data_2IBT
# 
_entry.id   2IBT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IBT         
NDB   PD0868       
RCSB  RCSB039388   
WWPDB D_1000039388 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G38 'adenine-specific DNA methyltransferase M.TaqI/DNA/AETA COMPLEX'     unspecified 
PDB 2ADM 'adenine-specific DNA methyltransferase M.TaqI/SAM complex'          unspecified 
PDB 1AQI 'adenine-specific DNA methyltransferase M.TaqI/SAH complex'          unspecified 
PDB 1AQJ 'adenine-specific DNA methyltransferase M.TaqI/sinefungin complex'   unspecified 
PDB 2IBS 'adenine-specific dna methyltransferase M.TAQI/2PR-DNA/AETA complex' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IBT 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lenz, T.'       1 ? 
'Scheidig, A.J.' 2 ? 
'Weinhold, E.'   3 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;2-Aminopurine Flipped into the Active Site of the Adenine-Specific DNA Methyltransferase M.TaqI: Crystal Structures and Time-Resolved Fluorescence
;
J.Am.Chem.Soc.   129 6240 6248 2007 JACSAT US 0002-7863 0004 ? 17455934 10.1021/ja069366n      
1       'Structure of the N6-adenine DNA methyltransferase M.TaqI in complex with DNA and a cofactor analog' Nat.Struct.Biol. 8   
121  125  2001 NSBIEW US 1072-8368 2024 ? 11175890 10.1038/84104          
2       
;Differential binding of S-adenosylmethionine S-adenosylhomocysteine and Sinefungin to the adenine-specific DNA methyltransferase M.TaqI
;
J.Mol.Biol.      265 56   67   1997 JMOBAK UK 0022-2836 0070 ? 8995524  10.1006/jmbi.1996.0711 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lenz, T.'         1  
primary 'Bonnist, E.Y.M.'  2  
primary 'Pljevaljcic, G.'  3  
primary 'Neely, R.K.'      4  
primary 'Dryden, D.T.F.'   5  
primary 'Scheidig, A.J.'   6  
primary 'Jones, A.C.'      7  
primary 'Weinhold, E.'     8  
1       'Goedecke, K.'     9  
1       'Pignot, M.'       10 
1       'Goody, R.S.'      11 
1       'Scheidig, A.J.'   12 
1       'Weinhold, E.'     13 
2       'Schluckebier, G.' 14 
2       'Kozak, M.'        15 
2       'Bleimling, N.'    16 
2       'Weinhold, E.'     17 
2       'Saenger, W.'      18 
# 
_cell.entry_id           2IBT 
_cell.length_a           59.339 
_cell.length_b           68.699 
_cell.length_c           114.022 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.09 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IBT 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*TP*TP*CP*GP*(2PR)P*TP*GP*TP*C)-3'"     3051.001  2    ?        ? ? ? 
2 polymer     syn "5'-D(*GP*AP*CP*AP*(3DR)P*CP*GP*(6MA)P*AP*C)-3'" 2927.949  2    ?        ? ? ? 
3 polymer     man 'Modification methylase TaqI'                    47931.195 2    2.1.1.72 ? ? ? 
4 non-polymer syn "5'-DEOXY-5'-[2-(AMINO)ETHYLTHIO]ADENOSINE"      326.375   2    ?        ? ? ? 
5 non-polymer syn GLYCEROL                                         92.094    7    ?        ? ? ? 
6 water       nat water                                            18.015    1041 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Adenine-specific methyltransferase TaqI, M.TaqI' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DT)(DT)(DC)(DG)(2PR)(DT)(DG)(DT)(DC)' GTTCGGTGTC B,E ? 
2 polydeoxyribonucleotide no yes '(DG)(DA)(DC)(DA)(3DR)(DC)(DG)(6MA)(DA)(DC)' GACANCGAAC C,F ? 
3 'polypeptide(L)'        no no  
;MGLPPLLSLPSNSAPRSLGRVETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGVEIDPKALDLP
PWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIHVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVL
VFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEG
EIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSSLVQWLNSEAMQKHVRTLYRDFVPHLTLRML
ERLPVRREYGFHTSPESARNF
;
;MGLPPLLSLPSNSAPRSLGRVETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGVEIDPKALDLP
PWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIHVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVL
VFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEG
EIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSSLVQWLNSEAMQKHVRTLYRDFVPHLTLRML
ERLPVRREYGFHTSPESARNF
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DT  n 
1 3   DT  n 
1 4   DC  n 
1 5   DG  n 
1 6   2PR n 
1 7   DT  n 
1 8   DG  n 
1 9   DT  n 
1 10  DC  n 
2 1   DG  n 
2 2   DA  n 
2 3   DC  n 
2 4   DA  n 
2 5   3DR n 
2 6   DC  n 
2 7   DG  n 
2 8   6MA n 
2 9   DA  n 
2 10  DC  n 
3 1   MET n 
3 2   GLY n 
3 3   LEU n 
3 4   PRO n 
3 5   PRO n 
3 6   LEU n 
3 7   LEU n 
3 8   SER n 
3 9   LEU n 
3 10  PRO n 
3 11  SER n 
3 12  ASN n 
3 13  SER n 
3 14  ALA n 
3 15  PRO n 
3 16  ARG n 
3 17  SER n 
3 18  LEU n 
3 19  GLY n 
3 20  ARG n 
3 21  VAL n 
3 22  GLU n 
3 23  THR n 
3 24  PRO n 
3 25  PRO n 
3 26  GLU n 
3 27  VAL n 
3 28  VAL n 
3 29  ASP n 
3 30  PHE n 
3 31  MET n 
3 32  VAL n 
3 33  SER n 
3 34  LEU n 
3 35  ALA n 
3 36  GLU n 
3 37  ALA n 
3 38  PRO n 
3 39  ARG n 
3 40  GLY n 
3 41  GLY n 
3 42  ARG n 
3 43  VAL n 
3 44  LEU n 
3 45  GLU n 
3 46  PRO n 
3 47  ALA n 
3 48  CYS n 
3 49  ALA n 
3 50  HIS n 
3 51  GLY n 
3 52  PRO n 
3 53  PHE n 
3 54  LEU n 
3 55  ARG n 
3 56  ALA n 
3 57  PHE n 
3 58  ARG n 
3 59  GLU n 
3 60  ALA n 
3 61  HIS n 
3 62  GLY n 
3 63  THR n 
3 64  ALA n 
3 65  TYR n 
3 66  ARG n 
3 67  PHE n 
3 68  VAL n 
3 69  GLY n 
3 70  VAL n 
3 71  GLU n 
3 72  ILE n 
3 73  ASP n 
3 74  PRO n 
3 75  LYS n 
3 76  ALA n 
3 77  LEU n 
3 78  ASP n 
3 79  LEU n 
3 80  PRO n 
3 81  PRO n 
3 82  TRP n 
3 83  ALA n 
3 84  GLU n 
3 85  GLY n 
3 86  ILE n 
3 87  LEU n 
3 88  ALA n 
3 89  ASP n 
3 90  PHE n 
3 91  LEU n 
3 92  LEU n 
3 93  TRP n 
3 94  GLU n 
3 95  PRO n 
3 96  GLY n 
3 97  GLU n 
3 98  ALA n 
3 99  PHE n 
3 100 ASP n 
3 101 LEU n 
3 102 ILE n 
3 103 LEU n 
3 104 GLY n 
3 105 ASN n 
3 106 PRO n 
3 107 PRO n 
3 108 TYR n 
3 109 GLY n 
3 110 ILE n 
3 111 VAL n 
3 112 GLY n 
3 113 GLU n 
3 114 ALA n 
3 115 SER n 
3 116 LYS n 
3 117 TYR n 
3 118 PRO n 
3 119 ILE n 
3 120 HIS n 
3 121 VAL n 
3 122 PHE n 
3 123 LYS n 
3 124 ALA n 
3 125 VAL n 
3 126 LYS n 
3 127 ASP n 
3 128 LEU n 
3 129 TYR n 
3 130 LYS n 
3 131 LYS n 
3 132 ALA n 
3 133 PHE n 
3 134 SER n 
3 135 THR n 
3 136 TRP n 
3 137 LYS n 
3 138 GLY n 
3 139 LYS n 
3 140 TYR n 
3 141 ASN n 
3 142 LEU n 
3 143 TYR n 
3 144 GLY n 
3 145 ALA n 
3 146 PHE n 
3 147 LEU n 
3 148 GLU n 
3 149 LYS n 
3 150 ALA n 
3 151 VAL n 
3 152 ARG n 
3 153 LEU n 
3 154 LEU n 
3 155 LYS n 
3 156 PRO n 
3 157 GLY n 
3 158 GLY n 
3 159 VAL n 
3 160 LEU n 
3 161 VAL n 
3 162 PHE n 
3 163 VAL n 
3 164 VAL n 
3 165 PRO n 
3 166 ALA n 
3 167 THR n 
3 168 TRP n 
3 169 LEU n 
3 170 VAL n 
3 171 LEU n 
3 172 GLU n 
3 173 ASP n 
3 174 PHE n 
3 175 ALA n 
3 176 LEU n 
3 177 LEU n 
3 178 ARG n 
3 179 GLU n 
3 180 PHE n 
3 181 LEU n 
3 182 ALA n 
3 183 ARG n 
3 184 GLU n 
3 185 GLY n 
3 186 LYS n 
3 187 THR n 
3 188 SER n 
3 189 VAL n 
3 190 TYR n 
3 191 TYR n 
3 192 LEU n 
3 193 GLY n 
3 194 GLU n 
3 195 VAL n 
3 196 PHE n 
3 197 PRO n 
3 198 GLN n 
3 199 LYS n 
3 200 LYS n 
3 201 VAL n 
3 202 SER n 
3 203 ALA n 
3 204 VAL n 
3 205 VAL n 
3 206 ILE n 
3 207 ARG n 
3 208 PHE n 
3 209 GLN n 
3 210 LYS n 
3 211 SER n 
3 212 GLY n 
3 213 LYS n 
3 214 GLY n 
3 215 LEU n 
3 216 SER n 
3 217 LEU n 
3 218 TRP n 
3 219 ASP n 
3 220 THR n 
3 221 GLN n 
3 222 GLU n 
3 223 SER n 
3 224 GLU n 
3 225 SER n 
3 226 GLY n 
3 227 PHE n 
3 228 THR n 
3 229 PRO n 
3 230 ILE n 
3 231 LEU n 
3 232 TRP n 
3 233 ALA n 
3 234 GLU n 
3 235 TYR n 
3 236 PRO n 
3 237 HIS n 
3 238 TRP n 
3 239 GLU n 
3 240 GLY n 
3 241 GLU n 
3 242 ILE n 
3 243 ILE n 
3 244 ARG n 
3 245 PHE n 
3 246 GLU n 
3 247 THR n 
3 248 GLU n 
3 249 GLU n 
3 250 THR n 
3 251 ARG n 
3 252 LYS n 
3 253 LEU n 
3 254 GLU n 
3 255 ILE n 
3 256 SER n 
3 257 GLY n 
3 258 MET n 
3 259 PRO n 
3 260 LEU n 
3 261 GLY n 
3 262 ASP n 
3 263 LEU n 
3 264 PHE n 
3 265 HIS n 
3 266 ILE n 
3 267 ARG n 
3 268 PHE n 
3 269 ALA n 
3 270 ALA n 
3 271 ARG n 
3 272 SER n 
3 273 PRO n 
3 274 GLU n 
3 275 PHE n 
3 276 LYS n 
3 277 LYS n 
3 278 HIS n 
3 279 PRO n 
3 280 ALA n 
3 281 VAL n 
3 282 ARG n 
3 283 LYS n 
3 284 GLU n 
3 285 PRO n 
3 286 GLY n 
3 287 PRO n 
3 288 GLY n 
3 289 LEU n 
3 290 VAL n 
3 291 PRO n 
3 292 VAL n 
3 293 LEU n 
3 294 THR n 
3 295 GLY n 
3 296 ARG n 
3 297 ASN n 
3 298 LEU n 
3 299 LYS n 
3 300 PRO n 
3 301 GLY n 
3 302 TRP n 
3 303 VAL n 
3 304 ASP n 
3 305 TYR n 
3 306 GLU n 
3 307 LYS n 
3 308 ASN n 
3 309 HIS n 
3 310 SER n 
3 311 GLY n 
3 312 LEU n 
3 313 TRP n 
3 314 MET n 
3 315 PRO n 
3 316 LYS n 
3 317 GLU n 
3 318 ARG n 
3 319 ALA n 
3 320 LYS n 
3 321 GLU n 
3 322 LEU n 
3 323 ARG n 
3 324 ASP n 
3 325 PHE n 
3 326 TYR n 
3 327 ALA n 
3 328 THR n 
3 329 PRO n 
3 330 HIS n 
3 331 LEU n 
3 332 VAL n 
3 333 VAL n 
3 334 ALA n 
3 335 HIS n 
3 336 THR n 
3 337 LYS n 
3 338 GLY n 
3 339 THR n 
3 340 ARG n 
3 341 VAL n 
3 342 VAL n 
3 343 ALA n 
3 344 ALA n 
3 345 TRP n 
3 346 ASP n 
3 347 GLU n 
3 348 ARG n 
3 349 ALA n 
3 350 TYR n 
3 351 PRO n 
3 352 TRP n 
3 353 ARG n 
3 354 GLU n 
3 355 GLU n 
3 356 PHE n 
3 357 HIS n 
3 358 LEU n 
3 359 LEU n 
3 360 PRO n 
3 361 LYS n 
3 362 GLU n 
3 363 GLY n 
3 364 VAL n 
3 365 ARG n 
3 366 LEU n 
3 367 ASP n 
3 368 PRO n 
3 369 SER n 
3 370 SER n 
3 371 LEU n 
3 372 VAL n 
3 373 GLN n 
3 374 TRP n 
3 375 LEU n 
3 376 ASN n 
3 377 SER n 
3 378 GLU n 
3 379 ALA n 
3 380 MET n 
3 381 GLN n 
3 382 LYS n 
3 383 HIS n 
3 384 VAL n 
3 385 ARG n 
3 386 THR n 
3 387 LEU n 
3 388 TYR n 
3 389 ARG n 
3 390 ASP n 
3 391 PHE n 
3 392 VAL n 
3 393 PRO n 
3 394 HIS n 
3 395 LEU n 
3 396 THR n 
3 397 LEU n 
3 398 ARG n 
3 399 MET n 
3 400 LEU n 
3 401 GLU n 
3 402 ARG n 
3 403 LEU n 
3 404 PRO n 
3 405 VAL n 
3 406 ARG n 
3 407 ARG n 
3 408 GLU n 
3 409 TYR n 
3 410 GLY n 
3 411 PHE n 
3 412 HIS n 
3 413 THR n 
3 414 SER n 
3 415 PRO n 
3 416 GLU n 
3 417 SER n 
3 418 ALA n 
3 419 ARG n 
3 420 ASN n 
3 421 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 taqIM 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    YT1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus aquaticus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     271 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ER2267 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PA1/MTAQ-A49A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'Solid-phase DNA synthesis using commercially available phosphoramidites' 
2 1 sample ? ? ? ? ? 'Solid-phase DNA synthesis using commercially available phosphoramidites' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MTTA_THEAQ P14385 3 
;MGLPPLLSLPSNSAPRSLGRVETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTAYRFVGVEIDPKALDLP
PWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIHVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVL
VFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEG
EIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSSLVQWLNSEAMQKHVRTLYRDFVPHLTLRML
ERLPVRREYGFHTSPESARNF
;
1 ? 
2 PDB 2IBT       2IBT   1 ? ? ? 
3 PDB 2IBT       2IBT   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IBT A 1 ? 421 ? P14385 1  ? 421 ? 1  421 
2 1 2IBT D 1 ? 421 ? P14385 1  ? 421 ? 1  421 
3 2 2IBT B 1 ? 10  ? 2IBT   1  ? 10  ? 1  10  
4 3 2IBT C 1 ? 10  ? 2IBT   11 ? 20  ? 11 20  
5 2 2IBT E 1 ? 10  ? 2IBT   1  ? 10  ? 1  10  
6 3 2IBT F 1 ? 10  ? 2IBT   11 ? 20  ? 11 20  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2PR 'DNA linking'       n "2-AMINO-9-[2-DEOXYRIBOFURANOSYL]-9H-PURINE-5'-MONOPHOSPHATE" 
"2-AMINOPURINE-2'-DEOXYRIBO-5'-MONOPHOSPHATE" 'C10 H14 N5 O6 P' 331.222 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE"                      'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'     
198.111 
6MA 'DNA linking'       n "N6-METHYL-DEOXY-ADENOSINE-5'-MONOPHOSPHATE"                  ? 'C11 H16 N5 O6 P' 345.248 
ALA 'L-peptide linking' y ALANINE                                                       ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                      ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                    ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                               ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                      ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                          ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                           ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                          ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                  ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                     ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                               ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                       ? 'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 
92.094  
HIS 'L-peptide linking' y HISTIDINE                                                     ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                         ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                    ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                       ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                        ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                    ? 'C5 H11 N O2 S'   149.211 
NEA non-polymer         . "5'-DEOXY-5'-[2-(AMINO)ETHYLTHIO]ADENOSINE"                   ? 'C12 H18 N6 O3 S' 326.375 
PHE 'L-peptide linking' y PHENYLALANINE                                                 ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                       ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                        ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                     ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                    ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                      ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                        ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2IBT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.3 
_exptl_crystal_grow.pdbx_details    
;3 microliters crystallization buffer (10mM Tris/HCl, 300mM NaCl, pH 7.3) containing the complex plus 1 microliter reservoir solution (100mM KCl, 100mM MgCl2, 6% isopropanol, 50mM sodium cacodylate, pH 6.0), VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 Tris/HCl            ? ? ? 
1 2  1 NaCl                ? ? ? 
1 3  1 KCl                 ? ? ? 
1 4  1 MgCl2               ? ? ? 
1 5  1 isopropanol         ? ? ? 
1 6  1 'sodium cacodylate' ? ? ? 
1 7  1 H2O                 ? ? ? 
1 8  2 Tris/HCl            ? ? ? 
1 9  2 NaCl                ? ? ? 
1 10 2 KCl                 ? ? ? 
1 11 2 MgCl2               ? ? ? 
1 12 2 'sodium cacodylate' ? ? ? 
1 13 2 H2O                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-05-13 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9310 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9310 
# 
_reflns.entry_id                     2IBT 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             19.92 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   98855 
_reflns.number_all                   100843 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        11.51 
_reflns.B_iso_Wilson_estimate        23.22 
_reflns.pdbx_redundancy              3.80 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.8 
_reflns_shell.percent_possible_all   97.3 
_reflns_shell.Rmerge_I_obs           0.38 
_reflns_shell.pdbx_Rsym_value        0.38 
_reflns_shell.meanI_over_sigI_obs    3.65 
_reflns_shell.pdbx_redundancy        3.76 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      15379 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IBT 
_refine.ls_number_reflns_obs                     98855 
_refine.ls_number_reflns_all                     100769 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.92 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_R_factor_obs                          0.1687 
_refine.ls_R_factor_all                          0.1687 
_refine.ls_R_factor_R_work                       0.16687 
_refine.ls_R_factor_R_free                       0.20322 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4943 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.944 
_refine.B_iso_mean                               17.313 
_refine.aniso_B[1][1]                            -0.07 
_refine.aniso_B[2][2]                            0.50 
_refine.aniso_B[3][3]                            -0.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.07 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1G38' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.107 
_refine.pdbx_overall_ESU_R_Free                  0.104 
_refine.overall_SU_ML                            0.066 
_refine.overall_SU_B                             1.948 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6378 
_refine_hist.pdbx_number_atoms_nucleic_acid   792 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             1041 
_refine_hist.number_atoms_total               8297 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        19.92 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 7557  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.459  2.108  ? 10415 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.111  5.000  ? 784   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.992 22.215 ? 298   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.423 15.000 ? 1078  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.452 15.000 ? 54    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 1098  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 5498  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.195  0.200  ? 3602  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.310  0.200  ? 4939  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.142  0.200  ? 845   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.162  0.200  ? 92    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.162  0.200  ? 65    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.822  1.500  ? 4037  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.294  2.000  ? 6352  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.946  3.000  ? 4324  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.959  4.500  ? 4063  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             6800 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               97.18 
_refine_ls_shell.R_factor_R_free                  0.314 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             358 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                7158 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IBT 
_struct.title                     
;Crystal structure of the adenine-specific DNA methyltransferase M.TaqI complexed with the cofactor analog AETA and a 10 bp DNA containing 2-aminopurine at the target position and an abasic site analog at the target base partner position
;
_struct.pdbx_descriptor           'Modification methylase TaqI/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IBT 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
'DNA, DNA methyltransferase, 2-aminopurine, abasic site analog, base flipping, nucleotide flipping, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'The asymmetric unit contains two independent biological assemblies, each consisting of M.TaqI, DNA and cofactor analog AETA.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO E 24  ? ALA E 35  ? PRO A 24  ALA A 35  1 ? 12 
HELX_P HELX_P2  2  GLY E 51  ? GLY E 62  ? GLY A 51  GLY A 62  1 ? 12 
HELX_P HELX_P3  3  ASP E 89  ? TRP E 93  ? ASP A 89  TRP A 93  5 ? 5  
HELX_P HELX_P4  4  PHE E 122 ? PHE E 133 ? PHE A 122 PHE A 133 1 ? 12 
HELX_P HELX_P5  5  ASN E 141 ? LEU E 153 ? ASN A 141 LEU A 153 1 ? 13 
HELX_P HELX_P6  6  THR E 167 ? VAL E 170 ? THR A 167 VAL A 170 5 ? 4  
HELX_P HELX_P7  7  LEU E 171 ? ASP E 173 ? LEU A 171 ASP A 173 5 ? 3  
HELX_P HELX_P8  8  PHE E 174 ? GLY E 185 ? PHE A 174 GLY A 185 1 ? 12 
HELX_P HELX_P9  9  THR E 247 ? ILE E 255 ? THR A 247 ILE A 255 1 ? 9  
HELX_P HELX_P10 10 ARG E 271 ? LYS E 277 ? ARG A 271 LYS A 277 1 ? 7  
HELX_P HELX_P11 11 THR E 294 ? ARG E 296 ? THR A 294 ARG A 296 5 ? 3  
HELX_P HELX_P12 12 GLU E 317 ? LEU E 322 ? GLU A 317 LEU A 322 5 ? 6  
HELX_P HELX_P13 13 ARG E 323 ? THR E 328 ? ARG A 323 THR A 328 5 ? 6  
HELX_P HELX_P14 14 ASP E 367 ? ASN E 376 ? ASP A 367 ASN A 376 1 ? 10 
HELX_P HELX_P15 15 SER E 377 ? ARG E 389 ? SER A 377 ARG A 389 1 ? 13 
HELX_P HELX_P16 16 THR E 396 ? GLU E 401 ? THR A 396 GLU A 401 1 ? 6  
HELX_P HELX_P17 17 PRO F 24  ? ALA F 35  ? PRO D 24  ALA D 35  1 ? 12 
HELX_P HELX_P18 18 GLY F 51  ? GLY F 62  ? GLY D 51  GLY D 62  1 ? 12 
HELX_P HELX_P19 19 ASP F 89  ? TRP F 93  ? ASP D 89  TRP D 93  5 ? 5  
HELX_P HELX_P20 20 PHE F 122 ? PHE F 133 ? PHE D 122 PHE D 133 1 ? 12 
HELX_P HELX_P21 21 ASN F 141 ? LEU F 153 ? ASN D 141 LEU D 153 1 ? 13 
HELX_P HELX_P22 22 THR F 167 ? VAL F 170 ? THR D 167 VAL D 170 5 ? 4  
HELX_P HELX_P23 23 LEU F 171 ? ASP F 173 ? LEU D 171 ASP D 173 5 ? 3  
HELX_P HELX_P24 24 PHE F 174 ? GLY F 185 ? PHE D 174 GLY D 185 1 ? 12 
HELX_P HELX_P25 25 THR F 247 ? SER F 256 ? THR D 247 SER D 256 1 ? 10 
HELX_P HELX_P26 26 LEU F 260 ? LEU F 263 ? LEU D 260 LEU D 263 1 ? 4  
HELX_P HELX_P27 27 ARG F 271 ? LYS F 277 ? ARG D 271 LYS D 277 1 ? 7  
HELX_P HELX_P28 28 THR F 294 ? ARG F 296 ? THR D 294 ARG D 296 5 ? 3  
HELX_P HELX_P29 29 PRO F 315 ? LEU F 322 ? PRO D 315 LEU D 322 5 ? 8  
HELX_P HELX_P30 30 ARG F 323 ? THR F 328 ? ARG D 323 THR D 328 5 ? 6  
HELX_P HELX_P31 31 ASP F 367 ? ASN F 376 ? ASP D 367 ASN D 376 1 ? 10 
HELX_P HELX_P32 32 SER F 377 ? ARG F 389 ? SER D 377 ARG D 389 1 ? 13 
HELX_P HELX_P33 33 THR F 396 ? ARG F 402 ? THR D 396 ARG D 402 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A DG  5  "O3'" ? ? ? 1_555 A 2PR 6  P  ? ? B DG  5  B 2PR 6  1_555 ? ? ? ? ? ? ?            1.600 ? 
covale2  covale ? ? A 2PR 6  "O3'" ? ? ? 1_555 A DT  7  P  ? ? B 2PR 6  B DT  7  1_555 ? ? ? ? ? ? ?            1.603 ? 
covale3  covale ? ? B DA  4  "O3'" ? ? ? 1_555 B 3DR 5  P  ? ? C DA  14 C 3DR 15 1_555 ? ? ? ? ? ? ?            1.592 ? 
covale4  covale ? ? B 3DR 5  "O3'" ? ? ? 1_555 B DC  6  P  ? ? C 3DR 15 C DC  16 1_555 ? ? ? ? ? ? ?            1.584 ? 
covale5  covale ? ? B DG  7  "O3'" ? ? ? 1_555 B 6MA 8  P  ? ? C DG  17 C 6MA 18 1_555 ? ? ? ? ? ? ?            1.593 ? 
covale6  covale ? ? B 6MA 8  "O3'" ? ? ? 1_555 B DA  9  P  ? ? C 6MA 18 C DA  19 1_555 ? ? ? ? ? ? ?            1.592 ? 
covale7  covale ? ? C DG  5  "O3'" ? ? ? 1_555 C 2PR 6  P  ? ? E DG  5  E 2PR 6  1_555 ? ? ? ? ? ? ?            1.622 ? 
covale8  covale ? ? C 2PR 6  "O3'" ? ? ? 1_555 C DT  7  P  ? ? E 2PR 6  E DT  7  1_555 ? ? ? ? ? ? ?            1.630 ? 
covale9  covale ? ? D DA  4  "O3'" ? ? ? 1_555 D 3DR 5  P  ? ? F DA  14 F 3DR 15 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale10 covale ? ? D 3DR 5  "O3'" ? ? ? 1_555 D DC  6  P  ? ? F 3DR 15 F DC  16 1_555 ? ? ? ? ? ? ?            1.592 ? 
covale11 covale ? ? D DG  7  "O3'" ? ? ? 1_555 D 6MA 8  P  ? ? F DG  17 F 6MA 18 1_555 ? ? ? ? ? ? ?            1.600 ? 
covale12 covale ? ? D 6MA 8  "O3'" ? ? ? 1_555 D DA  9  P  ? ? F 6MA 18 F DA  19 1_555 ? ? ? ? ? ? ?            1.597 ? 
hydrog1  hydrog ? ? A DG  1  N1    ? ? ? 1_555 B DC  10 N3 ? ? B DG  1  C DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1  N2    ? ? ? 1_555 B DC  10 O2 ? ? B DG  1  C DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1  O6    ? ? ? 1_555 B DC  10 N4 ? ? B DG  1  C DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  9  N1 ? ? B DT  2  C DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT  2  O4    ? ? ? 1_555 B DA  9  N6 ? ? B DT  2  C DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT  3  N3    ? ? ? 1_555 B 6MA 8  N1 ? ? B DT  3  C 6MA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  3  O4    ? ? ? 1_555 B 6MA 8  N6 ? ? B DT  3  C 6MA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  4  N3    ? ? ? 1_555 B DG  7  N1 ? ? B DC  4  C DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  4  N4    ? ? ? 1_555 B DG  7  O6 ? ? B DC  4  C DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  4  O2    ? ? ? 1_555 B DG  7  N2 ? ? B DC  4  C DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5  N1    ? ? ? 1_555 B DC  6  N3 ? ? B DG  5  C DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  5  N2    ? ? ? 1_555 B DC  6  O2 ? ? B DG  5  C DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  5  O6    ? ? ? 1_555 B DC  6  N4 ? ? B DG  5  C DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  7  N3    ? ? ? 1_555 B DA  4  N1 ? ? B DT  7  C DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  7  O4    ? ? ? 1_555 B DA  4  N6 ? ? B DT  7  C DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  3  N3 ? ? B DG  8  C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  3  O2 ? ? B DG  8  C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  3  N4 ? ? B DG  8  C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  2  N1 ? ? B DT  9  C DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  2  N6 ? ? B DT  9  C DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  10 N3    ? ? ? 1_555 B DG  1  N1 ? ? B DC  10 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC  10 N4    ? ? ? 1_555 B DG  1  O6 ? ? B DC  10 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  10 O2    ? ? ? 1_555 B DG  1  N2 ? ? B DC  10 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DG  1  N1    ? ? ? 1_555 D DC  10 N3 ? ? E DG  1  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DG  1  N2    ? ? ? 1_555 D DC  10 O2 ? ? E DG  1  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DG  1  O6    ? ? ? 1_555 D DC  10 N4 ? ? E DG  1  F DC  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  2  N3    ? ? ? 1_555 D DA  9  N1 ? ? E DT  2  F DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  2  O4    ? ? ? 1_555 D DA  9  N6 ? ? E DT  2  F DA  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DT  3  N3    ? ? ? 1_555 D 6MA 8  N1 ? ? E DT  3  F 6MA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT  3  O4    ? ? ? 1_555 D 6MA 8  N6 ? ? E DT  3  F 6MA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  4  N3    ? ? ? 1_555 D DG  7  N1 ? ? E DC  4  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DC  4  N4    ? ? ? 1_555 D DG  7  O6 ? ? E DC  4  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DC  4  O2    ? ? ? 1_555 D DG  7  N2 ? ? E DC  4  F DG  17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  5  N1    ? ? ? 1_555 D DC  6  N3 ? ? E DG  5  F DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DG  5  N2    ? ? ? 1_555 D DC  6  O2 ? ? E DG  5  F DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DG  5  O6    ? ? ? 1_555 D DC  6  N4 ? ? E DG  5  F DC  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DG  8  N1    ? ? ? 1_555 D DC  3  N3 ? ? E DG  8  F DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DG  8  N2    ? ? ? 1_555 D DC  3  O2 ? ? E DG  8  F DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  8  O6    ? ? ? 1_555 D DC  3  N4 ? ? E DG  8  F DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DT  9  N3    ? ? ? 1_555 D DA  2  N1 ? ? E DT  9  F DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DT  9  O4    ? ? ? 1_555 D DA  2  N6 ? ? E DT  9  F DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DC  10 N3    ? ? ? 1_555 D DG  1  N1 ? ? E DC  10 F DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DC  10 N4    ? ? ? 1_555 D DG  1  O6 ? ? E DC  10 F DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DC  10 O2    ? ? ? 1_555 D DG  1  N2 ? ? E DC  10 F DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 9 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 2 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
G 7 8 ? parallel      
G 8 9 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA E 83  ? LEU E 87  ? ALA A 83  LEU A 87  
A 2 ARG E 66  ? GLU E 71  ? ARG A 66  GLU A 71  
A 3 ARG E 42  ? PRO E 46  ? ARG A 42  PRO A 46  
A 4 PHE E 99  ? GLY E 104 ? PHE A 99  GLY A 104 
A 5 LEU E 154 ? PRO E 165 ? LEU A 154 PRO A 165 
A 6 ALA E 203 ? GLN E 209 ? ALA A 203 GLN A 209 
A 7 LYS E 186 ? GLY E 193 ? LYS A 186 GLY A 193 
A 8 LEU E 215 ? SER E 223 ? LEU A 215 SER A 223 
A 9 GLY E 226 ? TYR E 235 ? GLY A 226 TYR A 235 
B 1 MET E 258 ? PRO E 259 ? MET A 258 PRO A 259 
B 2 PRO E 404 ? VAL E 405 ? PRO A 404 VAL A 405 
C 1 PHE E 264 ? PHE E 268 ? PHE A 264 PHE A 268 
C 2 PHE E 356 ? PRO E 360 ? PHE A 356 PRO A 360 
C 3 HIS E 330 ? VAL E 333 ? HIS A 330 VAL A 333 
C 4 ALA E 343 ? ASP E 346 ? ALA A 343 ASP A 346 
D 1 LEU E 289 ? PRO E 291 ? LEU A 289 PRO A 291 
D 2 TRP E 313 ? PRO E 315 ? TRP A 313 PRO A 315 
E 1 LEU E 298 ? LYS E 299 ? LEU A 298 LYS A 299 
E 2 TRP E 302 ? VAL E 303 ? TRP A 302 VAL A 303 
F 1 VAL E 364 ? LEU E 366 ? VAL A 364 LEU A 366 
F 2 GLY E 410 ? HIS E 412 ? GLY A 410 HIS A 412 
G 1 ALA F 83  ? LEU F 87  ? ALA D 83  LEU D 87  
G 2 ARG F 66  ? GLU F 71  ? ARG D 66  GLU D 71  
G 3 ARG F 42  ? PRO F 46  ? ARG D 42  PRO D 46  
G 4 PHE F 99  ? GLY F 104 ? PHE D 99  GLY D 104 
G 5 LEU F 154 ? PRO F 165 ? LEU D 154 PRO D 165 
G 6 ALA F 203 ? GLN F 209 ? ALA D 203 GLN D 209 
G 7 LYS F 186 ? GLY F 193 ? LYS D 186 GLY D 193 
G 8 LEU F 215 ? GLU F 222 ? LEU D 215 GLU D 222 
G 9 PHE F 227 ? TYR F 235 ? PHE D 227 TYR D 235 
H 1 MET F 258 ? PRO F 259 ? MET D 258 PRO D 259 
H 2 PRO F 404 ? VAL F 405 ? PRO D 404 VAL D 405 
I 1 PHE F 264 ? PHE F 268 ? PHE D 264 PHE D 268 
I 2 PHE F 356 ? PRO F 360 ? PHE D 356 PRO D 360 
I 3 HIS F 330 ? VAL F 333 ? HIS D 330 VAL D 333 
I 4 ALA F 343 ? ASP F 346 ? ALA D 343 ASP D 346 
J 1 VAL F 290 ? PRO F 291 ? VAL D 290 PRO D 291 
J 2 TRP F 313 ? MET F 314 ? TRP D 313 MET D 314 
K 1 LEU F 298 ? LYS F 299 ? LEU D 298 LYS D 299 
K 2 TRP F 302 ? VAL F 303 ? TRP D 302 VAL D 303 
L 1 VAL F 364 ? LEU F 366 ? VAL D 364 LEU D 366 
L 2 GLY F 410 ? HIS F 412 ? GLY D 410 HIS D 412 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU E 84  ? O GLU A 84  N PHE E 67  ? N PHE A 67  
A 2 3 O ARG E 66  ? O ARG A 66  N VAL E 43  ? N VAL A 43  
A 3 4 N LEU E 44  ? N LEU A 44  O LEU E 101 ? O LEU A 101 
A 4 5 N PHE E 99  ? N PHE A 99  O LYS E 155 ? O LYS A 155 
A 5 6 N VAL E 164 ? N VAL A 164 O VAL E 204 ? O VAL A 204 
A 6 7 O VAL E 205 ? O VAL A 205 N TYR E 190 ? N TYR A 190 
A 7 8 N VAL E 189 ? N VAL A 189 O TRP E 218 ? O TRP A 218 
A 8 9 N LEU E 215 ? N LEU A 215 O TYR E 235 ? O TYR A 235 
B 1 2 N MET E 258 ? N MET A 258 O VAL E 405 ? O VAL A 405 
C 1 2 N HIS E 265 ? N HIS A 265 O LEU E 359 ? O LEU A 359 
C 2 3 O LEU E 358 ? O LEU A 358 N LEU E 331 ? N LEU A 331 
C 3 4 N HIS E 330 ? N HIS A 330 O ASP E 346 ? O ASP A 346 
D 1 2 N VAL E 290 ? N VAL A 290 O MET E 314 ? O MET A 314 
E 1 2 N LYS E 299 ? N LYS A 299 O TRP E 302 ? O TRP A 302 
F 1 2 N ARG E 365 ? N ARG A 365 O PHE E 411 ? O PHE A 411 
G 1 2 O GLU F 84  ? O GLU D 84  N PHE F 67  ? N PHE D 67  
G 2 3 O ARG F 66  ? O ARG D 66  N VAL F 43  ? N VAL D 43  
G 3 4 N LEU F 44  ? N LEU D 44  O LEU F 103 ? O LEU D 103 
G 4 5 N PHE F 99  ? N PHE D 99  O LYS F 155 ? O LYS D 155 
G 5 6 N VAL F 164 ? N VAL D 164 O VAL F 204 ? O VAL D 204 
G 6 7 O ARG F 207 ? O ARG D 207 N SER F 188 ? N SER D 188 
G 7 8 N VAL F 189 ? N VAL D 189 O TRP F 218 ? O TRP D 218 
G 8 9 N LEU F 215 ? N LEU D 215 O TYR F 235 ? O TYR D 235 
H 1 2 N MET F 258 ? N MET D 258 O VAL F 405 ? O VAL D 405 
I 1 2 N HIS F 265 ? N HIS D 265 O LEU F 359 ? O LEU D 359 
I 2 3 O LEU F 358 ? O LEU D 358 N LEU F 331 ? N LEU D 331 
I 3 4 N HIS F 330 ? N HIS D 330 O ASP F 346 ? O ASP D 346 
J 1 2 N VAL F 290 ? N VAL D 290 O MET F 314 ? O MET D 314 
K 1 2 N LYS F 299 ? N LYS D 299 O TRP F 302 ? O TRP D 302 
L 1 2 N ARG F 365 ? N ARG D 365 O PHE F 411 ? O PHE D 411 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE NEA A 2001' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NEA D 2002' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 3001' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 3002' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL D 3003' 
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL D 3004' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL D 3005' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL D 3006' 
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 3007' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 VAL E 21  ? VAL A 21   . ? 1_555 ? 
2  AC1 18 ALA E 47  ? ALA A 47   . ? 1_555 ? 
3  AC1 18 GLU E 71  ? GLU A 71   . ? 1_555 ? 
4  AC1 18 ILE E 72  ? ILE A 72   . ? 1_555 ? 
5  AC1 18 ASP E 73  ? ASP A 73   . ? 1_555 ? 
6  AC1 18 ALA E 76  ? ALA A 76   . ? 1_555 ? 
7  AC1 18 ALA E 88  ? ALA A 88   . ? 1_555 ? 
8  AC1 18 ASP E 89  ? ASP A 89   . ? 1_555 ? 
9  AC1 18 PHE E 90  ? PHE A 90   . ? 1_555 ? 
10 AC1 18 ASN E 105 ? ASN A 105  . ? 1_555 ? 
11 AC1 18 PRO E 107 ? PRO A 107  . ? 1_555 ? 
12 AC1 18 PHE E 146 ? PHE A 146  . ? 1_555 ? 
13 AC1 18 GOL I .   ? GOL A 3002 . ? 1_555 ? 
14 AC1 18 HOH T .   ? HOH A 3163 . ? 1_555 ? 
15 AC1 18 HOH T .   ? HOH A 3189 . ? 1_555 ? 
16 AC1 18 HOH T .   ? HOH A 3200 . ? 1_555 ? 
17 AC1 18 HOH T .   ? HOH A 3277 . ? 1_555 ? 
18 AC1 18 HOH T .   ? HOH A 3305 . ? 1_555 ? 
19 AC2 17 VAL F 21  ? VAL D 21   . ? 1_555 ? 
20 AC2 17 ALA F 47  ? ALA D 47   . ? 1_555 ? 
21 AC2 17 GLU F 71  ? GLU D 71   . ? 1_555 ? 
22 AC2 17 ILE F 72  ? ILE D 72   . ? 1_555 ? 
23 AC2 17 ASP F 73  ? ASP D 73   . ? 1_555 ? 
24 AC2 17 ALA F 76  ? ALA D 76   . ? 1_555 ? 
25 AC2 17 ALA F 88  ? ALA D 88   . ? 1_555 ? 
26 AC2 17 ASP F 89  ? ASP D 89   . ? 1_555 ? 
27 AC2 17 PHE F 90  ? PHE D 90   . ? 1_555 ? 
28 AC2 17 ASN F 105 ? ASN D 105  . ? 1_555 ? 
29 AC2 17 PRO F 107 ? PRO D 107  . ? 1_555 ? 
30 AC2 17 PHE F 146 ? PHE D 146  . ? 1_555 ? 
31 AC2 17 GOL L .   ? GOL D 3003 . ? 1_555 ? 
32 AC2 17 HOH U .   ? HOH D 3109 . ? 1_555 ? 
33 AC2 17 HOH U .   ? HOH D 3170 . ? 1_555 ? 
34 AC2 17 HOH U .   ? HOH D 3243 . ? 1_555 ? 
35 AC2 17 HOH U .   ? HOH D 3297 . ? 1_555 ? 
36 AC3 8  GLU E 317 ? GLU A 317  . ? 1_555 ? 
37 AC3 8  HOH T .   ? HOH A 3195 . ? 1_555 ? 
38 AC3 8  HOH T .   ? HOH A 3313 . ? 1_555 ? 
39 AC3 8  HOH T .   ? HOH A 3332 . ? 1_555 ? 
40 AC3 8  HOH T .   ? HOH A 3384 . ? 1_555 ? 
41 AC3 8  ALA F 233 ? ALA D 233  . ? 1_554 ? 
42 AC3 8  GLU F 234 ? GLU D 234  . ? 1_554 ? 
43 AC3 8  TYR F 235 ? TYR D 235  . ? 1_554 ? 
44 AC4 5  TYR E 129 ? TYR A 129  . ? 1_555 ? 
45 AC4 5  LEU E 142 ? LEU A 142  . ? 1_555 ? 
46 AC4 5  NEA G .   ? NEA A 2001 . ? 1_555 ? 
47 AC4 5  HOH T .   ? HOH A 3273 . ? 1_555 ? 
48 AC4 5  HOH T .   ? HOH A 3411 . ? 1_555 ? 
49 AC5 6  ILE F 72  ? ILE D 72   . ? 1_555 ? 
50 AC5 6  TYR F 129 ? TYR D 129  . ? 1_555 ? 
51 AC5 6  LEU F 142 ? LEU D 142  . ? 1_555 ? 
52 AC5 6  NEA K .   ? NEA D 2002 . ? 1_555 ? 
53 AC5 6  HOH U .   ? HOH D 3165 . ? 1_555 ? 
54 AC5 6  HOH U .   ? HOH D 3359 . ? 1_555 ? 
55 AC6 7  ARG F 42  ? ARG D 42   . ? 1_555 ? 
56 AC6 7  ARG F 66  ? ARG D 66   . ? 1_555 ? 
57 AC6 7  GLU F 84  ? GLU D 84   . ? 1_555 ? 
58 AC6 7  ILE F 86  ? ILE D 86   . ? 1_555 ? 
59 AC6 7  PRO F 95  ? PRO D 95   . ? 1_555 ? 
60 AC6 7  HOH U .   ? HOH D 3072 . ? 1_555 ? 
61 AC6 7  HOH U .   ? HOH D 3222 . ? 1_555 ? 
62 AC7 5  HIS E 278 ? HIS A 278  . ? 1_656 ? 
63 AC7 5  PRO E 279 ? PRO A 279  . ? 1_656 ? 
64 AC7 5  GLU E 321 ? GLU A 321  . ? 1_656 ? 
65 AC7 5  PRO F 81  ? PRO D 81   . ? 1_555 ? 
66 AC7 5  GOL O .   ? GOL D 3006 . ? 1_555 ? 
67 AC8 8  LYS E 277 ? LYS A 277  . ? 1_656 ? 
68 AC8 8  ARG F 58  ? ARG D 58   . ? 1_555 ? 
69 AC8 8  THR F 63  ? THR D 63   . ? 1_555 ? 
70 AC8 8  TYR F 65  ? TYR D 65   . ? 1_555 ? 
71 AC8 8  PHE F 67  ? PHE D 67   . ? 1_555 ? 
72 AC8 8  TRP F 82  ? TRP D 82   . ? 1_555 ? 
73 AC8 8  GOL N .   ? GOL D 3005 . ? 1_555 ? 
74 AC8 8  HOH U .   ? HOH D 3228 . ? 1_555 ? 
75 AC9 10 TYR E 191 ? TYR A 191  . ? 1_555 ? 
76 AC9 10 LEU E 192 ? LEU A 192  . ? 1_555 ? 
77 AC9 10 ASP E 219 ? ASP A 219  . ? 1_555 ? 
78 AC9 10 THR E 220 ? THR A 220  . ? 1_555 ? 
79 AC9 10 GLN E 221 ? GLN A 221  . ? 1_555 ? 
80 AC9 10 GLU E 222 ? GLU A 222  . ? 1_555 ? 
81 AC9 10 ARG E 389 ? ARG A 389  . ? 1_555 ? 
82 AC9 10 HOH T .   ? HOH A 3034 . ? 1_555 ? 
83 AC9 10 HOH T .   ? HOH A 3439 . ? 1_555 ? 
84 AC9 10 HOH T .   ? HOH A 3440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IBT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IBT 
_atom_sites.fract_transf_matrix[1][1]   0.016852 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000615 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008776 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 6.063   11.848  -7.825  1.00 26.12 ? 1    DG  B "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 6.380   11.020  -6.720  1.00 23.03 ? 1    DG  B "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 5.750   11.513  -5.425  1.00 21.27 ? 1    DG  B "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 4.389   11.962  -5.623  1.00 21.68 ? 1    DG  B "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 5.635   10.345  -4.472  1.00 17.60 ? 1    DG  B "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 6.538   10.499  -3.403  1.00 13.92 ? 1    DG  B "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 4.233   10.309  -3.893  1.00 19.29 ? 1    DG  B "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 3.552   11.450  -4.579  1.00 16.83 ? 1    DG  B "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 2.258   11.069  -5.128  1.00 14.50 ? 1    DG  B N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 1.910   11.079  -6.452  1.00 12.65 ? 1    DG  B C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 0.681   10.769  -6.660  1.00 12.67 ? 1    DG  B N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 0.137   10.561  -5.399  1.00 12.92 ? 1    DG  B C5    1 
ATOM   13   C C6    . DG  A 1 1   ? -1.186  10.189  -5.022  1.00 12.91 ? 1    DG  B C6    1 
ATOM   14   O O6    . DG  A 1 1   ? -2.157  9.994   -5.771  1.00 12.63 ? 1    DG  B O6    1 
ATOM   15   N N1    . DG  A 1 1   ? -1.337  10.088  -3.634  1.00 13.57 ? 1    DG  B N1    1 
ATOM   16   C C2    . DG  A 1 1   ? -0.285  10.300  -2.754  1.00 14.12 ? 1    DG  B C2    1 
ATOM   17   N N2    . DG  A 1 1   ? -0.546  10.158  -1.449  1.00 14.36 ? 1    DG  B N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 0.959   10.641  -3.107  1.00 15.13 ? 1    DG  B N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 1.107   10.752  -4.439  1.00 13.95 ? 1    DG  B C4    1 
ATOM   20   P P     . DT  A 1 2   ? 7.032   9.144   -2.750  1.00 10.79 ? 2    DT  B P     1 
ATOM   21   O OP1   . DT  A 1 2   ? 8.106   9.482   -1.803  1.00 10.75 ? 2    DT  B OP1   1 
ATOM   22   O OP2   . DT  A 1 2   ? 7.252   8.150   -3.826  1.00 9.98  ? 2    DT  B OP2   1 
ATOM   23   O "O5'" . DT  A 1 2   ? 5.730   8.627   -1.939  1.00 9.18  ? 2    DT  B "O5'" 1 
ATOM   24   C "C5'" . DT  A 1 2   ? 5.426   9.218   -0.691  1.00 9.57  ? 2    DT  B "C5'" 1 
ATOM   25   C "C4'" . DT  A 1 2   ? 4.412   8.303   -0.020  1.00 9.63  ? 2    DT  B "C4'" 1 
ATOM   26   O "O4'" . DT  A 1 2   ? 3.180   8.335   -0.786  1.00 9.19  ? 2    DT  B "O4'" 1 
ATOM   27   C "C3'" . DT  A 1 2   ? 4.802   6.822   0.060   1.00 8.06  ? 2    DT  B "C3'" 1 
ATOM   28   O "O3'" . DT  A 1 2   ? 4.182   6.286   1.215   1.00 11.37 ? 2    DT  B "O3'" 1 
ATOM   29   C "C2'" . DT  A 1 2   ? 4.084   6.186   -1.133  1.00 10.16 ? 2    DT  B "C2'" 1 
ATOM   30   C "C1'" . DT  A 1 2   ? 2.792   6.994   -1.048  1.00 9.69  ? 2    DT  B "C1'" 1 
ATOM   31   N N1    . DT  A 1 2   ? 1.887   6.971   -2.249  1.00 10.01 ? 2    DT  B N1    1 
ATOM   32   C C2    . DT  A 1 2   ? 0.518   6.797   -2.071  1.00 10.57 ? 2    DT  B C2    1 
ATOM   33   O O2    . DT  A 1 2   ? -0.062  6.638   -0.984  1.00 8.60  ? 2    DT  B O2    1 
ATOM   34   N N3    . DT  A 1 2   ? -0.194  6.808   -3.246  1.00 9.53  ? 2    DT  B N3    1 
ATOM   35   C C4    . DT  A 1 2   ? 0.291   6.979   -4.536  1.00 8.78  ? 2    DT  B C4    1 
ATOM   36   O O4    . DT  A 1 2   ? -0.489  6.962   -5.498  1.00 9.06  ? 2    DT  B O4    1 
ATOM   37   C C5    . DT  A 1 2   ? 1.728   7.160   -4.645  1.00 8.93  ? 2    DT  B C5    1 
ATOM   38   C C7    . DT  A 1 2   ? 2.378   7.546   -5.950  1.00 9.13  ? 2    DT  B C7    1 
ATOM   39   C C6    . DT  A 1 2   ? 2.440   7.156   -3.511  1.00 8.71  ? 2    DT  B C6    1 
ATOM   40   P P     . DT  A 1 3   ? 4.927   6.202   2.633   1.00 11.49 ? 3    DT  B P     1 
ATOM   41   O OP1   . DT  A 1 3   ? 5.336   7.561   3.032   1.00 11.33 ? 3    DT  B OP1   1 
ATOM   42   O OP2   . DT  A 1 3   ? 5.921   5.138   2.594   1.00 10.16 ? 3    DT  B OP2   1 
ATOM   43   O "O5'" . DT  A 1 3   ? 3.697   5.715   3.524   1.00 9.72  ? 3    DT  B "O5'" 1 
ATOM   44   C "C5'" . DT  A 1 3   ? 2.586   6.607   3.790   1.00 7.88  ? 3    DT  B "C5'" 1 
ATOM   45   C "C4'" . DT  A 1 3   ? 1.256   5.891   3.629   1.00 8.44  ? 3    DT  B "C4'" 1 
ATOM   46   O "O4'" . DT  A 1 3   ? 0.983   5.586   2.240   1.00 8.65  ? 3    DT  B "O4'" 1 
ATOM   47   C "C3'" . DT  A 1 3   ? 1.158   4.537   4.347   1.00 7.34  ? 3    DT  B "C3'" 1 
ATOM   48   O "O3'" . DT  A 1 3   ? 0.380   4.794   5.521   1.00 9.08  ? 3    DT  B "O3'" 1 
ATOM   49   C "C2'" . DT  A 1 3   ? 0.427   3.598   3.362   1.00 8.58  ? 3    DT  B "C2'" 1 
ATOM   50   C "C1'" . DT  A 1 3   ? 0.008   4.536   2.257   1.00 8.70  ? 3    DT  B "C1'" 1 
ATOM   51   N N1    . DT  A 1 3   ? -0.026  4.058   0.851   1.00 6.97  ? 3    DT  B N1    1 
ATOM   52   C C2    . DT  A 1 3   ? -1.236  4.002   0.190   1.00 7.18  ? 3    DT  B C2    1 
ATOM   53   O O2    . DT  A 1 3   ? -2.321  4.265   0.704   1.00 9.17  ? 3    DT  B O2    1 
ATOM   54   N N3    . DT  A 1 3   ? -1.130  3.620   -1.124  1.00 7.49  ? 3    DT  B N3    1 
ATOM   55   C C4    . DT  A 1 3   ? 0.038   3.303   -1.813  1.00 8.03  ? 3    DT  B C4    1 
ATOM   56   O O4    . DT  A 1 3   ? 0.008   3.009   -2.990  1.00 7.87  ? 3    DT  B O4    1 
ATOM   57   C C5    . DT  A 1 3   ? 1.275   3.369   -1.061  1.00 8.23  ? 3    DT  B C5    1 
ATOM   58   C C7    . DT  A 1 3   ? 2.546   2.789   -1.616  1.00 8.42  ? 3    DT  B C7    1 
ATOM   59   C C6    . DT  A 1 3   ? 1.193   3.734   0.233   1.00 6.71  ? 3    DT  B C6    1 
ATOM   60   P P     . DC  A 1 4   ? 0.603   3.863   6.816   1.00 9.83  ? 4    DC  B P     1 
ATOM   61   O OP1   . DC  A 1 4   ? 0.174   4.690   7.991   1.00 8.78  ? 4    DC  B OP1   1 
ATOM   62   O OP2   . DC  A 1 4   ? 1.960   3.308   6.813   1.00 9.35  ? 4    DC  B OP2   1 
ATOM   63   O "O5'" . DC  A 1 4   ? -0.371  2.610   6.591   1.00 8.99  ? 4    DC  B "O5'" 1 
ATOM   64   C "C5'" . DC  A 1 4   ? -1.774  2.795   6.782   1.00 9.57  ? 4    DC  B "C5'" 1 
ATOM   65   C "C4'" . DC  A 1 4   ? -2.508  1.564   6.276   1.00 9.70  ? 4    DC  B "C4'" 1 
ATOM   66   O "O4'" . DC  A 1 4   ? -2.383  1.542   4.847   1.00 9.61  ? 4    DC  B "O4'" 1 
ATOM   67   C "C3'" . DC  A 1 4   ? -2.002  0.219   6.763   1.00 8.07  ? 4    DC  B "C3'" 1 
ATOM   68   O "O3'" . DC  A 1 4   ? -2.834  -0.003  7.911   1.00 9.58  ? 4    DC  B "O3'" 1 
ATOM   69   C "C2'" . DC  A 1 4   ? -2.289  -0.743  5.600   1.00 8.26  ? 4    DC  B "C2'" 1 
ATOM   70   C "C1'" . DC  A 1 4   ? -2.428  0.216   4.395   1.00 8.24  ? 4    DC  B "C1'" 1 
ATOM   71   N N1    . DC  A 1 4   ? -1.339  0.108   3.376   1.00 8.16  ? 4    DC  B N1    1 
ATOM   72   C C2    . DC  A 1 4   ? -1.700  0.323   2.024   1.00 10.44 ? 4    DC  B C2    1 
ATOM   73   O O2    . DC  A 1 4   ? -2.847  0.627   1.746   1.00 11.34 ? 4    DC  B O2    1 
ATOM   74   N N3    . DC  A 1 4   ? -0.755  0.228   1.053   1.00 11.01 ? 4    DC  B N3    1 
ATOM   75   C C4    . DC  A 1 4   ? 0.507   -0.073  1.385   1.00 11.09 ? 4    DC  B C4    1 
ATOM   76   N N4    . DC  A 1 4   ? 1.395   -0.146  0.373   1.00 11.11 ? 4    DC  B N4    1 
ATOM   77   C C5    . DC  A 1 4   ? 0.919   -0.291  2.734   1.00 9.36  ? 4    DC  B C5    1 
ATOM   78   C C6    . DC  A 1 4   ? -0.029  -0.193  3.703   1.00 7.47  ? 4    DC  B C6    1 
ATOM   79   P P     . DG  A 1 5   ? -2.781  -1.322  8.827   1.00 9.01  ? 5    DG  B P     1 
ATOM   80   O OP1   . DG  A 1 5   ? -3.481  -0.972  10.080  1.00 8.84  ? 5    DG  B OP1   1 
ATOM   81   O OP2   . DG  A 1 5   ? -1.411  -1.852  8.844   1.00 9.49  ? 5    DG  B OP2   1 
ATOM   82   O "O5'" . DG  A 1 5   ? -3.707  -2.384  8.026   1.00 8.58  ? 5    DG  B "O5'" 1 
ATOM   83   C "C5'" . DG  A 1 5   ? -5.072  -2.129  7.714   1.00 8.85  ? 5    DG  B "C5'" 1 
ATOM   84   C "C4'" . DG  A 1 5   ? -5.647  -3.260  6.871   1.00 8.25  ? 5    DG  B "C4'" 1 
ATOM   85   O "O4'" . DG  A 1 5   ? -4.940  -3.198  5.601   1.00 9.20  ? 5    DG  B "O4'" 1 
ATOM   86   C "C3'" . DG  A 1 5   ? -5.460  -4.668  7.450   1.00 9.47  ? 5    DG  B "C3'" 1 
ATOM   87   O "O3'" . DG  A 1 5   ? -6.491  -5.511  6.969   1.00 9.27  ? 5    DG  B "O3'" 1 
ATOM   88   C "C2'" . DG  A 1 5   ? -4.138  -5.088  6.831   1.00 7.98  ? 5    DG  B "C2'" 1 
ATOM   89   C "C1'" . DG  A 1 5   ? -4.218  -4.401  5.461   1.00 7.87  ? 5    DG  B "C1'" 1 
ATOM   90   N N9    . DG  A 1 5   ? -2.911  -4.136  4.868   1.00 8.62  ? 5    DG  B N9    1 
ATOM   91   C C8    . DG  A 1 5   ? -1.686  -4.152  5.465   1.00 8.71  ? 5    DG  B C8    1 
ATOM   92   N N7    . DG  A 1 5   ? -0.700  -3.885  4.631   1.00 10.51 ? 5    DG  B N7    1 
ATOM   93   C C5    . DG  A 1 5   ? -1.316  -3.731  3.397   1.00 8.93  ? 5    DG  B C5    1 
ATOM   94   C C6    . DG  A 1 5   ? -0.771  -3.436  2.115   1.00 9.01  ? 5    DG  B C6    1 
ATOM   95   O O6    . DG  A 1 5   ? 0.417   -3.286  1.785   1.00 10.93 ? 5    DG  B O6    1 
ATOM   96   N N1    . DG  A 1 5   ? -1.755  -3.341  1.114   1.00 10.74 ? 5    DG  B N1    1 
ATOM   97   C C2    . DG  A 1 5   ? -3.094  -3.490  1.351   1.00 9.97  ? 5    DG  B C2    1 
ATOM   98   N N2    . DG  A 1 5   ? -3.876  -3.355  0.266   1.00 11.16 ? 5    DG  B N2    1 
ATOM   99   N N3    . DG  A 1 5   ? -3.618  -3.775  2.555   1.00 9.42  ? 5    DG  B N3    1 
ATOM   100  C C4    . DG  A 1 5   ? -2.677  -3.868  3.531   1.00 9.14  ? 5    DG  B C4    1 
HETATM 101  P P     . 2PR A 1 6   ? -7.878  -5.609  7.760   1.00 11.67 ? 6    2PR B P     1 
HETATM 102  O OP1   . 2PR A 1 6   ? -8.731  -6.398  6.844   1.00 12.73 ? 6    2PR B OP1   1 
HETATM 103  O OP2   . 2PR A 1 6   ? -8.355  -4.319  8.243   1.00 10.31 ? 6    2PR B OP2   1 
HETATM 104  O "O5'" . 2PR A 1 6   ? -7.410  -6.486  9.016   1.00 13.43 ? 6    2PR B "O5'" 1 
HETATM 105  C "C5'" . 2PR A 1 6   ? -8.261  -6.555  10.158  1.00 12.04 ? 6    2PR B "C5'" 1 
HETATM 106  C "C4'" . 2PR A 1 6   ? -8.372  -7.990  10.666  1.00 13.06 ? 6    2PR B "C4'" 1 
HETATM 107  O "O4'" . 2PR A 1 6   ? -9.131  -8.034  11.913  1.00 13.35 ? 6    2PR B "O4'" 1 
HETATM 108  C "C3'" . 2PR A 1 6   ? -9.114  -8.922  9.719   1.00 12.56 ? 6    2PR B "C3'" 1 
HETATM 109  O "O3'" . 2PR A 1 6   ? -8.498  -10.187 9.801   1.00 14.58 ? 6    2PR B "O3'" 1 
HETATM 110  C "C2'" . 2PR A 1 6   ? -10.546 -8.917  10.253  1.00 12.79 ? 6    2PR B "C2'" 1 
HETATM 111  C "C1'" . 2PR A 1 6   ? -10.324 -8.797  11.754  1.00 13.95 ? 6    2PR B "C1'" 1 
HETATM 112  N N9    . 2PR A 1 6   ? -11.294 -8.017  12.501  1.00 13.61 ? 6    2PR B N9    1 
HETATM 113  C C8    . 2PR A 1 6   ? -12.147 -7.016  12.060  1.00 13.44 ? 6    2PR B C8    1 
HETATM 114  N N7    . 2PR A 1 6   ? -12.865 -6.464  13.029  1.00 14.41 ? 6    2PR B N7    1 
HETATM 115  C C5    . 2PR A 1 6   ? -12.414 -7.136  14.178  1.00 13.65 ? 6    2PR B C5    1 
HETATM 116  C C6    . 2PR A 1 6   ? -12.750 -7.040  15.557  1.00 14.75 ? 6    2PR B C6    1 
HETATM 117  N N1    . 2PR A 1 6   ? -12.093 -7.861  16.417  1.00 15.58 ? 6    2PR B N1    1 
HETATM 118  C C2    . 2PR A 1 6   ? -11.187 -8.733  15.945  1.00 16.02 ? 6    2PR B C2    1 
HETATM 119  N N2    . 2PR A 1 6   ? -10.591 -9.525  16.851  1.00 15.59 ? 6    2PR B N2    1 
HETATM 120  N N3    . 2PR A 1 6   ? -10.779 -8.902  14.680  1.00 13.18 ? 6    2PR B N3    1 
HETATM 121  C C4    . 2PR A 1 6   ? -11.451 -8.083  13.854  1.00 13.54 ? 6    2PR B C4    1 
ATOM   122  P P     . DT  A 1 7   ? -8.616  -11.255 8.612   1.00 16.54 ? 7    DT  B P     1 
ATOM   123  O OP1   . DT  A 1 7   ? -10.053 -11.535 8.316   1.00 18.65 ? 7    DT  B OP1   1 
ATOM   124  O OP2   . DT  A 1 7   ? -7.660  -12.358 8.889   1.00 15.97 ? 7    DT  B OP2   1 
ATOM   125  O "O5'" . DT  A 1 7   ? -8.096  -10.428 7.346   1.00 17.72 ? 7    DT  B "O5'" 1 
ATOM   126  C "C5'" . DT  A 1 7   ? -6.818  -9.828  7.348   1.00 20.58 ? 7    DT  B "C5'" 1 
ATOM   127  C "C4'" . DT  A 1 7   ? -6.705  -9.040  6.058   1.00 23.37 ? 7    DT  B "C4'" 1 
ATOM   128  O "O4'" . DT  A 1 7   ? -5.434  -8.360  5.984   1.00 23.26 ? 7    DT  B "O4'" 1 
ATOM   129  C "C3'" . DT  A 1 7   ? -6.780  -9.910  4.820   1.00 24.22 ? 7    DT  B "C3'" 1 
ATOM   130  O "O3'" . DT  A 1 7   ? -7.391  -9.181  3.773   1.00 28.87 ? 7    DT  B "O3'" 1 
ATOM   131  C "C2'" . DT  A 1 7   ? -5.328  -10.242 4.508   1.00 23.29 ? 7    DT  B "C2'" 1 
ATOM   132  C "C1'" . DT  A 1 7   ? -4.603  -8.996  5.018   1.00 22.64 ? 7    DT  B "C1'" 1 
ATOM   133  N N1    . DT  A 1 7   ? -3.276  -9.324  5.613   1.00 22.26 ? 7    DT  B N1    1 
ATOM   134  C C2    . DT  A 1 7   ? -2.333  -10.004 4.836   1.00 21.71 ? 7    DT  B C2    1 
ATOM   135  O O2    . DT  A 1 7   ? -2.532  -10.360 3.687   1.00 22.32 ? 7    DT  B O2    1 
ATOM   136  N N3    . DT  A 1 7   ? -1.140  -10.253 5.476   1.00 20.14 ? 7    DT  B N3    1 
ATOM   137  C C4    . DT  A 1 7   ? -0.804  -9.888  6.761   1.00 20.00 ? 7    DT  B C4    1 
ATOM   138  O O4    . DT  A 1 7   ? 0.291   -10.158 7.224   1.00 21.56 ? 7    DT  B O4    1 
ATOM   139  C C5    . DT  A 1 7   ? -1.820  -9.173  7.518   1.00 21.14 ? 7    DT  B C5    1 
ATOM   140  C C7    . DT  A 1 7   ? -1.479  -8.512  8.822   1.00 21.41 ? 7    DT  B C7    1 
ATOM   141  C C6    . DT  A 1 7   ? -2.989  -8.934  6.913   1.00 20.54 ? 7    DT  B C6    1 
ATOM   142  P P     . DG  A 1 8   ? -8.224  -9.979  2.667   1.00 31.76 ? 8    DG  B P     1 
ATOM   143  O OP1   . DG  A 1 8   ? -9.046  -8.975  1.933   1.00 31.79 ? 8    DG  B OP1   1 
ATOM   144  O OP2   . DG  A 1 8   ? -8.872  -11.156 3.303   1.00 30.53 ? 8    DG  B OP2   1 
ATOM   145  O "O5'" . DG  A 1 8   ? -7.070  -10.508 1.690   1.00 31.89 ? 8    DG  B "O5'" 1 
ATOM   146  C "C5'" . DG  A 1 8   ? -6.542  -9.719  0.623   1.00 30.53 ? 8    DG  B "C5'" 1 
ATOM   147  C "C4'" . DG  A 1 8   ? -5.944  -10.665 -0.414  1.00 29.48 ? 8    DG  B "C4'" 1 
ATOM   148  O "O4'" . DG  A 1 8   ? -4.692  -11.232 0.063   1.00 28.49 ? 8    DG  B "O4'" 1 
ATOM   149  C "C3'" . DG  A 1 8   ? -6.819  -11.865 -0.773  1.00 29.91 ? 8    DG  B "C3'" 1 
ATOM   150  O "O3'" . DG  A 1 8   ? -6.722  -12.021 -2.186  1.00 32.05 ? 8    DG  B "O3'" 1 
ATOM   151  C "C2'" . DG  A 1 8   ? -6.212  -13.042 0.013   1.00 27.42 ? 8    DG  B "C2'" 1 
ATOM   152  C "C1'" . DG  A 1 8   ? -4.737  -12.659 0.102   1.00 24.57 ? 8    DG  B "C1'" 1 
ATOM   153  N N9    . DG  A 1 8   ? -4.017  -13.001 1.329   1.00 23.19 ? 8    DG  B N9    1 
ATOM   154  C C8    . DG  A 1 8   ? -4.500  -12.997 2.616   1.00 23.19 ? 8    DG  B C8    1 
ATOM   155  N N7    . DG  A 1 8   ? -3.610  -13.320 3.516   1.00 24.62 ? 8    DG  B N7    1 
ATOM   156  C C5    . DG  A 1 8   ? -2.441  -13.533 2.790   1.00 24.07 ? 8    DG  B C5    1 
ATOM   157  C C6    . DG  A 1 8   ? -1.136  -13.886 3.227   1.00 23.26 ? 8    DG  B C6    1 
ATOM   158  O O6    . DG  A 1 8   ? -0.730  -14.093 4.374   1.00 22.36 ? 8    DG  B O6    1 
ATOM   159  N N1    . DG  A 1 8   ? -0.226  -13.994 2.169   1.00 22.90 ? 8    DG  B N1    1 
ATOM   160  C C2    . DG  A 1 8   ? -0.559  -13.784 0.854   1.00 24.21 ? 8    DG  B C2    1 
ATOM   161  N N2    . DG  A 1 8   ? 0.443   -13.927 -0.036  1.00 23.02 ? 8    DG  B N2    1 
ATOM   162  N N3    . DG  A 1 8   ? -1.781  -13.428 0.432   1.00 23.96 ? 8    DG  B N3    1 
ATOM   163  C C4    . DG  A 1 8   ? -2.677  -13.327 1.445   1.00 24.31 ? 8    DG  B C4    1 
ATOM   164  P P     . DT  A 1 9   ? -7.598  -13.054 -3.049  1.00 33.24 ? 9    DT  B P     1 
ATOM   165  O OP1   . DT  A 1 9   ? -7.644  -12.459 -4.410  1.00 33.24 ? 9    DT  B OP1   1 
ATOM   166  O OP2   . DT  A 1 9   ? -8.837  -13.421 -2.329  1.00 34.02 ? 9    DT  B OP2   1 
ATOM   167  O "O5'" . DT  A 1 9   ? -6.635  -14.340 -3.114  1.00 33.07 ? 9    DT  B "O5'" 1 
ATOM   168  C "C5'" . DT  A 1 9   ? -5.378  -14.196 -3.770  1.00 31.12 ? 9    DT  B "C5'" 1 
ATOM   169  C "C4'" . DT  A 1 9   ? -4.464  -15.358 -3.447  1.00 29.98 ? 9    DT  B "C4'" 1 
ATOM   170  O "O4'" . DT  A 1 9   ? -4.016  -15.271 -2.080  1.00 28.81 ? 9    DT  B "O4'" 1 
ATOM   171  C "C3'" . DT  A 1 9   ? -5.071  -16.752 -3.561  1.00 30.14 ? 9    DT  B "C3'" 1 
ATOM   172  O "O3'" . DT  A 1 9   ? -4.580  -17.293 -4.780  1.00 33.68 ? 9    DT  B "O3'" 1 
ATOM   173  C "C2'" . DT  A 1 9   ? -4.532  -17.521 -2.351  1.00 28.44 ? 9    DT  B "C2'" 1 
ATOM   174  C "C1'" . DT  A 1 9   ? -3.504  -16.552 -1.777  1.00 25.50 ? 9    DT  B "C1'" 1 
ATOM   175  N N1    . DT  A 1 9   ? -3.300  -16.634 -0.289  1.00 25.69 ? 9    DT  B N1    1 
ATOM   176  C C2    . DT  A 1 9   ? -2.025  -16.877 0.213   1.00 25.98 ? 9    DT  B C2    1 
ATOM   177  O O2    . DT  A 1 9   ? -1.039  -17.049 -0.496  1.00 25.87 ? 9    DT  B O2    1 
ATOM   178  N N3    . DT  A 1 9   ? -1.959  -16.927 1.590   1.00 24.63 ? 9    DT  B N3    1 
ATOM   179  C C4    . DT  A 1 9   ? -3.003  -16.753 2.484   1.00 24.81 ? 9    DT  B C4    1 
ATOM   180  O O4    . DT  A 1 9   ? -2.823  -16.807 3.695   1.00 25.44 ? 9    DT  B O4    1 
ATOM   181  C C5    . DT  A 1 9   ? -4.309  -16.500 1.899   1.00 24.01 ? 9    DT  B C5    1 
ATOM   182  C C7    . DT  A 1 9   ? -5.531  -16.350 2.766   1.00 24.85 ? 9    DT  B C7    1 
ATOM   183  C C6    . DT  A 1 9   ? -4.388  -16.451 0.557   1.00 24.25 ? 9    DT  B C6    1 
ATOM   184  P P     . DC  A 1 10  ? -4.828  -18.795 -5.262  1.00 35.68 ? 10   DC  B P     1 
ATOM   185  O OP1   . DC  A 1 10  ? -4.828  -18.724 -6.751  1.00 35.31 ? 10   DC  B OP1   1 
ATOM   186  O OP2   . DC  A 1 10  ? -5.970  -19.398 -4.523  1.00 34.49 ? 10   DC  B OP2   1 
ATOM   187  O "O5'" . DC  A 1 10  ? -3.486  -19.549 -4.784  1.00 33.73 ? 10   DC  B "O5'" 1 
ATOM   188  C "C5'" . DC  A 1 10  ? -2.244  -19.469 -5.501  1.00 32.54 ? 10   DC  B "C5'" 1 
ATOM   189  C "C4'" . DC  A 1 10  ? -1.102  -19.845 -4.584  1.00 31.42 ? 10   DC  B "C4'" 1 
ATOM   190  O "O4'" . DC  A 1 10  ? -1.291  -19.255 -3.272  1.00 28.90 ? 10   DC  B "O4'" 1 
ATOM   191  C "C3'" . DC  A 1 10  ? -1.041  -21.344 -4.294  1.00 31.72 ? 10   DC  B "C3'" 1 
ATOM   192  O "O3'" . DC  A 1 10  ? -0.334  -22.019 -5.336  1.00 31.66 ? 10   DC  B "O3'" 1 
ATOM   193  C "C2'" . DC  A 1 10  ? -0.308  -21.416 -2.955  1.00 29.94 ? 10   DC  B "C2'" 1 
ATOM   194  C "C1'" . DC  A 1 10  ? -0.616  -20.065 -2.310  1.00 29.09 ? 10   DC  B "C1'" 1 
ATOM   195  N N1    . DC  A 1 10  ? -1.398  -20.140 -1.002  1.00 27.95 ? 10   DC  B N1    1 
ATOM   196  C C2    . DC  A 1 10  ? -0.717  -20.264 0.236   1.00 27.59 ? 10   DC  B C2    1 
ATOM   197  O O2    . DC  A 1 10  ? 0.519   -20.333 0.250   1.00 28.40 ? 10   DC  B O2    1 
ATOM   198  N N3    . DC  A 1 10  ? -1.436  -20.312 1.396   1.00 26.74 ? 10   DC  B N3    1 
ATOM   199  C C4    . DC  A 1 10  ? -2.775  -20.244 1.351   1.00 27.39 ? 10   DC  B C4    1 
ATOM   200  N N4    . DC  A 1 10  ? -3.435  -20.280 2.511   1.00 27.18 ? 10   DC  B N4    1 
ATOM   201  C C5    . DC  A 1 10  ? -3.493  -20.117 0.114   1.00 28.30 ? 10   DC  B C5    1 
ATOM   202  C C6    . DC  A 1 10  ? -2.766  -20.071 -1.020  1.00 28.85 ? 10   DC  B C6    1 
ATOM   203  O "O5'" . DG  B 2 1   ? 3.447   -20.818 11.450  1.00 38.19 ? 11   DG  C "O5'" 1 
ATOM   204  C "C5'" . DG  B 2 1   ? 4.588   -21.598 11.074  1.00 36.36 ? 11   DG  C "C5'" 1 
ATOM   205  C "C4'" . DG  B 2 1   ? 4.623   -21.862 9.577   1.00 34.00 ? 11   DG  C "C4'" 1 
ATOM   206  O "O4'" . DG  B 2 1   ? 3.267   -21.939 9.053   1.00 33.24 ? 11   DG  C "O4'" 1 
ATOM   207  C "C3'" . DG  B 2 1   ? 5.325   -20.770 8.775   1.00 33.97 ? 11   DG  C "C3'" 1 
ATOM   208  O "O3'" . DG  B 2 1   ? 6.351   -21.301 7.950   1.00 34.80 ? 11   DG  C "O3'" 1 
ATOM   209  C "C2'" . DG  B 2 1   ? 4.208   -20.148 7.947   1.00 31.75 ? 11   DG  C "C2'" 1 
ATOM   210  C "C1'" . DG  B 2 1   ? 3.288   -21.344 7.770   1.00 30.14 ? 11   DG  C "C1'" 1 
ATOM   211  N N9    . DG  B 2 1   ? 1.961   -20.945 7.322   1.00 28.74 ? 11   DG  C N9    1 
ATOM   212  C C8    . DG  B 2 1   ? 0.897   -20.616 8.128   1.00 28.59 ? 11   DG  C C8    1 
ATOM   213  N N7    . DG  B 2 1   ? -0.176  -20.288 7.463   1.00 28.00 ? 11   DG  C N7    1 
ATOM   214  C C5    . DG  B 2 1   ? 0.212   -20.411 6.126   1.00 27.23 ? 11   DG  C C5    1 
ATOM   215  C C6    . DG  B 2 1   ? -0.540  -20.181 4.956   1.00 27.42 ? 11   DG  C C6    1 
ATOM   216  O O6    . DG  B 2 1   ? -1.719  -19.815 4.891   1.00 27.66 ? 11   DG  C O6    1 
ATOM   217  N N1    . DG  B 2 1   ? 0.193   -20.406 3.790   1.00 28.41 ? 11   DG  C N1    1 
ATOM   218  C C2    . DG  B 2 1   ? 1.513   -20.808 3.768   1.00 28.39 ? 11   DG  C C2    1 
ATOM   219  N N2    . DG  B 2 1   ? 2.071   -20.975 2.550   1.00 28.20 ? 11   DG  C N2    1 
ATOM   220  N N3    . DG  B 2 1   ? 2.224   -21.019 4.865   1.00 26.22 ? 11   DG  C N3    1 
ATOM   221  C C4    . DG  B 2 1   ? 1.521   -20.802 6.011   1.00 27.13 ? 11   DG  C C4    1 
ATOM   222  P P     . DA  B 2 2   ? 7.375   -20.310 7.203   1.00 37.90 ? 12   DA  C P     1 
ATOM   223  O OP1   . DA  B 2 2   ? 8.670   -21.021 7.077   1.00 39.01 ? 12   DA  C OP1   1 
ATOM   224  O OP2   . DA  B 2 2   ? 7.332   -18.965 7.831   1.00 38.29 ? 12   DA  C OP2   1 
ATOM   225  O "O5'" . DA  B 2 2   ? 6.738   -20.153 5.738   1.00 34.57 ? 12   DA  C "O5'" 1 
ATOM   226  C "C5'" . DA  B 2 2   ? 7.009   -21.111 4.715   1.00 31.67 ? 12   DA  C "C5'" 1 
ATOM   227  C "C4'" . DA  B 2 2   ? 6.852   -20.546 3.307   1.00 28.26 ? 12   DA  C "C4'" 1 
ATOM   228  O "O4'" . DA  B 2 2   ? 5.526   -19.995 3.033   1.00 26.69 ? 12   DA  C "O4'" 1 
ATOM   229  C "C3'" . DA  B 2 2   ? 7.804   -19.427 2.952   1.00 28.26 ? 12   DA  C "C3'" 1 
ATOM   230  O "O3'" . DA  B 2 2   ? 8.144   -19.643 1.590   1.00 29.61 ? 12   DA  C "O3'" 1 
ATOM   231  C "C2'" . DA  B 2 2   ? 6.986   -18.142 3.199   1.00 26.66 ? 12   DA  C "C2'" 1 
ATOM   232  C "C1'" . DA  B 2 2   ? 5.574   -18.568 2.799   1.00 23.84 ? 12   DA  C "C1'" 1 
ATOM   233  N N9    . DA  B 2 2   ? 4.410   -18.095 3.552   1.00 21.38 ? 12   DA  C N9    1 
ATOM   234  C C8    . DA  B 2 2   ? 4.258   -17.907 4.912   1.00 20.46 ? 12   DA  C C8    1 
ATOM   235  N N7    . DA  B 2 2   ? 3.034   -17.548 5.258   1.00 19.80 ? 12   DA  C N7    1 
ATOM   236  C C5    . DA  B 2 2   ? 2.327   -17.524 4.058   1.00 19.15 ? 12   DA  C C5    1 
ATOM   237  C C6    . DA  B 2 2   ? 0.972   -17.246 3.706   1.00 21.31 ? 12   DA  C C6    1 
ATOM   238  N N6    . DA  B 2 2   ? 0.011   -16.901 4.576   1.00 20.94 ? 12   DA  C N6    1 
ATOM   239  N N1    . DA  B 2 2   ? 0.610   -17.321 2.397   1.00 19.79 ? 12   DA  C N1    1 
ATOM   240  C C2    . DA  B 2 2   ? 1.536   -17.659 1.500   1.00 21.15 ? 12   DA  C C2    1 
ATOM   241  N N3    . DA  B 2 2   ? 2.825   -17.954 1.713   1.00 21.51 ? 12   DA  C N3    1 
ATOM   242  C C4    . DA  B 2 2   ? 3.164   -17.871 3.014   1.00 19.93 ? 12   DA  C C4    1 
ATOM   243  P P     . DC  B 2 3   ? 9.240   -18.728 0.872   1.00 30.28 ? 13   DC  C P     1 
ATOM   244  O OP1   . DC  B 2 3   ? 9.630   -19.382 -0.406  1.00 31.09 ? 13   DC  C OP1   1 
ATOM   245  O OP2   . DC  B 2 3   ? 10.252  -18.351 1.895   1.00 30.68 ? 13   DC  C OP2   1 
ATOM   246  O "O5'" . DC  B 2 3   ? 8.379   -17.410 0.559   1.00 28.86 ? 13   DC  C "O5'" 1 
ATOM   247  C "C5'" . DC  B 2 3   ? 7.522   -17.317 -0.558  1.00 25.63 ? 13   DC  C "C5'" 1 
ATOM   248  C "C4'" . DC  B 2 3   ? 6.853   -15.947 -0.536  1.00 23.26 ? 13   DC  C "C4'" 1 
ATOM   249  O "O4'" . DC  B 2 3   ? 5.767   -15.927 0.433   1.00 21.07 ? 13   DC  C "O4'" 1 
ATOM   250  C "C3'" . DC  B 2 3   ? 7.747   -14.758 -0.131  1.00 21.57 ? 13   DC  C "C3'" 1 
ATOM   251  O "O3'" . DC  B 2 3   ? 7.539   -13.709 -1.061  1.00 21.59 ? 13   DC  C "O3'" 1 
ATOM   252  C "C2'" . DC  B 2 3   ? 7.215   -14.364 1.250   1.00 22.65 ? 13   DC  C "C2'" 1 
ATOM   253  C "C1'" . DC  B 2 3   ? 5.742   -14.596 0.937   1.00 21.47 ? 13   DC  C "C1'" 1 
ATOM   254  N N1    . DC  B 2 3   ? 4.771   -14.476 2.063   1.00 20.35 ? 13   DC  C N1    1 
ATOM   255  C C2    . DC  B 2 3   ? 3.406   -14.391 1.798   1.00 18.53 ? 13   DC  C C2    1 
ATOM   256  O O2    . DC  B 2 3   ? 2.997   -14.390 0.634   1.00 21.28 ? 13   DC  C O2    1 
ATOM   257  N N3    . DC  B 2 3   ? 2.538   -14.287 2.848   1.00 20.57 ? 13   DC  C N3    1 
ATOM   258  C C4    . DC  B 2 3   ? 2.999   -14.285 4.098   1.00 20.29 ? 13   DC  C C4    1 
ATOM   259  N N4    . DC  B 2 3   ? 2.109   -14.175 5.095   1.00 22.31 ? 13   DC  C N4    1 
ATOM   260  C C5    . DC  B 2 3   ? 4.386   -14.389 4.392   1.00 21.26 ? 13   DC  C C5    1 
ATOM   261  C C6    . DC  B 2 3   ? 5.229   -14.486 3.350   1.00 19.92 ? 13   DC  C C6    1 
ATOM   262  P P     . DA  B 2 4   ? 8.748   -12.777 -1.525  1.00 16.67 ? 14   DA  C P     1 
ATOM   263  O OP1   . DA  B 2 4   ? 9.456   -13.557 -2.562  1.00 17.98 ? 14   DA  C OP1   1 
ATOM   264  O OP2   . DA  B 2 4   ? 9.523   -12.254 -0.407  1.00 17.21 ? 14   DA  C OP2   1 
ATOM   265  O "O5'" . DA  B 2 4   ? 7.927   -11.638 -2.307  1.00 16.76 ? 14   DA  C "O5'" 1 
ATOM   266  C "C5'" . DA  B 2 4   ? 7.200   -10.649 -1.565  1.00 12.97 ? 14   DA  C "C5'" 1 
ATOM   267  C "C4'" . DA  B 2 4   ? 5.702   -10.844 -1.789  1.00 14.11 ? 14   DA  C "C4'" 1 
ATOM   268  O "O4'" . DA  B 2 4   ? 5.178   -11.682 -0.739  1.00 14.10 ? 14   DA  C "O4'" 1 
ATOM   269  C "C3'" . DA  B 2 4   ? 4.883   -9.572  -1.677  1.00 10.38 ? 14   DA  C "C3'" 1 
ATOM   270  O "O3'" . DA  B 2 4   ? 4.904   -8.954  -2.956  1.00 11.51 ? 14   DA  C "O3'" 1 
ATOM   271  C "C2'" . DA  B 2 4   ? 3.482   -10.066 -1.285  1.00 13.72 ? 14   DA  C "C2'" 1 
ATOM   272  C "C1'" . DA  B 2 4   ? 3.843   -11.297 -0.446  1.00 13.90 ? 14   DA  C "C1'" 1 
ATOM   273  N N9    . DA  B 2 4   ? 3.783   -11.137 1.007   1.00 14.44 ? 14   DA  C N9    1 
ATOM   274  C C8    . DA  B 2 4   ? 4.819   -11.122 1.891   1.00 14.79 ? 14   DA  C C8    1 
ATOM   275  N N7    . DA  B 2 4   ? 4.449   -10.998 3.151   1.00 14.63 ? 14   DA  C N7    1 
ATOM   276  C C5    . DA  B 2 4   ? 3.080   -10.957 3.086   1.00 14.76 ? 14   DA  C C5    1 
ATOM   277  C C6    . DA  B 2 4   ? 2.083   -10.829 4.084   1.00 14.16 ? 14   DA  C C6    1 
ATOM   278  N N6    . DA  B 2 4   ? 2.375   -10.744 5.373   1.00 15.90 ? 14   DA  C N6    1 
ATOM   279  N N1    . DA  B 2 4   ? 0.791   -10.812 3.690   1.00 15.72 ? 14   DA  C N1    1 
ATOM   280  C C2    . DA  B 2 4   ? 0.517   -10.903 2.388   1.00 14.88 ? 14   DA  C C2    1 
ATOM   281  N N3    . DA  B 2 4   ? 1.373   -11.025 1.367   1.00 15.13 ? 14   DA  C N3    1 
ATOM   282  C C4    . DA  B 2 4   ? 2.643   -11.044 1.785   1.00 14.22 ? 14   DA  C C4    1 
HETATM 283  O "O5'" . 3DR B 2 5   ? 3.955   -6.648  -2.492  1.00 11.94 ? 15   3DR C "O5'" 1 
HETATM 284  P P     . 3DR B 2 5   ? 5.212   -7.402  -3.130  1.00 11.99 ? 15   3DR C P     1 
HETATM 285  O OP1   . 3DR B 2 5   ? 5.291   -7.207  -4.601  1.00 12.00 ? 15   3DR C OP1   1 
HETATM 286  O OP2   . 3DR B 2 5   ? 6.397   -7.058  -2.298  1.00 11.28 ? 15   3DR C OP2   1 
HETATM 287  C "C2'" . 3DR B 2 5   ? -0.642  -6.699  -2.224  1.00 16.03 ? 15   3DR C "C2'" 1 
HETATM 288  C "C5'" . 3DR B 2 5   ? 2.769   -6.488  -3.274  1.00 12.33 ? 15   3DR C "C5'" 1 
HETATM 289  C "C4'" . 3DR B 2 5   ? 1.632   -7.433  -2.889  1.00 13.20 ? 15   3DR C "C4'" 1 
HETATM 290  O "O4'" . 3DR B 2 5   ? 1.431   -7.554  -1.467  1.00 16.30 ? 15   3DR C "O4'" 1 
HETATM 291  C "C1'" . 3DR B 2 5   ? 0.302   -6.801  -1.039  1.00 16.71 ? 15   3DR C "C1'" 1 
HETATM 292  C "C3'" . 3DR B 2 5   ? 0.272   -6.994  -3.427  1.00 13.96 ? 15   3DR C "C3'" 1 
HETATM 293  O "O3'" . 3DR B 2 5   ? -0.240  -8.073  -4.165  1.00 12.91 ? 15   3DR C "O3'" 1 
ATOM   294  P P     . DC  B 2 6   ? -0.196  -8.064  -5.748  1.00 14.88 ? 16   DC  C P     1 
ATOM   295  O OP1   . DC  B 2 6   ? -0.881  -9.320  -6.179  1.00 16.49 ? 16   DC  C OP1   1 
ATOM   296  O OP2   . DC  B 2 6   ? 1.150   -7.736  -6.269  1.00 13.80 ? 16   DC  C OP2   1 
ATOM   297  O "O5'" . DC  B 2 6   ? -1.135  -6.832  -6.176  1.00 13.94 ? 16   DC  C "O5'" 1 
ATOM   298  C "C5'" . DC  B 2 6   ? -2.554  -6.810  -5.949  1.00 13.84 ? 16   DC  C "C5'" 1 
ATOM   299  C "C4'" . DC  B 2 6   ? -3.073  -5.365  -5.938  1.00 13.50 ? 16   DC  C "C4'" 1 
ATOM   300  O "O4'" . DC  B 2 6   ? -2.726  -4.689  -4.699  1.00 9.67  ? 16   DC  C "O4'" 1 
ATOM   301  C "C3'" . DC  B 2 6   ? -2.507  -4.460  -7.026  1.00 11.54 ? 16   DC  C "C3'" 1 
ATOM   302  O "O3'" . DC  B 2 6   ? -3.502  -3.516  -7.330  1.00 12.78 ? 16   DC  C "O3'" 1 
ATOM   303  C "C2'" . DC  B 2 6   ? -1.355  -3.723  -6.351  1.00 10.74 ? 16   DC  C "C2'" 1 
ATOM   304  C "C1'" . DC  B 2 6   ? -2.000  -3.478  -4.987  1.00 9.94  ? 16   DC  C "C1'" 1 
ATOM   305  N N1    . DC  B 2 6   ? -1.027  -3.314  -3.861  1.00 8.80  ? 16   DC  C N1    1 
ATOM   306  C C2    . DC  B 2 6   ? -1.521  -3.189  -2.548  1.00 8.56  ? 16   DC  C C2    1 
ATOM   307  O O2    . DC  B 2 6   ? -2.756  -3.130  -2.340  1.00 8.75  ? 16   DC  C O2    1 
ATOM   308  N N3    . DC  B 2 6   ? -0.608  -3.091  -1.542  1.00 7.92  ? 16   DC  C N3    1 
ATOM   309  C C4    . DC  B 2 6   ? 0.694   -3.126  -1.800  1.00 8.00  ? 16   DC  C C4    1 
ATOM   310  N N4    . DC  B 2 6   ? 1.525   -3.049  -0.769  1.00 8.37  ? 16   DC  C N4    1 
ATOM   311  C C5    . DC  B 2 6   ? 1.218   -3.232  -3.125  1.00 8.05  ? 16   DC  C C5    1 
ATOM   312  C C6    . DC  B 2 6   ? 0.323   -3.345  -4.114  1.00 9.65  ? 16   DC  C C6    1 
ATOM   313  P P     . DG  B 2 7   ? -4.322  -3.590  -8.705  1.00 12.03 ? 17   DG  C P     1 
ATOM   314  O OP1   . DG  B 2 7   ? -4.991  -4.931  -8.829  1.00 12.95 ? 17   DG  C OP1   1 
ATOM   315  O OP2   . DG  B 2 7   ? -3.451  -3.108  -9.800  1.00 10.84 ? 17   DG  C OP2   1 
ATOM   316  O "O5'" . DG  B 2 7   ? -5.421  -2.476  -8.493  1.00 10.73 ? 17   DG  C "O5'" 1 
ATOM   317  C "C5'" . DG  B 2 7   ? -6.467  -2.669  -7.536  1.00 11.72 ? 17   DG  C "C5'" 1 
ATOM   318  C "C4'" . DG  B 2 7   ? -6.556  -1.464  -6.621  1.00 10.30 ? 17   DG  C "C4'" 1 
ATOM   319  O "O4'" . DG  B 2 7   ? -5.414  -1.418  -5.710  1.00 10.65 ? 17   DG  C "O4'" 1 
ATOM   320  C "C3'" . DG  B 2 7   ? -6.562  -0.097  -7.318  1.00 9.48  ? 17   DG  C "C3'" 1 
ATOM   321  O "O3'" . DG  B 2 7   ? -7.517  0.736   -6.683  1.00 11.23 ? 17   DG  C "O3'" 1 
ATOM   322  C "C2'" . DG  B 2 7   ? -5.153  0.429   -7.112  1.00 10.51 ? 17   DG  C "C2'" 1 
ATOM   323  C "C1'" . DG  B 2 7   ? -4.913  -0.088  -5.702  1.00 9.39  ? 17   DG  C "C1'" 1 
ATOM   324  N N9    . DG  B 2 7   ? -3.519  -0.090  -5.277  1.00 9.37  ? 17   DG  C N9    1 
ATOM   325  C C8    . DG  B 2 7   ? -2.346  -0.184  -6.016  1.00 8.57  ? 17   DG  C C8    1 
ATOM   326  N N7    . DG  B 2 7   ? -1.281  -0.149  -5.250  1.00 8.63  ? 17   DG  C N7    1 
ATOM   327  C C5    . DG  B 2 7   ? -1.747  -0.045  -3.943  1.00 10.01 ? 17   DG  C C5    1 
ATOM   328  C C6    . DG  B 2 7   ? -1.064  0.044   -2.685  1.00 9.28  ? 17   DG  C C6    1 
ATOM   329  O O6    . DG  B 2 7   ? 0.155   0.024   -2.437  1.00 9.80  ? 17   DG  C O6    1 
ATOM   330  N N1    . DG  B 2 7   ? -1.981  0.156   -1.623  1.00 7.78  ? 17   DG  C N1    1 
ATOM   331  C C2    . DG  B 2 7   ? -3.359  0.152   -1.760  1.00 8.96  ? 17   DG  C C2    1 
ATOM   332  N N2    . DG  B 2 7   ? -4.112  0.249   -0.641  1.00 8.41  ? 17   DG  C N2    1 
ATOM   333  N N3    . DG  B 2 7   ? -3.998  0.091   -2.916  1.00 9.17  ? 17   DG  C N3    1 
ATOM   334  C C4    . DG  B 2 7   ? -3.127  -0.003  -3.957  1.00 9.39  ? 17   DG  C C4    1 
HETATM 335  P P     . 6MA B 2 8   ? -8.881  1.033   -7.451  1.00 13.64 ? 18   6MA C P     1 
HETATM 336  O OP1   . 6MA B 2 8   ? -9.417  -0.259  -7.954  1.00 12.51 ? 18   6MA C OP1   1 
HETATM 337  O OP2   . 6MA B 2 8   ? -8.606  2.102   -8.414  1.00 15.18 ? 18   6MA C OP2   1 
HETATM 338  O "O5'" . 6MA B 2 8   ? -9.788  1.658   -6.284  1.00 12.92 ? 18   6MA C "O5'" 1 
HETATM 339  C "C5'" . 6MA B 2 8   ? -10.201 0.830   -5.189  1.00 11.54 ? 18   6MA C "C5'" 1 
HETATM 340  C "C4'" . 6MA B 2 8   ? -10.143 1.637   -3.900  1.00 11.02 ? 18   6MA C "C4'" 1 
HETATM 341  O "O4'" . 6MA B 2 8   ? -8.757  1.834   -3.519  1.00 10.32 ? 18   6MA C "O4'" 1 
HETATM 342  C "C3'" . 6MA B 2 8   ? -10.773 3.024   -3.968  1.00 10.07 ? 18   6MA C "C3'" 1 
HETATM 343  O "O3'" . 6MA B 2 8   ? -11.341 3.270   -2.676  1.00 11.87 ? 18   6MA C "O3'" 1 
HETATM 344  C "C2'" . 6MA B 2 8   ? -9.582  3.945   -4.284  1.00 9.98  ? 18   6MA C "C2'" 1 
HETATM 345  C "C1'" . 6MA B 2 8   ? -8.466  3.230   -3.530  1.00 9.28  ? 18   6MA C "C1'" 1 
HETATM 346  N N9    . 6MA B 2 8   ? -7.132  3.375   -4.121  1.00 9.65  ? 18   6MA C N9    1 
HETATM 347  C C8    . 6MA B 2 8   ? -6.773  3.505   -5.438  1.00 11.02 ? 18   6MA C C8    1 
HETATM 348  N N7    . 6MA B 2 8   ? -5.473  3.608   -5.623  1.00 8.63  ? 18   6MA C N7    1 
HETATM 349  C C5    . 6MA B 2 8   ? -4.945  3.473   -4.339  1.00 9.56  ? 18   6MA C C5    1 
HETATM 350  C C6    . 6MA B 2 8   ? -3.627  3.490   -3.812  1.00 8.94  ? 18   6MA C C6    1 
HETATM 351  N N1    . 6MA B 2 8   ? -3.518  3.376   -2.462  1.00 7.59  ? 18   6MA C N1    1 
HETATM 352  C C2    . 6MA B 2 8   ? -4.611  3.226   -1.692  1.00 9.43  ? 18   6MA C C2    1 
HETATM 353  N N3    . 6MA B 2 8   ? -5.886  3.216   -2.059  1.00 10.49 ? 18   6MA C N3    1 
HETATM 354  C C4    . 6MA B 2 8   ? -5.976  3.334   -3.405  1.00 10.40 ? 18   6MA C C4    1 
HETATM 355  N N6    . 6MA B 2 8   ? -2.467  3.588   -4.505  1.00 10.25 ? 18   6MA C N6    1 
HETATM 356  C C1    . 6MA B 2 8   ? -2.372  3.468   -5.972  1.00 9.07  ? 18   6MA C C1    1 
ATOM   357  P P     . DA  B 2 9   ? -12.050 4.631   -2.254  1.00 12.00 ? 19   DA  C P     1 
ATOM   358  O OP1   . DA  B 2 9   ? -13.098 4.269   -1.263  1.00 12.23 ? 19   DA  C OP1   1 
ATOM   359  O OP2   . DA  B 2 9   ? -12.388 5.415   -3.475  1.00 12.74 ? 19   DA  C OP2   1 
ATOM   360  O "O5'" . DA  B 2 9   ? -10.927 5.426   -1.472  1.00 10.73 ? 19   DA  C "O5'" 1 
ATOM   361  C "C5'" . DA  B 2 9   ? -10.593 5.056   -0.111  1.00 12.00 ? 19   DA  C "C5'" 1 
ATOM   362  C "C4'" . DA  B 2 9   ? -9.362  5.807   0.377   1.00 13.72 ? 19   DA  C "C4'" 1 
ATOM   363  O "O4'" . DA  B 2 9   ? -8.216  5.399   -0.404  1.00 12.56 ? 19   DA  C "O4'" 1 
ATOM   364  C "C3'" . DA  B 2 9   ? -9.418  7.304   0.170   1.00 14.45 ? 19   DA  C "C3'" 1 
ATOM   365  O "O3'" . DA  B 2 9   ? -10.055 7.909   1.274   1.00 13.53 ? 19   DA  C "O3'" 1 
ATOM   366  C "C2'" . DA  B 2 9   ? -7.939  7.704   0.124   1.00 16.23 ? 19   DA  C "C2'" 1 
ATOM   367  C "C1'" . DA  B 2 9   ? -7.281  6.454   -0.427  1.00 14.24 ? 19   DA  C "C1'" 1 
ATOM   368  N N9    . DA  B 2 9   ? -6.704  6.566   -1.773  1.00 12.90 ? 19   DA  C N9    1 
ATOM   369  C C8    . DA  B 2 9   ? -7.283  6.651   -3.014  1.00 12.61 ? 19   DA  C C8    1 
ATOM   370  N N7    . DA  B 2 9   ? -6.383  6.724   -3.995  1.00 11.86 ? 19   DA  C N7    1 
ATOM   371  C C5    . DA  B 2 9   ? -5.157  6.684   -3.340  1.00 11.16 ? 19   DA  C C5    1 
ATOM   372  C C6    . DA  B 2 9   ? -3.805  6.726   -3.771  1.00 11.07 ? 19   DA  C C6    1 
ATOM   373  N N6    . DA  B 2 9   ? -3.404  6.814   -5.050  1.00 11.29 ? 19   DA  C N6    1 
ATOM   374  N N1    . DA  B 2 9   ? -2.854  6.669   -2.825  1.00 10.94 ? 19   DA  C N1    1 
ATOM   375  C C2    . DA  B 2 9   ? -3.176  6.574   -1.528  1.00 11.16 ? 19   DA  C C2    1 
ATOM   376  N N3    . DA  B 2 9   ? -4.404  6.541   -1.001  1.00 11.54 ? 19   DA  C N3    1 
ATOM   377  C C4    . DA  B 2 9   ? -5.347  6.600   -1.968  1.00 11.40 ? 19   DA  C C4    1 
ATOM   378  P P     . DC  B 2 10  ? -10.493 9.452   1.185   1.00 14.04 ? 20   DC  C P     1 
ATOM   379  O OP1   . DC  B 2 10  ? -11.265 9.688   2.448   1.00 12.71 ? 20   DC  C OP1   1 
ATOM   380  O OP2   . DC  B 2 10  ? -11.113 9.758   -0.125  1.00 14.50 ? 20   DC  C OP2   1 
ATOM   381  O "O5'" . DC  B 2 10  ? -9.156  10.303  1.277   1.00 15.48 ? 20   DC  C "O5'" 1 
ATOM   382  C "C5'" . DC  B 2 10  ? -8.394  10.309  2.469   1.00 14.49 ? 20   DC  C "C5'" 1 
ATOM   383  C "C4'" . DC  B 2 10  ? -7.169  11.124  2.165   1.00 15.51 ? 20   DC  C "C4'" 1 
ATOM   384  O "O4'" . DC  B 2 10  ? -6.367  10.255  1.330   1.00 13.70 ? 20   DC  C "O4'" 1 
ATOM   385  C "C3'" . DC  B 2 10  ? -7.474  12.319  1.251   1.00 17.93 ? 20   DC  C "C3'" 1 
ATOM   386  O "O3'" . DC  B 2 10  ? -7.950  13.513  1.952   1.00 21.82 ? 20   DC  C "O3'" 1 
ATOM   387  C "C2'" . DC  B 2 10  ? -6.152  12.509  0.536   1.00 14.32 ? 20   DC  C "C2'" 1 
ATOM   388  C "C1'" . DC  B 2 10  ? -5.576  11.087  0.501   1.00 13.84 ? 20   DC  C "C1'" 1 
ATOM   389  N N1    . DC  B 2 10  ? -5.474  10.689  -0.915  1.00 12.33 ? 20   DC  C N1    1 
ATOM   390  C C2    . DC  B 2 10  ? -4.185  10.450  -1.414  1.00 12.23 ? 20   DC  C C2    1 
ATOM   391  O O2    . DC  B 2 10  ? -3.208  10.517  -0.645  1.00 13.03 ? 20   DC  C O2    1 
ATOM   392  N N3    . DC  B 2 10  ? -4.072  10.136  -2.721  1.00 11.87 ? 20   DC  C N3    1 
ATOM   393  C C4    . DC  B 2 10  ? -5.134  10.053  -3.528  1.00 11.94 ? 20   DC  C C4    1 
ATOM   394  N N4    . DC  B 2 10  ? -4.886  9.769   -4.815  1.00 10.41 ? 20   DC  C N4    1 
ATOM   395  C C5    . DC  B 2 10  ? -6.466  10.287  -3.040  1.00 13.52 ? 20   DC  C C5    1 
ATOM   396  C C6    . DC  B 2 10  ? -6.579  10.624  -1.740  1.00 12.77 ? 20   DC  C C6    1 
ATOM   397  O "O5'" . DG  C 1 1   ? 20.004  -14.301 52.571  1.00 20.47 ? 1    DG  E "O5'" 1 
ATOM   398  C "C5'" . DG  C 1 1   ? 19.330  -14.813 53.725  1.00 19.82 ? 1    DG  E "C5'" 1 
ATOM   399  C "C4'" . DG  C 1 1   ? 19.612  -13.947 54.949  1.00 17.06 ? 1    DG  E "C4'" 1 
ATOM   400  O "O4'" . DG  C 1 1   ? 21.025  -14.003 55.281  1.00 16.91 ? 1    DG  E "O4'" 1 
ATOM   401  C "C3'" . DG  C 1 1   ? 19.243  -12.472 54.778  1.00 14.15 ? 1    DG  E "C3'" 1 
ATOM   402  O "O3'" . DG  C 1 1   ? 18.588  -12.083 55.983  1.00 13.60 ? 1    DG  E "O3'" 1 
ATOM   403  C "C2'" . DG  C 1 1   ? 20.582  -11.789 54.576  1.00 15.03 ? 1    DG  E "C2'" 1 
ATOM   404  C "C1'" . DG  C 1 1   ? 21.573  -12.719 55.283  1.00 13.69 ? 1    DG  E "C1'" 1 
ATOM   405  N N9    . DG  C 1 1   ? 22.871  -12.751 54.612  1.00 13.11 ? 1    DG  E N9    1 
ATOM   406  C C8    . DG  C 1 1   ? 23.186  -13.079 53.305  1.00 13.65 ? 1    DG  E C8    1 
ATOM   407  N N7    . DG  C 1 1   ? 24.454  -13.012 53.040  1.00 11.64 ? 1    DG  E N7    1 
ATOM   408  C C5    . DG  C 1 1   ? 25.028  -12.580 54.237  1.00 12.11 ? 1    DG  E C5    1 
ATOM   409  C C6    . DG  C 1 1   ? 26.381  -12.316 54.574  1.00 12.05 ? 1    DG  E C6    1 
ATOM   410  O O6    . DG  C 1 1   ? 27.391  -12.361 53.853  1.00 13.00 ? 1    DG  E O6    1 
ATOM   411  N N1    . DG  C 1 1   ? 26.525  -11.934 55.907  1.00 12.75 ? 1    DG  E N1    1 
ATOM   412  C C2    . DG  C 1 1   ? 25.486  -11.831 56.807  1.00 11.96 ? 1    DG  E C2    1 
ATOM   413  N N2    . DG  C 1 1   ? 25.836  -11.463 58.057  1.00 14.00 ? 1    DG  E N2    1 
ATOM   414  N N3    . DG  C 1 1   ? 24.214  -12.071 56.512  1.00 13.87 ? 1    DG  E N3    1 
ATOM   415  C C4    . DG  C 1 1   ? 24.061  -12.449 55.214  1.00 12.56 ? 1    DG  E C4    1 
ATOM   416  P P     . DT  C 1 2   ? 18.206  -10.572 56.342  1.00 12.16 ? 2    DT  E P     1 
ATOM   417  O OP1   . DT  C 1 2   ? 17.141  -10.689 57.342  1.00 12.23 ? 2    DT  E OP1   1 
ATOM   418  O OP2   . DT  C 1 2   ? 17.999  -9.759  55.116  1.00 12.73 ? 2    DT  E OP2   1 
ATOM   419  O "O5'" . DT  C 1 2   ? 19.521  -9.992  57.053  1.00 12.58 ? 2    DT  E "O5'" 1 
ATOM   420  C "C5'" . DT  C 1 2   ? 19.916  -10.392 58.364  1.00 12.89 ? 2    DT  E "C5'" 1 
ATOM   421  C "C4'" . DT  C 1 2   ? 20.902  -9.371  58.930  1.00 12.28 ? 2    DT  E "C4'" 1 
ATOM   422  O "O4'" . DT  C 1 2   ? 22.180  -9.488  58.253  1.00 11.96 ? 2    DT  E "O4'" 1 
ATOM   423  C "C3'" . DT  C 1 2   ? 20.560  -7.874  58.801  1.00 11.75 ? 2    DT  E "C3'" 1 
ATOM   424  O "O3'" . DT  C 1 2   ? 21.205  -7.205  59.883  1.00 11.80 ? 2    DT  E "O3'" 1 
ATOM   425  C "C2'" . DT  C 1 2   ? 21.254  -7.479  57.499  1.00 11.32 ? 2    DT  E "C2'" 1 
ATOM   426  C "C1'" . DT  C 1 2   ? 22.560  -8.219  57.751  1.00 11.90 ? 2    DT  E "C1'" 1 
ATOM   427  N N1    . DT  C 1 2   ? 23.458  -8.428  56.590  1.00 12.22 ? 2    DT  E N1    1 
ATOM   428  C C2    . DT  C 1 2   ? 24.817  -8.225  56.763  1.00 11.58 ? 2    DT  E C2    1 
ATOM   429  O O2    . DT  C 1 2   ? 25.342  -7.885  57.831  1.00 11.13 ? 2    DT  E O2    1 
ATOM   430  N N3    . DT  C 1 2   ? 25.567  -8.473  55.643  1.00 11.84 ? 2    DT  E N3    1 
ATOM   431  C C4    . DT  C 1 2   ? 25.105  -8.870  54.396  1.00 12.28 ? 2    DT  E C4    1 
ATOM   432  O O4    . DT  C 1 2   ? 25.899  -9.063  53.478  1.00 13.02 ? 2    DT  E O4    1 
ATOM   433  C C5    . DT  C 1 2   ? 23.664  -9.070  54.281  1.00 11.80 ? 2    DT  E C5    1 
ATOM   434  C C7    . DT  C 1 2   ? 23.048  -9.650  53.021  1.00 11.41 ? 2    DT  E C7    1 
ATOM   435  C C6    . DT  C 1 2   ? 22.913  -8.841  55.377  1.00 11.89 ? 2    DT  E C6    1 
ATOM   436  P P     . DT  C 1 3   ? 20.457  -6.941  61.281  1.00 12.14 ? 3    DT  E P     1 
ATOM   437  O OP1   . DT  C 1 3   ? 20.065  -8.231  61.887  1.00 11.07 ? 3    DT  E OP1   1 
ATOM   438  O OP2   . DT  C 1 3   ? 19.465  -5.896  61.038  1.00 11.47 ? 3    DT  E OP2   1 
ATOM   439  O "O5'" . DT  C 1 3   ? 21.702  -6.326  62.095  1.00 10.79 ? 3    DT  E "O5'" 1 
ATOM   440  C "C5'" . DT  C 1 3   ? 22.779  -7.191  62.437  1.00 9.36  ? 3    DT  E "C5'" 1 
ATOM   441  C "C4'" . DT  C 1 3   ? 24.107  -6.497  62.258  1.00 10.24 ? 3    DT  E "C4'" 1 
ATOM   442  O "O4'" . DT  C 1 3   ? 24.432  -6.399  60.859  1.00 8.29  ? 3    DT  E "O4'" 1 
ATOM   443  C "C3'" . DT  C 1 3   ? 24.162  -5.053  62.774  1.00 9.60  ? 3    DT  E "C3'" 1 
ATOM   444  O "O3'" . DT  C 1 3   ? 24.956  -5.068  63.952  1.00 10.80 ? 3    DT  E "O3'" 1 
ATOM   445  C "C2'" . DT  C 1 3   ? 24.768  -4.218  61.629  1.00 9.83  ? 3    DT  E "C2'" 1 
ATOM   446  C "C1'" . DT  C 1 3   ? 25.338  -5.295  60.730  1.00 10.14 ? 3    DT  E "C1'" 1 
ATOM   447  N N1    . DT  C 1 3   ? 25.408  -5.067  59.237  1.00 9.29  ? 3    DT  E N1    1 
ATOM   448  C C2    . DT  C 1 3   ? 26.637  -5.149  58.582  1.00 9.76  ? 3    DT  E C2    1 
ATOM   449  O O2    . DT  C 1 3   ? 27.728  -5.336  59.125  1.00 10.24 ? 3    DT  E O2    1 
ATOM   450  N N3    . DT  C 1 3   ? 26.552  -5.009  57.216  1.00 10.39 ? 3    DT  E N3    1 
ATOM   451  C C4    . DT  C 1 3   ? 25.398  -4.791  56.475  1.00 9.67  ? 3    DT  E C4    1 
ATOM   452  O O4    . DT  C 1 3   ? 25.424  -4.704  55.259  1.00 9.18  ? 3    DT  E O4    1 
ATOM   453  C C5    . DT  C 1 3   ? 24.154  -4.716  57.216  1.00 9.82  ? 3    DT  E C5    1 
ATOM   454  C C7    . DT  C 1 3   ? 22.897  -4.204  56.537  1.00 11.66 ? 3    DT  E C7    1 
ATOM   455  C C6    . DT  C 1 3   ? 24.213  -4.851  58.548  1.00 11.30 ? 3    DT  E C6    1 
ATOM   456  P P     . DC  C 1 4   ? 24.743  -3.948  65.075  1.00 9.54  ? 4    DC  E P     1 
ATOM   457  O OP1   . DC  C 1 4   ? 25.233  -4.532  66.359  1.00 10.25 ? 4    DC  E OP1   1 
ATOM   458  O OP2   . DC  C 1 4   ? 23.364  -3.347  64.992  1.00 8.21  ? 4    DC  E OP2   1 
ATOM   459  O "O5'" . DC  C 1 4   ? 25.758  -2.833  64.598  1.00 8.18  ? 4    DC  E "O5'" 1 
ATOM   460  C "C5'" . DC  C 1 4   ? 27.149  -2.943  64.979  1.00 8.79  ? 4    DC  E "C5'" 1 
ATOM   461  C "C4'" . DC  C 1 4   ? 27.969  -1.898  64.231  1.00 9.80  ? 4    DC  E "C4'" 1 
ATOM   462  O "O4'" . DC  C 1 4   ? 27.740  -2.096  62.816  1.00 10.35 ? 4    DC  E "O4'" 1 
ATOM   463  C "C3'" . DC  C 1 4   ? 27.529  -0.455  64.488  1.00 9.99  ? 4    DC  E "C3'" 1 
ATOM   464  O "O3'" . DC  C 1 4   ? 28.289  0.008   65.618  1.00 8.17  ? 4    DC  E "O3'" 1 
ATOM   465  C "C2'" . DC  C 1 4   ? 27.815  0.287   63.189  1.00 9.27  ? 4    DC  E "C2'" 1 
ATOM   466  C "C1'" . DC  C 1 4   ? 27.884  -0.856  62.153  1.00 10.22 ? 4    DC  E "C1'" 1 
ATOM   467  N N1    . DC  C 1 4   ? 26.831  -0.858  61.114  1.00 10.20 ? 4    DC  E N1    1 
ATOM   468  C C2    . DC  C 1 4   ? 27.206  -1.289  59.831  1.00 13.43 ? 4    DC  E C2    1 
ATOM   469  O O2    . DC  C 1 4   ? 28.373  -1.631  59.598  1.00 14.44 ? 4    DC  E O2    1 
ATOM   470  N N3    . DC  C 1 4   ? 26.259  -1.318  58.863  1.00 11.24 ? 4    DC  E N3    1 
ATOM   471  C C4    . DC  C 1 4   ? 24.995  -0.964  59.141  1.00 11.95 ? 4    DC  E C4    1 
ATOM   472  N N4    . DC  C 1 4   ? 24.129  -1.032  58.123  1.00 13.24 ? 4    DC  E N4    1 
ATOM   473  C C5    . DC  C 1 4   ? 24.570  -0.542  60.437  1.00 12.84 ? 4    DC  E C5    1 
ATOM   474  C C6    . DC  C 1 4   ? 25.525  -0.510  61.396  1.00 11.96 ? 4    DC  E C6    1 
ATOM   475  P P     . DG  C 1 5   ? 28.180  1.493   66.212  1.00 8.50  ? 5    DG  E P     1 
ATOM   476  O OP1   . DG  C 1 5   ? 28.837  1.382   67.544  1.00 7.06  ? 5    DG  E OP1   1 
ATOM   477  O OP2   . DG  C 1 5   ? 26.832  2.070   66.058  1.00 7.96  ? 5    DG  E OP2   1 
ATOM   478  O "O5'" . DG  C 1 5   ? 29.156  2.382   65.290  1.00 9.12  ? 5    DG  E "O5'" 1 
ATOM   479  C "C5'" . DG  C 1 5   ? 30.536  2.045   65.102  1.00 7.22  ? 5    DG  E "C5'" 1 
ATOM   480  C "C4'" . DG  C 1 5   ? 31.139  2.981   64.053  1.00 9.49  ? 5    DG  E "C4'" 1 
ATOM   481  O "O4'" . DG  C 1 5   ? 30.462  2.776   62.782  1.00 9.52  ? 5    DG  E "O4'" 1 
ATOM   482  C "C3'" . DG  C 1 5   ? 30.987  4.476   64.333  1.00 8.83  ? 5    DG  E "C3'" 1 
ATOM   483  O "O3'" . DG  C 1 5   ? 32.100  5.181   63.737  1.00 10.38 ? 5    DG  E "O3'" 1 
ATOM   484  C "C2'" . DG  C 1 5   ? 29.654  4.839   63.672  1.00 7.38  ? 5    DG  E "C2'" 1 
ATOM   485  C "C1'" . DG  C 1 5   ? 29.723  3.920   62.444  1.00 8.95  ? 5    DG  E "C1'" 1 
ATOM   486  N N9    . DG  C 1 5   ? 28.389  3.535   61.933  1.00 8.83  ? 5    DG  E N9    1 
ATOM   487  C C8    . DG  C 1 5   ? 27.152  3.646   62.541  1.00 9.09  ? 5    DG  E C8    1 
ATOM   488  N N7    . DG  C 1 5   ? 26.183  3.215   61.764  1.00 10.35 ? 5    DG  E N7    1 
ATOM   489  C C5    . DG  C 1 5   ? 26.807  2.844   60.583  1.00 10.45 ? 5    DG  E C5    1 
ATOM   490  C C6    . DG  C 1 5   ? 26.292  2.327   59.365  1.00 12.25 ? 5    DG  E C6    1 
ATOM   491  O O6    . DG  C 1 5   ? 25.105  2.087   59.103  1.00 11.86 ? 5    DG  E O6    1 
ATOM   492  N N1    . DG  C 1 5   ? 27.303  2.079   58.426  1.00 10.88 ? 5    DG  E N1    1 
ATOM   493  C C2    . DG  C 1 5   ? 28.656  2.290   58.618  1.00 11.03 ? 5    DG  E C2    1 
ATOM   494  N N2    . DG  C 1 5   ? 29.500  1.983   57.611  1.00 11.33 ? 5    DG  E N2    1 
ATOM   495  N N3    . DG  C 1 5   ? 29.150  2.782   59.749  1.00 9.12  ? 5    DG  E N3    1 
ATOM   496  C C4    . DG  C 1 5   ? 28.169  3.030   60.673  1.00 10.83 ? 5    DG  E C4    1 
HETATM 497  P P     . 2PR C 1 6   ? 33.400  5.468   64.663  1.00 10.71 ? 6    2PR E P     1 
HETATM 498  O OP1   . 2PR C 1 6   ? 34.338  6.135   63.753  1.00 11.14 ? 6    2PR E OP1   1 
HETATM 499  O OP2   . 2PR C 1 6   ? 33.849  4.249   65.351  1.00 11.21 ? 6    2PR E OP2   1 
HETATM 500  O "O5'" . 2PR C 1 6   ? 32.795  6.479   65.730  1.00 9.94  ? 6    2PR E "O5'" 1 
HETATM 501  C "C5'" . 2PR C 1 6   ? 33.585  6.794   66.908  1.00 10.81 ? 6    2PR E "C5'" 1 
HETATM 502  C "C4'" . 2PR C 1 6   ? 33.646  8.313   67.070  1.00 11.80 ? 6    2PR E "C4'" 1 
HETATM 503  O "O4'" . 2PR C 1 6   ? 34.424  8.677   68.227  1.00 12.94 ? 6    2PR E "O4'" 1 
HETATM 504  C "C3'" . 2PR C 1 6   ? 34.323  9.074   65.922  1.00 11.80 ? 6    2PR E "C3'" 1 
HETATM 505  O "O3'" . 2PR C 1 6   ? 33.668  10.344  65.762  1.00 12.94 ? 6    2PR E "O3'" 1 
HETATM 506  C "C2'" . 2PR C 1 6   ? 35.784  9.163   66.399  1.00 12.13 ? 6    2PR E "C2'" 1 
HETATM 507  C "C1'" . 2PR C 1 6   ? 35.619  9.393   67.894  1.00 12.94 ? 6    2PR E "C1'" 1 
HETATM 508  N N9    . 2PR C 1 6   ? 36.573  8.717   68.761  1.00 11.93 ? 6    2PR E N9    1 
HETATM 509  C C8    . 2PR C 1 6   ? 37.362  7.624   68.484  1.00 13.49 ? 6    2PR E C8    1 
HETATM 510  N N7    . 2PR C 1 6   ? 38.060  7.214   69.541  1.00 13.54 ? 6    2PR E N7    1 
HETATM 511  C C5    . 2PR C 1 6   ? 37.660  8.066   70.566  1.00 13.06 ? 6    2PR E C5    1 
HETATM 512  C C6    . 2PR C 1 6   ? 38.009  8.154   71.938  1.00 13.57 ? 6    2PR E C6    1 
HETATM 513  N N1    . 2PR C 1 6   ? 37.425  9.124   72.684  1.00 13.89 ? 6    2PR E N1    1 
HETATM 514  C C2    . 2PR C 1 6   ? 36.542  9.946   72.099  1.00 12.83 ? 6    2PR E C2    1 
HETATM 515  N N2    . 2PR C 1 6   ? 36.016  10.885  72.890  1.00 15.44 ? 6    2PR E N2    1 
HETATM 516  N N3    . 2PR C 1 6   ? 36.130  9.957   70.825  1.00 11.29 ? 6    2PR E N3    1 
HETATM 517  C C4    . 2PR C 1 6   ? 36.741  8.990   70.105  1.00 12.29 ? 6    2PR E C4    1 
ATOM   518  P P     . DT  C 1 7   ? 32.209  10.530  65.059  1.00 19.14 ? 7    DT  E P     1 
ATOM   519  O OP1   . DT  C 1 7   ? 32.154  11.967  64.637  1.00 19.71 ? 7    DT  E OP1   1 
ATOM   520  O OP2   . DT  C 1 7   ? 31.097  9.981   65.891  1.00 16.81 ? 7    DT  E OP2   1 
ATOM   521  O "O5'" . DT  C 1 7   ? 32.462  9.664   63.724  1.00 16.73 ? 7    DT  E "O5'" 1 
ATOM   522  C "C5'" . DT  C 1 7   ? 31.473  8.761   63.234  1.00 18.56 ? 7    DT  E "C5'" 1 
ATOM   523  C "C4'" . DT  C 1 7   ? 31.996  8.225   61.912  1.00 16.77 ? 7    DT  E "C4'" 1 
ATOM   524  O "O4'" . DT  C 1 7   ? 31.110  7.191   61.417  1.00 18.07 ? 7    DT  E "O4'" 1 
ATOM   525  C "C3'" . DT  C 1 7   ? 32.109  9.266   60.788  1.00 17.34 ? 7    DT  E "C3'" 1 
ATOM   526  O "O3'" . DT  C 1 7   ? 33.298  9.047   60.046  1.00 20.76 ? 7    DT  E "O3'" 1 
ATOM   527  C "C2'" . DT  C 1 7   ? 30.898  8.927   59.930  1.00 18.51 ? 7    DT  E "C2'" 1 
ATOM   528  C "C1'" . DT  C 1 7   ? 30.985  7.404   60.030  1.00 19.14 ? 7    DT  E "C1'" 1 
ATOM   529  N N1    . DT  C 1 7   ? 29.778  6.728   59.466  1.00 20.25 ? 7    DT  E N1    1 
ATOM   530  C C2    . DT  C 1 7   ? 29.900  6.023   58.278  1.00 20.50 ? 7    DT  E C2    1 
ATOM   531  O O2    . DT  C 1 7   ? 30.955  5.878   57.671  1.00 21.53 ? 7    DT  E O2    1 
ATOM   532  N N3    . DT  C 1 7   ? 28.723  5.463   57.846  1.00 19.12 ? 7    DT  E N3    1 
ATOM   533  C C4    . DT  C 1 7   ? 27.475  5.537   58.455  1.00 20.46 ? 7    DT  E C4    1 
ATOM   534  O O4    . DT  C 1 7   ? 26.484  4.985   57.976  1.00 22.13 ? 7    DT  E O4    1 
ATOM   535  C C5    . DT  C 1 7   ? 27.414  6.300   59.684  1.00 20.57 ? 7    DT  E C5    1 
ATOM   536  C C7    . DT  C 1 7   ? 26.154  6.390   60.491  1.00 18.38 ? 7    DT  E C7    1 
ATOM   537  C C6    . DT  C 1 7   ? 28.561  6.845   60.124  1.00 19.59 ? 7    DT  E C6    1 
ATOM   538  P P     . DG  C 1 8   ? 34.024  10.247  59.280  1.00 23.35 ? 8    DG  E P     1 
ATOM   539  O OP1   . DG  C 1 8   ? 35.337  9.769   58.801  1.00 25.33 ? 8    DG  E OP1   1 
ATOM   540  O OP2   . DG  C 1 8   ? 33.925  11.485  60.094  1.00 24.50 ? 8    DG  E OP2   1 
ATOM   541  O "O5'" . DG  C 1 8   ? 33.100  10.452  57.983  1.00 23.67 ? 8    DG  E "O5'" 1 
ATOM   542  C "C5'" . DG  C 1 8   ? 32.881  9.449   56.998  1.00 21.49 ? 8    DG  E "C5'" 1 
ATOM   543  C "C4'" . DG  C 1 8   ? 32.094  10.067  55.844  1.00 23.13 ? 8    DG  E "C4'" 1 
ATOM   544  O "O4'" . DG  C 1 8   ? 30.707  10.324  56.217  1.00 22.10 ? 8    DG  E "O4'" 1 
ATOM   545  C "C3'" . DG  C 1 8   ? 32.608  11.413  55.336  1.00 23.39 ? 8    DG  E "C3'" 1 
ATOM   546  O "O3'" . DG  C 1 8   ? 32.423  11.390  53.939  1.00 29.44 ? 8    DG  E "O3'" 1 
ATOM   547  C "C2'" . DG  C 1 8   ? 31.708  12.456  56.018  1.00 21.84 ? 8    DG  E "C2'" 1 
ATOM   548  C "C1'" . DG  C 1 8   ? 30.381  11.702  56.099  1.00 17.81 ? 8    DG  E "C1'" 1 
ATOM   549  N N9    . DG  C 1 8   ? 29.550  11.966  57.278  1.00 16.09 ? 8    DG  E N9    1 
ATOM   550  C C8    . DG  C 1 8   ? 29.978  11.961  58.583  1.00 16.07 ? 8    DG  E C8    1 
ATOM   551  N N7    . DG  C 1 8   ? 29.035  12.193  59.455  1.00 15.84 ? 8    DG  E N7    1 
ATOM   552  C C5    . DG  C 1 8   ? 27.891  12.352  58.672  1.00 15.29 ? 8    DG  E C5    1 
ATOM   553  C C6    . DG  C 1 8   ? 26.549  12.641  59.048  1.00 15.61 ? 8    DG  E C6    1 
ATOM   554  O O6    . DG  C 1 8   ? 26.080  12.777  60.187  1.00 16.05 ? 8    DG  E O6    1 
ATOM   555  N N1    . DG  C 1 8   ? 25.691  12.729  57.939  1.00 14.63 ? 8    DG  E N1    1 
ATOM   556  C C2    . DG  C 1 8   ? 26.092  12.569  56.632  1.00 15.26 ? 8    DG  E C2    1 
ATOM   557  N N2    . DG  C 1 8   ? 25.130  12.704  55.699  1.00 15.71 ? 8    DG  E N2    1 
ATOM   558  N N3    . DG  C 1 8   ? 27.347  12.317  56.262  1.00 15.58 ? 8    DG  E N3    1 
ATOM   559  C C4    . DG  C 1 8   ? 28.196  12.215  57.326  1.00 15.71 ? 8    DG  E C4    1 
ATOM   560  P P     . DT  C 1 9   ? 33.005  12.546  52.994  1.00 32.48 ? 9    DT  E P     1 
ATOM   561  O OP1   . DT  C 1 9   ? 33.372  11.857  51.740  1.00 32.49 ? 9    DT  E OP1   1 
ATOM   562  O OP2   . DT  C 1 9   ? 33.963  13.416  53.720  1.00 32.06 ? 9    DT  E OP2   1 
ATOM   563  O "O5'" . DT  C 1 9   ? 31.724  13.469  52.760  1.00 29.03 ? 9    DT  E "O5'" 1 
ATOM   564  C "C5'" . DT  C 1 9   ? 30.600  12.972  52.061  1.00 26.94 ? 9    DT  E "C5'" 1 
ATOM   565  C "C4'" . DT  C 1 9   ? 29.520  14.026  52.130  1.00 25.47 ? 9    DT  E "C4'" 1 
ATOM   566  O "O4'" . DT  C 1 9   ? 28.924  14.082  53.451  1.00 22.89 ? 9    DT  E "O4'" 1 
ATOM   567  C "C3'" . DT  C 1 9   ? 29.993  15.443  51.813  1.00 25.58 ? 9    DT  E "C3'" 1 
ATOM   568  O "O3'" . DT  C 1 9   ? 29.317  15.806  50.621  1.00 30.04 ? 9    DT  E "O3'" 1 
ATOM   569  C "C2'" . DT  C 1 9   ? 29.555  16.302  53.001  1.00 23.02 ? 9    DT  E "C2'" 1 
ATOM   570  C "C1'" . DT  C 1 9   ? 28.518  15.420  53.690  1.00 19.88 ? 9    DT  E "C1'" 1 
ATOM   571  N N1    . DT  C 1 9   ? 28.364  15.555  55.162  1.00 18.27 ? 9    DT  E N1    1 
ATOM   572  C C2    . DT  C 1 9   ? 27.087  15.708  55.690  1.00 19.05 ? 9    DT  E C2    1 
ATOM   573  O O2    . DT  C 1 9   ? 26.073  15.780  55.002  1.00 16.44 ? 9    DT  E O2    1 
ATOM   574  N N3    . DT  C 1 9   ? 27.038  15.791  57.067  1.00 16.92 ? 9    DT  E N3    1 
ATOM   575  C C4    . DT  C 1 9   ? 28.107  15.739  57.952  1.00 16.74 ? 9    DT  E C4    1 
ATOM   576  O O4    . DT  C 1 9   ? 27.932  15.823  59.173  1.00 17.84 ? 9    DT  E O4    1 
ATOM   577  C C5    . DT  C 1 9   ? 29.406  15.574  57.338  1.00 17.21 ? 9    DT  E C5    1 
ATOM   578  C C7    . DT  C 1 9   ? 30.642  15.451  58.179  1.00 19.53 ? 9    DT  E C7    1 
ATOM   579  C C6    . DT  C 1 9   ? 29.477  15.487  55.987  1.00 18.11 ? 9    DT  E C6    1 
ATOM   580  P P     . DC  C 1 10  ? 29.814  16.965  49.630  1.00 31.77 ? 10   DC  E P     1 
ATOM   581  O OP1   . DC  C 1 10  ? 29.789  16.431  48.241  1.00 32.30 ? 10   DC  E OP1   1 
ATOM   582  O OP2   . DC  C 1 10  ? 31.041  17.616  50.148  1.00 31.29 ? 10   DC  E OP2   1 
ATOM   583  O "O5'" . DC  C 1 10  ? 28.500  17.865  49.785  1.00 31.49 ? 10   DC  E "O5'" 1 
ATOM   584  C "C5'" . DC  C 1 10  ? 28.624  19.116  50.319  1.00 28.13 ? 10   DC  E "C5'" 1 
ATOM   585  C "C4'" . DC  C 1 10  ? 27.350  19.559  50.981  1.00 26.16 ? 10   DC  E "C4'" 1 
ATOM   586  O "O4'" . DC  C 1 10  ? 27.233  18.957  52.304  1.00 23.83 ? 10   DC  E "O4'" 1 
ATOM   587  C "C3'" . DC  C 1 10  ? 27.479  21.062  51.175  1.00 25.93 ? 10   DC  E "C3'" 1 
ATOM   588  O "O3'" . DC  C 1 10  ? 26.228  21.750  51.107  1.00 28.02 ? 10   DC  E "O3'" 1 
ATOM   589  C "C2'" . DC  C 1 10  ? 28.098  21.160  52.555  1.00 22.75 ? 10   DC  E "C2'" 1 
ATOM   590  C "C1'" . DC  C 1 10  ? 27.387  19.998  53.252  1.00 21.64 ? 10   DC  E "C1'" 1 
ATOM   591  N N1    . DC  C 1 10  ? 28.076  19.648  54.517  1.00 20.56 ? 10   DC  E N1    1 
ATOM   592  C C2    . DC  C 1 10  ? 27.273  19.445  55.642  1.00 17.69 ? 10   DC  E C2    1 
ATOM   593  O O2    . DC  C 1 10  ? 26.046  19.531  55.507  1.00 19.65 ? 10   DC  E O2    1 
ATOM   594  N N3    . DC  C 1 10  ? 27.867  19.162  56.820  1.00 18.21 ? 10   DC  E N3    1 
ATOM   595  C C4    . DC  C 1 10  ? 29.205  19.076  56.896  1.00 18.58 ? 10   DC  E C4    1 
ATOM   596  N N4    . DC  C 1 10  ? 29.744  18.789  58.068  1.00 20.92 ? 10   DC  E N4    1 
ATOM   597  C C5    . DC  C 1 10  ? 30.047  19.285  55.768  1.00 18.82 ? 10   DC  E C5    1 
ATOM   598  C C6    . DC  C 1 10  ? 29.446  19.570  54.603  1.00 19.73 ? 10   DC  E C6    1 
ATOM   599  O "O5'" . DG  D 2 1   ? 23.499  21.340  65.421  1.00 33.90 ? 11   DG  F "O5'" 1 
ATOM   600  C "C5'" . DG  D 2 1   ? 22.064  21.295  65.452  1.00 32.73 ? 11   DG  F "C5'" 1 
ATOM   601  C "C4'" . DG  D 2 1   ? 21.497  20.758  64.140  1.00 30.35 ? 11   DG  F "C4'" 1 
ATOM   602  O "O4'" . DG  D 2 1   ? 22.528  20.740  63.108  1.00 28.82 ? 11   DG  F "O4'" 1 
ATOM   603  C "C3'" . DG  D 2 1   ? 20.978  19.326  64.184  1.00 30.31 ? 11   DG  F "C3'" 1 
ATOM   604  O "O3'" . DG  D 2 1   ? 20.044  19.155  63.139  1.00 32.03 ? 11   DG  F "O3'" 1 
ATOM   605  C "C2'" . DG  D 2 1   ? 22.251  18.545  63.872  1.00 28.03 ? 11   DG  F "C2'" 1 
ATOM   606  C "C1'" . DG  D 2 1   ? 22.773  19.398  62.719  1.00 24.00 ? 11   DG  F "C1'" 1 
ATOM   607  N N9    . DG  D 2 1   ? 24.189  19.233  62.393  1.00 23.44 ? 11   DG  F N9    1 
ATOM   608  C C8    . DG  D 2 1   ? 25.240  19.055  63.268  1.00 22.38 ? 11   DG  F C8    1 
ATOM   609  N N7    . DG  D 2 1   ? 26.398  18.962  62.673  1.00 22.56 ? 11   DG  F N7    1 
ATOM   610  C C5    . DG  D 2 1   ? 26.101  19.065  61.316  1.00 22.07 ? 11   DG  F C5    1 
ATOM   611  C C6    . DG  D 2 1   ? 26.949  19.011  60.180  1.00 21.54 ? 11   DG  F C6    1 
ATOM   612  O O6    . DG  D 2 1   ? 28.181  18.870  60.137  1.00 21.96 ? 11   DG  F O6    1 
ATOM   613  N N1    . DG  D 2 1   ? 26.247  19.168  58.992  1.00 21.48 ? 11   DG  F N1    1 
ATOM   614  C C2    . DG  D 2 1   ? 24.888  19.350  58.900  1.00 21.11 ? 11   DG  F C2    1 
ATOM   615  N N2    . DG  D 2 1   ? 24.407  19.471  57.659  1.00 20.67 ? 11   DG  F N2    1 
ATOM   616  N N3    . DG  D 2 1   ? 24.069  19.392  59.956  1.00 21.21 ? 11   DG  F N3    1 
ATOM   617  C C4    . DG  D 2 1   ? 24.743  19.245  61.129  1.00 22.39 ? 11   DG  F C4    1 
ATOM   618  P P     . DA  D 2 2   ? 18.494  18.894  63.399  1.00 34.87 ? 12   DA  F P     1 
ATOM   619  O OP1   . DA  D 2 2   ? 17.916  20.170  63.888  1.00 34.98 ? 12   DA  F OP1   1 
ATOM   620  O OP2   . DA  D 2 2   ? 18.361  17.660  64.205  1.00 33.32 ? 12   DA  F OP2   1 
ATOM   621  O "O5'" . DA  D 2 2   ? 17.894  18.652  61.937  1.00 31.98 ? 12   DA  F "O5'" 1 
ATOM   622  C "C5'" . DA  D 2 2   ? 18.119  19.603  60.908  1.00 30.57 ? 12   DA  F "C5'" 1 
ATOM   623  C "C4'" . DA  D 2 2   ? 18.115  18.916  59.551  1.00 28.23 ? 12   DA  F "C4'" 1 
ATOM   624  O "O4'" . DA  D 2 2   ? 19.446  18.484  59.173  1.00 27.35 ? 12   DA  F "O4'" 1 
ATOM   625  C "C3'" . DA  D 2 2   ? 17.253  17.666  59.432  1.00 28.09 ? 12   DA  F "C3'" 1 
ATOM   626  O "O3'" . DA  D 2 2   ? 16.756  17.706  58.106  1.00 28.76 ? 12   DA  F "O3'" 1 
ATOM   627  C "C2'" . DA  D 2 2   ? 18.239  16.519  59.678  1.00 24.87 ? 12   DA  F "C2'" 1 
ATOM   628  C "C1'" . DA  D 2 2   ? 19.498  17.061  59.007  1.00 21.99 ? 12   DA  F "C1'" 1 
ATOM   629  N N9    . DA  D 2 2   ? 20.783  16.715  59.602  1.00 20.68 ? 12   DA  F N9    1 
ATOM   630  C C8    . DA  D 2 2   ? 21.047  16.548  60.936  1.00 19.36 ? 12   DA  F C8    1 
ATOM   631  N N7    . DA  D 2 2   ? 22.303  16.287  61.200  1.00 19.72 ? 12   DA  F N7    1 
ATOM   632  C C5    . DA  D 2 2   ? 22.916  16.278  59.945  1.00 19.03 ? 12   DA  F C5    1 
ATOM   633  C C6    . DA  D 2 2   ? 24.248  16.058  59.524  1.00 18.72 ? 12   DA  F C6    1 
ATOM   634  N N6    . DA  D 2 2   ? 25.260  15.806  60.363  1.00 18.64 ? 12   DA  F N6    1 
ATOM   635  N N1    . DA  D 2 2   ? 24.512  16.122  58.198  1.00 17.73 ? 12   DA  F N1    1 
ATOM   636  C C2    . DA  D 2 2   ? 23.516  16.400  57.338  1.00 16.86 ? 12   DA  F C2    1 
ATOM   637  N N3    . DA  D 2 2   ? 22.225  16.615  57.614  1.00 17.46 ? 12   DA  F N3    1 
ATOM   638  C C4    . DA  D 2 2   ? 21.989  16.549  58.946  1.00 20.41 ? 12   DA  F C4    1 
ATOM   639  P P     . DC  D 2 3   ? 15.680  16.662  57.554  1.00 30.01 ? 13   DC  F P     1 
ATOM   640  O OP1   . DC  D 2 3   ? 14.960  17.368  56.476  1.00 29.60 ? 13   DC  F OP1   1 
ATOM   641  O OP2   . DC  D 2 3   ? 15.012  15.988  58.686  1.00 30.78 ? 13   DC  F OP2   1 
ATOM   642  O "O5'" . DC  D 2 3   ? 16.621  15.539  56.896  1.00 27.70 ? 13   DC  F "O5'" 1 
ATOM   643  C "C5'" . DC  D 2 3   ? 17.356  15.769  55.715  1.00 23.47 ? 13   DC  F "C5'" 1 
ATOM   644  C "C4'" . DC  D 2 3   ? 18.281  14.586  55.520  1.00 21.86 ? 13   DC  F "C4'" 1 
ATOM   645  O "O4'" . DC  D 2 3   ? 19.363  14.644  56.483  1.00 19.69 ? 13   DC  F "O4'" 1 
ATOM   646  C "C3'" . DC  D 2 3   ? 17.611  13.220  55.746  1.00 20.40 ? 13   DC  F "C3'" 1 
ATOM   647  O "O3'" . DC  D 2 3   ? 17.860  12.377  54.621  1.00 21.41 ? 13   DC  F "O3'" 1 
ATOM   648  C "C2'" . DC  D 2 3   ? 18.280  12.681  57.006  1.00 20.87 ? 13   DC  F "C2'" 1 
ATOM   649  C "C1'" . DC  D 2 3   ? 19.661  13.291  56.774  1.00 18.90 ? 13   DC  F "C1'" 1 
ATOM   650  N N1    . DC  D 2 3   ? 20.635  13.192  57.889  1.00 17.41 ? 13   DC  F N1    1 
ATOM   651  C C2    . DC  D 2 3   ? 22.019  13.167  57.602  1.00 16.78 ? 13   DC  F C2    1 
ATOM   652  O O2    . DC  D 2 3   ? 22.431  13.231  56.432  1.00 16.93 ? 13   DC  F O2    1 
ATOM   653  N N3    . DC  D 2 3   ? 22.893  13.083  58.638  1.00 16.39 ? 13   DC  F N3    1 
ATOM   654  C C4    . DC  D 2 3   ? 22.439  12.993  59.894  1.00 16.66 ? 13   DC  F C4    1 
ATOM   655  N N4    . DC  D 2 3   ? 23.343  12.911  60.882  1.00 16.95 ? 13   DC  F N4    1 
ATOM   656  C C5    . DC  D 2 3   ? 21.041  13.035  60.208  1.00 17.65 ? 13   DC  F C5    1 
ATOM   657  C C6    . DC  D 2 3   ? 20.182  13.122  59.181  1.00 16.90 ? 13   DC  F C6    1 
ATOM   658  P P     . DA  D 2 4   ? 16.926  11.161  54.182  1.00 18.04 ? 14   DA  F P     1 
ATOM   659  O OP1   . DA  D 2 4   ? 16.187  11.569  52.963  1.00 21.44 ? 14   DA  F OP1   1 
ATOM   660  O OP2   . DA  D 2 4   ? 16.149  10.669  55.355  1.00 17.72 ? 14   DA  F OP2   1 
ATOM   661  O "O5'" . DA  D 2 4   ? 17.989  10.117  53.620  1.00 21.46 ? 14   DA  F "O5'" 1 
ATOM   662  C "C5'" . DA  D 2 4   ? 18.682  9.173   54.423  1.00 17.53 ? 14   DA  F "C5'" 1 
ATOM   663  C "C4'" . DA  D 2 4   ? 20.163  9.295   54.148  1.00 16.05 ? 14   DA  F "C4'" 1 
ATOM   664  O "O4'" . DA  D 2 4   ? 20.739  10.241  55.094  1.00 15.88 ? 14   DA  F "O4'" 1 
ATOM   665  C "C3'" . DA  D 2 4   ? 20.960  8.024   54.394  1.00 15.53 ? 14   DA  F "C3'" 1 
ATOM   666  O "O3'" . DA  D 2 4   ? 20.914  7.174   53.253  1.00 13.73 ? 14   DA  F "O3'" 1 
ATOM   667  C "C2'" . DA  D 2 4   ? 22.360  8.588   54.579  1.00 15.88 ? 14   DA  F "C2'" 1 
ATOM   668  C "C1'" . DA  D 2 4   ? 22.080  9.874   55.356  1.00 15.70 ? 14   DA  F "C1'" 1 
ATOM   669  N N9    . DA  D 2 4   ? 22.278  9.802   56.812  1.00 14.89 ? 14   DA  F N9    1 
ATOM   670  C C8    . DA  D 2 4   ? 21.289  9.871   57.751  1.00 15.29 ? 14   DA  F C8    1 
ATOM   671  N N7    . DA  D 2 4   ? 21.763  9.817   58.982  1.00 16.10 ? 14   DA  F N7    1 
ATOM   672  C C5    . DA  D 2 4   ? 23.121  9.690   58.826  1.00 15.79 ? 14   DA  F C5    1 
ATOM   673  C C6    . DA  D 2 4   ? 24.169  9.576   59.776  1.00 15.84 ? 14   DA  F C6    1 
ATOM   674  N N6    . DA  D 2 4   ? 23.915  9.566   61.085  1.00 16.35 ? 14   DA  F N6    1 
ATOM   675  N N1    . DA  D 2 4   ? 25.438  9.468   59.322  1.00 16.33 ? 14   DA  F N1    1 
ATOM   676  C C2    . DA  D 2 4   ? 25.642  9.472   57.984  1.00 16.65 ? 14   DA  F C2    1 
ATOM   677  N N3    . DA  D 2 4   ? 24.725  9.596   57.002  1.00 17.43 ? 14   DA  F N3    1 
ATOM   678  C C4    . DA  D 2 4   ? 23.468  9.684   57.496  1.00 13.43 ? 14   DA  F C4    1 
HETATM 679  O "O5'" . 3DR D 2 5   ? 21.546  4.922   54.178  1.00 11.72 ? 15   3DR F "O5'" 1 
HETATM 680  P P     . 3DR D 2 5   ? 20.372  5.667   53.400  1.00 11.95 ? 15   3DR F P     1 
HETATM 681  O OP1   . 3DR D 2 5   ? 20.317  5.231   51.988  1.00 11.10 ? 15   3DR F OP1   1 
HETATM 682  O OP2   . 3DR D 2 5   ? 19.175  5.556   54.283  1.00 9.79  ? 15   3DR F OP2   1 
HETATM 683  C "C2'" . 3DR D 2 5   ? 26.030  4.965   54.582  1.00 11.77 ? 15   3DR F "C2'" 1 
HETATM 684  C "C5'" . 3DR D 2 5   ? 22.746  4.526   53.502  1.00 12.14 ? 15   3DR F "C5'" 1 
HETATM 685  C "C4'" . 3DR D 2 5   ? 23.847  5.555   53.692  1.00 11.79 ? 15   3DR F "C4'" 1 
HETATM 686  O "O4'" . 3DR D 2 5   ? 23.965  6.006   55.075  1.00 14.11 ? 15   3DR F "O4'" 1 
HETATM 687  C "C1'" . 3DR D 2 5   ? 25.321  5.975   55.470  1.00 12.41 ? 15   3DR F "C1'" 1 
HETATM 688  C "C3'" . 3DR D 2 5   ? 25.225  5.055   53.277  1.00 11.66 ? 15   3DR F "C3'" 1 
HETATM 689  O "O3'" . 3DR D 2 5   ? 25.747  6.028   52.395  1.00 14.03 ? 15   3DR F "O3'" 1 
ATOM   690  P P     . DC  D 2 6   ? 25.805  5.809   50.819  1.00 14.37 ? 16   DC  F P     1 
ATOM   691  O OP1   . DC  D 2 6   ? 26.551  6.975   50.255  1.00 13.78 ? 16   DC  F OP1   1 
ATOM   692  O OP2   . DC  D 2 6   ? 24.465  5.447   50.318  1.00 12.77 ? 16   DC  F OP2   1 
ATOM   693  O "O5'" . DC  D 2 6   ? 26.716  4.506   50.644  1.00 14.72 ? 16   DC  F "O5'" 1 
ATOM   694  C "C5'" . DC  D 2 6   ? 28.126  4.526   50.881  1.00 14.14 ? 16   DC  F "C5'" 1 
ATOM   695  C "C4'" . DC  D 2 6   ? 28.642  3.107   51.092  1.00 12.73 ? 16   DC  F "C4'" 1 
ATOM   696  O "O4'" . DC  D 2 6   ? 28.209  2.657   52.398  1.00 11.51 ? 16   DC  F "O4'" 1 
ATOM   697  C "C3'" . DC  D 2 6   ? 28.136  2.014   50.145  1.00 11.40 ? 16   DC  F "C3'" 1 
ATOM   698  O "O3'" . DC  D 2 6   ? 29.188  1.080   50.018  1.00 13.32 ? 16   DC  F "O3'" 1 
ATOM   699  C "C2'" . DC  D 2 6   ? 26.983  1.372   50.918  1.00 10.48 ? 16   DC  F "C2'" 1 
ATOM   700  C "C1'" . DC  D 2 6   ? 27.586  1.380   52.318  1.00 9.88  ? 16   DC  F "C1'" 1 
ATOM   701  N N1    . DC  D 2 6   ? 26.622  1.410   53.428  1.00 9.35  ? 16   DC  F N1    1 
ATOM   702  C C2    . DC  D 2 6   ? 27.120  1.459   54.758  1.00 9.17  ? 16   DC  F C2    1 
ATOM   703  O O2    . DC  D 2 6   ? 28.345  1.429   54.980  1.00 8.70  ? 16   DC  F O2    1 
ATOM   704  N N3    . DC  D 2 6   ? 26.212  1.516   55.761  1.00 10.28 ? 16   DC  F N3    1 
ATOM   705  C C4    . DC  D 2 6   ? 24.903  1.550   55.505  1.00 10.10 ? 16   DC  F C4    1 
ATOM   706  N N4    . DC  D 2 6   ? 24.061  1.635   56.529  1.00 9.34  ? 16   DC  F N4    1 
ATOM   707  C C5    . DC  D 2 6   ? 24.375  1.479   54.181  1.00 10.51 ? 16   DC  F C5    1 
ATOM   708  C C6    . DC  D 2 6   ? 25.271  1.420   53.198  1.00 9.39  ? 16   DC  F C6    1 
ATOM   709  P P     . DG  D 2 7   ? 29.943  0.915   48.626  1.00 12.00 ? 17   DG  F P     1 
ATOM   710  O OP1   . DG  D 2 7   ? 30.601  2.196   48.246  1.00 12.50 ? 17   DG  F OP1   1 
ATOM   711  O OP2   . DG  D 2 7   ? 29.008  0.316   47.639  1.00 11.37 ? 17   DG  F OP2   1 
ATOM   712  O "O5'" . DG  D 2 7   ? 31.003  -0.169  49.059  1.00 11.53 ? 17   DG  F "O5'" 1 
ATOM   713  C "C5'" . DG  D 2 7   ? 32.049  0.131   49.977  1.00 11.44 ? 17   DG  F "C5'" 1 
ATOM   714  C "C4'" . DG  D 2 7   ? 32.139  -0.958  51.025  1.00 9.66  ? 17   DG  F "C4'" 1 
ATOM   715  O "O4'" . DG  D 2 7   ? 30.990  -0.840  51.918  1.00 9.73  ? 17   DG  F "O4'" 1 
ATOM   716  C "C3'" . DG  D 2 7   ? 32.096  -2.393  50.494  1.00 8.84  ? 17   DG  F "C3'" 1 
ATOM   717  O "O3'" . DG  D 2 7   ? 33.027  -3.124  51.247  1.00 11.72 ? 17   DG  F "O3'" 1 
ATOM   718  C "C2'" . DG  D 2 7   ? 30.676  -2.878  50.774  1.00 8.82  ? 17   DG  F "C2'" 1 
ATOM   719  C "C1'" . DG  D 2 7   ? 30.417  -2.137  52.087  1.00 8.18  ? 17   DG  F "C1'" 1 
ATOM   720  N N9    . DG  D 2 7   ? 29.022  -2.041  52.507  1.00 9.16  ? 17   DG  F N9    1 
ATOM   721  C C8    . DG  D 2 7   ? 27.834  -2.067  51.770  1.00 8.81  ? 17   DG  F C8    1 
ATOM   722  N N7    . DG  D 2 7   ? 26.753  -1.949  52.538  1.00 8.58  ? 17   DG  F N7    1 
ATOM   723  C C5    . DG  D 2 7   ? 27.266  -1.880  53.838  1.00 9.56  ? 17   DG  F C5    1 
ATOM   724  C C6    . DG  D 2 7   ? 26.599  -1.752  55.104  1.00 10.94 ? 17   DG  F C6    1 
ATOM   725  O O6    . DG  D 2 7   ? 25.391  -1.687  55.332  1.00 9.14  ? 17   DG  F O6    1 
ATOM   726  N N1    . DG  D 2 7   ? 27.497  -1.684  56.190  1.00 7.79  ? 17   DG  F N1    1 
ATOM   727  C C2    . DG  D 2 7   ? 28.867  -1.730  56.044  1.00 9.92  ? 17   DG  F C2    1 
ATOM   728  N N2    . DG  D 2 7   ? 29.587  -1.652  57.174  1.00 8.94  ? 17   DG  F N2    1 
ATOM   729  N N3    . DG  D 2 7   ? 29.513  -1.863  54.882  1.00 9.09  ? 17   DG  F N3    1 
ATOM   730  C C4    . DG  D 2 7   ? 28.644  -1.913  53.823  1.00 10.47 ? 17   DG  F C4    1 
HETATM 731  P P     . 6MA D 2 8   ? 34.424  -3.530  50.581  1.00 13.88 ? 18   6MA F P     1 
HETATM 732  O OP1   . 6MA D 2 8   ? 35.064  -2.329  50.024  1.00 14.30 ? 18   6MA F OP1   1 
HETATM 733  O OP2   . 6MA D 2 8   ? 34.195  -4.789  49.828  1.00 15.42 ? 18   6MA F OP2   1 
HETATM 734  O "O5'" . 6MA D 2 8   ? 35.229  -3.961  51.899  1.00 12.86 ? 18   6MA F "O5'" 1 
HETATM 735  C "C5'" . 6MA D 2 8   ? 35.675  -2.971  52.826  1.00 12.12 ? 18   6MA F "C5'" 1 
HETATM 736  C "C4'" . 6MA D 2 8   ? 35.614  -3.545  54.234  1.00 10.87 ? 18   6MA F "C4'" 1 
HETATM 737  O "O4'" . 6MA D 2 8   ? 34.230  -3.725  54.645  1.00 9.58  ? 18   6MA F "O4'" 1 
HETATM 738  C "C3'" . 6MA D 2 8   ? 36.249  -4.904  54.434  1.00 10.88 ? 18   6MA F "C3'" 1 
HETATM 739  O "O3'" . 6MA D 2 8   ? 36.855  -4.921  55.756  1.00 12.14 ? 18   6MA F "O3'" 1 
HETATM 740  C "C2'" . 6MA D 2 8   ? 35.107  -5.920  54.304  1.00 10.09 ? 18   6MA F "C2'" 1 
HETATM 741  C "C1'" . 6MA D 2 8   ? 33.947  -5.103  54.884  1.00 8.83  ? 18   6MA F "C1'" 1 
HETATM 742  N N9    . 6MA D 2 8   ? 32.628  -5.319  54.289  1.00 10.11 ? 18   6MA F N9    1 
HETATM 743  C C8    . 6MA D 2 8   ? 32.295  -5.661  52.996  1.00 10.81 ? 18   6MA F C8    1 
HETATM 744  N N7    . 6MA D 2 8   ? 30.986  -5.736  52.808  1.00 9.73  ? 18   6MA F N7    1 
HETATM 745  C C5    . 6MA D 2 8   ? 30.433  -5.383  54.054  1.00 10.09 ? 18   6MA F C5    1 
HETATM 746  C C6    . 6MA D 2 8   ? 29.105  -5.285  54.574  1.00 9.28  ? 18   6MA F C6    1 
HETATM 747  N N1    . 6MA D 2 8   ? 28.922  -4.962  55.885  1.00 8.36  ? 18   6MA F N1    1 
HETATM 748  C C2    . 6MA D 2 8   ? 30.008  -4.716  56.653  1.00 8.56  ? 18   6MA F C2    1 
HETATM 749  N N3    . 6MA D 2 8   ? 31.287  -4.786  56.258  1.00 9.86  ? 18   6MA F N3    1 
HETATM 750  C C4    . 6MA D 2 8   ? 31.444  -5.136  54.967  1.00 10.68 ? 18   6MA F C4    1 
HETATM 751  N N6    . 6MA D 2 8   ? 27.962  -5.462  53.887  1.00 9.51  ? 18   6MA F N6    1 
HETATM 752  C C1    . 6MA D 2 8   ? 27.909  -5.656  52.439  1.00 11.43 ? 18   6MA F C1    1 
ATOM   753  P P     . DA  D 2 9   ? 37.507  -6.235  56.387  1.00 12.64 ? 19   DA  F P     1 
ATOM   754  O OP1   . DA  D 2 9   ? 38.567  -5.746  57.322  1.00 11.44 ? 19   DA  F OP1   1 
ATOM   755  O OP2   . DA  D 2 9   ? 37.833  -7.213  55.301  1.00 13.68 ? 19   DA  F OP2   1 
ATOM   756  O "O5'" . DA  D 2 9   ? 36.324  -6.865  57.252  1.00 10.46 ? 19   DA  F "O5'" 1 
ATOM   757  C "C5'" . DA  D 2 9   ? 35.959  -6.251  58.489  1.00 10.13 ? 19   DA  F "C5'" 1 
ATOM   758  C "C4'" . DA  D 2 9   ? 34.747  -6.963  59.054  1.00 13.77 ? 19   DA  F "C4'" 1 
ATOM   759  O "O4'" . DA  D 2 9   ? 33.633  -6.698  58.185  1.00 14.32 ? 19   DA  F "O4'" 1 
ATOM   760  C "C3'" . DA  D 2 9   ? 34.863  -8.481  59.082  1.00 15.09 ? 19   DA  F "C3'" 1 
ATOM   761  O "O3'" . DA  D 2 9   ? 35.354  -8.853  60.347  1.00 12.92 ? 19   DA  F "O3'" 1 
ATOM   762  C "C2'" . DA  D 2 9   ? 33.413  -8.937  58.924  1.00 17.39 ? 19   DA  F "C2'" 1 
ATOM   763  C "C1'" . DA  D 2 9   ? 32.691  -7.727  58.358  1.00 14.09 ? 19   DA  F "C1'" 1 
ATOM   764  N N9    . DA  D 2 9   ? 32.065  -8.025  57.066  1.00 12.36 ? 19   DA  F N9    1 
ATOM   765  C C8    . DA  D 2 9   ? 32.656  -8.277  55.846  1.00 11.92 ? 19   DA  F C8    1 
ATOM   766  N N7    . DA  D 2 9   ? 31.763  -8.504  54.884  1.00 11.98 ? 19   DA  F N7    1 
ATOM   767  C C5    . DA  D 2 9   ? 30.527  -8.391  55.541  1.00 11.70 ? 19   DA  F C5    1 
ATOM   768  C C6    . DA  D 2 9   ? 29.180  -8.495  55.112  1.00 11.05 ? 19   DA  F C6    1 
ATOM   769  N N6    . DA  D 2 9   ? 28.825  -8.790  53.858  1.00 11.91 ? 19   DA  F N6    1 
ATOM   770  N N1    . DA  D 2 9   ? 28.197  -8.307  56.027  1.00 10.12 ? 19   DA  F N1    1 
ATOM   771  C C2    . DA  D 2 9   ? 28.521  -8.027  57.300  1.00 13.03 ? 19   DA  F C2    1 
ATOM   772  N N3    . DA  D 2 9   ? 29.746  -7.910  57.817  1.00 11.39 ? 19   DA  F N3    1 
ATOM   773  C C4    . DA  D 2 9   ? 30.704  -8.088  56.881  1.00 12.62 ? 19   DA  F C4    1 
ATOM   774  P P     . DC  D 2 10  ? 35.770  -10.358 60.671  1.00 13.01 ? 20   DC  F P     1 
ATOM   775  O OP1   . DC  D 2 10  ? 36.515  -10.341 61.960  1.00 12.65 ? 20   DC  F OP1   1 
ATOM   776  O OP2   . DC  D 2 10  ? 36.467  -10.927 59.475  1.00 15.05 ? 20   DC  F OP2   1 
ATOM   777  O "O5'" . DC  D 2 10  ? 34.396  -11.137 60.882  1.00 15.62 ? 20   DC  F "O5'" 1 
ATOM   778  C "C5'" . DC  D 2 10  ? 33.588  -10.802 62.006  1.00 16.87 ? 20   DC  F "C5'" 1 
ATOM   779  C "C4'" . DC  D 2 10  ? 32.213  -11.429 61.892  1.00 18.53 ? 20   DC  F "C4'" 1 
ATOM   780  O "O4'" . DC  D 2 10  ? 31.610  -10.918 60.676  1.00 16.92 ? 20   DC  F "O4'" 1 
ATOM   781  C "C3'" . DC  D 2 10  ? 32.236  -12.958 61.801  1.00 20.87 ? 20   DC  F "C3'" 1 
ATOM   782  O "O3'" . DC  D 2 10  ? 31.369  -13.542 62.773  1.00 24.17 ? 20   DC  F "O3'" 1 
ATOM   783  C "C2'" . DC  D 2 10  ? 31.732  -13.245 60.396  1.00 19.88 ? 20   DC  F "C2'" 1 
ATOM   784  C "C1'" . DC  D 2 10  ? 30.917  -11.985 60.078  1.00 17.63 ? 20   DC  F "C1'" 1 
ATOM   785  N N1    . DC  D 2 10  ? 30.733  -11.848 58.619  1.00 16.61 ? 20   DC  F N1    1 
ATOM   786  C C2    . DC  D 2 10  ? 29.425  -11.729 58.102  1.00 15.32 ? 20   DC  F C2    1 
ATOM   787  O O2    . DC  D 2 10  ? 28.457  -11.716 58.880  1.00 16.48 ? 20   DC  F O2    1 
ATOM   788  N N3    . DC  D 2 10  ? 29.263  -11.651 56.753  1.00 15.67 ? 20   DC  F N3    1 
ATOM   789  C C4    . DC  D 2 10  ? 30.326  -11.676 55.943  1.00 14.41 ? 20   DC  F C4    1 
ATOM   790  N N4    . DC  D 2 10  ? 30.098  -11.600 54.632  1.00 16.09 ? 20   DC  F N4    1 
ATOM   791  C C5    . DC  D 2 10  ? 31.666  -11.767 56.442  1.00 16.02 ? 20   DC  F C5    1 
ATOM   792  C C6    . DC  D 2 10  ? 31.816  -11.868 57.779  1.00 15.14 ? 20   DC  F C6    1 
ATOM   793  N N     . VAL E 3 21  ? -17.575 -9.989  16.522  1.00 32.56 ? 21   VAL A N     1 
ATOM   794  C CA    . VAL E 3 21  ? -16.442 -10.947 16.264  1.00 32.96 ? 21   VAL A CA    1 
ATOM   795  C C     . VAL E 3 21  ? -15.685 -11.267 17.559  1.00 32.17 ? 21   VAL A C     1 
ATOM   796  O O     . VAL E 3 21  ? -15.359 -10.369 18.339  1.00 32.66 ? 21   VAL A O     1 
ATOM   797  C CB    . VAL E 3 21  ? -15.511 -10.483 15.086  1.00 33.23 ? 21   VAL A CB    1 
ATOM   798  C CG1   . VAL E 3 21  ? -15.700 -9.014  14.769  1.00 33.96 ? 21   VAL A CG1   1 
ATOM   799  C CG2   . VAL E 3 21  ? -14.037 -10.796 15.354  1.00 33.35 ? 21   VAL A CG2   1 
ATOM   800  N N     . GLU E 3 22  ? -15.402 -12.548 17.782  1.00 30.81 ? 22   GLU A N     1 
ATOM   801  C CA    . GLU E 3 22  ? -15.108 -12.992 19.138  1.00 28.88 ? 22   GLU A CA    1 
ATOM   802  C C     . GLU E 3 22  ? -13.724 -12.631 19.695  1.00 26.66 ? 22   GLU A C     1 
ATOM   803  O O     . GLU E 3 22  ? -12.724 -12.477 18.955  1.00 26.30 ? 22   GLU A O     1 
ATOM   804  C CB    . GLU E 3 22  ? -15.506 -14.466 19.384  1.00 28.84 ? 22   GLU A CB    1 
ATOM   805  C CG    . GLU E 3 22  ? -14.608 -15.532 18.771  1.00 29.23 ? 22   GLU A CG    1 
ATOM   806  C CD    . GLU E 3 22  ? -15.147 -16.960 18.934  1.00 31.38 ? 22   GLU A CD    1 
ATOM   807  O OE1   . GLU E 3 22  ? -16.275 -17.149 19.470  1.00 31.01 ? 22   GLU A OE1   1 
ATOM   808  O OE2   . GLU E 3 22  ? -14.426 -17.905 18.514  1.00 35.50 ? 22   GLU A OE2   1 
ATOM   809  N N     . THR E 3 23  ? -13.728 -12.425 21.009  1.00 23.55 ? 23   THR A N     1 
ATOM   810  C CA    . THR E 3 23  ? -12.539 -12.180 21.783  1.00 20.70 ? 23   THR A CA    1 
ATOM   811  C C     . THR E 3 23  ? -12.310 -13.419 22.651  1.00 19.08 ? 23   THR A C     1 
ATOM   812  O O     . THR E 3 23  ? -13.204 -13.807 23.402  1.00 18.95 ? 23   THR A O     1 
ATOM   813  C CB    . THR E 3 23  ? -12.692 -10.947 22.709  1.00 20.45 ? 23   THR A CB    1 
ATOM   814  O OG1   . THR E 3 23  ? -13.213 -9.830  21.975  1.00 18.64 ? 23   THR A OG1   1 
ATOM   815  C CG2   . THR E 3 23  ? -11.345 -10.557 23.303  1.00 19.70 ? 23   THR A CG2   1 
ATOM   816  N N     . PRO E 3 24  ? -11.110 -14.022 22.559  1.00 17.81 ? 24   PRO A N     1 
ATOM   817  C CA    . PRO E 3 24  ? -10.765 -15.160 23.414  1.00 17.19 ? 24   PRO A CA    1 
ATOM   818  C C     . PRO E 3 24  ? -10.988 -14.835 24.893  1.00 16.55 ? 24   PRO A C     1 
ATOM   819  O O     . PRO E 3 24  ? -10.698 -13.712 25.346  1.00 14.86 ? 24   PRO A O     1 
ATOM   820  C CB    . PRO E 3 24  ? -9.277  -15.396 23.106  1.00 16.98 ? 24   PRO A CB    1 
ATOM   821  C CG    . PRO E 3 24  ? -9.122  -14.890 21.682  1.00 17.45 ? 24   PRO A CG    1 
ATOM   822  C CD    . PRO E 3 24  ? -10.019 -13.684 21.631  1.00 18.34 ? 24   PRO A CD    1 
ATOM   823  N N     . PRO E 3 25  ? -11.516 -15.808 25.662  1.00 16.30 ? 25   PRO A N     1 
ATOM   824  C CA    . PRO E 3 25  ? -11.824 -15.529 27.062  1.00 16.45 ? 25   PRO A CA    1 
ATOM   825  C C     . PRO E 3 25  ? -10.617 -15.092 27.897  1.00 16.16 ? 25   PRO A C     1 
ATOM   826  O O     . PRO E 3 25  ? -10.781 -14.289 28.798  1.00 15.86 ? 25   PRO A O     1 
ATOM   827  C CB    . PRO E 3 25  ? -12.393 -16.865 27.579  1.00 16.99 ? 25   PRO A CB    1 
ATOM   828  C CG    . PRO E 3 25  ? -11.876 -17.890 26.635  1.00 16.98 ? 25   PRO A CG    1 
ATOM   829  C CD    . PRO E 3 25  ? -11.845 -17.197 25.291  1.00 16.80 ? 25   PRO A CD    1 
ATOM   830  N N     . GLU E 3 26  ? -9.424  -15.597 27.594  1.00 16.02 ? 26   GLU A N     1 
ATOM   831  C CA    . GLU E 3 26  ? -8.238  -15.188 28.348  1.00 16.69 ? 26   GLU A CA    1 
ATOM   832  C C     . GLU E 3 26  ? -7.844  -13.740 28.065  1.00 14.84 ? 26   GLU A C     1 
ATOM   833  O O     . GLU E 3 26  ? -7.276  -13.067 28.930  1.00 14.13 ? 26   GLU A O     1 
ATOM   834  C CB    . GLU E 3 26  ? -7.049  -16.118 28.121  1.00 17.56 ? 26   GLU A CB    1 
ATOM   835  C CG    . GLU E 3 26  ? -6.910  -16.616 26.716  1.00 22.93 ? 26   GLU A CG    1 
ATOM   836  C CD    . GLU E 3 26  ? -7.800  -17.821 26.418  1.00 25.74 ? 26   GLU A CD    1 
ATOM   837  O OE1   . GLU E 3 26  ? -7.652  -18.889 27.060  1.00 32.37 ? 26   GLU A OE1   1 
ATOM   838  O OE2   . GLU E 3 26  ? -8.646  -17.703 25.523  1.00 23.84 ? 26   GLU A OE2   1 
ATOM   839  N N     . VAL E 3 27  ? -8.140  -13.275 26.853  1.00 13.44 ? 27   VAL A N     1 
ATOM   840  C CA    . VAL E 3 27  ? -7.972  -11.850 26.523  1.00 12.49 ? 27   VAL A CA    1 
ATOM   841  C C     . VAL E 3 27  ? -8.977  -11.015 27.293  1.00 12.76 ? 27   VAL A C     1 
ATOM   842  O O     . VAL E 3 27  ? -8.624  -9.983  27.885  1.00 11.68 ? 27   VAL A O     1 
ATOM   843  C CB    . VAL E 3 27  ? -8.089  -11.589 24.999  1.00 12.59 ? 27   VAL A CB    1 
ATOM   844  C CG1   . VAL E 3 27  ? -7.988  -10.060 24.698  1.00 11.72 ? 27   VAL A CG1   1 
ATOM   845  C CG2   . VAL E 3 27  ? -7.014  -12.393 24.236  1.00 12.42 ? 27   VAL A CG2   1 
ATOM   846  N N     . VAL E 3 28  ? -10.234 -11.465 27.299  1.00 12.64 ? 28   VAL A N     1 
ATOM   847  C CA    . VAL E 3 28  ? -11.279 -10.757 28.046  1.00 13.23 ? 28   VAL A CA    1 
ATOM   848  C C     . VAL E 3 28  ? -10.891 -10.643 29.520  1.00 13.15 ? 28   VAL A C     1 
ATOM   849  O O     . VAL E 3 28  ? -10.955 -9.562  30.108  1.00 13.13 ? 28   VAL A O     1 
ATOM   850  C CB    . VAL E 3 28  ? -12.638 -11.445 27.899  1.00 13.35 ? 28   VAL A CB    1 
ATOM   851  C CG1   . VAL E 3 28  ? -13.695 -10.728 28.759  1.00 12.86 ? 28   VAL A CG1   1 
ATOM   852  C CG2   . VAL E 3 28  ? -13.063 -11.467 26.435  1.00 15.31 ? 28   VAL A CG2   1 
ATOM   853  N N     . ASP E 3 29  ? -10.479 -11.767 30.101  1.00 14.12 ? 29   ASP A N     1 
ATOM   854  C CA    . ASP E 3 29  ? -10.106 -11.825 31.522  1.00 14.78 ? 29   ASP A CA    1 
ATOM   855  C C     . ASP E 3 29  ? -8.931  -10.910 31.836  1.00 13.91 ? 29   ASP A C     1 
ATOM   856  O O     . ASP E 3 29  ? -8.919  -10.233 32.860  1.00 14.16 ? 29   ASP A O     1 
ATOM   857  C CB    . ASP E 3 29  ? -9.762  -13.257 31.911  1.00 15.33 ? 29   ASP A CB    1 
ATOM   858  C CG    . ASP E 3 29  ? -10.990 -14.168 31.971  1.00 19.54 ? 29   ASP A CG    1 
ATOM   859  O OD1   . ASP E 3 29  ? -12.147 -13.690 31.833  1.00 22.79 ? 29   ASP A OD1   1 
ATOM   860  O OD2   . ASP E 3 29  ? -10.781 -15.383 32.166  1.00 22.84 ? 29   ASP A OD2   1 
ATOM   861  N N     . PHE E 3 30  ? -7.931  -10.910 30.962  1.00 13.25 ? 30   PHE A N     1 
ATOM   862  C CA    . PHE E 3 30  ? -6.798  -10.012 31.141  1.00 12.54 ? 30   PHE A CA    1 
ATOM   863  C C     . PHE E 3 30  ? -7.269  -8.560  31.148  1.00 12.25 ? 30   PHE A C     1 
ATOM   864  O O     . PHE E 3 30  ? -6.922  -7.782  32.044  1.00 12.31 ? 30   PHE A O     1 
ATOM   865  C CB    . PHE E 3 30  ? -5.753  -10.256 30.045  1.00 12.30 ? 30   PHE A CB    1 
ATOM   866  C CG    . PHE E 3 30  ? -4.591  -9.288  30.077  1.00 13.19 ? 30   PHE A CG    1 
ATOM   867  C CD1   . PHE E 3 30  ? -3.782  -9.159  31.211  1.00 13.13 ? 30   PHE A CD1   1 
ATOM   868  C CD2   . PHE E 3 30  ? -4.295  -8.517  28.947  1.00 14.89 ? 30   PHE A CD2   1 
ATOM   869  C CE1   . PHE E 3 30  ? -2.701  -8.254  31.223  1.00 16.50 ? 30   PHE A CE1   1 
ATOM   870  C CE2   . PHE E 3 30  ? -3.230  -7.620  28.941  1.00 16.95 ? 30   PHE A CE2   1 
ATOM   871  C CZ    . PHE E 3 30  ? -2.434  -7.473  30.083  1.00 14.76 ? 30   PHE A CZ    1 
ATOM   872  N N     . MET E 3 31  ? -8.072  -8.188  30.150  1.00 11.50 ? 31   MET A N     1 
ATOM   873  C CA    . MET E 3 31  ? -8.575  -6.832  30.065  1.00 11.16 ? 31   MET A CA    1 
ATOM   874  C C     . MET E 3 31  ? -9.403  -6.440  31.282  1.00 12.03 ? 31   MET A C     1 
ATOM   875  O O     . MET E 3 31  ? -9.245  -5.347  31.821  1.00 12.94 ? 31   MET A O     1 
ATOM   876  C CB    . MET E 3 31  ? -9.388  -6.681  28.774  1.00 10.90 ? 31   MET A CB    1 
ATOM   877  C CG    . MET E 3 31  ? -8.480  -6.735  27.543  1.00 9.95  ? 31   MET A CG    1 
ATOM   878  S SD    . MET E 3 31  ? -9.368  -6.772  25.972  1.00 11.16 ? 31   MET A SD    1 
ATOM   879  C CE    . MET E 3 31  ? -10.212 -5.202  26.044  1.00 14.12 ? 31   MET A CE    1 
ATOM   880  N N     . VAL E 3 32  ? -10.270 -7.350  31.732  1.00 11.95 ? 32   VAL A N     1 
ATOM   881  C CA    . VAL E 3 32  ? -11.076 -7.101  32.938  1.00 12.59 ? 32   VAL A CA    1 
ATOM   882  C C     . VAL E 3 32  ? -10.189 -6.867  34.178  1.00 13.03 ? 32   VAL A C     1 
ATOM   883  O O     . VAL E 3 32  ? -10.508 -6.010  35.011  1.00 13.92 ? 32   VAL A O     1 
ATOM   884  C CB    . VAL E 3 32  ? -12.160 -8.212  33.136  1.00 12.49 ? 32   VAL A CB    1 
ATOM   885  C CG1   . VAL E 3 32  ? -12.764 -8.171  34.547  1.00 12.60 ? 32   VAL A CG1   1 
ATOM   886  C CG2   . VAL E 3 32  ? -13.260 -8.018  32.095  1.00 12.56 ? 32   VAL A CG2   1 
ATOM   887  N N     . SER E 3 33  ? -9.072  -7.591  34.268  1.00 13.30 ? 33   SER A N     1 
ATOM   888  C CA    . SER E 3 33  ? -8.090  -7.396  35.347  1.00 14.50 ? 33   SER A CA    1 
ATOM   889  C C     . SER E 3 33  ? -7.432  -6.002  35.358  1.00 15.18 ? 33   SER A C     1 
ATOM   890  O O     . SER E 3 33  ? -6.958  -5.552  36.407  1.00 15.31 ? 33   SER A O     1 
ATOM   891  C CB    . SER E 3 33  ? -7.024  -8.505  35.340  1.00 14.67 ? 33   SER A CB    1 
ATOM   892  O OG    . SER E 3 33  ? -5.946  -8.222  34.451  1.00 16.71 ? 33   SER A OG    1 
ATOM   893  N N     . LEU E 3 34  ? -7.423  -5.321  34.210  1.00 15.05 ? 34   LEU A N     1 
ATOM   894  C CA    . LEU E 3 34  ? -6.873  -3.958  34.103  1.00 16.48 ? 34   LEU A CA    1 
ATOM   895  C C     . LEU E 3 34  ? -7.924  -2.878  34.295  1.00 17.12 ? 34   LEU A C     1 
ATOM   896  O O     . LEU E 3 34  ? -7.605  -1.693  34.407  1.00 18.44 ? 34   LEU A O     1 
ATOM   897  C CB    . LEU E 3 34  ? -6.214  -3.761  32.730  1.00 16.04 ? 34   LEU A CB    1 
ATOM   898  C CG    . LEU E 3 34  ? -5.083  -4.713  32.347  1.00 16.44 ? 34   LEU A CG    1 
ATOM   899  C CD1   . LEU E 3 34  ? -4.761  -4.558  30.859  1.00 17.95 ? 34   LEU A CD1   1 
ATOM   900  C CD2   . LEU E 3 34  ? -3.832  -4.520  33.229  1.00 17.55 ? 34   LEU A CD2   1 
ATOM   901  N N     . ALA E 3 35  ? -9.182  -3.282  34.320  1.00 18.63 ? 35   ALA A N     1 
ATOM   902  C CA    . ALA E 3 35  ? -10.279 -2.333  34.338  1.00 19.37 ? 35   ALA A CA    1 
ATOM   903  C C     . ALA E 3 35  ? -10.650 -2.008  35.770  1.00 20.70 ? 35   ALA A C     1 
ATOM   904  O O     . ALA E 3 35  ? -10.481 -2.837  36.671  1.00 20.73 ? 35   ALA A O     1 
ATOM   905  C CB    . ALA E 3 35  ? -11.490 -2.881  33.583  1.00 18.70 ? 35   ALA A CB    1 
ATOM   906  N N     . GLU E 3 36  ? -11.150 -0.790  35.963  1.00 21.71 ? 36   GLU A N     1 
ATOM   907  C CA    . GLU E 3 36  ? -11.702 -0.360  37.243  1.00 23.21 ? 36   GLU A CA    1 
ATOM   908  C C     . GLU E 3 36  ? -12.754 0.719   37.045  1.00 22.65 ? 36   GLU A C     1 
ATOM   909  O O     . GLU E 3 36  ? -12.746 1.442   36.040  1.00 22.13 ? 36   GLU A O     1 
ATOM   910  C CB    . GLU E 3 36  ? -10.595 0.132   38.187  1.00 23.93 ? 36   GLU A CB    1 
ATOM   911  C CG    . GLU E 3 36  ? -9.722  1.250   37.618  1.00 28.22 ? 36   GLU A CG    1 
ATOM   912  C CD    . GLU E 3 36  ? -8.342  1.316   38.277  1.00 33.46 ? 36   GLU A CD    1 
ATOM   913  O OE1   . GLU E 3 36  ? -8.108  2.251   39.075  1.00 35.93 ? 36   GLU A OE1   1 
ATOM   914  O OE2   . GLU E 3 36  ? -7.491  0.430   37.991  1.00 37.34 ? 36   GLU A OE2   1 
ATOM   915  N N     . ALA E 3 37  ? -13.659 0.809   38.019  1.00 22.37 ? 37   ALA A N     1 
ATOM   916  C CA    . ALA E 3 37  ? -14.704 1.817   38.037  1.00 22.59 ? 37   ALA A CA    1 
ATOM   917  C C     . ALA E 3 37  ? -15.148 2.009   39.486  1.00 23.07 ? 37   ALA A C     1 
ATOM   918  O O     . ALA E 3 37  ? -15.105 1.061   40.271  1.00 22.40 ? 37   ALA A O     1 
ATOM   919  C CB    . ALA E 3 37  ? -15.886 1.387   37.161  1.00 22.54 ? 37   ALA A CB    1 
ATOM   920  N N     . PRO E 3 38  ? -15.541 3.239   39.856  1.00 23.65 ? 38   PRO A N     1 
ATOM   921  C CA    . PRO E 3 38  ? -16.056 3.383   41.223  1.00 24.32 ? 38   PRO A CA    1 
ATOM   922  C C     . PRO E 3 38  ? -17.446 2.760   41.396  1.00 25.13 ? 38   PRO A C     1 
ATOM   923  O O     . PRO E 3 38  ? -18.151 2.520   40.412  1.00 24.77 ? 38   PRO A O     1 
ATOM   924  C CB    . PRO E 3 38  ? -16.083 4.898   41.427  1.00 24.46 ? 38   PRO A CB    1 
ATOM   925  C CG    . PRO E 3 38  ? -16.192 5.472   40.059  1.00 24.38 ? 38   PRO A CG    1 
ATOM   926  C CD    . PRO E 3 38  ? -15.515 4.521   39.125  1.00 23.78 ? 38   PRO A CD    1 
ATOM   927  N N     . ARG E 3 39  ? -17.814 2.455   42.643  1.00 26.15 ? 39   ARG A N     1 
ATOM   928  C CA    . ARG E 3 39  ? -19.171 1.998   42.960  1.00 26.55 ? 39   ARG A CA    1 
ATOM   929  C C     . ARG E 3 39  ? -20.214 2.897   42.302  1.00 25.28 ? 39   ARG A C     1 
ATOM   930  O O     . ARG E 3 39  ? -20.149 4.121   42.405  1.00 25.40 ? 39   ARG A O     1 
ATOM   931  C CB    . ARG E 3 39  ? -19.369 1.922   44.491  1.00 26.71 ? 39   ARG A CB    1 
ATOM   932  C CG    . ARG E 3 39  ? -20.811 2.036   44.966  1.00 28.83 ? 39   ARG A CG    1 
ATOM   933  C CD    . ARG E 3 39  ? -20.908 2.347   46.478  1.00 29.38 ? 39   ARG A CD    1 
ATOM   934  N NE    . ARG E 3 39  ? -20.565 1.197   47.320  1.00 34.42 ? 39   ARG A NE    1 
ATOM   935  C CZ    . ARG E 3 39  ? -21.369 0.158   47.561  1.00 35.19 ? 39   ARG A CZ    1 
ATOM   936  N NH1   . ARG E 3 39  ? -22.588 0.091   47.021  1.00 35.29 ? 39   ARG A NH1   1 
ATOM   937  N NH2   . ARG E 3 39  ? -20.948 -0.825  48.344  1.00 35.07 ? 39   ARG A NH2   1 
ATOM   938  N N     . GLY E 3 40  ? -21.168 2.273   41.611  1.00 24.30 ? 40   GLY A N     1 
ATOM   939  C CA    . GLY E 3 40  ? -22.224 2.998   40.927  1.00 22.93 ? 40   GLY A CA    1 
ATOM   940  C C     . GLY E 3 40  ? -21.742 3.642   39.638  1.00 22.30 ? 40   GLY A C     1 
ATOM   941  O O     . GLY E 3 40  ? -22.508 4.330   38.959  1.00 23.18 ? 40   GLY A O     1 
ATOM   942  N N     . GLY E 3 41  ? -20.476 3.411   39.297  1.00 21.13 ? 41   GLY A N     1 
ATOM   943  C CA    . GLY E 3 41  ? -19.889 3.958   38.074  1.00 19.81 ? 41   GLY A CA    1 
ATOM   944  C C     . GLY E 3 41  ? -20.572 3.475   36.806  1.00 18.68 ? 41   GLY A C     1 
ATOM   945  O O     . GLY E 3 41  ? -21.151 2.379   36.772  1.00 18.46 ? 41   GLY A O     1 
ATOM   946  N N     . ARG E 3 42  ? -20.479 4.291   35.758  1.00 17.35 ? 42   ARG A N     1 
ATOM   947  C CA    . ARG E 3 42  ? -21.056 3.970   34.458  1.00 16.70 ? 42   ARG A CA    1 
ATOM   948  C C     . ARG E 3 42  ? -20.040 3.211   33.615  1.00 15.72 ? 42   ARG A C     1 
ATOM   949  O O     . ARG E 3 42  ? -18.920 3.691   33.388  1.00 15.46 ? 42   ARG A O     1 
ATOM   950  C CB    . ARG E 3 42  ? -21.520 5.234   33.743  1.00 17.22 ? 42   ARG A CB    1 
ATOM   951  C CG    . ARG E 3 42  ? -22.637 5.936   34.487  1.00 18.81 ? 42   ARG A CG    1 
ATOM   952  C CD    . ARG E 3 42  ? -22.734 7.398   34.084  1.00 20.30 ? 42   ARG A CD    1 
ATOM   953  N NE    . ARG E 3 42  ? -23.028 7.565   32.660  1.00 22.48 ? 42   ARG A NE    1 
ATOM   954  C CZ    . ARG E 3 42  ? -24.221 7.385   32.095  1.00 22.27 ? 42   ARG A CZ    1 
ATOM   955  N NH1   . ARG E 3 42  ? -25.270 7.008   32.818  1.00 20.74 ? 42   ARG A NH1   1 
ATOM   956  N NH2   . ARG E 3 42  ? -24.366 7.578   30.789  1.00 23.78 ? 42   ARG A NH2   1 
ATOM   957  N N     . VAL E 3 43  ? -20.456 2.031   33.171  1.00 14.81 ? 43   VAL A N     1 
ATOM   958  C CA    . VAL E 3 43  ? -19.597 1.080   32.462  1.00 13.84 ? 43   VAL A CA    1 
ATOM   959  C C     . VAL E 3 43  ? -20.168 0.759   31.086  1.00 13.95 ? 43   VAL A C     1 
ATOM   960  O O     . VAL E 3 43  ? -21.270 0.211   30.966  1.00 13.16 ? 43   VAL A O     1 
ATOM   961  C CB    . VAL E 3 43  ? -19.422 -0.229  33.288  1.00 14.30 ? 43   VAL A CB    1 
ATOM   962  C CG1   . VAL E 3 43  ? -18.660 -1.307  32.486  1.00 14.90 ? 43   VAL A CG1   1 
ATOM   963  C CG2   . VAL E 3 43  ? -18.741 0.050   34.623  1.00 13.56 ? 43   VAL A CG2   1 
ATOM   964  N N     . LEU E 3 44  ? -19.391 1.070   30.052  1.00 12.31 ? 44   LEU A N     1 
ATOM   965  C CA    . LEU E 3 44  ? -19.851 0.975   28.668  1.00 11.80 ? 44   LEU A CA    1 
ATOM   966  C C     . LEU E 3 44  ? -19.043 -0.047  27.866  1.00 11.95 ? 44   LEU A C     1 
ATOM   967  O O     . LEU E 3 44  ? -17.807 -0.038  27.911  1.00 11.03 ? 44   LEU A O     1 
ATOM   968  C CB    . LEU E 3 44  ? -19.720 2.339   27.979  1.00 11.98 ? 44   LEU A CB    1 
ATOM   969  C CG    . LEU E 3 44  ? -20.042 2.473   26.484  1.00 12.60 ? 44   LEU A CG    1 
ATOM   970  C CD1   . LEU E 3 44  ? -21.510 2.203   26.160  1.00 12.82 ? 44   LEU A CD1   1 
ATOM   971  C CD2   . LEU E 3 44  ? -19.613 3.854   25.943  1.00 11.96 ? 44   LEU A CD2   1 
ATOM   972  N N     . GLU E 3 45  ? -19.758 -0.896  27.138  1.00 11.54 ? 45   GLU A N     1 
ATOM   973  C CA    . GLU E 3 45  ? -19.158 -1.732  26.080  1.00 12.11 ? 45   GLU A CA    1 
ATOM   974  C C     . GLU E 3 45  ? -19.655 -1.287  24.703  1.00 12.03 ? 45   GLU A C     1 
ATOM   975  O O     . GLU E 3 45  ? -20.800 -1.541  24.340  1.00 11.29 ? 45   GLU A O     1 
ATOM   976  C CB    . GLU E 3 45  ? -19.389 -3.232  26.304  1.00 12.68 ? 45   GLU A CB    1 
ATOM   977  C CG    . GLU E 3 45  ? -18.734 -4.085  25.166  1.00 12.68 ? 45   GLU A CG    1 
ATOM   978  C CD    . GLU E 3 45  ? -18.854 -5.623  25.295  1.00 13.93 ? 45   GLU A CD    1 
ATOM   979  O OE1   . GLU E 3 45  ? -19.353 -6.142  26.320  1.00 15.04 ? 45   GLU A OE1   1 
ATOM   980  O OE2   . GLU E 3 45  ? -18.432 -6.334  24.352  1.00 13.46 ? 45   GLU A OE2   1 
ATOM   981  N N     . PRO E 3 46  ? -18.789 -0.580  23.941  1.00 12.23 ? 46   PRO A N     1 
ATOM   982  C CA    . PRO E 3 46  ? -19.126 -0.201  22.570  1.00 11.88 ? 46   PRO A CA    1 
ATOM   983  C C     . PRO E 3 46  ? -19.012 -1.423  21.661  1.00 11.36 ? 46   PRO A C     1 
ATOM   984  O O     . PRO E 3 46  ? -18.200 -2.320  21.937  1.00 11.51 ? 46   PRO A O     1 
ATOM   985  C CB    . PRO E 3 46  ? -18.035 0.814   22.182  1.00 11.80 ? 46   PRO A CB    1 
ATOM   986  C CG    . PRO E 3 46  ? -17.277 1.137   23.433  1.00 11.97 ? 46   PRO A CG    1 
ATOM   987  C CD    . PRO E 3 46  ? -17.472 -0.065  24.359  1.00 11.72 ? 46   PRO A CD    1 
ATOM   988  N N     . ALA E 3 47  ? -19.808 -1.441  20.594  1.00 10.30 ? 47   ALA A N     1 
ATOM   989  C CA    . ALA E 3 47  ? -19.853 -2.551  19.624  1.00 10.57 ? 47   ALA A CA    1 
ATOM   990  C C     . ALA E 3 47  ? -20.113 -3.884  20.327  1.00 11.01 ? 47   ALA A C     1 
ATOM   991  O O     . ALA E 3 47  ? -19.450 -4.872  20.046  1.00 11.17 ? 47   ALA A O     1 
ATOM   992  C CB    . ALA E 3 47  ? -18.540 -2.619  18.826  1.00 10.59 ? 47   ALA A CB    1 
ATOM   993  N N     . CYS E 3 48  ? -21.095 -3.905  21.221  1.00 11.18 ? 48   CYS A N     1 
ATOM   994  C CA    . CYS E 3 48  ? -21.126 -4.935  22.275  1.00 12.09 ? 48   CYS A CA    1 
ATOM   995  C C     . CYS E 3 48  ? -21.694 -6.295  21.848  1.00 11.83 ? 48   CYS A C     1 
ATOM   996  O O     . CYS E 3 48  ? -21.368 -7.311  22.472  1.00 12.24 ? 48   CYS A O     1 
ATOM   997  C CB    . CYS E 3 48  ? -21.910 -4.432  23.495  1.00 12.27 ? 48   CYS A CB    1 
ATOM   998  S SG    . CYS E 3 48  ? -23.665 -4.093  23.093  1.00 13.97 ? 48   CYS A SG    1 
ATOM   999  N N     . ALA E 3 49  ? -22.545 -6.326  20.819  1.00 12.45 ? 49   ALA A N     1 
ATOM   1000 C CA    . ALA E 3 49  ? -23.309 -7.543  20.495  1.00 12.46 ? 49   ALA A CA    1 
ATOM   1001 C C     . ALA E 3 49  ? -23.967 -8.105  21.785  1.00 12.80 ? 49   ALA A C     1 
ATOM   1002 O O     . ALA E 3 49  ? -24.797 -7.436  22.384  1.00 12.40 ? 49   ALA A O     1 
ATOM   1003 C CB    . ALA E 3 49  ? -22.421 -8.579  19.780  1.00 13.18 ? 49   ALA A CB    1 
ATOM   1004 N N     . HIS E 3 50  ? -23.572 -9.299  22.237  1.00 13.15 ? 50   HIS A N     1 
ATOM   1005 C CA    . HIS E 3 50  ? -24.201 -9.896  23.445  1.00 13.35 ? 50   HIS A CA    1 
ATOM   1006 C C     . HIS E 3 50  ? -23.563 -9.430  24.765  1.00 13.51 ? 50   HIS A C     1 
ATOM   1007 O O     . HIS E 3 50  ? -23.989 -9.834  25.856  1.00 13.58 ? 50   HIS A O     1 
ATOM   1008 C CB    . HIS E 3 50  ? -24.158 -11.407 23.353  1.00 13.81 ? 50   HIS A CB    1 
ATOM   1009 C CG    . HIS E 3 50  ? -22.771 -11.945 23.284  1.00 14.87 ? 50   HIS A CG    1 
ATOM   1010 N ND1   . HIS E 3 50  ? -22.128 -12.489 24.375  1.00 17.74 ? 50   HIS A ND1   1 
ATOM   1011 C CD2   . HIS E 3 50  ? -21.891 -12.002 22.256  1.00 14.64 ? 50   HIS A CD2   1 
ATOM   1012 C CE1   . HIS E 3 50  ? -20.918 -12.881 24.013  1.00 17.58 ? 50   HIS A CE1   1 
ATOM   1013 N NE2   . HIS E 3 50  ? -20.750 -12.598 22.735  1.00 18.05 ? 50   HIS A NE2   1 
ATOM   1014 N N     . GLY E 3 51  ? -22.551 -8.567  24.655  1.00 12.78 ? 51   GLY A N     1 
ATOM   1015 C CA    . GLY E 3 51  ? -21.910 -7.944  25.816  1.00 12.67 ? 51   GLY A CA    1 
ATOM   1016 C C     . GLY E 3 51  ? -21.014 -8.854  26.645  1.00 12.25 ? 51   GLY A C     1 
ATOM   1017 O O     . GLY E 3 51  ? -21.169 -8.933  27.867  1.00 12.49 ? 51   GLY A O     1 
ATOM   1018 N N     . PRO E 3 52  ? -20.031 -9.521  26.007  1.00 12.72 ? 52   PRO A N     1 
ATOM   1019 C CA    . PRO E 3 52  ? -19.123 -10.375 26.804  1.00 12.38 ? 52   PRO A CA    1 
ATOM   1020 C C     . PRO E 3 52  ? -18.271 -9.603  27.826  1.00 12.16 ? 52   PRO A C     1 
ATOM   1021 O O     . PRO E 3 52  ? -17.982 -10.131 28.904  1.00 12.11 ? 52   PRO A O     1 
ATOM   1022 C CB    . PRO E 3 52  ? -18.232 -11.040 25.747  1.00 12.28 ? 52   PRO A CB    1 
ATOM   1023 C CG    . PRO E 3 52  ? -18.300 -10.134 24.568  1.00 13.46 ? 52   PRO A CG    1 
ATOM   1024 C CD    . PRO E 3 52  ? -19.685 -9.531  24.575  1.00 13.16 ? 52   PRO A CD    1 
ATOM   1025 N N     . PHE E 3 53  ? -17.886 -8.366  27.525  1.00 11.27 ? 53   PHE A N     1 
ATOM   1026 C CA    . PHE E 3 53  ? -17.097 -7.586  28.478  1.00 11.46 ? 53   PHE A CA    1 
ATOM   1027 C C     . PHE E 3 53  ? -17.898 -7.110  29.697  1.00 11.83 ? 53   PHE A C     1 
ATOM   1028 O O     . PHE E 3 53  ? -17.391 -7.129  30.826  1.00 11.64 ? 53   PHE A O     1 
ATOM   1029 C CB    . PHE E 3 53  ? -16.419 -6.411  27.786  1.00 11.34 ? 53   PHE A CB    1 
ATOM   1030 C CG    . PHE E 3 53  ? -15.244 -6.817  26.942  1.00 11.79 ? 53   PHE A CG    1 
ATOM   1031 C CD1   . PHE E 3 53  ? -13.961 -6.828  27.487  1.00 11.47 ? 53   PHE A CD1   1 
ATOM   1032 C CD2   . PHE E 3 53  ? -15.418 -7.187  25.612  1.00 11.27 ? 53   PHE A CD2   1 
ATOM   1033 C CE1   . PHE E 3 53  ? -12.866 -7.207  26.698  1.00 12.69 ? 53   PHE A CE1   1 
ATOM   1034 C CE2   . PHE E 3 53  ? -14.319 -7.571  24.822  1.00 13.38 ? 53   PHE A CE2   1 
ATOM   1035 C CZ    . PHE E 3 53  ? -13.053 -7.572  25.369  1.00 13.77 ? 53   PHE A CZ    1 
ATOM   1036 N N     . LEU E 3 54  ? -19.129 -6.674  29.451  1.00 11.83 ? 54   LEU A N     1 
ATOM   1037 C CA    . LEU E 3 54  ? -20.059 -6.317  30.526  1.00 11.91 ? 54   LEU A CA    1 
ATOM   1038 C C     . LEU E 3 54  ? -20.237 -7.517  31.461  1.00 11.62 ? 54   LEU A C     1 
ATOM   1039 O O     . LEU E 3 54  ? -20.149 -7.382  32.692  1.00 12.85 ? 54   LEU A O     1 
ATOM   1040 C CB    . LEU E 3 54  ? -21.410 -5.899  29.943  1.00 12.09 ? 54   LEU A CB    1 
ATOM   1041 C CG    . LEU E 3 54  ? -21.421 -4.655  29.042  1.00 12.85 ? 54   LEU A CG    1 
ATOM   1042 C CD1   . LEU E 3 54  ? -22.827 -4.283  28.570  1.00 14.65 ? 54   LEU A CD1   1 
ATOM   1043 C CD2   . LEU E 3 54  ? -20.819 -3.500  29.782  1.00 13.13 ? 54   LEU A CD2   1 
ATOM   1044 N N     . ARG E 3 55  ? -20.436 -8.693  30.861  1.00 11.75 ? 55   ARG A N     1 
ATOM   1045 C CA    . ARG E 3 55  ? -20.700 -9.931  31.616  1.00 11.83 ? 55   ARG A CA    1 
ATOM   1046 C C     . ARG E 3 55  ? -19.484 -10.303 32.462  1.00 12.69 ? 55   ARG A C     1 
ATOM   1047 O O     . ARG E 3 55  ? -19.610 -10.604 33.654  1.00 12.56 ? 55   ARG A O     1 
ATOM   1048 C CB    . ARG E 3 55  ? -21.052 -11.067 30.659  1.00 12.16 ? 55   ARG A CB    1 
ATOM   1049 C CG    . ARG E 3 55  ? -22.336 -10.841 29.857  1.00 11.43 ? 55   ARG A CG    1 
ATOM   1050 C CD    . ARG E 3 55  ? -22.552 -11.920 28.810  1.00 10.63 ? 55   ARG A CD    1 
ATOM   1051 N NE    . ARG E 3 55  ? -23.694 -11.622 27.950  1.00 13.28 ? 55   ARG A NE    1 
ATOM   1052 C CZ    . ARG E 3 55  ? -24.915 -12.120 28.111  1.00 12.67 ? 55   ARG A CZ    1 
ATOM   1053 N NH1   . ARG E 3 55  ? -25.155 -12.956 29.124  1.00 11.48 ? 55   ARG A NH1   1 
ATOM   1054 N NH2   . ARG E 3 55  ? -25.882 -11.791 27.261  1.00 10.84 ? 55   ARG A NH2   1 
ATOM   1055 N N     . ALA E 3 56  ? -18.298 -10.228 31.856  1.00 12.71 ? 56   ALA A N     1 
ATOM   1056 C CA    . ALA E 3 56  ? -17.066 -10.571 32.565  1.00 13.74 ? 56   ALA A CA    1 
ATOM   1057 C C     . ALA E 3 56  ? -16.739 -9.573  33.673  1.00 13.68 ? 56   ALA A C     1 
ATOM   1058 O O     . ALA E 3 56  ? -16.255 -9.962  34.744  1.00 14.04 ? 56   ALA A O     1 
ATOM   1059 C CB    . ALA E 3 56  ? -15.902 -10.699 31.585  1.00 13.38 ? 56   ALA A CB    1 
ATOM   1060 N N     . PHE E 3 57  ? -17.008 -8.293  33.432  1.00 13.55 ? 57   PHE A N     1 
ATOM   1061 C CA    . PHE E 3 57  ? -16.726 -7.278  34.423  1.00 14.52 ? 57   PHE A CA    1 
ATOM   1062 C C     . PHE E 3 57  ? -17.664 -7.463  35.608  1.00 15.23 ? 57   PHE A C     1 
ATOM   1063 O O     . PHE E 3 57  ? -17.219 -7.449  36.758  1.00 15.23 ? 57   PHE A O     1 
ATOM   1064 C CB    . PHE E 3 57  ? -16.890 -5.867  33.854  1.00 14.90 ? 57   PHE A CB    1 
ATOM   1065 C CG    . PHE E 3 57  ? -16.434 -4.795  34.796  1.00 14.24 ? 57   PHE A CG    1 
ATOM   1066 C CD1   . PHE E 3 57  ? -15.115 -4.359  34.787  1.00 16.03 ? 57   PHE A CD1   1 
ATOM   1067 C CD2   . PHE E 3 57  ? -17.324 -4.236  35.727  1.00 17.06 ? 57   PHE A CD2   1 
ATOM   1068 C CE1   . PHE E 3 57  ? -14.674 -3.360  35.686  1.00 16.26 ? 57   PHE A CE1   1 
ATOM   1069 C CE2   . PHE E 3 57  ? -16.902 -3.246  36.622  1.00 15.92 ? 57   PHE A CE2   1 
ATOM   1070 C CZ    . PHE E 3 57  ? -15.574 -2.801  36.603  1.00 15.98 ? 57   PHE A CZ    1 
ATOM   1071 N N     . ARG E 3 58  ? -18.956 -7.639  35.322  1.00 15.15 ? 58   ARG A N     1 
ATOM   1072 C CA    . ARG E 3 58  ? -19.942 -7.923  36.378  1.00 15.81 ? 58   ARG A CA    1 
ATOM   1073 C C     . ARG E 3 58  ? -19.594 -9.158  37.223  1.00 16.53 ? 58   ARG A C     1 
ATOM   1074 O O     . ARG E 3 58  ? -19.730 -9.125  38.447  1.00 16.64 ? 58   ARG A O     1 
ATOM   1075 C CB    . ARG E 3 58  ? -21.335 -8.096  35.791  1.00 15.72 ? 58   ARG A CB    1 
ATOM   1076 C CG    . ARG E 3 58  ? -22.444 -7.965  36.821  1.00 16.49 ? 58   ARG A CG    1 
ATOM   1077 C CD    . ARG E 3 58  ? -23.746 -7.953  36.092  1.00 17.81 ? 58   ARG A CD    1 
ATOM   1078 N NE    . ARG E 3 58  ? -24.874 -7.544  36.928  1.00 21.37 ? 58   ARG A NE    1 
ATOM   1079 C CZ    . ARG E 3 58  ? -25.771 -8.394  37.401  1.00 21.53 ? 58   ARG A CZ    1 
ATOM   1080 N NH1   . ARG E 3 58  ? -25.654 -9.689  37.139  1.00 21.38 ? 58   ARG A NH1   1 
ATOM   1081 N NH2   . ARG E 3 58  ? -26.781 -7.945  38.139  1.00 23.05 ? 58   ARG A NH2   1 
ATOM   1082 N N     . GLU E 3 59  ? -19.192 -10.244 36.574  1.00 17.44 ? 59   GLU A N     1 
ATOM   1083 C CA    . GLU E 3 59  ? -18.812 -11.477 37.266  1.00 18.89 ? 59   GLU A CA    1 
ATOM   1084 C C     . GLU E 3 59  ? -17.626 -11.255 38.188  1.00 19.11 ? 59   GLU A C     1 
ATOM   1085 O O     . GLU E 3 59  ? -17.577 -11.798 39.295  1.00 18.83 ? 59   GLU A O     1 
ATOM   1086 C CB    . GLU E 3 59  ? -18.455 -12.559 36.255  1.00 19.47 ? 59   GLU A CB    1 
ATOM   1087 C CG    . GLU E 3 59  ? -18.310 -13.946 36.849  1.00 25.33 ? 59   GLU A CG    1 
ATOM   1088 C CD    . GLU E 3 59  ? -19.639 -14.505 37.302  1.00 30.78 ? 59   GLU A CD    1 
ATOM   1089 O OE1   . GLU E 3 59  ? -19.699 -15.038 38.433  1.00 36.06 ? 59   GLU A OE1   1 
ATOM   1090 O OE2   . GLU E 3 59  ? -20.623 -14.408 36.530  1.00 34.16 ? 59   GLU A OE2   1 
ATOM   1091 N N     . ALA E 3 60  ? -16.674 -10.445 37.726  1.00 19.47 ? 60   ALA A N     1 
ATOM   1092 C CA    . ALA E 3 60  ? -15.425 -10.220 38.454  1.00 20.32 ? 60   ALA A CA    1 
ATOM   1093 C C     . ALA E 3 60  ? -15.539 -9.167  39.549  1.00 21.20 ? 60   ALA A C     1 
ATOM   1094 O O     . ALA E 3 60  ? -14.994 -9.343  40.640  1.00 21.50 ? 60   ALA A O     1 
ATOM   1095 C CB    . ALA E 3 60  ? -14.297 -9.859  37.483  1.00 20.31 ? 60   ALA A CB    1 
ATOM   1096 N N     . HIS E 3 61  ? -16.228 -8.071  39.258  1.00 22.06 ? 61   HIS A N     1 
ATOM   1097 C CA    . HIS E 3 61  ? -16.226 -6.917  40.147  1.00 23.18 ? 61   HIS A CA    1 
ATOM   1098 C C     . HIS E 3 61  ? -17.575 -6.637  40.834  1.00 23.04 ? 61   HIS A C     1 
ATOM   1099 O O     . HIS E 3 61  ? -17.668 -5.726  41.660  1.00 24.90 ? 61   HIS A O     1 
ATOM   1100 C CB    . HIS E 3 61  ? -15.724 -5.665  39.409  1.00 23.91 ? 61   HIS A CB    1 
ATOM   1101 C CG    . HIS E 3 61  ? -14.335 -5.796  38.859  1.00 26.30 ? 61   HIS A CG    1 
ATOM   1102 N ND1   . HIS E 3 61  ? -14.062 -5.754  37.510  1.00 29.38 ? 61   HIS A ND1   1 
ATOM   1103 C CD2   . HIS E 3 61  ? -13.145 -5.990  39.476  1.00 29.01 ? 61   HIS A CD2   1 
ATOM   1104 C CE1   . HIS E 3 61  ? -12.761 -5.893  37.318  1.00 29.68 ? 61   HIS A CE1   1 
ATOM   1105 N NE2   . HIS E 3 61  ? -12.182 -6.044  38.496  1.00 30.80 ? 61   HIS A NE2   1 
ATOM   1106 N N     . GLY E 3 62  ? -18.605 -7.407  40.493  1.00 22.22 ? 62   GLY A N     1 
ATOM   1107 C CA    . GLY E 3 62  ? -19.918 -7.285  41.137  1.00 21.36 ? 62   GLY A CA    1 
ATOM   1108 C C     . GLY E 3 62  ? -20.967 -6.474  40.393  1.00 20.93 ? 62   GLY A C     1 
ATOM   1109 O O     . GLY E 3 62  ? -20.757 -6.046  39.262  1.00 20.40 ? 62   GLY A O     1 
ATOM   1110 N N     . THR E 3 63  ? -22.090 -6.232  41.062  1.00 20.46 ? 63   THR A N     1 
ATOM   1111 C CA    . THR E 3 63  ? -23.291 -5.720  40.408  1.00 19.62 ? 63   THR A CA    1 
ATOM   1112 C C     . THR E 3 63  ? -23.528 -4.210  40.540  1.00 19.02 ? 63   THR A C     1 
ATOM   1113 O O     . THR E 3 63  ? -24.354 -3.668  39.819  1.00 18.63 ? 63   THR A O     1 
ATOM   1114 C CB    . THR E 3 63  ? -24.557 -6.492  40.877  1.00 20.03 ? 63   THR A CB    1 
ATOM   1115 O OG1   . THR E 3 63  ? -24.816 -6.217  42.267  1.00 19.59 ? 63   THR A OG1   1 
ATOM   1116 C CG2   . THR E 3 63  ? -24.393 -8.004  40.672  1.00 19.94 ? 63   THR A CG2   1 
ATOM   1117 N N     . ALA E 3 64  ? -22.798 -3.536  41.433  1.00 18.12 ? 64   ALA A N     1 
ATOM   1118 C CA    . ALA E 3 64  ? -23.047 -2.123  41.755  1.00 18.61 ? 64   ALA A CA    1 
ATOM   1119 C C     . ALA E 3 64  ? -22.412 -1.157  40.749  1.00 18.40 ? 64   ALA A C     1 
ATOM   1120 O O     . ALA E 3 64  ? -21.563 -0.328  41.098  1.00 18.64 ? 64   ALA A O     1 
ATOM   1121 C CB    . ALA E 3 64  ? -22.600 -1.797  43.203  1.00 18.68 ? 64   ALA A CB    1 
ATOM   1122 N N     . TYR E 3 65  ? -22.843 -1.293  39.501  1.00 17.68 ? 65   TYR A N     1 
ATOM   1123 C CA    . TYR E 3 65  ? -22.453 -0.409  38.413  1.00 17.53 ? 65   TYR A CA    1 
ATOM   1124 C C     . TYR E 3 65  ? -23.640 -0.246  37.473  1.00 17.16 ? 65   TYR A C     1 
ATOM   1125 O O     . TYR E 3 65  ? -24.544 -1.107  37.437  1.00 17.09 ? 65   TYR A O     1 
ATOM   1126 C CB    . TYR E 3 65  ? -21.295 -1.035  37.619  1.00 17.53 ? 65   TYR A CB    1 
ATOM   1127 C CG    . TYR E 3 65  ? -20.126 -1.449  38.463  1.00 16.49 ? 65   TYR A CG    1 
ATOM   1128 C CD1   . TYR E 3 65  ? -19.101 -0.539  38.775  1.00 16.64 ? 65   TYR A CD1   1 
ATOM   1129 C CD2   . TYR E 3 65  ? -20.047 -2.749  38.971  1.00 17.16 ? 65   TYR A CD2   1 
ATOM   1130 C CE1   . TYR E 3 65  ? -18.021 -0.936  39.573  1.00 19.12 ? 65   TYR A CE1   1 
ATOM   1131 C CE2   . TYR E 3 65  ? -18.986 -3.151  39.765  1.00 19.49 ? 65   TYR A CE2   1 
ATOM   1132 C CZ    . TYR E 3 65  ? -17.975 -2.241  40.060  1.00 18.31 ? 65   TYR A CZ    1 
ATOM   1133 O OH    . TYR E 3 65  ? -16.933 -2.661  40.852  1.00 19.98 ? 65   TYR A OH    1 
ATOM   1134 N N     . ARG E 3 66  ? -23.612 0.832   36.689  1.00 16.46 ? 66   ARG A N     1 
ATOM   1135 C CA    . ARG E 3 66  ? -24.575 1.045   35.622  1.00 16.22 ? 66   ARG A CA    1 
ATOM   1136 C C     . ARG E 3 66  ? -23.978 0.545   34.297  1.00 15.68 ? 66   ARG A C     1 
ATOM   1137 O O     . ARG E 3 66  ? -23.114 1.201   33.731  1.00 16.12 ? 66   ARG A O     1 
ATOM   1138 C CB    . ARG E 3 66  ? -24.903 2.528   35.516  1.00 17.28 ? 66   ARG A CB    1 
ATOM   1139 C CG    . ARG E 3 66  ? -25.894 2.916   34.414  1.00 20.38 ? 66   ARG A CG    1 
ATOM   1140 C CD    . ARG E 3 66  ? -27.303 3.005   34.954  1.00 26.59 ? 66   ARG A CD    1 
ATOM   1141 N NE    . ARG E 3 66  ? -28.280 3.534   33.994  1.00 28.82 ? 66   ARG A NE    1 
ATOM   1142 C CZ    . ARG E 3 66  ? -29.130 4.528   34.264  1.00 30.90 ? 66   ARG A CZ    1 
ATOM   1143 N NH1   . ARG E 3 66  ? -29.115 5.111   35.454  1.00 32.00 ? 66   ARG A NH1   1 
ATOM   1144 N NH2   . ARG E 3 66  ? -30.004 4.940   33.351  1.00 31.26 ? 66   ARG A NH2   1 
ATOM   1145 N N     . PHE E 3 67  ? -24.470 -0.591  33.817  1.00 14.98 ? 67   PHE A N     1 
ATOM   1146 C CA    . PHE E 3 67  ? -23.910 -1.254  32.629  1.00 14.27 ? 67   PHE A CA    1 
ATOM   1147 C C     . PHE E 3 67  ? -24.675 -0.853  31.374  1.00 14.10 ? 67   PHE A C     1 
ATOM   1148 O O     . PHE E 3 67  ? -25.900 -0.912  31.344  1.00 14.63 ? 67   PHE A O     1 
ATOM   1149 C CB    . PHE E 3 67  ? -23.948 -2.782  32.780  1.00 14.30 ? 67   PHE A CB    1 
ATOM   1150 C CG    . PHE E 3 67  ? -23.050 -3.317  33.866  1.00 15.85 ? 67   PHE A CG    1 
ATOM   1151 C CD1   . PHE E 3 67  ? -21.699 -3.534  33.624  1.00 14.98 ? 67   PHE A CD1   1 
ATOM   1152 C CD2   . PHE E 3 67  ? -23.561 -3.611  35.138  1.00 16.61 ? 67   PHE A CD2   1 
ATOM   1153 C CE1   . PHE E 3 67  ? -20.859 -4.038  34.621  1.00 15.65 ? 67   PHE A CE1   1 
ATOM   1154 C CE2   . PHE E 3 67  ? -22.720 -4.113  36.140  1.00 15.10 ? 67   PHE A CE2   1 
ATOM   1155 C CZ    . PHE E 3 67  ? -21.373 -4.321  35.876  1.00 16.25 ? 67   PHE A CZ    1 
ATOM   1156 N N     . VAL E 3 68  ? -23.930 -0.458  30.336  1.00 13.63 ? 68   VAL A N     1 
ATOM   1157 C CA    . VAL E 3 68  ? -24.523 -0.010  29.068  1.00 12.74 ? 68   VAL A CA    1 
ATOM   1158 C C     . VAL E 3 68  ? -23.761 -0.655  27.894  1.00 12.04 ? 68   VAL A C     1 
ATOM   1159 O O     . VAL E 3 68  ? -22.553 -0.761  27.953  1.00 12.06 ? 68   VAL A O     1 
ATOM   1160 C CB    . VAL E 3 68  ? -24.472 1.551   28.942  1.00 12.78 ? 68   VAL A CB    1 
ATOM   1161 C CG1   . VAL E 3 68  ? -25.124 1.996   27.651  1.00 13.49 ? 68   VAL A CG1   1 
ATOM   1162 C CG2   . VAL E 3 68  ? -25.161 2.243   30.158  1.00 14.08 ? 68   VAL A CG2   1 
ATOM   1163 N N     . GLY E 3 69  ? -24.475 -1.098  26.855  1.00 11.97 ? 69   GLY A N     1 
ATOM   1164 C CA    . GLY E 3 69  ? -23.853 -1.642  25.647  1.00 11.58 ? 69   GLY A CA    1 
ATOM   1165 C C     . GLY E 3 69  ? -24.428 -0.862  24.472  1.00 12.25 ? 69   GLY A C     1 
ATOM   1166 O O     . GLY E 3 69  ? -25.616 -0.515  24.485  1.00 12.10 ? 69   GLY A O     1 
ATOM   1167 N N     . VAL E 3 70  ? -23.577 -0.534  23.490  1.00 10.78 ? 70   VAL A N     1 
ATOM   1168 C CA    . VAL E 3 70  ? -24.016 0.162   22.274  1.00 11.04 ? 70   VAL A CA    1 
ATOM   1169 C C     . VAL E 3 70  ? -23.695 -0.744  21.089  1.00 10.73 ? 70   VAL A C     1 
ATOM   1170 O O     . VAL E 3 70  ? -22.575 -1.228  20.972  1.00 9.99  ? 70   VAL A O     1 
ATOM   1171 C CB    . VAL E 3 70  ? -23.338 1.558   22.089  1.00 11.23 ? 70   VAL A CB    1 
ATOM   1172 C CG1   . VAL E 3 70  ? -23.701 2.165   20.710  1.00 11.31 ? 70   VAL A CG1   1 
ATOM   1173 C CG2   . VAL E 3 70  ? -23.731 2.512   23.253  1.00 11.86 ? 70   VAL A CG2   1 
ATOM   1174 N N     . GLU E 3 71  ? -24.681 -0.955  20.225  1.00 9.54  ? 71   GLU A N     1 
ATOM   1175 C CA    . GLU E 3 71  ? -24.560 -1.900  19.122  1.00 10.73 ? 71   GLU A CA    1 
ATOM   1176 C C     . GLU E 3 71  ? -25.386 -1.379  17.949  1.00 11.13 ? 71   GLU A C     1 
ATOM   1177 O O     . GLU E 3 71  ? -26.528 -0.936  18.134  1.00 12.26 ? 71   GLU A O     1 
ATOM   1178 C CB    . GLU E 3 71  ? -25.065 -3.275  19.576  1.00 10.40 ? 71   GLU A CB    1 
ATOM   1179 C CG    . GLU E 3 71  ? -25.297 -4.284  18.484  1.00 10.15 ? 71   GLU A CG    1 
ATOM   1180 C CD    . GLU E 3 71  ? -24.040 -4.610  17.687  1.00 12.28 ? 71   GLU A CD    1 
ATOM   1181 O OE1   . GLU E 3 71  ? -23.041 -5.064  18.297  1.00 13.06 ? 71   GLU A OE1   1 
ATOM   1182 O OE2   . GLU E 3 71  ? -24.075 -4.409  16.446  1.00 13.19 ? 71   GLU A OE2   1 
ATOM   1183 N N     . ILE E 3 72  ? -24.801 -1.427  16.754  1.00 11.28 ? 72   ILE A N     1 
ATOM   1184 C CA    . ILE E 3 72  ? -25.465 -0.893  15.568  1.00 12.42 ? 72   ILE A CA    1 
ATOM   1185 C C     . ILE E 3 72  ? -26.438 -1.865  14.890  1.00 13.06 ? 72   ILE A C     1 
ATOM   1186 O O     . ILE E 3 72  ? -27.355 -1.422  14.174  1.00 12.26 ? 72   ILE A O     1 
ATOM   1187 C CB    . ILE E 3 72  ? -24.403 -0.399  14.529  1.00 11.87 ? 72   ILE A CB    1 
ATOM   1188 C CG1   . ILE E 3 72  ? -24.993 0.706   13.649  1.00 12.54 ? 72   ILE A CG1   1 
ATOM   1189 C CG2   . ILE E 3 72  ? -23.838 -1.564  13.693  1.00 11.75 ? 72   ILE A CG2   1 
ATOM   1190 C CD1   . ILE E 3 72  ? -23.981 1.251   12.652  1.00 12.96 ? 72   ILE A CD1   1 
ATOM   1191 N N     . ASP E 3 73  ? -26.243 -3.172  15.094  1.00 14.17 ? 73   ASP A N     1 
ATOM   1192 C CA    . ASP E 3 73  ? -26.998 -4.186  14.351  1.00 15.41 ? 73   ASP A CA    1 
ATOM   1193 C C     . ASP E 3 73  ? -28.019 -4.833  15.280  1.00 16.17 ? 73   ASP A C     1 
ATOM   1194 O O     . ASP E 3 73  ? -27.621 -5.478  16.243  1.00 15.85 ? 73   ASP A O     1 
ATOM   1195 C CB    . ASP E 3 73  ? -26.049 -5.240  13.756  1.00 15.74 ? 73   ASP A CB    1 
ATOM   1196 C CG    . ASP E 3 73  ? -26.783 -6.399  13.054  1.00 18.17 ? 73   ASP A CG    1 
ATOM   1197 O OD1   . ASP E 3 73  ? -28.027 -6.357  12.881  1.00 18.55 ? 73   ASP A OD1   1 
ATOM   1198 O OD2   . ASP E 3 73  ? -26.084 -7.361  12.645  1.00 20.54 ? 73   ASP A OD2   1 
ATOM   1199 N N     . PRO E 3 74  ? -29.330 -4.638  15.012  1.00 17.09 ? 74   PRO A N     1 
ATOM   1200 C CA    . PRO E 3 74  ? -30.371 -5.212  15.894  1.00 18.13 ? 74   PRO A CA    1 
ATOM   1201 C C     . PRO E 3 74  ? -30.293 -6.726  16.063  1.00 18.34 ? 74   PRO A C     1 
ATOM   1202 O O     . PRO E 3 74  ? -30.684 -7.246  17.111  1.00 19.20 ? 74   PRO A O     1 
ATOM   1203 C CB    . PRO E 3 74  ? -31.675 -4.870  15.162  1.00 18.37 ? 74   PRO A CB    1 
ATOM   1204 C CG    . PRO E 3 74  ? -31.356 -3.704  14.349  1.00 18.75 ? 74   PRO A CG    1 
ATOM   1205 C CD    . PRO E 3 74  ? -29.937 -3.879  13.899  1.00 17.65 ? 74   PRO A CD    1 
ATOM   1206 N N     . LYS E 3 75  ? -29.829 -7.429  15.031  1.00 19.13 ? 75   LYS A N     1 
ATOM   1207 C CA    . LYS E 3 75  ? -29.651 -8.873  15.094  1.00 20.01 ? 75   LYS A CA    1 
ATOM   1208 C C     . LYS E 3 75  ? -28.564 -9.279  16.089  1.00 19.91 ? 75   LYS A C     1 
ATOM   1209 O O     . LYS E 3 75  ? -28.554 -10.425 16.562  1.00 20.32 ? 75   LYS A O     1 
ATOM   1210 C CB    . LYS E 3 75  ? -29.292 -9.436  13.717  1.00 20.37 ? 75   LYS A CB    1 
ATOM   1211 C CG    . LYS E 3 75  ? -30.428 -9.438  12.699  1.00 22.31 ? 75   LYS A CG    1 
ATOM   1212 C CD    . LYS E 3 75  ? -30.036 -10.224 11.432  1.00 22.60 ? 75   LYS A CD    1 
ATOM   1213 C CE    . LYS E 3 75  ? -28.988 -9.489  10.584  1.00 27.40 ? 75   LYS A CE    1 
ATOM   1214 N NZ    . LYS E 3 75  ? -28.920 -10.020 9.187   1.00 30.76 ? 75   LYS A NZ    1 
ATOM   1215 N N     . ALA E 3 76  ? -27.642 -8.358  16.371  1.00 18.38 ? 76   ALA A N     1 
ATOM   1216 C CA    . ALA E 3 76  ? -26.478 -8.644  17.213  1.00 17.95 ? 76   ALA A CA    1 
ATOM   1217 C C     . ALA E 3 76  ? -26.690 -8.281  18.690  1.00 17.35 ? 76   ALA A C     1 
ATOM   1218 O O     . ALA E 3 76  ? -26.123 -8.913  19.575  1.00 16.84 ? 76   ALA A O     1 
ATOM   1219 C CB    . ALA E 3 76  ? -25.224 -7.934  16.668  1.00 17.94 ? 76   ALA A CB    1 
ATOM   1220 N N     . LEU E 3 77  ? -27.476 -7.243  18.951  1.00 16.55 ? 77   LEU A N     1 
ATOM   1221 C CA    . LEU E 3 77  ? -27.648 -6.766  20.314  1.00 15.70 ? 77   LEU A CA    1 
ATOM   1222 C C     . LEU E 3 77  ? -28.427 -7.805  21.126  1.00 15.95 ? 77   LEU A C     1 
ATOM   1223 O O     . LEU E 3 77  ? -29.558 -8.138  20.785  1.00 16.28 ? 77   LEU A O     1 
ATOM   1224 C CB    . LEU E 3 77  ? -28.360 -5.416  20.321  1.00 15.80 ? 77   LEU A CB    1 
ATOM   1225 C CG    . LEU E 3 77  ? -28.667 -4.798  21.686  1.00 15.22 ? 77   LEU A CG    1 
ATOM   1226 C CD1   . LEU E 3 77  ? -27.387 -4.429  22.433  1.00 16.30 ? 77   LEU A CD1   1 
ATOM   1227 C CD2   . LEU E 3 77  ? -29.532 -3.559  21.475  1.00 18.41 ? 77   LEU A CD2   1 
ATOM   1228 N N     . ASP E 3 78  ? -27.807 -8.340  22.175  1.00 15.66 ? 78   ASP A N     1 
ATOM   1229 C CA    . ASP E 3 78  ? -28.450 -9.408  22.954  1.00 15.11 ? 78   ASP A CA    1 
ATOM   1230 C C     . ASP E 3 78  ? -27.912 -9.372  24.374  1.00 15.27 ? 78   ASP A C     1 
ATOM   1231 O O     . ASP E 3 78  ? -27.137 -10.235 24.785  1.00 15.52 ? 78   ASP A O     1 
ATOM   1232 C CB    . ASP E 3 78  ? -28.198 -10.768 22.291  1.00 16.07 ? 78   ASP A CB    1 
ATOM   1233 C CG    . ASP E 3 78  ? -29.061 -11.893 22.883  1.00 16.83 ? 78   ASP A CG    1 
ATOM   1234 O OD1   . ASP E 3 78  ? -30.111 -11.606 23.501  1.00 19.56 ? 78   ASP A OD1   1 
ATOM   1235 O OD2   . ASP E 3 78  ? -28.692 -13.066 22.685  1.00 18.05 ? 78   ASP A OD2   1 
ATOM   1236 N N     . LEU E 3 79  ? -28.319 -8.355  25.114  1.00 14.69 ? 79   LEU A N     1 
ATOM   1237 C CA    . LEU E 3 79  ? -27.767 -8.125  26.443  1.00 15.19 ? 79   LEU A CA    1 
ATOM   1238 C C     . LEU E 3 79  ? -28.652 -8.748  27.528  1.00 15.81 ? 79   LEU A C     1 
ATOM   1239 O O     . LEU E 3 79  ? -29.835 -8.968  27.300  1.00 16.86 ? 79   LEU A O     1 
ATOM   1240 C CB    . LEU E 3 79  ? -27.604 -6.632  26.702  1.00 14.29 ? 79   LEU A CB    1 
ATOM   1241 C CG    . LEU E 3 79  ? -26.572 -5.858  25.877  1.00 13.49 ? 79   LEU A CG    1 
ATOM   1242 C CD1   . LEU E 3 79  ? -26.587 -4.381  26.257  1.00 10.96 ? 79   LEU A CD1   1 
ATOM   1243 C CD2   . LEU E 3 79  ? -25.180 -6.464  26.063  1.00 12.01 ? 79   LEU A CD2   1 
ATOM   1244 N N     . PRO E 3 80  ? -28.070 -9.027  28.705  1.00 16.26 ? 80   PRO A N     1 
ATOM   1245 C CA    . PRO E 3 80  ? -28.886 -9.441  29.853  1.00 16.97 ? 80   PRO A CA    1 
ATOM   1246 C C     . PRO E 3 80  ? -29.736 -8.270  30.331  1.00 17.39 ? 80   PRO A C     1 
ATOM   1247 O O     . PRO E 3 80  ? -29.406 -7.109  30.061  1.00 17.22 ? 80   PRO A O     1 
ATOM   1248 C CB    . PRO E 3 80  ? -27.842 -9.819  30.916  1.00 17.06 ? 80   PRO A CB    1 
ATOM   1249 C CG    . PRO E 3 80  ? -26.583 -9.951  30.196  1.00 18.21 ? 80   PRO A CG    1 
ATOM   1250 C CD    . PRO E 3 80  ? -26.646 -8.970  29.068  1.00 16.35 ? 80   PRO A CD    1 
ATOM   1251 N N     . PRO E 3 81  ? -30.847 -8.569  31.030  1.00 18.14 ? 81   PRO A N     1 
ATOM   1252 C CA    . PRO E 3 81  ? -31.751 -7.534  31.521  1.00 17.63 ? 81   PRO A CA    1 
ATOM   1253 C C     . PRO E 3 81  ? -31.116 -6.499  32.457  1.00 17.23 ? 81   PRO A C     1 
ATOM   1254 O O     . PRO E 3 81  ? -31.627 -5.391  32.550  1.00 18.15 ? 81   PRO A O     1 
ATOM   1255 C CB    . PRO E 3 81  ? -32.873 -8.326  32.225  1.00 18.04 ? 81   PRO A CB    1 
ATOM   1256 C CG    . PRO E 3 81  ? -32.448 -9.699  32.284  1.00 18.46 ? 81   PRO A CG    1 
ATOM   1257 C CD    . PRO E 3 81  ? -31.336 -9.930  31.315  1.00 18.07 ? 81   PRO A CD    1 
ATOM   1258 N N     . TRP E 3 82  ? -29.994 -6.825  33.101  1.00 16.66 ? 82   TRP A N     1 
ATOM   1259 C CA    . TRP E 3 82  ? -29.335 -5.875  34.002  1.00 15.70 ? 82   TRP A CA    1 
ATOM   1260 C C     . TRP E 3 82  ? -28.495 -4.806  33.294  1.00 15.83 ? 82   TRP A C     1 
ATOM   1261 O O     . TRP E 3 82  ? -27.988 -3.887  33.943  1.00 16.17 ? 82   TRP A O     1 
ATOM   1262 C CB    . TRP E 3 82  ? -28.495 -6.589  35.071  1.00 15.95 ? 82   TRP A CB    1 
ATOM   1263 C CG    . TRP E 3 82  ? -27.594 -7.668  34.544  1.00 15.00 ? 82   TRP A CG    1 
ATOM   1264 C CD1   . TRP E 3 82  ? -27.819 -9.006  34.617  1.00 14.72 ? 82   TRP A CD1   1 
ATOM   1265 C CD2   . TRP E 3 82  ? -26.330 -7.508  33.843  1.00 15.14 ? 82   TRP A CD2   1 
ATOM   1266 N NE1   . TRP E 3 82  ? -26.780 -9.702  34.035  1.00 14.42 ? 82   TRP A NE1   1 
ATOM   1267 C CE2   . TRP E 3 82  ? -25.856 -8.812  33.552  1.00 13.72 ? 82   TRP A CE2   1 
ATOM   1268 C CE3   . TRP E 3 82  ? -25.553 -6.400  33.460  1.00 14.50 ? 82   TRP A CE3   1 
ATOM   1269 C CZ2   . TRP E 3 82  ? -24.640 -9.046  32.881  1.00 14.67 ? 82   TRP A CZ2   1 
ATOM   1270 C CZ3   . TRP E 3 82  ? -24.335 -6.632  32.777  1.00 14.72 ? 82   TRP A CZ3   1 
ATOM   1271 C CH2   . TRP E 3 82  ? -23.902 -7.945  32.500  1.00 15.35 ? 82   TRP A CH2   1 
ATOM   1272 N N     . ALA E 3 83  ? -28.355 -4.928  31.975  1.00 15.17 ? 83   ALA A N     1 
ATOM   1273 C CA    . ALA E 3 83  ? -27.625 -3.929  31.165  1.00 15.53 ? 83   ALA A CA    1 
ATOM   1274 C C     . ALA E 3 83  ? -28.582 -3.156  30.256  1.00 15.87 ? 83   ALA A C     1 
ATOM   1275 O O     . ALA E 3 83  ? -29.563 -3.721  29.761  1.00 17.47 ? 83   ALA A O     1 
ATOM   1276 C CB    . ALA E 3 83  ? -26.566 -4.616  30.331  1.00 15.85 ? 83   ALA A CB    1 
ATOM   1277 N N     . GLU E 3 84  ? -28.285 -1.885  30.013  1.00 15.42 ? 84   GLU A N     1 
ATOM   1278 C CA    . GLU E 3 84  ? -29.078 -1.105  29.056  1.00 16.01 ? 84   GLU A CA    1 
ATOM   1279 C C     . GLU E 3 84  ? -28.466 -1.229  27.666  1.00 15.55 ? 84   GLU A C     1 
ATOM   1280 O O     . GLU E 3 84  ? -27.305 -0.891  27.493  1.00 15.14 ? 84   GLU A O     1 
ATOM   1281 C CB    . GLU E 3 84  ? -29.120 0.366   29.431  1.00 17.23 ? 84   GLU A CB    1 
ATOM   1282 C CG    . GLU E 3 84  ? -30.203 1.100   28.624  1.00 21.48 ? 84   GLU A CG    1 
ATOM   1283 C CD    . GLU E 3 84  ? -30.021 2.610   28.528  1.00 27.37 ? 84   GLU A CD    1 
ATOM   1284 O OE1   . GLU E 3 84  ? -29.114 3.175   29.195  1.00 28.84 ? 84   GLU A OE1   1 
ATOM   1285 O OE2   . GLU E 3 84  ? -30.804 3.226   27.760  1.00 28.72 ? 84   GLU A OE2   1 
ATOM   1286 N N     . GLY E 3 85  ? -29.254 -1.699  26.698  1.00 15.18 ? 85   GLY A N     1 
ATOM   1287 C CA    . GLY E 3 85  ? -28.794 -1.808  25.312  1.00 15.82 ? 85   GLY A CA    1 
ATOM   1288 C C     . GLY E 3 85  ? -29.294 -0.662  24.464  1.00 16.79 ? 85   GLY A C     1 
ATOM   1289 O O     . GLY E 3 85  ? -30.487 -0.349  24.470  1.00 17.21 ? 85   GLY A O     1 
ATOM   1290 N N     . ILE E 3 86  ? -28.381 -0.041  23.719  1.00 16.03 ? 86   ILE A N     1 
ATOM   1291 C CA    . ILE E 3 86  ? -28.740 1.061   22.818  1.00 15.95 ? 86   ILE A CA    1 
ATOM   1292 C C     . ILE E 3 86  ? -28.404 0.666   21.390  1.00 15.27 ? 86   ILE A C     1 
ATOM   1293 O O     . ILE E 3 86  ? -27.305 0.153   21.131  1.00 14.21 ? 86   ILE A O     1 
ATOM   1294 C CB    . ILE E 3 86  ? -28.032 2.372   23.243  1.00 16.09 ? 86   ILE A CB    1 
ATOM   1295 C CG1   . ILE E 3 86  ? -28.574 2.819   24.611  1.00 17.68 ? 86   ILE A CG1   1 
ATOM   1296 C CG2   . ILE E 3 86  ? -28.225 3.507   22.199  1.00 16.94 ? 86   ILE A CG2   1 
ATOM   1297 C CD1   . ILE E 3 86  ? -27.619 3.655   25.434  1.00 21.17 ? 86   ILE A CD1   1 
ATOM   1298 N N     . LEU E 3 87  ? -29.361 0.861   20.480  1.00 14.19 ? 87   LEU A N     1 
ATOM   1299 C CA    . LEU E 3 87  ? -29.115 0.616   19.064  1.00 13.82 ? 87   LEU A CA    1 
ATOM   1300 C C     . LEU E 3 87  ? -28.669 1.908   18.440  1.00 13.73 ? 87   LEU A C     1 
ATOM   1301 O O     . LEU E 3 87  ? -29.475 2.829   18.272  1.00 13.80 ? 87   LEU A O     1 
ATOM   1302 C CB    . LEU E 3 87  ? -30.351 0.076   18.324  1.00 14.44 ? 87   LEU A CB    1 
ATOM   1303 C CG    . LEU E 3 87  ? -30.715 -1.383  18.598  1.00 15.40 ? 87   LEU A CG    1 
ATOM   1304 C CD1   . LEU E 3 87  ? -32.150 -1.679  18.162  1.00 17.55 ? 87   LEU A CD1   1 
ATOM   1305 C CD2   . LEU E 3 87  ? -29.690 -2.362  17.954  1.00 15.80 ? 87   LEU A CD2   1 
ATOM   1306 N N     . ALA E 3 88  ? -27.389 1.966   18.093  1.00 12.91 ? 88   ALA A N     1 
ATOM   1307 C CA    . ALA E 3 88  ? -26.767 3.200   17.603  1.00 12.30 ? 88   ALA A CA    1 
ATOM   1308 C C     . ALA E 3 88  ? -25.455 2.890   16.928  1.00 12.62 ? 88   ALA A C     1 
ATOM   1309 O O     . ALA E 3 88  ? -24.806 1.883   17.230  1.00 12.77 ? 88   ALA A O     1 
ATOM   1310 C CB    . ALA E 3 88  ? -26.506 4.171   18.754  1.00 12.00 ? 88   ALA A CB    1 
ATOM   1311 N N     . ASP E 3 89  ? -25.066 3.790   16.024  1.00 12.65 ? 89   ASP A N     1 
ATOM   1312 C CA    . ASP E 3 89  ? -23.686 3.869   15.558  1.00 12.44 ? 89   ASP A CA    1 
ATOM   1313 C C     . ASP E 3 89  ? -22.877 4.559   16.669  1.00 11.53 ? 89   ASP A C     1 
ATOM   1314 O O     . ASP E 3 89  ? -23.047 5.761   16.949  1.00 11.61 ? 89   ASP A O     1 
ATOM   1315 C CB    . ASP E 3 89  ? -23.612 4.656   14.236  1.00 11.29 ? 89   ASP A CB    1 
ATOM   1316 C CG    . ASP E 3 89  ? -22.193 4.731   13.670  1.00 12.31 ? 89   ASP A CG    1 
ATOM   1317 O OD1   . ASP E 3 89  ? -21.216 4.455   14.410  1.00 13.12 ? 89   ASP A OD1   1 
ATOM   1318 O OD2   . ASP E 3 89  ? -22.053 5.042   12.467  1.00 14.76 ? 89   ASP A OD2   1 
ATOM   1319 N N     . PHE E 3 90  ? -22.017 3.789   17.340  1.00 11.53 ? 90   PHE A N     1 
ATOM   1320 C CA    . PHE E 3 90  ? -21.232 4.305   18.454  1.00 10.87 ? 90   PHE A CA    1 
ATOM   1321 C C     . PHE E 3 90  ? -20.455 5.562   18.075  1.00 11.20 ? 90   PHE A C     1 
ATOM   1322 O O     . PHE E 3 90  ? -20.307 6.479   18.891  1.00 11.72 ? 90   PHE A O     1 
ATOM   1323 C CB    . PHE E 3 90  ? -20.266 3.221   18.965  1.00 11.10 ? 90   PHE A CB    1 
ATOM   1324 C CG    . PHE E 3 90  ? -19.304 3.704   20.026  1.00 11.21 ? 90   PHE A CG    1 
ATOM   1325 C CD1   . PHE E 3 90  ? -19.744 3.989   21.312  1.00 11.84 ? 90   PHE A CD1   1 
ATOM   1326 C CD2   . PHE E 3 90  ? -17.940 3.832   19.742  1.00 11.94 ? 90   PHE A CD2   1 
ATOM   1327 C CE1   . PHE E 3 90  ? -18.842 4.408   22.307  1.00 11.89 ? 90   PHE A CE1   1 
ATOM   1328 C CE2   . PHE E 3 90  ? -17.028 4.267   20.720  1.00 11.71 ? 90   PHE A CE2   1 
ATOM   1329 C CZ    . PHE E 3 90  ? -17.481 4.557   22.004  1.00 13.96 ? 90   PHE A CZ    1 
ATOM   1330 N N     . LEU E 3 91  ? -19.957 5.599   16.843  1.00 11.71 ? 91   LEU A N     1 
ATOM   1331 C CA    . LEU E 3 91  ? -19.109 6.695   16.390  1.00 12.26 ? 91   LEU A CA    1 
ATOM   1332 C C     . LEU E 3 91  ? -19.850 8.033   16.282  1.00 13.71 ? 91   LEU A C     1 
ATOM   1333 O O     . LEU E 3 91  ? -19.213 9.089   16.272  1.00 14.62 ? 91   LEU A O     1 
ATOM   1334 C CB    . LEU E 3 91  ? -18.416 6.340   15.066  1.00 12.22 ? 91   LEU A CB    1 
ATOM   1335 C CG    . LEU E 3 91  ? -17.464 5.143   15.143  1.00 11.76 ? 91   LEU A CG    1 
ATOM   1336 C CD1   . LEU E 3 91  ? -16.853 4.831   13.753  1.00 12.58 ? 91   LEU A CD1   1 
ATOM   1337 C CD2   . LEU E 3 91  ? -16.363 5.372   16.203  1.00 10.36 ? 91   LEU A CD2   1 
ATOM   1338 N N     . LEU E 3 92  ? -21.183 7.972   16.217  1.00 14.10 ? 92   LEU A N     1 
ATOM   1339 C CA    . LEU E 3 92  ? -22.027 9.176   16.055  1.00 15.10 ? 92   LEU A CA    1 
ATOM   1340 C C     . LEU E 3 92  ? -22.977 9.369   17.235  1.00 16.14 ? 92   LEU A C     1 
ATOM   1341 O O     . LEU E 3 92  ? -23.769 10.317  17.273  1.00 16.53 ? 92   LEU A O     1 
ATOM   1342 C CB    . LEU E 3 92  ? -22.810 9.109   14.740  1.00 14.71 ? 92   LEU A CB    1 
ATOM   1343 C CG    . LEU E 3 92  ? -21.991 9.076   13.447  1.00 17.46 ? 92   LEU A CG    1 
ATOM   1344 C CD1   . LEU E 3 92  ? -22.894 8.939   12.225  1.00 18.68 ? 92   LEU A CD1   1 
ATOM   1345 C CD2   . LEU E 3 92  ? -21.083 10.299  13.353  1.00 18.59 ? 92   LEU A CD2   1 
ATOM   1346 N N     . TRP E 3 93  ? -22.872 8.475   18.213  1.00 16.65 ? 93   TRP A N     1 
ATOM   1347 C CA    . TRP E 3 93  ? -23.759 8.464   19.368  1.00 17.11 ? 93   TRP A CA    1 
ATOM   1348 C C     . TRP E 3 93  ? -23.436 9.596   20.353  1.00 18.42 ? 93   TRP A C     1 
ATOM   1349 O O     . TRP E 3 93  ? -22.281 9.852   20.678  1.00 17.35 ? 93   TRP A O     1 
ATOM   1350 C CB    . TRP E 3 93  ? -23.620 7.084   20.021  1.00 16.74 ? 93   TRP A CB    1 
ATOM   1351 C CG    . TRP E 3 93  ? -24.417 6.857   21.255  1.00 16.75 ? 93   TRP A CG    1 
ATOM   1352 C CD1   . TRP E 3 93  ? -25.771 6.944   21.390  1.00 16.21 ? 93   TRP A CD1   1 
ATOM   1353 C CD2   . TRP E 3 93  ? -23.906 6.422   22.519  1.00 15.93 ? 93   TRP A CD2   1 
ATOM   1354 N NE1   . TRP E 3 93  ? -26.136 6.629   22.685  1.00 16.27 ? 93   TRP A NE1   1 
ATOM   1355 C CE2   . TRP E 3 93  ? -25.006 6.307   23.397  1.00 16.32 ? 93   TRP A CE2   1 
ATOM   1356 C CE3   . TRP E 3 93  ? -22.615 6.143   23.005  1.00 16.90 ? 93   TRP A CE3   1 
ATOM   1357 C CZ2   . TRP E 3 93  ? -24.861 5.906   24.736  1.00 16.81 ? 93   TRP A CZ2   1 
ATOM   1358 C CZ3   . TRP E 3 93  ? -22.467 5.762   24.336  1.00 16.42 ? 93   TRP A CZ3   1 
ATOM   1359 C CH2   . TRP E 3 93  ? -23.592 5.645   25.188  1.00 16.60 ? 93   TRP A CH2   1 
ATOM   1360 N N     . GLU E 3 94  ? -24.468 10.273  20.846  1.00 20.19 ? 94   GLU A N     1 
ATOM   1361 C CA    . GLU E 3 94  ? -24.262 11.310  21.851  1.00 22.83 ? 94   GLU A CA    1 
ATOM   1362 C C     . GLU E 3 94  ? -25.082 11.017  23.121  1.00 23.70 ? 94   GLU A C     1 
ATOM   1363 O O     . GLU E 3 94  ? -26.269 11.348  23.189  1.00 24.85 ? 94   GLU A O     1 
ATOM   1364 C CB    . GLU E 3 94  ? -24.567 12.695  21.261  1.00 23.56 ? 94   GLU A CB    1 
ATOM   1365 C CG    . GLU E 3 94  ? -23.601 13.114  20.136  1.00 27.21 ? 94   GLU A CG    1 
ATOM   1366 C CD    . GLU E 3 94  ? -22.205 13.500  20.643  1.00 32.66 ? 94   GLU A CD    1 
ATOM   1367 O OE1   . GLU E 3 94  ? -22.077 13.925  21.822  1.00 35.34 ? 94   GLU A OE1   1 
ATOM   1368 O OE2   . GLU E 3 94  ? -21.229 13.400  19.853  1.00 35.40 ? 94   GLU A OE2   1 
ATOM   1369 N N     . PRO E 3 95  ? -24.458 10.351  24.109  1.00 24.23 ? 95   PRO A N     1 
ATOM   1370 C CA    . PRO E 3 95  ? -25.132 10.043  25.376  1.00 24.51 ? 95   PRO A CA    1 
ATOM   1371 C C     . PRO E 3 95  ? -25.351 11.290  26.227  1.00 25.07 ? 95   PRO A C     1 
ATOM   1372 O O     . PRO E 3 95  ? -24.684 12.306  26.021  1.00 25.20 ? 95   PRO A O     1 
ATOM   1373 C CB    . PRO E 3 95  ? -24.147 9.118   26.080  1.00 24.67 ? 95   PRO A CB    1 
ATOM   1374 C CG    . PRO E 3 95  ? -22.812 9.488   25.514  1.00 24.74 ? 95   PRO A CG    1 
ATOM   1375 C CD    . PRO E 3 95  ? -23.076 9.833   24.081  1.00 24.23 ? 95   PRO A CD    1 
ATOM   1376 N N     . GLY E 3 96  ? -26.272 11.206  27.180  1.00 25.44 ? 96   GLY A N     1 
ATOM   1377 C CA    . GLY E 3 96  ? -26.511 12.317  28.102  1.00 26.04 ? 96   GLY A CA    1 
ATOM   1378 C C     . GLY E 3 96  ? -25.339 12.583  29.035  1.00 25.79 ? 96   GLY A C     1 
ATOM   1379 O O     . GLY E 3 96  ? -25.069 13.737  29.394  1.00 26.82 ? 96   GLY A O     1 
ATOM   1380 N N     . GLU E 3 97  ? -24.622 11.523  29.405  1.00 24.94 ? 97   GLU A N     1 
ATOM   1381 C CA    . GLU E 3 97  ? -23.587 11.597  30.432  1.00 23.81 ? 97   GLU A CA    1 
ATOM   1382 C C     . GLU E 3 97  ? -22.382 10.747  30.051  1.00 22.64 ? 97   GLU A C     1 
ATOM   1383 O O     . GLU E 3 97  ? -22.543 9.704   29.411  1.00 22.78 ? 97   GLU A O     1 
ATOM   1384 C CB    . GLU E 3 97  ? -24.166 11.127  31.773  1.00 24.11 ? 97   GLU A CB    1 
ATOM   1385 C CG    . GLU E 3 97  ? -23.174 11.032  32.931  1.00 24.27 ? 97   GLU A CG    1 
ATOM   1386 C CD    . GLU E 3 97  ? -23.844 10.712  34.274  1.00 25.59 ? 97   GLU A CD    1 
ATOM   1387 O OE1   . GLU E 3 97  ? -25.064 10.424  34.297  1.00 29.15 ? 97   GLU A OE1   1 
ATOM   1388 O OE2   . GLU E 3 97  ? -23.143 10.757  35.311  1.00 27.67 ? 97   GLU A OE2   1 
ATOM   1389 N N     . ALA E 3 98  ? -21.196 11.208  30.454  1.00 21.00 ? 98   ALA A N     1 
ATOM   1390 C CA    . ALA E 3 98  ? -19.919 10.509  30.233  1.00 19.74 ? 98   ALA A CA    1 
ATOM   1391 C C     . ALA E 3 98  ? -19.799 9.226   31.071  1.00 18.99 ? 98   ALA A C     1 
ATOM   1392 O O     . ALA E 3 98  ? -20.663 8.922   31.905  1.00 19.25 ? 98   ALA A O     1 
ATOM   1393 C CB    . ALA E 3 98  ? -18.748 11.447  30.514  1.00 19.83 ? 98   ALA A CB    1 
ATOM   1394 N N     . PHE E 3 99  ? -18.728 8.473   30.838  1.00 17.74 ? 99   PHE A N     1 
ATOM   1395 C CA    . PHE E 3 99  ? -18.551 7.154   31.460  1.00 16.67 ? 99   PHE A CA    1 
ATOM   1396 C C     . PHE E 3 99  ? -17.291 7.039   32.291  1.00 16.03 ? 99   PHE A C     1 
ATOM   1397 O O     . PHE E 3 99  ? -16.301 7.719   32.036  1.00 16.16 ? 99   PHE A O     1 
ATOM   1398 C CB    . PHE E 3 99  ? -18.573 6.053   30.384  1.00 16.75 ? 99   PHE A CB    1 
ATOM   1399 C CG    . PHE E 3 99  ? -19.909 5.895   29.739  1.00 16.45 ? 99   PHE A CG    1 
ATOM   1400 C CD1   . PHE E 3 99  ? -20.280 6.699   28.668  1.00 15.34 ? 99   PHE A CD1   1 
ATOM   1401 C CD2   . PHE E 3 99  ? -20.832 4.972   30.250  1.00 16.36 ? 99   PHE A CD2   1 
ATOM   1402 C CE1   . PHE E 3 99  ? -21.546 6.558   28.087  1.00 16.03 ? 99   PHE A CE1   1 
ATOM   1403 C CE2   . PHE E 3 99  ? -22.094 4.836   29.670  1.00 15.35 ? 99   PHE A CE2   1 
ATOM   1404 C CZ    . PHE E 3 99  ? -22.446 5.620   28.607  1.00 16.15 ? 99   PHE A CZ    1 
ATOM   1405 N N     . ASP E 3 100 ? -17.339 6.149   33.282  1.00 15.51 ? 100  ASP A N     1 
ATOM   1406 C CA    . ASP E 3 100 ? -16.217 5.905   34.164  1.00 15.25 ? 100  ASP A CA    1 
ATOM   1407 C C     . ASP E 3 100 ? -15.266 4.874   33.601  1.00 14.74 ? 100  ASP A C     1 
ATOM   1408 O O     . ASP E 3 100 ? -14.067 4.930   33.850  1.00 14.68 ? 100  ASP A O     1 
ATOM   1409 C CB    . ASP E 3 100 ? -16.727 5.400   35.502  1.00 16.00 ? 100  ASP A CB    1 
ATOM   1410 C CG    . ASP E 3 100 ? -17.472 6.465   36.251  1.00 17.45 ? 100  ASP A CG    1 
ATOM   1411 O OD1   . ASP E 3 100 ? -18.721 6.501   36.143  1.00 19.72 ? 100  ASP A OD1   1 
ATOM   1412 O OD2   . ASP E 3 100 ? -16.792 7.294   36.883  1.00 20.24 ? 100  ASP A OD2   1 
ATOM   1413 N N     . LEU E 3 101 ? -15.834 3.914   32.876  1.00 14.25 ? 101  LEU A N     1 
ATOM   1414 C CA    . LEU E 3 101 ? -15.071 2.835   32.322  1.00 13.50 ? 101  LEU A CA    1 
ATOM   1415 C C     . LEU E 3 101 ? -15.653 2.481   30.958  1.00 13.33 ? 101  LEU A C     1 
ATOM   1416 O O     . LEU E 3 101 ? -16.860 2.308   30.808  1.00 12.99 ? 101  LEU A O     1 
ATOM   1417 C CB    . LEU E 3 101 ? -15.100 1.630   33.270  1.00 13.36 ? 101  LEU A CB    1 
ATOM   1418 C CG    . LEU E 3 101 ? -14.560 0.337   32.648  1.00 13.60 ? 101  LEU A CG    1 
ATOM   1419 C CD1   . LEU E 3 101 ? -13.048 0.456   32.465  1.00 13.91 ? 101  LEU A CD1   1 
ATOM   1420 C CD2   . LEU E 3 101 ? -14.891 -0.830  33.542  1.00 15.01 ? 101  LEU A CD2   1 
ATOM   1421 N N     . ILE E 3 102 ? -14.775 2.379   29.967  1.00 12.34 ? 102  ILE A N     1 
ATOM   1422 C CA    . ILE E 3 102 ? -15.187 1.927   28.639  1.00 13.08 ? 102  ILE A CA    1 
ATOM   1423 C C     . ILE E 3 102 ? -14.287 0.770   28.283  1.00 13.08 ? 102  ILE A C     1 
ATOM   1424 O O     . ILE E 3 102 ? -13.080 0.886   28.376  1.00 13.47 ? 102  ILE A O     1 
ATOM   1425 C CB    . ILE E 3 102 ? -15.122 3.047   27.563  1.00 13.02 ? 102  ILE A CB    1 
ATOM   1426 C CG1   . ILE E 3 102 ? -15.983 4.233   27.992  1.00 13.77 ? 102  ILE A CG1   1 
ATOM   1427 C CG2   . ILE E 3 102 ? -15.609 2.492   26.200  1.00 12.42 ? 102  ILE A CG2   1 
ATOM   1428 C CD1   . ILE E 3 102 ? -15.778 5.474   27.152  1.00 16.02 ? 102  ILE A CD1   1 
ATOM   1429 N N     . LEU E 3 103 ? -14.879 -0.363  27.918  1.00 12.66 ? 103  LEU A N     1 
ATOM   1430 C CA    . LEU E 3 103 ? -14.043 -1.517  27.578  1.00 13.67 ? 103  LEU A CA    1 
ATOM   1431 C C     . LEU E 3 103 ? -14.598 -2.333  26.445  1.00 12.03 ? 103  LEU A C     1 
ATOM   1432 O O     . LEU E 3 103 ? -15.803 -2.328  26.175  1.00 12.03 ? 103  LEU A O     1 
ATOM   1433 C CB    . LEU E 3 103 ? -13.744 -2.422  28.791  1.00 13.97 ? 103  LEU A CB    1 
ATOM   1434 C CG    . LEU E 3 103 ? -14.745 -2.793  29.906  1.00 17.66 ? 103  LEU A CG    1 
ATOM   1435 C CD1   . LEU E 3 103 ? -16.219 -2.688  29.524  1.00 17.78 ? 103  LEU A CD1   1 
ATOM   1436 C CD2   . LEU E 3 103 ? -14.421 -4.161  30.574  1.00 16.80 ? 103  LEU A CD2   1 
ATOM   1437 N N     . GLY E 3 104 ? -13.691 -2.994  25.738  1.00 11.23 ? 104  GLY A N     1 
ATOM   1438 C CA    . GLY E 3 104 ? -14.120 -3.943  24.750  1.00 10.59 ? 104  GLY A CA    1 
ATOM   1439 C C     . GLY E 3 104 ? -13.205 -4.103  23.565  1.00 10.28 ? 104  GLY A C     1 
ATOM   1440 O O     . GLY E 3 104 ? -12.022 -3.780  23.630  1.00 10.32 ? 104  GLY A O     1 
ATOM   1441 N N     . ASN E 3 105 ? -13.788 -4.639  22.495  1.00 9.75  ? 105  ASN A N     1 
ATOM   1442 C CA    . ASN E 3 105 ? -13.058 -5.017  21.280  1.00 10.33 ? 105  ASN A CA    1 
ATOM   1443 C C     . ASN E 3 105 ? -13.762 -4.307  20.117  1.00 9.74  ? 105  ASN A C     1 
ATOM   1444 O O     . ASN E 3 105 ? -14.796 -4.765  19.647  1.00 9.45  ? 105  ASN A O     1 
ATOM   1445 C CB    . ASN E 3 105 ? -13.162 -6.540  21.140  1.00 10.05 ? 105  ASN A CB    1 
ATOM   1446 C CG    . ASN E 3 105 ? -12.341 -7.139  19.989  1.00 12.21 ? 105  ASN A CG    1 
ATOM   1447 O OD1   . ASN E 3 105 ? -12.035 -8.330  20.014  1.00 15.57 ? 105  ASN A OD1   1 
ATOM   1448 N ND2   . ASN E 3 105 ? -11.993 -6.347  18.998  1.00 13.41 ? 105  ASN A ND2   1 
ATOM   1449 N N     . PRO E 3 106 ? -13.223 -3.152  19.677  1.00 10.39 ? 106  PRO A N     1 
ATOM   1450 C CA    . PRO E 3 106 ? -13.879 -2.411  18.598  1.00 10.18 ? 106  PRO A CA    1 
ATOM   1451 C C     . PRO E 3 106 ? -13.770 -3.158  17.277  1.00 9.46  ? 106  PRO A C     1 
ATOM   1452 O O     . PRO E 3 106 ? -12.927 -4.053  17.142  1.00 8.79  ? 106  PRO A O     1 
ATOM   1453 C CB    . PRO E 3 106 ? -13.057 -1.111  18.502  1.00 9.92  ? 106  PRO A CB    1 
ATOM   1454 C CG    . PRO E 3 106 ? -11.788 -1.375  19.161  1.00 11.82 ? 106  PRO A CG    1 
ATOM   1455 C CD    . PRO E 3 106 ? -11.961 -2.532  20.117  1.00 10.15 ? 106  PRO A CD    1 
ATOM   1456 N N     . PRO E 3 107 ? -14.586 -2.775  16.283  1.00 9.10  ? 107  PRO A N     1 
ATOM   1457 C CA    . PRO E 3 107 ? -14.375 -3.325  14.949  1.00 8.53  ? 107  PRO A CA    1 
ATOM   1458 C C     . PRO E 3 107 ? -13.090 -2.731  14.357  1.00 8.38  ? 107  PRO A C     1 
ATOM   1459 O O     . PRO E 3 107 ? -12.673 -1.650  14.762  1.00 9.39  ? 107  PRO A O     1 
ATOM   1460 C CB    . PRO E 3 107 ? -15.606 -2.855  14.167  1.00 8.90  ? 107  PRO A CB    1 
ATOM   1461 C CG    . PRO E 3 107 ? -16.047 -1.606  14.872  1.00 10.40 ? 107  PRO A CG    1 
ATOM   1462 C CD    . PRO E 3 107 ? -15.698 -1.809  16.333  1.00 9.33  ? 107  PRO A CD    1 
ATOM   1463 N N     . TYR E 3 108 ? -12.464 -3.480  13.454  1.00 9.10  ? 108  TYR A N     1 
ATOM   1464 C CA    . TYR E 3 108 ? -11.224 -3.090  12.787  1.00 9.41  ? 108  TYR A CA    1 
ATOM   1465 C C     . TYR E 3 108 ? -11.491 -3.036  11.279  1.00 10.03 ? 108  TYR A C     1 
ATOM   1466 O O     . TYR E 3 108 ? -12.121 -3.945  10.707  1.00 11.12 ? 108  TYR A O     1 
ATOM   1467 C CB    . TYR E 3 108 ? -10.091 -4.130  12.995  1.00 10.21 ? 108  TYR A CB    1 
ATOM   1468 C CG    . TYR E 3 108 ? -9.793  -4.641  14.406  1.00 10.23 ? 108  TYR A CG    1 
ATOM   1469 C CD1   . TYR E 3 108 ? -10.210 -3.952  15.554  1.00 10.54 ? 108  TYR A CD1   1 
ATOM   1470 C CD2   . TYR E 3 108 ? -9.052  -5.820  14.588  1.00 11.77 ? 108  TYR A CD2   1 
ATOM   1471 C CE1   . TYR E 3 108 ? -9.915  -4.443  16.845  1.00 10.65 ? 108  TYR A CE1   1 
ATOM   1472 C CE2   . TYR E 3 108 ? -8.759  -6.315  15.861  1.00 9.63  ? 108  TYR A CE2   1 
ATOM   1473 C CZ    . TYR E 3 108 ? -9.183  -5.630  16.980  1.00 11.44 ? 108  TYR A CZ    1 
ATOM   1474 O OH    . TYR E 3 108 ? -8.879  -6.132  18.227  1.00 11.10 ? 108  TYR A OH    1 
ATOM   1475 N N     . GLY E 3 109 ? -10.976 -2.009  10.622  1.00 9.24  ? 109  GLY A N     1 
ATOM   1476 C CA    . GLY E 3 109 ? -11.062 -2.009  9.158   1.00 8.91  ? 109  GLY A CA    1 
ATOM   1477 C C     . GLY E 3 109 ? -11.067 -0.621  8.552   1.00 8.63  ? 109  GLY A C     1 
ATOM   1478 O O     . GLY E 3 109 ? -11.482 0.341   9.170   1.00 8.82  ? 109  GLY A O     1 
ATOM   1479 N N     . ILE E 3 110 ? -10.613 -0.546  7.310   1.00 8.79  ? 110  ILE A N     1 
ATOM   1480 C CA    . ILE E 3 110 ? -10.596 0.705   6.588   1.00 8.93  ? 110  ILE A CA    1 
ATOM   1481 C C     . ILE E 3 110 ? -11.949 0.892   5.927   1.00 9.11  ? 110  ILE A C     1 
ATOM   1482 O O     . ILE E 3 110 ? -12.511 -0.058  5.338   1.00 8.76  ? 110  ILE A O     1 
ATOM   1483 C CB    . ILE E 3 110 ? -9.459  0.713   5.515   1.00 9.07  ? 110  ILE A CB    1 
ATOM   1484 C CG1   . ILE E 3 110 ? -8.090  0.673   6.203   1.00 7.91  ? 110  ILE A CG1   1 
ATOM   1485 C CG2   . ILE E 3 110 ? -9.591  1.920   4.575   1.00 9.49  ? 110  ILE A CG2   1 
ATOM   1486 C CD1   . ILE E 3 110 ? -6.918  0.383   5.232   1.00 9.09  ? 110  ILE A CD1   1 
ATOM   1487 N N     . VAL E 3 111 ? -12.454 2.126   6.014   1.00 10.22 ? 111  VAL A N     1 
ATOM   1488 C CA    . VAL E 3 111 ? -13.673 2.528   5.316   1.00 9.91  ? 111  VAL A CA    1 
ATOM   1489 C C     . VAL E 3 111 ? -13.362 2.894   3.864   1.00 10.54 ? 111  VAL A C     1 
ATOM   1490 O O     . VAL E 3 111 ? -12.642 3.861   3.592   1.00 10.79 ? 111  VAL A O     1 
ATOM   1491 C CB    . VAL E 3 111 ? -14.382 3.709   6.028   1.00 10.60 ? 111  VAL A CB    1 
ATOM   1492 C CG1   . VAL E 3 111 ? -15.585 4.164   5.192   1.00 11.14 ? 111  VAL A CG1   1 
ATOM   1493 C CG2   . VAL E 3 111 ? -14.813 3.304   7.427   1.00 11.36 ? 111  VAL A CG2   1 
ATOM   1494 N N     . GLY E 3 112 ? -13.918 2.135   2.927   1.00 10.71 ? 112  GLY A N     1 
ATOM   1495 C CA    . GLY E 3 112 ? -13.663 2.430   1.518   1.00 11.57 ? 112  GLY A CA    1 
ATOM   1496 C C     . GLY E 3 112 ? -14.421 1.532   0.586   1.00 12.54 ? 112  GLY A C     1 
ATOM   1497 O O     . GLY E 3 112 ? -15.164 0.655   1.028   1.00 12.69 ? 112  GLY A O     1 
ATOM   1498 N N     . GLU E 3 113 ? -14.203 1.754   -0.704  1.00 13.00 ? 113  GLU A N     1 
ATOM   1499 C CA    . GLU E 3 113 ? -14.824 0.974   -1.785  1.00 15.59 ? 113  GLU A CA    1 
ATOM   1500 C C     . GLU E 3 113 ? -14.671 -0.538  -1.575  1.00 14.05 ? 113  GLU A C     1 
ATOM   1501 O O     . GLU E 3 113 ? -13.587 -1.025  -1.249  1.00 13.94 ? 113  GLU A O     1 
ATOM   1502 C CB    . GLU E 3 113 ? -14.208 1.420   -3.122  1.00 15.78 ? 113  GLU A CB    1 
ATOM   1503 C CG    . GLU E 3 113 ? -14.662 0.645   -4.364  1.00 20.53 ? 113  GLU A CG    1 
ATOM   1504 C CD    . GLU E 3 113 ? -14.058 1.195   -5.669  1.00 21.01 ? 113  GLU A CD    1 
ATOM   1505 O OE1   . GLU E 3 113 ? -13.750 0.385   -6.590  1.00 27.87 ? 113  GLU A OE1   1 
ATOM   1506 O OE2   . GLU E 3 113 ? -13.902 2.435   -5.784  1.00 27.09 ? 113  GLU A OE2   1 
ATOM   1507 N N     . ALA E 3 114 ? -15.765 -1.272  -1.776  1.00 14.03 ? 114  ALA A N     1 
ATOM   1508 C CA    . ALA E 3 114 ? -15.830 -2.694  -1.420  1.00 14.60 ? 114  ALA A CA    1 
ATOM   1509 C C     . ALA E 3 114 ? -14.866 -3.580  -2.194  1.00 14.92 ? 114  ALA A C     1 
ATOM   1510 O O     . ALA E 3 114 ? -14.492 -4.657  -1.713  1.00 15.65 ? 114  ALA A O     1 
ATOM   1511 C CB    . ALA E 3 114 ? -17.257 -3.216  -1.561  1.00 14.79 ? 114  ALA A CB    1 
ATOM   1512 N N     . SER E 3 115 ? -14.458 -3.137  -3.385  1.00 14.98 ? 115  SER A N     1 
ATOM   1513 C CA    . SER E 3 115 ? -13.494 -3.891  -4.178  1.00 15.05 ? 115  SER A CA    1 
ATOM   1514 C C     . SER E 3 115 ? -12.125 -4.011  -3.512  1.00 14.96 ? 115  SER A C     1 
ATOM   1515 O O     . SER E 3 115 ? -11.347 -4.888  -3.868  1.00 15.12 ? 115  SER A O     1 
ATOM   1516 C CB    . SER E 3 115 ? -13.327 -3.280  -5.572  1.00 15.18 ? 115  SER A CB    1 
ATOM   1517 O OG    . SER E 3 115 ? -12.700 -2.008  -5.506  1.00 17.71 ? 115  SER A OG    1 
ATOM   1518 N N     . LYS E 3 116 ? -11.842 -3.125  -2.558  1.00 13.72 ? 116  LYS A N     1 
ATOM   1519 C CA    . LYS E 3 116 ? -10.519 -3.028  -1.968  1.00 12.56 ? 116  LYS A CA    1 
ATOM   1520 C C     . LYS E 3 116 ? -10.519 -3.008  -0.419  1.00 12.21 ? 116  LYS A C     1 
ATOM   1521 O O     . LYS E 3 116 ? -9.556  -3.481  0.215   1.00 12.04 ? 116  LYS A O     1 
ATOM   1522 C CB    . LYS E 3 116 ? -9.815  -1.778  -2.539  1.00 12.68 ? 116  LYS A CB    1 
ATOM   1523 C CG    . LYS E 3 116 ? -8.314  -1.661  -2.222  1.00 11.40 ? 116  LYS A CG    1 
ATOM   1524 C CD    . LYS E 3 116 ? -7.527  -2.802  -2.825  1.00 12.28 ? 116  LYS A CD    1 
ATOM   1525 C CE    . LYS E 3 116 ? -6.039  -2.577  -2.647  1.00 11.72 ? 116  LYS A CE    1 
ATOM   1526 N NZ    . LYS E 3 116 ? -5.303  -3.671  -3.292  1.00 14.64 ? 116  LYS A NZ    1 
ATOM   1527 N N     . TYR E 3 117 ? -11.577 -2.442  0.173   1.00 10.94 ? 117  TYR A N     1 
ATOM   1528 C CA    . TYR E 3 117 ? -11.671 -2.226  1.622   1.00 10.40 ? 117  TYR A CA    1 
ATOM   1529 C C     . TYR E 3 117 ? -12.934 -2.837  2.231   1.00 10.74 ? 117  TYR A C     1 
ATOM   1530 O O     . TYR E 3 117 ? -13.940 -2.977  1.549   1.00 10.80 ? 117  TYR A O     1 
ATOM   1531 C CB    . TYR E 3 117 ? -11.599 -0.727  1.942   1.00 9.73  ? 117  TYR A CB    1 
ATOM   1532 C CG    . TYR E 3 117 ? -10.327 -0.123  1.374   1.00 10.20 ? 117  TYR A CG    1 
ATOM   1533 C CD1   . TYR E 3 117 ? -10.355 0.718   0.263   1.00 9.14  ? 117  TYR A CD1   1 
ATOM   1534 C CD2   . TYR E 3 117 ? -9.089  -0.418  1.953   1.00 11.04 ? 117  TYR A CD2   1 
ATOM   1535 C CE1   . TYR E 3 117 ? -9.153  1.264   -0.268  1.00 9.76  ? 117  TYR A CE1   1 
ATOM   1536 C CE2   . TYR E 3 117 ? -7.894  0.099   1.436   1.00 11.85 ? 117  TYR A CE2   1 
ATOM   1537 C CZ    . TYR E 3 117 ? -7.928  0.938   0.334   1.00 8.91  ? 117  TYR A CZ    1 
ATOM   1538 O OH    . TYR E 3 117 ? -6.731  1.436   -0.138  1.00 9.63  ? 117  TYR A OH    1 
ATOM   1539 N N     . PRO E 3 118 ? -12.852 -3.252  3.495   1.00 10.91 ? 118  PRO A N     1 
ATOM   1540 C CA    . PRO E 3 118 ? -13.944 -4.042  4.096   1.00 11.17 ? 118  PRO A CA    1 
ATOM   1541 C C     . PRO E 3 118 ? -15.131 -3.276  4.714   1.00 11.82 ? 118  PRO A C     1 
ATOM   1542 O O     . PRO E 3 118 ? -16.171 -3.898  4.990   1.00 11.95 ? 118  PRO A O     1 
ATOM   1543 C CB    . PRO E 3 118 ? -13.201 -4.828  5.185   1.00 10.74 ? 118  PRO A CB    1 
ATOM   1544 C CG    . PRO E 3 118 ? -12.184 -3.880  5.669   1.00 11.72 ? 118  PRO A CG    1 
ATOM   1545 C CD    . PRO E 3 118 ? -11.690 -3.170  4.402   1.00 10.98 ? 118  PRO A CD    1 
ATOM   1546 N N     . ILE E 3 119 ? -14.979 -1.986  5.001   1.00 12.01 ? 119  ILE A N     1 
ATOM   1547 C CA    . ILE E 3 119 ? -16.070 -1.251  5.687   1.00 12.41 ? 119  ILE A CA    1 
ATOM   1548 C C     . ILE E 3 119 ? -16.796 -0.347  4.704   1.00 13.37 ? 119  ILE A C     1 
ATOM   1549 O O     . ILE E 3 119 ? -16.187 0.539   4.095   1.00 13.28 ? 119  ILE A O     1 
ATOM   1550 C CB    . ILE E 3 119 ? -15.578 -0.424  6.912   1.00 12.48 ? 119  ILE A CB    1 
ATOM   1551 C CG1   . ILE E 3 119 ? -14.668 -1.240  7.834   1.00 13.06 ? 119  ILE A CG1   1 
ATOM   1552 C CG2   . ILE E 3 119 ? -16.771 0.123   7.712   1.00 11.31 ? 119  ILE A CG2   1 
ATOM   1553 C CD1   . ILE E 3 119 ? -15.262 -2.586  8.329   1.00 14.44 ? 119  ILE A CD1   1 
ATOM   1554 N N     . HIS E 3 120 ? -18.103 -0.573  4.573   1.00 14.59 ? 120  HIS A N     1 
ATOM   1555 C CA    . HIS E 3 120 ? -18.882 -0.001  3.478   1.00 15.44 ? 120  HIS A CA    1 
ATOM   1556 C C     . HIS E 3 120 ? -20.023 0.836   4.005   1.00 16.44 ? 120  HIS A C     1 
ATOM   1557 O O     . HIS E 3 120 ? -21.005 0.299   4.561   1.00 16.62 ? 120  HIS A O     1 
ATOM   1558 C CB    . HIS E 3 120 ? -19.425 -1.089  2.551   1.00 16.19 ? 120  HIS A CB    1 
ATOM   1559 C CG    . HIS E 3 120 ? -18.434 -2.155  2.222   1.00 16.72 ? 120  HIS A CG    1 
ATOM   1560 N ND1   . HIS E 3 120 ? -18.764 -3.490  2.216   1.00 16.74 ? 120  HIS A ND1   1 
ATOM   1561 C CD2   . HIS E 3 120 ? -17.116 -2.087  1.909   1.00 14.90 ? 120  HIS A CD2   1 
ATOM   1562 C CE1   . HIS E 3 120 ? -17.693 -4.203  1.914   1.00 17.73 ? 120  HIS A CE1   1 
ATOM   1563 N NE2   . HIS E 3 120 ? -16.681 -3.377  1.722   1.00 15.50 ? 120  HIS A NE2   1 
ATOM   1564 N N     . VAL E 3 121 ? -19.871 2.147   3.856   1.00 16.19 ? 121  VAL A N     1 
ATOM   1565 C CA    . VAL E 3 121 ? -20.882 3.124   4.287   1.00 16.49 ? 121  VAL A CA    1 
ATOM   1566 C C     . VAL E 3 121 ? -21.069 4.162   3.175   1.00 16.75 ? 121  VAL A C     1 
ATOM   1567 O O     . VAL E 3 121 ? -20.193 4.290   2.301   1.00 16.22 ? 121  VAL A O     1 
ATOM   1568 C CB    . VAL E 3 121 ? -20.523 3.784   5.656   1.00 16.27 ? 121  VAL A CB    1 
ATOM   1569 C CG1   . VAL E 3 121 ? -20.301 2.719   6.750   1.00 17.79 ? 121  VAL A CG1   1 
ATOM   1570 C CG2   . VAL E 3 121 ? -19.291 4.717   5.547   1.00 16.60 ? 121  VAL A CG2   1 
ATOM   1571 N N     . PHE E 3 122 ? -22.195 4.889   3.192   1.00 16.40 ? 122  PHE A N     1 
ATOM   1572 C CA    . PHE E 3 122 ? -22.385 5.996   2.250   1.00 16.84 ? 122  PHE A CA    1 
ATOM   1573 C C     . PHE E 3 122 ? -21.259 7.011   2.430   1.00 16.70 ? 122  PHE A C     1 
ATOM   1574 O O     . PHE E 3 122 ? -20.811 7.232   3.549   1.00 15.47 ? 122  PHE A O     1 
ATOM   1575 C CB    . PHE E 3 122 ? -23.689 6.742   2.526   1.00 17.51 ? 122  PHE A CB    1 
ATOM   1576 C CG    . PHE E 3 122 ? -24.933 5.985   2.160   1.00 18.31 ? 122  PHE A CG    1 
ATOM   1577 C CD1   . PHE E 3 122 ? -25.822 5.583   3.150   1.00 19.01 ? 122  PHE A CD1   1 
ATOM   1578 C CD2   . PHE E 3 122 ? -25.253 5.741   0.826   1.00 21.02 ? 122  PHE A CD2   1 
ATOM   1579 C CE1   . PHE E 3 122 ? -26.982 4.902   2.825   1.00 19.40 ? 122  PHE A CE1   1 
ATOM   1580 C CE2   . PHE E 3 122 ? -26.416 5.065   0.492   1.00 20.81 ? 122  PHE A CE2   1 
ATOM   1581 C CZ    . PHE E 3 122 ? -27.281 4.644   1.499   1.00 20.53 ? 122  PHE A CZ    1 
ATOM   1582 N N     . LYS E 3 123 ? -20.837 7.663   1.345   1.00 17.44 ? 123  LYS A N     1 
ATOM   1583 C CA    . LYS E 3 123 ? -19.865 8.758   1.465   1.00 18.13 ? 123  LYS A CA    1 
ATOM   1584 C C     . LYS E 3 123 ? -20.259 9.791   2.550   1.00 17.55 ? 123  LYS A C     1 
ATOM   1585 O O     . LYS E 3 123 ? -19.400 10.286  3.304   1.00 16.73 ? 123  LYS A O     1 
ATOM   1586 C CB    . LYS E 3 123 ? -19.623 9.432   0.101   1.00 18.58 ? 123  LYS A CB    1 
ATOM   1587 C CG    . LYS E 3 123 ? -18.660 10.619  0.211   1.00 19.69 ? 123  LYS A CG    1 
ATOM   1588 C CD    . LYS E 3 123 ? -18.134 11.098  -1.131  1.00 20.62 ? 123  LYS A CD    1 
ATOM   1589 C CE    . LYS E 3 123 ? -17.006 12.116  -0.926  1.00 25.01 ? 123  LYS A CE    1 
ATOM   1590 N NZ    . LYS E 3 123 ? -17.439 13.286  -0.074  1.00 25.23 ? 123  LYS A NZ    1 
ATOM   1591 N N     . ALA E 3 124 ? -21.556 10.095  2.649   1.00 17.45 ? 124  ALA A N     1 
ATOM   1592 C CA    . ALA E 3 124 ? -22.023 11.066  3.642   1.00 17.04 ? 124  ALA A CA    1 
ATOM   1593 C C     . ALA E 3 124 ? -21.763 10.605  5.087   1.00 16.06 ? 124  ALA A C     1 
ATOM   1594 O O     . ALA E 3 124 ? -21.513 11.423  5.972   1.00 15.76 ? 124  ALA A O     1 
ATOM   1595 C CB    . ALA E 3 124 ? -23.493 11.375  3.435   1.00 17.67 ? 124  ALA A CB    1 
ATOM   1596 N N     . VAL E 3 125 ? -21.824 9.292   5.315   1.00 16.38 ? 125  VAL A N     1 
ATOM   1597 C CA    . VAL E 3 125 ? -21.492 8.738   6.635   1.00 15.64 ? 125  VAL A CA    1 
ATOM   1598 C C     . VAL E 3 125 ? -19.980 8.860   6.896   1.00 14.80 ? 125  VAL A C     1 
ATOM   1599 O O     . VAL E 3 125 ? -19.564 9.298   7.967   1.00 13.91 ? 125  VAL A O     1 
ATOM   1600 C CB    . VAL E 3 125 ? -21.994 7.284   6.808   1.00 16.38 ? 125  VAL A CB    1 
ATOM   1601 C CG1   . VAL E 3 125 ? -21.536 6.709   8.132   1.00 16.98 ? 125  VAL A CG1   1 
ATOM   1602 C CG2   . VAL E 3 125 ? -23.528 7.234   6.704   1.00 17.19 ? 125  VAL A CG2   1 
ATOM   1603 N N     . LYS E 3 126 ? -19.162 8.527   5.895   1.00 13.88 ? 126  LYS A N     1 
ATOM   1604 C CA    . LYS E 3 126 ? -17.707 8.719   6.037   1.00 13.75 ? 126  LYS A CA    1 
ATOM   1605 C C     . LYS E 3 126 ? -17.382 10.194  6.337   1.00 13.34 ? 126  LYS A C     1 
ATOM   1606 O O     . LYS E 3 126 ? -16.541 10.499  7.185   1.00 12.59 ? 126  LYS A O     1 
ATOM   1607 C CB    . LYS E 3 126 ? -16.932 8.194   4.806   1.00 13.71 ? 126  LYS A CB    1 
ATOM   1608 C CG    . LYS E 3 126 ? -15.492 7.859   5.116   1.00 11.91 ? 126  LYS A CG    1 
ATOM   1609 C CD    . LYS E 3 126 ? -14.665 7.573   3.844   1.00 13.42 ? 126  LYS A CD    1 
ATOM   1610 C CE    . LYS E 3 126 ? -13.249 7.120   4.224   1.00 12.69 ? 126  LYS A CE    1 
ATOM   1611 N NZ    . LYS E 3 126 ? -12.358 7.001   3.037   1.00 11.55 ? 126  LYS A NZ    1 
ATOM   1612 N N     . ASP E 3 127 ? -18.084 11.110  5.669   1.00 14.12 ? 127  ASP A N     1 
ATOM   1613 C CA    . ASP E 3 127 ? -17.946 12.529  5.959   1.00 14.44 ? 127  ASP A CA    1 
ATOM   1614 C C     . ASP E 3 127 ? -18.268 12.920  7.403   1.00 13.76 ? 127  ASP A C     1 
ATOM   1615 O O     . ASP E 3 127 ? -17.548 13.717  8.008   1.00 13.43 ? 127  ASP A O     1 
ATOM   1616 C CB    . ASP E 3 127 ? -18.787 13.353  4.983   1.00 14.91 ? 127  ASP A CB    1 
ATOM   1617 C CG    . ASP E 3 127 ? -18.221 13.322  3.563   1.00 17.94 ? 127  ASP A CG    1 
ATOM   1618 O OD1   . ASP E 3 127 ? -17.026 12.959  3.382   1.00 18.85 ? 127  ASP A OD1   1 
ATOM   1619 O OD2   . ASP E 3 127 ? -18.978 13.666  2.633   1.00 22.45 ? 127  ASP A OD2   1 
ATOM   1620 N N     . LEU E 3 128 ? -19.330 12.343  7.961   1.00 13.41 ? 128  LEU A N     1 
ATOM   1621 C CA    . LEU E 3 128 ? -19.642 12.557  9.378   1.00 13.89 ? 128  LEU A CA    1 
ATOM   1622 C C     . LEU E 3 128 ? -18.517 12.050  10.296  1.00 13.21 ? 128  LEU A C     1 
ATOM   1623 O O     . LEU E 3 128 ? -18.159 12.707  11.274  1.00 12.31 ? 128  LEU A O     1 
ATOM   1624 C CB    . LEU E 3 128 ? -20.990 11.918  9.733   1.00 14.16 ? 128  LEU A CB    1 
ATOM   1625 C CG    . LEU E 3 128 ? -22.240 12.630  9.182   1.00 16.41 ? 128  LEU A CG    1 
ATOM   1626 C CD1   . LEU E 3 128 ? -23.511 11.874  9.593   1.00 17.81 ? 128  LEU A CD1   1 
ATOM   1627 C CD2   . LEU E 3 128 ? -22.268 14.083  9.688   1.00 17.71 ? 128  LEU A CD2   1 
ATOM   1628 N N     . TYR E 3 129 ? -17.942 10.891  9.962   1.00 13.09 ? 129  TYR A N     1 
ATOM   1629 C CA    . TYR E 3 129 ? -16.817 10.372  10.744  1.00 12.51 ? 129  TYR A CA    1 
ATOM   1630 C C     . TYR E 3 129 ? -15.631 11.337  10.713  1.00 12.91 ? 129  TYR A C     1 
ATOM   1631 O O     . TYR E 3 129 ? -15.031 11.640  11.741  1.00 11.36 ? 129  TYR A O     1 
ATOM   1632 C CB    . TYR E 3 129 ? -16.370 8.986   10.246  1.00 13.11 ? 129  TYR A CB    1 
ATOM   1633 C CG    . TYR E 3 129 ? -17.357 7.844   10.463  1.00 11.97 ? 129  TYR A CG    1 
ATOM   1634 C CD1   . TYR E 3 129 ? -18.478 7.985   11.302  1.00 11.54 ? 129  TYR A CD1   1 
ATOM   1635 C CD2   . TYR E 3 129 ? -17.128 6.599   9.861   1.00 12.48 ? 129  TYR A CD2   1 
ATOM   1636 C CE1   . TYR E 3 129 ? -19.360 6.906   11.499  1.00 13.06 ? 129  TYR A CE1   1 
ATOM   1637 C CE2   . TYR E 3 129 ? -18.003 5.521   10.039  1.00 13.18 ? 129  TYR A CE2   1 
ATOM   1638 C CZ    . TYR E 3 129 ? -19.119 5.685   10.860  1.00 12.78 ? 129  TYR A CZ    1 
ATOM   1639 O OH    . TYR E 3 129 ? -19.975 4.606   11.050  1.00 14.32 ? 129  TYR A OH    1 
ATOM   1640 N N     . LYS E 3 130 ? -15.293 11.824  9.526   1.00 12.94 ? 130  LYS A N     1 
ATOM   1641 C CA    . LYS E 3 130 ? -14.192 12.776  9.415   1.00 13.88 ? 130  LYS A CA    1 
ATOM   1642 C C     . LYS E 3 130 ? -14.459 14.060  10.186  1.00 14.95 ? 130  LYS A C     1 
ATOM   1643 O O     . LYS E 3 130 ? -13.572 14.581  10.852  1.00 16.22 ? 130  LYS A O     1 
ATOM   1644 C CB    . LYS E 3 130 ? -13.897 13.098  7.962   1.00 13.85 ? 130  LYS A CB    1 
ATOM   1645 C CG    . LYS E 3 130 ? -13.393 11.915  7.152   1.00 14.75 ? 130  LYS A CG    1 
ATOM   1646 C CD    . LYS E 3 130 ? -13.186 12.406  5.738   1.00 16.37 ? 130  LYS A CD    1 
ATOM   1647 C CE    . LYS E 3 130 ? -12.639 11.336  4.837   1.00 14.46 ? 130  LYS A CE    1 
ATOM   1648 N NZ    . LYS E 3 130 ? -12.674 11.819  3.426   1.00 14.16 ? 130  LYS A NZ    1 
ATOM   1649 N N     . LYS E 3 131 ? -15.695 14.551  10.125  1.00 15.72 ? 131  LYS A N     1 
ATOM   1650 C CA    . LYS E 3 131 ? -16.081 15.718  10.911  1.00 15.86 ? 131  LYS A CA    1 
ATOM   1651 C C     . LYS E 3 131 ? -15.952 15.436  12.423  1.00 15.25 ? 131  LYS A C     1 
ATOM   1652 O O     . LYS E 3 131 ? -15.482 16.285  13.179  1.00 16.06 ? 131  LYS A O     1 
ATOM   1653 C CB    . LYS E 3 131 ? -17.498 16.143  10.536  1.00 15.73 ? 131  LYS A CB    1 
ATOM   1654 C CG    . LYS E 3 131 ? -17.971 17.385  11.248  1.00 18.14 ? 131  LYS A CG    1 
ATOM   1655 C CD    . LYS E 3 131 ? -19.420 17.654  10.891  1.00 22.13 ? 131  LYS A CD    1 
ATOM   1656 C CE    . LYS E 3 131 ? -19.940 18.894  11.605  1.00 25.71 ? 131  LYS A CE    1 
ATOM   1657 N NZ    . LYS E 3 131 ? -19.919 18.742  13.096  1.00 27.96 ? 131  LYS A NZ    1 
ATOM   1658 N N     . ALA E 3 132 ? -16.329 14.227  12.839  1.00 14.44 ? 132  ALA A N     1 
ATOM   1659 C CA    . ALA E 3 132 ? -16.353 13.846  14.254  1.00 14.33 ? 132  ALA A CA    1 
ATOM   1660 C C     . ALA E 3 132 ? -14.980 13.643  14.894  1.00 14.02 ? 132  ALA A C     1 
ATOM   1661 O O     . ALA E 3 132 ? -14.821 13.873  16.096  1.00 15.08 ? 132  ALA A O     1 
ATOM   1662 C CB    . ALA E 3 132 ? -17.200 12.598  14.441  1.00 14.04 ? 132  ALA A CB    1 
ATOM   1663 N N     . PHE E 3 133 ? -13.993 13.223  14.099  1.00 12.90 ? 133  PHE A N     1 
ATOM   1664 C CA    . PHE E 3 133 ? -12.725 12.732  14.655  1.00 12.73 ? 133  PHE A CA    1 
ATOM   1665 C C     . PHE E 3 133 ? -11.495 13.539  14.274  1.00 12.53 ? 133  PHE A C     1 
ATOM   1666 O O     . PHE E 3 133 ? -11.075 13.546  13.121  1.00 13.38 ? 133  PHE A O     1 
ATOM   1667 C CB    . PHE E 3 133 ? -12.581 11.245  14.320  1.00 12.24 ? 133  PHE A CB    1 
ATOM   1668 C CG    . PHE E 3 133 ? -13.724 10.449  14.850  1.00 12.89 ? 133  PHE A CG    1 
ATOM   1669 C CD1   . PHE E 3 133 ? -14.046 10.528  16.199  1.00 12.68 ? 133  PHE A CD1   1 
ATOM   1670 C CD2   . PHE E 3 133 ? -14.526 9.680   14.008  1.00 14.92 ? 133  PHE A CD2   1 
ATOM   1671 C CE1   . PHE E 3 133 ? -15.144 9.827   16.714  1.00 12.02 ? 133  PHE A CE1   1 
ATOM   1672 C CE2   . PHE E 3 133 ? -15.618 8.971   14.513  1.00 14.23 ? 133  PHE A CE2   1 
ATOM   1673 C CZ    . PHE E 3 133 ? -15.928 9.051   15.870  1.00 13.28 ? 133  PHE A CZ    1 
ATOM   1674 N N     . SER E 3 134 ? -10.953 14.232  15.267  1.00 12.81 ? 134  SER A N     1 
ATOM   1675 C CA    . SER E 3 134 ? -9.769  15.082  15.071  1.00 13.35 ? 134  SER A CA    1 
ATOM   1676 C C     . SER E 3 134 ? -8.536  14.255  14.693  1.00 12.85 ? 134  SER A C     1 
ATOM   1677 O O     . SER E 3 134 ? -7.559  14.803  14.152  1.00 13.96 ? 134  SER A O     1 
ATOM   1678 C CB    . SER E 3 134 ? -9.472  15.897  16.324  1.00 13.50 ? 134  SER A CB    1 
ATOM   1679 O OG    . SER E 3 134 ? -9.051  15.091  17.408  1.00 15.11 ? 134  SER A OG    1 
ATOM   1680 N N     . THR E 3 135 ? -8.563  12.955  15.009  1.00 12.32 ? 135  THR A N     1 
ATOM   1681 C CA    . THR E 3 135 ? -7.412  12.075  14.750  1.00 11.21 ? 135  THR A CA    1 
ATOM   1682 C C     . THR E 3 135 ? -7.458  11.424  13.360  1.00 10.66 ? 135  THR A C     1 
ATOM   1683 O O     . THR E 3 135 ? -6.499  10.782  12.957  1.00 11.36 ? 135  THR A O     1 
ATOM   1684 C CB    . THR E 3 135 ? -7.239  10.961  15.812  1.00 11.48 ? 135  THR A CB    1 
ATOM   1685 O OG1   . THR E 3 135 ? -8.359  10.065  15.741  1.00 12.57 ? 135  THR A OG1   1 
ATOM   1686 C CG2   . THR E 3 135 ? -7.073  11.556  17.226  1.00 11.32 ? 135  THR A CG2   1 
ATOM   1687 N N     . TRP E 3 136 ? -8.558  11.596  12.632  1.00 10.95 ? 136  TRP A N     1 
ATOM   1688 C CA    . TRP E 3 136 ? -8.711  10.955  11.321  1.00 10.52 ? 136  TRP A CA    1 
ATOM   1689 C C     . TRP E 3 136 ? -7.610  11.422  10.353  1.00 11.35 ? 136  TRP A C     1 
ATOM   1690 O O     . TRP E 3 136 ? -7.411  12.623  10.154  1.00 11.42 ? 136  TRP A O     1 
ATOM   1691 C CB    . TRP E 3 136 ? -10.101 11.225  10.744  1.00 11.23 ? 136  TRP A CB    1 
ATOM   1692 C CG    . TRP E 3 136 ? -10.506 10.279  9.643   1.00 11.73 ? 136  TRP A CG    1 
ATOM   1693 C CD1   . TRP E 3 136 ? -10.064 10.294  8.328   1.00 11.61 ? 136  TRP A CD1   1 
ATOM   1694 C CD2   . TRP E 3 136 ? -11.431 9.172   9.744   1.00 11.23 ? 136  TRP A CD2   1 
ATOM   1695 N NE1   . TRP E 3 136 ? -10.658 9.272   7.627   1.00 10.50 ? 136  TRP A NE1   1 
ATOM   1696 C CE2   . TRP E 3 136 ? -11.498 8.568   8.465   1.00 10.61 ? 136  TRP A CE2   1 
ATOM   1697 C CE3   . TRP E 3 136 ? -12.205 8.630   10.799  1.00 10.47 ? 136  TRP A CE3   1 
ATOM   1698 C CZ2   . TRP E 3 136 ? -12.313 7.451   8.198   1.00 11.30 ? 136  TRP A CZ2   1 
ATOM   1699 C CZ3   . TRP E 3 136 ? -13.021 7.494   10.528  1.00 9.92  ? 136  TRP A CZ3   1 
ATOM   1700 C CH2   . TRP E 3 136 ? -13.072 6.934   9.240   1.00 10.55 ? 136  TRP A CH2   1 
ATOM   1701 N N     . LYS E 3 137 ? -6.883  10.465  9.785   1.00 11.20 ? 137  LYS A N     1 
ATOM   1702 C CA    . LYS E 3 137 ? -5.752  10.783  8.891   1.00 10.85 ? 137  LYS A CA    1 
ATOM   1703 C C     . LYS E 3 137 ? -5.567  9.655   7.892   1.00 10.53 ? 137  LYS A C     1 
ATOM   1704 O O     . LYS E 3 137 ? -5.706  8.470   8.249   1.00 10.43 ? 137  LYS A O     1 
ATOM   1705 C CB    . LYS E 3 137 ? -4.449  11.009  9.687   1.00 11.21 ? 137  LYS A CB    1 
ATOM   1706 C CG    . LYS E 3 137 ? -3.185  11.269  8.817   1.00 12.37 ? 137  LYS A CG    1 
ATOM   1707 C CD    . LYS E 3 137 ? -1.931  11.410  9.690   1.00 11.47 ? 137  LYS A CD    1 
ATOM   1708 C CE    . LYS E 3 137 ? -0.677  11.427  8.814   1.00 11.96 ? 137  LYS A CE    1 
ATOM   1709 N NZ    . LYS E 3 137 ? 0.561   11.410  9.647   1.00 12.88 ? 137  LYS A NZ    1 
ATOM   1710 N N     . GLY E 3 138 ? -5.226  10.032  6.656   1.00 10.09 ? 138  GLY A N     1 
ATOM   1711 C CA    . GLY E 3 138 ? -5.046  9.067   5.563   1.00 9.78  ? 138  GLY A CA    1 
ATOM   1712 C C     . GLY E 3 138 ? -6.330  8.284   5.345   1.00 9.90  ? 138  GLY A C     1 
ATOM   1713 O O     . GLY E 3 138 ? -7.417  8.836   5.443   1.00 9.86  ? 138  GLY A O     1 
ATOM   1714 N N     . LYS E 3 139 ? -6.201  6.981   5.087   1.00 8.70  ? 139  LYS A N     1 
ATOM   1715 C CA    . LYS E 3 139 ? -7.370  6.091   4.951   1.00 8.46  ? 139  LYS A CA    1 
ATOM   1716 C C     . LYS E 3 139 ? -8.000  5.844   6.330   1.00 8.98  ? 139  LYS A C     1 
ATOM   1717 O O     . LYS E 3 139 ? -9.222  5.595   6.461   1.00 9.80  ? 139  LYS A O     1 
ATOM   1718 C CB    . LYS E 3 139 ? -6.941  4.754   4.331   1.00 8.57  ? 139  LYS A CB    1 
ATOM   1719 C CG    . LYS E 3 139 ? -6.323  4.908   2.928   1.00 8.60  ? 139  LYS A CG    1 
ATOM   1720 C CD    . LYS E 3 139 ? -6.064  3.563   2.235   1.00 9.66  ? 139  LYS A CD    1 
ATOM   1721 C CE    . LYS E 3 139 ? -4.986  2.732   2.912   1.00 10.17 ? 139  LYS A CE    1 
ATOM   1722 N NZ    . LYS E 3 139 ? -3.629  3.425   3.015   1.00 10.71 ? 139  LYS A NZ    1 
ATOM   1723 N N     . TYR E 3 140 ? -7.157  5.934   7.355   1.00 8.81  ? 140  TYR A N     1 
ATOM   1724 C CA    . TYR E 3 140 ? -7.531  5.687   8.756   1.00 8.68  ? 140  TYR A CA    1 
ATOM   1725 C C     . TYR E 3 140 ? -8.190  4.313   8.980   1.00 8.27  ? 140  TYR A C     1 
ATOM   1726 O O     . TYR E 3 140 ? -7.991  3.385   8.186   1.00 8.49  ? 140  TYR A O     1 
ATOM   1727 C CB    . TYR E 3 140 ? -8.359  6.853   9.344   1.00 9.05  ? 140  TYR A CB    1 
ATOM   1728 C CG    . TYR E 3 140 ? -8.125  7.096   10.818  1.00 8.88  ? 140  TYR A CG    1 
ATOM   1729 C CD1   . TYR E 3 140 ? -6.822  7.204   11.336  1.00 9.18  ? 140  TYR A CD1   1 
ATOM   1730 C CD2   . TYR E 3 140 ? -9.201  7.210   11.708  1.00 10.22 ? 140  TYR A CD2   1 
ATOM   1731 C CE1   . TYR E 3 140 ? -6.589  7.424   12.692  1.00 11.11 ? 140  TYR A CE1   1 
ATOM   1732 C CE2   . TYR E 3 140 ? -8.971  7.448   13.075  1.00 10.15 ? 140  TYR A CE2   1 
ATOM   1733 C CZ    . TYR E 3 140 ? -7.677  7.543   13.558  1.00 11.35 ? 140  TYR A CZ    1 
ATOM   1734 O OH    . TYR E 3 140 ? -7.449  7.755   14.901  1.00 9.89  ? 140  TYR A OH    1 
ATOM   1735 N N     . ASN E 3 141 ? -8.917  4.152   10.088  1.00 8.16  ? 141  ASN A N     1 
ATOM   1736 C CA    . ASN E 3 141 ? -9.440  2.827   10.454  1.00 7.70  ? 141  ASN A CA    1 
ATOM   1737 C C     . ASN E 3 141 ? -10.524 3.011   11.492  1.00 7.85  ? 141  ASN A C     1 
ATOM   1738 O O     . ASN E 3 141 ? -10.425 3.920   12.346  1.00 8.50  ? 141  ASN A O     1 
ATOM   1739 C CB    . ASN E 3 141 ? -8.308  1.978   11.066  1.00 8.50  ? 141  ASN A CB    1 
ATOM   1740 C CG    . ASN E 3 141 ? -8.635  0.505   11.139  1.00 8.08  ? 141  ASN A CG    1 
ATOM   1741 O OD1   . ASN E 3 141 ? -9.548  0.071   11.853  1.00 8.64  ? 141  ASN A OD1   1 
ATOM   1742 N ND2   . ASN E 3 141 ? -7.841  -0.291  10.425  1.00 9.41  ? 141  ASN A ND2   1 
ATOM   1743 N N     . LEU E 3 142 ? -11.560 2.176   11.424  1.00 8.80  ? 142  LEU A N     1 
ATOM   1744 C CA    . LEU E 3 142 ? -12.584 2.176   12.465  1.00 9.40  ? 142  LEU A CA    1 
ATOM   1745 C C     . LEU E 3 142 ? -11.986 2.093   13.866  1.00 8.85  ? 142  LEU A C     1 
ATOM   1746 O O     . LEU E 3 142 ? -12.537 2.662   14.794  1.00 9.41  ? 142  LEU A O     1 
ATOM   1747 C CB    . LEU E 3 142 ? -13.508 0.977   12.296  1.00 9.66  ? 142  LEU A CB    1 
ATOM   1748 C CG    . LEU E 3 142 ? -14.960 1.084   11.855  1.00 15.06 ? 142  LEU A CG    1 
ATOM   1749 C CD1   . LEU E 3 142 ? -15.354 2.317   11.029  1.00 11.85 ? 142  LEU A CD1   1 
ATOM   1750 C CD2   . LEU E 3 142 ? -15.396 -0.267  11.233  1.00 10.77 ? 142  LEU A CD2   1 
ATOM   1751 N N     . TYR E 3 143 ? -10.894 1.350   14.033  1.00 8.91  ? 143  TYR A N     1 
ATOM   1752 C CA    . TYR E 3 143 ? -10.424 1.121   15.401  1.00 7.65  ? 143  TYR A CA    1 
ATOM   1753 C C     . TYR E 3 143 ? -9.819  2.372   16.003  1.00 7.91  ? 143  TYR A C     1 
ATOM   1754 O O     . TYR E 3 143 ? -9.921  2.604   17.212  1.00 8.71  ? 143  TYR A O     1 
ATOM   1755 C CB    . TYR E 3 143 ? -9.513  -0.095  15.518  1.00 8.19  ? 143  TYR A CB    1 
ATOM   1756 C CG    . TYR E 3 143 ? -8.030  0.075   15.249  1.00 7.51  ? 143  TYR A CG    1 
ATOM   1757 C CD1   . TYR E 3 143 ? -7.193  0.714   16.172  1.00 7.94  ? 143  TYR A CD1   1 
ATOM   1758 C CD2   . TYR E 3 143 ? -7.446  -0.495  14.107  1.00 9.49  ? 143  TYR A CD2   1 
ATOM   1759 C CE1   . TYR E 3 143 ? -5.799  0.832   15.953  1.00 8.07  ? 143  TYR A CE1   1 
ATOM   1760 C CE2   . TYR E 3 143 ? -6.066  -0.407  13.873  1.00 9.07  ? 143  TYR A CE2   1 
ATOM   1761 C CZ    . TYR E 3 143 ? -5.245  0.278   14.798  1.00 9.02  ? 143  TYR A CZ    1 
ATOM   1762 O OH    . TYR E 3 143 ? -3.894  0.348   14.596  1.00 9.90  ? 143  TYR A OH    1 
ATOM   1763 N N     . GLY E 3 144 ? -9.224  3.207   15.134  1.00 7.68  ? 144  GLY A N     1 
ATOM   1764 C CA    . GLY E 3 144 ? -8.723  4.524   15.548  1.00 9.25  ? 144  GLY A CA    1 
ATOM   1765 C C     . GLY E 3 144 ? -9.876  5.428   15.985  1.00 9.47  ? 144  GLY A C     1 
ATOM   1766 O O     . GLY E 3 144 ? -9.775  6.115   17.014  1.00 11.01 ? 144  GLY A O     1 
ATOM   1767 N N     . ALA E 3 145 ? -10.950 5.428   15.189  1.00 9.10  ? 145  ALA A N     1 
ATOM   1768 C CA    . ALA E 3 145 ? -12.144 6.243   15.452  1.00 9.41  ? 145  ALA A CA    1 
ATOM   1769 C C     . ALA E 3 145 ? -12.830 5.798   16.749  1.00 9.64  ? 145  ALA A C     1 
ATOM   1770 O O     . ALA E 3 145 ? -13.225 6.624   17.560  1.00 10.07 ? 145  ALA A O     1 
ATOM   1771 C CB    . ALA E 3 145 ? -13.124 6.180   14.275  1.00 10.31 ? 145  ALA A CB    1 
ATOM   1772 N N     . PHE E 3 146 ? -12.938 4.490   16.949  1.00 9.80  ? 146  PHE A N     1 
ATOM   1773 C CA    . PHE E 3 146 ? -13.464 3.954   18.235  1.00 9.81  ? 146  PHE A CA    1 
ATOM   1774 C C     . PHE E 3 146 ? -12.651 4.433   19.448  1.00 10.88 ? 146  PHE A C     1 
ATOM   1775 O O     . PHE E 3 146 ? -13.215 4.848   20.470  1.00 11.49 ? 146  PHE A O     1 
ATOM   1776 C CB    . PHE E 3 146 ? -13.549 2.422   18.204  1.00 10.05 ? 146  PHE A CB    1 
ATOM   1777 C CG    . PHE E 3 146 ? -14.893 1.916   17.767  1.00 9.29  ? 146  PHE A CG    1 
ATOM   1778 C CD1   . PHE E 3 146 ? -15.282 2.022   16.441  1.00 8.13  ? 146  PHE A CD1   1 
ATOM   1779 C CD2   . PHE E 3 146 ? -15.801 1.382   18.697  1.00 10.67 ? 146  PHE A CD2   1 
ATOM   1780 C CE1   . PHE E 3 146 ? -16.533 1.593   16.023  1.00 9.41  ? 146  PHE A CE1   1 
ATOM   1781 C CE2   . PHE E 3 146 ? -17.062 0.954   18.287  1.00 9.59  ? 146  PHE A CE2   1 
ATOM   1782 C CZ    . PHE E 3 146 ? -17.430 1.048   16.958  1.00 10.41 ? 146  PHE A CZ    1 
ATOM   1783 N N     . LEU E 3 147 ? -11.330 4.405   19.331  1.00 10.57 ? 147  LEU A N     1 
ATOM   1784 C CA    . LEU E 3 147 ? -10.442 4.860   20.402  1.00 10.68 ? 147  LEU A CA    1 
ATOM   1785 C C     . LEU E 3 147 ? -10.648 6.339   20.712  1.00 11.28 ? 147  LEU A C     1 
ATOM   1786 O O     . LEU E 3 147 ? -10.796 6.737   21.885  1.00 10.58 ? 147  LEU A O     1 
ATOM   1787 C CB    . LEU E 3 147 ? -8.985  4.604   20.023  1.00 11.33 ? 147  LEU A CB    1 
ATOM   1788 C CG    . LEU E 3 147 ? -8.469  3.190   20.258  1.00 11.55 ? 147  LEU A CG    1 
ATOM   1789 C CD1   . LEU E 3 147 ? -7.157  2.977   19.483  1.00 12.83 ? 147  LEU A CD1   1 
ATOM   1790 C CD2   . LEU E 3 147 ? -8.295  2.894   21.768  1.00 14.19 ? 147  LEU A CD2   1 
ATOM   1791 N N     . GLU E 3 148 ? -10.689 7.156   19.657  1.00 10.24 ? 148  GLU A N     1 
ATOM   1792 C CA    . GLU E 3 148 ? -10.904 8.583   19.863  1.00 11.16 ? 148  GLU A CA    1 
ATOM   1793 C C     . GLU E 3 148 ? -12.266 8.861   20.509  1.00 10.51 ? 148  GLU A C     1 
ATOM   1794 O O     . GLU E 3 148 ? -12.355 9.626   21.489  1.00 11.40 ? 148  GLU A O     1 
ATOM   1795 C CB    . GLU E 3 148 ? -10.792 9.364   18.560  1.00 10.55 ? 148  GLU A CB    1 
ATOM   1796 C CG    . GLU E 3 148 ? -10.834 10.877  18.871  1.00 11.45 ? 148  GLU A CG    1 
ATOM   1797 C CD    . GLU E 3 148 ? -10.855 11.804  17.664  1.00 12.68 ? 148  GLU A CD    1 
ATOM   1798 O OE1   . GLU E 3 148 ? -10.315 11.433  16.601  1.00 13.32 ? 148  GLU A OE1   1 
ATOM   1799 O OE2   . GLU E 3 148 ? -11.415 12.927  17.797  1.00 12.74 ? 148  GLU A OE2   1 
ATOM   1800 N N     . LYS E 3 149 ? -13.304 8.257   19.946  1.00 10.52 ? 149  LYS A N     1 
ATOM   1801 C CA    . LYS E 3 149 ? -14.672 8.396   20.464  1.00 11.69 ? 149  LYS A CA    1 
ATOM   1802 C C     . LYS E 3 149 ? -14.743 8.003   21.930  1.00 11.51 ? 149  LYS A C     1 
ATOM   1803 O O     . LYS E 3 149 ? -15.322 8.737   22.747  1.00 12.42 ? 149  LYS A O     1 
ATOM   1804 C CB    . LYS E 3 149 ? -15.669 7.576   19.631  1.00 11.23 ? 149  LYS A CB    1 
ATOM   1805 C CG    . LYS E 3 149 ? -17.148 7.712   20.056  1.00 12.03 ? 149  LYS A CG    1 
ATOM   1806 C CD    . LYS E 3 149 ? -17.602 9.188   19.926  1.00 13.55 ? 149  LYS A CD    1 
ATOM   1807 C CE    . LYS E 3 149 ? -19.084 9.322   20.261  1.00 14.92 ? 149  LYS A CE    1 
ATOM   1808 N NZ    . LYS E 3 149 ? -19.545 10.749  20.230  1.00 14.56 ? 149  LYS A NZ    1 
ATOM   1809 N N     . ALA E 3 150 ? -14.155 6.850   22.262  1.00 11.62 ? 150  ALA A N     1 
ATOM   1810 C CA    . ALA E 3 150 ? -14.147 6.373   23.649  1.00 12.34 ? 150  ALA A CA    1 
ATOM   1811 C C     . ALA E 3 150 ? -13.466 7.362   24.588  1.00 12.25 ? 150  ALA A C     1 
ATOM   1812 O O     . ALA E 3 150 ? -14.020 7.721   25.621  1.00 12.94 ? 150  ALA A O     1 
ATOM   1813 C CB    . ALA E 3 150 ? -13.528 4.999   23.741  1.00 12.26 ? 150  ALA A CB    1 
ATOM   1814 N N     . VAL E 3 151 ? -12.278 7.829   24.228  1.00 12.23 ? 151  VAL A N     1 
ATOM   1815 C CA    . VAL E 3 151 ? -11.601 8.839   25.054  1.00 12.60 ? 151  VAL A CA    1 
ATOM   1816 C C     . VAL E 3 151 ? -12.493 10.082  25.272  1.00 12.99 ? 151  VAL A C     1 
ATOM   1817 O O     . VAL E 3 151 ? -12.607 10.573  26.394  1.00 13.57 ? 151  VAL A O     1 
ATOM   1818 C CB    . VAL E 3 151 ? -10.231 9.244   24.454  1.00 12.20 ? 151  VAL A CB    1 
ATOM   1819 C CG1   . VAL E 3 151 ? -9.654  10.475  25.192  1.00 13.12 ? 151  VAL A CG1   1 
ATOM   1820 C CG2   . VAL E 3 151 ? -9.248  8.078   24.508  1.00 11.63 ? 151  VAL A CG2   1 
ATOM   1821 N N     . ARG E 3 152 ? -13.140 10.559  24.214  1.00 12.91 ? 152  ARG A N     1 
ATOM   1822 C CA    . ARG E 3 152 ? -14.040 11.733  24.306  1.00 13.60 ? 152  ARG A CA    1 
ATOM   1823 C C     . ARG E 3 152 ? -15.248 11.488  25.225  1.00 14.59 ? 152  ARG A C     1 
ATOM   1824 O O     . ARG E 3 152 ? -15.779 12.441  25.811  1.00 16.03 ? 152  ARG A O     1 
ATOM   1825 C CB    . ARG E 3 152 ? -14.501 12.188  22.912  1.00 13.69 ? 152  ARG A CB    1 
ATOM   1826 C CG    . ARG E 3 152 ? -13.357 12.819  22.108  1.00 13.25 ? 152  ARG A CG    1 
ATOM   1827 C CD    . ARG E 3 152 ? -13.840 13.386  20.776  1.00 14.47 ? 152  ARG A CD    1 
ATOM   1828 N NE    . ARG E 3 152 ? -12.716 13.930  20.009  1.00 16.29 ? 152  ARG A NE    1 
ATOM   1829 C CZ    . ARG E 3 152 ? -12.129 15.105  20.262  1.00 18.41 ? 152  ARG A CZ    1 
ATOM   1830 N NH1   . ARG E 3 152 ? -12.579 15.871  21.254  1.00 19.87 ? 152  ARG A NH1   1 
ATOM   1831 N NH2   . ARG E 3 152 ? -11.106 15.534  19.523  1.00 17.95 ? 152  ARG A NH2   1 
ATOM   1832 N N     . LEU E 3 153 ? -15.670 10.226  25.331  1.00 13.95 ? 153  LEU A N     1 
ATOM   1833 C CA    . LEU E 3 153 ? -16.785 9.829   26.209  1.00 15.01 ? 153  LEU A CA    1 
ATOM   1834 C C     . LEU E 3 153 ? -16.401 9.530   27.660  1.00 15.38 ? 153  LEU A C     1 
ATOM   1835 O O     . LEU E 3 153 ? -17.295 9.270   28.472  1.00 16.25 ? 153  LEU A O     1 
ATOM   1836 C CB    . LEU E 3 153 ? -17.539 8.625   25.635  1.00 14.81 ? 153  LEU A CB    1 
ATOM   1837 C CG    . LEU E 3 153 ? -18.271 8.837   24.308  1.00 15.73 ? 153  LEU A CG    1 
ATOM   1838 C CD1   . LEU E 3 153 ? -18.959 7.561   23.879  1.00 18.22 ? 153  LEU A CD1   1 
ATOM   1839 C CD2   . LEU E 3 153 ? -19.263 10.010  24.377  1.00 19.13 ? 153  LEU A CD2   1 
ATOM   1840 N N     . LEU E 3 154 ? -15.107 9.558   27.985  1.00 15.53 ? 154  LEU A N     1 
ATOM   1841 C CA    . LEU E 3 154 ? -14.662 9.339   29.360  1.00 15.92 ? 154  LEU A CA    1 
ATOM   1842 C C     . LEU E 3 154 ? -14.822 10.579  30.230  1.00 16.74 ? 154  LEU A C     1 
ATOM   1843 O O     . LEU E 3 154 ? -14.487 11.683  29.811  1.00 16.83 ? 154  LEU A O     1 
ATOM   1844 C CB    . LEU E 3 154 ? -13.199 8.882   29.424  1.00 16.07 ? 154  LEU A CB    1 
ATOM   1845 C CG    . LEU E 3 154 ? -12.839 7.455   29.010  1.00 15.23 ? 154  LEU A CG    1 
ATOM   1846 C CD1   . LEU E 3 154 ? -11.303 7.264   29.082  1.00 16.09 ? 154  LEU A CD1   1 
ATOM   1847 C CD2   . LEU E 3 154 ? -13.566 6.357   29.839  1.00 14.59 ? 154  LEU A CD2   1 
ATOM   1848 N N     . LYS E 3 155 ? -15.320 10.377  31.450  1.00 17.44 ? 155  LYS A N     1 
ATOM   1849 C CA    . LYS E 3 155 ? -15.219 11.390  32.496  1.00 18.59 ? 155  LYS A CA    1 
ATOM   1850 C C     . LYS E 3 155 ? -13.741 11.634  32.792  1.00 19.15 ? 155  LYS A C     1 
ATOM   1851 O O     . LYS E 3 155 ? -12.911 10.754  32.541  1.00 18.61 ? 155  LYS A O     1 
ATOM   1852 C CB    . LYS E 3 155 ? -15.876 10.896  33.783  1.00 19.12 ? 155  LYS A CB    1 
ATOM   1853 C CG    . LYS E 3 155 ? -17.368 10.743  33.736  1.00 20.44 ? 155  LYS A CG    1 
ATOM   1854 C CD    . LYS E 3 155 ? -17.866 10.147  35.058  1.00 23.40 ? 155  LYS A CD    1 
ATOM   1855 C CE    . LYS E 3 155 ? -19.345 9.853   35.036  1.00 26.77 ? 155  LYS A CE    1 
ATOM   1856 N NZ    . LYS E 3 155 ? -19.743 8.929   36.174  1.00 30.20 ? 155  LYS A NZ    1 
ATOM   1857 N N     . PRO E 3 156 ? -13.396 12.830  33.332  1.00 19.83 ? 156  PRO A N     1 
ATOM   1858 C CA    . PRO E 3 156 ? -12.030 13.030  33.856  1.00 20.22 ? 156  PRO A CA    1 
ATOM   1859 C C     . PRO E 3 156 ? -11.625 11.901  34.808  1.00 19.83 ? 156  PRO A C     1 
ATOM   1860 O O     . PRO E 3 156 ? -12.413 11.509  35.674  1.00 20.32 ? 156  PRO A O     1 
ATOM   1861 C CB    . PRO E 3 156 ? -12.112 14.382  34.599  1.00 20.32 ? 156  PRO A CB    1 
ATOM   1862 C CG    . PRO E 3 156 ? -13.563 14.769  34.582  1.00 21.39 ? 156  PRO A CG    1 
ATOM   1863 C CD    . PRO E 3 156 ? -14.225 14.043  33.464  1.00 20.36 ? 156  PRO A CD    1 
ATOM   1864 N N     . GLY E 3 157 ? -10.414 11.373  34.639  1.00 18.83 ? 157  GLY A N     1 
ATOM   1865 C CA    . GLY E 3 157 ? -9.943  10.220  35.399  1.00 17.72 ? 157  GLY A CA    1 
ATOM   1866 C C     . GLY E 3 157 ? -10.542 8.863   35.034  1.00 16.59 ? 157  GLY A C     1 
ATOM   1867 O O     . GLY E 3 157 ? -10.182 7.848   35.631  1.00 16.14 ? 157  GLY A O     1 
ATOM   1868 N N     . GLY E 3 158 ? -11.439 8.848   34.047  1.00 16.10 ? 158  GLY A N     1 
ATOM   1869 C CA    . GLY E 3 158 ? -12.034 7.613   33.539  1.00 15.08 ? 158  GLY A CA    1 
ATOM   1870 C C     . GLY E 3 158 ? -11.017 6.700   32.865  1.00 15.24 ? 158  GLY A C     1 
ATOM   1871 O O     . GLY E 3 158 ? -9.923  7.134   32.505  1.00 14.69 ? 158  GLY A O     1 
ATOM   1872 N N     . VAL E 3 159 ? -11.395 5.439   32.696  1.00 13.62 ? 159  VAL A N     1 
ATOM   1873 C CA    . VAL E 3 159 ? -10.508 4.420   32.128  1.00 13.58 ? 159  VAL A CA    1 
ATOM   1874 C C     . VAL E 3 159 ? -11.119 3.742   30.911  1.00 13.10 ? 159  VAL A C     1 
ATOM   1875 O O     . VAL E 3 159 ? -12.305 3.440   30.894  1.00 12.80 ? 159  VAL A O     1 
ATOM   1876 C CB    . VAL E 3 159 ? -10.107 3.388   33.213  1.00 13.81 ? 159  VAL A CB    1 
ATOM   1877 C CG1   . VAL E 3 159 ? -9.424  2.139   32.626  1.00 14.40 ? 159  VAL A CG1   1 
ATOM   1878 C CG2   . VAL E 3 159 ? -9.210  4.069   34.250  1.00 12.68 ? 159  VAL A CG2   1 
ATOM   1879 N N     . LEU E 3 160 ? -10.273 3.505   29.906  1.00 12.61 ? 160  LEU A N     1 
ATOM   1880 C CA    . LEU E 3 160 ? -10.620 2.753   28.717  1.00 13.13 ? 160  LEU A CA    1 
ATOM   1881 C C     . LEU E 3 160 ? -9.692  1.534   28.648  1.00 11.95 ? 160  LEU A C     1 
ATOM   1882 O O     . LEU E 3 160 ? -8.501  1.644   28.932  1.00 12.19 ? 160  LEU A O     1 
ATOM   1883 C CB    . LEU E 3 160 ? -10.441 3.671   27.504  1.00 13.61 ? 160  LEU A CB    1 
ATOM   1884 C CG    . LEU E 3 160 ? -10.308 3.252   26.058  1.00 17.33 ? 160  LEU A CG    1 
ATOM   1885 C CD1   . LEU E 3 160 ? -11.618 2.603   25.673  1.00 18.57 ? 160  LEU A CD1   1 
ATOM   1886 C CD2   . LEU E 3 160 ? -10.077 4.516   25.218  1.00 14.76 ? 160  LEU A CD2   1 
ATOM   1887 N N     . VAL E 3 161 ? -10.239 0.371   28.308  1.00 11.23 ? 161  VAL A N     1 
ATOM   1888 C CA    . VAL E 3 161 ? -9.413  -0.821  28.051  1.00 10.35 ? 161  VAL A CA    1 
ATOM   1889 C C     . VAL E 3 161 ? -9.952  -1.481  26.779  1.00 10.17 ? 161  VAL A C     1 
ATOM   1890 O O     . VAL E 3 161 ? -11.038 -2.067  26.788  1.00 9.45  ? 161  VAL A O     1 
ATOM   1891 C CB    . VAL E 3 161 ? -9.425  -1.854  29.231  1.00 10.88 ? 161  VAL A CB    1 
ATOM   1892 C CG1   . VAL E 3 161 ? -8.363  -2.905  29.005  1.00 10.23 ? 161  VAL A CG1   1 
ATOM   1893 C CG2   . VAL E 3 161 ? -9.225  -1.160  30.611  1.00 11.73 ? 161  VAL A CG2   1 
ATOM   1894 N N     . PHE E 3 162 ? -9.177  -1.383  25.694  1.00 10.38 ? 162  PHE A N     1 
ATOM   1895 C CA    . PHE E 3 162 ? -9.569  -1.901  24.383  1.00 9.67  ? 162  PHE A CA    1 
ATOM   1896 C C     . PHE E 3 162 ? -8.502  -2.863  23.908  1.00 9.44  ? 162  PHE A C     1 
ATOM   1897 O O     . PHE E 3 162 ? -7.331  -2.731  24.273  1.00 8.97  ? 162  PHE A O     1 
ATOM   1898 C CB    . PHE E 3 162 ? -9.604  -0.757  23.362  1.00 10.30 ? 162  PHE A CB    1 
ATOM   1899 C CG    . PHE E 3 162 ? -10.959 -0.077  23.195  1.00 11.32 ? 162  PHE A CG    1 
ATOM   1900 C CD1   . PHE E 3 162 ? -12.037 -0.344  24.033  1.00 11.99 ? 162  PHE A CD1   1 
ATOM   1901 C CD2   . PHE E 3 162 ? -11.128 0.863   22.164  1.00 11.63 ? 162  PHE A CD2   1 
ATOM   1902 C CE1   . PHE E 3 162 ? -13.277 0.323   23.839  1.00 13.42 ? 162  PHE A CE1   1 
ATOM   1903 C CE2   . PHE E 3 162 ? -12.354 1.533   21.978  1.00 14.61 ? 162  PHE A CE2   1 
ATOM   1904 C CZ    . PHE E 3 162 ? -13.424 1.250   22.815  1.00 14.45 ? 162  PHE A CZ    1 
ATOM   1905 N N     . VAL E 3 163 ? -8.901  -3.855  23.126  1.00 9.00  ? 163  VAL A N     1 
ATOM   1906 C CA    . VAL E 3 163 ? -7.934  -4.653  22.371  1.00 8.87  ? 163  VAL A CA    1 
ATOM   1907 C C     . VAL E 3 163 ? -8.041  -4.265  20.886  1.00 8.53  ? 163  VAL A C     1 
ATOM   1908 O O     . VAL E 3 163 ? -9.131  -4.263  20.299  1.00 9.27  ? 163  VAL A O     1 
ATOM   1909 C CB    . VAL E 3 163 ? -8.098  -6.189  22.556  1.00 9.20  ? 163  VAL A CB    1 
ATOM   1910 C CG1   . VAL E 3 163 ? -9.533  -6.659  22.209  1.00 10.25 ? 163  VAL A CG1   1 
ATOM   1911 C CG2   . VAL E 3 163 ? -7.020  -6.956  21.753  1.00 8.61  ? 163  VAL A CG2   1 
ATOM   1912 N N     . VAL E 3 164 ? -6.895  -3.956  20.288  1.00 8.42  ? 164  VAL A N     1 
ATOM   1913 C CA    . VAL E 3 164 ? -6.852  -3.371  18.948  1.00 8.60  ? 164  VAL A CA    1 
ATOM   1914 C C     . VAL E 3 164 ? -5.599  -3.898  18.251  1.00 8.48  ? 164  VAL A C     1 
ATOM   1915 O O     . VAL E 3 164 ? -4.705  -4.437  18.931  1.00 8.05  ? 164  VAL A O     1 
ATOM   1916 C CB    . VAL E 3 164 ? -6.847  -1.799  19.001  1.00 8.53  ? 164  VAL A CB    1 
ATOM   1917 C CG1   . VAL E 3 164 ? -8.208  -1.241  19.499  1.00 9.49  ? 164  VAL A CG1   1 
ATOM   1918 C CG2   . VAL E 3 164 ? -5.686  -1.276  19.872  1.00 10.92 ? 164  VAL A CG2   1 
ATOM   1919 N N     . PRO E 3 165 ? -5.524  -3.770  16.906  1.00 8.70  ? 165  PRO A N     1 
ATOM   1920 C CA    . PRO E 3 165 ? -4.275  -4.105  16.211  1.00 8.92  ? 165  PRO A CA    1 
ATOM   1921 C C     . PRO E 3 165 ? -3.094  -3.264  16.738  1.00 7.91  ? 165  PRO A C     1 
ATOM   1922 O O     . PRO E 3 165 ? -3.294  -2.178  17.291  1.00 9.52  ? 165  PRO A O     1 
ATOM   1923 C CB    . PRO E 3 165 ? -4.576  -3.756  14.738  1.00 8.83  ? 165  PRO A CB    1 
ATOM   1924 C CG    . PRO E 3 165 ? -6.099  -3.820  14.613  1.00 9.41  ? 165  PRO A CG    1 
ATOM   1925 C CD    . PRO E 3 165 ? -6.565  -3.287  15.966  1.00 8.86  ? 165  PRO A CD    1 
ATOM   1926 N N     . ALA E 3 166 ? -1.874  -3.764  16.558  1.00 7.79  ? 166  ALA A N     1 
ATOM   1927 C CA    . ALA E 3 166 ? -0.661  -3.084  17.034  1.00 7.59  ? 166  ALA A CA    1 
ATOM   1928 C C     . ALA E 3 166 ? -0.206  -1.987  16.056  1.00 8.05  ? 166  ALA A C     1 
ATOM   1929 O O     . ALA E 3 166 ? 0.786   -1.317  16.292  1.00 8.27  ? 166  ALA A O     1 
ATOM   1930 C CB    . ALA E 3 166 ? 0.475   -4.122  17.231  1.00 8.49  ? 166  ALA A CB    1 
ATOM   1931 N N     . THR E 3 167 ? -0.931  -1.817  14.952  1.00 8.14  ? 167  THR A N     1 
ATOM   1932 C CA    . THR E 3 167 ? -0.392  -1.021  13.862  1.00 8.66  ? 167  THR A CA    1 
ATOM   1933 C C     . THR E 3 167 ? -0.268  0.448   14.246  1.00 8.83  ? 167  THR A C     1 
ATOM   1934 O O     . THR E 3 167 ? 0.653   1.120   13.772  1.00 9.25  ? 167  THR A O     1 
ATOM   1935 C CB    . THR E 3 167 ? -1.170  -1.204  12.527  1.00 9.51  ? 167  THR A CB    1 
ATOM   1936 O OG1   . THR E 3 167 ? -2.426  -0.518  12.593  1.00 9.39  ? 167  THR A OG1   1 
ATOM   1937 C CG2   . THR E 3 167 ? -1.393  -2.700  12.264  1.00 10.17 ? 167  THR A CG2   1 
ATOM   1938 N N     . TRP E 3 168 ? -1.147  0.921   15.132  1.00 7.77  ? 168  TRP A N     1 
ATOM   1939 C CA    . TRP E 3 168 ? -1.113  2.334   15.560  1.00 8.72  ? 168  TRP A CA    1 
ATOM   1940 C C     . TRP E 3 168 ? 0.170   2.687   16.340  1.00 8.74  ? 168  TRP A C     1 
ATOM   1941 O O     . TRP E 3 168 ? 0.498   3.861   16.510  1.00 10.11 ? 168  TRP A O     1 
ATOM   1942 C CB    . TRP E 3 168 ? -2.371  2.704   16.370  1.00 9.40  ? 168  TRP A CB    1 
ATOM   1943 C CG    . TRP E 3 168 ? -2.397  2.076   17.708  1.00 10.58 ? 168  TRP A CG    1 
ATOM   1944 C CD1   . TRP E 3 168 ? -2.880  0.831   18.017  1.00 10.26 ? 168  TRP A CD1   1 
ATOM   1945 C CD2   . TRP E 3 168 ? -1.910  2.641   18.937  1.00 10.86 ? 168  TRP A CD2   1 
ATOM   1946 N NE1   . TRP E 3 168 ? -2.716  0.581   19.364  1.00 10.96 ? 168  TRP A NE1   1 
ATOM   1947 C CE2   . TRP E 3 168 ? -2.130  1.672   19.955  1.00 12.72 ? 168  TRP A CE2   1 
ATOM   1948 C CE3   . TRP E 3 168 ? -1.324  3.875   19.281  1.00 11.33 ? 168  TRP A CE3   1 
ATOM   1949 C CZ2   . TRP E 3 168 ? -1.764  1.891   21.293  1.00 12.23 ? 168  TRP A CZ2   1 
ATOM   1950 C CZ3   . TRP E 3 168 ? -0.958  4.098   20.610  1.00 12.50 ? 168  TRP A CZ3   1 
ATOM   1951 C CH2   . TRP E 3 168 ? -1.183  3.104   21.604  1.00 11.40 ? 168  TRP A CH2   1 
ATOM   1952 N N     . LEU E 3 169 ? 0.892   1.678   16.823  1.00 8.74  ? 169  LEU A N     1 
ATOM   1953 C CA    . LEU E 3 169 ? 2.146   1.968   17.544  1.00 9.67  ? 169  LEU A CA    1 
ATOM   1954 C C     . LEU E 3 169 ? 3.170   2.637   16.618  1.00 9.97  ? 169  LEU A C     1 
ATOM   1955 O O     . LEU E 3 169 ? 3.985   3.436   17.070  1.00 10.40 ? 169  LEU A O     1 
ATOM   1956 C CB    . LEU E 3 169 ? 2.793   0.723   18.134  1.00 10.12 ? 169  LEU A CB    1 
ATOM   1957 C CG    . LEU E 3 169 ? 2.066   -0.312  18.992  1.00 14.59 ? 169  LEU A CG    1 
ATOM   1958 C CD1   . LEU E 3 169 ? 3.055   -0.967  19.982  1.00 12.66 ? 169  LEU A CD1   1 
ATOM   1959 C CD2   . LEU E 3 169 ? 0.769   0.095   19.627  1.00 13.23 ? 169  LEU A CD2   1 
ATOM   1960 N N     . VAL E 3 170 ? 3.116   2.297   15.330  1.00 10.19 ? 170  VAL A N     1 
ATOM   1961 C CA    . VAL E 3 170 ? 4.179   2.668   14.389  1.00 10.20 ? 170  VAL A CA    1 
ATOM   1962 C C     . VAL E 3 170 ? 3.757   3.445   13.136  1.00 10.01 ? 170  VAL A C     1 
ATOM   1963 O O     . VAL E 3 170 ? 4.581   4.149   12.556  1.00 10.01 ? 170  VAL A O     1 
ATOM   1964 C CB    . VAL E 3 170 ? 5.050   1.434   13.954  1.00 11.41 ? 170  VAL A CB    1 
ATOM   1965 C CG1   . VAL E 3 170 ? 5.843   0.881   15.131  1.00 10.39 ? 170  VAL A CG1   1 
ATOM   1966 C CG2   . VAL E 3 170 ? 4.201   0.325   13.325  1.00 10.59 ? 170  VAL A CG2   1 
ATOM   1967 N N     . LEU E 3 171 ? 2.500   3.298   12.714  1.00 8.74  ? 171  LEU A N     1 
ATOM   1968 C CA    . LEU E 3 171 ? 2.074   3.779   11.394  1.00 9.07  ? 171  LEU A CA    1 
ATOM   1969 C C     . LEU E 3 171 ? 1.741   5.266   11.347  1.00 9.13  ? 171  LEU A C     1 
ATOM   1970 O O     . LEU E 3 171 ? 1.143   5.808   12.282  1.00 9.53  ? 171  LEU A O     1 
ATOM   1971 C CB    . LEU E 3 171 ? 0.888   2.965   10.889  1.00 8.39  ? 171  LEU A CB    1 
ATOM   1972 C CG    . LEU E 3 171 ? 1.194   1.497   10.552  1.00 6.97  ? 171  LEU A CG    1 
ATOM   1973 C CD1   . LEU E 3 171 ? 0.010   0.929   9.777   1.00 10.34 ? 171  LEU A CD1   1 
ATOM   1974 C CD2   . LEU E 3 171 ? 2.481   1.326   9.744   1.00 8.78  ? 171  LEU A CD2   1 
ATOM   1975 N N     . GLU E 3 172 ? 2.102   5.915   10.233  1.00 9.74  ? 172  GLU A N     1 
ATOM   1976 C CA    . GLU E 3 172 ? 1.808   7.328   10.033  1.00 10.62 ? 172  GLU A CA    1 
ATOM   1977 C C     . GLU E 3 172 ? 0.315   7.698   10.114  1.00 10.58 ? 172  GLU A C     1 
ATOM   1978 O O     . GLU E 3 172 ? -0.020  8.763   10.651  1.00 10.10 ? 172  GLU A O     1 
ATOM   1979 C CB    . GLU E 3 172 ? 2.404   7.839   8.714   1.00 12.06 ? 172  GLU A CB    1 
ATOM   1980 C CG    . GLU E 3 172 ? 3.884   8.155   8.822   1.00 16.03 ? 172  GLU A CG    1 
ATOM   1981 C CD    . GLU E 3 172 ? 4.192   9.287   9.804   1.00 19.92 ? 172  GLU A CD    1 
ATOM   1982 O OE1   . GLU E 3 172 ? 3.317   10.124  10.112  1.00 24.37 ? 172  GLU A OE1   1 
ATOM   1983 O OE2   . GLU E 3 172 ? 5.321   9.335   10.300  1.00 23.59 ? 172  GLU A OE2   1 
ATOM   1984 N N     . ASP E 3 173 ? -0.569  6.835   9.594   1.00 9.43  ? 173  ASP A N     1 
ATOM   1985 C CA    . ASP E 3 173 ? -2.019  7.076   9.672   1.00 10.05 ? 173  ASP A CA    1 
ATOM   1986 C C     . ASP E 3 173 ? -2.457  7.334   11.118  1.00 9.52  ? 173  ASP A C     1 
ATOM   1987 O O     . ASP E 3 173 ? -3.468  7.980   11.326  1.00 10.25 ? 173  ASP A O     1 
ATOM   1988 C CB    . ASP E 3 173 ? -2.842  5.908   9.094   1.00 10.13 ? 173  ASP A CB    1 
ATOM   1989 C CG    . ASP E 3 173 ? -3.252  6.124   7.624   1.00 14.32 ? 173  ASP A CG    1 
ATOM   1990 O OD1   . ASP E 3 173 ? -2.621  6.955   6.938   1.00 17.02 ? 173  ASP A OD1   1 
ATOM   1991 O OD2   . ASP E 3 173 ? -4.192  5.425   7.135   1.00 13.88 ? 173  ASP A OD2   1 
ATOM   1992 N N     . PHE E 3 174 ? -1.677  6.847   12.095  1.00 8.49  ? 174  PHE A N     1 
ATOM   1993 C CA    . PHE E 3 174 ? -2.074  6.934   13.518  1.00 9.75  ? 174  PHE A CA    1 
ATOM   1994 C C     . PHE E 3 174 ? -1.267  7.953   14.311  1.00 10.53 ? 174  PHE A C     1 
ATOM   1995 O O     . PHE E 3 174 ? -1.345  8.004   15.543  1.00 10.41 ? 174  PHE A O     1 
ATOM   1996 C CB    . PHE E 3 174 ? -2.035  5.528   14.154  1.00 9.65  ? 174  PHE A CB    1 
ATOM   1997 C CG    . PHE E 3 174 ? -3.017  4.577   13.520  1.00 9.68  ? 174  PHE A CG    1 
ATOM   1998 C CD1   . PHE E 3 174 ? -4.370  4.613   13.868  1.00 9.99  ? 174  PHE A CD1   1 
ATOM   1999 C CD2   . PHE E 3 174 ? -2.602  3.659   12.562  1.00 9.47  ? 174  PHE A CD2   1 
ATOM   2000 C CE1   . PHE E 3 174 ? -5.310  3.751   13.245  1.00 9.62  ? 174  PHE A CE1   1 
ATOM   2001 C CE2   . PHE E 3 174 ? -3.544  2.780   11.926  1.00 9.39  ? 174  PHE A CE2   1 
ATOM   2002 C CZ    . PHE E 3 174 ? -4.896  2.833   12.294  1.00 8.29  ? 174  PHE A CZ    1 
ATOM   2003 N N     . ALA E 3 175 ? -0.497  8.782   13.599  1.00 10.85 ? 175  ALA A N     1 
ATOM   2004 C CA    . ALA E 3 175 ? 0.297   9.829   14.278  1.00 11.23 ? 175  ALA A CA    1 
ATOM   2005 C C     . ALA E 3 175 ? -0.571  10.790  15.106  1.00 10.95 ? 175  ALA A C     1 
ATOM   2006 O O     . ALA E 3 175 ? -0.203  11.150  16.243  1.00 11.55 ? 175  ALA A O     1 
ATOM   2007 C CB    . ALA E 3 175 ? 1.116   10.614  13.266  1.00 11.50 ? 175  ALA A CB    1 
ATOM   2008 N N     . LEU E 3 176 ? -1.699  11.232  14.547  1.00 10.00 ? 176  LEU A N     1 
ATOM   2009 C CA    . LEU E 3 176 ? -2.586  12.145  15.274  1.00 11.12 ? 176  LEU A CA    1 
ATOM   2010 C C     . LEU E 3 176 ? -3.216  11.422  16.470  1.00 10.79 ? 176  LEU A C     1 
ATOM   2011 O O     . LEU E 3 176 ? -3.324  11.987  17.554  1.00 11.19 ? 176  LEU A O     1 
ATOM   2012 C CB    . LEU E 3 176 ? -3.655  12.736  14.365  1.00 11.19 ? 176  LEU A CB    1 
ATOM   2013 C CG    . LEU E 3 176 ? -3.127  13.599  13.211  1.00 13.16 ? 176  LEU A CG    1 
ATOM   2014 C CD1   . LEU E 3 176 ? -4.295  14.216  12.455  1.00 13.66 ? 176  LEU A CD1   1 
ATOM   2015 C CD2   . LEU E 3 176 ? -2.150  14.686  13.706  1.00 14.36 ? 176  LEU A CD2   1 
ATOM   2016 N N     . LEU E 3 177 ? -3.568  10.157  16.283  1.00 9.79  ? 177  LEU A N     1 
ATOM   2017 C CA    . LEU E 3 177 ? -4.131  9.374   17.382  1.00 9.82  ? 177  LEU A CA    1 
ATOM   2018 C C     . LEU E 3 177 ? -3.132  9.256   18.544  1.00 9.45  ? 177  LEU A C     1 
ATOM   2019 O O     . LEU E 3 177 ? -3.505  9.455   19.717  1.00 9.69  ? 177  LEU A O     1 
ATOM   2020 C CB    . LEU E 3 177 ? -4.574  7.985   16.893  1.00 9.96  ? 177  LEU A CB    1 
ATOM   2021 C CG    . LEU E 3 177 ? -5.100  7.039   17.972  1.00 10.80 ? 177  LEU A CG    1 
ATOM   2022 C CD1   . LEU E 3 177 ? -6.378  7.573   18.625  1.00 9.98  ? 177  LEU A CD1   1 
ATOM   2023 C CD2   . LEU E 3 177 ? -5.377  5.662   17.377  1.00 10.39 ? 177  LEU A CD2   1 
ATOM   2024 N N     . ARG E 3 178 ? -1.873  8.944   18.235  1.00 9.27  ? 178  ARG A N     1 
ATOM   2025 C CA    . ARG E 3 178 ? -0.829  8.828   19.276  1.00 10.24 ? 178  ARG A CA    1 
ATOM   2026 C C     . ARG E 3 178 ? -0.629  10.161  19.994  1.00 11.19 ? 178  ARG A C     1 
ATOM   2027 O O     . ARG E 3 178 ? -0.466  10.188  21.210  1.00 11.22 ? 178  ARG A O     1 
ATOM   2028 C CB    . ARG E 3 178 ? 0.515   8.394   18.692  1.00 10.82 ? 178  ARG A CB    1 
ATOM   2029 C CG    . ARG E 3 178 ? 0.570   6.946   18.220  1.00 8.90  ? 178  ARG A CG    1 
ATOM   2030 C CD    . ARG E 3 178 ? 2.004   6.512   17.964  1.00 11.83 ? 178  ARG A CD    1 
ATOM   2031 N NE    . ARG E 3 178 ? 2.650   7.303   16.913  1.00 11.11 ? 178  ARG A NE    1 
ATOM   2032 C CZ    . ARG E 3 178 ? 2.544   7.054   15.607  1.00 12.31 ? 178  ARG A CZ    1 
ATOM   2033 N NH1   . ARG E 3 178 ? 1.852   5.998   15.152  1.00 11.33 ? 178  ARG A NH1   1 
ATOM   2034 N NH2   . ARG E 3 178 ? 3.151   7.858   14.743  1.00 13.05 ? 178  ARG A NH2   1 
ATOM   2035 N N     . GLU E 3 179 ? -0.616  11.260  19.235  1.00 12.13 ? 179  GLU A N     1 
ATOM   2036 C CA    . GLU E 3 179 ? -0.467  12.588  19.829  1.00 13.57 ? 179  GLU A CA    1 
ATOM   2037 C C     . GLU E 3 179 ? -1.674  12.950  20.708  1.00 13.08 ? 179  GLU A C     1 
ATOM   2038 O O     . GLU E 3 179 ? -1.504  13.558  21.779  1.00 14.25 ? 179  GLU A O     1 
ATOM   2039 C CB    . GLU E 3 179 ? -0.202  13.631  18.730  1.00 13.38 ? 179  GLU A CB    1 
ATOM   2040 C CG    . GLU E 3 179 ? 1.156   13.413  18.045  1.00 15.67 ? 179  GLU A CG    1 
ATOM   2041 C CD    . GLU E 3 179 ? 1.298   14.119  16.688  1.00 17.13 ? 179  GLU A CD    1 
ATOM   2042 O OE1   . GLU E 3 179 ? 0.491   15.022  16.360  1.00 21.77 ? 179  GLU A OE1   1 
ATOM   2043 O OE2   . GLU E 3 179 ? 2.240   13.760  15.943  1.00 23.88 ? 179  GLU A OE2   1 
ATOM   2044 N N     . PHE E 3 180 ? -2.867  12.550  20.268  1.00 12.41 ? 180  PHE A N     1 
ATOM   2045 C CA    . PHE E 3 180 ? -4.121  12.737  21.012  1.00 12.41 ? 180  PHE A CA    1 
ATOM   2046 C C     . PHE E 3 180 ? -4.095  12.004  22.365  1.00 12.39 ? 180  PHE A C     1 
ATOM   2047 O O     . PHE E 3 180 ? -4.356  12.607  23.412  1.00 12.42 ? 180  PHE A O     1 
ATOM   2048 C CB    . PHE E 3 180 ? -5.298  12.291  20.133  1.00 11.79 ? 180  PHE A CB    1 
ATOM   2049 C CG    . PHE E 3 180 ? -6.625  12.303  20.815  1.00 12.85 ? 180  PHE A CG    1 
ATOM   2050 C CD1   . PHE E 3 180 ? -7.334  13.494  20.960  1.00 14.92 ? 180  PHE A CD1   1 
ATOM   2051 C CD2   . PHE E 3 180 ? -7.195  11.112  21.286  1.00 13.39 ? 180  PHE A CD2   1 
ATOM   2052 C CE1   . PHE E 3 180 ? -8.589  13.496  21.577  1.00 14.29 ? 180  PHE A CE1   1 
ATOM   2053 C CE2   . PHE E 3 180 ? -8.447  11.121  21.910  1.00 15.10 ? 180  PHE A CE2   1 
ATOM   2054 C CZ    . PHE E 3 180 ? -9.133  12.310  22.052  1.00 14.72 ? 180  PHE A CZ    1 
ATOM   2055 N N     . LEU E 3 181 ? -3.753  10.713  22.347  1.00 12.07 ? 181  LEU A N     1 
ATOM   2056 C CA    . LEU E 3 181 ? -3.646  9.911   23.574  1.00 12.52 ? 181  LEU A CA    1 
ATOM   2057 C C     . LEU E 3 181 ? -2.600  10.481  24.545  1.00 12.50 ? 181  LEU A C     1 
ATOM   2058 O O     . LEU E 3 181 ? -2.857  10.584  25.749  1.00 13.20 ? 181  LEU A O     1 
ATOM   2059 C CB    . LEU E 3 181 ? -3.322  8.456   23.232  1.00 12.29 ? 181  LEU A CB    1 
ATOM   2060 C CG    . LEU E 3 181 ? -4.367  7.669   22.424  1.00 11.30 ? 181  LEU A CG    1 
ATOM   2061 C CD1   . LEU E 3 181 ? -3.744  6.380   21.905  1.00 12.65 ? 181  LEU A CD1   1 
ATOM   2062 C CD2   . LEU E 3 181 ? -5.660  7.394   23.221  1.00 11.39 ? 181  LEU A CD2   1 
ATOM   2063 N N     . ALA E 3 182 ? -1.447  10.895  24.012  1.00 12.55 ? 182  ALA A N     1 
ATOM   2064 C CA    . ALA E 3 182 ? -0.377  11.469  24.826  1.00 13.15 ? 182  ALA A CA    1 
ATOM   2065 C C     . ALA E 3 182 ? -0.835  12.731  25.558  1.00 14.63 ? 182  ALA A C     1 
ATOM   2066 O O     . ALA E 3 182 ? -0.429  12.982  26.688  1.00 15.08 ? 182  ALA A O     1 
ATOM   2067 C CB    . ALA E 3 182 ? 0.822   11.796  23.957  1.00 12.55 ? 182  ALA A CB    1 
ATOM   2068 N N     . ARG E 3 183 ? -1.668  13.509  24.876  1.00 15.24 ? 183  ARG A N     1 
ATOM   2069 C CA    . ARG E 3 183 ? -2.146  14.817  25.329  1.00 17.44 ? 183  ARG A CA    1 
ATOM   2070 C C     . ARG E 3 183 ? -3.314  14.681  26.299  1.00 17.33 ? 183  ARG A C     1 
ATOM   2071 O O     . ARG E 3 183 ? -3.497  15.532  27.181  1.00 17.91 ? 183  ARG A O     1 
ATOM   2072 C CB    . ARG E 3 183 ? -2.566  15.603  24.084  1.00 17.62 ? 183  ARG A CB    1 
ATOM   2073 C CG    . ARG E 3 183 ? -2.902  17.057  24.225  1.00 21.01 ? 183  ARG A CG    1 
ATOM   2074 C CD    . ARG E 3 183 ? -3.434  17.603  22.890  1.00 19.54 ? 183  ARG A CD    1 
ATOM   2075 N NE    . ARG E 3 183 ? -2.445  17.493  21.817  1.00 22.68 ? 183  ARG A NE    1 
ATOM   2076 C CZ    . ARG E 3 183 ? -2.600  16.835  20.663  1.00 23.12 ? 183  ARG A CZ    1 
ATOM   2077 N NH1   . ARG E 3 183 ? -3.727  16.205  20.352  1.00 21.23 ? 183  ARG A NH1   1 
ATOM   2078 N NH2   . ARG E 3 183 ? -1.606  16.834  19.793  1.00 23.90 ? 183  ARG A NH2   1 
ATOM   2079 N N     . GLU E 3 184 ? -4.119  13.634  26.124  1.00 16.85 ? 184  GLU A N     1 
ATOM   2080 C CA    . GLU E 3 184 ? -5.393  13.503  26.853  1.00 16.56 ? 184  GLU A CA    1 
ATOM   2081 C C     . GLU E 3 184 ? -5.295  12.755  28.184  1.00 16.35 ? 184  GLU A C     1 
ATOM   2082 O O     . GLU E 3 184 ? -6.211  12.818  29.004  1.00 16.24 ? 184  GLU A O     1 
ATOM   2083 C CB    . GLU E 3 184 ? -6.461  12.847  25.964  1.00 17.08 ? 184  GLU A CB    1 
ATOM   2084 C CG    . GLU E 3 184 ? -6.916  13.692  24.796  1.00 18.97 ? 184  GLU A CG    1 
ATOM   2085 C CD    . GLU E 3 184 ? -7.865  14.803  25.195  1.00 23.78 ? 184  GLU A CD    1 
ATOM   2086 O OE1   . GLU E 3 184 ? -8.664  14.600  26.143  1.00 26.17 ? 184  GLU A OE1   1 
ATOM   2087 O OE2   . GLU E 3 184 ? -7.817  15.865  24.544  1.00 26.30 ? 184  GLU A OE2   1 
ATOM   2088 N N     . GLY E 3 185 ? -4.206  12.032  28.399  1.00 16.36 ? 185  GLY A N     1 
ATOM   2089 C CA    . GLY E 3 185 ? -4.027  11.298  29.657  1.00 16.16 ? 185  GLY A CA    1 
ATOM   2090 C C     . GLY E 3 185 ? -2.802  10.403  29.659  1.00 16.29 ? 185  GLY A C     1 
ATOM   2091 O O     . GLY E 3 185 ? -1.787  10.725  29.020  1.00 15.72 ? 185  GLY A O     1 
ATOM   2092 N N     . LYS E 3 186 ? -2.896  9.292   30.395  1.00 15.81 ? 186  LYS A N     1 
ATOM   2093 C CA    . LYS E 3 186 ? -1.791  8.326   30.505  1.00 16.72 ? 186  LYS A CA    1 
ATOM   2094 C C     . LYS E 3 186 ? -2.172  7.020   29.820  1.00 15.43 ? 186  LYS A C     1 
ATOM   2095 O O     . LYS E 3 186 ? -3.337  6.602   29.848  1.00 15.14 ? 186  LYS A O     1 
ATOM   2096 C CB    . LYS E 3 186 ? -1.352  8.069   31.961  1.00 16.39 ? 186  LYS A CB    1 
ATOM   2097 C CG    . LYS E 3 186 ? -2.413  7.438   32.865  1.00 19.15 ? 186  LYS A CG    1 
ATOM   2098 C CD    . LYS E 3 186 ? -1.893  7.257   34.309  1.00 20.56 ? 186  LYS A CD    1 
ATOM   2099 C CE    . LYS E 3 186 ? -1.969  8.565   35.082  1.00 26.48 ? 186  LYS A CE    1 
ATOM   2100 N NZ    . LYS E 3 186 ? -3.380  8.949   35.367  1.00 28.67 ? 186  LYS A NZ    1 
ATOM   2101 N N     . THR E 3 187 ? -1.170  6.377   29.231  1.00 14.68 ? 187  THR A N     1 
ATOM   2102 C CA    . THR E 3 187 ? -1.387  5.238   28.345  1.00 13.57 ? 187  THR A CA    1 
ATOM   2103 C C     . THR E 3 187 ? -0.472  4.062   28.726  1.00 13.52 ? 187  THR A C     1 
ATOM   2104 O O     . THR E 3 187 ? 0.731   4.248   28.931  1.00 13.92 ? 187  THR A O     1 
ATOM   2105 C CB    . THR E 3 187 ? -1.110  5.676   26.881  1.00 13.54 ? 187  THR A CB    1 
ATOM   2106 O OG1   . THR E 3 187 ? -2.020  6.731   26.546  1.00 14.34 ? 187  THR A OG1   1 
ATOM   2107 C CG2   . THR E 3 187 ? -1.241  4.478   25.875  1.00 13.41 ? 187  THR A CG2   1 
ATOM   2108 N N     . SER E 3 188 ? -1.053  2.867   28.859  1.00 12.40 ? 188  SER A N     1 
ATOM   2109 C CA    . SER E 3 188 ? -0.286  1.616   28.992  1.00 12.41 ? 188  SER A CA    1 
ATOM   2110 C C     . SER E 3 188 ? -0.619  0.726   27.802  1.00 11.70 ? 188  SER A C     1 
ATOM   2111 O O     . SER E 3 188 ? -1.789  0.544   27.486  1.00 10.76 ? 188  SER A O     1 
ATOM   2112 C CB    . SER E 3 188 ? -0.664  0.881   30.290  1.00 12.51 ? 188  SER A CB    1 
ATOM   2113 O OG    . SER E 3 188 ? 0.113   1.351   31.380  1.00 17.45 ? 188  SER A OG    1 
ATOM   2114 N N     . VAL E 3 189 ? 0.410   0.204   27.141  1.00 10.97 ? 189  VAL A N     1 
ATOM   2115 C CA    . VAL E 3 189 ? 0.256   -0.659  25.974  1.00 10.92 ? 189  VAL A CA    1 
ATOM   2116 C C     . VAL E 3 189 ? 0.825   -2.019  26.349  1.00 11.06 ? 189  VAL A C     1 
ATOM   2117 O O     . VAL E 3 189 ? 1.954   -2.104  26.840  1.00 10.98 ? 189  VAL A O     1 
ATOM   2118 C CB    . VAL E 3 189 ? 0.961   -0.066  24.727  1.00 10.62 ? 189  VAL A CB    1 
ATOM   2119 C CG1   . VAL E 3 189 ? 0.875   -1.054  23.514  1.00 11.58 ? 189  VAL A CG1   1 
ATOM   2120 C CG2   . VAL E 3 189 ? 0.301   1.256   24.369  1.00 10.34 ? 189  VAL A CG2   1 
ATOM   2121 N N     . TYR E 3 190 ? 0.013   -3.056  26.143  1.00 10.32 ? 190  TYR A N     1 
ATOM   2122 C CA    . TYR E 3 190 ? 0.389   -4.441  26.468  1.00 11.15 ? 190  TYR A CA    1 
ATOM   2123 C C     . TYR E 3 190 ? 0.399   -5.229  25.188  1.00 11.18 ? 190  TYR A C     1 
ATOM   2124 O O     . TYR E 3 190 ? -0.642  -5.373  24.533  1.00 10.88 ? 190  TYR A O     1 
ATOM   2125 C CB    . TYR E 3 190 ? -0.608  -5.076  27.462  1.00 12.24 ? 190  TYR A CB    1 
ATOM   2126 C CG    . TYR E 3 190 ? -0.812  -4.268  28.721  1.00 12.11 ? 190  TYR A CG    1 
ATOM   2127 C CD1   . TYR E 3 190 ? -1.682  -3.179  28.734  1.00 13.76 ? 190  TYR A CD1   1 
ATOM   2128 C CD2   . TYR E 3 190 ? -0.148  -4.604  29.903  1.00 13.67 ? 190  TYR A CD2   1 
ATOM   2129 C CE1   . TYR E 3 190 ? -1.870  -2.413  29.891  1.00 15.57 ? 190  TYR A CE1   1 
ATOM   2130 C CE2   . TYR E 3 190 ? -0.342  -3.866  31.066  1.00 13.82 ? 190  TYR A CE2   1 
ATOM   2131 C CZ    . TYR E 3 190 ? -1.196  -2.771  31.048  1.00 14.87 ? 190  TYR A CZ    1 
ATOM   2132 O OH    . TYR E 3 190 ? -1.409  -2.015  32.182  1.00 17.12 ? 190  TYR A OH    1 
ATOM   2133 N N     . TYR E 3 191 ? 1.578   -5.705  24.798  1.00 11.01 ? 191  TYR A N     1 
ATOM   2134 C CA    . TYR E 3 191 ? 1.675   -6.478  23.567  1.00 11.21 ? 191  TYR A CA    1 
ATOM   2135 C C     . TYR E 3 191 ? 1.151   -7.886  23.775  1.00 11.63 ? 191  TYR A C     1 
ATOM   2136 O O     . TYR E 3 191 ? 1.616   -8.589  24.679  1.00 11.95 ? 191  TYR A O     1 
ATOM   2137 C CB    . TYR E 3 191 ? 3.122   -6.526  23.085  1.00 11.55 ? 191  TYR A CB    1 
ATOM   2138 C CG    . TYR E 3 191 ? 3.343   -7.419  21.893  1.00 12.17 ? 191  TYR A CG    1 
ATOM   2139 C CD1   . TYR E 3 191 ? 3.160   -6.945  20.597  1.00 11.15 ? 191  TYR A CD1   1 
ATOM   2140 C CD2   . TYR E 3 191 ? 3.734   -8.750  22.071  1.00 11.87 ? 191  TYR A CD2   1 
ATOM   2141 C CE1   . TYR E 3 191 ? 3.371   -7.792  19.486  1.00 12.94 ? 191  TYR A CE1   1 
ATOM   2142 C CE2   . TYR E 3 191 ? 3.944   -9.592  20.996  1.00 12.90 ? 191  TYR A CE2   1 
ATOM   2143 C CZ    . TYR E 3 191 ? 3.763   -9.104  19.695  1.00 13.43 ? 191  TYR A CZ    1 
ATOM   2144 O OH    . TYR E 3 191 ? 3.984   -9.977  18.658  1.00 12.56 ? 191  TYR A OH    1 
ATOM   2145 N N     . LEU E 3 192 ? 0.197   -8.279  22.929  1.00 11.63 ? 192  LEU A N     1 
ATOM   2146 C CA    . LEU E 3 192 ? -0.310  -9.663  22.882  1.00 12.79 ? 192  LEU A CA    1 
ATOM   2147 C C     . LEU E 3 192 ? 0.178   -10.467 21.688  1.00 12.96 ? 192  LEU A C     1 
ATOM   2148 O O     . LEU E 3 192 ? 0.508   -11.651 21.833  1.00 13.67 ? 192  LEU A O     1 
ATOM   2149 C CB    . LEU E 3 192 ? -1.838  -9.684  22.894  1.00 13.12 ? 192  LEU A CB    1 
ATOM   2150 C CG    . LEU E 3 192 ? -2.539  -9.053  24.095  1.00 13.91 ? 192  LEU A CG    1 
ATOM   2151 C CD1   . LEU E 3 192 ? -4.033  -9.287  23.937  1.00 13.21 ? 192  LEU A CD1   1 
ATOM   2152 C CD2   . LEU E 3 192 ? -2.019  -9.616  25.422  1.00 15.00 ? 192  LEU A CD2   1 
ATOM   2153 N N     . GLY E 3 193 ? 0.203   -9.832  20.517  1.00 13.33 ? 193  GLY A N     1 
ATOM   2154 C CA    . GLY E 3 193 ? 0.591   -10.480 19.268  1.00 13.53 ? 193  GLY A CA    1 
ATOM   2155 C C     . GLY E 3 193 ? -0.620  -11.158 18.637  1.00 14.48 ? 193  GLY A C     1 
ATOM   2156 O O     . GLY E 3 193 ? -1.770  -10.729 18.845  1.00 13.91 ? 193  GLY A O     1 
ATOM   2157 N N     . GLU E 3 194 ? -0.366  -12.230 17.885  1.00 15.17 ? 194  GLU A N     1 
ATOM   2158 C CA    . GLU E 3 194 ? -1.411  -12.882 17.099  1.00 16.35 ? 194  GLU A CA    1 
ATOM   2159 C C     . GLU E 3 194 ? -2.225  -13.837 17.964  1.00 16.70 ? 194  GLU A C     1 
ATOM   2160 O O     . GLU E 3 194 ? -2.023  -15.057 17.910  1.00 17.17 ? 194  GLU A O     1 
ATOM   2161 C CB    . GLU E 3 194 ? -0.805  -13.563 15.866  1.00 17.49 ? 194  GLU A CB    1 
ATOM   2162 C CG    . GLU E 3 194 ? -0.190  -12.516 14.941  1.00 21.04 ? 194  GLU A CG    1 
ATOM   2163 C CD    . GLU E 3 194 ? 0.000   -12.973 13.496  1.00 28.20 ? 194  GLU A CD    1 
ATOM   2164 O OE1   . GLU E 3 194 ? -0.042  -14.193 13.203  1.00 29.69 ? 194  GLU A OE1   1 
ATOM   2165 O OE2   . GLU E 3 194 ? 0.209   -12.080 12.648  1.00 32.68 ? 194  GLU A OE2   1 
ATOM   2166 N N     . VAL E 3 195 ? -3.136  -13.259 18.747  1.00 16.18 ? 195  VAL A N     1 
ATOM   2167 C CA    . VAL E 3 195 ? -3.928  -13.982 19.758  1.00 17.34 ? 195  VAL A CA    1 
ATOM   2168 C C     . VAL E 3 195 ? -5.352  -14.323 19.312  1.00 16.86 ? 195  VAL A C     1 
ATOM   2169 O O     . VAL E 3 195 ? -6.101  -14.991 20.045  1.00 17.26 ? 195  VAL A O     1 
ATOM   2170 C CB    . VAL E 3 195 ? -3.992  -13.224 21.125  1.00 17.37 ? 195  VAL A CB    1 
ATOM   2171 C CG1   . VAL E 3 195 ? -2.625  -13.242 21.802  1.00 19.21 ? 195  VAL A CG1   1 
ATOM   2172 C CG2   . VAL E 3 195 ? -4.521  -11.786 20.951  1.00 18.20 ? 195  VAL A CG2   1 
ATOM   2173 N N     . PHE E 3 196 ? -5.731  -13.877 18.116  1.00 16.66 ? 196  PHE A N     1 
ATOM   2174 C CA    . PHE E 3 196 ? -7.043  -14.238 17.564  1.00 17.56 ? 196  PHE A CA    1 
ATOM   2175 C C     . PHE E 3 196 ? -6.887  -15.378 16.564  1.00 18.51 ? 196  PHE A C     1 
ATOM   2176 O O     . PHE E 3 196 ? -6.371  -15.165 15.467  1.00 18.25 ? 196  PHE A O     1 
ATOM   2177 C CB    . PHE E 3 196 ? -7.688  -13.038 16.869  1.00 17.04 ? 196  PHE A CB    1 
ATOM   2178 C CG    . PHE E 3 196 ? -8.011  -11.914 17.795  1.00 15.17 ? 196  PHE A CG    1 
ATOM   2179 C CD1   . PHE E 3 196 ? -9.113  -11.982 18.642  1.00 14.88 ? 196  PHE A CD1   1 
ATOM   2180 C CD2   . PHE E 3 196 ? -7.199  -10.787 17.832  1.00 16.73 ? 196  PHE A CD2   1 
ATOM   2181 C CE1   . PHE E 3 196 ? -9.419  -10.942 19.500  1.00 15.49 ? 196  PHE A CE1   1 
ATOM   2182 C CE2   . PHE E 3 196 ? -7.484  -9.742  18.699  1.00 15.99 ? 196  PHE A CE2   1 
ATOM   2183 C CZ    . PHE E 3 196 ? -8.590  -9.822  19.553  1.00 15.51 ? 196  PHE A CZ    1 
ATOM   2184 N N     . PRO E 3 197 ? -7.308  -16.597 16.945  1.00 20.24 ? 197  PRO A N     1 
ATOM   2185 C CA    . PRO E 3 197 ? -7.135  -17.762 16.071  1.00 21.51 ? 197  PRO A CA    1 
ATOM   2186 C C     . PRO E 3 197 ? -7.570  -17.589 14.615  1.00 22.16 ? 197  PRO A C     1 
ATOM   2187 O O     . PRO E 3 197 ? -6.866  -18.064 13.729  1.00 23.36 ? 197  PRO A O     1 
ATOM   2188 C CB    . PRO E 3 197 ? -7.987  -18.834 16.760  1.00 21.37 ? 197  PRO A CB    1 
ATOM   2189 C CG    . PRO E 3 197 ? -7.856  -18.479 18.227  1.00 21.55 ? 197  PRO A CG    1 
ATOM   2190 C CD    . PRO E 3 197 ? -7.942  -16.971 18.225  1.00 20.48 ? 197  PRO A CD    1 
ATOM   2191 N N     . GLN E 3 198 ? -8.691  -16.922 14.364  1.00 22.09 ? 198  GLN A N     1 
ATOM   2192 C CA    . GLN E 3 198 ? -9.206  -16.883 12.993  1.00 23.21 ? 198  GLN A CA    1 
ATOM   2193 C C     . GLN E 3 198 ? -8.746  -15.638 12.228  1.00 21.61 ? 198  GLN A C     1 
ATOM   2194 O O     . GLN E 3 198 ? -9.046  -15.494 11.043  1.00 21.86 ? 198  GLN A O     1 
ATOM   2195 C CB    . GLN E 3 198 ? -10.743 -16.968 12.978  1.00 24.15 ? 198  GLN A CB    1 
ATOM   2196 C CG    . GLN E 3 198 ? -11.381 -17.835 14.081  1.00 28.02 ? 198  GLN A CG    1 
ATOM   2197 C CD    . GLN E 3 198 ? -11.446 -19.310 13.727  1.00 33.18 ? 198  GLN A CD    1 
ATOM   2198 O OE1   . GLN E 3 198 ? -12.531 -19.839 13.464  1.00 36.78 ? 198  GLN A OE1   1 
ATOM   2199 N NE2   . GLN E 3 198 ? -10.291 -19.987 13.714  1.00 33.64 ? 198  GLN A NE2   1 
ATOM   2200 N N     . LYS E 3 199 ? -8.002  -14.750 12.890  1.00 20.33 ? 199  LYS A N     1 
ATOM   2201 C CA    . LYS E 3 199 ? -7.729  -13.421 12.321  1.00 18.55 ? 199  LYS A CA    1 
ATOM   2202 C C     . LYS E 3 199 ? -6.244  -13.094 12.192  1.00 17.83 ? 199  LYS A C     1 
ATOM   2203 O O     . LYS E 3 199 ? -5.465  -13.297 13.126  1.00 17.05 ? 199  LYS A O     1 
ATOM   2204 C CB    . LYS E 3 199 ? -8.435  -12.327 13.134  1.00 18.43 ? 199  LYS A CB    1 
ATOM   2205 C CG    . LYS E 3 199 ? -9.905  -12.584 13.460  1.00 18.11 ? 199  LYS A CG    1 
ATOM   2206 C CD    . LYS E 3 199 ? -10.785 -12.670 12.206  1.00 18.91 ? 199  LYS A CD    1 
ATOM   2207 C CE    . LYS E 3 199 ? -12.272 -12.888 12.564  1.00 22.87 ? 199  LYS A CE    1 
ATOM   2208 N NZ    . LYS E 3 199 ? -13.116 -12.942 11.332  1.00 21.71 ? 199  LYS A NZ    1 
ATOM   2209 N N     . LYS E 3 200 ? -5.871  -12.556 11.032  1.00 17.29 ? 200  LYS A N     1 
ATOM   2210 C CA    . LYS E 3 200 ? -4.497  -12.181 10.754  1.00 17.56 ? 200  LYS A CA    1 
ATOM   2211 C C     . LYS E 3 200 ? -4.265  -10.764 11.258  1.00 16.57 ? 200  LYS A C     1 
ATOM   2212 O O     . LYS E 3 200 ? -4.470  -9.793  10.529  1.00 17.03 ? 200  LYS A O     1 
ATOM   2213 C CB    . LYS E 3 200 ? -4.226  -12.250 9.250   1.00 17.83 ? 200  LYS A CB    1 
ATOM   2214 C CG    . LYS E 3 200 ? -2.892  -12.805 8.890   1.00 20.76 ? 200  LYS A CG    1 
ATOM   2215 C CD    . LYS E 3 200 ? -2.917  -13.200 7.433   1.00 22.80 ? 200  LYS A CD    1 
ATOM   2216 C CE    . LYS E 3 200 ? -2.513  -14.635 7.250   1.00 25.38 ? 200  LYS A CE    1 
ATOM   2217 N NZ    . LYS E 3 200 ? -2.711  -15.029 5.834   1.00 26.32 ? 200  LYS A NZ    1 
ATOM   2218 N N     . VAL E 3 201 ? -3.904  -10.656 12.530  1.00 15.81 ? 201  VAL A N     1 
ATOM   2219 C CA    . VAL E 3 201 ? -3.645  -9.363  13.148  1.00 14.78 ? 201  VAL A CA    1 
ATOM   2220 C C     . VAL E 3 201 ? -2.792  -9.573  14.400  1.00 13.67 ? 201  VAL A C     1 
ATOM   2221 O O     . VAL E 3 201 ? -2.980  -10.552 15.134  1.00 12.81 ? 201  VAL A O     1 
ATOM   2222 C CB    . VAL E 3 201 ? -4.970  -8.613  13.478  1.00 15.82 ? 201  VAL A CB    1 
ATOM   2223 C CG1   . VAL E 3 201 ? -5.718  -9.277  14.636  1.00 15.49 ? 201  VAL A CG1   1 
ATOM   2224 C CG2   . VAL E 3 201 ? -4.691  -7.129  13.775  1.00 15.30 ? 201  VAL A CG2   1 
ATOM   2225 N N     . SER E 3 202 ? -1.837  -8.668  14.600  1.00 12.01 ? 202  SER A N     1 
ATOM   2226 C CA    . SER E 3 202 ? -1.027  -8.651  15.817  1.00 11.83 ? 202  SER A CA    1 
ATOM   2227 C C     . SER E 3 202 ? -1.666  -7.599  16.727  1.00 11.25 ? 202  SER A C     1 
ATOM   2228 O O     . SER E 3 202 ? -1.857  -6.456  16.304  1.00 11.99 ? 202  SER A O     1 
ATOM   2229 C CB    . SER E 3 202 ? 0.426   -8.297  15.487  1.00 12.32 ? 202  SER A CB    1 
ATOM   2230 O OG    . SER E 3 202 ? 1.199   -8.238  16.669  1.00 13.36 ? 202  SER A OG    1 
ATOM   2231 N N     . ALA E 3 203 ? -2.026  -8.006  17.944  1.00 10.55 ? 203  ALA A N     1 
ATOM   2232 C CA    . ALA E 3 203 ? -2.874  -7.214  18.839  1.00 10.25 ? 203  ALA A CA    1 
ATOM   2233 C C     . ALA E 3 203 ? -2.137  -6.625  20.043  1.00 9.53  ? 203  ALA A C     1 
ATOM   2234 O O     . ALA E 3 203 ? -1.157  -7.202  20.548  1.00 10.42 ? 203  ALA A O     1 
ATOM   2235 C CB    . ALA E 3 203 ? -4.030  -8.073  19.342  1.00 10.18 ? 203  ALA A CB    1 
ATOM   2236 N N     . VAL E 3 204 ? -2.646  -5.495  20.516  1.00 8.90  ? 204  VAL A N     1 
ATOM   2237 C CA    . VAL E 3 204 ? -2.230  -4.958  21.800  1.00 9.04  ? 204  VAL A CA    1 
ATOM   2238 C C     . VAL E 3 204 ? -3.479  -4.660  22.601  1.00 9.12  ? 204  VAL A C     1 
ATOM   2239 O O     . VAL E 3 204 ? -4.554  -4.447  22.016  1.00 8.93  ? 204  VAL A O     1 
ATOM   2240 C CB    . VAL E 3 204 ? -1.386  -3.666  21.665  1.00 8.51  ? 204  VAL A CB    1 
ATOM   2241 C CG1   . VAL E 3 204 ? -0.103  -3.949  20.887  1.00 9.23  ? 204  VAL A CG1   1 
ATOM   2242 C CG2   . VAL E 3 204 ? -2.229  -2.489  21.045  1.00 8.31  ? 204  VAL A CG2   1 
ATOM   2243 N N     . VAL E 3 205 ? -3.324  -4.635  23.925  1.00 8.58  ? 205  VAL A N     1 
ATOM   2244 C CA    . VAL E 3 205 ? -4.319  -4.013  24.798  1.00 9.17  ? 205  VAL A CA    1 
ATOM   2245 C C     . VAL E 3 205 ? -3.805  -2.621  25.134  1.00 10.17 ? 205  VAL A C     1 
ATOM   2246 O O     . VAL E 3 205 ? -2.615  -2.444  25.454  1.00 11.03 ? 205  VAL A O     1 
ATOM   2247 C CB    . VAL E 3 205 ? -4.531  -4.829  26.100  1.00 9.51  ? 205  VAL A CB    1 
ATOM   2248 C CG1   . VAL E 3 205 ? -5.462  -4.075  27.094  1.00 8.18  ? 205  VAL A CG1   1 
ATOM   2249 C CG2   . VAL E 3 205 ? -5.097  -6.229  25.758  1.00 9.40  ? 205  VAL A CG2   1 
ATOM   2250 N N     . ILE E 3 206 ? -4.691  -1.640  25.023  1.00 10.03 ? 206  ILE A N     1 
ATOM   2251 C CA    . ILE E 3 206 ? -4.421  -0.304  25.511  1.00 11.34 ? 206  ILE A CA    1 
ATOM   2252 C C     . ILE E 3 206 ? -5.268  -0.075  26.760  1.00 12.47 ? 206  ILE A C     1 
ATOM   2253 O O     . ILE E 3 206 ? -6.479  -0.274  26.736  1.00 11.73 ? 206  ILE A O     1 
ATOM   2254 C CB    . ILE E 3 206 ? -4.669  0.792   24.435  1.00 11.24 ? 206  ILE A CB    1 
ATOM   2255 C CG1   . ILE E 3 206 ? -4.443  2.188   25.051  1.00 12.59 ? 206  ILE A CG1   1 
ATOM   2256 C CG2   . ILE E 3 206 ? -6.054  0.609   23.745  1.00 14.23 ? 206  ILE A CG2   1 
ATOM   2257 C CD1   . ILE E 3 206 ? -4.543  3.357   24.045  1.00 11.94 ? 206  ILE A CD1   1 
ATOM   2258 N N     . ARG E 3 207 ? -4.607  0.292   27.856  1.00 11.92 ? 207  ARG A N     1 
ATOM   2259 C CA    . ARG E 3 207 ? -5.299  0.829   29.013  1.00 13.37 ? 207  ARG A CA    1 
ATOM   2260 C C     . ARG E 3 207 ? -4.978  2.317   29.072  1.00 13.55 ? 207  ARG A C     1 
ATOM   2261 O O     . ARG E 3 207 ? -3.824  2.701   29.244  1.00 14.40 ? 207  ARG A O     1 
ATOM   2262 C CB    . ARG E 3 207 ? -4.846  0.140   30.298  1.00 14.01 ? 207  ARG A CB    1 
ATOM   2263 C CG    . ARG E 3 207 ? -5.554  0.670   31.531  1.00 16.19 ? 207  ARG A CG    1 
ATOM   2264 C CD    . ARG E 3 207 ? -4.821  0.303   32.784  1.00 19.44 ? 207  ARG A CD    1 
ATOM   2265 N NE    . ARG E 3 207 ? -5.690  0.497   33.940  1.00 24.33 ? 207  ARG A NE    1 
ATOM   2266 C CZ    . ARG E 3 207 ? -5.862  1.651   34.583  1.00 26.29 ? 207  ARG A CZ    1 
ATOM   2267 N NH1   . ARG E 3 207 ? -5.225  2.759   34.199  1.00 25.46 ? 207  ARG A NH1   1 
ATOM   2268 N NH2   . ARG E 3 207 ? -6.685  1.690   35.630  1.00 28.05 ? 207  ARG A NH2   1 
ATOM   2269 N N     . PHE E 3 208 ? -6.005  3.137   28.900  1.00 13.66 ? 208  PHE A N     1 
ATOM   2270 C CA    . PHE E 3 208 ? -5.842  4.581   28.924  1.00 13.72 ? 208  PHE A CA    1 
ATOM   2271 C C     . PHE E 3 208 ? -6.633  5.177   30.081  1.00 14.81 ? 208  PHE A C     1 
ATOM   2272 O O     . PHE E 3 208 ? -7.775  4.789   30.312  1.00 14.13 ? 208  PHE A O     1 
ATOM   2273 C CB    . PHE E 3 208 ? -6.349  5.178   27.614  1.00 13.68 ? 208  PHE A CB    1 
ATOM   2274 C CG    . PHE E 3 208 ? -6.423  6.678   27.615  1.00 13.63 ? 208  PHE A CG    1 
ATOM   2275 C CD1   . PHE E 3 208 ? -5.310  7.442   27.246  1.00 12.81 ? 208  PHE A CD1   1 
ATOM   2276 C CD2   . PHE E 3 208 ? -7.606  7.339   27.966  1.00 14.15 ? 208  PHE A CD2   1 
ATOM   2277 C CE1   . PHE E 3 208 ? -5.381  8.860   27.248  1.00 13.49 ? 208  PHE A CE1   1 
ATOM   2278 C CE2   . PHE E 3 208 ? -7.681  8.748   27.959  1.00 16.42 ? 208  PHE A CE2   1 
ATOM   2279 C CZ    . PHE E 3 208 ? -6.560  9.502   27.609  1.00 13.51 ? 208  PHE A CZ    1 
ATOM   2280 N N     . GLN E 3 209 ? -6.027  6.128   30.780  1.00 15.42 ? 209  GLN A N     1 
ATOM   2281 C CA    . GLN E 3 209 ? -6.725  6.855   31.855  1.00 16.58 ? 209  GLN A CA    1 
ATOM   2282 C C     . GLN E 3 209 ? -6.719  8.361   31.583  1.00 16.39 ? 209  GLN A C     1 
ATOM   2283 O O     . GLN E 3 209 ? -5.664  8.950   31.289  1.00 15.32 ? 209  GLN A O     1 
ATOM   2284 C CB    . GLN E 3 209 ? -6.113  6.541   33.225  1.00 16.44 ? 209  GLN A CB    1 
ATOM   2285 C CG    . GLN E 3 209 ? -6.877  7.211   34.383  1.00 18.73 ? 209  GLN A CG    1 
ATOM   2286 C CD    . GLN E 3 209 ? -6.383  6.832   35.761  1.00 19.95 ? 209  GLN A CD    1 
ATOM   2287 O OE1   . GLN E 3 209 ? -5.205  6.501   35.954  1.00 26.13 ? 209  GLN A OE1   1 
ATOM   2288 N NE2   . GLN E 3 209 ? -7.282  6.907   36.745  1.00 24.10 ? 209  GLN A NE2   1 
ATOM   2289 N N     . LYS E 3 210 ? -7.895  8.971   31.681  1.00 16.56 ? 210  LYS A N     1 
ATOM   2290 C CA    . LYS E 3 210 ? -8.069  10.378  31.300  1.00 17.72 ? 210  LYS A CA    1 
ATOM   2291 C C     . LYS E 3 210 ? -7.612  11.319  32.415  1.00 18.78 ? 210  LYS A C     1 
ATOM   2292 O O     . LYS E 3 210 ? -8.391  12.132  32.935  1.00 19.57 ? 210  LYS A O     1 
ATOM   2293 C CB    . LYS E 3 210 ? -9.516  10.656  30.902  1.00 17.52 ? 210  LYS A CB    1 
ATOM   2294 C CG    . LYS E 3 210 ? -9.652  11.814  29.947  1.00 19.21 ? 210  LYS A CG    1 
ATOM   2295 C CD    . LYS E 3 210 ? -11.007 11.792  29.304  1.00 19.33 ? 210  LYS A CD    1 
ATOM   2296 C CE    . LYS E 3 210 ? -11.287 13.006  28.456  1.00 19.82 ? 210  LYS A CE    1 
ATOM   2297 N NZ    . LYS E 3 210 ? -12.662 12.942  27.862  1.00 16.72 ? 210  LYS A NZ    1 
ATOM   2298 N N     . SER E 3 211 ? -6.332  11.189  32.750  1.00 19.57 ? 211  SER A N     1 
ATOM   2299 C CA    . SER E 3 211 ? -5.657  11.959  33.783  1.00 20.52 ? 211  SER A CA    1 
ATOM   2300 C C     . SER E 3 211 ? -4.175  11.604  33.677  1.00 20.66 ? 211  SER A C     1 
ATOM   2301 O O     . SER E 3 211 ? -3.820  10.567  33.110  1.00 20.88 ? 211  SER A O     1 
ATOM   2302 C CB    . SER E 3 211 ? -6.190  11.585  35.180  1.00 20.53 ? 211  SER A CB    1 
ATOM   2303 O OG    . SER E 3 211 ? -5.870  10.248  35.537  1.00 22.24 ? 211  SER A OG    1 
ATOM   2304 N N     . GLY E 3 212 ? -3.311  12.450  34.236  1.00 20.39 ? 212  GLY A N     1 
ATOM   2305 C CA    . GLY E 3 212 ? -1.876  12.190  34.205  1.00 19.43 ? 212  GLY A CA    1 
ATOM   2306 C C     . GLY E 3 212 ? -1.304  12.243  32.795  1.00 19.15 ? 212  GLY A C     1 
ATOM   2307 O O     . GLY E 3 212 ? -1.914  12.813  31.882  1.00 18.94 ? 212  GLY A O     1 
ATOM   2308 N N     . LYS E 3 213 ? -0.139  11.628  32.618  1.00 18.85 ? 213  LYS A N     1 
ATOM   2309 C CA    . LYS E 3 213 ? 0.567   11.675  31.331  1.00 18.84 ? 213  LYS A CA    1 
ATOM   2310 C C     . LYS E 3 213 ? 1.559   10.519  31.240  1.00 17.47 ? 213  LYS A C     1 
ATOM   2311 O O     . LYS E 3 213 ? 1.839   9.844   32.236  1.00 17.36 ? 213  LYS A O     1 
ATOM   2312 C CB    . LYS E 3 213 ? 1.304   13.017  31.147  1.00 19.54 ? 213  LYS A CB    1 
ATOM   2313 C CG    . LYS E 3 213 ? 2.602   13.115  31.952  1.00 20.80 ? 213  LYS A CG    1 
ATOM   2314 C CD    . LYS E 3 213 ? 3.378   14.425  31.730  1.00 21.98 ? 213  LYS A CD    1 
ATOM   2315 C CE    . LYS E 3 213 ? 4.663   14.394  32.560  1.00 27.68 ? 213  LYS A CE    1 
ATOM   2316 N NZ    . LYS E 3 213 ? 5.608   15.520  32.262  1.00 30.94 ? 213  LYS A NZ    1 
ATOM   2317 N N     . GLY E 3 214 ? 2.119   10.315  30.053  1.00 16.13 ? 214  GLY A N     1 
ATOM   2318 C CA    . GLY E 3 214 ? 3.150   9.299   29.898  1.00 15.02 ? 214  GLY A CA    1 
ATOM   2319 C C     . GLY E 3 214 ? 2.676   8.010   29.246  1.00 15.01 ? 214  GLY A C     1 
ATOM   2320 O O     . GLY E 3 214 ? 1.471   7.754   29.134  1.00 14.86 ? 214  GLY A O     1 
ATOM   2321 N N     . LEU E 3 215 ? 3.652   7.198   28.866  1.00 14.16 ? 215  LEU A N     1 
ATOM   2322 C CA    . LEU E 3 215 ? 3.428   5.903   28.247  1.00 13.82 ? 215  LEU A CA    1 
ATOM   2323 C C     . LEU E 3 215 ? 4.196   4.860   29.026  1.00 14.16 ? 215  LEU A C     1 
ATOM   2324 O O     . LEU E 3 215 ? 5.359   5.085   29.426  1.00 13.74 ? 215  LEU A O     1 
ATOM   2325 C CB    . LEU E 3 215 ? 3.914   5.933   26.803  1.00 13.84 ? 215  LEU A CB    1 
ATOM   2326 C CG    . LEU E 3 215 ? 3.976   4.610   26.029  1.00 13.04 ? 215  LEU A CG    1 
ATOM   2327 C CD1   . LEU E 3 215 ? 2.566   4.095   25.763  1.00 14.02 ? 215  LEU A CD1   1 
ATOM   2328 C CD2   . LEU E 3 215 ? 4.787   4.833   24.750  1.00 13.89 ? 215  LEU A CD2   1 
ATOM   2329 N N     . SER E 3 216 ? 3.547   3.719   29.264  1.00 13.26 ? 216  SER A N     1 
ATOM   2330 C CA    . SER E 3 216 ? 4.232   2.531   29.760  1.00 13.06 ? 216  SER A CA    1 
ATOM   2331 C C     . SER E 3 216 ? 4.041   1.415   28.745  1.00 12.48 ? 216  SER A C     1 
ATOM   2332 O O     . SER E 3 216 ? 2.917   1.174   28.288  1.00 12.84 ? 216  SER A O     1 
ATOM   2333 C CB    . SER E 3 216 ? 3.688   2.114   31.130  1.00 13.61 ? 216  SER A CB    1 
ATOM   2334 O OG    . SER E 3 216 ? 3.845   3.178   32.062  1.00 18.36 ? 216  SER A OG    1 
ATOM   2335 N N     . LEU E 3 217 ? 5.140   0.773   28.359  1.00 11.89 ? 217  LEU A N     1 
ATOM   2336 C CA    . LEU E 3 217 ? 5.080   -0.337  27.397  1.00 12.02 ? 217  LEU A CA    1 
ATOM   2337 C C     . LEU E 3 217 ? 5.337   -1.652  28.112  1.00 11.64 ? 217  LEU A C     1 
ATOM   2338 O O     . LEU E 3 217 ? 6.313   -1.785  28.864  1.00 11.23 ? 217  LEU A O     1 
ATOM   2339 C CB    . LEU E 3 217 ? 6.094   -0.130  26.268  1.00 11.90 ? 217  LEU A CB    1 
ATOM   2340 C CG    . LEU E 3 217 ? 6.116   -1.155  25.129  1.00 12.12 ? 217  LEU A CG    1 
ATOM   2341 C CD1   . LEU E 3 217 ? 4.790   -1.151  24.363  1.00 13.50 ? 217  LEU A CD1   1 
ATOM   2342 C CD2   . LEU E 3 217 ? 7.272   -0.836  24.193  1.00 12.10 ? 217  LEU A CD2   1 
ATOM   2343 N N     . TRP E 3 218 ? 4.458   -2.627  27.872  1.00 11.58 ? 218  TRP A N     1 
ATOM   2344 C CA    . TRP E 3 218 ? 4.519   -3.921  28.539  1.00 11.66 ? 218  TRP A CA    1 
ATOM   2345 C C     . TRP E 3 218 ? 4.515   -5.073  27.551  1.00 11.31 ? 218  TRP A C     1 
ATOM   2346 O O     . TRP E 3 218 ? 3.762   -5.047  26.582  1.00 10.94 ? 218  TRP A O     1 
ATOM   2347 C CB    . TRP E 3 218 ? 3.294   -4.134  29.431  1.00 12.08 ? 218  TRP A CB    1 
ATOM   2348 C CG    . TRP E 3 218 ? 2.993   -3.044  30.435  1.00 13.41 ? 218  TRP A CG    1 
ATOM   2349 C CD1   . TRP E 3 218 ? 2.460   -1.817  30.178  1.00 14.07 ? 218  TRP A CD1   1 
ATOM   2350 C CD2   . TRP E 3 218 ? 3.144   -3.131  31.864  1.00 14.56 ? 218  TRP A CD2   1 
ATOM   2351 N NE1   . TRP E 3 218 ? 2.287   -1.114  31.362  1.00 15.64 ? 218  TRP A NE1   1 
ATOM   2352 C CE2   . TRP E 3 218 ? 2.712   -1.896  32.406  1.00 16.12 ? 218  TRP A CE2   1 
ATOM   2353 C CE3   . TRP E 3 218 ? 3.614   -4.126  32.732  1.00 15.54 ? 218  TRP A CE3   1 
ATOM   2354 C CZ2   . TRP E 3 218 ? 2.725   -1.631  33.792  1.00 15.26 ? 218  TRP A CZ2   1 
ATOM   2355 C CZ3   . TRP E 3 218 ? 3.639   -3.861  34.117  1.00 15.43 ? 218  TRP A CZ3   1 
ATOM   2356 C CH2   . TRP E 3 218 ? 3.195   -2.620  34.624  1.00 14.89 ? 218  TRP A CH2   1 
ATOM   2357 N N     . ASP E 3 219 ? 5.314   -6.098  27.834  1.00 11.72 ? 219  ASP A N     1 
ATOM   2358 C CA    . ASP E 3 219 ? 5.196   -7.360  27.138  1.00 12.69 ? 219  ASP A CA    1 
ATOM   2359 C C     . ASP E 3 219 ? 4.185   -8.185  27.947  1.00 12.87 ? 219  ASP A C     1 
ATOM   2360 O O     . ASP E 3 219 ? 3.721   -7.745  29.015  1.00 12.51 ? 219  ASP A O     1 
ATOM   2361 C CB    . ASP E 3 219 ? 6.554   -8.062  27.097  1.00 13.27 ? 219  ASP A CB    1 
ATOM   2362 C CG    . ASP E 3 219 ? 6.684   -9.034  25.939  1.00 14.05 ? 219  ASP A CG    1 
ATOM   2363 O OD1   . ASP E 3 219 ? 5.668   -9.354  25.255  1.00 12.52 ? 219  ASP A OD1   1 
ATOM   2364 O OD2   . ASP E 3 219 ? 7.834   -9.481  25.709  1.00 15.45 ? 219  ASP A OD2   1 
ATOM   2365 N N     . THR E 3 220 ? 3.817   -9.346  27.421  1.00 13.39 ? 220  THR A N     1 
ATOM   2366 C CA    . THR E 3 220 ? 2.986   -10.276 28.209  1.00 13.48 ? 220  THR A CA    1 
ATOM   2367 C C     . THR E 3 220 ? 3.539   -11.668 28.055  1.00 14.95 ? 220  THR A C     1 
ATOM   2368 O O     . THR E 3 220 ? 4.234   -11.958 27.081  1.00 13.23 ? 220  THR A O     1 
ATOM   2369 C CB    . THR E 3 220 ? 1.494   -10.271 27.783  1.00 14.16 ? 220  THR A CB    1 
ATOM   2370 O OG1   . THR E 3 220 ? 1.374   -10.652 26.408  1.00 11.80 ? 220  THR A OG1   1 
ATOM   2371 C CG2   . THR E 3 220 ? 0.850   -8.908  27.997  1.00 12.58 ? 220  THR A CG2   1 
ATOM   2372 N N     . GLN E 3 221 ? 3.225   -12.527 29.022  1.00 15.49 ? 221  GLN A N     1 
ATOM   2373 C CA    . GLN E 3 221 ? 3.447   -13.955 28.878  1.00 19.37 ? 221  GLN A CA    1 
ATOM   2374 C C     . GLN E 3 221 ? 2.124   -14.643 29.162  1.00 18.62 ? 221  GLN A C     1 
ATOM   2375 O O     . GLN E 3 221 ? 1.389   -14.234 30.061  1.00 18.54 ? 221  GLN A O     1 
ATOM   2376 C CB    . GLN E 3 221 ? 4.566   -14.455 29.801  1.00 19.45 ? 221  GLN A CB    1 
ATOM   2377 C CG    . GLN E 3 221 ? 4.190   -14.819 31.222  1.00 23.36 ? 221  GLN A CG    1 
ATOM   2378 C CD    . GLN E 3 221 ? 5.380   -15.351 32.047  1.00 24.08 ? 221  GLN A CD    1 
ATOM   2379 O OE1   . GLN E 3 221 ? 6.417   -15.766 31.500  1.00 29.40 ? 221  GLN A OE1   1 
ATOM   2380 N NE2   . GLN E 3 221 ? 5.225   -15.333 33.370  1.00 28.61 ? 221  GLN A NE2   1 
ATOM   2381 N N     . GLU E 3 222 ? 1.797   -15.644 28.363  1.00 20.13 ? 222  GLU A N     1 
ATOM   2382 C CA    . GLU E 3 222 ? 0.516   -16.312 28.532  1.00 22.97 ? 222  GLU A CA    1 
ATOM   2383 C C     . GLU E 3 222 ? 0.747   -17.640 29.203  1.00 23.82 ? 222  GLU A C     1 
ATOM   2384 O O     . GLU E 3 222 ? 1.723   -18.347 28.909  1.00 23.97 ? 222  GLU A O     1 
ATOM   2385 C CB    . GLU E 3 222 ? -0.263  -16.473 27.209  1.00 23.69 ? 222  GLU A CB    1 
ATOM   2386 C CG    . GLU E 3 222 ? 0.396   -17.293 26.123  1.00 25.79 ? 222  GLU A CG    1 
ATOM   2387 C CD    . GLU E 3 222 ? -0.563  -17.702 24.992  1.00 26.53 ? 222  GLU A CD    1 
ATOM   2388 O OE1   . GLU E 3 222 ? -0.164  -18.543 24.155  1.00 31.64 ? 222  GLU A OE1   1 
ATOM   2389 O OE2   . GLU E 3 222 ? -1.710  -17.194 24.933  1.00 32.11 ? 222  GLU A OE2   1 
ATOM   2390 N N     . SER E 3 223 ? -0.143  -17.970 30.125  1.00 24.19 ? 223  SER A N     1 
ATOM   2391 C CA    . SER E 3 223 ? -0.075  -19.273 30.753  1.00 25.36 ? 223  SER A CA    1 
ATOM   2392 C C     . SER E 3 223 ? -1.478  -19.859 30.811  1.00 25.78 ? 223  SER A C     1 
ATOM   2393 O O     . SER E 3 223 ? -2.412  -19.273 30.277  1.00 24.96 ? 223  SER A O     1 
ATOM   2394 C CB    . SER E 3 223 ? 0.562   -19.162 32.140  1.00 24.80 ? 223  SER A CB    1 
ATOM   2395 O OG    . SER E 3 223 ? 1.788   -18.440 32.078  1.00 25.88 ? 223  SER A OG    1 
ATOM   2396 N N     . GLU E 3 224 ? -1.595  -21.027 31.441  1.00 27.25 ? 224  GLU A N     1 
ATOM   2397 C CA    . GLU E 3 224 ? -2.873  -21.664 31.749  1.00 28.61 ? 224  GLU A CA    1 
ATOM   2398 C C     . GLU E 3 224 ? -3.801  -20.648 32.441  1.00 28.99 ? 224  GLU A C     1 
ATOM   2399 O O     . GLU E 3 224 ? -4.979  -20.516 32.086  1.00 29.04 ? 224  GLU A O     1 
ATOM   2400 C CB    . GLU E 3 224 ? -2.632  -22.926 32.618  1.00 28.57 ? 224  GLU A CB    1 
ATOM   2401 C CG    . GLU E 3 224 ? -2.071  -24.173 31.836  1.00 29.91 ? 224  GLU A CG    1 
ATOM   2402 C CD    . GLU E 3 224 ? -1.148  -25.127 32.670  1.00 29.90 ? 224  GLU A CD    1 
ATOM   2403 O OE1   . GLU E 3 224 ? -0.631  -26.139 32.112  1.00 31.57 ? 224  GLU A OE1   1 
ATOM   2404 O OE2   . GLU E 3 224 ? -0.934  -24.882 33.871  1.00 31.23 ? 224  GLU A OE2   1 
ATOM   2405 N N     . SER E 3 225 ? -3.241  -19.903 33.393  1.00 29.27 ? 225  SER A N     1 
ATOM   2406 C CA    . SER E 3 225 ? -3.995  -18.985 34.246  1.00 29.21 ? 225  SER A CA    1 
ATOM   2407 C C     . SER E 3 225 ? -4.292  -17.602 33.635  1.00 28.67 ? 225  SER A C     1 
ATOM   2408 O O     . SER E 3 225 ? -4.826  -16.734 34.334  1.00 29.54 ? 225  SER A O     1 
ATOM   2409 C CB    . SER E 3 225 ? -3.260  -18.809 35.579  1.00 29.34 ? 225  SER A CB    1 
ATOM   2410 O OG    . SER E 3 225 ? -1.946  -18.327 35.374  1.00 31.71 ? 225  SER A OG    1 
ATOM   2411 N N     . GLY E 3 226 ? -3.921  -17.389 32.366  1.00 27.58 ? 226  GLY A N     1 
ATOM   2412 C CA    . GLY E 3 226 ? -4.180  -16.116 31.653  1.00 25.37 ? 226  GLY A CA    1 
ATOM   2413 C C     . GLY E 3 226 ? -2.906  -15.348 31.290  1.00 24.29 ? 226  GLY A C     1 
ATOM   2414 O O     . GLY E 3 226 ? -1.798  -15.901 31.381  1.00 24.51 ? 226  GLY A O     1 
ATOM   2415 N N     . PHE E 3 227 ? -3.046  -14.084 30.884  1.00 21.59 ? 227  PHE A N     1 
ATOM   2416 C CA    . PHE E 3 227 ? -1.878  -13.242 30.564  1.00 19.65 ? 227  PHE A CA    1 
ATOM   2417 C C     . PHE E 3 227 ? -1.289  -12.531 31.771  1.00 19.32 ? 227  PHE A C     1 
ATOM   2418 O O     . PHE E 3 227 ? -2.027  -12.011 32.612  1.00 18.92 ? 227  PHE A O     1 
ATOM   2419 C CB    . PHE E 3 227 ? -2.218  -12.201 29.495  1.00 19.36 ? 227  PHE A CB    1 
ATOM   2420 C CG    . PHE E 3 227 ? -2.533  -12.795 28.150  1.00 18.95 ? 227  PHE A CG    1 
ATOM   2421 C CD1   . PHE E 3 227 ? -1.519  -13.054 27.226  1.00 18.66 ? 227  PHE A CD1   1 
ATOM   2422 C CD2   . PHE E 3 227 ? -3.848  -13.085 27.801  1.00 19.93 ? 227  PHE A CD2   1 
ATOM   2423 C CE1   . PHE E 3 227 ? -1.817  -13.592 25.977  1.00 17.24 ? 227  PHE A CE1   1 
ATOM   2424 C CE2   . PHE E 3 227 ? -4.153  -13.631 26.547  1.00 18.68 ? 227  PHE A CE2   1 
ATOM   2425 C CZ    . PHE E 3 227 ? -3.134  -13.886 25.637  1.00 18.67 ? 227  PHE A CZ    1 
ATOM   2426 N N     . THR E 3 228 ? 0.038   -12.511 31.833  1.00 18.24 ? 228  THR A N     1 
ATOM   2427 C CA    . THR E 3 228 ? 0.768   -11.780 32.856  1.00 19.25 ? 228  THR A CA    1 
ATOM   2428 C C     . THR E 3 228 ? 1.580   -10.662 32.210  1.00 18.39 ? 228  THR A C     1 
ATOM   2429 O O     . THR E 3 228 ? 2.429   -10.953 31.370  1.00 18.72 ? 228  THR A O     1 
ATOM   2430 C CB    . THR E 3 228 ? 1.749   -12.693 33.614  1.00 19.38 ? 228  THR A CB    1 
ATOM   2431 O OG1   . THR E 3 228 ? 1.021   -13.751 34.254  1.00 22.86 ? 228  THR A OG1   1 
ATOM   2432 C CG2   . THR E 3 228 ? 2.518   -11.888 34.666  1.00 21.41 ? 228  THR A CG2   1 
ATOM   2433 N N     . PRO E 3 229 ? 1.347   -9.402  32.621  1.00 17.98 ? 229  PRO A N     1 
ATOM   2434 C CA    . PRO E 3 229 ? 2.110   -8.282  32.055  1.00 17.60 ? 229  PRO A CA    1 
ATOM   2435 C C     . PRO E 3 229 ? 3.542   -8.236  32.602  1.00 17.44 ? 229  PRO A C     1 
ATOM   2436 O O     . PRO E 3 229 ? 3.769   -8.508  33.786  1.00 16.98 ? 229  PRO A O     1 
ATOM   2437 C CB    . PRO E 3 229 ? 1.307   -7.051  32.484  1.00 17.60 ? 229  PRO A CB    1 
ATOM   2438 C CG    . PRO E 3 229 ? 0.594   -7.474  33.749  1.00 19.25 ? 229  PRO A CG    1 
ATOM   2439 C CD    . PRO E 3 229 ? 0.376   -8.953  33.651  1.00 17.73 ? 229  PRO A CD    1 
ATOM   2440 N N     . ILE E 3 230 ? 4.485   -7.906  31.724  1.00 16.48 ? 230  ILE A N     1 
ATOM   2441 C CA    . ILE E 3 230 ? 5.899   -7.761  32.066  1.00 16.77 ? 230  ILE A CA    1 
ATOM   2442 C C     . ILE E 3 230 ? 6.304   -6.356  31.651  1.00 16.63 ? 230  ILE A C     1 
ATOM   2443 O O     . ILE E 3 230 ? 6.226   -6.017  30.474  1.00 15.51 ? 230  ILE A O     1 
ATOM   2444 C CB    . ILE E 3 230 ? 6.786   -8.801  31.314  1.00 17.69 ? 230  ILE A CB    1 
ATOM   2445 C CG1   . ILE E 3 230 ? 6.292   -10.248 31.528  1.00 19.60 ? 230  ILE A CG1   1 
ATOM   2446 C CG2   . ILE E 3 230 ? 8.265   -8.650  31.703  1.00 17.89 ? 230  ILE A CG2   1 
ATOM   2447 C CD1   . ILE E 3 230 ? 6.238   -10.700 32.969  1.00 24.25 ? 230  ILE A CD1   1 
ATOM   2448 N N     . LEU E 3 231 ? 6.694   -5.516  32.607  1.00 15.74 ? 231  LEU A N     1 
ATOM   2449 C CA    . LEU E 3 231 ? 7.058   -4.157  32.258  1.00 15.92 ? 231  LEU A CA    1 
ATOM   2450 C C     . LEU E 3 231 ? 8.304   -4.121  31.358  1.00 15.22 ? 231  LEU A C     1 
ATOM   2451 O O     . LEU E 3 231 ? 9.335   -4.728  31.676  1.00 15.69 ? 231  LEU A O     1 
ATOM   2452 C CB    . LEU E 3 231 ? 7.252   -3.310  33.516  1.00 16.04 ? 231  LEU A CB    1 
ATOM   2453 C CG    . LEU E 3 231 ? 7.684   -1.876  33.245  1.00 16.80 ? 231  LEU A CG    1 
ATOM   2454 C CD1   . LEU E 3 231 ? 6.590   -1.046  32.528  1.00 18.24 ? 231  LEU A CD1   1 
ATOM   2455 C CD2   . LEU E 3 231 ? 8.113   -1.213  34.567  1.00 19.36 ? 231  LEU A CD2   1 
ATOM   2456 N N     . TRP E 3 232 ? 8.189   -3.439  30.220  1.00 14.14 ? 232  TRP A N     1 
ATOM   2457 C CA    . TRP E 3 232 ? 9.302   -3.345  29.267  1.00 13.42 ? 232  TRP A CA    1 
ATOM   2458 C C     . TRP E 3 232 ? 10.022  -1.988  29.303  1.00 13.32 ? 232  TRP A C     1 
ATOM   2459 O O     . TRP E 3 232 ? 11.254  -1.943  29.396  1.00 13.87 ? 232  TRP A O     1 
ATOM   2460 C CB    . TRP E 3 232 ? 8.818   -3.631  27.832  1.00 13.23 ? 232  TRP A CB    1 
ATOM   2461 C CG    . TRP E 3 232 ? 9.932   -3.777  26.857  1.00 13.56 ? 232  TRP A CG    1 
ATOM   2462 C CD1   . TRP E 3 232 ? 10.603  -2.755  26.227  1.00 14.19 ? 232  TRP A CD1   1 
ATOM   2463 C CD2   . TRP E 3 232 ? 10.531  -4.994  26.414  1.00 13.34 ? 232  TRP A CD2   1 
ATOM   2464 N NE1   . TRP E 3 232 ? 11.567  -3.277  25.399  1.00 12.94 ? 232  TRP A NE1   1 
ATOM   2465 C CE2   . TRP E 3 232 ? 11.561  -4.646  25.506  1.00 13.27 ? 232  TRP A CE2   1 
ATOM   2466 C CE3   . TRP E 3 232 ? 10.302  -6.358  26.693  1.00 13.02 ? 232  TRP A CE3   1 
ATOM   2467 C CZ2   . TRP E 3 232 ? 12.346  -5.606  24.854  1.00 14.75 ? 232  TRP A CZ2   1 
ATOM   2468 C CZ3   . TRP E 3 232 ? 11.098  -7.325  26.052  1.00 13.54 ? 232  TRP A CZ3   1 
ATOM   2469 C CH2   . TRP E 3 232 ? 12.106  -6.942  25.139  1.00 15.18 ? 232  TRP A CH2   1 
ATOM   2470 N N     . ALA E 3 233 ? 9.271   -0.899  29.181  1.00 12.94 ? 233  ALA A N     1 
ATOM   2471 C CA    . ALA E 3 233 ? 9.875   0.423   29.246  1.00 13.06 ? 233  ALA A CA    1 
ATOM   2472 C C     . ALA E 3 233 ? 8.861   1.472   29.650  1.00 13.78 ? 233  ALA A C     1 
ATOM   2473 O O     . ALA E 3 233 ? 7.645   1.250   29.544  1.00 13.36 ? 233  ALA A O     1 
ATOM   2474 C CB    . ALA E 3 233 ? 10.543  0.786   27.894  1.00 12.36 ? 233  ALA A CB    1 
ATOM   2475 N N     . GLU E 3 234 ? 9.367   2.608   30.122  1.00 13.00 ? 234  GLU A N     1 
ATOM   2476 C CA    . GLU E 3 234 ? 8.524   3.736   30.499  1.00 14.78 ? 234  GLU A CA    1 
ATOM   2477 C C     . GLU E 3 234 ? 9.026   4.996   29.815  1.00 14.39 ? 234  GLU A C     1 
ATOM   2478 O O     . GLU E 3 234 ? 10.247  5.232   29.742  1.00 14.22 ? 234  GLU A O     1 
ATOM   2479 C CB    . GLU E 3 234 ? 8.524   3.917   32.021  1.00 14.99 ? 234  GLU A CB    1 
ATOM   2480 C CG    . GLU E 3 234 ? 7.852   2.759   32.732  1.00 19.94 ? 234  GLU A CG    1 
ATOM   2481 C CD    . GLU E 3 234 ? 8.074   2.799   34.234  1.00 25.44 ? 234  GLU A CD    1 
ATOM   2482 O OE1   . GLU E 3 234 ? 9.013   2.129   34.710  1.00 27.39 ? 234  GLU A OE1   1 
ATOM   2483 O OE2   . GLU E 3 234 ? 7.318   3.508   34.932  1.00 27.90 ? 234  GLU A OE2   1 
ATOM   2484 N N     . TYR E 3 235 ? 8.073   5.767   29.292  1.00 13.85 ? 235  TYR A N     1 
ATOM   2485 C CA    . TYR E 3 235 ? 8.314   7.029   28.623  1.00 14.08 ? 235  TYR A CA    1 
ATOM   2486 C C     . TYR E 3 235 ? 7.432   8.108   29.254  1.00 14.40 ? 235  TYR A C     1 
ATOM   2487 O O     . TYR E 3 235 ? 6.381   8.457   28.728  1.00 13.52 ? 235  TYR A O     1 
ATOM   2488 C CB    . TYR E 3 235 ? 8.027   6.901   27.123  1.00 14.69 ? 235  TYR A CB    1 
ATOM   2489 C CG    . TYR E 3 235 ? 8.892   5.853   26.463  1.00 13.86 ? 235  TYR A CG    1 
ATOM   2490 C CD1   . TYR E 3 235 ? 8.428   4.550   26.277  1.00 14.61 ? 235  TYR A CD1   1 
ATOM   2491 C CD2   . TYR E 3 235 ? 10.190  6.160   26.037  1.00 16.68 ? 235  TYR A CD2   1 
ATOM   2492 C CE1   . TYR E 3 235 ? 9.232   3.576   25.672  1.00 13.62 ? 235  TYR A CE1   1 
ATOM   2493 C CE2   . TYR E 3 235 ? 11.008  5.193   25.434  1.00 15.03 ? 235  TYR A CE2   1 
ATOM   2494 C CZ    . TYR E 3 235 ? 10.523  3.902   25.253  1.00 16.11 ? 235  TYR A CZ    1 
ATOM   2495 O OH    . TYR E 3 235 ? 11.320  2.944   24.650  1.00 15.97 ? 235  TYR A OH    1 
ATOM   2496 N N     . PRO E 3 236 ? 7.863   8.645   30.410  1.00 15.23 ? 236  PRO A N     1 
ATOM   2497 C CA    . PRO E 3 236 ? 7.010   9.570   31.184  1.00 16.21 ? 236  PRO A CA    1 
ATOM   2498 C C     . PRO E 3 236 ? 6.657   10.882  30.466  1.00 16.87 ? 236  PRO A C     1 
ATOM   2499 O O     . PRO E 3 236 ? 5.686   11.548  30.847  1.00 17.44 ? 236  PRO A O     1 
ATOM   2500 C CB    . PRO E 3 236 ? 7.836   9.833   32.452  1.00 16.17 ? 236  PRO A CB    1 
ATOM   2501 C CG    . PRO E 3 236 ? 9.214   9.507   32.090  1.00 16.75 ? 236  PRO A CG    1 
ATOM   2502 C CD    . PRO E 3 236 ? 9.162   8.413   31.058  1.00 15.65 ? 236  PRO A CD    1 
ATOM   2503 N N     . HIS E 3 237 ? 7.423   11.238  29.437  1.00 16.87 ? 237  HIS A N     1 
ATOM   2504 C CA    . HIS E 3 237 ? 7.192   12.453  28.663  1.00 17.68 ? 237  HIS A CA    1 
ATOM   2505 C C     . HIS E 3 237 ? 6.769   12.192  27.215  1.00 17.10 ? 237  HIS A C     1 
ATOM   2506 O O     . HIS E 3 237 ? 6.902   13.074  26.355  1.00 16.59 ? 237  HIS A O     1 
ATOM   2507 C CB    . HIS E 3 237 ? 8.447   13.320  28.667  1.00 18.62 ? 237  HIS A CB    1 
ATOM   2508 C CG    . HIS E 3 237 ? 8.978   13.576  30.036  1.00 22.29 ? 237  HIS A CG    1 
ATOM   2509 N ND1   . HIS E 3 237 ? 8.263   14.271  30.985  1.00 25.91 ? 237  HIS A ND1   1 
ATOM   2510 C CD2   . HIS E 3 237 ? 10.129  13.188  30.634  1.00 25.42 ? 237  HIS A CD2   1 
ATOM   2511 C CE1   . HIS E 3 237 ? 8.961   14.320  32.105  1.00 26.20 ? 237  HIS A CE1   1 
ATOM   2512 N NE2   . HIS E 3 237 ? 10.095  13.669  31.920  1.00 27.14 ? 237  HIS A NE2   1 
ATOM   2513 N N     . TRP E 3 238 ? 6.265   10.981  26.953  1.00 15.52 ? 238  TRP A N     1 
ATOM   2514 C CA    . TRP E 3 238 ? 5.734   10.617  25.636  1.00 15.30 ? 238  TRP A CA    1 
ATOM   2515 C C     . TRP E 3 238 ? 4.835   11.704  25.090  1.00 15.13 ? 238  TRP A C     1 
ATOM   2516 O O     . TRP E 3 238 ? 3.976   12.210  25.808  1.00 14.69 ? 238  TRP A O     1 
ATOM   2517 C CB    . TRP E 3 238 ? 4.950   9.310   25.760  1.00 13.84 ? 238  TRP A CB    1 
ATOM   2518 C CG    . TRP E 3 238 ? 4.453   8.715   24.438  1.00 13.79 ? 238  TRP A CG    1 
ATOM   2519 C CD1   . TRP E 3 238 ? 5.211   8.368   23.351  1.00 13.79 ? 238  TRP A CD1   1 
ATOM   2520 C CD2   . TRP E 3 238 ? 3.101   8.370   24.116  1.00 12.37 ? 238  TRP A CD2   1 
ATOM   2521 N NE1   . TRP E 3 238 ? 4.405   7.835   22.359  1.00 13.26 ? 238  TRP A NE1   1 
ATOM   2522 C CE2   . TRP E 3 238 ? 3.107   7.823   22.806  1.00 12.65 ? 238  TRP A CE2   1 
ATOM   2523 C CE3   . TRP E 3 238 ? 1.877   8.464   24.808  1.00 11.05 ? 238  TRP A CE3   1 
ATOM   2524 C CZ2   . TRP E 3 238 ? 1.935   7.384   22.172  1.00 12.06 ? 238  TRP A CZ2   1 
ATOM   2525 C CZ3   . TRP E 3 238 ? 0.720   8.035   24.185  1.00 12.34 ? 238  TRP A CZ3   1 
ATOM   2526 C CH2   . TRP E 3 238 ? 0.754   7.497   22.869  1.00 12.62 ? 238  TRP A CH2   1 
ATOM   2527 N N     . GLU E 3 239 ? 5.041   12.065  23.823  1.00 15.44 ? 239  GLU A N     1 
ATOM   2528 C CA    . GLU E 3 239 ? 4.228   13.085  23.169  1.00 15.77 ? 239  GLU A CA    1 
ATOM   2529 C C     . GLU E 3 239 ? 3.578   12.548  21.898  1.00 14.66 ? 239  GLU A C     1 
ATOM   2530 O O     . GLU E 3 239 ? 3.101   13.325  21.055  1.00 15.71 ? 239  GLU A O     1 
ATOM   2531 C CB    . GLU E 3 239 ? 5.072   14.322  22.840  1.00 17.10 ? 239  GLU A CB    1 
ATOM   2532 C CG    . GLU E 3 239 ? 5.591   15.036  24.076  1.00 20.88 ? 239  GLU A CG    1 
ATOM   2533 C CD    . GLU E 3 239 ? 6.233   16.366  23.740  1.00 26.44 ? 239  GLU A CD    1 
ATOM   2534 O OE1   . GLU E 3 239 ? 6.699   16.539  22.589  1.00 27.00 ? 239  GLU A OE1   1 
ATOM   2535 O OE2   . GLU E 3 239 ? 6.263   17.237  24.637  1.00 29.06 ? 239  GLU A OE2   1 
ATOM   2536 N N     . GLY E 3 240 ? 3.550   11.225  21.771  1.00 13.80 ? 240  GLY A N     1 
ATOM   2537 C CA    . GLY E 3 240 ? 2.953   10.577  20.613  1.00 13.07 ? 240  GLY A CA    1 
ATOM   2538 C C     . GLY E 3 240 ? 3.938   10.042  19.598  1.00 13.17 ? 240  GLY A C     1 
ATOM   2539 O O     . GLY E 3 240 ? 3.535   9.683   18.481  1.00 12.29 ? 240  GLY A O     1 
ATOM   2540 N N     . GLU E 3 241 ? 5.214   9.970   19.989  1.00 12.42 ? 241  GLU A N     1 
ATOM   2541 C CA    . GLU E 3 241 ? 6.254   9.371   19.137  1.00 12.69 ? 241  GLU A CA    1 
ATOM   2542 C C     . GLU E 3 241 ? 5.903   7.905   18.871  1.00 12.17 ? 241  GLU A C     1 
ATOM   2543 O O     . GLU E 3 241 ? 5.205   7.276   19.662  1.00 10.66 ? 241  GLU A O     1 
ATOM   2544 C CB    . GLU E 3 241 ? 7.624   9.445   19.828  1.00 13.20 ? 241  GLU A CB    1 
ATOM   2545 C CG    . GLU E 3 241 ? 8.161   10.880  20.048  1.00 15.12 ? 241  GLU A CG    1 
ATOM   2546 C CD    . GLU E 3 241 ? 7.751   11.516  21.369  1.00 18.10 ? 241  GLU A CD    1 
ATOM   2547 O OE1   . GLU E 3 241 ? 8.377   12.540  21.744  1.00 19.75 ? 241  GLU A OE1   1 
ATOM   2548 O OE2   . GLU E 3 241 ? 6.829   11.012  22.046  1.00 16.23 ? 241  GLU A OE2   1 
ATOM   2549 N N     . ILE E 3 242 ? 6.384   7.381   17.741  1.00 11.51 ? 242  ILE A N     1 
ATOM   2550 C CA    . ILE E 3 242 ? 6.310   5.950   17.467  1.00 11.57 ? 242  ILE A CA    1 
ATOM   2551 C C     . ILE E 3 242 ? 6.750   5.128   18.683  1.00 11.59 ? 242  ILE A C     1 
ATOM   2552 O O     . ILE E 3 242 ? 7.720   5.477   19.384  1.00 10.96 ? 242  ILE A O     1 
ATOM   2553 C CB    . ILE E 3 242 ? 7.177   5.627   16.218  1.00 11.75 ? 242  ILE A CB    1 
ATOM   2554 C CG1   . ILE E 3 242 ? 6.499   6.173   14.946  1.00 11.82 ? 242  ILE A CG1   1 
ATOM   2555 C CG2   . ILE E 3 242 ? 7.518   4.145   16.128  1.00 13.19 ? 242  ILE A CG2   1 
ATOM   2556 C CD1   . ILE E 3 242 ? 7.480   6.228   13.724  1.00 12.76 ? 242  ILE A CD1   1 
ATOM   2557 N N     . ILE E 3 243 ? 6.005   4.051   18.933  1.00 10.27 ? 243  ILE A N     1 
ATOM   2558 C CA    . ILE E 3 243 ? 6.251   3.158   20.047  1.00 10.58 ? 243  ILE A CA    1 
ATOM   2559 C C     . ILE E 3 243 ? 6.996   1.912   19.567  1.00 10.26 ? 243  ILE A C     1 
ATOM   2560 O O     . ILE E 3 243 ? 6.548   1.225   18.633  1.00 9.92  ? 243  ILE A O     1 
ATOM   2561 C CB    . ILE E 3 243 ? 4.911   2.753   20.719  1.00 10.05 ? 243  ILE A CB    1 
ATOM   2562 C CG1   . ILE E 3 243 ? 4.130   3.994   21.200  1.00 11.01 ? 243  ILE A CG1   1 
ATOM   2563 C CG2   . ILE E 3 243 ? 5.173   1.710   21.823  1.00 10.64 ? 243  ILE A CG2   1 
ATOM   2564 C CD1   . ILE E 3 243 ? 2.674   3.693   21.695  1.00 12.10 ? 243  ILE A CD1   1 
ATOM   2565 N N     . ARG E 3 244 ? 8.120   1.611   20.216  1.00 9.55  ? 244  ARG A N     1 
ATOM   2566 C CA    . ARG E 3 244 ? 8.993   0.512   19.803  1.00 10.06 ? 244  ARG A CA    1 
ATOM   2567 C C     . ARG E 3 244 ? 9.475   -0.231  21.036  1.00 10.23 ? 244  ARG A C     1 
ATOM   2568 O O     . ARG E 3 244 ? 9.526   0.368   22.127  1.00 11.03 ? 244  ARG A O     1 
ATOM   2569 C CB    . ARG E 3 244 ? 10.234  1.076   19.113  1.00 10.69 ? 244  ARG A CB    1 
ATOM   2570 C CG    . ARG E 3 244 ? 9.956   2.171   18.092  1.00 10.41 ? 244  ARG A CG    1 
ATOM   2571 C CD    . ARG E 3 244 ? 11.237  2.527   17.318  1.00 10.41 ? 244  ARG A CD    1 
ATOM   2572 N NE    . ARG E 3 244 ? 12.291  3.103   18.177  1.00 12.10 ? 244  ARG A NE    1 
ATOM   2573 C CZ    . ARG E 3 244 ? 13.557  3.259   17.773  1.00 11.13 ? 244  ARG A CZ    1 
ATOM   2574 N NH1   . ARG E 3 244 ? 13.906  2.863   16.560  1.00 11.14 ? 244  ARG A NH1   1 
ATOM   2575 N NH2   . ARG E 3 244 ? 14.484  3.788   18.579  1.00 11.08 ? 244  ARG A NH2   1 
ATOM   2576 N N     . PHE E 3 245 ? 9.856   -1.502  20.857  1.00 10.41 ? 245  PHE A N     1 
ATOM   2577 C CA    . PHE E 3 245 ? 10.494  -2.284  21.944  1.00 11.29 ? 245  PHE A CA    1 
ATOM   2578 C C     . PHE E 3 245 ? 12.010  -2.043  21.890  1.00 11.37 ? 245  PHE A C     1 
ATOM   2579 O O     . PHE E 3 245 ? 12.736  -2.730  21.167  1.00 10.62 ? 245  PHE A O     1 
ATOM   2580 C CB    . PHE E 3 245 ? 10.166  -3.777  21.833  1.00 11.63 ? 245  PHE A CB    1 
ATOM   2581 C CG    . PHE E 3 245 ? 8.795   -4.118  22.349  1.00 11.60 ? 245  PHE A CG    1 
ATOM   2582 C CD1   . PHE E 3 245 ? 8.608   -4.428  23.680  1.00 11.32 ? 245  PHE A CD1   1 
ATOM   2583 C CD2   . PHE E 3 245 ? 7.671   -4.060  21.506  1.00 12.79 ? 245  PHE A CD2   1 
ATOM   2584 C CE1   . PHE E 3 245 ? 7.327   -4.699  24.182  1.00 11.08 ? 245  PHE A CE1   1 
ATOM   2585 C CE2   . PHE E 3 245 ? 6.389   -4.347  21.998  1.00 15.00 ? 245  PHE A CE2   1 
ATOM   2586 C CZ    . PHE E 3 245 ? 6.224   -4.660  23.348  1.00 12.78 ? 245  PHE A CZ    1 
ATOM   2587 N N     . GLU E 3 246 ? 12.474  -1.051  22.646  1.00 11.45 ? 246  GLU A N     1 
ATOM   2588 C CA    . GLU E 3 246 ? 13.886  -0.690  22.645  1.00 11.61 ? 246  GLU A CA    1 
ATOM   2589 C C     . GLU E 3 246 ? 14.634  -1.509  23.689  1.00 12.40 ? 246  GLU A C     1 
ATOM   2590 O O     . GLU E 3 246 ? 14.048  -1.914  24.716  1.00 13.07 ? 246  GLU A O     1 
ATOM   2591 C CB    . GLU E 3 246 ? 14.079  0.779   22.983  1.00 11.70 ? 246  GLU A CB    1 
ATOM   2592 C CG    . GLU E 3 246 ? 13.362  1.780   22.090  1.00 12.83 ? 246  GLU A CG    1 
ATOM   2593 C CD    . GLU E 3 246 ? 13.837  3.184   22.362  1.00 14.49 ? 246  GLU A CD    1 
ATOM   2594 O OE1   . GLU E 3 246 ? 14.746  3.655   21.627  1.00 13.85 ? 246  GLU A OE1   1 
ATOM   2595 O OE2   . GLU E 3 246 ? 13.352  3.812   23.341  1.00 13.52 ? 246  GLU A OE2   1 
ATOM   2596 N N     . THR E 3 247 ? 15.926  -1.716  23.444  1.00 12.15 ? 247  THR A N     1 
ATOM   2597 C CA    . THR E 3 247 ? 16.797  -2.423  24.389  1.00 12.92 ? 247  THR A CA    1 
ATOM   2598 C C     . THR E 3 247 ? 18.147  -1.699  24.423  1.00 13.27 ? 247  THR A C     1 
ATOM   2599 O O     . THR E 3 247 ? 18.425  -0.809  23.600  1.00 12.99 ? 247  THR A O     1 
ATOM   2600 C CB    . THR E 3 247 ? 17.054  -3.887  23.963  1.00 12.83 ? 247  THR A CB    1 
ATOM   2601 O OG1   . THR E 3 247 ? 17.861  -3.905  22.775  1.00 13.78 ? 247  THR A OG1   1 
ATOM   2602 C CG2   . THR E 3 247 ? 15.742  -4.663  23.712  1.00 12.06 ? 247  THR A CG2   1 
ATOM   2603 N N     . GLU E 3 248 ? 18.992  -2.092  25.372  1.00 13.34 ? 248  GLU A N     1 
ATOM   2604 C CA    . GLU E 3 248 ? 20.350  -1.561  25.447  1.00 14.28 ? 248  GLU A CA    1 
ATOM   2605 C C     . GLU E 3 248 ? 21.073  -1.728  24.105  1.00 13.97 ? 248  GLU A C     1 
ATOM   2606 O O     . GLU E 3 248 ? 21.791  -0.823  23.660  1.00 14.77 ? 248  GLU A O     1 
ATOM   2607 C CB    . GLU E 3 248 ? 21.089  -2.312  26.568  1.00 14.29 ? 248  GLU A CB    1 
ATOM   2608 C CG    . GLU E 3 248 ? 22.493  -1.880  26.833  1.00 17.85 ? 248  GLU A CG    1 
ATOM   2609 C CD    . GLU E 3 248 ? 23.010  -2.511  28.107  1.00 21.46 ? 248  GLU A CD    1 
ATOM   2610 O OE1   . GLU E 3 248 ? 23.057  -1.805  29.129  1.00 26.04 ? 248  GLU A OE1   1 
ATOM   2611 O OE2   . GLU E 3 248 ? 23.324  -3.716  28.087  1.00 23.71 ? 248  GLU A OE2   1 
ATOM   2612 N N     . GLU E 3 249 ? 20.838  -2.865  23.448  1.00 13.49 ? 249  GLU A N     1 
ATOM   2613 C CA    . GLU E 3 249 ? 21.462  -3.178  22.143  1.00 14.54 ? 249  GLU A CA    1 
ATOM   2614 C C     . GLU E 3 249 ? 20.941  -2.306  21.005  1.00 13.14 ? 249  GLU A C     1 
ATOM   2615 O O     . GLU E 3 249 ? 21.728  -1.795  20.205  1.00 12.57 ? 249  GLU A O     1 
ATOM   2616 C CB    . GLU E 3 249 ? 21.253  -4.659  21.755  1.00 15.36 ? 249  GLU A CB    1 
ATOM   2617 C CG    . GLU E 3 249 ? 21.882  -5.755  22.662  1.00 21.77 ? 249  GLU A CG    1 
ATOM   2618 C CD    . GLU E 3 249 ? 22.930  -5.285  23.679  1.00 29.06 ? 249  GLU A CD    1 
ATOM   2619 O OE1   . GLU E 3 249 ? 22.695  -5.522  24.899  1.00 32.13 ? 249  GLU A OE1   1 
ATOM   2620 O OE2   . GLU E 3 249 ? 23.981  -4.709  23.282  1.00 32.15 ? 249  GLU A OE2   1 
ATOM   2621 N N     . THR E 3 250 ? 19.618  -2.155  20.908  1.00 12.71 ? 250  THR A N     1 
ATOM   2622 C CA    . THR E 3 250 ? 19.042  -1.294  19.850  1.00 13.00 ? 250  THR A CA    1 
ATOM   2623 C C     . THR E 3 250 ? 19.577  0.138   19.990  1.00 13.11 ? 250  THR A C     1 
ATOM   2624 O O     . THR E 3 250 ? 19.947  0.773   19.000  1.00 13.04 ? 250  THR A O     1 
ATOM   2625 C CB    . THR E 3 250 ? 17.477  -1.309  19.787  1.00 12.86 ? 250  THR A CB    1 
ATOM   2626 O OG1   . THR E 3 250 ? 16.909  -0.699  20.953  1.00 13.25 ? 250  THR A OG1   1 
ATOM   2627 C CG2   . THR E 3 250 ? 16.936  -2.736  19.614  1.00 13.38 ? 250  THR A CG2   1 
ATOM   2628 N N     . ARG E 3 251 ? 19.632  0.631   21.226  1.00 12.26 ? 251  ARG A N     1 
ATOM   2629 C CA    . ARG E 3 251 ? 20.160  1.960   21.492  1.00 13.47 ? 251  ARG A CA    1 
ATOM   2630 C C     . ARG E 3 251 ? 21.628  2.054   21.075  1.00 13.36 ? 251  ARG A C     1 
ATOM   2631 O O     . ARG E 3 251 ? 22.048  3.033   20.470  1.00 14.35 ? 251  ARG A O     1 
ATOM   2632 C CB    . ARG E 3 251 ? 20.030  2.277   22.980  1.00 13.98 ? 251  ARG A CB    1 
ATOM   2633 C CG    . ARG E 3 251 ? 18.623  2.608   23.417  1.00 15.69 ? 251  ARG A CG    1 
ATOM   2634 C CD    . ARG E 3 251 ? 18.216  4.020   22.975  1.00 20.50 ? 251  ARG A CD    1 
ATOM   2635 N NE    . ARG E 3 251 ? 16.864  4.347   23.413  1.00 21.16 ? 251  ARG A NE    1 
ATOM   2636 C CZ    . ARG E 3 251 ? 16.565  4.850   24.605  1.00 24.75 ? 251  ARG A CZ    1 
ATOM   2637 N NH1   . ARG E 3 251 ? 17.531  5.069   25.500  1.00 25.56 ? 251  ARG A NH1   1 
ATOM   2638 N NH2   . ARG E 3 251 ? 15.297  5.127   24.912  1.00 24.02 ? 251  ARG A NH2   1 
ATOM   2639 N N     . LYS E 3 252 ? 22.396  1.033   21.435  1.00 13.42 ? 252  LYS A N     1 
ATOM   2640 C CA    . LYS E 3 252 ? 23.821  0.989   21.147  1.00 14.11 ? 252  LYS A CA    1 
ATOM   2641 C C     . LYS E 3 252 ? 24.103  1.012   19.647  1.00 14.15 ? 252  LYS A C     1 
ATOM   2642 O O     . LYS E 3 252 ? 25.043  1.672   19.187  1.00 14.32 ? 252  LYS A O     1 
ATOM   2643 C CB    . LYS E 3 252 ? 24.428  -0.276  21.735  1.00 14.73 ? 252  LYS A CB    1 
ATOM   2644 C CG    . LYS E 3 252 ? 25.954  -0.253  21.750  1.00 16.44 ? 252  LYS A CG    1 
ATOM   2645 C CD    . LYS E 3 252 ? 26.500  -1.549  22.311  1.00 18.11 ? 252  LYS A CD    1 
ATOM   2646 C CE    . LYS E 3 252 ? 25.960  -1.812  23.714  1.00 20.72 ? 252  LYS A CE    1 
ATOM   2647 N NZ    . LYS E 3 252 ? 26.575  -3.040  24.269  1.00 22.89 ? 252  LYS A NZ    1 
ATOM   2648 N N     . LEU E 3 253 ? 23.301  0.274   18.889  1.00 13.97 ? 253  LEU A N     1 
ATOM   2649 C CA    . LEU E 3 253 ? 23.475  0.245   17.441  1.00 14.49 ? 253  LEU A CA    1 
ATOM   2650 C C     . LEU E 3 253 ? 23.031  1.562   16.803  1.00 15.14 ? 253  LEU A C     1 
ATOM   2651 O O     . LEU E 3 253 ? 23.698  2.072   15.893  1.00 15.07 ? 253  LEU A O     1 
ATOM   2652 C CB    . LEU E 3 253 ? 22.734  -0.941  16.834  1.00 14.32 ? 253  LEU A CB    1 
ATOM   2653 C CG    . LEU E 3 253 ? 23.114  -1.310  15.403  1.00 15.30 ? 253  LEU A CG    1 
ATOM   2654 C CD1   . LEU E 3 253 ? 24.516  -1.878  15.350  1.00 16.06 ? 253  LEU A CD1   1 
ATOM   2655 C CD2   . LEU E 3 253 ? 22.103  -2.306  14.863  1.00 16.41 ? 253  LEU A CD2   1 
ATOM   2656 N N     . GLU E 3 254 ? 21.918  2.129   17.276  1.00 15.30 ? 254  GLU A N     1 
ATOM   2657 C CA    . GLU E 3 254 ? 21.439  3.392   16.709  1.00 16.63 ? 254  GLU A CA    1 
ATOM   2658 C C     . GLU E 3 254 ? 22.453  4.525   16.844  1.00 17.84 ? 254  GLU A C     1 
ATOM   2659 O O     . GLU E 3 254 ? 22.603  5.315   15.936  1.00 18.32 ? 254  GLU A O     1 
ATOM   2660 C CB    . GLU E 3 254 ? 20.058  3.783   17.220  1.00 16.46 ? 254  GLU A CB    1 
ATOM   2661 C CG    . GLU E 3 254 ? 18.990  2.898   16.581  1.00 15.57 ? 254  GLU A CG    1 
ATOM   2662 C CD    . GLU E 3 254 ? 17.554  3.194   17.030  1.00 17.35 ? 254  GLU A CD    1 
ATOM   2663 O OE1   . GLU E 3 254 ? 17.324  3.628   18.179  1.00 15.33 ? 254  GLU A OE1   1 
ATOM   2664 O OE2   . GLU E 3 254 ? 16.639  2.947   16.216  1.00 17.51 ? 254  GLU A OE2   1 
ATOM   2665 N N     . ILE E 3 255 ? 23.189  4.580   17.946  1.00 19.19 ? 255  ILE A N     1 
ATOM   2666 C CA    . ILE E 3 255 ? 24.165  5.664   18.071  1.00 21.35 ? 255  ILE A CA    1 
ATOM   2667 C C     . ILE E 3 255 ? 25.513  5.384   17.403  1.00 20.99 ? 255  ILE A C     1 
ATOM   2668 O O     . ILE E 3 255 ? 26.375  6.258   17.374  1.00 21.87 ? 255  ILE A O     1 
ATOM   2669 C CB    . ILE E 3 255 ? 24.322  6.177   19.523  1.00 21.82 ? 255  ILE A CB    1 
ATOM   2670 C CG1   . ILE E 3 255 ? 24.803  5.067   20.460  1.00 22.93 ? 255  ILE A CG1   1 
ATOM   2671 C CG2   . ILE E 3 255 ? 23.018  6.787   20.007  1.00 23.90 ? 255  ILE A CG2   1 
ATOM   2672 C CD1   . ILE E 3 255 ? 24.887  5.525   21.917  1.00 23.23 ? 255  ILE A CD1   1 
ATOM   2673 N N     . SER E 3 256 ? 25.666  4.189   16.834  1.00 20.10 ? 256  SER A N     1 
ATOM   2674 C CA    . SER E 3 256 ? 26.911  3.772   16.160  1.00 19.71 ? 256  SER A CA    1 
ATOM   2675 C C     . SER E 3 256 ? 27.079  4.286   14.722  1.00 19.39 ? 256  SER A C     1 
ATOM   2676 O O     . SER E 3 256 ? 28.156  4.153   14.141  1.00 18.77 ? 256  SER A O     1 
ATOM   2677 C CB    . SER E 3 256 ? 27.000  2.241   16.130  1.00 19.03 ? 256  SER A CB    1 
ATOM   2678 O OG    . SER E 3 256 ? 26.168  1.688   15.114  1.00 18.32 ? 256  SER A OG    1 
ATOM   2679 N N     . GLY E 3 257 ? 26.008  4.812   14.131  1.00 19.04 ? 257  GLY A N     1 
ATOM   2680 C CA    . GLY E 3 257 ? 26.074  5.239   12.731  1.00 19.41 ? 257  GLY A CA    1 
ATOM   2681 C C     . GLY E 3 257 ? 25.059  6.300   12.379  1.00 19.40 ? 257  GLY A C     1 
ATOM   2682 O O     . GLY E 3 257 ? 24.199  6.622   13.179  1.00 20.23 ? 257  GLY A O     1 
ATOM   2683 N N     . MET E 3 258 ? 25.180  6.845   11.177  1.00 19.31 ? 258  MET A N     1 
ATOM   2684 C CA    . MET E 3 258 ? 24.237  7.841   10.653  1.00 20.35 ? 258  MET A CA    1 
ATOM   2685 C C     . MET E 3 258 ? 22.905  7.141   10.370  1.00 18.12 ? 258  MET A C     1 
ATOM   2686 O O     . MET E 3 258 ? 22.935  6.014   9.860   1.00 19.10 ? 258  MET A O     1 
ATOM   2687 C CB    . MET E 3 258 ? 24.769  8.373   9.320   1.00 20.36 ? 258  MET A CB    1 
ATOM   2688 C CG    . MET E 3 258 ? 25.396  9.744   9.370   1.00 23.60 ? 258  MET A CG    1 
ATOM   2689 S SD    . MET E 3 258 ? 24.941  10.734  7.924   1.00 26.08 ? 258  MET A SD    1 
ATOM   2690 C CE    . MET E 3 258 ? 25.254  12.374  8.570   1.00 25.83 ? 258  MET A CE    1 
ATOM   2691 N N     . PRO E 3 259 ? 21.750  7.784   10.686  1.00 17.02 ? 259  PRO A N     1 
ATOM   2692 C CA    . PRO E 3 259 ? 20.486  7.202   10.191  1.00 15.78 ? 259  PRO A CA    1 
ATOM   2693 C C     . PRO E 3 259 ? 20.513  7.128   8.667   1.00 15.39 ? 259  PRO A C     1 
ATOM   2694 O O     . PRO E 3 259 ? 21.045  8.042   8.007   1.00 14.85 ? 259  PRO A O     1 
ATOM   2695 C CB    . PRO E 3 259 ? 19.403  8.189   10.670  1.00 15.99 ? 259  PRO A CB    1 
ATOM   2696 C CG    . PRO E 3 259 ? 20.041  8.996   11.732  1.00 18.03 ? 259  PRO A CG    1 
ATOM   2697 C CD    . PRO E 3 259 ? 21.519  9.019   11.456  1.00 16.62 ? 259  PRO A CD    1 
ATOM   2698 N N     . LEU E 3 260 ? 19.975  6.038   8.121   1.00 14.03 ? 260  LEU A N     1 
ATOM   2699 C CA    . LEU E 3 260 ? 19.991  5.801   6.683   1.00 14.12 ? 260  LEU A CA    1 
ATOM   2700 C C     . LEU E 3 260 ? 19.329  6.969   5.948   1.00 14.10 ? 260  LEU A C     1 
ATOM   2701 O O     . LEU E 3 260 ? 19.776  7.374   4.862   1.00 14.17 ? 260  LEU A O     1 
ATOM   2702 C CB    . LEU E 3 260 ? 19.289  4.476   6.365   1.00 13.53 ? 260  LEU A CB    1 
ATOM   2703 C CG    . LEU E 3 260 ? 19.326  3.969   4.924   1.00 14.10 ? 260  LEU A CG    1 
ATOM   2704 C CD1   . LEU E 3 260 ? 20.761  3.789   4.405   1.00 15.30 ? 260  LEU A CD1   1 
ATOM   2705 C CD2   . LEU E 3 260 ? 18.586  2.634   4.825   1.00 15.47 ? 260  LEU A CD2   1 
ATOM   2706 N N     . GLY E 3 261 ? 18.284  7.516   6.565   1.00 14.04 ? 261  GLY A N     1 
ATOM   2707 C CA    . GLY E 3 261 ? 17.527  8.644   6.015   1.00 15.06 ? 261  GLY A CA    1 
ATOM   2708 C C     . GLY E 3 261 ? 18.293  9.951   5.895   1.00 15.15 ? 261  GLY A C     1 
ATOM   2709 O O     . GLY E 3 261 ? 17.851  10.860  5.183   1.00 15.85 ? 261  GLY A O     1 
ATOM   2710 N N     . ASP E 3 262 ? 19.417  10.058  6.608   1.00 16.05 ? 262  ASP A N     1 
ATOM   2711 C CA    . ASP E 3 262 ? 20.333  11.204  6.457   1.00 16.91 ? 262  ASP A CA    1 
ATOM   2712 C C     . ASP E 3 262 ? 21.290  11.028  5.277   1.00 16.14 ? 262  ASP A C     1 
ATOM   2713 O O     . ASP E 3 262 ? 21.958  11.987  4.877   1.00 17.62 ? 262  ASP A O     1 
ATOM   2714 C CB    . ASP E 3 262 ? 21.144  11.425  7.742   1.00 16.97 ? 262  ASP A CB    1 
ATOM   2715 C CG    . ASP E 3 262 ? 20.312  12.014  8.876   1.00 19.63 ? 262  ASP A CG    1 
ATOM   2716 O OD1   . ASP E 3 262 ? 19.143  12.397  8.644   1.00 22.12 ? 262  ASP A OD1   1 
ATOM   2717 O OD2   . ASP E 3 262 ? 20.842  12.115  10.009  1.00 22.02 ? 262  ASP A OD2   1 
ATOM   2718 N N     . LEU E 3 263 ? 21.380  9.809   4.746   1.00 15.78 ? 263  LEU A N     1 
ATOM   2719 C CA    . LEU E 3 263 ? 22.288  9.497   3.632   1.00 15.34 ? 263  LEU A CA    1 
ATOM   2720 C C     . LEU E 3 263 ? 21.551  9.444   2.292   1.00 15.51 ? 263  LEU A C     1 
ATOM   2721 O O     . LEU E 3 263 ? 22.143  9.683   1.225   1.00 15.55 ? 263  LEU A O     1 
ATOM   2722 C CB    . LEU E 3 263 ? 23.010  8.168   3.867   1.00 14.93 ? 263  LEU A CB    1 
ATOM   2723 C CG    . LEU E 3 263 ? 24.054  8.129   4.983   1.00 16.67 ? 263  LEU A CG    1 
ATOM   2724 C CD1   . LEU E 3 263 ? 24.425  6.684   5.302   1.00 19.16 ? 263  LEU A CD1   1 
ATOM   2725 C CD2   . LEU E 3 263 ? 25.292  8.955   4.574   1.00 18.79 ? 263  LEU A CD2   1 
ATOM   2726 N N     . PHE E 3 264 ? 20.263  9.111   2.359   1.00 14.62 ? 264  PHE A N     1 
ATOM   2727 C CA    . PHE E 3 264 ? 19.474  8.860   1.155   1.00 14.11 ? 264  PHE A CA    1 
ATOM   2728 C C     . PHE E 3 264 ? 18.146  9.580   1.160   1.00 13.69 ? 264  PHE A C     1 
ATOM   2729 O O     . PHE E 3 264 ? 17.473  9.653   2.188   1.00 13.54 ? 264  PHE A O     1 
ATOM   2730 C CB    . PHE E 3 264 ? 19.162  7.358   1.030   1.00 13.70 ? 264  PHE A CB    1 
ATOM   2731 C CG    . PHE E 3 264 ? 20.360  6.497   0.795   1.00 12.69 ? 264  PHE A CG    1 
ATOM   2732 C CD1   . PHE E 3 264 ? 20.769  6.207   -0.494  1.00 14.69 ? 264  PHE A CD1   1 
ATOM   2733 C CD2   . PHE E 3 264 ? 21.067  5.948   1.871   1.00 12.35 ? 264  PHE A CD2   1 
ATOM   2734 C CE1   . PHE E 3 264 ? 21.875  5.390   -0.718  1.00 15.10 ? 264  PHE A CE1   1 
ATOM   2735 C CE2   . PHE E 3 264 ? 22.159  5.145   1.656   1.00 13.71 ? 264  PHE A CE2   1 
ATOM   2736 C CZ    . PHE E 3 264 ? 22.580  4.869   0.371   1.00 12.98 ? 264  PHE A CZ    1 
ATOM   2737 N N     . HIS E 3 265 ? 17.756  10.088  -0.012  1.00 12.96 ? 265  HIS A N     1 
ATOM   2738 C CA    . HIS E 3 265 ? 16.371  10.417  -0.264  1.00 13.11 ? 265  HIS A CA    1 
ATOM   2739 C C     . HIS E 3 265 ? 15.685  9.071   -0.401  1.00 12.30 ? 265  HIS A C     1 
ATOM   2740 O O     . HIS E 3 265 ? 16.219  8.181   -1.058  1.00 13.14 ? 265  HIS A O     1 
ATOM   2741 C CB    . HIS E 3 265 ? 16.238  11.150  -1.583  1.00 13.26 ? 265  HIS A CB    1 
ATOM   2742 C CG    . HIS E 3 265 ? 16.975  12.448  -1.628  1.00 14.73 ? 265  HIS A CG    1 
ATOM   2743 N ND1   . HIS E 3 265 ? 16.547  13.567  -0.949  1.00 18.22 ? 265  HIS A ND1   1 
ATOM   2744 C CD2   . HIS E 3 265 ? 18.102  12.810  -2.285  1.00 16.61 ? 265  HIS A CD2   1 
ATOM   2745 C CE1   . HIS E 3 265 ? 17.382  14.566  -1.183  1.00 18.81 ? 265  HIS A CE1   1 
ATOM   2746 N NE2   . HIS E 3 265 ? 18.335  14.133  -1.989  1.00 18.15 ? 265  HIS A NE2   1 
ATOM   2747 N N     . ILE E 3 266 ? 14.531  8.916   0.226   1.00 12.53 ? 266  ILE A N     1 
ATOM   2748 C CA    . ILE E 3 266 ? 13.796  7.663   0.104   1.00 12.37 ? 266  ILE A CA    1 
ATOM   2749 C C     . ILE E 3 266 ? 12.480  7.896   -0.620  1.00 11.69 ? 266  ILE A C     1 
ATOM   2750 O O     . ILE E 3 266 ? 11.653  8.712   -0.204  1.00 12.05 ? 266  ILE A O     1 
ATOM   2751 C CB    . ILE E 3 266 ? 13.550  6.976   1.469   1.00 12.88 ? 266  ILE A CB    1 
ATOM   2752 C CG1   . ILE E 3 266 ? 14.862  6.907   2.267   1.00 14.11 ? 266  ILE A CG1   1 
ATOM   2753 C CG2   . ILE E 3 266 ? 12.971  5.572   1.241   1.00 13.74 ? 266  ILE A CG2   1 
ATOM   2754 C CD1   . ILE E 3 266 ? 14.674  6.501   3.738   1.00 14.04 ? 266  ILE A CD1   1 
ATOM   2755 N N     . ARG E 3 267 ? 12.314  7.182   -1.721  1.00 10.67 ? 267  ARG A N     1 
ATOM   2756 C CA    . ARG E 3 267 ? 11.127  7.318   -2.551  1.00 11.47 ? 267  ARG A CA    1 
ATOM   2757 C C     . ARG E 3 267 ? 10.468  5.945   -2.676  1.00 10.62 ? 267  ARG A C     1 
ATOM   2758 O O     . ARG E 3 267 ? 11.085  4.918   -2.384  1.00 12.75 ? 267  ARG A O     1 
ATOM   2759 C CB    . ARG E 3 267 ? 11.506  7.843   -3.937  1.00 12.03 ? 267  ARG A CB    1 
ATOM   2760 C CG    . ARG E 3 267 ? 12.202  9.226   -3.910  1.00 14.65 ? 267  ARG A CG    1 
ATOM   2761 C CD    . ARG E 3 267 ? 11.196  10.360  -3.692  1.00 21.53 ? 267  ARG A CD    1 
ATOM   2762 N NE    . ARG E 3 267 ? 11.551  11.252  -2.593  1.00 31.28 ? 267  ARG A NE    1 
ATOM   2763 C CZ    . ARG E 3 267 ? 12.513  12.172  -2.612  1.00 32.66 ? 267  ARG A CZ    1 
ATOM   2764 N NH1   . ARG E 3 267 ? 13.278  12.343  -3.682  1.00 36.03 ? 267  ARG A NH1   1 
ATOM   2765 N NH2   . ARG E 3 267 ? 12.718  12.917  -1.537  1.00 35.07 ? 267  ARG A NH2   1 
ATOM   2766 N N     . PHE E 3 268 ? 9.223   5.935   -3.124  1.00 9.76  ? 268  PHE A N     1 
ATOM   2767 C CA    . PHE E 3 268 ? 8.531   4.675   -3.344  1.00 8.13  ? 268  PHE A CA    1 
ATOM   2768 C C     . PHE E 3 268 ? 8.327   4.462   -4.844  1.00 8.50  ? 268  PHE A C     1 
ATOM   2769 O O     . PHE E 3 268 ? 8.347   5.419   -5.626  1.00 7.61  ? 268  PHE A O     1 
ATOM   2770 C CB    . PHE E 3 268 ? 7.203   4.590   -2.574  1.00 8.72  ? 268  PHE A CB    1 
ATOM   2771 C CG    . PHE E 3 268 ? 6.828   3.172   -2.224  1.00 7.88  ? 268  PHE A CG    1 
ATOM   2772 C CD1   . PHE E 3 268 ? 5.933   2.439   -3.018  1.00 7.58  ? 268  PHE A CD1   1 
ATOM   2773 C CD2   . PHE E 3 268 ? 7.408   2.558   -1.104  1.00 8.57  ? 268  PHE A CD2   1 
ATOM   2774 C CE1   . PHE E 3 268 ? 5.631   1.101   -2.713  1.00 8.18  ? 268  PHE A CE1   1 
ATOM   2775 C CE2   . PHE E 3 268 ? 7.123   1.245   -0.793  1.00 7.65  ? 268  PHE A CE2   1 
ATOM   2776 C CZ    . PHE E 3 268 ? 6.224   0.515   -1.582  1.00 7.38  ? 268  PHE A CZ    1 
ATOM   2777 N N     . ALA E 3 269 ? 8.153   3.210   -5.239  1.00 7.67  ? 269  ALA A N     1 
ATOM   2778 C CA    . ALA E 3 269 ? 7.829   2.898   -6.635  1.00 8.25  ? 269  ALA A CA    1 
ATOM   2779 C C     . ALA E 3 269 ? 6.558   3.601   -7.134  1.00 8.65  ? 269  ALA A C     1 
ATOM   2780 O O     . ALA E 3 269 ? 5.640   3.862   -6.362  1.00 7.99  ? 269  ALA A O     1 
ATOM   2781 C CB    . ALA E 3 269 ? 7.693   1.401   -6.823  1.00 9.40  ? 269  ALA A CB    1 
ATOM   2782 N N     . ALA E 3 270 ? 6.513   3.879   -8.441  1.00 8.63  ? 270  ALA A N     1 
ATOM   2783 C CA    . ALA E 3 270 ? 5.262   4.218   -9.120  1.00 9.11  ? 270  ALA A CA    1 
ATOM   2784 C C     . ALA E 3 270 ? 4.266   3.076   -8.847  1.00 8.35  ? 270  ALA A C     1 
ATOM   2785 O O     . ALA E 3 270 ? 4.658   1.898   -8.722  1.00 8.08  ? 270  ALA A O     1 
ATOM   2786 C CB    . ALA E 3 270 ? 5.513   4.368   -10.605 1.00 9.45  ? 270  ALA A CB    1 
ATOM   2787 N N     . ARG E 3 271 ? 2.987   3.413   -8.728  1.00 8.26  ? 271  ARG A N     1 
ATOM   2788 C CA    . ARG E 3 271 ? 1.982   2.411   -8.356  1.00 7.79  ? 271  ARG A CA    1 
ATOM   2789 C C     . ARG E 3 271 ? 1.393   1.704   -9.570  1.00 7.82  ? 271  ARG A C     1 
ATOM   2790 O O     . ARG E 3 271 ? 1.473   2.207   -10.701 1.00 8.74  ? 271  ARG A O     1 
ATOM   2791 C CB    . ARG E 3 271 ? 0.861   3.028   -7.506  1.00 7.09  ? 271  ARG A CB    1 
ATOM   2792 C CG    . ARG E 3 271 ? 1.315   4.045   -6.442  1.00 8.43  ? 271  ARG A CG    1 
ATOM   2793 C CD    . ARG E 3 271 ? 2.463   3.515   -5.569  1.00 7.47  ? 271  ARG A CD    1 
ATOM   2794 N NE    . ARG E 3 271 ? 2.098   2.272   -4.872  1.00 7.65  ? 271  ARG A NE    1 
ATOM   2795 C CZ    . ARG E 3 271 ? 2.746   1.105   -4.958  1.00 7.75  ? 271  ARG A CZ    1 
ATOM   2796 N NH1   . ARG E 3 271 ? 3.833   0.956   -5.726  1.00 8.37  ? 271  ARG A NH1   1 
ATOM   2797 N NH2   . ARG E 3 271 ? 2.301   0.072   -4.247  1.00 6.26  ? 271  ARG A NH2   1 
ATOM   2798 N N     . SER E 3 272 ? 0.805   0.532   -9.334  1.00 7.71  ? 272  SER A N     1 
ATOM   2799 C CA    . SER E 3 272 ? 0.261   -0.280  -10.440 1.00 8.31  ? 272  SER A CA    1 
ATOM   2800 C C     . SER E 3 272 ? -0.601  0.474   -11.478 1.00 8.68  ? 272  SER A C     1 
ATOM   2801 O O     . SER E 3 272 ? -0.395  0.238   -12.671 1.00 9.81  ? 272  SER A O     1 
ATOM   2802 C CB    . SER E 3 272 ? -0.472  -1.527  -9.935  1.00 7.47  ? 272  SER A CB    1 
ATOM   2803 O OG    . SER E 3 272 ? -1.653  -1.214  -9.221  1.00 9.39  ? 272  SER A OG    1 
ATOM   2804 N N     . PRO E 3 273 ? -1.550  1.349   -11.049 1.00 9.33  ? 273  PRO A N     1 
ATOM   2805 C CA    . PRO E 3 273 ? -2.391  2.020   -12.060 1.00 9.67  ? 273  PRO A CA    1 
ATOM   2806 C C     . PRO E 3 273 ? -1.595  2.940   -12.975 1.00 9.88  ? 273  PRO A C     1 
ATOM   2807 O O     . PRO E 3 273 ? -1.962  3.099   -14.137 1.00 10.25 ? 273  PRO A O     1 
ATOM   2808 C CB    . PRO E 3 273 ? -3.397  2.830   -11.217 1.00 10.22 ? 273  PRO A CB    1 
ATOM   2809 C CG    . PRO E 3 273 ? -3.436  2.100   -9.877  1.00 10.39 ? 273  PRO A CG    1 
ATOM   2810 C CD    . PRO E 3 273 ? -1.949  1.783   -9.689  1.00 8.88  ? 273  PRO A CD    1 
ATOM   2811 N N     . GLU E 3 274 ? -0.510  3.538   -12.467 1.00 8.60  ? 274  GLU A N     1 
ATOM   2812 C CA    . GLU E 3 274 ? 0.339   4.406   -13.301 1.00 9.66  ? 274  GLU A CA    1 
ATOM   2813 C C     . GLU E 3 274 ? 0.969   3.633   -14.453 1.00 9.57  ? 274  GLU A C     1 
ATOM   2814 O O     . GLU E 3 274 ? 1.034   4.122   -15.580 1.00 8.78  ? 274  GLU A O     1 
ATOM   2815 C CB    . GLU E 3 274 ? 1.446   5.047   -12.468 1.00 8.89  ? 274  GLU A CB    1 
ATOM   2816 C CG    . GLU E 3 274 ? 0.991   5.813   -11.216 1.00 11.63 ? 274  GLU A CG    1 
ATOM   2817 C CD    . GLU E 3 274 ? 2.163   6.499   -10.499 1.00 12.58 ? 274  GLU A CD    1 
ATOM   2818 O OE1   . GLU E 3 274 ? 2.869   7.274   -11.200 1.00 13.99 ? 274  GLU A OE1   1 
ATOM   2819 O OE2   . GLU E 3 274 ? 2.387   6.265   -9.264  1.00 10.66 ? 274  GLU A OE2   1 
ATOM   2820 N N     . PHE E 3 275 ? 1.428   2.413   -14.174 1.00 9.20  ? 275  PHE A N     1 
ATOM   2821 C CA    . PHE E 3 275 ? 1.984   1.573   -15.234 1.00 9.74  ? 275  PHE A CA    1 
ATOM   2822 C C     . PHE E 3 275 ? 0.884   1.097   -16.177 1.00 10.19 ? 275  PHE A C     1 
ATOM   2823 O O     . PHE E 3 275 ? 1.056   1.139   -17.393 1.00 10.95 ? 275  PHE A O     1 
ATOM   2824 C CB    . PHE E 3 275 ? 2.678   0.357   -14.649 1.00 9.81  ? 275  PHE A CB    1 
ATOM   2825 C CG    . PHE E 3 275 ? 4.023   0.655   -14.053 1.00 8.72  ? 275  PHE A CG    1 
ATOM   2826 C CD1   . PHE E 3 275 ? 5.154   0.725   -14.872 1.00 9.84  ? 275  PHE A CD1   1 
ATOM   2827 C CD2   . PHE E 3 275 ? 4.162   0.864   -12.689 1.00 9.68  ? 275  PHE A CD2   1 
ATOM   2828 C CE1   . PHE E 3 275 ? 6.414   1.010   -14.334 1.00 10.29 ? 275  PHE A CE1   1 
ATOM   2829 C CE2   . PHE E 3 275 ? 5.403   1.139   -12.146 1.00 9.54  ? 275  PHE A CE2   1 
ATOM   2830 C CZ    . PHE E 3 275 ? 6.542   1.209   -12.988 1.00 9.51  ? 275  PHE A CZ    1 
ATOM   2831 N N     . LYS E 3 276 ? -0.240  0.659   -15.610 1.00 10.18 ? 276  LYS A N     1 
ATOM   2832 C CA    . LYS E 3 276 ? -1.327  0.066   -16.399 1.00 11.75 ? 276  LYS A CA    1 
ATOM   2833 C C     . LYS E 3 276 ? -1.858  1.005   -17.481 1.00 12.20 ? 276  LYS A C     1 
ATOM   2834 O O     . LYS E 3 276 ? -2.279  0.542   -18.534 1.00 12.74 ? 276  LYS A O     1 
ATOM   2835 C CB    . LYS E 3 276 ? -2.450  -0.400  -15.484 1.00 12.13 ? 276  LYS A CB    1 
ATOM   2836 C CG    . LYS E 3 276 ? -2.151  -1.702  -14.737 1.00 15.01 ? 276  LYS A CG    1 
ATOM   2837 C CD    . LYS E 3 276 ? -3.409  -2.133  -13.991 1.00 21.87 ? 276  LYS A CD    1 
ATOM   2838 C CE    . LYS E 3 276 ? -3.203  -3.401  -13.182 1.00 25.69 ? 276  LYS A CE    1 
ATOM   2839 N NZ    . LYS E 3 276 ? -3.413  -4.667  -13.956 1.00 30.83 ? 276  LYS A NZ    1 
ATOM   2840 N N     . LYS E 3 277 ? -1.847  2.314   -17.230 1.00 12.49 ? 277  LYS A N     1 
ATOM   2841 C CA    . LYS E 3 277 ? -2.342  3.251   -18.252 1.00 12.42 ? 277  LYS A CA    1 
ATOM   2842 C C     . LYS E 3 277 ? -1.233  3.835   -19.145 1.00 12.32 ? 277  LYS A C     1 
ATOM   2843 O O     . LYS E 3 277 ? -1.521  4.562   -20.101 1.00 12.22 ? 277  LYS A O     1 
ATOM   2844 C CB    . LYS E 3 277 ? -3.163  4.376   -17.609 1.00 13.64 ? 277  LYS A CB    1 
ATOM   2845 C CG    . LYS E 3 277 ? -2.366  5.322   -16.774 1.00 14.44 ? 277  LYS A CG    1 
ATOM   2846 C CD    . LYS E 3 277 ? -3.318  6.223   -15.984 1.00 19.76 ? 277  LYS A CD    1 
ATOM   2847 C CE    . LYS E 3 277 ? -2.574  7.443   -15.514 1.00 20.09 ? 277  LYS A CE    1 
ATOM   2848 N NZ    . LYS E 3 277 ? -3.478  8.370   -14.765 1.00 25.17 ? 277  LYS A NZ    1 
ATOM   2849 N N     . HIS E 3 278 ? 0.023   3.538   -18.834 1.00 11.27 ? 278  HIS A N     1 
ATOM   2850 C CA    . HIS E 3 278 ? 1.124   4.157   -19.567 1.00 11.10 ? 278  HIS A CA    1 
ATOM   2851 C C     . HIS E 3 278 ? 1.227   3.521   -20.974 1.00 10.92 ? 278  HIS A C     1 
ATOM   2852 O O     . HIS E 3 278 ? 1.238   2.298   -21.100 1.00 10.27 ? 278  HIS A O     1 
ATOM   2853 C CB    . HIS E 3 278 ? 2.440   4.070   -18.804 1.00 10.95 ? 278  HIS A CB    1 
ATOM   2854 C CG    . HIS E 3 278 ? 3.543   4.815   -19.472 1.00 13.10 ? 278  HIS A CG    1 
ATOM   2855 N ND1   . HIS E 3 278 ? 3.963   6.061   -19.055 1.00 16.11 ? 278  HIS A ND1   1 
ATOM   2856 C CD2   . HIS E 3 278 ? 4.273   4.517   -20.568 1.00 12.68 ? 278  HIS A CD2   1 
ATOM   2857 C CE1   . HIS E 3 278 ? 4.925   6.485   -19.853 1.00 14.55 ? 278  HIS A CE1   1 
ATOM   2858 N NE2   . HIS E 3 278 ? 5.127   5.571   -20.783 1.00 15.52 ? 278  HIS A NE2   1 
ATOM   2859 N N     . PRO E 3 279 ? 1.277   4.360   -22.032 1.00 12.38 ? 279  PRO A N     1 
ATOM   2860 C CA    . PRO E 3 279 ? 1.251   3.829   -23.416 1.00 12.44 ? 279  PRO A CA    1 
ATOM   2861 C C     . PRO E 3 279 ? 2.394   2.891   -23.788 1.00 12.56 ? 279  PRO A C     1 
ATOM   2862 O O     . PRO E 3 279 ? 2.246   2.093   -24.710 1.00 12.87 ? 279  PRO A O     1 
ATOM   2863 C CB    . PRO E 3 279 ? 1.315   5.080   -24.295 1.00 13.07 ? 279  PRO A CB    1 
ATOM   2864 C CG    . PRO E 3 279 ? 1.704   6.203   -23.407 1.00 13.58 ? 279  PRO A CG    1 
ATOM   2865 C CD    . PRO E 3 279 ? 1.277   5.834   -22.009 1.00 12.98 ? 279  PRO A CD    1 
ATOM   2866 N N     . ALA E 3 280 ? 3.508   2.992   -23.078 1.00 11.42 ? 280  ALA A N     1 
ATOM   2867 C CA    . ALA E 3 280 ? 4.660   2.108   -23.303 1.00 11.63 ? 280  ALA A CA    1 
ATOM   2868 C C     . ALA E 3 280 ? 4.503   0.702   -22.698 1.00 11.43 ? 280  ALA A C     1 
ATOM   2869 O O     . ALA E 3 280 ? 5.233   -0.221  -23.051 1.00 11.76 ? 280  ALA A O     1 
ATOM   2870 C CB    . ALA E 3 280 ? 5.936   2.755   -22.757 1.00 12.44 ? 280  ALA A CB    1 
ATOM   2871 N N     . VAL E 3 281 ? 3.567   0.554   -21.769 1.00 10.63 ? 281  VAL A N     1 
ATOM   2872 C CA    . VAL E 3 281 ? 3.424   -0.677  -21.012 1.00 10.98 ? 281  VAL A CA    1 
ATOM   2873 C C     . VAL E 3 281 ? 2.576   -1.694  -21.767 1.00 12.21 ? 281  VAL A C     1 
ATOM   2874 O O     . VAL E 3 281 ? 1.537   -1.344  -22.338 1.00 12.88 ? 281  VAL A O     1 
ATOM   2875 C CB    . VAL E 3 281 ? 2.865   -0.352  -19.597 1.00 10.82 ? 281  VAL A CB    1 
ATOM   2876 C CG1   . VAL E 3 281 ? 2.520   -1.620  -18.801 1.00 11.01 ? 281  VAL A CG1   1 
ATOM   2877 C CG2   . VAL E 3 281 ? 3.890   0.517   -18.835 1.00 9.60  ? 281  VAL A CG2   1 
ATOM   2878 N N     . ARG E 3 282 ? 3.014   -2.951  -21.752 1.00 12.58 ? 282  ARG A N     1 
ATOM   2879 C CA    . ARG E 3 282 ? 2.298   -4.054  -22.407 1.00 14.45 ? 282  ARG A CA    1 
ATOM   2880 C C     . ARG E 3 282 ? 1.993   -5.182  -21.431 1.00 15.45 ? 282  ARG A C     1 
ATOM   2881 O O     . ARG E 3 282 ? 2.584   -5.268  -20.360 1.00 15.01 ? 282  ARG A O     1 
ATOM   2882 C CB    . ARG E 3 282 ? 3.114   -4.595  -23.591 1.00 14.70 ? 282  ARG A CB    1 
ATOM   2883 C CG    . ARG E 3 282 ? 3.419   -3.579  -24.662 1.00 16.12 ? 282  ARG A CG    1 
ATOM   2884 C CD    . ARG E 3 282 ? 2.170   -3.215  -25.488 1.00 22.17 ? 282  ARG A CD    1 
ATOM   2885 N NE    . ARG E 3 282 ? 2.535   -2.290  -26.560 1.00 23.25 ? 282  ARG A NE    1 
ATOM   2886 C CZ    . ARG E 3 282 ? 2.630   -0.968  -26.412 1.00 25.59 ? 282  ARG A CZ    1 
ATOM   2887 N NH1   . ARG E 3 282 ? 2.361   -0.400  -25.245 1.00 24.17 ? 282  ARG A NH1   1 
ATOM   2888 N NH2   . ARG E 3 282 ? 2.987   -0.212  -27.437 1.00 25.31 ? 282  ARG A NH2   1 
ATOM   2889 N N     . LYS E 3 283 ? 1.050   -6.041  -21.804 1.00 17.35 ? 283  LYS A N     1 
ATOM   2890 C CA    . LYS E 3 283 ? 0.606   -7.134  -20.941 1.00 19.57 ? 283  LYS A CA    1 
ATOM   2891 C C     . LYS E 3 283 ? 1.226   -8.463  -21.376 1.00 20.12 ? 283  LYS A C     1 
ATOM   2892 O O     . LYS E 3 283 ? 0.889   -9.523  -20.856 1.00 19.88 ? 283  LYS A O     1 
ATOM   2893 C CB    . LYS E 3 283 ? -0.924  -7.225  -20.964 1.00 20.58 ? 283  LYS A CB    1 
ATOM   2894 C CG    . LYS E 3 283 ? -1.643  -5.920  -20.611 1.00 23.92 ? 283  LYS A CG    1 
ATOM   2895 C CD    . LYS E 3 283 ? -1.561  -5.621  -19.134 1.00 28.41 ? 283  LYS A CD    1 
ATOM   2896 C CE    . LYS E 3 283 ? -2.792  -6.089  -18.363 1.00 31.73 ? 283  LYS A CE    1 
ATOM   2897 N NZ    . LYS E 3 283 ? -3.275  -7.469  -18.719 1.00 32.61 ? 283  LYS A NZ    1 
ATOM   2898 N N     . GLU E 3 284 ? 2.131   -8.385  -22.342 1.00 20.86 ? 284  GLU A N     1 
ATOM   2899 C CA    . GLU E 3 284 ? 2.757   -9.558  -22.898 1.00 21.65 ? 284  GLU A CA    1 
ATOM   2900 C C     . GLU E 3 284 ? 4.221   -9.231  -23.167 1.00 21.05 ? 284  GLU A C     1 
ATOM   2901 O O     . GLU E 3 284 ? 4.550   -8.083  -23.498 1.00 20.87 ? 284  GLU A O     1 
ATOM   2902 C CB    . GLU E 3 284 ? 2.032   -9.927  -24.201 1.00 22.42 ? 284  GLU A CB    1 
ATOM   2903 C CG    . GLU E 3 284 ? 1.708   -11.402 -24.387 1.00 26.86 ? 284  GLU A CG    1 
ATOM   2904 C CD    . GLU E 3 284 ? 1.001   -12.046 -23.192 1.00 31.32 ? 284  GLU A CD    1 
ATOM   2905 O OE1   . GLU E 3 284 ? -0.108  -11.599 -22.813 1.00 34.01 ? 284  GLU A OE1   1 
ATOM   2906 O OE2   . GLU E 3 284 ? 1.550   -13.026 -22.646 1.00 33.40 ? 284  GLU A OE2   1 
ATOM   2907 N N     . PRO E 3 285 ? 5.113   -10.233 -23.025 1.00 21.15 ? 285  PRO A N     1 
ATOM   2908 C CA    . PRO E 3 285 ? 6.533   -10.029 -23.296 1.00 20.97 ? 285  PRO A CA    1 
ATOM   2909 C C     . PRO E 3 285 ? 6.765   -9.733  -24.777 1.00 21.51 ? 285  PRO A C     1 
ATOM   2910 O O     . PRO E 3 285 ? 5.896   -10.015 -25.606 1.00 21.06 ? 285  PRO A O     1 
ATOM   2911 C CB    . PRO E 3 285 ? 7.170   -11.362 -22.889 1.00 21.30 ? 285  PRO A CB    1 
ATOM   2912 C CG    . PRO E 3 285 ? 6.069   -12.340 -22.905 1.00 21.22 ? 285  PRO A CG    1 
ATOM   2913 C CD    . PRO E 3 285 ? 4.823   -11.609 -22.585 1.00 20.81 ? 285  PRO A CD    1 
ATOM   2914 N N     . GLY E 3 286 ? 7.911   -9.143  -25.096 1.00 21.58 ? 286  GLY A N     1 
ATOM   2915 C CA    . GLY E 3 286 ? 8.206   -8.795  -26.482 1.00 22.31 ? 286  GLY A CA    1 
ATOM   2916 C C     . GLY E 3 286 ? 9.598   -8.248  -26.674 1.00 22.61 ? 286  GLY A C     1 
ATOM   2917 O O     . GLY E 3 286 ? 10.302  -7.962  -25.702 1.00 22.40 ? 286  GLY A O     1 
ATOM   2918 N N     . PRO E 3 287 ? 10.009  -8.084  -27.946 1.00 23.13 ? 287  PRO A N     1 
ATOM   2919 C CA    . PRO E 3 287 ? 11.339  -7.564  -28.238 1.00 22.82 ? 287  PRO A CA    1 
ATOM   2920 C C     . PRO E 3 287 ? 11.550  -6.208  -27.572 1.00 22.11 ? 287  PRO A C     1 
ATOM   2921 O O     . PRO E 3 287 ? 10.693  -5.318  -27.673 1.00 23.26 ? 287  PRO A O     1 
ATOM   2922 C CB    . PRO E 3 287 ? 11.337  -7.422  -29.766 1.00 23.10 ? 287  PRO A CB    1 
ATOM   2923 C CG    . PRO E 3 287 ? 10.300  -8.381  -30.237 1.00 23.82 ? 287  PRO A CG    1 
ATOM   2924 C CD    . PRO E 3 287 ? 9.240   -8.375  -29.175 1.00 22.86 ? 287  PRO A CD    1 
ATOM   2925 N N     . GLY E 3 288 ? 12.665  -6.075  -26.863 1.00 21.25 ? 288  GLY A N     1 
ATOM   2926 C CA    . GLY E 3 288 ? 13.014  -4.824  -26.212 1.00 20.15 ? 288  GLY A CA    1 
ATOM   2927 C C     . GLY E 3 288 ? 12.254  -4.543  -24.923 1.00 18.89 ? 288  GLY A C     1 
ATOM   2928 O O     . GLY E 3 288 ? 12.507  -3.531  -24.288 1.00 19.57 ? 288  GLY A O     1 
ATOM   2929 N N     . LEU E 3 289 ? 11.338  -5.431  -24.544 1.00 17.52 ? 289  LEU A N     1 
ATOM   2930 C CA    . LEU E 3 289 ? 10.531  -5.246  -23.313 1.00 16.44 ? 289  LEU A CA    1 
ATOM   2931 C C     . LEU E 3 289 ? 11.142  -6.009  -22.137 1.00 15.57 ? 289  LEU A C     1 
ATOM   2932 O O     . LEU E 3 289 ? 11.683  -7.102  -22.325 1.00 15.44 ? 289  LEU A O     1 
ATOM   2933 C CB    . LEU E 3 289 ? 9.098   -5.736  -23.523 1.00 16.77 ? 289  LEU A CB    1 
ATOM   2934 C CG    . LEU E 3 289 ? 8.313   -5.109  -24.685 1.00 16.99 ? 289  LEU A CG    1 
ATOM   2935 C CD1   . LEU E 3 289 ? 6.881   -5.608  -24.660 1.00 20.74 ? 289  LEU A CD1   1 
ATOM   2936 C CD2   . LEU E 3 289 ? 8.375   -3.586  -24.613 1.00 16.98 ? 289  LEU A CD2   1 
ATOM   2937 N N     . VAL E 3 290 ? 11.066  -5.422  -20.934 1.00 13.61 ? 290  VAL A N     1 
ATOM   2938 C CA    . VAL E 3 290 ? 11.521  -6.087  -19.711 1.00 12.65 ? 290  VAL A CA    1 
ATOM   2939 C C     . VAL E 3 290 ? 10.347  -6.106  -18.718 1.00 12.18 ? 290  VAL A C     1 
ATOM   2940 O O     . VAL E 3 290 ? 9.416   -5.314  -18.857 1.00 11.74 ? 290  VAL A O     1 
ATOM   2941 C CB    . VAL E 3 290 ? 12.782  -5.394  -19.068 1.00 11.64 ? 290  VAL A CB    1 
ATOM   2942 C CG1   . VAL E 3 290 ? 13.969  -5.403  -20.047 1.00 13.71 ? 290  VAL A CG1   1 
ATOM   2943 C CG2   . VAL E 3 290 ? 12.472  -3.934  -18.601 1.00 12.87 ? 290  VAL A CG2   1 
ATOM   2944 N N     . PRO E 3 291 ? 10.378  -7.019  -17.724 1.00 11.87 ? 291  PRO A N     1 
ATOM   2945 C CA    . PRO E 3 291 ? 9.313   -6.981  -16.727 1.00 11.01 ? 291  PRO A CA    1 
ATOM   2946 C C     . PRO E 3 291 ? 9.342   -5.727  -15.847 1.00 11.14 ? 291  PRO A C     1 
ATOM   2947 O O     . PRO E 3 291 ? 10.415  -5.184  -15.499 1.00 10.97 ? 291  PRO A O     1 
ATOM   2948 C CB    . PRO E 3 291 ? 9.559   -8.239  -15.870 1.00 11.66 ? 291  PRO A CB    1 
ATOM   2949 C CG    . PRO E 3 291 ? 10.572  -9.039  -16.609 1.00 12.57 ? 291  PRO A CG    1 
ATOM   2950 C CD    . PRO E 3 291 ? 11.348  -8.086  -17.455 1.00 11.77 ? 291  PRO A CD    1 
ATOM   2951 N N     . VAL E 3 292 ? 8.145   -5.269  -15.509 1.00 10.24 ? 292  VAL A N     1 
ATOM   2952 C CA    . VAL E 3 292 ? 7.975   -4.308  -14.430 1.00 10.16 ? 292  VAL A CA    1 
ATOM   2953 C C     . VAL E 3 292 ? 8.077   -5.135  -13.154 1.00 10.19 ? 292  VAL A C     1 
ATOM   2954 O O     . VAL E 3 292 ? 7.253   -6.037  -12.900 1.00 10.65 ? 292  VAL A O     1 
ATOM   2955 C CB    . VAL E 3 292 ? 6.605   -3.592  -14.514 1.00 10.78 ? 292  VAL A CB    1 
ATOM   2956 C CG1   . VAL E 3 292 ? 6.407   -2.628  -13.358 1.00 9.52  ? 292  VAL A CG1   1 
ATOM   2957 C CG2   . VAL E 3 292 ? 6.483   -2.854  -15.832 1.00 10.55 ? 292  VAL A CG2   1 
ATOM   2958 N N     . LEU E 3 293 ? 9.096   -4.812  -12.362 1.00 10.04 ? 293  LEU A N     1 
ATOM   2959 C CA    . LEU E 3 293 ? 9.471   -5.639  -11.212 1.00 9.93  ? 293  LEU A CA    1 
ATOM   2960 C C     . LEU E 3 293 ? 8.573   -5.372  -9.999  1.00 9.67  ? 293  LEU A C     1 
ATOM   2961 O O     . LEU E 3 293 ? 8.045   -4.273  -9.830  1.00 9.00  ? 293  LEU A O     1 
ATOM   2962 C CB    . LEU E 3 293 ? 10.929  -5.380  -10.866 1.00 10.35 ? 293  LEU A CB    1 
ATOM   2963 C CG    . LEU E 3 293 ? 11.952  -5.590  -11.998 1.00 9.95  ? 293  LEU A CG    1 
ATOM   2964 C CD1   . LEU E 3 293 ? 13.361  -5.234  -11.511 1.00 11.19 ? 293  LEU A CD1   1 
ATOM   2965 C CD2   . LEU E 3 293 ? 11.892  -7.019  -12.529 1.00 10.54 ? 293  LEU A CD2   1 
ATOM   2966 N N     . THR E 3 294 ? 8.386   -6.395  -9.168  1.00 9.51  ? 294  THR A N     1 
ATOM   2967 C CA    . THR E 3 294 ? 7.656   -6.227  -7.896  1.00 9.15  ? 294  THR A CA    1 
ATOM   2968 C C     . THR E 3 294 ? 8.582   -6.683  -6.773  1.00 10.12 ? 294  THR A C     1 
ATOM   2969 O O     . THR E 3 294 ? 9.752   -6.981  -7.021  1.00 10.12 ? 294  THR A O     1 
ATOM   2970 C CB    . THR E 3 294 ? 6.387   -7.094  -7.848  1.00 9.79  ? 294  THR A CB    1 
ATOM   2971 O OG1   . THR E 3 294 ? 6.771   -8.478  -7.803  1.00 9.47  ? 294  THR A OG1   1 
ATOM   2972 C CG2   . THR E 3 294 ? 5.496   -6.836  -9.086  1.00 9.24  ? 294  THR A CG2   1 
ATOM   2973 N N     . GLY E 3 295 ? 8.047   -6.740  -5.552  1.00 9.88  ? 295  GLY A N     1 
ATOM   2974 C CA    . GLY E 3 295 ? 8.767   -7.279  -4.408  1.00 10.79 ? 295  GLY A CA    1 
ATOM   2975 C C     . GLY E 3 295 ? 9.279   -8.699  -4.602  1.00 11.66 ? 295  GLY A C     1 
ATOM   2976 O O     . GLY E 3 295 ? 10.303  -9.080  -4.029  1.00 12.39 ? 295  GLY A O     1 
ATOM   2977 N N     . ARG E 3 296 ? 8.575   -9.470  -5.422  1.00 11.17 ? 296  ARG A N     1 
ATOM   2978 C CA    . ARG E 3 296 ? 8.992   -10.846 -5.700  1.00 12.84 ? 296  ARG A CA    1 
ATOM   2979 C C     . ARG E 3 296 ? 10.300  -10.915 -6.476  1.00 12.84 ? 296  ARG A C     1 
ATOM   2980 O O     . ARG E 3 296 ? 10.990  -11.948 -6.446  1.00 13.96 ? 296  ARG A O     1 
ATOM   2981 C CB    . ARG E 3 296 ? 7.874   -11.628 -6.396  1.00 13.02 ? 296  ARG A CB    1 
ATOM   2982 C CG    . ARG E 3 296 ? 6.731   -11.947 -5.436  1.00 15.69 ? 296  ARG A CG    1 
ATOM   2983 C CD    . ARG E 3 296 ? 5.616   -12.728 -6.084  1.00 20.55 ? 296  ARG A CD    1 
ATOM   2984 N NE    . ARG E 3 296 ? 4.795   -13.371 -5.059  1.00 23.48 ? 296  ARG A NE    1 
ATOM   2985 C CZ    . ARG E 3 296 ? 3.709   -12.847 -4.506  1.00 25.23 ? 296  ARG A CZ    1 
ATOM   2986 N NH1   . ARG E 3 296 ? 3.277   -11.633 -4.855  1.00 26.55 ? 296  ARG A NH1   1 
ATOM   2987 N NH2   . ARG E 3 296 ? 3.052   -13.544 -3.580  1.00 25.63 ? 296  ARG A NH2   1 
ATOM   2988 N N     . ASN E 3 297 ? 10.652  -9.831  -7.166  1.00 11.55 ? 297  ASN A N     1 
ATOM   2989 C CA    . ASN E 3 297 ? 11.904  -9.770  -7.909  1.00 11.80 ? 297  ASN A CA    1 
ATOM   2990 C C     . ASN E 3 297 ? 13.105  -9.384  -7.042  1.00 12.01 ? 297  ASN A C     1 
ATOM   2991 O O     . ASN E 3 297 ? 14.261  -9.469  -7.491  1.00 12.37 ? 297  ASN A O     1 
ATOM   2992 C CB    . ASN E 3 297 ? 11.785  -8.791  -9.075  1.00 11.47 ? 297  ASN A CB    1 
ATOM   2993 C CG    . ASN E 3 297 ? 10.781  -9.255  -10.107 1.00 11.91 ? 297  ASN A CG    1 
ATOM   2994 O OD1   . ASN E 3 297 ? 9.622   -8.853  -10.076 1.00 11.80 ? 297  ASN A OD1   1 
ATOM   2995 N ND2   . ASN E 3 297 ? 11.210  -10.149 -11.004 1.00 11.31 ? 297  ASN A ND2   1 
ATOM   2996 N N     . LEU E 3 298 ? 12.820  -8.918  -5.829  1.00 12.28 ? 298  LEU A N     1 
ATOM   2997 C CA    . LEU E 3 298 ? 13.852  -8.426  -4.936  1.00 12.57 ? 298  LEU A CA    1 
ATOM   2998 C C     . LEU E 3 298 ? 14.275  -9.497  -3.939  1.00 13.20 ? 298  LEU A C     1 
ATOM   2999 O O     . LEU E 3 298 ? 13.464  -9.967  -3.143  1.00 13.71 ? 298  LEU A O     1 
ATOM   3000 C CB    . LEU E 3 298 ? 13.373  -7.170  -4.201  1.00 12.81 ? 298  LEU A CB    1 
ATOM   3001 C CG    . LEU E 3 298 ? 14.341  -6.603  -3.160  1.00 14.00 ? 298  LEU A CG    1 
ATOM   3002 C CD1   . LEU E 3 298 ? 15.656  -6.199  -3.808  1.00 14.82 ? 298  LEU A CD1   1 
ATOM   3003 C CD2   . LEU E 3 298 ? 13.698  -5.414  -2.477  1.00 15.37 ? 298  LEU A CD2   1 
ATOM   3004 N N     . LYS E 3 299 ? 15.545  -9.878  -4.016  1.00 14.51 ? 299  LYS A N     1 
ATOM   3005 C CA    . LYS E 3 299 ? 16.116  -10.899 -3.141  1.00 15.97 ? 299  LYS A CA    1 
ATOM   3006 C C     . LYS E 3 299 ? 17.228  -10.280 -2.304  1.00 15.83 ? 299  LYS A C     1 
ATOM   3007 O O     . LYS E 3 299 ? 17.714  -9.190  -2.609  1.00 15.16 ? 299  LYS A O     1 
ATOM   3008 C CB    . LYS E 3 299 ? 16.660  -12.068 -3.988  1.00 16.51 ? 299  LYS A CB    1 
ATOM   3009 C CG    . LYS E 3 299 ? 15.646  -12.601 -5.010  1.00 19.18 ? 299  LYS A CG    1 
ATOM   3010 C CD    . LYS E 3 299 ? 14.744  -13.632 -4.396  1.00 23.67 ? 299  LYS A CD    1 
ATOM   3011 C CE    . LYS E 3 299 ? 13.646  -14.087 -5.365  1.00 25.29 ? 299  LYS A CE    1 
ATOM   3012 N NZ    . LYS E 3 299 ? 14.082  -13.953 -6.776  1.00 27.48 ? 299  LYS A NZ    1 
ATOM   3013 N N     . PRO E 3 300 ? 17.641  -10.971 -1.223  1.00 16.68 ? 300  PRO A N     1 
ATOM   3014 C CA    . PRO E 3 300 ? 18.742  -10.351 -0.481  1.00 16.53 ? 300  PRO A CA    1 
ATOM   3015 C C     . PRO E 3 300 ? 20.033  -10.354 -1.296  1.00 16.56 ? 300  PRO A C     1 
ATOM   3016 O O     . PRO E 3 300 ? 20.591  -11.433 -1.592  1.00 16.99 ? 300  PRO A O     1 
ATOM   3017 C CB    . PRO E 3 300 ? 18.860  -11.222 0.780   1.00 17.01 ? 300  PRO A CB    1 
ATOM   3018 C CG    . PRO E 3 300 ? 17.584  -12.042 0.831   1.00 16.79 ? 300  PRO A CG    1 
ATOM   3019 C CD    . PRO E 3 300 ? 17.183  -12.226 -0.602  1.00 17.19 ? 300  PRO A CD    1 
ATOM   3020 N N     . GLY E 3 301 ? 20.459  -9.158  -1.693  1.00 15.44 ? 301  GLY A N     1 
ATOM   3021 C CA    . GLY E 3 301 ? 21.675  -8.921  -2.458  1.00 16.39 ? 301  GLY A CA    1 
ATOM   3022 C C     . GLY E 3 301 ? 21.611  -9.177  -3.950  1.00 16.76 ? 301  GLY A C     1 
ATOM   3023 O O     . GLY E 3 301 ? 22.647  -9.203  -4.625  1.00 17.90 ? 301  GLY A O     1 
ATOM   3024 N N     . TRP E 3 302 ? 20.415  -9.417  -4.480  1.00 15.78 ? 302  TRP A N     1 
ATOM   3025 C CA    . TRP E 3 302 ? 20.276  -9.539  -5.930  1.00 16.31 ? 302  TRP A CA    1 
ATOM   3026 C C     . TRP E 3 302 ? 18.854  -9.332  -6.413  1.00 16.39 ? 302  TRP A C     1 
ATOM   3027 O O     . TRP E 3 302 ? 17.890  -9.383  -5.634  1.00 15.99 ? 302  TRP A O     1 
ATOM   3028 C CB    . TRP E 3 302 ? 20.865  -10.858 -6.457  1.00 16.50 ? 302  TRP A CB    1 
ATOM   3029 C CG    . TRP E 3 302 ? 20.149  -12.101 -6.022  1.00 17.33 ? 302  TRP A CG    1 
ATOM   3030 C CD1   . TRP E 3 302 ? 20.228  -12.718 -4.807  1.00 16.97 ? 302  TRP A CD1   1 
ATOM   3031 C CD2   . TRP E 3 302 ? 19.269  -12.896 -6.823  1.00 18.89 ? 302  TRP A CD2   1 
ATOM   3032 N NE1   . TRP E 3 302 ? 19.444  -13.848 -4.800  1.00 18.93 ? 302  TRP A NE1   1 
ATOM   3033 C CE2   . TRP E 3 302 ? 18.844  -13.982 -6.026  1.00 18.47 ? 302  TRP A CE2   1 
ATOM   3034 C CE3   . TRP E 3 302 ? 18.801  -12.797 -8.141  1.00 18.34 ? 302  TRP A CE3   1 
ATOM   3035 C CZ2   . TRP E 3 302 ? 17.967  -14.966 -6.500  1.00 17.65 ? 302  TRP A CZ2   1 
ATOM   3036 C CZ3   . TRP E 3 302 ? 17.921  -13.778 -8.616  1.00 18.19 ? 302  TRP A CZ3   1 
ATOM   3037 C CH2   . TRP E 3 302 ? 17.512  -14.843 -7.796  1.00 17.76 ? 302  TRP A CH2   1 
ATOM   3038 N N     . VAL E 3 303 ? 18.746  -9.092  -7.713  1.00 15.89 ? 303  VAL A N     1 
ATOM   3039 C CA    . VAL E 3 303 ? 17.469  -8.817  -8.357  1.00 15.21 ? 303  VAL A CA    1 
ATOM   3040 C C     . VAL E 3 303 ? 17.254  -9.860  -9.444  1.00 15.54 ? 303  VAL A C     1 
ATOM   3041 O O     . VAL E 3 303 ? 18.153  -10.104 -10.263 1.00 15.42 ? 303  VAL A O     1 
ATOM   3042 C CB    . VAL E 3 303 ? 17.449  -7.388  -8.971  1.00 14.75 ? 303  VAL A CB    1 
ATOM   3043 C CG1   . VAL E 3 303 ? 16.112  -7.124  -9.681  1.00 14.68 ? 303  VAL A CG1   1 
ATOM   3044 C CG2   . VAL E 3 303 ? 17.722  -6.308  -7.898  1.00 14.83 ? 303  VAL A CG2   1 
ATOM   3045 N N     . ASP E 3 304 ? 16.085  -10.496 -9.426  1.00 15.63 ? 304  ASP A N     1 
ATOM   3046 C CA    . ASP E 3 304 ? 15.675  -11.441 -10.466 1.00 16.79 ? 304  ASP A CA    1 
ATOM   3047 C C     . ASP E 3 304 ? 15.045  -10.624 -11.591 1.00 16.37 ? 304  ASP A C     1 
ATOM   3048 O O     . ASP E 3 304 ? 13.865  -10.268 -11.527 1.00 16.83 ? 304  ASP A O     1 
ATOM   3049 C CB    . ASP E 3 304 ? 14.680  -12.469 -9.908  1.00 17.74 ? 304  ASP A CB    1 
ATOM   3050 C CG    . ASP E 3 304 ? 14.249  -13.498 -10.940 1.00 21.15 ? 304  ASP A CG    1 
ATOM   3051 O OD1   . ASP E 3 304 ? 14.468  -13.284 -12.164 1.00 24.83 ? 304  ASP A OD1   1 
ATOM   3052 O OD2   . ASP E 3 304 ? 13.677  -14.537 -10.530 1.00 27.14 ? 304  ASP A OD2   1 
ATOM   3053 N N     . TYR E 3 305 ? 15.830  -10.326 -12.623 1.00 15.07 ? 305  TYR A N     1 
ATOM   3054 C CA    . TYR E 3 305 ? 15.346  -9.463  -13.694 1.00 14.58 ? 305  TYR A CA    1 
ATOM   3055 C C     . TYR E 3 305 ? 14.451  -10.157 -14.722 1.00 15.92 ? 305  TYR A C     1 
ATOM   3056 O O     . TYR E 3 305 ? 13.862  -9.490  -15.579 1.00 15.99 ? 305  TYR A O     1 
ATOM   3057 C CB    . TYR E 3 305 ? 16.518  -8.826  -14.417 1.00 14.49 ? 305  TYR A CB    1 
ATOM   3058 C CG    . TYR E 3 305 ? 17.296  -7.816  -13.598 1.00 13.07 ? 305  TYR A CG    1 
ATOM   3059 C CD1   . TYR E 3 305 ? 16.774  -6.550  -13.337 1.00 11.91 ? 305  TYR A CD1   1 
ATOM   3060 C CD2   . TYR E 3 305 ? 18.558  -8.126  -13.102 1.00 13.40 ? 305  TYR A CD2   1 
ATOM   3061 C CE1   . TYR E 3 305 ? 17.504  -5.590  -12.606 1.00 12.61 ? 305  TYR A CE1   1 
ATOM   3062 C CE2   . TYR E 3 305 ? 19.300  -7.193  -12.380 1.00 12.20 ? 305  TYR A CE2   1 
ATOM   3063 C CZ    . TYR E 3 305 ? 18.766  -5.934  -12.120 1.00 12.70 ? 305  TYR A CZ    1 
ATOM   3064 O OH    . TYR E 3 305 ? 19.498  -5.022  -11.414 1.00 12.94 ? 305  TYR A OH    1 
ATOM   3065 N N     . GLU E 3 306 ? 14.359  -11.481 -14.655 1.00 17.12 ? 306  GLU A N     1 
ATOM   3066 C CA    . GLU E 3 306 ? 13.733  -12.230 -15.735 1.00 18.62 ? 306  GLU A CA    1 
ATOM   3067 C C     . GLU E 3 306 ? 12.283  -12.593 -15.471 1.00 18.28 ? 306  GLU A C     1 
ATOM   3068 O O     . GLU E 3 306 ? 11.466  -12.645 -16.404 1.00 18.86 ? 306  GLU A O     1 
ATOM   3069 C CB    . GLU E 3 306 ? 14.558  -13.475 -16.073 1.00 19.43 ? 306  GLU A CB    1 
ATOM   3070 C CG    . GLU E 3 306 ? 15.989  -13.171 -16.525 1.00 22.85 ? 306  GLU A CG    1 
ATOM   3071 C CD    . GLU E 3 306 ? 16.051  -12.437 -17.865 1.00 27.80 ? 306  GLU A CD    1 
ATOM   3072 O OE1   . GLU E 3 306 ? 15.203  -12.713 -18.748 1.00 31.37 ? 306  GLU A OE1   1 
ATOM   3073 O OE2   . GLU E 3 306 ? 16.952  -11.590 -18.042 1.00 29.78 ? 306  GLU A OE2   1 
ATOM   3074 N N     . LYS E 3 307 ? 11.961  -12.866 -14.213 1.00 18.03 ? 307  LYS A N     1 
ATOM   3075 C CA    . LYS E 3 307 ? 10.632  -13.385 -13.882 1.00 18.57 ? 307  LYS A CA    1 
ATOM   3076 C C     . LYS E 3 307 ? 9.628   -12.273 -13.797 1.00 17.63 ? 307  LYS A C     1 
ATOM   3077 O O     . LYS E 3 307 ? 9.893   -11.242 -13.193 1.00 18.13 ? 307  LYS A O     1 
ATOM   3078 C CB    . LYS E 3 307 ? 10.635  -14.152 -12.565 1.00 19.09 ? 307  LYS A CB    1 
ATOM   3079 C CG    . LYS E 3 307 ? 11.067  -15.560 -12.760 1.00 21.49 ? 307  LYS A CG    1 
ATOM   3080 C CD    . LYS E 3 307 ? 10.533  -16.455 -11.676 1.00 25.68 ? 307  LYS A CD    1 
ATOM   3081 C CE    . LYS E 3 307 ? 11.220  -17.793 -11.766 1.00 27.58 ? 307  LYS A CE    1 
ATOM   3082 N NZ    . LYS E 3 307 ? 12.684  -17.599 -11.921 1.00 30.61 ? 307  LYS A NZ    1 
ATOM   3083 N N     . ASN E 3 308 ? 8.464   -12.501 -14.380 1.00 16.58 ? 308  ASN A N     1 
ATOM   3084 C CA    . ASN E 3 308 ? 7.442   -11.494 -14.337 1.00 15.47 ? 308  ASN A CA    1 
ATOM   3085 C C     . ASN E 3 308 ? 6.358   -11.832 -13.324 1.00 15.12 ? 308  ASN A C     1 
ATOM   3086 O O     . ASN E 3 308 ? 5.708   -12.862 -13.439 1.00 14.98 ? 308  ASN A O     1 
ATOM   3087 C CB    . ASN E 3 308 ? 6.837   -11.293 -15.705 1.00 15.33 ? 308  ASN A CB    1 
ATOM   3088 C CG    . ASN E 3 308 ? 5.894   -10.123 -15.723 1.00 16.43 ? 308  ASN A CG    1 
ATOM   3089 O OD1   . ASN E 3 308 ? 4.800   -10.192 -15.177 1.00 17.89 ? 308  ASN A OD1   1 
ATOM   3090 N ND2   . ASN E 3 308 ? 6.327   -9.037  -16.321 1.00 13.45 ? 308  ASN A ND2   1 
ATOM   3091 N N     . HIS E 3 309 ? 6.171   -10.948 -12.346 1.00 13.65 ? 309  HIS A N     1 
ATOM   3092 C CA    . HIS E 3 309 ? 5.143   -11.114 -11.324 1.00 13.49 ? 309  HIS A CA    1 
ATOM   3093 C C     . HIS E 3 309 ? 4.047   -10.051 -11.364 1.00 13.53 ? 309  HIS A C     1 
ATOM   3094 O O     . HIS E 3 309 ? 3.085   -10.114 -10.595 1.00 14.03 ? 309  HIS A O     1 
ATOM   3095 C CB    . HIS E 3 309 ? 5.770   -11.094 -9.940  1.00 14.29 ? 309  HIS A CB    1 
ATOM   3096 C CG    . HIS E 3 309 ? 6.883   -12.077 -9.769  1.00 14.99 ? 309  HIS A CG    1 
ATOM   3097 N ND1   . HIS E 3 309 ? 6.663   -13.410 -9.498  1.00 17.56 ? 309  HIS A ND1   1 
ATOM   3098 C CD2   . HIS E 3 309 ? 8.226   -11.918 -9.825  1.00 16.37 ? 309  HIS A CD2   1 
ATOM   3099 C CE1   . HIS E 3 309 ? 7.827   -14.028 -9.386  1.00 17.08 ? 309  HIS A CE1   1 
ATOM   3100 N NE2   . HIS E 3 309 ? 8.791   -13.146 -9.580  1.00 17.53 ? 309  HIS A NE2   1 
ATOM   3101 N N     . SER E 3 310 ? 4.215   -9.055  -12.222 1.00 12.90 ? 310  SER A N     1 
ATOM   3102 C CA    . SER E 3 310 ? 3.280   -7.934  -12.309 1.00 13.42 ? 310  SER A CA    1 
ATOM   3103 C C     . SER E 3 310 ? 2.265   -8.062  -13.435 1.00 13.50 ? 310  SER A C     1 
ATOM   3104 O O     . SER E 3 310 ? 1.221   -7.390  -13.410 1.00 13.52 ? 310  SER A O     1 
ATOM   3105 C CB    . SER E 3 310 ? 4.062   -6.644  -12.557 1.00 12.65 ? 310  SER A CB    1 
ATOM   3106 O OG    . SER E 3 310 ? 4.767   -6.743  -13.790 1.00 12.33 ? 310  SER A OG    1 
ATOM   3107 N N     . GLY E 3 311 ? 2.593   -8.872  -14.442 1.00 13.66 ? 311  GLY A N     1 
ATOM   3108 C CA    . GLY E 3 311 ? 1.746   -8.984  -15.629 1.00 13.71 ? 311  GLY A CA    1 
ATOM   3109 C C     . GLY E 3 311 ? 2.039   -7.858  -16.612 1.00 13.47 ? 311  GLY A C     1 
ATOM   3110 O O     . GLY E 3 311 ? 1.361   -7.719  -17.612 1.00 15.04 ? 311  GLY A O     1 
ATOM   3111 N N     . LEU E 3 312 ? 3.054   -7.052  -16.315 1.00 12.72 ? 312  LEU A N     1 
ATOM   3112 C CA    . LEU E 3 312 ? 3.374   -5.845  -17.093 1.00 11.36 ? 312  LEU A CA    1 
ATOM   3113 C C     . LEU E 3 312 ? 4.820   -5.869  -17.599 1.00 11.90 ? 312  LEU A C     1 
ATOM   3114 O O     . LEU E 3 312 ? 5.735   -6.306  -16.896 1.00 10.68 ? 312  LEU A O     1 
ATOM   3115 C CB    . LEU E 3 312 ? 3.112   -4.574  -16.264 1.00 12.25 ? 312  LEU A CB    1 
ATOM   3116 C CG    . LEU E 3 312 ? 1.743   -4.482  -15.577 1.00 9.47  ? 312  LEU A CG    1 
ATOM   3117 C CD1   . LEU E 3 312 ? 1.672   -3.267  -14.653 1.00 11.99 ? 312  LEU A CD1   1 
ATOM   3118 C CD2   . LEU E 3 312 ? 0.626   -4.418  -16.613 1.00 11.18 ? 312  LEU A CD2   1 
ATOM   3119 N N     . TRP E 3 313 ? 4.993   -5.355  -18.818 1.00 11.68 ? 313  TRP A N     1 
ATOM   3120 C CA    . TRP E 3 313 ? 6.249   -5.319  -19.533 1.00 12.49 ? 313  TRP A CA    1 
ATOM   3121 C C     . TRP E 3 313 ? 6.395   -3.956  -20.179 1.00 12.58 ? 313  TRP A C     1 
ATOM   3122 O O     . TRP E 3 313 ? 5.401   -3.361  -20.636 1.00 12.41 ? 313  TRP A O     1 
ATOM   3123 C CB    . TRP E 3 313 ? 6.230   -6.352  -20.662 1.00 14.39 ? 313  TRP A CB    1 
ATOM   3124 C CG    . TRP E 3 313 ? 6.525   -7.735  -20.204 1.00 16.61 ? 313  TRP A CG    1 
ATOM   3125 C CD1   . TRP E 3 313 ? 7.759   -8.328  -20.137 1.00 17.71 ? 313  TRP A CD1   1 
ATOM   3126 C CD2   . TRP E 3 313 ? 5.586   -8.704  -19.751 1.00 19.07 ? 313  TRP A CD2   1 
ATOM   3127 N NE1   . TRP E 3 313 ? 7.639   -9.603  -19.669 1.00 20.43 ? 313  TRP A NE1   1 
ATOM   3128 C CE2   . TRP E 3 313 ? 6.316   -9.870  -19.432 1.00 19.38 ? 313  TRP A CE2   1 
ATOM   3129 C CE3   . TRP E 3 313 ? 4.200   -8.706  -19.581 1.00 19.39 ? 313  TRP A CE3   1 
ATOM   3130 C CZ2   . TRP E 3 313 ? 5.705   -11.025 -18.947 1.00 20.99 ? 313  TRP A CZ2   1 
ATOM   3131 C CZ3   . TRP E 3 313 ? 3.587   -9.858  -19.102 1.00 20.16 ? 313  TRP A CZ3   1 
ATOM   3132 C CH2   . TRP E 3 313 ? 4.339   -10.999 -18.782 1.00 19.38 ? 313  TRP A CH2   1 
ATOM   3133 N N     . MET E 3 314 ? 7.630   -3.459  -20.258 1.00 12.22 ? 314  MET A N     1 
ATOM   3134 C CA    . MET E 3 314 ? 7.863   -2.189  -20.939 1.00 12.78 ? 314  MET A CA    1 
ATOM   3135 C C     . MET E 3 314 ? 9.309   -2.020  -21.355 1.00 13.04 ? 314  MET A C     1 
ATOM   3136 O O     . MET E 3 314 ? 10.191  -2.737  -20.828 1.00 12.34 ? 314  MET A O     1 
ATOM   3137 C CB    . MET E 3 314 ? 7.436   -1.006  -20.050 1.00 12.21 ? 314  MET A CB    1 
ATOM   3138 C CG    . MET E 3 314 ? 8.416   -0.688  -18.904 1.00 12.47 ? 314  MET A CG    1 
ATOM   3139 S SD    . MET E 3 314 ? 7.851   0.703   -17.900 1.00 12.89 ? 314  MET A SD    1 
ATOM   3140 C CE    . MET E 3 314 ? 8.039   2.122   -18.996 1.00 13.62 ? 314  MET A CE    1 
ATOM   3141 N N     . PRO E 3 315 ? 9.573   -1.078  -22.281 1.00 13.51 ? 315  PRO A N     1 
ATOM   3142 C CA    . PRO E 3 315 ? 10.981  -0.819  -22.585 1.00 13.94 ? 315  PRO A CA    1 
ATOM   3143 C C     . PRO E 3 315 ? 11.666  -0.227  -21.338 1.00 13.66 ? 315  PRO A C     1 
ATOM   3144 O O     . PRO E 3 315 ? 11.145  0.721   -20.721 1.00 12.46 ? 315  PRO A O     1 
ATOM   3145 C CB    . PRO E 3 315 ? 10.916  0.222   -23.710 1.00 13.74 ? 315  PRO A CB    1 
ATOM   3146 C CG    . PRO E 3 315 ? 9.490   0.142   -24.258 1.00 13.53 ? 315  PRO A CG    1 
ATOM   3147 C CD    . PRO E 3 315 ? 8.663   -0.205  -23.062 1.00 14.21 ? 315  PRO A CD    1 
ATOM   3148 N N     . LYS E 3 316 ? 12.803  -0.815  -20.959 1.00 14.64 ? 316  LYS A N     1 
ATOM   3149 C CA    . LYS E 3 316 ? 13.588  -0.334  -19.827 1.00 15.58 ? 316  LYS A CA    1 
ATOM   3150 C C     . LYS E 3 316 ? 13.834  1.177   -19.899 1.00 15.28 ? 316  LYS A C     1 
ATOM   3151 O O     . LYS E 3 316 ? 13.724  1.864   -18.890 1.00 14.89 ? 316  LYS A O     1 
ATOM   3152 C CB    . LYS E 3 316 ? 14.927  -1.103  -19.756 1.00 15.87 ? 316  LYS A CB    1 
ATOM   3153 C CG    . LYS E 3 316 ? 15.650  -1.009  -18.409 1.00 18.17 ? 316  LYS A CG    1 
ATOM   3154 C CD    . LYS E 3 316 ? 17.127  -1.466  -18.503 1.00 16.90 ? 316  LYS A CD    1 
ATOM   3155 C CE    . LYS E 3 316 ? 18.049  -0.311  -18.888 1.00 18.70 ? 316  LYS A CE    1 
ATOM   3156 N NZ    . LYS E 3 316 ? 18.184  0.716   -17.801 1.00 19.19 ? 316  LYS A NZ    1 
ATOM   3157 N N     . GLU E 3 317 ? 14.167  1.691   -21.089 1.00 15.36 ? 317  GLU A N     1 
ATOM   3158 C CA    . GLU E 3 317 ? 14.559  3.097   -21.242 1.00 15.82 ? 317  GLU A CA    1 
ATOM   3159 C C     . GLU E 3 317 ? 13.405  4.080   -21.004 1.00 15.11 ? 317  GLU A C     1 
ATOM   3160 O O     . GLU E 3 317 ? 13.635  5.268   -20.799 1.00 15.62 ? 317  GLU A O     1 
ATOM   3161 C CB    . GLU E 3 317 ? 15.154  3.333   -22.647 1.00 15.39 ? 317  GLU A CB    1 
ATOM   3162 C CG    . GLU E 3 317 ? 14.130  3.201   -23.762 1.00 16.95 ? 317  GLU A CG    1 
ATOM   3163 C CD    . GLU E 3 317 ? 14.740  3.220   -25.154 1.00 19.48 ? 317  GLU A CD    1 
ATOM   3164 O OE1   . GLU E 3 317 ? 15.986  3.207   -25.284 1.00 20.91 ? 317  GLU A OE1   1 
ATOM   3165 O OE2   . GLU E 3 317 ? 13.954  3.246   -26.127 1.00 24.27 ? 317  GLU A OE2   1 
ATOM   3166 N N     . ARG E 3 318 ? 12.169  3.580   -21.061 1.00 14.26 ? 318  ARG A N     1 
ATOM   3167 C CA    . ARG E 3 318 ? 11.006  4.443   -20.875 1.00 13.91 ? 318  ARG A CA    1 
ATOM   3168 C C     . ARG E 3 318 ? 10.554  4.480   -19.410 1.00 13.25 ? 318  ARG A C     1 
ATOM   3169 O O     . ARG E 3 318 ? 9.636   5.219   -19.079 1.00 12.66 ? 318  ARG A O     1 
ATOM   3170 C CB    . ARG E 3 318 ? 9.853   3.997   -21.781 1.00 14.39 ? 318  ARG A CB    1 
ATOM   3171 C CG    . ARG E 3 318 ? 10.077  4.409   -23.241 1.00 16.88 ? 318  ARG A CG    1 
ATOM   3172 C CD    . ARG E 3 318 ? 9.102   5.527   -23.597 1.00 22.66 ? 318  ARG A CD    1 
ATOM   3173 N NE    . ARG E 3 318 ? 8.072   4.998   -24.442 1.00 25.66 ? 318  ARG A NE    1 
ATOM   3174 C CZ    . ARG E 3 318 ? 6.884   5.533   -24.698 1.00 22.21 ? 318  ARG A CZ    1 
ATOM   3175 N NH1   . ARG E 3 318 ? 6.445   6.649   -24.118 1.00 21.74 ? 318  ARG A NH1   1 
ATOM   3176 N NH2   . ARG E 3 318 ? 6.115   4.875   -25.536 1.00 23.07 ? 318  ARG A NH2   1 
ATOM   3177 N N     . ALA E 3 319 ? 11.220  3.695   -18.558 1.00 12.58 ? 319  ALA A N     1 
ATOM   3178 C CA    . ALA E 3 319 ? 10.882  3.635   -17.126 1.00 13.09 ? 319  ALA A CA    1 
ATOM   3179 C C     . ALA E 3 319 ? 10.959  5.027   -16.499 1.00 12.75 ? 319  ALA A C     1 
ATOM   3180 O O     . ALA E 3 319 ? 10.138  5.391   -15.639 1.00 12.92 ? 319  ALA A O     1 
ATOM   3181 C CB    . ALA E 3 319 ? 11.798  2.629   -16.380 1.00 12.72 ? 319  ALA A CB    1 
ATOM   3182 N N     . LYS E 3 320 ? 11.937  5.822   -16.945 1.00 12.33 ? 320  LYS A N     1 
ATOM   3183 C CA    . LYS E 3 320 ? 12.135  7.168   -16.393 1.00 12.93 ? 320  LYS A CA    1 
ATOM   3184 C C     . LYS E 3 320 ? 10.939  8.115   -16.568 1.00 12.50 ? 320  LYS A C     1 
ATOM   3185 O O     . LYS E 3 320 ? 10.856  9.144   -15.891 1.00 12.68 ? 320  LYS A O     1 
ATOM   3186 C CB    . LYS E 3 320 ? 13.420  7.809   -16.935 1.00 12.13 ? 320  LYS A CB    1 
ATOM   3187 C CG    . LYS E 3 320 ? 13.440  8.033   -18.444 1.00 13.88 ? 320  LYS A CG    1 
ATOM   3188 C CD    . LYS E 3 320 ? 14.727  8.734   -18.798 1.00 16.38 ? 320  LYS A CD    1 
ATOM   3189 C CE    . LYS E 3 320 ? 14.770  9.119   -20.263 1.00 18.20 ? 320  LYS A CE    1 
ATOM   3190 N NZ    . LYS E 3 320 ? 14.829  7.928   -21.158 1.00 22.63 ? 320  LYS A NZ    1 
ATOM   3191 N N     . GLU E 3 321 ? 10.024  7.777   -17.485 1.00 12.24 ? 321  GLU A N     1 
ATOM   3192 C CA    . GLU E 3 321 ? 8.828   8.576   -17.692 1.00 12.98 ? 321  GLU A CA    1 
ATOM   3193 C C     . GLU E 3 321 ? 7.865   8.436   -16.514 1.00 13.21 ? 321  GLU A C     1 
ATOM   3194 O O     . GLU E 3 321 ? 7.053   9.322   -16.291 1.00 14.64 ? 321  GLU A O     1 
ATOM   3195 C CB    . GLU E 3 321 ? 8.120   8.203   -18.986 1.00 13.18 ? 321  GLU A CB    1 
ATOM   3196 C CG    . GLU E 3 321 ? 8.950   8.567   -20.228 1.00 15.45 ? 321  GLU A CG    1 
ATOM   3197 C CD    . GLU E 3 321 ? 8.409   7.940   -21.502 1.00 18.24 ? 321  GLU A CD    1 
ATOM   3198 O OE1   . GLU E 3 321 ? 7.175   7.774   -21.639 1.00 17.17 ? 321  GLU A OE1   1 
ATOM   3199 O OE2   . GLU E 3 321 ? 9.239   7.604   -22.377 1.00 17.99 ? 321  GLU A OE2   1 
ATOM   3200 N N     . LEU E 3 322 ? 7.969   7.335   -15.773 1.00 13.05 ? 322  LEU A N     1 
ATOM   3201 C CA    . LEU E 3 322 ? 7.153   7.147   -14.564 1.00 13.05 ? 322  LEU A CA    1 
ATOM   3202 C C     . LEU E 3 322 ? 7.843   7.731   -13.322 1.00 13.09 ? 322  LEU A C     1 
ATOM   3203 O O     . LEU E 3 322 ? 7.234   8.470   -12.560 1.00 13.31 ? 322  LEU A O     1 
ATOM   3204 C CB    . LEU E 3 322 ? 6.802   5.680   -14.361 1.00 13.18 ? 322  LEU A CB    1 
ATOM   3205 C CG    . LEU E 3 322 ? 5.743   5.195   -15.375 1.00 14.99 ? 322  LEU A CG    1 
ATOM   3206 C CD1   . LEU E 3 322 ? 6.405   4.438   -16.506 1.00 15.74 ? 322  LEU A CD1   1 
ATOM   3207 C CD2   . LEU E 3 322 ? 4.694   4.347   -14.710 1.00 18.50 ? 322  LEU A CD2   1 
ATOM   3208 N N     . ARG E 3 323 ? 9.116   7.403   -13.134 1.00 13.11 ? 323  ARG A N     1 
ATOM   3209 C CA    . ARG E 3 323 ? 9.933   8.071   -12.111 1.00 13.06 ? 323  ARG A CA    1 
ATOM   3210 C C     . ARG E 3 323 ? 11.324  8.316   -12.674 1.00 13.28 ? 323  ARG A C     1 
ATOM   3211 O O     . ARG E 3 323 ? 11.969  7.390   -13.161 1.00 13.16 ? 323  ARG A O     1 
ATOM   3212 C CB    . ARG E 3 323 ? 10.062  7.221   -10.850 1.00 12.58 ? 323  ARG A CB    1 
ATOM   3213 C CG    . ARG E 3 323 ? 8.769   7.045   -10.035 1.00 13.17 ? 323  ARG A CG    1 
ATOM   3214 C CD    . ARG E 3 323 ? 8.230   8.342   -9.425  1.00 12.80 ? 323  ARG A CD    1 
ATOM   3215 N NE    . ARG E 3 323 ? 7.055   8.080   -8.575  1.00 12.89 ? 323  ARG A NE    1 
ATOM   3216 C CZ    . ARG E 3 323 ? 5.820   7.851   -9.041  1.00 12.31 ? 323  ARG A CZ    1 
ATOM   3217 N NH1   . ARG E 3 323 ? 5.578   7.854   -10.357 1.00 14.65 ? 323  ARG A NH1   1 
ATOM   3218 N NH2   . ARG E 3 323 ? 4.823   7.602   -8.193  1.00 10.94 ? 323  ARG A NH2   1 
ATOM   3219 N N     . ASP E 3 324 ? 11.789  9.548   -12.545 1.00 14.68 ? 324  ASP A N     1 
ATOM   3220 C CA    . ASP E 3 324 ? 13.100  9.917   -13.083 1.00 16.13 ? 324  ASP A CA    1 
ATOM   3221 C C     . ASP E 3 324 ? 14.241  9.021   -12.596 1.00 15.55 ? 324  ASP A C     1 
ATOM   3222 O O     . ASP E 3 324 ? 15.176  8.739   -13.346 1.00 15.96 ? 324  ASP A O     1 
ATOM   3223 C CB    . ASP E 3 324 ? 13.401  11.398  -12.833 1.00 17.25 ? 324  ASP A CB    1 
ATOM   3224 C CG    . ASP E 3 324 ? 13.423  11.778  -11.354 1.00 20.75 ? 324  ASP A CG    1 
ATOM   3225 O OD1   . ASP E 3 324 ? 13.790  12.943  -11.081 1.00 26.60 ? 324  ASP A OD1   1 
ATOM   3226 O OD2   . ASP E 3 324 ? 13.080  10.958  -10.462 1.00 24.32 ? 324  ASP A OD2   1 
ATOM   3227 N N     . PHE E 3 325 ? 14.150  8.564   -11.354 1.00 14.45 ? 325  PHE A N     1 
ATOM   3228 C CA    . PHE E 3 325 ? 15.205  7.742   -10.762 1.00 14.56 ? 325  PHE A CA    1 
ATOM   3229 C C     . PHE E 3 325 ? 15.320  6.314   -11.252 1.00 13.33 ? 325  PHE A C     1 
ATOM   3230 O O     . PHE E 3 325 ? 16.275  5.619   -10.901 1.00 14.45 ? 325  PHE A O     1 
ATOM   3231 C CB    . PHE E 3 325 ? 15.131  7.771   -9.237  1.00 14.50 ? 325  PHE A CB    1 
ATOM   3232 C CG    . PHE E 3 325 ? 13.842  7.226   -8.662  1.00 14.10 ? 325  PHE A CG    1 
ATOM   3233 C CD1   . PHE E 3 325 ? 13.600  5.864   -8.615  1.00 14.82 ? 325  PHE A CD1   1 
ATOM   3234 C CD2   . PHE E 3 325 ? 12.893  8.084   -8.138  1.00 14.58 ? 325  PHE A CD2   1 
ATOM   3235 C CE1   . PHE E 3 325 ? 12.401  5.366   -8.062  1.00 13.96 ? 325  PHE A CE1   1 
ATOM   3236 C CE2   . PHE E 3 325 ? 11.705  7.592   -7.575  1.00 11.68 ? 325  PHE A CE2   1 
ATOM   3237 C CZ    . PHE E 3 325 ? 11.471  6.239   -7.538  1.00 13.99 ? 325  PHE A CZ    1 
ATOM   3238 N N     . TYR E 3 326 ? 14.367  5.853   -12.072 1.00 13.16 ? 326  TYR A N     1 
ATOM   3239 C CA    . TYR E 3 326 ? 14.475  4.529   -12.681 1.00 13.26 ? 326  TYR A CA    1 
ATOM   3240 C C     . TYR E 3 326 ? 15.583  4.482   -13.762 1.00 13.26 ? 326  TYR A C     1 
ATOM   3241 O O     . TYR E 3 326 ? 15.939  3.407   -14.241 1.00 14.91 ? 326  TYR A O     1 
ATOM   3242 C CB    . TYR E 3 326 ? 13.154  4.088   -13.315 1.00 12.88 ? 326  TYR A CB    1 
ATOM   3243 C CG    . TYR E 3 326 ? 12.019  3.769   -12.345 1.00 12.17 ? 326  TYR A CG    1 
ATOM   3244 C CD1   . TYR E 3 326 ? 12.269  3.189   -11.108 1.00 13.64 ? 326  TYR A CD1   1 
ATOM   3245 C CD2   . TYR E 3 326 ? 10.685  3.981   -12.716 1.00 13.74 ? 326  TYR A CD2   1 
ATOM   3246 C CE1   . TYR E 3 326 ? 11.227  2.870   -10.233 1.00 13.09 ? 326  TYR A CE1   1 
ATOM   3247 C CE2   . TYR E 3 326 ? 9.639   3.659   -11.854 1.00 11.32 ? 326  TYR A CE2   1 
ATOM   3248 C CZ    . TYR E 3 326 ? 9.922   3.100   -10.615 1.00 13.24 ? 326  TYR A CZ    1 
ATOM   3249 O OH    . TYR E 3 326 ? 8.897   2.792   -9.742  1.00 12.09 ? 326  TYR A OH    1 
ATOM   3250 N N     . ALA E 3 327 ? 16.073  5.646   -14.155 1.00 13.95 ? 327  ALA A N     1 
ATOM   3251 C CA    . ALA E 3 327 ? 17.112  5.745   -15.188 1.00 14.99 ? 327  ALA A CA    1 
ATOM   3252 C C     . ALA E 3 327 ? 18.494  5.465   -14.610 1.00 15.87 ? 327  ALA A C     1 
ATOM   3253 O O     . ALA E 3 327 ? 19.438  5.208   -15.371 1.00 16.52 ? 327  ALA A O     1 
ATOM   3254 C CB    . ALA E 3 327 ? 17.084  7.133   -15.821 1.00 15.21 ? 327  ALA A CB    1 
ATOM   3255 N N     . THR E 3 328 ? 18.598  5.477   -13.278 1.00 15.76 ? 328  THR A N     1 
ATOM   3256 C CA    . THR E 3 328 ? 19.876  5.461   -12.557 1.00 16.57 ? 328  THR A CA    1 
ATOM   3257 C C     . THR E 3 328 ? 20.014  4.200   -11.675 1.00 15.13 ? 328  THR A C     1 
ATOM   3258 O O     . THR E 3 328 ? 19.111  3.915   -10.889 1.00 14.97 ? 328  THR A O     1 
ATOM   3259 C CB    . THR E 3 328 ? 19.940  6.701   -11.619 1.00 16.84 ? 328  THR A CB    1 
ATOM   3260 O OG1   . THR E 3 328 ? 19.648  7.893   -12.361 1.00 21.54 ? 328  THR A OG1   1 
ATOM   3261 C CG2   . THR E 3 328 ? 21.284  6.833   -10.956 1.00 19.41 ? 328  THR A CG2   1 
ATOM   3262 N N     . PRO E 3 329 ? 21.134  3.451   -11.783 1.00 14.35 ? 329  PRO A N     1 
ATOM   3263 C CA    . PRO E 3 329 ? 21.340  2.338   -10.826 1.00 13.59 ? 329  PRO A CA    1 
ATOM   3264 C C     . PRO E 3 329 ? 21.272  2.857   -9.390  1.00 13.49 ? 329  PRO A C     1 
ATOM   3265 O O     . PRO E 3 329 ? 21.788  3.945   -9.079  1.00 12.54 ? 329  PRO A O     1 
ATOM   3266 C CB    . PRO E 3 329 ? 22.750  1.833   -11.149 1.00 14.43 ? 329  PRO A CB    1 
ATOM   3267 C CG    . PRO E 3 329 ? 22.939  2.216   -12.609 1.00 14.91 ? 329  PRO A CG    1 
ATOM   3268 C CD    . PRO E 3 329 ? 22.235  3.538   -12.763 1.00 14.31 ? 329  PRO A CD    1 
ATOM   3269 N N     . HIS E 3 330 ? 20.588  2.110   -8.533  1.00 13.24 ? 330  HIS A N     1 
ATOM   3270 C CA    . HIS E 3 330 ? 20.376  2.581   -7.177  1.00 12.69 ? 330  HIS A CA    1 
ATOM   3271 C C     . HIS E 3 330 ? 19.956  1.464   -6.220  1.00 11.95 ? 330  HIS A C     1 
ATOM   3272 O O     . HIS E 3 330 ? 19.577  0.354   -6.635  1.00 11.95 ? 330  HIS A O     1 
ATOM   3273 C CB    . HIS E 3 330 ? 19.335  3.719   -7.150  1.00 13.24 ? 330  HIS A CB    1 
ATOM   3274 C CG    . HIS E 3 330 ? 17.955  3.258   -7.504  1.00 14.23 ? 330  HIS A CG    1 
ATOM   3275 N ND1   . HIS E 3 330 ? 17.488  3.232   -8.806  1.00 13.93 ? 330  HIS A ND1   1 
ATOM   3276 C CD2   . HIS E 3 330 ? 16.967  2.732   -6.737  1.00 14.42 ? 330  HIS A CD2   1 
ATOM   3277 C CE1   . HIS E 3 330 ? 16.269  2.724   -8.818  1.00 14.22 ? 330  HIS A CE1   1 
ATOM   3278 N NE2   . HIS E 3 330 ? 15.922  2.434   -7.574  1.00 14.04 ? 330  HIS A NE2   1 
ATOM   3279 N N     . LEU E 3 331 ? 19.985  1.808   -4.934  1.00 11.98 ? 331  LEU A N     1 
ATOM   3280 C CA    . LEU E 3 331 ? 19.634  0.893   -3.859  1.00 12.09 ? 331  LEU A CA    1 
ATOM   3281 C C     . LEU E 3 331 ? 18.118  0.752   -3.740  1.00 11.17 ? 331  LEU A C     1 
ATOM   3282 O O     . LEU E 3 331 ? 17.384  1.755   -3.698  1.00 10.94 ? 331  LEU A O     1 
ATOM   3283 C CB    . LEU E 3 331 ? 20.238  1.413   -2.545  1.00 11.53 ? 331  LEU A CB    1 
ATOM   3284 C CG    . LEU E 3 331 ? 19.993  0.672   -1.229  1.00 14.31 ? 331  LEU A CG    1 
ATOM   3285 C CD1   . LEU E 3 331 ? 20.658  -0.694  -1.228  1.00 16.07 ? 331  LEU A CD1   1 
ATOM   3286 C CD2   . LEU E 3 331 ? 20.471  1.527   -0.066  1.00 13.76 ? 331  LEU A CD2   1 
ATOM   3287 N N     . VAL E 3 332 ? 17.675  -0.501  -3.675  1.00 11.62 ? 332  VAL A N     1 
ATOM   3288 C CA    . VAL E 3 332 ? 16.262  -0.857  -3.489  1.00 10.67 ? 332  VAL A CA    1 
ATOM   3289 C C     . VAL E 3 332 ? 16.119  -1.667  -2.185  1.00 10.82 ? 332  VAL A C     1 
ATOM   3290 O O     . VAL E 3 332 ? 16.901  -2.578  -1.935  1.00 10.51 ? 332  VAL A O     1 
ATOM   3291 C CB    . VAL E 3 332 ? 15.714  -1.700  -4.704  1.00 11.15 ? 332  VAL A CB    1 
ATOM   3292 C CG1   . VAL E 3 332 ? 14.202  -1.980  -4.557  1.00 11.10 ? 332  VAL A CG1   1 
ATOM   3293 C CG2   . VAL E 3 332 ? 16.007  -0.996  -6.025  1.00 11.21 ? 332  VAL A CG2   1 
ATOM   3294 N N     . VAL E 3 333 ? 15.127  -1.323  -1.368  1.00 10.27 ? 333  VAL A N     1 
ATOM   3295 C CA    . VAL E 3 333 ? 14.867  -2.028  -0.103  1.00 10.16 ? 333  VAL A CA    1 
ATOM   3296 C C     . VAL E 3 333 ? 13.406  -2.471  -0.076  1.00 10.05 ? 333  VAL A C     1 
ATOM   3297 O O     . VAL E 3 333 ? 12.513  -1.699  -0.498  1.00 9.91  ? 333  VAL A O     1 
ATOM   3298 C CB    . VAL E 3 333 ? 15.140  -1.113  1.107   1.00 10.51 ? 333  VAL A CB    1 
ATOM   3299 C CG1   . VAL E 3 333 ? 14.819  -1.854  2.451   1.00 10.08 ? 333  VAL A CG1   1 
ATOM   3300 C CG2   . VAL E 3 333 ? 16.588  -0.603  1.078   1.00 10.48 ? 333  VAL A CG2   1 
ATOM   3301 N N     . ALA E 3 334 ? 13.174  -3.691  0.415   1.00 9.57  ? 334  ALA A N     1 
ATOM   3302 C CA    . ALA E 3 334 ? 11.847  -4.321  0.407   1.00 10.51 ? 334  ALA A CA    1 
ATOM   3303 C C     . ALA E 3 334 ? 10.860  -3.666  1.370   1.00 10.60 ? 334  ALA A C     1 
ATOM   3304 O O     . ALA E 3 334 ? 11.257  -3.166  2.439   1.00 11.13 ? 334  ALA A O     1 
ATOM   3305 C CB    . ALA E 3 334 ? 11.960  -5.841  0.702   1.00 10.83 ? 334  ALA A CB    1 
ATOM   3306 N N     . HIS E 3 335 ? 9.588   -3.678  0.985   1.00 10.40 ? 335  HIS A N     1 
ATOM   3307 C CA    . HIS E 3 335 ? 8.500   -3.158  1.838   1.00 10.41 ? 335  HIS A CA    1 
ATOM   3308 C C     . HIS E 3 335 ? 7.590   -4.249  2.397   1.00 10.97 ? 335  HIS A C     1 
ATOM   3309 O O     . HIS E 3 335 ? 7.004   -4.063  3.464   1.00 10.68 ? 335  HIS A O     1 
ATOM   3310 C CB    . HIS E 3 335 ? 7.675   -2.125  1.047   1.00 11.13 ? 335  HIS A CB    1 
ATOM   3311 C CG    . HIS E 3 335 ? 6.507   -1.533  1.796   1.00 10.53 ? 335  HIS A CG    1 
ATOM   3312 N ND1   . HIS E 3 335 ? 6.632   -0.914  3.024   1.00 8.76  ? 335  HIS A ND1   1 
ATOM   3313 C CD2   . HIS E 3 335 ? 5.203   -1.408  1.447   1.00 12.11 ? 335  HIS A CD2   1 
ATOM   3314 C CE1   . HIS E 3 335 ? 5.451   -0.457  3.409   1.00 9.78  ? 335  HIS A CE1   1 
ATOM   3315 N NE2   . HIS E 3 335 ? 4.567   -0.729  2.460   1.00 12.89 ? 335  HIS A NE2   1 
ATOM   3316 N N     . THR E 3 336 ? 7.459   -5.374  1.692   1.00 11.58 ? 336  THR A N     1 
ATOM   3317 C CA    . THR E 3 336 ? 6.454   -6.377  2.072   1.00 12.17 ? 336  THR A CA    1 
ATOM   3318 C C     . THR E 3 336 ? 7.068   -7.776  2.157   1.00 12.42 ? 336  THR A C     1 
ATOM   3319 O O     . THR E 3 336 ? 6.626   -8.738  1.493   1.00 12.75 ? 336  THR A O     1 
ATOM   3320 C CB    . THR E 3 336 ? 5.196   -6.287  1.160   1.00 12.28 ? 336  THR A CB    1 
ATOM   3321 O OG1   . THR E 3 336 ? 4.778   -4.908  1.050   1.00 11.49 ? 336  THR A OG1   1 
ATOM   3322 C CG2   . THR E 3 336 ? 4.024   -7.123  1.725   1.00 12.57 ? 336  THR A CG2   1 
ATOM   3323 N N     . LYS E 3 337 ? 8.092   -7.868  3.005   1.00 12.40 ? 337  LYS A N     1 
ATOM   3324 C CA    . LYS E 3 337 ? 8.695   -9.140  3.365   1.00 12.77 ? 337  LYS A CA    1 
ATOM   3325 C C     . LYS E 3 337 ? 8.662   -9.344  4.871   1.00 13.65 ? 337  LYS A C     1 
ATOM   3326 O O     . LYS E 3 337 ? 9.485   -10.076 5.410   1.00 15.16 ? 337  LYS A O     1 
ATOM   3327 C CB    . LYS E 3 337 ? 10.120  -9.206  2.826   1.00 12.24 ? 337  LYS A CB    1 
ATOM   3328 C CG    . LYS E 3 337 ? 10.133  -9.302  1.291   1.00 12.25 ? 337  LYS A CG    1 
ATOM   3329 C CD    . LYS E 3 337 ? 11.534  -9.246  0.706   1.00 15.23 ? 337  LYS A CD    1 
ATOM   3330 C CE    . LYS E 3 337 ? 11.432  -8.975  -0.803  1.00 14.77 ? 337  LYS A CE    1 
ATOM   3331 N NZ    . LYS E 3 337 ? 11.389  -10.234 -1.588  1.00 19.37 ? 337  LYS A NZ    1 
ATOM   3332 N N     . GLY E 3 338 ? 7.712   -8.682  5.541   1.00 12.85 ? 338  GLY A N     1 
ATOM   3333 C CA    . GLY E 3 338 ? 7.634   -8.700  6.990   1.00 13.01 ? 338  GLY A CA    1 
ATOM   3334 C C     . GLY E 3 338 ? 8.639   -7.757  7.643   1.00 13.38 ? 338  GLY A C     1 
ATOM   3335 O O     . GLY E 3 338 ? 9.193   -6.858  6.986   1.00 12.62 ? 338  GLY A O     1 
ATOM   3336 N N     . THR E 3 339 ? 8.896   -7.988  8.924   1.00 14.15 ? 339  THR A N     1 
ATOM   3337 C CA    . THR E 3 339 ? 9.849   -7.177  9.697   1.00 15.70 ? 339  THR A CA    1 
ATOM   3338 C C     . THR E 3 339 ? 11.249  -7.667  9.424   1.00 14.92 ? 339  THR A C     1 
ATOM   3339 O O     . THR E 3 339 ? 11.839  -8.441  10.207  1.00 15.45 ? 339  THR A O     1 
ATOM   3340 C CB    . THR E 3 339 ? 9.620   -7.311  11.211  1.00 16.16 ? 339  THR A CB    1 
ATOM   3341 O OG1   . THR E 3 339 ? 8.239   -7.172  11.489  1.00 18.16 ? 339  THR A OG1   1 
ATOM   3342 C CG2   . THR E 3 339 ? 10.408  -6.233  11.974  1.00 17.76 ? 339  THR A CG2   1 
ATOM   3343 N N     . ARG E 3 340 ? 11.779  -7.206  8.303   1.00 13.27 ? 340  ARG A N     1 
ATOM   3344 C CA    . ARG E 3 340 ? 13.040  -7.674  7.761   1.00 14.15 ? 340  ARG A CA    1 
ATOM   3345 C C     . ARG E 3 340 ? 13.579  -6.499  6.971   1.00 12.93 ? 340  ARG A C     1 
ATOM   3346 O O     . ARG E 3 340 ? 12.802  -5.643  6.527   1.00 12.17 ? 340  ARG A O     1 
ATOM   3347 C CB    . ARG E 3 340 ? 12.813  -8.834  6.781   1.00 13.74 ? 340  ARG A CB    1 
ATOM   3348 C CG    . ARG E 3 340 ? 12.301  -10.160 7.381   1.00 17.57 ? 340  ARG A CG    1 
ATOM   3349 C CD    . ARG E 3 340 ? 12.265  -11.244 6.286   1.00 18.47 ? 340  ARG A CD    1 
ATOM   3350 N NE    . ARG E 3 340 ? 13.546  -11.297 5.575   1.00 26.87 ? 340  ARG A NE    1 
ATOM   3351 C CZ    . ARG E 3 340 ? 13.931  -12.256 4.730   1.00 29.12 ? 340  ARG A CZ    1 
ATOM   3352 N NH1   . ARG E 3 340 ? 15.128  -12.183 4.151   1.00 30.53 ? 340  ARG A NH1   1 
ATOM   3353 N NH2   . ARG E 3 340 ? 13.134  -13.285 4.458   1.00 32.30 ? 340  ARG A NH2   1 
ATOM   3354 N N     . VAL E 3 341 ? 14.898  -6.474  6.791   1.00 12.12 ? 341  VAL A N     1 
ATOM   3355 C CA    . VAL E 3 341 ? 15.541  -5.529  5.885   1.00 11.72 ? 341  VAL A CA    1 
ATOM   3356 C C     . VAL E 3 341 ? 16.155  -6.357  4.775   1.00 11.63 ? 341  VAL A C     1 
ATOM   3357 O O     . VAL E 3 341 ? 17.066  -7.152  5.019   1.00 11.83 ? 341  VAL A O     1 
ATOM   3358 C CB    . VAL E 3 341 ? 16.613  -4.669  6.596   1.00 11.91 ? 341  VAL A CB    1 
ATOM   3359 C CG1   . VAL E 3 341 ? 17.175  -3.620  5.633   1.00 12.39 ? 341  VAL A CG1   1 
ATOM   3360 C CG2   . VAL E 3 341 ? 16.012  -3.974  7.791   1.00 10.63 ? 341  VAL A CG2   1 
ATOM   3361 N N     . VAL E 3 342 ? 15.594  -6.225  3.576   1.00 11.40 ? 342  VAL A N     1 
ATOM   3362 C CA    . VAL E 3 342 ? 16.094  -6.964  2.399   1.00 11.44 ? 342  VAL A CA    1 
ATOM   3363 C C     . VAL E 3 342 ? 16.437  -5.925  1.360   1.00 11.50 ? 342  VAL A C     1 
ATOM   3364 O O     . VAL E 3 342 ? 15.582  -5.128  0.986   1.00 10.67 ? 342  VAL A O     1 
ATOM   3365 C CB    . VAL E 3 342 ? 15.046  -7.939  1.846   1.00 11.76 ? 342  VAL A CB    1 
ATOM   3366 C CG1   . VAL E 3 342 ? 15.561  -8.611  0.586   1.00 11.77 ? 342  VAL A CG1   1 
ATOM   3367 C CG2   . VAL E 3 342 ? 14.687  -8.999  2.915   1.00 11.16 ? 342  VAL A CG2   1 
ATOM   3368 N N     . ALA E 3 343 ? 17.686  -5.933  0.897   1.00 11.42 ? 343  ALA A N     1 
ATOM   3369 C CA    . ALA E 3 343 ? 18.175  -4.877  0.015   1.00 10.93 ? 343  ALA A CA    1 
ATOM   3370 C C     . ALA E 3 343 ? 18.991  -5.438  -1.150  1.00 11.10 ? 343  ALA A C     1 
ATOM   3371 O O     . ALA E 3 343 ? 19.582  -6.513  -1.052  1.00 11.71 ? 343  ALA A O     1 
ATOM   3372 C CB    . ALA E 3 343 ? 18.993  -3.859  0.810   1.00 10.69 ? 343  ALA A CB    1 
ATOM   3373 N N     . ALA E 3 344 ? 18.980  -4.719  -2.269  1.00 11.18 ? 344  ALA A N     1 
ATOM   3374 C CA    . ALA E 3 344 ? 19.819  -5.069  -3.410  1.00 11.01 ? 344  ALA A CA    1 
ATOM   3375 C C     . ALA E 3 344 ? 20.121  -3.814  -4.211  1.00 11.71 ? 344  ALA A C     1 
ATOM   3376 O O     . ALA E 3 344 ? 19.365  -2.836  -4.175  1.00 10.76 ? 344  ALA A O     1 
ATOM   3377 C CB    . ALA E 3 344 ? 19.149  -6.114  -4.279  1.00 11.34 ? 344  ALA A CB    1 
ATOM   3378 N N     . TRP E 3 345 ? 21.239  -3.849  -4.923  1.00 12.05 ? 345  TRP A N     1 
ATOM   3379 C CA    . TRP E 3 345 ? 21.599  -2.755  -5.801  1.00 12.98 ? 345  TRP A CA    1 
ATOM   3380 C C     . TRP E 3 345 ? 21.007  -3.111  -7.150  1.00 12.52 ? 345  TRP A C     1 
ATOM   3381 O O     . TRP E 3 345 ? 21.298  -4.180  -7.707  1.00 13.79 ? 345  TRP A O     1 
ATOM   3382 C CB    . TRP E 3 345 ? 23.111  -2.664  -5.912  1.00 14.20 ? 345  TRP A CB    1 
ATOM   3383 C CG    . TRP E 3 345 ? 23.587  -1.500  -6.688  1.00 14.63 ? 345  TRP A CG    1 
ATOM   3384 C CD1   . TRP E 3 345 ? 24.119  -1.519  -7.955  1.00 16.57 ? 345  TRP A CD1   1 
ATOM   3385 C CD2   . TRP E 3 345 ? 23.622  -0.136  -6.255  1.00 16.75 ? 345  TRP A CD2   1 
ATOM   3386 N NE1   . TRP E 3 345 ? 24.474  -0.244  -8.329  1.00 16.86 ? 345  TRP A NE1   1 
ATOM   3387 C CE2   . TRP E 3 345 ? 24.181  0.623   -7.309  1.00 16.96 ? 345  TRP A CE2   1 
ATOM   3388 C CE3   . TRP E 3 345 ? 23.243  0.523   -5.075  1.00 16.64 ? 345  TRP A CE3   1 
ATOM   3389 C CZ2   . TRP E 3 345 ? 24.356  2.009   -7.222  1.00 16.64 ? 345  TRP A CZ2   1 
ATOM   3390 C CZ3   . TRP E 3 345 ? 23.421  1.901   -4.988  1.00 17.32 ? 345  TRP A CZ3   1 
ATOM   3391 C CH2   . TRP E 3 345 ? 23.972  2.627   -6.057  1.00 16.16 ? 345  TRP A CH2   1 
ATOM   3392 N N     . ASP E 3 346 ? 20.127  -2.253  -7.650  1.00 12.70 ? 346  ASP A N     1 
ATOM   3393 C CA    . ASP E 3 346 ? 19.601  -2.433  -8.997  1.00 12.21 ? 346  ASP A CA    1 
ATOM   3394 C C     . ASP E 3 346 ? 20.610  -1.891  -10.006 1.00 12.19 ? 346  ASP A C     1 
ATOM   3395 O O     . ASP E 3 346 ? 20.574  -0.714  -10.371 1.00 11.90 ? 346  ASP A O     1 
ATOM   3396 C CB    . ASP E 3 346 ? 18.270  -1.724  -9.180  1.00 12.14 ? 346  ASP A CB    1 
ATOM   3397 C CG    . ASP E 3 346 ? 17.690  -1.932  -10.565 1.00 11.58 ? 346  ASP A CG    1 
ATOM   3398 O OD1   . ASP E 3 346 ? 18.337  -2.613  -11.404 1.00 12.39 ? 346  ASP A OD1   1 
ATOM   3399 O OD2   . ASP E 3 346 ? 16.570  -1.438  -10.815 1.00 12.56 ? 346  ASP A OD2   1 
ATOM   3400 N N     . GLU E 3 347 ? 21.476  -2.784  -10.475 1.00 13.75 ? 347  GLU A N     1 
ATOM   3401 C CA    . GLU E 3 347 ? 22.578  -2.396  -11.353 1.00 15.81 ? 347  GLU A CA    1 
ATOM   3402 C C     . GLU E 3 347 ? 22.093  -1.994  -12.751 1.00 15.13 ? 347  GLU A C     1 
ATOM   3403 O O     . GLU E 3 347 ? 22.721  -1.158  -13.420 1.00 15.46 ? 347  GLU A O     1 
ATOM   3404 C CB    . GLU E 3 347 ? 23.623  -3.519  -11.422 1.00 15.60 ? 347  GLU A CB    1 
ATOM   3405 C CG    . GLU E 3 347 ? 23.286  -4.712  -12.287 1.00 19.93 ? 347  GLU A CG    1 
ATOM   3406 C CD    . GLU E 3 347 ? 24.250  -5.865  -12.073 1.00 20.96 ? 347  GLU A CD    1 
ATOM   3407 O OE1   . GLU E 3 347 ? 25.397  -5.606  -11.634 1.00 28.95 ? 347  GLU A OE1   1 
ATOM   3408 O OE2   . GLU E 3 347 ? 23.859  -7.027  -12.335 1.00 27.18 ? 347  GLU A OE2   1 
ATOM   3409 N N     . ARG E 3 348 ? 20.980  -2.592  -13.169 1.00 14.05 ? 348  ARG A N     1 
ATOM   3410 C CA    . ARG E 3 348 ? 20.474  -2.428  -14.543 1.00 13.85 ? 348  ARG A CA    1 
ATOM   3411 C C     . ARG E 3 348 ? 19.566  -1.217  -14.699 1.00 13.98 ? 348  ARG A C     1 
ATOM   3412 O O     . ARG E 3 348 ? 19.430  -0.689  -15.807 1.00 14.64 ? 348  ARG A O     1 
ATOM   3413 C CB    . ARG E 3 348 ? 19.720  -3.668  -14.986 1.00 13.90 ? 348  ARG A CB    1 
ATOM   3414 C CG    . ARG E 3 348 ? 20.564  -4.912  -15.066 1.00 14.59 ? 348  ARG A CG    1 
ATOM   3415 C CD    . ARG E 3 348 ? 19.849  -5.941  -15.878 1.00 15.65 ? 348  ARG A CD    1 
ATOM   3416 N NE    . ARG E 3 348 ? 20.483  -7.245  -15.766 1.00 16.56 ? 348  ARG A NE    1 
ATOM   3417 C CZ    . ARG E 3 348 ? 19.986  -8.354  -16.294 1.00 18.88 ? 348  ARG A CZ    1 
ATOM   3418 N NH1   . ARG E 3 348 ? 18.848  -8.315  -16.971 1.00 18.38 ? 348  ARG A NH1   1 
ATOM   3419 N NH2   . ARG E 3 348 ? 20.634  -9.505  -16.154 1.00 21.67 ? 348  ARG A NH2   1 
ATOM   3420 N N     . ALA E 3 349 ? 18.962  -0.783  -13.590 1.00 12.87 ? 349  ALA A N     1 
ATOM   3421 C CA    . ALA E 3 349 ? 18.037  0.359   -13.541 1.00 12.64 ? 349  ALA A CA    1 
ATOM   3422 C C     . ALA E 3 349 ? 16.733  0.042   -14.293 1.00 12.12 ? 349  ALA A C     1 
ATOM   3423 O O     . ALA E 3 349 ? 16.475  0.535   -15.407 1.00 11.91 ? 349  ALA A O     1 
ATOM   3424 C CB    . ALA E 3 349 ? 18.694  1.679   -14.022 1.00 13.52 ? 349  ALA A CB    1 
ATOM   3425 N N     . TYR E 3 350 ? 15.920  -0.804  -13.658 1.00 11.20 ? 350  TYR A N     1 
ATOM   3426 C CA    . TYR E 3 350 ? 14.688  -1.294  -14.249 1.00 10.48 ? 350  TYR A CA    1 
ATOM   3427 C C     . TYR E 3 350 ? 13.458  -0.549  -13.716 1.00 9.88  ? 350  TYR A C     1 
ATOM   3428 O O     . TYR E 3 350 ? 13.522  0.170   -12.715 1.00 9.73  ? 350  TYR A O     1 
ATOM   3429 C CB    . TYR E 3 350 ? 14.506  -2.779  -13.909 1.00 10.95 ? 350  TYR A CB    1 
ATOM   3430 C CG    . TYR E 3 350 ? 14.978  -3.777  -14.951 1.00 8.66  ? 350  TYR A CG    1 
ATOM   3431 C CD1   . TYR E 3 350 ? 16.190  -3.602  -15.632 1.00 10.84 ? 350  TYR A CD1   1 
ATOM   3432 C CD2   . TYR E 3 350 ? 14.221  -4.919  -15.226 1.00 10.71 ? 350  TYR A CD2   1 
ATOM   3433 C CE1   . TYR E 3 350 ? 16.627  -4.543  -16.558 1.00 9.58  ? 350  TYR A CE1   1 
ATOM   3434 C CE2   . TYR E 3 350 ? 14.654  -5.868  -16.148 1.00 11.91 ? 350  TYR A CE2   1 
ATOM   3435 C CZ    . TYR E 3 350 ? 15.851  -5.665  -16.814 1.00 10.43 ? 350  TYR A CZ    1 
ATOM   3436 O OH    . TYR E 3 350 ? 16.262  -6.624  -17.710 1.00 11.97 ? 350  TYR A OH    1 
ATOM   3437 N N     . PRO E 3 351 ? 12.321  -0.729  -14.398 1.00 9.68  ? 351  PRO A N     1 
ATOM   3438 C CA    . PRO E 3 351 ? 11.073  -0.220  -13.845 1.00 9.23  ? 351  PRO A CA    1 
ATOM   3439 C C     . PRO E 3 351 ? 10.614  -1.113  -12.693 1.00 8.45  ? 351  PRO A C     1 
ATOM   3440 O O     . PRO E 3 351 ? 10.630  -2.350  -12.827 1.00 9.62  ? 351  PRO A O     1 
ATOM   3441 C CB    . PRO E 3 351 ? 10.101  -0.347  -15.009 1.00 9.12  ? 351  PRO A CB    1 
ATOM   3442 C CG    . PRO E 3 351 ? 10.654  -1.430  -15.891 1.00 8.33  ? 351  PRO A CG    1 
ATOM   3443 C CD    . PRO E 3 351 ? 12.134  -1.437  -15.688 1.00 10.08 ? 351  PRO A CD    1 
ATOM   3444 N N     . TRP E 3 352 ? 10.203  -0.488  -11.586 1.00 9.40  ? 352  TRP A N     1 
ATOM   3445 C CA    . TRP E 3 352 ? 9.650   -1.205  -10.449 1.00 9.17  ? 352  TRP A CA    1 
ATOM   3446 C C     . TRP E 3 352 ? 8.253   -0.731  -10.147 1.00 8.61  ? 352  TRP A C     1 
ATOM   3447 O O     . TRP E 3 352 ? 7.992   0.476   -10.173 1.00 9.38  ? 352  TRP A O     1 
ATOM   3448 C CB    . TRP E 3 352 ? 10.489  -0.946  -9.187  1.00 8.82  ? 352  TRP A CB    1 
ATOM   3449 C CG    . TRP E 3 352 ? 11.852  -1.511  -9.208  1.00 10.32 ? 352  TRP A CG    1 
ATOM   3450 C CD1   . TRP E 3 352 ? 12.955  -0.996  -9.842  1.00 9.54  ? 352  TRP A CD1   1 
ATOM   3451 C CD2   . TRP E 3 352 ? 12.297  -2.683  -8.505  1.00 10.91 ? 352  TRP A CD2   1 
ATOM   3452 N NE1   . TRP E 3 352 ? 14.063  -1.789  -9.580  1.00 9.72  ? 352  TRP A NE1   1 
ATOM   3453 C CE2   . TRP E 3 352 ? 13.682  -2.838  -8.778  1.00 10.54 ? 352  TRP A CE2   1 
ATOM   3454 C CE3   . TRP E 3 352 ? 11.648  -3.638  -7.697  1.00 11.56 ? 352  TRP A CE3   1 
ATOM   3455 C CZ2   . TRP E 3 352 ? 14.442  -3.907  -8.245  1.00 9.98  ? 352  TRP A CZ2   1 
ATOM   3456 C CZ3   . TRP E 3 352 ? 12.411  -4.710  -7.161  1.00 10.29 ? 352  TRP A CZ3   1 
ATOM   3457 C CH2   . TRP E 3 352 ? 13.789  -4.832  -7.458  1.00 10.98 ? 352  TRP A CH2   1 
ATOM   3458 N N     . ARG E 3 353 ? 7.388   -1.678  -9.789  1.00 8.12  ? 353  ARG A N     1 
ATOM   3459 C CA    . ARG E 3 353 ? 6.017   -1.394  -9.361  1.00 8.44  ? 353  ARG A CA    1 
ATOM   3460 C C     . ARG E 3 353 ? 5.897   -1.392  -7.834  1.00 8.22  ? 353  ARG A C     1 
ATOM   3461 O O     . ARG E 3 353 ? 4.839   -1.070  -7.285  1.00 7.43  ? 353  ARG A O     1 
ATOM   3462 C CB    . ARG E 3 353 ? 5.090   -2.472  -9.932  1.00 8.73  ? 353  ARG A CB    1 
ATOM   3463 C CG    . ARG E 3 353 ? 3.637   -2.056  -10.100 1.00 10.88 ? 353  ARG A CG    1 
ATOM   3464 C CD    . ARG E 3 353 ? 2.713   -3.289  -10.068 1.00 11.36 ? 353  ARG A CD    1 
ATOM   3465 N NE    . ARG E 3 353 ? 2.626   -3.830  -8.708  1.00 12.91 ? 353  ARG A NE    1 
ATOM   3466 C CZ    . ARG E 3 353 ? 2.204   -5.054  -8.381  1.00 13.73 ? 353  ARG A CZ    1 
ATOM   3467 N NH1   . ARG E 3 353 ? 1.789   -5.924  -9.304  1.00 13.12 ? 353  ARG A NH1   1 
ATOM   3468 N NH2   . ARG E 3 353 ? 2.186   -5.402  -7.108  1.00 10.42 ? 353  ARG A NH2   1 
ATOM   3469 N N     . GLU E 3 354 ? 6.968   -1.820  -7.150  1.00 8.32  ? 354  GLU A N     1 
ATOM   3470 C CA    . GLU E 3 354 ? 6.981   -1.870  -5.685  1.00 7.74  ? 354  GLU A CA    1 
ATOM   3471 C C     . GLU E 3 354 ? 8.356   -1.492  -5.128  1.00 8.03  ? 354  GLU A C     1 
ATOM   3472 O O     . GLU E 3 354 ? 9.339   -1.332  -5.891  1.00 8.08  ? 354  GLU A O     1 
ATOM   3473 C CB    . GLU E 3 354 ? 6.534   -3.253  -5.176  1.00 8.04  ? 354  GLU A CB    1 
ATOM   3474 C CG    . GLU E 3 354 ? 5.146   -3.728  -5.697  1.00 7.43  ? 354  GLU A CG    1 
ATOM   3475 C CD    . GLU E 3 354 ? 3.972   -2.807  -5.272  1.00 7.43  ? 354  GLU A CD    1 
ATOM   3476 O OE1   . GLU E 3 354 ? 4.131   -1.998  -4.324  1.00 8.24  ? 354  GLU A OE1   1 
ATOM   3477 O OE2   . GLU E 3 354 ? 2.899   -2.889  -5.904  1.00 9.29  ? 354  GLU A OE2   1 
ATOM   3478 N N     . GLU E 3 355 ? 8.392   -1.349  -3.797  1.00 8.15  ? 355  GLU A N     1 
ATOM   3479 C CA    . GLU E 3 355 ? 9.600   -1.184  -2.970  1.00 7.62  ? 355  GLU A CA    1 
ATOM   3480 C C     . GLU E 3 355 ? 10.071  0.258   -2.802  1.00 7.96  ? 355  GLU A C     1 
ATOM   3481 O O     . GLU E 3 355 ? 9.600   1.158   -3.505  1.00 7.81  ? 355  GLU A O     1 
ATOM   3482 C CB    . GLU E 3 355 ? 10.757  -2.109  -3.435  1.00 8.81  ? 355  GLU A CB    1 
ATOM   3483 C CG    . GLU E 3 355 ? 10.387  -3.586  -3.698  1.00 8.76  ? 355  GLU A CG    1 
ATOM   3484 C CD    . GLU E 3 355 ? 9.831   -4.315  -2.474  1.00 10.69 ? 355  GLU A CD    1 
ATOM   3485 O OE1   . GLU E 3 355 ? 8.980   -3.726  -1.742  1.00 11.70 ? 355  GLU A OE1   1 
ATOM   3486 O OE2   . GLU E 3 355 ? 10.226  -5.502  -2.267  1.00 13.78 ? 355  GLU A OE2   1 
ATOM   3487 N N     . PHE E 3 356 ? 10.948  0.456   -1.807  1.00 8.25  ? 356  PHE A N     1 
ATOM   3488 C CA    . PHE E 3 356 ? 11.649  1.717   -1.601  1.00 8.28  ? 356  PHE A CA    1 
ATOM   3489 C C     . PHE E 3 356 ? 12.858  1.852   -2.514  1.00 8.49  ? 356  PHE A C     1 
ATOM   3490 O O     . PHE E 3 356 ? 13.598  0.883   -2.781  1.00 9.17  ? 356  PHE A O     1 
ATOM   3491 C CB    . PHE E 3 356 ? 12.135  1.834   -0.161  1.00 8.25  ? 356  PHE A CB    1 
ATOM   3492 C CG    . PHE E 3 356 ? 11.043  1.699   0.858   1.00 6.80  ? 356  PHE A CG    1 
ATOM   3493 C CD1   . PHE E 3 356 ? 10.169  2.769   1.117   1.00 7.98  ? 356  PHE A CD1   1 
ATOM   3494 C CD2   . PHE E 3 356 ? 10.917  0.521   1.585   1.00 7.48  ? 356  PHE A CD2   1 
ATOM   3495 C CE1   . PHE E 3 356 ? 9.157   2.630   2.100   1.00 7.64  ? 356  PHE A CE1   1 
ATOM   3496 C CE2   . PHE E 3 356 ? 9.922   0.382   2.559   1.00 7.91  ? 356  PHE A CE2   1 
ATOM   3497 C CZ    . PHE E 3 356 ? 9.060   1.417   2.823   1.00 9.03  ? 356  PHE A CZ    1 
ATOM   3498 N N     . HIS E 3 357 ? 13.072  3.084   -2.942  1.00 8.44  ? 357  HIS A N     1 
ATOM   3499 C CA    . HIS E 3 357 ? 14.130  3.429   -3.890  1.00 8.75  ? 357  HIS A CA    1 
ATOM   3500 C C     . HIS E 3 357 ? 14.914  4.571   -3.259  1.00 9.35  ? 357  HIS A C     1 
ATOM   3501 O O     . HIS E 3 357 ? 14.358  5.635   -2.984  1.00 10.28 ? 357  HIS A O     1 
ATOM   3502 C CB    . HIS E 3 357 ? 13.491  3.763   -5.252  1.00 8.92  ? 357  HIS A CB    1 
ATOM   3503 C CG    . HIS E 3 357 ? 12.798  2.573   -5.841  1.00 9.56  ? 357  HIS A CG    1 
ATOM   3504 N ND1   . HIS E 3 357 ? 13.448  1.662   -6.641  1.00 9.21  ? 357  HIS A ND1   1 
ATOM   3505 C CD2   . HIS E 3 357 ? 11.572  2.051   -5.599  1.00 11.33 ? 357  HIS A CD2   1 
ATOM   3506 C CE1   . HIS E 3 357 ? 12.630  0.661   -6.926  1.00 11.58 ? 357  HIS A CE1   1 
ATOM   3507 N NE2   . HIS E 3 357 ? 11.483  0.871   -6.299  1.00 10.33 ? 357  HIS A NE2   1 
ATOM   3508 N N     . LEU E 3 358 ? 16.172  4.282   -2.954  1.00 10.76 ? 358  LEU A N     1 
ATOM   3509 C CA    . LEU E 3 358 ? 17.023  5.157   -2.164  1.00 12.60 ? 358  LEU A CA    1 
ATOM   3510 C C     . LEU E 3 358 ? 18.057  5.791   -3.066  1.00 13.03 ? 358  LEU A C     1 
ATOM   3511 O O     . LEU E 3 358 ? 18.821  5.094   -3.742  1.00 13.53 ? 358  LEU A O     1 
ATOM   3512 C CB    . LEU E 3 358 ? 17.701  4.399   -1.009  1.00 13.25 ? 358  LEU A CB    1 
ATOM   3513 C CG    . LEU E 3 358 ? 16.795  3.978   0.163   1.00 13.35 ? 358  LEU A CG    1 
ATOM   3514 C CD1   . LEU E 3 358 ? 15.823  2.910   -0.261  1.00 15.42 ? 358  LEU A CD1   1 
ATOM   3515 C CD2   . LEU E 3 358 ? 17.644  3.477   1.323   1.00 14.62 ? 358  LEU A CD2   1 
ATOM   3516 N N     . LEU E 3 359 ? 18.031  7.115   -3.078  1.00 14.69 ? 359  LEU A N     1 
ATOM   3517 C CA    . LEU E 3 359 ? 18.928  7.914   -3.904  1.00 16.39 ? 359  LEU A CA    1 
ATOM   3518 C C     . LEU E 3 359 ? 19.849  8.716   -2.972  1.00 16.20 ? 359  LEU A C     1 
ATOM   3519 O O     . LEU E 3 359 ? 19.350  9.462   -2.124  1.00 15.80 ? 359  LEU A O     1 
ATOM   3520 C CB    . LEU E 3 359 ? 18.111  8.858   -4.793  1.00 17.28 ? 359  LEU A CB    1 
ATOM   3521 C CG    . LEU E 3 359 ? 16.837  8.377   -5.528  1.00 19.95 ? 359  LEU A CG    1 
ATOM   3522 C CD1   . LEU E 3 359 ? 17.053  7.059   -6.259  1.00 23.38 ? 359  LEU A CD1   1 
ATOM   3523 C CD2   . LEU E 3 359 ? 15.620  8.288   -4.620  1.00 24.16 ? 359  LEU A CD2   1 
ATOM   3524 N N     . PRO E 3 360 ? 21.182  8.560   -3.124  1.00 17.51 ? 360  PRO A N     1 
ATOM   3525 C CA    . PRO E 3 360 ? 22.116  9.197   -2.181  1.00 18.36 ? 360  PRO A CA    1 
ATOM   3526 C C     . PRO E 3 360 ? 22.019  10.715  -2.249  1.00 19.09 ? 360  PRO A C     1 
ATOM   3527 O O     . PRO E 3 360 ? 21.832  11.284  -3.329  1.00 19.68 ? 360  PRO A O     1 
ATOM   3528 C CB    . PRO E 3 360 ? 23.498  8.713   -2.658  1.00 18.35 ? 360  PRO A CB    1 
ATOM   3529 C CG    . PRO E 3 360 ? 23.294  8.314   -4.086  1.00 18.76 ? 360  PRO A CG    1 
ATOM   3530 C CD    . PRO E 3 360 ? 21.891  7.772   -4.150  1.00 17.88 ? 360  PRO A CD    1 
ATOM   3531 N N     . LYS E 3 361 ? 22.091  11.362  -1.089  1.00 19.57 ? 361  LYS A N     1 
ATOM   3532 C CA    . LYS E 3 361 ? 22.026  12.810  -1.020  1.00 20.79 ? 361  LYS A CA    1 
ATOM   3533 C C     . LYS E 3 361 ? 23.342  13.407  -1.517  1.00 21.67 ? 361  LYS A C     1 
ATOM   3534 O O     . LYS E 3 361 ? 24.359  12.722  -1.575  1.00 21.66 ? 361  LYS A O     1 
ATOM   3535 C CB    . LYS E 3 361 ? 21.722  13.266  0.405   1.00 20.06 ? 361  LYS A CB    1 
ATOM   3536 C CG    . LYS E 3 361 ? 20.391  12.728  0.917   1.00 19.23 ? 361  LYS A CG    1 
ATOM   3537 C CD    . LYS E 3 361 ? 19.883  13.480  2.129   1.00 18.46 ? 361  LYS A CD    1 
ATOM   3538 C CE    . LYS E 3 361 ? 18.498  12.982  2.484   1.00 19.21 ? 361  LYS A CE    1 
ATOM   3539 N NZ    . LYS E 3 361 ? 18.012  13.501  3.786   1.00 21.14 ? 361  LYS A NZ    1 
ATOM   3540 N N     . GLU E 3 362 ? 23.302  14.677  -1.895  1.00 23.56 ? 362  GLU A N     1 
ATOM   3541 C CA    . GLU E 3 362 ? 24.501  15.377  -2.378  1.00 25.45 ? 362  GLU A CA    1 
ATOM   3542 C C     . GLU E 3 362 ? 25.622  15.249  -1.348  1.00 25.15 ? 362  GLU A C     1 
ATOM   3543 O O     . GLU E 3 362 ? 25.384  15.438  -0.154  1.00 25.66 ? 362  GLU A O     1 
ATOM   3544 C CB    . GLU E 3 362 ? 24.178  16.850  -2.624  1.00 26.32 ? 362  GLU A CB    1 
ATOM   3545 C CG    . GLU E 3 362 ? 25.257  17.615  -3.410  1.00 30.80 ? 362  GLU A CG    1 
ATOM   3546 C CD    . GLU E 3 362 ? 25.604  16.942  -4.734  1.00 36.25 ? 362  GLU A CD    1 
ATOM   3547 O OE1   . GLU E 3 362 ? 24.676  16.514  -5.465  1.00 39.48 ? 362  GLU A OE1   1 
ATOM   3548 O OE2   . GLU E 3 362 ? 26.810  16.838  -5.046  1.00 39.64 ? 362  GLU A OE2   1 
ATOM   3549 N N     . GLY E 3 363 ? 26.819  14.879  -1.805  1.00 25.39 ? 363  GLY A N     1 
ATOM   3550 C CA    . GLY E 3 363 ? 27.983  14.751  -0.918  1.00 25.17 ? 363  GLY A CA    1 
ATOM   3551 C C     . GLY E 3 363 ? 28.139  13.413  -0.217  1.00 25.27 ? 363  GLY A C     1 
ATOM   3552 O O     . GLY E 3 363 ? 29.085  13.218  0.567   1.00 25.53 ? 363  GLY A O     1 
ATOM   3553 N N     . VAL E 3 364 ? 27.215  12.488  -0.477  1.00 24.25 ? 364  VAL A N     1 
ATOM   3554 C CA    . VAL E 3 364 ? 27.281  11.164  0.139   1.00 24.12 ? 364  VAL A CA    1 
ATOM   3555 C C     . VAL E 3 364 ? 28.138  10.223  -0.693  1.00 24.50 ? 364  VAL A C     1 
ATOM   3556 O O     . VAL E 3 364 ? 27.918  10.072  -1.895  1.00 24.45 ? 364  VAL A O     1 
ATOM   3557 C CB    . VAL E 3 364 ? 25.879  10.565  0.386   1.00 23.58 ? 364  VAL A CB    1 
ATOM   3558 C CG1   . VAL E 3 364 ? 25.985  9.128   0.917   1.00 23.34 ? 364  VAL A CG1   1 
ATOM   3559 C CG2   . VAL E 3 364 ? 25.118  11.434  1.379   1.00 22.52 ? 364  VAL A CG2   1 
ATOM   3560 N N     . ARG E 3 365 ? 29.122  9.615   -0.034  1.00 25.40 ? 365  ARG A N     1 
ATOM   3561 C CA    . ARG E 3 365 ? 29.948  8.557   -0.611  1.00 26.70 ? 365  ARG A CA    1 
ATOM   3562 C C     . ARG E 3 365 ? 29.437  7.203   -0.122  1.00 26.81 ? 365  ARG A C     1 
ATOM   3563 O O     . ARG E 3 365 ? 29.186  7.022   1.075   1.00 26.86 ? 365  ARG A O     1 
ATOM   3564 C CB    . ARG E 3 365 ? 31.422  8.733   -0.208  1.00 27.13 ? 365  ARG A CB    1 
ATOM   3565 C CG    . ARG E 3 365 ? 32.214  9.698   -1.101  1.00 30.79 ? 365  ARG A CG    1 
ATOM   3566 C CD    . ARG E 3 365 ? 32.025  11.152  -0.672  1.00 36.61 ? 365  ARG A CD    1 
ATOM   3567 N NE    . ARG E 3 365 ? 32.238  12.120  -1.755  1.00 39.66 ? 365  ARG A NE    1 
ATOM   3568 C CZ    . ARG E 3 365 ? 31.293  12.512  -2.612  1.00 41.84 ? 365  ARG A CZ    1 
ATOM   3569 N NH1   . ARG E 3 365 ? 30.062  12.016  -2.538  1.00 42.08 ? 365  ARG A NH1   1 
ATOM   3570 N NH2   . ARG E 3 365 ? 31.579  13.398  -3.558  1.00 43.14 ? 365  ARG A NH2   1 
ATOM   3571 N N     . LEU E 3 366 ? 29.282  6.252   -1.038  1.00 27.02 ? 366  LEU A N     1 
ATOM   3572 C CA    . LEU E 3 366 ? 28.805  4.920   -0.664  1.00 27.18 ? 366  LEU A CA    1 
ATOM   3573 C C     . LEU E 3 366 ? 29.666  3.787   -1.208  1.00 26.58 ? 366  LEU A C     1 
ATOM   3574 O O     . LEU E 3 366 ? 30.310  3.932   -2.244  1.00 26.78 ? 366  LEU A O     1 
ATOM   3575 C CB    . LEU E 3 366 ? 27.329  4.714   -1.068  1.00 27.63 ? 366  LEU A CB    1 
ATOM   3576 C CG    . LEU E 3 366 ? 26.621  5.440   -2.215  1.00 29.04 ? 366  LEU A CG    1 
ATOM   3577 C CD1   . LEU E 3 366 ? 27.198  5.136   -3.620  1.00 30.53 ? 366  LEU A CD1   1 
ATOM   3578 C CD2   . LEU E 3 366 ? 25.138  5.096   -2.183  1.00 27.85 ? 366  LEU A CD2   1 
ATOM   3579 N N     . ASP E 3 367 ? 29.688  2.675   -0.477  1.00 25.90 ? 367  ASP A N     1 
ATOM   3580 C CA    . ASP E 3 367 ? 30.227  1.412   -0.962  1.00 25.18 ? 367  ASP A CA    1 
ATOM   3581 C C     . ASP E 3 367 ? 29.010  0.498   -1.114  1.00 23.99 ? 367  ASP A C     1 
ATOM   3582 O O     . ASP E 3 367 ? 28.633  -0.185  -0.164  1.00 23.82 ? 367  ASP A O     1 
ATOM   3583 C CB    . ASP E 3 367 ? 31.238  0.835   0.046   1.00 25.75 ? 367  ASP A CB    1 
ATOM   3584 C CG    . ASP E 3 367 ? 31.856  -0.494  -0.402  1.00 27.82 ? 367  ASP A CG    1 
ATOM   3585 O OD1   . ASP E 3 367 ? 33.054  -0.710  -0.107  1.00 33.47 ? 367  ASP A OD1   1 
ATOM   3586 O OD2   . ASP E 3 367 ? 31.179  -1.349  -1.011  1.00 29.62 ? 367  ASP A OD2   1 
ATOM   3587 N N     . PRO E 3 368 ? 28.366  0.516   -2.300  1.00 22.82 ? 368  PRO A N     1 
ATOM   3588 C CA    . PRO E 3 368 ? 27.118  -0.225  -2.463  1.00 22.03 ? 368  PRO A CA    1 
ATOM   3589 C C     . PRO E 3 368 ? 27.170  -1.686  -2.008  1.00 21.52 ? 368  PRO A C     1 
ATOM   3590 O O     . PRO E 3 368 ? 26.297  -2.106  -1.249  1.00 20.46 ? 368  PRO A O     1 
ATOM   3591 C CB    . PRO E 3 368 ? 26.841  -0.125  -3.975  1.00 22.14 ? 368  PRO A CB    1 
ATOM   3592 C CG    . PRO E 3 368 ? 27.490  1.155   -4.377  1.00 22.32 ? 368  PRO A CG    1 
ATOM   3593 C CD    . PRO E 3 368 ? 28.733  1.243   -3.532  1.00 22.58 ? 368  PRO A CD    1 
ATOM   3594 N N     . SER E 3 369 ? 28.173  -2.450  -2.443  1.00 21.25 ? 369  SER A N     1 
ATOM   3595 C CA    . SER E 3 369 ? 28.212  -3.872  -2.098  1.00 21.62 ? 369  SER A CA    1 
ATOM   3596 C C     . SER E 3 369 ? 28.282  -4.107  -0.572  1.00 21.02 ? 369  SER A C     1 
ATOM   3597 O O     . SER E 3 369 ? 27.563  -4.963  -0.044  1.00 20.62 ? 369  SER A O     1 
ATOM   3598 C CB    . SER E 3 369 ? 29.315  -4.623  -2.870  1.00 22.06 ? 369  SER A CB    1 
ATOM   3599 O OG    . SER E 3 369 ? 30.604  -4.312  -2.394  1.00 25.25 ? 369  SER A OG    1 
ATOM   3600 N N     . SER E 3 370 ? 29.109  -3.316  0.112   1.00 20.14 ? 370  SER A N     1 
ATOM   3601 C CA    . SER E 3 370 ? 29.242  -3.386  1.578   1.00 20.31 ? 370  SER A CA    1 
ATOM   3602 C C     . SER E 3 370 ? 27.968  -2.946  2.288   1.00 19.10 ? 370  SER A C     1 
ATOM   3603 O O     . SER E 3 370 ? 27.568  -3.548  3.293   1.00 18.84 ? 370  SER A O     1 
ATOM   3604 C CB    . SER E 3 370 ? 30.391  -2.503  2.072   1.00 20.49 ? 370  SER A CB    1 
ATOM   3605 O OG    . SER E 3 370 ? 31.622  -2.983  1.569   1.00 24.55 ? 370  SER A OG    1 
ATOM   3606 N N     . LEU E 3 371 ? 27.354  -1.875  1.790   1.00 17.60 ? 371  LEU A N     1 
ATOM   3607 C CA    . LEU E 3 371 ? 26.124  -1.384  2.408   1.00 17.20 ? 371  LEU A CA    1 
ATOM   3608 C C     . LEU E 3 371 ? 25.004  -2.416  2.264   1.00 16.13 ? 371  LEU A C     1 
ATOM   3609 O O     . LEU E 3 371 ? 24.278  -2.687  3.224   1.00 15.22 ? 371  LEU A O     1 
ATOM   3610 C CB    . LEU E 3 371 ? 25.716  -0.013  1.842   1.00 16.76 ? 371  LEU A CB    1 
ATOM   3611 C CG    . LEU E 3 371 ? 24.352  0.563   2.260   1.00 17.08 ? 371  LEU A CG    1 
ATOM   3612 C CD1   . LEU E 3 371 ? 24.245  0.785   3.777   1.00 16.91 ? 371  LEU A CD1   1 
ATOM   3613 C CD2   . LEU E 3 371 ? 24.084  1.851   1.521   1.00 17.85 ? 371  LEU A CD2   1 
ATOM   3614 N N     . VAL E 3 372 ? 24.871  -2.991  1.072   1.00 15.66 ? 372  VAL A N     1 
ATOM   3615 C CA    . VAL E 3 372 ? 23.885  -4.029  0.840   1.00 15.24 ? 372  VAL A CA    1 
ATOM   3616 C C     . VAL E 3 372 ? 24.144  -5.208  1.783   1.00 15.19 ? 372  VAL A C     1 
ATOM   3617 O O     . VAL E 3 372 ? 23.203  -5.759  2.378   1.00 14.43 ? 372  VAL A O     1 
ATOM   3618 C CB    . VAL E 3 372 ? 23.861  -4.452  -0.647  1.00 15.40 ? 372  VAL A CB    1 
ATOM   3619 C CG1   . VAL E 3 372 ? 22.995  -5.687  -0.864  1.00 15.80 ? 372  VAL A CG1   1 
ATOM   3620 C CG2   . VAL E 3 372 ? 23.385  -3.255  -1.521  1.00 14.82 ? 372  VAL A CG2   1 
ATOM   3621 N N     . GLN E 3 373 ? 25.418  -5.560  1.942   1.00 15.33 ? 373  GLN A N     1 
ATOM   3622 C CA    . GLN E 3 373 ? 25.796  -6.616  2.875   1.00 16.59 ? 373  GLN A CA    1 
ATOM   3623 C C     . GLN E 3 373 ? 25.296  -6.310  4.302   1.00 16.11 ? 373  GLN A C     1 
ATOM   3624 O O     . GLN E 3 373 ? 24.681  -7.171  4.957   1.00 16.66 ? 373  GLN A O     1 
ATOM   3625 C CB    . GLN E 3 373 ? 27.307  -6.838  2.851   1.00 17.88 ? 373  GLN A CB    1 
ATOM   3626 C CG    . GLN E 3 373 ? 27.730  -8.052  3.642   1.00 22.39 ? 373  GLN A CG    1 
ATOM   3627 C CD    . GLN E 3 373 ? 29.184  -8.433  3.412   1.00 28.82 ? 373  GLN A CD    1 
ATOM   3628 O OE1   . GLN E 3 373 ? 29.895  -7.826  2.590   1.00 31.80 ? 373  GLN A OE1   1 
ATOM   3629 N NE2   . GLN E 3 373 ? 29.634  -9.450  4.134   1.00 30.23 ? 373  GLN A NE2   1 
ATOM   3630 N N     . TRP E 3 374 ? 25.565  -5.097  4.762   1.00 15.30 ? 374  TRP A N     1 
ATOM   3631 C CA    . TRP E 3 374 ? 25.169  -4.666  6.097   1.00 14.61 ? 374  TRP A CA    1 
ATOM   3632 C C     . TRP E 3 374 ? 23.638  -4.677  6.276   1.00 14.28 ? 374  TRP A C     1 
ATOM   3633 O O     . TRP E 3 374 ? 23.107  -5.175  7.280   1.00 13.67 ? 374  TRP A O     1 
ATOM   3634 C CB    . TRP E 3 374 ? 25.731  -3.277  6.390   1.00 15.22 ? 374  TRP A CB    1 
ATOM   3635 C CG    . TRP E 3 374 ? 25.101  -2.606  7.573   1.00 16.03 ? 374  TRP A CG    1 
ATOM   3636 C CD1   . TRP E 3 374 ? 24.422  -1.422  7.575   1.00 15.83 ? 374  TRP A CD1   1 
ATOM   3637 C CD2   . TRP E 3 374 ? 25.086  -3.083  8.933   1.00 16.55 ? 374  TRP A CD2   1 
ATOM   3638 N NE1   . TRP E 3 374 ? 23.970  -1.132  8.850   1.00 16.78 ? 374  TRP A NE1   1 
ATOM   3639 C CE2   . TRP E 3 374 ? 24.367  -2.132  9.699   1.00 14.48 ? 374  TRP A CE2   1 
ATOM   3640 C CE3   . TRP E 3 374 ? 25.606  -4.227  9.575   1.00 18.10 ? 374  TRP A CE3   1 
ATOM   3641 C CZ2   . TRP E 3 374 ? 24.162  -2.279  11.076  1.00 16.58 ? 374  TRP A CZ2   1 
ATOM   3642 C CZ3   . TRP E 3 374 ? 25.388  -4.381  10.953  1.00 16.43 ? 374  TRP A CZ3   1 
ATOM   3643 C CH2   . TRP E 3 374 ? 24.677  -3.408  11.682  1.00 15.67 ? 374  TRP A CH2   1 
ATOM   3644 N N     . LEU E 3 375 ? 22.933  -4.103  5.306   1.00 13.42 ? 375  LEU A N     1 
ATOM   3645 C CA    . LEU E 3 375 ? 21.460  -4.108  5.359   1.00 13.87 ? 375  LEU A CA    1 
ATOM   3646 C C     . LEU E 3 375 ? 20.842  -5.508  5.427   1.00 14.14 ? 375  LEU A C     1 
ATOM   3647 O O     . LEU E 3 375 ? 19.821  -5.712  6.112   1.00 13.86 ? 375  LEU A O     1 
ATOM   3648 C CB    . LEU E 3 375 ? 20.880  -3.299  4.202   1.00 13.35 ? 375  LEU A CB    1 
ATOM   3649 C CG    . LEU E 3 375 ? 21.220  -1.800  4.247   1.00 13.95 ? 375  LEU A CG    1 
ATOM   3650 C CD1   . LEU E 3 375 ? 20.800  -1.119  2.927   1.00 14.81 ? 375  LEU A CD1   1 
ATOM   3651 C CD2   . LEU E 3 375 ? 20.632  -1.055  5.475   1.00 14.41 ? 375  LEU A CD2   1 
ATOM   3652 N N     . ASN E 3 376 ? 21.470  -6.474  4.752   1.00 14.03 ? 376  ASN A N     1 
ATOM   3653 C CA    . ASN E 3 376 ? 20.961  -7.848  4.722   1.00 14.87 ? 376  ASN A CA    1 
ATOM   3654 C C     . ASN E 3 376 ? 21.480  -8.714  5.878   1.00 14.84 ? 376  ASN A C     1 
ATOM   3655 O O     . ASN E 3 376 ? 21.128  -9.889  5.983   1.00 14.94 ? 376  ASN A O     1 
ATOM   3656 C CB    . ASN E 3 376 ? 21.303  -8.517  3.391   1.00 14.81 ? 376  ASN A CB    1 
ATOM   3657 C CG    . ASN E 3 376 ? 20.486  -7.960  2.238   1.00 16.20 ? 376  ASN A CG    1 
ATOM   3658 O OD1   . ASN E 3 376 ? 19.257  -7.894  2.310   1.00 18.68 ? 376  ASN A OD1   1 
ATOM   3659 N ND2   . ASN E 3 376 ? 21.165  -7.553  1.169   1.00 15.67 ? 376  ASN A ND2   1 
ATOM   3660 N N     . SER E 3 377 ? 22.291  -8.115  6.737   1.00 15.15 ? 377  SER A N     1 
ATOM   3661 C CA    . SER E 3 377 ? 23.026  -8.865  7.761   1.00 15.31 ? 377  SER A CA    1 
ATOM   3662 C C     . SER E 3 377 ? 22.099  -9.347  8.873   1.00 16.35 ? 377  SER A C     1 
ATOM   3663 O O     . SER E 3 377 ? 21.034  -8.760  9.105   1.00 15.60 ? 377  SER A O     1 
ATOM   3664 C CB    . SER E 3 377 ? 24.140  -8.004  8.349   1.00 15.18 ? 377  SER A CB    1 
ATOM   3665 O OG    . SER E 3 377 ? 23.615  -7.006  9.196   1.00 15.70 ? 377  SER A OG    1 
ATOM   3666 N N     . GLU E 3 378 ? 22.528  -10.401 9.575   1.00 16.58 ? 378  GLU A N     1 
ATOM   3667 C CA    . GLU E 3 378 ? 21.747  -10.958 10.694  1.00 18.83 ? 378  GLU A CA    1 
ATOM   3668 C C     . GLU E 3 378 ? 21.549  -9.915  11.781  1.00 17.14 ? 378  GLU A C     1 
ATOM   3669 O O     . GLU E 3 378 ? 20.463  -9.833  12.368  1.00 16.66 ? 378  GLU A O     1 
ATOM   3670 C CB    . GLU E 3 378 ? 22.437  -12.191 11.283  1.00 19.16 ? 378  GLU A CB    1 
ATOM   3671 C CG    . GLU E 3 378 ? 22.700  -13.296 10.279  1.00 23.19 ? 378  GLU A CG    1 
ATOM   3672 C CD    . GLU E 3 378 ? 23.321  -14.554 10.890  1.00 24.37 ? 378  GLU A CD    1 
ATOM   3673 O OE1   . GLU E 3 378 ? 23.277  -14.736 12.137  1.00 32.24 ? 378  GLU A OE1   1 
ATOM   3674 O OE2   . GLU E 3 378 ? 23.846  -15.382 10.101  1.00 32.28 ? 378  GLU A OE2   1 
ATOM   3675 N N     . ALA E 3 379 ? 22.603  -9.138  12.054  1.00 16.11 ? 379  ALA A N     1 
ATOM   3676 C CA    . ALA E 3 379 ? 22.561  -8.076  13.042  1.00 15.41 ? 379  ALA A CA    1 
ATOM   3677 C C     . ALA E 3 379 ? 21.408  -7.112  12.748  1.00 15.16 ? 379  ALA A C     1 
ATOM   3678 O O     . ALA E 3 379 ? 20.629  -6.741  13.646  1.00 14.95 ? 379  ALA A O     1 
ATOM   3679 C CB    . ALA E 3 379 ? 23.883  -7.343  13.092  1.00 16.83 ? 379  ALA A CB    1 
ATOM   3680 N N     . MET E 3 380 ? 21.272  -6.751  11.472  1.00 13.46 ? 380  MET A N     1 
ATOM   3681 C CA    . MET E 3 380 ? 20.193  -5.842  11.050  1.00 13.68 ? 380  MET A CA    1 
ATOM   3682 C C     . MET E 3 380 ? 18.779  -6.443  11.214  1.00 13.00 ? 380  MET A C     1 
ATOM   3683 O O     . MET E 3 380 ? 17.840  -5.746  11.602  1.00 12.99 ? 380  MET A O     1 
ATOM   3684 C CB    . MET E 3 380 ? 20.437  -5.353  9.616   1.00 13.37 ? 380  MET A CB    1 
ATOM   3685 C CG    . MET E 3 380 ? 19.443  -4.281  9.172   1.00 15.39 ? 380  MET A CG    1 
ATOM   3686 S SD    . MET E 3 380 ? 19.462  -2.812  10.228  1.00 17.24 ? 380  MET A SD    1 
ATOM   3687 C CE    . MET E 3 380 ? 20.850  -1.912  9.556   1.00 18.01 ? 380  MET A CE    1 
ATOM   3688 N N     . GLN E 3 381 ? 18.632  -7.727  10.900  1.00 12.95 ? 381  GLN A N     1 
ATOM   3689 C CA    . GLN E 3 381 ? 17.351  -8.429  11.012  1.00 12.82 ? 381  GLN A CA    1 
ATOM   3690 C C     . GLN E 3 381 ? 16.920  -8.497  12.474  1.00 12.81 ? 381  GLN A C     1 
ATOM   3691 O O     . GLN E 3 381 ? 15.771  -8.206  12.797  1.00 12.39 ? 381  GLN A O     1 
ATOM   3692 C CB    . GLN E 3 381 ? 17.440  -9.842  10.420  1.00 13.23 ? 381  GLN A CB    1 
ATOM   3693 C CG    . GLN E 3 381 ? 18.095  -9.903  9.040   1.00 13.26 ? 381  GLN A CG    1 
ATOM   3694 C CD    . GLN E 3 381 ? 17.507  -8.912  8.051   1.00 14.23 ? 381  GLN A CD    1 
ATOM   3695 O OE1   . GLN E 3 381 ? 16.284  -8.817  7.893   1.00 16.17 ? 381  GLN A OE1   1 
ATOM   3696 N NE2   . GLN E 3 381 ? 18.387  -8.185  7.348   1.00 14.07 ? 381  GLN A NE2   1 
ATOM   3697 N N     . LYS E 3 382 ? 17.867  -8.830  13.353  1.00 13.13 ? 382  LYS A N     1 
ATOM   3698 C CA    . LYS E 3 382 ? 17.556  -8.908  14.794  1.00 13.30 ? 382  LYS A CA    1 
ATOM   3699 C C     . LYS E 3 382 ? 17.181  -7.510  15.314  1.00 12.33 ? 382  LYS A C     1 
ATOM   3700 O O     . LYS E 3 382 ? 16.283  -7.385  16.138  1.00 12.13 ? 382  LYS A O     1 
ATOM   3701 C CB    . LYS E 3 382 ? 18.748  -9.484  15.567  1.00 14.36 ? 382  LYS A CB    1 
ATOM   3702 C CG    . LYS E 3 382 ? 18.544  -9.645  17.082  1.00 17.73 ? 382  LYS A CG    1 
ATOM   3703 C CD    . LYS E 3 382 ? 19.896  -9.643  17.787  1.00 23.51 ? 382  LYS A CD    1 
ATOM   3704 C CE    . LYS E 3 382 ? 19.779  -9.855  19.299  1.00 26.79 ? 382  LYS A CE    1 
ATOM   3705 N NZ    . LYS E 3 382 ? 18.914  -8.827  19.934  1.00 29.91 ? 382  LYS A NZ    1 
ATOM   3706 N N     . HIS E 3 383 ? 17.871  -6.475  14.839  1.00 11.12 ? 383  HIS A N     1 
ATOM   3707 C CA    . HIS E 3 383 ? 17.578  -5.070  15.227  1.00 10.94 ? 383  HIS A CA    1 
ATOM   3708 C C     . HIS E 3 383 ? 16.105  -4.671  14.956  1.00 11.24 ? 383  HIS A C     1 
ATOM   3709 O O     . HIS E 3 383 ? 15.368  -4.226  15.867  1.00 10.52 ? 383  HIS A O     1 
ATOM   3710 C CB    . HIS E 3 383 ? 18.567  -4.122  14.504  1.00 11.41 ? 383  HIS A CB    1 
ATOM   3711 C CG    . HIS E 3 383 ? 18.435  -2.676  14.881  1.00 10.82 ? 383  HIS A CG    1 
ATOM   3712 N ND1   . HIS E 3 383 ? 18.814  -2.191  16.114  1.00 11.04 ? 383  HIS A ND1   1 
ATOM   3713 C CD2   . HIS E 3 383 ? 17.996  -1.602  14.174  1.00 9.85  ? 383  HIS A CD2   1 
ATOM   3714 C CE1   . HIS E 3 383 ? 18.594  -0.888  16.160  1.00 12.28 ? 383  HIS A CE1   1 
ATOM   3715 N NE2   . HIS E 3 383 ? 18.114  -0.503  14.985  1.00 11.40 ? 383  HIS A NE2   1 
ATOM   3716 N N     . VAL E 3 384 ? 15.661  -4.866  13.711  1.00 10.91 ? 384  VAL A N     1 
ATOM   3717 C CA    . VAL E 3 384 ? 14.296  -4.500  13.355  1.00 10.47 ? 384  VAL A CA    1 
ATOM   3718 C C     . VAL E 3 384 ? 13.250  -5.411  14.023  1.00 10.31 ? 384  VAL A C     1 
ATOM   3719 O O     . VAL E 3 384 ? 12.192  -4.934  14.414  1.00 10.48 ? 384  VAL A O     1 
ATOM   3720 C CB    . VAL E 3 384 ? 14.065  -4.337  11.813  1.00 10.75 ? 384  VAL A CB    1 
ATOM   3721 C CG1   . VAL E 3 384 ? 14.987  -3.239  11.267  1.00 10.54 ? 384  VAL A CG1   1 
ATOM   3722 C CG2   . VAL E 3 384 ? 14.259  -5.638  11.050  1.00 12.05 ? 384  VAL A CG2   1 
ATOM   3723 N N     . ARG E 3 385 ? 13.562  -6.696  14.169  1.00 11.12 ? 385  ARG A N     1 
ATOM   3724 C CA    . ARG E 3 385 ? 12.621  -7.603  14.837  1.00 11.61 ? 385  ARG A CA    1 
ATOM   3725 C C     . ARG E 3 385 ? 12.454  -7.261  16.326  1.00 10.82 ? 385  ARG A C     1 
ATOM   3726 O O     . ARG E 3 385 ? 11.347  -7.341  16.880  1.00 10.16 ? 385  ARG A O     1 
ATOM   3727 C CB    . ARG E 3 385 ? 13.002  -9.073  14.640  1.00 13.06 ? 385  ARG A CB    1 
ATOM   3728 C CG    . ARG E 3 385 ? 11.873  -10.068 14.995  1.00 18.61 ? 385  ARG A CG    1 
ATOM   3729 C CD    . ARG E 3 385 ? 10.484  -9.617  14.468  1.00 26.40 ? 385  ARG A CD    1 
ATOM   3730 N NE    . ARG E 3 385 ? 9.500   -10.701 14.386  1.00 32.06 ? 385  ARG A NE    1 
ATOM   3731 C CZ    . ARG E 3 385 ? 8.771   -11.163 15.406  1.00 34.42 ? 385  ARG A CZ    1 
ATOM   3732 N NH1   . ARG E 3 385 ? 8.902   -10.661 16.635  1.00 35.34 ? 385  ARG A NH1   1 
ATOM   3733 N NH2   . ARG E 3 385 ? 7.902   -12.144 15.194  1.00 35.88 ? 385  ARG A NH2   1 
ATOM   3734 N N     . THR E 3 386 ? 13.548  -6.861  16.970  1.00 10.72 ? 386  THR A N     1 
ATOM   3735 C CA    . THR E 3 386 ? 13.445  -6.420  18.355  1.00 10.61 ? 386  THR A CA    1 
ATOM   3736 C C     . THR E 3 386 ? 12.535  -5.207  18.467  1.00 9.73  ? 386  THR A C     1 
ATOM   3737 O O     . THR E 3 386 ? 11.587  -5.195  19.256  1.00 9.92  ? 386  THR A O     1 
ATOM   3738 C CB    . THR E 3 386 ? 14.836  -6.099  18.946  1.00 10.43 ? 386  THR A CB    1 
ATOM   3739 O OG1   . THR E 3 386 ? 15.666  -7.256  18.844  1.00 11.76 ? 386  THR A OG1   1 
ATOM   3740 C CG2   . THR E 3 386 ? 14.710  -5.663  20.388  1.00 11.96 ? 386  THR A CG2   1 
ATOM   3741 N N     . LEU E 3 387 ? 12.818  -4.174  17.665  1.00 9.10  ? 387  LEU A N     1 
ATOM   3742 C CA    . LEU E 3 387 ? 12.110  -2.901  17.769  1.00 8.66  ? 387  LEU A CA    1 
ATOM   3743 C C     . LEU E 3 387 ? 10.623  -2.960  17.437  1.00 8.16  ? 387  LEU A C     1 
ATOM   3744 O O     . LEU E 3 387 ? 9.802   -2.347  18.132  1.00 8.57  ? 387  LEU A O     1 
ATOM   3745 C CB    . LEU E 3 387 ? 12.777  -1.888  16.848  1.00 8.65  ? 387  LEU A CB    1 
ATOM   3746 C CG    . LEU E 3 387 ? 14.126  -1.386  17.369  1.00 8.33  ? 387  LEU A CG    1 
ATOM   3747 C CD1   . LEU E 3 387 ? 14.809  -0.624  16.230  1.00 11.17 ? 387  LEU A CD1   1 
ATOM   3748 C CD2   . LEU E 3 387 ? 13.924  -0.489  18.622  1.00 11.64 ? 387  LEU A CD2   1 
ATOM   3749 N N     . TYR E 3 388 ? 10.296  -3.691  16.376  1.00 8.49  ? 388  TYR A N     1 
ATOM   3750 C CA    . TYR E 3 388 ? 8.986   -3.583  15.745  1.00 8.88  ? 388  TYR A CA    1 
ATOM   3751 C C     . TYR E 3 388 ? 8.192   -4.880  15.744  1.00 9.00  ? 388  TYR A C     1 
ATOM   3752 O O     . TYR E 3 388 ? 7.043   -4.891  15.300  1.00 9.27  ? 388  TYR A O     1 
ATOM   3753 C CB    . TYR E 3 388 ? 9.142   -3.064  14.305  1.00 9.41  ? 388  TYR A CB    1 
ATOM   3754 C CG    . TYR E 3 388 ? 9.947   -1.779  14.250  1.00 9.11  ? 388  TYR A CG    1 
ATOM   3755 C CD1   . TYR E 3 388 ? 9.446   -0.589  14.773  1.00 10.11 ? 388  TYR A CD1   1 
ATOM   3756 C CD2   . TYR E 3 388 ? 11.227  -1.762  13.670  1.00 10.16 ? 388  TYR A CD2   1 
ATOM   3757 C CE1   . TYR E 3 388 ? 10.212  0.584   14.734  1.00 10.95 ? 388  TYR A CE1   1 
ATOM   3758 C CE2   . TYR E 3 388 ? 11.992  -0.606  13.632  1.00 12.42 ? 388  TYR A CE2   1 
ATOM   3759 C CZ    . TYR E 3 388 ? 11.480  0.569   14.157  1.00 10.55 ? 388  TYR A CZ    1 
ATOM   3760 O OH    . TYR E 3 388 ? 12.246  1.732   14.124  1.00 10.73 ? 388  TYR A OH    1 
ATOM   3761 N N     . ARG E 3 389 ? 8.821   -5.955  16.217  1.00 8.31  ? 389  ARG A N     1 
ATOM   3762 C CA    . ARG E 3 389 ? 8.194   -7.282  16.292  1.00 9.47  ? 389  ARG A CA    1 
ATOM   3763 C C     . ARG E 3 389 ? 7.403   -7.586  15.009  1.00 9.96  ? 389  ARG A C     1 
ATOM   3764 O O     . ARG E 3 389 ? 7.973   -7.565  13.905  1.00 9.83  ? 389  ARG A O     1 
ATOM   3765 C CB    . ARG E 3 389 ? 7.312   -7.387  17.557  1.00 9.70  ? 389  ARG A CB    1 
ATOM   3766 C CG    . ARG E 3 389 ? 8.148   -7.187  18.833  1.00 9.76  ? 389  ARG A CG    1 
ATOM   3767 C CD    . ARG E 3 389 ? 7.438   -7.651  20.115  1.00 10.99 ? 389  ARG A CD    1 
ATOM   3768 N NE    . ARG E 3 389 ? 8.372   -7.582  21.249  1.00 14.98 ? 389  ARG A NE    1 
ATOM   3769 C CZ    . ARG E 3 389 ? 8.110   -8.031  22.477  1.00 16.83 ? 389  ARG A CZ    1 
ATOM   3770 N NH1   . ARG E 3 389 ? 6.931   -8.574  22.744  1.00 15.34 ? 389  ARG A NH1   1 
ATOM   3771 N NH2   . ARG E 3 389 ? 9.026   -7.935  23.438  1.00 13.91 ? 389  ARG A NH2   1 
ATOM   3772 N N     . ASP E 3 390 ? 6.113   -7.876  15.172  1.00 9.35  ? 390  ASP A N     1 
ATOM   3773 C CA    . ASP E 3 390 ? 5.225   -8.206  14.053  1.00 9.55  ? 390  ASP A CA    1 
ATOM   3774 C C     . ASP E 3 390 ? 4.018   -7.254  13.970  1.00 9.22  ? 390  ASP A C     1 
ATOM   3775 O O     . ASP E 3 390 ? 2.935   -7.668  13.540  1.00 9.05  ? 390  ASP A O     1 
ATOM   3776 C CB    . ASP E 3 390 ? 4.734   -9.659  14.153  1.00 9.80  ? 390  ASP A CB    1 
ATOM   3777 C CG    . ASP E 3 390 ? 3.962   -9.944  15.448  1.00 10.81 ? 390  ASP A CG    1 
ATOM   3778 O OD1   . ASP E 3 390 ? 3.848   -9.041  16.321  1.00 12.21 ? 390  ASP A OD1   1 
ATOM   3779 O OD2   . ASP E 3 390 ? 3.443   -11.071 15.556  1.00 15.31 ? 390  ASP A OD2   1 
ATOM   3780 N N     . PHE E 3 391 ? 4.211   -5.990  14.359  1.00 8.56  ? 391  PHE A N     1 
ATOM   3781 C CA    . PHE E 3 391 ? 3.094   -5.034  14.435  1.00 8.40  ? 391  PHE A CA    1 
ATOM   3782 C C     . PHE E 3 391 ? 2.425   -4.931  13.073  1.00 8.70  ? 391  PHE A C     1 
ATOM   3783 O O     . PHE E 3 391 ? 1.204   -4.901  12.959  1.00 8.53  ? 391  PHE A O     1 
ATOM   3784 C CB    . PHE E 3 391 ? 3.593   -3.628  14.826  1.00 8.96  ? 391  PHE A CB    1 
ATOM   3785 C CG    . PHE E 3 391 ? 4.301   -3.547  16.158  1.00 9.40  ? 391  PHE A CG    1 
ATOM   3786 C CD1   . PHE E 3 391 ? 4.135   -4.525  17.147  1.00 9.99  ? 391  PHE A CD1   1 
ATOM   3787 C CD2   . PHE E 3 391 ? 5.082   -2.421  16.437  1.00 11.13 ? 391  PHE A CD2   1 
ATOM   3788 C CE1   . PHE E 3 391 ? 4.793   -4.400  18.379  1.00 10.71 ? 391  PHE A CE1   1 
ATOM   3789 C CE2   . PHE E 3 391 ? 5.736   -2.274  17.663  1.00 11.46 ? 391  PHE A CE2   1 
ATOM   3790 C CZ    . PHE E 3 391 ? 5.590   -3.266  18.639  1.00 10.70 ? 391  PHE A CZ    1 
ATOM   3791 N N     . VAL E 3 392 ? 3.265   -4.844  12.036  1.00 8.66  ? 392  VAL A N     1 
ATOM   3792 C CA    . VAL E 3 392 ? 2.799   -4.694  10.661  1.00 9.11  ? 392  VAL A CA    1 
ATOM   3793 C C     . VAL E 3 392 ? 3.592   -5.632  9.755   1.00 9.16  ? 392  VAL A C     1 
ATOM   3794 O O     . VAL E 3 392 ? 4.739   -5.969  10.071  1.00 9.85  ? 392  VAL A O     1 
ATOM   3795 C CB    . VAL E 3 392 ? 2.925   -3.230  10.155  1.00 8.01  ? 392  VAL A CB    1 
ATOM   3796 C CG1   . VAL E 3 392 ? 1.922   -2.305  10.901  1.00 9.34  ? 392  VAL A CG1   1 
ATOM   3797 C CG2   . VAL E 3 392 ? 4.373   -2.727  10.257  1.00 9.36  ? 392  VAL A CG2   1 
ATOM   3798 N N     . PRO E 3 393 ? 2.979   -6.078  8.642   1.00 10.34 ? 393  PRO A N     1 
ATOM   3799 C CA    . PRO E 3 393 ? 3.663   -7.018  7.735   1.00 11.19 ? 393  PRO A CA    1 
ATOM   3800 C C     . PRO E 3 393 ? 4.651   -6.327  6.775   1.00 11.37 ? 393  PRO A C     1 
ATOM   3801 O O     . PRO E 3 393 ? 4.842   -6.789  5.649   1.00 13.80 ? 393  PRO A O     1 
ATOM   3802 C CB    . PRO E 3 393 ? 2.489   -7.636  6.952   1.00 11.65 ? 393  PRO A CB    1 
ATOM   3803 C CG    . PRO E 3 393 ? 1.525   -6.466  6.826   1.00 11.38 ? 393  PRO A CG    1 
ATOM   3804 C CD    . PRO E 3 393 ? 1.612   -5.762  8.178   1.00 11.27 ? 393  PRO A CD    1 
ATOM   3805 N N     . HIS E 3 394 ? 5.275   -5.243  7.215   1.00 11.18 ? 394  HIS A N     1 
ATOM   3806 C CA    . HIS E 3 394 ? 6.140   -4.429  6.349   1.00 10.48 ? 394  HIS A CA    1 
ATOM   3807 C C     . HIS E 3 394 ? 7.347   -3.903  7.095   1.00 9.78  ? 394  HIS A C     1 
ATOM   3808 O O     . HIS E 3 394 ? 7.317   -3.781  8.320   1.00 10.74 ? 394  HIS A O     1 
ATOM   3809 C CB    . HIS E 3 394 ? 5.395   -3.174  5.886   1.00 9.94  ? 394  HIS A CB    1 
ATOM   3810 C CG    . HIS E 3 394 ? 4.202   -3.443  5.032   1.00 10.38 ? 394  HIS A CG    1 
ATOM   3811 N ND1   . HIS E 3 394 ? 2.905   -3.266  5.479   1.00 14.26 ? 394  HIS A ND1   1 
ATOM   3812 C CD2   . HIS E 3 394 ? 4.107   -3.864  3.752   1.00 9.64  ? 394  HIS A CD2   1 
ATOM   3813 C CE1   . HIS E 3 394 ? 2.066   -3.584  4.506   1.00 8.55  ? 394  HIS A CE1   1 
ATOM   3814 N NE2   . HIS E 3 394 ? 2.769   -3.946  3.449   1.00 12.59 ? 394  HIS A NE2   1 
ATOM   3815 N N     . LEU E 3 395 ? 8.396   -3.551  6.339   1.00 7.98  ? 395  LEU A N     1 
ATOM   3816 C CA    . LEU E 3 395 ? 9.348   -2.547  6.798   1.00 8.49  ? 395  LEU A CA    1 
ATOM   3817 C C     . LEU E 3 395 ? 8.780   -1.218  6.269   1.00 8.12  ? 395  LEU A C     1 
ATOM   3818 O O     . LEU E 3 395 ? 8.553   -1.069  5.061   1.00 7.74  ? 395  LEU A O     1 
ATOM   3819 C CB    . LEU E 3 395 ? 10.733  -2.822  6.217   1.00 7.37  ? 395  LEU A CB    1 
ATOM   3820 C CG    . LEU E 3 395 ? 11.841  -1.912  6.747   1.00 10.03 ? 395  LEU A CG    1 
ATOM   3821 C CD1   . LEU E 3 395 ? 12.236  -2.290  8.163   1.00 9.19  ? 395  LEU A CD1   1 
ATOM   3822 C CD2   . LEU E 3 395 ? 13.050  -1.936  5.800   1.00 9.60  ? 395  LEU A CD2   1 
ATOM   3823 N N     . THR E 3 396 ? 8.455   -0.295  7.168   1.00 7.83  ? 396  THR A N     1 
ATOM   3824 C CA    . THR E 3 396 ? 7.870   0.979   6.743   1.00 7.92  ? 396  THR A CA    1 
ATOM   3825 C C     . THR E 3 396 ? 8.954   2.046   6.592   1.00 8.59  ? 396  THR A C     1 
ATOM   3826 O O     . THR E 3 396 ? 10.075  1.871   7.065   1.00 8.78  ? 396  THR A O     1 
ATOM   3827 C CB    . THR E 3 396 ? 6.828   1.487   7.755   1.00 7.45  ? 396  THR A CB    1 
ATOM   3828 O OG1   . THR E 3 396 ? 7.494   1.776   8.993   1.00 8.75  ? 396  THR A OG1   1 
ATOM   3829 C CG2   . THR E 3 396 ? 5.695   0.454   7.961   1.00 7.82  ? 396  THR A CG2   1 
ATOM   3830 N N     . LEU E 3 397 ? 8.605   3.171   5.980   1.00 8.67  ? 397  LEU A N     1 
ATOM   3831 C CA    . LEU E 3 397 ? 9.563   4.269   5.817   1.00 9.82  ? 397  LEU A CA    1 
ATOM   3832 C C     . LEU E 3 397 ? 10.127  4.741   7.153   1.00 9.11  ? 397  LEU A C     1 
ATOM   3833 O O     . LEU E 3 397 ? 11.330  4.962   7.282   1.00 9.28  ? 397  LEU A O     1 
ATOM   3834 C CB    . LEU E 3 397 ? 8.910   5.448   5.096   1.00 9.67  ? 397  LEU A CB    1 
ATOM   3835 C CG    . LEU E 3 397 ? 9.815   6.655   4.830   1.00 11.95 ? 397  LEU A CG    1 
ATOM   3836 C CD1   . LEU E 3 397 ? 11.063  6.224   4.103   1.00 14.97 ? 397  LEU A CD1   1 
ATOM   3837 C CD2   . LEU E 3 397 ? 9.058   7.614   3.957   1.00 15.54 ? 397  LEU A CD2   1 
ATOM   3838 N N     . ARG E 3 398 ? 9.251   4.846   8.157   1.00 8.87  ? 398  ARG A N     1 
ATOM   3839 C CA    . ARG E 3 398 ? 9.689   5.336   9.462   1.00 9.80  ? 398  ARG A CA    1 
ATOM   3840 C C     . ARG E 3 398 ? 10.684  4.413   10.131  1.00 10.28 ? 398  ARG A C     1 
ATOM   3841 O O     . ARG E 3 398 ? 11.507  4.872   10.929  1.00 11.35 ? 398  ARG A O     1 
ATOM   3842 C CB    . ARG E 3 398 ? 8.491   5.598   10.367  1.00 9.04  ? 398  ARG A CB    1 
ATOM   3843 C CG    . ARG E 3 398 ? 7.633   6.746   9.868   1.00 12.24 ? 398  ARG A CG    1 
ATOM   3844 C CD    . ARG E 3 398 ? 8.482   7.999   9.679   1.00 19.94 ? 398  ARG A CD    1 
ATOM   3845 N NE    . ARG E 3 398 ? 7.668   9.126   9.241   1.00 28.14 ? 398  ARG A NE    1 
ATOM   3846 C CZ    . ARG E 3 398 ? 7.771   9.732   8.063   1.00 29.98 ? 398  ARG A CZ    1 
ATOM   3847 N NH1   . ARG E 3 398 ? 8.687   9.358   7.173   1.00 30.80 ? 398  ARG A NH1   1 
ATOM   3848 N NH2   . ARG E 3 398 ? 6.963   10.747  7.788   1.00 33.65 ? 398  ARG A NH2   1 
ATOM   3849 N N     . MET E 3 399 ? 10.588  3.116   9.839   1.00 9.38  ? 399  MET A N     1 
ATOM   3850 C CA    . MET E 3 399 ? 11.585  2.151   10.302  1.00 9.99  ? 399  MET A CA    1 
ATOM   3851 C C     . MET E 3 399 ? 12.881  2.302   9.499   1.00 9.61  ? 399  MET A C     1 
ATOM   3852 O O     . MET E 3 399 ? 13.976  2.448   10.060  1.00 10.00 ? 399  MET A O     1 
ATOM   3853 C CB    . MET E 3 399 ? 11.052  0.719   10.166  1.00 10.12 ? 399  MET A CB    1 
ATOM   3854 C CG    . MET E 3 399 ? 9.747   0.440   10.918  1.00 9.24  ? 399  MET A CG    1 
ATOM   3855 S SD    . MET E 3 399 ? 9.100   -1.189  10.463  1.00 10.01 ? 399  MET A SD    1 
ATOM   3856 C CE    . MET E 3 399 ? 7.563   -1.146  11.390  1.00 10.77 ? 399  MET A CE    1 
ATOM   3857 N N     . LEU E 3 400 ? 12.729  2.298   8.179   1.00 9.47  ? 400  LEU A N     1 
ATOM   3858 C CA    . LEU E 3 400 ? 13.857  2.304   7.257   1.00 9.31  ? 400  LEU A CA    1 
ATOM   3859 C C     . LEU E 3 400 ? 14.766  3.534   7.426   1.00 10.16 ? 400  LEU A C     1 
ATOM   3860 O O     . LEU E 3 400 ? 15.992  3.408   7.439   1.00 10.30 ? 400  LEU A O     1 
ATOM   3861 C CB    . LEU E 3 400 ? 13.341  2.206   5.812   1.00 9.82  ? 400  LEU A CB    1 
ATOM   3862 C CG    . LEU E 3 400 ? 14.362  2.346   4.676   1.00 9.27  ? 400  LEU A CG    1 
ATOM   3863 C CD1   . LEU E 3 400 ? 15.437  1.242   4.759   1.00 11.61 ? 400  LEU A CD1   1 
ATOM   3864 C CD2   . LEU E 3 400 ? 13.597  2.276   3.359   1.00 9.78  ? 400  LEU A CD2   1 
ATOM   3865 N N     . GLU E 3 401 ? 14.167  4.703   7.593   1.00 9.86  ? 401  GLU A N     1 
ATOM   3866 C CA    . GLU E 3 401 ? 14.973  5.920   7.639   1.00 11.42 ? 401  GLU A CA    1 
ATOM   3867 C C     . GLU E 3 401 ? 15.856  5.977   8.900   1.00 12.04 ? 401  GLU A C     1 
ATOM   3868 O O     . GLU E 3 401 ? 16.839  6.702   8.930   1.00 12.66 ? 401  GLU A O     1 
ATOM   3869 C CB    . GLU E 3 401 ? 14.086  7.152   7.520   1.00 12.23 ? 401  GLU A CB    1 
ATOM   3870 C CG    . GLU E 3 401 ? 13.178  7.373   8.695   1.00 14.34 ? 401  GLU A CG    1 
ATOM   3871 C CD    . GLU E 3 401 ? 12.184  8.500   8.436   1.00 19.04 ? 401  GLU A CD    1 
ATOM   3872 O OE1   . GLU E 3 401 ? 11.504  8.906   9.394   1.00 21.49 ? 401  GLU A OE1   1 
ATOM   3873 O OE2   . GLU E 3 401 ? 12.081  8.972   7.274   1.00 25.31 ? 401  GLU A OE2   1 
ATOM   3874 N N     . ARG E 3 402 ? 15.477  5.219   9.936   1.00 11.86 ? 402  ARG A N     1 
ATOM   3875 C CA    . ARG E 3 402 ? 16.252  5.158   11.184  1.00 12.98 ? 402  ARG A CA    1 
ATOM   3876 C C     . ARG E 3 402 ? 17.318  4.061   11.247  1.00 12.94 ? 402  ARG A C     1 
ATOM   3877 O O     . ARG E 3 402 ? 18.004  3.921   12.274  1.00 13.45 ? 402  ARG A O     1 
ATOM   3878 C CB    . ARG E 3 402 ? 15.280  5.026   12.377  1.00 13.03 ? 402  ARG A CB    1 
ATOM   3879 C CG    . ARG E 3 402 ? 14.481  6.287   12.639  1.00 13.87 ? 402  ARG A CG    1 
ATOM   3880 C CD    . ARG E 3 402 ? 13.861  6.317   14.050  1.00 15.57 ? 402  ARG A CD    1 
ATOM   3881 N NE    . ARG E 3 402 ? 14.872  6.558   15.085  1.00 21.10 ? 402  ARG A NE    1 
ATOM   3882 C CZ    . ARG E 3 402 ? 14.617  6.638   16.391  1.00 22.92 ? 402  ARG A CZ    1 
ATOM   3883 N NH1   . ARG E 3 402 ? 13.374  6.535   16.854  1.00 21.04 ? 402  ARG A NH1   1 
ATOM   3884 N NH2   . ARG E 3 402 ? 15.620  6.845   17.238  1.00 26.11 ? 402  ARG A NH2   1 
ATOM   3885 N N     . LEU E 3 403 ? 17.462  3.252   10.192  1.00 13.21 ? 403  LEU A N     1 
ATOM   3886 C CA    . LEU E 3 403 ? 18.481  2.177   10.217  1.00 13.18 ? 403  LEU A CA    1 
ATOM   3887 C C     . LEU E 3 403 ? 19.884  2.778   10.312  1.00 14.09 ? 403  LEU A C     1 
ATOM   3888 O O     . LEU E 3 403 ? 20.188  3.706   9.588   1.00 13.99 ? 403  LEU A O     1 
ATOM   3889 C CB    . LEU E 3 403 ? 18.385  1.270   8.998   1.00 13.32 ? 403  LEU A CB    1 
ATOM   3890 C CG    . LEU E 3 403 ? 17.075  0.496   8.818   1.00 13.03 ? 403  LEU A CG    1 
ATOM   3891 C CD1   . LEU E 3 403 ? 17.207  -0.413  7.611   1.00 12.38 ? 403  LEU A CD1   1 
ATOM   3892 C CD2   . LEU E 3 403 ? 16.755  -0.316  10.095  1.00 14.63 ? 403  LEU A CD2   1 
ATOM   3893 N N     . PRO E 3 404 ? 20.725  2.272   11.237  1.00 14.84 ? 404  PRO A N     1 
ATOM   3894 C CA    . PRO E 3 404 ? 22.051  2.883   11.409  1.00 15.43 ? 404  PRO A CA    1 
ATOM   3895 C C     . PRO E 3 404 ? 23.090  2.374   10.402  1.00 15.73 ? 404  PRO A C     1 
ATOM   3896 O O     . PRO E 3 404 ? 23.153  1.170   10.122  1.00 15.62 ? 404  PRO A O     1 
ATOM   3897 C CB    . PRO E 3 404 ? 22.437  2.475   12.847  1.00 15.54 ? 404  PRO A CB    1 
ATOM   3898 C CG    . PRO E 3 404 ? 21.741  1.161   13.056  1.00 15.21 ? 404  PRO A CG    1 
ATOM   3899 C CD    . PRO E 3 404 ? 20.483  1.166   12.188  1.00 15.35 ? 404  PRO A CD    1 
ATOM   3900 N N     . VAL E 3 405 ? 23.877  3.306   9.863   1.00 15.92 ? 405  VAL A N     1 
ATOM   3901 C CA    . VAL E 3 405 ? 24.897  3.031   8.849   1.00 17.11 ? 405  VAL A CA    1 
ATOM   3902 C C     . VAL E 3 405 ? 26.216  3.717   9.259   1.00 17.57 ? 405  VAL A C     1 
ATOM   3903 O O     . VAL E 3 405 ? 26.291  4.951   9.301   1.00 18.24 ? 405  VAL A O     1 
ATOM   3904 C CB    . VAL E 3 405 ? 24.430  3.562   7.475   1.00 17.21 ? 405  VAL A CB    1 
ATOM   3905 C CG1   . VAL E 3 405 ? 25.517  3.370   6.397   1.00 18.28 ? 405  VAL A CG1   1 
ATOM   3906 C CG2   . VAL E 3 405 ? 23.137  2.867   7.062   1.00 16.08 ? 405  VAL A CG2   1 
ATOM   3907 N N     . ARG E 3 406 ? 27.233  2.912   9.560   1.00 18.34 ? 406  ARG A N     1 
ATOM   3908 C CA    . ARG E 3 406 ? 28.550  3.422   9.960   1.00 19.54 ? 406  ARG A CA    1 
ATOM   3909 C C     . ARG E 3 406 ? 29.447  3.703   8.754   1.00 20.26 ? 406  ARG A C     1 
ATOM   3910 O O     . ARG E 3 406 ? 29.062  3.435   7.607   1.00 20.20 ? 406  ARG A O     1 
ATOM   3911 C CB    . ARG E 3 406 ? 29.247  2.456   10.923  1.00 19.63 ? 406  ARG A CB    1 
ATOM   3912 C CG    . ARG E 3 406 ? 29.628  1.086   10.354  1.00 20.33 ? 406  ARG A CG    1 
ATOM   3913 C CD    . ARG E 3 406 ? 30.356  0.332   11.453  1.00 21.91 ? 406  ARG A CD    1 
ATOM   3914 N NE    . ARG E 3 406 ? 30.507  -1.101  11.240  1.00 24.90 ? 406  ARG A NE    1 
ATOM   3915 C CZ    . ARG E 3 406 ? 31.632  -1.694  10.846  1.00 23.36 ? 406  ARG A CZ    1 
ATOM   3916 N NH1   . ARG E 3 406 ? 32.715  -0.975  10.578  1.00 23.94 ? 406  ARG A NH1   1 
ATOM   3917 N NH2   . ARG E 3 406 ? 31.666  -3.013  10.699  1.00 25.38 ? 406  ARG A NH2   1 
ATOM   3918 N N     . ARG E 3 407 ? 30.642  4.235   9.023   1.00 20.08 ? 407  ARG A N     1 
ATOM   3919 C CA    . ARG E 3 407 ? 31.499  4.823   7.974   1.00 21.02 ? 407  ARG A CA    1 
ATOM   3920 C C     . ARG E 3 407 ? 32.081  3.824   6.981   1.00 21.16 ? 407  ARG A C     1 
ATOM   3921 O O     . ARG E 3 407 ? 32.523  4.218   5.899   1.00 22.14 ? 407  ARG A O     1 
ATOM   3922 C CB    . ARG E 3 407 ? 32.628  5.667   8.597   1.00 20.70 ? 407  ARG A CB    1 
ATOM   3923 C CG    . ARG E 3 407 ? 32.152  6.891   9.356   1.00 21.28 ? 407  ARG A CG    1 
ATOM   3924 C CD    . ARG E 3 407 ? 33.326  7.621   10.010  1.00 22.06 ? 407  ARG A CD    1 
ATOM   3925 N NE    . ARG E 3 407 ? 32.893  8.621   10.993  1.00 24.10 ? 407  ARG A NE    1 
ATOM   3926 C CZ    . ARG E 3 407 ? 32.821  8.413   12.305  1.00 25.98 ? 407  ARG A CZ    1 
ATOM   3927 N NH1   . ARG E 3 407 ? 33.143  7.229   12.825  1.00 26.06 ? 407  ARG A NH1   1 
ATOM   3928 N NH2   . ARG E 3 407 ? 32.424  9.396   13.108  1.00 27.19 ? 407  ARG A NH2   1 
ATOM   3929 N N     . GLU E 3 408 ? 32.095  2.544   7.346   1.00 22.02 ? 408  GLU A N     1 
ATOM   3930 C CA    . GLU E 3 408 ? 32.506  1.474   6.439   1.00 22.82 ? 408  GLU A CA    1 
ATOM   3931 C C     . GLU E 3 408 ? 31.656  1.469   5.156   1.00 23.22 ? 408  GLU A C     1 
ATOM   3932 O O     . GLU E 3 408 ? 32.150  1.149   4.061   1.00 22.80 ? 408  GLU A O     1 
ATOM   3933 C CB    . GLU E 3 408 ? 32.374  0.108   7.139   1.00 23.34 ? 408  GLU A CB    1 
ATOM   3934 C CG    . GLU E 3 408 ? 32.728  -1.099  6.259   1.00 25.89 ? 408  GLU A CG    1 
ATOM   3935 C CD    . GLU E 3 408 ? 34.221  -1.340  6.152   1.00 29.66 ? 408  GLU A CD    1 
ATOM   3936 O OE1   . GLU E 3 408 ? 34.631  -2.133  5.266   1.00 32.46 ? 408  GLU A OE1   1 
ATOM   3937 O OE2   . GLU E 3 408 ? 34.981  -0.748  6.954   1.00 28.88 ? 408  GLU A OE2   1 
ATOM   3938 N N     . TYR E 3 409 ? 30.381  1.839   5.307   1.00 23.28 ? 409  TYR A N     1 
ATOM   3939 C CA    . TYR E 3 409 ? 29.371  1.614   4.263   1.00 23.48 ? 409  TYR A CA    1 
ATOM   3940 C C     . TYR E 3 409 ? 28.966  2.891   3.549   1.00 23.82 ? 409  TYR A C     1 
ATOM   3941 O O     . TYR E 3 409 ? 28.686  2.885   2.355   1.00 24.43 ? 409  TYR A O     1 
ATOM   3942 C CB    . TYR E 3 409 ? 28.127  0.971   4.884   1.00 23.13 ? 409  TYR A CB    1 
ATOM   3943 C CG    . TYR E 3 409 ? 28.436  -0.224  5.746   1.00 22.45 ? 409  TYR A CG    1 
ATOM   3944 C CD1   . TYR E 3 409 ? 29.100  -1.333  5.217   1.00 22.75 ? 409  TYR A CD1   1 
ATOM   3945 C CD2   . TYR E 3 409 ? 28.073  -0.249  7.091   1.00 22.68 ? 409  TYR A CD2   1 
ATOM   3946 C CE1   . TYR E 3 409 ? 29.389  -2.441  5.999   1.00 22.46 ? 409  TYR A CE1   1 
ATOM   3947 C CE2   . TYR E 3 409 ? 28.361  -1.352  7.889   1.00 23.47 ? 409  TYR A CE2   1 
ATOM   3948 C CZ    . TYR E 3 409 ? 29.025  -2.443  7.336   1.00 23.25 ? 409  TYR A CZ    1 
ATOM   3949 O OH    . TYR E 3 409 ? 29.320  -3.547  8.106   1.00 23.53 ? 409  TYR A OH    1 
ATOM   3950 N N     . GLY E 3 410 ? 28.930  3.984   4.294   1.00 24.56 ? 410  GLY A N     1 
ATOM   3951 C CA    . GLY E 3 410 ? 28.463  5.250   3.772   1.00 25.30 ? 410  GLY A CA    1 
ATOM   3952 C C     . GLY E 3 410 ? 29.065  6.377   4.572   1.00 25.80 ? 410  GLY A C     1 
ATOM   3953 O O     . GLY E 3 410 ? 29.394  6.215   5.756   1.00 25.58 ? 410  GLY A O     1 
ATOM   3954 N N     . PHE E 3 411 ? 29.211  7.523   3.922   1.00 26.44 ? 411  PHE A N     1 
ATOM   3955 C CA    . PHE E 3 411 ? 29.867  8.663   4.530   1.00 27.17 ? 411  PHE A CA    1 
ATOM   3956 C C     . PHE E 3 411 ? 29.350  9.961   3.920   1.00 27.51 ? 411  PHE A C     1 
ATOM   3957 O O     . PHE E 3 411 ? 29.464  10.186  2.706   1.00 27.17 ? 411  PHE A O     1 
ATOM   3958 C CB    . PHE E 3 411 ? 31.395  8.562   4.353   1.00 27.27 ? 411  PHE A CB    1 
ATOM   3959 C CG    . PHE E 3 411 ? 32.154  9.606   5.130   1.00 28.11 ? 411  PHE A CG    1 
ATOM   3960 C CD1   . PHE E 3 411 ? 32.692  9.310   6.383   1.00 27.83 ? 411  PHE A CD1   1 
ATOM   3961 C CD2   . PHE E 3 411 ? 32.301  10.897  4.623   1.00 27.20 ? 411  PHE A CD2   1 
ATOM   3962 C CE1   . PHE E 3 411 ? 33.373  10.294  7.117   1.00 28.19 ? 411  PHE A CE1   1 
ATOM   3963 C CE2   . PHE E 3 411 ? 32.971  11.876  5.354   1.00 27.92 ? 411  PHE A CE2   1 
ATOM   3964 C CZ    . PHE E 3 411 ? 33.516  11.565  6.596   1.00 26.64 ? 411  PHE A CZ    1 
ATOM   3965 N N     . HIS E 3 412 ? 28.795  10.820  4.771   1.00 28.01 ? 412  HIS A N     1 
ATOM   3966 C CA    . HIS E 3 412 ? 28.324  12.130  4.325   1.00 28.76 ? 412  HIS A CA    1 
ATOM   3967 C C     . HIS E 3 412 ? 29.421  13.187  4.448   1.00 29.63 ? 412  HIS A C     1 
ATOM   3968 O O     . HIS E 3 412 ? 29.820  13.545  5.564   1.00 29.38 ? 412  HIS A O     1 
ATOM   3969 C CB    . HIS E 3 412 ? 27.107  12.565  5.144   1.00 28.63 ? 412  HIS A CB    1 
ATOM   3970 C CG    . HIS E 3 412 ? 26.147  13.424  4.388   1.00 29.81 ? 412  HIS A CG    1 
ATOM   3971 N ND1   . HIS E 3 412 ? 26.555  14.381  3.480   1.00 30.64 ? 412  HIS A ND1   1 
ATOM   3972 C CD2   . HIS E 3 412 ? 24.793  13.477  4.410   1.00 30.19 ? 412  HIS A CD2   1 
ATOM   3973 C CE1   . HIS E 3 412 ? 25.491  14.981  2.972   1.00 31.26 ? 412  HIS A CE1   1 
ATOM   3974 N NE2   . HIS E 3 412 ? 24.410  14.446  3.514   1.00 30.41 ? 412  HIS A NE2   1 
ATOM   3975 N N     . THR E 3 413 ? 29.894  13.696  3.310   1.00 30.38 ? 413  THR A N     1 
ATOM   3976 C CA    . THR E 3 413 ? 30.960  14.696  3.321   1.00 31.69 ? 413  THR A CA    1 
ATOM   3977 C C     . THR E 3 413 ? 30.427  16.112  3.518   1.00 32.48 ? 413  THR A C     1 
ATOM   3978 O O     . THR E 3 413 ? 31.216  17.047  3.670   1.00 33.03 ? 413  THR A O     1 
ATOM   3979 C CB    . THR E 3 413 ? 31.830  14.651  2.041   1.00 31.69 ? 413  THR A CB    1 
ATOM   3980 O OG1   . THR E 3 413 ? 31.029  14.974  0.892   1.00 31.85 ? 413  THR A OG1   1 
ATOM   3981 C CG2   . THR E 3 413 ? 32.466  13.280  1.874   1.00 31.33 ? 413  THR A CG2   1 
ATOM   3982 N N     . VAL F 3 21  ? 42.968  12.738  70.861  1.00 32.15 ? 21   VAL D N     1 
ATOM   3983 C CA    . VAL F 3 21  ? 41.630  12.714  71.533  1.00 31.68 ? 21   VAL D CA    1 
ATOM   3984 C C     . VAL F 3 21  ? 41.751  13.065  73.024  1.00 30.96 ? 21   VAL D C     1 
ATOM   3985 O O     . VAL F 3 21  ? 42.557  12.462  73.756  1.00 31.00 ? 21   VAL D O     1 
ATOM   3986 C CB    . VAL F 3 21  ? 40.934  11.341  71.362  1.00 31.92 ? 21   VAL D CB    1 
ATOM   3987 C CG1   . VAL F 3 21  ? 39.780  11.199  72.332  1.00 32.62 ? 21   VAL D CG1   1 
ATOM   3988 C CG2   . VAL F 3 21  ? 40.450  11.148  69.915  1.00 32.63 ? 21   VAL D CG2   1 
ATOM   3989 N N     . GLU F 3 22  ? 40.965  14.057  73.456  1.00 29.77 ? 22   GLU D N     1 
ATOM   3990 C CA    . GLU F 3 22  ? 40.838  14.388  74.873  1.00 28.21 ? 22   GLU D CA    1 
ATOM   3991 C C     . GLU F 3 22  ? 39.389  14.433  75.357  1.00 26.09 ? 22   GLU D C     1 
ATOM   3992 O O     . GLU F 3 22  ? 38.450  14.746  74.609  1.00 27.02 ? 22   GLU D O     1 
ATOM   3993 C CB    . GLU F 3 22  ? 41.562  15.697  75.228  1.00 29.10 ? 22   GLU D CB    1 
ATOM   3994 C CG    . GLU F 3 22  ? 42.793  15.508  76.146  1.00 32.58 ? 22   GLU D CG    1 
ATOM   3995 C CD    . GLU F 3 22  ? 42.446  15.401  77.641  1.00 36.48 ? 22   GLU D CD    1 
ATOM   3996 O OE1   . GLU F 3 22  ? 41.720  14.459  78.045  1.00 38.73 ? 22   GLU D OE1   1 
ATOM   3997 O OE2   . GLU F 3 22  ? 42.922  16.258  78.425  1.00 38.28 ? 22   GLU D OE2   1 
ATOM   3998 N N     . THR F 3 23  ? 39.226  14.094  76.624  1.00 22.93 ? 23   THR D N     1 
ATOM   3999 C CA    . THR F 3 23  ? 37.925  14.099  77.268  1.00 18.58 ? 23   THR D CA    1 
ATOM   4000 C C     . THR F 3 23  ? 37.689  15.516  77.787  1.00 17.16 ? 23   THR D C     1 
ATOM   4001 O O     . THR F 3 23  ? 38.589  16.098  78.390  1.00 16.14 ? 23   THR D O     1 
ATOM   4002 C CB    . THR F 3 23  ? 37.917  13.082  78.413  1.00 18.59 ? 23   THR D CB    1 
ATOM   4003 O OG1   . THR F 3 23  ? 38.439  11.830  77.931  1.00 17.19 ? 23   THR D OG1   1 
ATOM   4004 C CG2   . THR F 3 23  ? 36.505  12.871  78.959  1.00 15.94 ? 23   THR D CG2   1 
ATOM   4005 N N     . PRO F 3 24  ? 36.485  16.083  77.552  1.00 16.08 ? 24   PRO D N     1 
ATOM   4006 C CA    . PRO F 3 24  ? 36.214  17.421  78.107  1.00 15.53 ? 24   PRO D CA    1 
ATOM   4007 C C     . PRO F 3 24  ? 36.362  17.447  79.640  1.00 14.72 ? 24   PRO D C     1 
ATOM   4008 O O     . PRO F 3 24  ? 35.957  16.491  80.301  1.00 13.00 ? 24   PRO D O     1 
ATOM   4009 C CB    . PRO F 3 24  ? 34.752  17.671  77.716  1.00 15.82 ? 24   PRO D CB    1 
ATOM   4010 C CG    . PRO F 3 24  ? 34.531  16.792  76.509  1.00 17.18 ? 24   PRO D CG    1 
ATOM   4011 C CD    . PRO F 3 24  ? 35.339  15.560  76.787  1.00 16.14 ? 24   PRO D CD    1 
ATOM   4012 N N     . PRO F 3 25  ? 36.955  18.524  80.197  1.00 14.32 ? 25   PRO D N     1 
ATOM   4013 C CA    . PRO F 3 25  ? 37.100  18.692  81.648  1.00 13.68 ? 25   PRO D CA    1 
ATOM   4014 C C     . PRO F 3 25  ? 35.835  18.345  82.458  1.00 12.51 ? 25   PRO D C     1 
ATOM   4015 O O     . PRO F 3 25  ? 35.928  17.698  83.495  1.00 11.66 ? 25   PRO D O     1 
ATOM   4016 C CB    . PRO F 3 25  ? 37.423  20.188  81.787  1.00 15.28 ? 25   PRO D CB    1 
ATOM   4017 C CG    . PRO F 3 25  ? 38.111  20.532  80.537  1.00 14.82 ? 25   PRO D CG    1 
ATOM   4018 C CD    . PRO F 3 25  ? 37.550  19.653  79.456  1.00 15.22 ? 25   PRO D CD    1 
ATOM   4019 N N     . GLU F 3 26  ? 34.667  18.797  81.999  1.00 11.80 ? 26   GLU D N     1 
ATOM   4020 C CA    . GLU F 3 26  ? 33.398  18.541  82.708  1.00 10.66 ? 26   GLU D CA    1 
ATOM   4021 C C     . GLU F 3 26  ? 33.086  17.035  82.821  1.00 10.65 ? 26   GLU D C     1 
ATOM   4022 O O     . GLU F 3 26  ? 32.526  16.550  83.829  1.00 9.35  ? 26   GLU D O     1 
ATOM   4023 C CB    . GLU F 3 26  ? 32.235  19.256  82.010  1.00 11.97 ? 26   GLU D CB    1 
ATOM   4024 C CG    . GLU F 3 26  ? 32.288  20.788  82.137  1.00 12.60 ? 26   GLU D CG    1 
ATOM   4025 C CD    . GLU F 3 26  ? 33.283  21.461  81.187  1.00 13.99 ? 26   GLU D CD    1 
ATOM   4026 O OE1   . GLU F 3 26  ? 33.742  20.811  80.197  1.00 16.24 ? 26   GLU D OE1   1 
ATOM   4027 O OE2   . GLU F 3 26  ? 33.596  22.653  81.424  1.00 14.18 ? 26   GLU D OE2   1 
ATOM   4028 N N     . VAL F 3 27  ? 33.450  16.305  81.769  1.00 8.81  ? 27   VAL D N     1 
ATOM   4029 C CA    . VAL F 3 27  ? 33.248  14.864  81.747  1.00 9.09  ? 27   VAL D CA    1 
ATOM   4030 C C     . VAL F 3 27  ? 34.229  14.188  82.708  1.00 8.82  ? 27   VAL D C     1 
ATOM   4031 O O     . VAL F 3 27  ? 33.854  13.280  83.477  1.00 9.26  ? 27   VAL D O     1 
ATOM   4032 C CB    . VAL F 3 27  ? 33.391  14.286  80.333  1.00 8.80  ? 27   VAL D CB    1 
ATOM   4033 C CG1   . VAL F 3 27  ? 33.357  12.773  80.368  1.00 10.31 ? 27   VAL D CG1   1 
ATOM   4034 C CG2   . VAL F 3 27  ? 32.244  14.805  79.416  1.00 10.66 ? 27   VAL D CG2   1 
ATOM   4035 N N     . VAL F 3 28  ? 35.487  14.611  82.635  1.00 9.34  ? 28   VAL D N     1 
ATOM   4036 C CA    . VAL F 3 28  ? 36.521  14.088  83.545  1.00 9.38  ? 28   VAL D CA    1 
ATOM   4037 C C     . VAL F 3 28  ? 36.080  14.305  85.013  1.00 10.17 ? 28   VAL D C     1 
ATOM   4038 O O     . VAL F 3 28  ? 36.108  13.381  85.834  1.00 9.62  ? 28   VAL D O     1 
ATOM   4039 C CB    . VAL F 3 28  ? 37.911  14.735  83.264  1.00 10.24 ? 28   VAL D CB    1 
ATOM   4040 C CG1   . VAL F 3 28  ? 38.960  14.261  84.285  1.00 10.06 ? 28   VAL D CG1   1 
ATOM   4041 C CG2   . VAL F 3 28  ? 38.381  14.432  81.842  1.00 10.48 ? 28   VAL D CG2   1 
ATOM   4042 N N     . ASP F 3 29  ? 35.654  15.523  85.330  1.00 10.10 ? 29   ASP D N     1 
ATOM   4043 C CA    . ASP F 3 29  ? 35.271  15.854  86.702  1.00 11.21 ? 29   ASP D CA    1 
ATOM   4044 C C     . ASP F 3 29  ? 34.093  15.002  87.198  1.00 10.16 ? 29   ASP D C     1 
ATOM   4045 O O     . ASP F 3 29  ? 34.126  14.488  88.314  1.00 10.21 ? 29   ASP D O     1 
ATOM   4046 C CB    . ASP F 3 29  ? 34.992  17.350  86.797  1.00 12.95 ? 29   ASP D CB    1 
ATOM   4047 C CG    . ASP F 3 29  ? 36.283  18.191  86.741  1.00 18.69 ? 29   ASP D CG    1 
ATOM   4048 O OD1   . ASP F 3 29  ? 36.167  19.439  86.677  1.00 25.65 ? 29   ASP D OD1   1 
ATOM   4049 O OD2   . ASP F 3 29  ? 37.419  17.630  86.779  1.00 22.67 ? 29   ASP D OD2   1 
ATOM   4050 N N     . PHE F 3 30  ? 33.083  14.798  86.344  1.00 9.20  ? 30   PHE D N     1 
ATOM   4051 C CA    . PHE F 3 30  ? 31.967  13.920  86.675  1.00 9.36  ? 30   PHE D CA    1 
ATOM   4052 C C     . PHE F 3 30  ? 32.455  12.478  86.922  1.00 8.91  ? 30   PHE D C     1 
ATOM   4053 O O     . PHE F 3 30  ? 32.062  11.845  87.895  1.00 9.95  ? 30   PHE D O     1 
ATOM   4054 C CB    . PHE F 3 30  ? 30.936  13.964  85.533  1.00 8.78  ? 30   PHE D CB    1 
ATOM   4055 C CG    . PHE F 3 30  ? 29.785  13.039  85.696  1.00 8.46  ? 30   PHE D CG    1 
ATOM   4056 C CD1   . PHE F 3 30  ? 28.993  13.058  86.844  1.00 11.86 ? 30   PHE D CD1   1 
ATOM   4057 C CD2   . PHE F 3 30  ? 29.463  12.148  84.666  1.00 9.37  ? 30   PHE D CD2   1 
ATOM   4058 C CE1   . PHE F 3 30  ? 27.906  12.192  86.964  1.00 11.00 ? 30   PHE D CE1   1 
ATOM   4059 C CE2   . PHE F 3 30  ? 28.400  11.296  84.768  1.00 10.36 ? 30   PHE D CE2   1 
ATOM   4060 C CZ    . PHE F 3 30  ? 27.615  11.295  85.928  1.00 10.96 ? 30   PHE D CZ    1 
ATOM   4061 N N     . MET F 3 31  ? 33.300  11.952  86.033  1.00 8.90  ? 31   MET D N     1 
ATOM   4062 C CA    . MET F 3 31  ? 33.802  10.590  86.185  1.00 8.01  ? 31   MET D CA    1 
ATOM   4063 C C     . MET F 3 31  ? 34.610  10.397  87.474  1.00 8.55  ? 31   MET D C     1 
ATOM   4064 O O     . MET F 3 31  ? 34.422  9.416   88.196  1.00 8.40  ? 31   MET D O     1 
ATOM   4065 C CB    . MET F 3 31  ? 34.616  10.207  84.963  1.00 8.06  ? 31   MET D CB    1 
ATOM   4066 C CG    . MET F 3 31  ? 33.727  9.959   83.753  1.00 5.94  ? 31   MET D CG    1 
ATOM   4067 S SD    . MET F 3 31  ? 34.709  9.814   82.256  1.00 9.88  ? 31   MET D SD    1 
ATOM   4068 C CE    . MET F 3 31  ? 35.495  8.206   82.498  1.00 10.90 ? 31   MET D CE    1 
ATOM   4069 N N     . VAL F 3 32  ? 35.478  11.359  87.760  1.00 8.84  ? 32   VAL D N     1 
ATOM   4070 C CA    . VAL F 3 32  ? 36.292  11.344  88.991  1.00 10.22 ? 32   VAL D CA    1 
ATOM   4071 C C     . VAL F 3 32  ? 35.387  11.341  90.235  1.00 11.26 ? 32   VAL D C     1 
ATOM   4072 O O     . VAL F 3 32  ? 35.666  10.643  91.200  1.00 11.27 ? 32   VAL D O     1 
ATOM   4073 C CB    . VAL F 3 32  ? 37.316  12.490  88.997  1.00 9.93  ? 32   VAL D CB    1 
ATOM   4074 C CG1   . VAL F 3 32  ? 37.984  12.634  90.362  1.00 11.14 ? 32   VAL D CG1   1 
ATOM   4075 C CG2   . VAL F 3 32  ? 38.409  12.229  87.918  1.00 11.35 ? 32   VAL D CG2   1 
ATOM   4076 N N     . SER F 3 33  ? 34.272  12.068  90.172  1.00 12.15 ? 33   SER D N     1 
ATOM   4077 C CA    . SER F 3 33  ? 33.260  12.045  91.254  1.00 12.46 ? 33   SER D CA    1 
ATOM   4078 C C     . SER F 3 33  ? 32.589  10.668  91.533  1.00 13.10 ? 33   SER D C     1 
ATOM   4079 O O     . SER F 3 33  ? 32.090  10.414  92.646  1.00 13.87 ? 33   SER D O     1 
ATOM   4080 C CB    . SER F 3 33  ? 32.197  13.140  91.014  1.00 12.83 ? 33   SER D CB    1 
ATOM   4081 O OG    . SER F 3 33  ? 31.131  12.686  90.198  1.00 14.25 ? 33   SER D OG    1 
ATOM   4082 N N     . LEU F 3 34  ? 32.535  9.815   90.516  1.00 12.10 ? 34   LEU D N     1 
ATOM   4083 C CA    . LEU F 3 34  ? 31.953  8.483   90.602  1.00 13.14 ? 34   LEU D CA    1 
ATOM   4084 C C     . LEU F 3 34  ? 33.000  7.443   91.015  1.00 14.40 ? 34   LEU D C     1 
ATOM   4085 O O     . LEU F 3 34  ? 32.679  6.320   91.417  1.00 14.93 ? 34   LEU D O     1 
ATOM   4086 C CB    . LEU F 3 34  ? 31.379  8.108   89.233  1.00 12.52 ? 34   LEU D CB    1 
ATOM   4087 C CG    . LEU F 3 34  ? 30.202  8.929   88.692  1.00 12.82 ? 34   LEU D CG    1 
ATOM   4088 C CD1   . LEU F 3 34  ? 29.938  8.532   87.232  1.00 14.05 ? 34   LEU D CD1   1 
ATOM   4089 C CD2   . LEU F 3 34  ? 28.924  8.721   89.533  1.00 13.50 ? 34   LEU D CD2   1 
ATOM   4090 N N     . ALA F 3 35  ? 34.258  7.822   90.863  1.00 15.04 ? 35   ALA D N     1 
ATOM   4091 C CA    . ALA F 3 35  ? 35.387  6.927   91.107  1.00 16.30 ? 35   ALA D CA    1 
ATOM   4092 C C     . ALA F 3 35  ? 35.688  6.816   92.586  1.00 17.36 ? 35   ALA D C     1 
ATOM   4093 O O     . ALA F 3 35  ? 35.582  7.787   93.342  1.00 18.55 ? 35   ALA D O     1 
ATOM   4094 C CB    . ALA F 3 35  ? 36.615  7.423   90.352  1.00 16.60 ? 35   ALA D CB    1 
ATOM   4095 N N     . GLU F 3 36  ? 36.066  5.621   93.007  1.00 18.03 ? 36   GLU D N     1 
ATOM   4096 C CA    . GLU F 3 36  ? 36.579  5.469   94.355  1.00 19.09 ? 36   GLU D CA    1 
ATOM   4097 C C     . GLU F 3 36  ? 37.610  4.364   94.387  1.00 18.47 ? 36   GLU D C     1 
ATOM   4098 O O     . GLU F 3 36  ? 37.645  3.506   93.512  1.00 17.25 ? 36   GLU D O     1 
ATOM   4099 C CB    . GLU F 3 36  ? 35.450  5.218   95.359  1.00 19.82 ? 36   GLU D CB    1 
ATOM   4100 C CG    . GLU F 3 36  ? 34.635  3.967   95.137  1.00 24.54 ? 36   GLU D CG    1 
ATOM   4101 C CD    . GLU F 3 36  ? 33.247  4.070   95.761  1.00 31.02 ? 36   GLU D CD    1 
ATOM   4102 O OE1   . GLU F 3 36  ? 33.101  4.723   96.827  1.00 34.15 ? 36   GLU D OE1   1 
ATOM   4103 O OE2   . GLU F 3 36  ? 32.293  3.513   95.173  1.00 34.54 ? 36   GLU D OE2   1 
ATOM   4104 N N     . ALA F 3 37  ? 38.460  4.423   95.404  1.00 19.07 ? 37   ALA D N     1 
ATOM   4105 C CA    . ALA F 3 37  ? 39.461  3.414   95.615  1.00 19.08 ? 37   ALA D CA    1 
ATOM   4106 C C     . ALA F 3 37  ? 39.814  3.446   97.089  1.00 19.53 ? 37   ALA D C     1 
ATOM   4107 O O     . ALA F 3 37  ? 39.772  4.509   97.712  1.00 19.04 ? 37   ALA D O     1 
ATOM   4108 C CB    . ALA F 3 37  ? 40.698  3.690   94.753  1.00 19.38 ? 37   ALA D CB    1 
ATOM   4109 N N     . PRO F 3 38  ? 40.185  2.289   97.644  1.00 19.52 ? 38   PRO D N     1 
ATOM   4110 C CA    . PRO F 3 38  ? 40.626  2.304   99.047  1.00 20.01 ? 38   PRO D CA    1 
ATOM   4111 C C     . PRO F 3 38  ? 41.962  3.047   99.153  1.00 20.11 ? 38   PRO D C     1 
ATOM   4112 O O     . PRO F 3 38  ? 42.665  3.189   98.151  1.00 19.49 ? 38   PRO D O     1 
ATOM   4113 C CB    . PRO F 3 38  ? 40.795  0.821   99.373  1.00 20.30 ? 38   PRO D CB    1 
ATOM   4114 C CG    . PRO F 3 38  ? 41.023  0.141   98.033  1.00 20.09 ? 38   PRO D CG    1 
ATOM   4115 C CD    . PRO F 3 38  ? 40.256  0.952   97.027  1.00 19.75 ? 38   PRO D CD    1 
ATOM   4116 N N     . ARG F 3 39  ? 42.317  3.539   100.337 1.00 20.36 ? 39   ARG D N     1 
ATOM   4117 C CA    . ARG F 3 39  ? 43.644  4.134   100.495 1.00 21.36 ? 39   ARG D CA    1 
ATOM   4118 C C     . ARG F 3 39  ? 44.695  3.066   100.163 1.00 20.24 ? 39   ARG D C     1 
ATOM   4119 O O     . ARG F 3 39  ? 44.518  1.886   100.489 1.00 20.46 ? 39   ARG D O     1 
ATOM   4120 C CB    . ARG F 3 39  ? 43.855  4.696   101.905 1.00 22.24 ? 39   ARG D CB    1 
ATOM   4121 C CG    . ARG F 3 39  ? 43.885  3.625   102.983 1.00 26.35 ? 39   ARG D CG    1 
ATOM   4122 C CD    . ARG F 3 39  ? 44.794  4.040   104.136 1.00 33.10 ? 39   ARG D CD    1 
ATOM   4123 N NE    . ARG F 3 39  ? 44.161  4.961   105.081 1.00 37.48 ? 39   ARG D NE    1 
ATOM   4124 C CZ    . ARG F 3 39  ? 43.297  4.601   106.029 1.00 39.51 ? 39   ARG D CZ    1 
ATOM   4125 N NH1   . ARG F 3 39  ? 42.928  3.330   106.172 1.00 41.02 ? 39   ARG D NH1   1 
ATOM   4126 N NH2   . ARG F 3 39  ? 42.795  5.525   106.835 1.00 40.49 ? 39   ARG D NH2   1 
ATOM   4127 N N     . GLY F 3 40  ? 45.767  3.486   99.497  1.00 19.10 ? 40   GLY D N     1 
ATOM   4128 C CA    . GLY F 3 40  ? 46.796  2.565   98.974  1.00 18.73 ? 40   GLY D CA    1 
ATOM   4129 C C     . GLY F 3 40  ? 46.362  1.799   97.732  1.00 18.59 ? 40   GLY D C     1 
ATOM   4130 O O     . GLY F 3 40  ? 47.127  0.987   97.183  1.00 19.47 ? 40   GLY D O     1 
ATOM   4131 N N     . GLY F 3 41  ? 45.133  2.055   97.292  1.00 16.55 ? 41   GLY D N     1 
ATOM   4132 C CA    . GLY F 3 41  ? 44.553  1.363   96.145  1.00 15.62 ? 41   GLY D CA    1 
ATOM   4133 C C     . GLY F 3 41  ? 45.369  1.532   94.875  1.00 14.52 ? 41   GLY D C     1 
ATOM   4134 O O     . GLY F 3 41  ? 46.104  2.523   94.700  1.00 14.49 ? 41   GLY D O     1 
ATOM   4135 N N     . ARG F 3 42  ? 45.235  0.549   93.997  1.00 13.71 ? 42   ARG D N     1 
ATOM   4136 C CA    . ARG F 3 42  ? 45.923  0.568   92.709  1.00 12.29 ? 42   ARG D CA    1 
ATOM   4137 C C     . ARG F 3 42  ? 44.968  1.172   91.698  1.00 11.56 ? 42   ARG D C     1 
ATOM   4138 O O     . ARG F 3 42  ? 43.881  0.640   91.484  1.00 11.97 ? 42   ARG D O     1 
ATOM   4139 C CB    . ARG F 3 42  ? 46.319  -0.847  92.300  1.00 13.10 ? 42   ARG D CB    1 
ATOM   4140 C CG    . ARG F 3 42  ? 47.365  -1.479  93.230  1.00 13.33 ? 42   ARG D CG    1 
ATOM   4141 C CD    . ARG F 3 42  ? 47.405  -2.997  93.071  1.00 16.02 ? 42   ARG D CD    1 
ATOM   4142 N NE    . ARG F 3 42  ? 47.756  -3.453  91.728  1.00 17.46 ? 42   ARG D NE    1 
ATOM   4143 C CZ    . ARG F 3 42  ? 48.989  -3.463  91.220  1.00 19.17 ? 42   ARG D CZ    1 
ATOM   4144 N NH1   . ARG F 3 42  ? 50.034  -3.007  91.920  1.00 17.98 ? 42   ARG D NH1   1 
ATOM   4145 N NH2   . ARG F 3 42  ? 49.176  -3.908  89.993  1.00 20.63 ? 42   ARG D NH2   1 
ATOM   4146 N N     . VAL F 3 43  ? 45.396  2.257   91.072  1.00 10.52 ? 43   VAL D N     1 
ATOM   4147 C CA    . VAL F 3 43  ? 44.536  3.045   90.171  1.00 10.28 ? 43   VAL D CA    1 
ATOM   4148 C C     . VAL F 3 43  ? 45.177  3.052   88.778  1.00 9.55  ? 43   VAL D C     1 
ATOM   4149 O O     . VAL F 3 43  ? 46.347  3.425   88.622  1.00 9.87  ? 43   VAL D O     1 
ATOM   4150 C CB    . VAL F 3 43  ? 44.417  4.485   90.683  1.00 10.48 ? 43   VAL D CB    1 
ATOM   4151 C CG1   . VAL F 3 43  ? 43.599  5.367   89.703  1.00 10.27 ? 43   VAL D CG1   1 
ATOM   4152 C CG2   . VAL F 3 43  ? 43.821  4.513   92.104  1.00 10.73 ? 43   VAL D CG2   1 
ATOM   4153 N N     . LEU F 3 44  ? 44.401  2.681   87.766  1.00 9.05  ? 44   LEU D N     1 
ATOM   4154 C CA    . LEU F 3 44  ? 44.919  2.521   86.403  1.00 9.38  ? 44   LEU D CA    1 
ATOM   4155 C C     . LEU F 3 44  ? 44.145  3.357   85.393  1.00 8.77  ? 44   LEU D C     1 
ATOM   4156 O O     . LEU F 3 44  ? 42.907  3.369   85.418  1.00 9.25  ? 44   LEU D O     1 
ATOM   4157 C CB    . LEU F 3 44  ? 44.758  1.061   85.980  1.00 9.11  ? 44   LEU D CB    1 
ATOM   4158 C CG    . LEU F 3 44  ? 45.080  0.691   84.529  1.00 9.74  ? 44   LEU D CG    1 
ATOM   4159 C CD1   . LEU F 3 44  ? 46.573  0.963   84.182  1.00 9.79  ? 44   LEU D CD1   1 
ATOM   4160 C CD2   . LEU F 3 44  ? 44.633  -0.765  84.272  1.00 10.94 ? 44   LEU D CD2   1 
ATOM   4161 N N     . GLU F 3 45  ? 44.882  4.034   84.518  1.00 9.01  ? 45   GLU D N     1 
ATOM   4162 C CA    . GLU F 3 45  ? 44.292  4.708   83.351  1.00 9.47  ? 45   GLU D CA    1 
ATOM   4163 C C     . GLU F 3 45  ? 44.783  4.018   82.084  1.00 9.19  ? 45   GLU D C     1 
ATOM   4164 O O     . GLU F 3 45  ? 45.932  4.176   81.710  1.00 8.57  ? 45   GLU D O     1 
ATOM   4165 C CB    . GLU F 3 45  ? 44.607  6.219   83.299  1.00 9.47  ? 45   GLU D CB    1 
ATOM   4166 C CG    . GLU F 3 45  ? 43.950  6.849   82.035  1.00 10.78 ? 45   GLU D CG    1 
ATOM   4167 C CD    . GLU F 3 45  ? 44.098  8.366   81.865  1.00 12.25 ? 45   GLU D CD    1 
ATOM   4168 O OE1   . GLU F 3 45  ? 44.649  9.064   82.746  1.00 15.02 ? 45   GLU D OE1   1 
ATOM   4169 O OE2   . GLU F 3 45  ? 43.642  8.870   80.815  1.00 14.68 ? 45   GLU D OE2   1 
ATOM   4170 N N     . PRO F 3 46  ? 43.913  3.219   81.442  1.00 9.95  ? 46   PRO D N     1 
ATOM   4171 C CA    . PRO F 3 46  ? 44.275  2.634   80.160  1.00 9.81  ? 46   PRO D CA    1 
ATOM   4172 C C     . PRO F 3 46  ? 44.247  3.676   79.049  1.00 9.93  ? 46   PRO D C     1 
ATOM   4173 O O     . PRO F 3 46  ? 43.486  4.649   79.142  1.00 10.04 ? 46   PRO D O     1 
ATOM   4174 C CB    . PRO F 3 46  ? 43.172  1.590   79.909  1.00 10.33 ? 46   PRO D CB    1 
ATOM   4175 C CG    . PRO F 3 46  ? 42.417  1.445   81.198  1.00 10.60 ? 46   PRO D CG    1 
ATOM   4176 C CD    . PRO F 3 46  ? 42.602  2.749   81.927  1.00 9.73  ? 46   PRO D CD    1 
ATOM   4177 N N     . ALA F 3 47  ? 45.062  3.470   78.016  1.00 9.55  ? 47   ALA D N     1 
ATOM   4178 C CA    . ALA F 3 47  ? 45.118  4.378   76.851  1.00 10.23 ? 47   ALA D CA    1 
ATOM   4179 C C     . ALA F 3 47  ? 45.400  5.809   77.311  1.00 10.51 ? 47   ALA D C     1 
ATOM   4180 O O     . ALA F 3 47  ? 44.724  6.752   76.892  1.00 10.14 ? 47   ALA D O     1 
ATOM   4181 C CB    . ALA F 3 47  ? 43.779  4.322   76.061  1.00 9.99  ? 47   ALA D CB    1 
ATOM   4182 N N     . CYS F 3 48  ? 46.380  5.958   78.213  1.00 10.61 ? 48   CYS D N     1 
ATOM   4183 C CA    . CYS F 3 48  ? 46.448  7.162   79.063  1.00 11.76 ? 48   CYS D CA    1 
ATOM   4184 C C     . CYS F 3 48  ? 47.000  8.425   78.410  1.00 11.53 ? 48   CYS D C     1 
ATOM   4185 O O     . CYS F 3 48  ? 46.688  9.530   78.863  1.00 12.67 ? 48   CYS D O     1 
ATOM   4186 C CB    . CYS F 3 48  ? 47.246  6.880   80.350  1.00 12.11 ? 48   CYS D CB    1 
ATOM   4187 S SG    . CYS F 3 48  ? 48.967  6.399   80.026  1.00 13.09 ? 48   CYS D SG    1 
ATOM   4188 N N     . ALA F 3 49  ? 47.843  8.280   77.380  1.00 11.65 ? 49   ALA D N     1 
ATOM   4189 C CA    . ALA F 3 49  ? 48.627  9.414   76.863  1.00 11.21 ? 49   ALA D CA    1 
ATOM   4190 C C     . ALA F 3 49  ? 49.326  10.157  78.032  1.00 11.57 ? 49   ALA D C     1 
ATOM   4191 O O     . ALA F 3 49  ? 50.084  9.528   78.765  1.00 11.97 ? 49   ALA D O     1 
ATOM   4192 C CB    . ALA F 3 49  ? 47.760  10.340  76.006  1.00 11.72 ? 49   ALA D CB    1 
ATOM   4193 N N     . HIS F 3 50  ? 49.029  11.441  78.246  1.00 12.02 ? 50   HIS D N     1 
ATOM   4194 C CA    . HIS F 3 50  ? 49.621  12.204  79.376  1.00 12.81 ? 50   HIS D CA    1 
ATOM   4195 C C     . HIS F 3 50  ? 48.947  11.975  80.744  1.00 12.44 ? 50   HIS D C     1 
ATOM   4196 O O     . HIS F 3 50  ? 49.358  12.568  81.745  1.00 12.47 ? 50   HIS D O     1 
ATOM   4197 C CB    . HIS F 3 50  ? 49.612  13.697  79.063  1.00 13.73 ? 50   HIS D CB    1 
ATOM   4198 C CG    . HIS F 3 50  ? 48.234  14.268  78.934  1.00 16.59 ? 50   HIS D CG    1 
ATOM   4199 N ND1   . HIS F 3 50  ? 47.698  15.144  79.855  1.00 21.95 ? 50   HIS D ND1   1 
ATOM   4200 C CD2   . HIS F 3 50  ? 47.275  14.070  77.999  1.00 18.93 ? 50   HIS D CD2   1 
ATOM   4201 C CE1   . HIS F 3 50  ? 46.474  15.479  79.478  1.00 20.16 ? 50   HIS D CE1   1 
ATOM   4202 N NE2   . HIS F 3 50  ? 46.195  14.842  78.356  1.00 21.13 ? 50   HIS D NE2   1 
ATOM   4203 N N     . GLY F 3 51  ? 47.924  11.126  80.785  1.00 10.91 ? 51   GLY D N     1 
ATOM   4204 C CA    . GLY F 3 51  ? 47.284  10.721  82.031  1.00 10.24 ? 51   GLY D CA    1 
ATOM   4205 C C     . GLY F 3 51  ? 46.368  11.765  82.677  1.00 9.83  ? 51   GLY D C     1 
ATOM   4206 O O     . GLY F 3 51  ? 46.487  12.044  83.883  1.00 10.66 ? 51   GLY D O     1 
ATOM   4207 N N     . PRO F 3 52  ? 45.414  12.320  81.911  1.00 10.46 ? 52   PRO D N     1 
ATOM   4208 C CA    . PRO F 3 52  ? 44.523  13.326  82.502  1.00 9.64  ? 52   PRO D CA    1 
ATOM   4209 C C     . PRO F 3 52  ? 43.643  12.769  83.611  1.00 9.51  ? 52   PRO D C     1 
ATOM   4210 O O     . PRO F 3 52  ? 43.288  13.509  84.542  1.00 9.69  ? 52   PRO D O     1 
ATOM   4211 C CB    . PRO F 3 52  ? 43.660  13.782  81.297  1.00 11.04 ? 52   PRO D CB    1 
ATOM   4212 C CG    . PRO F 3 52  ? 43.672  12.605  80.377  1.00 10.81 ? 52   PRO D CG    1 
ATOM   4213 C CD    . PRO F 3 52  ? 45.081  12.072  80.492  1.00 10.07 ? 52   PRO D CD    1 
ATOM   4214 N N     . PHE F 3 53  ? 43.276  11.491  83.539  1.00 8.29  ? 53   PHE D N     1 
ATOM   4215 C CA    . PHE F 3 53  ? 42.441  10.902  84.601  1.00 9.31  ? 53   PHE D CA    1 
ATOM   4216 C C     . PHE F 3 53  ? 43.237  10.612  85.873  1.00 9.00  ? 53   PHE D C     1 
ATOM   4217 O O     . PHE F 3 53  ? 42.729  10.816  86.978  1.00 9.64  ? 53   PHE D O     1 
ATOM   4218 C CB    . PHE F 3 53  ? 41.721  9.649   84.120  1.00 9.30  ? 53   PHE D CB    1 
ATOM   4219 C CG    . PHE F 3 53  ? 40.557  9.936   83.205  1.00 9.82  ? 53   PHE D CG    1 
ATOM   4220 C CD1   . PHE F 3 53  ? 39.280  10.107  83.729  1.00 10.24 ? 53   PHE D CD1   1 
ATOM   4221 C CD2   . PHE F 3 53  ? 40.743  10.068  81.830  1.00 11.38 ? 53   PHE D CD2   1 
ATOM   4222 C CE1   . PHE F 3 53  ? 38.188  10.376  82.895  1.00 11.82 ? 53   PHE D CE1   1 
ATOM   4223 C CE2   . PHE F 3 53  ? 39.644  10.351  80.969  1.00 10.45 ? 53   PHE D CE2   1 
ATOM   4224 C CZ    . PHE F 3 53  ? 38.369  10.500  81.503  1.00 11.44 ? 53   PHE D CZ    1 
ATOM   4225 N N     . LEU F 3 54  ? 44.486  10.175  85.714  1.00 9.22  ? 54   LEU D N     1 
ATOM   4226 C CA    . LEU F 3 54  ? 45.363  9.972   86.894  1.00 10.32 ? 54   LEU D CA    1 
ATOM   4227 C C     . LEU F 3 54  ? 45.571  11.324  87.616  1.00 9.83  ? 54   LEU D C     1 
ATOM   4228 O O     . LEU F 3 54  ? 45.447  11.420  88.852  1.00 10.56 ? 54   LEU D O     1 
ATOM   4229 C CB    . LEU F 3 54  ? 46.708  9.368   86.493  1.00 10.32 ? 54   LEU D CB    1 
ATOM   4230 C CG    . LEU F 3 54  ? 46.654  7.955   85.871  1.00 11.21 ? 54   LEU D CG    1 
ATOM   4231 C CD1   . LEU F 3 54  ? 48.047  7.498   85.437  1.00 11.77 ? 54   LEU D CD1   1 
ATOM   4232 C CD2   . LEU F 3 54  ? 46.007  6.928   86.789  1.00 11.86 ? 54   LEU D CD2   1 
ATOM   4233 N N     . ARG F 3 55  ? 45.849  12.352  86.829  1.00 10.45 ? 55   ARG D N     1 
ATOM   4234 C CA    . ARG F 3 55  ? 46.060  13.719  87.350  1.00 10.82 ? 55   ARG D CA    1 
ATOM   4235 C C     . ARG F 3 55  ? 44.817  14.211  88.077  1.00 10.75 ? 55   ARG D C     1 
ATOM   4236 O O     . ARG F 3 55  ? 44.898  14.664  89.222  1.00 11.32 ? 55   ARG D O     1 
ATOM   4237 C CB    . ARG F 3 55  ? 46.451  14.689  86.225  1.00 10.67 ? 55   ARG D CB    1 
ATOM   4238 C CG    . ARG F 3 55  ? 47.789  14.364  85.558  1.00 11.27 ? 55   ARG D CG    1 
ATOM   4239 C CD    . ARG F 3 55  ? 48.011  15.197  84.292  1.00 11.33 ? 55   ARG D CD    1 
ATOM   4240 N NE    . ARG F 3 55  ? 49.119  14.643  83.521  1.00 12.98 ? 55   ARG D NE    1 
ATOM   4241 C CZ    . ARG F 3 55  ? 50.360  15.102  83.543  1.00 13.23 ? 55   ARG D CZ    1 
ATOM   4242 N NH1   . ARG F 3 55  ? 50.686  16.142  84.318  1.00 12.56 ? 55   ARG D NH1   1 
ATOM   4243 N NH2   . ARG F 3 55  ? 51.282  14.507  82.796  1.00 10.92 ? 55   ARG D NH2   1 
ATOM   4244 N N     . ALA F 3 56  ? 43.659  14.124  87.415  1.00 10.80 ? 56   ALA D N     1 
ATOM   4245 C CA    . ALA F 3 56  ? 42.415  14.587  88.050  1.00 10.59 ? 56   ALA D CA    1 
ATOM   4246 C C     . ALA F 3 56  ? 42.060  13.792  89.310  1.00 10.82 ? 56   ALA D C     1 
ATOM   4247 O O     . ALA F 3 56  ? 41.573  14.368  90.302  1.00 11.60 ? 56   ALA D O     1 
ATOM   4248 C CB    . ALA F 3 56  ? 41.252  14.590  87.058  1.00 11.20 ? 56   ALA D CB    1 
ATOM   4249 N N     . PHE F 3 57  ? 42.324  12.482  89.303  1.00 10.19 ? 57   PHE D N     1 
ATOM   4250 C CA    . PHE F 3 57  ? 42.005  11.659  90.467  1.00 10.88 ? 57   PHE D CA    1 
ATOM   4251 C C     . PHE F 3 57  ? 42.901  12.049  91.643  1.00 11.76 ? 57   PHE D C     1 
ATOM   4252 O O     . PHE F 3 57  ? 42.425  12.219  92.766  1.00 11.96 ? 57   PHE D O     1 
ATOM   4253 C CB    . PHE F 3 57  ? 42.118  10.152  90.164  1.00 10.50 ? 57   PHE D CB    1 
ATOM   4254 C CG    . PHE F 3 57  ? 41.616  9.290   91.274  1.00 10.73 ? 57   PHE D CG    1 
ATOM   4255 C CD1   . PHE F 3 57  ? 40.259  8.931   91.347  1.00 13.95 ? 57   PHE D CD1   1 
ATOM   4256 C CD2   . PHE F 3 57  ? 42.482  8.866   92.291  1.00 12.48 ? 57   PHE D CD2   1 
ATOM   4257 C CE1   . PHE F 3 57  ? 39.785  8.153   92.400  1.00 14.79 ? 57   PHE D CE1   1 
ATOM   4258 C CE2   . PHE F 3 57  ? 42.010  8.096   93.356  1.00 12.12 ? 57   PHE D CE2   1 
ATOM   4259 C CZ    . PHE F 3 57  ? 40.677  7.724   93.408  1.00 13.62 ? 57   PHE D CZ    1 
ATOM   4260 N N     . ARG F 3 58  ? 44.193  12.205  91.378  1.00 12.91 ? 58   ARG D N     1 
ATOM   4261 C CA    . ARG F 3 58  ? 45.133  12.628  92.436  1.00 13.93 ? 58   ARG D CA    1 
ATOM   4262 C C     . ARG F 3 58  ? 44.815  14.023  92.989  1.00 15.07 ? 58   ARG D C     1 
ATOM   4263 O O     . ARG F 3 58  ? 44.956  14.258  94.201  1.00 14.96 ? 58   ARG D O     1 
ATOM   4264 C CB    . ARG F 3 58  ? 46.550  12.617  91.911  1.00 14.00 ? 58   ARG D CB    1 
ATOM   4265 C CG    . ARG F 3 58  ? 47.598  12.585  93.011  1.00 14.65 ? 58   ARG D CG    1 
ATOM   4266 C CD    . ARG F 3 58  ? 48.905  12.294  92.357  1.00 17.03 ? 58   ARG D CD    1 
ATOM   4267 N NE    . ARG F 3 58  ? 49.986  11.977  93.297  1.00 21.54 ? 58   ARG D NE    1 
ATOM   4268 C CZ    . ARG F 3 58  ? 50.990  12.798  93.563  1.00 21.85 ? 58   ARG D CZ    1 
ATOM   4269 N NH1   . ARG F 3 58  ? 51.021  14.005  92.999  1.00 21.32 ? 58   ARG D NH1   1 
ATOM   4270 N NH2   . ARG F 3 58  ? 51.954  12.417  94.405  1.00 21.38 ? 58   ARG D NH2   1 
ATOM   4271 N N     . GLU F 3 59  ? 44.413  14.947  92.121  1.00 15.27 ? 59   GLU D N     1 
ATOM   4272 C CA    . GLU F 3 59  ? 44.030  16.284  92.569  1.00 17.27 ? 59   GLU D CA    1 
ATOM   4273 C C     . GLU F 3 59  ? 42.816  16.220  93.495  1.00 17.22 ? 59   GLU D C     1 
ATOM   4274 O O     . GLU F 3 59  ? 42.770  16.892  94.536  1.00 17.55 ? 59   GLU D O     1 
ATOM   4275 C CB    . GLU F 3 59  ? 43.742  17.180  91.370  1.00 17.29 ? 59   GLU D CB    1 
ATOM   4276 C CG    . GLU F 3 59  ? 43.495  18.646  91.710  1.00 23.45 ? 59   GLU D CG    1 
ATOM   4277 C CD    . GLU F 3 59  ? 43.774  19.543  90.528  1.00 30.33 ? 59   GLU D CD    1 
ATOM   4278 O OE1   . GLU F 3 59  ? 44.935  19.540  90.043  1.00 34.11 ? 59   GLU D OE1   1 
ATOM   4279 O OE2   . GLU F 3 59  ? 42.838  20.243  90.079  1.00 33.50 ? 59   GLU D OE2   1 
ATOM   4280 N N     . ALA F 3 60  ? 41.833  15.419  93.116  1.00 16.28 ? 60   ALA D N     1 
ATOM   4281 C CA    . ALA F 3 60  ? 40.579  15.349  93.862  1.00 17.29 ? 60   ALA D CA    1 
ATOM   4282 C C     . ALA F 3 60  ? 40.660  14.529  95.148  1.00 18.27 ? 60   ALA D C     1 
ATOM   4283 O O     . ALA F 3 60  ? 40.020  14.874  96.143  1.00 18.95 ? 60   ALA D O     1 
ATOM   4284 C CB    . ALA F 3 60  ? 39.464  14.832  92.970  1.00 16.14 ? 60   ALA D CB    1 
ATOM   4285 N N     . HIS F 3 61  ? 41.433  13.441  95.127  1.00 19.16 ? 61   HIS D N     1 
ATOM   4286 C CA    . HIS F 3 61  ? 41.363  12.438  96.194  1.00 20.01 ? 61   HIS D CA    1 
ATOM   4287 C C     . HIS F 3 61  ? 42.674  12.254  96.938  1.00 19.77 ? 61   HIS D C     1 
ATOM   4288 O O     . HIS F 3 61  ? 42.731  11.545  97.953  1.00 20.75 ? 61   HIS D O     1 
ATOM   4289 C CB    . HIS F 3 61  ? 40.877  11.103  95.629  1.00 20.14 ? 61   HIS D CB    1 
ATOM   4290 C CG    . HIS F 3 61  ? 39.555  11.193  94.929  1.00 22.58 ? 61   HIS D CG    1 
ATOM   4291 N ND1   . HIS F 3 61  ? 38.387  11.524  95.586  1.00 27.54 ? 61   HIS D ND1   1 
ATOM   4292 C CD2   . HIS F 3 61  ? 39.221  11.033  93.627  1.00 24.40 ? 61   HIS D CD2   1 
ATOM   4293 C CE1   . HIS F 3 61  ? 37.389  11.543  94.720  1.00 27.27 ? 61   HIS D CE1   1 
ATOM   4294 N NE2   . HIS F 3 61  ? 37.864  11.230  93.529  1.00 27.01 ? 61   HIS D NE2   1 
ATOM   4295 N N     . GLY F 3 62  ? 43.725  12.875  96.423  1.00 19.62 ? 62   GLY D N     1 
ATOM   4296 C CA    . GLY F 3 62  ? 45.013  12.911  97.095  1.00 19.43 ? 62   GLY D CA    1 
ATOM   4297 C C     . GLY F 3 62  ? 46.023  11.895  96.590  1.00 19.86 ? 62   GLY D C     1 
ATOM   4298 O O     . GLY F 3 62  ? 45.798  11.222  95.570  1.00 19.13 ? 62   GLY D O     1 
ATOM   4299 N N     . THR F 3 63  ? 47.126  11.782  97.330  1.00 19.55 ? 63   THR D N     1 
ATOM   4300 C CA    . THR F 3 63  ? 48.322  11.062  96.884  1.00 19.14 ? 63   THR D CA    1 
ATOM   4301 C C     . THR F 3 63  ? 48.468  9.619   97.398  1.00 17.52 ? 63   THR D C     1 
ATOM   4302 O O     . THR F 3 63  ? 49.388  8.910   96.979  1.00 18.05 ? 63   THR D O     1 
ATOM   4303 C CB    . THR F 3 63  ? 49.613  11.826  97.278  1.00 20.12 ? 63   THR D CB    1 
ATOM   4304 O OG1   . THR F 3 63  ? 49.737  11.833  98.708  1.00 20.98 ? 63   THR D OG1   1 
ATOM   4305 C CG2   . THR F 3 63  ? 49.602  13.267  96.763  1.00 20.74 ? 63   THR D CG2   1 
ATOM   4306 N N     . ALA F 3 64  ? 47.581  9.181   98.293  1.00 16.62 ? 64   ALA D N     1 
ATOM   4307 C CA    . ALA F 3 64  ? 47.683  7.846   98.899  1.00 16.08 ? 64   ALA D CA    1 
ATOM   4308 C C     . ALA F 3 64  ? 47.167  6.693   97.998  1.00 14.84 ? 64   ALA D C     1 
ATOM   4309 O O     . ALA F 3 64  ? 46.296  5.901   98.386  1.00 15.55 ? 64   ALA D O     1 
ATOM   4310 C CB    . ALA F 3 64  ? 47.001  7.840   100.294 1.00 15.48 ? 64   ALA D CB    1 
ATOM   4311 N N     . TYR F 3 65  ? 47.696  6.625   96.775  1.00 14.47 ? 65   TYR D N     1 
ATOM   4312 C CA    . TYR F 3 65  ? 47.350  5.546   95.825  1.00 13.15 ? 65   TYR D CA    1 
ATOM   4313 C C     . TYR F 3 65  ? 48.558  5.221   94.977  1.00 11.71 ? 65   TYR D C     1 
ATOM   4314 O O     . TYR F 3 65  ? 49.478  6.025   94.891  1.00 12.24 ? 65   TYR D O     1 
ATOM   4315 C CB    . TYR F 3 65  ? 46.206  5.976   94.884  1.00 13.82 ? 65   TYR D CB    1 
ATOM   4316 C CG    . TYR F 3 65  ? 45.011  6.532   95.607  1.00 14.37 ? 65   TYR D CG    1 
ATOM   4317 C CD1   . TYR F 3 65  ? 43.995  5.686   96.049  1.00 14.24 ? 65   TYR D CD1   1 
ATOM   4318 C CD2   . TYR F 3 65  ? 44.905  7.909   95.852  1.00 15.51 ? 65   TYR D CD2   1 
ATOM   4319 C CE1   . TYR F 3 65  ? 42.886  6.194   96.730  1.00 15.96 ? 65   TYR D CE1   1 
ATOM   4320 C CE2   . TYR F 3 65  ? 43.806  8.433   96.542  1.00 15.75 ? 65   TYR D CE2   1 
ATOM   4321 C CZ    . TYR F 3 65  ? 42.803  7.562   96.971  1.00 16.71 ? 65   TYR D CZ    1 
ATOM   4322 O OH    . TYR F 3 65  ? 41.707  8.049   97.648  1.00 18.03 ? 65   TYR D OH    1 
ATOM   4323 N N     . ARG F 3 66  ? 48.551  4.030   94.367  1.00 11.29 ? 66   ARG D N     1 
ATOM   4324 C CA    . ARG F 3 66  ? 49.494  3.715   93.295  1.00 10.43 ? 66   ARG D CA    1 
ATOM   4325 C C     . ARG F 3 66  ? 48.855  4.080   91.957  1.00 11.02 ? 66   ARG D C     1 
ATOM   4326 O O     . ARG F 3 66  ? 47.795  3.547   91.645  1.00 11.45 ? 66   ARG D O     1 
ATOM   4327 C CB    . ARG F 3 66  ? 49.850  2.230   93.289  1.00 10.97 ? 66   ARG D CB    1 
ATOM   4328 C CG    . ARG F 3 66  ? 51.022  1.934   92.347  1.00 10.33 ? 66   ARG D CG    1 
ATOM   4329 C CD    . ARG F 3 66  ? 51.308  0.453   92.171  1.00 11.47 ? 66   ARG D CD    1 
ATOM   4330 N NE    . ARG F 3 66  ? 52.406  0.342   91.201  1.00 11.33 ? 66   ARG D NE    1 
ATOM   4331 C CZ    . ARG F 3 66  ? 53.691  0.503   91.499  1.00 11.82 ? 66   ARG D CZ    1 
ATOM   4332 N NH1   . ARG F 3 66  ? 54.058  0.715   92.764  1.00 9.54  ? 66   ARG D NH1   1 
ATOM   4333 N NH2   . ARG F 3 66  ? 54.611  0.406   90.535  1.00 12.77 ? 66   ARG D NH2   1 
ATOM   4334 N N     . PHE F 3 67  ? 49.518  4.944   91.186  1.00 10.96 ? 67   PHE D N     1 
ATOM   4335 C CA    . PHE F 3 67  ? 48.984  5.412   89.894  1.00 10.98 ? 67   PHE D CA    1 
ATOM   4336 C C     . PHE F 3 67  ? 49.744  4.774   88.741  1.00 10.93 ? 67   PHE D C     1 
ATOM   4337 O O     . PHE F 3 67  ? 50.964  4.878   88.689  1.00 10.12 ? 67   PHE D O     1 
ATOM   4338 C CB    . PHE F 3 67  ? 49.096  6.923   89.776  1.00 12.61 ? 67   PHE D CB    1 
ATOM   4339 C CG    . PHE F 3 67  ? 48.247  7.677   90.771  1.00 12.84 ? 67   PHE D CG    1 
ATOM   4340 C CD1   . PHE F 3 67  ? 46.936  8.017   90.459  1.00 13.50 ? 67   PHE D CD1   1 
ATOM   4341 C CD2   . PHE F 3 67  ? 48.755  8.029   92.030  1.00 14.73 ? 67   PHE D CD2   1 
ATOM   4342 C CE1   . PHE F 3 67  ? 46.133  8.717   91.379  1.00 12.90 ? 67   PHE D CE1   1 
ATOM   4343 C CE2   . PHE F 3 67  ? 47.956  8.741   92.961  1.00 13.41 ? 67   PHE D CE2   1 
ATOM   4344 C CZ    . PHE F 3 67  ? 46.654  9.079   92.635  1.00 13.89 ? 67   PHE D CZ    1 
ATOM   4345 N N     . VAL F 3 68  ? 49.006  4.164   87.807  1.00 10.47 ? 68   VAL D N     1 
ATOM   4346 C CA    . VAL F 3 68  ? 49.601  3.441   86.680  1.00 9.61  ? 68   VAL D CA    1 
ATOM   4347 C C     . VAL F 3 68  ? 48.864  3.862   85.395  1.00 9.85  ? 68   VAL D C     1 
ATOM   4348 O O     . VAL F 3 68  ? 47.640  3.998   85.419  1.00 9.65  ? 68   VAL D O     1 
ATOM   4349 C CB    . VAL F 3 68  ? 49.464  1.927   86.880  1.00 9.44  ? 68   VAL D CB    1 
ATOM   4350 C CG1   . VAL F 3 68  ? 50.094  1.190   85.726  1.00 10.33 ? 68   VAL D CG1   1 
ATOM   4351 C CG2   . VAL F 3 68  ? 50.136  1.486   88.228  1.00 9.42  ? 68   VAL D CG2   1 
ATOM   4352 N N     . GLY F 3 69  ? 49.611  4.118   84.323  1.00 10.06 ? 69   GLY D N     1 
ATOM   4353 C CA    . GLY F 3 69  ? 49.011  4.420   82.995  1.00 9.53  ? 69   GLY D CA    1 
ATOM   4354 C C     . GLY F 3 69  ? 49.607  3.473   81.965  1.00 10.12 ? 69   GLY D C     1 
ATOM   4355 O O     . GLY F 3 69  ? 50.803  3.143   82.032  1.00 10.29 ? 69   GLY D O     1 
ATOM   4356 N N     . VAL F 3 70  ? 48.779  3.004   81.032  1.00 10.27 ? 70   VAL D N     1 
ATOM   4357 C CA    . VAL F 3 70  ? 49.249  2.122   79.961  1.00 10.35 ? 70   VAL D CA    1 
ATOM   4358 C C     . VAL F 3 70  ? 48.915  2.793   78.641  1.00 10.48 ? 70   VAL D C     1 
ATOM   4359 O O     . VAL F 3 70  ? 47.778  3.200   78.421  1.00 10.57 ? 70   VAL D O     1 
ATOM   4360 C CB    . VAL F 3 70  ? 48.600  0.711   80.029  1.00 10.72 ? 70   VAL D CB    1 
ATOM   4361 C CG1   . VAL F 3 70  ? 48.980  -0.126  78.788  1.00 10.88 ? 70   VAL D CG1   1 
ATOM   4362 C CG2   . VAL F 3 70  ? 48.963  -0.011  81.354  1.00 9.20  ? 70   VAL D CG2   1 
ATOM   4363 N N     . GLU F 3 71  ? 49.922  2.937   77.781  1.00 10.64 ? 71   GLU D N     1 
ATOM   4364 C CA    . GLU F 3 71  ? 49.760  3.635   76.513  1.00 10.21 ? 71   GLU D CA    1 
ATOM   4365 C C     . GLU F 3 71  ? 50.592  2.922   75.443  1.00 10.76 ? 71   GLU D C     1 
ATOM   4366 O O     . GLU F 3 71  ? 51.707  2.501   75.706  1.00 10.65 ? 71   GLU D O     1 
ATOM   4367 C CB    . GLU F 3 71  ? 50.258  5.067   76.673  1.00 11.07 ? 71   GLU D CB    1 
ATOM   4368 C CG    . GLU F 3 71  ? 50.541  5.834   75.399  1.00 10.15 ? 71   GLU D CG    1 
ATOM   4369 C CD    . GLU F 3 71  ? 49.303  6.049   74.547  1.00 12.36 ? 71   GLU D CD    1 
ATOM   4370 O OE1   . GLU F 3 71  ? 48.274  6.572   75.053  1.00 13.25 ? 71   GLU D OE1   1 
ATOM   4371 O OE2   . GLU F 3 71  ? 49.371  5.694   73.357  1.00 12.53 ? 71   GLU D OE2   1 
ATOM   4372 N N     . ILE F 3 72  ? 50.043  2.798   74.241  1.00 10.37 ? 72   ILE D N     1 
ATOM   4373 C CA    . ILE F 3 72  ? 50.711  2.044   73.185  1.00 11.72 ? 72   ILE D CA    1 
ATOM   4374 C C     . ILE F 3 72  ? 51.721  2.860   72.368  1.00 12.28 ? 72   ILE D C     1 
ATOM   4375 O O     . ILE F 3 72  ? 52.669  2.294   71.785  1.00 13.68 ? 72   ILE D O     1 
ATOM   4376 C CB    . ILE F 3 72  ? 49.663  1.386   72.231  1.00 10.95 ? 72   ILE D CB    1 
ATOM   4377 C CG1   . ILE F 3 72  ? 50.273  0.173   71.505  1.00 12.31 ? 72   ILE D CG1   1 
ATOM   4378 C CG2   . ILE F 3 72  ? 49.062  2.424   71.284  1.00 10.86 ? 72   ILE D CG2   1 
ATOM   4379 C CD1   . ILE F 3 72  ? 49.241  -0.599  70.664  1.00 12.43 ? 72   ILE D CD1   1 
ATOM   4380 N N     . ASP F 3 73  ? 51.519  4.174   72.308  1.00 13.44 ? 73   ASP D N     1 
ATOM   4381 C CA    . ASP F 3 73  ? 52.298  5.059   71.451  1.00 14.45 ? 73   ASP D CA    1 
ATOM   4382 C C     . ASP F 3 73  ? 53.367  5.774   72.282  1.00 15.51 ? 73   ASP D C     1 
ATOM   4383 O O     . ASP F 3 73  ? 53.016  6.546   73.164  1.00 15.10 ? 73   ASP D O     1 
ATOM   4384 C CB    . ASP F 3 73  ? 51.351  6.096   70.836  1.00 15.03 ? 73   ASP D CB    1 
ATOM   4385 C CG    . ASP F 3 73  ? 52.021  6.991   69.805  1.00 16.36 ? 73   ASP D CG    1 
ATOM   4386 O OD1   . ASP F 3 73  ? 53.264  6.981   69.691  1.00 16.52 ? 73   ASP D OD1   1 
ATOM   4387 O OD2   . ASP F 3 73  ? 51.277  7.712   69.104  1.00 19.78 ? 73   ASP D OD2   1 
ATOM   4388 N N     . PRO F 3 74  ? 54.664  5.551   71.968  1.00 16.87 ? 74   PRO D N     1 
ATOM   4389 C CA    . PRO F 3 74  ? 55.755  6.215   72.729  1.00 18.20 ? 74   PRO D CA    1 
ATOM   4390 C C     . PRO F 3 74  ? 55.660  7.736   72.698  1.00 18.74 ? 74   PRO D C     1 
ATOM   4391 O O     . PRO F 3 74  ? 56.037  8.395   73.670  1.00 20.20 ? 74   PRO D O     1 
ATOM   4392 C CB    . PRO F 3 74  ? 57.039  5.786   71.996  1.00 18.18 ? 74   PRO D CB    1 
ATOM   4393 C CG    . PRO F 3 74  ? 56.666  4.720   71.091  1.00 18.26 ? 74   PRO D CG    1 
ATOM   4394 C CD    . PRO F 3 74  ? 55.186  4.733   70.858  1.00 17.01 ? 74   PRO D CD    1 
ATOM   4395 N N     . LYS F 3 75  ? 55.160  8.290   71.597  1.00 19.37 ? 75   LYS D N     1 
ATOM   4396 C CA    . LYS F 3 75  ? 55.015  9.736   71.455  1.00 20.57 ? 75   LYS D CA    1 
ATOM   4397 C C     . LYS F 3 75  ? 53.937  10.301  72.375  1.00 19.42 ? 75   LYS D C     1 
ATOM   4398 O O     . LYS F 3 75  ? 53.971  11.489  72.694  1.00 20.45 ? 75   LYS D O     1 
ATOM   4399 C CB    . LYS F 3 75  ? 54.651  10.129  70.024  1.00 20.17 ? 75   LYS D CB    1 
ATOM   4400 C CG    . LYS F 3 75  ? 55.601  9.637   68.929  1.00 22.89 ? 75   LYS D CG    1 
ATOM   4401 C CD    . LYS F 3 75  ? 55.348  10.385  67.608  1.00 24.03 ? 75   LYS D CD    1 
ATOM   4402 C CE    . LYS F 3 75  ? 53.898  10.262  67.130  1.00 28.17 ? 75   LYS D CE    1 
ATOM   4403 N NZ    . LYS F 3 75  ? 53.703  10.775  65.727  1.00 31.68 ? 75   LYS D NZ    1 
ATOM   4404 N N     . ALA F 3 76  ? 52.979  9.461   72.774  1.00 18.85 ? 76   ALA D N     1 
ATOM   4405 C CA    . ALA F 3 76  ? 51.820  9.925   73.557  1.00 17.68 ? 76   ALA D CA    1 
ATOM   4406 C C     . ALA F 3 76  ? 52.030  9.777   75.056  1.00 17.38 ? 76   ALA D C     1 
ATOM   4407 O O     . ALA F 3 76  ? 51.523  10.586  75.841  1.00 17.44 ? 76   ALA D O     1 
ATOM   4408 C CB    . ALA F 3 76  ? 50.538  9.188   73.126  1.00 17.70 ? 76   ALA D CB    1 
ATOM   4409 N N     . LEU F 3 77  ? 52.759  8.737   75.456  1.00 16.89 ? 77   LEU D N     1 
ATOM   4410 C CA    . LEU F 3 77  ? 52.969  8.466   76.884  1.00 16.40 ? 77   LEU D CA    1 
ATOM   4411 C C     . LEU F 3 77  ? 53.773  9.602   77.515  1.00 16.39 ? 77   LEU D C     1 
ATOM   4412 O O     . LEU F 3 77  ? 54.889  9.891   77.099  1.00 16.66 ? 77   LEU D O     1 
ATOM   4413 C CB    . LEU F 3 77  ? 53.662  7.115   77.082  1.00 15.75 ? 77   LEU D CB    1 
ATOM   4414 C CG    . LEU F 3 77  ? 53.979  6.703   78.522  1.00 15.86 ? 77   LEU D CG    1 
ATOM   4415 C CD1   . LEU F 3 77  ? 52.705  6.512   79.348  1.00 15.31 ? 77   LEU D CD1   1 
ATOM   4416 C CD2   . LEU F 3 77  ? 54.823  5.450   78.510  1.00 19.28 ? 77   LEU D CD2   1 
ATOM   4417 N N     . ASP F 3 78  ? 53.194  10.268  78.505  1.00 15.84 ? 78   ASP D N     1 
ATOM   4418 C CA    . ASP F 3 78  ? 53.909  11.359  79.147  1.00 15.94 ? 78   ASP D CA    1 
ATOM   4419 C C     . ASP F 3 78  ? 53.321  11.628  80.516  1.00 15.32 ? 78   ASP D C     1 
ATOM   4420 O O     . ASP F 3 78  ? 52.642  12.632  80.707  1.00 15.08 ? 78   ASP D O     1 
ATOM   4421 C CB    . ASP F 3 78  ? 53.843  12.619  78.297  1.00 17.21 ? 78   ASP D CB    1 
ATOM   4422 C CG    . ASP F 3 78  ? 54.873  13.653  78.707  1.00 18.40 ? 78   ASP D CG    1 
ATOM   4423 O OD1   . ASP F 3 78  ? 55.870  13.287  79.358  1.00 22.27 ? 78   ASP D OD1   1 
ATOM   4424 O OD2   . ASP F 3 78  ? 54.683  14.826  78.345  1.00 23.63 ? 78   ASP D OD2   1 
ATOM   4425 N N     . LEU F 3 79  ? 53.578  10.703  81.437  1.00 14.90 ? 79   LEU D N     1 
ATOM   4426 C CA    . LEU F 3 79  ? 52.982  10.721  82.771  1.00 15.04 ? 79   LEU D CA    1 
ATOM   4427 C C     . LEU F 3 79  ? 53.844  11.519  83.734  1.00 15.50 ? 79   LEU D C     1 
ATOM   4428 O O     . LEU F 3 79  ? 55.026  11.680  83.495  1.00 16.97 ? 79   LEU D O     1 
ATOM   4429 C CB    . LEU F 3 79  ? 52.797  9.291   83.301  1.00 14.84 ? 79   LEU D CB    1 
ATOM   4430 C CG    . LEU F 3 79  ? 51.803  8.355   82.574  1.00 13.74 ? 79   LEU D CG    1 
ATOM   4431 C CD1   . LEU F 3 79  ? 51.725  7.007   83.293  1.00 14.37 ? 79   LEU D CD1   1 
ATOM   4432 C CD2   . LEU F 3 79  ? 50.398  8.987   82.483  1.00 14.83 ? 79   LEU D CD2   1 
ATOM   4433 N N     . PRO F 3 80  ? 53.247  12.037  84.820  1.00 15.90 ? 80   PRO D N     1 
ATOM   4434 C CA    . PRO F 3 80  ? 54.066  12.641  85.878  1.00 15.95 ? 80   PRO D CA    1 
ATOM   4435 C C     . PRO F 3 80  ? 55.011  11.605  86.507  1.00 15.79 ? 80   PRO D C     1 
ATOM   4436 O O     . PRO F 3 80  ? 54.708  10.408  86.480  1.00 14.91 ? 80   PRO D O     1 
ATOM   4437 C CB    . PRO F 3 80  ? 53.025  13.085  86.902  1.00 16.03 ? 80   PRO D CB    1 
ATOM   4438 C CG    . PRO F 3 80  ? 51.760  13.262  86.101  1.00 17.14 ? 80   PRO D CG    1 
ATOM   4439 C CD    . PRO F 3 80  ? 51.810  12.111  85.128  1.00 16.32 ? 80   PRO D CD    1 
ATOM   4440 N N     . PRO F 3 81  ? 56.119  12.065  87.119  1.00 15.68 ? 81   PRO D N     1 
ATOM   4441 C CA    . PRO F 3 81  ? 57.064  11.152  87.778  1.00 15.61 ? 81   PRO D CA    1 
ATOM   4442 C C     . PRO F 3 81  ? 56.461  10.300  88.905  1.00 14.55 ? 81   PRO D C     1 
ATOM   4443 O O     . PRO F 3 81  ? 57.042  9.290   89.259  1.00 15.42 ? 81   PRO D O     1 
ATOM   4444 C CB    . PRO F 3 81  ? 58.115  12.104  88.365  1.00 16.62 ? 81   PRO D CB    1 
ATOM   4445 C CG    . PRO F 3 81  ? 57.368  13.435  88.520  1.00 17.42 ? 81   PRO D CG    1 
ATOM   4446 C CD    . PRO F 3 81  ? 56.545  13.475  87.257  1.00 16.39 ? 81   PRO D CD    1 
ATOM   4447 N N     . TRP F 3 82  ? 55.323  10.703  89.461  1.00 13.34 ? 82   TRP D N     1 
ATOM   4448 C CA    . TRP F 3 82  ? 54.662  9.936   90.537  1.00 12.85 ? 82   TRP D CA    1 
ATOM   4449 C C     . TRP F 3 82  ? 53.792  8.774   90.030  1.00 12.32 ? 82   TRP D C     1 
ATOM   4450 O O     . TRP F 3 82  ? 53.214  8.022   90.831  1.00 12.24 ? 82   TRP D O     1 
ATOM   4451 C CB    . TRP F 3 82  ? 53.846  10.863  91.461  1.00 13.93 ? 82   TRP D CB    1 
ATOM   4452 C CG    . TRP F 3 82  ? 52.952  11.881  90.774  1.00 14.42 ? 82   TRP D CG    1 
ATOM   4453 C CD1   . TRP F 3 82  ? 53.178  13.224  90.648  1.00 14.18 ? 82   TRP D CD1   1 
ATOM   4454 C CD2   . TRP F 3 82  ? 51.683  11.626  90.153  1.00 14.15 ? 82   TRP D CD2   1 
ATOM   4455 N NE1   . TRP F 3 82  ? 52.120  13.828  89.979  1.00 15.50 ? 82   TRP D NE1   1 
ATOM   4456 C CE2   . TRP F 3 82  ? 51.194  12.863  89.673  1.00 14.07 ? 82   TRP D CE2   1 
ATOM   4457 C CE3   . TRP F 3 82  ? 50.907  10.471  89.966  1.00 14.78 ? 82   TRP D CE3   1 
ATOM   4458 C CZ2   . TRP F 3 82  ? 49.970  12.969  88.993  1.00 14.68 ? 82   TRP D CZ2   1 
ATOM   4459 C CZ3   . TRP F 3 82  ? 49.697  10.576  89.301  1.00 15.63 ? 82   TRP D CZ3   1 
ATOM   4460 C CH2   . TRP F 3 82  ? 49.233  11.820  88.832  1.00 15.47 ? 82   TRP D CH2   1 
ATOM   4461 N N     . ALA F 3 83  ? 53.664  8.636   88.705  1.00 11.86 ? 83   ALA D N     1 
ATOM   4462 C CA    . ALA F 3 83  ? 52.907  7.496   88.151  1.00 11.60 ? 83   ALA D CA    1 
ATOM   4463 C C     . ALA F 3 83  ? 53.832  6.530   87.428  1.00 10.80 ? 83   ALA D C     1 
ATOM   4464 O O     . ALA F 3 83  ? 54.880  6.947   86.909  1.00 11.67 ? 83   ALA D O     1 
ATOM   4465 C CB    . ALA F 3 83  ? 51.778  7.960   87.197  1.00 11.83 ? 83   ALA D CB    1 
ATOM   4466 N N     . GLU F 3 84  ? 53.446  5.253   87.412  1.00 11.27 ? 84   GLU D N     1 
ATOM   4467 C CA    . GLU F 3 84  ? 54.146  4.244   86.613  1.00 11.36 ? 84   GLU D CA    1 
ATOM   4468 C C     . GLU F 3 84  ? 53.568  4.240   85.202  1.00 11.80 ? 84   GLU D C     1 
ATOM   4469 O O     . GLU F 3 84  ? 52.389  3.957   85.015  1.00 10.95 ? 84   GLU D O     1 
ATOM   4470 C CB    . GLU F 3 84  ? 54.001  2.854   87.216  1.00 11.81 ? 84   GLU D CB    1 
ATOM   4471 C CG    . GLU F 3 84  ? 54.842  1.795   86.504  1.00 12.34 ? 84   GLU D CG    1 
ATOM   4472 C CD    . GLU F 3 84  ? 54.437  0.389   86.879  1.00 13.00 ? 84   GLU D CD    1 
ATOM   4473 O OE1   . GLU F 3 84  ? 53.677  0.221   87.861  1.00 15.53 ? 84   GLU D OE1   1 
ATOM   4474 O OE2   . GLU F 3 84  ? 54.889  -0.546  86.189  1.00 16.22 ? 84   GLU D OE2   1 
ATOM   4475 N N     . GLY F 3 85  ? 54.425  4.517   84.226  1.00 12.15 ? 85   GLY D N     1 
ATOM   4476 C CA    . GLY F 3 85  ? 54.015  4.512   82.816  1.00 12.98 ? 85   GLY D CA    1 
ATOM   4477 C C     . GLY F 3 85  ? 54.448  3.232   82.139  1.00 13.41 ? 85   GLY D C     1 
ATOM   4478 O O     . GLY F 3 85  ? 55.620  2.841   82.213  1.00 13.98 ? 85   GLY D O     1 
ATOM   4479 N N     . ILE F 3 86  ? 53.498  2.553   81.504  1.00 13.71 ? 86   ILE D N     1 
ATOM   4480 C CA    . ILE F 3 86  ? 53.789  1.313   80.792  1.00 13.95 ? 86   ILE D CA    1 
ATOM   4481 C C     . ILE F 3 86  ? 53.517  1.489   79.301  1.00 13.85 ? 86   ILE D C     1 
ATOM   4482 O O     . ILE F 3 86  ? 52.457  1.949   78.925  1.00 13.97 ? 86   ILE D O     1 
ATOM   4483 C CB    . ILE F 3 86  ? 52.985  0.137   81.357  1.00 14.36 ? 86   ILE D CB    1 
ATOM   4484 C CG1   . ILE F 3 86  ? 53.409  -0.113  82.812  1.00 14.05 ? 86   ILE D CG1   1 
ATOM   4485 C CG2   . ILE F 3 86  ? 53.194  -1.132  80.516  1.00 13.93 ? 86   ILE D CG2   1 
ATOM   4486 C CD1   . ILE F 3 86  ? 52.305  -0.481  83.679  1.00 16.11 ? 86   ILE D CD1   1 
ATOM   4487 N N     . LEU F 3 87  ? 54.492  1.113   78.473  1.00 13.91 ? 87   LEU D N     1 
ATOM   4488 C CA    . LEU F 3 87  ? 54.370  1.178   77.027  1.00 14.52 ? 87   LEU D CA    1 
ATOM   4489 C C     . LEU F 3 87  ? 53.936  -0.200  76.564  1.00 14.24 ? 87   LEU D C     1 
ATOM   4490 O O     . LEU F 3 87  ? 54.753  -1.145  76.549  1.00 13.85 ? 87   LEU D O     1 
ATOM   4491 C CB    . LEU F 3 87  ? 55.732  1.516   76.421  1.00 15.61 ? 87   LEU D CB    1 
ATOM   4492 C CG    . LEU F 3 87  ? 55.816  2.445   75.219  1.00 18.93 ? 87   LEU D CG    1 
ATOM   4493 C CD1   . LEU F 3 87  ? 54.871  3.668   75.256  1.00 18.30 ? 87   LEU D CD1   1 
ATOM   4494 C CD2   . LEU F 3 87  ? 57.265  2.941   75.169  1.00 21.15 ? 87   LEU D CD2   1 
ATOM   4495 N N     . ALA F 3 88  ? 52.652  -0.335  76.229  1.00 12.66 ? 88   ALA D N     1 
ATOM   4496 C CA    . ALA F 3 88  ? 52.077  -1.627  75.838  1.00 12.49 ? 88   ALA D CA    1 
ATOM   4497 C C     . ALA F 3 88  ? 50.732  -1.454  75.193  1.00 12.56 ? 88   ALA D C     1 
ATOM   4498 O O     . ALA F 3 88  ? 50.058  -0.451  75.391  1.00 12.40 ? 88   ALA D O     1 
ATOM   4499 C CB    . ALA F 3 88  ? 51.912  -2.558  77.046  1.00 12.19 ? 88   ALA D CB    1 
ATOM   4500 N N     . ASP F 3 89  ? 50.332  -2.483  74.461  1.00 12.03 ? 89   ASP D N     1 
ATOM   4501 C CA    . ASP F 3 89  ? 48.968  -2.617  74.009  1.00 11.29 ? 89   ASP D CA    1 
ATOM   4502 C C     . ASP F 3 89  ? 48.131  -3.089  75.196  1.00 10.33 ? 89   ASP D C     1 
ATOM   4503 O O     . ASP F 3 89  ? 48.276  -4.212  75.693  1.00 10.08 ? 89   ASP D O     1 
ATOM   4504 C CB    . ASP F 3 89  ? 48.919  -3.586  72.824  1.00 10.88 ? 89   ASP D CB    1 
ATOM   4505 C CG    . ASP F 3 89  ? 47.506  -3.804  72.289  1.00 12.61 ? 89   ASP D CG    1 
ATOM   4506 O OD1   . ASP F 3 89  ? 46.522  -3.477  72.993  1.00 11.52 ? 89   ASP D OD1   1 
ATOM   4507 O OD2   . ASP F 3 89  ? 47.400  -4.336  71.156  1.00 13.67 ? 89   ASP D OD2   1 
ATOM   4508 N N     . PHE F 3 90  ? 47.256  -2.212  75.675  1.00 10.00 ? 90   PHE D N     1 
ATOM   4509 C CA    . PHE F 3 90  ? 46.478  -2.527  76.856  1.00 10.12 ? 90   PHE D CA    1 
ATOM   4510 C C     . PHE F 3 90  ? 45.719  -3.852  76.725  1.00 10.05 ? 90   PHE D C     1 
ATOM   4511 O O     . PHE F 3 90  ? 45.550  -4.595  77.699  1.00 10.16 ? 90   PHE D O     1 
ATOM   4512 C CB    . PHE F 3 90  ? 45.496  -1.388  77.136  1.00 9.80  ? 90   PHE D CB    1 
ATOM   4513 C CG    . PHE F 3 90  ? 44.538  -1.663  78.267  1.00 10.23 ? 90   PHE D CG    1 
ATOM   4514 C CD1   . PHE F 3 90  ? 44.983  -1.699  79.592  1.00 11.46 ? 90   PHE D CD1   1 
ATOM   4515 C CD2   . PHE F 3 90  ? 43.185  -1.874  78.008  1.00 9.65  ? 90   PHE D CD2   1 
ATOM   4516 C CE1   . PHE F 3 90  ? 44.076  -1.925  80.644  1.00 11.90 ? 90   PHE D CE1   1 
ATOM   4517 C CE2   . PHE F 3 90  ? 42.283  -2.086  79.038  1.00 9.31  ? 90   PHE D CE2   1 
ATOM   4518 C CZ    . PHE F 3 90  ? 42.738  -2.126  80.368  1.00 11.72 ? 90   PHE D CZ    1 
ATOM   4519 N N     . LEU F 3 91  ? 45.229  -4.122  75.516  1.00 10.12 ? 91   LEU D N     1 
ATOM   4520 C CA    . LEU F 3 91  ? 44.417  -5.291  75.293  1.00 10.65 ? 91   LEU D CA    1 
ATOM   4521 C C     . LEU F 3 91  ? 45.150  -6.617  75.415  1.00 12.24 ? 91   LEU D C     1 
ATOM   4522 O O     . LEU F 3 91  ? 44.507  -7.655  75.564  1.00 11.97 ? 91   LEU D O     1 
ATOM   4523 C CB    . LEU F 3 91  ? 43.710  -5.201  73.946  1.00 10.21 ? 91   LEU D CB    1 
ATOM   4524 C CG    . LEU F 3 91  ? 42.721  -4.029  73.884  1.00 9.39  ? 91   LEU D CG    1 
ATOM   4525 C CD1   . LEU F 3 91  ? 42.177  -3.872  72.446  1.00 9.52  ? 91   LEU D CD1   1 
ATOM   4526 C CD2   . LEU F 3 91  ? 41.572  -4.130  74.927  1.00 8.79  ? 91   LEU D CD2   1 
ATOM   4527 N N     . LEU F 3 92  ? 46.482  -6.569  75.345  1.00 12.68 ? 92   LEU D N     1 
ATOM   4528 C CA    . LEU F 3 92  ? 47.302  -7.775  75.405  1.00 14.32 ? 92   LEU D CA    1 
ATOM   4529 C C     . LEU F 3 92  ? 48.203  -7.776  76.648  1.00 15.55 ? 92   LEU D C     1 
ATOM   4530 O O     . LEU F 3 92  ? 49.010  -8.694  76.847  1.00 16.31 ? 92   LEU D O     1 
ATOM   4531 C CB    . LEU F 3 92  ? 48.130  -7.905  74.117  1.00 14.81 ? 92   LEU D CB    1 
ATOM   4532 C CG    . LEU F 3 92  ? 47.336  -8.097  72.811  1.00 15.70 ? 92   LEU D CG    1 
ATOM   4533 C CD1   . LEU F 3 92  ? 48.262  -7.971  71.627  1.00 17.21 ? 92   LEU D CD1   1 
ATOM   4534 C CD2   . LEU F 3 92  ? 46.588  -9.422  72.781  1.00 18.60 ? 92   LEU D CD2   1 
ATOM   4535 N N     . TRP F 3 93  ? 48.043  -6.754  77.482  1.00 15.60 ? 93   TRP D N     1 
ATOM   4536 C CA    . TRP F 3 93  ? 48.896  -6.519  78.654  1.00 16.89 ? 93   TRP D CA    1 
ATOM   4537 C C     . TRP F 3 93  ? 48.542  -7.407  79.845  1.00 18.58 ? 93   TRP D C     1 
ATOM   4538 O O     . TRP F 3 93  ? 47.368  -7.601  80.146  1.00 17.94 ? 93   TRP D O     1 
ATOM   4539 C CB    . TRP F 3 93  ? 48.801  -5.042  79.032  1.00 16.96 ? 93   TRP D CB    1 
ATOM   4540 C CG    . TRP F 3 93  ? 49.560  -4.615  80.249  1.00 15.73 ? 93   TRP D CG    1 
ATOM   4541 C CD1   . TRP F 3 93  ? 50.910  -4.697  80.463  1.00 16.44 ? 93   TRP D CD1   1 
ATOM   4542 C CD2   . TRP F 3 93  ? 49.006  -3.953  81.386  1.00 14.70 ? 93   TRP D CD2   1 
ATOM   4543 N NE1   . TRP F 3 93  ? 51.223  -4.159  81.702  1.00 15.86 ? 93   TRP D NE1   1 
ATOM   4544 C CE2   . TRP F 3 93  ? 50.068  -3.696  82.282  1.00 15.26 ? 93   TRP D CE2   1 
ATOM   4545 C CE3   . TRP F 3 93  ? 47.700  -3.581  81.754  1.00 15.38 ? 93   TRP D CE3   1 
ATOM   4546 C CZ2   . TRP F 3 93  ? 49.863  -3.062  83.517  1.00 15.19 ? 93   TRP D CZ2   1 
ATOM   4547 C CZ3   . TRP F 3 93  ? 47.500  -2.958  82.974  1.00 16.44 ? 93   TRP D CZ3   1 
ATOM   4548 C CH2   . TRP F 3 93  ? 48.580  -2.713  83.844  1.00 15.35 ? 93   TRP D CH2   1 
ATOM   4549 N N     . GLU F 3 94  ? 49.573  -7.944  80.512  1.00 20.54 ? 94   GLU D N     1 
ATOM   4550 C CA    . GLU F 3 94  ? 49.405  -8.770  81.711  1.00 23.24 ? 94   GLU D CA    1 
ATOM   4551 C C     . GLU F 3 94  ? 50.135  -8.159  82.926  1.00 23.76 ? 94   GLU D C     1 
ATOM   4552 O O     . GLU F 3 94  ? 51.339  -8.345  83.071  1.00 25.43 ? 94   GLU D O     1 
ATOM   4553 C CB    . GLU F 3 94  ? 49.915  -10.198 81.453  1.00 24.01 ? 94   GLU D CB    1 
ATOM   4554 C CG    . GLU F 3 94  ? 49.106  -11.008 80.425  1.00 27.53 ? 94   GLU D CG    1 
ATOM   4555 C CD    . GLU F 3 94  ? 47.650  -11.217 80.846  1.00 33.25 ? 94   GLU D CD    1 
ATOM   4556 O OE1   . GLU F 3 94  ? 46.765  -11.251 79.960  1.00 36.30 ? 94   GLU D OE1   1 
ATOM   4557 O OE2   . GLU F 3 94  ? 47.386  -11.346 82.063  1.00 35.04 ? 94   GLU D OE2   1 
ATOM   4558 N N     . PRO F 3 95  ? 49.421  -7.405  83.782  1.00 24.07 ? 95   PRO D N     1 
ATOM   4559 C CA    . PRO F 3 95  ? 50.073  -6.737  84.923  1.00 23.94 ? 95   PRO D CA    1 
ATOM   4560 C C     . PRO F 3 95  ? 50.558  -7.639  86.060  1.00 24.39 ? 95   PRO D C     1 
ATOM   4561 O O     . PRO F 3 95  ? 51.488  -7.246  86.781  1.00 25.38 ? 95   PRO D O     1 
ATOM   4562 C CB    . PRO F 3 95  ? 48.991  -5.784  85.448  1.00 23.56 ? 95   PRO D CB    1 
ATOM   4563 C CG    . PRO F 3 95  ? 47.715  -6.359  84.987  1.00 23.89 ? 95   PRO D CG    1 
ATOM   4564 C CD    . PRO F 3 95  ? 47.991  -7.067  83.693  1.00 23.64 ? 95   PRO D CD    1 
ATOM   4565 N N     . GLY F 3 96  ? 49.930  -8.797  86.250  1.00 23.67 ? 96   GLY D N     1 
ATOM   4566 C CA    . GLY F 3 96  ? 50.287  -9.679  87.382  1.00 24.00 ? 96   GLY D CA    1 
ATOM   4567 C C     . GLY F 3 96  ? 49.558  -9.451  88.705  1.00 23.55 ? 96   GLY D C     1 
ATOM   4568 O O     . GLY F 3 96  ? 49.357  -10.403 89.475  1.00 24.60 ? 96   GLY D O     1 
ATOM   4569 N N     . GLU F 3 97  ? 49.224  -8.196  89.012  1.00 22.41 ? 97   GLU D N     1 
ATOM   4570 C CA    . GLU F 3 97  ? 48.326  -7.882  90.125  1.00 21.61 ? 97   GLU D CA    1 
ATOM   4571 C C     . GLU F 3 97  ? 47.196  -7.026  89.558  1.00 19.78 ? 97   GLU D C     1 
ATOM   4572 O O     . GLU F 3 97  ? 47.458  -6.114  88.770  1.00 19.86 ? 97   GLU D O     1 
ATOM   4573 C CB    . GLU F 3 97  ? 49.041  -7.164  91.288  1.00 21.79 ? 97   GLU D CB    1 
ATOM   4574 C CG    . GLU F 3 97  ? 48.136  -6.976  92.541  1.00 23.64 ? 97   GLU D CG    1 
ATOM   4575 C CD    . GLU F 3 97  ? 48.823  -6.284  93.735  1.00 24.87 ? 97   GLU D CD    1 
ATOM   4576 O OE1   . GLU F 3 97  ? 48.122  -5.971  94.728  1.00 27.08 ? 97   GLU D OE1   1 
ATOM   4577 O OE2   . GLU F 3 97  ? 50.051  -6.033  93.687  1.00 29.35 ? 97   GLU D OE2   1 
ATOM   4578 N N     . ALA F 3 98  ? 45.963  -7.351  89.951  1.00 17.71 ? 98   ALA D N     1 
ATOM   4579 C CA    . ALA F 3 98  ? 44.757  -6.640  89.508  1.00 15.86 ? 98   ALA D CA    1 
ATOM   4580 C C     . ALA F 3 98  ? 44.630  -5.254  90.167  1.00 14.66 ? 98   ALA D C     1 
ATOM   4581 O O     . ALA F 3 98  ? 45.444  -4.885  91.037  1.00 14.30 ? 98   ALA D O     1 
ATOM   4582 C CB    . ALA F 3 98  ? 43.523  -7.491  89.787  1.00 16.00 ? 98   ALA D CB    1 
ATOM   4583 N N     . PHE F 3 99  ? 43.620  -4.482  89.740  1.00 13.52 ? 99   PHE D N     1 
ATOM   4584 C CA    . PHE F 3 99  ? 43.449  -3.080  90.171  1.00 12.93 ? 99   PHE D CA    1 
ATOM   4585 C C     . PHE F 3 99  ? 42.185  -2.845  90.973  1.00 11.98 ? 99   PHE D C     1 
ATOM   4586 O O     . PHE F 3 99  ? 41.193  -3.562  90.815  1.00 12.22 ? 99   PHE D O     1 
ATOM   4587 C CB    . PHE F 3 99  ? 43.511  -2.122  88.967  1.00 12.49 ? 99   PHE D CB    1 
ATOM   4588 C CG    . PHE F 3 99  ? 44.868  -2.072  88.356  1.00 12.67 ? 99   PHE D CG    1 
ATOM   4589 C CD1   . PHE F 3 99  ? 45.267  -3.085  87.488  1.00 12.81 ? 99   PHE D CD1   1 
ATOM   4590 C CD2   . PHE F 3 99  ? 45.790  -1.080  88.732  1.00 10.82 ? 99   PHE D CD2   1 
ATOM   4591 C CE1   . PHE F 3 99  ? 46.551  -3.094  86.953  1.00 14.02 ? 99   PHE D CE1   1 
ATOM   4592 C CE2   . PHE F 3 99  ? 47.078  -1.076  88.196  1.00 11.74 ? 99   PHE D CE2   1 
ATOM   4593 C CZ    . PHE F 3 99  ? 47.450  -2.086  87.299  1.00 13.02 ? 99   PHE D CZ    1 
ATOM   4594 N N     . ASP F 3 100 ? 42.251  -1.861  91.858  1.00 11.81 ? 100  ASP D N     1 
ATOM   4595 C CA    . ASP F 3 100 ? 41.098  -1.427  92.634  1.00 11.91 ? 100  ASP D CA    1 
ATOM   4596 C C     . ASP F 3 100 ? 40.211  -0.492  91.823  1.00 10.94 ? 100  ASP D C     1 
ATOM   4597 O O     . ASP F 3 100 ? 38.993  -0.524  91.944  1.00 12.19 ? 100  ASP D O     1 
ATOM   4598 C CB    . ASP F 3 100 ? 41.543  -0.727  93.904  1.00 12.37 ? 100  ASP D CB    1 
ATOM   4599 C CG    . ASP F 3 100 ? 42.274  -1.670  94.844  1.00 15.46 ? 100  ASP D CG    1 
ATOM   4600 O OD1   . ASP F 3 100 ? 43.522  -1.650  94.868  1.00 18.10 ? 100  ASP D OD1   1 
ATOM   4601 O OD2   . ASP F 3 100 ? 41.571  -2.470  95.483  1.00 18.85 ? 100  ASP D OD2   1 
ATOM   4602 N N     . LEU F 3 101 ? 40.840  0.307   90.982  1.00 11.09 ? 101  LEU D N     1 
ATOM   4603 C CA    . LEU F 3 101 ? 40.119  1.304   90.195  1.00 10.63 ? 101  LEU D CA    1 
ATOM   4604 C C     . LEU F 3 101 ? 40.733  1.413   88.810  1.00 10.37 ? 101  LEU D C     1 
ATOM   4605 O O     . LEU F 3 101 ? 41.946  1.514   88.663  1.00 11.10 ? 101  LEU D O     1 
ATOM   4606 C CB    . LEU F 3 101 ? 40.117  2.669   90.899  1.00 10.49 ? 101  LEU D CB    1 
ATOM   4607 C CG    . LEU F 3 101 ? 39.594  3.895   90.126  1.00 11.62 ? 101  LEU D CG    1 
ATOM   4608 C CD1   . LEU F 3 101 ? 38.098  3.710   89.773  1.00 12.23 ? 101  LEU D CD1   1 
ATOM   4609 C CD2   . LEU F 3 101 ? 39.792  5.195   90.915  1.00 11.91 ? 101  LEU D CD2   1 
ATOM   4610 N N     . ILE F 3 102 ? 39.873  1.401   87.794  1.00 9.69  ? 102  ILE D N     1 
ATOM   4611 C CA    . ILE F 3 102 ? 40.335  1.610   86.422  1.00 8.97  ? 102  ILE D CA    1 
ATOM   4612 C C     . ILE F 3 102 ? 39.455  2.693   85.863  1.00 9.33  ? 102  ILE D C     1 
ATOM   4613 O O     . ILE F 3 102 ? 38.238  2.593   85.957  1.00 9.92  ? 102  ILE D O     1 
ATOM   4614 C CB    . ILE F 3 102 ? 40.223  0.325   85.574  1.00 9.27  ? 102  ILE D CB    1 
ATOM   4615 C CG1   . ILE F 3 102 ? 41.058  -0.789  86.222  1.00 8.99  ? 102  ILE D CG1   1 
ATOM   4616 C CG2   . ILE F 3 102 ? 40.705  0.599   84.145  1.00 9.54  ? 102  ILE D CG2   1 
ATOM   4617 C CD1   . ILE F 3 102 ? 40.947  -2.144  85.534  1.00 9.27  ? 102  ILE D CD1   1 
ATOM   4618 N N     . LEU F 3 103 ? 40.064  3.732   85.300  1.00 9.25  ? 103  LEU D N     1 
ATOM   4619 C CA    . LEU F 3 103 ? 39.262  4.829   84.757  1.00 9.80  ? 103  LEU D CA    1 
ATOM   4620 C C     . LEU F 3 103 ? 39.842  5.442   83.519  1.00 9.67  ? 103  LEU D C     1 
ATOM   4621 O O     . LEU F 3 103 ? 41.051  5.404   83.289  1.00 9.21  ? 103  LEU D O     1 
ATOM   4622 C CB    . LEU F 3 103 ? 38.989  5.898   85.811  1.00 11.59 ? 103  LEU D CB    1 
ATOM   4623 C CG    . LEU F 3 103 ? 40.047  6.956   86.085  1.00 11.43 ? 103  LEU D CG    1 
ATOM   4624 C CD1   . LEU F 3 103 ? 39.507  7.984   87.089  1.00 16.13 ? 103  LEU D CD1   1 
ATOM   4625 C CD2   . LEU F 3 103 ? 41.313  6.298   86.640  1.00 13.80 ? 103  LEU D CD2   1 
ATOM   4626 N N     . GLY F 3 104 ? 38.954  6.003   82.710  1.00 8.47  ? 104  GLY D N     1 
ATOM   4627 C CA    . GLY F 3 104 ? 39.412  6.728   81.535  1.00 8.39  ? 104  GLY D CA    1 
ATOM   4628 C C     . GLY F 3 104 ? 38.474  6.658   80.349  1.00 9.03  ? 104  GLY D C     1 
ATOM   4629 O O     . GLY F 3 104 ? 37.273  6.373   80.471  1.00 8.61  ? 104  GLY D O     1 
ATOM   4630 N N     . ASN F 3 105 ? 39.072  6.906   79.190  1.00 8.60  ? 105  ASN D N     1 
ATOM   4631 C CA    . ASN F 3 105 ? 38.362  7.093   77.941  1.00 9.39  ? 105  ASN D CA    1 
ATOM   4632 C C     . ASN F 3 105 ? 39.095  6.186   76.965  1.00 9.01  ? 105  ASN D C     1 
ATOM   4633 O O     . ASN F 3 105 ? 40.163  6.555   76.465  1.00 9.57  ? 105  ASN D O     1 
ATOM   4634 C CB    . ASN F 3 105 ? 38.512  8.566   77.549  1.00 9.41  ? 105  ASN D CB    1 
ATOM   4635 C CG    . ASN F 3 105 ? 37.678  8.987   76.322  1.00 10.87 ? 105  ASN D CG    1 
ATOM   4636 O OD1   . ASN F 3 105 ? 37.344  10.157  76.185  1.00 12.35 ? 105  ASN D OD1   1 
ATOM   4637 N ND2   . ASN F 3 105 ? 37.368  8.059   75.444  1.00 10.61 ? 105  ASN D ND2   1 
ATOM   4638 N N     . PRO F 3 106 ? 38.538  4.991   76.697  1.00 9.32  ? 106  PRO D N     1 
ATOM   4639 C CA    . PRO F 3 106 ? 39.214  4.095   75.726  1.00 8.87  ? 106  PRO D CA    1 
ATOM   4640 C C     . PRO F 3 106 ? 39.119  4.655   74.298  1.00 9.44  ? 106  PRO D C     1 
ATOM   4641 O O     . PRO F 3 106 ? 38.283  5.520   74.030  1.00 9.13  ? 106  PRO D O     1 
ATOM   4642 C CB    . PRO F 3 106 ? 38.403  2.800   75.814  1.00 8.96  ? 106  PRO D CB    1 
ATOM   4643 C CG    . PRO F 3 106 ? 37.028  3.255   76.305  1.00 9.85  ? 106  PRO D CG    1 
ATOM   4644 C CD    . PRO F 3 106 ? 37.283  4.413   77.220  1.00 9.33  ? 106  PRO D CD    1 
ATOM   4645 N N     . PRO F 3 107 ? 39.947  4.143   73.375  1.00 8.83  ? 107  PRO D N     1 
ATOM   4646 C CA    . PRO F 3 107 ? 39.738  4.488   71.976  1.00 8.93  ? 107  PRO D CA    1 
ATOM   4647 C C     . PRO F 3 107 ? 38.438  3.831   71.494  1.00 8.86  ? 107  PRO D C     1 
ATOM   4648 O O     . PRO F 3 107 ? 38.017  2.792   72.026  1.00 9.36  ? 107  PRO D O     1 
ATOM   4649 C CB    . PRO F 3 107 ? 40.952  3.865   71.265  1.00 8.96  ? 107  PRO D CB    1 
ATOM   4650 C CG    . PRO F 3 107 ? 41.361  2.714   72.134  1.00 9.24  ? 107  PRO D CG    1 
ATOM   4651 C CD    . PRO F 3 107 ? 41.067  3.197   73.558  1.00 9.82  ? 107  PRO D CD    1 
ATOM   4652 N N     . TYR F 3 108 ? 37.790  4.482   70.527  1.00 8.79  ? 108  TYR D N     1 
ATOM   4653 C CA    . TYR F 3 108 ? 36.590  3.932   69.930  1.00 8.66  ? 108  TYR D CA    1 
ATOM   4654 C C     . TYR F 3 108 ? 36.865  3.612   68.451  1.00 8.77  ? 108  TYR D C     1 
ATOM   4655 O O     . TYR F 3 108 ? 37.494  4.406   67.737  1.00 10.14 ? 108  TYR D O     1 
ATOM   4656 C CB    . TYR F 3 108 ? 35.426  4.927   69.950  1.00 8.75  ? 108  TYR D CB    1 
ATOM   4657 C CG    . TYR F 3 108 ? 35.123  5.644   71.260  1.00 8.86  ? 108  TYR D CG    1 
ATOM   4658 C CD1   . TYR F 3 108 ? 35.545  5.157   72.501  1.00 10.37 ? 108  TYR D CD1   1 
ATOM   4659 C CD2   . TYR F 3 108 ? 34.413  6.836   71.230  1.00 9.20  ? 108  TYR D CD2   1 
ATOM   4660 C CE1   . TYR F 3 108 ? 35.237  5.879   73.698  1.00 8.58  ? 108  TYR D CE1   1 
ATOM   4661 C CE2   . TYR F 3 108 ? 34.102  7.559   72.388  1.00 8.69  ? 108  TYR D CE2   1 
ATOM   4662 C CZ    . TYR F 3 108 ? 34.501  7.073   73.617  1.00 9.31  ? 108  TYR D CZ    1 
ATOM   4663 O OH    . TYR F 3 108 ? 34.162  7.834   74.722  1.00 9.15  ? 108  TYR D OH    1 
ATOM   4664 N N     . GLY F 3 109 ? 36.337  2.491   67.987  1.00 8.59  ? 109  GLY D N     1 
ATOM   4665 C CA    . GLY F 3 109 ? 36.439  2.188   66.558  1.00 8.56  ? 109  GLY D CA    1 
ATOM   4666 C C     . GLY F 3 109 ? 36.447  0.711   66.200  1.00 8.57  ? 109  GLY D C     1 
ATOM   4667 O O     . GLY F 3 109 ? 36.861  -0.138  66.992  1.00 8.54  ? 109  GLY D O     1 
ATOM   4668 N N     . ILE F 3 110 ? 35.993  0.423   64.977  1.00 8.90  ? 110  ILE D N     1 
ATOM   4669 C CA    . ILE F 3 110 ? 35.998  -0.931  64.436  1.00 9.24  ? 110  ILE D CA    1 
ATOM   4670 C C     . ILE F 3 110 ? 37.346  -1.282  63.806  1.00 9.24  ? 110  ILE D C     1 
ATOM   4671 O O     . ILE F 3 110 ? 37.906  -0.482  63.043  1.00 8.68  ? 110  ILE D O     1 
ATOM   4672 C CB    . ILE F 3 110 ? 34.869  -1.104  63.373  1.00 8.92  ? 110  ILE D CB    1 
ATOM   4673 C CG1   . ILE F 3 110 ? 33.502  -0.884  64.031  1.00 8.30  ? 110  ILE D CG1   1 
ATOM   4674 C CG2   . ILE F 3 110 ? 34.938  -2.511  62.715  1.00 10.43 ? 110  ILE D CG2   1 
ATOM   4675 C CD1   . ILE F 3 110 ? 32.348  -0.691  63.029  1.00 10.62 ? 110  ILE D CD1   1 
ATOM   4676 N N     . VAL F 3 111 ? 37.870  -2.447  64.179  1.00 10.30 ? 111  VAL D N     1 
ATOM   4677 C CA    . VAL F 3 111 ? 39.067  -2.989  63.548  1.00 10.21 ? 111  VAL D CA    1 
ATOM   4678 C C     . VAL F 3 111 ? 38.736  -3.559  62.159  1.00 11.12 ? 111  VAL D C     1 
ATOM   4679 O O     . VAL F 3 111 ? 37.976  -4.529  62.028  1.00 10.81 ? 111  VAL D O     1 
ATOM   4680 C CB    . VAL F 3 111 ? 39.758  -4.066  64.421  1.00 11.03 ? 111  VAL D CB    1 
ATOM   4681 C CG1   . VAL F 3 111 ? 41.060  -4.484  63.739  1.00 10.30 ? 111  VAL D CG1   1 
ATOM   4682 C CG2   . VAL F 3 111 ? 40.034  -3.555  65.855  1.00 10.43 ? 111  VAL D CG2   1 
ATOM   4683 N N     . GLY F 3 112 ? 39.329  -2.982  61.120  1.00 10.89 ? 112  GLY D N     1 
ATOM   4684 C CA    . GLY F 3 112 ? 39.072  -3.516  59.779  1.00 12.54 ? 112  GLY D CA    1 
ATOM   4685 C C     . GLY F 3 112 ? 39.846  -2.789  58.699  1.00 13.95 ? 112  GLY D C     1 
ATOM   4686 O O     . GLY F 3 112 ? 40.669  -1.933  58.993  1.00 13.56 ? 112  GLY D O     1 
ATOM   4687 N N     . GLU F 3 113 ? 39.560  -3.139  57.452  1.00 14.44 ? 113  GLU D N     1 
ATOM   4688 C CA    . GLU F 3 113 ? 40.280  -2.600  56.291  1.00 16.52 ? 113  GLU D CA    1 
ATOM   4689 C C     . GLU F 3 113 ? 40.146  -1.087  56.225  1.00 15.78 ? 113  GLU D C     1 
ATOM   4690 O O     . GLU F 3 113 ? 39.045  -0.557  56.366  1.00 15.61 ? 113  GLU D O     1 
ATOM   4691 C CB    . GLU F 3 113 ? 39.703  -3.225  55.011  1.00 16.82 ? 113  GLU D CB    1 
ATOM   4692 C CG    . GLU F 3 113 ? 40.417  -2.850  53.735  1.00 20.13 ? 113  GLU D CG    1 
ATOM   4693 C CD    . GLU F 3 113 ? 39.711  -3.403  52.506  1.00 20.82 ? 113  GLU D CD    1 
ATOM   4694 O OE1   . GLU F 3 113 ? 39.414  -2.607  51.583  1.00 27.07 ? 113  GLU D OE1   1 
ATOM   4695 O OE2   . GLU F 3 113 ? 39.444  -4.636  52.466  1.00 25.88 ? 113  GLU D OE2   1 
ATOM   4696 N N     . ALA F 3 114 ? 41.270  -0.403  55.975  1.00 15.66 ? 114  ALA D N     1 
ATOM   4697 C CA    . ALA F 3 114 ? 41.348  1.062   56.038  1.00 15.67 ? 114  ALA D CA    1 
ATOM   4698 C C     . ALA F 3 114 ? 40.420  1.836   55.103  1.00 15.54 ? 114  ALA D C     1 
ATOM   4699 O O     . ALA F 3 114 ? 40.093  2.995   55.374  1.00 17.14 ? 114  ALA D O     1 
ATOM   4700 C CB    . ALA F 3 114 ? 42.788  1.525   55.842  1.00 15.95 ? 114  ALA D CB    1 
ATOM   4701 N N     . SER F 3 115 ? 39.986  1.208   54.014  1.00 15.91 ? 115  SER D N     1 
ATOM   4702 C CA    . SER F 3 115 ? 39.060  1.861   53.086  1.00 15.40 ? 115  SER D CA    1 
ATOM   4703 C C     . SER F 3 115 ? 37.680  2.099   53.736  1.00 15.04 ? 115  SER D C     1 
ATOM   4704 O O     . SER F 3 115 ? 36.894  2.945   53.276  1.00 15.42 ? 115  SER D O     1 
ATOM   4705 C CB    . SER F 3 115 ? 38.907  1.023   51.804  1.00 15.95 ? 115  SER D CB    1 
ATOM   4706 O OG    . SER F 3 115 ? 38.200  -0.169  52.066  1.00 17.47 ? 115  SER D OG    1 
ATOM   4707 N N     . LYS F 3 116 ? 37.404  1.375   54.820  1.00 13.15 ? 116  LYS D N     1 
ATOM   4708 C CA    . LYS F 3 116 ? 36.070  1.388   55.417  1.00 12.86 ? 116  LYS D CA    1 
ATOM   4709 C C     . LYS F 3 116 ? 36.082  1.614   56.927  1.00 12.56 ? 116  LYS D C     1 
ATOM   4710 O O     . LYS F 3 116 ? 35.133  2.181   57.464  1.00 12.84 ? 116  LYS D O     1 
ATOM   4711 C CB    . LYS F 3 116 ? 35.360  0.066   55.110  1.00 12.79 ? 116  LYS D CB    1 
ATOM   4712 C CG    . LYS F 3 116 ? 33.869  0.042   55.422  1.00 13.01 ? 116  LYS D CG    1 
ATOM   4713 C CD    . LYS F 3 116 ? 33.095  1.015   54.544  1.00 12.94 ? 116  LYS D CD    1 
ATOM   4714 C CE    . LYS F 3 116 ? 31.605  0.881   54.755  1.00 11.27 ? 116  LYS D CE    1 
ATOM   4715 N NZ    . LYS F 3 116 ? 30.825  1.805   53.867  1.00 13.96 ? 116  LYS D NZ    1 
ATOM   4716 N N     . TYR F 3 117 ? 37.119  1.122   57.606  1.00 11.43 ? 117  TYR D N     1 
ATOM   4717 C CA    . TYR F 3 117 ? 37.131  1.147   59.074  1.00 11.44 ? 117  TYR D CA    1 
ATOM   4718 C C     . TYR F 3 117 ? 38.375  1.839   59.599  1.00 11.20 ? 117  TYR D C     1 
ATOM   4719 O O     . TYR F 3 117 ? 39.401  1.845   58.911  1.00 11.33 ? 117  TYR D O     1 
ATOM   4720 C CB    . TYR F 3 117 ? 37.039  -0.280  59.621  1.00 10.45 ? 117  TYR D CB    1 
ATOM   4721 C CG    . TYR F 3 117 ? 35.771  -0.953  59.153  1.00 10.72 ? 117  TYR D CG    1 
ATOM   4722 C CD1   . TYR F 3 117 ? 35.807  -1.999  58.216  1.00 9.82  ? 117  TYR D CD1   1 
ATOM   4723 C CD2   . TYR F 3 117 ? 34.528  -0.551  59.660  1.00 10.12 ? 117  TYR D CD2   1 
ATOM   4724 C CE1   . TYR F 3 117 ? 34.612  -2.621  57.788  1.00 10.48 ? 117  TYR D CE1   1 
ATOM   4725 C CE2   . TYR F 3 117 ? 33.317  -1.146  59.220  1.00 10.75 ? 117  TYR D CE2   1 
ATOM   4726 C CZ    . TYR F 3 117 ? 33.372  -2.184  58.297  1.00 8.99  ? 117  TYR D CZ    1 
ATOM   4727 O OH    . TYR F 3 117 ? 32.194  -2.785  57.903  1.00 10.17 ? 117  TYR D OH    1 
ATOM   4728 N N     . PRO F 3 118 ? 38.280  2.429   60.803  1.00 10.94 ? 118  PRO D N     1 
ATOM   4729 C CA    . PRO F 3 118 ? 39.388  3.288   61.271  1.00 11.52 ? 118  PRO D CA    1 
ATOM   4730 C C     . PRO F 3 118 ? 40.558  2.644   62.022  1.00 12.11 ? 118  PRO D C     1 
ATOM   4731 O O     . PRO F 3 118 ? 41.632  3.287   62.131  1.00 12.86 ? 118  PRO D O     1 
ATOM   4732 C CB    . PRO F 3 118 ? 38.674  4.267   62.209  1.00 11.01 ? 118  PRO D CB    1 
ATOM   4733 C CG    . PRO F 3 118 ? 37.623  3.442   62.837  1.00 11.50 ? 118  PRO D CG    1 
ATOM   4734 C CD    . PRO F 3 118 ? 37.142  2.466   61.750  1.00 10.55 ? 118  PRO D CD    1 
ATOM   4735 N N     . ILE F 3 119 ? 40.383  1.433   62.539  1.00 11.56 ? 119  ILE D N     1 
ATOM   4736 C CA    . ILE F 3 119 ? 41.448  0.813   63.349  1.00 12.40 ? 119  ILE D CA    1 
ATOM   4737 C C     . ILE F 3 119 ? 42.174  -0.247  62.535  1.00 12.82 ? 119  ILE D C     1 
ATOM   4738 O O     . ILE F 3 119 ? 41.575  -1.242  62.123  1.00 12.63 ? 119  ILE D O     1 
ATOM   4739 C CB    . ILE F 3 119 ? 40.932  0.215   64.675  1.00 12.23 ? 119  ILE D CB    1 
ATOM   4740 C CG1   . ILE F 3 119 ? 40.096  1.243   65.448  1.00 12.28 ? 119  ILE D CG1   1 
ATOM   4741 C CG2   . ILE F 3 119 ? 42.113  -0.284  65.520  1.00 12.51 ? 119  ILE D CG2   1 
ATOM   4742 C CD1   . ILE F 3 119 ? 40.762  2.598   65.663  1.00 15.03 ? 119  ILE D CD1   1 
ATOM   4743 N N     . HIS F 3 120 ? 43.463  -0.008  62.308  1.00 14.55 ? 120  HIS D N     1 
ATOM   4744 C CA    . HIS F 3 120 ? 44.238  -0.831  61.389  1.00 15.70 ? 120  HIS D CA    1 
ATOM   4745 C C     . HIS F 3 120 ? 45.345  -1.594  62.120  1.00 16.51 ? 120  HIS D C     1 
ATOM   4746 O O     . HIS F 3 120 ? 46.271  -0.991  62.695  1.00 17.21 ? 120  HIS D O     1 
ATOM   4747 C CB    . HIS F 3 120 ? 44.795  0.022   60.240  1.00 16.17 ? 120  HIS D CB    1 
ATOM   4748 C CG    . HIS F 3 120 ? 43.845  1.083   59.761  1.00 17.73 ? 120  HIS D CG    1 
ATOM   4749 N ND1   . HIS F 3 120 ? 44.212  2.405   59.633  1.00 18.47 ? 120  HIS D ND1   1 
ATOM   4750 C CD2   . HIS F 3 120 ? 42.530  1.025   59.430  1.00 17.23 ? 120  HIS D CD2   1 
ATOM   4751 C CE1   . HIS F 3 120 ? 43.176  3.111   59.214  1.00 18.58 ? 120  HIS D CE1   1 
ATOM   4752 N NE2   . HIS F 3 120 ? 42.141  2.297   59.086  1.00 18.20 ? 120  HIS D NE2   1 
ATOM   4753 N N     . VAL F 3 121 ? 45.211  -2.916  62.128  1.00 16.36 ? 121  VAL D N     1 
ATOM   4754 C CA    . VAL F 3 121 ? 46.218  -3.818  62.728  1.00 17.10 ? 121  VAL D CA    1 
ATOM   4755 C C     . VAL F 3 121 ? 46.403  -5.019  61.797  1.00 17.38 ? 121  VAL D C     1 
ATOM   4756 O O     . VAL F 3 121 ? 45.566  -5.247  60.919  1.00 17.21 ? 121  VAL D O     1 
ATOM   4757 C CB    . VAL F 3 121 ? 45.826  -4.308  64.160  1.00 17.91 ? 121  VAL D CB    1 
ATOM   4758 C CG1   . VAL F 3 121 ? 45.687  -3.121  65.147  1.00 17.18 ? 121  VAL D CG1   1 
ATOM   4759 C CG2   . VAL F 3 121 ? 44.567  -5.163  64.151  1.00 17.43 ? 121  VAL D CG2   1 
ATOM   4760 N N     . PHE F 3 122 ? 47.488  -5.780  61.977  1.00 17.28 ? 122  PHE D N     1 
ATOM   4761 C CA    . PHE F 3 122 ? 47.648  -7.033  61.230  1.00 17.84 ? 122  PHE D CA    1 
ATOM   4762 C C     . PHE F 3 122 ? 46.533  -8.002  61.617  1.00 18.23 ? 122  PHE D C     1 
ATOM   4763 O O     . PHE F 3 122 ? 46.039  -7.981  62.752  1.00 17.78 ? 122  PHE D O     1 
ATOM   4764 C CB    . PHE F 3 122 ? 48.993  -7.717  61.516  1.00 18.00 ? 122  PHE D CB    1 
ATOM   4765 C CG    . PHE F 3 122 ? 50.190  -6.949  61.042  1.00 18.77 ? 122  PHE D CG    1 
ATOM   4766 C CD1   . PHE F 3 122 ? 51.115  -6.464  61.961  1.00 21.02 ? 122  PHE D CD1   1 
ATOM   4767 C CD2   . PHE F 3 122 ? 50.414  -6.736  59.685  1.00 20.36 ? 122  PHE D CD2   1 
ATOM   4768 C CE1   . PHE F 3 122 ? 52.237  -5.755  61.535  1.00 21.36 ? 122  PHE D CE1   1 
ATOM   4769 C CE2   . PHE F 3 122 ? 51.521  -6.037  59.249  1.00 21.07 ? 122  PHE D CE2   1 
ATOM   4770 C CZ    . PHE F 3 122 ? 52.442  -5.537  60.191  1.00 20.01 ? 122  PHE D CZ    1 
ATOM   4771 N N     . LYS F 3 123 ? 46.150  -8.858  60.675  1.00 18.75 ? 123  LYS D N     1 
ATOM   4772 C CA    . LYS F 3 123 ? 45.146  -9.891  60.949  1.00 19.22 ? 123  LYS D CA    1 
ATOM   4773 C C     . LYS F 3 123 ? 45.524  -10.705 62.191  1.00 18.34 ? 123  LYS D C     1 
ATOM   4774 O O     . LYS F 3 123 ? 44.668  -11.069 63.013  1.00 17.26 ? 123  LYS D O     1 
ATOM   4775 C CB    . LYS F 3 123 ? 44.994  -10.818 59.730  1.00 19.64 ? 123  LYS D CB    1 
ATOM   4776 C CG    . LYS F 3 123 ? 43.809  -11.761 59.824  1.00 20.98 ? 123  LYS D CG    1 
ATOM   4777 C CD    . LYS F 3 123 ? 43.837  -12.826 58.723  1.00 22.22 ? 123  LYS D CD    1 
ATOM   4778 C CE    . LYS F 3 123 ? 42.962  -14.034 59.093  1.00 25.51 ? 123  LYS D CE    1 
ATOM   4779 N NZ    . LYS F 3 123 ? 43.581  -14.923 60.146  1.00 28.02 ? 123  LYS D NZ    1 
ATOM   4780 N N     . ALA F 3 124 ? 46.816  -10.984 62.329  1.00 17.43 ? 124  ALA D N     1 
ATOM   4781 C CA    . ALA F 3 124 ? 47.312  -11.781 63.435  1.00 17.58 ? 124  ALA D CA    1 
ATOM   4782 C C     . ALA F 3 124 ? 47.030  -11.130 64.800  1.00 16.85 ? 124  ALA D C     1 
ATOM   4783 O O     . ALA F 3 124 ? 46.755  -11.840 65.801  1.00 16.54 ? 124  ALA D O     1 
ATOM   4784 C CB    . ALA F 3 124 ? 48.803  -12.068 63.244  1.00 17.97 ? 124  ALA D CB    1 
ATOM   4785 N N     . VAL F 3 125 ? 47.097  -9.793  64.827  1.00 17.02 ? 125  VAL D N     1 
ATOM   4786 C CA    . VAL F 3 125 ? 46.772  -9.022  66.024  1.00 15.99 ? 125  VAL D CA    1 
ATOM   4787 C C     . VAL F 3 125 ? 45.263  -9.117  66.295  1.00 15.13 ? 125  VAL D C     1 
ATOM   4788 O O     . VAL F 3 125 ? 44.847  -9.366  67.424  1.00 14.13 ? 125  VAL D O     1 
ATOM   4789 C CB    . VAL F 3 125 ? 47.220  -7.547  65.928  1.00 16.46 ? 125  VAL D CB    1 
ATOM   4790 C CG1   . VAL F 3 125 ? 46.718  -6.775  67.134  1.00 16.57 ? 125  VAL D CG1   1 
ATOM   4791 C CG2   . VAL F 3 125 ? 48.759  -7.438  65.794  1.00 17.61 ? 125  VAL D CG2   1 
ATOM   4792 N N     . LYS F 3 126 ? 44.441  -8.924  65.256  1.00 14.14 ? 126  LYS D N     1 
ATOM   4793 C CA    . LYS F 3 126 ? 42.997  -9.078  65.448  1.00 13.78 ? 126  LYS D CA    1 
ATOM   4794 C C     . LYS F 3 126 ? 42.678  -10.477 65.977  1.00 13.69 ? 126  LYS D C     1 
ATOM   4795 O O     . LYS F 3 126 ? 41.804  -10.632 66.828  1.00 13.64 ? 126  LYS D O     1 
ATOM   4796 C CB    . LYS F 3 126 ? 42.227  -8.785  64.161  1.00 14.06 ? 126  LYS D CB    1 
ATOM   4797 C CG    . LYS F 3 126 ? 40.721  -8.589  64.390  1.00 12.55 ? 126  LYS D CG    1 
ATOM   4798 C CD    . LYS F 3 126 ? 39.992  -8.412  63.067  1.00 11.71 ? 126  LYS D CD    1 
ATOM   4799 C CE    . LYS F 3 126 ? 38.626  -7.687  63.292  1.00 9.90  ? 126  LYS D CE    1 
ATOM   4800 N NZ    . LYS F 3 126 ? 37.766  -7.779  62.080  1.00 9.87  ? 126  LYS D NZ    1 
ATOM   4801 N N     . ASP F 3 127 ? 43.381  -11.502 65.477  1.00 14.00 ? 127  ASP D N     1 
ATOM   4802 C CA    . ASP F 3 127 ? 43.204  -12.867 65.976  1.00 14.39 ? 127  ASP D CA    1 
ATOM   4803 C C     . ASP F 3 127 ? 43.520  -12.999 67.467  1.00 13.96 ? 127  ASP D C     1 
ATOM   4804 O O     . ASP F 3 127 ? 42.813  -13.693 68.197  1.00 13.30 ? 127  ASP D O     1 
ATOM   4805 C CB    . ASP F 3 127 ? 44.040  -13.879 65.176  1.00 15.16 ? 127  ASP D CB    1 
ATOM   4806 C CG    . ASP F 3 127 ? 43.510  -14.104 63.753  1.00 18.15 ? 127  ASP D CG    1 
ATOM   4807 O OD1   . ASP F 3 127 ? 42.376  -13.682 63.435  1.00 19.74 ? 127  ASP D OD1   1 
ATOM   4808 O OD2   . ASP F 3 127 ? 44.250  -14.717 62.938  1.00 22.47 ? 127  ASP D OD2   1 
ATOM   4809 N N     . LEU F 3 128 ? 44.594  -12.343 67.915  1.00 14.40 ? 128  LEU D N     1 
ATOM   4810 C CA    . LEU F 3 128 ? 44.907  -12.307 69.347  1.00 13.57 ? 128  LEU D CA    1 
ATOM   4811 C C     . LEU F 3 128 ? 43.780  -11.640 70.136  1.00 13.20 ? 128  LEU D C     1 
ATOM   4812 O O     . LEU F 3 128 ? 43.410  -12.145 71.199  1.00 13.75 ? 128  LEU D O     1 
ATOM   4813 C CB    . LEU F 3 128 ? 46.234  -11.590 69.621  1.00 14.01 ? 128  LEU D CB    1 
ATOM   4814 C CG    . LEU F 3 128 ? 47.506  -12.321 69.138  1.00 15.00 ? 128  LEU D CG    1 
ATOM   4815 C CD1   . LEU F 3 128 ? 48.699  -11.374 69.141  1.00 17.54 ? 128  LEU D CD1   1 
ATOM   4816 C CD2   . LEU F 3 128 ? 47.778  -13.561 70.014  1.00 18.48 ? 128  LEU D CD2   1 
ATOM   4817 N N     . TYR F 3 129 ? 43.204  -10.555 69.605  1.00 12.45 ? 129  TYR D N     1 
ATOM   4818 C CA    . TYR F 3 129 ? 42.059  -9.919  70.284  1.00 12.35 ? 129  TYR D CA    1 
ATOM   4819 C C     . TYR F 3 129 ? 40.870  -10.865 70.421  1.00 12.70 ? 129  TYR D C     1 
ATOM   4820 O O     . TYR F 3 129 ? 40.283  -11.028 71.500  1.00 12.19 ? 129  TYR D O     1 
ATOM   4821 C CB    . TYR F 3 129 ? 41.612  -8.628  69.568  1.00 12.50 ? 129  TYR D CB    1 
ATOM   4822 C CG    . TYR F 3 129 ? 42.615  -7.493  69.636  1.00 12.31 ? 129  TYR D CG    1 
ATOM   4823 C CD1   . TYR F 3 129 ? 43.709  -7.526  70.525  1.00 11.33 ? 129  TYR D CD1   1 
ATOM   4824 C CD2   . TYR F 3 129 ? 42.458  -6.367  68.824  1.00 12.08 ? 129  TYR D CD2   1 
ATOM   4825 C CE1   . TYR F 3 129 ? 44.617  -6.465  70.575  1.00 13.01 ? 129  TYR D CE1   1 
ATOM   4826 C CE2   . TYR F 3 129 ? 43.341  -5.315  68.870  1.00 14.12 ? 129  TYR D CE2   1 
ATOM   4827 C CZ    . TYR F 3 129 ? 44.413  -5.348  69.759  1.00 13.53 ? 129  TYR D CZ    1 
ATOM   4828 O OH    . TYR F 3 129 ? 45.278  -4.269  69.762  1.00 15.41 ? 129  TYR D OH    1 
ATOM   4829 N N     . LYS F 3 130 ? 40.506  -11.501 69.316  1.00 13.49 ? 130  LYS D N     1 
ATOM   4830 C CA    . LYS F 3 130 ? 39.420  -12.479 69.361  1.00 14.00 ? 130  LYS D CA    1 
ATOM   4831 C C     . LYS F 3 130 ? 39.636  -13.613 70.370  1.00 15.06 ? 130  LYS D C     1 
ATOM   4832 O O     . LYS F 3 130 ? 38.713  -13.998 71.091  1.00 13.96 ? 130  LYS D O     1 
ATOM   4833 C CB    . LYS F 3 130 ? 39.134  -13.018 67.959  1.00 14.57 ? 130  LYS D CB    1 
ATOM   4834 C CG    . LYS F 3 130 ? 38.498  -11.997 67.035  1.00 13.67 ? 130  LYS D CG    1 
ATOM   4835 C CD    . LYS F 3 130 ? 38.529  -12.551 65.637  1.00 14.11 ? 130  LYS D CD    1 
ATOM   4836 C CE    . LYS F 3 130 ? 37.888  -11.622 64.634  1.00 15.24 ? 130  LYS D CE    1 
ATOM   4837 N NZ    . LYS F 3 130 ? 37.854  -12.297 63.272  1.00 15.25 ? 130  LYS D NZ    1 
ATOM   4838 N N     . LYS F 3 131 ? 40.863  -14.121 70.444  1.00 15.12 ? 131  LYS D N     1 
ATOM   4839 C CA    . LYS F 3 131 ? 41.217  -15.154 71.414  1.00 17.00 ? 131  LYS D CA    1 
ATOM   4840 C C     . LYS F 3 131 ? 41.050  -14.648 72.859  1.00 16.24 ? 131  LYS D C     1 
ATOM   4841 O O     . LYS F 3 131 ? 40.566  -15.376 73.729  1.00 16.57 ? 131  LYS D O     1 
ATOM   4842 C CB    . LYS F 3 131 ? 42.666  -15.589 71.179  1.00 17.39 ? 131  LYS D CB    1 
ATOM   4843 C CG    . LYS F 3 131 ? 43.062  -16.851 71.933  1.00 19.50 ? 131  LYS D CG    1 
ATOM   4844 C CD    . LYS F 3 131 ? 44.521  -17.214 71.655  1.00 20.67 ? 131  LYS D CD    1 
ATOM   4845 C CE    . LYS F 3 131 ? 44.891  -18.527 72.340  1.00 25.94 ? 131  LYS D CE    1 
ATOM   4846 N NZ    . LYS F 3 131 ? 44.688  -18.462 73.817  1.00 30.53 ? 131  LYS D NZ    1 
ATOM   4847 N N     . ALA F 3 132 ? 41.453  -13.398 73.088  1.00 15.26 ? 132  ALA D N     1 
ATOM   4848 C CA    . ALA F 3 132 ? 41.497  -12.822 74.426  1.00 14.33 ? 132  ALA D CA    1 
ATOM   4849 C C     . ALA F 3 132 ? 40.117  -12.467 74.952  1.00 14.15 ? 132  ALA D C     1 
ATOM   4850 O O     . ALA F 3 132 ? 39.892  -12.549 76.157  1.00 14.36 ? 132  ALA D O     1 
ATOM   4851 C CB    . ALA F 3 132 ? 42.400  -11.599 74.459  1.00 15.30 ? 132  ALA D CB    1 
ATOM   4852 N N     . PHE F 3 133 ? 39.198  -12.100 74.050  1.00 12.30 ? 133  PHE D N     1 
ATOM   4853 C CA    . PHE F 3 133 ? 37.922  -11.476 74.472  1.00 11.70 ? 133  PHE D CA    1 
ATOM   4854 C C     . PHE F 3 133 ? 36.679  -12.302 74.201  1.00 12.18 ? 133  PHE D C     1 
ATOM   4855 O O     . PHE F 3 133 ? 36.290  -12.494 73.045  1.00 11.97 ? 133  PHE D O     1 
ATOM   4856 C CB    . PHE F 3 133 ? 37.846  -10.050 73.904  1.00 11.38 ? 133  PHE D CB    1 
ATOM   4857 C CG    . PHE F 3 133 ? 38.994  -9.197  74.361  1.00 10.25 ? 133  PHE D CG    1 
ATOM   4858 C CD1   . PHE F 3 133 ? 39.225  -9.019  75.727  1.00 11.70 ? 133  PHE D CD1   1 
ATOM   4859 C CD2   . PHE F 3 133 ? 39.877  -8.646  73.449  1.00 10.09 ? 133  PHE D CD2   1 
ATOM   4860 C CE1   . PHE F 3 133 ? 40.307  -8.268  76.178  1.00 11.34 ? 133  PHE D CE1   1 
ATOM   4861 C CE2   . PHE F 3 133 ? 40.988  -7.899  73.885  1.00 10.71 ? 133  PHE D CE2   1 
ATOM   4862 C CZ    . PHE F 3 133 ? 41.201  -7.712  75.252  1.00 11.49 ? 133  PHE D CZ    1 
ATOM   4863 N N     . SER F 3 134 ? 36.071  -12.805 75.283  1.00 12.03 ? 134  SER D N     1 
ATOM   4864 C CA    . SER F 3 134 ? 34.895  -13.680 75.181  1.00 12.29 ? 134  SER D CA    1 
ATOM   4865 C C     . SER F 3 134 ? 33.656  -12.926 74.672  1.00 11.88 ? 134  SER D C     1 
ATOM   4866 O O     . SER F 3 134 ? 32.695  -13.551 74.177  1.00 12.30 ? 134  SER D O     1 
ATOM   4867 C CB    . SER F 3 134 ? 34.582  -14.336 76.538  1.00 12.75 ? 134  SER D CB    1 
ATOM   4868 O OG    . SER F 3 134 ? 34.245  -13.368 77.525  1.00 14.13 ? 134  SER D OG    1 
ATOM   4869 N N     . THR F 3 135 ? 33.690  -11.598 74.797  1.00 10.74 ? 135  THR D N     1 
ATOM   4870 C CA    . THR F 3 135 ? 32.575  -10.727 74.388  1.00 10.72 ? 135  THR D CA    1 
ATOM   4871 C C     . THR F 3 135 ? 32.677  -10.301 72.932  1.00 10.47 ? 135  THR D C     1 
ATOM   4872 O O     . THR F 3 135 ? 31.760  -9.663  72.398  1.00 11.38 ? 135  THR D O     1 
ATOM   4873 C CB    . THR F 3 135 ? 32.458  -9.452  75.278  1.00 10.25 ? 135  THR D CB    1 
ATOM   4874 O OG1   . THR F 3 135 ? 33.627  -8.629  75.114  1.00 10.29 ? 135  THR D OG1   1 
ATOM   4875 C CG2   . THR F 3 135 ? 32.274  -9.824  76.766  1.00 12.43 ? 135  THR D CG2   1 
ATOM   4876 N N     . TRP F 3 136 ? 33.798  -10.622 72.278  1.00 10.01 ? 136  TRP D N     1 
ATOM   4877 C CA    . TRP F 3 136 ? 33.986  -10.194 70.886  1.00 10.72 ? 136  TRP D CA    1 
ATOM   4878 C C     . TRP F 3 136 ? 32.915  -10.816 69.983  1.00 10.51 ? 136  TRP D C     1 
ATOM   4879 O O     . TRP F 3 136 ? 32.800  -12.045 69.901  1.00 12.13 ? 136  TRP D O     1 
ATOM   4880 C CB    . TRP F 3 136 ? 35.389  -10.556 70.375  1.00 10.18 ? 136  TRP D CB    1 
ATOM   4881 C CG    . TRP F 3 136 ? 35.800  -9.786  69.107  1.00 11.37 ? 136  TRP D CG    1 
ATOM   4882 C CD1   . TRP F 3 136 ? 35.343  -9.982  67.819  1.00 10.08 ? 136  TRP D CD1   1 
ATOM   4883 C CD2   . TRP F 3 136 ? 36.753  -8.716  69.028  1.00 10.60 ? 136  TRP D CD2   1 
ATOM   4884 N NE1   . TRP F 3 136 ? 35.950  -9.100  66.960  1.00 9.03  ? 136  TRP D NE1   1 
ATOM   4885 C CE2   . TRP F 3 136 ? 36.834  -8.324  67.668  1.00 10.58 ? 136  TRP D CE2   1 
ATOM   4886 C CE3   . TRP F 3 136 ? 37.544  -8.043  69.979  1.00 10.62 ? 136  TRP D CE3   1 
ATOM   4887 C CZ2   . TRP F 3 136 ? 37.662  -7.263  67.237  1.00 11.08 ? 136  TRP D CZ2   1 
ATOM   4888 C CZ3   . TRP F 3 136 ? 38.376  -7.009  69.554  1.00 10.01 ? 136  TRP D CZ3   1 
ATOM   4889 C CH2   . TRP F 3 136 ? 38.432  -6.632  68.186  1.00 12.41 ? 136  TRP D CH2   1 
ATOM   4890 N N     . LYS F 3 137 ? 32.149  -9.963  69.301  1.00 10.04 ? 137  LYS D N     1 
ATOM   4891 C CA    . LYS F 3 137 ? 31.009  -10.408 68.486  1.00 10.32 ? 137  LYS D CA    1 
ATOM   4892 C C     . LYS F 3 137 ? 30.875  -9.515  67.253  1.00 9.98  ? 137  LYS D C     1 
ATOM   4893 O O     . LYS F 3 137 ? 30.993  -8.284  67.358  1.00 9.81  ? 137  LYS D O     1 
ATOM   4894 C CB    . LYS F 3 137 ? 29.702  -10.350 69.301  1.00 11.15 ? 137  LYS D CB    1 
ATOM   4895 C CG    . LYS F 3 137 ? 28.481  -10.842 68.501  1.00 12.32 ? 137  LYS D CG    1 
ATOM   4896 C CD    . LYS F 3 137 ? 27.245  -10.943 69.366  1.00 11.35 ? 137  LYS D CD    1 
ATOM   4897 C CE    . LYS F 3 137 ? 26.031  -11.100 68.479  1.00 12.38 ? 137  LYS D CE    1 
ATOM   4898 N NZ    . LYS F 3 137 ? 24.776  -11.024 69.263  1.00 15.56 ? 137  LYS D NZ    1 
ATOM   4899 N N     . GLY F 3 138 ? 30.578  -10.132 66.094  1.00 9.37  ? 138  GLY D N     1 
ATOM   4900 C CA    . GLY F 3 138 ? 30.426  -9.351  64.851  1.00 9.38  ? 138  GLY D CA    1 
ATOM   4901 C C     . GLY F 3 138 ? 31.707  -8.591  64.505  1.00 9.15  ? 138  GLY D C     1 
ATOM   4902 O O     . GLY F 3 138 ? 32.801  -9.109  64.692  1.00 10.47 ? 138  GLY D O     1 
ATOM   4903 N N     . LYS F 3 139 ? 31.584  -7.366  64.005  1.00 8.70  ? 139  LYS D N     1 
ATOM   4904 C CA    . LYS F 3 139 ? 32.767  -6.552  63.722  1.00 9.01  ? 139  LYS D CA    1 
ATOM   4905 C C     . LYS F 3 139 ? 33.362  -6.068  65.057  1.00 8.80  ? 139  LYS D C     1 
ATOM   4906 O O     . LYS F 3 139 ? 34.570  -5.862  65.169  1.00 8.66  ? 139  LYS D O     1 
ATOM   4907 C CB    . LYS F 3 139 ? 32.411  -5.373  62.816  1.00 8.91  ? 139  LYS D CB    1 
ATOM   4908 C CG    . LYS F 3 139 ? 31.757  -5.776  61.467  1.00 10.39 ? 139  LYS D CG    1 
ATOM   4909 C CD    . LYS F 3 139 ? 31.563  -4.543  60.570  1.00 10.23 ? 139  LYS D CD    1 
ATOM   4910 C CE    . LYS F 3 139 ? 30.505  -3.569  61.124  1.00 9.75  ? 139  LYS D CE    1 
ATOM   4911 N NZ    . LYS F 3 139 ? 29.143  -4.197  61.272  1.00 9.46  ? 139  LYS D NZ    1 
ATOM   4912 N N     . TYR F 3 140 ? 32.490  -5.929  66.062  1.00 8.21  ? 140  TYR D N     1 
ATOM   4913 C CA    . TYR F 3 140 ? 32.834  -5.466  67.423  1.00 7.91  ? 140  TYR D CA    1 
ATOM   4914 C C     . TYR F 3 140 ? 33.500  -4.078  67.404  1.00 7.61  ? 140  TYR D C     1 
ATOM   4915 O O     . TYR F 3 140 ? 33.310  -3.313  66.461  1.00 8.22  ? 140  TYR D O     1 
ATOM   4916 C CB    . TYR F 3 140 ? 33.659  -6.506  68.201  1.00 8.86  ? 140  TYR D CB    1 
ATOM   4917 C CG    . TYR F 3 140 ? 33.427  -6.481  69.706  1.00 7.28  ? 140  TYR D CG    1 
ATOM   4918 C CD1   . TYR F 3 140 ? 32.129  -6.508  70.226  1.00 7.52  ? 140  TYR D CD1   1 
ATOM   4919 C CD2   . TYR F 3 140 ? 34.496  -6.453  70.597  1.00 8.91  ? 140  TYR D CD2   1 
ATOM   4920 C CE1   . TYR F 3 140 ? 31.886  -6.495  71.590  1.00 9.12  ? 140  TYR D CE1   1 
ATOM   4921 C CE2   . TYR F 3 140 ? 34.270  -6.456  71.976  1.00 9.35  ? 140  TYR D CE2   1 
ATOM   4922 C CZ    . TYR F 3 140 ? 32.959  -6.465  72.461  1.00 9.65  ? 140  TYR D CZ    1 
ATOM   4923 O OH    . TYR F 3 140 ? 32.709  -6.434  73.809  1.00 11.04 ? 140  TYR D OH    1 
ATOM   4924 N N     . ASN F 3 141 ? 34.258  -3.742  68.448  1.00 7.10  ? 141  ASN D N     1 
ATOM   4925 C CA    . ASN F 3 141 ? 34.788  -2.365  68.610  1.00 7.16  ? 141  ASN D CA    1 
ATOM   4926 C C     . ASN F 3 141 ? 35.866  -2.385  69.686  1.00 7.27  ? 141  ASN D C     1 
ATOM   4927 O O     . ASN F 3 141 ? 35.737  -3.115  70.679  1.00 7.22  ? 141  ASN D O     1 
ATOM   4928 C CB    . ASN F 3 141 ? 33.670  -1.420  69.066  1.00 8.10  ? 141  ASN D CB    1 
ATOM   4929 C CG    . ASN F 3 141 ? 34.025  0.071   68.917  1.00 7.38  ? 141  ASN D CG    1 
ATOM   4930 O OD1   . ASN F 3 141 ? 34.961  0.585   69.551  1.00 8.64  ? 141  ASN D OD1   1 
ATOM   4931 N ND2   . ASN F 3 141 ? 33.239  0.783   68.094  1.00 7.75  ? 141  ASN D ND2   1 
ATOM   4932 N N     . LEU F 3 142 ? 36.906  -1.585  69.493  1.00 7.24  ? 142  LEU D N     1 
ATOM   4933 C CA    . LEU F 3 142 ? 37.927  -1.431  70.530  1.00 8.58  ? 142  LEU D CA    1 
ATOM   4934 C C     . LEU F 3 142 ? 37.313  -1.097  71.879  1.00 8.92  ? 142  LEU D C     1 
ATOM   4935 O O     . LEU F 3 142 ? 37.812  -1.554  72.897  1.00 9.19  ? 142  LEU D O     1 
ATOM   4936 C CB    . LEU F 3 142 ? 38.927  -0.333  70.191  1.00 9.39  ? 142  LEU D CB    1 
ATOM   4937 C CG    . LEU F 3 142 ? 39.890  -0.560  69.036  1.00 11.00 ? 142  LEU D CG    1 
ATOM   4938 C CD1   . LEU F 3 142 ? 40.797  0.693   68.900  1.00 12.71 ? 142  LEU D CD1   1 
ATOM   4939 C CD2   . LEU F 3 142 ? 40.728  -1.857  69.217  1.00 12.71 ? 142  LEU D CD2   1 
ATOM   4940 N N     . TYR F 3 143 ? 36.248  -0.289  71.906  1.00 8.39  ? 143  TYR D N     1 
ATOM   4941 C CA    . TYR F 3 143 ? 35.781  0.150   73.218  1.00 8.65  ? 143  TYR D CA    1 
ATOM   4942 C C     . TYR F 3 143 ? 35.155  -1.001  74.013  1.00 8.72  ? 143  TYR D C     1 
ATOM   4943 O O     . TYR F 3 143 ? 35.246  -1.032  75.257  1.00 9.28  ? 143  TYR D O     1 
ATOM   4944 C CB    . TYR F 3 143 ? 34.885  1.370   73.100  1.00 8.59  ? 143  TYR D CB    1 
ATOM   4945 C CG    . TYR F 3 143 ? 33.419  1.143   72.857  1.00 8.96  ? 143  TYR D CG    1 
ATOM   4946 C CD1   . TYR F 3 143 ? 32.579  0.666   73.884  1.00 7.35  ? 143  TYR D CD1   1 
ATOM   4947 C CD2   . TYR F 3 143 ? 32.832  1.529   71.635  1.00 6.40  ? 143  TYR D CD2   1 
ATOM   4948 C CE1   . TYR F 3 143 ? 31.201  0.518   73.668  1.00 7.46  ? 143  TYR D CE1   1 
ATOM   4949 C CE2   . TYR F 3 143 ? 31.447  1.384   71.418  1.00 8.24  ? 143  TYR D CE2   1 
ATOM   4950 C CZ    . TYR F 3 143 ? 30.654  0.881   72.438  1.00 9.17  ? 143  TYR D CZ    1 
ATOM   4951 O OH    . TYR F 3 143 ? 29.300  0.753   72.260  1.00 9.35  ? 143  TYR D OH    1 
ATOM   4952 N N     . GLY F 3 144 ? 34.530  -1.940  73.284  1.00 8.00  ? 144  GLY D N     1 
ATOM   4953 C CA    . GLY F 3 144 ? 34.009  -3.191  73.851  1.00 9.17  ? 144  GLY D CA    1 
ATOM   4954 C C     . GLY F 3 144 ? 35.150  -4.024  74.432  1.00 9.16  ? 144  GLY D C     1 
ATOM   4955 O O     . GLY F 3 144 ? 35.059  -4.539  75.552  1.00 9.48  ? 144  GLY D O     1 
ATOM   4956 N N     . ALA F 3 145 ? 36.227  -4.160  73.662  1.00 8.87  ? 145  ALA D N     1 
ATOM   4957 C CA    . ALA F 3 145 ? 37.394  -4.920  74.110  1.00 8.48  ? 145  ALA D CA    1 
ATOM   4958 C C     . ALA F 3 145 ? 38.044  -4.276  75.351  1.00 7.80  ? 145  ALA D C     1 
ATOM   4959 O O     . ALA F 3 145 ? 38.388  -4.978  76.304  1.00 7.96  ? 145  ALA D O     1 
ATOM   4960 C CB    . ALA F 3 145 ? 38.417  -5.027  72.979  1.00 8.82  ? 145  ALA D CB    1 
ATOM   4961 N N     . PHE F 3 146 ? 38.211  -2.956  75.338  1.00 8.47  ? 146  PHE D N     1 
ATOM   4962 C CA    . PHE F 3 146 ? 38.747  -2.250  76.507  1.00 8.58  ? 146  PHE D CA    1 
ATOM   4963 C C     . PHE F 3 146 ? 37.880  -2.502  77.746  1.00 9.16  ? 146  PHE D C     1 
ATOM   4964 O O     . PHE F 3 146 ? 38.411  -2.708  78.833  1.00 8.94  ? 146  PHE D O     1 
ATOM   4965 C CB    . PHE F 3 146 ? 38.848  -0.747  76.219  1.00 8.37  ? 146  PHE D CB    1 
ATOM   4966 C CG    . PHE F 3 146 ? 40.195  -0.325  75.730  1.00 8.47  ? 146  PHE D CG    1 
ATOM   4967 C CD1   . PHE F 3 146 ? 40.624  -0.668  74.446  1.00 9.60  ? 146  PHE D CD1   1 
ATOM   4968 C CD2   . PHE F 3 146 ? 41.063  0.409   76.567  1.00 8.41  ? 146  PHE D CD2   1 
ATOM   4969 C CE1   . PHE F 3 146 ? 41.899  -0.296  73.986  1.00 10.20 ? 146  PHE D CE1   1 
ATOM   4970 C CE2   . PHE F 3 146 ? 42.334  0.781   76.133  1.00 9.24  ? 146  PHE D CE2   1 
ATOM   4971 C CZ    . PHE F 3 146 ? 42.763  0.424   74.835  1.00 10.44 ? 146  PHE D CZ    1 
ATOM   4972 N N     . LEU F 3 147 ? 36.558  -2.479  77.591  1.00 9.22  ? 147  LEU D N     1 
ATOM   4973 C CA    . LEU F 3 147 ? 35.673  -2.749  78.738  1.00 10.40 ? 147  LEU D CA    1 
ATOM   4974 C C     . LEU F 3 147 ? 35.893  -4.142  79.317  1.00 10.91 ? 147  LEU D C     1 
ATOM   4975 O O     . LEU F 3 147 ? 36.048  -4.300  80.551  1.00 11.13 ? 147  LEU D O     1 
ATOM   4976 C CB    . LEU F 3 147 ? 34.191  -2.558  78.389  1.00 10.74 ? 147  LEU D CB    1 
ATOM   4977 C CG    . LEU F 3 147 ? 33.694  -1.124  78.435  1.00 11.28 ? 147  LEU D CG    1 
ATOM   4978 C CD1   . LEU F 3 147 ? 32.346  -1.021  77.698  1.00 14.85 ? 147  LEU D CD1   1 
ATOM   4979 C CD2   . LEU F 3 147 ? 33.574  -0.584  79.878  1.00 12.92 ? 147  LEU D CD2   1 
ATOM   4980 N N     . GLU F 3 148 ? 35.879  -5.150  78.441  1.00 9.85  ? 148  GLU D N     1 
ATOM   4981 C CA    . GLU F 3 148 ? 36.099  -6.518  78.900  1.00 10.74 ? 148  GLU D CA    1 
ATOM   4982 C C     . GLU F 3 148 ? 37.461  -6.648  79.578  1.00 9.85  ? 148  GLU D C     1 
ATOM   4983 O O     . GLU F 3 148 ? 37.539  -7.188  80.679  1.00 10.18 ? 148  GLU D O     1 
ATOM   4984 C CB    . GLU F 3 148 ? 35.950  -7.539  77.767  1.00 10.53 ? 148  GLU D CB    1 
ATOM   4985 C CG    . GLU F 3 148 ? 36.077  -8.976  78.303  1.00 10.70 ? 148  GLU D CG    1 
ATOM   4986 C CD    . GLU F 3 148 ? 36.108  -10.075 77.241  1.00 11.82 ? 148  GLU D CD    1 
ATOM   4987 O OE1   . GLU F 3 148 ? 35.571  -9.883  76.142  1.00 12.66 ? 148  GLU D OE1   1 
ATOM   4988 O OE2   . GLU F 3 148 ? 36.671  -11.151 77.543  1.00 13.87 ? 148  GLU D OE2   1 
ATOM   4989 N N     . LYS F 3 149 ? 38.514  -6.132  78.940  1.00 10.16 ? 149  LYS D N     1 
ATOM   4990 C CA    . LYS F 3 149 ? 39.878  -6.187  79.521  1.00 9.92  ? 149  LYS D CA    1 
ATOM   4991 C C     . LYS F 3 149 ? 39.893  -5.596  80.917  1.00 10.35 ? 149  LYS D C     1 
ATOM   4992 O O     . LYS F 3 149 ? 40.468  -6.178  81.860  1.00 10.14 ? 149  LYS D O     1 
ATOM   4993 C CB    . LYS F 3 149 ? 40.898  -5.459  78.630  1.00 10.22 ? 149  LYS D CB    1 
ATOM   4994 C CG    . LYS F 3 149 ? 42.376  -5.542  79.119  1.00 10.32 ? 149  LYS D CG    1 
ATOM   4995 C CD    . LYS F 3 149 ? 42.828  -7.013  79.185  1.00 13.27 ? 149  LYS D CD    1 
ATOM   4996 C CE    . LYS F 3 149 ? 44.302  -7.099  79.534  1.00 11.75 ? 149  LYS D CE    1 
ATOM   4997 N NZ    . LYS F 3 149 ? 44.756  -8.522  79.607  1.00 13.60 ? 149  LYS D NZ    1 
ATOM   4998 N N     . ALA F 3 150 ? 39.286  -4.426  81.044  1.00 9.86  ? 150  ALA D N     1 
ATOM   4999 C CA    . ALA F 3 150 ? 39.268  -3.707  82.315  1.00 10.13 ? 150  ALA D CA    1 
ATOM   5000 C C     . ALA F 3 150 ? 38.576  -4.518  83.401  1.00 10.43 ? 150  ALA D C     1 
ATOM   5001 O O     . ALA F 3 150 ? 39.109  -4.647  84.530  1.00 10.48 ? 150  ALA D O     1 
ATOM   5002 C CB    . ALA F 3 150 ? 38.604  -2.365  82.136  1.00 10.59 ? 150  ALA D CB    1 
ATOM   5003 N N     . VAL F 3 151 ? 37.423  -5.097  83.055  1.00 9.67  ? 151  VAL D N     1 
ATOM   5004 C CA    . VAL F 3 151 ? 36.680  -5.940  84.004  1.00 10.99 ? 151  VAL D CA    1 
ATOM   5005 C C     . VAL F 3 151 ? 37.566  -7.105  84.472  1.00 11.23 ? 151  VAL D C     1 
ATOM   5006 O O     . VAL F 3 151 ? 37.614  -7.422  85.665  1.00 11.83 ? 151  VAL D O     1 
ATOM   5007 C CB    . VAL F 3 151 ? 35.337  -6.438  83.432  1.00 11.41 ? 151  VAL D CB    1 
ATOM   5008 C CG1   . VAL F 3 151 ? 34.772  -7.605  84.301  1.00 12.43 ? 151  VAL D CG1   1 
ATOM   5009 C CG2   . VAL F 3 151 ? 34.345  -5.255  83.296  1.00 10.40 ? 151  VAL D CG2   1 
ATOM   5010 N N     . ARG F 3 152 ? 38.287  -7.724  83.536  1.00 10.92 ? 152  ARG D N     1 
ATOM   5011 C CA    . ARG F 3 152 ? 39.158  -8.848  83.865  1.00 11.74 ? 152  ARG D CA    1 
ATOM   5012 C C     . ARG F 3 152 ? 40.342  -8.434  84.730  1.00 12.40 ? 152  ARG D C     1 
ATOM   5013 O O     . ARG F 3 152 ? 40.902  -9.292  85.439  1.00 13.34 ? 152  ARG D O     1 
ATOM   5014 C CB    . ARG F 3 152 ? 39.621  -9.583  82.605  1.00 10.90 ? 152  ARG D CB    1 
ATOM   5015 C CG    . ARG F 3 152 ? 38.479  -10.280 81.887  1.00 12.47 ? 152  ARG D CG    1 
ATOM   5016 C CD    . ARG F 3 152 ? 38.957  -11.104 80.707  1.00 14.53 ? 152  ARG D CD    1 
ATOM   5017 N NE    . ARG F 3 152 ? 37.826  -11.776 80.057  1.00 15.48 ? 152  ARG D NE    1 
ATOM   5018 C CZ    . ARG F 3 152 ? 37.257  -12.910 80.474  1.00 18.27 ? 152  ARG D CZ    1 
ATOM   5019 N NH1   . ARG F 3 152 ? 37.704  -13.553 81.553  1.00 18.20 ? 152  ARG D NH1   1 
ATOM   5020 N NH2   . ARG F 3 152 ? 36.234  -13.419 79.795  1.00 17.08 ? 152  ARG D NH2   1 
ATOM   5021 N N     . LEU F 3 153 ? 40.712  -7.144  84.667  1.00 11.73 ? 153  LEU D N     1 
ATOM   5022 C CA    . LEU F 3 153 ? 41.826  -6.580  85.458  1.00 12.23 ? 153  LEU D CA    1 
ATOM   5023 C C     . LEU F 3 153 ? 41.432  -6.006  86.815  1.00 12.64 ? 153  LEU D C     1 
ATOM   5024 O O     . LEU F 3 153 ? 42.295  -5.477  87.538  1.00 14.19 ? 153  LEU D O     1 
ATOM   5025 C CB    . LEU F 3 153 ? 42.591  -5.519  84.681  1.00 12.76 ? 153  LEU D CB    1 
ATOM   5026 C CG    . LEU F 3 153 ? 43.357  -6.007  83.447  1.00 13.87 ? 153  LEU D CG    1 
ATOM   5027 C CD1   . LEU F 3 153 ? 44.075  -4.862  82.801  1.00 13.10 ? 153  LEU D CD1   1 
ATOM   5028 C CD2   . LEU F 3 153 ? 44.332  -7.111  83.825  1.00 15.87 ? 153  LEU D CD2   1 
ATOM   5029 N N     . LEU F 3 154 ? 40.150  -6.072  87.154  1.00 12.43 ? 154  LEU D N     1 
ATOM   5030 C CA    . LEU F 3 154 ? 39.691  -5.604  88.456  1.00 12.48 ? 154  LEU D CA    1 
ATOM   5031 C C     . LEU F 3 154 ? 39.817  -6.678  89.531  1.00 12.37 ? 154  LEU D C     1 
ATOM   5032 O O     . LEU F 3 154 ? 39.508  -7.854  89.302  1.00 13.04 ? 154  LEU D O     1 
ATOM   5033 C CB    . LEU F 3 154 ? 38.227  -5.158  88.391  1.00 12.44 ? 154  LEU D CB    1 
ATOM   5034 C CG    . LEU F 3 154 ? 37.934  -3.881  87.606  1.00 12.10 ? 154  LEU D CG    1 
ATOM   5035 C CD1   . LEU F 3 154 ? 36.425  -3.680  87.450  1.00 14.76 ? 154  LEU D CD1   1 
ATOM   5036 C CD2   . LEU F 3 154 ? 38.588  -2.644  88.287  1.00 12.98 ? 154  LEU D CD2   1 
ATOM   5037 N N     . LYS F 3 155 ? 40.244  -6.239  90.712  1.00 13.23 ? 155  LYS D N     1 
ATOM   5038 C CA    . LYS F 3 155 ? 40.077  -7.023  91.933  1.00 14.46 ? 155  LYS D CA    1 
ATOM   5039 C C     . LYS F 3 155 ? 38.586  -7.236  92.248  1.00 14.98 ? 155  LYS D C     1 
ATOM   5040 O O     . LYS F 3 155 ? 37.721  -6.443  91.821  1.00 14.09 ? 155  LYS D O     1 
ATOM   5041 C CB    . LYS F 3 155 ? 40.759  -6.307  93.102  1.00 14.73 ? 155  LYS D CB    1 
ATOM   5042 C CG    . LYS F 3 155 ? 42.261  -6.308  92.964  1.00 18.38 ? 155  LYS D CG    1 
ATOM   5043 C CD    . LYS F 3 155 ? 42.975  -5.558  94.076  1.00 19.38 ? 155  LYS D CD    1 
ATOM   5044 C CE    . LYS F 3 155 ? 44.457  -5.923  94.030  1.00 22.04 ? 155  LYS D CE    1 
ATOM   5045 N NZ    . LYS F 3 155 ? 45.155  -5.675  95.323  1.00 24.19 ? 155  LYS D NZ    1 
ATOM   5046 N N     . PRO F 3 156 ? 38.264  -8.298  93.017  1.00 16.24 ? 156  PRO D N     1 
ATOM   5047 C CA    . PRO F 3 156 ? 36.895  -8.380  93.528  1.00 16.79 ? 156  PRO D CA    1 
ATOM   5048 C C     . PRO F 3 156 ? 36.565  -7.096  94.279  1.00 16.68 ? 156  PRO D C     1 
ATOM   5049 O O     . PRO F 3 156 ? 37.406  -6.580  95.033  1.00 17.73 ? 156  PRO D O     1 
ATOM   5050 C CB    . PRO F 3 156 ? 36.955  -9.572  94.496  1.00 17.76 ? 156  PRO D CB    1 
ATOM   5051 C CG    . PRO F 3 156 ? 38.044  -10.431 93.933  1.00 16.74 ? 156  PRO D CG    1 
ATOM   5052 C CD    . PRO F 3 156 ? 39.086  -9.435  93.481  1.00 16.35 ? 156  PRO D CD    1 
ATOM   5053 N N     . GLY F 3 157 ? 35.378  -6.544  94.018  1.00 16.10 ? 157  GLY D N     1 
ATOM   5054 C CA    . GLY F 3 157 ? 34.941  -5.289  94.611  1.00 14.99 ? 157  GLY D CA    1 
ATOM   5055 C C     . GLY F 3 157 ? 35.488  -4.033  93.932  1.00 13.93 ? 157  GLY D C     1 
ATOM   5056 O O     . GLY F 3 157 ? 35.067  -2.908  94.249  1.00 14.60 ? 157  GLY D O     1 
ATOM   5057 N N     . GLY F 3 158 ? 36.412  -4.223  92.988  1.00 13.51 ? 158  GLY D N     1 
ATOM   5058 C CA    . GLY F 3 158 ? 37.022  -3.120  92.244  1.00 12.14 ? 158  GLY D CA    1 
ATOM   5059 C C     . GLY F 3 158 ? 36.025  -2.371  91.365  1.00 11.64 ? 158  GLY D C     1 
ATOM   5060 O O     . GLY F 3 158 ? 34.937  -2.868  91.095  1.00 12.11 ? 158  GLY D O     1 
ATOM   5061 N N     . VAL F 3 159 ? 36.415  -1.184  90.917  1.00 11.21 ? 159  VAL D N     1 
ATOM   5062 C CA    . VAL F 3 159 ? 35.497  -0.263  90.217  1.00 11.30 ? 159  VAL D CA    1 
ATOM   5063 C C     . VAL F 3 159 ? 36.134  0.199   88.913  1.00 11.39 ? 159  VAL D C     1 
ATOM   5064 O O     . VAL F 3 159 ? 37.328  0.464   88.881  1.00 10.53 ? 159  VAL D O     1 
ATOM   5065 C CB    . VAL F 3 159 ? 35.151  0.959   91.105  1.00 12.46 ? 159  VAL D CB    1 
ATOM   5066 C CG1   . VAL F 3 159 ? 34.367  2.014   90.313  1.00 12.00 ? 159  VAL D CG1   1 
ATOM   5067 C CG2   . VAL F 3 159 ? 34.366  0.521   92.343  1.00 13.61 ? 159  VAL D CG2   1 
ATOM   5068 N N     . LEU F 3 160 ? 35.328  0.268   87.843  1.00 10.92 ? 160  LEU D N     1 
ATOM   5069 C CA    . LEU F 3 160 ? 35.764  0.836   86.567  1.00 10.66 ? 160  LEU D CA    1 
ATOM   5070 C C     . LEU F 3 160 ? 34.812  1.993   86.273  1.00 9.41  ? 160  LEU D C     1 
ATOM   5071 O O     . LEU F 3 160 ? 33.620  1.897   86.566  1.00 8.66  ? 160  LEU D O     1 
ATOM   5072 C CB    . LEU F 3 160 ? 35.711  -0.255  85.488  1.00 12.34 ? 160  LEU D CB    1 
ATOM   5073 C CG    . LEU F 3 160 ? 35.237  -0.200  84.040  1.00 14.97 ? 160  LEU D CG    1 
ATOM   5074 C CD1   . LEU F 3 160 ? 35.349  -1.630  83.481  1.00 16.69 ? 160  LEU D CD1   1 
ATOM   5075 C CD2   . LEU F 3 160 ? 33.839  0.342   83.815  1.00 15.66 ? 160  LEU D CD2   1 
ATOM   5076 N N     . VAL F 3 161 ? 35.357  3.077   85.729  1.00 8.81  ? 161  VAL D N     1 
ATOM   5077 C CA    . VAL F 3 161 ? 34.562  4.241   85.311  1.00 8.81  ? 161  VAL D CA    1 
ATOM   5078 C C     . VAL F 3 161 ? 35.120  4.650   83.939  1.00 8.30  ? 161  VAL D C     1 
ATOM   5079 O O     . VAL F 3 161 ? 36.228  5.186   83.849  1.00 7.03  ? 161  VAL D O     1 
ATOM   5080 C CB    . VAL F 3 161 ? 34.658  5.431   86.296  1.00 9.65  ? 161  VAL D CB    1 
ATOM   5081 C CG1   . VAL F 3 161 ? 33.714  6.581   85.865  1.00 10.18 ? 161  VAL D CG1   1 
ATOM   5082 C CG2   . VAL F 3 161 ? 34.357  4.985   87.754  1.00 10.14 ? 161  VAL D CG2   1 
ATOM   5083 N N     . PHE F 3 162 ? 34.376  4.347   82.877  1.00 8.33  ? 162  PHE D N     1 
ATOM   5084 C CA    . PHE F 3 162 ? 34.809  4.679   81.506  1.00 8.06  ? 162  PHE D CA    1 
ATOM   5085 C C     . PHE F 3 162 ? 33.753  5.549   80.874  1.00 7.62  ? 162  PHE D C     1 
ATOM   5086 O O     . PHE F 3 162 ? 32.570  5.432   81.227  1.00 8.45  ? 162  PHE D O     1 
ATOM   5087 C CB    . PHE F 3 162 ? 34.843  3.416   80.648  1.00 9.38  ? 162  PHE D CB    1 
ATOM   5088 C CG    . PHE F 3 162 ? 36.155  2.681   80.637  1.00 9.00  ? 162  PHE D CG    1 
ATOM   5089 C CD1   . PHE F 3 162 ? 37.232  3.052   81.454  1.00 12.22 ? 162  PHE D CD1   1 
ATOM   5090 C CD2   . PHE F 3 162 ? 36.288  1.556   79.819  1.00 12.37 ? 162  PHE D CD2   1 
ATOM   5091 C CE1   . PHE F 3 162 ? 38.448  2.322   81.417  1.00 12.30 ? 162  PHE D CE1   1 
ATOM   5092 C CE2   . PHE F 3 162 ? 37.489  0.809   79.788  1.00 14.60 ? 162  PHE D CE2   1 
ATOM   5093 C CZ    . PHE F 3 162 ? 38.566  1.192   80.584  1.00 12.35 ? 162  PHE D CZ    1 
ATOM   5094 N N     . VAL F 3 163 ? 34.172  6.421   79.963  1.00 6.72  ? 163  VAL D N     1 
ATOM   5095 C CA    . VAL F 3 163 ? 33.229  7.097   79.050  1.00 6.30  ? 163  VAL D CA    1 
ATOM   5096 C C     . VAL F 3 163 ? 33.336  6.430   77.660  1.00 6.87  ? 163  VAL D C     1 
ATOM   5097 O O     . VAL F 3 163 ? 34.438  6.301   77.099  1.00 6.61  ? 163  VAL D O     1 
ATOM   5098 C CB    . VAL F 3 163 ? 33.441  8.638   78.978  1.00 7.36  ? 163  VAL D CB    1 
ATOM   5099 C CG1   . VAL F 3 163 ? 34.893  9.060   78.605  1.00 5.94  ? 163  VAL D CG1   1 
ATOM   5100 C CG2   . VAL F 3 163 ? 32.413  9.267   78.052  1.00 6.53  ? 163  VAL D CG2   1 
ATOM   5101 N N     . VAL F 3 164 ? 32.186  6.003   77.127  1.00 6.35  ? 164  VAL D N     1 
ATOM   5102 C CA    . VAL F 3 164 ? 32.152  5.205   75.898  1.00 7.20  ? 164  VAL D CA    1 
ATOM   5103 C C     . VAL F 3 164 ? 30.909  5.604   75.091  1.00 7.80  ? 164  VAL D C     1 
ATOM   5104 O O     . VAL F 3 164 ? 29.985  6.271   75.630  1.00 8.15  ? 164  VAL D O     1 
ATOM   5105 C CB    . VAL F 3 164 ? 32.093  3.669   76.174  1.00 7.02  ? 164  VAL D CB    1 
ATOM   5106 C CG1   . VAL F 3 164 ? 33.375  3.158   76.831  1.00 6.05  ? 164  VAL D CG1   1 
ATOM   5107 C CG2   . VAL F 3 164 ? 30.873  3.287   77.047  1.00 7.48  ? 164  VAL D CG2   1 
ATOM   5108 N N     . PRO F 3 165 ? 30.863  5.214   73.807  1.00 8.10  ? 165  PRO D N     1 
ATOM   5109 C CA    . PRO F 3 165 ? 29.608  5.408   73.074  1.00 8.11  ? 165  PRO D CA    1 
ATOM   5110 C C     . PRO F 3 165 ? 28.437  4.687   73.744  1.00 7.80  ? 165  PRO D C     1 
ATOM   5111 O O     . PRO F 3 165 ? 28.633  3.685   74.464  1.00 6.87  ? 165  PRO D O     1 
ATOM   5112 C CB    . PRO F 3 165 ? 29.893  4.769   71.698  1.00 8.48  ? 165  PRO D CB    1 
ATOM   5113 C CG    . PRO F 3 165 ? 31.383  4.920   71.521  1.00 9.70  ? 165  PRO D CG    1 
ATOM   5114 C CD    . PRO F 3 165 ? 31.922  4.642   72.939  1.00 8.38  ? 165  PRO D CD    1 
ATOM   5115 N N     . ALA F 3 166 ? 27.235  5.207   73.508  1.00 7.09  ? 166  ALA D N     1 
ATOM   5116 C CA    . ALA F 3 166 ? 25.996  4.625   74.021  1.00 7.04  ? 166  ALA D CA    1 
ATOM   5117 C C     . ALA F 3 166 ? 25.568  3.372   73.248  1.00 7.48  ? 166  ALA D C     1 
ATOM   5118 O O     . ALA F 3 166 ? 24.602  2.706   73.613  1.00 8.60  ? 166  ALA D O     1 
ATOM   5119 C CB    . ALA F 3 166 ? 24.872  5.671   73.942  1.00 7.46  ? 166  ALA D CB    1 
ATOM   5120 N N     . THR F 3 167 ? 26.281  3.041   72.173  1.00 7.66  ? 167  THR D N     1 
ATOM   5121 C CA    . THR F 3 167 ? 25.773  2.013   71.255  1.00 7.61  ? 167  THR D CA    1 
ATOM   5122 C C     . THR F 3 167 ? 25.599  0.625   71.872  1.00 7.44  ? 167  THR D C     1 
ATOM   5123 O O     . THR F 3 167 ? 24.687  -0.112  71.507  1.00 8.14  ? 167  THR D O     1 
ATOM   5124 C CB    . THR F 3 167 ? 26.544  1.983   69.920  1.00 7.85  ? 167  THR D CB    1 
ATOM   5125 O OG1   . THR F 3 167 ? 27.799  1.339   70.117  1.00 7.68  ? 167  THR D OG1   1 
ATOM   5126 C CG2   . THR F 3 167 ? 26.708  3.401   69.390  1.00 7.07  ? 167  THR D CG2   1 
ATOM   5127 N N     . TRP F 3 168 ? 26.439  0.299   72.851  1.00 7.77  ? 168  TRP D N     1 
ATOM   5128 C CA    . TRP F 3 168 ? 26.392  -1.017  73.492  1.00 8.03  ? 168  TRP D CA    1 
ATOM   5129 C C     . TRP F 3 168 ? 25.102  -1.228  74.303  1.00 7.45  ? 168  TRP D C     1 
ATOM   5130 O O     . TRP F 3 168 ? 24.756  -2.357  74.642  1.00 7.85  ? 168  TRP D O     1 
ATOM   5131 C CB    . TRP F 3 168 ? 27.631  -1.223  74.362  1.00 8.97  ? 168  TRP D CB    1 
ATOM   5132 C CG    . TRP F 3 168 ? 27.671  -0.357  75.567  1.00 8.35  ? 168  TRP D CG    1 
ATOM   5133 C CD1   . TRP F 3 168 ? 28.156  0.924   75.657  1.00 8.29  ? 168  TRP D CD1   1 
ATOM   5134 C CD2   . TRP F 3 168 ? 27.177  -0.695  76.871  1.00 9.66  ? 168  TRP D CD2   1 
ATOM   5135 N NE1   . TRP F 3 168 ? 27.998  1.399   76.945  1.00 9.48  ? 168  TRP D NE1   1 
ATOM   5136 C CE2   . TRP F 3 168 ? 27.413  0.425   77.712  1.00 11.34 ? 168  TRP D CE2   1 
ATOM   5137 C CE3   . TRP F 3 168 ? 26.577  -1.844  77.412  1.00 9.52  ? 168  TRP D CE3   1 
ATOM   5138 C CZ2   . TRP F 3 168 ? 27.050  0.435   79.068  1.00 10.97 ? 168  TRP D CZ2   1 
ATOM   5139 C CZ3   . TRP F 3 168 ? 26.222  -1.848  78.773  1.00 10.85 ? 168  TRP D CZ3   1 
ATOM   5140 C CH2   . TRP F 3 168 ? 26.476  -0.714  79.587  1.00 9.35  ? 168  TRP D CH2   1 
ATOM   5141 N N     . LEU F 3 169 ? 24.400  -0.138  74.604  1.00 7.35  ? 169  LEU D N     1 
ATOM   5142 C CA    . LEU F 3 169 ? 23.110  -0.263  75.321  1.00 7.16  ? 169  LEU D CA    1 
ATOM   5143 C C     . LEU F 3 169 ? 22.088  -1.079  74.528  1.00 8.34  ? 169  LEU D C     1 
ATOM   5144 O O     . LEU F 3 169 ? 21.251  -1.769  75.112  1.00 8.95  ? 169  LEU D O     1 
ATOM   5145 C CB    . LEU F 3 169 ? 22.514  1.110   75.621  1.00 7.14  ? 169  LEU D CB    1 
ATOM   5146 C CG    . LEU F 3 169 ? 23.000  1.738   76.922  1.00 7.65  ? 169  LEU D CG    1 
ATOM   5147 C CD1   . LEU F 3 169 ? 24.486  1.987   76.951  1.00 9.92  ? 169  LEU D CD1   1 
ATOM   5148 C CD2   . LEU F 3 169 ? 22.245  3.055   77.125  1.00 8.74  ? 169  LEU D CD2   1 
ATOM   5149 N N     . VAL F 3 170 ? 22.169  -0.975  73.202  1.00 8.49  ? 170  VAL D N     1 
ATOM   5150 C CA    . VAL F 3 170 ? 21.110  -1.498  72.343  1.00 8.41  ? 170  VAL D CA    1 
ATOM   5151 C C     . VAL F 3 170 ? 21.577  -2.458  71.237  1.00 9.16  ? 170  VAL D C     1 
ATOM   5152 O O     . VAL F 3 170 ? 20.784  -3.280  70.780  1.00 9.43  ? 170  VAL D O     1 
ATOM   5153 C CB    . VAL F 3 170 ? 20.269  -0.348  71.714  1.00 8.60  ? 170  VAL D CB    1 
ATOM   5154 C CG1   . VAL F 3 170 ? 19.459  0.377   72.797  1.00 10.67 ? 170  VAL D CG1   1 
ATOM   5155 C CG2   . VAL F 3 170 ? 21.152  0.633   70.903  1.00 7.71  ? 170  VAL D CG2   1 
ATOM   5156 N N     . LEU F 3 171 ? 22.833  -2.339  70.802  1.00 8.31  ? 171  LEU D N     1 
ATOM   5157 C CA    . LEU F 3 171 ? 23.260  -3.052  69.591  1.00 8.70  ? 171  LEU D CA    1 
ATOM   5158 C C     . LEU F 3 171 ? 23.539  -4.549  69.805  1.00 9.24  ? 171  LEU D C     1 
ATOM   5159 O O     . LEU F 3 171 ? 24.055  -4.972  70.842  1.00 9.00  ? 171  LEU D O     1 
ATOM   5160 C CB    . LEU F 3 171 ? 24.447  -2.335  68.912  1.00 8.12  ? 171  LEU D CB    1 
ATOM   5161 C CG    . LEU F 3 171 ? 24.197  -0.950  68.310  1.00 6.63  ? 171  LEU D CG    1 
ATOM   5162 C CD1   . LEU F 3 171 ? 25.416  -0.479  67.562  1.00 8.59  ? 171  LEU D CD1   1 
ATOM   5163 C CD2   . LEU F 3 171 ? 22.937  -0.873  67.381  1.00 8.01  ? 171  LEU D CD2   1 
ATOM   5164 N N     . GLU F 3 172 ? 23.194  -5.362  68.806  1.00 9.16  ? 172  GLU D N     1 
ATOM   5165 C CA    . GLU F 3 172 ? 23.492  -6.792  68.861  1.00 10.39 ? 172  GLU D CA    1 
ATOM   5166 C C     . GLU F 3 172 ? 24.966  -7.139  68.994  1.00 9.76  ? 172  GLU D C     1 
ATOM   5167 O O     . GLU F 3 172 ? 25.307  -8.139  69.644  1.00 10.33 ? 172  GLU D O     1 
ATOM   5168 C CB    . GLU F 3 172 ? 22.918  -7.508  67.631  1.00 10.84 ? 172  GLU D CB    1 
ATOM   5169 C CG    . GLU F 3 172 ? 21.436  -7.763  67.757  1.00 14.49 ? 172  GLU D CG    1 
ATOM   5170 C CD    . GLU F 3 172 ? 21.084  -8.756  68.870  1.00 19.85 ? 172  GLU D CD    1 
ATOM   5171 O OE1   . GLU F 3 172 ? 19.900  -8.825  69.203  1.00 23.13 ? 172  GLU D OE1   1 
ATOM   5172 O OE2   . GLU F 3 172 ? 21.967  -9.476  69.425  1.00 24.31 ? 172  GLU D OE2   1 
ATOM   5173 N N     . ASP F 3 173 ? 25.853  -6.354  68.368  1.00 9.61  ? 173  ASP D N     1 
ATOM   5174 C CA    . ASP F 3 173 ? 27.285  -6.602  68.518  1.00 10.13 ? 173  ASP D CA    1 
ATOM   5175 C C     . ASP F 3 173 ? 27.723  -6.617  69.977  1.00 9.39  ? 173  ASP D C     1 
ATOM   5176 O O     . ASP F 3 173 ? 28.742  -7.225  70.305  1.00 9.28  ? 173  ASP D O     1 
ATOM   5177 C CB    . ASP F 3 173 ? 28.156  -5.595  67.749  1.00 11.14 ? 173  ASP D CB    1 
ATOM   5178 C CG    . ASP F 3 173 ? 28.538  -6.092  66.359  1.00 14.49 ? 173  ASP D CG    1 
ATOM   5179 O OD1   . ASP F 3 173 ? 27.875  -7.042  65.839  1.00 16.61 ? 173  ASP D OD1   1 
ATOM   5180 O OD2   . ASP F 3 173 ? 29.489  -5.524  65.780  1.00 13.33 ? 173  ASP D OD2   1 
ATOM   5181 N N     . PHE F 3 174 ? 26.964  -5.964  70.849  1.00 8.76  ? 174  PHE D N     1 
ATOM   5182 C CA    . PHE F 3 174 ? 27.373  -5.855  72.260  1.00 8.30  ? 174  PHE D CA    1 
ATOM   5183 C C     . PHE F 3 174 ? 26.546  -6.742  73.194  1.00 9.06  ? 174  PHE D C     1 
ATOM   5184 O O     . PHE F 3 174 ? 26.613  -6.587  74.422  1.00 7.77  ? 174  PHE D O     1 
ATOM   5185 C CB    . PHE F 3 174 ? 27.381  -4.370  72.685  1.00 8.96  ? 174  PHE D CB    1 
ATOM   5186 C CG    . PHE F 3 174 ? 28.340  -3.544  71.880  1.00 7.47  ? 174  PHE D CG    1 
ATOM   5187 C CD1   . PHE F 3 174 ? 29.704  -3.533  72.199  1.00 9.83  ? 174  PHE D CD1   1 
ATOM   5188 C CD2   . PHE F 3 174 ? 27.896  -2.793  70.797  1.00 7.47  ? 174  PHE D CD2   1 
ATOM   5189 C CE1   . PHE F 3 174 ? 30.615  -2.792  71.437  1.00 9.34  ? 174  PHE D CE1   1 
ATOM   5190 C CE2   . PHE F 3 174 ? 28.806  -2.042  70.012  1.00 8.90  ? 174  PHE D CE2   1 
ATOM   5191 C CZ    . PHE F 3 174 ? 30.167  -2.029  70.361  1.00 8.91  ? 174  PHE D CZ    1 
ATOM   5192 N N     . ALA F 3 175 ? 25.801  -7.699  72.615  1.00 8.28  ? 175  ALA D N     1 
ATOM   5193 C CA    . ALA F 3 175 ? 24.958  -8.586  73.422  1.00 9.20  ? 175  ALA D CA    1 
ATOM   5194 C C     . ALA F 3 175 ? 25.782  -9.427  74.401  1.00 9.29  ? 175  ALA D C     1 
ATOM   5195 O O     . ALA F 3 175 ? 25.380  -9.610  75.555  1.00 10.24 ? 175  ALA D O     1 
ATOM   5196 C CB    . ALA F 3 175 ? 24.064  -9.472  72.529  1.00 9.02  ? 175  ALA D CB    1 
ATOM   5197 N N     . LEU F 3 176 ? 26.949  -9.913  73.963  1.00 9.30  ? 176  LEU D N     1 
ATOM   5198 C CA    . LEU F 3 176 ? 27.786  -10.729 74.850  1.00 9.30  ? 176  LEU D CA    1 
ATOM   5199 C C     . LEU F 3 176 ? 28.428  -9.847  75.912  1.00 8.96  ? 176  LEU D C     1 
ATOM   5200 O O     . LEU F 3 176 ? 28.552  -10.259 77.065  1.00 9.86  ? 176  LEU D O     1 
ATOM   5201 C CB    . LEU F 3 176 ? 28.858  -11.511 74.081  1.00 9.13  ? 176  LEU D CB    1 
ATOM   5202 C CG    . LEU F 3 176 ? 28.348  -12.552 73.076  1.00 11.80 ? 176  LEU D CG    1 
ATOM   5203 C CD1   . LEU F 3 176 ? 29.524  -13.209 72.350  1.00 14.08 ? 176  LEU D CD1   1 
ATOM   5204 C CD2   . LEU F 3 176 ? 27.479  -13.577 73.765  1.00 12.58 ? 176  LEU D CD2   1 
ATOM   5205 N N     . LEU F 3 177 ? 28.809  -8.631  75.527  1.00 8.50  ? 177  LEU D N     1 
ATOM   5206 C CA    . LEU F 3 177 ? 29.345  -7.665  76.492  1.00 8.84  ? 177  LEU D CA    1 
ATOM   5207 C C     . LEU F 3 177 ? 28.325  -7.353  77.609  1.00 8.35  ? 177  LEU D C     1 
ATOM   5208 O O     . LEU F 3 177 ? 28.683  -7.372  78.789  1.00 8.51  ? 177  LEU D O     1 
ATOM   5209 C CB    . LEU F 3 177 ? 29.827  -6.391  75.784  1.00 9.61  ? 177  LEU D CB    1 
ATOM   5210 C CG    . LEU F 3 177 ? 30.331  -5.261  76.701  1.00 9.03  ? 177  LEU D CG    1 
ATOM   5211 C CD1   . LEU F 3 177 ? 31.578  -5.680  77.464  1.00 9.56  ? 177  LEU D CD1   1 
ATOM   5212 C CD2   . LEU F 3 177 ? 30.597  -3.986  75.887  1.00 9.62  ? 177  LEU D CD2   1 
ATOM   5213 N N     . ARG F 3 178 ? 27.073  -7.094  77.232  1.00 7.90  ? 178  ARG D N     1 
ATOM   5214 C CA    . ARG F 3 178 ? 26.025  -6.774  78.211  1.00 8.81  ? 178  ARG D CA    1 
ATOM   5215 C C     . ARG F 3 178 ? 25.841  -7.975  79.153  1.00 9.47  ? 178  ARG D C     1 
ATOM   5216 O O     . ARG F 3 178 ? 25.741  -7.803  80.366  1.00 9.83  ? 178  ARG D O     1 
ATOM   5217 C CB    . ARG F 3 178 ? 24.697  -6.431  77.521  1.00 8.95  ? 178  ARG D CB    1 
ATOM   5218 C CG    . ARG F 3 178 ? 24.634  -5.032  76.840  1.00 8.70  ? 178  ARG D CG    1 
ATOM   5219 C CD    . ARG F 3 178 ? 23.181  -4.659  76.534  1.00 8.23  ? 178  ARG D CD    1 
ATOM   5220 N NE    . ARG F 3 178 ? 22.556  -5.639  75.624  1.00 11.66 ? 178  ARG D NE    1 
ATOM   5221 C CZ    . ARG F 3 178 ? 22.689  -5.632  74.297  1.00 10.69 ? 178  ARG D CZ    1 
ATOM   5222 N NH1   . ARG F 3 178 ? 23.398  -4.684  73.688  1.00 11.58 ? 178  ARG D NH1   1 
ATOM   5223 N NH2   . ARG F 3 178 ? 22.076  -6.572  73.575  1.00 10.12 ? 178  ARG D NH2   1 
ATOM   5224 N N     . GLU F 3 179 ? 25.820  -9.182  78.591  1.00 10.38 ? 179  GLU D N     1 
ATOM   5225 C CA    . GLU F 3 179 ? 25.617  -10.398 79.398  1.00 11.27 ? 179  GLU D CA    1 
ATOM   5226 C C     . GLU F 3 179 ? 26.794  -10.638 80.355  1.00 11.11 ? 179  GLU D C     1 
ATOM   5227 O O     . GLU F 3 179 ? 26.599  -11.046 81.508  1.00 11.60 ? 179  GLU D O     1 
ATOM   5228 C CB    . GLU F 3 179 ? 25.328  -11.593 78.490  1.00 11.24 ? 179  GLU D CB    1 
ATOM   5229 C CG    . GLU F 3 179 ? 23.965  -11.481 77.796  1.00 13.28 ? 179  GLU D CG    1 
ATOM   5230 C CD    . GLU F 3 179 ? 23.811  -12.372 76.566  1.00 18.08 ? 179  GLU D CD    1 
ATOM   5231 O OE1   . GLU F 3 179 ? 24.664  -13.259 76.340  1.00 19.44 ? 179  GLU D OE1   1 
ATOM   5232 O OE2   . GLU F 3 179 ? 22.827  -12.153 75.805  1.00 20.49 ? 179  GLU D OE2   1 
ATOM   5233 N N     . PHE F 3 180 ? 27.999  -10.347 79.871  1.00 11.00 ? 180  PHE D N     1 
ATOM   5234 C CA    . PHE F 3 180 ? 29.226  -10.404 80.660  1.00 11.06 ? 180  PHE D CA    1 
ATOM   5235 C C     . PHE F 3 180 ? 29.168  -9.447  81.852  1.00 11.40 ? 180  PHE D C     1 
ATOM   5236 O O     . PHE F 3 180 ? 29.360  -9.867  83.002  1.00 11.78 ? 180  PHE D O     1 
ATOM   5237 C CB    . PHE F 3 180 ? 30.407  -10.068 79.746  1.00 10.76 ? 180  PHE D CB    1 
ATOM   5238 C CG    . PHE F 3 180 ? 31.741  -10.010 80.430  1.00 10.60 ? 180  PHE D CG    1 
ATOM   5239 C CD1   . PHE F 3 180 ? 32.446  -11.183 80.729  1.00 13.69 ? 180  PHE D CD1   1 
ATOM   5240 C CD2   . PHE F 3 180 ? 32.340  -8.766  80.707  1.00 11.31 ? 180  PHE D CD2   1 
ATOM   5241 C CE1   . PHE F 3 180 ? 33.728  -11.109 81.319  1.00 12.65 ? 180  PHE D CE1   1 
ATOM   5242 C CE2   . PHE F 3 180 ? 33.615  -8.706  81.296  1.00 12.59 ? 180  PHE D CE2   1 
ATOM   5243 C CZ    . PHE F 3 180 ? 34.287  -9.875  81.598  1.00 11.44 ? 180  PHE D CZ    1 
ATOM   5244 N N     . LEU F 3 181 ? 28.887  -8.167  81.596  1.00 11.09 ? 181  LEU D N     1 
ATOM   5245 C CA    . LEU F 3 181 ? 28.773  -7.185  82.671  1.00 10.79 ? 181  LEU D CA    1 
ATOM   5246 C C     . LEU F 3 181 ? 27.731  -7.633  83.698  1.00 11.75 ? 181  LEU D C     1 
ATOM   5247 O O     . LEU F 3 181 ? 27.956  -7.518  84.910  1.00 12.02 ? 181  LEU D O     1 
ATOM   5248 C CB    . LEU F 3 181 ? 28.403  -5.807  82.101  1.00 11.06 ? 181  LEU D CB    1 
ATOM   5249 C CG    . LEU F 3 181 ? 29.465  -5.197  81.177  1.00 9.35  ? 181  LEU D CG    1 
ATOM   5250 C CD1   . LEU F 3 181 ? 28.827  -3.999  80.418  1.00 10.56 ? 181  LEU D CD1   1 
ATOM   5251 C CD2   . LEU F 3 181 ? 30.661  -4.718  81.981  1.00 13.34 ? 181  LEU D CD2   1 
ATOM   5252 N N     . ALA F 3 182 ? 26.612  -8.147  83.192  1.00 11.92 ? 182  ALA D N     1 
ATOM   5253 C CA    . ALA F 3 182 ? 25.484  -8.561  84.048  1.00 12.30 ? 182  ALA D CA    1 
ATOM   5254 C C     . ALA F 3 182 ? 25.909  -9.660  84.995  1.00 13.24 ? 182  ALA D C     1 
ATOM   5255 O O     . ALA F 3 182 ? 25.491  -9.674  86.157  1.00 13.65 ? 182  ALA D O     1 
ATOM   5256 C CB    . ALA F 3 182 ? 24.275  -9.009  83.209  1.00 11.61 ? 182  ALA D CB    1 
ATOM   5257 N N     . ARG F 3 183 ? 26.739  -10.582 84.515  1.00 13.17 ? 183  ARG D N     1 
ATOM   5258 C CA    . ARG F 3 183 ? 27.134  -11.715 85.378  1.00 14.13 ? 183  ARG D CA    1 
ATOM   5259 C C     . ARG F 3 183 ? 28.365  -11.442 86.244  1.00 14.18 ? 183  ARG D C     1 
ATOM   5260 O O     . ARG F 3 183 ? 28.590  -12.159 87.222  1.00 14.51 ? 183  ARG D O     1 
ATOM   5261 C CB    . ARG F 3 183 ? 27.297  -12.993 84.562  1.00 14.52 ? 183  ARG D CB    1 
ATOM   5262 C CG    . ARG F 3 183 ? 28.611  -13.147 83.850  1.00 17.16 ? 183  ARG D CG    1 
ATOM   5263 C CD    . ARG F 3 183 ? 28.704  -14.524 83.202  1.00 19.91 ? 183  ARG D CD    1 
ATOM   5264 N NE    . ARG F 3 183 ? 27.698  -14.663 82.161  1.00 22.66 ? 183  ARG D NE    1 
ATOM   5265 C CZ    . ARG F 3 183 ? 27.909  -14.406 80.871  1.00 22.63 ? 183  ARG D CZ    1 
ATOM   5266 N NH1   . ARG F 3 183 ? 29.111  -14.029 80.442  1.00 21.91 ? 183  ARG D NH1   1 
ATOM   5267 N NH2   . ARG F 3 183 ? 26.910  -14.548 80.014  1.00 23.89 ? 183  ARG D NH2   1 
ATOM   5268 N N     . GLU F 3 184 ? 29.138  -10.404 85.906  1.00 12.81 ? 184  GLU D N     1 
ATOM   5269 C CA    . GLU F 3 184 ? 30.435  -10.141 86.562  1.00 12.80 ? 184  GLU D CA    1 
ATOM   5270 C C     . GLU F 3 184 ? 30.356  -9.152  87.718  1.00 12.13 ? 184  GLU D C     1 
ATOM   5271 O O     . GLU F 3 184 ? 31.262  -9.088  88.557  1.00 13.38 ? 184  GLU D O     1 
ATOM   5272 C CB    . GLU F 3 184 ? 31.478  -9.672  85.547  1.00 12.85 ? 184  GLU D CB    1 
ATOM   5273 C CG    . GLU F 3 184 ? 31.899  -10.743 84.545  1.00 14.44 ? 184  GLU D CG    1 
ATOM   5274 C CD    . GLU F 3 184 ? 32.760  -11.832 85.164  1.00 19.44 ? 184  GLU D CD    1 
ATOM   5275 O OE1   . GLU F 3 184 ? 33.692  -11.494 85.931  1.00 21.33 ? 184  GLU D OE1   1 
ATOM   5276 O OE2   . GLU F 3 184 ? 32.497  -13.020 84.872  1.00 23.06 ? 184  GLU D OE2   1 
ATOM   5277 N N     . GLY F 3 185 ? 29.273  -8.396  87.786  1.00 11.88 ? 185  GLY D N     1 
ATOM   5278 C CA    . GLY F 3 185 ? 29.143  -7.398  88.847  1.00 11.94 ? 185  GLY D CA    1 
ATOM   5279 C C     . GLY F 3 185 ? 27.917  -6.548  88.679  1.00 12.72 ? 185  GLY D C     1 
ATOM   5280 O O     . GLY F 3 185 ? 26.922  -6.986  88.097  1.00 12.97 ? 185  GLY D O     1 
ATOM   5281 N N     . LYS F 3 186 ? 28.002  -5.330  89.203  1.00 11.75 ? 186  LYS D N     1 
ATOM   5282 C CA    . LYS F 3 186 ? 26.881  -4.403  89.185  1.00 12.66 ? 186  LYS D CA    1 
ATOM   5283 C C     . LYS F 3 186 ? 27.227  -3.200  88.319  1.00 12.16 ? 186  LYS D C     1 
ATOM   5284 O O     . LYS F 3 186 ? 28.355  -2.670  88.363  1.00 11.98 ? 186  LYS D O     1 
ATOM   5285 C CB    . LYS F 3 186 ? 26.479  -3.981  90.606  1.00 13.66 ? 186  LYS D CB    1 
ATOM   5286 C CG    . LYS F 3 186 ? 27.515  -3.174  91.351  1.00 16.38 ? 186  LYS D CG    1 
ATOM   5287 C CD    . LYS F 3 186 ? 26.923  -2.660  92.658  1.00 22.74 ? 186  LYS D CD    1 
ATOM   5288 C CE    . LYS F 3 186 ? 26.864  -3.760  93.722  1.00 25.75 ? 186  LYS D CE    1 
ATOM   5289 N NZ    . LYS F 3 186 ? 28.197  -4.092  94.325  1.00 27.00 ? 186  LYS D NZ    1 
ATOM   5290 N N     . THR F 3 187 ? 26.255  -2.774  87.519  1.00 11.76 ? 187  THR D N     1 
ATOM   5291 C CA    . THR F 3 187 ? 26.518  -1.788  86.483  1.00 11.32 ? 187  THR D CA    1 
ATOM   5292 C C     . THR F 3 187 ? 25.644  -0.561  86.659  1.00 11.53 ? 187  THR D C     1 
ATOM   5293 O O     . THR F 3 187 ? 24.444  -0.701  86.857  1.00 11.41 ? 187  THR D O     1 
ATOM   5294 C CB    . THR F 3 187 ? 26.226  -2.412  85.100  1.00 11.51 ? 187  THR D CB    1 
ATOM   5295 O OG1   . THR F 3 187 ? 27.096  -3.535  84.915  1.00 13.03 ? 187  THR D OG1   1 
ATOM   5296 C CG2   . THR F 3 187 ? 26.431  -1.391  83.957  1.00 12.17 ? 187  THR D CG2   1 
ATOM   5297 N N     . SER F 3 188 ? 26.250  0.616   86.578  1.00 10.36 ? 188  SER D N     1 
ATOM   5298 C CA    . SER F 3 188 ? 25.495  1.873   86.499  1.00 10.40 ? 188  SER D CA    1 
ATOM   5299 C C     . SER F 3 188 ? 25.839  2.593   85.211  1.00 10.07 ? 188  SER D C     1 
ATOM   5300 O O     . SER F 3 188 ? 27.013  2.776   84.893  1.00 9.20  ? 188  SER D O     1 
ATOM   5301 C CB    . SER F 3 188 ? 25.802  2.791   87.685  1.00 12.24 ? 188  SER D CB    1 
ATOM   5302 O OG    . SER F 3 188 ? 25.314  2.194   88.875  1.00 14.32 ? 188  SER D OG    1 
ATOM   5303 N N     . VAL F 3 189 ? 24.804  2.979   84.472  1.00 8.50  ? 189  VAL D N     1 
ATOM   5304 C CA    . VAL F 3 189 ? 24.983  3.705   83.208  1.00 8.65  ? 189  VAL D CA    1 
ATOM   5305 C C     . VAL F 3 189 ? 24.436  5.123   83.368  1.00 8.18  ? 189  VAL D C     1 
ATOM   5306 O O     . VAL F 3 189 ? 23.291  5.292   83.814  1.00 9.03  ? 189  VAL D O     1 
ATOM   5307 C CB    . VAL F 3 189 ? 24.253  2.994   82.039  1.00 8.53  ? 189  VAL D CB    1 
ATOM   5308 C CG1   . VAL F 3 189 ? 24.470  3.763   80.707  1.00 9.92  ? 189  VAL D CG1   1 
ATOM   5309 C CG2   . VAL F 3 189 ? 24.728  1.550   81.907  1.00 9.37  ? 189  VAL D CG2   1 
ATOM   5310 N N     . TYR F 3 190 ? 25.249  6.126   82.985  1.00 8.66  ? 190  TYR D N     1 
ATOM   5311 C CA    . TYR F 3 190 ? 24.873  7.541   83.065  1.00 8.40  ? 190  TYR D CA    1 
ATOM   5312 C C     . TYR F 3 190 ? 24.858  8.135   81.670  1.00 8.59  ? 190  TYR D C     1 
ATOM   5313 O O     . TYR F 3 190 ? 25.904  8.217   81.020  1.00 8.69  ? 190  TYR D O     1 
ATOM   5314 C CB    . TYR F 3 190 ? 25.879  8.334   83.925  1.00 9.07  ? 190  TYR D CB    1 
ATOM   5315 C CG    . TYR F 3 190 ? 26.090  7.743   85.282  1.00 9.26  ? 190  TYR D CG    1 
ATOM   5316 C CD1   . TYR F 3 190 ? 26.974  6.657   85.465  1.00 10.09 ? 190  TYR D CD1   1 
ATOM   5317 C CD2   . TYR F 3 190 ? 25.407  8.248   86.386  1.00 9.89  ? 190  TYR D CD2   1 
ATOM   5318 C CE1   . TYR F 3 190 ? 27.178  6.108   86.721  1.00 11.59 ? 190  TYR D CE1   1 
ATOM   5319 C CE2   . TYR F 3 190 ? 25.596  7.704   87.653  1.00 10.81 ? 190  TYR D CE2   1 
ATOM   5320 C CZ    . TYR F 3 190 ? 26.485  6.645   87.817  1.00 12.93 ? 190  TYR D CZ    1 
ATOM   5321 O OH    . TYR F 3 190 ? 26.664  6.102   89.067  1.00 15.55 ? 190  TYR D OH    1 
ATOM   5322 N N     . TYR F 3 191 ? 23.671  8.517   81.195  1.00 8.49  ? 191  TYR D N     1 
ATOM   5323 C CA    . TYR F 3 191 ? 23.554  9.068   79.857  1.00 9.34  ? 191  TYR D CA    1 
ATOM   5324 C C     . TYR F 3 191 ? 24.074  10.501  79.836  1.00 9.51  ? 191  TYR D C     1 
ATOM   5325 O O     . TYR F 3 191 ? 23.599  11.338  80.623  1.00 10.55 ? 191  TYR D O     1 
ATOM   5326 C CB    . TYR F 3 191 ? 22.096  9.033   79.393  1.00 9.91  ? 191  TYR D CB    1 
ATOM   5327 C CG    . TYR F 3 191 ? 21.892  9.741   78.078  1.00 10.05 ? 191  TYR D CG    1 
ATOM   5328 C CD1   . TYR F 3 191 ? 22.195  9.100   76.860  1.00 11.22 ? 191  TYR D CD1   1 
ATOM   5329 C CD2   . TYR F 3 191 ? 21.428  11.055  78.046  1.00 10.76 ? 191  TYR D CD2   1 
ATOM   5330 C CE1   . TYR F 3 191 ? 22.030  9.771   75.643  1.00 9.72  ? 191  TYR D CE1   1 
ATOM   5331 C CE2   . TYR F 3 191 ? 21.243  11.725  76.836  1.00 12.10 ? 191  TYR D CE2   1 
ATOM   5332 C CZ    . TYR F 3 191 ? 21.546  11.073  75.648  1.00 12.07 ? 191  TYR D CZ    1 
ATOM   5333 O OH    . TYR F 3 191 ? 21.354  11.760  74.475  1.00 10.41 ? 191  TYR D OH    1 
ATOM   5334 N N     . LEU F 3 192 ? 25.032  10.774  78.940  1.00 9.46  ? 192  LEU D N     1 
ATOM   5335 C CA    . LEU F 3 192 ? 25.526  12.134  78.692  1.00 10.79 ? 192  LEU D CA    1 
ATOM   5336 C C     . LEU F 3 192 ? 25.044  12.695  77.348  1.00 11.45 ? 192  LEU D C     1 
ATOM   5337 O O     . LEU F 3 192 ? 24.706  13.871  77.271  1.00 11.89 ? 192  LEU D O     1 
ATOM   5338 C CB    . LEU F 3 192 ? 27.057  12.196  78.692  1.00 12.06 ? 192  LEU D CB    1 
ATOM   5339 C CG    . LEU F 3 192 ? 27.812  11.740  79.951  1.00 12.52 ? 192  LEU D CG    1 
ATOM   5340 C CD1   . LEU F 3 192 ? 29.316  11.801  79.714  1.00 13.92 ? 192  LEU D CD1   1 
ATOM   5341 C CD2   . LEU F 3 192 ? 27.395  12.567  81.139  1.00 16.31 ? 192  LEU D CD2   1 
ATOM   5342 N N     . GLY F 3 193 ? 25.071  11.859  76.306  1.00 11.17 ? 193  GLY D N     1 
ATOM   5343 C CA    . GLY F 3 193 ? 24.684  12.258  74.942  1.00 11.54 ? 193  GLY D CA    1 
ATOM   5344 C C     . GLY F 3 193 ? 25.876  12.827  74.181  1.00 11.74 ? 193  GLY D C     1 
ATOM   5345 O O     . GLY F 3 193 ? 27.028  12.453  74.433  1.00 10.65 ? 193  GLY D O     1 
ATOM   5346 N N     . GLU F 3 194 ? 25.606  13.727  73.247  1.00 12.08 ? 194  GLU D N     1 
ATOM   5347 C CA    . GLU F 3 194 ? 26.646  14.210  72.347  1.00 14.36 ? 194  GLU D CA    1 
ATOM   5348 C C     . GLU F 3 194 ? 27.504  15.309  72.979  1.00 15.21 ? 194  GLU D C     1 
ATOM   5349 O O     . GLU F 3 194 ? 27.370  16.493  72.653  1.00 17.03 ? 194  GLU D O     1 
ATOM   5350 C CB    . GLU F 3 194 ? 26.021  14.695  71.035  1.00 15.15 ? 194  GLU D CB    1 
ATOM   5351 C CG    . GLU F 3 194 ? 25.413  13.595  70.208  1.00 19.14 ? 194  GLU D CG    1 
ATOM   5352 C CD    . GLU F 3 194 ? 24.785  14.139  68.948  1.00 26.73 ? 194  GLU D CD    1 
ATOM   5353 O OE1   . GLU F 3 194 ? 23.901  15.023  69.058  1.00 29.60 ? 194  GLU D OE1   1 
ATOM   5354 O OE2   . GLU F 3 194 ? 25.175  13.685  67.846  1.00 30.68 ? 194  GLU D OE2   1 
ATOM   5355 N N     . VAL F 3 195 ? 28.420  14.903  73.850  1.00 15.34 ? 195  VAL D N     1 
ATOM   5356 C CA    . VAL F 3 195 ? 29.214  15.831  74.647  1.00 15.76 ? 195  VAL D CA    1 
ATOM   5357 C C     . VAL F 3 195 ? 30.610  16.169  74.078  1.00 15.42 ? 195  VAL D C     1 
ATOM   5358 O O     . VAL F 3 195 ? 31.339  16.962  74.668  1.00 15.66 ? 195  VAL D O     1 
ATOM   5359 C CB    . VAL F 3 195 ? 29.372  15.299  76.117  1.00 15.49 ? 195  VAL D CB    1 
ATOM   5360 C CG1   . VAL F 3 195 ? 28.059  15.362  76.873  1.00 17.18 ? 195  VAL D CG1   1 
ATOM   5361 C CG2   . VAL F 3 195 ? 29.972  13.882  76.127  1.00 16.68 ? 195  VAL D CG2   1 
ATOM   5362 N N     . PHE F 3 196 ? 31.007  15.552  72.959  1.00 15.05 ? 196  PHE D N     1 
ATOM   5363 C CA    . PHE F 3 196 ? 32.341  15.819  72.401  1.00 14.95 ? 196  PHE D CA    1 
ATOM   5364 C C     . PHE F 3 196 ? 32.205  16.744  71.207  1.00 15.81 ? 196  PHE D C     1 
ATOM   5365 O O     . PHE F 3 196 ? 31.587  16.355  70.212  1.00 15.79 ? 196  PHE D O     1 
ATOM   5366 C CB    . PHE F 3 196 ? 33.022  14.528  71.957  1.00 14.96 ? 196  PHE D CB    1 
ATOM   5367 C CG    . PHE F 3 196 ? 33.173  13.516  73.047  1.00 14.57 ? 196  PHE D CG    1 
ATOM   5368 C CD1   . PHE F 3 196 ? 34.176  13.663  74.003  1.00 15.24 ? 196  PHE D CD1   1 
ATOM   5369 C CD2   . PHE F 3 196 ? 32.353  12.393  73.095  1.00 15.45 ? 196  PHE D CD2   1 
ATOM   5370 C CE1   . PHE F 3 196 ? 34.343  12.711  75.030  1.00 14.63 ? 196  PHE D CE1   1 
ATOM   5371 C CE2   . PHE F 3 196 ? 32.519  11.448  74.095  1.00 16.29 ? 196  PHE D CE2   1 
ATOM   5372 C CZ    . PHE F 3 196 ? 33.517  11.622  75.075  1.00 15.18 ? 196  PHE D CZ    1 
ATOM   5373 N N     . PRO F 3 197 ? 32.773  17.967  71.300  1.00 17.05 ? 197  PRO D N     1 
ATOM   5374 C CA    . PRO F 3 197 ? 32.651  18.917  70.194  1.00 17.62 ? 197  PRO D CA    1 
ATOM   5375 C C     . PRO F 3 197 ? 33.045  18.308  68.844  1.00 18.23 ? 197  PRO D C     1 
ATOM   5376 O O     . PRO F 3 197 ? 34.077  17.633  68.736  1.00 17.26 ? 197  PRO D O     1 
ATOM   5377 C CB    . PRO F 3 197 ? 33.609  20.042  70.595  1.00 18.01 ? 197  PRO D CB    1 
ATOM   5378 C CG    . PRO F 3 197 ? 33.541  20.038  72.076  1.00 18.29 ? 197  PRO D CG    1 
ATOM   5379 C CD    . PRO F 3 197 ? 33.507  18.562  72.433  1.00 16.58 ? 197  PRO D CD    1 
ATOM   5380 N N     . GLN F 3 198 ? 32.170  18.512  67.859  1.00 18.99 ? 198  GLN D N     1 
ATOM   5381 C CA    . GLN F 3 198 ? 32.388  18.104  66.463  1.00 20.32 ? 198  GLN D CA    1 
ATOM   5382 C C     . GLN F 3 198 ? 32.486  16.585  66.211  1.00 20.53 ? 198  GLN D C     1 
ATOM   5383 O O     . GLN F 3 198 ? 32.916  16.153  65.137  1.00 21.77 ? 198  GLN D O     1 
ATOM   5384 C CB    . GLN F 3 198 ? 33.570  18.873  65.831  1.00 21.09 ? 198  GLN D CB    1 
ATOM   5385 C CG    . GLN F 3 198 ? 33.255  20.350  65.470  1.00 21.90 ? 198  GLN D CG    1 
ATOM   5386 C CD    . GLN F 3 198 ? 32.288  20.511  64.293  1.00 26.30 ? 198  GLN D CD    1 
ATOM   5387 O OE1   . GLN F 3 198 ? 31.735  21.594  64.077  1.00 27.49 ? 198  GLN D OE1   1 
ATOM   5388 N NE2   . GLN F 3 198 ? 32.079  19.435  63.530  1.00 26.38 ? 198  GLN D NE2   1 
ATOM   5389 N N     . LYS F 3 199 ? 32.073  15.781  67.189  1.00 20.07 ? 199  LYS D N     1 
ATOM   5390 C CA    . LYS F 3 199 ? 31.936  14.332  66.988  1.00 19.74 ? 199  LYS D CA    1 
ATOM   5391 C C     . LYS F 3 199 ? 30.481  13.929  67.092  1.00 19.03 ? 199  LYS D C     1 
ATOM   5392 O O     . LYS F 3 199 ? 29.741  14.465  67.924  1.00 19.71 ? 199  LYS D O     1 
ATOM   5393 C CB    . LYS F 3 199 ? 32.712  13.541  68.037  1.00 20.00 ? 199  LYS D CB    1 
ATOM   5394 C CG    . LYS F 3 199 ? 34.162  13.877  68.140  1.00 20.90 ? 199  LYS D CG    1 
ATOM   5395 C CD    . LYS F 3 199 ? 34.801  12.884  69.064  1.00 23.95 ? 199  LYS D CD    1 
ATOM   5396 C CE    . LYS F 3 199 ? 36.151  13.336  69.566  1.00 27.00 ? 199  LYS D CE    1 
ATOM   5397 N NZ    . LYS F 3 199 ? 37.116  13.687  68.483  1.00 29.42 ? 199  LYS D NZ    1 
ATOM   5398 N N     . LYS F 3 200 ? 30.084  12.946  66.285  1.00 17.66 ? 200  LYS D N     1 
ATOM   5399 C CA    . LYS F 3 200 ? 28.687  12.517  66.237  1.00 17.14 ? 200  LYS D CA    1 
ATOM   5400 C C     . LYS F 3 200 ? 28.307  11.598  67.401  1.00 16.32 ? 200  LYS D C     1 
ATOM   5401 O O     . LYS F 3 200 ? 27.122  11.397  67.682  1.00 17.03 ? 200  LYS D O     1 
ATOM   5402 C CB    . LYS F 3 200 ? 28.400  11.837  64.894  1.00 17.75 ? 200  LYS D CB    1 
ATOM   5403 C CG    . LYS F 3 200 ? 27.796  12.765  63.854  1.00 19.85 ? 200  LYS D CG    1 
ATOM   5404 C CD    . LYS F 3 200 ? 28.781  13.783  63.399  1.00 23.41 ? 200  LYS D CD    1 
ATOM   5405 C CE    . LYS F 3 200 ? 28.248  14.532  62.200  1.00 22.61 ? 200  LYS D CE    1 
ATOM   5406 N NZ    . LYS F 3 200 ? 29.398  14.975  61.392  1.00 24.89 ? 200  LYS D NZ    1 
ATOM   5407 N N     . VAL F 3 201 ? 29.305  11.062  68.089  1.00 14.25 ? 201  VAL D N     1 
ATOM   5408 C CA    . VAL F 3 201 ? 29.035  10.041  69.104  1.00 13.47 ? 201  VAL D CA    1 
ATOM   5409 C C     . VAL F 3 201 ? 28.198  10.519  70.310  1.00 12.30 ? 201  VAL D C     1 
ATOM   5410 O O     . VAL F 3 201 ? 28.371  11.629  70.831  1.00 12.19 ? 201  VAL D O     1 
ATOM   5411 C CB    . VAL F 3 201 ? 30.335  9.349   69.578  1.00 14.20 ? 201  VAL D CB    1 
ATOM   5412 C CG1   . VAL F 3 201 ? 31.297  10.358  70.209  1.00 14.00 ? 201  VAL D CG1   1 
ATOM   5413 C CG2   . VAL F 3 201 ? 29.996  8.233   70.555  1.00 14.57 ? 201  VAL D CG2   1 
ATOM   5414 N N     . SER F 3 202 ? 27.266  9.671   70.707  1.00 10.75 ? 202  SER D N     1 
ATOM   5415 C CA    . SER F 3 202 ? 26.406  9.920   71.848  1.00 10.10 ? 202  SER D CA    1 
ATOM   5416 C C     . SER F 3 202 ? 27.007  9.038   72.936  1.00 9.52  ? 202  SER D C     1 
ATOM   5417 O O     . SER F 3 202 ? 27.216  7.832   72.717  1.00 9.56  ? 202  SER D O     1 
ATOM   5418 C CB    . SER F 3 202 ? 24.967  9.508   71.544  1.00 10.93 ? 202  SER D CB    1 
ATOM   5419 O OG    . SER F 3 202 ? 24.148  9.692   72.686  1.00 12.58 ? 202  SER D OG    1 
ATOM   5420 N N     . ALA F 3 203 ? 27.351  9.648   74.071  1.00 8.42  ? 203  ALA D N     1 
ATOM   5421 C CA    . ALA F 3 203 ? 28.187  8.994   75.093  1.00 7.71  ? 203  ALA D CA    1 
ATOM   5422 C C     . ALA F 3 203 ? 27.416  8.613   76.371  1.00 8.35  ? 203  ALA D C     1 
ATOM   5423 O O     . ALA F 3 203 ? 26.446  9.298   76.761  1.00 8.44  ? 203  ALA D O     1 
ATOM   5424 C CB    . ALA F 3 203 ? 29.385  9.922   75.448  1.00 8.62  ? 203  ALA D CB    1 
ATOM   5425 N N     . VAL F 3 204 ? 27.897  7.557   77.036  1.00 7.54  ? 204  VAL D N     1 
ATOM   5426 C CA    . VAL F 3 204 ? 27.464  7.237   78.401  1.00 7.46  ? 204  VAL D CA    1 
ATOM   5427 C C     . VAL F 3 204 ? 28.722  7.096   79.260  1.00 7.71  ? 204  VAL D C     1 
ATOM   5428 O O     . VAL F 3 204 ? 29.806  6.795   78.747  1.00 7.50  ? 204  VAL D O     1 
ATOM   5429 C CB    . VAL F 3 204 ? 26.640  5.924   78.494  1.00 7.72  ? 204  VAL D CB    1 
ATOM   5430 C CG1   . VAL F 3 204 ? 25.351  6.034   77.669  1.00 8.19  ? 204  VAL D CG1   1 
ATOM   5431 C CG2   . VAL F 3 204 ? 27.456  4.673   78.094  1.00 7.61  ? 204  VAL D CG2   1 
ATOM   5432 N N     . VAL F 3 205 ? 28.556  7.282   80.554  1.00 6.98  ? 205  VAL D N     1 
ATOM   5433 C CA    . VAL F 3 205 ? 29.568  6.840   81.501  1.00 7.83  ? 205  VAL D CA    1 
ATOM   5434 C C     . VAL F 3 205 ? 29.073  5.523   82.081  1.00 8.66  ? 205  VAL D C     1 
ATOM   5435 O O     . VAL F 3 205 ? 27.891  5.386   82.445  1.00 9.08  ? 205  VAL D O     1 
ATOM   5436 C CB    . VAL F 3 205 ? 29.830  7.888   82.617  1.00 7.50  ? 205  VAL D CB    1 
ATOM   5437 C CG1   . VAL F 3 205 ? 30.717  7.280   83.749  1.00 9.27  ? 205  VAL D CG1   1 
ATOM   5438 C CG2   . VAL F 3 205 ? 30.459  9.189   82.032  1.00 9.00  ? 205  VAL D CG2   1 
ATOM   5439 N N     . ILE F 3 206 ? 29.964  4.545   82.135  1.00 8.90  ? 206  ILE D N     1 
ATOM   5440 C CA    . ILE F 3 206 ? 29.660  3.302   82.804  1.00 9.31  ? 206  ILE D CA    1 
ATOM   5441 C C     . ILE F 3 206 ? 30.461  3.260   84.097  1.00 10.18 ? 206  ILE D C     1 
ATOM   5442 O O     . ILE F 3 206 ? 31.664  3.456   84.070  1.00 10.37 ? 206  ILE D O     1 
ATOM   5443 C CB    . ILE F 3 206 ? 29.936  2.053   81.909  1.00 10.19 ? 206  ILE D CB    1 
ATOM   5444 C CG1   . ILE F 3 206 ? 29.728  0.779   82.741  1.00 9.97  ? 206  ILE D CG1   1 
ATOM   5445 C CG2   . ILE F 3 206 ? 31.327  2.136   81.212  1.00 11.48 ? 206  ILE D CG2   1 
ATOM   5446 C CD1   . ILE F 3 206 ? 29.777  -0.532  81.948  1.00 9.88  ? 206  ILE D CD1   1 
ATOM   5447 N N     . ARG F 3 207 ? 29.774  3.089   85.229  1.00 9.96  ? 207  ARG D N     1 
ATOM   5448 C CA    . ARG F 3 207 ? 30.465  2.736   86.484  1.00 11.02 ? 207  ARG D CA    1 
ATOM   5449 C C     . ARG F 3 207 ? 30.133  1.286   86.801  1.00 10.82 ? 207  ARG D C     1 
ATOM   5450 O O     . ARG F 3 207 ? 28.979  0.964   87.072  1.00 12.07 ? 207  ARG D O     1 
ATOM   5451 C CB    . ARG F 3 207 ? 30.025  3.643   87.636  1.00 11.40 ? 207  ARG D CB    1 
ATOM   5452 C CG    . ARG F 3 207 ? 30.782  3.393   88.931  1.00 13.25 ? 207  ARG D CG    1 
ATOM   5453 C CD    . ARG F 3 207 ? 30.042  3.977   90.126  1.00 19.15 ? 207  ARG D CD    1 
ATOM   5454 N NE    . ARG F 3 207 ? 30.710  3.682   91.404  1.00 24.69 ? 207  ARG D NE    1 
ATOM   5455 C CZ    . ARG F 3 207 ? 30.596  2.540   92.093  1.00 24.57 ? 207  ARG D CZ    1 
ATOM   5456 N NH1   . ARG F 3 207 ? 29.871  1.526   91.642  1.00 26.92 ? 207  ARG D NH1   1 
ATOM   5457 N NH2   . ARG F 3 207 ? 31.238  2.402   93.245  1.00 28.44 ? 207  ARG D NH2   1 
ATOM   5458 N N     . PHE F 3 208 ? 31.130  0.409   86.729  1.00 10.70 ? 208  PHE D N     1 
ATOM   5459 C CA    . PHE F 3 208 ? 30.930  -1.005  86.980  1.00 9.71  ? 208  PHE D CA    1 
ATOM   5460 C C     . PHE F 3 208 ? 31.691  -1.343  88.256  1.00 10.84 ? 208  PHE D C     1 
ATOM   5461 O O     . PHE F 3 208 ? 32.818  -0.890  88.431  1.00 10.81 ? 208  PHE D O     1 
ATOM   5462 C CB    . PHE F 3 208 ? 31.489  -1.827  85.813  1.00 10.97 ? 208  PHE D CB    1 
ATOM   5463 C CG    . PHE F 3 208 ? 31.557  -3.291  86.092  1.00 9.56  ? 208  PHE D CG    1 
ATOM   5464 C CD1   . PHE F 3 208 ? 30.457  -4.122  85.808  1.00 11.18 ? 208  PHE D CD1   1 
ATOM   5465 C CD2   . PHE F 3 208 ? 32.717  -3.866  86.650  1.00 10.32 ? 208  PHE D CD2   1 
ATOM   5466 C CE1   . PHE F 3 208 ? 30.515  -5.498  86.072  1.00 11.87 ? 208  PHE D CE1   1 
ATOM   5467 C CE2   . PHE F 3 208 ? 32.783  -5.230  86.913  1.00 9.66  ? 208  PHE D CE2   1 
ATOM   5468 C CZ    . PHE F 3 208 ? 31.682  -6.059  86.626  1.00 11.25 ? 208  PHE D CZ    1 
ATOM   5469 N N     . GLN F 3 209 ? 31.055  -2.105  89.145  1.00 11.27 ? 209  GLN D N     1 
ATOM   5470 C CA    . GLN F 3 209 ? 31.766  -2.649  90.308  1.00 12.53 ? 209  GLN D CA    1 
ATOM   5471 C C     . GLN F 3 209 ? 31.768  -4.172  90.272  1.00 12.64 ? 209  GLN D C     1 
ATOM   5472 O O     . GLN F 3 209 ? 30.720  -4.804  90.039  1.00 12.09 ? 209  GLN D O     1 
ATOM   5473 C CB    . GLN F 3 209 ? 31.189  -2.138  91.625  1.00 13.07 ? 209  GLN D CB    1 
ATOM   5474 C CG    . GLN F 3 209 ? 32.050  -2.583  92.814  1.00 15.36 ? 209  GLN D CG    1 
ATOM   5475 C CD    . GLN F 3 209 ? 31.561  -2.024  94.131  1.00 20.72 ? 209  GLN D CD    1 
ATOM   5476 O OE1   . GLN F 3 209 ? 30.377  -1.719  94.293  1.00 24.57 ? 209  GLN D OE1   1 
ATOM   5477 N NE2   . GLN F 3 209 ? 32.483  -1.871  95.082  1.00 22.46 ? 209  GLN D NE2   1 
ATOM   5478 N N     . LYS F 3 210 ? 32.942  -4.763  90.502  1.00 13.52 ? 210  LYS D N     1 
ATOM   5479 C CA    . LYS F 3 210 ? 33.110  -6.210  90.353  1.00 14.53 ? 210  LYS D CA    1 
ATOM   5480 C C     . LYS F 3 210 ? 32.606  -6.966  91.583  1.00 15.56 ? 210  LYS D C     1 
ATOM   5481 O O     . LYS F 3 210 ? 33.349  -7.721  92.243  1.00 15.96 ? 210  LYS D O     1 
ATOM   5482 C CB    . LYS F 3 210 ? 34.567  -6.572  90.042  1.00 15.26 ? 210  LYS D CB    1 
ATOM   5483 C CG    . LYS F 3 210 ? 34.708  -7.940  89.390  1.00 14.75 ? 210  LYS D CG    1 
ATOM   5484 C CD    . LYS F 3 210 ? 36.118  -8.153  88.876  1.00 15.41 ? 210  LYS D CD    1 
ATOM   5485 C CE    . LYS F 3 210 ? 36.227  -9.363  88.002  1.00 17.26 ? 210  LYS D CE    1 
ATOM   5486 N NZ    . LYS F 3 210 ? 37.634  -9.544  87.525  1.00 16.79 ? 210  LYS D NZ    1 
ATOM   5487 N N     . SER F 3 211 ? 31.341  -6.736  91.894  1.00 15.82 ? 211  SER D N     1 
ATOM   5488 C CA    . SER F 3 211 ? 30.662  -7.377  93.013  1.00 16.81 ? 211  SER D CA    1 
ATOM   5489 C C     . SER F 3 211 ? 29.159  -7.124  92.879  1.00 16.97 ? 211  SER D C     1 
ATOM   5490 O O     . SER F 3 211 ? 28.730  -6.141  92.246  1.00 16.28 ? 211  SER D O     1 
ATOM   5491 C CB    . SER F 3 211 ? 31.195  -6.825  94.352  1.00 17.30 ? 211  SER D CB    1 
ATOM   5492 O OG    . SER F 3 211 ? 30.839  -5.471  94.515  1.00 18.38 ? 211  SER D OG    1 
ATOM   5493 N N     . GLY F 3 212 ? 28.357  -8.013  93.470  1.00 16.82 ? 212  GLY D N     1 
ATOM   5494 C CA    . GLY F 3 212 ? 26.907  -7.863  93.426  1.00 16.76 ? 212  GLY D CA    1 
ATOM   5495 C C     . GLY F 3 212 ? 26.345  -8.026  92.021  1.00 16.53 ? 212  GLY D C     1 
ATOM   5496 O O     . GLY F 3 212 ? 26.949  -8.702  91.166  1.00 16.18 ? 212  GLY D O     1 
ATOM   5497 N N     . LYS F 3 213 ? 25.176  -7.422  91.799  1.00 16.19 ? 213  LYS D N     1 
ATOM   5498 C CA    . LYS F 3 213 ? 24.456  -7.581  90.535  1.00 15.76 ? 213  LYS D CA    1 
ATOM   5499 C C     . LYS F 3 213 ? 23.483  -6.436  90.226  1.00 14.74 ? 213  LYS D C     1 
ATOM   5500 O O     . LYS F 3 213 ? 23.186  -5.579  91.073  1.00 14.74 ? 213  LYS D O     1 
ATOM   5501 C CB    . LYS F 3 213 ? 23.713  -8.926  90.495  1.00 16.68 ? 213  LYS D CB    1 
ATOM   5502 C CG    . LYS F 3 213 ? 22.536  -8.986  91.439  1.00 20.51 ? 213  LYS D CG    1 
ATOM   5503 C CD    . LYS F 3 213 ? 21.773  -10.301 91.291  1.00 24.37 ? 213  LYS D CD    1 
ATOM   5504 C CE    . LYS F 3 213 ? 20.607  -10.363 92.248  1.00 28.78 ? 213  LYS D CE    1 
ATOM   5505 N NZ    . LYS F 3 213 ? 19.626  -9.255  92.009  1.00 31.34 ? 213  LYS D NZ    1 
ATOM   5506 N N     . GLY F 3 214 ? 22.979  -6.443  88.997  1.00 13.62 ? 214  GLY D N     1 
ATOM   5507 C CA    . GLY F 3 214 ? 21.942  -5.510  88.602  1.00 12.98 ? 214  GLY D CA    1 
ATOM   5508 C C     . GLY F 3 214 ? 22.438  -4.323  87.807  1.00 12.80 ? 214  GLY D C     1 
ATOM   5509 O O     . GLY F 3 214 ? 23.654  -4.078  87.648  1.00 12.29 ? 214  GLY D O     1 
ATOM   5510 N N     . LEU F 3 215 ? 21.466  -3.574  87.328  1.00 11.02 ? 215  LEU D N     1 
ATOM   5511 C CA    . LEU F 3 215 ? 21.708  -2.418  86.493  1.00 10.22 ? 215  LEU D CA    1 
ATOM   5512 C C     . LEU F 3 215 ? 20.989  -1.221  87.119  1.00 10.57 ? 215  LEU D C     1 
ATOM   5513 O O     . LEU F 3 215 ? 19.861  -1.361  87.594  1.00 11.28 ? 215  LEU D O     1 
ATOM   5514 C CB    . LEU F 3 215 ? 21.157  -2.680  85.101  1.00 9.63  ? 215  LEU D CB    1 
ATOM   5515 C CG    . LEU F 3 215 ? 21.142  -1.505  84.109  1.00 10.45 ? 215  LEU D CG    1 
ATOM   5516 C CD1   . LEU F 3 215 ? 22.555  -1.061  83.762  1.00 10.71 ? 215  LEU D CD1   1 
ATOM   5517 C CD2   . LEU F 3 215 ? 20.355  -1.928  82.855  1.00 10.39 ? 215  LEU D CD2   1 
ATOM   5518 N N     . SER F 3 216 ? 21.650  -0.067  87.105  1.00 10.01 ? 216  SER D N     1 
ATOM   5519 C CA    . SER F 3 216 ? 21.035  1.218   87.442  1.00 10.80 ? 216  SER D CA    1 
ATOM   5520 C C     . SER F 3 216 ? 21.209  2.135   86.248  1.00 10.57 ? 216  SER D C     1 
ATOM   5521 O O     . SER F 3 216 ? 22.302  2.244   85.729  1.00 10.83 ? 216  SER D O     1 
ATOM   5522 C CB    . SER F 3 216 ? 21.703  1.836   88.674  1.00 11.04 ? 216  SER D CB    1 
ATOM   5523 O OG    . SER F 3 216 ? 21.432  1.032   89.812  1.00 16.84 ? 216  SER D OG    1 
ATOM   5524 N N     . LEU F 3 217 ? 20.124  2.783   85.809  1.00 9.53  ? 217  LEU D N     1 
ATOM   5525 C CA    . LEU F 3 217 ? 20.161  3.697   84.660  1.00 9.99  ? 217  LEU D CA    1 
ATOM   5526 C C     . LEU F 3 217 ? 19.902  5.115   85.144  1.00 9.96  ? 217  LEU D C     1 
ATOM   5527 O O     . LEU F 3 217 ? 18.930  5.362   85.885  1.00 10.08 ? 217  LEU D O     1 
ATOM   5528 C CB    . LEU F 3 217 ? 19.115  3.281   83.613  1.00 8.84  ? 217  LEU D CB    1 
ATOM   5529 C CG    . LEU F 3 217 ? 19.039  4.109   82.327  1.00 9.58  ? 217  LEU D CG    1 
ATOM   5530 C CD1   . LEU F 3 217 ? 20.394  4.005   81.552  1.00 11.89 ? 217  LEU D CD1   1 
ATOM   5531 C CD2   . LEU F 3 217 ? 17.845  3.608   81.477  1.00 10.02 ? 217  LEU D CD2   1 
ATOM   5532 N N     . TRP F 3 218 ? 20.771  6.035   84.748  1.00 9.97  ? 218  TRP D N     1 
ATOM   5533 C CA    . TRP F 3 218 ? 20.761  7.398   85.256  1.00 9.51  ? 218  TRP D CA    1 
ATOM   5534 C C     . TRP F 3 218 ? 20.759  8.360   84.087  1.00 9.70  ? 218  TRP D C     1 
ATOM   5535 O O     . TRP F 3 218 ? 21.503  8.135   83.121  1.00 9.78  ? 218  TRP D O     1 
ATOM   5536 C CB    . TRP F 3 218 ? 22.026  7.677   86.076  1.00 10.92 ? 218  TRP D CB    1 
ATOM   5537 C CG    . TRP F 3 218 ? 22.281  6.790   87.247  1.00 11.39 ? 218  TRP D CG    1 
ATOM   5538 C CD1   . TRP F 3 218 ? 22.784  5.507   87.235  1.00 13.57 ? 218  TRP D CD1   1 
ATOM   5539 C CD2   . TRP F 3 218 ? 22.118  7.151   88.618  1.00 13.33 ? 218  TRP D CD2   1 
ATOM   5540 N NE1   . TRP F 3 218 ? 22.930  5.049   88.537  1.00 14.90 ? 218  TRP D NE1   1 
ATOM   5541 C CE2   . TRP F 3 218 ? 22.524  6.040   89.399  1.00 13.61 ? 218  TRP D CE2   1 
ATOM   5542 C CE3   . TRP F 3 218 ? 21.679  8.317   89.264  1.00 13.17 ? 218  TRP D CE3   1 
ATOM   5543 C CZ2   . TRP F 3 218 ? 22.477  6.053   90.802  1.00 12.23 ? 218  TRP D CZ2   1 
ATOM   5544 C CZ3   . TRP F 3 218 ? 21.628  8.327   90.674  1.00 14.69 ? 218  TRP D CZ3   1 
ATOM   5545 C CH2   . TRP F 3 218 ? 22.024  7.197   91.414  1.00 13.92 ? 218  TRP D CH2   1 
ATOM   5546 N N     . ASP F 3 219 ? 19.931  9.406   84.166  1.00 10.09 ? 219  ASP D N     1 
ATOM   5547 C CA    . ASP F 3 219 ? 20.031  10.530  83.255  1.00 10.48 ? 219  ASP D CA    1 
ATOM   5548 C C     . ASP F 3 219 ? 21.076  11.441  83.873  1.00 9.86  ? 219  ASP D C     1 
ATOM   5549 O O     . ASP F 3 219 ? 21.549  11.163  84.982  1.00 9.81  ? 219  ASP D O     1 
ATOM   5550 C CB    . ASP F 3 219 ? 18.695  11.266  83.162  1.00 11.21 ? 219  ASP D CB    1 
ATOM   5551 C CG    . ASP F 3 219 ? 18.504  11.983  81.831  1.00 12.55 ? 219  ASP D CG    1 
ATOM   5552 O OD1   . ASP F 3 219 ? 19.499  12.199  81.078  1.00 11.86 ? 219  ASP D OD1   1 
ATOM   5553 O OD2   . ASP F 3 219 ? 17.329  12.333  81.540  1.00 16.90 ? 219  ASP D OD2   1 
ATOM   5554 N N     . THR F 3 220 ? 21.428  12.521  83.184  1.00 10.60 ? 220  THR D N     1 
ATOM   5555 C CA    . THR F 3 220 ? 22.284  13.548  83.775  1.00 11.42 ? 220  THR D CA    1 
ATOM   5556 C C     . THR F 3 220 ? 21.793  14.923  83.372  1.00 11.87 ? 220  THR D C     1 
ATOM   5557 O O     . THR F 3 220 ? 21.060  15.088  82.389  1.00 11.65 ? 220  THR D O     1 
ATOM   5558 C CB    . THR F 3 220 ? 23.775  13.455  83.340  1.00 11.13 ? 220  THR D CB    1 
ATOM   5559 O OG1   . THR F 3 220 ? 23.879  13.613  81.920  1.00 11.38 ? 220  THR D OG1   1 
ATOM   5560 C CG2   . THR F 3 220 ? 24.452  12.135  83.787  1.00 10.78 ? 220  THR D CG2   1 
ATOM   5561 N N     . GLN F 3 221 ? 22.211  15.914  84.138  1.00 12.91 ? 221  GLN D N     1 
ATOM   5562 C CA    . GLN F 3 221 ? 22.043  17.298  83.739  1.00 13.93 ? 221  GLN D CA    1 
ATOM   5563 C C     . GLN F 3 221 ? 23.335  18.030  84.034  1.00 13.66 ? 221  GLN D C     1 
ATOM   5564 O O     . GLN F 3 221 ? 24.079  17.650  84.949  1.00 13.28 ? 221  GLN D O     1 
ATOM   5565 C CB    . GLN F 3 221 ? 20.858  17.953  84.460  1.00 14.76 ? 221  GLN D CB    1 
ATOM   5566 C CG    . GLN F 3 221 ? 20.977  18.001  85.948  1.00 14.95 ? 221  GLN D CG    1 
ATOM   5567 C CD    . GLN F 3 221 ? 19.836  18.788  86.610  1.00 17.16 ? 221  GLN D CD    1 
ATOM   5568 O OE1   . GLN F 3 221 ? 18.714  18.839  86.091  1.00 20.27 ? 221  GLN D OE1   1 
ATOM   5569 N NE2   . GLN F 3 221 ? 20.138  19.414  87.743  1.00 19.87 ? 221  GLN D NE2   1 
ATOM   5570 N N     . GLU F 3 222 ? 23.610  19.060  83.249  1.00 13.78 ? 222  GLU D N     1 
ATOM   5571 C CA    . GLU F 3 222 ? 24.820  19.849  83.448  1.00 14.68 ? 222  GLU D CA    1 
ATOM   5572 C C     . GLU F 3 222 ? 24.775  20.552  84.789  1.00 14.77 ? 222  GLU D C     1 
ATOM   5573 O O     . GLU F 3 222 ? 23.713  20.992  85.227  1.00 14.14 ? 222  GLU D O     1 
ATOM   5574 C CB    . GLU F 3 222 ? 24.949  20.903  82.360  1.00 14.65 ? 222  GLU D CB    1 
ATOM   5575 C CG    . GLU F 3 222 ? 25.305  20.353  81.001  1.00 18.24 ? 222  GLU D CG    1 
ATOM   5576 C CD    . GLU F 3 222 ? 25.596  21.477  80.049  1.00 24.25 ? 222  GLU D CD    1 
ATOM   5577 O OE1   . GLU F 3 222 ? 24.821  21.662  79.101  1.00 27.17 ? 222  GLU D OE1   1 
ATOM   5578 O OE2   . GLU F 3 222 ? 26.587  22.203  80.268  1.00 29.76 ? 222  GLU D OE2   1 
ATOM   5579 N N     . SER F 3 223 ? 25.928  20.649  85.439  1.00 15.69 ? 223  SER D N     1 
ATOM   5580 C CA    . SER F 3 223 ? 26.010  21.352  86.716  1.00 17.69 ? 223  SER D CA    1 
ATOM   5581 C C     . SER F 3 223 ? 27.151  22.369  86.657  1.00 19.08 ? 223  SER D C     1 
ATOM   5582 O O     . SER F 3 223 ? 27.797  22.536  85.609  1.00 19.13 ? 223  SER D O     1 
ATOM   5583 C CB    . SER F 3 223 ? 26.230  20.351  87.850  1.00 17.47 ? 223  SER D CB    1 
ATOM   5584 O OG    . SER F 3 223 ? 27.512  19.763  87.734  1.00 20.66 ? 223  SER D OG    1 
ATOM   5585 N N     . GLU F 3 224 ? 27.418  23.033  87.781  1.00 20.26 ? 224  GLU D N     1 
ATOM   5586 C CA    . GLU F 3 224 ? 28.433  24.083  87.819  1.00 22.30 ? 224  GLU D CA    1 
ATOM   5587 C C     . GLU F 3 224 ? 29.781  23.610  87.231  1.00 23.13 ? 224  GLU D C     1 
ATOM   5588 O O     . GLU F 3 224 ? 30.359  24.275  86.364  1.00 24.12 ? 224  GLU D O     1 
ATOM   5589 C CB    . GLU F 3 224 ? 28.583  24.598  89.253  1.00 22.52 ? 224  GLU D CB    1 
ATOM   5590 C CG    . GLU F 3 224 ? 29.583  25.731  89.433  1.00 25.56 ? 224  GLU D CG    1 
ATOM   5591 C CD    . GLU F 3 224 ? 29.503  26.308  90.824  1.00 28.80 ? 224  GLU D CD    1 
ATOM   5592 O OE1   . GLU F 3 224 ? 30.474  26.148  91.596  1.00 32.05 ? 224  GLU D OE1   1 
ATOM   5593 O OE2   . GLU F 3 224 ? 28.454  26.893  91.157  1.00 30.38 ? 224  GLU D OE2   1 
ATOM   5594 N N     . SER F 3 225 ? 30.257  22.450  87.673  1.00 23.15 ? 225  SER D N     1 
ATOM   5595 C CA    . SER F 3 225 ? 31.576  21.982  87.250  1.00 23.64 ? 225  SER D CA    1 
ATOM   5596 C C     . SER F 3 225 ? 31.550  20.723  86.381  1.00 22.50 ? 225  SER D C     1 
ATOM   5597 O O     . SER F 3 225 ? 32.584  20.321  85.832  1.00 22.97 ? 225  SER D O     1 
ATOM   5598 C CB    . SER F 3 225 ? 32.450  21.735  88.475  1.00 24.20 ? 225  SER D CB    1 
ATOM   5599 O OG    . SER F 3 225 ? 32.069  20.527  89.113  1.00 27.02 ? 225  SER D OG    1 
ATOM   5600 N N     . GLY F 3 226 ? 30.382  20.094  86.266  1.00 20.46 ? 226  GLY D N     1 
ATOM   5601 C CA    . GLY F 3 226 ? 30.291  18.858  85.518  1.00 17.86 ? 226  GLY D CA    1 
ATOM   5602 C C     . GLY F 3 226 ? 28.882  18.421  85.216  1.00 15.70 ? 226  GLY D C     1 
ATOM   5603 O O     . GLY F 3 226 ? 28.166  19.064  84.444  1.00 14.90 ? 226  GLY D O     1 
ATOM   5604 N N     . PHE F 3 227 ? 28.509  17.299  85.809  1.00 13.97 ? 227  PHE D N     1 
ATOM   5605 C CA    . PHE F 3 227 ? 27.178  16.731  85.612  1.00 13.39 ? 227  PHE D CA    1 
ATOM   5606 C C     . PHE F 3 227 ? 26.643  16.246  86.937  1.00 13.21 ? 227  PHE D C     1 
ATOM   5607 O O     . PHE F 3 227 ? 27.398  15.830  87.812  1.00 12.81 ? 227  PHE D O     1 
ATOM   5608 C CB    . PHE F 3 227 ? 27.187  15.575  84.579  1.00 12.60 ? 227  PHE D CB    1 
ATOM   5609 C CG    . PHE F 3 227 ? 27.613  16.000  83.199  1.00 12.02 ? 227  PHE D CG    1 
ATOM   5610 C CD1   . PHE F 3 227 ? 26.655  16.419  82.258  1.00 14.99 ? 227  PHE D CD1   1 
ATOM   5611 C CD2   . PHE F 3 227 ? 28.961  16.009  82.844  1.00 12.73 ? 227  PHE D CD2   1 
ATOM   5612 C CE1   . PHE F 3 227 ? 27.051  16.840  80.981  1.00 13.28 ? 227  PHE D CE1   1 
ATOM   5613 C CE2   . PHE F 3 227 ? 29.379  16.438  81.576  1.00 11.54 ? 227  PHE D CE2   1 
ATOM   5614 C CZ    . PHE F 3 227 ? 28.413  16.852  80.639  1.00 12.31 ? 227  PHE D CZ    1 
ATOM   5615 N N     . THR F 3 228 ? 25.323  16.335  87.067  1.00 13.68 ? 228  THR D N     1 
ATOM   5616 C CA    . THR F 3 228 ? 24.588  15.752  88.165  1.00 14.06 ? 228  THR D CA    1 
ATOM   5617 C C     . THR F 3 228 ? 23.783  14.560  87.669  1.00 13.48 ? 228  THR D C     1 
ATOM   5618 O O     . THR F 3 228 ? 22.986  14.708  86.748  1.00 14.15 ? 228  THR D O     1 
ATOM   5619 C CB    . THR F 3 228 ? 23.586  16.765  88.759  1.00 14.62 ? 228  THR D CB    1 
ATOM   5620 O OG1   . THR F 3 228 ? 24.293  17.937  89.163  1.00 16.37 ? 228  THR D OG1   1 
ATOM   5621 C CG2   . THR F 3 228 ? 22.856  16.150  89.958  1.00 14.87 ? 228  THR D CG2   1 
ATOM   5622 N N     . PRO F 3 229 ? 23.971  13.388  88.294  1.00 13.72 ? 229  PRO D N     1 
ATOM   5623 C CA    . PRO F 3 229 ? 23.205  12.212  87.913  1.00 13.59 ? 229  PRO D CA    1 
ATOM   5624 C C     . PRO F 3 229 ? 21.795  12.253  88.495  1.00 14.04 ? 229  PRO D C     1 
ATOM   5625 O O     . PRO F 3 229 ? 21.585  12.735  89.624  1.00 14.52 ? 229  PRO D O     1 
ATOM   5626 C CB    . PRO F 3 229 ? 24.008  11.060  88.517  1.00 14.68 ? 229  PRO D CB    1 
ATOM   5627 C CG    . PRO F 3 229 ? 24.728  11.676  89.675  1.00 14.39 ? 229  PRO D CG    1 
ATOM   5628 C CD    . PRO F 3 229 ? 24.927  13.111  89.387  1.00 13.41 ? 229  PRO D CD    1 
ATOM   5629 N N     . ILE F 3 230 ? 20.839  11.760  87.718  1.00 13.00 ? 230  ILE D N     1 
ATOM   5630 C CA    . ILE F 3 230 ? 19.450  11.711  88.136  1.00 13.86 ? 230  ILE D CA    1 
ATOM   5631 C C     . ILE F 3 230 ? 18.959  10.284  87.892  1.00 13.10 ? 230  ILE D C     1 
ATOM   5632 O O     . ILE F 3 230 ? 18.918  9.839   86.743  1.00 13.56 ? 230  ILE D O     1 
ATOM   5633 C CB    . ILE F 3 230 ? 18.575  12.689  87.303  1.00 13.94 ? 230  ILE D CB    1 
ATOM   5634 C CG1   . ILE F 3 230 ? 19.132  14.133  87.325  1.00 14.76 ? 230  ILE D CG1   1 
ATOM   5635 C CG2   . ILE F 3 230 ? 17.120  12.602  87.758  1.00 15.80 ? 230  ILE D CG2   1 
ATOM   5636 C CD1   . ILE F 3 230 ? 19.206  14.810  88.696  1.00 17.55 ? 230  ILE D CD1   1 
ATOM   5637 N N     . LEU F 3 231 ? 18.594  9.563   88.953  1.00 12.63 ? 231  LEU D N     1 
ATOM   5638 C CA    . LEU F 3 231 ? 18.204  8.154   88.794  1.00 12.23 ? 231  LEU D CA    1 
ATOM   5639 C C     . LEU F 3 231 ? 16.964  8.030   87.928  1.00 12.32 ? 231  LEU D C     1 
ATOM   5640 O O     . LEU F 3 231 ? 15.957  8.702   88.167  1.00 12.50 ? 231  LEU D O     1 
ATOM   5641 C CB    . LEU F 3 231 ? 17.970  7.471   90.153  1.00 12.19 ? 231  LEU D CB    1 
ATOM   5642 C CG    . LEU F 3 231 ? 17.623  5.971   90.073  1.00 11.99 ? 231  LEU D CG    1 
ATOM   5643 C CD1   . LEU F 3 231 ? 18.764  5.136   89.490  1.00 11.18 ? 231  LEU D CD1   1 
ATOM   5644 C CD2   . LEU F 3 231 ? 17.234  5.438   91.439  1.00 13.36 ? 231  LEU D CD2   1 
ATOM   5645 N N     . TRP F 3 232 ? 17.042  7.158   86.927  1.00 11.68 ? 232  TRP D N     1 
ATOM   5646 C CA    . TRP F 3 232 ? 15.909  6.922   86.041  1.00 11.21 ? 232  TRP D CA    1 
ATOM   5647 C C     . TRP F 3 232 ? 15.212  5.606   86.348  1.00 11.93 ? 232  TRP D C     1 
ATOM   5648 O O     . TRP F 3 232 ? 13.978  5.558   86.450  1.00 12.33 ? 232  TRP D O     1 
ATOM   5649 C CB    . TRP F 3 232 ? 16.356  6.959   84.578  1.00 11.30 ? 232  TRP D CB    1 
ATOM   5650 C CG    . TRP F 3 232 ? 15.222  6.922   83.611  1.00 9.93  ? 232  TRP D CG    1 
ATOM   5651 C CD1   . TRP F 3 232 ? 14.534  5.817   83.185  1.00 10.16 ? 232  TRP D CD1   1 
ATOM   5652 C CD2   . TRP F 3 232 ? 14.626  8.051   82.960  1.00 11.10 ? 232  TRP D CD2   1 
ATOM   5653 N NE1   . TRP F 3 232 ? 13.545  6.193   82.287  1.00 12.95 ? 232  TRP D NE1   1 
ATOM   5654 C CE2   . TRP F 3 232 ? 13.589  7.556   82.129  1.00 11.02 ? 232  TRP D CE2   1 
ATOM   5655 C CE3   . TRP F 3 232 ? 14.880  9.431   82.985  1.00 11.90 ? 232  TRP D CE3   1 
ATOM   5656 C CZ2   . TRP F 3 232 ? 12.806  8.402   81.321  1.00 12.95 ? 232  TRP D CZ2   1 
ATOM   5657 C CZ3   . TRP F 3 232 ? 14.101  10.271  82.173  1.00 13.38 ? 232  TRP D CZ3   1 
ATOM   5658 C CH2   . TRP F 3 232 ? 13.078  9.745   81.361  1.00 12.28 ? 232  TRP D CH2   1 
ATOM   5659 N N     . ALA F 3 233 ? 15.982  4.531   86.443  1.00 11.65 ? 233  ALA D N     1 
ATOM   5660 C CA    . ALA F 3 233 ? 15.415  3.191   86.661  1.00 12.47 ? 233  ALA D CA    1 
ATOM   5661 C C     . ALA F 3 233 ? 16.436  2.233   87.262  1.00 13.45 ? 233  ALA D C     1 
ATOM   5662 O O     . ALA F 3 233 ? 17.644  2.454   87.163  1.00 13.63 ? 233  ALA D O     1 
ATOM   5663 C CB    . ALA F 3 233 ? 14.876  2.618   85.343  1.00 12.57 ? 233  ALA D CB    1 
ATOM   5664 N N     . GLU F 3 234 ? 15.940  1.161   87.876  1.00 13.84 ? 234  GLU D N     1 
ATOM   5665 C CA    . GLU F 3 234 ? 16.803  0.104   88.373  1.00 14.54 ? 234  GLU D CA    1 
ATOM   5666 C C     . GLU F 3 234 ? 16.245  -1.234  87.946  1.00 14.51 ? 234  GLU D C     1 
ATOM   5667 O O     . GLU F 3 234 ? 15.024  -1.457  87.983  1.00 14.91 ? 234  GLU D O     1 
ATOM   5668 C CB    . GLU F 3 234 ? 16.952  0.170   89.889  1.00 15.80 ? 234  GLU D CB    1 
ATOM   5669 C CG    . GLU F 3 234 ? 17.835  1.306   90.384  1.00 19.27 ? 234  GLU D CG    1 
ATOM   5670 C CD    . GLU F 3 234 ? 17.878  1.380   91.894  1.00 24.16 ? 234  GLU D CD    1 
ATOM   5671 O OE1   . GLU F 3 234 ? 18.815  0.810   92.496  1.00 29.84 ? 234  GLU D OE1   1 
ATOM   5672 O OE2   . GLU F 3 234 ? 16.980  2.001   92.491  1.00 28.02 ? 234  GLU D OE2   1 
ATOM   5673 N N     . TYR F 3 235 ? 17.151  -2.114  87.532  1.00 13.42 ? 235  TYR D N     1 
ATOM   5674 C CA    . TYR F 3 235 ? 16.798  -3.459  87.094  1.00 13.39 ? 235  TYR D CA    1 
ATOM   5675 C C     . TYR F 3 235 ? 17.666  -4.422  87.897  1.00 13.32 ? 235  TYR D C     1 
ATOM   5676 O O     . TYR F 3 235 ? 18.763  -4.782  87.487  1.00 12.91 ? 235  TYR D O     1 
ATOM   5677 C CB    . TYR F 3 235 ? 17.025  -3.617  85.592  1.00 12.91 ? 235  TYR D CB    1 
ATOM   5678 C CG    . TYR F 3 235 ? 16.199  -2.662  84.752  1.00 13.14 ? 235  TYR D CG    1 
ATOM   5679 C CD1   . TYR F 3 235 ? 16.697  -1.414  84.404  1.00 10.86 ? 235  TYR D CD1   1 
ATOM   5680 C CD2   . TYR F 3 235 ? 14.931  -3.018  84.295  1.00 13.30 ? 235  TYR D CD2   1 
ATOM   5681 C CE1   . TYR F 3 235 ? 15.960  -0.512  83.619  1.00 10.76 ? 235  TYR D CE1   1 
ATOM   5682 C CE2   . TYR F 3 235 ? 14.182  -2.139  83.529  1.00 13.25 ? 235  TYR D CE2   1 
ATOM   5683 C CZ    . TYR F 3 235 ? 14.705  -0.887  83.187  1.00 12.82 ? 235  TYR D CZ    1 
ATOM   5684 O OH    . TYR F 3 235 ? 13.977  -0.021  82.425  1.00 14.49 ? 235  TYR D OH    1 
ATOM   5685 N N     . PRO F 3 236 ? 17.187  -4.809  89.080  1.00 13.68 ? 236  PRO D N     1 
ATOM   5686 C CA    . PRO F 3 236 ? 17.988  -5.648  89.963  1.00 14.72 ? 236  PRO D CA    1 
ATOM   5687 C C     . PRO F 3 236 ? 18.328  -7.025  89.387  1.00 14.71 ? 236  PRO D C     1 
ATOM   5688 O O     . PRO F 3 236 ? 19.326  -7.620  89.795  1.00 15.88 ? 236  PRO D O     1 
ATOM   5689 C CB    . PRO F 3 236 ? 17.117  -5.753  91.231  1.00 15.31 ? 236  PRO D CB    1 
ATOM   5690 C CG    . PRO F 3 236 ? 15.725  -5.481  90.760  1.00 14.57 ? 236  PRO D CG    1 
ATOM   5691 C CD    . PRO F 3 236 ? 15.902  -4.429  89.692  1.00 14.40 ? 236  PRO D CD    1 
ATOM   5692 N N     . HIS F 3 237 ? 17.534  -7.508  88.434  1.00 14.81 ? 237  HIS D N     1 
ATOM   5693 C CA    . HIS F 3 237 ? 17.725  -8.838  87.848  1.00 15.72 ? 237  HIS D CA    1 
ATOM   5694 C C     . HIS F 3 237 ? 18.268  -8.787  86.423  1.00 14.28 ? 237  HIS D C     1 
ATOM   5695 O O     . HIS F 3 237 ? 18.215  -9.787  85.698  1.00 14.64 ? 237  HIS D O     1 
ATOM   5696 C CB    . HIS F 3 237 ? 16.418  -9.630  87.875  1.00 16.93 ? 237  HIS D CB    1 
ATOM   5697 C CG    . HIS F 3 237 ? 15.739  -9.598  89.208  1.00 20.86 ? 237  HIS D CG    1 
ATOM   5698 N ND1   . HIS F 3 237 ? 14.597  -8.859  89.443  1.00 25.15 ? 237  HIS D ND1   1 
ATOM   5699 C CD2   . HIS F 3 237 ? 16.075  -10.163 90.391  1.00 24.51 ? 237  HIS D CD2   1 
ATOM   5700 C CE1   . HIS F 3 237 ? 14.242  -8.999  90.709  1.00 24.36 ? 237  HIS D CE1   1 
ATOM   5701 N NE2   . HIS F 3 237 ? 15.119  -9.790  91.304  1.00 25.30 ? 237  HIS D NE2   1 
ATOM   5702 N N     . TRP F 3 238 ? 18.815  -7.636  86.033  1.00 13.49 ? 238  TRP D N     1 
ATOM   5703 C CA    . TRP F 3 238 ? 19.428  -7.491  84.720  1.00 12.29 ? 238  TRP D CA    1 
ATOM   5704 C C     . TRP F 3 238 ? 20.335  -8.660  84.365  1.00 13.02 ? 238  TRP D C     1 
ATOM   5705 O O     . TRP F 3 238 ? 21.226  -9.009  85.128  1.00 12.77 ? 238  TRP D O     1 
ATOM   5706 C CB    . TRP F 3 238 ? 20.226  -6.193  84.656  1.00 11.59 ? 238  TRP D CB    1 
ATOM   5707 C CG    . TRP F 3 238 ? 20.701  -5.815  83.278  1.00 9.80  ? 238  TRP D CG    1 
ATOM   5708 C CD1   . TRP F 3 238 ? 19.931  -5.648  82.148  1.00 10.29 ? 238  TRP D CD1   1 
ATOM   5709 C CD2   . TRP F 3 238 ? 22.051  -5.512  82.893  1.00 9.42  ? 238  TRP D CD2   1 
ATOM   5710 N NE1   . TRP F 3 238 ? 20.739  -5.280  81.079  1.00 10.17 ? 238  TRP D NE1   1 
ATOM   5711 C CE2   . TRP F 3 238 ? 22.036  -5.186  81.515  1.00 10.30 ? 238  TRP D CE2   1 
ATOM   5712 C CE3   . TRP F 3 238 ? 23.274  -5.500  83.579  1.00 10.42 ? 238  TRP D CE3   1 
ATOM   5713 C CZ2   . TRP F 3 238 ? 23.210  -4.847  80.808  1.00 9.78  ? 238  TRP D CZ2   1 
ATOM   5714 C CZ3   . TRP F 3 238 ? 24.435  -5.159  82.879  1.00 9.20  ? 238  TRP D CZ3   1 
ATOM   5715 C CH2   . TRP F 3 238 ? 24.387  -4.830  81.507  1.00 9.41  ? 238  TRP D CH2   1 
ATOM   5716 N N     . GLU F 3 239 ? 20.080  -9.260  83.202  1.00 12.75 ? 239  GLU D N     1 
ATOM   5717 C CA    . GLU F 3 239 ? 20.895  -10.357 82.698  1.00 15.26 ? 239  GLU D CA    1 
ATOM   5718 C C     . GLU F 3 239 ? 21.558  -10.007 81.355  1.00 14.05 ? 239  GLU D C     1 
ATOM   5719 O O     . GLU F 3 239 ? 22.034  -10.907 80.648  1.00 14.31 ? 239  GLU D O     1 
ATOM   5720 C CB    . GLU F 3 239 ? 20.048  -11.618 82.524  1.00 15.00 ? 239  GLU D CB    1 
ATOM   5721 C CG    . GLU F 3 239 ? 19.476  -12.183 83.807  1.00 19.25 ? 239  GLU D CG    1 
ATOM   5722 C CD    . GLU F 3 239 ? 18.631  -13.426 83.570  1.00 20.49 ? 239  GLU D CD    1 
ATOM   5723 O OE1   . GLU F 3 239 ? 18.372  -13.791 82.397  1.00 27.14 ? 239  GLU D OE1   1 
ATOM   5724 O OE2   . GLU F 3 239 ? 18.228  -14.050 84.568  1.00 27.16 ? 239  GLU D OE2   1 
ATOM   5725 N N     . GLY F 3 240 ? 21.580  -8.717  81.014  1.00 13.07 ? 240  GLY D N     1 
ATOM   5726 C CA    . GLY F 3 240 ? 22.235  -8.256  79.772  1.00 12.14 ? 240  GLY D CA    1 
ATOM   5727 C C     . GLY F 3 240 ? 21.250  -7.874  78.683  1.00 12.27 ? 240  GLY D C     1 
ATOM   5728 O O     . GLY F 3 240 ? 21.644  -7.695  77.519  1.00 12.59 ? 240  GLY D O     1 
ATOM   5729 N N     . GLU F 3 241 ? 19.970  -7.750  79.039  1.00 12.12 ? 241  GLU D N     1 
ATOM   5730 C CA    . GLU F 3 241 ? 18.970  -7.256  78.084  1.00 11.57 ? 241  GLU D CA    1 
ATOM   5731 C C     . GLU F 3 241 ? 19.335  -5.863  77.587  1.00 10.42 ? 241  GLU D C     1 
ATOM   5732 O O     . GLU F 3 241 ? 20.019  -5.110  78.282  1.00 9.81  ? 241  GLU D O     1 
ATOM   5733 C CB    . GLU F 3 241 ? 17.582  -7.169  78.729  1.00 12.71 ? 241  GLU D CB    1 
ATOM   5734 C CG    . GLU F 3 241 ? 17.005  -8.500  79.160  1.00 12.75 ? 241  GLU D CG    1 
ATOM   5735 C CD    . GLU F 3 241 ? 17.330  -8.900  80.605  1.00 15.36 ? 241  GLU D CD    1 
ATOM   5736 O OE1   . GLU F 3 241 ? 16.603  -9.782  81.136  1.00 18.29 ? 241  GLU D OE1   1 
ATOM   5737 O OE2   . GLU F 3 241 ? 18.295  -8.377  81.210  1.00 13.72 ? 241  GLU D OE2   1 
ATOM   5738 N N     . ILE F 3 242 ? 18.823  -5.523  76.401  1.00 10.69 ? 242  ILE D N     1 
ATOM   5739 C CA    . ILE F 3 242 ? 18.924  -4.164  75.856  1.00 9.95  ? 242  ILE D CA    1 
ATOM   5740 C C     . ILE F 3 242 ? 18.474  -3.127  76.901  1.00 9.88  ? 242  ILE D C     1 
ATOM   5741 O O     . ILE F 3 242 ? 17.470  -3.339  77.642  1.00 9.97  ? 242  ILE D O     1 
ATOM   5742 C CB    . ILE F 3 242 ? 18.068  -4.043  74.575  1.00 9.84  ? 242  ILE D CB    1 
ATOM   5743 C CG1   . ILE F 3 242 ? 18.779  -4.712  73.384  1.00 10.33 ? 242  ILE D CG1   1 
ATOM   5744 C CG2   . ILE F 3 242 ? 17.721  -2.595  74.263  1.00 12.10 ? 242  ILE D CG2   1 
ATOM   5745 C CD1   . ILE F 3 242 ? 17.830  -5.038  72.219  1.00 14.91 ? 242  ILE D CD1   1 
ATOM   5746 N N     . ILE F 3 243 ? 19.236  -2.037  76.975  1.00 9.99  ? 243  ILE D N     1 
ATOM   5747 C CA    . ILE F 3 243 ? 19.005  -0.984  77.956  1.00 10.28 ? 243  ILE D CA    1 
ATOM   5748 C C     . ILE F 3 243 ? 18.238  0.154   77.289  1.00 10.72 ? 243  ILE D C     1 
ATOM   5749 O O     . ILE F 3 243 ? 18.682  0.692   76.274  1.00 11.28 ? 243  ILE D O     1 
ATOM   5750 C CB    . ILE F 3 243 ? 20.335  -0.435  78.573  1.00 10.73 ? 243  ILE D CB    1 
ATOM   5751 C CG1   . ILE F 3 243 ? 21.145  -1.574  79.221  1.00 11.76 ? 243  ILE D CG1   1 
ATOM   5752 C CG2   . ILE F 3 243 ? 20.047  0.735   79.572  1.00 8.95  ? 243  ILE D CG2   1 
ATOM   5753 C CD1   . ILE F 3 243 ? 22.502  -1.143  79.787  1.00 10.56 ? 243  ILE D CD1   1 
ATOM   5754 N N     . ARG F 3 244 ? 17.121  0.548   77.901  1.00 10.42 ? 244  ARG D N     1 
ATOM   5755 C CA    . ARG F 3 244 ? 16.236  1.591   77.335  1.00 9.92  ? 244  ARG D CA    1 
ATOM   5756 C C     . ARG F 3 244 ? 15.730  2.535   78.427  1.00 10.31 ? 244  ARG D C     1 
ATOM   5757 O O     . ARG F 3 244 ? 15.686  2.152   79.591  1.00 10.61 ? 244  ARG D O     1 
ATOM   5758 C CB    . ARG F 3 244 ? 15.016  0.935   76.685  1.00 10.25 ? 244  ARG D CB    1 
ATOM   5759 C CG    . ARG F 3 244 ? 15.337  -0.293  75.858  1.00 8.47  ? 244  ARG D CG    1 
ATOM   5760 C CD    . ARG F 3 244 ? 14.079  -0.806  75.159  1.00 9.20  ? 244  ARG D CD    1 
ATOM   5761 N NE    . ARG F 3 244 ? 13.023  -1.229  76.089  1.00 10.49 ? 244  ARG D NE    1 
ATOM   5762 C CZ    . ARG F 3 244 ? 11.774  -1.516  75.702  1.00 12.56 ? 244  ARG D CZ    1 
ATOM   5763 N NH1   . ARG F 3 244 ? 11.422  -1.441  74.410  1.00 10.06 ? 244  ARG D NH1   1 
ATOM   5764 N NH2   . ARG F 3 244 ? 10.868  -1.872  76.601  1.00 13.84 ? 244  ARG D NH2   1 
ATOM   5765 N N     . PHE F 3 245 ? 15.352  3.755   78.040  1.00 10.19 ? 245  PHE D N     1 
ATOM   5766 C CA    . PHE F 3 245 ? 14.707  4.696   78.964  1.00 10.32 ? 245  PHE D CA    1 
ATOM   5767 C C     . PHE F 3 245 ? 13.204  4.455   78.882  1.00 10.83 ? 245  PHE D C     1 
ATOM   5768 O O     . PHE F 3 245 ? 12.513  5.013   78.025  1.00 10.43 ? 245  PHE D O     1 
ATOM   5769 C CB    . PHE F 3 245 ? 15.049  6.152   78.617  1.00 10.78 ? 245  PHE D CB    1 
ATOM   5770 C CG    . PHE F 3 245 ? 16.402  6.581   79.097  1.00 10.39 ? 245  PHE D CG    1 
ATOM   5771 C CD1   . PHE F 3 245 ? 16.571  7.090   80.392  1.00 11.47 ? 245  PHE D CD1   1 
ATOM   5772 C CD2   . PHE F 3 245 ? 17.516  6.461   78.265  1.00 11.82 ? 245  PHE D CD2   1 
ATOM   5773 C CE1   . PHE F 3 245 ? 17.810  7.495   80.847  1.00 10.72 ? 245  PHE D CE1   1 
ATOM   5774 C CE2   . PHE F 3 245 ? 18.761  6.870   78.708  1.00 12.28 ? 245  PHE D CE2   1 
ATOM   5775 C CZ    . PHE F 3 245 ? 18.923  7.375   80.014  1.00 11.41 ? 245  PHE D CZ    1 
ATOM   5776 N N     . GLU F 3 246 ? 12.723  3.597   79.775  1.00 11.65 ? 246  GLU D N     1 
ATOM   5777 C CA    . GLU F 3 246 ? 11.309  3.257   79.862  1.00 12.81 ? 246  GLU D CA    1 
ATOM   5778 C C     . GLU F 3 246 ? 10.560  4.265   80.722  1.00 12.97 ? 246  GLU D C     1 
ATOM   5779 O O     . GLU F 3 246 ? 11.132  4.859   81.669  1.00 13.02 ? 246  GLU D O     1 
ATOM   5780 C CB    . GLU F 3 246 ? 11.127  1.860   80.447  1.00 12.84 ? 246  GLU D CB    1 
ATOM   5781 C CG    . GLU F 3 246 ? 11.836  0.749   79.681  1.00 13.46 ? 246  GLU D CG    1 
ATOM   5782 C CD    . GLU F 3 246 ? 11.434  -0.630  80.158  1.00 14.45 ? 246  GLU D CD    1 
ATOM   5783 O OE1   . GLU F 3 246 ? 10.628  -1.267  79.462  1.00 14.35 ? 246  GLU D OE1   1 
ATOM   5784 O OE2   . GLU F 3 246 ? 11.922  -1.093  81.217  1.00 15.86 ? 246  GLU D OE2   1 
ATOM   5785 N N     . THR F 3 247 ? 9.280   4.447   80.390  1.00 12.63 ? 247  THR D N     1 
ATOM   5786 C CA    . THR F 3 247 ? 8.367   5.273   81.189  1.00 13.91 ? 247  THR D CA    1 
ATOM   5787 C C     . THR F 3 247 ? 7.034   4.524   81.334  1.00 14.79 ? 247  THR D C     1 
ATOM   5788 O O     . THR F 3 247 ? 6.809   3.477   80.700  1.00 13.95 ? 247  THR D O     1 
ATOM   5789 C CB    . THR F 3 247 ? 8.101   6.631   80.541  1.00 13.61 ? 247  THR D CB    1 
ATOM   5790 O OG1   . THR F 3 247 ? 7.386   6.438   79.308  1.00 13.60 ? 247  THR D OG1   1 
ATOM   5791 C CG2   . THR F 3 247 ? 9.414   7.407   80.279  1.00 13.21 ? 247  THR D CG2   1 
ATOM   5792 N N     . GLU F 3 248 ? 6.145   5.050   82.168  1.00 17.02 ? 248  GLU D N     1 
ATOM   5793 C CA    . GLU F 3 248 ? 4.822   4.450   82.280  1.00 18.98 ? 248  GLU D CA    1 
ATOM   5794 C C     . GLU F 3 248 ? 4.140   4.414   80.904  1.00 17.69 ? 248  GLU D C     1 
ATOM   5795 O O     . GLU F 3 248 ? 3.488   3.425   80.565  1.00 18.33 ? 248  GLU D O     1 
ATOM   5796 C CB    . GLU F 3 248 ? 3.959   5.206   83.296  1.00 19.51 ? 248  GLU D CB    1 
ATOM   5797 C CG    . GLU F 3 248 ? 2.799   4.351   83.799  1.00 21.62 ? 248  GLU D CG    1 
ATOM   5798 C CD    . GLU F 3 248 ? 1.838   5.100   84.721  1.00 23.54 ? 248  GLU D CD    1 
ATOM   5799 O OE1   . GLU F 3 248 ? 0.897   4.451   85.226  1.00 30.96 ? 248  GLU D OE1   1 
ATOM   5800 O OE2   . GLU F 3 248 ? 2.005   6.323   84.933  1.00 28.87 ? 248  GLU D OE2   1 
ATOM   5801 N N     . GLU F 3 249 ? 4.314   5.486   80.125  1.00 17.51 ? 249  GLU D N     1 
ATOM   5802 C CA    . GLU F 3 249 ? 3.785   5.596   78.757  1.00 17.81 ? 249  GLU D CA    1 
ATOM   5803 C C     . GLU F 3 249 ? 4.347   4.545   77.787  1.00 16.67 ? 249  GLU D C     1 
ATOM   5804 O O     . GLU F 3 249 ? 3.590   3.915   77.036  1.00 16.06 ? 249  GLU D O     1 
ATOM   5805 C CB    . GLU F 3 249 ? 4.069   6.977   78.185  1.00 18.56 ? 249  GLU D CB    1 
ATOM   5806 C CG    . GLU F 3 249 ? 2.998   8.008   78.446  1.00 24.95 ? 249  GLU D CG    1 
ATOM   5807 C CD    . GLU F 3 249 ? 3.307   9.311   77.727  1.00 30.76 ? 249  GLU D CD    1 
ATOM   5808 O OE1   . GLU F 3 249 ? 4.302   9.972   78.103  1.00 34.28 ? 249  GLU D OE1   1 
ATOM   5809 O OE2   . GLU F 3 249 ? 2.563   9.666   76.777  1.00 35.06 ? 249  GLU D OE2   1 
ATOM   5810 N N     . THR F 3 250 ? 5.668   4.361   77.776  1.00 14.97 ? 250  THR D N     1 
ATOM   5811 C CA    . THR F 3 250 ? 6.230   3.361   76.858  1.00 14.40 ? 250  THR D CA    1 
ATOM   5812 C C     . THR F 3 250 ? 5.727   1.972   77.236  1.00 14.65 ? 250  THR D C     1 
ATOM   5813 O O     . THR F 3 250 ? 5.355   1.185   76.372  1.00 14.32 ? 250  THR D O     1 
ATOM   5814 C CB    . THR F 3 250 ? 7.789   3.381   76.765  1.00 14.39 ? 250  THR D CB    1 
ATOM   5815 O OG1   . THR F 3 250 ? 8.378   2.950   78.005  1.00 12.46 ? 250  THR D OG1   1 
ATOM   5816 C CG2   . THR F 3 250 ? 8.284   4.767   76.409  1.00 12.48 ? 250  THR D CG2   1 
ATOM   5817 N N     . ARG F 3 251 ? 5.694   1.682   78.538  1.00 14.96 ? 251  ARG D N     1 
ATOM   5818 C CA    . ARG F 3 251 ? 5.210   0.402   79.028  1.00 16.34 ? 251  ARG D CA    1 
ATOM   5819 C C     . ARG F 3 251 ? 3.748   0.169   78.641  1.00 16.67 ? 251  ARG D C     1 
ATOM   5820 O O     . ARG F 3 251 ? 3.393   -0.893  78.154  1.00 17.18 ? 251  ARG D O     1 
ATOM   5821 C CB    . ARG F 3 251 ? 5.378   0.327   80.538  1.00 16.81 ? 251  ARG D CB    1 
ATOM   5822 C CG    . ARG F 3 251 ? 6.812   0.090   80.978  1.00 18.64 ? 251  ARG D CG    1 
ATOM   5823 C CD    . ARG F 3 251 ? 6.933   0.161   82.485  1.00 23.33 ? 251  ARG D CD    1 
ATOM   5824 N NE    . ARG F 3 251 ? 8.319   -0.010  82.906  1.00 27.10 ? 251  ARG D NE    1 
ATOM   5825 C CZ    . ARG F 3 251 ? 9.071   0.947   83.444  1.00 27.93 ? 251  ARG D CZ    1 
ATOM   5826 N NH1   . ARG F 3 251 ? 8.564   2.154   83.656  1.00 28.53 ? 251  ARG D NH1   1 
ATOM   5827 N NH2   . ARG F 3 251 ? 10.332  0.685   83.784  1.00 28.46 ? 251  ARG D NH2   1 
ATOM   5828 N N     . LYS F 3 252 ? 2.918   1.180   78.854  1.00 16.91 ? 252  LYS D N     1 
ATOM   5829 C CA    . LYS F 3 252 ? 1.486   1.095   78.563  1.00 17.60 ? 252  LYS D CA    1 
ATOM   5830 C C     . LYS F 3 252 ? 1.246   0.773   77.087  1.00 16.91 ? 252  LYS D C     1 
ATOM   5831 O O     . LYS F 3 252 ? 0.442   -0.099  76.746  1.00 17.08 ? 252  LYS D O     1 
ATOM   5832 C CB    . LYS F 3 252 ? 0.833   2.424   78.910  1.00 17.76 ? 252  LYS D CB    1 
ATOM   5833 C CG    . LYS F 3 252 ? -0.645  2.382   79.097  1.00 20.92 ? 252  LYS D CG    1 
ATOM   5834 C CD    . LYS F 3 252 ? -1.165  3.767   79.482  1.00 21.58 ? 252  LYS D CD    1 
ATOM   5835 C CE    . LYS F 3 252 ? -0.854  4.054   80.949  1.00 23.73 ? 252  LYS D CE    1 
ATOM   5836 N NZ    . LYS F 3 252 ? -1.508  5.304   81.395  1.00 24.22 ? 252  LYS D NZ    1 
ATOM   5837 N N     . LEU F 3 253 ? 1.969   1.474   76.224  1.00 16.03 ? 253  LEU D N     1 
ATOM   5838 C CA    . LEU F 3 253 ? 1.828   1.291   74.792  1.00 16.01 ? 253  LEU D CA    1 
ATOM   5839 C C     . LEU F 3 253 ? 2.265   -0.106  74.384  1.00 15.62 ? 253  LEU D C     1 
ATOM   5840 O O     . LEU F 3 253 ? 1.618   -0.738  73.560  1.00 14.84 ? 253  LEU D O     1 
ATOM   5841 C CB    . LEU F 3 253 ? 2.613   2.348   74.027  1.00 15.49 ? 253  LEU D CB    1 
ATOM   5842 C CG    . LEU F 3 253 ? 2.168   2.570   72.581  1.00 16.66 ? 253  LEU D CG    1 
ATOM   5843 C CD1   . LEU F 3 253 ? 0.790   3.278   72.481  1.00 16.31 ? 253  LEU D CD1   1 
ATOM   5844 C CD2   . LEU F 3 253 ? 3.226   3.382   71.855  1.00 15.08 ? 253  LEU D CD2   1 
ATOM   5845 N N     . GLU F 3 254 ? 3.373   -0.579  74.952  1.00 15.56 ? 254  GLU D N     1 
ATOM   5846 C CA    . GLU F 3 254 ? 3.883   -1.900  74.604  1.00 16.33 ? 254  GLU D CA    1 
ATOM   5847 C C     . GLU F 3 254 ? 2.926   -3.025  75.009  1.00 18.02 ? 254  GLU D C     1 
ATOM   5848 O O     . GLU F 3 254 ? 2.737   -3.967  74.252  1.00 18.07 ? 254  GLU D O     1 
ATOM   5849 C CB    . GLU F 3 254 ? 5.288   -2.107  75.174  1.00 16.22 ? 254  GLU D CB    1 
ATOM   5850 C CG    . GLU F 3 254 ? 6.346   -1.371  74.333  1.00 14.98 ? 254  GLU D CG    1 
ATOM   5851 C CD    . GLU F 3 254 ? 7.773   -1.550  74.835  1.00 16.52 ? 254  GLU D CD    1 
ATOM   5852 O OE1   . GLU F 3 254 ? 7.976   -1.809  76.046  1.00 15.70 ? 254  GLU D OE1   1 
ATOM   5853 O OE2   . GLU F 3 254 ? 8.696   -1.415  74.008  1.00 17.29 ? 254  GLU D OE2   1 
ATOM   5854 N N     . ILE F 3 255 ? 2.294   -2.916  76.180  1.00 20.00 ? 255  ILE D N     1 
ATOM   5855 C CA    . ILE F 3 255 ? 1.311   -3.948  76.589  1.00 22.00 ? 255  ILE D CA    1 
ATOM   5856 C C     . ILE F 3 255 ? -0.001  -3.879  75.769  1.00 22.51 ? 255  ILE D C     1 
ATOM   5857 O O     . ILE F 3 255 ? -0.696  -4.890  75.614  1.00 23.57 ? 255  ILE D O     1 
ATOM   5858 C CB    . ILE F 3 255 ? 1.038   -3.958  78.132  1.00 23.22 ? 255  ILE D CB    1 
ATOM   5859 C CG1   . ILE F 3 255 ? 0.698   -2.561  78.635  1.00 24.55 ? 255  ILE D CG1   1 
ATOM   5860 C CG2   . ILE F 3 255 ? 2.221   -4.531  78.902  1.00 24.38 ? 255  ILE D CG2   1 
ATOM   5861 C CD1   . ILE F 3 255 ? 1.081   -2.314  80.107  1.00 26.67 ? 255  ILE D CD1   1 
ATOM   5862 N N     . SER F 3 256 ? -0.293  -2.713  75.196  1.00 22.41 ? 256  SER D N     1 
ATOM   5863 C CA    . SER F 3 256 ? -1.547  -2.453  74.473  1.00 22.61 ? 256  SER D CA    1 
ATOM   5864 C C     . SER F 3 256 ? -1.672  -3.119  73.098  1.00 22.63 ? 256  SER D C     1 
ATOM   5865 O O     . SER F 3 256 ? -2.753  -3.126  72.502  1.00 22.49 ? 256  SER D O     1 
ATOM   5866 C CB    . SER F 3 256 ? -1.741  -0.943  74.298  1.00 22.53 ? 256  SER D CB    1 
ATOM   5867 O OG    . SER F 3 256 ? -1.117  -0.479  73.111  1.00 24.16 ? 256  SER D OG    1 
ATOM   5868 N N     . GLY F 3 257 ? -0.568  -3.632  72.568  1.00 21.86 ? 257  GLY D N     1 
ATOM   5869 C CA    . GLY F 3 257 ? -0.578  -4.126  71.194  1.00 22.43 ? 257  GLY D CA    1 
ATOM   5870 C C     . GLY F 3 257 ? 0.340   -5.309  71.015  1.00 21.84 ? 257  GLY D C     1 
ATOM   5871 O O     . GLY F 3 257 ? 1.102   -5.640  71.909  1.00 22.66 ? 257  GLY D O     1 
ATOM   5872 N N     . MET F 3 258 ? 0.244   -5.960  69.860  1.00 21.72 ? 258  MET D N     1 
ATOM   5873 C CA    . MET F 3 258 ? 1.137   -7.052  69.514  1.00 22.13 ? 258  MET D CA    1 
ATOM   5874 C C     . MET F 3 258 ? 2.440   -6.439  68.961  1.00 19.93 ? 258  MET D C     1 
ATOM   5875 O O     . MET F 3 258 ? 2.378   -5.411  68.287  1.00 19.82 ? 258  MET D O     1 
ATOM   5876 C CB    . MET F 3 258 ? 0.475   -7.930  68.452  1.00 21.97 ? 258  MET D CB    1 
ATOM   5877 C CG    . MET F 3 258 ? 1.018   -9.351  68.377  1.00 24.76 ? 258  MET D CG    1 
ATOM   5878 S SD    . MET F 3 258 ? 0.334   -10.296 66.997  1.00 29.37 ? 258  MET D SD    1 
ATOM   5879 C CE    . MET F 3 258 ? -1.350  -9.658  66.983  1.00 28.78 ? 258  MET D CE    1 
ATOM   5880 N N     . PRO F 3 259 ? 3.606   -7.040  69.275  1.00 18.28 ? 259  PRO D N     1 
ATOM   5881 C CA    . PRO F 3 259 ? 4.843   -6.556  68.645  1.00 17.45 ? 259  PRO D CA    1 
ATOM   5882 C C     . PRO F 3 259 ? 4.790   -6.705  67.128  1.00 16.07 ? 259  PRO D C     1 
ATOM   5883 O O     . PRO F 3 259 ? 4.311   -7.726  66.622  1.00 15.75 ? 259  PRO D O     1 
ATOM   5884 C CB    . PRO F 3 259 ? 5.925   -7.492  69.196  1.00 17.20 ? 259  PRO D CB    1 
ATOM   5885 C CG    . PRO F 3 259 ? 5.372   -8.067  70.430  1.00 18.94 ? 259  PRO D CG    1 
ATOM   5886 C CD    . PRO F 3 259 ? 3.871   -8.134  70.231  1.00 18.31 ? 259  PRO D CD    1 
ATOM   5887 N N     . LEU F 3 260 ? 5.314   -5.707  66.425  1.00 15.31 ? 260  LEU D N     1 
ATOM   5888 C CA    . LEU F 3 260 ? 5.306   -5.698  64.975  1.00 14.63 ? 260  LEU D CA    1 
ATOM   5889 C C     . LEU F 3 260 ? 5.959   -6.971  64.426  1.00 14.25 ? 260  LEU D C     1 
ATOM   5890 O O     . LEU F 3 260 ? 5.574   -7.476  63.359  1.00 14.29 ? 260  LEU D O     1 
ATOM   5891 C CB    . LEU F 3 260 ? 6.035   -4.451  64.452  1.00 13.92 ? 260  LEU D CB    1 
ATOM   5892 C CG    . LEU F 3 260 ? 6.019   -4.191  62.938  1.00 14.40 ? 260  LEU D CG    1 
ATOM   5893 C CD1   . LEU F 3 260 ? 4.623   -3.963  62.359  1.00 16.71 ? 260  LEU D CD1   1 
ATOM   5894 C CD2   . LEU F 3 260 ? 6.912   -3.021  62.620  1.00 16.13 ? 260  LEU D CD2   1 
ATOM   5895 N N     . GLY F 3 261 ? 6.944   -7.484  65.161  1.00 14.34 ? 261  GLY D N     1 
ATOM   5896 C CA    . GLY F 3 261 ? 7.722   -8.644  64.716  1.00 14.91 ? 261  GLY D CA    1 
ATOM   5897 C C     . GLY F 3 261 ? 6.962   -9.951  64.818  1.00 15.58 ? 261  GLY D C     1 
ATOM   5898 O O     . GLY F 3 261 ? 7.344   -10.946 64.223  1.00 15.95 ? 261  GLY D O     1 
ATOM   5899 N N     . ASP F 3 262 ? 5.867   -9.944  65.566  1.00 16.45 ? 262  ASP D N     1 
ATOM   5900 C CA    . ASP F 3 262 ? 4.978   -11.107 65.605  1.00 17.45 ? 262  ASP D CA    1 
ATOM   5901 C C     . ASP F 3 262 ? 3.997   -11.100 64.427  1.00 17.37 ? 262  ASP D C     1 
ATOM   5902 O O     . ASP F 3 262 ? 3.334   -12.116 64.159  1.00 18.31 ? 262  ASP D O     1 
ATOM   5903 C CB    . ASP F 3 262 ? 4.200   -11.139 66.927  1.00 17.66 ? 262  ASP D CB    1 
ATOM   5904 C CG    . ASP F 3 262 ? 5.058   -11.539 68.120  1.00 20.21 ? 262  ASP D CG    1 
ATOM   5905 O OD1   . ASP F 3 262 ? 6.247   -11.895 67.962  1.00 24.15 ? 262  ASP D OD1   1 
ATOM   5906 O OD2   . ASP F 3 262 ? 4.530   -11.504 69.255  1.00 24.21 ? 262  ASP D OD2   1 
ATOM   5907 N N     . LEU F 3 263 ? 3.890   -9.964  63.749  1.00 16.47 ? 263  LEU D N     1 
ATOM   5908 C CA    . LEU F 3 263 ? 3.010   -9.819  62.586  1.00 16.29 ? 263  LEU D CA    1 
ATOM   5909 C C     . LEU F 3 263 ? 3.742   -9.978  61.255  1.00 16.37 ? 263  LEU D C     1 
ATOM   5910 O O     . LEU F 3 263 ? 3.133   -10.348 60.239  1.00 16.75 ? 263  LEU D O     1 
ATOM   5911 C CB    . LEU F 3 263 ? 2.267   -8.485  62.614  1.00 16.95 ? 263  LEU D CB    1 
ATOM   5912 C CG    . LEU F 3 263 ? 1.238   -8.318  63.731  1.00 17.40 ? 263  LEU D CG    1 
ATOM   5913 C CD1   . LEU F 3 263 ? 0.835   -6.858  63.808  1.00 17.56 ? 263  LEU D CD1   1 
ATOM   5914 C CD2   . LEU F 3 263 ? 0.028   -9.247  63.487  1.00 20.70 ? 263  LEU D CD2   1 
ATOM   5915 N N     . PHE F 3 264 ? 5.040   -9.678  61.255  1.00 15.40 ? 264  PHE D N     1 
ATOM   5916 C CA    . PHE F 3 264 ? 5.811   -9.603  60.016  1.00 15.27 ? 264  PHE D CA    1 
ATOM   5917 C C     . PHE F 3 264 ? 7.125   -10.346 60.128  1.00 15.47 ? 264  PHE D C     1 
ATOM   5918 O O     . PHE F 3 264 ? 7.765   -10.319 61.183  1.00 14.93 ? 264  PHE D O     1 
ATOM   5919 C CB    . PHE F 3 264 ? 6.138   -8.134  59.699  1.00 14.69 ? 264  PHE D CB    1 
ATOM   5920 C CG    . PHE F 3 264 ? 4.951   -7.306  59.285  1.00 15.21 ? 264  PHE D CG    1 
ATOM   5921 C CD1   . PHE F 3 264 ? 4.593   -7.196  57.938  1.00 15.93 ? 264  PHE D CD1   1 
ATOM   5922 C CD2   . PHE F 3 264 ? 4.191   -6.620  60.239  1.00 15.22 ? 264  PHE D CD2   1 
ATOM   5923 C CE1   . PHE F 3 264 ? 3.512   -6.424  57.542  1.00 16.81 ? 264  PHE D CE1   1 
ATOM   5924 C CE2   . PHE F 3 264 ? 3.098   -5.830  59.846  1.00 17.12 ? 264  PHE D CE2   1 
ATOM   5925 C CZ    . PHE F 3 264 ? 2.754   -5.740  58.499  1.00 16.31 ? 264  PHE D CZ    1 
ATOM   5926 N N     . HIS F 3 265 ? 7.527   -10.995 59.034  1.00 14.87 ? 265  HIS D N     1 
ATOM   5927 C CA    . HIS F 3 265 ? 8.926   -11.368 58.830  1.00 15.19 ? 265  HIS D CA    1 
ATOM   5928 C C     . HIS F 3 265 ? 9.644   -10.071 58.481  1.00 14.96 ? 265  HIS D C     1 
ATOM   5929 O O     . HIS F 3 265 ? 9.173   -9.322  57.631  1.00 15.31 ? 265  HIS D O     1 
ATOM   5930 C CB    . HIS F 3 265 ? 9.067   -12.341 57.655  1.00 15.71 ? 265  HIS D CB    1 
ATOM   5931 C CG    . HIS F 3 265 ? 8.343   -13.632 57.850  1.00 17.59 ? 265  HIS D CG    1 
ATOM   5932 N ND1   . HIS F 3 265 ? 8.739   -14.570 58.777  1.00 19.48 ? 265  HIS D ND1   1 
ATOM   5933 C CD2   . HIS F 3 265 ? 7.252   -14.146 57.233  1.00 18.87 ? 265  HIS D CD2   1 
ATOM   5934 C CE1   . HIS F 3 265 ? 7.914   -15.602 58.734  1.00 20.06 ? 265  HIS D CE1   1 
ATOM   5935 N NE2   . HIS F 3 265 ? 7.011   -15.375 57.799  1.00 19.63 ? 265  HIS D NE2   1 
ATOM   5936 N N     . ILE F 3 266 ? 10.764  -9.791  59.143  1.00 14.30 ? 266  ILE D N     1 
ATOM   5937 C CA    . ILE F 3 266 ? 11.517  -8.559  58.854  1.00 14.01 ? 266  ILE D CA    1 
ATOM   5938 C C     . ILE F 3 266 ? 12.828  -8.933  58.187  1.00 13.75 ? 266  ILE D C     1 
ATOM   5939 O O     . ILE F 3 266 ? 13.625  -9.683  58.745  1.00 13.47 ? 266  ILE D O     1 
ATOM   5940 C CB    . ILE F 3 266 ? 11.799  -7.706  60.113  1.00 14.46 ? 266  ILE D CB    1 
ATOM   5941 C CG1   . ILE F 3 266 ? 10.490  -7.405  60.859  1.00 14.82 ? 266  ILE D CG1   1 
ATOM   5942 C CG2   . ILE F 3 266 ? 12.547  -6.398  59.725  1.00 13.74 ? 266  ILE D CG2   1 
ATOM   5943 C CD1   . ILE F 3 266 ? 10.676  -6.783  62.225  1.00 15.06 ? 266  ILE D CD1   1 
ATOM   5944 N N     . ARG F 3 267 ? 13.014  -8.424  56.978  1.00 12.25 ? 267  ARG D N     1 
ATOM   5945 C CA    . ARG F 3 267 ? 14.219  -8.704  56.192  1.00 12.04 ? 267  ARG D CA    1 
ATOM   5946 C C     . ARG F 3 267 ? 14.905  -7.385  55.870  1.00 11.28 ? 267  ARG D C     1 
ATOM   5947 O O     . ARG F 3 267 ? 14.287  -6.326  55.995  1.00 11.53 ? 267  ARG D O     1 
ATOM   5948 C CB    . ARG F 3 267 ? 13.835  -9.408  54.889  1.00 11.93 ? 267  ARG D CB    1 
ATOM   5949 C CG    . ARG F 3 267 ? 13.108  -10.743 55.113  1.00 14.03 ? 267  ARG D CG    1 
ATOM   5950 C CD    . ARG F 3 267 ? 13.983  -11.714 55.872  1.00 18.47 ? 267  ARG D CD    1 
ATOM   5951 N NE    . ARG F 3 267 ? 13.326  -13.013 56.038  1.00 24.75 ? 267  ARG D NE    1 
ATOM   5952 C CZ    . ARG F 3 267 ? 12.956  -13.518 57.210  1.00 26.20 ? 267  ARG D CZ    1 
ATOM   5953 N NH1   . ARG F 3 267 ? 13.181  -12.843 58.337  1.00 26.81 ? 267  ARG D NH1   1 
ATOM   5954 N NH2   . ARG F 3 267 ? 12.356  -14.704 57.252  1.00 28.00 ? 267  ARG D NH2   1 
ATOM   5955 N N     . PHE F 3 268 ? 16.172  -7.447  55.466  1.00 10.61 ? 268  PHE D N     1 
ATOM   5956 C CA    . PHE F 3 268 ? 16.866  -6.222  55.032  1.00 10.24 ? 268  PHE D CA    1 
ATOM   5957 C C     . PHE F 3 268 ? 17.084  -6.264  53.535  1.00 10.23 ? 268  PHE D C     1 
ATOM   5958 O O     . PHE F 3 268 ? 17.082  -7.338  52.930  1.00 10.82 ? 268  PHE D O     1 
ATOM   5959 C CB    . PHE F 3 268 ? 18.220  -6.012  55.741  1.00 10.19 ? 268  PHE D CB    1 
ATOM   5960 C CG    . PHE F 3 268 ? 18.565  -4.559  55.928  1.00 9.18  ? 268  PHE D CG    1 
ATOM   5961 C CD1   . PHE F 3 268 ? 19.522  -3.922  55.125  1.00 7.97  ? 268  PHE D CD1   1 
ATOM   5962 C CD2   . PHE F 3 268 ? 17.894  -3.809  56.897  1.00 8.74  ? 268  PHE D CD2   1 
ATOM   5963 C CE1   . PHE F 3 268 ? 19.813  -2.552  55.298  1.00 10.14 ? 268  PHE D CE1   1 
ATOM   5964 C CE2   . PHE F 3 268 ? 18.183  -2.440  57.081  1.00 9.68  ? 268  PHE D CE2   1 
ATOM   5965 C CZ    . PHE F 3 268 ? 19.135  -1.808  56.281  1.00 9.56  ? 268  PHE D CZ    1 
ATOM   5966 N N     . ALA F 3 269 ? 17.282  -5.089  52.948  1.00 10.23 ? 269  ALA D N     1 
ATOM   5967 C CA    . ALA F 3 269 ? 17.620  -4.988  51.521  1.00 10.00 ? 269  ALA D CA    1 
ATOM   5968 C C     . ALA F 3 269 ? 18.891  -5.778  51.179  1.00 10.55 ? 269  ALA D C     1 
ATOM   5969 O O     . ALA F 3 269 ? 19.808  -5.935  52.013  1.00 9.83  ? 269  ALA D O     1 
ATOM   5970 C CB    . ALA F 3 269 ? 17.800  -3.539  51.126  1.00 10.79 ? 269  ALA D CB    1 
ATOM   5971 N N     . ALA F 3 270 ? 18.932  -6.283  49.943  1.00 10.36 ? 270  ALA D N     1 
ATOM   5972 C CA    . ALA F 3 270 ? 20.200  -6.744  49.362  1.00 10.28 ? 270  ALA D CA    1 
ATOM   5973 C C     . ALA F 3 270 ? 21.201  -5.580  49.467  1.00 10.16 ? 270  ALA D C     1 
ATOM   5974 O O     . ALA F 3 270 ? 20.809  -4.423  49.373  1.00 10.17 ? 270  ALA D O     1 
ATOM   5975 C CB    . ALA F 3 270 ? 20.000  -7.150  47.911  1.00 10.35 ? 270  ALA D CB    1 
ATOM   5976 N N     . ARG F 3 271 ? 22.481  -5.884  49.680  1.00 9.44  ? 271  ARG D N     1 
ATOM   5977 C CA    . ARG F 3 271 ? 23.487  -4.843  49.924  1.00 9.39  ? 271  ARG D CA    1 
ATOM   5978 C C     . ARG F 3 271 ? 24.094  -4.407  48.607  1.00 9.69  ? 271  ARG D C     1 
ATOM   5979 O O     . ARG F 3 271 ? 23.993  -5.123  47.618  1.00 10.33 ? 271  ARG D O     1 
ATOM   5980 C CB    . ARG F 3 271 ? 24.592  -5.336  50.863  1.00 9.29  ? 271  ARG D CB    1 
ATOM   5981 C CG    . ARG F 3 271 ? 24.081  -6.237  52.027  1.00 8.29  ? 271  ARG D CG    1 
ATOM   5982 C CD    . ARG F 3 271 ? 23.008  -5.549  52.907  1.00 7.70  ? 271  ARG D CD    1 
ATOM   5983 N NE    . ARG F 3 271 ? 23.395  -4.204  53.353  1.00 8.30  ? 271  ARG D NE    1 
ATOM   5984 C CZ    . ARG F 3 271 ? 22.721  -3.075  53.083  1.00 10.01 ? 271  ARG D CZ    1 
ATOM   5985 N NH1   . ARG F 3 271 ? 21.629  -3.087  52.310  1.00 8.93  ? 271  ARG D NH1   1 
ATOM   5986 N NH2   . ARG F 3 271 ? 23.155  -1.907  53.560  1.00 8.65  ? 271  ARG D NH2   1 
ATOM   5987 N N     . SER F 3 272 ? 24.757  -3.254  48.617  1.00 9.08  ? 272  SER D N     1 
ATOM   5988 C CA    . SER F 3 272 ? 25.342  -2.700  47.390  1.00 9.80  ? 272  SER D CA    1 
ATOM   5989 C C     . SER F 3 272 ? 26.188  -3.687  46.541  1.00 9.91  ? 272  SER D C     1 
ATOM   5990 O O     . SER F 3 272 ? 25.979  -3.713  45.329  1.00 11.07 ? 272  SER D O     1 
ATOM   5991 C CB    . SER F 3 272 ? 26.105  -1.399  47.670  1.00 9.44  ? 272  SER D CB    1 
ATOM   5992 O OG    . SER F 3 272 ? 27.251  -1.621  48.467  1.00 10.95 ? 272  SER D OG    1 
ATOM   5993 N N     . PRO F 3 273 ? 27.089  -4.508  47.151  1.00 10.04 ? 273  PRO D N     1 
ATOM   5994 C CA    . PRO F 3 273 ? 27.900  -5.434  46.334  1.00 10.59 ? 273  PRO D CA    1 
ATOM   5995 C C     . PRO F 3 273 ? 27.078  -6.474  45.585  1.00 10.61 ? 273  PRO D C     1 
ATOM   5996 O O     . PRO F 3 273 ? 27.496  -6.934  44.514  1.00 11.84 ? 273  PRO D O     1 
ATOM   5997 C CB    . PRO F 3 273 ? 28.810  -6.128  47.373  1.00 10.61 ? 273  PRO D CB    1 
ATOM   5998 C CG    . PRO F 3 273 ? 28.894  -5.105  48.486  1.00 11.41 ? 273  PRO D CG    1 
ATOM   5999 C CD    . PRO F 3 273 ? 27.472  -4.627  48.575  1.00 10.07 ? 273  PRO D CD    1 
ATOM   6000 N N     . GLU F 3 274 ? 25.920  -6.828  46.133  1.00 10.77 ? 274  GLU D N     1 
ATOM   6001 C CA    . GLU F 3 274 ? 25.036  -7.783  45.497  1.00 11.21 ? 274  GLU D CA    1 
ATOM   6002 C C     . GLU F 3 274 ? 24.487  -7.213  44.203  1.00 11.26 ? 274  GLU D C     1 
ATOM   6003 O O     . GLU F 3 274 ? 24.361  -7.935  43.195  1.00 11.94 ? 274  GLU D O     1 
ATOM   6004 C CB    . GLU F 3 274 ? 23.884  -8.151  46.422  1.00 10.73 ? 274  GLU D CB    1 
ATOM   6005 C CG    . GLU F 3 274 ? 24.322  -8.789  47.725  1.00 12.08 ? 274  GLU D CG    1 
ATOM   6006 C CD    . GLU F 3 274 ? 23.141  -9.376  48.474  1.00 11.58 ? 274  GLU D CD    1 
ATOM   6007 O OE1   . GLU F 3 274 ? 22.526  -10.352 47.959  1.00 13.04 ? 274  GLU D OE1   1 
ATOM   6008 O OE2   . GLU F 3 274 ? 22.814  -8.856  49.559  1.00 10.19 ? 274  GLU D OE2   1 
ATOM   6009 N N     . PHE F 3 275 ? 24.193  -5.915  44.216  1.00 10.21 ? 275  PHE D N     1 
ATOM   6010 C CA    . PHE F 3 275 ? 23.710  -5.236  43.009  1.00 11.06 ? 275  PHE D CA    1 
ATOM   6011 C C     . PHE F 3 275 ? 24.846  -5.086  42.023  1.00 12.43 ? 275  PHE D C     1 
ATOM   6012 O O     . PHE F 3 275 ? 24.681  -5.410  40.850  1.00 11.26 ? 275  PHE D O     1 
ATOM   6013 C CB    . PHE F 3 275 ? 23.077  -3.881  43.349  1.00 10.51 ? 275  PHE D CB    1 
ATOM   6014 C CG    . PHE F 3 275 ? 21.707  -3.999  43.904  1.00 10.93 ? 275  PHE D CG    1 
ATOM   6015 C CD1   . PHE F 3 275 ? 20.603  -4.083  43.051  1.00 10.87 ? 275  PHE D CD1   1 
ATOM   6016 C CD2   . PHE F 3 275 ? 21.503  -4.040  45.277  1.00 12.02 ? 275  PHE D CD2   1 
ATOM   6017 C CE1   . PHE F 3 275 ? 19.300  -4.185  43.588  1.00 11.26 ? 275  PHE D CE1   1 
ATOM   6018 C CE2   . PHE F 3 275 ? 20.208  -4.148  45.815  1.00 10.33 ? 275  PHE D CE2   1 
ATOM   6019 C CZ    . PHE F 3 275 ? 19.121  -4.227  44.967  1.00 10.97 ? 275  PHE D CZ    1 
ATOM   6020 N N     . LYS F 3 276 ? 26.014  -4.663  42.519  1.00 12.79 ? 276  LYS D N     1 
ATOM   6021 C CA    . LYS F 3 276 ? 27.170  -4.409  41.655  1.00 15.39 ? 276  LYS D CA    1 
ATOM   6022 C C     . LYS F 3 276 ? 27.584  -5.647  40.866  1.00 15.96 ? 276  LYS D C     1 
ATOM   6023 O O     . LYS F 3 276 ? 28.112  -5.528  39.761  1.00 17.64 ? 276  LYS D O     1 
ATOM   6024 C CB    . LYS F 3 276 ? 28.351  -3.877  42.463  1.00 15.71 ? 276  LYS D CB    1 
ATOM   6025 C CG    . LYS F 3 276 ? 28.154  -2.406  42.814  1.00 17.77 ? 276  LYS D CG    1 
ATOM   6026 C CD    . LYS F 3 276 ? 29.376  -1.819  43.488  1.00 22.57 ? 276  LYS D CD    1 
ATOM   6027 C CE    . LYS F 3 276 ? 29.309  -1.980  44.985  1.00 25.57 ? 276  LYS D CE    1 
ATOM   6028 N NZ    . LYS F 3 276 ? 30.420  -1.251  45.662  1.00 25.74 ? 276  LYS D NZ    1 
ATOM   6029 N N     . LYS F 3 277 ? 27.332  -6.824  41.420  1.00 16.35 ? 277  LYS D N     1 
ATOM   6030 C CA    . LYS F 3 277 ? 27.738  -8.065  40.761  1.00 17.24 ? 277  LYS D CA    1 
ATOM   6031 C C     . LYS F 3 277 ? 26.632  -8.697  39.919  1.00 16.37 ? 277  LYS D C     1 
ATOM   6032 O O     . LYS F 3 277 ? 26.858  -9.719  39.277  1.00 17.90 ? 277  LYS D O     1 
ATOM   6033 C CB    . LYS F 3 277 ? 28.315  -9.065  41.759  1.00 16.84 ? 277  LYS D CB    1 
ATOM   6034 C CG    . LYS F 3 277 ? 27.326  -9.741  42.689  1.00 18.24 ? 277  LYS D CG    1 
ATOM   6035 C CD    . LYS F 3 277 ? 28.026  -10.838 43.505  1.00 20.12 ? 277  LYS D CD    1 
ATOM   6036 C CE    . LYS F 3 277 ? 27.129  -11.306 44.616  1.00 23.75 ? 277  LYS D CE    1 
ATOM   6037 N NZ    . LYS F 3 277 ? 27.520  -12.664 45.092  1.00 28.92 ? 277  LYS D NZ    1 
ATOM   6038 N N     . HIS F 3 278 ? 25.439  -8.109  39.932  1.00 14.56 ? 278  HIS D N     1 
ATOM   6039 C CA    . HIS F 3 278 ? 24.315  -8.705  39.211  1.00 13.73 ? 278  HIS D CA    1 
ATOM   6040 C C     . HIS F 3 278 ? 24.335  -8.346  37.715  1.00 13.17 ? 278  HIS D C     1 
ATOM   6041 O O     . HIS F 3 278 ? 24.506  -7.170  37.360  1.00 12.06 ? 278  HIS D O     1 
ATOM   6042 C CB    . HIS F 3 278 ? 22.990  -8.302  39.844  1.00 13.89 ? 278  HIS D CB    1 
ATOM   6043 C CG    . HIS F 3 278 ? 21.823  -9.024  39.258  1.00 15.11 ? 278  HIS D CG    1 
ATOM   6044 N ND1   . HIS F 3 278 ? 21.266  -10.138 39.847  1.00 20.11 ? 278  HIS D ND1   1 
ATOM   6045 C CD2   . HIS F 3 278 ? 21.154  -8.834  38.098  1.00 16.42 ? 278  HIS D CD2   1 
ATOM   6046 C CE1   . HIS F 3 278 ? 20.277  -10.584 39.092  1.00 18.09 ? 278  HIS D CE1   1 
ATOM   6047 N NE2   . HIS F 3 278 ? 20.178  -9.803  38.032  1.00 20.75 ? 278  HIS D NE2   1 
ATOM   6048 N N     . PRO F 3 279 ? 24.155  -9.360  36.829  1.00 13.28 ? 279  PRO D N     1 
ATOM   6049 C CA    . PRO F 3 279 ? 24.298  -9.090  35.391  1.00 13.44 ? 279  PRO D CA    1 
ATOM   6050 C C     . PRO F 3 279 ? 23.315  -8.079  34.796  1.00 13.43 ? 279  PRO D C     1 
ATOM   6051 O O     . PRO F 3 279 ? 23.605  -7.537  33.741  1.00 14.96 ? 279  PRO D O     1 
ATOM   6052 C CB    . PRO F 3 279 ? 24.089  -10.471 34.742  1.00 13.25 ? 279  PRO D CB    1 
ATOM   6053 C CG    . PRO F 3 279 ? 23.252  -11.217 35.726  1.00 13.97 ? 279  PRO D CG    1 
ATOM   6054 C CD    . PRO F 3 279 ? 23.842  -10.785 37.065  1.00 12.84 ? 279  PRO D CD    1 
ATOM   6055 N N     . ALA F 3 280 ? 22.179  -7.832  35.448  1.00 13.49 ? 280  ALA D N     1 
ATOM   6056 C CA    . ALA F 3 280 ? 21.169  -6.897  34.910  1.00 13.65 ? 280  ALA D CA    1 
ATOM   6057 C C     . ALA F 3 280 ? 21.407  -5.445  35.350  1.00 12.71 ? 280  ALA D C     1 
ATOM   6058 O O     . ALA F 3 280 ? 20.830  -4.522  34.792  1.00 13.11 ? 280  ALA D O     1 
ATOM   6059 C CB    . ALA F 3 280 ? 19.765  -7.352  35.336  1.00 14.64 ? 280  ALA D CB    1 
ATOM   6060 N N     . VAL F 3 281 ? 22.249  -5.254  36.364  1.00 12.15 ? 281  VAL D N     1 
ATOM   6061 C CA    . VAL F 3 281 ? 22.476  -3.923  36.916  1.00 12.22 ? 281  VAL D CA    1 
ATOM   6062 C C     . VAL F 3 281 ? 23.404  -3.101  36.025  1.00 12.68 ? 281  VAL D C     1 
ATOM   6063 O O     . VAL F 3 281 ? 24.397  -3.623  35.504  1.00 11.73 ? 281  VAL D O     1 
ATOM   6064 C CB    . VAL F 3 281 ? 23.009  -3.994  38.381  1.00 12.39 ? 281  VAL D CB    1 
ATOM   6065 C CG1   . VAL F 3 281 ? 23.465  -2.628  38.881  1.00 12.44 ? 281  VAL D CG1   1 
ATOM   6066 C CG2   . VAL F 3 281 ? 21.927  -4.566  39.288  1.00 13.62 ? 281  VAL D CG2   1 
ATOM   6067 N N     . ARG F 3 282 ? 23.055  -1.824  35.878  1.00 12.83 ? 282  ARG D N     1 
ATOM   6068 C CA    . ARG F 3 282 ? 23.809  -0.850  35.087  1.00 14.38 ? 282  ARG D CA    1 
ATOM   6069 C C     . ARG F 3 282 ? 24.131  0.438   35.874  1.00 15.25 ? 282  ARG D C     1 
ATOM   6070 O O     . ARG F 3 282 ? 23.464  0.779   36.860  1.00 14.35 ? 282  ARG D O     1 
ATOM   6071 C CB    . ARG F 3 282 ? 22.986  -0.485  33.839  1.00 14.47 ? 282  ARG D CB    1 
ATOM   6072 C CG    . ARG F 3 282 ? 22.714  -1.672  32.897  1.00 16.45 ? 282  ARG D CG    1 
ATOM   6073 C CD    . ARG F 3 282 ? 24.009  -2.155  32.249  1.00 17.77 ? 282  ARG D CD    1 
ATOM   6074 N NE    . ARG F 3 282 ? 23.791  -3.251  31.309  1.00 18.49 ? 282  ARG D NE    1 
ATOM   6075 C CZ    . ARG F 3 282 ? 23.792  -4.549  31.614  1.00 21.67 ? 282  ARG D CZ    1 
ATOM   6076 N NH1   . ARG F 3 282 ? 24.009  -4.970  32.864  1.00 19.63 ? 282  ARG D NH1   1 
ATOM   6077 N NH2   . ARG F 3 282 ? 23.581  -5.447  30.648  1.00 21.87 ? 282  ARG D NH2   1 
ATOM   6078 N N     . LYS F 3 283 ? 25.136  1.171   35.399  1.00 16.92 ? 283  LYS D N     1 
ATOM   6079 C CA    . LYS F 3 283 ? 25.551  2.422   36.023  1.00 19.41 ? 283  LYS D CA    1 
ATOM   6080 C C     . LYS F 3 283 ? 24.949  3.664   35.352  1.00 19.01 ? 283  LYS D C     1 
ATOM   6081 O O     . LYS F 3 283 ? 25.261  4.797   35.716  1.00 19.31 ? 283  LYS D O     1 
ATOM   6082 C CB    . LYS F 3 283 ? 27.080  2.495   36.053  1.00 20.44 ? 283  LYS D CB    1 
ATOM   6083 C CG    . LYS F 3 283 ? 27.703  2.227   37.447  1.00 24.65 ? 283  LYS D CG    1 
ATOM   6084 C CD    . LYS F 3 283 ? 27.829  0.742   37.799  1.00 29.23 ? 283  LYS D CD    1 
ATOM   6085 C CE    . LYS F 3 283 ? 28.313  0.555   39.249  1.00 28.77 ? 283  LYS D CE    1 
ATOM   6086 N NZ    . LYS F 3 283 ? 28.727  -0.840  39.610  1.00 31.90 ? 283  LYS D NZ    1 
ATOM   6087 N N     . GLU F 3 284 ? 24.073  3.435   34.376  1.00 19.62 ? 284  GLU D N     1 
ATOM   6088 C CA    . GLU F 3 284 ? 23.445  4.505   33.606  1.00 19.92 ? 284  GLU D CA    1 
ATOM   6089 C C     . GLU F 3 284 ? 21.987  4.142   33.352  1.00 19.64 ? 284  GLU D C     1 
ATOM   6090 O O     . GLU F 3 284 ? 21.660  2.958   33.263  1.00 19.55 ? 284  GLU D O     1 
ATOM   6091 C CB    . GLU F 3 284 ? 24.152  4.713   32.250  1.00 20.20 ? 284  GLU D CB    1 
ATOM   6092 C CG    . GLU F 3 284 ? 25.646  5.141   32.313  1.00 23.26 ? 284  GLU D CG    1 
ATOM   6093 C CD    . GLU F 3 284 ? 25.874  6.507   32.964  1.00 26.26 ? 284  GLU D CD    1 
ATOM   6094 O OE1   . GLU F 3 284 ? 24.942  7.341   32.994  1.00 27.29 ? 284  GLU D OE1   1 
ATOM   6095 O OE2   . GLU F 3 284 ? 27.005  6.742   33.450  1.00 28.51 ? 284  GLU D OE2   1 
ATOM   6096 N N     . PRO F 3 285 ? 21.107  5.156   33.235  1.00 19.92 ? 285  PRO D N     1 
ATOM   6097 C CA    . PRO F 3 285 ? 19.698  4.870   32.958  1.00 20.03 ? 285  PRO D CA    1 
ATOM   6098 C C     . PRO F 3 285 ? 19.542  4.360   31.534  1.00 20.66 ? 285  PRO D C     1 
ATOM   6099 O O     . PRO F 3 285 ? 20.462  4.501   30.733  1.00 20.17 ? 285  PRO D O     1 
ATOM   6100 C CB    . PRO F 3 285 ? 19.022  6.238   33.124  1.00 20.57 ? 285  PRO D CB    1 
ATOM   6101 C CG    . PRO F 3 285 ? 20.088  7.235   32.899  1.00 20.15 ? 285  PRO D CG    1 
ATOM   6102 C CD    . PRO F 3 285 ? 21.377  6.609   33.317  1.00 20.29 ? 285  PRO D CD    1 
ATOM   6103 N N     . GLY F 3 286 ? 18.397  3.761   31.220  1.00 21.01 ? 286  GLY D N     1 
ATOM   6104 C CA    . GLY F 3 286 ? 18.132  3.325   29.850  1.00 21.79 ? 286  GLY D CA    1 
ATOM   6105 C C     . GLY F 3 286 ? 16.797  2.628   29.740  1.00 23.07 ? 286  GLY D C     1 
ATOM   6106 O O     . GLY F 3 286 ? 16.053  2.574   30.733  1.00 22.14 ? 286  GLY D O     1 
ATOM   6107 N N     . PRO F 3 287 ? 16.492  2.080   28.538  1.00 23.61 ? 287  PRO D N     1 
ATOM   6108 C CA    . PRO F 3 287 ? 15.209  1.433   28.285  1.00 23.65 ? 287  PRO D CA    1 
ATOM   6109 C C     . PRO F 3 287 ? 14.976  0.307   29.267  1.00 23.01 ? 287  PRO D C     1 
ATOM   6110 O O     . PRO F 3 287 ? 15.805  -0.608  29.406  1.00 23.61 ? 287  PRO D O     1 
ATOM   6111 C CB    . PRO F 3 287 ? 15.352  0.884   26.859  1.00 23.59 ? 287  PRO D CB    1 
ATOM   6112 C CG    . PRO F 3 287 ? 16.369  1.746   26.231  1.00 24.68 ? 287  PRO D CG    1 
ATOM   6113 C CD    . PRO F 3 287 ? 17.357  2.035   27.343  1.00 24.08 ? 287  PRO D CD    1 
ATOM   6114 N N     . GLY F 3 288 ? 13.865  0.416   29.970  1.00 21.68 ? 288  GLY D N     1 
ATOM   6115 C CA    . GLY F 3 288 ? 13.438  -0.609  30.863  1.00 20.21 ? 288  GLY D CA    1 
ATOM   6116 C C     . GLY F 3 288 ? 14.236  -0.677  32.147  1.00 18.72 ? 288  GLY D C     1 
ATOM   6117 O O     . GLY F 3 288 ? 14.167  -1.683  32.819  1.00 19.98 ? 288  GLY D O     1 
ATOM   6118 N N     . LEU F 3 289 ? 14.983  0.378   32.486  1.00 17.05 ? 289  LEU D N     1 
ATOM   6119 C CA    . LEU F 3 289 ? 15.710  0.408   33.777  1.00 15.38 ? 289  LEU D CA    1 
ATOM   6120 C C     . LEU F 3 289 ? 15.035  1.361   34.773  1.00 14.52 ? 289  LEU D C     1 
ATOM   6121 O O     . LEU F 3 289 ? 14.593  2.446   34.397  1.00 15.37 ? 289  LEU D O     1 
ATOM   6122 C CB    . LEU F 3 289 ? 17.178  0.829   33.578  1.00 15.29 ? 289  LEU D CB    1 
ATOM   6123 C CG    . LEU F 3 289 ? 18.054  0.017   32.610  1.00 14.97 ? 289  LEU D CG    1 
ATOM   6124 C CD1   . LEU F 3 289 ? 19.519  0.490   32.597  1.00 17.40 ? 289  LEU D CD1   1 
ATOM   6125 C CD2   . LEU F 3 289 ? 17.992  -1.465  32.888  1.00 15.72 ? 289  LEU D CD2   1 
ATOM   6126 N N     . VAL F 3 290 ? 14.963  0.938   36.041  1.00 13.31 ? 290  VAL D N     1 
ATOM   6127 C CA    . VAL F 3 290 ? 14.484  1.777   37.138  1.00 12.32 ? 290  VAL D CA    1 
ATOM   6128 C C     . VAL F 3 290 ? 15.621  1.990   38.139  1.00 12.10 ? 290  VAL D C     1 
ATOM   6129 O O     . VAL F 3 290 ? 16.550  1.204   38.174  1.00 10.77 ? 290  VAL D O     1 
ATOM   6130 C CB    . VAL F 3 290 ? 13.240  1.166   37.853  1.00 12.65 ? 290  VAL D CB    1 
ATOM   6131 C CG1   . VAL F 3 290 ? 12.080  0.943   36.835  1.00 12.32 ? 290  VAL D CG1   1 
ATOM   6132 C CG2   . VAL F 3 290 ? 13.576  -0.129  38.585  1.00 13.05 ? 290  VAL D CG2   1 
ATOM   6133 N N     . PRO F 3 291 ? 15.567  3.079   38.917  1.00 11.52 ? 291  PRO D N     1 
ATOM   6134 C CA    . PRO F 3 291 ? 16.612  3.280   39.927  1.00 11.44 ? 291  PRO D CA    1 
ATOM   6135 C C     . PRO F 3 291 ? 16.540  2.231   41.019  1.00 10.89 ? 291  PRO D C     1 
ATOM   6136 O O     . PRO F 3 291 ? 15.438  1.853   41.444  1.00 11.26 ? 291  PRO D O     1 
ATOM   6137 C CB    . PRO F 3 291 ? 16.305  4.680   40.505  1.00 11.67 ? 291  PRO D CB    1 
ATOM   6138 C CG    . PRO F 3 291 ? 14.945  5.030   40.039  1.00 13.26 ? 291  PRO D CG    1 
ATOM   6139 C CD    . PRO F 3 291 ? 14.589  4.181   38.871  1.00 12.29 ? 291  PRO D CD    1 
ATOM   6140 N N     . VAL F 3 292 ? 17.711  1.764   41.460  1.00 10.74 ? 292  VAL D N     1 
ATOM   6141 C CA    . VAL F 3 292 ? 17.804  0.982   42.683  1.00 10.56 ? 292  VAL D CA    1 
ATOM   6142 C C     . VAL F 3 292 ? 17.659  1.978   43.841  1.00 10.24 ? 292  VAL D C     1 
ATOM   6143 O O     . VAL F 3 292 ? 18.445  2.932   43.974  1.00 10.47 ? 292  VAL D O     1 
ATOM   6144 C CB    . VAL F 3 292 ? 19.150  0.230   42.788  1.00 10.19 ? 292  VAL D CB    1 
ATOM   6145 C CG1   . VAL F 3 292 ? 19.254  -0.502  44.108  1.00 11.46 ? 292  VAL D CG1   1 
ATOM   6146 C CG2   . VAL F 3 292 ? 19.298  -0.773  41.624  1.00 10.51 ? 292  VAL D CG2   1 
ATOM   6147 N N     . LEU F 3 293 ? 16.634  1.765   44.648  1.00 9.38  ? 293  LEU D N     1 
ATOM   6148 C CA    . LEU F 3 293 ? 16.207  2.751   45.631  1.00 9.77  ? 293  LEU D CA    1 
ATOM   6149 C C     . LEU F 3 293 ? 17.078  2.693   46.894  1.00 9.78  ? 293  LEU D C     1 
ATOM   6150 O O     . LEU F 3 293 ? 17.620  1.644   47.231  1.00 10.06 ? 293  LEU D O     1 
ATOM   6151 C CB    . LEU F 3 293 ? 14.747  2.496   45.993  1.00 8.78  ? 293  LEU D CB    1 
ATOM   6152 C CG    . LEU F 3 293 ? 13.739  2.610   44.823  1.00 8.93  ? 293  LEU D CG    1 
ATOM   6153 C CD1   . LEU F 3 293 ? 12.336  2.447   45.373  1.00 9.58  ? 293  LEU D CD1   1 
ATOM   6154 C CD2   . LEU F 3 293 ? 13.883  3.913   44.065  1.00 9.55  ? 293  LEU D CD2   1 
ATOM   6155 N N     . THR F 3 294 ? 17.234  3.828   47.568  1.00 10.06 ? 294  THR D N     1 
ATOM   6156 C CA    . THR F 3 294 ? 17.918  3.839   48.868  1.00 10.15 ? 294  THR D CA    1 
ATOM   6157 C C     . THR F 3 294 ? 17.024  4.474   49.912  1.00 9.84  ? 294  THR D C     1 
ATOM   6158 O O     . THR F 3 294 ? 15.888  4.822   49.631  1.00 10.54 ? 294  THR D O     1 
ATOM   6159 C CB    . THR F 3 294 ? 19.283  4.603   48.825  1.00 10.21 ? 294  THR D CB    1 
ATOM   6160 O OG1   . THR F 3 294 ? 19.057  5.999   48.729  1.00 10.50 ? 294  THR D OG1   1 
ATOM   6161 C CG2   . THR F 3 294 ? 20.135  4.143   47.651  1.00 10.92 ? 294  THR D CG2   1 
ATOM   6162 N N     . GLY F 3 295 ? 17.544  4.653   51.127  1.00 9.36  ? 295  GLY D N     1 
ATOM   6163 C CA    . GLY F 3 295 ? 16.784  5.372   52.155  1.00 10.74 ? 295  GLY D CA    1 
ATOM   6164 C C     . GLY F 3 295 ? 16.342  6.781   51.757  1.00 10.99 ? 295  GLY D C     1 
ATOM   6165 O O     . GLY F 3 295 ? 15.332  7.286   52.256  1.00 12.08 ? 295  GLY D O     1 
ATOM   6166 N N     . ARG F 3 296 ? 17.080  7.396   50.841  1.00 11.54 ? 296  ARG D N     1 
ATOM   6167 C CA    . ARG F 3 296 ? 16.752  8.722   50.350  1.00 12.85 ? 296  ARG D CA    1 
ATOM   6168 C C     . ARG F 3 296 ? 15.463  8.711   49.533  1.00 13.07 ? 296  ARG D C     1 
ATOM   6169 O O     . ARG F 3 296 ? 14.852  9.764   49.304  1.00 14.02 ? 296  ARG D O     1 
ATOM   6170 C CB    . ARG F 3 296 ? 17.930  9.304   49.554  1.00 13.60 ? 296  ARG D CB    1 
ATOM   6171 C CG    . ARG F 3 296 ? 19.179  9.476   50.419  1.00 14.94 ? 296  ARG D CG    1 
ATOM   6172 C CD    . ARG F 3 296 ? 20.166  10.416  49.780  1.00 18.81 ? 296  ARG D CD    1 
ATOM   6173 N NE    . ARG F 3 296 ? 21.070  11.013  50.757  1.00 22.15 ? 296  ARG D NE    1 
ATOM   6174 C CZ    . ARG F 3 296 ? 22.202  10.468  51.186  1.00 25.06 ? 296  ARG D CZ    1 
ATOM   6175 N NH1   . ARG F 3 296 ? 22.588  9.255   50.770  1.00 26.26 ? 296  ARG D NH1   1 
ATOM   6176 N NH2   . ARG F 3 296 ? 22.938  11.140  52.073  1.00 26.59 ? 296  ARG D NH2   1 
ATOM   6177 N N     . ASN F 3 297 ? 15.045  7.529   49.088  1.00 12.84 ? 297  ASN D N     1 
ATOM   6178 C CA    . ASN F 3 297 ? 13.787  7.413   48.338  1.00 12.62 ? 297  ASN D CA    1 
ATOM   6179 C C     . ASN F 3 297 ? 12.585  7.147   49.224  1.00 13.70 ? 297  ASN D C     1 
ATOM   6180 O O     . ASN F 3 297 ? 11.439  7.212   48.766  1.00 15.08 ? 297  ASN D O     1 
ATOM   6181 C CB    . ASN F 3 297 ? 13.902  6.306   47.288  1.00 12.53 ? 297  ASN D CB    1 
ATOM   6182 C CG    . ASN F 3 297 ? 14.973  6.593   46.274  1.00 10.91 ? 297  ASN D CG    1 
ATOM   6183 O OD1   . ASN F 3 297 ? 16.084  6.084   46.371  1.00 10.70 ? 297  ASN D OD1   1 
ATOM   6184 N ND2   . ASN F 3 297 ? 14.647  7.429   45.279  1.00 14.06 ? 297  ASN D ND2   1 
ATOM   6185 N N     . LEU F 3 298 ? 12.852  6.811   50.487  1.00 13.89 ? 298  LEU D N     1 
ATOM   6186 C CA    . LEU F 3 298 ? 11.791  6.511   51.436  1.00 13.98 ? 298  LEU D CA    1 
ATOM   6187 C C     . LEU F 3 298 ? 11.379  7.746   52.205  1.00 14.56 ? 298  LEU D C     1 
ATOM   6188 O O     . LEU F 3 298 ? 12.214  8.428   52.806  1.00 13.92 ? 298  LEU D O     1 
ATOM   6189 C CB    . LEU F 3 298 ? 12.197  5.396   52.389  1.00 13.72 ? 298  LEU D CB    1 
ATOM   6190 C CG    . LEU F 3 298 ? 11.109  4.945   53.379  1.00 13.83 ? 298  LEU D CG    1 
ATOM   6191 C CD1   . LEU F 3 298 ? 9.869   4.375   52.661  1.00 12.94 ? 298  LEU D CD1   1 
ATOM   6192 C CD2   . LEU F 3 298 ? 11.665  3.915   54.338  1.00 17.50 ? 298  LEU D CD2   1 
ATOM   6193 N N     . LYS F 3 299 ? 10.086  8.038   52.161  1.00 15.12 ? 299  LYS D N     1 
ATOM   6194 C CA    . LYS F 3 299 ? 9.526   9.201   52.848  1.00 16.24 ? 299  LYS D CA    1 
ATOM   6195 C C     . LYS F 3 299 ? 8.387   8.717   53.745  1.00 15.97 ? 299  LYS D C     1 
ATOM   6196 O O     . LYS F 3 299 ? 7.934   7.574   53.599  1.00 15.63 ? 299  LYS D O     1 
ATOM   6197 C CB    . LYS F 3 299 ? 9.027   10.247  51.822  1.00 16.72 ? 299  LYS D CB    1 
ATOM   6198 C CG    . LYS F 3 299 ? 10.142  11.130  51.226  1.00 19.09 ? 299  LYS D CG    1 
ATOM   6199 C CD    . LYS F 3 299 ? 10.943  10.422  50.144  1.00 22.66 ? 299  LYS D CD    1 
ATOM   6200 C CE    . LYS F 3 299 ? 11.816  11.376  49.339  1.00 22.94 ? 299  LYS D CE    1 
ATOM   6201 N NZ    . LYS F 3 299 ? 12.788  12.163  50.162  1.00 25.79 ? 299  LYS D NZ    1 
ATOM   6202 N N     . PRO F 3 300 ? 7.930   9.555   54.697  1.00 16.60 ? 300  PRO D N     1 
ATOM   6203 C CA    . PRO F 3 300 ? 6.811   9.081   55.517  1.00 17.07 ? 300  PRO D CA    1 
ATOM   6204 C C     . PRO F 3 300 ? 5.522   8.952   54.706  1.00 17.64 ? 300  PRO D C     1 
ATOM   6205 O O     . PRO F 3 300 ? 4.937   9.978   54.304  1.00 18.52 ? 300  PRO D O     1 
ATOM   6206 C CB    . PRO F 3 300 ? 6.672   10.174  56.592  1.00 17.28 ? 300  PRO D CB    1 
ATOM   6207 C CG    . PRO F 3 300 ? 7.939   10.949  56.539  1.00 18.01 ? 300  PRO D CG    1 
ATOM   6208 C CD    . PRO F 3 300 ? 8.375   10.893  55.109  1.00 17.16 ? 300  PRO D CD    1 
ATOM   6209 N N     . GLY F 3 301 ? 5.109   7.713   54.439  1.00 16.50 ? 301  GLY D N     1 
ATOM   6210 C CA    . GLY F 3 301 ? 3.850   7.447   53.756  1.00 17.64 ? 301  GLY D CA    1 
ATOM   6211 C C     . GLY F 3 301 ? 3.934   7.399   52.247  1.00 17.77 ? 301  GLY D C     1 
ATOM   6212 O O     . GLY F 3 301 ? 2.921   7.156   51.578  1.00 19.45 ? 301  GLY D O     1 
ATOM   6213 N N     . TRP F 3 302 ? 5.126   7.621   51.693  1.00 18.01 ? 302  TRP D N     1 
ATOM   6214 C CA    . TRP F 3 302 ? 5.319   7.504   50.252  1.00 18.44 ? 302  TRP D CA    1 
ATOM   6215 C C     . TRP F 3 302 ? 6.765   7.229   49.828  1.00 18.18 ? 302  TRP D C     1 
ATOM   6216 O O     . TRP F 3 302 ? 7.715   7.375   50.612  1.00 17.83 ? 302  TRP D O     1 
ATOM   6217 C CB    . TRP F 3 302 ? 4.771   8.740   49.528  1.00 19.53 ? 302  TRP D CB    1 
ATOM   6218 C CG    . TRP F 3 302 ? 5.487   10.024  49.846  1.00 19.60 ? 302  TRP D CG    1 
ATOM   6219 C CD1   . TRP F 3 302 ? 5.405   10.762  51.006  1.00 20.46 ? 302  TRP D CD1   1 
ATOM   6220 C CD2   . TRP F 3 302 ? 6.370   10.743  48.976  1.00 21.16 ? 302  TRP D CD2   1 
ATOM   6221 N NE1   . TRP F 3 302 ? 6.196   11.888  50.906  1.00 22.17 ? 302  TRP D NE1   1 
ATOM   6222 C CE2   . TRP F 3 302 ? 6.793   11.905  49.673  1.00 21.00 ? 302  TRP D CE2   1 
ATOM   6223 C CE3   . TRP F 3 302 ? 6.853   10.514  47.680  1.00 20.47 ? 302  TRP D CE3   1 
ATOM   6224 C CZ2   . TRP F 3 302 ? 7.680   12.839  49.111  1.00 21.98 ? 302  TRP D CZ2   1 
ATOM   6225 C CZ3   . TRP F 3 302 ? 7.726   11.445  47.117  1.00 21.35 ? 302  TRP D CZ3   1 
ATOM   6226 C CH2   . TRP F 3 302 ? 8.135   12.590  47.834  1.00 21.73 ? 302  TRP D CH2   1 
ATOM   6227 N N     . VAL F 3 303 ? 6.916   6.859   48.563  1.00 17.97 ? 303  VAL D N     1 
ATOM   6228 C CA    . VAL F 3 303 ? 8.195   6.490   47.987  1.00 17.41 ? 303  VAL D CA    1 
ATOM   6229 C C     . VAL F 3 303 ? 8.435   7.369   46.761  1.00 17.88 ? 303  VAL D C     1 
ATOM   6230 O O     . VAL F 3 303 ? 7.556   7.489   45.883  1.00 17.17 ? 303  VAL D O     1 
ATOM   6231 C CB    . VAL F 3 303 ? 8.218   4.981   47.581  1.00 17.25 ? 303  VAL D CB    1 
ATOM   6232 C CG1   . VAL F 3 303 ? 9.546   4.590   46.884  1.00 17.48 ? 303  VAL D CG1   1 
ATOM   6233 C CG2   . VAL F 3 303 ? 7.948   4.050   48.782  1.00 17.37 ? 303  VAL D CG2   1 
ATOM   6234 N N     . ASP F 3 304 ? 9.608   7.997   46.708  1.00 17.68 ? 304  ASP D N     1 
ATOM   6235 C CA    . ASP F 3 304 ? 10.063  8.684   45.501  1.00 18.59 ? 304  ASP D CA    1 
ATOM   6236 C C     . ASP F 3 304 ? 10.716  7.668   44.552  1.00 18.68 ? 304  ASP D C     1 
ATOM   6237 O O     . ASP F 3 304 ? 11.796  7.135   44.834  1.00 17.91 ? 304  ASP D O     1 
ATOM   6238 C CB    . ASP F 3 304 ? 11.030  9.821   45.858  1.00 19.19 ? 304  ASP D CB    1 
ATOM   6239 C CG    . ASP F 3 304 ? 11.601  10.525  44.630  1.00 21.31 ? 304  ASP D CG    1 
ATOM   6240 O OD1   . ASP F 3 304 ? 12.652  11.193  44.754  1.00 25.51 ? 304  ASP D OD1   1 
ATOM   6241 O OD2   . ASP F 3 304 ? 11.021  10.415  43.541  1.00 23.02 ? 304  ASP D OD2   1 
ATOM   6242 N N     . TYR F 3 305 ? 10.051  7.387   43.432  1.00 18.81 ? 305  TYR D N     1 
ATOM   6243 C CA    . TYR F 3 305 ? 10.576  6.430   42.452  1.00 19.42 ? 305  TYR D CA    1 
ATOM   6244 C C     . TYR F 3 305 ? 11.424  7.083   41.369  1.00 20.78 ? 305  TYR D C     1 
ATOM   6245 O O     . TYR F 3 305 ? 12.015  6.393   40.531  1.00 21.07 ? 305  TYR D O     1 
ATOM   6246 C CB    . TYR F 3 305 ? 9.441   5.648   41.798  1.00 19.36 ? 305  TYR D CB    1 
ATOM   6247 C CG    . TYR F 3 305 ? 8.641   4.800   42.751  1.00 18.23 ? 305  TYR D CG    1 
ATOM   6248 C CD1   . TYR F 3 305 ? 9.104   3.552   43.176  1.00 17.70 ? 305  TYR D CD1   1 
ATOM   6249 C CD2   . TYR F 3 305 ? 7.395   5.235   43.203  1.00 16.81 ? 305  TYR D CD2   1 
ATOM   6250 C CE1   . TYR F 3 305 ? 8.349   2.766   44.044  1.00 17.03 ? 305  TYR D CE1   1 
ATOM   6251 C CE2   . TYR F 3 305 ? 6.635   4.462   44.055  1.00 16.86 ? 305  TYR D CE2   1 
ATOM   6252 C CZ    . TYR F 3 305 ? 7.119   3.234   44.480  1.00 17.56 ? 305  TYR D CZ    1 
ATOM   6253 O OH    . TYR F 3 305 ? 6.355   2.482   45.323  1.00 19.23 ? 305  TYR D OH    1 
ATOM   6254 N N     . GLU F 3 306 ? 11.492  8.410   41.410  1.00 21.90 ? 306  GLU D N     1 
ATOM   6255 C CA    . GLU F 3 306 ? 12.078  9.200   40.336  1.00 23.70 ? 306  GLU D CA    1 
ATOM   6256 C C     . GLU F 3 306 ? 13.584  9.403   40.482  1.00 22.98 ? 306  GLU D C     1 
ATOM   6257 O O     . GLU F 3 306 ? 14.340  9.081   39.551  1.00 23.86 ? 306  GLU D O     1 
ATOM   6258 C CB    . GLU F 3 306 ? 11.317  10.532  40.172  1.00 23.46 ? 306  GLU D CB    1 
ATOM   6259 C CG    . GLU F 3 306 ? 9.841   10.329  39.779  1.00 26.15 ? 306  GLU D CG    1 
ATOM   6260 C CD    . GLU F 3 306 ? 9.087   11.625  39.476  1.00 27.23 ? 306  GLU D CD    1 
ATOM   6261 O OE1   . GLU F 3 306 ? 9.506   12.714  39.942  1.00 31.53 ? 306  GLU D OE1   1 
ATOM   6262 O OE2   . GLU F 3 306 ? 8.049   11.547  38.772  1.00 32.61 ? 306  GLU D OE2   1 
ATOM   6263 N N     . LYS F 3 307 ? 14.026  9.908   41.637  1.00 21.84 ? 307  LYS D N     1 
ATOM   6264 C CA    . LYS F 3 307 ? 15.439  10.273  41.804  1.00 21.63 ? 307  LYS D CA    1 
ATOM   6265 C C     . LYS F 3 307 ? 16.310  9.080   42.154  1.00 20.23 ? 307  LYS D C     1 
ATOM   6266 O O     . LYS F 3 307 ? 15.970  8.295   43.041  1.00 20.49 ? 307  LYS D O     1 
ATOM   6267 C CB    . LYS F 3 307 ? 15.652  11.380  42.848  1.00 21.29 ? 307  LYS D CB    1 
ATOM   6268 C CG    . LYS F 3 307 ? 16.990  12.103  42.635  1.00 23.16 ? 307  LYS D CG    1 
ATOM   6269 C CD    . LYS F 3 307 ? 17.273  13.205  43.625  1.00 24.19 ? 307  LYS D CD    1 
ATOM   6270 C CE    . LYS F 3 307 ? 18.539  13.950  43.227  1.00 27.88 ? 307  LYS D CE    1 
ATOM   6271 N NZ    . LYS F 3 307 ? 19.784  13.164  43.502  1.00 31.82 ? 307  LYS D NZ    1 
ATOM   6272 N N     . ASN F 3 308 ? 17.428  8.963   41.441  1.00 19.06 ? 308  ASN D N     1 
ATOM   6273 C CA    . ASN F 3 308 ? 18.421  7.933   41.717  1.00 17.97 ? 308  ASN D CA    1 
ATOM   6274 C C     . ASN F 3 308 ? 19.539  8.435   42.629  1.00 17.82 ? 308  ASN D C     1 
ATOM   6275 O O     . ASN F 3 308 ? 20.257  9.401   42.294  1.00 17.98 ? 308  ASN D O     1 
ATOM   6276 C CB    . ASN F 3 308 ? 18.992  7.375   40.412  1.00 17.56 ? 308  ASN D CB    1 
ATOM   6277 C CG    . ASN F 3 308 ? 19.936  6.224   40.633  1.00 17.95 ? 308  ASN D CG    1 
ATOM   6278 O OD1   . ASN F 3 308 ? 20.925  6.348   41.343  1.00 20.38 ? 308  ASN D OD1   1 
ATOM   6279 N ND2   . ASN F 3 308 ? 19.655  5.108   40.003  1.00 16.89 ? 308  ASN D ND2   1 
ATOM   6280 N N     . HIS F 3 309 ? 19.681  7.764   43.771  1.00 16.72 ? 309  HIS D N     1 
ATOM   6281 C CA    . HIS F 3 309 ? 20.698  8.091   44.779  1.00 16.44 ? 309  HIS D CA    1 
ATOM   6282 C C     . HIS F 3 309 ? 21.787  7.018   44.928  1.00 16.42 ? 309  HIS D C     1 
ATOM   6283 O O     . HIS F 3 309 ? 22.796  7.236   45.633  1.00 16.27 ? 309  HIS D O     1 
ATOM   6284 C CB    . HIS F 3 309 ? 20.027  8.283   46.143  1.00 16.51 ? 309  HIS D CB    1 
ATOM   6285 C CG    . HIS F 3 309 ? 19.067  9.419   46.188  1.00 16.81 ? 309  HIS D CG    1 
ATOM   6286 N ND1   . HIS F 3 309 ? 17.702  9.239   46.103  1.00 18.69 ? 309  HIS D ND1   1 
ATOM   6287 C CD2   . HIS F 3 309 ? 19.266  10.750  46.316  1.00 18.32 ? 309  HIS D CD2   1 
ATOM   6288 C CE1   . HIS F 3 309 ? 17.101  10.413  46.182  1.00 17.69 ? 309  HIS D CE1   1 
ATOM   6289 N NE2   . HIS F 3 309 ? 18.026  11.345  46.306  1.00 18.73 ? 309  HIS D NE2   1 
ATOM   6290 N N     . SER F 3 310 ? 21.569  5.856   44.302  1.00 14.91 ? 310  SER D N     1 
ATOM   6291 C CA    . SER F 3 310 ? 22.495  4.711   44.370  1.00 13.71 ? 310  SER D CA    1 
ATOM   6292 C C     . SER F 3 310 ? 23.541  4.673   43.260  1.00 13.17 ? 310  SER D C     1 
ATOM   6293 O O     . SER F 3 310 ? 24.566  4.007   43.396  1.00 14.50 ? 310  SER D O     1 
ATOM   6294 C CB    . SER F 3 310 ? 21.696  3.408   44.302  1.00 13.40 ? 310  SER D CB    1 
ATOM   6295 O OG    . SER F 3 310 ? 21.013  3.359   43.053  1.00 11.60 ? 310  SER D OG    1 
ATOM   6296 N N     . GLY F 3 311 ? 23.264  5.332   42.139  1.00 12.51 ? 311  GLY D N     1 
ATOM   6297 C CA    . GLY F 3 311 ? 24.125  5.207   40.968  1.00 12.57 ? 311  GLY D CA    1 
ATOM   6298 C C     . GLY F 3 311 ? 23.894  3.924   40.179  1.00 12.45 ? 311  GLY D C     1 
ATOM   6299 O O     . GLY F 3 311 ? 24.637  3.622   39.245  1.00 13.80 ? 311  GLY D O     1 
ATOM   6300 N N     . LEU F 3 312 ? 22.871  3.165   40.572  1.00 12.27 ? 312  LEU D N     1 
ATOM   6301 C CA    . LEU F 3 312 ? 22.598  1.845   39.980  1.00 11.59 ? 312  LEU D CA    1 
ATOM   6302 C C     . LEU F 3 312 ? 21.188  1.798   39.422  1.00 11.38 ? 312  LEU D C     1 
ATOM   6303 O O     . LEU F 3 312 ? 20.274  2.343   40.016  1.00 11.30 ? 312  LEU D O     1 
ATOM   6304 C CB    . LEU F 3 312 ? 22.753  0.745   41.038  1.00 11.76 ? 312  LEU D CB    1 
ATOM   6305 C CG    . LEU F 3 312 ? 24.120  0.697   41.729  1.00 13.47 ? 312  LEU D CG    1 
ATOM   6306 C CD1   . LEU F 3 312 ? 24.128  -0.365  42.848  1.00 16.72 ? 312  LEU D CD1   1 
ATOM   6307 C CD2   . LEU F 3 312 ? 25.225  0.443   40.733  1.00 15.74 ? 312  LEU D CD2   1 
ATOM   6308 N N     . TRP F 3 313 ? 21.041  1.129   38.283  1.00 11.36 ? 313  TRP D N     1 
ATOM   6309 C CA    . TRP F 3 313 ? 19.744  0.956   37.629  1.00 13.04 ? 313  TRP D CA    1 
ATOM   6310 C C     . TRP F 3 313 ? 19.612  -0.502  37.227  1.00 12.46 ? 313  TRP D C     1 
ATOM   6311 O O     . TRP F 3 313 ? 20.609  -1.162  36.952  1.00 12.58 ? 313  TRP D O     1 
ATOM   6312 C CB    . TRP F 3 313 ? 19.670  1.808   36.358  1.00 14.52 ? 313  TRP D CB    1 
ATOM   6313 C CG    . TRP F 3 313 ? 19.363  3.320   36.554  1.00 17.76 ? 313  TRP D CG    1 
ATOM   6314 C CD1   . TRP F 3 313 ? 18.129  3.923   36.517  1.00 19.18 ? 313  TRP D CD1   1 
ATOM   6315 C CD2   . TRP F 3 313 ? 20.311  4.368   36.748  1.00 20.79 ? 313  TRP D CD2   1 
ATOM   6316 N NE1   . TRP F 3 313 ? 18.254  5.272   36.698  1.00 20.94 ? 313  TRP D NE1   1 
ATOM   6317 C CE2   . TRP F 3 313 ? 19.584  5.576   36.846  1.00 19.62 ? 313  TRP D CE2   1 
ATOM   6318 C CE3   . TRP F 3 313 ? 21.706  4.404   36.863  1.00 20.81 ? 313  TRP D CE3   1 
ATOM   6319 C CZ2   . TRP F 3 313 ? 20.205  6.813   37.050  1.00 20.34 ? 313  TRP D CZ2   1 
ATOM   6320 C CZ3   . TRP F 3 313 ? 22.328  5.629   37.071  1.00 19.85 ? 313  TRP D CZ3   1 
ATOM   6321 C CH2   . TRP F 3 313 ? 21.578  6.819   37.168  1.00 21.02 ? 313  TRP D CH2   1 
ATOM   6322 N N     . MET F 3 314 ? 18.377  -0.990  37.147  1.00 12.01 ? 314  MET D N     1 
ATOM   6323 C CA    . MET F 3 314 ? 18.145  -2.364  36.718  1.00 12.75 ? 314  MET D CA    1 
ATOM   6324 C C     . MET F 3 314 ? 16.699  -2.515  36.242  1.00 12.51 ? 314  MET D C     1 
ATOM   6325 O O     . MET F 3 314 ? 15.863  -1.682  36.560  1.00 12.42 ? 314  MET D O     1 
ATOM   6326 C CB    . MET F 3 314 ? 18.458  -3.321  37.869  1.00 12.12 ? 314  MET D CB    1 
ATOM   6327 C CG    . MET F 3 314 ? 17.430  -3.408  39.003  1.00 14.63 ? 314  MET D CG    1 
ATOM   6328 S SD    . MET F 3 314 ? 17.856  -4.767  40.136  1.00 14.18 ? 314  MET D SD    1 
ATOM   6329 C CE    . MET F 3 314 ? 17.802  -6.236  39.105  1.00 15.82 ? 314  MET D CE    1 
ATOM   6330 N N     . PRO F 3 315 ? 16.421  -3.558  35.446  1.00 13.14 ? 315  PRO D N     1 
ATOM   6331 C CA    . PRO F 3 315 ? 15.041  -3.788  35.054  1.00 13.22 ? 315  PRO D CA    1 
ATOM   6332 C C     . PRO F 3 315 ? 14.218  -4.146  36.285  1.00 13.01 ? 315  PRO D C     1 
ATOM   6333 O O     . PRO F 3 315 ? 14.636  -5.004  37.076  1.00 13.06 ? 315  PRO D O     1 
ATOM   6334 C CB    . PRO F 3 315 ? 15.140  -4.997  34.100  1.00 13.05 ? 315  PRO D CB    1 
ATOM   6335 C CG    . PRO F 3 315 ? 16.559  -5.037  33.665  1.00 14.24 ? 315  PRO D CG    1 
ATOM   6336 C CD    . PRO F 3 315 ? 17.343  -4.544  34.847  1.00 12.89 ? 315  PRO D CD    1 
ATOM   6337 N N     . LYS F 3 316 ? 13.083  -3.462  36.454  1.00 14.18 ? 316  LYS D N     1 
ATOM   6338 C CA    . LYS F 3 316 ? 12.201  -3.724  37.597  1.00 14.69 ? 316  LYS D CA    1 
ATOM   6339 C C     . LYS F 3 316 ? 11.857  -5.212  37.693  1.00 14.61 ? 316  LYS D C     1 
ATOM   6340 O O     . LYS F 3 316 ? 11.930  -5.793  38.774  1.00 13.99 ? 316  LYS D O     1 
ATOM   6341 C CB    . LYS F 3 316 ? 10.922  -2.879  37.523  1.00 15.33 ? 316  LYS D CB    1 
ATOM   6342 C CG    . LYS F 3 316 ? 10.242  -2.723  38.889  1.00 17.38 ? 316  LYS D CG    1 
ATOM   6343 C CD    . LYS F 3 316 ? 8.917   -1.999  38.824  1.00 17.25 ? 316  LYS D CD    1 
ATOM   6344 C CE    . LYS F 3 316 ? 7.771   -2.959  38.543  1.00 22.73 ? 316  LYS D CE    1 
ATOM   6345 N NZ    . LYS F 3 316 ? 6.451   -2.402  38.961  1.00 24.18 ? 316  LYS D NZ    1 
ATOM   6346 N N     . GLU F 3 317 ? 11.547  -5.834  36.547  1.00 14.74 ? 317  GLU D N     1 
ATOM   6347 C CA    . GLU F 3 317 ? 11.186  -7.259  36.515  1.00 16.30 ? 317  GLU D CA    1 
ATOM   6348 C C     . GLU F 3 317 ? 12.268  -8.227  36.997  1.00 15.56 ? 317  GLU D C     1 
ATOM   6349 O O     . GLU F 3 317 ? 11.954  -9.373  37.339  1.00 17.40 ? 317  GLU D O     1 
ATOM   6350 C CB    . GLU F 3 317 ? 10.684  -7.679  35.124  1.00 16.50 ? 317  GLU D CB    1 
ATOM   6351 C CG    . GLU F 3 317 ? 9.404   -6.925  34.676  1.00 20.49 ? 317  GLU D CG    1 
ATOM   6352 C CD    . GLU F 3 317 ? 8.096   -7.433  35.302  1.00 25.32 ? 317  GLU D CD    1 
ATOM   6353 O OE1   . GLU F 3 317 ? 8.089   -8.546  35.899  1.00 27.19 ? 317  GLU D OE1   1 
ATOM   6354 O OE2   . GLU F 3 317 ? 7.067   -6.706  35.188  1.00 24.95 ? 317  GLU D OE2   1 
ATOM   6355 N N     . ARG F 3 318 ? 13.537  -7.804  37.020  1.00 14.89 ? 318  ARG D N     1 
ATOM   6356 C CA    . ARG F 3 318 ? 14.603  -8.677  37.536  1.00 13.37 ? 318  ARG D CA    1 
ATOM   6357 C C     . ARG F 3 318 ? 15.010  -8.457  39.001  1.00 13.96 ? 318  ARG D C     1 
ATOM   6358 O O     . ARG F 3 318 ? 15.858  -9.173  39.515  1.00 13.47 ? 318  ARG D O     1 
ATOM   6359 C CB    . ARG F 3 318 ? 15.841  -8.643  36.631  1.00 13.60 ? 318  ARG D CB    1 
ATOM   6360 C CG    . ARG F 3 318 ? 15.552  -9.136  35.220  1.00 12.85 ? 318  ARG D CG    1 
ATOM   6361 C CD    . ARG F 3 318 ? 16.859  -9.303  34.436  1.00 12.72 ? 318  ARG D CD    1 
ATOM   6362 N NE    . ARG F 3 318 ? 17.678  -10.385 34.974  1.00 12.46 ? 318  ARG D NE    1 
ATOM   6363 C CZ    . ARG F 3 318 ? 18.820  -10.822 34.443  1.00 15.11 ? 318  ARG D CZ    1 
ATOM   6364 N NH1   . ARG F 3 318 ? 19.295  -10.283 33.323  1.00 14.58 ? 318  ARG D NH1   1 
ATOM   6365 N NH2   . ARG F 3 318 ? 19.479  -11.811 35.027  1.00 13.65 ? 318  ARG D NH2   1 
ATOM   6366 N N     . ALA F 3 319 ? 14.382  -7.488  39.661  1.00 13.84 ? 319  ALA D N     1 
ATOM   6367 C CA    . ALA F 3 319 ? 14.648  -7.212  41.075  1.00 14.47 ? 319  ALA D CA    1 
ATOM   6368 C C     . ALA F 3 319 ? 14.477  -8.447  41.953  1.00 14.38 ? 319  ALA D C     1 
ATOM   6369 O O     . ALA F 3 319 ? 15.239  -8.659  42.896  1.00 14.28 ? 319  ALA D O     1 
ATOM   6370 C CB    . ALA F 3 319 ? 13.733  -6.113  41.563  1.00 14.64 ? 319  ALA D CB    1 
ATOM   6371 N N     . LYS F 3 320 ? 13.468  -9.262  41.642  1.00 14.21 ? 320  LYS D N     1 
ATOM   6372 C CA    . LYS F 3 320 ? 13.189  -10.459 42.439  1.00 14.93 ? 320  LYS D CA    1 
ATOM   6373 C C     . LYS F 3 320 ? 14.362  -11.448 42.469  1.00 14.47 ? 320  LYS D C     1 
ATOM   6374 O O     . LYS F 3 320 ? 14.436  -12.306 43.342  1.00 15.35 ? 320  LYS D O     1 
ATOM   6375 C CB    . LYS F 3 320 ? 11.900  -11.136 41.952  1.00 14.08 ? 320  LYS D CB    1 
ATOM   6376 C CG    . LYS F 3 320 ? 11.897  -11.616 40.493  1.00 15.55 ? 320  LYS D CG    1 
ATOM   6377 C CD    . LYS F 3 320 ? 10.491  -12.136 40.139  1.00 17.61 ? 320  LYS D CD    1 
ATOM   6378 C CE    . LYS F 3 320 ? 10.265  -12.153 38.642  1.00 22.82 ? 320  LYS D CE    1 
ATOM   6379 N NZ    . LYS F 3 320 ? 10.526  -13.490 38.083  1.00 27.36 ? 320  LYS D NZ    1 
ATOM   6380 N N     . GLU F 3 321 ? 15.290  -11.332 41.521  1.00 13.90 ? 321  GLU D N     1 
ATOM   6381 C CA    . GLU F 3 321 ? 16.463  -12.203 41.514  1.00 14.25 ? 321  GLU D CA    1 
ATOM   6382 C C     . GLU F 3 321 ? 17.393  -11.921 42.700  1.00 15.10 ? 321  GLU D C     1 
ATOM   6383 O O     . GLU F 3 321 ? 18.091  -12.813 43.163  1.00 16.31 ? 321  GLU D O     1 
ATOM   6384 C CB    . GLU F 3 321 ? 17.239  -12.065 40.207  1.00 14.11 ? 321  GLU D CB    1 
ATOM   6385 C CG    . GLU F 3 321 ? 16.455  -12.624 39.016  1.00 14.98 ? 321  GLU D CG    1 
ATOM   6386 C CD    . GLU F 3 321 ? 17.109  -12.301 37.695  1.00 16.22 ? 321  GLU D CD    1 
ATOM   6387 O OE1   . GLU F 3 321 ? 18.352  -12.306 37.630  1.00 15.98 ? 321  GLU D OE1   1 
ATOM   6388 O OE2   . GLU F 3 321 ? 16.367  -12.048 36.730  1.00 16.43 ? 321  GLU D OE2   1 
ATOM   6389 N N     . LEU F 3 322 ? 17.350  -10.693 43.203  1.00 15.66 ? 322  LEU D N     1 
ATOM   6390 C CA    . LEU F 3 322 ? 18.193  -10.319 44.344  1.00 15.80 ? 322  LEU D CA    1 
ATOM   6391 C C     . LEU F 3 322 ? 17.517  -10.724 45.651  1.00 15.60 ? 322  LEU D C     1 
ATOM   6392 O O     . LEU F 3 322 ? 18.116  -11.414 46.482  1.00 15.47 ? 322  LEU D O     1 
ATOM   6393 C CB    . LEU F 3 322 ? 18.519  -8.831  44.309  1.00 16.27 ? 322  LEU D CB    1 
ATOM   6394 C CG    . LEU F 3 322 ? 19.579  -8.515  43.226  1.00 18.58 ? 322  LEU D CG    1 
ATOM   6395 C CD1   . LEU F 3 322 ? 18.964  -7.774  42.036  1.00 19.68 ? 322  LEU D CD1   1 
ATOM   6396 C CD2   . LEU F 3 322 ? 20.723  -7.727  43.785  1.00 20.25 ? 322  LEU D CD2   1 
ATOM   6397 N N     . ARG F 3 323 ? 16.260  -10.306 45.812  1.00 15.60 ? 323  ARG D N     1 
ATOM   6398 C CA    . ARG F 3 323 ? 15.397  -10.816 46.888  1.00 15.35 ? 323  ARG D CA    1 
ATOM   6399 C C     . ARG F 3 323 ? 14.001  -11.124 46.351  1.00 15.06 ? 323  ARG D C     1 
ATOM   6400 O O     . ARG F 3 323 ? 13.385  -10.264 45.717  1.00 15.09 ? 323  ARG D O     1 
ATOM   6401 C CB    . ARG F 3 323 ? 15.285  -9.795  48.005  1.00 14.63 ? 323  ARG D CB    1 
ATOM   6402 C CG    . ARG F 3 323 ? 16.602  -9.509  48.720  1.00 14.69 ? 323  ARG D CG    1 
ATOM   6403 C CD    . ARG F 3 323 ? 17.096  -10.706 49.535  1.00 13.99 ? 323  ARG D CD    1 
ATOM   6404 N NE    . ARG F 3 323 ? 18.220  -10.368 50.427  1.00 14.77 ? 323  ARG D NE    1 
ATOM   6405 C CZ    . ARG F 3 323 ? 19.491  -10.293 50.042  1.00 13.26 ? 323  ARG D CZ    1 
ATOM   6406 N NH1   . ARG F 3 323 ? 19.824  -10.561 48.779  1.00 13.29 ? 323  ARG D NH1   1 
ATOM   6407 N NH2   . ARG F 3 323 ? 20.444  -9.991  50.921  1.00 13.73 ? 323  ARG D NH2   1 
ATOM   6408 N N     . ASP F 3 324 ? 13.498  -12.323 46.636  1.00 16.47 ? 324  ASP D N     1 
ATOM   6409 C CA    . ASP F 3 324 ? 12.195  -12.712 46.075  1.00 17.24 ? 324  ASP D CA    1 
ATOM   6410 C C     . ASP F 3 324 ? 11.104  -11.721 46.434  1.00 16.59 ? 324  ASP D C     1 
ATOM   6411 O O     . ASP F 3 324 ? 10.209  -11.491 45.649  1.00 16.87 ? 324  ASP D O     1 
ATOM   6412 C CB    . ASP F 3 324 ? 11.781  -14.145 46.435  1.00 18.06 ? 324  ASP D CB    1 
ATOM   6413 C CG    . ASP F 3 324 ? 11.824  -14.435 47.916  1.00 22.44 ? 324  ASP D CG    1 
ATOM   6414 O OD1   . ASP F 3 324 ? 11.610  -15.624 48.247  1.00 28.69 ? 324  ASP D OD1   1 
ATOM   6415 O OD2   . ASP F 3 324 ? 12.073  -13.529 48.751  1.00 26.84 ? 324  ASP D OD2   1 
ATOM   6416 N N     . PHE F 3 325 ? 11.211  -11.100 47.601  1.00 15.78 ? 325  PHE D N     1 
ATOM   6417 C CA    . PHE F 3 325 ? 10.167  -10.180 48.056  1.00 15.07 ? 325  PHE D CA    1 
ATOM   6418 C C     . PHE F 3 325 ? 10.094  -8.830  47.317  1.00 14.53 ? 325  PHE D C     1 
ATOM   6419 O O     . PHE F 3 325 ? 9.128   -8.100  47.464  1.00 14.64 ? 325  PHE D O     1 
ATOM   6420 C CB    . PHE F 3 325 ? 10.223  -9.990  49.586  1.00 15.66 ? 325  PHE D CB    1 
ATOM   6421 C CG    . PHE F 3 325 ? 11.537  -9.442  50.104  1.00 14.85 ? 325  PHE D CG    1 
ATOM   6422 C CD1   . PHE F 3 325 ? 11.876  -8.099  49.934  1.00 17.00 ? 325  PHE D CD1   1 
ATOM   6423 C CD2   . PHE F 3 325 ? 12.420  -10.276 50.802  1.00 15.29 ? 325  PHE D CD2   1 
ATOM   6424 C CE1   . PHE F 3 325 ? 13.096  -7.598  50.436  1.00 17.80 ? 325  PHE D CE1   1 
ATOM   6425 C CE2   . PHE F 3 325 ? 13.616  -9.790  51.316  1.00 17.12 ? 325  PHE D CE2   1 
ATOM   6426 C CZ    . PHE F 3 325 ? 13.963  -8.454  51.130  1.00 16.09 ? 325  PHE D CZ    1 
ATOM   6427 N N     . TYR F 3 326 ? 11.093  -8.506  46.494  1.00 13.92 ? 326  TYR D N     1 
ATOM   6428 C CA    . TYR F 3 326 ? 11.008  -7.300  45.678  1.00 13.91 ? 326  TYR D CA    1 
ATOM   6429 C C     . TYR F 3 326 ? 9.952   -7.466  44.575  1.00 14.71 ? 326  TYR D C     1 
ATOM   6430 O O     . TYR F 3 326 ? 9.629   -6.510  43.870  1.00 15.94 ? 326  TYR D O     1 
ATOM   6431 C CB    . TYR F 3 326 ? 12.352  -6.988  45.018  1.00 12.65 ? 326  TYR D CB    1 
ATOM   6432 C CG    . TYR F 3 326 ? 13.449  -6.542  45.951  1.00 12.78 ? 326  TYR D CG    1 
ATOM   6433 C CD1   . TYR F 3 326 ? 13.171  -5.769  47.083  1.00 13.20 ? 326  TYR D CD1   1 
ATOM   6434 C CD2   . TYR F 3 326 ? 14.777  -6.837  45.655  1.00 15.07 ? 326  TYR D CD2   1 
ATOM   6435 C CE1   . TYR F 3 326 ? 14.205  -5.357  47.943  1.00 12.68 ? 326  TYR D CE1   1 
ATOM   6436 C CE2   . TYR F 3 326 ? 15.822  -6.412  46.490  1.00 14.24 ? 326  TYR D CE2   1 
ATOM   6437 C CZ    . TYR F 3 326 ? 15.513  -5.668  47.621  1.00 12.99 ? 326  TYR D CZ    1 
ATOM   6438 O OH    . TYR F 3 326 ? 16.541  -5.282  48.467  1.00 13.42 ? 326  TYR D OH    1 
ATOM   6439 N N     . ALA F 3 327 ? 9.443   -8.688  44.436  1.00 15.77 ? 327  ALA D N     1 
ATOM   6440 C CA    . ALA F 3 327 ? 8.436   -9.007  43.417  1.00 17.31 ? 327  ALA D CA    1 
ATOM   6441 C C     . ALA F 3 327 ? 7.050   -8.498  43.797  1.00 18.18 ? 327  ALA D C     1 
ATOM   6442 O O     . ALA F 3 327 ? 6.205   -8.284  42.918  1.00 18.97 ? 327  ALA D O     1 
ATOM   6443 C CB    . ALA F 3 327 ? 8.383   -10.506 43.188  1.00 17.61 ? 327  ALA D CB    1 
ATOM   6444 N N     . THR F 3 328 ? 6.802   -8.316  45.089  1.00 18.17 ? 328  THR D N     1 
ATOM   6445 C CA    . THR F 3 328 ? 5.456   -7.951  45.537  1.00 19.66 ? 328  THR D CA    1 
ATOM   6446 C C     . THR F 3 328 ? 5.409   -6.686  46.404  1.00 18.64 ? 328  THR D C     1 
ATOM   6447 O O     . THR F 3 328 ? 6.340   -6.428  47.169  1.00 18.55 ? 328  THR D O     1 
ATOM   6448 C CB    . THR F 3 328 ? 4.718   -9.137  46.202  1.00 20.03 ? 328  THR D CB    1 
ATOM   6449 O OG1   . THR F 3 328 ? 5.559   -9.760  47.179  1.00 22.73 ? 328  THR D OG1   1 
ATOM   6450 C CG2   . THR F 3 328 ? 4.352   -10.167 45.152  1.00 22.49 ? 328  THR D CG2   1 
ATOM   6451 N N     . PRO F 3 329 ? 4.339   -5.873  46.255  1.00 18.57 ? 329  PRO D N     1 
ATOM   6452 C CA    . PRO F 3 329 ? 4.177   -4.686  47.088  1.00 17.59 ? 329  PRO D CA    1 
ATOM   6453 C C     . PRO F 3 329 ? 4.232   -5.046  48.570  1.00 16.80 ? 329  PRO D C     1 
ATOM   6454 O O     . PRO F 3 329 ? 3.669   -6.058  48.998  1.00 16.45 ? 329  PRO D O     1 
ATOM   6455 C CB    . PRO F 3 329 ? 2.788   -4.154  46.700  1.00 18.39 ? 329  PRO D CB    1 
ATOM   6456 C CG    . PRO F 3 329 ? 2.552   -4.692  45.337  1.00 19.32 ? 329  PRO D CG    1 
ATOM   6457 C CD    . PRO F 3 329 ? 3.242   -6.010  45.274  1.00 18.65 ? 329  PRO D CD    1 
ATOM   6458 N N     . HIS F 3 330 ? 4.932   -4.223  49.343  1.00 15.71 ? 330  HIS D N     1 
ATOM   6459 C CA    . HIS F 3 330 ? 5.114   -4.529  50.752  1.00 14.90 ? 330  HIS D CA    1 
ATOM   6460 C C     . HIS F 3 330 ? 5.519   -3.302  51.548  1.00 14.19 ? 330  HIS D C     1 
ATOM   6461 O O     . HIS F 3 330 ? 5.935   -2.286  50.984  1.00 13.08 ? 330  HIS D O     1 
ATOM   6462 C CB    . HIS F 3 330 ? 6.153   -5.644  50.929  1.00 14.88 ? 330  HIS D CB    1 
ATOM   6463 C CG    . HIS F 3 330 ? 7.523   -5.270  50.460  1.00 15.18 ? 330  HIS D CG    1 
ATOM   6464 N ND1   . HIS F 3 330 ? 7.927   -5.401  49.148  1.00 15.31 ? 330  HIS D ND1   1 
ATOM   6465 C CD2   . HIS F 3 330 ? 8.577   -4.742  51.128  1.00 16.11 ? 330  HIS D CD2   1 
ATOM   6466 C CE1   . HIS F 3 330 ? 9.176   -4.987  49.031  1.00 16.58 ? 330  HIS D CE1   1 
ATOM   6467 N NE2   . HIS F 3 330 ? 9.594   -4.579  50.218  1.00 13.63 ? 330  HIS D NE2   1 
ATOM   6468 N N     . LEU F 3 331 ? 5.437   -3.448  52.863  1.00 13.64 ? 331  LEU D N     1 
ATOM   6469 C CA    . LEU F 3 331 ? 5.833   -2.404  53.803  1.00 13.50 ? 331  LEU D CA    1 
ATOM   6470 C C     . LEU F 3 331 ? 7.363   -2.269  53.897  1.00 12.54 ? 331  LEU D C     1 
ATOM   6471 O O     . LEU F 3 331 ? 8.075   -3.265  54.068  1.00 12.28 ? 331  LEU D O     1 
ATOM   6472 C CB    . LEU F 3 331 ? 5.249   -2.736  55.184  1.00 13.62 ? 331  LEU D CB    1 
ATOM   6473 C CG    . LEU F 3 331 ? 5.517   -1.766  56.333  1.00 14.09 ? 331  LEU D CG    1 
ATOM   6474 C CD1   . LEU F 3 331 ? 4.966   -0.370  56.079  1.00 15.33 ? 331  LEU D CD1   1 
ATOM   6475 C CD2   . LEU F 3 331 ? 4.950   -2.326  57.637  1.00 14.56 ? 331  LEU D CD2   1 
ATOM   6476 N N     . VAL F 3 332 ? 7.838   -1.030  53.774  1.00 12.25 ? 332  VAL D N     1 
ATOM   6477 C CA    . VAL F 3 332 ? 9.253   -0.683  53.918  1.00 11.67 ? 332  VAL D CA    1 
ATOM   6478 C C     . VAL F 3 332 ? 9.382   0.301   55.081  1.00 11.67 ? 332  VAL D C     1 
ATOM   6479 O O     . VAL F 3 332 ? 8.580   1.232   55.208  1.00 10.47 ? 332  VAL D O     1 
ATOM   6480 C CB    . VAL F 3 332 ? 9.833   -0.065  52.597  1.00 12.30 ? 332  VAL D CB    1 
ATOM   6481 C CG1   . VAL F 3 332 ? 11.330  0.208   52.702  1.00 12.39 ? 332  VAL D CG1   1 
ATOM   6482 C CG2   . VAL F 3 332 ? 9.560   -0.962  51.387  1.00 12.14 ? 332  VAL D CG2   1 
ATOM   6483 N N     . VAL F 3 333 ? 10.371  0.065   55.946  1.00 10.80 ? 333  VAL D N     1 
ATOM   6484 C CA    . VAL F 3 333 ? 10.626  0.942   57.094  1.00 11.11 ? 333  VAL D CA    1 
ATOM   6485 C C     . VAL F 3 333 ? 12.100  1.332   57.095  1.00 10.81 ? 333  VAL D C     1 
ATOM   6486 O O     . VAL F 3 333 ? 12.983  0.495   56.813  1.00 9.12  ? 333  VAL D O     1 
ATOM   6487 C CB    . VAL F 3 333 ? 10.267  0.268   58.433  1.00 11.35 ? 333  VAL D CB    1 
ATOM   6488 C CG1   . VAL F 3 333 ? 10.565  1.226   59.631  1.00 10.94 ? 333  VAL D CG1   1 
ATOM   6489 C CG2   . VAL F 3 333 ? 8.793   -0.151  58.462  1.00 11.56 ? 333  VAL D CG2   1 
ATOM   6490 N N     . ALA F 3 334 ? 12.351  2.599   57.416  1.00 10.79 ? 334  ALA D N     1 
ATOM   6491 C CA    . ALA F 3 334 ? 13.683  3.207   57.306  1.00 11.11 ? 334  ALA D CA    1 
ATOM   6492 C C     . ALA F 3 334 ? 14.648  2.736   58.393  1.00 11.22 ? 334  ALA D C     1 
ATOM   6493 O O     . ALA F 3 334 ? 14.235  2.476   59.525  1.00 11.54 ? 334  ALA D O     1 
ATOM   6494 C CB    . ALA F 3 334 ? 13.561  4.719   57.365  1.00 11.44 ? 334  ALA D CB    1 
ATOM   6495 N N     . HIS F 3 335 ? 15.931  2.662   58.038  1.00 9.96  ? 335  HIS D N     1 
ATOM   6496 C CA    . HIS F 3 335 ? 16.968  2.266   58.993  1.00 9.96  ? 335  HIS D CA    1 
ATOM   6497 C C     . HIS F 3 335 ? 17.884  3.416   59.379  1.00 10.67 ? 335  HIS D C     1 
ATOM   6498 O O     . HIS F 3 335 ? 18.477  3.381   60.460  1.00 10.30 ? 335  HIS D O     1 
ATOM   6499 C CB    . HIS F 3 335 ? 17.784  1.099   58.380  1.00 10.24 ? 335  HIS D CB    1 
ATOM   6500 C CG    . HIS F 3 335 ? 18.969  0.645   59.188  1.00 10.01 ? 335  HIS D CG    1 
ATOM   6501 N ND1   . HIS F 3 335 ? 18.864  0.195   60.485  1.00 10.12 ? 335  HIS D ND1   1 
ATOM   6502 C CD2   . HIS F 3 335 ? 20.265  0.453   58.828  1.00 11.32 ? 335  HIS D CD2   1 
ATOM   6503 C CE1   . HIS F 3 335 ? 20.052  -0.211  60.908  1.00 10.47 ? 335  HIS D CE1   1 
ATOM   6504 N NE2   . HIS F 3 335 ? 20.920  -0.074  59.919  1.00 9.35  ? 335  HIS D NE2   1 
ATOM   6505 N N     . THR F 3 336 ? 18.041  4.409   58.500  1.00 10.49 ? 336  THR D N     1 
ATOM   6506 C CA    . THR F 3 336 ? 19.050  5.458   58.730  1.00 11.37 ? 336  THR D CA    1 
ATOM   6507 C C     . THR F 3 336 ? 18.437  6.849   58.621  1.00 11.49 ? 336  THR D C     1 
ATOM   6508 O O     . THR F 3 336 ? 18.877  7.704   57.836  1.00 10.67 ? 336  THR D O     1 
ATOM   6509 C CB    . THR F 3 336 ? 20.287  5.235   57.818  1.00 11.16 ? 336  THR D CB    1 
ATOM   6510 O OG1   . THR F 3 336 ? 20.658  3.850   57.906  1.00 10.83 ? 336  THR D OG1   1 
ATOM   6511 C CG2   . THR F 3 336 ? 21.496  6.079   58.252  1.00 12.77 ? 336  THR D CG2   1 
ATOM   6512 N N     . LYS F 3 337 ? 17.393  7.057   59.426  1.00 11.86 ? 337  LYS D N     1 
ATOM   6513 C CA    . LYS F 3 337 ? 16.786  8.373   59.588  1.00 12.46 ? 337  LYS D CA    1 
ATOM   6514 C C     . LYS F 3 337 ? 16.835  8.824   61.055  1.00 13.43 ? 337  LYS D C     1 
ATOM   6515 O O     . LYS F 3 337 ? 16.067  9.689   61.477  1.00 13.56 ? 337  LYS D O     1 
ATOM   6516 C CB    . LYS F 3 337 ? 15.349  8.383   59.032  1.00 12.29 ? 337  LYS D CB    1 
ATOM   6517 C CG    . LYS F 3 337 ? 15.306  8.066   57.501  1.00 12.19 ? 337  LYS D CG    1 
ATOM   6518 C CD    . LYS F 3 337 ? 13.912  8.229   56.900  1.00 13.10 ? 337  LYS D CD    1 
ATOM   6519 C CE    . LYS F 3 337 ? 13.843  7.761   55.448  1.00 14.15 ? 337  LYS D CE    1 
ATOM   6520 N NZ    . LYS F 3 337 ? 14.324  8.820   54.548  1.00 20.08 ? 337  LYS D NZ    1 
ATOM   6521 N N     . GLY F 3 338 ? 17.757  8.248   61.821  1.00 13.46 ? 338  GLY D N     1 
ATOM   6522 C CA    . GLY F 3 338 ? 17.855  8.548   63.258  1.00 13.33 ? 338  GLY D CA    1 
ATOM   6523 C C     . GLY F 3 338 ? 16.800  7.776   64.036  1.00 13.33 ? 338  GLY D C     1 
ATOM   6524 O O     . GLY F 3 338 ? 16.271  6.762   63.550  1.00 13.49 ? 338  GLY D O     1 
ATOM   6525 N N     . THR F 3 339 ? 16.475  8.265   65.233  1.00 13.40 ? 339  THR D N     1 
ATOM   6526 C CA    . THR F 3 339 ? 15.512  7.595   66.107  1.00 14.36 ? 339  THR D CA    1 
ATOM   6527 C C     . THR F 3 339 ? 14.111  7.983   65.724  1.00 14.59 ? 339  THR D C     1 
ATOM   6528 O O     . THR F 3 339 ? 13.485  8.859   66.334  1.00 14.53 ? 339  THR D O     1 
ATOM   6529 C CB    . THR F 3 339 ? 15.727  7.998   67.557  1.00 14.78 ? 339  THR D CB    1 
ATOM   6530 O OG1   . THR F 3 339 ? 17.104  7.833   67.841  1.00 15.64 ? 339  THR D OG1   1 
ATOM   6531 C CG2   . THR F 3 339 ? 14.901  7.098   68.509  1.00 15.58 ? 339  THR D CG2   1 
ATOM   6532 N N     . ARG F 3 340 ? 13.619  7.322   64.692  1.00 13.75 ? 340  ARG D N     1 
ATOM   6533 C CA    . ARG F 3 340 ? 12.291  7.589   64.210  1.00 14.49 ? 340  ARG D CA    1 
ATOM   6534 C C     . ARG F 3 340 ? 11.804  6.365   63.450  1.00 13.92 ? 340  ARG D C     1 
ATOM   6535 O O     . ARG F 3 340 ? 12.603  5.499   63.095  1.00 13.39 ? 340  ARG D O     1 
ATOM   6536 C CB    . ARG F 3 340 ? 12.289  8.824   63.328  1.00 16.34 ? 340  ARG D CB    1 
ATOM   6537 C CG    . ARG F 3 340 ? 13.038  8.714   62.065  1.00 18.80 ? 340  ARG D CG    1 
ATOM   6538 C CD    . ARG F 3 340 ? 12.917  10.038  61.337  1.00 27.70 ? 340  ARG D CD    1 
ATOM   6539 N NE    . ARG F 3 340 ? 13.398  11.122  62.182  1.00 32.48 ? 340  ARG D NE    1 
ATOM   6540 C CZ    . ARG F 3 340 ? 13.051  12.397  62.057  1.00 36.48 ? 340  ARG D CZ    1 
ATOM   6541 N NH1   . ARG F 3 340 ? 12.201  12.774  61.105  1.00 39.12 ? 340  ARG D NH1   1 
ATOM   6542 N NH2   . ARG F 3 340 ? 13.557  13.298  62.895  1.00 38.58 ? 340  ARG D NH2   1 
ATOM   6543 N N     . VAL F 3 341 ? 10.498  6.309   63.225  1.00 12.42 ? 341  VAL D N     1 
ATOM   6544 C CA    . VAL F 3 341 ? 9.884   5.244   62.475  1.00 11.83 ? 341  VAL D CA    1 
ATOM   6545 C C     . VAL F 3 341 ? 9.279   5.934   61.260  1.00 11.46 ? 341  VAL D C     1 
ATOM   6546 O O     . VAL F 3 341 ? 8.374   6.774   61.392  1.00 10.99 ? 341  VAL D O     1 
ATOM   6547 C CB    . VAL F 3 341 ? 8.783   4.532   63.274  1.00 11.57 ? 341  VAL D CB    1 
ATOM   6548 C CG1   . VAL F 3 341 ? 8.210   3.366   62.457  1.00 11.80 ? 341  VAL D CG1   1 
ATOM   6549 C CG2   . VAL F 3 341 ? 9.320   4.029   64.628  1.00 11.97 ? 341  VAL D CG2   1 
ATOM   6550 N N     . VAL F 3 342 ? 9.844   5.621   60.106  1.00 10.93 ? 342  VAL D N     1 
ATOM   6551 C CA    . VAL F 3 342 ? 9.391   6.196   58.826  1.00 11.61 ? 342  VAL D CA    1 
ATOM   6552 C C     . VAL F 3 342 ? 9.061   5.002   57.950  1.00 11.52 ? 342  VAL D C     1 
ATOM   6553 O O     . VAL F 3 342 ? 9.926   4.144   57.717  1.00 11.14 ? 342  VAL D O     1 
ATOM   6554 C CB    . VAL F 3 342 ? 10.492  7.058   58.164  1.00 11.49 ? 342  VAL D CB    1 
ATOM   6555 C CG1   . VAL F 3 342 ? 10.016  7.580   56.784  1.00 12.57 ? 342  VAL D CG1   1 
ATOM   6556 C CG2   . VAL F 3 342 ? 10.889  8.208   59.058  1.00 12.39 ? 342  VAL D CG2   1 
ATOM   6557 N N     . ALA F 3 343 ? 7.811   4.945   57.478  1.00 11.71 ? 343  ALA D N     1 
ATOM   6558 C CA    . ALA F 3 343 ? 7.304   3.762   56.792  1.00 11.50 ? 343  ALA D CA    1 
ATOM   6559 C C     . ALA F 3 343 ? 6.509   4.132   55.555  1.00 11.58 ? 343  ALA D C     1 
ATOM   6560 O O     . ALA F 3 343 ? 5.872   5.166   55.509  1.00 11.85 ? 343  ALA D O     1 
ATOM   6561 C CB    . ALA F 3 343 ? 6.437   2.936   57.724  1.00 11.27 ? 343  ALA D CB    1 
ATOM   6562 N N     . ALA F 3 344 ? 6.555   3.269   54.558  1.00 12.14 ? 344  ALA D N     1 
ATOM   6563 C CA    . ALA F 3 344 ? 5.707   3.458   53.376  1.00 11.83 ? 344  ALA D CA    1 
ATOM   6564 C C     . ALA F 3 344 ? 5.422   2.122   52.735  1.00 12.98 ? 344  ALA D C     1 
ATOM   6565 O O     . ALA F 3 344 ? 6.221   1.189   52.839  1.00 13.08 ? 344  ALA D O     1 
ATOM   6566 C CB    . ALA F 3 344 ? 6.363   4.431   52.372  1.00 12.59 ? 344  ALA D CB    1 
ATOM   6567 N N     . TRP F 3 345 ? 4.278   2.030   52.058  1.00 13.21 ? 345  TRP D N     1 
ATOM   6568 C CA    . TRP F 3 345 ? 3.960   0.869   51.246  1.00 14.52 ? 345  TRP D CA    1 
ATOM   6569 C C     . TRP F 3 345 ? 4.584   1.051   49.863  1.00 14.42 ? 345  TRP D C     1 
ATOM   6570 O O     . TRP F 3 345 ? 4.292   2.045   49.169  1.00 13.28 ? 345  TRP D O     1 
ATOM   6571 C CB    . TRP F 3 345 ? 2.440   0.773   51.111  1.00 16.24 ? 345  TRP D CB    1 
ATOM   6572 C CG    . TRP F 3 345 ? 1.956   -0.469  50.482  1.00 18.19 ? 345  TRP D CG    1 
ATOM   6573 C CD1   . TRP F 3 345 ? 1.493   -0.623  49.198  1.00 20.17 ? 345  TRP D CD1   1 
ATOM   6574 C CD2   . TRP F 3 345 ? 1.877   -1.755  51.093  1.00 19.90 ? 345  TRP D CD2   1 
ATOM   6575 N NE1   . TRP F 3 345 ? 1.132   -1.936  48.984  1.00 20.33 ? 345  TRP D NE1   1 
ATOM   6576 C CE2   . TRP F 3 345 ? 1.348   -2.644  50.132  1.00 20.88 ? 345  TRP D CE2   1 
ATOM   6577 C CE3   . TRP F 3 345 ? 2.192   -2.244  52.365  1.00 20.70 ? 345  TRP D CE3   1 
ATOM   6578 C CZ2   . TRP F 3 345 ? 1.143   -4.003  50.405  1.00 20.15 ? 345  TRP D CZ2   1 
ATOM   6579 C CZ3   . TRP F 3 345 ? 1.977   -3.598  52.636  1.00 20.67 ? 345  TRP D CZ3   1 
ATOM   6580 C CH2   . TRP F 3 345 ? 1.459   -4.451  51.662  1.00 19.63 ? 345  TRP D CH2   1 
ATOM   6581 N N     . ASP F 3 346 ? 5.454   0.126   49.468  1.00 14.63 ? 346  ASP D N     1 
ATOM   6582 C CA    . ASP F 3 346 ? 6.016   0.166   48.121  1.00 14.72 ? 346  ASP D CA    1 
ATOM   6583 C C     . ASP F 3 346 ? 5.034   -0.500  47.157  1.00 15.36 ? 346  ASP D C     1 
ATOM   6584 O O     . ASP F 3 346 ? 5.106   -1.719  46.936  1.00 14.94 ? 346  ASP D O     1 
ATOM   6585 C CB    . ASP F 3 346 ? 7.372   -0.557  48.066  1.00 14.98 ? 346  ASP D CB    1 
ATOM   6586 C CG    . ASP F 3 346 ? 8.023   -0.486  46.681  1.00 14.95 ? 346  ASP D CG    1 
ATOM   6587 O OD1   . ASP F 3 346 ? 7.462   0.163   45.771  1.00 16.03 ? 346  ASP D OD1   1 
ATOM   6588 O OD2   . ASP F 3 346 ? 9.096   -1.095  46.505  1.00 16.36 ? 346  ASP D OD2   1 
ATOM   6589 N N     . GLU F 3 347 ? 4.141   0.308   46.579  1.00 16.49 ? 347  GLU D N     1 
ATOM   6590 C CA    . GLU F 3 347 ? 3.073   -0.215  45.722  1.00 18.63 ? 347  GLU D CA    1 
ATOM   6591 C C     . GLU F 3 347 ? 3.614   -0.761  44.396  1.00 18.04 ? 347  GLU D C     1 
ATOM   6592 O O     . GLU F 3 347 ? 2.996   -1.649  43.797  1.00 19.03 ? 347  GLU D O     1 
ATOM   6593 C CB    . GLU F 3 347 ? 2.009   0.861   45.461  1.00 18.39 ? 347  GLU D CB    1 
ATOM   6594 C CG    . GLU F 3 347 ? 2.519   2.038   44.630  1.00 22.24 ? 347  GLU D CG    1 
ATOM   6595 C CD    . GLU F 3 347 ? 1.574   3.232   44.600  1.00 23.48 ? 347  GLU D CD    1 
ATOM   6596 O OE1   . GLU F 3 347 ? 0.466   3.156   45.202  1.00 30.63 ? 347  GLU D OE1   1 
ATOM   6597 O OE2   . GLU F 3 347 ? 1.952   4.254   43.972  1.00 28.75 ? 347  GLU D OE2   1 
ATOM   6598 N N     . ARG F 3 348 ? 4.756   -0.236  43.942  1.00 17.56 ? 348  ARG D N     1 
ATOM   6599 C CA    . ARG F 3 348 ? 5.314   -0.616  42.633  1.00 18.23 ? 348  ARG D CA    1 
ATOM   6600 C C     . ARG F 3 348 ? 6.249   -1.835  42.647  1.00 17.74 ? 348  ARG D C     1 
ATOM   6601 O O     . ARG F 3 348 ? 6.567   -2.388  41.577  1.00 19.06 ? 348  ARG D O     1 
ATOM   6602 C CB    . ARG F 3 348 ? 6.052   0.561   41.998  1.00 18.10 ? 348  ARG D CB    1 
ATOM   6603 C CG    . ARG F 3 348 ? 5.230   1.821   41.840  1.00 20.70 ? 348  ARG D CG    1 
ATOM   6604 C CD    . ARG F 3 348 ? 5.851   2.684   40.752  1.00 23.50 ? 348  ARG D CD    1 
ATOM   6605 N NE    . ARG F 3 348 ? 5.354   4.053   40.762  1.00 24.25 ? 348  ARG D NE    1 
ATOM   6606 C CZ    . ARG F 3 348 ? 5.868   5.038   40.023  1.00 27.31 ? 348  ARG D CZ    1 
ATOM   6607 N NH1   . ARG F 3 348 ? 6.898   4.810   39.213  1.00 26.49 ? 348  ARG D NH1   1 
ATOM   6608 N NH2   . ARG F 3 348 ? 5.354   6.259   40.099  1.00 29.98 ? 348  ARG D NH2   1 
ATOM   6609 N N     . ALA F 3 349 ? 6.677   -2.246  43.842  1.00 16.67 ? 349  ALA D N     1 
ATOM   6610 C CA    . ALA F 3 349 ? 7.652   -3.330  44.031  1.00 15.16 ? 349  ALA D CA    1 
ATOM   6611 C C     . ALA F 3 349 ? 8.973   -3.078  43.270  1.00 14.49 ? 349  ALA D C     1 
ATOM   6612 O O     . ALA F 3 349 ? 9.263   -3.704  42.253  1.00 13.98 ? 349  ALA D O     1 
ATOM   6613 C CB    . ALA F 3 349 ? 7.031   -4.705  43.708  1.00 15.92 ? 349  ALA D CB    1 
ATOM   6614 N N     . TYR F 3 350 ? 9.758   -2.128  43.786  1.00 13.29 ? 350  TYR D N     1 
ATOM   6615 C CA    . TYR F 3 350 ? 11.037  -1.738  43.185  1.00 12.50 ? 350  TYR D CA    1 
ATOM   6616 C C     . TYR F 3 350 ? 12.219  -2.476  43.814  1.00 11.87 ? 350  TYR D C     1 
ATOM   6617 O O     . TYR F 3 350 ? 12.097  -3.046  44.901  1.00 11.85 ? 350  TYR D O     1 
ATOM   6618 C CB    . TYR F 3 350 ? 11.264  -0.226  43.349  1.00 13.01 ? 350  TYR D CB    1 
ATOM   6619 C CG    . TYR F 3 350 ? 10.906  0.617   42.150  1.00 14.16 ? 350  TYR D CG    1 
ATOM   6620 C CD1   . TYR F 3 350 ? 9.710   0.412   41.474  1.00 14.41 ? 350  TYR D CD1   1 
ATOM   6621 C CD2   . TYR F 3 350 ? 11.764  1.638   41.696  1.00 13.56 ? 350  TYR D CD2   1 
ATOM   6622 C CE1   . TYR F 3 350 ? 9.364   1.182   40.390  1.00 15.82 ? 350  TYR D CE1   1 
ATOM   6623 C CE2   . TYR F 3 350 ? 11.428  2.412   40.600  1.00 16.31 ? 350  TYR D CE2   1 
ATOM   6624 C CZ    . TYR F 3 350 ? 10.213  2.184   39.960  1.00 16.01 ? 350  TYR D CZ    1 
ATOM   6625 O OH    . TYR F 3 350 ? 9.840   2.937   38.877  1.00 17.27 ? 350  TYR D OH    1 
ATOM   6626 N N     . PRO F 3 351 ? 13.379  -2.463  43.129  1.00 11.02 ? 351  PRO D N     1 
ATOM   6627 C CA    . PRO F 3 351 ? 14.613  -2.922  43.763  1.00 10.14 ? 351  PRO D CA    1 
ATOM   6628 C C     . PRO F 3 351 ? 15.048  -1.901  44.829  1.00 9.27  ? 351  PRO D C     1 
ATOM   6629 O O     . PRO F 3 351 ? 15.061  -0.693  44.542  1.00 10.03 ? 351  PRO D O     1 
ATOM   6630 C CB    . PRO F 3 351 ? 15.622  -2.915  42.618  1.00 9.63  ? 351  PRO D CB    1 
ATOM   6631 C CG    . PRO F 3 351 ? 15.053  -1.895  41.624  1.00 11.28 ? 351  PRO D CG    1 
ATOM   6632 C CD    . PRO F 3 351 ? 13.586  -2.041  41.729  1.00 10.93 ? 351  PRO D CD    1 
ATOM   6633 N N     . TRP F 3 352 ? 15.382  -2.375  46.030  1.00 9.67  ? 352  TRP D N     1 
ATOM   6634 C CA    . TRP F 3 352 ? 15.932  -1.513  47.077  1.00 9.75  ? 352  TRP D CA    1 
ATOM   6635 C C     . TRP F 3 352 ? 17.321  -1.945  47.468  1.00 9.75  ? 352  TRP D C     1 
ATOM   6636 O O     . TRP F 3 352 ? 17.585  -3.161  47.556  1.00 9.53  ? 352  TRP D O     1 
ATOM   6637 C CB    . TRP F 3 352 ? 15.068  -1.596  48.349  1.00 9.89  ? 352  TRP D CB    1 
ATOM   6638 C CG    . TRP F 3 352 ? 13.726  -0.967  48.217  1.00 10.42 ? 352  TRP D CG    1 
ATOM   6639 C CD1   . TRP F 3 352 ? 12.623  -1.501  47.598  1.00 11.31 ? 352  TRP D CD1   1 
ATOM   6640 C CD2   . TRP F 3 352 ? 13.325  0.316   48.723  1.00 11.69 ? 352  TRP D CD2   1 
ATOM   6641 N NE1   . TRP F 3 352 ? 11.560  -0.618  47.692  1.00 11.76 ? 352  TRP D NE1   1 
ATOM   6642 C CE2   . TRP F 3 352 ? 11.962  0.501   48.367  1.00 11.37 ? 352  TRP D CE2   1 
ATOM   6643 C CE3   . TRP F 3 352 ? 13.983  1.326   49.446  1.00 12.02 ? 352  TRP D CE3   1 
ATOM   6644 C CZ2   . TRP F 3 352 ? 11.250  1.659   48.701  1.00 11.00 ? 352  TRP D CZ2   1 
ATOM   6645 C CZ3   . TRP F 3 352 ? 13.278  2.482   49.778  1.00 12.21 ? 352  TRP D CZ3   1 
ATOM   6646 C CH2   . TRP F 3 352 ? 11.915  2.633   49.408  1.00 12.22 ? 352  TRP D CH2   1 
ATOM   6647 N N     . ARG F 3 353 ? 18.196  -0.958  47.710  1.00 9.41  ? 353  ARG D N     1 
ATOM   6648 C CA    . ARG F 3 353 ? 19.563  -1.207  48.217  1.00 9.67  ? 353  ARG D CA    1 
ATOM   6649 C C     . ARG F 3 353 ? 19.658  -1.004  49.722  1.00 9.41  ? 353  ARG D C     1 
ATOM   6650 O O     . ARG F 3 353 ? 20.709  -1.319  50.330  1.00 9.42  ? 353  ARG D O     1 
ATOM   6651 C CB    . ARG F 3 353 ? 20.564  -0.248  47.536  1.00 9.76  ? 353  ARG D CB    1 
ATOM   6652 C CG    . ARG F 3 353 ? 21.997  -0.765  47.452  1.00 11.73 ? 353  ARG D CG    1 
ATOM   6653 C CD    . ARG F 3 353 ? 22.979  0.408   47.257  1.00 11.97 ? 353  ARG D CD    1 
ATOM   6654 N NE    . ARG F 3 353 ? 23.030  1.178   48.504  1.00 14.37 ? 353  ARG D NE    1 
ATOM   6655 C CZ    . ARG F 3 353 ? 23.482  2.427   48.663  1.00 13.90 ? 353  ARG D CZ    1 
ATOM   6656 N NH1   . ARG F 3 353 ? 23.979  3.159   47.657  1.00 13.81 ? 353  ARG D NH1   1 
ATOM   6657 N NH2   . ARG F 3 353 ? 23.443  2.948   49.875  1.00 12.96 ? 353  ARG D NH2   1 
ATOM   6658 N N     . GLU F 3 354 ? 18.597  -0.447  50.319  1.00 8.94  ? 354  GLU D N     1 
ATOM   6659 C CA    . GLU F 3 354 ? 18.569  -0.209  51.763  1.00 8.85  ? 354  GLU D CA    1 
ATOM   6660 C C     . GLU F 3 354 ? 17.174  -0.433  52.351  1.00 9.29  ? 354  GLU D C     1 
ATOM   6661 O O     . GLU F 3 354 ? 16.194  -0.677  51.610  1.00 9.59  ? 354  GLU D O     1 
ATOM   6662 C CB    . GLU F 3 354 ? 19.039  1.223   52.068  1.00 7.66  ? 354  GLU D CB    1 
ATOM   6663 C CG    . GLU F 3 354 ? 20.409  1.601   51.494  1.00 7.74  ? 354  GLU D CG    1 
ATOM   6664 C CD    . GLU F 3 354 ? 21.586  0.753   52.048  1.00 7.90  ? 354  GLU D CD    1 
ATOM   6665 O OE1   . GLU F 3 354 ? 21.420  0.082   53.095  1.00 8.54  ? 354  GLU D OE1   1 
ATOM   6666 O OE2   . GLU F 3 354 ? 22.693  0.793   51.432  1.00 8.53  ? 354  GLU D OE2   1 
ATOM   6667 N N     . GLU F 3 355 ? 17.121  -0.323  53.689  1.00 8.32  ? 355  GLU D N     1 
ATOM   6668 C CA    . GLU F 3 355 ? 15.912  -0.350  54.518  1.00 8.26  ? 355  GLU D CA    1 
ATOM   6669 C C     . GLU F 3 355 ? 15.399  -1.741  54.880  1.00 8.85  ? 355  GLU D C     1 
ATOM   6670 O O     . GLU F 3 355 ? 15.815  -2.767  54.313  1.00 8.42  ? 355  GLU D O     1 
ATOM   6671 C CB    . GLU F 3 355 ? 14.782  0.557   53.950  1.00 8.47  ? 355  GLU D CB    1 
ATOM   6672 C CG    . GLU F 3 355 ? 15.247  1.938   53.407  1.00 8.18  ? 355  GLU D CG    1 
ATOM   6673 C CD    . GLU F 3 355 ? 15.791  2.859   54.510  1.00 10.96 ? 355  GLU D CD    1 
ATOM   6674 O OE1   . GLU F 3 355 ? 16.603  2.385   55.332  1.00 13.75 ? 355  GLU D OE1   1 
ATOM   6675 O OE2   . GLU F 3 355 ? 15.372  4.043   54.558  1.00 13.64 ? 355  GLU D OE2   1 
ATOM   6676 N N     . PHE F 3 356 ? 14.493  -1.763  55.853  1.00 8.65  ? 356  PHE D N     1 
ATOM   6677 C CA    . PHE F 3 356 ? 13.812  -2.978  56.241  1.00 8.68  ? 356  PHE D CA    1 
ATOM   6678 C C     . PHE F 3 356 ? 12.618  -3.232  55.343  1.00 9.22  ? 356  PHE D C     1 
ATOM   6679 O O     . PHE F 3 356 ? 11.907  -2.298  54.951  1.00 10.74 ? 356  PHE D O     1 
ATOM   6680 C CB    . PHE F 3 356 ? 13.276  -2.853  57.663  1.00 8.61  ? 356  PHE D CB    1 
ATOM   6681 C CG    . PHE F 3 356 ? 14.331  -2.569  58.694  1.00 8.68  ? 356  PHE D CG    1 
ATOM   6682 C CD1   . PHE F 3 356 ? 15.167  -3.588  59.148  1.00 9.81  ? 356  PHE D CD1   1 
ATOM   6683 C CD2   . PHE F 3 356 ? 14.462  -1.290  59.237  1.00 11.84 ? 356  PHE D CD2   1 
ATOM   6684 C CE1   . PHE F 3 356 ? 16.137  -3.333  60.137  1.00 9.56  ? 356  PHE D CE1   1 
ATOM   6685 C CE2   . PHE F 3 356 ? 15.434  -1.021  60.203  1.00 10.41 ? 356  PHE D CE2   1 
ATOM   6686 C CZ    . PHE F 3 356 ? 16.277  -2.055  60.646  1.00 9.62  ? 356  PHE D CZ    1 
ATOM   6687 N N     . HIS F 3 357 ? 12.403  -4.512  55.068  1.00 9.83  ? 357  HIS D N     1 
ATOM   6688 C CA    . HIS F 3 357 ? 11.315  -4.996  54.201  1.00 10.54 ? 357  HIS D CA    1 
ATOM   6689 C C     . HIS F 3 357 ? 10.502  -6.016  54.984  1.00 11.44 ? 357  HIS D C     1 
ATOM   6690 O O     . HIS F 3 357 ? 11.034  -7.059  55.415  1.00 11.82 ? 357  HIS D O     1 
ATOM   6691 C CB    . HIS F 3 357 ? 11.931  -5.536  52.898  1.00 10.49 ? 357  HIS D CB    1 
ATOM   6692 C CG    . HIS F 3 357 ? 12.642  -4.463  52.151  1.00 10.98 ? 357  HIS D CG    1 
ATOM   6693 N ND1   . HIS F 3 357 ? 12.008  -3.685  51.211  1.00 10.88 ? 357  HIS D ND1   1 
ATOM   6694 C CD2   . HIS F 3 357 ? 13.870  -3.923  52.325  1.00 12.31 ? 357  HIS D CD2   1 
ATOM   6695 C CE1   . HIS F 3 357 ? 12.843  -2.756  50.780  1.00 12.50 ? 357  HIS D CE1   1 
ATOM   6696 N NE2   . HIS F 3 357 ? 13.964  -2.850  51.472  1.00 11.94 ? 357  HIS D NE2   1 
ATOM   6697 N N     . LEU F 3 358 ? 9.235   -5.648  55.226  1.00 11.58 ? 358  LEU D N     1 
ATOM   6698 C CA    . LEU F 3 358 ? 8.348   -6.381  56.123  1.00 12.90 ? 358  LEU D CA    1 
ATOM   6699 C C     . LEU F 3 358 ? 7.301   -7.129  55.320  1.00 13.51 ? 358  LEU D C     1 
ATOM   6700 O O     . LEU F 3 358 ? 6.612   -6.539  54.495  1.00 14.06 ? 358  LEU D O     1 
ATOM   6701 C CB    . LEU F 3 358 ? 7.684   -5.414  57.106  1.00 13.02 ? 358  LEU D CB    1 
ATOM   6702 C CG    . LEU F 3 358 ? 8.593   -4.915  58.234  1.00 14.59 ? 358  LEU D CG    1 
ATOM   6703 C CD1   . LEU F 3 358 ? 9.620   -3.900  57.702  1.00 16.82 ? 358  LEU D CD1   1 
ATOM   6704 C CD2   . LEU F 3 358 ? 7.758   -4.276  59.326  1.00 17.03 ? 358  LEU D CD2   1 
ATOM   6705 N N     . LEU F 3 359 ? 7.226   -8.429  55.561  1.00 14.98 ? 359  LEU D N     1 
ATOM   6706 C CA    . LEU F 3 359 ? 6.343   -9.326  54.803  1.00 16.21 ? 359  LEU D CA    1 
ATOM   6707 C C     . LEU F 3 359 ? 5.438   -10.034 55.810  1.00 16.63 ? 359  LEU D C     1 
ATOM   6708 O O     . LEU F 3 359 ? 5.939   -10.639 56.770  1.00 15.63 ? 359  LEU D O     1 
ATOM   6709 C CB    . LEU F 3 359 ? 7.164   -10.350 54.011  1.00 17.00 ? 359  LEU D CB    1 
ATOM   6710 C CG    . LEU F 3 359 ? 8.492   -9.860  53.391  1.00 19.17 ? 359  LEU D CG    1 
ATOM   6711 C CD1   . LEU F 3 359 ? 9.367   -11.036 52.965  1.00 23.38 ? 359  LEU D CD1   1 
ATOM   6712 C CD2   . LEU F 3 359 ? 8.276   -8.876  52.252  1.00 21.74 ? 359  LEU D CD2   1 
ATOM   6713 N N     . PRO F 3 360 ? 4.104   -9.900  55.626  1.00 17.74 ? 360  PRO D N     1 
ATOM   6714 C CA    . PRO F 3 360 ? 3.164   -10.446 56.611  1.00 18.35 ? 360  PRO D CA    1 
ATOM   6715 C C     . PRO F 3 360 ? 3.379   -11.929 56.822  1.00 19.12 ? 360  PRO D C     1 
ATOM   6716 O O     . PRO F 3 360 ? 3.675   -12.672 55.865  1.00 19.15 ? 360  PRO D O     1 
ATOM   6717 C CB    . PRO F 3 360 ? 1.772   -10.153 56.016  1.00 18.46 ? 360  PRO D CB    1 
ATOM   6718 C CG    . PRO F 3 360 ? 1.977   -9.600  54.681  1.00 18.92 ? 360  PRO D CG    1 
ATOM   6719 C CD    . PRO F 3 360 ? 3.426   -9.212  54.514  1.00 17.88 ? 360  PRO D CD    1 
ATOM   6720 N N     . LYS F 3 361 ? 3.279   -12.348 58.078  1.00 19.58 ? 361  LYS D N     1 
ATOM   6721 C CA    . LYS F 3 361 ? 3.318   -13.758 58.423  1.00 20.69 ? 361  LYS D CA    1 
ATOM   6722 C C     . LYS F 3 361 ? 2.002   -14.423 57.996  1.00 21.58 ? 361  LYS D C     1 
ATOM   6723 O O     . LYS F 3 361 ? 0.992   -13.752 57.791  1.00 21.86 ? 361  LYS D O     1 
ATOM   6724 C CB    . LYS F 3 361 ? 3.556   -13.937 59.929  1.00 20.15 ? 361  LYS D CB    1 
ATOM   6725 C CG    . LYS F 3 361 ? 4.984   -13.591 60.337  1.00 20.96 ? 361  LYS D CG    1 
ATOM   6726 C CD    . LYS F 3 361 ? 5.310   -13.900 61.789  1.00 20.96 ? 361  LYS D CD    1 
ATOM   6727 C CE    . LYS F 3 361 ? 6.767   -13.525 62.072  1.00 21.60 ? 361  LYS D CE    1 
ATOM   6728 N NZ    . LYS F 3 361 ? 7.222   -13.872 63.435  1.00 23.51 ? 361  LYS D NZ    1 
ATOM   6729 N N     . GLU F 3 362 ? 2.042   -15.740 57.848  1.00 23.86 ? 362  GLU D N     1 
ATOM   6730 C CA    . GLU F 3 362 ? 0.862   -16.538 57.498  1.00 25.56 ? 362  GLU D CA    1 
ATOM   6731 C C     . GLU F 3 362 ? -0.250  -16.352 58.537  1.00 25.60 ? 362  GLU D C     1 
ATOM   6732 O O     . GLU F 3 362 ? -0.016  -16.502 59.739  1.00 25.77 ? 362  GLU D O     1 
ATOM   6733 C CB    . GLU F 3 362 ? 1.261   -18.010 57.408  1.00 26.60 ? 362  GLU D CB    1 
ATOM   6734 C CG    . GLU F 3 362 ? 0.293   -18.885 56.624  1.00 30.26 ? 362  GLU D CG    1 
ATOM   6735 C CD    . GLU F 3 362 ? 0.441   -20.353 56.976  1.00 35.64 ? 362  GLU D CD    1 
ATOM   6736 O OE1   . GLU F 3 362 ? 0.335   -20.687 58.182  1.00 37.47 ? 362  GLU D OE1   1 
ATOM   6737 O OE2   . GLU F 3 362 ? 0.672   -21.172 56.053  1.00 37.93 ? 362  GLU D OE2   1 
ATOM   6738 N N     . GLY F 3 363 ? -1.447  -16.006 58.063  1.00 26.02 ? 363  GLY D N     1 
ATOM   6739 C CA    . GLY F 3 363 ? -2.620  -15.817 58.925  1.00 25.91 ? 363  GLY D CA    1 
ATOM   6740 C C     . GLY F 3 363 ? -2.824  -14.387 59.389  1.00 26.18 ? 363  GLY D C     1 
ATOM   6741 O O     . GLY F 3 363 ? -3.809  -14.071 60.060  1.00 25.95 ? 363  GLY D O     1 
ATOM   6742 N N     . VAL F 3 364 ? -1.887  -13.508 59.040  1.00 26.19 ? 364  VAL D N     1 
ATOM   6743 C CA    . VAL F 3 364 ? -1.996  -12.108 59.441  1.00 26.26 ? 364  VAL D CA    1 
ATOM   6744 C C     . VAL F 3 364 ? -2.950  -11.286 58.550  1.00 26.84 ? 364  VAL D C     1 
ATOM   6745 O O     . VAL F 3 364 ? -2.791  -11.238 57.329  1.00 26.98 ? 364  VAL D O     1 
ATOM   6746 C CB    . VAL F 3 364 ? -0.586  -11.440 59.546  1.00 26.10 ? 364  VAL D CB    1 
ATOM   6747 C CG1   . VAL F 3 364 ? -0.702  -9.947  59.825  1.00 25.22 ? 364  VAL D CG1   1 
ATOM   6748 C CG2   . VAL F 3 364 ? 0.238   -12.117 60.637  1.00 25.33 ? 364  VAL D CG2   1 
ATOM   6749 N N     . ARG F 3 365 ? -3.933  -10.638 59.184  1.00 28.03 ? 365  ARG D N     1 
ATOM   6750 C CA    . ARG F 3 365 ? -4.769  -9.622  58.534  1.00 29.09 ? 365  ARG D CA    1 
ATOM   6751 C C     . ARG F 3 365 ? -4.212  -8.253  58.855  1.00 28.87 ? 365  ARG D C     1 
ATOM   6752 O O     . ARG F 3 365 ? -3.871  -7.970  60.005  1.00 29.04 ? 365  ARG D O     1 
ATOM   6753 C CB    . ARG F 3 365 ? -6.208  -9.665  59.053  1.00 29.83 ? 365  ARG D CB    1 
ATOM   6754 C CG    . ARG F 3 365 ? -7.085  -10.680 58.378  1.00 32.69 ? 365  ARG D CG    1 
ATOM   6755 C CD    . ARG F 3 365 ? -7.653  -11.597 59.426  1.00 37.57 ? 365  ARG D CD    1 
ATOM   6756 N NE    . ARG F 3 365 ? -8.378  -12.732 58.853  1.00 41.56 ? 365  ARG D NE    1 
ATOM   6757 C CZ    . ARG F 3 365 ? -7.811  -13.801 58.294  1.00 43.71 ? 365  ARG D CZ    1 
ATOM   6758 N NH1   . ARG F 3 365 ? -6.484  -13.906 58.206  1.00 44.37 ? 365  ARG D NH1   1 
ATOM   6759 N NH2   . ARG F 3 365 ? -8.580  -14.772 57.818  1.00 44.51 ? 365  ARG D NH2   1 
ATOM   6760 N N     . LEU F 3 366 ? -4.134  -7.397  57.846  1.00 28.80 ? 366  LEU D N     1 
ATOM   6761 C CA    . LEU F 3 366 ? -3.646  -6.043  58.055  1.00 28.69 ? 366  LEU D CA    1 
ATOM   6762 C C     . LEU F 3 366 ? -4.492  -5.015  57.324  1.00 28.45 ? 366  LEU D C     1 
ATOM   6763 O O     . LEU F 3 366 ? -5.131  -5.319  56.313  1.00 28.52 ? 366  LEU D O     1 
ATOM   6764 C CB    . LEU F 3 366 ? -2.159  -5.919  57.655  1.00 29.38 ? 366  LEU D CB    1 
ATOM   6765 C CG    . LEU F 3 366 ? -1.526  -6.693  56.489  1.00 30.14 ? 366  LEU D CG    1 
ATOM   6766 C CD1   . LEU F 3 366 ? -2.211  -6.419  55.138  1.00 31.61 ? 366  LEU D CD1   1 
ATOM   6767 C CD2   . LEU F 3 366 ? -0.039  -6.384  56.392  1.00 29.07 ? 366  LEU D CD2   1 
ATOM   6768 N N     . ASP F 3 367 ? -4.514  -3.801  57.860  1.00 27.83 ? 367  ASP D N     1 
ATOM   6769 C CA    . ASP F 3 367 ? -4.995  -2.647  57.123  1.00 27.41 ? 367  ASP D CA    1 
ATOM   6770 C C     . ASP F 3 367 ? -3.758  -1.799  56.809  1.00 26.64 ? 367  ASP D C     1 
ATOM   6771 O O     . ASP F 3 367 ? -3.360  -0.965  57.625  1.00 26.21 ? 367  ASP D O     1 
ATOM   6772 C CB    . ASP F 3 367 ? -6.024  -1.873  57.954  1.00 27.98 ? 367  ASP D CB    1 
ATOM   6773 C CG    . ASP F 3 367 ? -6.586  -0.661  57.225  1.00 29.23 ? 367  ASP D CG    1 
ATOM   6774 O OD1   . ASP F 3 367 ? -6.116  -0.336  56.115  1.00 32.41 ? 367  ASP D OD1   1 
ATOM   6775 O OD2   . ASP F 3 367 ? -7.503  -0.015  57.774  1.00 31.91 ? 367  ASP D OD2   1 
ATOM   6776 N N     . PRO F 3 368 ? -3.132  -2.033  55.631  1.00 25.76 ? 368  PRO D N     1 
ATOM   6777 C CA    . PRO F 3 368 ? -1.830  -1.421  55.314  1.00 24.72 ? 368  PRO D CA    1 
ATOM   6778 C C     . PRO F 3 368 ? -1.815  0.100   55.438  1.00 23.46 ? 368  PRO D C     1 
ATOM   6779 O O     . PRO F 3 368 ? -0.872  0.657   55.999  1.00 22.64 ? 368  PRO D O     1 
ATOM   6780 C CB    . PRO F 3 368 ? -1.583  -1.821  53.850  1.00 25.12 ? 368  PRO D CB    1 
ATOM   6781 C CG    . PRO F 3 368 ? -2.438  -2.996  53.618  1.00 25.16 ? 368  PRO D CG    1 
ATOM   6782 C CD    . PRO F 3 368 ? -3.620  -2.885  54.533  1.00 25.65 ? 368  PRO D CD    1 
ATOM   6783 N N     . SER F 3 369 ? -2.834  0.772   54.912  1.00 22.63 ? 369  SER D N     1 
ATOM   6784 C CA    . SER F 3 369 ? -2.839  2.236   54.946  1.00 22.24 ? 369  SER D CA    1 
ATOM   6785 C C     . SER F 3 369 ? -2.938  2.784   56.383  1.00 21.62 ? 369  SER D C     1 
ATOM   6786 O O     . SER F 3 369 ? -2.273  3.775   56.736  1.00 20.92 ? 369  SER D O     1 
ATOM   6787 C CB    . SER F 3 369 ? -3.944  2.820   54.060  1.00 22.55 ? 369  SER D CB    1 
ATOM   6788 O OG    . SER F 3 369 ? -5.217  2.359   54.471  1.00 25.76 ? 369  SER D OG    1 
ATOM   6789 N N     . SER F 3 370 ? -3.752  2.137   57.214  1.00 21.09 ? 370  SER D N     1 
ATOM   6790 C CA    . SER F 3 370 ? -3.882  2.604   58.595  1.00 20.66 ? 370  SER D CA    1 
ATOM   6791 C C     . SER F 3 370 ? -2.642  2.230   59.443  1.00 19.82 ? 370  SER D C     1 
ATOM   6792 O O     . SER F 3 370 ? -2.239  3.000   60.329  1.00 19.85 ? 370  SER D O     1 
ATOM   6793 C CB    . SER F 3 370 ? -5.190  2.129   59.231  1.00 21.58 ? 370  SER D CB    1 
ATOM   6794 O OG    . SER F 3 370 ? -5.094  0.783   59.628  1.00 23.25 ? 370  SER D OG    1 
ATOM   6795 N N     . LEU F 3 371 ? -2.037  1.085   59.145  1.00 18.98 ? 371  LEU D N     1 
ATOM   6796 C CA    . LEU F 3 371 ? -0.779  0.659   59.808  1.00 17.96 ? 371  LEU D CA    1 
ATOM   6797 C C     . LEU F 3 371 ? 0.356   1.635   59.490  1.00 16.93 ? 371  LEU D C     1 
ATOM   6798 O O     . LEU F 3 371 ? 1.092   2.059   60.383  1.00 16.56 ? 371  LEU D O     1 
ATOM   6799 C CB    . LEU F 3 371 ? -0.376  -0.753  59.382  1.00 18.03 ? 371  LEU D CB    1 
ATOM   6800 C CG    . LEU F 3 371 ? 0.372   -1.734  60.298  1.00 20.43 ? 371  LEU D CG    1 
ATOM   6801 C CD1   . LEU F 3 371 ? 1.344   -2.599  59.495  1.00 19.75 ? 371  LEU D CD1   1 
ATOM   6802 C CD2   . LEU F 3 371 ? 1.071   -1.099  61.509  1.00 19.70 ? 371  LEU D CD2   1 
ATOM   6803 N N     . VAL F 3 372 ? 0.492   2.005   58.219  1.00 16.36 ? 372  VAL D N     1 
ATOM   6804 C CA    . VAL F 3 372 ? 1.492   2.992   57.811  1.00 15.81 ? 372  VAL D CA    1 
ATOM   6805 C C     . VAL F 3 372 ? 1.285   4.342   58.533  1.00 16.18 ? 372  VAL D C     1 
ATOM   6806 O O     . VAL F 3 372 ? 2.245   4.960   59.018  1.00 15.39 ? 372  VAL D O     1 
ATOM   6807 C CB    . VAL F 3 372 ? 1.544   3.159   56.257  1.00 15.77 ? 372  VAL D CB    1 
ATOM   6808 C CG1   . VAL F 3 372 ? 2.372   4.379   55.864  1.00 16.24 ? 372  VAL D CG1   1 
ATOM   6809 C CG2   . VAL F 3 372 ? 2.121   1.911   55.593  1.00 16.25 ? 372  VAL D CG2   1 
ATOM   6810 N N     . GLN F 3 373 ? 0.032   4.799   58.595  1.00 16.75 ? 373  GLN D N     1 
ATOM   6811 C CA    . GLN F 3 373 ? -0.302  6.012   59.350  1.00 18.50 ? 373  GLN D CA    1 
ATOM   6812 C C     . GLN F 3 373 ? 0.136   5.877   60.817  1.00 17.16 ? 373  GLN D C     1 
ATOM   6813 O O     . GLN F 3 373 ? 0.752   6.790   61.357  1.00 17.18 ? 373  GLN D O     1 
ATOM   6814 C CB    . GLN F 3 373 ? -1.797  6.326   59.248  1.00 18.64 ? 373  GLN D CB    1 
ATOM   6815 C CG    . GLN F 3 373 ? -2.211  7.604   59.972  1.00 22.03 ? 373  GLN D CG    1 
ATOM   6816 C CD    . GLN F 3 373 ? -3.675  7.953   59.734  1.00 22.89 ? 373  GLN D CD    1 
ATOM   6817 O OE1   . GLN F 3 373 ? -4.248  7.583   58.707  1.00 29.69 ? 373  GLN D OE1   1 
ATOM   6818 N NE2   . GLN F 3 373 ? -4.286  8.670   60.686  1.00 28.30 ? 373  GLN D NE2   1 
ATOM   6819 N N     . TRP F 3 374 ? -0.151  4.732   61.437  1.00 16.51 ? 374  TRP D N     1 
ATOM   6820 C CA    . TRP F 3 374 ? 0.241   4.502   62.839  1.00 15.93 ? 374  TRP D CA    1 
ATOM   6821 C C     . TRP F 3 374 ? 1.765   4.522   63.004  1.00 15.31 ? 374  TRP D C     1 
ATOM   6822 O O     . TRP F 3 374 ? 2.289   5.190   63.896  1.00 15.17 ? 374  TRP D O     1 
ATOM   6823 C CB    . TRP F 3 374 ? -0.355  3.193   63.362  1.00 15.78 ? 374  TRP D CB    1 
ATOM   6824 C CG    . TRP F 3 374 ? 0.253   2.705   64.656  1.00 16.07 ? 374  TRP D CG    1 
ATOM   6825 C CD1   . TRP F 3 374 ? 0.930   1.538   64.846  1.00 16.08 ? 374  TRP D CD1   1 
ATOM   6826 C CD2   . TRP F 3 374 ? 0.228   3.372   65.929  1.00 15.13 ? 374  TRP D CD2   1 
ATOM   6827 N NE1   . TRP F 3 374 ? 1.340   1.434   66.169  1.00 16.10 ? 374  TRP D NE1   1 
ATOM   6828 C CE2   . TRP F 3 374 ? 0.929   2.546   66.849  1.00 15.81 ? 374  TRP D CE2   1 
ATOM   6829 C CE3   . TRP F 3 374 ? -0.298  4.597   66.379  1.00 16.86 ? 374  TRP D CE3   1 
ATOM   6830 C CZ2   . TRP F 3 374 ? 1.105   2.895   68.201  1.00 16.67 ? 374  TRP D CZ2   1 
ATOM   6831 C CZ3   . TRP F 3 374 ? -0.125  4.946   67.741  1.00 16.51 ? 374  TRP D CZ3   1 
ATOM   6832 C CH2   . TRP F 3 374 ? 0.568   4.090   68.627  1.00 16.33 ? 374  TRP D CH2   1 
ATOM   6833 N N     . LEU F 3 375 ? 2.479   3.818   62.126  1.00 14.53 ? 375  LEU D N     1 
ATOM   6834 C CA    . LEU F 3 375 ? 3.951   3.800   62.197  1.00 14.04 ? 375  LEU D CA    1 
ATOM   6835 C C     . LEU F 3 375 ? 4.553   5.203   62.060  1.00 13.57 ? 375  LEU D C     1 
ATOM   6836 O O     . LEU F 3 375 ? 5.549   5.520   62.713  1.00 13.71 ? 375  LEU D O     1 
ATOM   6837 C CB    . LEU F 3 375 ? 4.533   2.827   61.160  1.00 13.84 ? 375  LEU D CB    1 
ATOM   6838 C CG    . LEU F 3 375 ? 4.189   1.353   61.424  1.00 14.10 ? 375  LEU D CG    1 
ATOM   6839 C CD1   . LEU F 3 375 ? 4.715   0.451   60.294  1.00 14.33 ? 375  LEU D CD1   1 
ATOM   6840 C CD2   . LEU F 3 375 ? 4.700   0.866   62.773  1.00 12.90 ? 375  LEU D CD2   1 
ATOM   6841 N N     . ASN F 3 376 ? 3.933   6.051   61.237  1.00 13.89 ? 376  ASN D N     1 
ATOM   6842 C CA    . ASN F 3 376 ? 4.441   7.384   60.999  1.00 14.00 ? 376  ASN D CA    1 
ATOM   6843 C C     . ASN F 3 376 ? 3.907   8.408   61.999  1.00 14.29 ? 376  ASN D C     1 
ATOM   6844 O O     . ASN F 3 376 ? 4.238   9.598   61.886  1.00 15.04 ? 376  ASN D O     1 
ATOM   6845 C CB    . ASN F 3 376 ? 4.108   7.854   59.568  1.00 14.87 ? 376  ASN D CB    1 
ATOM   6846 C CG    . ASN F 3 376 ? 4.938   7.139   58.510  1.00 13.91 ? 376  ASN D CG    1 
ATOM   6847 O OD1   . ASN F 3 376 ? 6.151   6.989   58.651  1.00 16.21 ? 376  ASN D OD1   1 
ATOM   6848 N ND2   . ASN F 3 376 ? 4.286   6.710   57.440  1.00 16.42 ? 376  ASN D ND2   1 
ATOM   6849 N N     . SER F 3 377 ? 3.106   7.951   62.963  1.00 14.67 ? 377  SER D N     1 
ATOM   6850 C CA    . SER F 3 377 ? 2.406   8.886   63.860  1.00 15.27 ? 377  SER D CA    1 
ATOM   6851 C C     . SER F 3 377 ? 3.355   9.583   64.840  1.00 16.16 ? 377  SER D C     1 
ATOM   6852 O O     . SER F 3 377 ? 4.419   9.052   65.170  1.00 15.60 ? 377  SER D O     1 
ATOM   6853 C CB    . SER F 3 377 ? 1.266   8.193   64.617  1.00 14.91 ? 377  SER D CB    1 
ATOM   6854 O OG    . SER F 3 377 ? 1.746   7.304   65.602  1.00 16.37 ? 377  SER D OG    1 
ATOM   6855 N N     . GLU F 3 378 ? 2.965   10.771  65.289  1.00 16.74 ? 378  GLU D N     1 
ATOM   6856 C CA    . GLU F 3 378 ? 3.697   11.457  66.364  1.00 18.00 ? 378  GLU D CA    1 
ATOM   6857 C C     . GLU F 3 378 ? 3.864   10.576  67.607  1.00 16.03 ? 378  GLU D C     1 
ATOM   6858 O O     . GLU F 3 378 ? 4.932   10.591  68.234  1.00 16.88 ? 378  GLU D O     1 
ATOM   6859 C CB    . GLU F 3 378 ? 3.024   12.789  66.726  1.00 18.16 ? 378  GLU D CB    1 
ATOM   6860 C CG    . GLU F 3 378 ? 3.797   13.570  67.762  1.00 21.64 ? 378  GLU D CG    1 
ATOM   6861 C CD    . GLU F 3 378 ? 3.149   14.887  68.167  1.00 23.30 ? 378  GLU D CD    1 
ATOM   6862 O OE1   . GLU F 3 378 ? 2.021   15.198  67.703  1.00 31.30 ? 378  GLU D OE1   1 
ATOM   6863 O OE2   . GLU F 3 378 ? 3.783   15.611  68.972  1.00 31.19 ? 378  GLU D OE2   1 
ATOM   6864 N N     . ALA F 3 379 ? 2.823   9.815   67.958  1.00 14.99 ? 379  ALA D N     1 
ATOM   6865 C CA    . ALA F 3 379 ? 2.847   8.940   69.147  1.00 14.01 ? 379  ALA D CA    1 
ATOM   6866 C C     . ALA F 3 379 ? 3.998   7.946   69.006  1.00 13.43 ? 379  ALA D C     1 
ATOM   6867 O O     . ALA F 3 379 ? 4.745   7.672   69.968  1.00 13.13 ? 379  ALA D O     1 
ATOM   6868 C CB    . ALA F 3 379 ? 1.533   8.198   69.307  1.00 14.43 ? 379  ALA D CB    1 
ATOM   6869 N N     . MET F 3 380 ? 4.139   7.416   67.791  1.00 12.56 ? 380  MET D N     1 
ATOM   6870 C CA    . MET F 3 380 ? 5.209   6.452   67.512  1.00 12.44 ? 380  MET D CA    1 
ATOM   6871 C C     . MET F 3 380 ? 6.584   7.091   67.578  1.00 12.07 ? 380  MET D C     1 
ATOM   6872 O O     . MET F 3 380 ? 7.508   6.493   68.135  1.00 13.20 ? 380  MET D O     1 
ATOM   6873 C CB    . MET F 3 380 ? 5.013   5.749   66.172  1.00 12.10 ? 380  MET D CB    1 
ATOM   6874 C CG    . MET F 3 380 ? 6.007   4.572   65.972  1.00 13.25 ? 380  MET D CG    1 
ATOM   6875 S SD    . MET F 3 380 ? 5.897   3.248   67.224  1.00 16.26 ? 380  MET D SD    1 
ATOM   6876 C CE    . MET F 3 380 ? 4.397   2.410   66.688  1.00 15.52 ? 380  MET D CE    1 
ATOM   6877 N N     . GLN F 3 381 ? 6.733   8.295   67.016  1.00 12.35 ? 381  GLN D N     1 
ATOM   6878 C CA    . GLN F 3 381 ? 8.036   9.010   67.083  1.00 11.72 ? 381  GLN D CA    1 
ATOM   6879 C C     . GLN F 3 381 ? 8.434   9.280   68.546  1.00 12.49 ? 381  GLN D C     1 
ATOM   6880 O O     . GLN F 3 381 ? 9.575   9.041   68.945  1.00 11.68 ? 381  GLN D O     1 
ATOM   6881 C CB    . GLN F 3 381 ? 8.019   10.316  66.284  1.00 12.48 ? 381  GLN D CB    1 
ATOM   6882 C CG    . GLN F 3 381 ? 7.400   10.168  64.875  1.00 13.33 ? 381  GLN D CG    1 
ATOM   6883 C CD    . GLN F 3 381 ? 7.920   8.953   64.107  1.00 11.66 ? 381  GLN D CD    1 
ATOM   6884 O OE1   . GLN F 3 381 ? 9.125   8.803   63.923  1.00 13.31 ? 381  GLN D OE1   1 
ATOM   6885 N NE2   . GLN F 3 381 ? 7.007   8.096   63.640  1.00 13.80 ? 381  GLN D NE2   1 
ATOM   6886 N N     . LYS F 3 382 ? 7.471   9.736   69.352  1.00 12.37 ? 382  LYS D N     1 
ATOM   6887 C CA    . LYS F 3 382 ? 7.723   10.003  70.777  1.00 13.06 ? 382  LYS D CA    1 
ATOM   6888 C C     . LYS F 3 382 ? 8.107   8.727   71.524  1.00 12.53 ? 382  LYS D C     1 
ATOM   6889 O O     . LYS F 3 382 ? 8.982   8.738   72.395  1.00 12.33 ? 382  LYS D O     1 
ATOM   6890 C CB    . LYS F 3 382 ? 6.487   10.639  71.427  1.00 13.11 ? 382  LYS D CB    1 
ATOM   6891 C CG    . LYS F 3 382 ? 6.766   11.222  72.818  1.00 18.36 ? 382  LYS D CG    1 
ATOM   6892 C CD    . LYS F 3 382 ? 5.481   11.421  73.627  1.00 23.60 ? 382  LYS D CD    1 
ATOM   6893 C CE    . LYS F 3 382 ? 5.781   12.185  74.920  1.00 27.78 ? 382  LYS D CE    1 
ATOM   6894 N NZ    . LYS F 3 382 ? 4.635   12.107  75.864  1.00 30.13 ? 382  LYS D NZ    1 
ATOM   6895 N N     . HIS F 3 383 ? 7.463   7.622   71.166  1.00 12.07 ? 383  HIS D N     1 
ATOM   6896 C CA    . HIS F 3 383 ? 7.710   6.326   71.786  1.00 11.76 ? 383  HIS D CA    1 
ATOM   6897 C C     . HIS F 3 383 ? 9.177   5.881   71.578  1.00 11.77 ? 383  HIS D C     1 
ATOM   6898 O O     . HIS F 3 383 ? 9.886   5.552   72.539  1.00 10.58 ? 383  HIS D O     1 
ATOM   6899 C CB    . HIS F 3 383 ? 6.711   5.298   71.224  1.00 12.37 ? 383  HIS D CB    1 
ATOM   6900 C CG    . HIS F 3 383 ? 6.874   3.915   71.776  1.00 11.19 ? 383  HIS D CG    1 
ATOM   6901 N ND1   . HIS F 3 383 ? 6.556   3.588   73.077  1.00 12.14 ? 383  HIS D ND1   1 
ATOM   6902 C CD2   . HIS F 3 383 ? 7.331   2.776   71.203  1.00 10.58 ? 383  HIS D CD2   1 
ATOM   6903 C CE1   . HIS F 3 383 ? 6.813   2.307   73.281  1.00 12.37 ? 383  HIS D CE1   1 
ATOM   6904 N NE2   . HIS F 3 383 ? 7.280   1.790   72.155  1.00 11.62 ? 383  HIS D NE2   1 
ATOM   6905 N N     . VAL F 3 384 ? 9.649   5.920   70.332  1.00 11.24 ? 384  VAL D N     1 
ATOM   6906 C CA    . VAL F 3 384 ? 11.041  5.469   70.084  1.00 11.16 ? 384  VAL D CA    1 
ATOM   6907 C C     . VAL F 3 384 ? 12.071  6.477   70.630  1.00 11.07 ? 384  VAL D C     1 
ATOM   6908 O O     . VAL F 3 384 ? 13.113  6.086   71.151  1.00 10.36 ? 384  VAL D O     1 
ATOM   6909 C CB    . VAL F 3 384 ? 11.330  5.069   68.590  1.00 11.25 ? 384  VAL D CB    1 
ATOM   6910 C CG1   . VAL F 3 384 ? 10.527  3.835   68.207  1.00 12.56 ? 384  VAL D CG1   1 
ATOM   6911 C CG2   . VAL F 3 384 ? 11.064  6.217   67.619  1.00 12.64 ? 384  VAL D CG2   1 
ATOM   6912 N N     . ARG F 3 385 ? 11.748  7.763   70.551  1.00 11.27 ? 385  ARG D N     1 
ATOM   6913 C CA    . ARG F 3 385 ? 12.642  8.814   71.029  1.00 12.19 ? 385  ARG D CA    1 
ATOM   6914 C C     . ARG F 3 385 ? 12.801  8.706   72.554  1.00 11.08 ? 385  ARG D C     1 
ATOM   6915 O O     . ARG F 3 385 ? 13.879  8.948   73.100  1.00 10.43 ? 385  ARG D O     1 
ATOM   6916 C CB    . ARG F 3 385 ? 12.059  10.178  70.648  1.00 14.11 ? 385  ARG D CB    1 
ATOM   6917 C CG    . ARG F 3 385 ? 12.909  11.367  70.967  1.00 20.46 ? 385  ARG D CG    1 
ATOM   6918 C CD    . ARG F 3 385 ? 12.389  12.597  70.187  1.00 26.23 ? 385  ARG D CD    1 
ATOM   6919 N NE    . ARG F 3 385 ? 10.946  12.832  70.364  1.00 31.19 ? 385  ARG D NE    1 
ATOM   6920 C CZ    . ARG F 3 385 ? 10.028  12.814  69.393  1.00 32.88 ? 385  ARG D CZ    1 
ATOM   6921 N NH1   . ARG F 3 385 ? 10.359  12.572  68.127  1.00 35.18 ? 385  ARG D NH1   1 
ATOM   6922 N NH2   . ARG F 3 385 ? 8.757   13.058  69.691  1.00 34.27 ? 385  ARG D NH2   1 
ATOM   6923 N N     . THR F 3 386 ? 11.721  8.357   73.240  1.00 11.04 ? 386  THR D N     1 
ATOM   6924 C CA    . THR F 3 386 ? 11.793  8.131   74.694  1.00 11.97 ? 386  THR D CA    1 
ATOM   6925 C C     . THR F 3 386 ? 12.713  6.956   75.014  1.00 11.52 ? 386  THR D C     1 
ATOM   6926 O O     . THR F 3 386 ? 13.663  7.083   75.807  1.00 11.74 ? 386  THR D O     1 
ATOM   6927 C CB    . THR F 3 386 ? 10.392  7.898   75.306  1.00 11.98 ? 386  THR D CB    1 
ATOM   6928 O OG1   . THR F 3 386 ? 9.558   9.014   74.980  1.00 11.69 ? 386  THR D OG1   1 
ATOM   6929 C CG2   . THR F 3 386 ? 10.468  7.744   76.827  1.00 12.22 ? 386  THR D CG2   1 
ATOM   6930 N N     . LEU F 3 387 ? 12.445  5.814   74.388  1.00 10.51 ? 387  LEU D N     1 
ATOM   6931 C CA    . LEU F 3 387 ? 13.150  4.595   74.721  1.00 10.01 ? 387  LEU D CA    1 
ATOM   6932 C C     . LEU F 3 387 ? 14.644  4.656   74.379  1.00 9.77  ? 387  LEU D C     1 
ATOM   6933 O O     . LEU F 3 387 ? 15.478  4.251   75.181  1.00 10.32 ? 387  LEU D O     1 
ATOM   6934 C CB    . LEU F 3 387 ? 12.518  3.417   73.989  1.00 9.81  ? 387  LEU D CB    1 
ATOM   6935 C CG    . LEU F 3 387 ? 11.136  2.976   74.482  1.00 9.74  ? 387  LEU D CG    1 
ATOM   6936 C CD1   . LEU F 3 387 ? 10.480  2.114   73.392  1.00 11.01 ? 387  LEU D CD1   1 
ATOM   6937 C CD2   . LEU F 3 387 ? 11.266  2.202   75.797  1.00 11.12 ? 387  LEU D CD2   1 
ATOM   6938 N N     . TYR F 3 388 ? 14.964  5.166   73.191  1.00 9.76  ? 388  TYR D N     1 
ATOM   6939 C CA    . TYR F 3 388 ? 16.302  4.963   72.625  1.00 9.72  ? 388  TYR D CA    1 
ATOM   6940 C C     . TYR F 3 388 ? 17.084  6.247   72.465  1.00 9.30  ? 388  TYR D C     1 
ATOM   6941 O O     . TYR F 3 388 ? 18.230  6.221   72.012  1.00 9.67  ? 388  TYR D O     1 
ATOM   6942 C CB    . TYR F 3 388 ? 16.192  4.218   71.282  1.00 9.59  ? 388  TYR D CB    1 
ATOM   6943 C CG    . TYR F 3 388 ? 15.375  2.948   71.407  1.00 9.37  ? 388  TYR D CG    1 
ATOM   6944 C CD1   . TYR F 3 388 ? 15.850  1.862   72.154  1.00 9.74  ? 388  TYR D CD1   1 
ATOM   6945 C CD2   . TYR F 3 388 ? 14.125  2.833   70.793  1.00 9.19  ? 388  TYR D CD2   1 
ATOM   6946 C CE1   . TYR F 3 388 ? 15.095  0.681   72.293  1.00 8.36  ? 388  TYR D CE1   1 
ATOM   6947 C CE2   . TYR F 3 388 ? 13.349  1.655   70.935  1.00 10.56 ? 388  TYR D CE2   1 
ATOM   6948 C CZ    . TYR F 3 388 ? 13.854  0.585   71.678  1.00 8.78  ? 388  TYR D CZ    1 
ATOM   6949 O OH    . TYR F 3 388 ? 13.117  -0.554  71.828  1.00 9.27  ? 388  TYR D OH    1 
ATOM   6950 N N     . ARG F 3 389 ? 16.470  7.372   72.820  1.00 9.12  ? 389  ARG D N     1 
ATOM   6951 C CA    . ARG F 3 389 ? 17.134  8.667   72.668  1.00 9.04  ? 389  ARG D CA    1 
ATOM   6952 C C     . ARG F 3 389 ? 17.921  8.761   71.352  1.00 9.67  ? 389  ARG D C     1 
ATOM   6953 O O     . ARG F 3 389 ? 17.341  8.564   70.264  1.00 9.40  ? 389  ARG D O     1 
ATOM   6954 C CB    . ARG F 3 389 ? 17.999  8.960   73.895  1.00 9.78  ? 389  ARG D CB    1 
ATOM   6955 C CG    . ARG F 3 389 ? 17.138  9.039   75.149  1.00 10.38 ? 389  ARG D CG    1 
ATOM   6956 C CD    . ARG F 3 389 ? 17.880  9.652   76.311  1.00 9.98  ? 389  ARG D CD    1 
ATOM   6957 N NE    . ARG F 3 389 ? 16.946  9.854   77.419  1.00 12.70 ? 389  ARG D NE    1 
ATOM   6958 C CZ    . ARG F 3 389 ? 17.245  10.502  78.536  1.00 14.98 ? 389  ARG D CZ    1 
ATOM   6959 N NH1   . ARG F 3 389 ? 18.455  11.054  78.702  1.00 15.26 ? 389  ARG D NH1   1 
ATOM   6960 N NH2   . ARG F 3 389 ? 16.331  10.603  79.485  1.00 13.12 ? 389  ARG D NH2   1 
ATOM   6961 N N     . ASP F 3 390 ? 19.228  9.009   71.454  1.00 8.51  ? 390  ASP D N     1 
ATOM   6962 C CA    . ASP F 3 390 ? 20.102  9.150   70.284  1.00 8.84  ? 390  ASP D CA    1 
ATOM   6963 C C     . ASP F 3 390 ? 21.319  8.227   70.418  1.00 8.20  ? 390  ASP D C     1 
ATOM   6964 O O     . ASP F 3 390 ? 22.397  8.554   69.911  1.00 8.41  ? 390  ASP D O     1 
ATOM   6965 C CB    . ASP F 3 390 ? 20.543  10.612  70.134  1.00 9.47  ? 390  ASP D CB    1 
ATOM   6966 C CG    . ASP F 3 390 ? 21.371  11.109  71.324  1.00 10.32 ? 390  ASP D CG    1 
ATOM   6967 O OD1   . ASP F 3 390 ? 21.577  10.369  72.303  1.00 10.57 ? 390  ASP D OD1   1 
ATOM   6968 O OD2   . ASP F 3 390 ? 21.794  12.269  71.280  1.00 12.24 ? 390  ASP D OD2   1 
ATOM   6969 N N     . PHE F 3 391 ? 21.123  7.070   71.051  1.00 8.40  ? 391  PHE D N     1 
ATOM   6970 C CA    . PHE F 3 391 ? 22.220  6.126   71.272  1.00 8.59  ? 391  PHE D CA    1 
ATOM   6971 C C     . PHE F 3 391 ? 22.904  5.785   69.955  1.00 8.33  ? 391  PHE D C     1 
ATOM   6972 O O     . PHE F 3 391 ? 24.135  5.752   69.876  1.00 8.62  ? 391  PHE D O     1 
ATOM   6973 C CB    . PHE F 3 391 ? 21.732  4.805   71.877  1.00 8.84  ? 391  PHE D CB    1 
ATOM   6974 C CG    . PHE F 3 391 ? 20.989  4.920   73.180  1.00 8.30  ? 391  PHE D CG    1 
ATOM   6975 C CD1   . PHE F 3 391 ? 21.143  6.021   74.034  1.00 8.97  ? 391  PHE D CD1   1 
ATOM   6976 C CD2   . PHE F 3 391 ? 20.190  3.848   73.592  1.00 10.15 ? 391  PHE D CD2   1 
ATOM   6977 C CE1   . PHE F 3 391 ? 20.440  6.083   75.248  1.00 10.34 ? 391  PHE D CE1   1 
ATOM   6978 C CE2   . PHE F 3 391 ? 19.484  3.895   74.813  1.00 10.50 ? 391  PHE D CE2   1 
ATOM   6979 C CZ    . PHE F 3 391 ? 19.624  5.006   75.638  1.00 10.17 ? 391  PHE D CZ    1 
ATOM   6980 N N     . VAL F 3 392 ? 22.100  5.500   68.924  1.00 8.20  ? 392  VAL D N     1 
ATOM   6981 C CA    . VAL F 3 392 ? 22.637  5.150   67.607  1.00 8.73  ? 392  VAL D CA    1 
ATOM   6982 C C     . VAL F 3 392 ? 21.851  5.940   66.544  1.00 9.43  ? 392  VAL D C     1 
ATOM   6983 O O     . VAL F 3 392 ? 20.728  6.347   66.803  1.00 9.56  ? 392  VAL D O     1 
ATOM   6984 C CB    . VAL F 3 392 ? 22.496  3.621   67.311  1.00 9.06  ? 392  VAL D CB    1 
ATOM   6985 C CG1   . VAL F 3 392 ? 23.369  2.787   68.234  1.00 9.46  ? 392  VAL D CG1   1 
ATOM   6986 C CG2   . VAL F 3 392 ? 21.030  3.170   67.404  1.00 9.50  ? 392  VAL D CG2   1 
ATOM   6987 N N     . PRO F 3 393 ? 22.445  6.145   65.353  1.00 9.94  ? 393  PRO D N     1 
ATOM   6988 C CA    . PRO F 3 393 ? 21.840  6.914   64.263  1.00 10.53 ? 393  PRO D CA    1 
ATOM   6989 C C     . PRO F 3 393 ? 20.835  6.117   63.405  1.00 11.41 ? 393  PRO D C     1 
ATOM   6990 O O     . PRO F 3 393 ? 20.539  6.492   62.269  1.00 12.47 ? 393  PRO D O     1 
ATOM   6991 C CB    . PRO F 3 393 ? 23.060  7.319   63.427  1.00 11.04 ? 393  PRO D CB    1 
ATOM   6992 C CG    . PRO F 3 393 ? 23.990  6.152   63.580  1.00 9.76  ? 393  PRO D CG    1 
ATOM   6993 C CD    . PRO F 3 393 ? 23.796  5.671   65.000  1.00 10.01 ? 393  PRO D CD    1 
ATOM   6994 N N     . HIS F 3 394 ? 20.299  5.047   63.963  1.00 11.14 ? 394  HIS D N     1 
ATOM   6995 C CA    . HIS F 3 394 ? 19.402  4.154   63.228  1.00 10.37 ? 394  HIS D CA    1 
ATOM   6996 C C     . HIS F 3 394 ? 18.177  3.793   64.042  1.00 10.22 ? 394  HIS D C     1 
ATOM   6997 O O     . HIS F 3 394 ? 18.223  3.775   65.275  1.00 10.91 ? 394  HIS D O     1 
ATOM   6998 C CB    . HIS F 3 394 ? 20.120  2.840   62.977  1.00 10.15 ? 394  HIS D CB    1 
ATOM   6999 C CG    . HIS F 3 394 ? 21.296  2.952   62.075  1.00 11.97 ? 394  HIS D CG    1 
ATOM   7000 N ND1   . HIS F 3 394 ? 22.597  2.812   62.516  1.00 13.52 ? 394  HIS D ND1   1 
ATOM   7001 C CD2   . HIS F 3 394 ? 21.367  3.183   60.745  1.00 9.44  ? 394  HIS D CD2   1 
ATOM   7002 C CE1   . HIS F 3 394 ? 23.419  2.952   61.492  1.00 11.16 ? 394  HIS D CE1   1 
ATOM   7003 N NE2   . HIS F 3 394 ? 22.696  3.172   60.406  1.00 14.08 ? 394  HIS D NE2   1 
ATOM   7004 N N     . LEU F 3 395 ? 17.095  3.456   63.347  1.00 9.02  ? 395  LEU D N     1 
ATOM   7005 C CA    . LEU F 3 395 ? 16.157  2.493   63.915  1.00 9.70  ? 395  LEU D CA    1 
ATOM   7006 C C     . LEU F 3 395 ? 16.693  1.071   63.637  1.00 9.74  ? 395  LEU D C     1 
ATOM   7007 O O     . LEU F 3 395 ? 16.880  0.685   62.473  1.00 9.46  ? 395  LEU D O     1 
ATOM   7008 C CB    . LEU F 3 395 ? 14.775  2.663   63.275  1.00 9.06  ? 395  LEU D CB    1 
ATOM   7009 C CG    . LEU F 3 395 ? 13.660  1.797   63.890  1.00 10.30 ? 395  LEU D CG    1 
ATOM   7010 C CD1   . LEU F 3 395 ? 13.206  2.334   65.242  1.00 10.72 ? 395  LEU D CD1   1 
ATOM   7011 C CD2   . LEU F 3 395 ? 12.497  1.751   62.905  1.00 11.54 ? 395  LEU D CD2   1 
ATOM   7012 N N     . THR F 3 396 ? 16.956  0.288   64.688  1.00 8.91  ? 396  THR D N     1 
ATOM   7013 C CA    . THR F 3 396 ? 17.513  -1.065  64.475  1.00 9.08  ? 396  THR D CA    1 
ATOM   7014 C C     . THR F 3 396 ? 16.423  -2.133  64.451  1.00 9.42  ? 396  THR D C     1 
ATOM   7015 O O     . THR F 3 396 ? 15.303  -1.893  64.883  1.00 8.70  ? 396  THR D O     1 
ATOM   7016 C CB    . THR F 3 396 ? 18.544  -1.456  65.564  1.00 9.87  ? 396  THR D CB    1 
ATOM   7017 O OG1   . THR F 3 396 ? 17.868  -1.539  66.824  1.00 10.98 ? 396  THR D OG1   1 
ATOM   7018 C CG2   . THR F 3 396 ? 19.688  -0.413  65.653  1.00 8.81  ? 396  THR D CG2   1 
ATOM   7019 N N     . LEU F 3 397 ? 16.787  -3.339  64.029  1.00 9.64  ? 397  LEU D N     1 
ATOM   7020 C CA    . LEU F 3 397 ? 15.826  -4.431  64.007  1.00 10.55 ? 397  LEU D CA    1 
ATOM   7021 C C     . LEU F 3 397 ? 15.230  -4.669  65.398  1.00 10.01 ? 397  LEU D C     1 
ATOM   7022 O O     . LEU F 3 397 ? 14.026  -4.865  65.529  1.00 10.30 ? 397  LEU D O     1 
ATOM   7023 C CB    . LEU F 3 397 ? 16.476  -5.707  63.496  1.00 9.84  ? 397  LEU D CB    1 
ATOM   7024 C CG    . LEU F 3 397 ? 15.599  -6.961  63.498  1.00 11.16 ? 397  LEU D CG    1 
ATOM   7025 C CD1   . LEU F 3 397 ? 14.392  -6.768  62.661  1.00 12.59 ? 397  LEU D CD1   1 
ATOM   7026 C CD2   . LEU F 3 397 ? 16.431  -8.114  62.944  1.00 13.84 ? 397  LEU D CD2   1 
ATOM   7027 N N     . ARG F 3 398 ? 16.083  -4.639  66.426  1.00 9.33  ? 398  ARG D N     1 
ATOM   7028 C CA    . ARG F 3 398 ? 15.617  -4.912  67.786  1.00 9.87  ? 398  ARG D CA    1 
ATOM   7029 C C     . ARG F 3 398 ? 14.593  -3.873  68.271  1.00 10.76 ? 398  ARG D C     1 
ATOM   7030 O O     . ARG F 3 398 ? 13.732  -4.197  69.086  1.00 12.58 ? 398  ARG D O     1 
ATOM   7031 C CB    . ARG F 3 398 ? 16.813  -4.992  68.740  1.00 11.18 ? 398  ARG D CB    1 
ATOM   7032 C CG    . ARG F 3 398 ? 17.724  -6.165  68.450  1.00 12.35 ? 398  ARG D CG    1 
ATOM   7033 C CD    . ARG F 3 398 ? 17.056  -7.485  68.848  1.00 21.50 ? 398  ARG D CD    1 
ATOM   7034 N NE    . ARG F 3 398 ? 16.365  -8.122  67.735  1.00 27.28 ? 398  ARG D NE    1 
ATOM   7035 C CZ    . ARG F 3 398 ? 16.867  -9.116  66.994  1.00 30.92 ? 398  ARG D CZ    1 
ATOM   7036 N NH1   . ARG F 3 398 ? 18.084  -9.599  67.231  1.00 32.72 ? 398  ARG D NH1   1 
ATOM   7037 N NH2   . ARG F 3 398 ? 16.143  -9.639  66.009  1.00 30.36 ? 398  ARG D NH2   1 
ATOM   7038 N N     . MET F 3 399 ? 14.725  -2.629  67.814  1.00 9.24  ? 399  MET D N     1 
ATOM   7039 C CA    . MET F 3 399 ? 13.731  -1.583  68.098  1.00 8.98  ? 399  MET D CA    1 
ATOM   7040 C C     . MET F 3 399 ? 12.464  -1.830  67.293  1.00 9.51  ? 399  MET D C     1 
ATOM   7041 O O     . MET F 3 399 ? 11.351  -1.786  67.827  1.00 10.52 ? 399  MET D O     1 
ATOM   7042 C CB    . MET F 3 399 ? 14.277  -0.198  67.717  1.00 9.09  ? 399  MET D CB    1 
ATOM   7043 C CG    . MET F 3 399 ? 15.520  0.259   68.516  1.00 9.03  ? 399  MET D CG    1 
ATOM   7044 S SD    . MET F 3 399 ? 16.270  1.705   67.756  1.00 9.67  ? 399  MET D SD    1 
ATOM   7045 C CE    . MET F 3 399 ? 17.820  1.777   68.667  1.00 9.24  ? 399  MET D CE    1 
ATOM   7046 N N     . LEU F 3 400 ? 12.651  -2.079  65.999  1.00 10.11 ? 400  LEU D N     1 
ATOM   7047 C CA    . LEU F 3 400 ? 11.534  -2.276  65.073  1.00 10.17 ? 400  LEU D CA    1 
ATOM   7048 C C     . LEU F 3 400 ? 10.631  -3.451  65.445  1.00 11.19 ? 400  LEU D C     1 
ATOM   7049 O O     . LEU F 3 400 ? 9.403   -3.312  65.429  1.00 12.02 ? 400  LEU D O     1 
ATOM   7050 C CB    . LEU F 3 400 ? 12.073  -2.482  63.664  1.00 9.84  ? 400  LEU D CB    1 
ATOM   7051 C CG    . LEU F 3 400 ? 11.060  -2.679  62.528  1.00 9.11  ? 400  LEU D CG    1 
ATOM   7052 C CD1   . LEU F 3 400 ? 10.071  -1.512  62.426  1.00 11.39 ? 400  LEU D CD1   1 
ATOM   7053 C CD2   . LEU F 3 400 ? 11.846  -2.839  61.217  1.00 11.50 ? 400  LEU D CD2   1 
ATOM   7054 N N     . GLU F 3 401 ? 11.246  -4.591  65.768  1.00 11.72 ? 401  GLU D N     1 
ATOM   7055 C CA    . GLU F 3 401 ? 10.527  -5.817  66.134  1.00 13.28 ? 401  GLU D CA    1 
ATOM   7056 C C     . GLU F 3 401 ? 9.516   -5.568  67.250  1.00 12.71 ? 401  GLU D C     1 
ATOM   7057 O O     . GLU F 3 401 ? 8.461   -6.202  67.278  1.00 12.96 ? 401  GLU D O     1 
ATOM   7058 C CB    . GLU F 3 401 ? 11.492  -6.845  66.691  1.00 14.16 ? 401  GLU D CB    1 
ATOM   7059 C CG    . GLU F 3 401 ? 12.245  -7.665  65.729  1.00 21.14 ? 401  GLU D CG    1 
ATOM   7060 C CD    . GLU F 3 401 ? 13.066  -8.714  66.471  1.00 23.83 ? 401  GLU D CD    1 
ATOM   7061 O OE1   . GLU F 3 401 ? 13.631  -8.414  67.554  1.00 25.84 ? 401  GLU D OE1   1 
ATOM   7062 O OE2   . GLU F 3 401 ? 13.123  -9.849  65.978  1.00 30.42 ? 401  GLU D OE2   1 
ATOM   7063 N N     . ARG F 3 402 ? 9.898   -4.704  68.192  1.00 12.47 ? 402  ARG D N     1 
ATOM   7064 C CA    . ARG F 3 402 ? 9.101   -4.422  69.390  1.00 13.00 ? 402  ARG D CA    1 
ATOM   7065 C C     . ARG F 3 402 ? 8.042   -3.333  69.269  1.00 13.27 ? 402  ARG D C     1 
ATOM   7066 O O     . ARG F 3 402 ? 7.319   -3.076  70.239  1.00 12.67 ? 402  ARG D O     1 
ATOM   7067 C CB    . ARG F 3 402 ? 10.042  -4.037  70.543  1.00 13.67 ? 402  ARG D CB    1 
ATOM   7068 C CG    . ARG F 3 402 ? 10.973  -5.138  70.970  1.00 15.93 ? 402  ARG D CG    1 
ATOM   7069 C CD    . ARG F 3 402 ? 11.478  -4.893  72.391  1.00 17.12 ? 402  ARG D CD    1 
ATOM   7070 N NE    . ARG F 3 402 ? 10.425  -5.229  73.349  1.00 20.73 ? 402  ARG D NE    1 
ATOM   7071 C CZ    . ARG F 3 402 ? 10.539  -5.192  74.672  1.00 22.51 ? 402  ARG D CZ    1 
ATOM   7072 N NH1   . ARG F 3 402 ? 11.677  -4.831  75.243  1.00 22.68 ? 402  ARG D NH1   1 
ATOM   7073 N NH2   . ARG F 3 402 ? 9.493   -5.520  75.429  1.00 23.81 ? 402  ARG D NH2   1 
ATOM   7074 N N     . LEU F 3 403 ? 7.930   -2.690  68.109  1.00 12.81 ? 403  LEU D N     1 
ATOM   7075 C CA    . LEU F 3 403 ? 6.937   -1.613  67.961  1.00 13.93 ? 403  LEU D CA    1 
ATOM   7076 C C     . LEU F 3 403 ? 5.536   -2.160  68.198  1.00 14.54 ? 403  LEU D C     1 
ATOM   7077 O O     . LEU F 3 403 ? 5.173   -3.173  67.618  1.00 14.45 ? 403  LEU D O     1 
ATOM   7078 C CB    . LEU F 3 403 ? 7.023   -0.955  66.579  1.00 14.38 ? 403  LEU D CB    1 
ATOM   7079 C CG    . LEU F 3 403 ? 8.352   -0.265  66.240  1.00 14.59 ? 403  LEU D CG    1 
ATOM   7080 C CD1   . LEU F 3 403 ? 8.163   0.521   64.951  1.00 14.55 ? 403  LEU D CD1   1 
ATOM   7081 C CD2   . LEU F 3 403 ? 8.885   0.627   67.363  1.00 13.79 ? 403  LEU D CD2   1 
ATOM   7082 N N     . PRO F 3 404 ? 4.750   -1.513  69.080  1.00 15.84 ? 404  PRO D N     1 
ATOM   7083 C CA    . PRO F 3 404 ? 3.417   -2.092  69.331  1.00 16.84 ? 404  PRO D CA    1 
ATOM   7084 C C     . PRO F 3 404 ? 2.381   -1.789  68.249  1.00 17.34 ? 404  PRO D C     1 
ATOM   7085 O O     . PRO F 3 404 ? 2.291   -0.652  67.784  1.00 18.03 ? 404  PRO D O     1 
ATOM   7086 C CB    . PRO F 3 404 ? 2.998   -1.448  70.653  1.00 17.16 ? 404  PRO D CB    1 
ATOM   7087 C CG    . PRO F 3 404 ? 3.736   -0.150  70.690  1.00 16.90 ? 404  PRO D CG    1 
ATOM   7088 C CD    . PRO F 3 404 ? 5.012   -0.321  69.908  1.00 15.88 ? 404  PRO D CD    1 
ATOM   7089 N N     . VAL F 3 405 ? 1.609   -2.812  67.886  1.00 18.43 ? 405  VAL D N     1 
ATOM   7090 C CA    . VAL F 3 405 ? 0.523   -2.706  66.894  1.00 20.07 ? 405  VAL D CA    1 
ATOM   7091 C C     . VAL F 3 405 ? -0.819  -3.268  67.461  1.00 21.33 ? 405  VAL D C     1 
ATOM   7092 O O     . VAL F 3 405 ? -0.926  -4.478  67.704  1.00 23.04 ? 405  VAL D O     1 
ATOM   7093 C CB    . VAL F 3 405 ? 0.894   -3.493  65.622  1.00 19.79 ? 405  VAL D CB    1 
ATOM   7094 C CG1   . VAL F 3 405 ? -0.184  -3.327  64.548  1.00 19.86 ? 405  VAL D CG1   1 
ATOM   7095 C CG2   . VAL F 3 405 ? 2.286   -3.065  65.093  1.00 19.27 ? 405  VAL D CG2   1 
ATOM   7096 N N     . ARG F 3 406 ? -1.832  -2.420  67.656  1.00 23.07 ? 406  ARG D N     1 
ATOM   7097 C CA    . ARG F 3 406 ? -3.154  -2.894  68.154  1.00 24.11 ? 406  ARG D CA    1 
ATOM   7098 C C     . ARG F 3 406 ? -4.051  -3.427  67.024  1.00 24.84 ? 406  ARG D C     1 
ATOM   7099 O O     . ARG F 3 406 ? -3.670  -3.359  65.853  1.00 24.71 ? 406  ARG D O     1 
ATOM   7100 C CB    . ARG F 3 406 ? -3.887  -1.801  68.932  1.00 24.77 ? 406  ARG D CB    1 
ATOM   7101 C CG    . ARG F 3 406 ? -4.224  -0.562  68.119  1.00 26.05 ? 406  ARG D CG    1 
ATOM   7102 C CD    . ARG F 3 406 ? -4.839  0.512   68.993  1.00 28.60 ? 406  ARG D CD    1 
ATOM   7103 N NE    . ARG F 3 406 ? -6.267  0.675   68.756  1.00 33.63 ? 406  ARG D NE    1 
ATOM   7104 C CZ    . ARG F 3 406 ? -6.835  1.792   68.304  1.00 31.57 ? 406  ARG D CZ    1 
ATOM   7105 N NH1   . ARG F 3 406 ? -6.106  2.867   68.034  1.00 32.00 ? 406  ARG D NH1   1 
ATOM   7106 N NH2   . ARG F 3 406 ? -8.143  1.831   68.129  1.00 33.84 ? 406  ARG D NH2   1 
ATOM   7107 N N     . ARG F 3 407 ? -5.239  -3.934  67.378  1.00 25.21 ? 407  ARG D N     1 
ATOM   7108 C CA    . ARG F 3 407 ? -6.124  -4.657  66.424  1.00 25.95 ? 407  ARG D CA    1 
ATOM   7109 C C     . ARG F 3 407 ? -6.712  -3.788  65.302  1.00 26.41 ? 407  ARG D C     1 
ATOM   7110 O O     . ARG F 3 407 ? -7.173  -4.303  64.284  1.00 26.42 ? 407  ARG D O     1 
ATOM   7111 C CB    . ARG F 3 407 ? -7.262  -5.393  67.171  1.00 25.79 ? 407  ARG D CB    1 
ATOM   7112 C CG    . ARG F 3 407 ? -6.801  -6.512  68.123  1.00 26.66 ? 407  ARG D CG    1 
ATOM   7113 C CD    . ARG F 3 407 ? -7.968  -7.142  68.896  1.00 26.49 ? 407  ARG D CD    1 
ATOM   7114 N NE    . ARG F 3 407 ? -7.520  -7.932  70.048  1.00 27.72 ? 407  ARG D NE    1 
ATOM   7115 C CZ    . ARG F 3 407 ? -7.367  -7.457  71.288  1.00 28.87 ? 407  ARG D CZ    1 
ATOM   7116 N NH1   . ARG F 3 407 ? -7.623  -6.175  71.573  1.00 28.15 ? 407  ARG D NH1   1 
ATOM   7117 N NH2   . ARG F 3 407 ? -6.946  -8.269  72.261  1.00 29.85 ? 407  ARG D NH2   1 
ATOM   7118 N N     . GLU F 3 408 ? -6.714  -2.475  65.498  1.00 27.08 ? 408  GLU D N     1 
ATOM   7119 C CA    . GLU F 3 408 ? -7.129  -1.520  64.469  1.00 27.97 ? 408  GLU D CA    1 
ATOM   7120 C C     . GLU F 3 408 ? -6.319  -1.715  63.174  1.00 27.89 ? 408  GLU D C     1 
ATOM   7121 O O     . GLU F 3 408 ? -6.854  -1.588  62.060  1.00 27.95 ? 408  GLU D O     1 
ATOM   7122 C CB    . GLU F 3 408 ? -6.954  -0.095  65.019  1.00 28.60 ? 408  GLU D CB    1 
ATOM   7123 C CG    . GLU F 3 408 ? -7.074  1.052   64.015  1.00 30.57 ? 408  GLU D CG    1 
ATOM   7124 C CD    . GLU F 3 408 ? -8.496  1.528   63.793  1.00 33.63 ? 408  GLU D CD    1 
ATOM   7125 O OE1   . GLU F 3 408 ? -9.425  1.052   64.487  1.00 35.21 ? 408  GLU D OE1   1 
ATOM   7126 O OE2   . GLU F 3 408 ? -8.679  2.399   62.915  1.00 36.53 ? 408  GLU D OE2   1 
ATOM   7127 N N     . TYR F 3 409 ? -5.046  -2.072  63.340  1.00 27.30 ? 409  TYR D N     1 
ATOM   7128 C CA    . TYR F 3 409 ? -4.054  -2.028  62.263  1.00 27.76 ? 409  TYR D CA    1 
ATOM   7129 C C     . TYR F 3 409 ? -3.689  -3.411  61.742  1.00 27.67 ? 409  TYR D C     1 
ATOM   7130 O O     . TYR F 3 409 ? -3.498  -3.598  60.539  1.00 27.89 ? 409  TYR D O     1 
ATOM   7131 C CB    . TYR F 3 409 ? -2.798  -1.311  62.762  1.00 27.51 ? 409  TYR D CB    1 
ATOM   7132 C CG    . TYR F 3 409 ? -3.108  0.008   63.429  1.00 27.64 ? 409  TYR D CG    1 
ATOM   7133 C CD1   . TYR F 3 409 ? -3.751  1.017   62.725  1.00 27.42 ? 409  TYR D CD1   1 
ATOM   7134 C CD2   . TYR F 3 409 ? -2.768  0.244   64.764  1.00 27.80 ? 409  TYR D CD2   1 
ATOM   7135 C CE1   . TYR F 3 409 ? -4.056  2.231   63.316  1.00 28.42 ? 409  TYR D CE1   1 
ATOM   7136 C CE2   . TYR F 3 409 ? -3.068  1.473   65.372  1.00 28.25 ? 409  TYR D CE2   1 
ATOM   7137 C CZ    . TYR F 3 409 ? -3.718  2.456   64.633  1.00 27.77 ? 409  TYR D CZ    1 
ATOM   7138 O OH    . TYR F 3 409 ? -4.043  3.668   65.187  1.00 27.96 ? 409  TYR D OH    1 
ATOM   7139 N N     . GLY F 3 410 ? -3.587  -4.365  62.661  1.00 27.97 ? 410  GLY D N     1 
ATOM   7140 C CA    . GLY F 3 410 ? -3.184  -5.730  62.351  1.00 28.42 ? 410  GLY D CA    1 
ATOM   7141 C C     . GLY F 3 410 ? -3.688  -6.727  63.380  1.00 29.39 ? 410  GLY D C     1 
ATOM   7142 O O     . GLY F 3 410 ? -3.937  -6.384  64.544  1.00 29.06 ? 410  GLY D O     1 
ATOM   7143 N N     . PHE F 3 411 ? -3.840  -7.970  62.941  1.00 29.82 ? 411  PHE D N     1 
ATOM   7144 C CA    . PHE F 3 411 ? -4.431  -9.019  63.756  1.00 30.85 ? 411  PHE D CA    1 
ATOM   7145 C C     . PHE F 3 411 ? -3.914  -10.364 63.279  1.00 31.37 ? 411  PHE D C     1 
ATOM   7146 O O     . PHE F 3 411 ? -3.970  -10.670 62.086  1.00 31.17 ? 411  PHE D O     1 
ATOM   7147 C CB    . PHE F 3 411 ? -5.969  -8.987  63.641  1.00 30.94 ? 411  PHE D CB    1 
ATOM   7148 C CG    . PHE F 3 411 ? -6.674  -9.937  64.586  1.00 31.32 ? 411  PHE D CG    1 
ATOM   7149 C CD1   . PHE F 3 411 ? -6.936  -11.256 64.213  1.00 31.66 ? 411  PHE D CD1   1 
ATOM   7150 C CD2   . PHE F 3 411 ? -7.073  -9.510  65.851  1.00 31.89 ? 411  PHE D CD2   1 
ATOM   7151 C CE1   . PHE F 3 411 ? -7.567  -12.135 65.090  1.00 30.48 ? 411  PHE D CE1   1 
ATOM   7152 C CE2   . PHE F 3 411 ? -7.717  -10.391 66.741  1.00 29.51 ? 411  PHE D CE2   1 
ATOM   7153 C CZ    . PHE F 3 411 ? -7.973  -11.696 66.353  1.00 30.63 ? 411  PHE D CZ    1 
ATOM   7154 N N     . HIS F 3 412 ? -3.429  -11.174 64.215  1.00 32.14 ? 412  HIS D N     1 
ATOM   7155 C CA    . HIS F 3 412 ? -2.982  -12.520 63.888  1.00 32.99 ? 412  HIS D CA    1 
ATOM   7156 C C     . HIS F 3 412 ? -4.073  -13.537 64.195  1.00 33.54 ? 412  HIS D C     1 
ATOM   7157 O O     . HIS F 3 412 ? -4.500  -13.670 65.349  1.00 33.35 ? 412  HIS D O     1 
ATOM   7158 C CB    . HIS F 3 412 ? -1.718  -12.879 64.668  1.00 33.10 ? 412  HIS D CB    1 
ATOM   7159 C CG    . HIS F 3 412 ? -0.847  -13.873 63.967  1.00 33.93 ? 412  HIS D CG    1 
ATOM   7160 N ND1   . HIS F 3 412 ? 0.528   -13.766 63.937  1.00 34.59 ? 412  HIS D ND1   1 
ATOM   7161 C CD2   . HIS F 3 412 ? -1.155  -14.976 63.243  1.00 33.90 ? 412  HIS D CD2   1 
ATOM   7162 C CE1   . HIS F 3 412 ? 1.029   -14.771 63.241  1.00 34.28 ? 412  HIS D CE1   1 
ATOM   7163 N NE2   . HIS F 3 412 ? 0.029   -15.518 62.807  1.00 34.14 ? 412  HIS D NE2   1 
ATOM   7164 N N     . THR F 3 413 ? -4.526  -14.246 63.163  1.00 34.03 ? 413  THR D N     1 
ATOM   7165 C CA    . THR F 3 413 ? -5.575  -15.249 63.344  1.00 34.88 ? 413  THR D CA    1 
ATOM   7166 C C     . THR F 3 413 ? -5.014  -16.603 63.792  1.00 35.58 ? 413  THR D C     1 
ATOM   7167 O O     . THR F 3 413 ? -5.685  -17.365 64.507  1.00 35.75 ? 413  THR D O     1 
ATOM   7168 C CB    . THR F 3 413 ? -6.443  -15.424 62.078  1.00 34.83 ? 413  THR D CB    1 
ATOM   7169 O OG1   . THR F 3 413 ? -5.609  -15.756 60.958  1.00 35.05 ? 413  THR D OG1   1 
ATOM   7170 C CG2   . THR F 3 413 ? -7.209  -14.135 61.786  1.00 35.08 ? 413  THR D CG2   1 
HETATM 7171 N N     . NEA G 4 .   ? -17.119 -6.409  19.884  1.00 13.03 ? 2001 NEA A N     1 
HETATM 7172 C CB    . NEA G 4 .   ? -16.891 -7.464  18.872  1.00 13.78 ? 2001 NEA A CB    1 
HETATM 7173 C CG    . NEA G 4 .   ? -16.043 -6.999  17.688  1.00 13.93 ? 2001 NEA A CG    1 
HETATM 7174 S SD    . NEA G 4 .   ? -16.749 -5.583  16.797  1.00 13.87 ? 2001 NEA A SD    1 
HETATM 7175 C "C5'" . NEA G 4 .   ? -18.131 -6.445  15.991  1.00 13.54 ? 2001 NEA A "C5'" 1 
HETATM 7176 C "C4'" . NEA G 4 .   ? -19.485 -5.891  16.463  1.00 12.87 ? 2001 NEA A "C4'" 1 
HETATM 7177 O "O4'" . NEA G 4 .   ? -19.506 -4.485  16.360  1.00 12.92 ? 2001 NEA A "O4'" 1 
HETATM 7178 C "C3'" . NEA G 4 .   ? -20.682 -6.375  15.646  1.00 14.66 ? 2001 NEA A "C3'" 1 
HETATM 7179 O "O3'" . NEA G 4 .   ? -21.711 -6.827  16.507  1.00 14.08 ? 2001 NEA A "O3'" 1 
HETATM 7180 C "C2'" . NEA G 4 .   ? -21.138 -5.140  14.869  1.00 13.13 ? 2001 NEA A "C2'" 1 
HETATM 7181 O "O2'" . NEA G 4 .   ? -22.523 -5.153  14.533  1.00 14.06 ? 2001 NEA A "O2'" 1 
HETATM 7182 C "C1'" . NEA G 4 .   ? -20.738 -4.015  15.804  1.00 13.67 ? 2001 NEA A "C1'" 1 
HETATM 7183 N N9    . NEA G 4 .   ? -20.434 -2.705  15.196  1.00 12.42 ? 2001 NEA A N9    1 
HETATM 7184 C C8    . NEA G 4 .   ? -19.675 -2.454  14.074  1.00 13.13 ? 2001 NEA A C8    1 
HETATM 7185 N N7    . NEA G 4 .   ? -19.635 -1.111  13.879  1.00 12.51 ? 2001 NEA A N7    1 
HETATM 7186 C C5    . NEA G 4 .   ? -20.337 -0.496  14.876  1.00 11.96 ? 2001 NEA A C5    1 
HETATM 7187 C C6    . NEA G 4 .   ? -20.631 0.838   15.184  1.00 12.50 ? 2001 NEA A C6    1 
HETATM 7188 N N6    . NEA G 4 .   ? -20.177 1.848   14.447  1.00 12.13 ? 2001 NEA A N6    1 
HETATM 7189 N N1    . NEA G 4 .   ? -21.389 1.130   16.291  1.00 13.01 ? 2001 NEA A N1    1 
HETATM 7190 C C2    . NEA G 4 .   ? -21.879 0.123   17.096  1.00 13.11 ? 2001 NEA A C2    1 
HETATM 7191 N N3    . NEA G 4 .   ? -21.617 -1.189  16.778  1.00 12.78 ? 2001 NEA A N3    1 
HETATM 7192 C C4    . NEA G 4 .   ? -20.847 -1.498  15.696  1.00 13.36 ? 2001 NEA A C4    1 
HETATM 7193 C C1    . GOL H 5 .   ? 16.719  0.178   -27.228 1.00 22.26 ? 3001 GOL A C1    1 
HETATM 7194 O O1    . GOL H 5 .   ? 17.156  0.920   -26.101 1.00 20.51 ? 3001 GOL A O1    1 
HETATM 7195 C C2    . GOL H 5 .   ? 15.521  -0.698  -26.878 1.00 22.36 ? 3001 GOL A C2    1 
HETATM 7196 O O2    . GOL H 5 .   ? 14.587  0.065   -26.136 1.00 23.98 ? 3001 GOL A O2    1 
HETATM 7197 C C3    . GOL H 5 .   ? 15.948  -1.904  -26.041 1.00 21.06 ? 3001 GOL A C3    1 
HETATM 7198 O O3    . GOL H 5 .   ? 16.809  -2.778  -26.748 1.00 20.46 ? 3001 GOL A O3    1 
HETATM 7199 C C1    . GOL I 5 .   ? -19.159 1.425   10.398  1.00 20.96 ? 3002 GOL A C1    1 
HETATM 7200 O O1    . GOL I 5 .   ? -19.063 1.943   11.705  1.00 16.78 ? 3002 GOL A O1    1 
HETATM 7201 C C2    . GOL I 5 .   ? -19.514 -0.064  10.375  1.00 23.56 ? 3002 GOL A C2    1 
HETATM 7202 O O2    . GOL I 5 .   ? -18.662 -0.795  11.228  1.00 24.61 ? 3002 GOL A O2    1 
HETATM 7203 C C3    . GOL I 5 .   ? -20.966 -0.275  10.788  1.00 26.22 ? 3002 GOL A C3    1 
HETATM 7204 O O3    . GOL I 5 .   ? -21.802 0.026   9.685   1.00 27.99 ? 3002 GOL A O3    1 
HETATM 7205 C C1    . GOL J 5 .   ? 3.851   -11.759 23.970  1.00 20.65 ? 3007 GOL A C1    1 
HETATM 7206 O O1    . GOL J 5 .   ? 5.200   -11.508 23.605  1.00 19.10 ? 3007 GOL A O1    1 
HETATM 7207 C C2    . GOL J 5 .   ? 3.571   -13.253 24.052  1.00 22.30 ? 3007 GOL A C2    1 
HETATM 7208 O O2    . GOL J 5 .   ? 4.444   -13.865 24.979  1.00 24.33 ? 3007 GOL A O2    1 
HETATM 7209 C C3    . GOL J 5 .   ? 2.107   -13.500 24.437  1.00 22.87 ? 3007 GOL A C3    1 
HETATM 7210 O O3    . GOL J 5 .   ? 1.912   -13.368 25.830  1.00 20.48 ? 3007 GOL A O3    1 
HETATM 7211 N N     . NEA K 4 .   ? 42.365  8.247   76.367  1.00 13.67 ? 2002 NEA D N     1 
HETATM 7212 C CB    . NEA K 4 .   ? 42.390  9.121   75.140  1.00 15.38 ? 2002 NEA D CB    1 
HETATM 7213 C CG    . NEA K 4 .   ? 41.485  8.577   74.041  1.00 14.50 ? 2002 NEA D CG    1 
HETATM 7214 S SD    . NEA K 4 .   ? 42.011  6.938   73.471  1.00 15.27 ? 2002 NEA D SD    1 
HETATM 7215 C "C5'" . NEA K 4 .   ? 43.452  7.519   72.516  1.00 13.03 ? 2002 NEA D "C5'" 1 
HETATM 7216 C "C4'" . NEA K 4 .   ? 44.788  7.051   73.122  1.00 12.06 ? 2002 NEA D "C4'" 1 
HETATM 7217 O "O4'" . NEA K 4 .   ? 44.757  5.628   73.255  1.00 12.56 ? 2002 NEA D "O4'" 1 
HETATM 7218 C "C3'" . NEA K 4 .   ? 46.031  7.406   72.296  1.00 11.67 ? 2002 NEA D "C3'" 1 
HETATM 7219 O "O3'" . NEA K 4 .   ? 47.058  7.958   73.140  1.00 12.10 ? 2002 NEA D "O3'" 1 
HETATM 7220 C "C2'" . NEA K 4 .   ? 46.371  6.054   71.669  1.00 12.76 ? 2002 NEA D "C2'" 1 
HETATM 7221 O "O2'" . NEA K 4 .   ? 47.720  5.886   71.327  1.00 12.41 ? 2002 NEA D "O2'" 1 
HETATM 7222 C "C1'" . NEA K 4 .   ? 45.979  5.099   72.780  1.00 11.44 ? 2002 NEA D "C1'" 1 
HETATM 7223 N N9    . NEA K 4 .   ? 45.707  3.707   72.405  1.00 10.45 ? 2002 NEA D N9    1 
HETATM 7224 C C8    . NEA K 4 .   ? 44.998  3.254   71.310  1.00 10.45 ? 2002 NEA D C8    1 
HETATM 7225 N N7    . NEA K 4 .   ? 44.971  1.904   71.372  1.00 10.81 ? 2002 NEA D N7    1 
HETATM 7226 C C5    . NEA K 4 .   ? 45.648  1.500   72.485  1.00 9.13  ? 2002 NEA D C5    1 
HETATM 7227 C C6    . NEA K 4 .   ? 45.924  0.237   73.037  1.00 11.82 ? 2002 NEA D C6    1 
HETATM 7228 N N6    . NEA K 4 .   ? 45.515  -0.900  72.484  1.00 11.40 ? 2002 NEA D N6    1 
HETATM 7229 N N1    . NEA K 4 .   ? 46.632  0.182   74.226  1.00 9.85  ? 2002 NEA D N1    1 
HETATM 7230 C C2    . NEA K 4 .   ? 47.093  1.326   74.834  1.00 10.39 ? 2002 NEA D C2    1 
HETATM 7231 N N3    . NEA K 4 .   ? 46.819  2.564   74.303  1.00 9.74  ? 2002 NEA D N3    1 
HETATM 7232 C C4    . NEA K 4 .   ? 46.099  2.638   73.147  1.00 10.33 ? 2002 NEA D C4    1 
HETATM 7233 C C1    . GOL L 5 .   ? 44.525  -1.219  68.413  1.00 23.87 ? 3003 GOL D C1    1 
HETATM 7234 O O1    . GOL L 5 .   ? 44.576  -1.499  69.799  1.00 20.26 ? 3003 GOL D O1    1 
HETATM 7235 C C2    . GOL L 5 .   ? 45.024  0.190   68.072  1.00 26.26 ? 3003 GOL D C2    1 
HETATM 7236 O O2    . GOL L 5 .   ? 44.241  1.194   68.690  1.00 25.61 ? 3003 GOL D O2    1 
HETATM 7237 C C3    . GOL L 5 .   ? 46.479  0.343   68.487  1.00 28.34 ? 3003 GOL D C3    1 
HETATM 7238 O O3    . GOL L 5 .   ? 47.285  -0.320  67.537  1.00 31.25 ? 3003 GOL D O3    1 
HETATM 7239 C C1    . GOL M 5 .   ? 51.409  -2.065  87.547  1.00 24.32 ? 3004 GOL D C1    1 
HETATM 7240 O O1    . GOL M 5 .   ? 52.086  -1.648  88.730  1.00 19.02 ? 3004 GOL D O1    1 
HETATM 7241 C C2    . GOL M 5 .   ? 51.795  -3.474  87.072  1.00 25.05 ? 3004 GOL D C2    1 
HETATM 7242 O O2    . GOL M 5 .   ? 51.465  -4.443  88.041  1.00 25.82 ? 3004 GOL D O2    1 
HETATM 7243 C C3    . GOL M 5 .   ? 53.290  -3.611  86.780  1.00 26.16 ? 3004 GOL D C3    1 
HETATM 7244 O O3    . GOL M 5 .   ? 53.631  -2.863  85.645  1.00 26.85 ? 3004 GOL D O3    1 
HETATM 7245 C C1    . GOL N 5 .   ? 57.551  8.993   93.385  1.00 45.86 ? 3005 GOL D C1    1 
HETATM 7246 O O1    . GOL N 5 .   ? 56.613  9.836   94.010  1.00 45.66 ? 3005 GOL D O1    1 
HETATM 7247 C C2    . GOL N 5 .   ? 58.429  9.808   92.447  1.00 46.40 ? 3005 GOL D C2    1 
HETATM 7248 O O2    . GOL N 5 .   ? 59.002  8.938   91.499  1.00 47.14 ? 3005 GOL D O2    1 
HETATM 7249 C C3    . GOL N 5 .   ? 59.542  10.475  93.246  1.00 46.81 ? 3005 GOL D C3    1 
HETATM 7250 O O3    . GOL N 5 .   ? 60.661  9.617   93.309  1.00 46.99 ? 3005 GOL D O3    1 
HETATM 7251 C C1    . GOL O 5 .   ? 51.606  8.528   94.347  1.00 24.06 ? 3006 GOL D C1    1 
HETATM 7252 O O1    . GOL O 5 .   ? 50.819  9.645   94.743  1.00 23.56 ? 3006 GOL D O1    1 
HETATM 7253 C C2    . GOL O 5 .   ? 52.966  8.600   95.066  1.00 25.65 ? 3006 GOL D C2    1 
HETATM 7254 O O2    . GOL O 5 .   ? 53.401  9.933   95.186  1.00 26.83 ? 3006 GOL D O2    1 
HETATM 7255 C C3    . GOL O 5 .   ? 54.006  7.790   94.311  1.00 25.29 ? 3006 GOL D C3    1 
HETATM 7256 O O3    . GOL O 5 .   ? 55.172  7.620   95.097  1.00 25.64 ? 3006 GOL D O3    1 
HETATM 7257 O O     . HOH P 6 .   ? -7.654  -3.117  10.650  1.00 9.51  ? 11   HOH B O     1 
HETATM 7258 O O     . HOH P 6 .   ? 5.029   3.279   0.953   1.00 13.81 ? 12   HOH B O     1 
HETATM 7259 O O     . HOH P 6 .   ? 8.886   8.416   0.561   1.00 13.04 ? 13   HOH B O     1 
HETATM 7260 O O     . HOH P 6 .   ? -0.164  8.594   1.724   1.00 28.20 ? 14   HOH B O     1 
HETATM 7261 O O     . HOH P 6 .   ? -1.452  -7.425  3.488   1.00 30.74 ? 15   HOH B O     1 
HETATM 7262 O O     . HOH P 6 .   ? 8.655   12.010  -1.320  1.00 30.21 ? 16   HOH B O     1 
HETATM 7263 O O     . HOH P 6 .   ? -1.316  -24.964 -5.138  1.00 30.09 ? 17   HOH B O     1 
HETATM 7264 O O     . HOH P 6 .   ? 2.424   -21.579 -1.068  1.00 26.98 ? 18   HOH B O     1 
HETATM 7265 O O     . HOH P 6 .   ? -3.456  -6.758  0.223   1.00 36.00 ? 19   HOH B O     1 
HETATM 7266 O O     . HOH P 6 .   ? 4.159   11.333  -9.477  1.00 39.90 ? 20   HOH B O     1 
HETATM 7267 O O     . HOH P 6 .   ? 0.840   -16.098 -2.165  1.00 32.35 ? 21   HOH B O     1 
HETATM 7268 O O     . HOH P 6 .   ? 3.817   4.622   8.378   1.00 9.11  ? 22   HOH B O     1 
HETATM 7269 O O     . HOH P 6 .   ? 5.465   6.632   -5.449  1.00 11.44 ? 23   HOH B O     1 
HETATM 7270 O O     . HOH P 6 .   ? -5.260  -6.411  2.516   1.00 34.04 ? 24   HOH B O     1 
HETATM 7271 O O     . HOH P 6 .   ? -2.524  -9.618  0.398   1.00 34.11 ? 25   HOH B O     1 
HETATM 7272 O O     . HOH P 6 .   ? -0.243  6.865   -8.091  1.00 15.14 ? 26   HOH B O     1 
HETATM 7273 O O     . HOH P 6 .   ? -1.369  -4.646  8.923   1.00 11.04 ? 27   HOH B O     1 
HETATM 7274 O O     . HOH P 6 .   ? 8.097   5.551   0.741   1.00 13.20 ? 28   HOH B O     1 
HETATM 7275 O O     . HOH P 6 .   ? 8.410   8.191   -6.193  1.00 13.71 ? 29   HOH B O     1 
HETATM 7276 O O     . HOH P 6 .   ? -9.049  -2.647  6.216   1.00 10.93 ? 30   HOH B O     1 
HETATM 7277 O O     . HOH P 6 .   ? -4.867  -3.132  11.218  1.00 8.43  ? 31   HOH B O     1 
HETATM 7278 O O     . HOH P 6 .   ? -8.585  -5.769  4.176   1.00 28.70 ? 32   HOH B O     1 
HETATM 7279 O O     . HOH P 6 .   ? 0.856   -2.034  7.398   1.00 12.26 ? 33   HOH B O     1 
HETATM 7280 O O     . HOH P 6 .   ? 6.026   3.591   4.832   1.00 11.17 ? 34   HOH B O     1 
HETATM 7281 O O     . HOH P 6 .   ? 6.001   7.785   5.854   1.00 31.92 ? 35   HOH B O     1 
HETATM 7282 O O     . HOH P 6 .   ? 6.991   9.543   2.381   1.00 17.15 ? 36   HOH B O     1 
HETATM 7283 O O     . HOH P 6 .   ? 1.668   10.269  0.528   1.00 25.96 ? 37   HOH B O     1 
HETATM 7284 O O     . HOH P 6 .   ? 3.842   1.988   5.172   1.00 10.44 ? 38   HOH B O     1 
HETATM 7285 O O     . HOH P 6 .   ? 1.654   -10.228 9.635   1.00 41.69 ? 39   HOH B O     1 
HETATM 7286 O O     . HOH P 6 .   ? 1.870   0.342   6.291   1.00 11.97 ? 40   HOH B O     1 
HETATM 7287 O O     . HOH P 6 .   ? -5.349  1.007   9.435   1.00 10.45 ? 41   HOH B O     1 
HETATM 7288 O O     . HOH P 6 .   ? -11.249 -7.500  6.893   1.00 24.26 ? 42   HOH B O     1 
HETATM 7289 O O     . HOH P 6 .   ? 5.857   5.490   6.885   1.00 14.54 ? 43   HOH B O     1 
HETATM 7290 O O     . HOH P 6 .   ? -2.556  9.233   -8.326  1.00 29.10 ? 44   HOH B O     1 
HETATM 7291 O O     . HOH P 6 .   ? -2.132  5.100   -9.254  1.00 13.65 ? 45   HOH B O     1 
HETATM 7292 O O     . HOH P 6 .   ? -11.984 -9.975  6.956   1.00 35.71 ? 46   HOH B O     1 
HETATM 7293 O O     . HOH P 6 .   ? -7.669  -13.340 3.650   1.00 27.45 ? 47   HOH B O     1 
HETATM 7294 O O     . HOH P 6 .   ? -15.556 -6.265  12.937  1.00 31.86 ? 48   HOH B O     1 
HETATM 7295 O O     . HOH P 6 .   ? -7.622  -15.056 8.147   1.00 42.36 ? 49   HOH B O     1 
HETATM 7296 O O     . HOH P 6 .   ? -2.201  7.730   2.997   1.00 25.46 ? 50   HOH B O     1 
HETATM 7297 O O     . HOH P 6 .   ? 3.668   11.431  1.852   1.00 25.74 ? 51   HOH B O     1 
HETATM 7298 O O     . HOH P 6 .   ? 9.791   10.648  -6.749  1.00 30.03 ? 52   HOH B O     1 
HETATM 7299 O O     . HOH P 6 .   ? -7.694  -3.112  3.833   1.00 28.02 ? 53   HOH B O     1 
HETATM 7300 O O     . HOH P 6 .   ? -0.152  9.840   -9.200  1.00 40.76 ? 54   HOH B O     1 
HETATM 7301 O O     . HOH P 6 .   ? 2.179   -18.596 -3.707  1.00 27.33 ? 55   HOH B O     1 
HETATM 7302 O O     . HOH P 6 .   ? 6.106   11.936  1.257   1.00 30.06 ? 56   HOH B O     1 
HETATM 7303 O O     . HOH P 6 .   ? -6.167  -12.903 6.228   1.00 41.02 ? 57   HOH B O     1 
HETATM 7304 O O     . HOH P 6 .   ? -7.118  -16.089 -1.049  1.00 81.18 ? 58   HOH B O     1 
HETATM 7305 O O     . HOH P 6 .   ? -6.463  -19.920 2.228   1.00 38.31 ? 59   HOH B O     1 
HETATM 7306 O O     . HOH Q 6 .   ? 9.547   -18.733 9.469   1.00 46.86 ? 48   HOH C O     1 
HETATM 7307 O O     . HOH Q 6 .   ? 10.850  -16.139 -1.970  1.00 37.97 ? 72   HOH C O     1 
HETATM 7308 O O     . HOH Q 6 .   ? -8.562  -1.120  -10.452 1.00 24.92 ? 96   HOH C O     1 
HETATM 7309 O O     . HOH Q 6 .   ? -13.601 8.760   -1.075  1.00 42.97 ? 118  HOH C O     1 
HETATM 7310 O O     . HOH Q 6 .   ? -10.350 7.483   -4.125  1.00 20.05 ? 129  HOH C O     1 
HETATM 7311 O O     . HOH Q 6 .   ? -7.029  9.897   -6.917  1.00 27.07 ? 144  HOH C O     1 
HETATM 7312 O O     . HOH Q 6 .   ? -4.913  4.888   -8.133  1.00 17.45 ? 169  HOH C O     1 
HETATM 7313 O O     . HOH Q 6 .   ? -3.248  -19.857 8.168   1.00 31.96 ? 188  HOH C O     1 
HETATM 7314 O O     . HOH Q 6 .   ? -8.075  6.845   -6.271  1.00 35.30 ? 245  HOH C O     1 
HETATM 7315 O O     . HOH Q 6 .   ? -1.908  -4.898  -11.342 1.00 31.17 ? 258  HOH C O     1 
HETATM 7316 O O     . HOH Q 6 .   ? -14.224 7.538   -3.387  1.00 30.99 ? 263  HOH C O     1 
HETATM 7317 O O     . HOH Q 6 .   ? 5.607   -18.379 -2.920  1.00 54.66 ? 346  HOH C O     1 
HETATM 7318 O O     . HOH Q 6 .   ? 11.672  -12.689 -3.595  1.00 38.60 ? 358  HOH C O     1 
HETATM 7319 O O     . HOH Q 6 .   ? -3.075  -10.548 -7.106  1.00 38.82 ? 373  HOH C O     1 
HETATM 7320 O O     . HOH Q 6 .   ? 1.292   -18.514 11.011  1.00 46.92 ? 386  HOH C O     1 
HETATM 7321 O O     . HOH Q 6 .   ? 3.249   -15.718 -1.784  1.00 30.41 ? 433  HOH C O     1 
HETATM 7322 O O     . HOH Q 6 .   ? -13.916 6.044   0.758   1.00 12.80 ? 458  HOH C O     1 
HETATM 7323 O O     . HOH Q 6 .   ? 0.080   -10.291 -0.842  1.00 40.23 ? 479  HOH C O     1 
HETATM 7324 O O     . HOH Q 6 .   ? 4.138   -18.827 -0.450  1.00 19.32 ? 482  HOH C O     1 
HETATM 7325 O O     . HOH Q 6 .   ? -4.454  7.695   1.682   1.00 25.39 ? 501  HOH C O     1 
HETATM 7326 O O     . HOH Q 6 .   ? 3.288   -14.122 7.690   1.00 45.71 ? 513  HOH C O     1 
HETATM 7327 O O     . HOH Q 6 .   ? -9.825  13.167  4.119   1.00 26.58 ? 519  HOH C O     1 
HETATM 7328 O O     . HOH Q 6 .   ? 5.121   -11.242 7.009   1.00 41.21 ? 556  HOH C O     1 
HETATM 7329 O O     . HOH Q 6 .   ? -6.618  3.381   -9.500  1.00 45.43 ? 573  HOH C O     1 
HETATM 7330 O O     . HOH Q 6 .   ? 4.423   -9.088  -6.345  1.00 24.08 ? 597  HOH C O     1 
HETATM 7331 O O     . HOH Q 6 .   ? -6.181  -6.809  -7.349  1.00 25.80 ? 628  HOH C O     1 
HETATM 7332 O O     . HOH Q 6 .   ? -15.993 4.441   -1.961  1.00 24.40 ? 629  HOH C O     1 
HETATM 7333 O O     . HOH Q 6 .   ? -2.458  -17.979 6.583   1.00 36.69 ? 646  HOH C O     1 
HETATM 7334 O O     . HOH Q 6 .   ? -9.672  9.690   -2.493  1.00 29.91 ? 668  HOH C O     1 
HETATM 7335 O O     . HOH Q 6 .   ? 10.632  -13.143 1.722   1.00 33.36 ? 699  HOH C O     1 
HETATM 7336 O O     . HOH Q 6 .   ? 10.240  -17.139 4.758   1.00 36.58 ? 784  HOH C O     1 
HETATM 7337 O O     . HOH Q 6 .   ? 6.671   -16.784 6.131   1.00 45.12 ? 797  HOH C O     1 
HETATM 7338 O O     . HOH Q 6 .   ? 4.934   -9.430  5.241   1.00 26.78 ? 803  HOH C O     1 
HETATM 7339 O O     . HOH Q 6 .   ? -5.810  0.459   -12.602 1.00 34.48 ? 810  HOH C O     1 
HETATM 7340 O O     . HOH Q 6 .   ? -9.727  11.798  -3.884  1.00 34.05 ? 852  HOH C O     1 
HETATM 7341 O O     . HOH Q 6 .   ? 8.346   -15.296 4.581   1.00 37.23 ? 882  HOH C O     1 
HETATM 7342 O O     . HOH Q 6 .   ? -5.131  -1.573  -11.395 1.00 36.41 ? 883  HOH C O     1 
HETATM 7343 O O     . HOH Q 6 .   ? 2.650   -9.000  -8.107  1.00 35.46 ? 913  HOH C O     1 
HETATM 7344 O O     . HOH Q 6 .   ? 10.001  -15.716 2.212   1.00 39.76 ? 1003 HOH C O     1 
HETATM 7345 O O     . HOH Q 6 .   ? -5.288  13.369  3.172   1.00 49.87 ? 1015 HOH C O     1 
HETATM 7346 O O     . HOH Q 6 .   ? 4.359   -21.234 5.191   1.00 37.64 ? 1029 HOH C O     1 
HETATM 7347 O O     . HOH R 6 .   ? 16.320  -9.179  59.495  1.00 13.71 ? 13   HOH E O     1 
HETATM 7348 O O     . HOH R 6 .   ? 33.067  3.552   67.856  1.00 8.56  ? 14   HOH E O     1 
HETATM 7349 O O     . HOH R 6 .   ? 16.836  -10.149 52.761  1.00 15.17 ? 22   HOH E O     1 
HETATM 7350 O O     . HOH R 6 .   ? 35.007  11.459  63.965  1.00 35.34 ? 29   HOH E O     1 
HETATM 7351 O O     . HOH R 6 .   ? 18.271  -10.294 61.392  1.00 17.26 ? 59   HOH E O     1 
HETATM 7352 O O     . HOH R 6 .   ? 29.264  4.321   55.224  1.00 27.92 ? 134  HOH E O     1 
HETATM 7353 O O     . HOH R 6 .   ? 23.856  -11.173 60.176  1.00 32.72 ? 221  HOH E O     1 
HETATM 7354 O O     . HOH R 6 .   ? 19.568  -8.205  64.776  1.00 28.25 ? 260  HOH E O     1 
HETATM 7355 O O     . HOH R 6 .   ? 27.986  -12.087 51.243  1.00 31.79 ? 261  HOH E O     1 
HETATM 7356 O O     . HOH R 6 .   ? 22.425  -12.987 58.599  1.00 26.40 ? 289  HOH E O     1 
HETATM 7357 O O     . HOH R 6 .   ? 36.414  11.241  56.624  1.00 43.28 ? 307  HOH E O     1 
HETATM 7358 O O     . HOH R 6 .   ? 32.285  9.979   50.979  1.00 51.00 ? 333  HOH E O     1 
HETATM 7359 O O     . HOH R 6 .   ? 25.831  12.826  52.963  1.00 38.01 ? 385  HOH E O     1 
HETATM 7360 O O     . HOH R 6 .   ? 19.995  -8.520  53.414  1.00 12.40 ? 429  HOH E O     1 
HETATM 7361 O O     . HOH R 6 .   ? 29.724  7.736   66.145  1.00 17.15 ? 431  HOH E O     1 
HETATM 7362 O O     . HOH R 6 .   ? 30.262  3.609   68.335  1.00 8.52  ? 434  HOH E O     1 
HETATM 7363 O O     . HOH R 6 .   ? 33.850  5.073   61.002  1.00 23.57 ? 435  HOH E O     1 
HETATM 7364 O O     . HOH R 6 .   ? 28.684  8.541   56.597  1.00 33.36 ? 440  HOH E O     1 
HETATM 7365 O O     . HOH R 6 .   ? 17.344  -6.528  59.311  1.00 14.00 ? 442  HOH E O     1 
HETATM 7366 O O     . HOH R 6 .   ? 25.605  -9.193  50.939  1.00 21.31 ? 457  HOH E O     1 
HETATM 7367 O O     . HOH R 6 .   ? 26.942  4.912   65.837  1.00 8.27  ? 462  HOH E O     1 
HETATM 7368 O O     . HOH R 6 .   ? 32.309  2.473   58.181  1.00 20.40 ? 470  HOH E O     1 
HETATM 7369 O O     . HOH R 6 .   ? 34.513  2.378   63.406  1.00 10.02 ? 476  HOH E O     1 
HETATM 7370 O O     . HOH R 6 .   ? 21.570  -4.288  66.741  1.00 10.42 ? 507  HOH E O     1 
HETATM 7371 O O     . HOH R 6 .   ? 31.792  4.463   55.482  1.00 37.32 ? 510  HOH E O     1 
HETATM 7372 O O     . HOH R 6 .   ? 30.750  -0.727  67.271  1.00 8.80  ? 558  HOH E O     1 
HETATM 7373 O O     . HOH R 6 .   ? 23.607  -0.549  64.024  1.00 10.95 ? 575  HOH E O     1 
HETATM 7374 O O     . HOH R 6 .   ? 28.713  5.969   67.796  1.00 12.80 ? 595  HOH E O     1 
HETATM 7375 O O     . HOH R 6 .   ? 21.563  -2.339  63.056  1.00 11.85 ? 598  HOH E O     1 
HETATM 7376 O O     . HOH R 6 .   ? 27.511  -8.080  49.563  1.00 17.78 ? 599  HOH E O     1 
HETATM 7377 O O     . HOH R 6 .   ? 19.515  -5.536  65.350  1.00 14.53 ? 617  HOH E O     1 
HETATM 7378 O O     . HOH R 6 .   ? 22.635  -16.040 55.540  1.00 26.88 ? 624  HOH E O     1 
HETATM 7379 O O     . HOH R 6 .   ? 24.335  2.098   64.812  1.00 14.64 ? 635  HOH E O     1 
HETATM 7380 O O     . HOH R 6 .   ? 16.461  -13.113 58.497  1.00 32.11 ? 643  HOH E O     1 
HETATM 7381 O O     . HOH R 6 .   ? 24.063  17.571  53.637  1.00 31.98 ? 669  HOH E O     1 
HETATM 7382 O O     . HOH R 6 .   ? 27.767  11.366  53.594  1.00 38.09 ? 679  HOH E O     1 
HETATM 7383 O O     . HOH R 6 .   ? 20.303  -4.343  59.046  1.00 11.82 ? 693  HOH E O     1 
HETATM 7384 O O     . HOH R 6 .   ? 25.572  -9.283  60.532  1.00 28.86 ? 696  HOH E O     1 
HETATM 7385 O O     . HOH R 6 .   ? 24.241  14.862  53.273  1.00 35.60 ? 719  HOH E O     1 
HETATM 7386 O O     . HOH R 6 .   ? 33.237  2.655   61.088  1.00 23.38 ? 734  HOH E O     1 
HETATM 7387 O O     . HOH R 6 .   ? 28.193  -9.714  47.382  1.00 20.46 ? 740  HOH E O     1 
HETATM 7388 O O     . HOH R 6 .   ? 27.059  7.642   64.985  1.00 19.46 ? 746  HOH E O     1 
HETATM 7389 O O     . HOH R 6 .   ? 30.473  -9.488  46.229  1.00 29.65 ? 779  HOH E O     1 
HETATM 7390 O O     . HOH R 6 .   ? 15.657  -12.837 52.640  1.00 30.51 ? 783  HOH E O     1 
HETATM 7391 O O     . HOH R 6 .   ? 32.764  16.006  55.053  1.00 36.26 ? 828  HOH E O     1 
HETATM 7392 O O     . HOH R 6 .   ? 31.264  1.235   60.585  1.00 31.33 ? 876  HOH E O     1 
HETATM 7393 O O     . HOH R 6 .   ? 19.990  -14.405 58.713  1.00 42.20 ? 897  HOH E O     1 
HETATM 7394 O O     . HOH R 6 .   ? 27.939  24.056  49.846  1.00 36.06 ? 909  HOH E O     1 
HETATM 7395 O O     . HOH R 6 .   ? 34.034  16.168  57.681  1.00 33.30 ? 948  HOH E O     1 
HETATM 7396 O O     . HOH R 6 .   ? 35.638  9.022   54.657  1.00 43.55 ? 950  HOH E O     1 
HETATM 7397 O O     . HOH R 6 .   ? 32.563  17.913  53.339  1.00 48.28 ? 955  HOH E O     1 
HETATM 7398 O O     . HOH R 6 .   ? 36.451  7.742   63.154  1.00 50.42 ? 959  HOH E O     1 
HETATM 7399 O O     . HOH R 6 .   ? 33.203  13.885  49.338  1.00 45.34 ? 967  HOH E O     1 
HETATM 7400 O O     . HOH R 6 .   ? 31.687  12.722  61.942  1.00 32.97 ? 1021 HOH E O     1 
HETATM 7401 O O     . HOH R 6 .   ? 28.515  8.640   63.215  1.00 43.38 ? 1034 HOH E O     1 
HETATM 7402 O O     . HOH R 6 .   ? 40.908  6.832   69.506  1.00 37.41 ? 1037 HOH E O     1 
HETATM 7403 O O     . HOH S 6 .   ? 26.167  9.362   63.036  1.00 16.37 ? 21   HOH F O     1 
HETATM 7404 O O     . HOH S 6 .   ? 39.308  -7.138  59.717  1.00 11.65 ? 22   HOH F O     1 
HETATM 7405 O O     . HOH S 6 .   ? 21.549  6.684   50.024  1.00 18.71 ? 23   HOH F O     1 
HETATM 7406 O O     . HOH S 6 .   ? 20.928  9.261   61.619  1.00 17.67 ? 24   HOH F O     1 
HETATM 7407 O O     . HOH S 6 .   ? 34.774  -7.373  51.136  1.00 31.08 ? 25   HOH F O     1 
HETATM 7408 O O     . HOH S 6 .   ? 34.309  -1.504  47.452  1.00 37.69 ? 26   HOH F O     1 
HETATM 7409 O O     . HOH S 6 .   ? 41.334  -6.170  56.755  1.00 24.75 ? 27   HOH F O     1 
HETATM 7410 O O     . HOH S 6 .   ? 14.477  11.792  57.275  1.00 28.58 ? 28   HOH F O     1 
HETATM 7411 O O     . HOH S 6 .   ? 39.107  -9.690  55.962  1.00 44.53 ? 29   HOH F O     1 
HETATM 7412 O O     . HOH S 6 .   ? 21.966  14.174  53.927  1.00 27.70 ? 30   HOH F O     1 
HETATM 7413 O O     . HOH S 6 .   ? 35.162  -11.620 57.026  1.00 32.03 ? 31   HOH F O     1 
HETATM 7414 O O     . HOH S 6 .   ? 30.285  -7.503  50.793  1.00 21.71 ? 32   HOH F O     1 
HETATM 7415 O O     . HOH S 6 .   ? 38.919  -10.226 58.542  1.00 33.28 ? 33   HOH F O     1 
HETATM 7416 O O     . HOH S 6 .   ? 23.342  22.571  61.385  1.00 38.16 ? 34   HOH F O     1 
HETATM 7417 O O     . HOH S 6 .   ? 21.554  20.067  59.569  1.00 31.84 ? 35   HOH F O     1 
HETATM 7418 O O     . HOH S 6 .   ? 35.721  -0.013  51.134  1.00 23.81 ? 36   HOH F O     1 
HETATM 7419 O O     . HOH S 6 .   ? 30.368  -9.998  51.756  1.00 33.40 ? 37   HOH F O     1 
HETATM 7420 O O     . HOH S 6 .   ? 20.786  17.520  55.338  1.00 33.70 ? 38   HOH F O     1 
HETATM 7421 O O     . HOH S 6 .   ? 24.705  15.695  63.096  1.00 31.03 ? 39   HOH F O     1 
HETATM 7422 O O     . HOH S 6 .   ? 31.529  2.039   45.603  1.00 38.61 ? 40   HOH F O     1 
HETATM 7423 O O     . HOH S 6 .   ? 27.637  9.799   60.938  1.00 19.91 ? 41   HOH F O     1 
HETATM 7424 O O     . HOH S 6 .   ? 32.183  -5.706  48.535  1.00 26.02 ? 42   HOH F O     1 
HETATM 7425 O O     . HOH S 6 .   ? 27.663  1.658   45.673  1.00 21.47 ? 43   HOH F O     1 
HETATM 7426 O O     . HOH S 6 .   ? 29.554  2.554   43.798  1.00 34.78 ? 44   HOH F O     1 
HETATM 7427 O O     . HOH S 6 .   ? 21.336  19.911  56.696  1.00 24.92 ? 45   HOH F O     1 
HETATM 7428 O O     . HOH S 6 .   ? 26.063  9.516   54.464  1.00 26.42 ? 46   HOH F O     1 
HETATM 7429 O O     . HOH S 6 .   ? 35.714  -9.518  55.138  1.00 22.45 ? 47   HOH F O     1 
HETATM 7430 O O     . HOH S 6 .   ? 29.780  -8.606  60.817  1.00 27.74 ? 48   HOH F O     1 
HETATM 7431 O O     . HOH S 6 .   ? 29.814  19.192  62.142  1.00 22.14 ? 49   HOH F O     1 
HETATM 7432 O O     . HOH S 6 .   ? 27.668  -8.498  61.841  1.00 26.97 ? 50   HOH F O     1 
HETATM 7433 O O     . HOH S 6 .   ? 32.825  -9.140  52.247  1.00 38.96 ? 51   HOH F O     1 
HETATM 7434 O O     . HOH S 6 .   ? 38.950  -12.252 55.773  1.00 40.70 ? 52   HOH F O     1 
HETATM 7435 O O     . HOH S 6 .   ? 20.634  22.711  60.474  1.00 42.40 ? 53   HOH F O     1 
HETATM 7436 O O     . HOH S 6 .   ? 20.510  11.171  63.253  1.00 40.86 ? 54   HOH F O     1 
HETATM 7437 O O     . HOH S 6 .   ? 43.004  -4.396  57.902  1.00 33.03 ? 55   HOH F O     1 
HETATM 7438 O O     . HOH S 6 .   ? 22.344  13.144  63.465  1.00 42.17 ? 56   HOH F O     1 
HETATM 7439 O O     . HOH T 6 .   ? 21.342  -8.536  -9.294  1.00 27.61 ? 3008 HOH A O     1 
HETATM 7440 O O     . HOH T 6 .   ? 32.435  4.093   11.968  1.00 11.73 ? 3009 HOH A O     1 
HETATM 7441 O O     . HOH T 6 .   ? 6.097   -4.226  12.669  1.00 12.06 ? 3010 HOH A O     1 
HETATM 7442 O O     . HOH T 6 .   ? 27.117  16.993  5.362   1.00 30.47 ? 3011 HOH A O     1 
HETATM 7443 O O     . HOH T 6 .   ? 17.524  -5.722  -19.985 1.00 17.00 ? 3012 HOH A O     1 
HETATM 7444 O O     . HOH T 6 .   ? -27.089 10.130  20.091  1.00 24.13 ? 3013 HOH A O     1 
HETATM 7445 O O     . HOH T 6 .   ? -14.911 16.449  17.428  1.00 48.83 ? 3014 HOH A O     1 
HETATM 7446 O O     . HOH T 6 .   ? -8.114  11.562  5.647   1.00 19.33 ? 3015 HOH A O     1 
HETATM 7447 O O     . HOH T 6 .   ? -10.492 -15.403 16.312  1.00 19.92 ? 3016 HOH A O     1 
HETATM 7448 O O     . HOH T 6 .   ? -10.439 5.306   3.922   1.00 8.35  ? 3017 HOH A O     1 
HETATM 7449 O O     . HOH T 6 .   ? 7.256   2.157   -26.717 1.00 19.59 ? 3018 HOH A O     1 
HETATM 7450 O O     . HOH T 6 .   ? 4.296   -2.661  -1.657  1.00 13.56 ? 3019 HOH A O     1 
HETATM 7451 O O     . HOH T 6 .   ? -3.438  5.792   4.418   1.00 12.23 ? 3020 HOH A O     1 
HETATM 7452 O O     . HOH T 6 .   ? -12.907 -11.652 33.735  1.00 23.49 ? 3021 HOH A O     1 
HETATM 7453 O O     . HOH T 6 .   ? 22.854  1.174   25.114  1.00 17.97 ? 3022 HOH A O     1 
HETATM 7454 O O     . HOH T 6 .   ? 14.195  -2.734  -22.655 1.00 16.41 ? 3023 HOH A O     1 
HETATM 7455 O O     . HOH T 6 .   ? -10.586 -10.901 35.009  1.00 22.56 ? 3024 HOH A O     1 
HETATM 7456 O O     . HOH T 6 .   ? -19.331 -2.764  6.114   1.00 25.64 ? 3025 HOH A O     1 
HETATM 7457 O O     . HOH T 6 .   ? 18.371  -6.376  18.990  1.00 21.39 ? 3026 HOH A O     1 
HETATM 7458 O O     . HOH T 6 .   ? -5.124  12.785  5.641   1.00 15.76 ? 3027 HOH A O     1 
HETATM 7459 O O     . HOH T 6 .   ? 21.438  -6.317  16.249  1.00 22.06 ? 3028 HOH A O     1 
HETATM 7460 O O     . HOH T 6 .   ? -8.173  14.790  28.633  1.00 19.89 ? 3029 HOH A O     1 
HETATM 7461 O O     . HOH T 6 .   ? 12.117  -11.918 -18.971 1.00 27.85 ? 3030 HOH A O     1 
HETATM 7462 O O     . HOH T 6 .   ? -17.869 -12.917 29.004  1.00 19.74 ? 3031 HOH A O     1 
HETATM 7463 O O     . HOH T 6 .   ? -32.031 -2.273  27.220  1.00 29.56 ? 3032 HOH A O     1 
HETATM 7464 O O     . HOH T 6 .   ? 6.301   -11.161 18.660  1.00 32.64 ? 3033 HOH A O     1 
HETATM 7465 O O     . HOH T 6 .   ? 3.518   -16.377 26.175  1.00 23.82 ? 3034 HOH A O     1 
HETATM 7466 O O     . HOH T 6 .   ? -15.217 -5.759  0.624   1.00 23.53 ? 3035 HOH A O     1 
HETATM 7467 O O     . HOH T 6 .   ? 11.376  -13.814 -8.789  1.00 21.09 ? 3036 HOH A O     1 
HETATM 7468 O O     . HOH T 6 .   ? 21.661  6.276   13.745  1.00 24.88 ? 3037 HOH A O     1 
HETATM 7469 O O     . HOH T 6 .   ? -0.583  8.548   6.491   1.00 29.23 ? 3038 HOH A O     1 
HETATM 7470 O O     . HOH T 6 .   ? 11.044  -4.389  33.868  1.00 20.41 ? 3039 HOH A O     1 
HETATM 7471 O O     . HOH T 6 .   ? 15.719  4.118   -28.080 1.00 33.06 ? 3040 HOH A O     1 
HETATM 7472 O O     . HOH T 6 .   ? 5.665   -15.786 -12.468 1.00 40.71 ? 3041 HOH A O     1 
HETATM 7473 O O     . HOH T 6 .   ? 26.231  11.355  -3.574  1.00 44.92 ? 3042 HOH A O     1 
HETATM 7474 O O     . HOH T 6 .   ? 10.802  0.644   33.269  1.00 25.46 ? 3043 HOH A O     1 
HETATM 7475 O O     . HOH T 6 .   ? 5.126   10.060  15.230  1.00 26.79 ? 3044 HOH A O     1 
HETATM 7476 O O     . HOH T 6 .   ? -17.355 5.448   2.418   1.00 24.74 ? 3045 HOH A O     1 
HETATM 7477 O O     . HOH T 6 .   ? -18.082 12.462  21.957  1.00 31.73 ? 3046 HOH A O     1 
HETATM 7478 O O     . HOH T 6 .   ? -3.092  3.215   32.055  1.00 27.43 ? 3047 HOH A O     1 
HETATM 7479 O O     . HOH T 6 .   ? 10.196  6.218   18.391  1.00 21.49 ? 3048 HOH A O     1 
HETATM 7480 O O     . HOH T 6 .   ? -4.739  2.463   -14.665 1.00 19.91 ? 3049 HOH A O     1 
HETATM 7481 O O     . HOH T 6 .   ? -1.374  13.894  29.164  1.00 18.97 ? 3050 HOH A O     1 
HETATM 7482 O O     . HOH T 6 .   ? 14.512  4.927   -17.830 1.00 19.02 ? 3051 HOH A O     1 
HETATM 7483 O O     . HOH T 6 .   ? -22.186 -11.853 34.263  1.00 19.69 ? 3052 HOH A O     1 
HETATM 7484 O O     . HOH T 6 .   ? 11.906  7.796   -22.151 1.00 24.40 ? 3053 HOH A O     1 
HETATM 7485 O O     . HOH T 6 .   ? 18.012  -15.442 -2.524  1.00 45.65 ? 3054 HOH A O     1 
HETATM 7486 O O     . HOH T 6 .   ? -25.463 -11.553 19.494  1.00 20.11 ? 3055 HOH A O     1 
HETATM 7487 O O     . HOH T 6 .   ? -14.196 -14.349 30.297  1.00 32.04 ? 3056 HOH A O     1 
HETATM 7488 O O     . HOH T 6 .   ? -16.478 -6.629  4.517   1.00 27.46 ? 3057 HOH A O     1 
HETATM 7489 O O     . HOH T 6 .   ? -25.826 6.480   35.838  1.00 28.10 ? 3058 HOH A O     1 
HETATM 7490 O O     . HOH T 6 .   ? -22.080 -10.925 39.604  1.00 42.09 ? 3059 HOH A O     1 
HETATM 7491 O O     . HOH T 6 .   ? 8.619   -10.750 9.661   1.00 29.33 ? 3060 HOH A O     1 
HETATM 7492 O O     . HOH T 6 .   ? -7.509  17.407  13.616  1.00 33.52 ? 3061 HOH A O     1 
HETATM 7493 O O     . HOH T 6 .   ? 35.298  3.842   5.337   1.00 24.26 ? 3062 HOH A O     1 
HETATM 7494 O O     . HOH T 6 .   ? -31.052 2.564   32.116  1.00 38.80 ? 3063 HOH A O     1 
HETATM 7495 O O     . HOH T 6 .   ? -0.647  3.758   32.693  1.00 31.47 ? 3064 HOH A O     1 
HETATM 7496 O O     . HOH T 6 .   ? -18.601 -13.168 19.968  1.00 26.88 ? 3065 HOH A O     1 
HETATM 7497 O O     . HOH T 6 .   ? -20.877 13.613  31.918  1.00 27.81 ? 3066 HOH A O     1 
HETATM 7498 O O     . HOH T 6 .   ? -2.613  -10.666 -22.676 1.00 50.07 ? 3067 HOH A O     1 
HETATM 7499 O O     . HOH T 6 .   ? 6.962   11.963  -16.929 1.00 35.64 ? 3068 HOH A O     1 
HETATM 7500 O O     . HOH T 6 .   ? 28.146  6.980   7.978   1.00 22.57 ? 3069 HOH A O     1 
HETATM 7501 O O     . HOH T 6 .   ? 3.214   8.174   -13.525 1.00 30.09 ? 3070 HOH A O     1 
HETATM 7502 O O     . HOH T 6 .   ? 22.897  -7.518  -14.366 1.00 33.58 ? 3071 HOH A O     1 
HETATM 7503 O O     . HOH T 6 .   ? 26.602  -6.834  -1.769  1.00 28.00 ? 3072 HOH A O     1 
HETATM 7504 O O     . HOH T 6 .   ? 2.936   -12.189 -15.302 1.00 38.84 ? 3073 HOH A O     1 
HETATM 7505 O O     . HOH T 6 .   ? -6.614  -5.393  -5.096  1.00 15.70 ? 3074 HOH A O     1 
HETATM 7506 O O     . HOH T 6 .   ? 8.850   12.812  24.244  1.00 23.36 ? 3075 HOH A O     1 
HETATM 7507 O O     . HOH T 6 .   ? 20.757  16.052  -1.721  1.00 28.59 ? 3076 HOH A O     1 
HETATM 7508 O O     . HOH T 6 .   ? 18.112  5.604   19.684  1.00 19.52 ? 3077 HOH A O     1 
HETATM 7509 O O     . HOH T 6 .   ? 25.250  -11.277 8.981   1.00 29.52 ? 3078 HOH A O     1 
HETATM 7510 O O     . HOH T 6 .   ? 10.597  -15.269 -17.222 1.00 27.31 ? 3079 HOH A O     1 
HETATM 7511 O O     . HOH T 6 .   ? 34.708  1.549   3.168   1.00 49.91 ? 3080 HOH A O     1 
HETATM 7512 O O     . HOH T 6 .   ? -0.071  -3.802  34.589  1.00 28.26 ? 3081 HOH A O     1 
HETATM 7513 O O     . HOH T 6 .   ? 28.875  -3.776  10.555  1.00 25.72 ? 3082 HOH A O     1 
HETATM 7514 O O     . HOH T 6 .   ? 16.072  2.663   -17.095 1.00 23.32 ? 3083 HOH A O     1 
HETATM 7515 O O     . HOH T 6 .   ? 11.042  6.004   15.612  1.00 20.96 ? 3084 HOH A O     1 
HETATM 7516 O O     . HOH T 6 .   ? 16.995  8.317   13.428  1.00 30.93 ? 3085 HOH A O     1 
HETATM 7517 O O     . HOH T 6 .   ? 32.957  1.760   10.148  1.00 23.90 ? 3086 HOH A O     1 
HETATM 7518 O O     . HOH T 6 .   ? 19.077  -11.940 -16.267 1.00 35.53 ? 3087 HOH A O     1 
HETATM 7519 O O     . HOH T 6 .   ? 27.854  17.815  1.773   1.00 32.67 ? 3088 HOH A O     1 
HETATM 7520 O O     . HOH T 6 .   ? 8.366   -11.562 24.140  1.00 28.97 ? 3089 HOH A O     1 
HETATM 7521 O O     . HOH T 6 .   ? 25.746  2.104   12.570  1.00 37.46 ? 3090 HOH A O     1 
HETATM 7522 O O     . HOH T 6 .   ? -23.364 -11.182 36.601  1.00 29.99 ? 3091 HOH A O     1 
HETATM 7523 O O     . HOH T 6 .   ? 2.439   11.613  7.409   1.00 25.63 ? 3092 HOH A O     1 
HETATM 7524 O O     . HOH T 6 .   ? -22.116 -7.551  43.747  1.00 37.83 ? 3093 HOH A O     1 
HETATM 7525 O O     . HOH T 6 .   ? -16.314 3.584   44.626  1.00 34.52 ? 3094 HOH A O     1 
HETATM 7526 O O     . HOH T 6 .   ? 26.071  -8.414  -11.548 1.00 40.48 ? 3095 HOH A O     1 
HETATM 7527 O O     . HOH T 6 .   ? 19.250  3.906   -17.674 1.00 41.58 ? 3096 HOH A O     1 
HETATM 7528 O O     . HOH T 6 .   ? -14.597 -14.705 25.761  1.00 29.67 ? 3097 HOH A O     1 
HETATM 7529 O O     . HOH T 6 .   ? 13.115  -3.929  29.182  1.00 31.20 ? 3098 HOH A O     1 
HETATM 7530 O O     . HOH T 6 .   ? -12.946 14.798  2.778   1.00 37.04 ? 3099 HOH A O     1 
HETATM 7531 O O     . HOH T 6 .   ? -20.927 -4.186  3.972   1.00 36.26 ? 3100 HOH A O     1 
HETATM 7532 O O     . HOH T 6 .   ? -15.248 15.949  22.742  1.00 28.14 ? 3101 HOH A O     1 
HETATM 7533 O O     . HOH T 6 .   ? -4.934  -12.341 32.916  1.00 28.77 ? 3102 HOH A O     1 
HETATM 7534 O O     . HOH T 6 .   ? 26.347  0.391   10.412  1.00 20.28 ? 3103 HOH A O     1 
HETATM 7535 O O     . HOH T 6 .   ? -17.435 9.113   38.625  1.00 31.67 ? 3104 HOH A O     1 
HETATM 7536 O O     . HOH T 6 .   ? 0.697   17.457  20.850  1.00 54.04 ? 3105 HOH A O     1 
HETATM 7537 O O     . HOH T 6 .   ? 14.472  -8.179  -26.218 1.00 44.34 ? 3106 HOH A O     1 
HETATM 7538 O O     . HOH T 6 .   ? 3.223   -14.011 -25.007 1.00 34.00 ? 3107 HOH A O     1 
HETATM 7539 O O     . HOH T 6 .   ? -14.423 18.664  13.506  1.00 28.30 ? 3108 HOH A O     1 
HETATM 7540 O O     . HOH T 6 .   ? 30.277  -1.728  -4.364  1.00 29.57 ? 3109 HOH A O     1 
HETATM 7541 O O     . HOH T 6 .   ? -16.417 15.962  6.781   1.00 34.07 ? 3110 HOH A O     1 
HETATM 7542 O O     . HOH T 6 .   ? 2.596   -11.972 -8.378  1.00 42.70 ? 3111 HOH A O     1 
HETATM 7543 O O     . HOH T 6 .   ? -5.582  14.470  8.853   1.00 35.76 ? 3112 HOH A O     1 
HETATM 7544 O O     . HOH T 6 .   ? -26.332 -3.880  43.033  1.00 35.56 ? 3113 HOH A O     1 
HETATM 7545 O O     . HOH T 6 .   ? 20.139  -14.292 -1.245  1.00 41.33 ? 3114 HOH A O     1 
HETATM 7546 O O     . HOH T 6 .   ? -10.838 -15.664 9.347   1.00 41.99 ? 3115 HOH A O     1 
HETATM 7547 O O     . HOH T 6 .   ? 7.056   -15.164 28.327  1.00 42.86 ? 3116 HOH A O     1 
HETATM 7548 O O     . HOH T 6 .   ? 12.684  6.310   22.115  1.00 42.51 ? 3117 HOH A O     1 
HETATM 7549 O O     . HOH T 6 .   ? 27.547  -1.576  11.710  1.00 20.78 ? 3118 HOH A O     1 
HETATM 7550 O O     . HOH T 6 .   ? 25.360  -0.404  -13.308 1.00 27.25 ? 3119 HOH A O     1 
HETATM 7551 O O     . HOH T 6 .   ? -20.485 13.456  16.238  1.00 34.67 ? 3120 HOH A O     1 
HETATM 7552 O O     . HOH T 6 .   ? -13.315 15.397  26.669  1.00 39.64 ? 3121 HOH A O     1 
HETATM 7553 O O     . HOH T 6 .   ? 14.398  13.687  0.655   1.00 34.98 ? 3122 HOH A O     1 
HETATM 7554 O O     . HOH T 6 .   ? 1.721   14.540  13.474  1.00 36.77 ? 3123 HOH A O     1 
HETATM 7555 O O     . HOH T 6 .   ? -18.696 -14.324 16.467  1.00 47.79 ? 3124 HOH A O     1 
HETATM 7556 O O     . HOH T 6 .   ? 0.815   -14.195 20.975  1.00 42.72 ? 3125 HOH A O     1 
HETATM 7557 O O     . HOH T 6 .   ? -30.926 4.697   19.555  1.00 26.93 ? 3126 HOH A O     1 
HETATM 7558 O O     . HOH T 6 .   ? 32.302  11.304  10.671  1.00 34.85 ? 3127 HOH A O     1 
HETATM 7559 O O     . HOH T 6 .   ? -8.962  -6.429  -3.612  1.00 32.02 ? 3128 HOH A O     1 
HETATM 7560 O O     . HOH T 6 .   ? 16.038  6.232   21.282  1.00 36.76 ? 3129 HOH A O     1 
HETATM 7561 O O     . HOH T 6 .   ? 4.745   10.804  33.697  1.00 37.65 ? 3130 HOH A O     1 
HETATM 7562 O O     . HOH T 6 .   ? 24.698  -9.777  4.827   1.00 26.74 ? 3131 HOH A O     1 
HETATM 7563 O O     . HOH T 6 .   ? 13.193  9.514   4.441   1.00 42.50 ? 3132 HOH A O     1 
HETATM 7564 O O     . HOH T 6 .   ? -5.008  9.886   -13.304 1.00 36.98 ? 3133 HOH A O     1 
HETATM 7565 O O     . HOH T 6 .   ? -1.114  8.623   -12.806 1.00 54.48 ? 3134 HOH A O     1 
HETATM 7566 O O     . HOH T 6 .   ? 0.785   -8.398  -9.490  1.00 37.45 ? 3135 HOH A O     1 
HETATM 7567 O O     . HOH T 6 .   ? -4.160  -17.119 17.404  1.00 34.44 ? 3136 HOH A O     1 
HETATM 7568 O O     . HOH T 6 .   ? -1.404  -15.471 34.343  1.00 37.12 ? 3137 HOH A O     1 
HETATM 7569 O O     . HOH T 6 .   ? 18.164  6.863   15.947  1.00 37.88 ? 3138 HOH A O     1 
HETATM 7570 O O     . HOH T 6 .   ? 20.485  5.382   20.893  1.00 31.93 ? 3139 HOH A O     1 
HETATM 7571 O O     . HOH T 6 .   ? -28.753 9.876   22.549  1.00 41.02 ? 3140 HOH A O     1 
HETATM 7572 O O     . HOH T 6 .   ? 10.369  -10.492 -20.435 1.00 46.00 ? 3141 HOH A O     1 
HETATM 7573 O O     . HOH T 6 .   ? 12.216  7.101   28.934  1.00 40.79 ? 3142 HOH A O     1 
HETATM 7574 O O     . HOH T 6 .   ? -1.417  -7.588  -15.102 1.00 35.02 ? 3143 HOH A O     1 
HETATM 7575 O O     . HOH T 6 .   ? 1.430   -16.526 12.727  1.00 43.27 ? 3144 HOH A O     1 
HETATM 7576 O O     . HOH T 6 .   ? -16.267 13.796  29.765  1.00 47.67 ? 3145 HOH A O     1 
HETATM 7577 O O     . HOH T 6 .   ? 4.412   9.122   -17.669 1.00 32.22 ? 3146 HOH A O     1 
HETATM 7578 O O     . HOH T 6 .   ? 11.897  11.881  7.432   1.00 49.66 ? 3147 HOH A O     1 
HETATM 7579 O O     . HOH T 6 .   ? -11.707 -12.622 16.337  1.00 41.36 ? 3148 HOH A O     1 
HETATM 7580 O O     . HOH T 6 .   ? -25.409 10.824  37.506  1.00 59.05 ? 3149 HOH A O     1 
HETATM 7581 O O     . HOH T 6 .   ? 0.670   17.252  14.875  1.00 45.40 ? 3150 HOH A O     1 
HETATM 7582 O O     . HOH T 6 .   ? -15.527 15.233  25.195  1.00 35.69 ? 3151 HOH A O     1 
HETATM 7583 O O     . HOH T 6 .   ? -17.866 13.300  27.289  1.00 47.58 ? 3152 HOH A O     1 
HETATM 7584 O O     . HOH T 6 .   ? 7.781   10.900  4.600   1.00 40.82 ? 3153 HOH A O     1 
HETATM 7585 O O     . HOH T 6 .   ? -14.310 -16.732 22.071  1.00 28.76 ? 3154 HOH A O     1 
HETATM 7586 O O     . HOH T 6 .   ? -3.555  -17.808 28.527  1.00 41.76 ? 3155 HOH A O     1 
HETATM 7587 O O     . HOH T 6 .   ? -5.924  -13.569 30.989  1.00 29.74 ? 3156 HOH A O     1 
HETATM 7588 O O     . HOH T 6 .   ? 4.283   -11.914 -26.522 1.00 43.87 ? 3157 HOH A O     1 
HETATM 7589 O O     . HOH T 6 .   ? -8.323  14.633  33.687  1.00 34.62 ? 3158 HOH A O     1 
HETATM 7590 O O     . HOH T 6 .   ? -27.337 9.761   33.096  1.00 49.93 ? 3159 HOH A O     1 
HETATM 7591 O O     . HOH T 6 .   ? -14.814 12.725  37.035  1.00 47.52 ? 3160 HOH A O     1 
HETATM 7592 O O     . HOH T 6 .   ? -31.915 -3.279  31.276  1.00 40.08 ? 3161 HOH A O     1 
HETATM 7593 O O     . HOH T 6 .   ? 31.558  16.987  -0.926  1.00 52.97 ? 3162 HOH A O     1 
HETATM 7594 O O     . HOH T 6 .   ? -22.076 -9.473  15.886  1.00 27.22 ? 3163 HOH A O     1 
HETATM 7595 O O     . HOH T 6 .   ? 20.574  -10.395 -11.591 1.00 37.06 ? 3164 HOH A O     1 
HETATM 7596 O O     . HOH T 6 .   ? 22.277  -6.705  -7.700  1.00 32.30 ? 3165 HOH A O     1 
HETATM 7597 O O     . HOH T 6 .   ? 7.948   -4.472  10.855  1.00 21.09 ? 3166 HOH A O     1 
HETATM 7598 O O     . HOH T 6 .   ? -28.796 2.131   31.809  1.00 37.77 ? 3167 HOH A O     1 
HETATM 7599 O O     . HOH T 6 .   ? 16.892  1.937   13.870  1.00 11.53 ? 3168 HOH A O     1 
HETATM 7600 O O     . HOH T 6 .   ? -6.833  -3.500  0.885   1.00 17.64 ? 3169 HOH A O     1 
HETATM 7601 O O     . HOH T 6 .   ? 10.720  0.216   24.605  1.00 14.04 ? 3170 HOH A O     1 
HETATM 7602 O O     . HOH T 6 .   ? 9.847   9.938   27.978  1.00 14.18 ? 3171 HOH A O     1 
HETATM 7603 O O     . HOH T 6 .   ? -4.533  -12.797 15.716  1.00 15.13 ? 3172 HOH A O     1 
HETATM 7604 O O     . HOH T 6 .   ? -11.221 4.176   7.670   1.00 9.53  ? 3173 HOH A O     1 
HETATM 7605 O O     . HOH T 6 .   ? 21.364  4.363   -4.331  1.00 12.76 ? 3174 HOH A O     1 
HETATM 7606 O O     . HOH T 6 .   ? 9.676   -5.908  4.454   1.00 15.06 ? 3175 HOH A O     1 
HETATM 7607 O O     . HOH T 6 .   ? 5.710   3.501   10.118  1.00 10.75 ? 3176 HOH A O     1 
HETATM 7608 O O     . HOH T 6 .   ? -17.265 2.708   2.444   1.00 15.95 ? 3177 HOH A O     1 
HETATM 7609 O O     . HOH T 6 .   ? 7.630   -8.689  -12.029 1.00 13.01 ? 3178 HOH A O     1 
HETATM 7610 O O     . HOH T 6 .   ? -23.447 9.699   0.156   1.00 18.22 ? 3179 HOH A O     1 
HETATM 7611 O O     . HOH T 6 .   ? 3.338   1.916   2.395   1.00 12.57 ? 3180 HOH A O     1 
HETATM 7612 O O     . HOH T 6 .   ? 14.459  1.474   12.667  1.00 9.88  ? 3181 HOH A O     1 
HETATM 7613 O O     . HOH T 6 .   ? 12.874  -4.993  3.799   1.00 14.69 ? 3182 HOH A O     1 
HETATM 7614 O O     . HOH T 6 .   ? 6.453   -4.503  -1.377  1.00 11.94 ? 3183 HOH A O     1 
HETATM 7615 O O     . HOH T 6 .   ? 11.519  4.429   20.520  1.00 15.61 ? 3184 HOH A O     1 
HETATM 7616 O O     . HOH T 6 .   ? -4.803  -7.361  9.485   1.00 13.65 ? 3185 HOH A O     1 
HETATM 7617 O O     . HOH T 6 .   ? 9.381   3.496   22.089  1.00 17.67 ? 3186 HOH A O     1 
HETATM 7618 O O     . HOH T 6 .   ? 4.337   6.984   12.365  1.00 12.37 ? 3187 HOH A O     1 
HETATM 7619 O O     . HOH T 6 .   ? -8.322  -6.201  -0.907  1.00 30.87 ? 3188 HOH A O     1 
HETATM 7620 O O     . HOH T 6 .   ? -17.893 -7.715  22.129  1.00 21.17 ? 3189 HOH A O     1 
HETATM 7621 O O     . HOH T 6 .   ? -16.228 -1.871  -5.101  1.00 34.50 ? 3190 HOH A O     1 
HETATM 7622 O O     . HOH T 6 .   ? -5.913  -16.744 21.956  1.00 23.33 ? 3191 HOH A O     1 
HETATM 7623 O O     . HOH T 6 .   ? 13.591  -12.302 -0.533  1.00 21.76 ? 3192 HOH A O     1 
HETATM 7624 O O     . HOH T 6 .   ? 2.567   7.295   32.690  1.00 25.52 ? 3193 HOH A O     1 
HETATM 7625 O O     . HOH T 6 .   ? 1.779   11.663  27.576  1.00 19.86 ? 3194 HOH A O     1 
HETATM 7626 O O     . HOH T 6 .   ? 14.889  -0.027  -23.432 1.00 16.00 ? 3195 HOH A O     1 
HETATM 7627 O O     . HOH T 6 .   ? -19.084 11.502  17.487  1.00 15.02 ? 3196 HOH A O     1 
HETATM 7628 O O     . HOH T 6 .   ? 14.801  -8.658  -18.174 1.00 16.64 ? 3197 HOH A O     1 
HETATM 7629 O O     . HOH T 6 .   ? -3.986  9.646   13.390  1.00 11.49 ? 3198 HOH A O     1 
HETATM 7630 O O     . HOH T 6 .   ? 7.936   9.284   16.041  1.00 17.39 ? 3199 HOH A O     1 
HETATM 7631 O O     . HOH T 6 .   ? -16.743 -4.759  22.477  1.00 13.85 ? 3200 HOH A O     1 
HETATM 7632 O O     . HOH T 6 .   ? 4.004   -14.362 -9.047  1.00 33.25 ? 3201 HOH A O     1 
HETATM 7633 O O     . HOH T 6 .   ? 6.089   -0.407  -25.608 1.00 18.68 ? 3202 HOH A O     1 
HETATM 7634 O O     . HOH T 6 .   ? 2.383   -12.812 17.419  1.00 14.76 ? 3203 HOH A O     1 
HETATM 7635 O O     . HOH T 6 .   ? -22.302 7.036   -1.139  1.00 22.94 ? 3204 HOH A O     1 
HETATM 7636 O O     . HOH T 6 .   ? -10.198 8.508   4.935   1.00 11.05 ? 3205 HOH A O     1 
HETATM 7637 O O     . HOH T 6 .   ? 9.279   -10.056 27.942  1.00 28.47 ? 3206 HOH A O     1 
HETATM 7638 O O     . HOH T 6 .   ? 11.400  7.413   11.678  1.00 24.90 ? 3207 HOH A O     1 
HETATM 7639 O O     . HOH T 6 .   ? 18.219  -11.836 -13.607 1.00 19.67 ? 3208 HOH A O     1 
HETATM 7640 O O     . HOH T 6 .   ? -23.602 -13.606 31.683  1.00 16.67 ? 3209 HOH A O     1 
HETATM 7641 O O     . HOH T 6 .   ? -15.878 -9.522  21.779  1.00 19.63 ? 3210 HOH A O     1 
HETATM 7642 O O     . HOH T 6 .   ? 11.110  -6.958  21.371  1.00 14.47 ? 3211 HOH A O     1 
HETATM 7643 O O     . HOH T 6 .   ? 0.711   -5.177  -11.906 1.00 15.98 ? 3212 HOH A O     1 
HETATM 7644 O O     . HOH T 6 .   ? -10.137 -2.334  -6.293  1.00 19.42 ? 3213 HOH A O     1 
HETATM 7645 O O     . HOH T 6 .   ? 1.574   -8.105  11.151  1.00 20.50 ? 3214 HOH A O     1 
HETATM 7646 O O     . HOH T 6 .   ? 16.704  1.984   20.478  1.00 12.94 ? 3215 HOH A O     1 
HETATM 7647 O O     . HOH T 6 .   ? 0.986   -0.900  -6.878  1.00 9.97  ? 3216 HOH A O     1 
HETATM 7648 O O     . HOH T 6 .   ? -20.076 14.072  12.808  1.00 23.79 ? 3217 HOH A O     1 
HETATM 7649 O O     . HOH T 6 .   ? 10.041  11.483  -11.665 1.00 34.38 ? 3218 HOH A O     1 
HETATM 7650 O O     . HOH T 6 .   ? -8.394  14.900  11.303  1.00 18.89 ? 3219 HOH A O     1 
HETATM 7651 O O     . HOH T 6 .   ? 6.155   -8.365  10.401  1.00 15.30 ? 3220 HOH A O     1 
HETATM 7652 O O     . HOH T 6 .   ? -4.761  14.994  35.256  1.00 35.68 ? 3221 HOH A O     1 
HETATM 7653 O O     . HOH T 6 .   ? -26.076 -4.495  37.839  1.00 24.45 ? 3222 HOH A O     1 
HETATM 7654 O O     . HOH T 6 .   ? 0.226   13.578  11.595  1.00 20.58 ? 3223 HOH A O     1 
HETATM 7655 O O     . HOH T 6 .   ? -12.034 -5.951  -0.602  1.00 33.28 ? 3224 HOH A O     1 
HETATM 7656 O O     . HOH T 6 .   ? -1.035  -6.526  12.507  1.00 18.18 ? 3225 HOH A O     1 
HETATM 7657 O O     . HOH T 6 .   ? -14.062 -1.775  39.921  1.00 27.20 ? 3226 HOH A O     1 
HETATM 7658 O O     . HOH T 6 .   ? -3.930  14.762  17.653  1.00 18.99 ? 3227 HOH A O     1 
HETATM 7659 O O     . HOH T 6 .   ? -26.698 6.104   15.597  1.00 30.96 ? 3228 HOH A O     1 
HETATM 7660 O O     . HOH T 6 .   ? -0.705  -5.636  -24.338 1.00 24.75 ? 3229 HOH A O     1 
HETATM 7661 O O     . HOH T 6 .   ? -3.887  14.972  31.458  1.00 39.98 ? 3230 HOH A O     1 
HETATM 7662 O O     . HOH T 6 .   ? 13.048  4.021   28.093  1.00 41.44 ? 3231 HOH A O     1 
HETATM 7663 O O     . HOH T 6 .   ? -11.588 -5.674  1.821   1.00 31.95 ? 3232 HOH A O     1 
HETATM 7664 O O     . HOH T 6 .   ? 24.007  5.128   -10.106 1.00 26.99 ? 3233 HOH A O     1 
HETATM 7665 O O     . HOH T 6 .   ? -15.114 -12.380 34.984  1.00 17.77 ? 3234 HOH A O     1 
HETATM 7666 O O     . HOH T 6 .   ? -16.661 -12.238 22.019  1.00 30.47 ? 3235 HOH A O     1 
HETATM 7667 O O     . HOH T 6 .   ? 4.083   -7.146  -26.001 1.00 28.22 ? 3236 HOH A O     1 
HETATM 7668 O O     . HOH T 6 .   ? 10.869  4.217   13.715  1.00 17.79 ? 3237 HOH A O     1 
HETATM 7669 O O     . HOH T 6 .   ? 0.864   10.640  35.292  1.00 27.45 ? 3238 HOH A O     1 
HETATM 7670 O O     . HOH T 6 .   ? 19.070  5.837   13.942  1.00 25.46 ? 3239 HOH A O     1 
HETATM 7671 O O     . HOH T 6 .   ? 1.661   4.938   31.669  1.00 22.80 ? 3240 HOH A O     1 
HETATM 7672 O O     . HOH T 6 .   ? 0.541   -11.640 -3.044  1.00 45.98 ? 3241 HOH A O     1 
HETATM 7673 O O     . HOH T 6 .   ? -5.848  -5.863  -1.301  1.00 26.66 ? 3242 HOH A O     1 
HETATM 7674 O O     . HOH T 6 .   ? 29.897  5.721   12.159  1.00 24.68 ? 3243 HOH A O     1 
HETATM 7675 O O     . HOH T 6 .   ? 14.697  -3.305  27.200  1.00 31.45 ? 3244 HOH A O     1 
HETATM 7676 O O     . HOH T 6 .   ? 23.038  -5.996  -4.574  1.00 14.63 ? 3245 HOH A O     1 
HETATM 7677 O O     . HOH T 6 .   ? 0.723   14.982  22.197  1.00 24.15 ? 3246 HOH A O     1 
HETATM 7678 O O     . HOH T 6 .   ? 25.885  0.274   -10.709 1.00 32.36 ? 3247 HOH A O     1 
HETATM 7679 O O     . HOH T 6 .   ? 7.860   5.966   22.268  1.00 14.56 ? 3248 HOH A O     1 
HETATM 7680 O O     . HOH T 6 .   ? 13.605  11.017  1.829   1.00 23.87 ? 3249 HOH A O     1 
HETATM 7681 O O     . HOH T 6 .   ? 27.319  2.471   20.636  1.00 17.57 ? 3250 HOH A O     1 
HETATM 7682 O O     . HOH T 6 .   ? -6.498  15.678  17.851  1.00 33.40 ? 3251 HOH A O     1 
HETATM 7683 O O     . HOH T 6 .   ? -20.468 -4.404  42.929  1.00 33.61 ? 3252 HOH A O     1 
HETATM 7684 O O     . HOH T 6 .   ? 15.318  -11.499 7.609   1.00 28.11 ? 3253 HOH A O     1 
HETATM 7685 O O     . HOH T 6 .   ? -3.286  -5.483  10.862  1.00 14.11 ? 3254 HOH A O     1 
HETATM 7686 O O     . HOH T 6 .   ? 8.564   -6.840  -0.679  1.00 14.06 ? 3255 HOH A O     1 
HETATM 7687 O O     . HOH T 6 .   ? 22.257  5.613   -6.774  1.00 15.55 ? 3256 HOH A O     1 
HETATM 7688 O O     . HOH T 6 .   ? -16.485 12.674  18.297  1.00 21.09 ? 3257 HOH A O     1 
HETATM 7689 O O     . HOH T 6 .   ? 20.006  -4.032  17.857  1.00 16.88 ? 3258 HOH A O     1 
HETATM 7690 O O     . HOH T 6 .   ? -2.068  -2.173  -18.982 1.00 20.06 ? 3259 HOH A O     1 
HETATM 7691 O O     . HOH T 6 .   ? 15.556  1.535   -11.672 1.00 18.17 ? 3260 HOH A O     1 
HETATM 7692 O O     . HOH T 6 .   ? -5.303  2.996   7.409   1.00 10.95 ? 3261 HOH A O     1 
HETATM 7693 O O     . HOH T 6 .   ? -15.317 10.995  2.847   1.00 29.76 ? 3262 HOH A O     1 
HETATM 7694 O O     . HOH T 6 .   ? 25.488  -5.741  -3.864  1.00 31.88 ? 3263 HOH A O     1 
HETATM 7695 O O     . HOH T 6 .   ? -0.531  9.044   27.239  1.00 12.44 ? 3264 HOH A O     1 
HETATM 7696 O O     . HOH T 6 .   ? 10.599  8.402   14.078  1.00 42.25 ? 3265 HOH A O     1 
HETATM 7697 O O     . HOH T 6 .   ? 8.022   -14.956 -15.831 1.00 20.72 ? 3266 HOH A O     1 
HETATM 7698 O O     . HOH T 6 .   ? 15.361  10.807  3.709   1.00 25.39 ? 3267 HOH A O     1 
HETATM 7699 O O     . HOH T 6 .   ? 9.050   8.233   23.089  1.00 26.93 ? 3268 HOH A O     1 
HETATM 7700 O O     . HOH T 6 .   ? -29.118 0.443   14.981  1.00 17.80 ? 3269 HOH A O     1 
HETATM 7701 O O     . HOH T 6 .   ? -3.057  5.704   -21.833 1.00 14.08 ? 3270 HOH A O     1 
HETATM 7702 O O     . HOH T 6 .   ? 18.062  -9.692  4.183   1.00 18.44 ? 3271 HOH A O     1 
HETATM 7703 O O     . HOH T 6 .   ? 7.137   11.877  -11.911 1.00 46.67 ? 3272 HOH A O     1 
HETATM 7704 O O     . HOH T 6 .   ? -21.515 -0.889  7.024   1.00 35.28 ? 3273 HOH A O     1 
HETATM 7705 O O     . HOH T 6 .   ? 3.402   12.538  11.704  1.00 43.88 ? 3274 HOH A O     1 
HETATM 7706 O O     . HOH T 6 .   ? -9.007  -4.318  -6.049  1.00 28.10 ? 3275 HOH A O     1 
HETATM 7707 O O     . HOH T 6 .   ? -14.020 -10.032 11.458  1.00 39.38 ? 3276 HOH A O     1 
HETATM 7708 O O     . HOH T 6 .   ? -23.358 -7.316  13.262  1.00 24.13 ? 3277 HOH A O     1 
HETATM 7709 O O     . HOH T 6 .   ? -16.483 7.132   0.670   1.00 25.48 ? 3278 HOH A O     1 
HETATM 7710 O O     . HOH T 6 .   ? -31.971 1.739   25.347  1.00 22.06 ? 3279 HOH A O     1 
HETATM 7711 O O     . HOH T 6 .   ? 5.152   6.751   32.085  1.00 26.50 ? 3280 HOH A O     1 
HETATM 7712 O O     . HOH T 6 .   ? -32.165 -5.644  19.705  1.00 52.37 ? 3281 HOH A O     1 
HETATM 7713 O O     . HOH T 6 .   ? 4.026   -16.548 35.612  1.00 53.82 ? 3282 HOH A O     1 
HETATM 7714 O O     . HOH T 6 .   ? -26.762 -1.796  35.005  1.00 24.78 ? 3283 HOH A O     1 
HETATM 7715 O O     . HOH T 6 .   ? -19.719 -9.556  14.592  1.00 32.38 ? 3284 HOH A O     1 
HETATM 7716 O O     . HOH T 6 .   ? -1.728  16.291  17.028  1.00 21.97 ? 3285 HOH A O     1 
HETATM 7717 O O     . HOH T 6 .   ? 20.367  -2.794  30.087  1.00 25.56 ? 3286 HOH A O     1 
HETATM 7718 O O     . HOH T 6 .   ? -30.790 -4.947  27.731  1.00 28.06 ? 3287 HOH A O     1 
HETATM 7719 O O     . HOH T 6 .   ? 15.813  10.321  -15.450 1.00 28.95 ? 3288 HOH A O     1 
HETATM 7720 O O     . HOH T 6 .   ? -13.065 4.110   36.205  1.00 23.98 ? 3289 HOH A O     1 
HETATM 7721 O O     . HOH T 6 .   ? -19.367 -9.530  21.058  1.00 36.09 ? 3290 HOH A O     1 
HETATM 7722 O O     . HOH T 6 .   ? 30.862  3.286   14.378  1.00 23.46 ? 3291 HOH A O     1 
HETATM 7723 O O     . HOH T 6 .   ? 8.998   8.909   -24.944 1.00 38.00 ? 3292 HOH A O     1 
HETATM 7724 O O     . HOH T 6 .   ? -31.470 -8.333  19.566  1.00 37.02 ? 3293 HOH A O     1 
HETATM 7725 O O     . HOH T 6 .   ? -14.252 7.937   36.386  1.00 28.92 ? 3294 HOH A O     1 
HETATM 7726 O O     . HOH T 6 .   ? -4.088  -8.221  -2.644  1.00 40.54 ? 3295 HOH A O     1 
HETATM 7727 O O     . HOH T 6 .   ? -14.388 -13.471 37.322  1.00 36.15 ? 3296 HOH A O     1 
HETATM 7728 O O     . HOH T 6 .   ? -18.410 0.057   -1.638  1.00 20.23 ? 3297 HOH A O     1 
HETATM 7729 O O     . HOH T 6 .   ? 4.804   10.173  -13.169 1.00 32.43 ? 3298 HOH A O     1 
HETATM 7730 O O     . HOH T 6 .   ? -11.708 14.418  25.233  1.00 23.13 ? 3299 HOH A O     1 
HETATM 7731 O O     . HOH T 6 .   ? 10.094  -9.507  -23.105 1.00 23.15 ? 3300 HOH A O     1 
HETATM 7732 O O     . HOH T 6 .   ? -28.533 7.114   23.987  1.00 31.26 ? 3301 HOH A O     1 
HETATM 7733 O O     . HOH T 6 .   ? 11.507  -6.513  30.700  1.00 30.69 ? 3302 HOH A O     1 
HETATM 7734 O O     . HOH T 6 .   ? -14.964 -4.778  11.024  1.00 29.52 ? 3303 HOH A O     1 
HETATM 7735 O O     . HOH T 6 .   ? 18.050  -3.832  27.418  1.00 26.03 ? 3304 HOH A O     1 
HETATM 7736 O O     . HOH T 6 .   ? -22.529 -4.112  11.840  1.00 27.79 ? 3305 HOH A O     1 
HETATM 7737 O O     . HOH T 6 .   ? 18.336  4.138   -24.082 1.00 19.99 ? 3306 HOH A O     1 
HETATM 7738 O O     . HOH T 6 .   ? 18.247  -6.539  22.021  1.00 19.77 ? 3307 HOH A O     1 
HETATM 7739 O O     . HOH T 6 .   ? -2.356  6.431   -11.841 1.00 17.38 ? 3308 HOH A O     1 
HETATM 7740 O O     . HOH T 6 .   ? 25.535  -9.938  11.534  1.00 18.25 ? 3309 HOH A O     1 
HETATM 7741 O O     . HOH T 6 .   ? 16.584  -4.260  -22.123 1.00 18.28 ? 3310 HOH A O     1 
HETATM 7742 O O     . HOH T 6 .   ? 26.666  3.382   23.251  1.00 21.08 ? 3311 HOH A O     1 
HETATM 7743 O O     . HOH T 6 .   ? -22.911 -12.200 19.718  1.00 21.29 ? 3312 HOH A O     1 
HETATM 7744 O O     . HOH T 6 .   ? 17.483  0.173   -23.278 1.00 19.54 ? 3313 HOH A O     1 
HETATM 7745 O O     . HOH T 6 .   ? -18.427 -13.737 31.822  1.00 26.03 ? 3314 HOH A O     1 
HETATM 7746 O O     . HOH T 6 .   ? 12.713  -16.674 -15.436 1.00 25.60 ? 3315 HOH A O     1 
HETATM 7747 O O     . HOH T 6 .   ? 27.856  -0.609  14.225  1.00 25.23 ? 3316 HOH A O     1 
HETATM 7748 O O     . HOH T 6 .   ? -0.743  -2.673  -21.458 1.00 20.29 ? 3317 HOH A O     1 
HETATM 7749 O O     . HOH T 6 .   ? 19.927  -4.565  -18.980 1.00 19.90 ? 3318 HOH A O     1 
HETATM 7750 O O     . HOH T 6 .   ? 25.132  0.511   26.473  1.00 23.80 ? 3319 HOH A O     1 
HETATM 7751 O O     . HOH T 6 .   ? 23.815  -9.415  0.790   1.00 28.95 ? 3320 HOH A O     1 
HETATM 7752 O O     . HOH T 6 .   ? 9.268   10.067  25.143  1.00 27.65 ? 3321 HOH A O     1 
HETATM 7753 O O     . HOH T 6 .   ? 6.119   9.143   12.574  1.00 28.59 ? 3322 HOH A O     1 
HETATM 7754 O O     . HOH T 6 .   ? 23.851  3.332   23.746  1.00 21.29 ? 3323 HOH A O     1 
HETATM 7755 O O     . HOH T 6 .   ? -16.224 -14.332 33.245  1.00 24.33 ? 3324 HOH A O     1 
HETATM 7756 O O     . HOH T 6 .   ? -23.970 4.892   10.722  1.00 25.02 ? 3325 HOH A O     1 
HETATM 7757 O O     . HOH T 6 .   ? -15.495 -13.850 28.335  1.00 30.26 ? 3326 HOH A O     1 
HETATM 7758 O O     . HOH T 6 .   ? -11.874 -5.869  8.766   1.00 29.35 ? 3327 HOH A O     1 
HETATM 7759 O O     . HOH T 6 .   ? -18.420 -5.169  12.573  1.00 25.56 ? 3328 HOH A O     1 
HETATM 7760 O O     . HOH T 6 .   ? 17.519  3.254   -19.682 1.00 24.42 ? 3329 HOH A O     1 
HETATM 7761 O O     . HOH T 6 .   ? 20.046  7.595   -7.355  1.00 34.06 ? 3330 HOH A O     1 
HETATM 7762 O O     . HOH T 6 .   ? -22.184 14.008  5.711   1.00 23.39 ? 3331 HOH A O     1 
HETATM 7763 O O     . HOH T 6 .   ? 16.701  -5.462  -26.538 1.00 23.89 ? 3332 HOH A O     1 
HETATM 7764 O O     . HOH T 6 .   ? 14.324  12.070  -16.492 1.00 34.06 ? 3333 HOH A O     1 
HETATM 7765 O O     . HOH T 6 .   ? 2.378   -17.817 24.319  1.00 29.65 ? 3334 HOH A O     1 
HETATM 7766 O O     . HOH T 6 .   ? -15.523 9.563   0.704   1.00 29.40 ? 3335 HOH A O     1 
HETATM 7767 O O     . HOH T 6 .   ? 6.318   -2.375  -27.562 1.00 25.82 ? 3336 HOH A O     1 
HETATM 7768 O O     . HOH T 6 .   ? 20.712  2.053   26.657  1.00 29.73 ? 3337 HOH A O     1 
HETATM 7769 O O     . HOH T 6 .   ? -18.829 -14.606 24.764  1.00 27.72 ? 3338 HOH A O     1 
HETATM 7770 O O     . HOH T 6 .   ? 27.827  5.690   23.912  1.00 29.32 ? 3339 HOH A O     1 
HETATM 7771 O O     . HOH T 6 .   ? 29.007  -4.743  24.846  1.00 27.95 ? 3340 HOH A O     1 
HETATM 7772 O O     . HOH T 6 .   ? 14.049  -16.745 -8.698  1.00 28.93 ? 3341 HOH A O     1 
HETATM 7773 O O     . HOH T 6 .   ? -10.400 -9.615  37.465  1.00 31.42 ? 3342 HOH A O     1 
HETATM 7774 O O     . HOH T 6 .   ? 27.646  -6.975  7.418   1.00 28.52 ? 3343 HOH A O     1 
HETATM 7775 O O     . HOH T 6 .   ? 28.543  7.466   11.130  1.00 41.87 ? 3344 HOH A O     1 
HETATM 7776 O O     . HOH T 6 .   ? -9.791  -4.500  -8.219  1.00 35.90 ? 3345 HOH A O     1 
HETATM 7777 O O     . HOH T 6 .   ? 16.529  10.245  8.785   1.00 37.45 ? 3346 HOH A O     1 
HETATM 7778 O O     . HOH T 6 .   ? 21.917  5.465   23.504  1.00 35.57 ? 3347 HOH A O     1 
HETATM 7779 O O     . HOH T 6 .   ? -6.170  -16.252 24.252  1.00 32.63 ? 3348 HOH A O     1 
HETATM 7780 O O     . HOH T 6 .   ? -21.083 -14.532 31.789  1.00 38.72 ? 3349 HOH A O     1 
HETATM 7781 O O     . HOH T 6 .   ? -29.269 5.286   17.133  1.00 34.07 ? 3350 HOH A O     1 
HETATM 7782 O O     . HOH T 6 .   ? 13.011  -9.066  21.965  1.00 28.83 ? 3351 HOH A O     1 
HETATM 7783 O O     . HOH T 6 .   ? 28.818  10.538  7.673   1.00 45.60 ? 3352 HOH A O     1 
HETATM 7784 O O     . HOH T 6 .   ? 27.427  -9.561  7.302   1.00 38.19 ? 3353 HOH A O     1 
HETATM 7785 O O     . HOH T 6 .   ? 11.392  -8.844  29.401  1.00 33.72 ? 3354 HOH A O     1 
HETATM 7786 O O     . HOH T 6 .   ? 20.026  -5.507  24.751  1.00 26.91 ? 3355 HOH A O     1 
HETATM 7787 O O     . HOH T 6 .   ? -8.058  -18.611 21.577  1.00 29.14 ? 3356 HOH A O     1 
HETATM 7788 O O     . HOH T 6 .   ? 1.132   -6.740  -26.205 1.00 35.01 ? 3357 HOH A O     1 
HETATM 7789 O O     . HOH T 6 .   ? 18.431  -2.009  -22.347 1.00 20.73 ? 3358 HOH A O     1 
HETATM 7790 O O     . HOH T 6 .   ? -22.813 -15.222 19.479  1.00 19.92 ? 3359 HOH A O     1 
HETATM 7791 O O     . HOH T 6 .   ? 26.965  -7.234  10.609  1.00 28.76 ? 3360 HOH A O     1 
HETATM 7792 O O     . HOH T 6 .   ? 13.787  -9.205  10.917  1.00 31.81 ? 3361 HOH A O     1 
HETATM 7793 O O     . HOH T 6 .   ? -4.882  6.632   -12.543 1.00 29.45 ? 3362 HOH A O     1 
HETATM 7794 O O     . HOH T 6 .   ? -11.570 -15.447 19.199  1.00 32.60 ? 3363 HOH A O     1 
HETATM 7795 O O     . HOH T 6 .   ? -20.534 16.335  6.697   1.00 37.88 ? 3364 HOH A O     1 
HETATM 7796 O O     . HOH T 6 .   ? 17.851  6.606   -23.592 1.00 34.77 ? 3365 HOH A O     1 
HETATM 7797 O O     . HOH T 6 .   ? -3.206  -8.076  34.934  1.00 31.07 ? 3366 HOH A O     1 
HETATM 7798 O O     . HOH T 6 .   ? -31.553 6.286   36.200  1.00 38.97 ? 3367 HOH A O     1 
HETATM 7799 O O     . HOH T 6 .   ? 16.080  -6.049  -24.075 1.00 28.84 ? 3368 HOH A O     1 
HETATM 7800 O O     . HOH T 6 .   ? -7.309  -16.590 31.351  1.00 31.97 ? 3369 HOH A O     1 
HETATM 7801 O O     . HOH T 6 .   ? -19.606 -15.279 18.997  1.00 36.06 ? 3370 HOH A O     1 
HETATM 7802 O O     . HOH T 6 .   ? -14.885 15.601  4.255   1.00 38.45 ? 3371 HOH A O     1 
HETATM 7803 O O     . HOH T 6 .   ? -0.194  -9.954  -18.174 1.00 28.81 ? 3372 HOH A O     1 
HETATM 7804 O O     . HOH T 6 .   ? 1.060   -15.843 32.536  1.00 40.24 ? 3373 HOH A O     1 
HETATM 7805 O O     . HOH T 6 .   ? -21.890 14.805  2.911   1.00 29.85 ? 3374 HOH A O     1 
HETATM 7806 O O     . HOH T 6 .   ? -19.396 15.969  14.720  1.00 35.27 ? 3375 HOH A O     1 
HETATM 7807 O O     . HOH T 6 .   ? -29.840 -6.388  11.083  1.00 36.25 ? 3376 HOH A O     1 
HETATM 7808 O O     . HOH T 6 .   ? 14.173  -7.863  -23.422 1.00 37.18 ? 3377 HOH A O     1 
HETATM 7809 O O     . HOH T 6 .   ? 18.311  6.675   -9.219  1.00 38.14 ? 3378 HOH A O     1 
HETATM 7810 O O     . HOH T 6 .   ? 19.977  17.076  0.644   1.00 40.73 ? 3379 HOH A O     1 
HETATM 7811 O O     . HOH T 6 .   ? 24.447  -3.385  19.684  1.00 40.55 ? 3380 HOH A O     1 
HETATM 7812 O O     . HOH T 6 .   ? -19.139 -10.582 18.968  1.00 34.55 ? 3381 HOH A O     1 
HETATM 7813 O O     . HOH T 6 .   ? 2.796   8.147   -16.016 1.00 35.03 ? 3382 HOH A O     1 
HETATM 7814 O O     . HOH T 6 .   ? -17.490 14.226  32.198  1.00 36.40 ? 3383 HOH A O     1 
HETATM 7815 O O     . HOH T 6 .   ? 12.205  -1.296  -26.753 1.00 38.22 ? 3384 HOH A O     1 
HETATM 7816 O O     . HOH T 6 .   ? -30.640 -10.839 18.939  1.00 38.79 ? 3385 HOH A O     1 
HETATM 7817 O O     . HOH T 6 .   ? 11.797  4.732   -26.191 1.00 37.03 ? 3386 HOH A O     1 
HETATM 7818 O O     . HOH T 6 .   ? -31.432 -1.989  33.645  1.00 42.86 ? 3387 HOH A O     1 
HETATM 7819 O O     . HOH T 6 .   ? -22.884 13.651  13.496  1.00 33.77 ? 3388 HOH A O     1 
HETATM 7820 O O     . HOH T 6 .   ? 15.967  9.470   11.218  1.00 35.22 ? 3389 HOH A O     1 
HETATM 7821 O O     . HOH T 6 .   ? -27.262 8.214   18.445  1.00 35.36 ? 3390 HOH A O     1 
HETATM 7822 O O     . HOH T 6 .   ? -14.890 -6.798  8.891   1.00 39.24 ? 3391 HOH A O     1 
HETATM 7823 O O     . HOH T 6 .   ? -1.169  -20.655 22.173  1.00 37.59 ? 3392 HOH A O     1 
HETATM 7824 O O     . HOH T 6 .   ? 25.010  6.100   -7.025  1.00 31.13 ? 3393 HOH A O     1 
HETATM 7825 O O     . HOH T 6 .   ? -12.268 -12.682 9.036   1.00 37.29 ? 3394 HOH A O     1 
HETATM 7826 O O     . HOH T 6 .   ? 21.141  14.665  5.727   1.00 36.84 ? 3395 HOH A O     1 
HETATM 7827 O O     . HOH T 6 .   ? 20.272  5.039   25.736  1.00 35.68 ? 3396 HOH A O     1 
HETATM 7828 O O     . HOH T 6 .   ? 11.470  -17.557 -8.146  1.00 40.20 ? 3397 HOH A O     1 
HETATM 7829 O O     . HOH T 6 .   ? 11.987  -15.990 3.364   1.00 39.50 ? 3398 HOH A O     1 
HETATM 7830 O O     . HOH T 6 .   ? -16.247 3.663   -4.645  1.00 39.78 ? 3399 HOH A O     1 
HETATM 7831 O O     . HOH T 6 .   ? 20.482  -2.404  -20.728 1.00 28.22 ? 3400 HOH A O     1 
HETATM 7832 O O     . HOH T 6 .   ? 26.809  16.013  7.586   1.00 49.75 ? 3401 HOH A O     1 
HETATM 7833 O O     . HOH T 6 .   ? 11.862  10.560  -21.339 1.00 38.64 ? 3402 HOH A O     1 
HETATM 7834 O O     . HOH T 6 .   ? 3.517   -13.548 19.846  1.00 37.65 ? 3403 HOH A O     1 
HETATM 7835 O O     . HOH T 6 .   ? 27.256  8.249   -3.959  1.00 37.70 ? 3404 HOH A O     1 
HETATM 7836 O O     . HOH T 6 .   ? 20.974  0.385   29.016  1.00 31.62 ? 3405 HOH A O     1 
HETATM 7837 O O     . HOH T 6 .   ? -27.744 -3.037  40.385  1.00 32.44 ? 3406 HOH A O     1 
HETATM 7838 O O     . HOH T 6 .   ? 15.313  -4.293  -29.460 1.00 47.74 ? 3407 HOH A O     1 
HETATM 7839 O O     . HOH T 6 .   ? -22.641 16.531  13.654  1.00 46.51 ? 3408 HOH A O     1 
HETATM 7840 O O     . HOH T 6 .   ? -26.285 8.630   28.778  1.00 39.70 ? 3409 HOH A O     1 
HETATM 7841 O O     . HOH T 6 .   ? 11.240  10.825  2.651   1.00 46.96 ? 3410 HOH A O     1 
HETATM 7842 O O     . HOH T 6 .   ? -18.052 -3.230  10.428  1.00 36.24 ? 3411 HOH A O     1 
HETATM 7843 O O     . HOH T 6 .   ? -10.182 18.181  19.650  1.00 29.41 ? 3412 HOH A O     1 
HETATM 7844 O O     . HOH T 6 .   ? 16.383  -8.149  22.784  1.00 38.73 ? 3413 HOH A O     1 
HETATM 7845 O O     . HOH T 6 .   ? 13.209  -12.549 1.895   1.00 40.44 ? 3414 HOH A O     1 
HETATM 7846 O O     . HOH T 6 .   ? -33.707 -8.202  16.298  1.00 34.22 ? 3415 HOH A O     1 
HETATM 7847 O O     . HOH T 6 .   ? 25.253  -9.312  -3.521  1.00 43.99 ? 3416 HOH A O     1 
HETATM 7848 O O     . HOH T 6 .   ? 33.961  16.904  4.394   1.00 49.40 ? 3417 HOH A O     1 
HETATM 7849 O O     . HOH T 6 .   ? 1.876   -4.479  -28.331 1.00 36.58 ? 3418 HOH A O     1 
HETATM 7850 O O     . HOH T 6 .   ? -12.106 -17.103 33.655  1.00 49.44 ? 3419 HOH A O     1 
HETATM 7851 O O     . HOH T 6 .   ? -7.791  17.031  19.819  1.00 48.21 ? 3420 HOH A O     1 
HETATM 7852 O O     . HOH T 6 .   ? -2.789  -10.552 34.957  1.00 44.94 ? 3421 HOH A O     1 
HETATM 7853 O O     . HOH T 6 .   ? -9.463  -5.114  38.079  1.00 48.98 ? 3422 HOH A O     1 
HETATM 7854 O O     . HOH T 6 .   ? -6.301  16.486  22.013  1.00 45.08 ? 3423 HOH A O     1 
HETATM 7855 O O     . HOH T 6 .   ? -26.798 6.151   28.273  1.00 44.50 ? 3424 HOH A O     1 
HETATM 7856 O O     . HOH T 6 .   ? -27.820 8.054   26.636  1.00 43.44 ? 3425 HOH A O     1 
HETATM 7857 O O     . HOH T 6 .   ? -21.402 -11.585 17.709  1.00 31.06 ? 3426 HOH A O     1 
HETATM 7858 O O     . HOH T 6 .   ? -13.659 -15.283 15.471  1.00 39.07 ? 3427 HOH A O     1 
HETATM 7859 O O     . HOH T 6 .   ? -2.349  17.955  27.864  1.00 36.56 ? 3428 HOH A O     1 
HETATM 7860 O O     . HOH T 6 .   ? -23.568 -17.966 17.499  1.00 42.64 ? 3429 HOH A O     1 
HETATM 7861 O O     . HOH T 6 .   ? -0.425  -10.042 -11.120 1.00 46.73 ? 3430 HOH A O     1 
HETATM 7862 O O     . HOH T 6 .   ? 1.787   16.091  24.659  1.00 38.58 ? 3431 HOH A O     1 
HETATM 7863 O O     . HOH T 6 .   ? 2.988   -13.984 -20.754 1.00 45.54 ? 3432 HOH A O     1 
HETATM 7864 O O     . HOH T 6 .   ? 15.054  10.743  6.696   1.00 38.91 ? 3433 HOH A O     1 
HETATM 7865 O O     . HOH T 6 .   ? -3.808  -17.645 25.939  1.00 31.01 ? 3434 HOH A O     1 
HETATM 7866 O O     . HOH T 6 .   ? -29.798 6.783   20.394  1.00 40.24 ? 3435 HOH A O     1 
HETATM 7867 O O     . HOH T 6 .   ? -18.502 -17.620 19.568  1.00 33.50 ? 3436 HOH A O     1 
HETATM 7868 O O     . HOH T 6 .   ? -22.494 13.120  24.141  1.00 41.65 ? 3437 HOH A O     1 
HETATM 7869 O O     . HOH T 6 .   ? 36.767  1.163   0.982   1.00 50.01 ? 3438 HOH A O     1 
HETATM 7870 O O     . HOH T 6 .   ? 4.023   -15.759 22.668  1.00 30.69 ? 3439 HOH A O     1 
HETATM 7871 O O     . HOH T 6 .   ? 6.606   -12.105 21.431  1.00 37.03 ? 3440 HOH A O     1 
HETATM 7872 O O     . HOH T 6 .   ? 10.865  -9.742  18.420  1.00 39.13 ? 3441 HOH A O     1 
HETATM 7873 O O     . HOH T 6 .   ? -1.397  -17.487 33.029  1.00 41.08 ? 3442 HOH A O     1 
HETATM 7874 O O     . HOH U 6 .   ? 20.445  14.124  79.272  1.00 18.03 ? 3007 HOH D O     1 
HETATM 7875 O O     . HOH U 6 .   ? 15.232  -6.363  86.823  1.00 10.73 ? 3008 HOH D O     1 
HETATM 7876 O O     . HOH U 6 .   ? 40.377  16.852  90.014  1.00 16.68 ? 3009 HOH D O     1 
HETATM 7877 O O     . HOH U 6 .   ? -7.032  -3.410  70.367  1.00 13.18 ? 3010 HOH D O     1 
HETATM 7878 O O     . HOH U 6 .   ? 10.981  -0.515  70.359  1.00 10.13 ? 3011 HOH D O     1 
HETATM 7879 O O     . HOH U 6 .   ? 47.551  -8.652  57.954  1.00 26.29 ? 3012 HOH D O     1 
HETATM 7880 O O     . HOH U 6 .   ? 12.210  7.562   86.273  1.00 33.60 ? 3013 HOH D O     1 
HETATM 7881 O O     . HOH U 6 .   ? 8.968   7.282   38.131  1.00 45.32 ? 3014 HOH D O     1 
HETATM 7882 O O     . HOH U 6 .   ? 31.550  -3.310  46.951  1.00 21.79 ? 3015 HOH D O     1 
HETATM 7883 O O     . HOH U 6 .   ? 36.561  -11.029 85.244  1.00 21.24 ? 3016 HOH D O     1 
HETATM 7884 O O     . HOH U 6 .   ? 21.217  1.190   55.630  1.00 11.80 ? 3017 HOH D O     1 
HETATM 7885 O O     . HOH U 6 .   ? 10.158  -2.040  83.497  1.00 34.61 ? 3018 HOH D O     1 
HETATM 7886 O O     . HOH U 6 .   ? 14.024  10.222  86.763  1.00 32.01 ? 3019 HOH D O     1 
HETATM 7887 O O     . HOH U 6 .   ? 7.673   9.042   42.509  1.00 23.90 ? 3020 HOH D O     1 
HETATM 7888 O O     . HOH U 6 .   ? 28.887  -6.309  63.192  1.00 14.74 ? 3021 HOH D O     1 
HETATM 7889 O O     . HOH U 6 .   ? 8.389   -0.789  71.516  1.00 11.94 ? 3022 HOH D O     1 
HETATM 7890 O O     . HOH U 6 .   ? 8.640   0.279   77.914  1.00 15.14 ? 3023 HOH D O     1 
HETATM 7891 O O     . HOH U 6 .   ? 16.992  11.161  65.870  1.00 24.21 ? 3024 HOH D O     1 
HETATM 7892 O O     . HOH U 6 .   ? 16.864  14.302  79.878  1.00 36.51 ? 3025 HOH D O     1 
HETATM 7893 O O     . HOH U 6 .   ? 3.702   -4.936  72.046  1.00 22.82 ? 3026 HOH D O     1 
HETATM 7894 O O     . HOH U 6 .   ? 7.583   9.143   60.217  1.00 21.12 ? 3027 HOH D O     1 
HETATM 7895 O O     . HOH U 6 .   ? 42.080  5.842   61.353  1.00 22.93 ? 3028 HOH D O     1 
HETATM 7896 O O     . HOH U 6 .   ? -0.875  0.073   68.179  1.00 28.20 ? 3029 HOH D O     1 
HETATM 7897 O O     . HOH U 6 .   ? 9.211   -6.002  40.889  1.00 25.62 ? 3030 HOH D O     1 
HETATM 7898 O O     . HOH U 6 .   ? 18.127  5.630   44.394  1.00 15.65 ? 3031 HOH D O     1 
HETATM 7899 O O     . HOH U 6 .   ? 28.862  -11.065 91.546  1.00 35.42 ? 3032 HOH D O     1 
HETATM 7900 O O     . HOH U 6 .   ? 45.299  -13.474 72.953  1.00 27.84 ? 3033 HOH D O     1 
HETATM 7901 O O     . HOH U 6 .   ? 2.636   4.254   52.064  1.00 19.10 ? 3034 HOH D O     1 
HETATM 7902 O O     . HOH U 6 .   ? -10.681 -10.974 59.923  1.00 21.08 ? 3035 HOH D O     1 
HETATM 7903 O O     . HOH U 6 .   ? 56.142  8.128   84.708  1.00 22.77 ? 3036 HOH D O     1 
HETATM 7904 O O     . HOH U 6 .   ? 11.932  10.923  55.220  1.00 23.01 ? 3037 HOH D O     1 
HETATM 7905 O O     . HOH U 6 .   ? 31.652  -13.862 78.002  1.00 25.70 ? 3038 HOH D O     1 
HETATM 7906 O O     . HOH U 6 .   ? 22.476  1.476   30.873  1.00 24.18 ? 3039 HOH D O     1 
HETATM 7907 O O     . HOH U 6 .   ? 40.098  -13.330 83.125  1.00 24.17 ? 3040 HOH D O     1 
HETATM 7908 O O     . HOH U 6 .   ? 40.598  -11.831 62.709  1.00 20.59 ? 3041 HOH D O     1 
HETATM 7909 O O     . HOH U 6 .   ? 31.843  19.364  78.730  1.00 22.96 ? 3042 HOH D O     1 
HETATM 7910 O O     . HOH U 6 .   ? 8.176   1.782   37.206  1.00 26.80 ? 3043 HOH D O     1 
HETATM 7911 O O     . HOH U 6 .   ? 41.493  -15.913 67.280  1.00 22.44 ? 3044 HOH D O     1 
HETATM 7912 O O     . HOH U 6 .   ? 11.880  -1.675  34.272  1.00 20.30 ? 3045 HOH D O     1 
HETATM 7913 O O     . HOH U 6 .   ? 9.937   -10.942 62.941  1.00 24.84 ? 3046 HOH D O     1 
HETATM 7914 O O     . HOH U 6 .   ? 3.775   7.646   72.640  1.00 27.00 ? 3047 HOH D O     1 
HETATM 7915 O O     . HOH U 6 .   ? 45.231  -3.073  96.074  1.00 32.34 ? 3048 HOH D O     1 
HETATM 7916 O O     . HOH U 6 .   ? 43.209  -9.951  81.488  1.00 25.89 ? 3049 HOH D O     1 
HETATM 7917 O O     . HOH U 6 .   ? 11.052  -8.283  40.255  1.00 18.98 ? 3050 HOH D O     1 
HETATM 7918 O O     . HOH U 6 .   ? 1.601   7.910   56.859  1.00 27.49 ? 3051 HOH D O     1 
HETATM 7919 O O     . HOH U 6 .   ? 28.365  12.551  90.560  1.00 30.61 ? 3052 HOH D O     1 
HETATM 7920 O O     . HOH U 6 .   ? 23.500  -0.904  89.751  1.00 28.38 ? 3053 HOH D O     1 
HETATM 7921 O O     . HOH U 6 .   ? 40.162  4.472   102.185 1.00 37.59 ? 3054 HOH D O     1 
HETATM 7922 O O     . HOH U 6 .   ? 35.748  15.577  90.362  1.00 19.53 ? 3055 HOH D O     1 
HETATM 7923 O O     . HOH U 6 .   ? 25.168  -13.713 46.026  1.00 31.68 ? 3056 HOH D O     1 
HETATM 7924 O O     . HOH U 6 .   ? 49.129  -3.622  66.517  1.00 31.82 ? 3057 HOH D O     1 
HETATM 7925 O O     . HOH U 6 .   ? 13.935  -6.787  70.294  1.00 24.97 ? 3058 HOH D O     1 
HETATM 7926 O O     . HOH U 6 .   ? 7.051   6.910   84.068  1.00 27.94 ? 3059 HOH D O     1 
HETATM 7927 O O     . HOH U 6 .   ? -0.294  10.319  67.330  1.00 24.05 ? 3060 HOH D O     1 
HETATM 7928 O O     . HOH U 6 .   ? 16.294  -9.809  83.623  1.00 23.73 ? 3061 HOH D O     1 
HETATM 7929 O O     . HOH U 6 .   ? 33.151  -11.082 88.855  1.00 19.61 ? 3062 HOH D O     1 
HETATM 7930 O O     . HOH U 6 .   ? -0.620  -13.009 55.572  1.00 38.06 ? 3063 HOH D O     1 
HETATM 7931 O O     . HOH U 6 .   ? 27.698  15.309  90.504  1.00 26.63 ? 3064 HOH D O     1 
HETATM 7932 O O     . HOH U 6 .   ? 6.939   8.702   78.081  1.00 22.02 ? 3065 HOH D O     1 
HETATM 7933 O O     . HOH U 6 .   ? 25.994  8.813   67.143  1.00 19.78 ? 3066 HOH D O     1 
HETATM 7934 O O     . HOH U 6 .   ? 24.210  -5.976  94.310  1.00 25.50 ? 3067 HOH D O     1 
HETATM 7935 O O     . HOH U 6 .   ? 15.061  -14.312 47.829  1.00 28.30 ? 3068 HOH D O     1 
HETATM 7936 O O     . HOH U 6 .   ? 33.809  -14.001 71.319  1.00 19.92 ? 3069 HOH D O     1 
HETATM 7937 O O     . HOH U 6 .   ? 6.798   8.042   75.440  1.00 23.78 ? 3070 HOH D O     1 
HETATM 7938 O O     . HOH U 6 .   ? 17.898  10.535  39.034  1.00 26.96 ? 3071 HOH D O     1 
HETATM 7939 O O     . HOH U 6 .   ? 53.744  -4.183  83.111  1.00 22.72 ? 3072 HOH D O     1 
HETATM 7940 O O     . HOH U 6 .   ? 9.212   -3.400  79.779  1.00 29.56 ? 3073 HOH D O     1 
HETATM 7941 O O     . HOH U 6 .   ? 9.776   -13.705 43.924  1.00 29.65 ? 3074 HOH D O     1 
HETATM 7942 O O     . HOH U 6 .   ? 19.829  -2.764  90.102  1.00 25.77 ? 3075 HOH D O     1 
HETATM 7943 O O     . HOH U 6 .   ? 6.096   0.243   38.096  1.00 23.78 ? 3076 HOH D O     1 
HETATM 7944 O O     . HOH U 6 .   ? 57.776  11.850  77.785  1.00 51.91 ? 3077 HOH D O     1 
HETATM 7945 O O     . HOH U 6 .   ? 33.507  -11.781 65.415  1.00 17.78 ? 3078 HOH D O     1 
HETATM 7946 O O     . HOH U 6 .   ? 3.131   4.367   49.043  1.00 33.01 ? 3079 HOH D O     1 
HETATM 7947 O O     . HOH U 6 .   ? 14.462  -3.047  71.783  1.00 15.77 ? 3080 HOH D O     1 
HETATM 7948 O O     . HOH U 6 .   ? 15.309  10.336  90.142  1.00 24.84 ? 3081 HOH D O     1 
HETATM 7949 O O     . HOH U 6 .   ? 7.152   -3.424  78.039  1.00 22.93 ? 3082 HOH D O     1 
HETATM 7950 O O     . HOH U 6 .   ? 41.029  4.377   57.600  1.00 22.76 ? 3083 HOH D O     1 
HETATM 7951 O O     . HOH U 6 .   ? 36.195  16.042  73.033  1.00 41.49 ? 3084 HOH D O     1 
HETATM 7952 O O     . HOH U 6 .   ? 40.407  17.105  80.285  1.00 31.89 ? 3085 HOH D O     1 
HETATM 7953 O O     . HOH U 6 .   ? 42.947  -6.424  61.218  1.00 24.92 ? 3086 HOH D O     1 
HETATM 7954 O O     . HOH U 6 .   ? 22.124  6.402   29.658  1.00 38.25 ? 3087 HOH D O     1 
HETATM 7955 O O     . HOH U 6 .   ? 33.065  -9.927  93.678  1.00 42.50 ? 3088 HOH D O     1 
HETATM 7956 O O     . HOH U 6 .   ? 22.494  -2.971  91.055  1.00 28.26 ? 3089 HOH D O     1 
HETATM 7957 O O     . HOH U 6 .   ? 25.562  -8.089  65.540  1.00 29.52 ? 3090 HOH D O     1 
HETATM 7958 O O     . HOH U 6 .   ? 36.358  -14.341 71.252  1.00 19.78 ? 3091 HOH D O     1 
HETATM 7959 O O     . HOH U 6 .   ? 54.238  13.899  94.107  1.00 51.97 ? 3092 HOH D O     1 
HETATM 7960 O O     . HOH U 6 .   ? 11.484  11.713  58.545  1.00 42.21 ? 3093 HOH D O     1 
HETATM 7961 O O     . HOH U 6 .   ? 29.410  17.289  63.909  1.00 45.63 ? 3094 HOH D O     1 
HETATM 7962 O O     . HOH U 6 .   ? 14.389  11.083  46.782  1.00 24.28 ? 3095 HOH D O     1 
HETATM 7963 O O     . HOH U 6 .   ? 17.562  5.215   67.507  1.00 21.04 ? 3096 HOH D O     1 
HETATM 7964 O O     . HOH U 6 .   ? 8.567   11.350  42.981  1.00 34.50 ? 3097 HOH D O     1 
HETATM 7965 O O     . HOH U 6 .   ? 12.571  -4.045  80.892  1.00 28.56 ? 3098 HOH D O     1 
HETATM 7966 O O     . HOH U 6 .   ? 6.989   -5.231  74.498  1.00 32.25 ? 3099 HOH D O     1 
HETATM 7967 O O     . HOH U 6 .   ? 18.849  12.921  74.245  1.00 24.30 ? 3100 HOH D O     1 
HETATM 7968 O O     . HOH U 6 .   ? 38.184  -12.447 86.771  1.00 36.37 ? 3101 HOH D O     1 
HETATM 7969 O O     . HOH U 6 .   ? 20.706  -6.045  92.658  1.00 44.01 ? 3102 HOH D O     1 
HETATM 7970 O O     . HOH U 6 .   ? 29.437  -10.172 95.077  1.00 30.11 ? 3103 HOH D O     1 
HETATM 7971 O O     . HOH U 6 .   ? -2.708  -6.442  66.728  1.00 29.56 ? 3104 HOH D O     1 
HETATM 7972 O O     . HOH U 6 .   ? 6.318   -4.599  72.046  1.00 28.16 ? 3105 HOH D O     1 
HETATM 7973 O O     . HOH U 6 .   ? 41.139  11.684  77.971  1.00 22.65 ? 3106 HOH D O     1 
HETATM 7974 O O     . HOH U 6 .   ? 35.043  -13.562 64.058  1.00 34.81 ? 3107 HOH D O     1 
HETATM 7975 O O     . HOH U 6 .   ? 14.665  2.311   91.971  1.00 21.44 ? 3108 HOH D O     1 
HETATM 7976 O O     . HOH U 6 .   ? 48.602  8.062   69.713  1.00 27.91 ? 3109 HOH D O     1 
HETATM 7977 O O     . HOH U 6 .   ? -7.770  -1.397  68.120  1.00 29.07 ? 3110 HOH D O     1 
HETATM 7978 O O     . HOH U 6 .   ? -0.935  3.062   86.622  1.00 39.68 ? 3111 HOH D O     1 
HETATM 7979 O O     . HOH U 6 .   ? 56.392  10.884  75.101  1.00 40.27 ? 3112 HOH D O     1 
HETATM 7980 O O     . HOH U 6 .   ? 46.876  13.523  99.813  1.00 29.74 ? 3113 HOH D O     1 
HETATM 7981 O O     . HOH U 6 .   ? 35.943  16.821  70.491  1.00 31.07 ? 3114 HOH D O     1 
HETATM 7982 O O     . HOH U 6 .   ? 4.529   -17.039 57.745  1.00 29.60 ? 3115 HOH D O     1 
HETATM 7983 O O     . HOH U 6 .   ? 41.039  5.110   108.286 1.00 34.37 ? 3116 HOH D O     1 
HETATM 7984 O O     . HOH U 6 .   ? 30.539  8.126   94.239  1.00 58.34 ? 3117 HOH D O     1 
HETATM 7985 O O     . HOH U 6 .   ? -6.525  -10.717 69.832  1.00 38.23 ? 3118 HOH D O     1 
HETATM 7986 O O     . HOH U 6 .   ? 11.309  5.092   38.394  1.00 23.42 ? 3119 HOH D O     1 
HETATM 7987 O O     . HOH U 6 .   ? 0.222   -2.621  44.425  1.00 41.90 ? 3120 HOH D O     1 
HETATM 7988 O O     . HOH U 6 .   ? 1.507   -7.334  48.108  1.00 22.39 ? 3121 HOH D O     1 
HETATM 7989 O O     . HOH U 6 .   ? 28.999  21.338  89.683  1.00 51.85 ? 3122 HOH D O     1 
HETATM 7990 O O     . HOH U 6 .   ? 40.415  5.137   68.102  1.00 25.10 ? 3123 HOH D O     1 
HETATM 7991 O O     . HOH U 6 .   ? 14.247  -4.533  74.133  1.00 21.35 ? 3124 HOH D O     1 
HETATM 7992 O O     . HOH U 6 .   ? 12.346  2.785   32.975  1.00 26.34 ? 3125 HOH D O     1 
HETATM 7993 O O     . HOH U 6 .   ? 7.583   13.963  52.435  1.00 50.24 ? 3126 HOH D O     1 
HETATM 7994 O O     . HOH U 6 .   ? 38.512  -15.151 77.224  1.00 45.46 ? 3127 HOH D O     1 
HETATM 7995 O O     . HOH U 6 .   ? 29.286  18.993  72.486  1.00 39.24 ? 3128 HOH D O     1 
HETATM 7996 O O     . HOH U 6 .   ? 36.957  5.879   65.419  1.00 22.80 ? 3129 HOH D O     1 
HETATM 7997 O O     . HOH U 6 .   ? 39.289  -7.240  96.690  1.00 33.70 ? 3130 HOH D O     1 
HETATM 7998 O O     . HOH U 6 .   ? 20.112  -8.607  74.173  1.00 26.09 ? 3131 HOH D O     1 
HETATM 7999 O O     . HOH U 6 .   ? 44.879  11.114  73.533  1.00 40.65 ? 3132 HOH D O     1 
HETATM 8000 O O     . HOH U 6 .   ? 26.736  -6.531  35.765  1.00 47.73 ? 3133 HOH D O     1 
HETATM 8001 O O     . HOH U 6 .   ? 38.911  -3.110  94.992  1.00 24.11 ? 3134 HOH D O     1 
HETATM 8002 O O     . HOH U 6 .   ? 28.480  18.273  89.675  1.00 32.19 ? 3135 HOH D O     1 
HETATM 8003 O O     . HOH U 6 .   ? 23.964  -15.477 74.949  1.00 31.31 ? 3136 HOH D O     1 
HETATM 8004 O O     . HOH U 6 .   ? 23.401  8.294   30.939  1.00 36.27 ? 3137 HOH D O     1 
HETATM 8005 O O     . HOH U 6 .   ? 48.958  15.640  91.720  1.00 37.08 ? 3138 HOH D O     1 
HETATM 8006 O O     . HOH U 6 .   ? 46.028  -11.330 88.500  1.00 42.75 ? 3139 HOH D O     1 
HETATM 8007 O O     . HOH U 6 .   ? 18.745  16.301  81.586  1.00 32.69 ? 3140 HOH D O     1 
HETATM 8008 O O     . HOH U 6 .   ? 13.782  -12.745 36.817  1.00 35.42 ? 3141 HOH D O     1 
HETATM 8009 O O     . HOH U 6 .   ? 35.129  -16.318 79.826  1.00 48.92 ? 3142 HOH D O     1 
HETATM 8010 O O     . HOH U 6 .   ? 36.759  -1.317  95.620  1.00 36.87 ? 3143 HOH D O     1 
HETATM 8011 O O     . HOH U 6 .   ? 29.902  22.722  84.056  1.00 25.21 ? 3144 HOH D O     1 
HETATM 8012 O O     . HOH U 6 .   ? 44.539  11.645  76.747  1.00 29.38 ? 3145 HOH D O     1 
HETATM 8013 O O     . HOH U 6 .   ? -5.551  -15.207 67.292  1.00 58.55 ? 3146 HOH D O     1 
HETATM 8014 O O     . HOH U 6 .   ? 30.252  -7.135  44.283  1.00 28.74 ? 3147 HOH D O     1 
HETATM 8015 O O     . HOH U 6 .   ? 10.289  -10.527 65.869  1.00 38.03 ? 3148 HOH D O     1 
HETATM 8016 O O     . HOH U 6 .   ? 15.877  -14.332 45.021  1.00 43.82 ? 3149 HOH D O     1 
HETATM 8017 O O     . HOH U 6 .   ? 22.780  12.577  68.511  1.00 39.48 ? 3150 HOH D O     1 
HETATM 8018 O O     . HOH U 6 .   ? 34.928  13.892  64.041  1.00 40.81 ? 3151 HOH D O     1 
HETATM 8019 O O     . HOH U 6 .   ? 43.324  0.218   102.193 1.00 42.01 ? 3152 HOH D O     1 
HETATM 8020 O O     . HOH U 6 .   ? 3.317   -3.868  41.409  1.00 48.30 ? 3153 HOH D O     1 
HETATM 8021 O O     . HOH U 6 .   ? 38.070  5.093   58.675  1.00 30.65 ? 3154 HOH D O     1 
HETATM 8022 O O     . HOH U 6 .   ? 15.322  -3.626  30.702  1.00 32.04 ? 3155 HOH D O     1 
HETATM 8023 O O     . HOH U 6 .   ? 41.864  -0.656  52.366  1.00 37.36 ? 3156 HOH D O     1 
HETATM 8024 O O     . HOH U 6 .   ? 10.884  -14.253 60.244  1.00 31.38 ? 3157 HOH D O     1 
HETATM 8025 O O     . HOH U 6 .   ? -3.634  4.020   67.687  1.00 31.28 ? 3158 HOH D O     1 
HETATM 8026 O O     . HOH U 6 .   ? 42.300  -4.131  97.340  1.00 31.28 ? 3159 HOH D O     1 
HETATM 8027 O O     . HOH U 6 .   ? 50.580  -5.973  75.704  1.00 26.70 ? 3160 HOH D O     1 
HETATM 8028 O O     . HOH U 6 .   ? 48.207  -10.178 84.725  1.00 35.21 ? 3161 HOH D O     1 
HETATM 8029 O O     . HOH U 6 .   ? 46.500  3.358   60.956  1.00 39.56 ? 3162 HOH D O     1 
HETATM 8030 O O     . HOH U 6 .   ? 53.740  -6.762  83.709  1.00 36.18 ? 3163 HOH D O     1 
HETATM 8031 O O     . HOH U 6 .   ? 55.839  13.551  75.196  1.00 52.23 ? 3164 HOH D O     1 
HETATM 8032 O O     . HOH U 6 .   ? 47.006  0.657   64.746  1.00 31.86 ? 3165 HOH D O     1 
HETATM 8033 O O     . HOH U 6 .   ? 24.747  16.775  75.970  1.00 44.44 ? 3166 HOH D O     1 
HETATM 8034 O O     . HOH U 6 .   ? 39.708  -18.178 73.063  1.00 42.92 ? 3167 HOH D O     1 
HETATM 8035 O O     . HOH U 6 .   ? 29.969  6.244   92.339  1.00 35.62 ? 3168 HOH D O     1 
HETATM 8036 O O     . HOH U 6 .   ? 11.008  -5.387  78.169  1.00 36.92 ? 3169 HOH D O     1 
HETATM 8037 O O     . HOH U 6 .   ? 47.120  10.666  72.375  1.00 25.18 ? 3170 HOH D O     1 
HETATM 8038 O O     . HOH U 6 .   ? -4.355  -10.181 67.479  1.00 56.65 ? 3171 HOH D O     1 
HETATM 8039 O O     . HOH U 6 .   ? 40.469  -11.822 85.226  1.00 32.47 ? 3172 HOH D O     1 
HETATM 8040 O O     . HOH U 6 .   ? 22.924  -13.153 72.964  1.00 36.00 ? 3173 HOH D O     1 
HETATM 8041 O O     . HOH U 6 .   ? 5.511   -9.525  35.826  1.00 33.20 ? 3174 HOH D O     1 
HETATM 8042 O O     . HOH U 6 .   ? 25.099  9.416   52.209  1.00 37.03 ? 3175 HOH D O     1 
HETATM 8043 O O     . HOH U 6 .   ? 24.999  5.728   47.168  1.00 34.35 ? 3176 HOH D O     1 
HETATM 8044 O O     . HOH U 6 .   ? -9.891  -2.938  61.899  1.00 42.65 ? 3177 HOH D O     1 
HETATM 8045 O O     . HOH U 6 .   ? 27.888  -2.760  38.390  1.00 37.12 ? 3178 HOH D O     1 
HETATM 8046 O O     . HOH U 6 .   ? 20.332  12.817  51.977  1.00 30.73 ? 3179 HOH D O     1 
HETATM 8047 O O     . HOH U 6 .   ? 40.580  6.450   99.586  1.00 35.53 ? 3180 HOH D O     1 
HETATM 8048 O O     . HOH U 6 .   ? -5.170  -0.188  53.196  1.00 39.65 ? 3181 HOH D O     1 
HETATM 8049 O O     . HOH U 6 .   ? 22.509  16.590  70.801  1.00 42.92 ? 3182 HOH D O     1 
HETATM 8050 O O     . HOH U 6 .   ? 7.170   8.357   39.651  1.00 34.07 ? 3183 HOH D O     1 
HETATM 8051 O O     . HOH U 6 .   ? 15.593  6.242   35.855  1.00 41.10 ? 3184 HOH D O     1 
HETATM 8052 O O     . HOH U 6 .   ? 26.028  18.045  91.210  1.00 48.56 ? 3185 HOH D O     1 
HETATM 8053 O O     . HOH U 6 .   ? 48.186  14.053  75.146  1.00 38.95 ? 3186 HOH D O     1 
HETATM 8054 O O     . HOH U 6 .   ? 26.082  -2.771  29.417  1.00 38.87 ? 3187 HOH D O     1 
HETATM 8055 O O     . HOH U 6 .   ? 23.549  16.215  80.881  1.00 25.65 ? 3188 HOH D O     1 
HETATM 8056 O O     . HOH U 6 .   ? 41.593  18.197  87.982  1.00 27.51 ? 3189 HOH D O     1 
HETATM 8057 O O     . HOH U 6 .   ? 10.368  6.296   84.420  1.00 40.95 ? 3190 HOH D O     1 
HETATM 8058 O O     . HOH U 6 .   ? 25.732  0.484   90.622  1.00 45.33 ? 3191 HOH D O     1 
HETATM 8059 O O     . HOH U 6 .   ? 29.149  -8.521  72.615  1.00 8.50  ? 3192 HOH D O     1 
HETATM 8060 O O     . HOH U 6 .   ? 36.566  -4.227  66.105  1.00 11.56 ? 3193 HOH D O     1 
HETATM 8061 O O     . HOH U 6 .   ? 17.370  -7.745  74.965  1.00 15.89 ? 3194 HOH D O     1 
HETATM 8062 O O     . HOH U 6 .   ? 26.527  27.432  89.623  1.00 21.95 ? 3195 HOH D O     1 
HETATM 8063 O O     . HOH U 6 .   ? 15.917  -1.041  80.101  1.00 11.40 ? 3196 HOH D O     1 
HETATM 8064 O O     . HOH U 6 .   ? 23.207  -8.120  86.835  1.00 18.93 ? 3197 HOH D O     1 
HETATM 8065 O O     . HOH U 6 .   ? 19.615  -2.925  68.227  1.00 11.42 ? 3198 HOH D O     1 
HETATM 8066 O O     . HOH U 6 .   ? 25.631  -5.672  86.079  1.00 10.49 ? 3199 HOH D O     1 
HETATM 8067 O O     . HOH U 6 .   ? 0.685   12.095  64.242  1.00 27.81 ? 3200 HOH D O     1 
HETATM 8068 O O     . HOH U 6 .   ? 35.789  -5.966  62.664  1.00 11.99 ? 3201 HOH D O     1 
HETATM 8069 O O     . HOH U 6 .   ? 30.998  -16.099 70.966  1.00 40.47 ? 3202 HOH D O     1 
HETATM 8070 O O     . HOH U 6 .   ? 10.050  -4.277  46.171  1.00 18.80 ? 3203 HOH D O     1 
HETATM 8071 O O     . HOH U 6 .   ? 28.961  -12.906 77.623  1.00 14.49 ? 3204 HOH D O     1 
HETATM 8072 O O     . HOH U 6 .   ? 49.208  16.963  87.265  1.00 24.04 ? 3205 HOH D O     1 
HETATM 8073 O O     . HOH U 6 .   ? 19.224  5.033   69.617  1.00 11.26 ? 3206 HOH D O     1 
HETATM 8074 O O     . HOH U 6 .   ? 26.456  -10.114 88.764  1.00 17.12 ? 3207 HOH D O     1 
HETATM 8075 O O     . HOH U 6 .   ? 13.788  -2.303  78.598  1.00 13.77 ? 3208 HOH D O     1 
HETATM 8076 O O     . HOH U 6 .   ? 41.934  7.146   79.250  1.00 11.26 ? 3209 HOH D O     1 
HETATM 8077 O O     . HOH U 6 .   ? 35.539  -8.946  64.233  1.00 10.55 ? 3210 HOH D O     1 
HETATM 8078 O O     . HOH U 6 .   ? 26.595  7.263   69.256  1.00 19.19 ? 3211 HOH D O     1 
HETATM 8079 O O     . HOH U 6 .   ? 26.777  -14.551 77.293  1.00 18.74 ? 3212 HOH D O     1 
HETATM 8080 O O     . HOH U 6 .   ? 29.743  13.984  70.844  1.00 14.74 ? 3213 HOH D O     1 
HETATM 8081 O O     . HOH U 6 .   ? 19.383  -3.844  62.998  1.00 9.79  ? 3214 HOH D O     1 
HETATM 8082 O O     . HOH U 6 .   ? 12.564  4.499   60.627  1.00 14.26 ? 3215 HOH D O     1 
HETATM 8083 O O     . HOH U 6 .   ? 3.079   -7.440  51.559  1.00 17.98 ? 3216 HOH D O     1 
HETATM 8084 O O     . HOH U 6 .   ? 44.172  -9.793  77.141  1.00 16.66 ? 3217 HOH D O     1 
HETATM 8085 O O     . HOH U 6 .   ? 50.187  -1.923  95.229  1.00 17.40 ? 3218 HOH D O     1 
HETATM 8086 O O     . HOH U 6 .   ? 23.421  8.541   67.261  1.00 19.19 ? 3219 HOH D O     1 
HETATM 8087 O O     . HOH U 6 .   ? 17.410  -3.432  80.606  1.00 16.19 ? 3220 HOH D O     1 
HETATM 8088 O O     . HOH U 6 .   ? 14.369  2.756   82.054  1.00 12.76 ? 3221 HOH D O     1 
HETATM 8089 O O     . HOH U 6 .   ? 52.694  -3.554  90.782  1.00 26.88 ? 3222 HOH D O     1 
HETATM 8090 O O     . HOH U 6 .   ? 11.586  -11.753 61.090  1.00 20.13 ? 3223 HOH D O     1 
HETATM 8091 O O     . HOH U 6 .   ? 49.851  1.321   96.805  1.00 18.88 ? 3224 HOH D O     1 
HETATM 8092 O O     . HOH U 6 .   ? 20.959  -6.148  70.977  1.00 10.35 ? 3225 HOH D O     1 
HETATM 8093 O O     . HOH U 6 .   ? 44.881  2.244   63.670  1.00 25.42 ? 3226 HOH D O     1 
HETATM 8094 O O     . HOH U 6 .   ? 21.708  19.567  81.218  1.00 16.19 ? 3227 HOH D O     1 
HETATM 8095 O O     . HOH U 6 .   ? 55.956  6.665   97.548  1.00 19.46 ? 3228 HOH D O     1 
HETATM 8096 O O     . HOH U 6 .   ? 43.443  15.316  71.343  1.00 39.99 ? 3229 HOH D O     1 
HETATM 8097 O O     . HOH U 6 .   ? -1.910  4.951   84.781  1.00 26.89 ? 3230 HOH D O     1 
HETATM 8098 O O     . HOH U 6 .   ? 0.888   9.450   60.732  1.00 24.68 ? 3231 HOH D O     1 
HETATM 8099 O O     . HOH U 6 .   ? 19.268  8.692   66.534  1.00 13.41 ? 3232 HOH D O     1 
HETATM 8100 O O     . HOH U 6 .   ? 5.244   8.164   44.641  1.00 37.29 ? 3233 HOH D O     1 
HETATM 8101 O O     . HOH U 6 .   ? 25.375  8.276   91.139  1.00 28.07 ? 3234 HOH D O     1 
HETATM 8102 O O     . HOH U 6 .   ? 47.461  -14.394 66.122  1.00 21.66 ? 3235 HOH D O     1 
HETATM 8103 O O     . HOH U 6 .   ? -1.242  5.120   54.715  1.00 34.15 ? 3236 HOH D O     1 
HETATM 8104 O O     . HOH U 6 .   ? 28.580  20.983  82.638  1.00 32.86 ? 3237 HOH D O     1 
HETATM 8105 O O     . HOH U 6 .   ? 4.113   -6.018  53.721  1.00 14.55 ? 3238 HOH D O     1 
HETATM 8106 O O     . HOH U 6 .   ? 22.856  14.202  72.782  1.00 15.78 ? 3239 HOH D O     1 
HETATM 8107 O O     . HOH U 6 .   ? 49.354  -4.536  69.472  1.00 32.78 ? 3240 HOH D O     1 
HETATM 8108 O O     . HOH U 6 .   ? 27.414  4.692   47.020  1.00 36.66 ? 3241 HOH D O     1 
HETATM 8109 O O     . HOH U 6 .   ? 24.507  -1.466  50.803  1.00 10.49 ? 3242 HOH D O     1 
HETATM 8110 O O     . HOH U 6 .   ? 43.311  9.991   78.407  1.00 18.95 ? 3243 HOH D O     1 
HETATM 8111 O O     . HOH U 6 .   ? 24.953  1.938   45.208  1.00 14.51 ? 3244 HOH D O     1 
HETATM 8112 O O     . HOH U 6 .   ? 19.896  -4.706  32.264  1.00 18.53 ? 3245 HOH D O     1 
HETATM 8113 O O     . HOH U 6 .   ? 22.115  -2.751  60.393  1.00 14.04 ? 3246 HOH D O     1 
HETATM 8114 O O     . HOH U 6 .   ? 52.109  -8.183  79.591  1.00 22.05 ? 3247 HOH D O     1 
HETATM 8115 O O     . HOH U 6 .   ? 16.053  -5.481  81.760  1.00 30.94 ? 3248 HOH D O     1 
HETATM 8116 O O     . HOH U 6 .   ? 15.768  5.329   61.090  1.00 14.49 ? 3249 HOH D O     1 
HETATM 8117 O O     . HOH U 6 .   ? 41.548  -10.645 78.337  1.00 23.97 ? 3250 HOH D O     1 
HETATM 8118 O O     . HOH U 6 .   ? 32.117  3.188   52.055  1.00 18.74 ? 3251 HOH D O     1 
HETATM 8119 O O     . HOH U 6 .   ? 37.836  0.751   94.205  1.00 19.81 ? 3252 HOH D O     1 
HETATM 8120 O O     . HOH U 6 .   ? 4.252   6.147   47.321  1.00 21.84 ? 3253 HOH D O     1 
HETATM 8121 O O     . HOH U 6 .   ? 21.764  -11.465 70.787  1.00 37.21 ? 3254 HOH D O     1 
HETATM 8122 O O     . HOH U 6 .   ? 14.093  9.240   77.511  1.00 16.19 ? 3255 HOH D O     1 
HETATM 8123 O O     . HOH U 6 .   ? 37.417  -15.734 73.486  1.00 29.22 ? 3256 HOH D O     1 
HETATM 8124 O O     . HOH U 6 .   ? 17.046  5.603   55.918  1.00 14.90 ? 3257 HOH D O     1 
HETATM 8125 O O     . HOH U 6 .   ? 30.215  -12.882 65.399  1.00 18.33 ? 3258 HOH D O     1 
HETATM 8126 O O     . HOH U 6 .   ? 8.611   -9.893  67.857  1.00 28.87 ? 3259 HOH D O     1 
HETATM 8127 O O     . HOH U 6 .   ? 27.484  3.433   41.804  1.00 48.08 ? 3260 HOH D O     1 
HETATM 8128 O O     . HOH U 6 .   ? 34.713  20.940  85.435  1.00 30.74 ? 3261 HOH D O     1 
HETATM 8129 O O     . HOH U 6 .   ? 43.882  -1.622  56.145  1.00 20.63 ? 3262 HOH D O     1 
HETATM 8130 O O     . HOH U 6 .   ? 18.070  -8.229  31.566  1.00 29.32 ? 3263 HOH D O     1 
HETATM 8131 O O     . HOH U 6 .   ? 59.259  8.169   88.458  1.00 26.30 ? 3264 HOH D O     1 
HETATM 8132 O O     . HOH U 6 .   ? 16.239  4.607   33.290  1.00 24.49 ? 3265 HOH D O     1 
HETATM 8133 O O     . HOH U 6 .   ? 43.269  16.212  84.101  1.00 19.39 ? 3266 HOH D O     1 
HETATM 8134 O O     . HOH U 6 .   ? 19.152  3.063   55.535  1.00 14.16 ? 3267 HOH D O     1 
HETATM 8135 O O     . HOH U 6 .   ? 38.997  7.390   96.771  1.00 28.51 ? 3268 HOH D O     1 
HETATM 8136 O O     . HOH U 6 .   ? 26.538  0.360   33.083  1.00 25.97 ? 3269 HOH D O     1 
HETATM 8137 O O     . HOH U 6 .   ? 46.707  -15.471 63.734  1.00 26.55 ? 3270 HOH D O     1 
HETATM 8138 O O     . HOH U 6 .   ? 50.896  13.168  75.308  1.00 23.41 ? 3271 HOH D O     1 
HETATM 8139 O O     . HOH U 6 .   ? 25.037  -12.876 71.069  1.00 22.79 ? 3272 HOH D O     1 
HETATM 8140 O O     . HOH U 6 .   ? 45.500  -9.468  91.941  1.00 29.89 ? 3273 HOH D O     1 
HETATM 8141 O O     . HOH U 6 .   ? 42.620  -9.999  87.586  1.00 40.90 ? 3274 HOH D O     1 
HETATM 8142 O O     . HOH U 6 .   ? 28.280  1.009   89.753  1.00 24.93 ? 3275 HOH D O     1 
HETATM 8143 O O     . HOH U 6 .   ? 24.051  -10.661 43.260  1.00 19.22 ? 3276 HOH D O     1 
HETATM 8144 O O     . HOH U 6 .   ? 30.651  -3.011  65.592  1.00 12.44 ? 3277 HOH D O     1 
HETATM 8145 O O     . HOH U 6 .   ? 17.083  -11.133 63.985  1.00 39.77 ? 3278 HOH D O     1 
HETATM 8146 O O     . HOH U 6 .   ? 15.053  -4.260  76.854  1.00 16.33 ? 3279 HOH D O     1 
HETATM 8147 O O     . HOH U 6 .   ? 42.605  -3.674  60.595  1.00 12.80 ? 3280 HOH D O     1 
HETATM 8148 O O     . HOH U 6 .   ? 24.332  -12.523 82.097  1.00 19.66 ? 3281 HOH D O     1 
HETATM 8149 O O     . HOH U 6 .   ? 18.700  -2.161  92.412  1.00 32.02 ? 3282 HOH D O     1 
HETATM 8150 O O     . HOH U 6 .   ? 45.930  -15.746 68.122  1.00 31.75 ? 3283 HOH D O     1 
HETATM 8151 O O     . HOH U 6 .   ? 49.162  -4.564  64.096  1.00 29.51 ? 3284 HOH D O     1 
HETATM 8152 O O     . HOH U 6 .   ? 5.312   5.785   74.469  1.00 14.90 ? 3285 HOH D O     1 
HETATM 8153 O O     . HOH U 6 .   ? 30.530  16.805  87.934  1.00 22.74 ? 3286 HOH D O     1 
HETATM 8154 O O     . HOH U 6 .   ? 47.456  15.955  89.463  1.00 23.76 ? 3287 HOH D O     1 
HETATM 8155 O O     . HOH U 6 .   ? 27.894  -9.021  36.241  1.00 27.60 ? 3288 HOH D O     1 
HETATM 8156 O O     . HOH U 6 .   ? 22.870  -8.072  31.106  1.00 29.96 ? 3289 HOH D O     1 
HETATM 8157 O O     . HOH U 6 .   ? 13.682  10.981  52.275  1.00 21.91 ? 3290 HOH D O     1 
HETATM 8158 O O     . HOH U 6 .   ? 22.963  -11.529 67.084  1.00 26.01 ? 3291 HOH D O     1 
HETATM 8159 O O     . HOH U 6 .   ? 57.197  -0.382  78.590  1.00 37.99 ? 3292 HOH D O     1 
HETATM 8160 O O     . HOH U 6 .   ? 15.875  13.161  83.696  1.00 25.18 ? 3293 HOH D O     1 
HETATM 8161 O O     . HOH U 6 .   ? 45.024  10.358  99.411  1.00 21.63 ? 3294 HOH D O     1 
HETATM 8162 O O     . HOH U 6 .   ? 15.656  -7.556  31.358  1.00 30.94 ? 3295 HOH D O     1 
HETATM 8163 O O     . HOH U 6 .   ? 45.842  -11.777 76.091  1.00 35.23 ? 3296 HOH D O     1 
HETATM 8164 O O     . HOH U 6 .   ? 48.047  4.831   68.755  1.00 25.92 ? 3297 HOH D O     1 
HETATM 8165 O O     . HOH U 6 .   ? 18.477  10.805  91.610  1.00 17.92 ? 3298 HOH D O     1 
HETATM 8166 O O     . HOH U 6 .   ? 15.928  20.296  86.708  1.00 19.82 ? 3299 HOH D O     1 
HETATM 8167 O O     . HOH U 6 .   ? 19.898  -14.106 38.818  1.00 18.29 ? 3300 HOH D O     1 
HETATM 8168 O O     . HOH U 6 .   ? 32.046  23.892  83.232  1.00 20.48 ? 3301 HOH D O     1 
HETATM 8169 O O     . HOH U 6 .   ? 40.813  17.083  83.003  1.00 20.76 ? 3302 HOH D O     1 
HETATM 8170 O O     . HOH U 6 .   ? 15.776  -6.833  84.008  1.00 25.09 ? 3303 HOH D O     1 
HETATM 8171 O O     . HOH U 6 .   ? 22.999  -11.708 45.617  1.00 21.18 ? 3304 HOH D O     1 
HETATM 8172 O O     . HOH U 6 .   ? 20.808  19.516  90.756  1.00 25.14 ? 3305 HOH D O     1 
HETATM 8173 O O     . HOH U 6 .   ? 45.214  16.927  82.217  1.00 29.39 ? 3306 HOH D O     1 
HETATM 8174 O O     . HOH U 6 .   ? -7.028  -4.738  74.114  1.00 23.60 ? 3307 HOH D O     1 
HETATM 8175 O O     . HOH U 6 .   ? 43.820  17.437  86.786  1.00 25.02 ? 3308 HOH D O     1 
HETATM 8176 O O     . HOH U 6 .   ? 38.077  15.943  88.957  1.00 27.03 ? 3309 HOH D O     1 
HETATM 8177 O O     . HOH U 6 .   ? -2.188  2.343   68.882  1.00 27.90 ? 3310 HOH D O     1 
HETATM 8178 O O     . HOH U 6 .   ? -0.151  5.285   87.215  1.00 26.48 ? 3311 HOH D O     1 
HETATM 8179 O O     . HOH U 6 .   ? 54.323  0.345   72.625  1.00 24.66 ? 3312 HOH D O     1 
HETATM 8180 O O     . HOH U 6 .   ? 4.996   8.294   81.047  1.00 27.87 ? 3313 HOH D O     1 
HETATM 8181 O O     . HOH U 6 .   ? 25.282  0.888   30.647  1.00 31.84 ? 3314 HOH D O     1 
HETATM 8182 O O     . HOH U 6 .   ? 17.066  12.170  72.289  1.00 29.19 ? 3315 HOH D O     1 
HETATM 8183 O O     . HOH U 6 .   ? 35.625  14.681  93.004  1.00 27.48 ? 3316 HOH D O     1 
HETATM 8184 O O     . HOH U 6 .   ? 41.875  -8.345  59.706  1.00 24.08 ? 3317 HOH D O     1 
HETATM 8185 O O     . HOH U 6 .   ? 24.270  -12.050 40.921  1.00 31.77 ? 3318 HOH D O     1 
HETATM 8186 O O     . HOH U 6 .   ? 18.613  18.229  90.638  1.00 39.27 ? 3319 HOH D O     1 
HETATM 8187 O O     . HOH U 6 .   ? -5.541  -2.465  72.602  1.00 24.68 ? 3320 HOH D O     1 
HETATM 8188 O O     . HOH U 6 .   ? 29.553  20.717  79.982  1.00 29.90 ? 3321 HOH D O     1 
HETATM 8189 O O     . HOH U 6 .   ? 18.184  -15.936 39.838  1.00 25.01 ? 3322 HOH D O     1 
HETATM 8190 O O     . HOH U 6 .   ? 49.299  4.788   100.043 1.00 28.45 ? 3323 HOH D O     1 
HETATM 8191 O O     . HOH U 6 .   ? 10.134  11.470  63.309  1.00 30.32 ? 3324 HOH D O     1 
HETATM 8192 O O     . HOH U 6 .   ? 21.447  10.289  65.778  1.00 32.69 ? 3325 HOH D O     1 
HETATM 8193 O O     . HOH U 6 .   ? -2.427  1.529   71.853  1.00 32.07 ? 3326 HOH D O     1 
HETATM 8194 O O     . HOH U 6 .   ? 39.648  18.399  92.207  1.00 34.09 ? 3327 HOH D O     1 
HETATM 8195 O O     . HOH U 6 .   ? 31.548  -13.957 82.189  1.00 34.24 ? 3328 HOH D O     1 
HETATM 8196 O O     . HOH U 6 .   ? 42.485  -10.174 92.285  1.00 27.99 ? 3329 HOH D O     1 
HETATM 8197 O O     . HOH U 6 .   ? 40.691  -11.155 60.351  1.00 34.01 ? 3330 HOH D O     1 
HETATM 8198 O O     . HOH U 6 .   ? 45.613  -9.313  86.803  1.00 32.64 ? 3331 HOH D O     1 
HETATM 8199 O O     . HOH U 6 .   ? 32.060  17.708  61.325  1.00 46.98 ? 3332 HOH D O     1 
HETATM 8200 O O     . HOH U 6 .   ? 56.521  0.092   84.174  1.00 38.93 ? 3333 HOH D O     1 
HETATM 8201 O O     . HOH U 6 .   ? 39.309  17.982  85.160  1.00 39.02 ? 3334 HOH D O     1 
HETATM 8202 O O     . HOH U 6 .   ? -3.104  -7.081  69.642  1.00 46.40 ? 3335 HOH D O     1 
HETATM 8203 O O     . HOH U 6 .   ? 21.873  13.345  92.115  1.00 26.24 ? 3336 HOH D O     1 
HETATM 8204 O O     . HOH U 6 .   ? 56.240  -3.312  81.951  1.00 35.17 ? 3337 HOH D O     1 
HETATM 8205 O O     . HOH U 6 .   ? 32.886  -1.098  43.238  1.00 38.59 ? 3338 HOH D O     1 
HETATM 8206 O O     . HOH U 6 .   ? 43.931  -15.454 75.113  1.00 36.15 ? 3339 HOH D O     1 
HETATM 8207 O O     . HOH U 6 .   ? 52.587  -6.364  77.688  1.00 34.72 ? 3340 HOH D O     1 
HETATM 8208 O O     . HOH U 6 .   ? 0.064   3.862   52.622  1.00 32.89 ? 3341 HOH D O     1 
HETATM 8209 O O     . HOH U 6 .   ? -1.335  7.915   66.778  1.00 42.57 ? 3342 HOH D O     1 
HETATM 8210 O O     . HOH U 6 .   ? 46.293  -0.557  56.748  1.00 42.72 ? 3343 HOH D O     1 
HETATM 8211 O O     . HOH U 6 .   ? 12.084  11.045  77.982  1.00 34.27 ? 3344 HOH D O     1 
HETATM 8212 O O     . HOH U 6 .   ? 25.174  -13.569 66.317  1.00 43.08 ? 3345 HOH D O     1 
HETATM 8213 O O     . HOH U 6 .   ? -2.396  6.970   63.830  1.00 31.20 ? 3346 HOH D O     1 
HETATM 8214 O O     . HOH U 6 .   ? 22.459  -13.321 38.702  1.00 28.89 ? 3347 HOH D O     1 
HETATM 8215 O O     . HOH U 6 .   ? 24.226  14.159  93.172  1.00 30.10 ? 3348 HOH D O     1 
HETATM 8216 O O     . HOH U 6 .   ? 34.259  0.785   41.956  1.00 36.79 ? 3349 HOH D O     1 
HETATM 8217 O O     . HOH U 6 .   ? 16.937  16.921  92.031  1.00 36.31 ? 3350 HOH D O     1 
HETATM 8218 O O     . HOH U 6 .   ? 6.871   -8.707  49.057  1.00 32.53 ? 3351 HOH D O     1 
HETATM 8219 O O     . HOH U 6 .   ? 4.907   -3.017  79.099  1.00 32.62 ? 3352 HOH D O     1 
HETATM 8220 O O     . HOH U 6 .   ? 17.024  14.056  91.358  1.00 28.07 ? 3353 HOH D O     1 
HETATM 8221 O O     . HOH U 6 .   ? 34.920  10.171  94.196  1.00 40.58 ? 3354 HOH D O     1 
HETATM 8222 O O     . HOH U 6 .   ? 20.265  -7.258  31.129  1.00 31.80 ? 3355 HOH D O     1 
HETATM 8223 O O     . HOH U 6 .   ? 46.266  16.113  95.834  1.00 37.26 ? 3356 HOH D O     1 
HETATM 8224 O O     . HOH U 6 .   ? -11.015 -3.123  59.347  1.00 39.37 ? 3357 HOH D O     1 
HETATM 8225 O O     . HOH U 6 .   ? 18.314  -1.224  28.970  1.00 27.52 ? 3358 HOH D O     1 
HETATM 8226 O O     . HOH U 6 .   ? 43.191  3.501   67.761  1.00 40.47 ? 3359 HOH D O     1 
HETATM 8227 O O     . HOH U 6 .   ? -9.446  -14.806 67.022  1.00 42.84 ? 3360 HOH D O     1 
HETATM 8228 O O     . HOH U 6 .   ? 46.122  18.220  87.980  1.00 39.20 ? 3361 HOH D O     1 
HETATM 8229 O O     . HOH U 6 .   ? 8.685   -9.359  38.930  1.00 32.60 ? 3362 HOH D O     1 
HETATM 8230 O O     . HOH U 6 .   ? 24.309  8.185   35.565  1.00 39.85 ? 3363 HOH D O     1 
HETATM 8231 O O     . HOH U 6 .   ? 20.474  13.153  67.108  1.00 34.14 ? 3364 HOH D O     1 
HETATM 8232 O O     . HOH U 6 .   ? 26.234  5.409   38.126  1.00 36.81 ? 3365 HOH D O     1 
HETATM 8233 O O     . HOH U 6 .   ? 31.019  -5.469  39.337  1.00 37.82 ? 3366 HOH D O     1 
HETATM 8234 O O     . HOH U 6 .   ? 23.529  -12.875 84.778  1.00 38.91 ? 3367 HOH D O     1 
HETATM 8235 O O     . HOH U 6 .   ? -0.810  -5.662  47.301  1.00 41.99 ? 3368 HOH D O     1 
HETATM 8236 O O     . HOH U 6 .   ? 31.117  -13.995 69.271  1.00 29.63 ? 3369 HOH D O     1 
HETATM 8237 O O     . HOH U 6 .   ? 18.831  14.766  77.168  1.00 43.02 ? 3370 HOH D O     1 
HETATM 8238 O O     . HOH U 6 .   ? 12.280  -11.256 35.459  1.00 31.60 ? 3371 HOH D O     1 
HETATM 8239 O O     . HOH U 6 .   ? 26.435  -14.969 70.238  1.00 42.34 ? 3372 HOH D O     1 
HETATM 8240 O O     . HOH U 6 .   ? 14.935  11.869  92.918  1.00 33.29 ? 3373 HOH D O     1 
HETATM 8241 O O     . HOH U 6 .   ? -3.769  5.142   61.761  1.00 38.10 ? 3374 HOH D O     1 
HETATM 8242 O O     . HOH U 6 .   ? 19.007  13.838  92.592  1.00 45.32 ? 3375 HOH D O     1 
HETATM 8243 O O     . HOH U 6 .   ? 54.998  -3.790  76.293  1.00 53.91 ? 3376 HOH D O     1 
HETATM 8244 O O     . HOH U 6 .   ? 16.562  12.370  59.835  1.00 46.33 ? 3377 HOH D O     1 
HETATM 8245 O O     . HOH U 6 .   ? 29.139  21.014  63.935  1.00 46.56 ? 3378 HOH D O     1 
HETATM 8246 O O     . HOH U 6 .   ? 38.396  11.412  67.444  1.00 55.19 ? 3379 HOH D O     1 
HETATM 8247 O O     . HOH U 6 .   ? -0.003  7.453   54.871  1.00 38.96 ? 3380 HOH D O     1 
HETATM 8248 O O     . HOH U 6 .   ? 4.262   3.548   46.682  1.00 39.65 ? 3381 HOH D O     1 
HETATM 8249 O O     . HOH U 6 .   ? -4.365  -5.138  70.833  1.00 35.12 ? 3382 HOH D O     1 
HETATM 8250 O O     . HOH U 6 .   ? -8.077  -15.262 65.063  1.00 45.48 ? 3383 HOH D O     1 
HETATM 8251 O O     . HOH U 6 .   ? 27.432  -16.834 76.171  1.00 40.17 ? 3384 HOH D O     1 
HETATM 8252 O O     . HOH U 6 .   ? 36.945  6.573   97.609  1.00 47.36 ? 3385 HOH D O     1 
HETATM 8253 O O     . HOH U 6 .   ? 14.213  -11.221 61.383  1.00 43.99 ? 3386 HOH D O     1 
HETATM 8254 O O     . HOH U 6 .   ? 8.011   -3.444  82.889  1.00 36.51 ? 3387 HOH D O     1 
HETATM 8255 O O     . HOH U 6 .   ? 31.082  19.174  76.238  1.00 31.49 ? 3388 HOH D O     1 
HETATM 8256 O O     . HOH U 6 .   ? 17.359  -9.273  94.114  1.00 38.99 ? 3389 HOH D O     1 
HETATM 8257 O O     . HOH U 6 .   ? 14.634  -10.944 79.879  1.00 40.19 ? 3390 HOH D O     1 
HETATM 8258 O O     . HOH U 6 .   ? 44.366  14.636  68.754  1.00 58.36 ? 3391 HOH D O     1 
HETATM 8259 O O     . HOH U 6 .   ? 17.660  17.748  83.287  1.00 47.09 ? 3392 HOH D O     1 
HETATM 8260 O O     . HOH U 6 .   ? 4.828   12.653  54.292  1.00 45.05 ? 3393 HOH D O     1 
HETATM 8261 O O     . HOH U 6 .   ? 4.965   -12.940 53.643  1.00 33.74 ? 3394 HOH D O     1 
HETATM 8262 O O     . HOH U 6 .   ? 0.660   7.841   52.329  1.00 39.73 ? 3395 HOH D O     1 
HETATM 8263 O O     . HOH U 6 .   ? 30.828  -14.536 75.829  1.00 43.50 ? 3396 HOH D O     1 
HETATM 8264 O O     . HOH U 6 .   ? 22.491  16.603  66.955  1.00 49.14 ? 3397 HOH D O     1 
HETATM 8265 O O     . HOH U 6 .   ? -8.096  2.194   55.624  1.00 49.76 ? 3398 HOH D O     1 
HETATM 8266 O O     . HOH U 6 .   ? 35.180  -14.855 83.985  1.00 65.74 ? 3399 HOH D O     1 
HETATM 8267 O O     . HOH U 6 .   ? 43.753  5.676   69.150  1.00 24.25 ? 3400 HOH D O     1 
HETATM 8268 O O     . HOH U 6 .   ? 17.151  14.485  95.221  1.00 30.38 ? 3401 HOH D O     1 
HETATM 8269 O O     . HOH U 6 .   ? 47.927  4.338   101.992 1.00 31.74 ? 3402 HOH D O     1 
HETATM 8270 O O     . HOH U 6 .   ? 14.910  14.924  89.833  1.00 28.70 ? 3403 HOH D O     1 
HETATM 8271 O O     . HOH U 6 .   ? 12.372  13.682  93.233  1.00 41.79 ? 3404 HOH D O     1 
HETATM 8272 O O     . HOH U 6 .   ? 17.127  10.776  93.752  1.00 39.54 ? 3405 HOH D O     1 
HETATM 8273 O O     . HOH U 6 .   ? 28.387  19.923  76.285  1.00 35.34 ? 3406 HOH D O     1 
HETATM 8274 O O     . HOH U 6 .   ? 31.553  -4.996  45.008  1.00 33.68 ? 3407 HOH D O     1 
HETATM 8275 O O     . HOH U 6 .   ? 40.868  6.345   65.810  1.00 40.23 ? 3408 HOH D O     1 
HETATM 8276 O O     . HOH U 6 .   ? 19.020  -8.199  71.661  1.00 30.34 ? 3409 HOH D O     1 
HETATM 8277 O O     . HOH U 6 .   ? 12.637  -8.183  92.782  1.00 37.64 ? 3410 HOH D O     1 
HETATM 8278 O O     . HOH U 6 .   ? 43.146  -3.432  51.172  1.00 34.84 ? 3411 HOH D O     1 
HETATM 8279 O O     . HOH U 6 .   ? 15.008  5.084   30.648  1.00 54.72 ? 3412 HOH D O     1 
HETATM 8280 O O     . HOH U 6 .   ? -8.710  -1.785  60.068  1.00 50.11 ? 3413 HOH D O     1 
HETATM 8281 O O     . HOH U 6 .   ? 37.368  14.002  71.989  1.00 44.81 ? 3414 HOH D O     1 
HETATM 8282 O O     . HOH U 6 .   ? 26.520  -12.241 47.679  1.00 45.25 ? 3415 HOH D O     1 
HETATM 8283 O O     . HOH U 6 .   ? 14.214  -6.930  80.657  1.00 53.59 ? 3416 HOH D O     1 
HETATM 8284 O O     . HOH U 6 .   ? 12.267  2.395   30.400  1.00 19.81 ? 3417 HOH D O     1 
HETATM 8285 O O     . HOH U 6 .   ? 13.489  -7.684  32.729  1.00 25.64 ? 3418 HOH D O     1 
HETATM 8286 O O     . HOH U 6 .   ? 39.040  18.313  76.124  1.00 30.76 ? 3419 HOH D O     1 
HETATM 8287 O O     . HOH U 6 .   ? 34.719  19.504  88.993  1.00 58.03 ? 3420 HOH D O     1 
HETATM 8288 O O     . HOH U 6 .   ? 22.310  21.750  79.537  1.00 26.98 ? 3421 HOH D O     1 
HETATM 8289 O O     . HOH U 6 .   ? 4.574   13.809  70.983  1.00 36.68 ? 3422 HOH D O     1 
HETATM 8290 O O     . HOH U 6 .   ? 35.695  22.790  83.824  1.00 44.84 ? 3423 HOH D O     1 
HETATM 8291 O O     . HOH U 6 .   ? 17.844  -15.386 42.584  1.00 33.90 ? 3424 HOH D O     1 
HETATM 8292 O O     . HOH U 6 .   ? 32.765  17.717  88.538  1.00 34.65 ? 3425 HOH D O     1 
HETATM 8293 O O     . HOH U 6 .   ? 2.903   11.914  71.202  1.00 40.37 ? 3426 HOH D O     1 
HETATM 8294 O O     . HOH U 6 .   ? 6.493   13.282  68.140  1.00 51.63 ? 3427 HOH D O     1 
HETATM 8295 O O     . HOH U 6 .   ? 33.154  4.195   92.411  1.00 49.00 ? 3428 HOH D O     1 
HETATM 8296 O O     . HOH U 6 .   ? 13.387  12.182  88.661  1.00 40.27 ? 3429 HOH D O     1 
HETATM 8297 O O     . HOH U 6 .   ? 20.954  -9.731  88.051  1.00 42.96 ? 3430 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  G   B . n 
A 1 2   DT  2   2   2   DT  T   B . n 
A 1 3   DT  3   3   3   DT  T   B . n 
A 1 4   DC  4   4   4   DC  C   B . n 
A 1 5   DG  5   5   5   DG  G   B . n 
A 1 6   2PR 6   6   6   2PR 2PR B . n 
A 1 7   DT  7   7   7   DT  T   B . n 
A 1 8   DG  8   8   8   DG  G   B . n 
A 1 9   DT  9   9   9   DT  T   B . n 
A 1 10  DC  10  10  10  DC  C   B . n 
B 2 1   DG  1   11  11  DG  G   C . n 
B 2 2   DA  2   12  12  DA  A   C . n 
B 2 3   DC  3   13  13  DC  C   C . n 
B 2 4   DA  4   14  14  DA  A   C . n 
B 2 5   3DR 5   15  15  3DR 3DR C . n 
B 2 6   DC  6   16  16  DC  C   C . n 
B 2 7   DG  7   17  17  DG  G   C . n 
B 2 8   6MA 8   18  18  6MA 6MA C . n 
B 2 9   DA  9   19  19  DA  A   C . n 
B 2 10  DC  10  20  20  DC  C   C . n 
C 1 1   DG  1   1   1   DG  G   E . n 
C 1 2   DT  2   2   2   DT  T   E . n 
C 1 3   DT  3   3   3   DT  T   E . n 
C 1 4   DC  4   4   4   DC  C   E . n 
C 1 5   DG  5   5   5   DG  G   E . n 
C 1 6   2PR 6   6   6   2PR 2PR E . n 
C 1 7   DT  7   7   7   DT  T   E . n 
C 1 8   DG  8   8   8   DG  G   E . n 
C 1 9   DT  9   9   9   DT  T   E . n 
C 1 10  DC  10  10  10  DC  C   E . n 
D 2 1   DG  1   11  11  DG  G   F . n 
D 2 2   DA  2   12  12  DA  A   F . n 
D 2 3   DC  3   13  13  DC  C   F . n 
D 2 4   DA  4   14  14  DA  A   F . n 
D 2 5   3DR 5   15  15  3DR 3DR F . n 
D 2 6   DC  6   16  16  DC  C   F . n 
D 2 7   DG  7   17  17  DG  G   F . n 
D 2 8   6MA 8   18  18  6MA 6MA F . n 
D 2 9   DA  9   19  19  DA  A   F . n 
D 2 10  DC  10  20  20  DC  C   F . n 
E 3 1   MET 1   1   ?   ?   ?   A . n 
E 3 2   GLY 2   2   ?   ?   ?   A . n 
E 3 3   LEU 3   3   ?   ?   ?   A . n 
E 3 4   PRO 4   4   ?   ?   ?   A . n 
E 3 5   PRO 5   5   ?   ?   ?   A . n 
E 3 6   LEU 6   6   ?   ?   ?   A . n 
E 3 7   LEU 7   7   ?   ?   ?   A . n 
E 3 8   SER 8   8   ?   ?   ?   A . n 
E 3 9   LEU 9   9   ?   ?   ?   A . n 
E 3 10  PRO 10  10  ?   ?   ?   A . n 
E 3 11  SER 11  11  ?   ?   ?   A . n 
E 3 12  ASN 12  12  ?   ?   ?   A . n 
E 3 13  SER 13  13  ?   ?   ?   A . n 
E 3 14  ALA 14  14  ?   ?   ?   A . n 
E 3 15  PRO 15  15  ?   ?   ?   A . n 
E 3 16  ARG 16  16  ?   ?   ?   A . n 
E 3 17  SER 17  17  ?   ?   ?   A . n 
E 3 18  LEU 18  18  ?   ?   ?   A . n 
E 3 19  GLY 19  19  ?   ?   ?   A . n 
E 3 20  ARG 20  20  ?   ?   ?   A . n 
E 3 21  VAL 21  21  21  VAL VAL A . n 
E 3 22  GLU 22  22  22  GLU GLU A . n 
E 3 23  THR 23  23  23  THR THR A . n 
E 3 24  PRO 24  24  24  PRO PRO A . n 
E 3 25  PRO 25  25  25  PRO PRO A . n 
E 3 26  GLU 26  26  26  GLU GLU A . n 
E 3 27  VAL 27  27  27  VAL VAL A . n 
E 3 28  VAL 28  28  28  VAL VAL A . n 
E 3 29  ASP 29  29  29  ASP ASP A . n 
E 3 30  PHE 30  30  30  PHE PHE A . n 
E 3 31  MET 31  31  31  MET MET A . n 
E 3 32  VAL 32  32  32  VAL VAL A . n 
E 3 33  SER 33  33  33  SER SER A . n 
E 3 34  LEU 34  34  34  LEU LEU A . n 
E 3 35  ALA 35  35  35  ALA ALA A . n 
E 3 36  GLU 36  36  36  GLU GLU A . n 
E 3 37  ALA 37  37  37  ALA ALA A . n 
E 3 38  PRO 38  38  38  PRO PRO A . n 
E 3 39  ARG 39  39  39  ARG ARG A . n 
E 3 40  GLY 40  40  40  GLY GLY A . n 
E 3 41  GLY 41  41  41  GLY GLY A . n 
E 3 42  ARG 42  42  42  ARG ARG A . n 
E 3 43  VAL 43  43  43  VAL VAL A . n 
E 3 44  LEU 44  44  44  LEU LEU A . n 
E 3 45  GLU 45  45  45  GLU GLU A . n 
E 3 46  PRO 46  46  46  PRO PRO A . n 
E 3 47  ALA 47  47  47  ALA ALA A . n 
E 3 48  CYS 48  48  48  CYS CYS A . n 
E 3 49  ALA 49  49  49  ALA ALA A . n 
E 3 50  HIS 50  50  50  HIS HIS A . n 
E 3 51  GLY 51  51  51  GLY GLY A . n 
E 3 52  PRO 52  52  52  PRO PRO A . n 
E 3 53  PHE 53  53  53  PHE PHE A . n 
E 3 54  LEU 54  54  54  LEU LEU A . n 
E 3 55  ARG 55  55  55  ARG ARG A . n 
E 3 56  ALA 56  56  56  ALA ALA A . n 
E 3 57  PHE 57  57  57  PHE PHE A . n 
E 3 58  ARG 58  58  58  ARG ARG A . n 
E 3 59  GLU 59  59  59  GLU GLU A . n 
E 3 60  ALA 60  60  60  ALA ALA A . n 
E 3 61  HIS 61  61  61  HIS HIS A . n 
E 3 62  GLY 62  62  62  GLY GLY A . n 
E 3 63  THR 63  63  63  THR THR A . n 
E 3 64  ALA 64  64  64  ALA ALA A . n 
E 3 65  TYR 65  65  65  TYR TYR A . n 
E 3 66  ARG 66  66  66  ARG ARG A . n 
E 3 67  PHE 67  67  67  PHE PHE A . n 
E 3 68  VAL 68  68  68  VAL VAL A . n 
E 3 69  GLY 69  69  69  GLY GLY A . n 
E 3 70  VAL 70  70  70  VAL VAL A . n 
E 3 71  GLU 71  71  71  GLU GLU A . n 
E 3 72  ILE 72  72  72  ILE ILE A . n 
E 3 73  ASP 73  73  73  ASP ASP A . n 
E 3 74  PRO 74  74  74  PRO PRO A . n 
E 3 75  LYS 75  75  75  LYS LYS A . n 
E 3 76  ALA 76  76  76  ALA ALA A . n 
E 3 77  LEU 77  77  77  LEU LEU A . n 
E 3 78  ASP 78  78  78  ASP ASP A . n 
E 3 79  LEU 79  79  79  LEU LEU A . n 
E 3 80  PRO 80  80  80  PRO PRO A . n 
E 3 81  PRO 81  81  81  PRO PRO A . n 
E 3 82  TRP 82  82  82  TRP TRP A . n 
E 3 83  ALA 83  83  83  ALA ALA A . n 
E 3 84  GLU 84  84  84  GLU GLU A . n 
E 3 85  GLY 85  85  85  GLY GLY A . n 
E 3 86  ILE 86  86  86  ILE ILE A . n 
E 3 87  LEU 87  87  87  LEU LEU A . n 
E 3 88  ALA 88  88  88  ALA ALA A . n 
E 3 89  ASP 89  89  89  ASP ASP A . n 
E 3 90  PHE 90  90  90  PHE PHE A . n 
E 3 91  LEU 91  91  91  LEU LEU A . n 
E 3 92  LEU 92  92  92  LEU LEU A . n 
E 3 93  TRP 93  93  93  TRP TRP A . n 
E 3 94  GLU 94  94  94  GLU GLU A . n 
E 3 95  PRO 95  95  95  PRO PRO A . n 
E 3 96  GLY 96  96  96  GLY GLY A . n 
E 3 97  GLU 97  97  97  GLU GLU A . n 
E 3 98  ALA 98  98  98  ALA ALA A . n 
E 3 99  PHE 99  99  99  PHE PHE A . n 
E 3 100 ASP 100 100 100 ASP ASP A . n 
E 3 101 LEU 101 101 101 LEU LEU A . n 
E 3 102 ILE 102 102 102 ILE ILE A . n 
E 3 103 LEU 103 103 103 LEU LEU A . n 
E 3 104 GLY 104 104 104 GLY GLY A . n 
E 3 105 ASN 105 105 105 ASN ASN A . n 
E 3 106 PRO 106 106 106 PRO PRO A . n 
E 3 107 PRO 107 107 107 PRO PRO A . n 
E 3 108 TYR 108 108 108 TYR TYR A . n 
E 3 109 GLY 109 109 109 GLY GLY A . n 
E 3 110 ILE 110 110 110 ILE ILE A . n 
E 3 111 VAL 111 111 111 VAL VAL A . n 
E 3 112 GLY 112 112 112 GLY GLY A . n 
E 3 113 GLU 113 113 113 GLU GLU A . n 
E 3 114 ALA 114 114 114 ALA ALA A . n 
E 3 115 SER 115 115 115 SER SER A . n 
E 3 116 LYS 116 116 116 LYS LYS A . n 
E 3 117 TYR 117 117 117 TYR TYR A . n 
E 3 118 PRO 118 118 118 PRO PRO A . n 
E 3 119 ILE 119 119 119 ILE ILE A . n 
E 3 120 HIS 120 120 120 HIS HIS A . n 
E 3 121 VAL 121 121 121 VAL VAL A . n 
E 3 122 PHE 122 122 122 PHE PHE A . n 
E 3 123 LYS 123 123 123 LYS LYS A . n 
E 3 124 ALA 124 124 124 ALA ALA A . n 
E 3 125 VAL 125 125 125 VAL VAL A . n 
E 3 126 LYS 126 126 126 LYS LYS A . n 
E 3 127 ASP 127 127 127 ASP ASP A . n 
E 3 128 LEU 128 128 128 LEU LEU A . n 
E 3 129 TYR 129 129 129 TYR TYR A . n 
E 3 130 LYS 130 130 130 LYS LYS A . n 
E 3 131 LYS 131 131 131 LYS LYS A . n 
E 3 132 ALA 132 132 132 ALA ALA A . n 
E 3 133 PHE 133 133 133 PHE PHE A . n 
E 3 134 SER 134 134 134 SER SER A . n 
E 3 135 THR 135 135 135 THR THR A . n 
E 3 136 TRP 136 136 136 TRP TRP A . n 
E 3 137 LYS 137 137 137 LYS LYS A . n 
E 3 138 GLY 138 138 138 GLY GLY A . n 
E 3 139 LYS 139 139 139 LYS LYS A . n 
E 3 140 TYR 140 140 140 TYR TYR A . n 
E 3 141 ASN 141 141 141 ASN ASN A . n 
E 3 142 LEU 142 142 142 LEU LEU A . n 
E 3 143 TYR 143 143 143 TYR TYR A . n 
E 3 144 GLY 144 144 144 GLY GLY A . n 
E 3 145 ALA 145 145 145 ALA ALA A . n 
E 3 146 PHE 146 146 146 PHE PHE A . n 
E 3 147 LEU 147 147 147 LEU LEU A . n 
E 3 148 GLU 148 148 148 GLU GLU A . n 
E 3 149 LYS 149 149 149 LYS LYS A . n 
E 3 150 ALA 150 150 150 ALA ALA A . n 
E 3 151 VAL 151 151 151 VAL VAL A . n 
E 3 152 ARG 152 152 152 ARG ARG A . n 
E 3 153 LEU 153 153 153 LEU LEU A . n 
E 3 154 LEU 154 154 154 LEU LEU A . n 
E 3 155 LYS 155 155 155 LYS LYS A . n 
E 3 156 PRO 156 156 156 PRO PRO A . n 
E 3 157 GLY 157 157 157 GLY GLY A . n 
E 3 158 GLY 158 158 158 GLY GLY A . n 
E 3 159 VAL 159 159 159 VAL VAL A . n 
E 3 160 LEU 160 160 160 LEU LEU A . n 
E 3 161 VAL 161 161 161 VAL VAL A . n 
E 3 162 PHE 162 162 162 PHE PHE A . n 
E 3 163 VAL 163 163 163 VAL VAL A . n 
E 3 164 VAL 164 164 164 VAL VAL A . n 
E 3 165 PRO 165 165 165 PRO PRO A . n 
E 3 166 ALA 166 166 166 ALA ALA A . n 
E 3 167 THR 167 167 167 THR THR A . n 
E 3 168 TRP 168 168 168 TRP TRP A . n 
E 3 169 LEU 169 169 169 LEU LEU A . n 
E 3 170 VAL 170 170 170 VAL VAL A . n 
E 3 171 LEU 171 171 171 LEU LEU A . n 
E 3 172 GLU 172 172 172 GLU GLU A . n 
E 3 173 ASP 173 173 173 ASP ASP A . n 
E 3 174 PHE 174 174 174 PHE PHE A . n 
E 3 175 ALA 175 175 175 ALA ALA A . n 
E 3 176 LEU 176 176 176 LEU LEU A . n 
E 3 177 LEU 177 177 177 LEU LEU A . n 
E 3 178 ARG 178 178 178 ARG ARG A . n 
E 3 179 GLU 179 179 179 GLU GLU A . n 
E 3 180 PHE 180 180 180 PHE PHE A . n 
E 3 181 LEU 181 181 181 LEU LEU A . n 
E 3 182 ALA 182 182 182 ALA ALA A . n 
E 3 183 ARG 183 183 183 ARG ARG A . n 
E 3 184 GLU 184 184 184 GLU GLU A . n 
E 3 185 GLY 185 185 185 GLY GLY A . n 
E 3 186 LYS 186 186 186 LYS LYS A . n 
E 3 187 THR 187 187 187 THR THR A . n 
E 3 188 SER 188 188 188 SER SER A . n 
E 3 189 VAL 189 189 189 VAL VAL A . n 
E 3 190 TYR 190 190 190 TYR TYR A . n 
E 3 191 TYR 191 191 191 TYR TYR A . n 
E 3 192 LEU 192 192 192 LEU LEU A . n 
E 3 193 GLY 193 193 193 GLY GLY A . n 
E 3 194 GLU 194 194 194 GLU GLU A . n 
E 3 195 VAL 195 195 195 VAL VAL A . n 
E 3 196 PHE 196 196 196 PHE PHE A . n 
E 3 197 PRO 197 197 197 PRO PRO A . n 
E 3 198 GLN 198 198 198 GLN GLN A . n 
E 3 199 LYS 199 199 199 LYS LYS A . n 
E 3 200 LYS 200 200 200 LYS LYS A . n 
E 3 201 VAL 201 201 201 VAL VAL A . n 
E 3 202 SER 202 202 202 SER SER A . n 
E 3 203 ALA 203 203 203 ALA ALA A . n 
E 3 204 VAL 204 204 204 VAL VAL A . n 
E 3 205 VAL 205 205 205 VAL VAL A . n 
E 3 206 ILE 206 206 206 ILE ILE A . n 
E 3 207 ARG 207 207 207 ARG ARG A . n 
E 3 208 PHE 208 208 208 PHE PHE A . n 
E 3 209 GLN 209 209 209 GLN GLN A . n 
E 3 210 LYS 210 210 210 LYS LYS A . n 
E 3 211 SER 211 211 211 SER SER A . n 
E 3 212 GLY 212 212 212 GLY GLY A . n 
E 3 213 LYS 213 213 213 LYS LYS A . n 
E 3 214 GLY 214 214 214 GLY GLY A . n 
E 3 215 LEU 215 215 215 LEU LEU A . n 
E 3 216 SER 216 216 216 SER SER A . n 
E 3 217 LEU 217 217 217 LEU LEU A . n 
E 3 218 TRP 218 218 218 TRP TRP A . n 
E 3 219 ASP 219 219 219 ASP ASP A . n 
E 3 220 THR 220 220 220 THR THR A . n 
E 3 221 GLN 221 221 221 GLN GLN A . n 
E 3 222 GLU 222 222 222 GLU GLU A . n 
E 3 223 SER 223 223 223 SER SER A . n 
E 3 224 GLU 224 224 224 GLU GLU A . n 
E 3 225 SER 225 225 225 SER SER A . n 
E 3 226 GLY 226 226 226 GLY GLY A . n 
E 3 227 PHE 227 227 227 PHE PHE A . n 
E 3 228 THR 228 228 228 THR THR A . n 
E 3 229 PRO 229 229 229 PRO PRO A . n 
E 3 230 ILE 230 230 230 ILE ILE A . n 
E 3 231 LEU 231 231 231 LEU LEU A . n 
E 3 232 TRP 232 232 232 TRP TRP A . n 
E 3 233 ALA 233 233 233 ALA ALA A . n 
E 3 234 GLU 234 234 234 GLU GLU A . n 
E 3 235 TYR 235 235 235 TYR TYR A . n 
E 3 236 PRO 236 236 236 PRO PRO A . n 
E 3 237 HIS 237 237 237 HIS HIS A . n 
E 3 238 TRP 238 238 238 TRP TRP A . n 
E 3 239 GLU 239 239 239 GLU GLU A . n 
E 3 240 GLY 240 240 240 GLY GLY A . n 
E 3 241 GLU 241 241 241 GLU GLU A . n 
E 3 242 ILE 242 242 242 ILE ILE A . n 
E 3 243 ILE 243 243 243 ILE ILE A . n 
E 3 244 ARG 244 244 244 ARG ARG A . n 
E 3 245 PHE 245 245 245 PHE PHE A . n 
E 3 246 GLU 246 246 246 GLU GLU A . n 
E 3 247 THR 247 247 247 THR THR A . n 
E 3 248 GLU 248 248 248 GLU GLU A . n 
E 3 249 GLU 249 249 249 GLU GLU A . n 
E 3 250 THR 250 250 250 THR THR A . n 
E 3 251 ARG 251 251 251 ARG ARG A . n 
E 3 252 LYS 252 252 252 LYS LYS A . n 
E 3 253 LEU 253 253 253 LEU LEU A . n 
E 3 254 GLU 254 254 254 GLU GLU A . n 
E 3 255 ILE 255 255 255 ILE ILE A . n 
E 3 256 SER 256 256 256 SER SER A . n 
E 3 257 GLY 257 257 257 GLY GLY A . n 
E 3 258 MET 258 258 258 MET MET A . n 
E 3 259 PRO 259 259 259 PRO PRO A . n 
E 3 260 LEU 260 260 260 LEU LEU A . n 
E 3 261 GLY 261 261 261 GLY GLY A . n 
E 3 262 ASP 262 262 262 ASP ASP A . n 
E 3 263 LEU 263 263 263 LEU LEU A . n 
E 3 264 PHE 264 264 264 PHE PHE A . n 
E 3 265 HIS 265 265 265 HIS HIS A . n 
E 3 266 ILE 266 266 266 ILE ILE A . n 
E 3 267 ARG 267 267 267 ARG ARG A . n 
E 3 268 PHE 268 268 268 PHE PHE A . n 
E 3 269 ALA 269 269 269 ALA ALA A . n 
E 3 270 ALA 270 270 270 ALA ALA A . n 
E 3 271 ARG 271 271 271 ARG ARG A . n 
E 3 272 SER 272 272 272 SER SER A . n 
E 3 273 PRO 273 273 273 PRO PRO A . n 
E 3 274 GLU 274 274 274 GLU GLU A . n 
E 3 275 PHE 275 275 275 PHE PHE A . n 
E 3 276 LYS 276 276 276 LYS LYS A . n 
E 3 277 LYS 277 277 277 LYS LYS A . n 
E 3 278 HIS 278 278 278 HIS HIS A . n 
E 3 279 PRO 279 279 279 PRO PRO A . n 
E 3 280 ALA 280 280 280 ALA ALA A . n 
E 3 281 VAL 281 281 281 VAL VAL A . n 
E 3 282 ARG 282 282 282 ARG ARG A . n 
E 3 283 LYS 283 283 283 LYS LYS A . n 
E 3 284 GLU 284 284 284 GLU GLU A . n 
E 3 285 PRO 285 285 285 PRO PRO A . n 
E 3 286 GLY 286 286 286 GLY GLY A . n 
E 3 287 PRO 287 287 287 PRO PRO A . n 
E 3 288 GLY 288 288 288 GLY GLY A . n 
E 3 289 LEU 289 289 289 LEU LEU A . n 
E 3 290 VAL 290 290 290 VAL VAL A . n 
E 3 291 PRO 291 291 291 PRO PRO A . n 
E 3 292 VAL 292 292 292 VAL VAL A . n 
E 3 293 LEU 293 293 293 LEU LEU A . n 
E 3 294 THR 294 294 294 THR THR A . n 
E 3 295 GLY 295 295 295 GLY GLY A . n 
E 3 296 ARG 296 296 296 ARG ARG A . n 
E 3 297 ASN 297 297 297 ASN ASN A . n 
E 3 298 LEU 298 298 298 LEU LEU A . n 
E 3 299 LYS 299 299 299 LYS LYS A . n 
E 3 300 PRO 300 300 300 PRO PRO A . n 
E 3 301 GLY 301 301 301 GLY GLY A . n 
E 3 302 TRP 302 302 302 TRP TRP A . n 
E 3 303 VAL 303 303 303 VAL VAL A . n 
E 3 304 ASP 304 304 304 ASP ASP A . n 
E 3 305 TYR 305 305 305 TYR TYR A . n 
E 3 306 GLU 306 306 306 GLU GLU A . n 
E 3 307 LYS 307 307 307 LYS LYS A . n 
E 3 308 ASN 308 308 308 ASN ASN A . n 
E 3 309 HIS 309 309 309 HIS HIS A . n 
E 3 310 SER 310 310 310 SER SER A . n 
E 3 311 GLY 311 311 311 GLY GLY A . n 
E 3 312 LEU 312 312 312 LEU LEU A . n 
E 3 313 TRP 313 313 313 TRP TRP A . n 
E 3 314 MET 314 314 314 MET MET A . n 
E 3 315 PRO 315 315 315 PRO PRO A . n 
E 3 316 LYS 316 316 316 LYS LYS A . n 
E 3 317 GLU 317 317 317 GLU GLU A . n 
E 3 318 ARG 318 318 318 ARG ARG A . n 
E 3 319 ALA 319 319 319 ALA ALA A . n 
E 3 320 LYS 320 320 320 LYS LYS A . n 
E 3 321 GLU 321 321 321 GLU GLU A . n 
E 3 322 LEU 322 322 322 LEU LEU A . n 
E 3 323 ARG 323 323 323 ARG ARG A . n 
E 3 324 ASP 324 324 324 ASP ASP A . n 
E 3 325 PHE 325 325 325 PHE PHE A . n 
E 3 326 TYR 326 326 326 TYR TYR A . n 
E 3 327 ALA 327 327 327 ALA ALA A . n 
E 3 328 THR 328 328 328 THR THR A . n 
E 3 329 PRO 329 329 329 PRO PRO A . n 
E 3 330 HIS 330 330 330 HIS HIS A . n 
E 3 331 LEU 331 331 331 LEU LEU A . n 
E 3 332 VAL 332 332 332 VAL VAL A . n 
E 3 333 VAL 333 333 333 VAL VAL A . n 
E 3 334 ALA 334 334 334 ALA ALA A . n 
E 3 335 HIS 335 335 335 HIS HIS A . n 
E 3 336 THR 336 336 336 THR THR A . n 
E 3 337 LYS 337 337 337 LYS LYS A . n 
E 3 338 GLY 338 338 338 GLY GLY A . n 
E 3 339 THR 339 339 339 THR THR A . n 
E 3 340 ARG 340 340 340 ARG ARG A . n 
E 3 341 VAL 341 341 341 VAL VAL A . n 
E 3 342 VAL 342 342 342 VAL VAL A . n 
E 3 343 ALA 343 343 343 ALA ALA A . n 
E 3 344 ALA 344 344 344 ALA ALA A . n 
E 3 345 TRP 345 345 345 TRP TRP A . n 
E 3 346 ASP 346 346 346 ASP ASP A . n 
E 3 347 GLU 347 347 347 GLU GLU A . n 
E 3 348 ARG 348 348 348 ARG ARG A . n 
E 3 349 ALA 349 349 349 ALA ALA A . n 
E 3 350 TYR 350 350 350 TYR TYR A . n 
E 3 351 PRO 351 351 351 PRO PRO A . n 
E 3 352 TRP 352 352 352 TRP TRP A . n 
E 3 353 ARG 353 353 353 ARG ARG A . n 
E 3 354 GLU 354 354 354 GLU GLU A . n 
E 3 355 GLU 355 355 355 GLU GLU A . n 
E 3 356 PHE 356 356 356 PHE PHE A . n 
E 3 357 HIS 357 357 357 HIS HIS A . n 
E 3 358 LEU 358 358 358 LEU LEU A . n 
E 3 359 LEU 359 359 359 LEU LEU A . n 
E 3 360 PRO 360 360 360 PRO PRO A . n 
E 3 361 LYS 361 361 361 LYS LYS A . n 
E 3 362 GLU 362 362 362 GLU GLU A . n 
E 3 363 GLY 363 363 363 GLY GLY A . n 
E 3 364 VAL 364 364 364 VAL VAL A . n 
E 3 365 ARG 365 365 365 ARG ARG A . n 
E 3 366 LEU 366 366 366 LEU LEU A . n 
E 3 367 ASP 367 367 367 ASP ASP A . n 
E 3 368 PRO 368 368 368 PRO PRO A . n 
E 3 369 SER 369 369 369 SER SER A . n 
E 3 370 SER 370 370 370 SER SER A . n 
E 3 371 LEU 371 371 371 LEU LEU A . n 
E 3 372 VAL 372 372 372 VAL VAL A . n 
E 3 373 GLN 373 373 373 GLN GLN A . n 
E 3 374 TRP 374 374 374 TRP TRP A . n 
E 3 375 LEU 375 375 375 LEU LEU A . n 
E 3 376 ASN 376 376 376 ASN ASN A . n 
E 3 377 SER 377 377 377 SER SER A . n 
E 3 378 GLU 378 378 378 GLU GLU A . n 
E 3 379 ALA 379 379 379 ALA ALA A . n 
E 3 380 MET 380 380 380 MET MET A . n 
E 3 381 GLN 381 381 381 GLN GLN A . n 
E 3 382 LYS 382 382 382 LYS LYS A . n 
E 3 383 HIS 383 383 383 HIS HIS A . n 
E 3 384 VAL 384 384 384 VAL VAL A . n 
E 3 385 ARG 385 385 385 ARG ARG A . n 
E 3 386 THR 386 386 386 THR THR A . n 
E 3 387 LEU 387 387 387 LEU LEU A . n 
E 3 388 TYR 388 388 388 TYR TYR A . n 
E 3 389 ARG 389 389 389 ARG ARG A . n 
E 3 390 ASP 390 390 390 ASP ASP A . n 
E 3 391 PHE 391 391 391 PHE PHE A . n 
E 3 392 VAL 392 392 392 VAL VAL A . n 
E 3 393 PRO 393 393 393 PRO PRO A . n 
E 3 394 HIS 394 394 394 HIS HIS A . n 
E 3 395 LEU 395 395 395 LEU LEU A . n 
E 3 396 THR 396 396 396 THR THR A . n 
E 3 397 LEU 397 397 397 LEU LEU A . n 
E 3 398 ARG 398 398 398 ARG ARG A . n 
E 3 399 MET 399 399 399 MET MET A . n 
E 3 400 LEU 400 400 400 LEU LEU A . n 
E 3 401 GLU 401 401 401 GLU GLU A . n 
E 3 402 ARG 402 402 402 ARG ARG A . n 
E 3 403 LEU 403 403 403 LEU LEU A . n 
E 3 404 PRO 404 404 404 PRO PRO A . n 
E 3 405 VAL 405 405 405 VAL VAL A . n 
E 3 406 ARG 406 406 406 ARG ARG A . n 
E 3 407 ARG 407 407 407 ARG ARG A . n 
E 3 408 GLU 408 408 408 GLU GLU A . n 
E 3 409 TYR 409 409 409 TYR TYR A . n 
E 3 410 GLY 410 410 410 GLY GLY A . n 
E 3 411 PHE 411 411 411 PHE PHE A . n 
E 3 412 HIS 412 412 412 HIS HIS A . n 
E 3 413 THR 413 413 413 THR THR A . n 
E 3 414 SER 414 414 ?   ?   ?   A . n 
E 3 415 PRO 415 415 ?   ?   ?   A . n 
E 3 416 GLU 416 416 ?   ?   ?   A . n 
E 3 417 SER 417 417 ?   ?   ?   A . n 
E 3 418 ALA 418 418 ?   ?   ?   A . n 
E 3 419 ARG 419 419 ?   ?   ?   A . n 
E 3 420 ASN 420 420 ?   ?   ?   A . n 
E 3 421 PHE 421 421 ?   ?   ?   A . n 
F 3 1   MET 1   1   ?   ?   ?   D . n 
F 3 2   GLY 2   2   ?   ?   ?   D . n 
F 3 3   LEU 3   3   ?   ?   ?   D . n 
F 3 4   PRO 4   4   ?   ?   ?   D . n 
F 3 5   PRO 5   5   ?   ?   ?   D . n 
F 3 6   LEU 6   6   ?   ?   ?   D . n 
F 3 7   LEU 7   7   ?   ?   ?   D . n 
F 3 8   SER 8   8   ?   ?   ?   D . n 
F 3 9   LEU 9   9   ?   ?   ?   D . n 
F 3 10  PRO 10  10  ?   ?   ?   D . n 
F 3 11  SER 11  11  ?   ?   ?   D . n 
F 3 12  ASN 12  12  ?   ?   ?   D . n 
F 3 13  SER 13  13  ?   ?   ?   D . n 
F 3 14  ALA 14  14  ?   ?   ?   D . n 
F 3 15  PRO 15  15  ?   ?   ?   D . n 
F 3 16  ARG 16  16  ?   ?   ?   D . n 
F 3 17  SER 17  17  ?   ?   ?   D . n 
F 3 18  LEU 18  18  ?   ?   ?   D . n 
F 3 19  GLY 19  19  ?   ?   ?   D . n 
F 3 20  ARG 20  20  ?   ?   ?   D . n 
F 3 21  VAL 21  21  21  VAL VAL D . n 
F 3 22  GLU 22  22  22  GLU GLU D . n 
F 3 23  THR 23  23  23  THR THR D . n 
F 3 24  PRO 24  24  24  PRO PRO D . n 
F 3 25  PRO 25  25  25  PRO PRO D . n 
F 3 26  GLU 26  26  26  GLU GLU D . n 
F 3 27  VAL 27  27  27  VAL VAL D . n 
F 3 28  VAL 28  28  28  VAL VAL D . n 
F 3 29  ASP 29  29  29  ASP ASP D . n 
F 3 30  PHE 30  30  30  PHE PHE D . n 
F 3 31  MET 31  31  31  MET MET D . n 
F 3 32  VAL 32  32  32  VAL VAL D . n 
F 3 33  SER 33  33  33  SER SER D . n 
F 3 34  LEU 34  34  34  LEU LEU D . n 
F 3 35  ALA 35  35  35  ALA ALA D . n 
F 3 36  GLU 36  36  36  GLU GLU D . n 
F 3 37  ALA 37  37  37  ALA ALA D . n 
F 3 38  PRO 38  38  38  PRO PRO D . n 
F 3 39  ARG 39  39  39  ARG ARG D . n 
F 3 40  GLY 40  40  40  GLY GLY D . n 
F 3 41  GLY 41  41  41  GLY GLY D . n 
F 3 42  ARG 42  42  42  ARG ARG D . n 
F 3 43  VAL 43  43  43  VAL VAL D . n 
F 3 44  LEU 44  44  44  LEU LEU D . n 
F 3 45  GLU 45  45  45  GLU GLU D . n 
F 3 46  PRO 46  46  46  PRO PRO D . n 
F 3 47  ALA 47  47  47  ALA ALA D . n 
F 3 48  CYS 48  48  48  CYS CYS D . n 
F 3 49  ALA 49  49  49  ALA ALA D . n 
F 3 50  HIS 50  50  50  HIS HIS D . n 
F 3 51  GLY 51  51  51  GLY GLY D . n 
F 3 52  PRO 52  52  52  PRO PRO D . n 
F 3 53  PHE 53  53  53  PHE PHE D . n 
F 3 54  LEU 54  54  54  LEU LEU D . n 
F 3 55  ARG 55  55  55  ARG ARG D . n 
F 3 56  ALA 56  56  56  ALA ALA D . n 
F 3 57  PHE 57  57  57  PHE PHE D . n 
F 3 58  ARG 58  58  58  ARG ARG D . n 
F 3 59  GLU 59  59  59  GLU GLU D . n 
F 3 60  ALA 60  60  60  ALA ALA D . n 
F 3 61  HIS 61  61  61  HIS HIS D . n 
F 3 62  GLY 62  62  62  GLY GLY D . n 
F 3 63  THR 63  63  63  THR THR D . n 
F 3 64  ALA 64  64  64  ALA ALA D . n 
F 3 65  TYR 65  65  65  TYR TYR D . n 
F 3 66  ARG 66  66  66  ARG ARG D . n 
F 3 67  PHE 67  67  67  PHE PHE D . n 
F 3 68  VAL 68  68  68  VAL VAL D . n 
F 3 69  GLY 69  69  69  GLY GLY D . n 
F 3 70  VAL 70  70  70  VAL VAL D . n 
F 3 71  GLU 71  71  71  GLU GLU D . n 
F 3 72  ILE 72  72  72  ILE ILE D . n 
F 3 73  ASP 73  73  73  ASP ASP D . n 
F 3 74  PRO 74  74  74  PRO PRO D . n 
F 3 75  LYS 75  75  75  LYS LYS D . n 
F 3 76  ALA 76  76  76  ALA ALA D . n 
F 3 77  LEU 77  77  77  LEU LEU D . n 
F 3 78  ASP 78  78  78  ASP ASP D . n 
F 3 79  LEU 79  79  79  LEU LEU D . n 
F 3 80  PRO 80  80  80  PRO PRO D . n 
F 3 81  PRO 81  81  81  PRO PRO D . n 
F 3 82  TRP 82  82  82  TRP TRP D . n 
F 3 83  ALA 83  83  83  ALA ALA D . n 
F 3 84  GLU 84  84  84  GLU GLU D . n 
F 3 85  GLY 85  85  85  GLY GLY D . n 
F 3 86  ILE 86  86  86  ILE ILE D . n 
F 3 87  LEU 87  87  87  LEU LEU D . n 
F 3 88  ALA 88  88  88  ALA ALA D . n 
F 3 89  ASP 89  89  89  ASP ASP D . n 
F 3 90  PHE 90  90  90  PHE PHE D . n 
F 3 91  LEU 91  91  91  LEU LEU D . n 
F 3 92  LEU 92  92  92  LEU LEU D . n 
F 3 93  TRP 93  93  93  TRP TRP D . n 
F 3 94  GLU 94  94  94  GLU GLU D . n 
F 3 95  PRO 95  95  95  PRO PRO D . n 
F 3 96  GLY 96  96  96  GLY GLY D . n 
F 3 97  GLU 97  97  97  GLU GLU D . n 
F 3 98  ALA 98  98  98  ALA ALA D . n 
F 3 99  PHE 99  99  99  PHE PHE D . n 
F 3 100 ASP 100 100 100 ASP ASP D . n 
F 3 101 LEU 101 101 101 LEU LEU D . n 
F 3 102 ILE 102 102 102 ILE ILE D . n 
F 3 103 LEU 103 103 103 LEU LEU D . n 
F 3 104 GLY 104 104 104 GLY GLY D . n 
F 3 105 ASN 105 105 105 ASN ASN D . n 
F 3 106 PRO 106 106 106 PRO PRO D . n 
F 3 107 PRO 107 107 107 PRO PRO D . n 
F 3 108 TYR 108 108 108 TYR TYR D . n 
F 3 109 GLY 109 109 109 GLY GLY D . n 
F 3 110 ILE 110 110 110 ILE ILE D . n 
F 3 111 VAL 111 111 111 VAL VAL D . n 
F 3 112 GLY 112 112 112 GLY GLY D . n 
F 3 113 GLU 113 113 113 GLU GLU D . n 
F 3 114 ALA 114 114 114 ALA ALA D . n 
F 3 115 SER 115 115 115 SER SER D . n 
F 3 116 LYS 116 116 116 LYS LYS D . n 
F 3 117 TYR 117 117 117 TYR TYR D . n 
F 3 118 PRO 118 118 118 PRO PRO D . n 
F 3 119 ILE 119 119 119 ILE ILE D . n 
F 3 120 HIS 120 120 120 HIS HIS D . n 
F 3 121 VAL 121 121 121 VAL VAL D . n 
F 3 122 PHE 122 122 122 PHE PHE D . n 
F 3 123 LYS 123 123 123 LYS LYS D . n 
F 3 124 ALA 124 124 124 ALA ALA D . n 
F 3 125 VAL 125 125 125 VAL VAL D . n 
F 3 126 LYS 126 126 126 LYS LYS D . n 
F 3 127 ASP 127 127 127 ASP ASP D . n 
F 3 128 LEU 128 128 128 LEU LEU D . n 
F 3 129 TYR 129 129 129 TYR TYR D . n 
F 3 130 LYS 130 130 130 LYS LYS D . n 
F 3 131 LYS 131 131 131 LYS LYS D . n 
F 3 132 ALA 132 132 132 ALA ALA D . n 
F 3 133 PHE 133 133 133 PHE PHE D . n 
F 3 134 SER 134 134 134 SER SER D . n 
F 3 135 THR 135 135 135 THR THR D . n 
F 3 136 TRP 136 136 136 TRP TRP D . n 
F 3 137 LYS 137 137 137 LYS LYS D . n 
F 3 138 GLY 138 138 138 GLY GLY D . n 
F 3 139 LYS 139 139 139 LYS LYS D . n 
F 3 140 TYR 140 140 140 TYR TYR D . n 
F 3 141 ASN 141 141 141 ASN ASN D . n 
F 3 142 LEU 142 142 142 LEU LEU D . n 
F 3 143 TYR 143 143 143 TYR TYR D . n 
F 3 144 GLY 144 144 144 GLY GLY D . n 
F 3 145 ALA 145 145 145 ALA ALA D . n 
F 3 146 PHE 146 146 146 PHE PHE D . n 
F 3 147 LEU 147 147 147 LEU LEU D . n 
F 3 148 GLU 148 148 148 GLU GLU D . n 
F 3 149 LYS 149 149 149 LYS LYS D . n 
F 3 150 ALA 150 150 150 ALA ALA D . n 
F 3 151 VAL 151 151 151 VAL VAL D . n 
F 3 152 ARG 152 152 152 ARG ARG D . n 
F 3 153 LEU 153 153 153 LEU LEU D . n 
F 3 154 LEU 154 154 154 LEU LEU D . n 
F 3 155 LYS 155 155 155 LYS LYS D . n 
F 3 156 PRO 156 156 156 PRO PRO D . n 
F 3 157 GLY 157 157 157 GLY GLY D . n 
F 3 158 GLY 158 158 158 GLY GLY D . n 
F 3 159 VAL 159 159 159 VAL VAL D . n 
F 3 160 LEU 160 160 160 LEU LEU D . n 
F 3 161 VAL 161 161 161 VAL VAL D . n 
F 3 162 PHE 162 162 162 PHE PHE D . n 
F 3 163 VAL 163 163 163 VAL VAL D . n 
F 3 164 VAL 164 164 164 VAL VAL D . n 
F 3 165 PRO 165 165 165 PRO PRO D . n 
F 3 166 ALA 166 166 166 ALA ALA D . n 
F 3 167 THR 167 167 167 THR THR D . n 
F 3 168 TRP 168 168 168 TRP TRP D . n 
F 3 169 LEU 169 169 169 LEU LEU D . n 
F 3 170 VAL 170 170 170 VAL VAL D . n 
F 3 171 LEU 171 171 171 LEU LEU D . n 
F 3 172 GLU 172 172 172 GLU GLU D . n 
F 3 173 ASP 173 173 173 ASP ASP D . n 
F 3 174 PHE 174 174 174 PHE PHE D . n 
F 3 175 ALA 175 175 175 ALA ALA D . n 
F 3 176 LEU 176 176 176 LEU LEU D . n 
F 3 177 LEU 177 177 177 LEU LEU D . n 
F 3 178 ARG 178 178 178 ARG ARG D . n 
F 3 179 GLU 179 179 179 GLU GLU D . n 
F 3 180 PHE 180 180 180 PHE PHE D . n 
F 3 181 LEU 181 181 181 LEU LEU D . n 
F 3 182 ALA 182 182 182 ALA ALA D . n 
F 3 183 ARG 183 183 183 ARG ARG D . n 
F 3 184 GLU 184 184 184 GLU GLU D . n 
F 3 185 GLY 185 185 185 GLY GLY D . n 
F 3 186 LYS 186 186 186 LYS LYS D . n 
F 3 187 THR 187 187 187 THR THR D . n 
F 3 188 SER 188 188 188 SER SER D . n 
F 3 189 VAL 189 189 189 VAL VAL D . n 
F 3 190 TYR 190 190 190 TYR TYR D . n 
F 3 191 TYR 191 191 191 TYR TYR D . n 
F 3 192 LEU 192 192 192 LEU LEU D . n 
F 3 193 GLY 193 193 193 GLY GLY D . n 
F 3 194 GLU 194 194 194 GLU GLU D . n 
F 3 195 VAL 195 195 195 VAL VAL D . n 
F 3 196 PHE 196 196 196 PHE PHE D . n 
F 3 197 PRO 197 197 197 PRO PRO D . n 
F 3 198 GLN 198 198 198 GLN GLN D . n 
F 3 199 LYS 199 199 199 LYS LYS D . n 
F 3 200 LYS 200 200 200 LYS LYS D . n 
F 3 201 VAL 201 201 201 VAL VAL D . n 
F 3 202 SER 202 202 202 SER SER D . n 
F 3 203 ALA 203 203 203 ALA ALA D . n 
F 3 204 VAL 204 204 204 VAL VAL D . n 
F 3 205 VAL 205 205 205 VAL VAL D . n 
F 3 206 ILE 206 206 206 ILE ILE D . n 
F 3 207 ARG 207 207 207 ARG ARG D . n 
F 3 208 PHE 208 208 208 PHE PHE D . n 
F 3 209 GLN 209 209 209 GLN GLN D . n 
F 3 210 LYS 210 210 210 LYS LYS D . n 
F 3 211 SER 211 211 211 SER SER D . n 
F 3 212 GLY 212 212 212 GLY GLY D . n 
F 3 213 LYS 213 213 213 LYS LYS D . n 
F 3 214 GLY 214 214 214 GLY GLY D . n 
F 3 215 LEU 215 215 215 LEU LEU D . n 
F 3 216 SER 216 216 216 SER SER D . n 
F 3 217 LEU 217 217 217 LEU LEU D . n 
F 3 218 TRP 218 218 218 TRP TRP D . n 
F 3 219 ASP 219 219 219 ASP ASP D . n 
F 3 220 THR 220 220 220 THR THR D . n 
F 3 221 GLN 221 221 221 GLN GLN D . n 
F 3 222 GLU 222 222 222 GLU GLU D . n 
F 3 223 SER 223 223 223 SER SER D . n 
F 3 224 GLU 224 224 224 GLU GLU D . n 
F 3 225 SER 225 225 225 SER SER D . n 
F 3 226 GLY 226 226 226 GLY GLY D . n 
F 3 227 PHE 227 227 227 PHE PHE D . n 
F 3 228 THR 228 228 228 THR THR D . n 
F 3 229 PRO 229 229 229 PRO PRO D . n 
F 3 230 ILE 230 230 230 ILE ILE D . n 
F 3 231 LEU 231 231 231 LEU LEU D . n 
F 3 232 TRP 232 232 232 TRP TRP D . n 
F 3 233 ALA 233 233 233 ALA ALA D . n 
F 3 234 GLU 234 234 234 GLU GLU D . n 
F 3 235 TYR 235 235 235 TYR TYR D . n 
F 3 236 PRO 236 236 236 PRO PRO D . n 
F 3 237 HIS 237 237 237 HIS HIS D . n 
F 3 238 TRP 238 238 238 TRP TRP D . n 
F 3 239 GLU 239 239 239 GLU GLU D . n 
F 3 240 GLY 240 240 240 GLY GLY D . n 
F 3 241 GLU 241 241 241 GLU GLU D . n 
F 3 242 ILE 242 242 242 ILE ILE D . n 
F 3 243 ILE 243 243 243 ILE ILE D . n 
F 3 244 ARG 244 244 244 ARG ARG D . n 
F 3 245 PHE 245 245 245 PHE PHE D . n 
F 3 246 GLU 246 246 246 GLU GLU D . n 
F 3 247 THR 247 247 247 THR THR D . n 
F 3 248 GLU 248 248 248 GLU GLU D . n 
F 3 249 GLU 249 249 249 GLU GLU D . n 
F 3 250 THR 250 250 250 THR THR D . n 
F 3 251 ARG 251 251 251 ARG ARG D . n 
F 3 252 LYS 252 252 252 LYS LYS D . n 
F 3 253 LEU 253 253 253 LEU LEU D . n 
F 3 254 GLU 254 254 254 GLU GLU D . n 
F 3 255 ILE 255 255 255 ILE ILE D . n 
F 3 256 SER 256 256 256 SER SER D . n 
F 3 257 GLY 257 257 257 GLY GLY D . n 
F 3 258 MET 258 258 258 MET MET D . n 
F 3 259 PRO 259 259 259 PRO PRO D . n 
F 3 260 LEU 260 260 260 LEU LEU D . n 
F 3 261 GLY 261 261 261 GLY GLY D . n 
F 3 262 ASP 262 262 262 ASP ASP D . n 
F 3 263 LEU 263 263 263 LEU LEU D . n 
F 3 264 PHE 264 264 264 PHE PHE D . n 
F 3 265 HIS 265 265 265 HIS HIS D . n 
F 3 266 ILE 266 266 266 ILE ILE D . n 
F 3 267 ARG 267 267 267 ARG ARG D . n 
F 3 268 PHE 268 268 268 PHE PHE D . n 
F 3 269 ALA 269 269 269 ALA ALA D . n 
F 3 270 ALA 270 270 270 ALA ALA D . n 
F 3 271 ARG 271 271 271 ARG ARG D . n 
F 3 272 SER 272 272 272 SER SER D . n 
F 3 273 PRO 273 273 273 PRO PRO D . n 
F 3 274 GLU 274 274 274 GLU GLU D . n 
F 3 275 PHE 275 275 275 PHE PHE D . n 
F 3 276 LYS 276 276 276 LYS LYS D . n 
F 3 277 LYS 277 277 277 LYS LYS D . n 
F 3 278 HIS 278 278 278 HIS HIS D . n 
F 3 279 PRO 279 279 279 PRO PRO D . n 
F 3 280 ALA 280 280 280 ALA ALA D . n 
F 3 281 VAL 281 281 281 VAL VAL D . n 
F 3 282 ARG 282 282 282 ARG ARG D . n 
F 3 283 LYS 283 283 283 LYS LYS D . n 
F 3 284 GLU 284 284 284 GLU GLU D . n 
F 3 285 PRO 285 285 285 PRO PRO D . n 
F 3 286 GLY 286 286 286 GLY GLY D . n 
F 3 287 PRO 287 287 287 PRO PRO D . n 
F 3 288 GLY 288 288 288 GLY GLY D . n 
F 3 289 LEU 289 289 289 LEU LEU D . n 
F 3 290 VAL 290 290 290 VAL VAL D . n 
F 3 291 PRO 291 291 291 PRO PRO D . n 
F 3 292 VAL 292 292 292 VAL VAL D . n 
F 3 293 LEU 293 293 293 LEU LEU D . n 
F 3 294 THR 294 294 294 THR THR D . n 
F 3 295 GLY 295 295 295 GLY GLY D . n 
F 3 296 ARG 296 296 296 ARG ARG D . n 
F 3 297 ASN 297 297 297 ASN ASN D . n 
F 3 298 LEU 298 298 298 LEU LEU D . n 
F 3 299 LYS 299 299 299 LYS LYS D . n 
F 3 300 PRO 300 300 300 PRO PRO D . n 
F 3 301 GLY 301 301 301 GLY GLY D . n 
F 3 302 TRP 302 302 302 TRP TRP D . n 
F 3 303 VAL 303 303 303 VAL VAL D . n 
F 3 304 ASP 304 304 304 ASP ASP D . n 
F 3 305 TYR 305 305 305 TYR TYR D . n 
F 3 306 GLU 306 306 306 GLU GLU D . n 
F 3 307 LYS 307 307 307 LYS LYS D . n 
F 3 308 ASN 308 308 308 ASN ASN D . n 
F 3 309 HIS 309 309 309 HIS HIS D . n 
F 3 310 SER 310 310 310 SER SER D . n 
F 3 311 GLY 311 311 311 GLY GLY D . n 
F 3 312 LEU 312 312 312 LEU LEU D . n 
F 3 313 TRP 313 313 313 TRP TRP D . n 
F 3 314 MET 314 314 314 MET MET D . n 
F 3 315 PRO 315 315 315 PRO PRO D . n 
F 3 316 LYS 316 316 316 LYS LYS D . n 
F 3 317 GLU 317 317 317 GLU GLU D . n 
F 3 318 ARG 318 318 318 ARG ARG D . n 
F 3 319 ALA 319 319 319 ALA ALA D . n 
F 3 320 LYS 320 320 320 LYS LYS D . n 
F 3 321 GLU 321 321 321 GLU GLU D . n 
F 3 322 LEU 322 322 322 LEU LEU D . n 
F 3 323 ARG 323 323 323 ARG ARG D . n 
F 3 324 ASP 324 324 324 ASP ASP D . n 
F 3 325 PHE 325 325 325 PHE PHE D . n 
F 3 326 TYR 326 326 326 TYR TYR D . n 
F 3 327 ALA 327 327 327 ALA ALA D . n 
F 3 328 THR 328 328 328 THR THR D . n 
F 3 329 PRO 329 329 329 PRO PRO D . n 
F 3 330 HIS 330 330 330 HIS HIS D . n 
F 3 331 LEU 331 331 331 LEU LEU D . n 
F 3 332 VAL 332 332 332 VAL VAL D . n 
F 3 333 VAL 333 333 333 VAL VAL D . n 
F 3 334 ALA 334 334 334 ALA ALA D . n 
F 3 335 HIS 335 335 335 HIS HIS D . n 
F 3 336 THR 336 336 336 THR THR D . n 
F 3 337 LYS 337 337 337 LYS LYS D . n 
F 3 338 GLY 338 338 338 GLY GLY D . n 
F 3 339 THR 339 339 339 THR THR D . n 
F 3 340 ARG 340 340 340 ARG ARG D . n 
F 3 341 VAL 341 341 341 VAL VAL D . n 
F 3 342 VAL 342 342 342 VAL VAL D . n 
F 3 343 ALA 343 343 343 ALA ALA D . n 
F 3 344 ALA 344 344 344 ALA ALA D . n 
F 3 345 TRP 345 345 345 TRP TRP D . n 
F 3 346 ASP 346 346 346 ASP ASP D . n 
F 3 347 GLU 347 347 347 GLU GLU D . n 
F 3 348 ARG 348 348 348 ARG ARG D . n 
F 3 349 ALA 349 349 349 ALA ALA D . n 
F 3 350 TYR 350 350 350 TYR TYR D . n 
F 3 351 PRO 351 351 351 PRO PRO D . n 
F 3 352 TRP 352 352 352 TRP TRP D . n 
F 3 353 ARG 353 353 353 ARG ARG D . n 
F 3 354 GLU 354 354 354 GLU GLU D . n 
F 3 355 GLU 355 355 355 GLU GLU D . n 
F 3 356 PHE 356 356 356 PHE PHE D . n 
F 3 357 HIS 357 357 357 HIS HIS D . n 
F 3 358 LEU 358 358 358 LEU LEU D . n 
F 3 359 LEU 359 359 359 LEU LEU D . n 
F 3 360 PRO 360 360 360 PRO PRO D . n 
F 3 361 LYS 361 361 361 LYS LYS D . n 
F 3 362 GLU 362 362 362 GLU GLU D . n 
F 3 363 GLY 363 363 363 GLY GLY D . n 
F 3 364 VAL 364 364 364 VAL VAL D . n 
F 3 365 ARG 365 365 365 ARG ARG D . n 
F 3 366 LEU 366 366 366 LEU LEU D . n 
F 3 367 ASP 367 367 367 ASP ASP D . n 
F 3 368 PRO 368 368 368 PRO PRO D . n 
F 3 369 SER 369 369 369 SER SER D . n 
F 3 370 SER 370 370 370 SER SER D . n 
F 3 371 LEU 371 371 371 LEU LEU D . n 
F 3 372 VAL 372 372 372 VAL VAL D . n 
F 3 373 GLN 373 373 373 GLN GLN D . n 
F 3 374 TRP 374 374 374 TRP TRP D . n 
F 3 375 LEU 375 375 375 LEU LEU D . n 
F 3 376 ASN 376 376 376 ASN ASN D . n 
F 3 377 SER 377 377 377 SER SER D . n 
F 3 378 GLU 378 378 378 GLU GLU D . n 
F 3 379 ALA 379 379 379 ALA ALA D . n 
F 3 380 MET 380 380 380 MET MET D . n 
F 3 381 GLN 381 381 381 GLN GLN D . n 
F 3 382 LYS 382 382 382 LYS LYS D . n 
F 3 383 HIS 383 383 383 HIS HIS D . n 
F 3 384 VAL 384 384 384 VAL VAL D . n 
F 3 385 ARG 385 385 385 ARG ARG D . n 
F 3 386 THR 386 386 386 THR THR D . n 
F 3 387 LEU 387 387 387 LEU LEU D . n 
F 3 388 TYR 388 388 388 TYR TYR D . n 
F 3 389 ARG 389 389 389 ARG ARG D . n 
F 3 390 ASP 390 390 390 ASP ASP D . n 
F 3 391 PHE 391 391 391 PHE PHE D . n 
F 3 392 VAL 392 392 392 VAL VAL D . n 
F 3 393 PRO 393 393 393 PRO PRO D . n 
F 3 394 HIS 394 394 394 HIS HIS D . n 
F 3 395 LEU 395 395 395 LEU LEU D . n 
F 3 396 THR 396 396 396 THR THR D . n 
F 3 397 LEU 397 397 397 LEU LEU D . n 
F 3 398 ARG 398 398 398 ARG ARG D . n 
F 3 399 MET 399 399 399 MET MET D . n 
F 3 400 LEU 400 400 400 LEU LEU D . n 
F 3 401 GLU 401 401 401 GLU GLU D . n 
F 3 402 ARG 402 402 402 ARG ARG D . n 
F 3 403 LEU 403 403 403 LEU LEU D . n 
F 3 404 PRO 404 404 404 PRO PRO D . n 
F 3 405 VAL 405 405 405 VAL VAL D . n 
F 3 406 ARG 406 406 406 ARG ARG D . n 
F 3 407 ARG 407 407 407 ARG ARG D . n 
F 3 408 GLU 408 408 408 GLU GLU D . n 
F 3 409 TYR 409 409 409 TYR TYR D . n 
F 3 410 GLY 410 410 410 GLY GLY D . n 
F 3 411 PHE 411 411 411 PHE PHE D . n 
F 3 412 HIS 412 412 412 HIS HIS D . n 
F 3 413 THR 413 413 413 THR THR D . n 
F 3 414 SER 414 414 ?   ?   ?   D . n 
F 3 415 PRO 415 415 ?   ?   ?   D . n 
F 3 416 GLU 416 416 ?   ?   ?   D . n 
F 3 417 SER 417 417 ?   ?   ?   D . n 
F 3 418 ALA 418 418 ?   ?   ?   D . n 
F 3 419 ARG 419 419 ?   ?   ?   D . n 
F 3 420 ASN 420 420 ?   ?   ?   D . n 
F 3 421 PHE 421 421 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 NEA 1   2001 1    NEA NEA A . 
H 5 GOL 1   3001 1    GOL GOL A . 
I 5 GOL 1   3002 2    GOL GOL A . 
J 5 GOL 1   3007 7    GOL GOL A . 
K 4 NEA 1   2002 2    NEA NEA D . 
L 5 GOL 1   3003 3    GOL GOL D . 
M 5 GOL 1   3004 4    GOL GOL D . 
N 5 GOL 1   3005 5    GOL GOL D . 
O 5 GOL 1   3006 6    GOL GOL D . 
P 6 HOH 1   11   10   HOH HOH B . 
P 6 HOH 2   12   26   HOH HOH B . 
P 6 HOH 3   13   30   HOH HOH B . 
P 6 HOH 4   14   31   HOH HOH B . 
P 6 HOH 5   15   80   HOH HOH B . 
P 6 HOH 6   16   125  HOH HOH B . 
P 6 HOH 7   17   147  HOH HOH B . 
P 6 HOH 8   18   211  HOH HOH B . 
P 6 HOH 9   19   228  HOH HOH B . 
P 6 HOH 10  20   316  HOH HOH B . 
P 6 HOH 11  21   368  HOH HOH B . 
P 6 HOH 12  22   413  HOH HOH B . 
P 6 HOH 13  23   420  HOH HOH B . 
P 6 HOH 14  24   422  HOH HOH B . 
P 6 HOH 15  25   425  HOH HOH B . 
P 6 HOH 16  26   428  HOH HOH B . 
P 6 HOH 17  27   436  HOH HOH B . 
P 6 HOH 18  28   445  HOH HOH B . 
P 6 HOH 19  29   446  HOH HOH B . 
P 6 HOH 20  30   448  HOH HOH B . 
P 6 HOH 21  31   456  HOH HOH B . 
P 6 HOH 22  32   471  HOH HOH B . 
P 6 HOH 23  33   477  HOH HOH B . 
P 6 HOH 24  34   478  HOH HOH B . 
P 6 HOH 25  35   489  HOH HOH B . 
P 6 HOH 26  36   496  HOH HOH B . 
P 6 HOH 27  37   518  HOH HOH B . 
P 6 HOH 28  38   520  HOH HOH B . 
P 6 HOH 29  39   542  HOH HOH B . 
P 6 HOH 30  40   559  HOH HOH B . 
P 6 HOH 31  41   565  HOH HOH B . 
P 6 HOH 32  42   566  HOH HOH B . 
P 6 HOH 33  43   601  HOH HOH B . 
P 6 HOH 34  44   623  HOH HOH B . 
P 6 HOH 35  45   653  HOH HOH B . 
P 6 HOH 36  46   664  HOH HOH B . 
P 6 HOH 37  47   684  HOH HOH B . 
P 6 HOH 38  48   687  HOH HOH B . 
P 6 HOH 39  49   700  HOH HOH B . 
P 6 HOH 40  50   764  HOH HOH B . 
P 6 HOH 41  51   776  HOH HOH B . 
P 6 HOH 42  52   800  HOH HOH B . 
P 6 HOH 43  53   819  HOH HOH B . 
P 6 HOH 44  54   884  HOH HOH B . 
P 6 HOH 45  55   889  HOH HOH B . 
P 6 HOH 46  56   917  HOH HOH B . 
P 6 HOH 47  57   1019 HOH HOH B . 
P 6 HOH 48  58   1030 HOH HOH B . 
P 6 HOH 49  59   1040 HOH HOH B . 
Q 6 HOH 1   48   48   HOH HOH C . 
Q 6 HOH 2   72   72   HOH HOH C . 
Q 6 HOH 3   96   96   HOH HOH C . 
Q 6 HOH 4   118  118  HOH HOH C . 
Q 6 HOH 5   129  129  HOH HOH C . 
Q 6 HOH 6   144  144  HOH HOH C . 
Q 6 HOH 7   169  169  HOH HOH C . 
Q 6 HOH 8   188  188  HOH HOH C . 
Q 6 HOH 9   245  245  HOH HOH C . 
Q 6 HOH 10  258  258  HOH HOH C . 
Q 6 HOH 11  263  263  HOH HOH C . 
Q 6 HOH 12  346  346  HOH HOH C . 
Q 6 HOH 13  358  358  HOH HOH C . 
Q 6 HOH 14  373  373  HOH HOH C . 
Q 6 HOH 15  386  386  HOH HOH C . 
Q 6 HOH 16  433  433  HOH HOH C . 
Q 6 HOH 17  458  458  HOH HOH C . 
Q 6 HOH 18  479  479  HOH HOH C . 
Q 6 HOH 19  482  482  HOH HOH C . 
Q 6 HOH 20  501  501  HOH HOH C . 
Q 6 HOH 21  513  513  HOH HOH C . 
Q 6 HOH 22  519  519  HOH HOH C . 
Q 6 HOH 23  556  556  HOH HOH C . 
Q 6 HOH 24  573  573  HOH HOH C . 
Q 6 HOH 25  597  597  HOH HOH C . 
Q 6 HOH 26  628  628  HOH HOH C . 
Q 6 HOH 27  629  629  HOH HOH C . 
Q 6 HOH 28  646  646  HOH HOH C . 
Q 6 HOH 29  668  668  HOH HOH C . 
Q 6 HOH 30  699  699  HOH HOH C . 
Q 6 HOH 31  784  784  HOH HOH C . 
Q 6 HOH 32  797  797  HOH HOH C . 
Q 6 HOH 33  803  803  HOH HOH C . 
Q 6 HOH 34  810  810  HOH HOH C . 
Q 6 HOH 35  852  852  HOH HOH C . 
Q 6 HOH 36  882  882  HOH HOH C . 
Q 6 HOH 37  883  883  HOH HOH C . 
Q 6 HOH 38  913  913  HOH HOH C . 
Q 6 HOH 39  1003 1003 HOH HOH C . 
Q 6 HOH 40  1015 1015 HOH HOH C . 
Q 6 HOH 41  1029 1029 HOH HOH C . 
R 6 HOH 1   13   13   HOH HOH E . 
R 6 HOH 2   14   14   HOH HOH E . 
R 6 HOH 3   22   22   HOH HOH E . 
R 6 HOH 4   29   29   HOH HOH E . 
R 6 HOH 5   59   59   HOH HOH E . 
R 6 HOH 6   134  134  HOH HOH E . 
R 6 HOH 7   221  221  HOH HOH E . 
R 6 HOH 8   260  260  HOH HOH E . 
R 6 HOH 9   261  261  HOH HOH E . 
R 6 HOH 10  289  289  HOH HOH E . 
R 6 HOH 11  307  307  HOH HOH E . 
R 6 HOH 12  333  333  HOH HOH E . 
R 6 HOH 13  385  385  HOH HOH E . 
R 6 HOH 14  429  429  HOH HOH E . 
R 6 HOH 15  431  431  HOH HOH E . 
R 6 HOH 16  434  434  HOH HOH E . 
R 6 HOH 17  435  435  HOH HOH E . 
R 6 HOH 18  440  440  HOH HOH E . 
R 6 HOH 19  442  442  HOH HOH E . 
R 6 HOH 20  457  457  HOH HOH E . 
R 6 HOH 21  462  462  HOH HOH E . 
R 6 HOH 22  470  470  HOH HOH E . 
R 6 HOH 23  476  476  HOH HOH E . 
R 6 HOH 24  507  507  HOH HOH E . 
R 6 HOH 25  510  510  HOH HOH E . 
R 6 HOH 26  558  558  HOH HOH E . 
R 6 HOH 27  575  575  HOH HOH E . 
R 6 HOH 28  595  595  HOH HOH E . 
R 6 HOH 29  598  598  HOH HOH E . 
R 6 HOH 30  599  599  HOH HOH E . 
R 6 HOH 31  617  617  HOH HOH E . 
R 6 HOH 32  624  624  HOH HOH E . 
R 6 HOH 33  635  635  HOH HOH E . 
R 6 HOH 34  643  643  HOH HOH E . 
R 6 HOH 35  669  669  HOH HOH E . 
R 6 HOH 36  679  679  HOH HOH E . 
R 6 HOH 37  693  693  HOH HOH E . 
R 6 HOH 38  696  696  HOH HOH E . 
R 6 HOH 39  719  719  HOH HOH E . 
R 6 HOH 40  734  734  HOH HOH E . 
R 6 HOH 41  740  740  HOH HOH E . 
R 6 HOH 42  746  746  HOH HOH E . 
R 6 HOH 43  779  779  HOH HOH E . 
R 6 HOH 44  783  783  HOH HOH E . 
R 6 HOH 45  828  828  HOH HOH E . 
R 6 HOH 46  876  876  HOH HOH E . 
R 6 HOH 47  897  897  HOH HOH E . 
R 6 HOH 48  909  909  HOH HOH E . 
R 6 HOH 49  948  948  HOH HOH E . 
R 6 HOH 50  950  950  HOH HOH E . 
R 6 HOH 51  955  955  HOH HOH E . 
R 6 HOH 52  959  959  HOH HOH E . 
R 6 HOH 53  967  967  HOH HOH E . 
R 6 HOH 54  1021 1021 HOH HOH E . 
R 6 HOH 55  1034 1034 HOH HOH E . 
R 6 HOH 56  1037 1037 HOH HOH E . 
S 6 HOH 1   21   4    HOH HOH F . 
S 6 HOH 2   22   17   HOH HOH F . 
S 6 HOH 3   23   47   HOH HOH F . 
S 6 HOH 4   24   92   HOH HOH F . 
S 6 HOH 5   25   95   HOH HOH F . 
S 6 HOH 6   26   106  HOH HOH F . 
S 6 HOH 7   27   109  HOH HOH F . 
S 6 HOH 8   28   157  HOH HOH F . 
S 6 HOH 9   29   159  HOH HOH F . 
S 6 HOH 10  30   181  HOH HOH F . 
S 6 HOH 11  31   230  HOH HOH F . 
S 6 HOH 12  32   235  HOH HOH F . 
S 6 HOH 13  33   252  HOH HOH F . 
S 6 HOH 14  34   253  HOH HOH F . 
S 6 HOH 15  35   254  HOH HOH F . 
S 6 HOH 16  36   265  HOH HOH F . 
S 6 HOH 17  37   323  HOH HOH F . 
S 6 HOH 18  38   342  HOH HOH F . 
S 6 HOH 19  39   344  HOH HOH F . 
S 6 HOH 20  40   382  HOH HOH F . 
S 6 HOH 21  41   398  HOH HOH F . 
S 6 HOH 22  42   402  HOH HOH F . 
S 6 HOH 23  43   408  HOH HOH F . 
S 6 HOH 24  44   493  HOH HOH F . 
S 6 HOH 25  45   503  HOH HOH F . 
S 6 HOH 26  46   526  HOH HOH F . 
S 6 HOH 27  47   577  HOH HOH F . 
S 6 HOH 28  48   685  HOH HOH F . 
S 6 HOH 29  49   745  HOH HOH F . 
S 6 HOH 30  50   818  HOH HOH F . 
S 6 HOH 31  51   859  HOH HOH F . 
S 6 HOH 32  52   861  HOH HOH F . 
S 6 HOH 33  53   895  HOH HOH F . 
S 6 HOH 34  54   899  HOH HOH F . 
S 6 HOH 35  55   946  HOH HOH F . 
S 6 HOH 36  56   970  HOH HOH F . 
T 6 HOH 1   3008 1    HOH HOH A . 
T 6 HOH 2   3009 3    HOH HOH A . 
T 6 HOH 3   3010 5    HOH HOH A . 
T 6 HOH 4   3011 9    HOH HOH A . 
T 6 HOH 5   3012 15   HOH HOH A . 
T 6 HOH 6   3013 25   HOH HOH A . 
T 6 HOH 7   3014 27   HOH HOH A . 
T 6 HOH 8   3015 32   HOH HOH A . 
T 6 HOH 9   3016 35   HOH HOH A . 
T 6 HOH 10  3017 36   HOH HOH A . 
T 6 HOH 11  3018 37   HOH HOH A . 
T 6 HOH 12  3019 38   HOH HOH A . 
T 6 HOH 13  3020 42   HOH HOH A . 
T 6 HOH 14  3021 45   HOH HOH A . 
T 6 HOH 15  3022 49   HOH HOH A . 
T 6 HOH 16  3023 51   HOH HOH A . 
T 6 HOH 17  3024 52   HOH HOH A . 
T 6 HOH 18  3025 53   HOH HOH A . 
T 6 HOH 19  3026 57   HOH HOH A . 
T 6 HOH 20  3027 60   HOH HOH A . 
T 6 HOH 21  3028 65   HOH HOH A . 
T 6 HOH 22  3029 67   HOH HOH A . 
T 6 HOH 23  3030 71   HOH HOH A . 
T 6 HOH 24  3031 79   HOH HOH A . 
T 6 HOH 25  3032 81   HOH HOH A . 
T 6 HOH 26  3033 83   HOH HOH A . 
T 6 HOH 27  3034 87   HOH HOH A . 
T 6 HOH 28  3035 89   HOH HOH A . 
T 6 HOH 29  3036 90   HOH HOH A . 
T 6 HOH 30  3037 91   HOH HOH A . 
T 6 HOH 31  3038 93   HOH HOH A . 
T 6 HOH 32  3039 99   HOH HOH A . 
T 6 HOH 33  3040 100  HOH HOH A . 
T 6 HOH 34  3041 102  HOH HOH A . 
T 6 HOH 35  3042 110  HOH HOH A . 
T 6 HOH 36  3043 112  HOH HOH A . 
T 6 HOH 37  3044 113  HOH HOH A . 
T 6 HOH 38  3045 116  HOH HOH A . 
T 6 HOH 39  3046 121  HOH HOH A . 
T 6 HOH 40  3047 122  HOH HOH A . 
T 6 HOH 41  3048 128  HOH HOH A . 
T 6 HOH 42  3049 130  HOH HOH A . 
T 6 HOH 43  3050 131  HOH HOH A . 
T 6 HOH 44  3051 133  HOH HOH A . 
T 6 HOH 45  3052 135  HOH HOH A . 
T 6 HOH 46  3053 137  HOH HOH A . 
T 6 HOH 47  3054 138  HOH HOH A . 
T 6 HOH 48  3055 142  HOH HOH A . 
T 6 HOH 49  3056 143  HOH HOH A . 
T 6 HOH 50  3057 145  HOH HOH A . 
T 6 HOH 51  3058 149  HOH HOH A . 
T 6 HOH 52  3059 153  HOH HOH A . 
T 6 HOH 53  3060 154  HOH HOH A . 
T 6 HOH 54  3061 156  HOH HOH A . 
T 6 HOH 55  3062 158  HOH HOH A . 
T 6 HOH 56  3063 160  HOH HOH A . 
T 6 HOH 57  3064 161  HOH HOH A . 
T 6 HOH 58  3065 165  HOH HOH A . 
T 6 HOH 59  3066 167  HOH HOH A . 
T 6 HOH 60  3067 170  HOH HOH A . 
T 6 HOH 61  3068 171  HOH HOH A . 
T 6 HOH 62  3069 172  HOH HOH A . 
T 6 HOH 63  3070 174  HOH HOH A . 
T 6 HOH 64  3071 178  HOH HOH A . 
T 6 HOH 65  3072 180  HOH HOH A . 
T 6 HOH 66  3073 183  HOH HOH A . 
T 6 HOH 67  3074 189  HOH HOH A . 
T 6 HOH 68  3075 190  HOH HOH A . 
T 6 HOH 69  3076 193  HOH HOH A . 
T 6 HOH 70  3077 195  HOH HOH A . 
T 6 HOH 71  3078 196  HOH HOH A . 
T 6 HOH 72  3079 199  HOH HOH A . 
T 6 HOH 73  3080 200  HOH HOH A . 
T 6 HOH 74  3081 201  HOH HOH A . 
T 6 HOH 75  3082 204  HOH HOH A . 
T 6 HOH 76  3083 208  HOH HOH A . 
T 6 HOH 77  3084 210  HOH HOH A . 
T 6 HOH 78  3085 212  HOH HOH A . 
T 6 HOH 79  3086 214  HOH HOH A . 
T 6 HOH 80  3087 215  HOH HOH A . 
T 6 HOH 81  3088 216  HOH HOH A . 
T 6 HOH 82  3089 218  HOH HOH A . 
T 6 HOH 83  3090 219  HOH HOH A . 
T 6 HOH 84  3091 222  HOH HOH A . 
T 6 HOH 85  3092 226  HOH HOH A . 
T 6 HOH 86  3093 229  HOH HOH A . 
T 6 HOH 87  3094 231  HOH HOH A . 
T 6 HOH 88  3095 233  HOH HOH A . 
T 6 HOH 89  3096 234  HOH HOH A . 
T 6 HOH 90  3097 236  HOH HOH A . 
T 6 HOH 91  3098 237  HOH HOH A . 
T 6 HOH 92  3099 239  HOH HOH A . 
T 6 HOH 93  3100 240  HOH HOH A . 
T 6 HOH 94  3101 242  HOH HOH A . 
T 6 HOH 95  3102 248  HOH HOH A . 
T 6 HOH 96  3103 249  HOH HOH A . 
T 6 HOH 97  3104 250  HOH HOH A . 
T 6 HOH 98  3105 256  HOH HOH A . 
T 6 HOH 99  3106 262  HOH HOH A . 
T 6 HOH 100 3107 264  HOH HOH A . 
T 6 HOH 101 3108 266  HOH HOH A . 
T 6 HOH 102 3109 273  HOH HOH A . 
T 6 HOH 103 3110 274  HOH HOH A . 
T 6 HOH 104 3111 276  HOH HOH A . 
T 6 HOH 105 3112 277  HOH HOH A . 
T 6 HOH 106 3113 282  HOH HOH A . 
T 6 HOH 107 3114 284  HOH HOH A . 
T 6 HOH 108 3115 291  HOH HOH A . 
T 6 HOH 109 3116 293  HOH HOH A . 
T 6 HOH 110 3117 294  HOH HOH A . 
T 6 HOH 111 3118 296  HOH HOH A . 
T 6 HOH 112 3119 297  HOH HOH A . 
T 6 HOH 113 3120 301  HOH HOH A . 
T 6 HOH 114 3121 304  HOH HOH A . 
T 6 HOH 115 3122 305  HOH HOH A . 
T 6 HOH 116 3123 306  HOH HOH A . 
T 6 HOH 117 3124 310  HOH HOH A . 
T 6 HOH 118 3125 312  HOH HOH A . 
T 6 HOH 119 3126 317  HOH HOH A . 
T 6 HOH 120 3127 318  HOH HOH A . 
T 6 HOH 121 3128 324  HOH HOH A . 
T 6 HOH 122 3129 327  HOH HOH A . 
T 6 HOH 123 3130 330  HOH HOH A . 
T 6 HOH 124 3131 331  HOH HOH A . 
T 6 HOH 125 3132 334  HOH HOH A . 
T 6 HOH 126 3133 335  HOH HOH A . 
T 6 HOH 127 3134 336  HOH HOH A . 
T 6 HOH 128 3135 341  HOH HOH A . 
T 6 HOH 129 3136 343  HOH HOH A . 
T 6 HOH 130 3137 348  HOH HOH A . 
T 6 HOH 131 3138 349  HOH HOH A . 
T 6 HOH 132 3139 350  HOH HOH A . 
T 6 HOH 133 3140 354  HOH HOH A . 
T 6 HOH 134 3141 355  HOH HOH A . 
T 6 HOH 135 3142 356  HOH HOH A . 
T 6 HOH 136 3143 359  HOH HOH A . 
T 6 HOH 137 3144 360  HOH HOH A . 
T 6 HOH 138 3145 361  HOH HOH A . 
T 6 HOH 139 3146 364  HOH HOH A . 
T 6 HOH 140 3147 366  HOH HOH A . 
T 6 HOH 141 3148 370  HOH HOH A . 
T 6 HOH 142 3149 372  HOH HOH A . 
T 6 HOH 143 3150 374  HOH HOH A . 
T 6 HOH 144 3151 375  HOH HOH A . 
T 6 HOH 145 3152 377  HOH HOH A . 
T 6 HOH 146 3153 378  HOH HOH A . 
T 6 HOH 147 3154 380  HOH HOH A . 
T 6 HOH 148 3155 381  HOH HOH A . 
T 6 HOH 149 3156 383  HOH HOH A . 
T 6 HOH 150 3157 384  HOH HOH A . 
T 6 HOH 151 3158 387  HOH HOH A . 
T 6 HOH 152 3159 389  HOH HOH A . 
T 6 HOH 153 3160 390  HOH HOH A . 
T 6 HOH 154 3161 391  HOH HOH A . 
T 6 HOH 155 3162 392  HOH HOH A . 
T 6 HOH 156 3163 395  HOH HOH A . 
T 6 HOH 157 3164 399  HOH HOH A . 
T 6 HOH 158 3165 400  HOH HOH A . 
T 6 HOH 159 3166 403  HOH HOH A . 
T 6 HOH 160 3167 406  HOH HOH A . 
T 6 HOH 161 3168 409  HOH HOH A . 
T 6 HOH 162 3169 410  HOH HOH A . 
T 6 HOH 163 3170 411  HOH HOH A . 
T 6 HOH 164 3171 414  HOH HOH A . 
T 6 HOH 165 3172 415  HOH HOH A . 
T 6 HOH 166 3173 416  HOH HOH A . 
T 6 HOH 167 3174 417  HOH HOH A . 
T 6 HOH 168 3175 419  HOH HOH A . 
T 6 HOH 169 3176 421  HOH HOH A . 
T 6 HOH 170 3177 423  HOH HOH A . 
T 6 HOH 171 3178 424  HOH HOH A . 
T 6 HOH 172 3179 426  HOH HOH A . 
T 6 HOH 173 3180 427  HOH HOH A . 
T 6 HOH 174 3181 430  HOH HOH A . 
T 6 HOH 175 3182 432  HOH HOH A . 
T 6 HOH 176 3183 437  HOH HOH A . 
T 6 HOH 177 3184 438  HOH HOH A . 
T 6 HOH 178 3185 439  HOH HOH A . 
T 6 HOH 179 3186 441  HOH HOH A . 
T 6 HOH 180 3187 443  HOH HOH A . 
T 6 HOH 181 3188 444  HOH HOH A . 
T 6 HOH 182 3189 447  HOH HOH A . 
T 6 HOH 183 3190 450  HOH HOH A . 
T 6 HOH 184 3191 451  HOH HOH A . 
T 6 HOH 185 3192 452  HOH HOH A . 
T 6 HOH 186 3193 453  HOH HOH A . 
T 6 HOH 187 3194 454  HOH HOH A . 
T 6 HOH 188 3195 459  HOH HOH A . 
T 6 HOH 189 3196 460  HOH HOH A . 
T 6 HOH 190 3197 463  HOH HOH A . 
T 6 HOH 191 3198 464  HOH HOH A . 
T 6 HOH 192 3199 465  HOH HOH A . 
T 6 HOH 193 3200 466  HOH HOH A . 
T 6 HOH 194 3201 467  HOH HOH A . 
T 6 HOH 195 3202 469  HOH HOH A . 
T 6 HOH 196 3203 472  HOH HOH A . 
T 6 HOH 197 3204 474  HOH HOH A . 
T 6 HOH 198 3205 475  HOH HOH A . 
T 6 HOH 199 3206 483  HOH HOH A . 
T 6 HOH 200 3207 485  HOH HOH A . 
T 6 HOH 201 3208 486  HOH HOH A . 
T 6 HOH 202 3209 487  HOH HOH A . 
T 6 HOH 203 3210 491  HOH HOH A . 
T 6 HOH 204 3211 492  HOH HOH A . 
T 6 HOH 205 3212 494  HOH HOH A . 
T 6 HOH 206 3213 497  HOH HOH A . 
T 6 HOH 207 3214 498  HOH HOH A . 
T 6 HOH 208 3215 499  HOH HOH A . 
T 6 HOH 209 3216 500  HOH HOH A . 
T 6 HOH 210 3217 508  HOH HOH A . 
T 6 HOH 211 3218 509  HOH HOH A . 
T 6 HOH 212 3219 512  HOH HOH A . 
T 6 HOH 213 3220 515  HOH HOH A . 
T 6 HOH 214 3221 516  HOH HOH A . 
T 6 HOH 215 3222 521  HOH HOH A . 
T 6 HOH 216 3223 523  HOH HOH A . 
T 6 HOH 217 3224 528  HOH HOH A . 
T 6 HOH 218 3225 531  HOH HOH A . 
T 6 HOH 219 3226 532  HOH HOH A . 
T 6 HOH 220 3227 538  HOH HOH A . 
T 6 HOH 221 3228 539  HOH HOH A . 
T 6 HOH 222 3229 541  HOH HOH A . 
T 6 HOH 223 3230 544  HOH HOH A . 
T 6 HOH 224 3231 548  HOH HOH A . 
T 6 HOH 225 3232 550  HOH HOH A . 
T 6 HOH 226 3233 553  HOH HOH A . 
T 6 HOH 227 3234 555  HOH HOH A . 
T 6 HOH 228 3235 557  HOH HOH A . 
T 6 HOH 229 3236 561  HOH HOH A . 
T 6 HOH 230 3237 563  HOH HOH A . 
T 6 HOH 231 3238 564  HOH HOH A . 
T 6 HOH 232 3239 567  HOH HOH A . 
T 6 HOH 233 3240 569  HOH HOH A . 
T 6 HOH 234 3241 571  HOH HOH A . 
T 6 HOH 235 3242 572  HOH HOH A . 
T 6 HOH 236 3243 574  HOH HOH A . 
T 6 HOH 237 3244 576  HOH HOH A . 
T 6 HOH 238 3245 578  HOH HOH A . 
T 6 HOH 239 3246 580  HOH HOH A . 
T 6 HOH 240 3247 581  HOH HOH A . 
T 6 HOH 241 3248 583  HOH HOH A . 
T 6 HOH 242 3249 584  HOH HOH A . 
T 6 HOH 243 3250 585  HOH HOH A . 
T 6 HOH 244 3251 586  HOH HOH A . 
T 6 HOH 245 3252 588  HOH HOH A . 
T 6 HOH 246 3253 589  HOH HOH A . 
T 6 HOH 247 3254 593  HOH HOH A . 
T 6 HOH 248 3255 594  HOH HOH A . 
T 6 HOH 249 3256 600  HOH HOH A . 
T 6 HOH 250 3257 608  HOH HOH A . 
T 6 HOH 251 3258 610  HOH HOH A . 
T 6 HOH 252 3259 612  HOH HOH A . 
T 6 HOH 253 3260 615  HOH HOH A . 
T 6 HOH 254 3261 618  HOH HOH A . 
T 6 HOH 255 3262 620  HOH HOH A . 
T 6 HOH 256 3263 627  HOH HOH A . 
T 6 HOH 257 3264 630  HOH HOH A . 
T 6 HOH 258 3265 633  HOH HOH A . 
T 6 HOH 259 3266 636  HOH HOH A . 
T 6 HOH 260 3267 637  HOH HOH A . 
T 6 HOH 261 3268 644  HOH HOH A . 
T 6 HOH 262 3269 650  HOH HOH A . 
T 6 HOH 263 3270 651  HOH HOH A . 
T 6 HOH 264 3271 654  HOH HOH A . 
T 6 HOH 265 3272 655  HOH HOH A . 
T 6 HOH 266 3273 656  HOH HOH A . 
T 6 HOH 267 3274 657  HOH HOH A . 
T 6 HOH 268 3275 659  HOH HOH A . 
T 6 HOH 269 3276 660  HOH HOH A . 
T 6 HOH 270 3277 661  HOH HOH A . 
T 6 HOH 271 3278 662  HOH HOH A . 
T 6 HOH 272 3279 663  HOH HOH A . 
T 6 HOH 273 3280 665  HOH HOH A . 
T 6 HOH 274 3281 666  HOH HOH A . 
T 6 HOH 275 3282 667  HOH HOH A . 
T 6 HOH 276 3283 670  HOH HOH A . 
T 6 HOH 277 3284 672  HOH HOH A . 
T 6 HOH 278 3285 677  HOH HOH A . 
T 6 HOH 279 3286 678  HOH HOH A . 
T 6 HOH 280 3287 680  HOH HOH A . 
T 6 HOH 281 3288 682  HOH HOH A . 
T 6 HOH 282 3289 683  HOH HOH A . 
T 6 HOH 283 3290 686  HOH HOH A . 
T 6 HOH 284 3291 688  HOH HOH A . 
T 6 HOH 285 3292 690  HOH HOH A . 
T 6 HOH 286 3293 691  HOH HOH A . 
T 6 HOH 287 3294 695  HOH HOH A . 
T 6 HOH 288 3295 702  HOH HOH A . 
T 6 HOH 289 3296 703  HOH HOH A . 
T 6 HOH 290 3297 704  HOH HOH A . 
T 6 HOH 291 3298 705  HOH HOH A . 
T 6 HOH 292 3299 706  HOH HOH A . 
T 6 HOH 293 3300 710  HOH HOH A . 
T 6 HOH 294 3301 713  HOH HOH A . 
T 6 HOH 295 3302 714  HOH HOH A . 
T 6 HOH 296 3303 716  HOH HOH A . 
T 6 HOH 297 3304 720  HOH HOH A . 
T 6 HOH 298 3305 723  HOH HOH A . 
T 6 HOH 299 3306 727  HOH HOH A . 
T 6 HOH 300 3307 728  HOH HOH A . 
T 6 HOH 301 3308 729  HOH HOH A . 
T 6 HOH 302 3309 732  HOH HOH A . 
T 6 HOH 303 3310 736  HOH HOH A . 
T 6 HOH 304 3311 738  HOH HOH A . 
T 6 HOH 305 3312 739  HOH HOH A . 
T 6 HOH 306 3313 742  HOH HOH A . 
T 6 HOH 307 3314 744  HOH HOH A . 
T 6 HOH 308 3315 747  HOH HOH A . 
T 6 HOH 309 3316 748  HOH HOH A . 
T 6 HOH 310 3317 750  HOH HOH A . 
T 6 HOH 311 3318 752  HOH HOH A . 
T 6 HOH 312 3319 753  HOH HOH A . 
T 6 HOH 313 3320 754  HOH HOH A . 
T 6 HOH 314 3321 755  HOH HOH A . 
T 6 HOH 315 3322 756  HOH HOH A . 
T 6 HOH 316 3323 757  HOH HOH A . 
T 6 HOH 317 3324 761  HOH HOH A . 
T 6 HOH 318 3325 762  HOH HOH A . 
T 6 HOH 319 3326 767  HOH HOH A . 
T 6 HOH 320 3327 770  HOH HOH A . 
T 6 HOH 321 3328 771  HOH HOH A . 
T 6 HOH 322 3329 774  HOH HOH A . 
T 6 HOH 323 3330 775  HOH HOH A . 
T 6 HOH 324 3331 777  HOH HOH A . 
T 6 HOH 325 3332 781  HOH HOH A . 
T 6 HOH 326 3333 782  HOH HOH A . 
T 6 HOH 327 3334 786  HOH HOH A . 
T 6 HOH 328 3335 788  HOH HOH A . 
T 6 HOH 329 3336 790  HOH HOH A . 
T 6 HOH 330 3337 791  HOH HOH A . 
T 6 HOH 331 3338 793  HOH HOH A . 
T 6 HOH 332 3339 795  HOH HOH A . 
T 6 HOH 333 3340 796  HOH HOH A . 
T 6 HOH 334 3341 799  HOH HOH A . 
T 6 HOH 335 3342 804  HOH HOH A . 
T 6 HOH 336 3343 805  HOH HOH A . 
T 6 HOH 337 3344 807  HOH HOH A . 
T 6 HOH 338 3345 809  HOH HOH A . 
T 6 HOH 339 3346 812  HOH HOH A . 
T 6 HOH 340 3347 815  HOH HOH A . 
T 6 HOH 341 3348 816  HOH HOH A . 
T 6 HOH 342 3349 821  HOH HOH A . 
T 6 HOH 343 3350 824  HOH HOH A . 
T 6 HOH 344 3351 825  HOH HOH A . 
T 6 HOH 345 3352 826  HOH HOH A . 
T 6 HOH 346 3353 827  HOH HOH A . 
T 6 HOH 347 3354 832  HOH HOH A . 
T 6 HOH 348 3355 834  HOH HOH A . 
T 6 HOH 349 3356 835  HOH HOH A . 
T 6 HOH 350 3357 838  HOH HOH A . 
T 6 HOH 351 3358 843  HOH HOH A . 
T 6 HOH 352 3359 844  HOH HOH A . 
T 6 HOH 353 3360 847  HOH HOH A . 
T 6 HOH 354 3361 849  HOH HOH A . 
T 6 HOH 355 3362 851  HOH HOH A . 
T 6 HOH 356 3363 854  HOH HOH A . 
T 6 HOH 357 3364 856  HOH HOH A . 
T 6 HOH 358 3365 857  HOH HOH A . 
T 6 HOH 359 3366 858  HOH HOH A . 
T 6 HOH 360 3367 860  HOH HOH A . 
T 6 HOH 361 3368 862  HOH HOH A . 
T 6 HOH 362 3369 863  HOH HOH A . 
T 6 HOH 363 3370 871  HOH HOH A . 
T 6 HOH 364 3371 873  HOH HOH A . 
T 6 HOH 365 3372 874  HOH HOH A . 
T 6 HOH 366 3373 877  HOH HOH A . 
T 6 HOH 367 3374 878  HOH HOH A . 
T 6 HOH 368 3375 879  HOH HOH A . 
T 6 HOH 369 3376 880  HOH HOH A . 
T 6 HOH 370 3377 885  HOH HOH A . 
T 6 HOH 371 3378 886  HOH HOH A . 
T 6 HOH 372 3379 887  HOH HOH A . 
T 6 HOH 373 3380 890  HOH HOH A . 
T 6 HOH 374 3381 891  HOH HOH A . 
T 6 HOH 375 3382 892  HOH HOH A . 
T 6 HOH 376 3383 896  HOH HOH A . 
T 6 HOH 377 3384 898  HOH HOH A . 
T 6 HOH 378 3385 900  HOH HOH A . 
T 6 HOH 379 3386 902  HOH HOH A . 
T 6 HOH 380 3387 903  HOH HOH A . 
T 6 HOH 381 3388 904  HOH HOH A . 
T 6 HOH 382 3389 905  HOH HOH A . 
T 6 HOH 383 3390 906  HOH HOH A . 
T 6 HOH 384 3391 907  HOH HOH A . 
T 6 HOH 385 3392 908  HOH HOH A . 
T 6 HOH 386 3393 912  HOH HOH A . 
T 6 HOH 387 3394 914  HOH HOH A . 
T 6 HOH 388 3395 915  HOH HOH A . 
T 6 HOH 389 3396 919  HOH HOH A . 
T 6 HOH 390 3397 922  HOH HOH A . 
T 6 HOH 391 3398 923  HOH HOH A . 
T 6 HOH 392 3399 924  HOH HOH A . 
T 6 HOH 393 3400 926  HOH HOH A . 
T 6 HOH 394 3401 927  HOH HOH A . 
T 6 HOH 395 3402 928  HOH HOH A . 
T 6 HOH 396 3403 930  HOH HOH A . 
T 6 HOH 397 3404 935  HOH HOH A . 
T 6 HOH 398 3405 936  HOH HOH A . 
T 6 HOH 399 3406 937  HOH HOH A . 
T 6 HOH 400 3407 939  HOH HOH A . 
T 6 HOH 401 3408 940  HOH HOH A . 
T 6 HOH 402 3409 941  HOH HOH A . 
T 6 HOH 403 3410 944  HOH HOH A . 
T 6 HOH 404 3411 945  HOH HOH A . 
T 6 HOH 405 3412 947  HOH HOH A . 
T 6 HOH 406 3413 949  HOH HOH A . 
T 6 HOH 407 3414 953  HOH HOH A . 
T 6 HOH 408 3415 958  HOH HOH A . 
T 6 HOH 409 3416 963  HOH HOH A . 
T 6 HOH 410 3417 964  HOH HOH A . 
T 6 HOH 411 3418 966  HOH HOH A . 
T 6 HOH 412 3419 969  HOH HOH A . 
T 6 HOH 413 3420 978  HOH HOH A . 
T 6 HOH 414 3421 979  HOH HOH A . 
T 6 HOH 415 3422 980  HOH HOH A . 
T 6 HOH 416 3423 981  HOH HOH A . 
T 6 HOH 417 3424 986  HOH HOH A . 
T 6 HOH 418 3425 991  HOH HOH A . 
T 6 HOH 419 3426 992  HOH HOH A . 
T 6 HOH 420 3427 996  HOH HOH A . 
T 6 HOH 421 3428 1000 HOH HOH A . 
T 6 HOH 422 3429 1002 HOH HOH A . 
T 6 HOH 423 3430 1004 HOH HOH A . 
T 6 HOH 424 3431 1005 HOH HOH A . 
T 6 HOH 425 3432 1006 HOH HOH A . 
T 6 HOH 426 3433 1008 HOH HOH A . 
T 6 HOH 427 3434 1016 HOH HOH A . 
T 6 HOH 428 3435 1020 HOH HOH A . 
T 6 HOH 429 3436 1022 HOH HOH A . 
T 6 HOH 430 3437 1023 HOH HOH A . 
T 6 HOH 431 3438 1025 HOH HOH A . 
T 6 HOH 432 3439 1026 HOH HOH A . 
T 6 HOH 433 3440 1028 HOH HOH A . 
T 6 HOH 434 3441 1036 HOH HOH A . 
T 6 HOH 435 3442 1038 HOH HOH A . 
U 6 HOH 1   3007 2    HOH HOH D . 
U 6 HOH 2   3008 6    HOH HOH D . 
U 6 HOH 3   3009 7    HOH HOH D . 
U 6 HOH 4   3010 8    HOH HOH D . 
U 6 HOH 5   3011 11   HOH HOH D . 
U 6 HOH 6   3012 12   HOH HOH D . 
U 6 HOH 7   3013 16   HOH HOH D . 
U 6 HOH 8   3014 18   HOH HOH D . 
U 6 HOH 9   3015 19   HOH HOH D . 
U 6 HOH 10  3016 20   HOH HOH D . 
U 6 HOH 11  3017 21   HOH HOH D . 
U 6 HOH 12  3018 23   HOH HOH D . 
U 6 HOH 13  3019 24   HOH HOH D . 
U 6 HOH 14  3020 28   HOH HOH D . 
U 6 HOH 15  3021 33   HOH HOH D . 
U 6 HOH 16  3022 34   HOH HOH D . 
U 6 HOH 17  3023 39   HOH HOH D . 
U 6 HOH 18  3024 40   HOH HOH D . 
U 6 HOH 19  3025 41   HOH HOH D . 
U 6 HOH 20  3026 43   HOH HOH D . 
U 6 HOH 21  3027 44   HOH HOH D . 
U 6 HOH 22  3028 46   HOH HOH D . 
U 6 HOH 23  3029 50   HOH HOH D . 
U 6 HOH 24  3030 54   HOH HOH D . 
U 6 HOH 25  3031 55   HOH HOH D . 
U 6 HOH 26  3032 56   HOH HOH D . 
U 6 HOH 27  3033 58   HOH HOH D . 
U 6 HOH 28  3034 61   HOH HOH D . 
U 6 HOH 29  3035 62   HOH HOH D . 
U 6 HOH 30  3036 63   HOH HOH D . 
U 6 HOH 31  3037 64   HOH HOH D . 
U 6 HOH 32  3038 66   HOH HOH D . 
U 6 HOH 33  3039 68   HOH HOH D . 
U 6 HOH 34  3040 69   HOH HOH D . 
U 6 HOH 35  3041 70   HOH HOH D . 
U 6 HOH 36  3042 73   HOH HOH D . 
U 6 HOH 37  3043 74   HOH HOH D . 
U 6 HOH 38  3044 75   HOH HOH D . 
U 6 HOH 39  3045 76   HOH HOH D . 
U 6 HOH 40  3046 77   HOH HOH D . 
U 6 HOH 41  3047 78   HOH HOH D . 
U 6 HOH 42  3048 82   HOH HOH D . 
U 6 HOH 43  3049 84   HOH HOH D . 
U 6 HOH 44  3050 85   HOH HOH D . 
U 6 HOH 45  3051 86   HOH HOH D . 
U 6 HOH 46  3052 88   HOH HOH D . 
U 6 HOH 47  3053 94   HOH HOH D . 
U 6 HOH 48  3054 97   HOH HOH D . 
U 6 HOH 49  3055 98   HOH HOH D . 
U 6 HOH 50  3056 101  HOH HOH D . 
U 6 HOH 51  3057 103  HOH HOH D . 
U 6 HOH 52  3058 104  HOH HOH D . 
U 6 HOH 53  3059 105  HOH HOH D . 
U 6 HOH 54  3060 107  HOH HOH D . 
U 6 HOH 55  3061 108  HOH HOH D . 
U 6 HOH 56  3062 111  HOH HOH D . 
U 6 HOH 57  3063 114  HOH HOH D . 
U 6 HOH 58  3064 115  HOH HOH D . 
U 6 HOH 59  3065 117  HOH HOH D . 
U 6 HOH 60  3066 119  HOH HOH D . 
U 6 HOH 61  3067 120  HOH HOH D . 
U 6 HOH 62  3068 123  HOH HOH D . 
U 6 HOH 63  3069 124  HOH HOH D . 
U 6 HOH 64  3070 126  HOH HOH D . 
U 6 HOH 65  3071 127  HOH HOH D . 
U 6 HOH 66  3072 132  HOH HOH D . 
U 6 HOH 67  3073 136  HOH HOH D . 
U 6 HOH 68  3074 139  HOH HOH D . 
U 6 HOH 69  3075 140  HOH HOH D . 
U 6 HOH 70  3076 141  HOH HOH D . 
U 6 HOH 71  3077 146  HOH HOH D . 
U 6 HOH 72  3078 148  HOH HOH D . 
U 6 HOH 73  3079 150  HOH HOH D . 
U 6 HOH 74  3080 151  HOH HOH D . 
U 6 HOH 75  3081 152  HOH HOH D . 
U 6 HOH 76  3082 155  HOH HOH D . 
U 6 HOH 77  3083 162  HOH HOH D . 
U 6 HOH 78  3084 163  HOH HOH D . 
U 6 HOH 79  3085 164  HOH HOH D . 
U 6 HOH 80  3086 166  HOH HOH D . 
U 6 HOH 81  3087 168  HOH HOH D . 
U 6 HOH 82  3088 173  HOH HOH D . 
U 6 HOH 83  3089 175  HOH HOH D . 
U 6 HOH 84  3090 176  HOH HOH D . 
U 6 HOH 85  3091 177  HOH HOH D . 
U 6 HOH 86  3092 179  HOH HOH D . 
U 6 HOH 87  3093 182  HOH HOH D . 
U 6 HOH 88  3094 184  HOH HOH D . 
U 6 HOH 89  3095 185  HOH HOH D . 
U 6 HOH 90  3096 186  HOH HOH D . 
U 6 HOH 91  3097 187  HOH HOH D . 
U 6 HOH 92  3098 191  HOH HOH D . 
U 6 HOH 93  3099 192  HOH HOH D . 
U 6 HOH 94  3100 194  HOH HOH D . 
U 6 HOH 95  3101 197  HOH HOH D . 
U 6 HOH 96  3102 198  HOH HOH D . 
U 6 HOH 97  3103 202  HOH HOH D . 
U 6 HOH 98  3104 203  HOH HOH D . 
U 6 HOH 99  3105 205  HOH HOH D . 
U 6 HOH 100 3106 206  HOH HOH D . 
U 6 HOH 101 3107 207  HOH HOH D . 
U 6 HOH 102 3108 209  HOH HOH D . 
U 6 HOH 103 3109 213  HOH HOH D . 
U 6 HOH 104 3110 217  HOH HOH D . 
U 6 HOH 105 3111 220  HOH HOH D . 
U 6 HOH 106 3112 223  HOH HOH D . 
U 6 HOH 107 3113 224  HOH HOH D . 
U 6 HOH 108 3114 225  HOH HOH D . 
U 6 HOH 109 3115 227  HOH HOH D . 
U 6 HOH 110 3116 232  HOH HOH D . 
U 6 HOH 111 3117 238  HOH HOH D . 
U 6 HOH 112 3118 241  HOH HOH D . 
U 6 HOH 113 3119 243  HOH HOH D . 
U 6 HOH 114 3120 244  HOH HOH D . 
U 6 HOH 115 3121 246  HOH HOH D . 
U 6 HOH 116 3122 247  HOH HOH D . 
U 6 HOH 117 3123 251  HOH HOH D . 
U 6 HOH 118 3124 255  HOH HOH D . 
U 6 HOH 119 3125 257  HOH HOH D . 
U 6 HOH 120 3126 259  HOH HOH D . 
U 6 HOH 121 3127 267  HOH HOH D . 
U 6 HOH 122 3128 268  HOH HOH D . 
U 6 HOH 123 3129 269  HOH HOH D . 
U 6 HOH 124 3130 270  HOH HOH D . 
U 6 HOH 125 3131 271  HOH HOH D . 
U 6 HOH 126 3132 272  HOH HOH D . 
U 6 HOH 127 3133 275  HOH HOH D . 
U 6 HOH 128 3134 278  HOH HOH D . 
U 6 HOH 129 3135 279  HOH HOH D . 
U 6 HOH 130 3136 280  HOH HOH D . 
U 6 HOH 131 3137 281  HOH HOH D . 
U 6 HOH 132 3138 283  HOH HOH D . 
U 6 HOH 133 3139 285  HOH HOH D . 
U 6 HOH 134 3140 286  HOH HOH D . 
U 6 HOH 135 3141 287  HOH HOH D . 
U 6 HOH 136 3142 288  HOH HOH D . 
U 6 HOH 137 3143 290  HOH HOH D . 
U 6 HOH 138 3144 292  HOH HOH D . 
U 6 HOH 139 3145 295  HOH HOH D . 
U 6 HOH 140 3146 298  HOH HOH D . 
U 6 HOH 141 3147 299  HOH HOH D . 
U 6 HOH 142 3148 300  HOH HOH D . 
U 6 HOH 143 3149 302  HOH HOH D . 
U 6 HOH 144 3150 303  HOH HOH D . 
U 6 HOH 145 3151 308  HOH HOH D . 
U 6 HOH 146 3152 309  HOH HOH D . 
U 6 HOH 147 3153 311  HOH HOH D . 
U 6 HOH 148 3154 313  HOH HOH D . 
U 6 HOH 149 3155 314  HOH HOH D . 
U 6 HOH 150 3156 315  HOH HOH D . 
U 6 HOH 151 3157 319  HOH HOH D . 
U 6 HOH 152 3158 320  HOH HOH D . 
U 6 HOH 153 3159 321  HOH HOH D . 
U 6 HOH 154 3160 322  HOH HOH D . 
U 6 HOH 155 3161 325  HOH HOH D . 
U 6 HOH 156 3162 326  HOH HOH D . 
U 6 HOH 157 3163 328  HOH HOH D . 
U 6 HOH 158 3164 329  HOH HOH D . 
U 6 HOH 159 3165 332  HOH HOH D . 
U 6 HOH 160 3166 337  HOH HOH D . 
U 6 HOH 161 3167 338  HOH HOH D . 
U 6 HOH 162 3168 339  HOH HOH D . 
U 6 HOH 163 3169 340  HOH HOH D . 
U 6 HOH 164 3170 345  HOH HOH D . 
U 6 HOH 165 3171 347  HOH HOH D . 
U 6 HOH 166 3172 351  HOH HOH D . 
U 6 HOH 167 3173 352  HOH HOH D . 
U 6 HOH 168 3174 353  HOH HOH D . 
U 6 HOH 169 3175 357  HOH HOH D . 
U 6 HOH 170 3176 362  HOH HOH D . 
U 6 HOH 171 3177 363  HOH HOH D . 
U 6 HOH 172 3178 365  HOH HOH D . 
U 6 HOH 173 3179 367  HOH HOH D . 
U 6 HOH 174 3180 369  HOH HOH D . 
U 6 HOH 175 3181 371  HOH HOH D . 
U 6 HOH 176 3182 376  HOH HOH D . 
U 6 HOH 177 3183 379  HOH HOH D . 
U 6 HOH 178 3184 388  HOH HOH D . 
U 6 HOH 179 3185 393  HOH HOH D . 
U 6 HOH 180 3186 394  HOH HOH D . 
U 6 HOH 181 3187 396  HOH HOH D . 
U 6 HOH 182 3188 397  HOH HOH D . 
U 6 HOH 183 3189 401  HOH HOH D . 
U 6 HOH 184 3190 404  HOH HOH D . 
U 6 HOH 185 3191 405  HOH HOH D . 
U 6 HOH 186 3192 407  HOH HOH D . 
U 6 HOH 187 3193 412  HOH HOH D . 
U 6 HOH 188 3194 418  HOH HOH D . 
U 6 HOH 189 3195 449  HOH HOH D . 
U 6 HOH 190 3196 455  HOH HOH D . 
U 6 HOH 191 3197 461  HOH HOH D . 
U 6 HOH 192 3198 468  HOH HOH D . 
U 6 HOH 193 3199 473  HOH HOH D . 
U 6 HOH 194 3200 480  HOH HOH D . 
U 6 HOH 195 3201 481  HOH HOH D . 
U 6 HOH 196 3202 484  HOH HOH D . 
U 6 HOH 197 3203 488  HOH HOH D . 
U 6 HOH 198 3204 490  HOH HOH D . 
U 6 HOH 199 3205 495  HOH HOH D . 
U 6 HOH 200 3206 502  HOH HOH D . 
U 6 HOH 201 3207 504  HOH HOH D . 
U 6 HOH 202 3208 505  HOH HOH D . 
U 6 HOH 203 3209 506  HOH HOH D . 
U 6 HOH 204 3210 511  HOH HOH D . 
U 6 HOH 205 3211 514  HOH HOH D . 
U 6 HOH 206 3212 517  HOH HOH D . 
U 6 HOH 207 3213 522  HOH HOH D . 
U 6 HOH 208 3214 524  HOH HOH D . 
U 6 HOH 209 3215 525  HOH HOH D . 
U 6 HOH 210 3216 527  HOH HOH D . 
U 6 HOH 211 3217 529  HOH HOH D . 
U 6 HOH 212 3218 530  HOH HOH D . 
U 6 HOH 213 3219 533  HOH HOH D . 
U 6 HOH 214 3220 534  HOH HOH D . 
U 6 HOH 215 3221 535  HOH HOH D . 
U 6 HOH 216 3222 536  HOH HOH D . 
U 6 HOH 217 3223 537  HOH HOH D . 
U 6 HOH 218 3224 540  HOH HOH D . 
U 6 HOH 219 3225 543  HOH HOH D . 
U 6 HOH 220 3226 545  HOH HOH D . 
U 6 HOH 221 3227 546  HOH HOH D . 
U 6 HOH 222 3228 547  HOH HOH D . 
U 6 HOH 223 3229 549  HOH HOH D . 
U 6 HOH 224 3230 551  HOH HOH D . 
U 6 HOH 225 3231 552  HOH HOH D . 
U 6 HOH 226 3232 554  HOH HOH D . 
U 6 HOH 227 3233 560  HOH HOH D . 
U 6 HOH 228 3234 562  HOH HOH D . 
U 6 HOH 229 3235 568  HOH HOH D . 
U 6 HOH 230 3236 570  HOH HOH D . 
U 6 HOH 231 3237 579  HOH HOH D . 
U 6 HOH 232 3238 582  HOH HOH D . 
U 6 HOH 233 3239 587  HOH HOH D . 
U 6 HOH 234 3240 590  HOH HOH D . 
U 6 HOH 235 3241 591  HOH HOH D . 
U 6 HOH 236 3242 592  HOH HOH D . 
U 6 HOH 237 3243 596  HOH HOH D . 
U 6 HOH 238 3244 602  HOH HOH D . 
U 6 HOH 239 3245 603  HOH HOH D . 
U 6 HOH 240 3246 604  HOH HOH D . 
U 6 HOH 241 3247 605  HOH HOH D . 
U 6 HOH 242 3248 606  HOH HOH D . 
U 6 HOH 243 3249 607  HOH HOH D . 
U 6 HOH 244 3250 609  HOH HOH D . 
U 6 HOH 245 3251 611  HOH HOH D . 
U 6 HOH 246 3252 613  HOH HOH D . 
U 6 HOH 247 3253 614  HOH HOH D . 
U 6 HOH 248 3254 616  HOH HOH D . 
U 6 HOH 249 3255 619  HOH HOH D . 
U 6 HOH 250 3256 621  HOH HOH D . 
U 6 HOH 251 3257 622  HOH HOH D . 
U 6 HOH 252 3258 625  HOH HOH D . 
U 6 HOH 253 3259 626  HOH HOH D . 
U 6 HOH 254 3260 631  HOH HOH D . 
U 6 HOH 255 3261 632  HOH HOH D . 
U 6 HOH 256 3262 634  HOH HOH D . 
U 6 HOH 257 3263 638  HOH HOH D . 
U 6 HOH 258 3264 639  HOH HOH D . 
U 6 HOH 259 3265 640  HOH HOH D . 
U 6 HOH 260 3266 641  HOH HOH D . 
U 6 HOH 261 3267 642  HOH HOH D . 
U 6 HOH 262 3268 645  HOH HOH D . 
U 6 HOH 263 3269 647  HOH HOH D . 
U 6 HOH 264 3270 648  HOH HOH D . 
U 6 HOH 265 3271 649  HOH HOH D . 
U 6 HOH 266 3272 652  HOH HOH D . 
U 6 HOH 267 3273 658  HOH HOH D . 
U 6 HOH 268 3274 671  HOH HOH D . 
U 6 HOH 269 3275 673  HOH HOH D . 
U 6 HOH 270 3276 674  HOH HOH D . 
U 6 HOH 271 3277 675  HOH HOH D . 
U 6 HOH 272 3278 676  HOH HOH D . 
U 6 HOH 273 3279 681  HOH HOH D . 
U 6 HOH 274 3280 689  HOH HOH D . 
U 6 HOH 275 3281 692  HOH HOH D . 
U 6 HOH 276 3282 694  HOH HOH D . 
U 6 HOH 277 3283 697  HOH HOH D . 
U 6 HOH 278 3284 698  HOH HOH D . 
U 6 HOH 279 3285 701  HOH HOH D . 
U 6 HOH 280 3286 707  HOH HOH D . 
U 6 HOH 281 3287 708  HOH HOH D . 
U 6 HOH 282 3288 709  HOH HOH D . 
U 6 HOH 283 3289 711  HOH HOH D . 
U 6 HOH 284 3290 712  HOH HOH D . 
U 6 HOH 285 3291 715  HOH HOH D . 
U 6 HOH 286 3292 717  HOH HOH D . 
U 6 HOH 287 3293 718  HOH HOH D . 
U 6 HOH 288 3294 721  HOH HOH D . 
U 6 HOH 289 3295 722  HOH HOH D . 
U 6 HOH 290 3296 724  HOH HOH D . 
U 6 HOH 291 3297 725  HOH HOH D . 
U 6 HOH 292 3298 726  HOH HOH D . 
U 6 HOH 293 3299 730  HOH HOH D . 
U 6 HOH 294 3300 731  HOH HOH D . 
U 6 HOH 295 3301 733  HOH HOH D . 
U 6 HOH 296 3302 735  HOH HOH D . 
U 6 HOH 297 3303 737  HOH HOH D . 
U 6 HOH 298 3304 741  HOH HOH D . 
U 6 HOH 299 3305 743  HOH HOH D . 
U 6 HOH 300 3306 749  HOH HOH D . 
U 6 HOH 301 3307 751  HOH HOH D . 
U 6 HOH 302 3308 758  HOH HOH D . 
U 6 HOH 303 3309 759  HOH HOH D . 
U 6 HOH 304 3310 760  HOH HOH D . 
U 6 HOH 305 3311 763  HOH HOH D . 
U 6 HOH 306 3312 765  HOH HOH D . 
U 6 HOH 307 3313 766  HOH HOH D . 
U 6 HOH 308 3314 768  HOH HOH D . 
U 6 HOH 309 3315 769  HOH HOH D . 
U 6 HOH 310 3316 772  HOH HOH D . 
U 6 HOH 311 3317 773  HOH HOH D . 
U 6 HOH 312 3318 778  HOH HOH D . 
U 6 HOH 313 3319 780  HOH HOH D . 
U 6 HOH 314 3320 785  HOH HOH D . 
U 6 HOH 315 3321 787  HOH HOH D . 
U 6 HOH 316 3322 789  HOH HOH D . 
U 6 HOH 317 3323 792  HOH HOH D . 
U 6 HOH 318 3324 794  HOH HOH D . 
U 6 HOH 319 3325 798  HOH HOH D . 
U 6 HOH 320 3326 801  HOH HOH D . 
U 6 HOH 321 3327 802  HOH HOH D . 
U 6 HOH 322 3328 806  HOH HOH D . 
U 6 HOH 323 3329 808  HOH HOH D . 
U 6 HOH 324 3330 811  HOH HOH D . 
U 6 HOH 325 3331 813  HOH HOH D . 
U 6 HOH 326 3332 814  HOH HOH D . 
U 6 HOH 327 3333 817  HOH HOH D . 
U 6 HOH 328 3334 820  HOH HOH D . 
U 6 HOH 329 3335 822  HOH HOH D . 
U 6 HOH 330 3336 823  HOH HOH D . 
U 6 HOH 331 3337 829  HOH HOH D . 
U 6 HOH 332 3338 830  HOH HOH D . 
U 6 HOH 333 3339 831  HOH HOH D . 
U 6 HOH 334 3340 833  HOH HOH D . 
U 6 HOH 335 3341 836  HOH HOH D . 
U 6 HOH 336 3342 837  HOH HOH D . 
U 6 HOH 337 3343 839  HOH HOH D . 
U 6 HOH 338 3344 840  HOH HOH D . 
U 6 HOH 339 3345 841  HOH HOH D . 
U 6 HOH 340 3346 842  HOH HOH D . 
U 6 HOH 341 3347 845  HOH HOH D . 
U 6 HOH 342 3348 846  HOH HOH D . 
U 6 HOH 343 3349 848  HOH HOH D . 
U 6 HOH 344 3350 850  HOH HOH D . 
U 6 HOH 345 3351 853  HOH HOH D . 
U 6 HOH 346 3352 855  HOH HOH D . 
U 6 HOH 347 3353 864  HOH HOH D . 
U 6 HOH 348 3354 865  HOH HOH D . 
U 6 HOH 349 3355 866  HOH HOH D . 
U 6 HOH 350 3356 867  HOH HOH D . 
U 6 HOH 351 3357 868  HOH HOH D . 
U 6 HOH 352 3358 869  HOH HOH D . 
U 6 HOH 353 3359 870  HOH HOH D . 
U 6 HOH 354 3360 872  HOH HOH D . 
U 6 HOH 355 3361 875  HOH HOH D . 
U 6 HOH 356 3362 881  HOH HOH D . 
U 6 HOH 357 3363 888  HOH HOH D . 
U 6 HOH 358 3364 893  HOH HOH D . 
U 6 HOH 359 3365 894  HOH HOH D . 
U 6 HOH 360 3366 901  HOH HOH D . 
U 6 HOH 361 3367 910  HOH HOH D . 
U 6 HOH 362 3368 911  HOH HOH D . 
U 6 HOH 363 3369 916  HOH HOH D . 
U 6 HOH 364 3370 918  HOH HOH D . 
U 6 HOH 365 3371 920  HOH HOH D . 
U 6 HOH 366 3372 921  HOH HOH D . 
U 6 HOH 367 3373 925  HOH HOH D . 
U 6 HOH 368 3374 929  HOH HOH D . 
U 6 HOH 369 3375 931  HOH HOH D . 
U 6 HOH 370 3376 932  HOH HOH D . 
U 6 HOH 371 3377 933  HOH HOH D . 
U 6 HOH 372 3378 934  HOH HOH D . 
U 6 HOH 373 3379 938  HOH HOH D . 
U 6 HOH 374 3380 942  HOH HOH D . 
U 6 HOH 375 3381 943  HOH HOH D . 
U 6 HOH 376 3382 951  HOH HOH D . 
U 6 HOH 377 3383 952  HOH HOH D . 
U 6 HOH 378 3384 954  HOH HOH D . 
U 6 HOH 379 3385 956  HOH HOH D . 
U 6 HOH 380 3386 957  HOH HOH D . 
U 6 HOH 381 3387 960  HOH HOH D . 
U 6 HOH 382 3388 961  HOH HOH D . 
U 6 HOH 383 3389 962  HOH HOH D . 
U 6 HOH 384 3390 965  HOH HOH D . 
U 6 HOH 385 3391 968  HOH HOH D . 
U 6 HOH 386 3392 971  HOH HOH D . 
U 6 HOH 387 3393 972  HOH HOH D . 
U 6 HOH 388 3394 973  HOH HOH D . 
U 6 HOH 389 3395 974  HOH HOH D . 
U 6 HOH 390 3396 975  HOH HOH D . 
U 6 HOH 391 3397 976  HOH HOH D . 
U 6 HOH 392 3398 977  HOH HOH D . 
U 6 HOH 393 3399 982  HOH HOH D . 
U 6 HOH 394 3400 983  HOH HOH D . 
U 6 HOH 395 3401 984  HOH HOH D . 
U 6 HOH 396 3402 985  HOH HOH D . 
U 6 HOH 397 3403 987  HOH HOH D . 
U 6 HOH 398 3404 988  HOH HOH D . 
U 6 HOH 399 3405 989  HOH HOH D . 
U 6 HOH 400 3406 990  HOH HOH D . 
U 6 HOH 401 3407 993  HOH HOH D . 
U 6 HOH 402 3408 994  HOH HOH D . 
U 6 HOH 403 3409 995  HOH HOH D . 
U 6 HOH 404 3410 997  HOH HOH D . 
U 6 HOH 405 3411 998  HOH HOH D . 
U 6 HOH 406 3412 999  HOH HOH D . 
U 6 HOH 407 3413 1001 HOH HOH D . 
U 6 HOH 408 3414 1007 HOH HOH D . 
U 6 HOH 409 3415 1009 HOH HOH D . 
U 6 HOH 410 3416 1010 HOH HOH D . 
U 6 HOH 411 3417 1011 HOH HOH D . 
U 6 HOH 412 3418 1012 HOH HOH D . 
U 6 HOH 413 3419 1013 HOH HOH D . 
U 6 HOH 414 3420 1014 HOH HOH D . 
U 6 HOH 415 3421 1017 HOH HOH D . 
U 6 HOH 416 3422 1018 HOH HOH D . 
U 6 HOH 417 3423 1024 HOH HOH D . 
U 6 HOH 418 3424 1027 HOH HOH D . 
U 6 HOH 419 3425 1031 HOH HOH D . 
U 6 HOH 420 3426 1032 HOH HOH D . 
U 6 HOH 421 3427 1033 HOH HOH D . 
U 6 HOH 422 3428 1035 HOH HOH D . 
U 6 HOH 423 3429 1039 HOH HOH D . 
U 6 HOH 424 3430 1041 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 2PR 6 B 2PR 6  ? DG ? 
2 B 6MA 8 C 6MA 18 ? A  ? 
3 C 2PR 6 E 2PR 6  ? DG ? 
4 D 6MA 8 F 6MA 18 ? A  ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,I,J,P,Q,T   
2 1 C,D,F,K,L,M,N,O,R,S,U 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-29 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0005 ? 1 
ProDC  'data collection' .        ? 2 
MAR345 'data collection' .        ? 3 
XDS    'data scaling'    .        ? 4 
MOLREP phasing           .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N3 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   DG 
_pdbx_validate_close_contact.auth_seq_id_1    11 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1029 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C4'" B DG  1   ? ? "C3'" B DG  1   ? ? "C2'" B DG  1   ? ? 109.22 103.10 6.12  0.90 N 
2  1 "O4'" B DG  1   ? ? "C1'" B DG  1   ? ? "C2'" B DG  1   ? ? 109.93 106.80 3.13  0.50 N 
3  1 "O4'" B DG  5   ? ? "C1'" B DG  5   ? ? N9    B DG  5   ? ? 110.12 108.30 1.82  0.30 N 
4  1 "O4'" B DT  7   ? ? "C1'" B DT  7   ? ? N1    B DT  7   ? ? 110.30 108.30 2.00  0.30 N 
5  1 "O4'" B DC  10  ? ? "C1'" B DC  10  ? ? N1    B DC  10  ? ? 111.30 108.30 3.00  0.30 N 
6  1 "O4'" C DG  11  ? ? "C1'" C DG  11  ? ? N9    C DG  11  ? ? 112.38 108.30 4.08  0.30 N 
7  1 "O4'" C DA  12  ? ? "C1'" C DA  12  ? ? N9    C DA  12  ? ? 102.06 108.00 -5.94 0.70 N 
8  1 "C3'" C DC  13  ? ? "C2'" C DC  13  ? ? "C1'" C DC  13  ? ? 96.40  102.40 -6.00 0.80 N 
9  1 "O4'" C DC  13  ? ? "C1'" C DC  13  ? ? N1    C DC  13  ? ? 110.73 108.30 2.43  0.30 N 
10 1 "O4'" C DC  20  ? ? "C1'" C DC  20  ? ? N1    C DC  20  ? ? 116.25 108.30 7.95  0.30 N 
11 1 "C3'" E DT  2   ? ? "C2'" E DT  2   ? ? "C1'" E DT  2   ? ? 97.07  102.40 -5.33 0.80 N 
12 1 "O4'" E DT  3   ? ? "C1'" E DT  3   ? ? N1    E DT  3   ? ? 103.54 108.00 -4.46 0.70 N 
13 1 "O4'" E DG  5   ? ? "C1'" E DG  5   ? ? N9    E DG  5   ? ? 110.24 108.30 1.94  0.30 N 
14 1 "O4'" E DT  7   ? ? "C1'" E DT  7   ? ? N1    E DT  7   ? ? 112.02 108.30 3.72  0.30 N 
15 1 "O4'" E DG  8   ? ? "C1'" E DG  8   ? ? N9    E DG  8   ? ? 103.76 108.00 -4.24 0.70 N 
16 1 "O4'" E DC  10  ? ? "C1'" E DC  10  ? ? N1    E DC  10  ? ? 116.63 108.30 8.33  0.30 N 
17 1 "O4'" F DA  12  ? ? "C1'" F DA  12  ? ? N9    F DA  12  ? ? 102.73 108.00 -5.27 0.70 N 
18 1 "C3'" F DC  13  ? ? "C2'" F DC  13  ? ? "C1'" F DC  13  ? ? 97.47  102.40 -4.93 0.80 N 
19 1 "O4'" F DC  13  ? ? "C1'" F DC  13  ? ? N1    F DC  13  ? ? 110.88 108.30 2.58  0.30 N 
20 1 "O4'" F DC  16  ? ? "C1'" F DC  16  ? ? N1    F DC  16  ? ? 103.08 108.00 -4.92 0.70 N 
21 1 "O4'" F DG  17  ? ? "C1'" F DG  17  ? ? N9    F DG  17  ? ? 110.96 108.30 2.66  0.30 N 
22 1 "O4'" F DC  20  ? ? "C1'" F DC  20  ? ? N1    F DC  20  ? ? 114.28 108.30 5.98  0.30 N 
23 1 NE    A ARG 318 ? ? CZ    A ARG 318 ? ? NH2   A ARG 318 ? ? 116.41 120.30 -3.89 0.50 N 
24 1 CA    D LEU 160 ? ? CB    D LEU 160 ? ? CG    D LEU 160 ? ? 130.73 115.30 15.43 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 49  ? ? 48.27   -115.01 
2  1 ASP A 78  ? ? -153.24 71.73   
3  1 LYS A 116 ? ? -131.06 -31.69  
4  1 TYR A 140 ? ? 54.37   -160.18 
5  1 ALA A 349 ? ? 67.82   73.51   
6  1 GLU A 355 ? ? 87.62   164.29  
7  1 ARG A 389 ? ? 42.96   -123.20 
8  1 PRO A 393 ? ? -80.83  32.27   
9  1 ALA D 49  ? ? 48.80   -119.10 
10 1 ASP D 78  ? ? -159.35 71.68   
11 1 LYS D 116 ? ? -131.15 -32.86  
12 1 TYR D 140 ? ? 57.38   -157.50 
13 1 ALA D 349 ? ? 55.97   72.64   
14 1 GLU D 355 ? ? 83.72   166.11  
15 1 ARG D 389 ? ? 40.51   -121.49 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_1   D 
_pdbx_validate_peptide_omega.auth_seq_id_1    394 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_2   D 
_pdbx_validate_peptide_omega.auth_seq_id_2    395 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.01 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? E MET 1   
2  1 Y 1 A GLY 2   ? E GLY 2   
3  1 Y 1 A LEU 3   ? E LEU 3   
4  1 Y 1 A PRO 4   ? E PRO 4   
5  1 Y 1 A PRO 5   ? E PRO 5   
6  1 Y 1 A LEU 6   ? E LEU 6   
7  1 Y 1 A LEU 7   ? E LEU 7   
8  1 Y 1 A SER 8   ? E SER 8   
9  1 Y 1 A LEU 9   ? E LEU 9   
10 1 Y 1 A PRO 10  ? E PRO 10  
11 1 Y 1 A SER 11  ? E SER 11  
12 1 Y 1 A ASN 12  ? E ASN 12  
13 1 Y 1 A SER 13  ? E SER 13  
14 1 Y 1 A ALA 14  ? E ALA 14  
15 1 Y 1 A PRO 15  ? E PRO 15  
16 1 Y 1 A ARG 16  ? E ARG 16  
17 1 Y 1 A SER 17  ? E SER 17  
18 1 Y 1 A LEU 18  ? E LEU 18  
19 1 Y 1 A GLY 19  ? E GLY 19  
20 1 Y 1 A ARG 20  ? E ARG 20  
21 1 Y 1 A SER 414 ? E SER 414 
22 1 Y 1 A PRO 415 ? E PRO 415 
23 1 Y 1 A GLU 416 ? E GLU 416 
24 1 Y 1 A SER 417 ? E SER 417 
25 1 Y 1 A ALA 418 ? E ALA 418 
26 1 Y 1 A ARG 419 ? E ARG 419 
27 1 Y 1 A ASN 420 ? E ASN 420 
28 1 Y 1 A PHE 421 ? E PHE 421 
29 1 Y 1 D MET 1   ? F MET 1   
30 1 Y 1 D GLY 2   ? F GLY 2   
31 1 Y 1 D LEU 3   ? F LEU 3   
32 1 Y 1 D PRO 4   ? F PRO 4   
33 1 Y 1 D PRO 5   ? F PRO 5   
34 1 Y 1 D LEU 6   ? F LEU 6   
35 1 Y 1 D LEU 7   ? F LEU 7   
36 1 Y 1 D SER 8   ? F SER 8   
37 1 Y 1 D LEU 9   ? F LEU 9   
38 1 Y 1 D PRO 10  ? F PRO 10  
39 1 Y 1 D SER 11  ? F SER 11  
40 1 Y 1 D ASN 12  ? F ASN 12  
41 1 Y 1 D SER 13  ? F SER 13  
42 1 Y 1 D ALA 14  ? F ALA 14  
43 1 Y 1 D PRO 15  ? F PRO 15  
44 1 Y 1 D ARG 16  ? F ARG 16  
45 1 Y 1 D SER 17  ? F SER 17  
46 1 Y 1 D LEU 18  ? F LEU 18  
47 1 Y 1 D GLY 19  ? F GLY 19  
48 1 Y 1 D ARG 20  ? F ARG 20  
49 1 Y 1 D SER 414 ? F SER 414 
50 1 Y 1 D PRO 415 ? F PRO 415 
51 1 Y 1 D GLU 416 ? F GLU 416 
52 1 Y 1 D SER 417 ? F SER 417 
53 1 Y 1 D ALA 418 ? F ALA 418 
54 1 Y 1 D ARG 419 ? F ARG 419 
55 1 Y 1 D ASN 420 ? F ASN 420 
56 1 Y 1 D PHE 421 ? F PHE 421 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2IBT 'double helix'         
2IBT 'b-form double helix'  
2IBT 'mismatched base pair' 
2IBT 'internal loop'        
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC  10 1_555 -0.300 -0.065 -0.242 -25.321 3.958   0.930  1  B_DG1:DC20_C  B 1  ? C 20 ? 19 1 
1 A DT 2  1_555 B DA  9  1_555 0.006  -0.202 0.162  -6.556  0.709   6.459  2  B_DT2:DA19_C  B 2  ? C 19 ? 20 1 
1 A DT 3  1_555 B 6MA 8  1_555 -0.057 -0.183 0.071  -5.028  -22.638 3.465  3  B_DT3:6MA18_C B 3  ? C 18 ? 20 1 
1 A DC 4  1_555 B DG  7  1_555 0.432  -0.029 -0.341 11.876  -8.223  5.209  4  B_DC4:DG17_C  B 4  ? C 17 ? 19 1 
1 A DG 5  1_555 B DC  6  1_555 -0.293 -0.121 0.305  16.624  1.976   -2.780 5  B_DG5:DC16_C  B 5  ? C 16 ? 19 1 
1 A DT 7  1_555 B DA  4  1_555 0.100  -0.216 0.610  -24.549 2.885   0.096  6  B_DT7:DA14_C  B 7  ? C 14 ? 20 1 
1 A DG 8  1_555 B DC  3  1_555 -0.214 -0.127 0.093  -9.599  -6.904  0.961  7  B_DG8:DC13_C  B 8  ? C 13 ? 19 1 
1 A DT 9  1_555 B DA  2  1_555 0.123  -0.194 0.210  -0.857  -8.975  3.394  8  B_DT9:DA12_C  B 9  ? C 12 ? 20 1 
1 A DC 10 1_555 B DG  1  1_555 0.345  -0.182 0.391  0.969   -14.658 -2.670 9  B_DC10:DG11_C B 10 ? C 11 ? 19 1 
1 C DG 1  1_555 D DC  10 1_555 -0.267 -0.123 -0.485 -18.350 10.925  -0.070 10 E_DG1:DC20_F  E 1  ? F 20 ? 19 1 
1 C DT 2  1_555 D DA  9  1_555 -0.058 -0.214 0.162  -5.514  3.433   5.640  11 E_DT2:DA19_F  E 2  ? F 19 ? 20 1 
1 C DT 3  1_555 D 6MA 8  1_555 -0.094 -0.158 -0.013 -5.004  -21.505 4.077  12 E_DT3:6MA18_F E 3  ? F 18 ? 20 1 
1 C DC 4  1_555 D DG  7  1_555 0.452  -0.001 -0.319 11.366  -8.287  4.783  13 E_DC4:DG17_F  E 4  ? F 17 ? 19 1 
1 C DG 5  1_555 D DC  6  1_555 -0.224 -0.108 0.197  19.154  3.673   -3.841 14 E_DG5:DC16_F  E 5  ? F 16 ? 19 1 
1 C DG 8  1_555 D DC  3  1_555 -0.235 -0.125 -0.117 -9.153  -6.866  -2.517 15 E_DG8:DC13_F  E 8  ? F 13 ? 19 1 
1 C DT 9  1_555 D DA  2  1_555 -0.107 -0.147 0.090  0.516   -9.753  0.405  16 E_DT9:DA12_F  E 9  ? F 12 ? 20 1 
1 C DC 10 1_555 D DG  1  1_555 0.222  -0.354 -0.314 10.114  -0.151  -3.486 17 E_DC10:DG11_F E 10 ? F 11 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1 1_555 B DC  10 1_555 A DT 2  1_555 B DA  9 1_555 -0.311 -0.604 3.090 -1.986 9.236   27.668 -3.045 0.220  2.764 18.638  
4.008   29.207 1  BB_DG1DT2:DA19DC20_CC  B 1 ? C 20 ? B 2  ? C 19 ? 
1 A DT 2 1_555 B DA  9  1_555 A DT 3  1_555 B 6MA 8 1_555 -0.859 -0.111 3.239 2.709  -10.393 38.365 1.028  1.573  3.099 -15.450 
-4.026  39.785 2  BB_DT2DT3:6MA18DA19_CC B 2 ? C 19 ? B 3  ? C 18 ? 
1 A DT 3 1_555 B 6MA 8  1_555 A DC 4  1_555 B DG  7 1_555 0.990  2.309  2.998 7.197  -0.883  43.159 3.178  -0.687 3.072 -1.190  
-9.702  43.735 3  BB_DT3DC4:DG176MA18_CC B 3 ? C 18 ? B 4  ? C 17 ? 
1 A DC 4 1_555 B DG  7  1_555 A DG 5  1_555 B DC  6 1_555 0.171  2.070  3.265 1.807  9.047   21.603 1.642  0.268  3.811 22.842  
-4.562  23.468 4  BB_DC4DG5:DC16DG17_CC  B 4 ? C 17 ? B 5  ? C 16 ? 
1 A DT 7 1_555 B DA  4  1_555 A DG 8  1_555 B DC  3 1_555 -1.790 -0.499 2.980 6.393  -13.333 35.262 0.746  3.463  2.641 -20.910 
-10.027 38.145 5  BB_DT7DG8:DC13DA14_CC  B 7 ? C 14 ? B 8  ? C 13 ? 
1 A DG 8 1_555 B DC  3  1_555 A DT 9  1_555 B DA  2 1_555 -0.185 -0.203 3.059 -1.674 5.576   23.543 -2.127 -0.053 2.938 13.405  
4.024   24.243 6  BB_DG8DT9:DA12DC13_CC  B 8 ? C 13 ? B 9  ? C 12 ? 
1 A DT 9 1_555 B DA  2  1_555 A DC 10 1_555 B DG  1 1_555 0.511  -0.405 3.210 -2.187 -4.913  42.561 -0.072 -0.913 3.206 -6.736  
2.998   42.884 7  BB_DT9DC10:DG11DA12_CC B 9 ? C 12 ? B 10 ? C 11 ? 
1 C DG 1 1_555 D DC  10 1_555 C DT 2  1_555 D DA  9 1_555 -0.275 -0.696 3.245 -3.937 7.204   25.874 -3.250 -0.379 2.955 15.596  
8.523   27.124 8  EE_DG1DT2:DA19DC20_FF  E 1 ? F 20 ? E 2  ? F 19 ? 
1 C DT 2 1_555 D DA  9  1_555 C DT 3  1_555 D 6MA 8 1_555 -0.869 -0.157 3.244 3.846  -10.702 38.268 0.991  1.714  3.080 -15.901 
-5.715  39.862 9  EE_DT2DT3:6MA18DA19_FF E 2 ? F 19 ? E 3  ? F 18 ? 
1 C DT 3 1_555 D 6MA 8  1_555 C DC 4  1_555 D DG  7 1_555 0.947  2.312  2.970 6.169  -0.710  44.328 3.097  -0.725 3.033 -0.935  
-8.129  44.739 10 EE_DT3DC4:DG176MA18_FF E 3 ? F 18 ? E 4  ? F 17 ? 
1 C DC 4 1_555 D DG  7  1_555 C DG 5  1_555 D DC  6 1_555 0.116  2.086  3.146 2.214  9.405   21.159 1.615  0.552  3.713 24.059  
-5.665  23.238 11 EE_DC4DG5:DC16DG17_FF  E 4 ? F 17 ? E 5  ? F 16 ? 
1 C DG 8 1_555 D DC  3  1_555 C DT 9  1_555 D DA  2 1_555 -0.368 -0.275 3.050 -1.763 1.241   26.795 -0.890 0.368  3.052 2.672   
3.797   26.880 12 EE_DG8DT9:DA12DC13_FF  E 8 ? F 13 ? E 9  ? F 12 ? 
1 C DT 9 1_555 D DA  2  1_555 C DC 10 1_555 D DG  1 1_555 1.253  0.998  3.108 7.284  2.186   36.531 1.273  -0.998 3.340 3.441   
-11.468 37.288 13 EE_DT9DC10:DG11DA12_FF E 9 ? F 12 ? E 10 ? F 11 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "5'-DEOXY-5'-[2-(AMINO)ETHYLTHIO]ADENOSINE" NEA 
5 GLYCEROL                                    GOL 
6 water                                       HOH 
#