHE B . n 
B 1 75  HIS 75  97  97  HIS HIS B . n 
B 1 76  ALA 76  98  98  ALA ALA B . n 
B 1 77  TYR 77  99  99  TYR TYR B . n 
B 1 78  ALA 78  100 100 ALA ALA B . n 
B 1 79  ILE 79  101 101 ILE ILE B . n 
B 1 80  PHE 80  102 102 PHE PHE B . n 
B 1 81  LEU 81  103 103 LEU LEU B . n 
B 1 82  MET 82  104 104 MET MET B . n 
B 1 83  GLU 83  105 105 GLU GLU B . n 
B 1 84  ARG 84  106 106 ARG ARG B . n 
B 1 85  ILE 85  107 107 ILE ILE B . n 
B 1 86  PHE 86  108 108 PHE PHE B . n 
B 1 87  ASP 87  109 109 ASP ASP B . n 
B 1 88  VAL 88  110 110 VAL VAL B . n 
B 1 89  GLN 89  111 111 GLN GLN B . n 
B 1 90  LEU 90  112 112 LEU LEU B . n 
B 1 91  PRO 91  113 113 PRO PRO B . n 
B 1 92  HIS 92  114 114 HIS HIS B . n 
B 1 93  TYR 93  115 115 TYR TYR B . n 
B 1 94  SER 94  116 116 SER SER B . n 
B 1 95  PRO 95  117 117 PRO PRO B . n 
B 1 96  SER 96  118 118 SER SER B . n 
B 1 97  ASP 97  119 119 ASP ASP B . n 
B 1 98  GLU 98  120 120 GLU GLU B . n 
B 1 99  LYS 99  121 121 LYS LYS B . n 
B 1 100 ALA 100 122 122 ALA ALA B . n 
B 1 101 ARG 101 123 123 ARG ARG B . n 
B 1 102 MET 102 124 124 MET MET B . n 
B 1 103 LYS 103 125 125 LYS LYS B . n 
B 1 104 LEU 104 126 126 LEU LEU B . n 
B 1 105 THR 105 127 127 THR THR B . n 
B 1 106 LEU 106 128 128 LEU LEU B . n 
B 1 107 LEU 107 129 129 LEU LEU B . n 
B 1 108 HIS 108 130 130 HIS HIS B . n 
B 1 109 ARG 109 131 131 ARG ARG B . n 
B 1 110 GLU 110 132 132 GLU GLU B . n 
B 1 111 LEU 111 133 133 LEU LEU B . n 
B 1 112 GLN 112 134 134 GLN GLN B . n 
B 1 113 ALA 113 135 135 ALA ALA B . n 
B 1 114 LEU 114 136 136 LEU LEU B . n 
B 1 115 THR 115 137 137 THR THR B . n 
B 1 116 GLU 116 138 138 GLU GLU B . n 
B 1 117 ALA 117 139 139 ALA ALA B . n 
B 1 118 MET 118 140 140 MET MET B . n 
B 1 119 TYR 119 141 141 TYR TYR B . n 
B 1 120 THR 120 142 142 THR THR B . n 
B 1 121 ASN 121 143 143 ASN ASN B . n 
B 1 122 LEU 122 144 144 LEU LEU B . n 
B 1 123 HIS 123 145 145 HIS HIS B . n 
B 1 124 ALA 124 146 146 ALA ALA B . n 
B 1 125 VAL 125 147 147 VAL VAL B . n 
B 1 126 LEU 126 148 148 LEU LEU B . n 
B 1 127 LEU 127 149 149 LEU LEU B . n 
B 1 128 GLY 128 150 150 GLY GLY B . n 
B 1 129 ASP 129 151 151 ASP ASP B . n 
B 1 130 ALA 130 152 152 ALA ALA B . n 
B 1 131 THR 131 153 153 THR THR B . n 
B 1 132 GLU 132 154 154 GLU GLU B . n 
B 1 133 ALA 133 155 155 ALA ALA B . n 
B 1 134 GLY 134 156 156 GLY GLY B . n 
B 1 135 SER 135 157 157 SER SER B . n 
B 1 136 GLY 136 158 158 GLY GLY B . n 
B 1 137 TRP 137 159 159 TRP TRP B . n 
B 1 138 HIS 138 160 160 HIS HIS B . n 
B 1 139 GLU 139 161 161 GLU GLU B . n 
B 1 140 MET 140 162 162 MET MET B . n 
B 1 141 GLY 141 163 163 GLY GLY B . n 
B 1 142 LEU 142 164 164 LEU LEU B . n 
B 1 143 LEU 143 165 165 LEU LEU B . n 
B 1 144 ASP 144 166 166 ASP ASP B . n 
B 1 145 PHE 145 167 167 PHE PHE B . n 
B 1 146 SER 146 168 168 SER SER B . n 
B 1 147 TYR 147 169 169 TYR TYR B . n 
B 1 148 SER 148 170 170 SER SER B . n 
B 1 149 PHE 149 171 171 PHE PHE B . n 
B 1 150 LEU 150 172 172 LEU LEU B . n 
B 1 151 LEU 151 173 173 LEU LEU B . n 
B 1 152 ARG 152 174 174 ARG ARG B . n 
B 1 153 ALA 153 175 175 ALA ALA B . n 
B 1 154 GLY 154 176 176 GLY GLY B . n 
B 1 155 TYR 155 177 177 TYR TYR B . n 
B 1 156 LEU 156 178 178 LEU LEU B . n 
B 1 157 THR 157 179 179 THR THR B . n 
B 1 158 LEU 158 180 180 LEU LEU B . n 
B 1 159 TYR 159 181 181 TYR TYR B . n 
B 1 160 GLY 160 182 182 GLY GLY B . n 
B 1 161 ILE 161 183 183 ILE ILE B . n 
B 1 162 GLU 162 184 184 GLU GLU B . n 
B 1 163 ALA 163 185 185 ALA ALA B . n 
B 1 164 LEU 164 186 186 LEU LEU B . n 
B 1 165 PRO 165 187 187 PRO PRO B . n 
B 1 166 ARG 166 188 188 ARG ARG B . n 
B 1 167 THR 167 189 189 THR THR B . n 
B 1 168 HIS 168 190 190 HIS HIS B . n 
B 1 169 GLU 169 191 191 GLU GLU B . n 
B 1 170 SER 170 192 192 SER SER B . n 
B 1 171 GLN 171 193 193 GLN GLN B . n 
B 1 172 ALA 172 194 194 ALA ALA B . n 
B 1 173 GLN 173 195 195 GLN GLN B . n 
B 1 174 ASP 174 196 196 ASP ASP B . n 
B 1 175 ARG 175 197 197 ARG ARG B . n 
B 1 176 VAL 176 198 198 VAL VAL B . n 
B 1 177 HIS 177 199 199 HIS HIS B . n 
B 1 178 SER 178 200 200 SER SER B . n 
B 1 179 ALA 179 201 201 ALA ALA B . n 
B 1 180 ASP 180 202 202 ASP ASP B . n 
B 1 181 VAL 181 203 203 VAL VAL B . n 
B 1 182 PHE 182 204 204 PHE PHE B . n 
B 1 183 HIS 183 205 205 HIS HIS B . n 
B 1 184 THR 184 206 206 THR THR B . n 
B 1 185 PHE 185 207 207 PHE PHE B . n 
B 1 186 ARG 186 208 208 ARG ARG B . n 
B 1 187 GLN 187 209 209 GLN GLN B . n 
B 1 188 LEU 188 210 210 LEU LEU B . n 
B 1 189 ASP 189 211 211 ASP ASP B . n 
B 1 190 ARG 190 212 212 ARG ARG B . n 
B 1 191 LEU 191 213 213 LEU LEU B . n 
B 1 192 LEU 192 214 214 LEU LEU B . n 
B 1 193 PRO 193 215 215 PRO PRO B . n 
B 1 194 LYS 194 216 216 LYS LYS B . n 
B 1 195 LEU 195 217 217 LEU LEU B . n 
B 1 196 ALA 196 218 218 ALA ALA B . n 
B 1 197 ARG 197 219 219 ARG ARG B . n 
B 1 198 GLY 198 220 220 GLY GLY B . n 
B 1 199 SER 199 221 221 SER SER B . n 
B 1 200 LEU 200 222 222 LEU LEU B . n 
B 1 201 SER 201 223 223 SER SER B . n 
B 1 202 VAL 202 224 224 VAL VAL B . n 
B 1 203 GLY 203 225 225 GLY GLY B . n 
B 1 204 ASP 204 226 226 ASP ASP B . n 
B 1 205 LYS 205 227 227 LYS LYS B . n 
B 1 206 ASP 206 228 228 ASP ASP B . n 
B 1 207 HIS 207 229 229 HIS HIS B . n 
B 1 208 MET 208 230 230 MET MET B . n 
B 1 209 CYS 209 231 231 CYS CYS B . n 
B 1 210 SER 210 232 232 SER SER B . n 
B 1 211 VAL 211 233 233 VAL VAL B . n 
B 1 212 LYS 212 234 234 LYS LYS B . n 
B 1 213 SER 213 235 235 SER SER B . n 
B 1 214 ARG 214 236 236 ARG ARG B . n 
B 1 215 LEU 215 237 237 LEU LEU B . n 
B 1 216 TRP 216 238 238 TRP TRP B . n 
B 1 217 LYS 217 239 239 LYS LYS B . n 
B 1 218 LEU 218 240 240 LEU LEU B . n 
B 1 219 LEU 219 241 241 LEU LEU B . n 
B 1 220 SER 220 242 242 SER SER B . n 
B 1 221 PRO 221 243 243 PRO PRO B . n 
B 1 222 ALA 222 244 244 ALA ALA B . n 
B 1 223 ARG 223 245 245 ARG ARG B . n 
B 1 224 LEU 224 246 246 LEU LEU B . n 
B 1 225 ALA 225 247 247 ALA ALA B . n 
B 1 226 ARG 226 248 248 ARG ARG B . n 
B 1 227 ARG 227 249 249 ARG ARG B . n 
B 1 228 ALA 228 250 250 ALA ALA B . n 
B 1 229 HIS 229 251 251 HIS HIS B . n 
B 1 230 ARG 230 252 252 ARG ARG B . n 
B 1 231 SER 231 253 253 SER SER B . n 
B 1 232 LYS 232 254 254 LYS LYS B . n 
B 1 233 TRP 233 255 255 TRP TRP B . n 
B 1 234 LEU 234 256 256 LEU LEU B . n 
B 1 235 GLU 235 257 257 GLU GLU B . n 
B 1 236 SER 236 258 258 SER SER B . n 
B 1 237 TYR 237 259 259 TYR TYR B . n 
B 1 238 LEU 238 260 260 LEU LEU B . n 
B 1 239 LEU 239 261 261 LEU LEU B . n 
B 1 240 HIS 240 262 262 HIS HIS B . n 
B 1 241 LEU 241 263 263 LEU LEU B . n 
B 1 242 GLU 242 264 264 GLU GLU B . n 
B 1 243 GLU 243 265 265 GLU GLU B . n 
B 1 244 MET 244 266 266 MET MET B . n 
B 1 245 GLY 245 267 267 GLY GLY B . n 
B 1 246 VAL 246 268 268 VAL VAL B . n 
B 1 247 SER 247 269 269 SER SER B . n 
B 1 248 GLU 248 270 270 GLU GLU B . n 
B 1 249 GLU 249 271 271 GLU GLU B . n 
B 1 250 MET 250 272 272 MET MET B . n 
B 1 251 GLN 251 273 273 GLN GLN B . n 
B 1 252 ALA 252 274 274 ALA ALA B . n 
B 1 253 ARG 253 275 275 ARG ARG B . n 
B 1 254 ALA 254 276 276 ALA ALA B . n 
B 1 255 LEU 255 277 277 LEU LEU B . n 
B 1 256 VAL 256 278 278 VAL VAL B . n 
B 1 257 LEU 257 279 279 LEU LEU B . n 
B 1 258 GLN 258 280 280 GLN GLN B . n 
B 1 259 LEU 259 281 281 LEU LEU B . n 
B 1 260 TRP 260 282 282 TRP TRP B . n 
B 1 261 ALA 261 283 283 ALA ALA B . n 
B 1 262 THR 262 284 284 THR THR B . n 
B 1 263 GLN 263 285 285 GLN GLN B . n 
B 1 264 GLY 264 286 286 GLY GLY B . n 
B 1 265 ASN 265 287 287 ASN ASN B . n 
B 1 266 MET 266 288 288 MET MET B . n 
B 1 267 GLY 267 289 289 GLY GLY B . n 
B 1 268 PRO 268 290 290 PRO PRO B . n 
B 1 269 ALA 269 291 291 ALA ALA B . n 
B 1 270 ALA 270 292 292 ALA ALA B . n 
B 1 271 PHE 271 293 293 PHE PHE B . n 
B 1 272 TRP 272 294 294 TRP TRP B . n 
B 1 273 LEU 273 295 295 LEU LEU B . n 
B 1 274 LEU 274 296 296 LEU LEU B . n 
B 1 275 LEU 275 297 297 LEU LEU B . n 
B 1 276 PHE 276 298 298 PHE PHE B . n 
B 1 277 LEU 277 299 299 LEU LEU B . n 
B 1 278 LEU 278 300 300 LEU LEU B . n 
B 1 279 LYS 279 301 301 LYS LYS B . n 
B 1 280 ASN 280 302 302 ASN ASN B . n 
B 1 281 PRO 281 303 303 PRO PRO B . n 
B 1 282 GLU 282 304 304 GLU GLU B . n 
B 1 283 ALA 283 305 305 ALA ALA B . n 
B 1 284 LEU 284 306 306 LEU LEU B . n 
B 1 285 ALA 285 307 307 ALA ALA B . n 
B 1 286 ALA 286 308 308 ALA ALA B . n 
B 1 287 VAL 287 309 309 VAL VAL B . n 
B 1 288 ARG 288 310 310 ARG ARG B . n 
B 1 289 GLY 289 311 311 GLY GLY B . n 
B 1 290 GLU 290 312 312 GLU GLU B . n 
B 1 291 LEU 291 313 313 LEU LEU B . n 
B 1 292 GLU 292 314 314 GLU GLU B . n 
B 1 293 SER 293 315 315 SER SER B . n 
B 1 294 ILE 294 316 316 ILE ILE B . n 
B 1 295 LEU 295 317 317 LEU LEU B . n 
B 1 296 TRP 296 318 318 TRP TRP B . n 
B 1 297 GLN 297 319 ?   ?   ?   B . n 
B 1 298 ALA 298 320 ?   ?   ?   B . n 
B 1 299 GLU 299 321 ?   ?   ?   B . n 
B 1 300 GLN 300 322 ?   ?   ?   B . n 
B 1 301 PRO 301 323 ?   ?   ?   B . n 
B 1 302 VAL 302 324 ?   ?   ?   B . n 
B 1 303 SER 303 325 ?   ?   ?   B . n 
B 1 304 GLN 304 326 ?   ?   ?   B . n 
B 1 305 THR 305 327 ?   ?   ?   B . n 
B 1 306 THR 306 328 ?   ?   ?   B . n 
B 1 307 THR 307 329 ?   ?   ?   B . n 
B 1 308 LEU 308 330 ?   ?   ?   B . n 
B 1 309 PRO 309 331 331 PRO PRO B . n 
B 1 310 GLN 310 332 332 GLN GLN B . n 
B 1 311 LYS 311 333 333 LYS LYS B . n 
B 1 312 VAL 312 334 334 VAL VAL B . n 
B 1 313 LEU 313 335 335 LEU LEU B . n 
B 1 314 ASP 314 336 336 ASP ASP B . n 
B 1 315 SER 315 337 337 SER SER B . n 
B 1 316 THR 316 338 338 THR THR B . n 
B 1 317 PRO 317 339 339 PRO PRO B . n 
B 1 318 VAL 318 340 340 VAL VAL B . n 
B 1 319 LEU 319 341 341 LEU LEU B . n 
B 1 320 ASP 320 342 342 ASP ASP B . n 
B 1 321 SER 321 343 343 SER SER B . n 
B 1 322 VAL 322 344 344 VAL VAL B . n 
B 1 323 LEU 323 345 345 LEU LEU B . n 
B 1 324 SER 324 346 346 SER SER B . n 
B 1 325 GLU 325 347 347 GLU GLU B . n 
B 1 326 SER 326 348 348 SER SER B . n 
B 1 327 LEU 327 349 349 LEU LEU B . n 
B 1 328 ARG 328 350 350 ARG ARG B . n 
B 1 329 LEU 329 351 351 LEU LEU B . n 
B 1 330 THR 330 352 352 THR THR B . n 
B 1 331 ALA 331 353 353 ALA ALA B . n 
B 1 332 ALA 332 354 354 ALA ALA B . n 
B 1 333 PRO 333 355 355 PRO PRO B . n 
B 1 334 PHE 334 356 356 PHE PHE B . n 
B 1 335 ILE 335 357 357 ILE ILE B . n 
B 1 336 THR 336 358 358 THR THR B . n 
B 1 337 ARG 337 359 359 ARG ARG B . n 
B 1 338 GLU 338 360 360 GLU GLU B . n 
B 1 339 VAL 339 361 361 VAL VAL B . n 
B 1 340 VAL 340 362 362 VAL VAL B . n 
B 1 341 VAL 341 363 363 VAL VAL B . n 
B 1 342 ASP 342 364 364 ASP ASP B . n 
B 1 343 LEU 343 365 365 LEU LEU B . n 
B 1 344 ALA 344 366 366 ALA ALA B . n 
B 1 345 MET 345 367 367 MET MET B . n 
B 1 346 PRO 346 368 368 PRO PRO B . n 
B 1 347 MET 347 369 369 MET MET B . n 
B 1 348 ALA 348 370 370 ALA ALA B . n 
B 1 349 ASP 349 371 371 ASP ASP B . n 
B 1 350 GLY 350 372 372 GLY GLY B . n 
B 1 351 ARG 351 373 373 ARG ARG B . n 
B 1 352 GLU 352 374 374 GLU GLU B . n 
B 1 353 PHE 353 375 375 PHE PHE B . n 
B 1 354 ASN 354 376 376 ASN ASN B . n 
B 1 355 LEU 355 377 377 LEU LEU B . n 
B 1 356 ARG 356 378 378 ARG ARG B . n 
B 1 357 ARG 357 379 379 ARG ARG B . n 
B 1 358 GLY 358 380 380 GLY GLY B . n 
B 1 359 ASP 359 381 381 ASP ASP B . n 
B 1 360 ARG 360 382 382 ARG ARG B . n 
B 1 361 LEU 361 383 383 LEU LEU B . n 
B 1 362 LEU 362 384 384 LEU LEU B . n 
B 1 363 LEU 363 385 385 LEU LEU B . n 
B 1 364 PHE 364 386 386 PHE PHE B . n 
B 1 365 PRO 365 387 387 PRO PRO B . n 
B 1 366 PHE 366 388 388 PHE PHE B . n 
B 1 367 LEU 367 389 389 LEU LEU B . n 
B 1 368 SER 368 390 390 SER SER B . n 
B 1 369 PRO 369 391 391 PRO PRO B . n 
B 1 370 GLN 370 392 392 GLN GLN B . n 
B 1 371 ARG 371 393 393 ARG ARG B . n 
B 1 372 ASP 372 394 394 ASP ASP B . n 
B 1 373 PRO 373 395 395 PRO PRO B . n 
B 1 374 GLU 374 396 396 GLU GLU B . n 
B 1 375 ILE 375 397 397 ILE ILE B . n 
B 1 376 TYR 376 398 398 TYR TYR B . n 
B 1 377 THR 377 399 399 THR THR B . n 
B 1 378 ASP 378 400 400 ASP ASP B . n 
B 1 379 PRO 379 401 401 PRO PRO B . n 
B 1 380 GLU 380 402 402 GLU GLU B . n 
B 1 381 VAL 381 403 403 VAL VAL B . n 
B 1 382 PHE 382 404 404 PHE PHE B . n 
B 1 383 LYS 383 405 405 LYS LYS B . n 
B 1 384 TYR 384 406 406 TYR TYR B . n 
B 1 385 ASN 385 407 407 ASN ASN B . n 
B 1 386 ARG 386 408 408 ARG ARG B . n 
B 1 387 PHE 387 409 409 PHE PHE B . n 
B 1 388 LEU 388 410 410 LEU LEU B . n 
B 1 389 ASN 389 411 411 ASN ASN B . n 
B 1 390 PRO 390 412 412 PRO PRO B . n 
B 1 391 ASP 391 413 413 ASP ASP B . n 
B 1 392 GLY 392 414 414 GLY GLY B . n 
B 1 393 SER 393 415 415 SER SER B . n 
B 1 394 GLU 394 416 416 GLU GLU B . n 
B 1 395 LYS 395 417 417 LYS LYS B . n 
B 1 396 LYS 396 418 418 LYS LYS B . n 
B 1 397 ASP 397 419 419 ASP ASP B . n 
B 1 398 PHE 398 420 420 PHE PHE B . n 
B 1 399 TYR 399 421 421 TYR TYR B . n 
B 1 400 LYS 400 422 422 LYS LYS B . n 
B 1 401 ASP 401 423 423 ASP ASP B . n 
B 1 402 GLY 402 424 424 GLY GLY B . n 
B 1 403 LYS 403 425 425 LYS LYS B . n 
B 1 404 ARG 404 426 426 ARG ARG B . n 
B 1 405 LEU 405 427 427 LEU LEU B . n 
B 1 406 LYS 406 428 428 LYS LYS B . n 
B 1 407 ASN 407 429 429 ASN ASN B . n 
B 1 408 TYR 408 430 430 TYR TYR B . n 
B 1 409 ASN 409 431 431 ASN ASN B . n 
B 1 410 MET 410 432 432 MET MET B . n 
B 1 411 PRO 411 433 433 PRO PRO B . n 
B 1 412 TRP 412 434 434 TRP TRP B . n 
B 1 413 GLY 413 435 435 GLY GLY B . n 
B 1 414 ALA 414 436 436 ALA ALA B . n 
B 1 415 GLY 415 437 437 GLY GLY B . n 
B 1 416 HIS 416 438 438 HIS HIS B . n 
B 1 417 ASN 417 439 439 ASN ASN B . n 
B 1 418 HIS 418 440 440 HIS HIS B . n 
B 1 419 CYS 419 441 441 CYS CYS B . n 
B 1 420 LEU 420 442 442 LEU LEU B . n 
B 1 421 GLY 421 443 443 GLY GLY B . n 
B 1 422 ARG 422 444 444 ARG ARG B . n 
B 1 423 SER 423 445 445 SER SER B . n 
B 1 424 TYR 424 446 446 TYR TYR B . n 
B 1 425 ALA 425 447 447 ALA ALA B . n 
B 1 426 VAL 426 448 448 VAL VAL B . n 
B 1 427 ASN 427 449 449 ASN ASN B . n 
B 1 428 SER 428 450 450 SER SER B . n 
B 1 429 ILE 429 451 451 ILE ILE B . n 
B 1 430 LYS 430 452 452 LYS LYS B . n 
B 1 431 GLN 431 453 453 GLN GLN B . n 
B 1 432 PHE 432 454 454 PHE PHE B . n 
B 1 433 VAL 433 455 455 VAL VAL B . n 
B 1 434 PHE 434 456 456 PHE PHE B . n 
B 1 435 LEU 435 457 457 LEU LEU B . n 
B 1 436 VAL 436 458 458 VAL VAL B . n 
B 1 437 LEU 437 459 459 LEU LEU B . n 
B 1 438 VAL 438 460 460 VAL VAL B . n 
B 1 439 HIS 439 461 461 HIS HIS B . n 
B 1 440 LEU 440 462 462 LEU LEU B . n 
B 1 441 ASP 441 463 463 ASP ASP B . n 
B 1 442 LEU 442 464 464 LEU LEU B . n 
B 1 443 GLU 443 465 465 GLU GLU B . n 
B 1 444 LEU 444 466 466 LEU LEU B . n 
B 1 445 ILE 445 467 467 ILE ILE B . n 
B 1 446 ASN 446 468 468 ASN ASN B . n 
B 1 447 ALA 447 469 469 ALA ALA B . n 
B 1 448 ASP 448 470 470 ASP ASP B . n 
B 1 449 VAL 449 471 471 VAL VAL B . n 
B 1 450 GLU 450 472 472 GLU GLU B . n 
B 1 451 ILE 451 473 473 ILE ILE B . n 
B 1 452 PRO 452 474 474 PRO PRO B . n 
B 1 453 GLU 453 475 475 GLU GLU B . n 
B 1 454 PHE 454 476 476 PHE PHE B . n 
B 1 455 ASP 455 477 477 ASP ASP B . n 
B 1 456 LEU 456 478 478 LEU LEU B . n 
B 1 457 SER 457 479 479 SER SER B . n 
B 1 458 ARG 458 480 480 ARG ARG B . n 
B 1 459 TYR 459 481 481 TYR TYR B . n 
B 1 460 GLY 460 482 482 GLY GLY B . n 
B 1 461 PHE 461 483 483 PHE PHE B . n 
B 1 462 GLY 462 484 484 GLY GLY B . n 
B 1 463 LEU 463 485 485 LEU LEU B . n 
B 1 464 MET 464 486 486 MET MET B . n 
B 1 465 GLN 465 487 487 GLN GLN B . n 
B 1 466 PRO 466 488 488 PRO PRO B . n 
B 1 467 GLU 467 489 489 GLU GLU B . n 
B 1 468 HIS 468 490 490 HIS HIS B . n 
B 1 469 ASP 469 491 491 ASP ASP B . n 
B 1 470 VAL 470 492 492 VAL VAL B . n 
B 1 471 PRO 471 493 493 PRO PRO B . n 
B 1 472 VAL 472 494 494 VAL VAL B . n 
B 1 473 ARG 473 495 495 ARG ARG B . n 
B 1 474 TYR 474 496 496 TYR TYR B . n 
B 1 475 ARG 475 497 497 ARG ARG B . n 
B 1 476 ILE 476 498 498 ILE ILE B . n 
B 1 477 ARG 477 499 499 ARG ARG B . n 
B 1 478 PRO 478 500 500 PRO PRO B . n 
B 1 479 HIS 479 501 501 HIS HIS B . n 
B 1 480 HIS 480 502 502 HIS HIS B . n 
B 1 481 HIS 481 503 ?   ?   ?   B . n 
B 1 482 HIS 482 504 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HEM 1   600 600 HEM HEM A . 
D 3 NA  1   701 701 NA  NA  B . 
E 2 HEM 1   600 600 HEM HEM B . 
F 4 HOH 1   601 2   HOH HOH A . 
F 4 HOH 2   602 5   HOH HOH A . 
F 4 HOH 3   603 8   HOH HOH A . 
F 4 HOH 4   604 9   HOH HOH A . 
F 4 HOH 5   605 10  HOH HOH A . 
F 4 HOH 6   606 11  HOH HOH A . 
F 4 HOH 7   607 12  HOH HOH A . 
F 4 HOH 8   608 13  HOH HOH A . 
F 4 HOH 9   609 16  HOH HOH A . 
F 4 HOH 10  610 17  HOH HOH A . 
F 4 HOH 11  611 21  HOH HOH A . 
F 4 HOH 12  612 22  HOH HOH A . 
F 4 HOH 13  613 24  HOH HOH A . 
F 4 HOH 14  614 26  HOH HOH A . 
F 4 HOH 15  615 27  HOH HOH A . 
F 4 HOH 16  616 31  HOH HOH A . 
F 4 HOH 17  617 33  HOH HOH A . 
F 4 HOH 18  618 35  HOH HOH A . 
F 4 HOH 19  619 36  HOH HOH A . 
F 4 HOH 20  620 38  HOH HOH A . 
F 4 HOH 21  621 46  HOH HOH A . 
F 4 HOH 22  622 48  HOH HOH A . 
F 4 HOH 23  623 49  HOH HOH A . 
F 4 HOH 24  624 51  HOH HOH A . 
F 4 HOH 25  625 52  HOH HOH A . 
F 4 HOH 26  626 55  HOH HOH A . 
F 4 HOH 27  627 60  HOH HOH A . 
F 4 HOH 28  628 62  HOH HOH A . 
F 4 HOH 29  629 63  HOH HOH A . 
F 4 HOH 30  630 64  HOH HOH A . 
F 4 HOH 31  631 69  HOH HOH A . 
F 4 HOH 32  632 71  HOH HOH A . 
F 4 HOH 33  633 80  HOH HOH A . 
F 4 HOH 34  634 81  HOH HOH A . 
F 4 HOH 35  635 84  HOH HOH A . 
F 4 HOH 36  636 86  HOH HOH A . 
F 4 HOH 37  637 88  HOH HOH A . 
F 4 HOH 38  638 94  HOH HOH A . 
F 4 HOH 39  639 96  HOH HOH A . 
F 4 HOH 40  640 99  HOH HOH A . 
F 4 HOH 41  641 106 HOH HOH A . 
F 4 HOH 42  642 108 HOH HOH A . 
F 4 HOH 43  643 111 HOH HOH A . 
F 4 HOH 44  644 115 HOH HOH A . 
F 4 HOH 45  645 118 HOH HOH A . 
F 4 HOH 46  646 120 HOH HOH A . 
F 4 HOH 47  647 121 HOH HOH A . 
F 4 HOH 48  648 133 HOH HOH A . 
F 4 HOH 49  649 136 HOH HOH A . 
F 4 HOH 50  650 138 HOH HOH A . 
F 4 HOH 51  651 144 HOH HOH A . 
F 4 HOH 52  652 145 HOH HOH A . 
F 4 HOH 53  653 146 HOH HOH A . 
F 4 HOH 54  654 150 HOH HOH A . 
F 4 HOH 55  655 152 HOH HOH A . 
F 4 HOH 56  656 153 HOH HOH A . 
F 4 HOH 57  657 156 HOH HOH A . 
F 4 HOH 58  658 159 HOH HOH A . 
F 4 HOH 59  659 160 HOH HOH A . 
F 4 HOH 60  660 1   HOH HOH A . 
F 4 HOH 61  661 164 HOH HOH A . 
F 4 HOH 62  662 167 HOH HOH A . 
F 4 HOH 63  663 169 HOH HOH A . 
F 4 HOH 64  664 171 HOH HOH A . 
F 4 HOH 65  665 175 HOH HOH A . 
F 4 HOH 66  666 181 HOH HOH A . 
F 4 HOH 67  667 182 HOH HOH A . 
F 4 HOH 68  668 183 HOH HOH A . 
F 4 HOH 69  669 184 HOH HOH A . 
F 4 HOH 70  670 187 HOH HOH A . 
F 4 HOH 71  671 191 HOH HOH A . 
F 4 HOH 72  672 192 HOH HOH A . 
F 4 HOH 73  673 194 HOH HOH A . 
F 4 HOH 74  674 197 HOH HOH A . 
F 4 HOH 75  675 198 HOH HOH A . 
F 4 HOH 76  676 200 HOH HOH A . 
F 4 HOH 77  677 203 HOH HOH A . 
F 4 HOH 78  678 204 HOH HOH A . 
F 4 HOH 79  679 205 HOH HOH A . 
F 4 HOH 80  680 206 HOH HOH A . 
F 4 HOH 81  681 209 HOH HOH A . 
F 4 HOH 82  682 210 HOH HOH A . 
F 4 HOH 83  683 211 HOH HOH A . 
F 4 HOH 84  684 212 HOH HOH A . 
F 4 HOH 85  685 214 HOH HOH A . 
F 4 HOH 86  686 217 HOH HOH A . 
F 4 HOH 87  687 219 HOH HOH A . 
F 4 HOH 88  688 222 HOH HOH A . 
F 4 HOH 89  689 224 HOH HOH A . 
F 4 HOH 90  690 227 HOH HOH A . 
F 4 HOH 91  691 228 HOH HOH A . 
F 4 HOH 92  692 231 HOH HOH A . 
F 4 HOH 93  693 232 HOH HOH A . 
F 4 HOH 94  694 233 HOH HOH A . 
F 4 HOH 95  695 236 HOH HOH A . 
F 4 HOH 96  696 244 HOH HOH A . 
F 4 HOH 97  697 249 HOH HOH A . 
F 4 HOH 98  698 250 HOH HOH A . 
F 4 HOH 99  699 251 HOH HOH A . 
F 4 HOH 100 700 252 HOH HOH A . 
F 4 HOH 101 701 253 HOH HOH A . 
F 4 HOH 102 702 255 HOH HOH A . 
F 4 HOH 103 703 257 HOH HOH A . 
F 4 HOH 104 704 259 HOH HOH A . 
F 4 HOH 105 705 261 HOH HOH A . 
F 4 HOH 106 706 263 HOH HOH A . 
F 4 HOH 107 707 264 HOH HOH A . 
F 4 HOH 108 708 268 HOH HOH A . 
F 4 HOH 109 709 271 HOH HOH A . 
F 4 HOH 110 710 274 HOH HOH A . 
F 4 HOH 111 711 275 HOH HOH A . 
F 4 HOH 112 712 277 HOH HOH A . 
F 4 HOH 113 713 283 HOH HOH A . 
F 4 HOH 114 714 285 HOH HOH A . 
F 4 HOH 115 715 287 HOH HOH A . 
F 4 HOH 116 716 288 HOH HOH A . 
F 4 HOH 117 717 291 HOH HOH A . 
F 4 HOH 118 718 292 HOH HOH A . 
F 4 HOH 119 719 294 HOH HOH A . 
F 4 HOH 120 720 300 HOH HOH A . 
F 4 HOH 121 721 302 HOH HOH A . 
F 4 HOH 122 722 303 HOH HOH A . 
F 4 HOH 123 723 304 HOH HOH A . 
F 4 HOH 124 724 309 HOH HOH A . 
F 4 HOH 125 725 311 HOH HOH A . 
F 4 HOH 126 726 314 HOH HOH A . 
F 4 HOH 127 727 319 HOH HOH A . 
F 4 HOH 128 728 326 HOH HOH A . 
F 4 HOH 129 729 327 HOH HOH A . 
F 4 HOH 130 730 330 HOH HOH A . 
F 4 HOH 131 731 332 HOH HOH A . 
F 4 HOH 132 732 335 HOH HOH A . 
F 4 HOH 133 733 338 HOH HOH A . 
F 4 HOH 134 734 343 HOH HOH A . 
F 4 HOH 135 735 344 HOH HOH A . 
F 4 HOH 136 736 345 HOH HOH A . 
F 4 HOH 137 737 346 HOH HOH A . 
F 4 HOH 138 738 348 HOH HOH A . 
F 4 HOH 139 739 350 HOH HOH A . 
F 4 HOH 140 740 352 HOH HOH A . 
F 4 HOH 141 741 353 HOH HOH A . 
F 4 HOH 142 742 355 HOH HOH A . 
F 4 HOH 143 743 357 HOH HOH A . 
F 4 HOH 144 744 358 HOH HOH A . 
F 4 HOH 145 745 361 HOH HOH A . 
F 4 HOH 146 746 365 HOH HOH A . 
F 4 HOH 147 747 366 HOH HOH A . 
F 4 HOH 148 748 368 HOH HOH A . 
F 4 HOH 149 749 369 HOH HOH A . 
F 4 HOH 150 750 370 HOH HOH A . 
F 4 HOH 151 751 373 HOH HOH A . 
F 4 HOH 152 752 374 HOH HOH A . 
F 4 HOH 153 753 375 HOH HOH A . 
F 4 HOH 154 754 377 HOH HOH A . 
F 4 HOH 155 755 380 HOH HOH A . 
F 4 HOH 156 756 383 HOH HOH A . 
F 4 HOH 157 757 389 HOH HOH A . 
F 4 HOH 158 758 390 HOH HOH A . 
F 4 HOH 159 759 393 HOH HOH A . 
F 4 HOH 160 760 396 HOH HOH A . 
F 4 HOH 161 761 397 HOH HOH A . 
F 4 HOH 162 762 400 HOH HOH A . 
F 4 HOH 163 763 401 HOH HOH A . 
F 4 HOH 164 764 405 HOH HOH A . 
F 4 HOH 165 765 406 HOH HOH A . 
F 4 HOH 166 766 410 HOH HOH A . 
F 4 HOH 167 767 411 HOH HOH A . 
F 4 HOH 168 768 412 HOH HOH A . 
F 4 HOH 169 769 414 HOH HOH A . 
F 4 HOH 170 770 416 HOH HOH A . 
F 4 HOH 171 771 419 HOH HOH A . 
F 4 HOH 172 772 421 HOH HOH A . 
F 4 HOH 173 773 423 HOH HOH A . 
F 4 HOH 174 774 427 HOH HOH A . 
F 4 HOH 175 775 428 HOH HOH A . 
F 4 HOH 176 776 431 HOH HOH A . 
F 4 HOH 177 777 433 HOH HOH A . 
F 4 HOH 178 778 437 HOH HOH A . 
F 4 HOH 179 779 438 HOH HOH A . 
F 4 HOH 180 780 440 HOH HOH A . 
F 4 HOH 181 781 441 HOH HOH A . 
F 4 HOH 182 782 447 HOH HOH A . 
F 4 HOH 183 783 449 HOH HOH A . 
F 4 HOH 184 784 451 HOH HOH A . 
F 4 HOH 185 785 453 HOH HOH A . 
F 4 HOH 186 786 455 HOH HOH A . 
F 4 HOH 187 787 456 HOH HOH A . 
F 4 HOH 188 788 457 HOH HOH A . 
F 4 HOH 189 789 460 HOH HOH A . 
F 4 HOH 190 790 465 HOH HOH A . 
F 4 HOH 191 791 466 HOH HOH A . 
F 4 HOH 192 792 467 HOH HOH A . 
F 4 HOH 193 793 468 HOH HOH A . 
F 4 HOH 194 794 473 HOH HOH A . 
F 4 HOH 195 795 474 HOH HOH A . 
F 4 HOH 196 796 475 HOH HOH A . 
F 4 HOH 197 797 480 HOH HOH A . 
F 4 HOH 198 798 482 HOH HOH A . 
F 4 HOH 199 799 485 HOH HOH A . 
F 4 HOH 200 800 486 HOH HOH A . 
F 4 HOH 201 801 498 HOH HOH A . 
F 4 HOH 202 802 500 HOH HOH A . 
F 4 HOH 203 803 502 HOH HOH A . 
F 4 HOH 204 804 503 HOH HOH A . 
F 4 HOH 205 805 505 HOH HOH A . 
F 4 HOH 206 806 506 HOH HOH A . 
F 4 HOH 207 807 507 HOH HOH A . 
F 4 HOH 208 808 508 HOH HOH A . 
F 4 HOH 209 809 509 HOH HOH A . 
F 4 HOH 210 810 510 HOH HOH A . 
F 4 HOH 211 811 511 HOH HOH A . 
F 4 HOH 212 812 513 HOH HOH A . 
G 4 HOH 1   702 3   HOH HOH B . 
G 4 HOH 2   703 6   HOH HOH B . 
G 4 HOH 3   704 7   HOH HOH B . 
G 4 HOH 4   705 14  HOH HOH B . 
G 4 HOH 5   706 18  HOH HOH B . 
G 4 HOH 6   707 19  HOH HOH B . 
G 4 HOH 7   708 23  HOH HOH B . 
G 4 HOH 8   709 25  HOH HOH B . 
G 4 HOH 9   710 28  HOH HOH B . 
G 4 HOH 10  711 30  HOH HOH B . 
G 4 HOH 11  712 32  HOH HOH B . 
G 4 HOH 12  713 34  HOH HOH B . 
G 4 HOH 13  714 37  HOH HOH B . 
G 4 HOH 14  715 39  HOH HOH B . 
G 4 HOH 15  716 45  HOH HOH B . 
G 4 HOH 16  717 47  HOH HOH B . 
G 4 HOH 17  718 50  HOH HOH B . 
G 4 HOH 18  719 56  HOH HOH B . 
G 4 HOH 19  720 57  HOH HOH B . 
G 4 HOH 20  721 58  HOH HOH B . 
G 4 HOH 21  722 59  HOH HOH B . 
G 4 HOH 22  723 61  HOH HOH B . 
G 4 HOH 23  724 65  HOH HOH B . 
G 4 HOH 24  725 66  HOH HOH B . 
G 4 HOH 25  726 67  HOH HOH B . 
G 4 HOH 26  727 74  HOH HOH B . 
G 4 HOH 27  728 76  HOH HOH B . 
G 4 HOH 28  729 77  HOH HOH B . 
G 4 HOH 29  730 78  HOH HOH B . 
G 4 HOH 30  731 79  HOH HOH B . 
G 4 HOH 31  732 82  HOH HOH B . 
G 4 HOH 32  733 83  HOH HOH B . 
G 4 HOH 33  734 87  HOH HOH B . 
G 4 HOH 34  735 89  HOH HOH B . 
G 4 HOH 35  736 91  HOH HOH B . 
G 4 HOH 36  737 92  HOH HOH B . 
G 4 HOH 37  738 93  HOH HOH B . 
G 4 HOH 38  739 95  HOH HOH B . 
G 4 HOH 39  740 101 HOH HOH B . 
G 4 HOH 40  741 102 HOH HOH B . 
G 4 HOH 41  742 103 HOH HOH B . 
G 4 HOH 42  743 104 HOH HOH B . 
G 4 HOH 43  744 107 HOH HOH B . 
G 4 HOH 44  745 110 HOH HOH B . 
G 4 HOH 45  746 112 HOH HOH B . 
G 4 HOH 46  747 113 HOH HOH B . 
G 4 HOH 47  748 116 HOH HOH B . 
G 4 HOH 48  749 117 HOH HOH B . 
G 4 HOH 49  750 119 HOH HOH B . 
G 4 HOH 50  751 122 HOH HOH B . 
G 4 HOH 51  752 123 HOH HOH B . 
G 4 HOH 52  753 126 HOH HOH B . 
G 4 HOH 53  754 127 HOH HOH B . 
G 4 HOH 54  755 128 HOH HOH B . 
G 4 HOH 55  756 129 HOH HOH B . 
G 4 HOH 56  757 130 HOH HOH B . 
G 4 HOH 57  758 131 HOH HOH B . 
G 4 HOH 58  759 132 HOH HOH B . 
G 4 HOH 59  760 134 HOH HOH B . 
G 4 HOH 60  761 135 HOH HOH B . 
G 4 HOH 61  762 139 HOH HOH B . 
G 4 HOH 62  763 140 HOH HOH B . 
G 4 HOH 63  764 141 HOH HOH B . 
G 4 HOH 64  765 143 HOH HOH B . 
G 4 HOH 65  766 147 HOH HOH B . 
G 4 HOH 66  767 148 HOH HOH B . 
G 4 HOH 67  768 151 HOH HOH B . 
G 4 HOH 68  769 154 HOH HOH B . 
G 4 HOH 69  770 158 HOH HOH B . 
G 4 HOH 70  771 163 HOH HOH B . 
G 4 HOH 71  772 168 HOH HOH B . 
G 4 HOH 72  773 172 HOH HOH B . 
G 4 HOH 73  774 176 HOH HOH B . 
G 4 HOH 74  775 177 HOH HOH B . 
G 4 HOH 75  776 179 HOH HOH B . 
G 4 HOH 76  777 185 HOH HOH B . 
G 4 HOH 77  778 186 HOH HOH B . 
G 4 HOH 78  779 189 HOH HOH B . 
G 4 HOH 79  780 190 HOH HOH B . 
G 4 HOH 80  781 193 HOH HOH B . 
G 4 HOH 81  782 195 HOH HOH B . 
G 4 HOH 82  783 202 HOH HOH B . 
G 4 HOH 83  784 208 HOH HOH B . 
G 4 HOH 84  785 213 HOH HOH B . 
G 4 HOH 85  786 215 HOH HOH B . 
G 4 HOH 86  787 216 HOH HOH B . 
G 4 HOH 87  788 218 HOH HOH B . 
G 4 HOH 88  789 221 HOH HOH B . 
G 4 HOH 89  790 225 HOH HOH B . 
G 4 HOH 90  791 226 HOH HOH B . 
G 4 HOH 91  792 229 HOH HOH B . 
G 4 HOH 92  793 234 HOH HOH B . 
G 4 HOH 93  794 235 HOH HOH B . 
G 4 HOH 94  795 237 HOH HOH B . 
G 4 HOH 95  796 238 HOH HOH B . 
G 4 HOH 96  797 240 HOH HOH B . 
G 4 HOH 97  798 241 HOH HOH B . 
G 4 HOH 98  799 243 HOH HOH B . 
G 4 HOH 99  800 245 HOH HOH B . 
G 4 HOH 100 801 246 HOH HOH B . 
G 4 HOH 101 802 247 HOH HOH B . 
G 4 HOH 102 803 248 HOH HOH B . 
G 4 HOH 103 804 254 HOH HOH B . 
G 4 HOH 104 805 256 HOH HOH B . 
G 4 HOH 105 806 258 HOH HOH B . 
G 4 HOH 106 807 262 HOH HOH B . 
G 4 HOH 107 808 265 HOH HOH B . 
G 4 HOH 108 809 266 HOH HOH B . 
G 4 HOH 109 810 267 HOH HOH B . 
G 4 HOH 110 811 269 HOH HOH B . 
G 4 HOH 111 812 270 HOH HOH B . 
G 4 HOH 112 813 272 HOH HOH B . 
G 4 HOH 113 814 273 HOH HOH B . 
G 4 HOH 114 815 276 HOH HOH B . 
G 4 HOH 115 816 278 HOH HOH B . 
G 4 HOH 116 817 279 HOH HOH B . 
G 4 HOH 117 818 280 HOH HOH B . 
G 4 HOH 118 819 281 HOH HOH B . 
G 4 HOH 119 820 282 HOH HOH B . 
G 4 HOH 120 821 284 HOH HOH B . 
G 4 HOH 121 822 286 HOH HOH B . 
G 4 HOH 122 823 290 HOH HOH B . 
G 4 HOH 123 824 293 HOH HOH B . 
G 4 HOH 124 825 296 HOH HOH B . 
G 4 HOH 125 826 297 HOH HOH B . 
G 4 HOH 126 827 298 HOH HOH B . 
G 4 HOH 127 828 299 HOH HOH B . 
G 4 HOH 128 829 301 HOH HOH B . 
G 4 HOH 129 830 305 HOH HOH B . 
G 4 HOH 130 831 306 HOH HOH B . 
G 4 HOH 131 832 307 HOH HOH B . 
G 4 HOH 132 833 308 HOH HOH B . 
G 4 HOH 133 834 312 HOH HOH B . 
G 4 HOH 134 835 313 HOH HOH B . 
G 4 HOH 135 836 315 HOH HOH B . 
G 4 HOH 136 837 317 HOH HOH B . 
G 4 HOH 137 838 318 HOH HOH B . 
G 4 HOH 138 839 320 HOH HOH B . 
G 4 HOH 139 840 321 HOH HOH B . 
G 4 HOH 140 841 322 HOH HOH B . 
G 4 HOH 141 842 323 HOH HOH B . 
G 4 HOH 142 843 324 HOH HOH B . 
G 4 HOH 143 844 325 HOH HOH B . 
G 4 HOH 144 845 329 HOH HOH B . 
G 4 HOH 145 846 331 HOH HOH B . 
G 4 HOH 146 847 333 HOH HOH B . 
G 4 HOH 147 848 334 HOH HOH B . 
G 4 HOH 148 849 336 HOH HOH B . 
G 4 HOH 149 850 337 HOH HOH B . 
G 4 HOH 150 851 339 HOH HOH B . 
G 4 HOH 151 852 340 HOH HOH B . 
G 4 HOH 152 853 341 HOH HOH B . 
G 4 HOH 153 854 347 HOH HOH B . 
G 4 HOH 154 855 356 HOH HOH B . 
G 4 HOH 155 856 359 HOH HOH B . 
G 4 HOH 156 857 360 HOH HOH B . 
G 4 HOH 157 858 362 HOH HOH B . 
G 4 HOH 158 859 363 HOH HOH B . 
G 4 HOH 159 860 364 HOH HOH B . 
G 4 HOH 160 861 371 HOH HOH B . 
G 4 HOH 161 862 372 HOH HOH B . 
G 4 HOH 162 863 378 HOH HOH B . 
G 4 HOH 163 864 379 HOH HOH B . 
G 4 HOH 164 865 381 HOH HOH B . 
G 4 HOH 165 866 382 HOH HOH B . 
G 4 HOH 166 867 385 HOH HOH B . 
G 4 HOH 167 868 386 HOH HOH B . 
G 4 HOH 168 869 387 HOH HOH B . 
G 4 HOH 169 870 391 HOH HOH B . 
G 4 HOH 170 871 392 HOH HOH B . 
G 4 HOH 171 872 395 HOH HOH B . 
G 4 HOH 172 873 399 HOH HOH B . 
G 4 HOH 173 874 402 HOH HOH B . 
G 4 HOH 174 875 403 HOH HOH B . 
G 4 HOH 175 876 407 HOH HOH B . 
G 4 HOH 176 877 408 HOH HOH B . 
G 4 HOH 177 878 409 HOH HOH B . 
G 4 HOH 178 879 413 HOH HOH B . 
G 4 HOH 179 880 415 HOH HOH B . 
G 4 HOH 180 881 417 HOH HOH B . 
G 4 HOH 181 882 418 HOH HOH B . 
G 4 HOH 182 883 420 HOH HOH B . 
G 4 HOH 183 884 422 HOH HOH B . 
G 4 HOH 184 885 424 HOH HOH B . 
G 4 HOH 185 886 425 HOH HOH B . 
G 4 HOH 186 887 426 HOH HOH B . 
G 4 HOH 187 888 429 HOH HOH B . 
G 4 HOH 188 889 430 HOH HOH B . 
G 4 HOH 189 890 434 HOH HOH B . 
G 4 HOH 190 891 439 HOH HOH B . 
G 4 HOH 191 892 442 HOH HOH B . 
G 4 HOH 192 893 443 HOH HOH B . 
G 4 HOH 193 894 445 HOH HOH B . 
G 4 HOH 194 895 446 HOH HOH B . 
G 4 HOH 195 896 452 HOH HOH B . 
G 4 HOH 196 897 459 HOH HOH B . 
G 4 HOH 197 898 461 HOH HOH B . 
G 4 HOH 198 899 462 HOH HOH B . 
G 4 HOH 199 900 463 HOH HOH B . 
G 4 HOH 200 901 464 HOH HOH B . 
G 4 HOH 201 902 469 HOH HOH B . 
G 4 HOH 202 903 470 HOH HOH B . 
G 4 HOH 203 904 472 HOH HOH B . 
G 4 HOH 204 905 476 HOH HOH B . 
G 4 HOH 205 906 477 HOH HOH B . 
G 4 HOH 206 907 478 HOH HOH B . 
G 4 HOH 207 908 483 HOH HOH B . 
G 4 HOH 208 909 484 HOH HOH B . 
G 4 HOH 209 910 487 HOH HOH B . 
G 4 HOH 210 911 488 HOH HOH B . 
G 4 HOH 211 912 490 HOH HOH B . 
G 4 HOH 212 913 492 HOH HOH B . 
G 4 HOH 213 914 493 HOH HOH B . 
G 4 HOH 214 915 496 HOH HOH B . 
G 4 HOH 215 916 499 HOH HOH B . 
G 4 HOH 216 917 501 HOH HOH B . 
G 4 HOH 217 918 514 HOH HOH B . 
G 4 HOH 218 919 515 HOH HOH B . 
G 4 HOH 219 920 516 HOH HOH B . 
G 4 HOH 220 921 517 HOH HOH B . 
G 4 HOH 221 922 518 HOH HOH B . 
G 4 HOH 222 923 519 HOH HOH B . 
G 4 HOH 223 924 520 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 419 ? A CYS 441 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NA ? C HEM . ? A HEM 600 ? 1_555 97.9  ? 
2  SG ? A CYS 419 ? A CYS 441 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NB ? C HEM . ? A HEM 600 ? 1_555 87.0  ? 
3  NA ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NB ? C HEM . ? A HEM 600 ? 1_555 89.6  ? 
4  SG ? A CYS 419 ? A CYS 441 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NC ? C HEM . ? A HEM 600 ? 1_555 88.4  ? 
5  NA ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NC ? C HEM . ? A HEM 600 ? 1_555 173.7 ? 
6  NB ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 NC ? C HEM . ? A HEM 600 ? 1_555 90.2  ? 
7  SG ? A CYS 419 ? A CYS 441 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 ND ? C HEM . ? A HEM 600 ? 1_555 95.9  ? 
8  NA ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 ND ? C HEM . ? A HEM 600 ? 1_555 92.0  ? 
9  NB ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 ND ? C HEM . ? A HEM 600 ? 1_555 176.5 ? 
10 NC ? C HEM .   ? A HEM 600 ? 1_555 FE ? C HEM . ? A HEM 600 ? 1_555 ND ? C HEM . ? A HEM 600 ? 1_555 87.9  ? 
11 SG ? B CYS 419 ? B CYS 441 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NA ? E HEM . ? B HEM 600 ? 1_555 98.3  ? 
12 SG ? B CYS 419 ? B CYS 441 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NB ? E HEM . ? B HEM 600 ? 1_555 90.2  ? 
13 NA ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NB ? E HEM . ? B HEM 600 ? 1_555 91.7  ? 
14 SG ? B CYS 419 ? B CYS 441 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NC ? E HEM . ? B HEM 600 ? 1_555 86.9  ? 
15 NA ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NC ? E HEM . ? B HEM 600 ? 1_555 174.6 ? 
16 NB ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 NC ? E HEM . ? B HEM 600 ? 1_555 86.6  ? 
17 SG ? B CYS 419 ? B CYS 441 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 ND ? E HEM . ? B HEM 600 ? 1_555 95.2  ? 
18 NA ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 ND ? E HEM . ? B HEM 600 ? 1_555 90.1  ? 
19 NB ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 ND ? E HEM . ? B HEM 600 ? 1_555 174.1 ? 
20 NC ? E HEM .   ? B HEM 600 ? 1_555 FE ? E HEM . ? B HEM 600 ? 1_555 ND ? E HEM . ? B HEM 600 ? 1_555 91.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-10-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
SOLVE    phasing           .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 39  ? ? 66.67   -50.45  
2  1 ASP A 49  ? ? -156.20 84.49   
3  1 HIS A 130 ? ? 57.28   -124.13 
4  1 ARG A 188 ? ? 71.05   97.35   
5  1 ASN A 439 ? ? -109.61 62.66   
6  1 PRO B 38  ? ? -39.70  133.65  
7  1 TRP B 39  ? ? 67.41   -52.19  
8  1 ASP B 49  ? ? -164.58 85.08   
9  1 HIS B 130 ? ? 56.37   -126.26 
10 1 PRO B 187 ? ? -41.05  -75.41  
11 1 ARG B 188 ? ? 85.85   94.38   
12 1 GLN B 332 ? ? -33.05  -38.07  
13 1 SER B 337 ? ? -142.44 46.15   
14 1 ASP B 477 ? ? -69.14  99.55   
15 1 HIS B 501 ? ? -43.43  82.71   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LEU A 186 ? ? PRO A 187 ? ? 130.64 
2 1 LEU B 186 ? ? PRO B 187 ? ? 132.64 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 320 ? A ALA 298 
2  1 Y 1 A GLU 321 ? A GLU 299 
3  1 Y 1 A GLN 322 ? A GLN 300 
4  1 Y 1 A PRO 323 ? A PRO 301 
5  1 Y 1 A VAL 324 ? A VAL 302 
6  1 Y 1 A SER 325 ? A SER 303 
7  1 Y 1 A GLN 326 ? A GLN 304 
8  1 Y 1 A THR 327 ? A THR 305 
9  1 Y 1 A HIS 502 ? A HIS 480 
10 1 Y 1 A HIS 503 ? A HIS 481 
11 1 Y 1 A HIS 504 ? A HIS 482 
12 1 Y 1 B GLN 319 ? B GLN 297 
13 1 Y 1 B ALA 320 ? B ALA 298 
14 1 Y 1 B GLU 321 ? B GLU 299 
15 1 Y 1 B GLN 322 ? B GLN 300 
16 1 Y 1 B PRO 323 ? B PRO 301 
17 1 Y 1 B VAL 324 ? B VAL 302 
18 1 Y 1 B SER 325 ? B SER 303 
19 1 Y 1 B GLN 326 ? B GLN 304 
20 1 Y 1 B THR 327 ? B THR 305 
21 1 Y 1 B THR 328 ? B THR 306 
22 1 Y 1 B THR 329 ? B THR 307 
23 1 Y 1 B LEU 330 ? B LEU 308 
24 1 Y 1 B HIS 503 ? B HIS 481 
25 1 Y 1 B HIS 504 ? B HIS 482 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
3 'SODIUM ION'                      NA  
4 water                             HOH 
#