data_2IFG
# 
_entry.id   2IFG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IFG         
RCSB  RCSB039513   
WWPDB D_1000039513 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IFG 
_pdbx_database_status.recvd_initial_deposition_date   2006-09-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, X.'       1 
'Garcia, K.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural and mechanistic insights into nerve growth factor interactions with the TrkA and p75 receptors.' 
_citation.journal_abbrev            Neuron 
_citation.journal_volume            53 
_citation.page_first                25 
_citation.page_last                 38 
_citation.year                      2007 
_citation.journal_id_ASTM           NERNET 
_citation.country                   US 
_citation.journal_id_ISSN           0896-6273 
_citation.journal_id_CSD            2038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17196528 
_citation.pdbx_database_id_DOI      10.1016/j.neuron.2006.09.034 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wehrman, T.'   1 ? 
primary 'He, X.'        2 ? 
primary 'Raab, B.'      3 ? 
primary 'Dukipatti, A.' 4 ? 
primary 'Blau, H.'      5 ? 
primary 'Garcia, K.C.'  6 ? 
# 
_cell.entry_id           2IFG 
_cell.length_a           110.215 
_cell.length_b           81.681 
_cell.length_c           115.748 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.15 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IFG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man 'High affinity nerve growth factor receptor' 37898.797 2 2.7.10.1 ? ? ? 
2 polymer  man 'Beta-nerve growth factor' 13515.410 2 ?        ? ? ? 
3 branched man '2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2 ?        ? ? 
? 
4 branched man 
'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   4 
?        ? ? ? 
5 branched man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose'  586.542   6 
?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Neurotrophic tyrosine kinase receptor type 1, TRK1 transforming tyrosine kinase protein, p140-TrkA, Trk-A' 
2 Beta-NGF                                                                                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTP
RLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPT
LKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAE
VSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVN
NGNYTLLAANPFGQASASIMAAFMDNP
;
;CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTP
RLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPT
LKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAE
VSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVN
NGNYTLLAANPFGQASASIMAAFMDNP
;
A,B ? 
2 'polypeptide(L)' no no 
;SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYC
TTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
;
;SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYC
TTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
;
E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   PRO n 
1 3   ASP n 
1 4   ALA n 
1 5   CYS n 
1 6   CYS n 
1 7   PRO n 
1 8   HIS n 
1 9   GLY n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  CYS n 
1 16  THR n 
1 17  ARG n 
1 18  ASP n 
1 19  GLY n 
1 20  ALA n 
1 21  LEU n 
1 22  ASP n 
1 23  SER n 
1 24  LEU n 
1 25  HIS n 
1 26  HIS n 
1 27  LEU n 
1 28  PRO n 
1 29  GLY n 
1 30  ALA n 
1 31  GLU n 
1 32  ASN n 
1 33  LEU n 
1 34  THR n 
1 35  GLU n 
1 36  LEU n 
1 37  TYR n 
1 38  ILE n 
1 39  GLU n 
1 40  ASN n 
1 41  GLN n 
1 42  GLN n 
1 43  HIS n 
1 44  LEU n 
1 45  GLN n 
1 46  HIS n 
1 47  LEU n 
1 48  GLU n 
1 49  LEU n 
1 50  ARG n 
1 51  ASP n 
1 52  LEU n 
1 53  ARG n 
1 54  GLY n 
1 55  LEU n 
1 56  GLY n 
1 57  GLU n 
1 58  LEU n 
1 59  ARG n 
1 60  ASN n 
1 61  LEU n 
1 62  THR n 
1 63  ILE n 
1 64  VAL n 
1 65  LYS n 
1 66  SER n 
1 67  GLY n 
1 68  LEU n 
1 69  ARG n 
1 70  PHE n 
1 71  VAL n 
1 72  ALA n 
1 73  PRO n 
1 74  ASP n 
1 75  ALA n 
1 76  PHE n 
1 77  HIS n 
1 78  PHE n 
1 79  THR n 
1 80  PRO n 
1 81  ARG n 
1 82  LEU n 
1 83  SER n 
1 84  ARG n 
1 85  LEU n 
1 86  ASN n 
1 87  LEU n 
1 88  SER n 
1 89  PHE n 
1 90  ASN n 
1 91  ALA n 
1 92  LEU n 
1 93  GLU n 
1 94  SER n 
1 95  LEU n 
1 96  SER n 
1 97  TRP n 
1 98  LYS n 
1 99  THR n 
1 100 VAL n 
1 101 GLN n 
1 102 GLY n 
1 103 LEU n 
1 104 SER n 
1 105 LEU n 
1 106 GLN n 
1 107 GLU n 
1 108 LEU n 
1 109 VAL n 
1 110 LEU n 
1 111 SER n 
1 112 GLY n 
1 113 ASN n 
1 114 PRO n 
1 115 LEU n 
1 116 HIS n 
1 117 CYS n 
1 118 SER n 
1 119 CYS n 
1 120 ALA n 
1 121 LEU n 
1 122 ARG n 
1 123 TRP n 
1 124 LEU n 
1 125 GLN n 
1 126 ARG n 
1 127 TRP n 
1 128 GLU n 
1 129 GLU n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLY n 
1 134 GLY n 
1 135 VAL n 
1 136 PRO n 
1 137 GLU n 
1 138 GLN n 
1 139 LYS n 
1 140 LEU n 
1 141 GLN n 
1 142 CYS n 
1 143 HIS n 
1 144 GLY n 
1 145 GLN n 
1 146 GLY n 
1 147 PRO n 
1 148 LEU n 
1 149 ALA n 
1 150 HIS n 
1 151 MET n 
1 152 PRO n 
1 153 ASN n 
1 154 ALA n 
1 155 SER n 
1 156 CYS n 
1 157 GLY n 
1 158 VAL n 
1 159 PRO n 
1 160 THR n 
1 161 LEU n 
1 162 LYS n 
1 163 VAL n 
1 164 GLN n 
1 165 VAL n 
1 166 PRO n 
1 167 ASN n 
1 168 ALA n 
1 169 SER n 
1 170 VAL n 
1 171 ASP n 
1 172 VAL n 
1 173 GLY n 
1 174 ASP n 
1 175 ASP n 
1 176 VAL n 
1 177 LEU n 
1 178 LEU n 
1 179 ARG n 
1 180 CYS n 
1 181 GLN n 
1 182 VAL n 
1 183 GLU n 
1 184 GLY n 
1 185 ARG n 
1 186 GLY n 
1 187 LEU n 
1 188 GLU n 
1 189 GLN n 
1 190 ALA n 
1 191 GLY n 
1 192 TRP n 
1 193 ILE n 
1 194 LEU n 
1 195 THR n 
1 196 GLU n 
1 197 LEU n 
1 198 GLU n 
1 199 GLN n 
1 200 SER n 
1 201 ALA n 
1 202 THR n 
1 203 VAL n 
1 204 MET n 
1 205 LYS n 
1 206 SER n 
1 207 GLY n 
1 208 GLY n 
1 209 LEU n 
1 210 PRO n 
1 211 SER n 
1 212 LEU n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 LEU n 
1 217 ALA n 
1 218 ASN n 
1 219 VAL n 
1 220 THR n 
1 221 SER n 
1 222 ASP n 
1 223 LEU n 
1 224 ASN n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 VAL n 
1 229 THR n 
1 230 CYS n 
1 231 TRP n 
1 232 ALA n 
1 233 GLU n 
1 234 ASN n 
1 235 ASP n 
1 236 VAL n 
1 237 GLY n 
1 238 ARG n 
1 239 ALA n 
1 240 GLU n 
1 241 VAL n 
1 242 SER n 
1 243 VAL n 
1 244 GLN n 
1 245 VAL n 
1 246 ASN n 
1 247 VAL n 
1 248 SER n 
1 249 PHE n 
1 250 PRO n 
1 251 ALA n 
1 252 SER n 
1 253 VAL n 
1 254 GLN n 
1 255 LEU n 
1 256 HIS n 
1 257 THR n 
1 258 ALA n 
1 259 VAL n 
1 260 GLU n 
1 261 MET n 
1 262 HIS n 
1 263 HIS n 
1 264 TRP n 
1 265 CYS n 
1 266 ILE n 
1 267 PRO n 
1 268 PHE n 
1 269 SER n 
1 270 VAL n 
1 271 ASP n 
1 272 GLY n 
1 273 GLN n 
1 274 PRO n 
1 275 ALA n 
1 276 PRO n 
1 277 SER n 
1 278 LEU n 
1 279 ARG n 
1 280 TRP n 
1 281 LEU n 
1 282 PHE n 
1 283 ASN n 
1 284 GLY n 
1 285 SER n 
1 286 VAL n 
1 287 LEU n 
1 288 ASN n 
1 289 GLU n 
1 290 THR n 
1 291 SER n 
1 292 PHE n 
1 293 ILE n 
1 294 PHE n 
1 295 THR n 
1 296 GLU n 
1 297 PHE n 
1 298 LEU n 
1 299 GLU n 
1 300 PRO n 
1 301 ALA n 
1 302 ALA n 
1 303 ASN n 
1 304 GLU n 
1 305 THR n 
1 306 VAL n 
1 307 ARG n 
1 308 HIS n 
1 309 GLY n 
1 310 CYS n 
1 311 LEU n 
1 312 ARG n 
1 313 LEU n 
1 314 ASN n 
1 315 GLN n 
1 316 PRO n 
1 317 THR n 
1 318 HIS n 
1 319 VAL n 
1 320 ASN n 
1 321 ASN n 
1 322 GLY n 
1 323 ASN n 
1 324 TYR n 
1 325 THR n 
1 326 LEU n 
1 327 LEU n 
1 328 ALA n 
1 329 ALA n 
1 330 ASN n 
1 331 PRO n 
1 332 PHE n 
1 333 GLY n 
1 334 GLN n 
1 335 ALA n 
1 336 SER n 
1 337 ALA n 
1 338 SER n 
1 339 ILE n 
1 340 MET n 
1 341 ALA n 
1 342 ALA n 
1 343 PHE n 
1 344 MET n 
1 345 ASP n 
1 346 ASN n 
1 347 PRO n 
2 1   SER n 
2 2   SER n 
2 3   SER n 
2 4   HIS n 
2 5   PRO n 
2 6   ILE n 
2 7   PHE n 
2 8   HIS n 
2 9   ARG n 
2 10  GLY n 
2 11  GLU n 
2 12  PHE n 
2 13  SER n 
2 14  VAL n 
2 15  CYS n 
2 16  ASP n 
2 17  SER n 
2 18  VAL n 
2 19  SER n 
2 20  VAL n 
2 21  TRP n 
2 22  VAL n 
2 23  GLY n 
2 24  ASP n 
2 25  LYS n 
2 26  THR n 
2 27  THR n 
2 28  ALA n 
2 29  THR n 
2 30  ASP n 
2 31  ILE n 
2 32  LYS n 
2 33  GLY n 
2 34  LYS n 
2 35  GLU n 
2 36  VAL n 
2 37  MET n 
2 38  VAL n 
2 39  LEU n 
2 40  GLY n 
2 41  GLU n 
2 42  VAL n 
2 43  ASN n 
2 44  ILE n 
2 45  ASN n 
2 46  ASN n 
2 47  SER n 
2 48  VAL n 
2 49  PHE n 
2 50  LYS n 
2 51  GLN n 
2 52  TYR n 
2 53  PHE n 
2 54  PHE n 
2 55  GLU n 
2 56  THR n 
2 57  LYS n 
2 58  CYS n 
2 59  ARG n 
2 60  ASP n 
2 61  PRO n 
2 62  ASN n 
2 63  PRO n 
2 64  VAL n 
2 65  ASP n 
2 66  SER n 
2 67  GLY n 
2 68  CYS n 
2 69  ARG n 
2 70  GLY n 
2 71  ILE n 
2 72  ASP n 
2 73  SER n 
2 74  LYS n 
2 75  HIS n 
2 76  TRP n 
2 77  ASN n 
2 78  SER n 
2 79  TYR n 
2 80  CYS n 
2 81  THR n 
2 82  THR n 
2 83  THR n 
2 84  HIS n 
2 85  THR n 
2 86  PHE n 
2 87  VAL n 
2 88  LYS n 
2 89  ALA n 
2 90  LEU n 
2 91  THR n 
2 92  MET n 
2 93  ASP n 
2 94  GLY n 
2 95  LYS n 
2 96  GLN n 
2 97  ALA n 
2 98  ALA n 
2 99  TRP n 
2 100 ARG n 
2 101 PHE n 
2 102 ILE n 
2 103 ARG n 
2 104 ILE n 
2 105 ASP n 
2 106 THR n 
2 107 ALA n 
2 108 CYS n 
2 109 VAL n 
2 110 CYS n 
2 111 VAL n 
2 112 LEU n 
2 113 SER n 
2 114 ARG n 
2 115 LYS n 
2 116 ALA n 
2 117 VAL n 
2 118 ARG n 
2 119 ARG n 
2 120 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'NTRK1, TRK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 
7108 Spodoptera ? ? ? ? ? TN5 ? ? ? ? ? ? ? PLASMID ? ? ? PACGP67A ? ? 
2 1 sample ? ? ? human Homo NGFB         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 
7108 Spodoptera ? ? ? ? ? ?   ? ? ? ? ? ? ? ?       ? ? ? ?        ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NTRK1_HUMAN P04629 1 
;CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTP
RLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPT
LKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAE
VSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVN
NGNYTLLAANPFGQASASIMAAFMDNP
;
36  ? 
2 UNP NGF_HUMAN   P01138 2 
;SSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCT
TTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
;
123 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IFG A 1 ? 347 ? P04629 36  ? 382 ? 36 382 
2 1 2IFG B 1 ? 347 ? P04629 36  ? 382 ? 36 382 
3 2 2IFG E 1 ? 120 ? P01138 122 ? 241 ? 1  120 
4 2 2IFG F 1 ? 120 ? P01138 122 ? 241 ? 1  120 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                   ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                  ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                      ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                  ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                 ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                    ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose  ? 'C8 H15 N O6'    221.208 
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                    ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2IFG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.91 
_exptl_crystal.density_percent_sol   75.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'PEG, GLYCINE, PH 7.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 293K, pH 7.50' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2IFG 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.400 
_reflns.number_obs                   26668 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.40 
_reflns_shell.d_res_low              3.50 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2IFG 
_refine.ls_number_reflns_obs                     26668 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             12 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.297 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.297 
_refine.ls_R_factor_R_free                       0.331 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1WWW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7037 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         446 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7483 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.60  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.40 
_refine_ls_shell.d_res_low                        3.50 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.37 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.391 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IFG 
_struct.title                     'Structure of the extracellular segment of human TRKA in complex with nerve growth factor' 
_struct.pdbx_descriptor           'Structure of the extracellular segment of human TRKA in complex with nerve growth factor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IFG 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRK, TRKA, NGF, NERVE GROWTH FACTOR, RECEPTOR-LIGAND COMPLEX, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 4 ? 
J N N 5 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 4 ? 
P N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 48  ? LEU A 52  ? GLU A 83  LEU A 87  5 ? 5  
HELX_P HELX_P2  2  ASP A 74  ? PHE A 78  ? ASP A 109 PHE A 113 5 ? 5  
HELX_P HELX_P3  3  SER A 118 ? ALA A 120 ? SER A 153 ALA A 155 5 ? 3  
HELX_P HELX_P4  4  LEU A 121 ? GLU A 130 ? LEU A 156 GLU A 165 1 ? 10 
HELX_P HELX_P5  5  VAL A 135 ? LYS A 139 ? VAL A 170 LYS A 174 5 ? 5  
HELX_P HELX_P6  6  THR A 317 ? ASN A 321 ? THR A 352 ASN A 356 5 ? 5  
HELX_P HELX_P7  7  GLU B 48  ? ARG B 53  ? GLU B 83  ARG B 88  5 ? 6  
HELX_P HELX_P8  8  ASP B 74  ? PHE B 78  ? ASP B 109 PHE B 113 5 ? 5  
HELX_P HELX_P9  9  SER B 96  ? VAL B 100 ? SER B 131 VAL B 135 5 ? 5  
HELX_P HELX_P10 10 SER B 118 ? ALA B 120 ? SER B 153 ALA B 155 5 ? 3  
HELX_P HELX_P11 11 LEU B 121 ? GLU B 130 ? LEU B 156 GLU B 165 1 ? 10 
HELX_P HELX_P12 12 VAL B 135 ? LYS B 139 ? VAL B 170 LYS B 174 5 ? 5  
HELX_P HELX_P13 13 THR B 220 ? ASN B 224 ? THR B 255 ASN B 259 5 ? 5  
HELX_P HELX_P14 14 THR B 317 ? ASN B 321 ? THR B 352 ASN B 356 5 ? 5  
HELX_P HELX_P15 15 PRO C 5   ? GLY C 10  ? PRO E 5   GLY E 10  1 ? 6  
HELX_P HELX_P16 16 PRO D 5   ? GLY D 10  ? PRO F 5   GLY F 10  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 1   SG  ? ? ? 1_555 A CYS 6   SG ? ? A CYS 36  A CYS 41  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf2  disulf ?    ? A CYS 5   SG  ? ? ? 1_555 A CYS 15  SG ? ? A CYS 40  A CYS 50  1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf3  disulf ?    ? A CYS 117 SG  ? ? ? 1_555 A CYS 142 SG ? ? A CYS 152 A CYS 177 1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf4  disulf ?    ? A CYS 119 SG  ? ? ? 1_555 A CYS 156 SG ? ? A CYS 154 A CYS 191 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf5  disulf ?    ? A CYS 180 SG  ? ? ? 1_555 A CYS 230 SG ? ? A CYS 215 A CYS 265 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf6  disulf ?    ? A CYS 265 SG  ? ? ? 1_555 A CYS 310 SG ? ? A CYS 300 A CYS 345 1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf7  disulf ?    ? B CYS 1   SG  ? ? ? 1_555 B CYS 6   SG ? ? B CYS 36  B CYS 41  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf8  disulf ?    ? B CYS 5   SG  ? ? ? 1_555 B CYS 15  SG ? ? B CYS 40  B CYS 50  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf9  disulf ?    ? B CYS 117 SG  ? ? ? 1_555 B CYS 142 SG ? ? B CYS 152 B CYS 177 1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf10 disulf ?    ? B CYS 119 SG  ? ? ? 1_555 B CYS 156 SG ? ? B CYS 154 B CYS 191 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf11 disulf ?    ? B CYS 180 SG  ? ? ? 1_555 B CYS 230 SG ? ? B CYS 215 B CYS 265 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf12 disulf ?    ? B CYS 265 SG  ? ? ? 1_555 B CYS 310 SG ? ? B CYS 300 B CYS 345 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf13 disulf ?    ? C CYS 15  SG  ? ? ? 1_555 C CYS 80  SG ? ? E CYS 15  E CYS 80  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf14 disulf ?    ? C CYS 58  SG  ? ? ? 1_555 C CYS 108 SG ? ? E CYS 58  E CYS 108 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf15 disulf ?    ? C CYS 68  SG  ? ? ? 1_555 C CYS 110 SG ? ? E CYS 68  E CYS 110 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf16 disulf ?    ? D CYS 15  SG  ? ? ? 1_555 D CYS 80  SG ? ? F CYS 15  F CYS 80  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf17 disulf ?    ? D CYS 58  SG  ? ? ? 1_555 D CYS 108 SG ? ? F CYS 58  F CYS 108 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf18 disulf ?    ? D CYS 68  SG  ? ? ? 1_555 D CYS 110 SG ? ? F CYS 68  F CYS 110 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
covale1  covale one  ? A ASN 60  ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 95  I NAG 1   1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale2  covale one  ? A ASN 86  ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 121 J NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale3  covale one  ? A ASN 153 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 188 C NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale4  covale one  ? A ASN 227 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 262 D NAG 1   1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5  covale one  ? A ASN 246 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 281 G NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale6  covale one  ? A ASN 323 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 358 H NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale7  covale one  ? B ASN 60  ND2 ? ? ? 1_555 O NAG .   C1 ? ? B ASN 95  O NAG 1   1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale8  covale one  ? B ASN 86  ND2 ? ? ? 1_555 P NAG .   C1 ? ? B ASN 121 P NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale9  covale one  ? B ASN 153 ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 188 K NAG 1   1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale10 covale one  ? B ASN 227 ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 262 L NAG 1   1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale11 covale one  ? B ASN 246 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 281 M NAG 1   1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale12 covale one  ? B ASN 323 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 358 N NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale13 covale both ? E NAG .   O4  ? ? ? 1_555 E NDG .   C1 ? ? C NAG 1   C NDG 2   1_555 ? ? ? ? ? ? ? 1.400 ? ?               
covale14 covale both ? F NAG .   O4  ? ? ? 1_555 F NDG .   C1 ? ? D NAG 1   D NDG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
covale15 covale both ? F NDG .   O4  ? ? ? 1_555 F MAN .   C1 ? ? D NDG 2   D MAN 3   1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale16 covale both ? G NAG .   O4  ? ? ? 1_555 G NDG .   C1 ? ? G NAG 1   G NDG 2   1_555 ? ? ? ? ? ? ? 1.386 ? ?               
covale17 covale both ? G NDG .   O4  ? ? ? 1_555 G BMA .   C1 ? ? G NDG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.386 ? ?               
covale18 covale both ? H NAG .   O4  ? ? ? 1_555 H NDG .   C1 ? ? H NAG 1   H NDG 2   1_555 ? ? ? ? ? ? ? 1.396 ? ?               
covale19 covale both ? H NDG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? H NDG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale20 covale both ? I NAG .   O4  ? ? ? 1_555 I NDG .   C1 ? ? I NAG 1   I NDG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale21 covale both ? I NDG .   O4  ? ? ? 1_555 I MAN .   C1 ? ? I NDG 2   I MAN 3   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
covale22 covale both ? J NAG .   O4  ? ? ? 1_555 J NDG .   C1 ? ? J NAG 1   J NDG 2   1_555 ? ? ? ? ? ? ? 1.389 ? ?               
covale23 covale both ? J NDG .   O4  ? ? ? 1_555 J BMA .   C1 ? ? J NDG 2   J BMA 3   1_555 ? ? ? ? ? ? ? 1.388 ? ?               
covale24 covale both ? K NAG .   O4  ? ? ? 1_555 K NDG .   C1 ? ? K NAG 1   K NDG 2   1_555 ? ? ? ? ? ? ? 1.384 ? ?               
covale25 covale both ? L NAG .   O4  ? ? ? 1_555 L NDG .   C1 ? ? L NAG 1   L NDG 2   1_555 ? ? ? ? ? ? ? 1.388 ? ?               
covale26 covale both ? L NDG .   O4  ? ? ? 1_555 L MAN .   C1 ? ? L NDG 2   L MAN 3   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale27 covale both ? M NAG .   O4  ? ? ? 1_555 M NDG .   C1 ? ? M NAG 1   M NDG 2   1_555 ? ? ? ? ? ? ? 1.384 ? ?               
covale28 covale both ? M NDG .   O4  ? ? ? 1_555 M BMA .   C1 ? ? M NDG 2   M BMA 3   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale29 covale both ? N NAG .   O4  ? ? ? 1_555 N NDG .   C1 ? ? N NAG 1   N NDG 2   1_555 ? ? ? ? ? ? ? 1.394 ? ?               
covale30 covale both ? N NDG .   O4  ? ? ? 1_555 N BMA .   C1 ? ? N NDG 2   N BMA 3   1_555 ? ? ? ? ? ? ? 1.390 ? ?               
covale31 covale both ? O NAG .   O4  ? ? ? 1_555 O NDG .   C1 ? ? O NAG 1   O NDG 2   1_555 ? ? ? ? ? ? ? 1.388 ? ?               
covale32 covale both ? O NDG .   O4  ? ? ? 1_555 O MAN .   C1 ? ? O NDG 2   O MAN 3   1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale33 covale both ? P NAG .   O4  ? ? ? 1_555 P NDG .   C1 ? ? P NAG 1   P NDG 2   1_555 ? ? ? ? ? ? ? 1.390 ? ?               
covale34 covale both ? P NDG .   O4  ? ? ? 1_555 P BMA .   C1 ? ? P NDG 2   P BMA 3   1_555 ? ? ? ? ? ? ? 1.388 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 CYS 1   A . ? CYS 36  A PRO 2   A ? PRO 37  A 1 -0.32 
2 GLN 273 A . ? GLN 308 A PRO 274 A ? PRO 309 A 1 0.51  
3 CYS 1   B . ? CYS 36  B PRO 2   B ? PRO 37  B 1 -0.20 
4 GLN 273 B . ? GLN 308 B PRO 274 B ? PRO 309 B 1 -0.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 4 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 4 ? 
H ? 4 ? 
I ? 5 ? 
J ? 2 ? 
K ? 4 ? 
L ? 3 ? 
M ? 3 ? 
N ? 4 ? 
O ? 4 ? 
P ? 5 ? 
Q ? 2 ? 
R ? 5 ? 
S ? 2 ? 
T ? 2 ? 
U ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 13  ? ARG A 14  ? LEU A 48  ARG A 49  
A 2 GLU A 35  ? TYR A 37  ? GLU A 70  TYR A 72  
A 3 ASN A 60  ? THR A 62  ? ASN A 95  THR A 97  
A 4 ARG A 84  ? ASN A 86  ? ARG A 119 ASN A 121 
A 5 GLU A 107 ? VAL A 109 ? GLU A 142 VAL A 144 
B 1 HIS A 46  ? LEU A 47  ? HIS A 81  LEU A 82  
B 2 PHE A 70  ? VAL A 71  ? PHE A 105 VAL A 106 
C 1 THR A 160 ? GLN A 164 ? THR A 195 GLN A 199 
C 2 VAL A 176 ? GLU A 183 ? VAL A 211 GLU A 218 
C 3 SER A 211 ? ALA A 217 ? SER A 246 ALA A 252 
C 4 ALA A 201 ? VAL A 203 ? ALA A 236 VAL A 238 
D 1 TRP A 192 ? LEU A 194 ? TRP A 227 LEU A 229 
D 2 VAL A 228 ? CYS A 230 ? VAL A 263 CYS A 265 
D 3 VAL A 241 ? VAL A 243 ? VAL A 276 VAL A 278 
E 1 GLU A 233 ? ASN A 234 ? GLU A 268 ASN A 269 
E 2 GLY A 237 ? ARG A 238 ? GLY A 272 ARG A 273 
F 1 PHE A 249 ? LEU A 255 ? PHE A 284 LEU A 290 
F 2 TRP A 264 ? GLN A 273 ? TRP A 299 GLN A 308 
F 3 VAL A 259 ? GLU A 260 ? VAL A 294 GLU A 295 
G 1 PHE A 249 ? LEU A 255 ? PHE A 284 LEU A 290 
G 2 TRP A 264 ? GLN A 273 ? TRP A 299 GLN A 308 
G 3 ARG A 307 ? LEU A 313 ? ARG A 342 LEU A 348 
G 4 ILE A 293 ? PHE A 297 ? ILE A 328 PHE A 332 
H 1 SER A 285 ? VAL A 286 ? SER A 320 VAL A 321 
H 2 SER A 277 ? PHE A 282 ? SER A 312 PHE A 317 
H 3 GLY A 322 ? ASN A 330 ? GLY A 357 ASN A 365 
H 4 GLY A 333 ? ALA A 341 ? GLY A 368 ALA A 376 
I 1 GLY B 12  ? ARG B 14  ? GLY B 47  ARG B 49  
I 2 GLU B 35  ? TYR B 37  ? GLU B 70  TYR B 72  
I 3 ASN B 60  ? THR B 62  ? ASN B 95  THR B 97  
I 4 ARG B 84  ? ASN B 86  ? ARG B 119 ASN B 121 
I 5 GLU B 107 ? VAL B 109 ? GLU B 142 VAL B 144 
J 1 HIS B 46  ? LEU B 47  ? HIS B 81  LEU B 82  
J 2 PHE B 70  ? VAL B 71  ? PHE B 105 VAL B 106 
K 1 THR B 160 ? GLN B 164 ? THR B 195 GLN B 199 
K 2 VAL B 176 ? GLU B 183 ? VAL B 211 GLU B 218 
K 3 SER B 211 ? ALA B 217 ? SER B 246 ALA B 252 
K 4 ALA B 201 ? VAL B 203 ? ALA B 236 VAL B 238 
L 1 TRP B 192 ? LEU B 194 ? TRP B 227 LEU B 229 
L 2 VAL B 228 ? CYS B 230 ? VAL B 263 CYS B 265 
L 3 VAL B 241 ? VAL B 243 ? VAL B 276 VAL B 278 
M 1 PHE B 249 ? LEU B 255 ? PHE B 284 LEU B 290 
M 2 TRP B 264 ? GLN B 273 ? TRP B 299 GLN B 308 
M 3 VAL B 259 ? GLU B 260 ? VAL B 294 GLU B 295 
N 1 PHE B 249 ? LEU B 255 ? PHE B 284 LEU B 290 
N 2 TRP B 264 ? GLN B 273 ? TRP B 299 GLN B 308 
N 3 ARG B 307 ? LEU B 313 ? ARG B 342 LEU B 348 
N 4 ILE B 293 ? PHE B 297 ? ILE B 328 PHE B 332 
O 1 SER B 285 ? VAL B 286 ? SER B 320 VAL B 321 
O 2 SER B 277 ? PHE B 282 ? SER B 312 PHE B 317 
O 3 GLY B 322 ? ASN B 330 ? GLY B 357 ASN B 365 
O 4 GLY B 333 ? ALA B 341 ? GLY B 368 ALA B 376 
P 1 GLU C 11  ? SER C 13  ? GLU E 11  SER E 13  
P 2 GLN D 96  ? ARG D 114 ? GLN F 96  ARG F 114 
P 3 TRP D 76  ? ASP D 93  ? TRP F 76  ASP F 93  
P 4 GLU D 35  ? VAL D 38  ? GLU F 35  VAL F 38  
P 5 THR D 27  ? THR D 29  ? THR F 27  THR F 29  
Q 1 SER C 17  ? VAL C 22  ? SER E 17  VAL E 22  
Q 2 PHE C 53  ? CYS C 58  ? PHE E 53  CYS E 58  
R 1 THR C 27  ? THR C 29  ? THR E 27  THR E 29  
R 2 GLU C 35  ? VAL C 38  ? GLU E 35  VAL E 38  
R 3 TRP C 76  ? MET C 92  ? TRP E 76  MET E 92  
R 4 ALA C 97  ? ARG C 114 ? ALA E 97  ARG E 114 
R 5 GLU D 11  ? SER D 13  ? GLU F 11  SER F 13  
S 1 GLU C 41  ? ASN C 43  ? GLU E 41  ASN E 43  
S 2 VAL C 48  ? LYS C 50  ? VAL E 48  LYS E 50  
T 1 SER D 17  ? VAL D 22  ? SER F 17  VAL F 22  
T 2 PHE D 53  ? CYS D 58  ? PHE F 53  CYS F 58  
U 1 GLU D 41  ? ILE D 44  ? GLU F 41  ILE F 44  
U 2 SER D 47  ? LYS D 50  ? SER F 47  LYS F 50  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 13  ? N LEU A 48  O GLU A 35  ? O GLU A 70  
A 2 3 N LEU A 36  ? N LEU A 71  O THR A 62  ? O THR A 97  
A 3 4 N LEU A 61  ? N LEU A 96  O ASN A 86  ? O ASN A 121 
A 4 5 N LEU A 85  ? N LEU A 120 O GLU A 107 ? O GLU A 142 
B 1 2 N LEU A 47  ? N LEU A 82  O PHE A 70  ? O PHE A 105 
C 1 2 N THR A 160 ? N THR A 195 O GLU A 183 ? O GLU A 218 
C 2 3 N LEU A 178 ? N LEU A 213 O LEU A 214 ? O LEU A 249 
C 3 4 O ALA A 217 ? O ALA A 252 N ALA A 201 ? N ALA A 236 
D 1 2 N ILE A 193 ? N ILE A 228 O THR A 229 ? O THR A 264 
D 2 3 N CYS A 230 ? N CYS A 265 O VAL A 241 ? O VAL A 276 
E 1 2 N ASN A 234 ? N ASN A 269 O GLY A 237 ? O GLY A 272 
F 1 2 N SER A 252 ? N SER A 287 O ASP A 271 ? O ASP A 306 
F 2 3 O CYS A 265 ? O CYS A 300 N VAL A 259 ? N VAL A 294 
G 1 2 N SER A 252 ? N SER A 287 O ASP A 271 ? O ASP A 306 
G 2 3 N TRP A 264 ? N TRP A 299 O LEU A 313 ? O LEU A 348 
G 3 4 O ARG A 312 ? O ARG A 347 N PHE A 294 ? N PHE A 329 
H 1 2 O SER A 285 ? O SER A 320 N PHE A 282 ? N PHE A 317 
H 2 3 N ARG A 279 ? N ARG A 314 O LEU A 327 ? O LEU A 362 
H 3 4 N TYR A 324 ? N TYR A 359 O ILE A 339 ? O ILE A 374 
I 1 2 N LEU B 13  ? N LEU B 48  O GLU B 35  ? O GLU B 70  
I 2 3 N LEU B 36  ? N LEU B 71  O THR B 62  ? O THR B 97  
I 3 4 N LEU B 61  ? N LEU B 96  O ASN B 86  ? O ASN B 121 
I 4 5 N LEU B 85  ? N LEU B 120 O GLU B 107 ? O GLU B 142 
J 1 2 N LEU B 47  ? N LEU B 82  O PHE B 70  ? O PHE B 105 
K 1 2 N LYS B 162 ? N LYS B 197 O GLN B 181 ? O GLN B 216 
K 2 3 N VAL B 176 ? N VAL B 211 O LEU B 216 ? O LEU B 251 
K 3 4 O THR B 215 ? O THR B 250 N VAL B 203 ? N VAL B 238 
L 1 2 N ILE B 193 ? N ILE B 228 O THR B 229 ? O THR B 264 
L 2 3 N VAL B 228 ? N VAL B 263 O VAL B 243 ? O VAL B 278 
M 1 2 N PHE B 249 ? N PHE B 284 O GLN B 273 ? O GLN B 308 
M 2 3 O CYS B 265 ? O CYS B 300 N VAL B 259 ? N VAL B 294 
N 1 2 N PHE B 249 ? N PHE B 284 O GLN B 273 ? O GLN B 308 
N 2 3 N VAL B 270 ? N VAL B 305 O ARG B 307 ? O ARG B 342 
N 3 4 O ARG B 312 ? O ARG B 347 N PHE B 294 ? N PHE B 329 
O 1 2 O SER B 285 ? O SER B 320 N PHE B 282 ? N PHE B 317 
O 2 3 N ARG B 279 ? N ARG B 314 O LEU B 327 ? O LEU B 362 
O 3 4 N TYR B 324 ? N TYR B 359 O ILE B 339 ? O ILE B 374 
P 1 2 N PHE C 12  ? N PHE E 12  O LEU D 112 ? O LEU F 112 
P 2 3 O SER D 113 ? O SER F 113 N ASN D 77  ? N ASN F 77  
P 3 4 O MET D 92  ? O MET F 92  N MET D 37  ? N MET F 37  
P 4 5 O VAL D 36  ? O VAL F 36  N ALA D 28  ? N ALA F 28  
Q 1 2 N VAL C 22  ? N VAL E 22  O PHE C 53  ? O PHE E 53  
R 1 2 N ALA C 28  ? N ALA E 28  O VAL C 36  ? O VAL E 36  
R 2 3 N MET C 37  ? N MET E 37  O MET C 92  ? O MET E 92  
R 3 4 N ASN C 77  ? N ASN E 77  O SER C 113 ? O SER E 113 
R 4 5 N LEU C 112 ? N LEU E 112 O PHE D 12  ? O PHE F 12  
S 1 2 N VAL C 42  ? N VAL E 42  O PHE C 49  ? O PHE E 49  
T 1 2 N VAL D 22  ? N VAL F 22  O PHE D 53  ? O PHE F 53  
U 1 2 N VAL D 42  ? N VAL F 42  O PHE D 49  ? O PHE F 49  
# 
_database_PDB_matrix.entry_id          2IFG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IFG 
_atom_sites.fract_transf_matrix[1][1]   0.009073 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002287 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012243 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008910 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 1   ? -56.162 -22.263 27.882  1.00 191.16 ? 36  CYS A N   1 
ATOM   2    C CA  . CYS A 1 1   ? -55.571 -20.896 27.947  1.00 190.18 ? 36  CYS A CA  1 
ATOM   3    C C   . CYS A 1 1   ? -56.114 -19.964 26.866  1.00 188.54 ? 36  CYS A C   1 
ATOM   4    O O   . CYS A 1 1   ? -55.793 -20.113 25.685  1.00 189.16 ? 36  CYS A O   1 
ATOM   5    C CB  . CYS A 1 1   ? -54.044 -20.973 27.833  1.00 169.23 ? 36  CYS A CB  1 
ATOM   6    S SG  . CYS A 1 1   ? -53.257 -19.432 27.254  1.00 158.00 ? 36  CYS A SG  1 
ATOM   7    N N   . PRO A 1 2   ? -56.956 -18.992 27.257  1.00 151.50 ? 37  PRO A N   1 
ATOM   8    C CA  . PRO A 1 2   ? -57.390 -18.773 28.643  1.00 153.14 ? 37  PRO A CA  1 
ATOM   9    C C   . PRO A 1 2   ? -58.580 -19.662 29.016  1.00 154.46 ? 37  PRO A C   1 
ATOM   10   O O   . PRO A 1 2   ? -59.334 -20.102 28.147  1.00 155.28 ? 37  PRO A O   1 
ATOM   11   C CB  . PRO A 1 2   ? -57.763 -17.288 28.661  1.00 178.61 ? 37  PRO A CB  1 
ATOM   12   C CG  . PRO A 1 2   ? -56.967 -16.705 27.523  1.00 165.91 ? 37  PRO A CG  1 
ATOM   13   C CD  . PRO A 1 2   ? -57.136 -17.762 26.469  1.00 168.29 ? 37  PRO A CD  1 
ATOM   14   N N   . ASP A 1 3   ? -58.739 -19.915 30.312  1.00 158.59 ? 38  ASP A N   1 
ATOM   15   C CA  . ASP A 1 3   ? -59.829 -20.739 30.832  1.00 158.77 ? 38  ASP A CA  1 
ATOM   16   C C   . ASP A 1 3   ? -59.591 -20.970 32.320  1.00 154.44 ? 38  ASP A C   1 
ATOM   17   O O   . ASP A 1 3   ? -60.528 -21.125 33.103  1.00 154.54 ? 38  ASP A O   1 
ATOM   18   C CB  . ASP A 1 3   ? -59.884 -22.084 30.103  1.00 181.60 ? 38  ASP A CB  1 
ATOM   19   C CG  . ASP A 1 3   ? -61.077 -22.924 30.517  1.00 186.96 ? 38  ASP A CG  1 
ATOM   20   O OD1 . ASP A 1 3   ? -61.176 -23.273 31.713  1.00 193.68 ? 38  ASP A OD1 1 
ATOM   21   O OD2 . ASP A 1 3   ? -61.918 -23.233 29.647  1.00 193.36 ? 38  ASP A OD2 1 
ATOM   22   N N   . ALA A 1 4   ? -58.317 -20.992 32.694  1.00 122.15 ? 39  ALA A N   1 
ATOM   23   C CA  . ALA A 1 4   ? -57.905 -21.187 34.075  1.00 119.20 ? 39  ALA A CA  1 
ATOM   24   C C   . ALA A 1 4   ? -56.457 -20.730 34.225  1.00 117.21 ? 39  ALA A C   1 
ATOM   25   O O   . ALA A 1 4   ? -55.781 -21.105 35.184  1.00 115.99 ? 39  ALA A O   1 
ATOM   26   C CB  . ALA A 1 4   ? -58.036 -22.653 34.460  1.00 139.59 ? 39  ALA A CB  1 
ATOM   27   N N   . CYS A 1 5   ? -55.988 -19.920 33.274  1.00 142.28 ? 40  CYS A N   1 
ATOM   28   C CA  . CYS A 1 5   ? -54.616 -19.421 33.315  1.00 143.05 ? 40  CYS A CA  1 
ATOM   29   C C   . CYS A 1 5   ? -54.165 -18.512 32.165  1.00 147.22 ? 40  CYS A C   1 
ATOM   30   O O   . CYS A 1 5   ? -54.964 -18.006 31.379  1.00 145.82 ? 40  CYS A O   1 
ATOM   31   C CB  . CYS A 1 5   ? -53.638 -20.593 33.374  1.00 178.63 ? 40  CYS A CB  1 
ATOM   32   S SG  . CYS A 1 5   ? -51.979 -20.034 33.847  1.00 162.66 ? 40  CYS A SG  1 
ATOM   33   N N   . CYS A 1 6   ? -52.845 -18.331 32.123  1.00 156.76 ? 41  CYS A N   1 
ATOM   34   C CA  . CYS A 1 6   ? -52.075 -17.569 31.139  1.00 162.44 ? 41  CYS A CA  1 
ATOM   35   C C   . CYS A 1 6   ? -52.326 -16.091 30.851  1.00 166.09 ? 41  CYS A C   1 
ATOM   36   O O   . CYS A 1 6   ? -52.180 -15.653 29.711  1.00 166.27 ? 41  CYS A O   1 
ATOM   37   C CB  . CYS A 1 6   ? -52.061 -18.324 29.805  1.00 200.00 ? 41  CYS A CB  1 
ATOM   38   S SG  . CYS A 1 6   ? -53.550 -18.123 28.779  1.00 200.00 ? 41  CYS A SG  1 
ATOM   39   N N   . PRO A 1 7   ? -52.691 -15.295 31.865  1.00 96.78  ? 42  PRO A N   1 
ATOM   40   C CA  . PRO A 1 7   ? -52.905 -13.885 31.530  1.00 99.76  ? 42  PRO A CA  1 
ATOM   41   C C   . PRO A 1 7   ? -51.565 -13.214 31.229  1.00 102.96 ? 42  PRO A C   1 
ATOM   42   O O   . PRO A 1 7   ? -51.050 -13.319 30.118  1.00 101.34 ? 42  PRO A O   1 
ATOM   43   C CB  . PRO A 1 7   ? -53.580 -13.332 32.784  1.00 185.10 ? 42  PRO A CB  1 
ATOM   44   C CG  . PRO A 1 7   ? -53.019 -14.189 33.873  1.00 185.44 ? 42  PRO A CG  1 
ATOM   45   C CD  . PRO A 1 7   ? -53.075 -15.566 33.259  1.00 182.87 ? 42  PRO A CD  1 
ATOM   46   N N   . HIS A 1 8   ? -51.001 -12.536 32.223  1.00 196.26 ? 43  HIS A N   1 
ATOM   47   C CA  . HIS A 1 8   ? -49.716 -11.860 32.067  1.00 200.00 ? 43  HIS A CA  1 
ATOM   48   C C   . HIS A 1 8   ? -49.630 -11.098 30.742  1.00 200.00 ? 43  HIS A C   1 
ATOM   49   O O   . HIS A 1 8   ? -50.477 -10.256 30.443  1.00 200.00 ? 43  HIS A O   1 
ATOM   50   C CB  . HIS A 1 8   ? -48.575 -12.882 32.147  1.00 177.66 ? 43  HIS A CB  1 
ATOM   51   C CG  . HIS A 1 8   ? -47.228 -12.270 32.385  1.00 181.75 ? 43  HIS A CG  1 
ATOM   52   N ND1 . HIS A 1 8   ? -46.741 -11.224 31.632  1.00 185.36 ? 43  HIS A ND1 1 
ATOM   53   C CD2 . HIS A 1 8   ? -46.263 -12.565 33.287  1.00 185.66 ? 43  HIS A CD2 1 
ATOM   54   C CE1 . HIS A 1 8   ? -45.534 -10.900 32.060  1.00 187.27 ? 43  HIS A CE1 1 
ATOM   55   N NE2 . HIS A 1 8   ? -45.220 -11.699 33.064  1.00 187.29 ? 43  HIS A NE2 1 
ATOM   56   N N   . GLY A 1 9   ? -48.603 -11.407 29.955  1.00 200.00 ? 44  GLY A N   1 
ATOM   57   C CA  . GLY A 1 9   ? -48.404 -10.751 28.674  1.00 200.00 ? 44  GLY A CA  1 
ATOM   58   C C   . GLY A 1 9   ? -47.086 -11.155 28.035  1.00 200.00 ? 44  GLY A C   1 
ATOM   59   O O   . GLY A 1 9   ? -47.065 -11.727 26.944  1.00 200.00 ? 44  GLY A O   1 
ATOM   60   N N   . SER A 1 10  ? -45.984 -10.855 28.717  1.00 181.35 ? 45  SER A N   1 
ATOM   61   C CA  . SER A 1 10  ? -44.652 -11.195 28.223  1.00 179.83 ? 45  SER A CA  1 
ATOM   62   C C   . SER A 1 10  ? -44.356 -12.651 28.567  1.00 175.90 ? 45  SER A C   1 
ATOM   63   O O   . SER A 1 10  ? -45.272 -13.467 28.673  1.00 176.23 ? 45  SER A O   1 
ATOM   64   C CB  . SER A 1 10  ? -43.602 -10.288 28.871  1.00 189.34 ? 45  SER A CB  1 
ATOM   65   O OG  . SER A 1 10  ? -43.890 -8.920  28.638  1.00 190.80 ? 45  SER A OG  1 
ATOM   66   N N   . SER A 1 11  ? -43.076 -12.973 28.734  1.00 161.68 ? 46  SER A N   1 
ATOM   67   C CA  . SER A 1 11  ? -42.670 -14.329 29.088  1.00 160.19 ? 46  SER A CA  1 
ATOM   68   C C   . SER A 1 11  ? -43.257 -14.622 30.466  1.00 160.56 ? 46  SER A C   1 
ATOM   69   O O   . SER A 1 11  ? -42.603 -14.410 31.490  1.00 161.67 ? 46  SER A O   1 
ATOM   70   C CB  . SER A 1 11  ? -41.143 -14.430 29.136  1.00 144.49 ? 46  SER A CB  1 
ATOM   71   O OG  . SER A 1 11  ? -40.729 -15.741 29.480  1.00 152.86 ? 46  SER A OG  1 
ATOM   72   N N   . GLY A 1 12  ? -44.490 -15.118 30.482  1.00 137.26 ? 47  GLY A N   1 
ATOM   73   C CA  . GLY A 1 12  ? -45.162 -15.384 31.742  1.00 135.14 ? 47  GLY A CA  1 
ATOM   74   C C   . GLY A 1 12  ? -46.353 -16.323 31.638  1.00 135.88 ? 47  GLY A C   1 
ATOM   75   O O   . GLY A 1 12  ? -47.170 -16.184 30.723  1.00 137.98 ? 47  GLY A O   1 
ATOM   76   N N   . LEU A 1 13  ? -46.395 -17.273 32.496  1.00 111.69 ? 48  LEU A N   1 
ATOM   77   C CA  . LEU A 1 13  ? -47.576 -18.123 32.671  1.00 111.09 ? 48  LEU A CA  1 
ATOM   78   C C   . LEU A 1 13  ? -48.222 -17.923 34.044  1.00 113.32 ? 48  LEU A C   1 
ATOM   79   O O   . LEU A 1 13  ? -47.561 -18.223 35.041  1.00 113.89 ? 48  LEU A O   1 
ATOM   80   C CB  . LEU A 1 13  ? -47.214 -19.600 32.496  1.00 136.38 ? 48  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 13  ? -46.941 -20.088 31.073  1.00 145.23 ? 48  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 13  ? -46.573 -21.564 31.107  1.00 145.23 ? 48  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 13  ? -48.173 -19.865 30.207  1.00 145.23 ? 48  LEU A CD2 1 
ATOM   84   N N   . ARG A 1 14  ? -49.334 -17.267 34.034  1.00 119.25 ? 49  ARG A N   1 
ATOM   85   C CA  . ARG A 1 14  ? -49.947 -16.852 35.287  1.00 117.64 ? 49  ARG A CA  1 
ATOM   86   C C   . ARG A 1 14  ? -51.231 -17.620 35.560  1.00 120.04 ? 49  ARG A C   1 
ATOM   87   O O   . ARG A 1 14  ? -52.208 -17.506 34.812  1.00 120.08 ? 49  ARG A O   1 
ATOM   88   C CB  . ARG A 1 14  ? -50.245 -15.351 35.279  1.00 198.47 ? 49  ARG A CB  1 
ATOM   89   C CG  . ARG A 1 14  ? -49.015 -14.457 35.280  1.00 200.00 ? 49  ARG A CG  1 
ATOM   90   C CD  . ARG A 1 14  ? -49.416 -12.993 35.427  1.00 200.00 ? 49  ARG A CD  1 
ATOM   91   N NE  . ARG A 1 14  ? -48.271 -12.089 35.346  1.00 200.00 ? 49  ARG A NE  1 
ATOM   92   C CZ  . ARG A 1 14  ? -48.353 -10.765 35.437  1.00 200.00 ? 49  ARG A CZ  1 
ATOM   93   N NH1 . ARG A 1 14  ? -49.530 -10.180 35.614  1.00 200.00 ? 49  ARG A NH1 1 
ATOM   94   N NH2 . ARG A 1 14  ? -47.257 -10.023 35.345  1.00 200.00 ? 49  ARG A NH2 1 
ATOM   95   N N   . CYS A 1 15  ? -51.243 -18.374 36.669  1.00 58.10  ? 50  CYS A N   1 
ATOM   96   C CA  . CYS A 1 15  ? -52.435 -19.135 37.056  1.00 59.62  ? 50  CYS A CA  1 
ATOM   97   C C   . CYS A 1 15  ? -52.676 -19.036 38.568  1.00 58.76  ? 50  CYS A C   1 
ATOM   98   O O   . CYS A 1 15  ? -52.955 -20.039 39.225  1.00 59.09  ? 50  CYS A O   1 
ATOM   99   C CB  . CYS A 1 15  ? -52.271 -20.642 36.807  1.00 95.51  ? 50  CYS A CB  1 
ATOM   100  S SG  . CYS A 1 15  ? -51.458 -21.312 35.323  1.00 97.57  ? 50  CYS A SG  1 
ATOM   101  N N   . THR A 1 16  ? -52.793 -17.815 39.074  1.00 163.72 ? 51  THR A N   1 
ATOM   102  C CA  . THR A 1 16  ? -53.097 -17.639 40.494  1.00 162.80 ? 51  THR A CA  1 
ATOM   103  C C   . THR A 1 16  ? -54.583 -17.966 40.786  1.00 168.74 ? 51  THR A C   1 
ATOM   104  O O   . THR A 1 16  ? -55.341 -17.090 41.206  1.00 167.72 ? 51  THR A O   1 
ATOM   105  C CB  . THR A 1 16  ? -52.809 -16.187 40.963  1.00 191.74 ? 51  THR A CB  1 
ATOM   106  O OG1 . THR A 1 16  ? -51.478 -15.811 40.577  1.00 188.61 ? 51  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 16  ? -52.935 -16.081 42.486  1.00 185.84 ? 51  THR A CG2 1 
ATOM   108  N N   . ARG A 1 17  ? -55.000 -19.212 40.546  1.00 112.35 ? 52  ARG A N   1 
ATOM   109  C CA  . ARG A 1 17  ? -56.380 -19.623 40.831  1.00 121.49 ? 52  ARG A CA  1 
ATOM   110  C C   . ARG A 1 17  ? -56.555 -21.051 41.362  1.00 123.77 ? 52  ARG A C   1 
ATOM   111  O O   . ARG A 1 17  ? -56.844 -21.240 42.541  1.00 122.41 ? 52  ARG A O   1 
ATOM   112  C CB  . ARG A 1 17  ? -57.289 -19.443 39.613  1.00 166.96 ? 52  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 17  ? -58.672 -20.041 39.863  1.00 182.94 ? 52  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 17  ? -59.782 -19.416 39.040  1.00 200.00 ? 52  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 17  ? -61.077 -19.963 39.440  1.00 200.00 ? 52  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 17  ? -62.251 -19.538 38.986  1.00 200.00 ? 52  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 17  ? -62.308 -18.548 38.107  1.00 200.00 ? 52  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 17  ? -63.371 -20.104 39.416  1.00 200.00 ? 52  ARG A NH2 1 
ATOM   119  N N   . ASP A 1 18  ? -56.415 -22.057 40.504  1.00 64.75  ? 53  ASP A N   1 
ATOM   120  C CA  . ASP A 1 18  ? -56.569 -23.435 40.967  1.00 71.51  ? 53  ASP A CA  1 
ATOM   121  C C   . ASP A 1 18  ? -55.936 -24.497 40.079  1.00 76.03  ? 53  ASP A C   1 
ATOM   122  O O   . ASP A 1 18  ? -55.697 -24.272 38.894  1.00 74.79  ? 53  ASP A O   1 
ATOM   123  C CB  . ASP A 1 18  ? -58.048 -23.768 41.153  1.00 183.21 ? 53  ASP A CB  1 
ATOM   124  C CG  . ASP A 1 18  ? -58.265 -25.202 41.589  1.00 188.22 ? 53  ASP A CG  1 
ATOM   125  O OD1 . ASP A 1 18  ? -57.812 -25.561 42.695  1.00 194.40 ? 53  ASP A OD1 1 
ATOM   126  O OD2 . ASP A 1 18  ? -58.879 -25.973 40.824  1.00 194.75 ? 53  ASP A OD2 1 
ATOM   127  N N   . GLY A 1 19  ? -55.681 -25.660 40.673  1.00 179.83 ? 54  GLY A N   1 
ATOM   128  C CA  . GLY A 1 19  ? -55.075 -26.766 39.956  1.00 185.40 ? 54  GLY A CA  1 
ATOM   129  C C   . GLY A 1 19  ? -55.509 -26.882 38.510  1.00 190.01 ? 54  GLY A C   1 
ATOM   130  O O   . GLY A 1 19  ? -56.701 -26.873 38.206  1.00 191.00 ? 54  GLY A O   1 
ATOM   131  N N   . ALA A 1 20  ? -54.529 -26.987 37.617  1.00 188.97 ? 55  ALA A N   1 
ATOM   132  C CA  . ALA A 1 20  ? -54.783 -27.108 36.186  1.00 191.85 ? 55  ALA A CA  1 
ATOM   133  C C   . ALA A 1 20  ? -53.486 -27.490 35.485  1.00 194.51 ? 55  ALA A C   1 
ATOM   134  O O   . ALA A 1 20  ? -53.199 -27.022 34.383  1.00 195.00 ? 55  ALA A O   1 
ATOM   135  C CB  . ALA A 1 20  ? -55.311 -25.791 35.633  1.00 187.03 ? 55  ALA A CB  1 
ATOM   136  N N   . LEU A 1 21  ? -52.705 -28.342 36.139  1.00 198.03 ? 56  LEU A N   1 
ATOM   137  C CA  . LEU A 1 21  ? -51.430 -28.794 35.597  1.00 200.00 ? 56  LEU A CA  1 
ATOM   138  C C   . LEU A 1 21  ? -51.570 -30.181 34.982  1.00 199.53 ? 56  LEU A C   1 
ATOM   139  O O   . LEU A 1 21  ? -50.675 -30.654 34.283  1.00 199.67 ? 56  LEU A O   1 
ATOM   140  C CB  . LEU A 1 21  ? -50.375 -28.830 36.705  1.00 188.74 ? 56  LEU A CB  1 
ATOM   141  C CG  . LEU A 1 21  ? -50.206 -27.555 37.535  1.00 193.35 ? 56  LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 21  ? -49.175 -27.791 38.626  1.00 196.07 ? 56  LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 21  ? -49.784 -26.403 36.639  1.00 196.07 ? 56  LEU A CD2 1 
ATOM   144  N N   . ASP A 1 22  ? -52.702 -30.827 35.249  1.00 197.88 ? 57  ASP A N   1 
ATOM   145  C CA  . ASP A 1 22  ? -52.970 -32.165 34.732  1.00 197.71 ? 57  ASP A CA  1 
ATOM   146  C C   . ASP A 1 22  ? -52.884 -32.221 33.209  1.00 196.72 ? 57  ASP A C   1 
ATOM   147  O O   . ASP A 1 22  ? -52.864 -33.303 32.621  1.00 196.39 ? 57  ASP A O   1 
ATOM   148  C CB  . ASP A 1 22  ? -54.356 -32.637 35.185  1.00 126.51 ? 57  ASP A CB  1 
ATOM   149  C CG  . ASP A 1 22  ? -54.473 -32.741 36.695  1.00 127.81 ? 57  ASP A CG  1 
ATOM   150  O OD1 . ASP A 1 22  ? -53.706 -33.518 37.300  1.00 129.38 ? 57  ASP A OD1 1 
ATOM   151  O OD2 . ASP A 1 22  ? -55.333 -32.048 37.277  1.00 129.50 ? 57  ASP A OD2 1 
ATOM   152  N N   . SER A 1 23  ? -52.832 -31.054 32.573  1.00 200.00 ? 58  SER A N   1 
ATOM   153  C CA  . SER A 1 23  ? -52.749 -30.980 31.118  1.00 200.00 ? 58  SER A CA  1 
ATOM   154  C C   . SER A 1 23  ? -51.975 -29.747 30.661  1.00 200.00 ? 58  SER A C   1 
ATOM   155  O O   . SER A 1 23  ? -52.162 -29.271 29.541  1.00 200.00 ? 58  SER A O   1 
ATOM   156  C CB  . SER A 1 23  ? -54.155 -30.956 30.510  1.00 200.00 ? 58  SER A CB  1 
ATOM   157  O OG  . SER A 1 23  ? -54.878 -32.126 30.848  1.00 198.61 ? 58  SER A OG  1 
ATOM   158  N N   . LEU A 1 24  ? -51.105 -29.236 31.527  1.00 176.67 ? 59  LEU A N   1 
ATOM   159  C CA  . LEU A 1 24  ? -50.310 -28.057 31.201  1.00 176.18 ? 59  LEU A CA  1 
ATOM   160  C C   . LEU A 1 24  ? -48.947 -28.457 30.642  1.00 177.96 ? 59  LEU A C   1 
ATOM   161  O O   . LEU A 1 24  ? -48.061 -27.618 30.475  1.00 176.97 ? 59  LEU A O   1 
ATOM   162  C CB  . LEU A 1 24  ? -50.125 -27.184 32.446  1.00 177.18 ? 59  LEU A CB  1 
ATOM   163  C CG  . LEU A 1 24  ? -49.510 -25.800 32.219  1.00 171.43 ? 59  LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 24  ? -50.400 -24.992 31.288  1.00 168.60 ? 59  LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 24  ? -49.345 -25.085 33.548  1.00 168.74 ? 59  LEU A CD2 1 
ATOM   166  N N   . HIS A 1 25  ? -48.789 -29.744 30.353  1.00 200.00 ? 60  HIS A N   1 
ATOM   167  C CA  . HIS A 1 25  ? -47.540 -30.265 29.810  1.00 200.00 ? 60  HIS A CA  1 
ATOM   168  C C   . HIS A 1 25  ? -47.775 -30.824 28.411  1.00 200.00 ? 60  HIS A C   1 
ATOM   169  O O   . HIS A 1 25  ? -46.839 -30.984 27.628  1.00 200.00 ? 60  HIS A O   1 
ATOM   170  C CB  . HIS A 1 25  ? -46.991 -31.371 30.715  1.00 200.00 ? 60  HIS A CB  1 
ATOM   171  C CG  . HIS A 1 25  ? -46.872 -30.972 32.153  1.00 200.00 ? 60  HIS A CG  1 
ATOM   172  N ND1 . HIS A 1 25  ? -46.117 -29.896 32.568  1.00 200.00 ? 60  HIS A ND1 1 
ATOM   173  C CD2 . HIS A 1 25  ? -47.415 -31.505 33.273  1.00 200.00 ? 60  HIS A CD2 1 
ATOM   174  C CE1 . HIS A 1 25  ? -46.200 -29.783 33.881  1.00 200.00 ? 60  HIS A CE1 1 
ATOM   175  N NE2 . HIS A 1 25  ? -46.982 -30.747 34.334  1.00 200.00 ? 60  HIS A NE2 1 
ATOM   176  N N   . HIS A 1 26  ? -49.035 -31.122 28.109  1.00 200.00 ? 61  HIS A N   1 
ATOM   177  C CA  . HIS A 1 26  ? -49.411 -31.664 26.809  1.00 200.00 ? 61  HIS A CA  1 
ATOM   178  C C   . HIS A 1 26  ? -49.576 -30.545 25.783  1.00 200.00 ? 61  HIS A C   1 
ATOM   179  O O   . HIS A 1 26  ? -48.900 -30.530 24.753  1.00 200.00 ? 61  HIS A O   1 
ATOM   180  C CB  . HIS A 1 26  ? -50.722 -32.449 26.921  1.00 199.45 ? 61  HIS A CB  1 
ATOM   181  C CG  . HIS A 1 26  ? -50.655 -33.611 27.863  1.00 200.00 ? 61  HIS A CG  1 
ATOM   182  N ND1 . HIS A 1 26  ? -50.374 -33.467 29.205  1.00 200.00 ? 61  HIS A ND1 1 
ATOM   183  C CD2 . HIS A 1 26  ? -50.841 -34.937 27.658  1.00 200.00 ? 61  HIS A CD2 1 
ATOM   184  C CE1 . HIS A 1 26  ? -50.389 -34.654 29.786  1.00 200.00 ? 61  HIS A CE1 1 
ATOM   185  N NE2 . HIS A 1 26  ? -50.670 -35.563 28.869  1.00 200.00 ? 61  HIS A NE2 1 
ATOM   186  N N   . LEU A 1 27  ? -50.477 -29.609 26.073  1.00 200.00 ? 62  LEU A N   1 
ATOM   187  C CA  . LEU A 1 27  ? -50.738 -28.485 25.179  1.00 200.00 ? 62  LEU A CA  1 
ATOM   188  C C   . LEU A 1 27  ? -50.814 -27.165 25.948  1.00 200.00 ? 62  LEU A C   1 
ATOM   189  O O   . LEU A 1 27  ? -51.884 -26.568 26.075  1.00 200.00 ? 62  LEU A O   1 
ATOM   190  C CB  . LEU A 1 27  ? -52.049 -28.715 24.417  1.00 200.00 ? 62  LEU A CB  1 
ATOM   191  C CG  . LEU A 1 27  ? -52.471 -27.658 23.391  1.00 200.00 ? 62  LEU A CG  1 
ATOM   192  C CD1 . LEU A 1 27  ? -51.419 -27.547 22.298  1.00 200.00 ? 62  LEU A CD1 1 
ATOM   193  C CD2 . LEU A 1 27  ? -53.818 -28.036 22.796  1.00 200.00 ? 62  LEU A CD2 1 
ATOM   194  N N   . PRO A 1 28  ? -49.672 -26.695 26.477  1.00 200.00 ? 63  PRO A N   1 
ATOM   195  C CA  . PRO A 1 28  ? -49.626 -25.439 27.232  1.00 200.00 ? 63  PRO A CA  1 
ATOM   196  C C   . PRO A 1 28  ? -49.649 -24.215 26.319  1.00 200.00 ? 63  PRO A C   1 
ATOM   197  O O   . PRO A 1 28  ? -50.342 -23.236 26.595  1.00 200.00 ? 63  PRO A O   1 
ATOM   198  C CB  . PRO A 1 28  ? -48.319 -25.560 28.005  1.00 200.00 ? 63  PRO A CB  1 
ATOM   199  C CG  . PRO A 1 28  ? -47.445 -26.282 27.033  1.00 200.00 ? 63  PRO A CG  1 
ATOM   200  C CD  . PRO A 1 28  ? -48.362 -27.371 26.509  1.00 200.00 ? 63  PRO A CD  1 
ATOM   201  N N   . GLY A 1 29  ? -48.886 -24.282 25.231  1.00 192.38 ? 64  GLY A N   1 
ATOM   202  C CA  . GLY A 1 29  ? -48.828 -23.176 24.293  1.00 189.37 ? 64  GLY A CA  1 
ATOM   203  C C   . GLY A 1 29  ? -47.405 -22.841 23.891  1.00 185.86 ? 64  GLY A C   1 
ATOM   204  O O   . GLY A 1 29  ? -47.118 -22.614 22.716  1.00 185.92 ? 64  GLY A O   1 
ATOM   205  N N   . ALA A 1 30  ? -46.510 -22.809 24.874  1.00 183.30 ? 65  ALA A N   1 
ATOM   206  C CA  . ALA A 1 30  ? -45.107 -22.502 24.630  1.00 180.41 ? 65  ALA A CA  1 
ATOM   207  C C   . ALA A 1 30  ? -44.250 -23.012 25.783  1.00 177.14 ? 65  ALA A C   1 
ATOM   208  O O   . ALA A 1 30  ? -44.300 -22.474 26.890  1.00 175.98 ? 65  ALA A O   1 
ATOM   209  C CB  . ALA A 1 30  ? -44.923 -20.999 24.465  1.00 180.49 ? 65  ALA A CB  1 
ATOM   210  N N   . GLU A 1 31  ? -43.466 -24.052 25.516  1.00 190.08 ? 66  GLU A N   1 
ATOM   211  C CA  . GLU A 1 31  ? -42.597 -24.644 26.526  1.00 187.76 ? 66  GLU A CA  1 
ATOM   212  C C   . GLU A 1 31  ? -41.862 -23.569 27.315  1.00 182.93 ? 66  GLU A C   1 
ATOM   213  O O   . GLU A 1 31  ? -41.654 -23.701 28.520  1.00 183.02 ? 66  GLU A O   1 
ATOM   214  C CB  . GLU A 1 31  ? -41.573 -25.582 25.874  1.00 172.17 ? 66  GLU A CB  1 
ATOM   215  C CG  . GLU A 1 31  ? -42.169 -26.807 25.191  1.00 176.03 ? 66  GLU A CG  1 
ATOM   216  C CD  . GLU A 1 31  ? -42.819 -26.490 23.858  1.00 179.55 ? 66  GLU A CD  1 
ATOM   217  O OE1 . GLU A 1 31  ? -43.423 -27.406 23.259  1.00 181.11 ? 66  GLU A OE1 1 
ATOM   218  O OE2 . GLU A 1 31  ? -42.722 -25.331 23.403  1.00 181.17 ? 66  GLU A OE2 1 
ATOM   219  N N   . ASN A 1 32  ? -41.477 -22.501 26.627  1.00 147.34 ? 67  ASN A N   1 
ATOM   220  C CA  . ASN A 1 32  ? -40.760 -21.405 27.258  1.00 143.83 ? 67  ASN A CA  1 
ATOM   221  C C   . ASN A 1 32  ? -41.678 -20.538 28.113  1.00 141.12 ? 67  ASN A C   1 
ATOM   222  O O   . ASN A 1 32  ? -42.894 -20.535 27.940  1.00 139.54 ? 67  ASN A O   1 
ATOM   223  C CB  . ASN A 1 32  ? -40.080 -20.542 26.192  1.00 179.74 ? 67  ASN A CB  1 
ATOM   224  C CG  . ASN A 1 32  ? -39.220 -19.447 26.791  1.00 178.46 ? 67  ASN A CG  1 
ATOM   225  O OD1 . ASN A 1 32  ? -38.276 -19.720 27.531  1.00 178.85 ? 67  ASN A OD1 1 
ATOM   226  N ND2 . ASN A 1 32  ? -39.540 -18.198 26.470  1.00 178.04 ? 67  ASN A ND2 1 
ATOM   227  N N   . LEU A 1 33  ? -41.068 -19.811 29.041  1.00 75.75  ? 68  LEU A N   1 
ATOM   228  C CA  . LEU A 1 33  ? -41.763 -18.914 29.957  1.00 76.08  ? 68  LEU A CA  1 
ATOM   229  C C   . LEU A 1 33  ? -40.652 -18.289 30.785  1.00 71.10  ? 68  LEU A C   1 
ATOM   230  O O   . LEU A 1 33  ? -39.506 -18.267 30.343  1.00 69.96  ? 68  LEU A O   1 
ATOM   231  C CB  . LEU A 1 33  ? -42.714 -19.693 30.867  1.00 154.75 ? 68  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 33  ? -42.084 -20.611 31.918  1.00 166.31 ? 68  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 33  ? -43.179 -21.203 32.781  1.00 172.09 ? 68  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 33  ? -41.279 -21.713 31.248  1.00 172.27 ? 68  LEU A CD2 1 
ATOM   235  N N   . THR A 1 34  ? -40.964 -17.790 31.977  1.00 147.77 ? 69  THR A N   1 
ATOM   236  C CA  . THR A 1 34  ? -39.917 -17.196 32.794  1.00 149.17 ? 69  THR A CA  1 
ATOM   237  C C   . THR A 1 34  ? -40.414 -16.929 34.204  1.00 148.36 ? 69  THR A C   1 
ATOM   238  O O   . THR A 1 34  ? -39.666 -16.821 35.166  1.00 147.45 ? 69  THR A O   1 
ATOM   239  C CB  . THR A 1 34  ? -39.430 -15.854 32.183  1.00 103.64 ? 69  THR A CB  1 
ATOM   240  O OG1 . THR A 1 34  ? -38.670 -16.113 30.997  1.00 33.58  ? 69  THR A OG1 1 
ATOM   241  C CG2 . THR A 1 34  ? -38.568 -15.083 33.174  1.00 33.58  ? 69  THR A CG2 1 
ATOM   242  N N   . GLU A 1 35  ? -41.726 -16.821 34.312  1.00 54.86  ? 70  GLU A N   1 
ATOM   243  C CA  . GLU A 1 35  ? -42.381 -16.618 35.597  1.00 54.30  ? 70  GLU A CA  1 
ATOM   244  C C   . GLU A 1 35  ? -43.605 -17.517 35.739  1.00 53.50  ? 70  GLU A C   1 
ATOM   245  O O   . GLU A 1 35  ? -44.388 -17.617 34.783  1.00 55.66  ? 70  GLU A O   1 
ATOM   246  C CB  . GLU A 1 35  ? -42.814 -15.157 35.754  1.00 146.39 ? 70  GLU A CB  1 
ATOM   247  C CG  . GLU A 1 35  ? -41.672 -14.159 35.837  1.00 148.76 ? 70  GLU A CG  1 
ATOM   248  C CD  . GLU A 1 35  ? -42.158 -12.739 36.065  1.00 152.70 ? 70  GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 35  ? -42.861 -12.503 37.071  1.00 154.92 ? 70  GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 35  ? -41.838 -11.858 35.238  1.00 154.92 ? 70  GLU A OE2 1 
ATOM   251  N N   . LEU A 1 36  ? -43.699 -18.200 36.816  1.00 75.09  ? 71  LEU A N   1 
ATOM   252  C CA  . LEU A 1 36  ? -44.865 -19.038 37.110  1.00 75.85  ? 71  LEU A CA  1 
ATOM   253  C C   . LEU A 1 36  ? -45.485 -18.692 38.465  1.00 76.69  ? 71  LEU A C   1 
ATOM   254  O O   . LEU A 1 36  ? -44.763 -18.711 39.467  1.00 75.39  ? 71  LEU A O   1 
ATOM   255  C CB  . LEU A 1 36  ? -44.478 -20.518 37.118  1.00 134.66 ? 71  LEU A CB  1 
ATOM   256  C CG  . LEU A 1 36  ? -44.438 -21.265 35.788  1.00 143.08 ? 71  LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 36  ? -43.955 -22.687 36.019  1.00 133.71 ? 71  LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 36  ? -45.823 -21.270 35.164  1.00 143.08 ? 71  LEU A CD2 1 
ATOM   259  N N   . TYR A 1 37  ? -46.723 -18.283 38.453  1.00 69.03  ? 72  TYR A N   1 
ATOM   260  C CA  . TYR A 1 37  ? -47.393 -17.884 39.685  1.00 70.37  ? 72  TYR A CA  1 
ATOM   261  C C   . TYR A 1 37  ? -48.466 -18.894 40.068  1.00 72.18  ? 72  TYR A C   1 
ATOM   262  O O   . TYR A 1 37  ? -49.500 -18.975 39.399  1.00 71.80  ? 72  TYR A O   1 
ATOM   263  C CB  . TYR A 1 37  ? -47.997 -16.486 39.533  1.00 131.77 ? 72  TYR A CB  1 
ATOM   264  C CG  . TYR A 1 37  ? -46.954 -15.389 39.521  1.00 134.25 ? 72  TYR A CG  1 
ATOM   265  C CD1 . TYR A 1 37  ? -45.973 -15.344 38.529  1.00 138.88 ? 72  TYR A CD1 1 
ATOM   266  C CD2 . TYR A 1 37  ? -46.928 -14.413 40.518  1.00 136.95 ? 72  TYR A CD2 1 
ATOM   267  C CE1 . TYR A 1 37  ? -44.988 -14.354 38.531  1.00 138.21 ? 72  TYR A CE1 1 
ATOM   268  C CE2 . TYR A 1 37  ? -45.948 -13.419 40.530  1.00 138.94 ? 72  TYR A CE2 1 
ATOM   269  C CZ  . TYR A 1 37  ? -44.982 -13.397 39.534  1.00 136.55 ? 72  TYR A CZ  1 
ATOM   270  O OH  . TYR A 1 37  ? -44.008 -12.422 39.543  1.00 139.03 ? 72  TYR A OH  1 
ATOM   271  N N   . ILE A 1 38  ? -48.200 -19.668 41.114  1.00 61.84  ? 73  ILE A N   1 
ATOM   272  C CA  . ILE A 1 38  ? -49.138 -20.692 41.553  1.00 63.01  ? 73  ILE A CA  1 
ATOM   273  C C   . ILE A 1 38  ? -49.478 -20.495 43.037  1.00 61.80  ? 73  ILE A C   1 
ATOM   274  O O   . ILE A 1 38  ? -49.926 -21.415 43.687  1.00 62.01  ? 73  ILE A O   1 
ATOM   275  C CB  . ILE A 1 38  ? -48.568 -22.116 41.311  1.00 52.95  ? 73  ILE A CB  1 
ATOM   276  C CG1 . ILE A 1 38  ? -48.131 -22.257 39.852  1.00 60.31  ? 73  ILE A CG1 1 
ATOM   277  C CG2 . ILE A 1 38  ? -49.629 -23.170 41.599  1.00 60.31  ? 73  ILE A CG2 1 
ATOM   278  C CD1 . ILE A 1 38  ? -47.562 -23.618 39.503  1.00 130.37 ? 73  ILE A CD1 1 
ATOM   279  N N   . GLU A 1 39  ? -49.554 -19.228 43.405  1.00 122.04 ? 74  GLU A N   1 
ATOM   280  C CA  . GLU A 1 39  ? -50.027 -18.871 44.720  1.00 127.75 ? 74  GLU A CA  1 
ATOM   281  C C   . GLU A 1 39  ? -51.467 -19.429 44.650  1.00 129.83 ? 74  GLU A C   1 
ATOM   282  O O   . GLU A 1 39  ? -52.079 -19.448 43.572  1.00 128.25 ? 74  GLU A O   1 
ATOM   283  C CB  . GLU A 1 39  ? -50.086 -17.349 44.848  1.00 200.00 ? 74  GLU A CB  1 
ATOM   284  C CG  . GLU A 1 39  ? -48.934 -16.629 44.164  1.00 200.00 ? 74  GLU A CG  1 
ATOM   285  C CD  . GLU A 1 39  ? -49.334 -15.267 43.628  1.00 200.00 ? 74  GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 39  ? -49.847 -14.441 44.412  1.00 200.00 ? 74  GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 39  ? -49.134 -15.024 42.419  1.00 200.00 ? 74  GLU A OE2 1 
ATOM   288  N N   . ASN A 1 40  ? -51.982 -19.922 45.773  1.00 95.00  ? 75  ASN A N   1 
ATOM   289  C CA  . ASN A 1 40  ? -53.352 -20.443 45.870  1.00 99.03  ? 75  ASN A CA  1 
ATOM   290  C C   . ASN A 1 40  ? -53.773 -21.661 45.018  1.00 98.32  ? 75  ASN A C   1 
ATOM   291  O O   . ASN A 1 40  ? -54.027 -21.526 43.823  1.00 99.52  ? 75  ASN A O   1 
ATOM   292  C CB  . ASN A 1 40  ? -54.341 -19.297 45.606  1.00 123.79 ? 75  ASN A CB  1 
ATOM   293  C CG  . ASN A 1 40  ? -55.703 -19.537 46.240  1.00 127.59 ? 75  ASN A CG  1 
ATOM   294  O OD1 . ASN A 1 40  ? -55.853 -19.472 47.460  1.00 124.67 ? 75  ASN A OD1 1 
ATOM   295  N ND2 . ASN A 1 40  ? -56.700 -19.813 45.412  1.00 123.85 ? 75  ASN A ND2 1 
ATOM   296  N N   . GLN A 1 41  ? -53.887 -22.833 45.654  1.00 93.81  ? 76  GLN A N   1 
ATOM   297  C CA  . GLN A 1 41  ? -54.291 -24.073 44.968  1.00 93.64  ? 76  GLN A CA  1 
ATOM   298  C C   . GLN A 1 41  ? -54.547 -25.250 45.904  1.00 103.47 ? 76  GLN A C   1 
ATOM   299  O O   . GLN A 1 41  ? -53.657 -25.678 46.636  1.00 102.39 ? 76  GLN A O   1 
ATOM   300  C CB  . GLN A 1 41  ? -53.235 -24.515 43.960  1.00 94.64  ? 76  GLN A CB  1 
ATOM   301  C CG  . GLN A 1 41  ? -53.288 -23.802 42.637  1.00 81.18  ? 76  GLN A CG  1 
ATOM   302  C CD  . GLN A 1 41  ? -52.648 -24.606 41.536  1.00 68.39  ? 76  GLN A CD  1 
ATOM   303  O OE1 . GLN A 1 41  ? -52.554 -24.150 40.399  1.00 63.18  ? 76  GLN A OE1 1 
ATOM   304  N NE2 . GLN A 1 41  ? -52.206 -25.815 41.864  1.00 60.50  ? 76  GLN A NE2 1 
ATOM   305  N N   . GLN A 1 42  ? -55.761 -25.788 45.855  1.00 164.94 ? 77  GLN A N   1 
ATOM   306  C CA  . GLN A 1 42  ? -56.127 -26.921 46.694  1.00 175.14 ? 77  GLN A CA  1 
ATOM   307  C C   . GLN A 1 42  ? -55.128 -28.064 46.566  1.00 177.45 ? 77  GLN A C   1 
ATOM   308  O O   . GLN A 1 42  ? -54.340 -28.305 47.480  1.00 178.76 ? 77  GLN A O   1 
ATOM   309  C CB  . GLN A 1 42  ? -57.529 -27.424 46.334  1.00 187.55 ? 77  GLN A CB  1 
ATOM   310  C CG  . GLN A 1 42  ? -58.671 -26.710 47.053  1.00 197.70 ? 77  GLN A CG  1 
ATOM   311  C CD  . GLN A 1 42  ? -58.779 -25.239 46.698  1.00 200.00 ? 77  GLN A CD  1 
ATOM   312  O OE1 . GLN A 1 42  ? -57.851 -24.462 46.921  1.00 200.00 ? 77  GLN A OE1 1 
ATOM   313  N NE2 . GLN A 1 42  ? -59.922 -24.849 46.145  1.00 200.00 ? 77  GLN A NE2 1 
ATOM   314  N N   . HIS A 1 43  ? -55.162 -28.762 45.433  1.00 200.00 ? 78  HIS A N   1 
ATOM   315  C CA  . HIS A 1 43  ? -54.251 -29.880 45.186  1.00 200.00 ? 78  HIS A CA  1 
ATOM   316  C C   . HIS A 1 43  ? -52.785 -29.457 45.235  1.00 200.00 ? 78  HIS A C   1 
ATOM   317  O O   . HIS A 1 43  ? -52.450 -28.407 45.785  1.00 200.00 ? 78  HIS A O   1 
ATOM   318  C CB  . HIS A 1 43  ? -54.553 -30.523 43.828  1.00 199.42 ? 78  HIS A CB  1 
ATOM   319  C CG  . HIS A 1 43  ? -55.648 -31.544 43.869  1.00 200.00 ? 78  HIS A CG  1 
ATOM   320  N ND1 . HIS A 1 43  ? -55.551 -32.710 44.597  1.00 200.00 ? 78  HIS A ND1 1 
ATOM   321  C CD2 . HIS A 1 43  ? -56.857 -31.580 43.261  1.00 200.00 ? 78  HIS A CD2 1 
ATOM   322  C CE1 . HIS A 1 43  ? -56.652 -33.421 44.436  1.00 200.00 ? 78  HIS A CE1 1 
ATOM   323  N NE2 . HIS A 1 43  ? -57.461 -32.758 43.629  1.00 200.00 ? 78  HIS A NE2 1 
ATOM   324  N N   . LEU A 1 44  ? -51.918 -30.283 44.656  1.00 81.61  ? 79  LEU A N   1 
ATOM   325  C CA  . LEU A 1 44  ? -50.483 -30.014 44.630  1.00 77.30  ? 79  LEU A CA  1 
ATOM   326  C C   . LEU A 1 44  ? -49.905 -30.140 46.032  1.00 70.77  ? 79  LEU A C   1 
ATOM   327  O O   . LEU A 1 44  ? -49.641 -29.146 46.702  1.00 68.67  ? 79  LEU A O   1 
ATOM   328  C CB  . LEU A 1 44  ? -50.212 -28.611 44.076  1.00 143.06 ? 79  LEU A CB  1 
ATOM   329  C CG  . LEU A 1 44  ? -48.748 -28.194 43.921  1.00 147.84 ? 79  LEU A CG  1 
ATOM   330  C CD1 . LEU A 1 44  ? -48.040 -29.142 42.965  1.00 135.06 ? 79  LEU A CD1 1 
ATOM   331  C CD2 . LEU A 1 44  ? -48.678 -26.764 43.406  1.00 159.06 ? 79  LEU A CD2 1 
ATOM   332  N N   . GLN A 1 45  ? -49.712 -31.378 46.469  1.00 90.53  ? 80  GLN A N   1 
ATOM   333  C CA  . GLN A 1 45  ? -49.175 -31.656 47.793  1.00 87.88  ? 80  GLN A CA  1 
ATOM   334  C C   . GLN A 1 45  ? -47.687 -31.972 47.710  1.00 83.14  ? 80  GLN A C   1 
ATOM   335  O O   . GLN A 1 45  ? -46.882 -31.415 48.452  1.00 81.40  ? 80  GLN A O   1 
ATOM   336  C CB  . GLN A 1 45  ? -49.917 -32.843 48.413  1.00 140.15 ? 80  GLN A CB  1 
ATOM   337  C CG  . GLN A 1 45  ? -49.560 -33.124 49.861  1.00 144.57 ? 80  GLN A CG  1 
ATOM   338  C CD  . GLN A 1 45  ? -50.087 -32.065 50.803  1.00 141.58 ? 80  GLN A CD  1 
ATOM   339  O OE1 . GLN A 1 45  ? -49.752 -30.888 50.682  1.00 139.50 ? 80  GLN A OE1 1 
ATOM   340  N NE2 . GLN A 1 45  ? -50.920 -32.478 51.751  1.00 140.39 ? 80  GLN A NE2 1 
ATOM   341  N N   . HIS A 1 46  ? -47.333 -32.875 46.800  1.00 92.26  ? 81  HIS A N   1 
ATOM   342  C CA  . HIS A 1 46  ? -45.945 -33.289 46.605  1.00 90.91  ? 81  HIS A CA  1 
ATOM   343  C C   . HIS A 1 46  ? -45.373 -32.677 45.330  1.00 87.47  ? 81  HIS A C   1 
ATOM   344  O O   . HIS A 1 46  ? -45.717 -33.107 44.233  1.00 86.13  ? 81  HIS A O   1 
ATOM   345  C CB  . HIS A 1 46  ? -45.854 -34.816 46.485  1.00 132.45 ? 81  HIS A CB  1 
ATOM   346  C CG  . HIS A 1 46  ? -46.448 -35.562 47.640  1.00 134.39 ? 81  HIS A CG  1 
ATOM   347  N ND1 . HIS A 1 46  ? -45.893 -35.552 48.901  1.00 128.10 ? 81  HIS A ND1 1 
ATOM   348  C CD2 . HIS A 1 46  ? -47.542 -36.358 47.717  1.00 137.37 ? 81  HIS A CD2 1 
ATOM   349  C CE1 . HIS A 1 46  ? -46.617 -36.310 49.705  1.00 127.42 ? 81  HIS A CE1 1 
ATOM   350  N NE2 . HIS A 1 46  ? -47.623 -36.811 49.011  1.00 130.20 ? 81  HIS A NE2 1 
ATOM   351  N N   . LEU A 1 47  ? -44.507 -31.680 45.465  1.00 55.91  ? 82  LEU A N   1 
ATOM   352  C CA  . LEU A 1 47  ? -43.904 -31.071 44.290  1.00 55.60  ? 82  LEU A CA  1 
ATOM   353  C C   . LEU A 1 47  ? -42.716 -31.925 43.887  1.00 59.35  ? 82  LEU A C   1 
ATOM   354  O O   . LEU A 1 47  ? -41.787 -32.100 44.669  1.00 58.09  ? 82  LEU A O   1 
ATOM   355  C CB  . LEU A 1 47  ? -43.432 -29.649 44.592  1.00 52.55  ? 82  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 47  ? -42.674 -28.952 43.456  1.00 40.92  ? 82  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 47  ? -43.534 -28.935 42.207  1.00 24.23  ? 82  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 47  ? -42.302 -27.538 43.867  1.00 24.65  ? 82  LEU A CD2 1 
ATOM   359  N N   . GLU A 1 48  ? -42.744 -32.463 42.673  1.00 53.84  ? 83  GLU A N   1 
ATOM   360  C CA  . GLU A 1 48  ? -41.648 -33.300 42.204  1.00 60.23  ? 83  GLU A CA  1 
ATOM   361  C C   . GLU A 1 48  ? -41.201 -32.954 40.792  1.00 61.07  ? 83  GLU A C   1 
ATOM   362  O O   . GLU A 1 48  ? -41.789 -32.100 40.134  1.00 59.86  ? 83  GLU A O   1 
ATOM   363  C CB  . GLU A 1 48  ? -42.042 -34.778 42.274  1.00 114.88 ? 83  GLU A CB  1 
ATOM   364  C CG  . GLU A 1 48  ? -43.286 -35.136 41.483  1.00 125.36 ? 83  GLU A CG  1 
ATOM   365  C CD  . GLU A 1 48  ? -43.625 -36.611 41.576  1.00 133.10 ? 83  GLU A CD  1 
ATOM   366  O OE1 . GLU A 1 48  ? -42.799 -37.440 41.138  1.00 137.21 ? 83  GLU A OE1 1 
ATOM   367  O OE2 . GLU A 1 48  ? -44.715 -36.941 42.088  1.00 136.67 ? 83  GLU A OE2 1 
ATOM   368  N N   . LEU A 1 49  ? -40.152 -33.630 40.340  1.00 98.24  ? 84  LEU A N   1 
ATOM   369  C CA  . LEU A 1 49  ? -39.586 -33.413 39.015  1.00 102.30 ? 84  LEU A CA  1 
ATOM   370  C C   . LEU A 1 49  ? -40.604 -33.603 37.894  1.00 105.81 ? 84  LEU A C   1 
ATOM   371  O O   . LEU A 1 49  ? -40.468 -33.028 36.815  1.00 105.03 ? 84  LEU A O   1 
ATOM   372  C CB  . LEU A 1 49  ? -38.409 -34.367 38.799  1.00 169.97 ? 84  LEU A CB  1 
ATOM   373  C CG  . LEU A 1 49  ? -37.608 -34.214 37.506  1.00 167.63 ? 84  LEU A CG  1 
ATOM   374  C CD1 . LEU A 1 49  ? -36.952 -32.843 37.478  1.00 159.46 ? 84  LEU A CD1 1 
ATOM   375  C CD2 . LEU A 1 49  ? -36.557 -35.310 37.417  1.00 159.23 ? 84  LEU A CD2 1 
ATOM   376  N N   . ARG A 1 50  ? -41.622 -34.413 38.154  1.00 178.37 ? 85  ARG A N   1 
ATOM   377  C CA  . ARG A 1 50  ? -42.652 -34.684 37.160  1.00 182.19 ? 85  ARG A CA  1 
ATOM   378  C C   . ARG A 1 50  ? -43.636 -33.522 37.025  1.00 176.92 ? 85  ARG A C   1 
ATOM   379  O O   . ARG A 1 50  ? -44.389 -33.449 36.053  1.00 178.05 ? 85  ARG A O   1 
ATOM   380  C CB  . ARG A 1 50  ? -43.392 -35.976 37.534  1.00 161.97 ? 85  ARG A CB  1 
ATOM   381  C CG  . ARG A 1 50  ? -44.460 -36.433 36.546  1.00 176.13 ? 85  ARG A CG  1 
ATOM   382  C CD  . ARG A 1 50  ? -45.816 -35.807 36.844  1.00 191.18 ? 85  ARG A CD  1 
ATOM   383  N NE  . ARG A 1 50  ? -46.303 -36.153 38.177  1.00 199.90 ? 85  ARG A NE  1 
ATOM   384  C CZ  . ARG A 1 50  ? -46.578 -37.390 38.580  1.00 200.00 ? 85  ARG A CZ  1 
ATOM   385  N NH1 . ARG A 1 50  ? -46.415 -38.414 37.753  1.00 200.00 ? 85  ARG A NH1 1 
ATOM   386  N NH2 . ARG A 1 50  ? -47.017 -37.605 39.812  1.00 200.00 ? 85  ARG A NH2 1 
ATOM   387  N N   . ASP A 1 51  ? -43.613 -32.606 37.989  1.00 108.35 ? 86  ASP A N   1 
ATOM   388  C CA  . ASP A 1 51  ? -44.518 -31.460 37.978  1.00 103.32 ? 86  ASP A CA  1 
ATOM   389  C C   . ASP A 1 51  ? -43.980 -30.252 37.213  1.00 102.04 ? 86  ASP A C   1 
ATOM   390  O O   . ASP A 1 51  ? -44.739 -29.354 36.852  1.00 100.34 ? 86  ASP A O   1 
ATOM   391  C CB  . ASP A 1 51  ? -44.860 -31.060 39.414  1.00 52.53  ? 86  ASP A CB  1 
ATOM   392  C CG  . ASP A 1 51  ? -45.560 -32.171 40.176  1.00 49.42  ? 86  ASP A CG  1 
ATOM   393  O OD1 . ASP A 1 51  ? -46.672 -32.569 39.770  1.00 45.05  ? 86  ASP A OD1 1 
ATOM   394  O OD2 . ASP A 1 51  ? -44.997 -32.651 41.180  1.00 46.79  ? 86  ASP A OD2 1 
ATOM   395  N N   . LEU A 1 52  ? -42.673 -30.226 36.972  1.00 69.30  ? 87  LEU A N   1 
ATOM   396  C CA  . LEU A 1 52  ? -42.054 -29.133 36.228  1.00 71.97  ? 87  LEU A CA  1 
ATOM   397  C C   . LEU A 1 52  ? -41.530 -29.661 34.901  1.00 73.27  ? 87  LEU A C   1 
ATOM   398  O O   . LEU A 1 52  ? -40.717 -29.022 34.237  1.00 70.46  ? 87  LEU A O   1 
ATOM   399  C CB  . LEU A 1 52  ? -40.906 -28.510 37.026  1.00 134.99 ? 87  LEU A CB  1 
ATOM   400  C CG  . LEU A 1 52  ? -41.285 -27.701 38.270  1.00 141.40 ? 87  LEU A CG  1 
ATOM   401  C CD1 . LEU A 1 52  ? -41.872 -28.621 39.326  1.00 145.84 ? 87  LEU A CD1 1 
ATOM   402  C CD2 . LEU A 1 52  ? -40.054 -26.992 38.811  1.00 145.87 ? 87  LEU A CD2 1 
ATOM   403  N N   . ARG A 1 53  ? -42.016 -30.841 34.530  1.00 125.72 ? 88  ARG A N   1 
ATOM   404  C CA  . ARG A 1 53  ? -41.632 -31.507 33.291  1.00 129.87 ? 88  ARG A CA  1 
ATOM   405  C C   . ARG A 1 53  ? -41.923 -30.620 32.085  1.00 125.48 ? 88  ARG A C   1 
ATOM   406  O O   . ARG A 1 53  ? -42.946 -30.783 31.418  1.00 125.94 ? 88  ARG A O   1 
ATOM   407  C CB  . ARG A 1 53  ? -42.402 -32.825 33.157  1.00 188.89 ? 88  ARG A CB  1 
ATOM   408  C CG  . ARG A 1 53  ? -42.015 -33.681 31.960  1.00 200.00 ? 88  ARG A CG  1 
ATOM   409  C CD  . ARG A 1 53  ? -40.639 -34.301 32.136  1.00 200.00 ? 88  ARG A CD  1 
ATOM   410  N NE  . ARG A 1 53  ? -40.316 -35.228 31.055  1.00 200.00 ? 88  ARG A NE  1 
ATOM   411  C CZ  . ARG A 1 53  ? -39.204 -35.954 30.999  1.00 200.00 ? 88  ARG A CZ  1 
ATOM   412  N NH1 . ARG A 1 53  ? -38.300 -35.862 31.965  1.00 200.00 ? 88  ARG A NH1 1 
ATOM   413  N NH2 . ARG A 1 53  ? -38.996 -36.774 29.978  1.00 200.00 ? 88  ARG A NH2 1 
ATOM   414  N N   . GLY A 1 54  ? -41.023 -29.684 31.807  1.00 81.50  ? 89  GLY A N   1 
ATOM   415  C CA  . GLY A 1 54  ? -41.216 -28.799 30.677  1.00 80.01  ? 89  GLY A CA  1 
ATOM   416  C C   . GLY A 1 54  ? -40.035 -27.882 30.454  1.00 81.38  ? 89  GLY A C   1 
ATOM   417  O O   . GLY A 1 54  ? -40.204 -26.669 30.388  1.00 78.98  ? 89  GLY A O   1 
ATOM   418  N N   . LEU A 1 55  ? -38.847 -28.472 30.339  1.00 200.00 ? 90  LEU A N   1 
ATOM   419  C CA  . LEU A 1 55  ? -37.597 -27.739 30.120  1.00 200.00 ? 90  LEU A CA  1 
ATOM   420  C C   . LEU A 1 55  ? -37.804 -26.236 29.953  1.00 200.00 ? 90  LEU A C   1 
ATOM   421  O O   . LEU A 1 55  ? -37.895 -25.736 28.832  1.00 200.00 ? 90  LEU A O   1 
ATOM   422  C CB  . LEU A 1 55  ? -36.877 -28.291 28.884  1.00 170.28 ? 90  LEU A CB  1 
ATOM   423  C CG  . LEU A 1 55  ? -36.475 -29.770 28.899  1.00 187.08 ? 90  LEU A CG  1 
ATOM   424  C CD1 . LEU A 1 55  ? -35.889 -30.153 27.548  1.00 197.24 ? 90  LEU A CD1 1 
ATOM   425  C CD2 . LEU A 1 55  ? -35.469 -30.021 30.011  1.00 197.13 ? 90  LEU A CD2 1 
ATOM   426  N N   . GLY A 1 56  ? -37.874 -25.518 31.070  1.00 71.23  ? 91  GLY A N   1 
ATOM   427  C CA  . GLY A 1 56  ? -38.081 -24.086 31.001  1.00 66.29  ? 91  GLY A CA  1 
ATOM   428  C C   . GLY A 1 56  ? -36.876 -23.244 31.366  1.00 64.16  ? 91  GLY A C   1 
ATOM   429  O O   . GLY A 1 56  ? -35.874 -23.743 31.874  1.00 61.70  ? 91  GLY A O   1 
ATOM   430  N N   . GLU A 1 57  ? -36.986 -21.952 31.080  1.00 91.38  ? 92  GLU A N   1 
ATOM   431  C CA  . GLU A 1 57  ? -35.948 -20.976 31.381  1.00 93.42  ? 92  GLU A CA  1 
ATOM   432  C C   . GLU A 1 57  ? -36.591 -19.947 32.304  1.00 93.22  ? 92  GLU A C   1 
ATOM   433  O O   . GLU A 1 57  ? -36.696 -18.763 31.988  1.00 91.69  ? 92  GLU A O   1 
ATOM   434  C CB  . GLU A 1 57  ? -35.444 -20.311 30.095  1.00 153.77 ? 92  GLU A CB  1 
ATOM   435  C CG  . GLU A 1 57  ? -34.519 -19.119 30.321  1.00 157.72 ? 92  GLU A CG  1 
ATOM   436  C CD  . GLU A 1 57  ? -33.466 -19.383 31.381  1.00 162.74 ? 92  GLU A CD  1 
ATOM   437  O OE1 . GLU A 1 57  ? -32.654 -20.315 31.198  1.00 165.62 ? 92  GLU A OE1 1 
ATOM   438  O OE2 . GLU A 1 57  ? -33.453 -18.658 32.399  1.00 164.48 ? 92  GLU A OE2 1 
ATOM   439  N N   . LEU A 1 58  ? -37.033 -20.430 33.454  1.00 74.94  ? 93  LEU A N   1 
ATOM   440  C CA  . LEU A 1 58  ? -37.684 -19.590 34.432  1.00 79.05  ? 93  LEU A CA  1 
ATOM   441  C C   . LEU A 1 58  ? -36.718 -19.000 35.453  1.00 74.57  ? 93  LEU A C   1 
ATOM   442  O O   . LEU A 1 58  ? -35.767 -19.645 35.884  1.00 72.84  ? 93  LEU A O   1 
ATOM   443  C CB  . LEU A 1 58  ? -38.775 -20.401 35.141  1.00 159.31 ? 93  LEU A CB  1 
ATOM   444  C CG  . LEU A 1 58  ? -39.540 -19.807 36.328  1.00 179.16 ? 93  LEU A CG  1 
ATOM   445  C CD1 . LEU A 1 58  ? -40.817 -20.604 36.545  1.00 191.15 ? 93  LEU A CD1 1 
ATOM   446  C CD2 . LEU A 1 58  ? -38.674 -19.828 37.581  1.00 191.34 ? 93  LEU A CD2 1 
ATOM   447  N N   . ARG A 1 59  ? -36.977 -17.750 35.808  1.00 103.28 ? 94  ARG A N   1 
ATOM   448  C CA  . ARG A 1 59  ? -36.223 -17.003 36.803  1.00 103.31 ? 94  ARG A CA  1 
ATOM   449  C C   . ARG A 1 59  ? -37.058 -16.728 38.044  1.00 103.54 ? 94  ARG A C   1 
ATOM   450  O O   . ARG A 1 59  ? -36.482 -16.495 39.105  1.00 102.05 ? 94  ARG A O   1 
ATOM   451  C CB  . ARG A 1 59  ? -35.749 -15.672 36.213  1.00 142.05 ? 94  ARG A CB  1 
ATOM   452  C CG  . ARG A 1 59  ? -34.929 -15.797 34.939  1.00 148.90 ? 94  ARG A CG  1 
ATOM   453  C CD  . ARG A 1 59  ? -34.589 -14.420 34.384  1.00 148.90 ? 94  ARG A CD  1 
ATOM   454  N NE  . ARG A 1 59  ? -33.857 -14.495 33.123  1.00 148.90 ? 94  ARG A NE  1 
ATOM   455  C CZ  . ARG A 1 59  ? -33.481 -13.435 32.413  1.00 148.90 ? 94  ARG A CZ  1 
ATOM   456  N NH1 . ARG A 1 59  ? -33.767 -12.212 32.839  1.00 148.90 ? 94  ARG A NH1 1 
ATOM   457  N NH2 . ARG A 1 59  ? -32.818 -13.597 31.275  1.00 148.90 ? 94  ARG A NH2 1 
ATOM   458  N N   . ASN A 1 60  ? -38.385 -16.732 37.931  1.00 54.56  ? 95  ASN A N   1 
ATOM   459  C CA  . ASN A 1 60  ? -39.240 -16.490 39.073  1.00 55.02  ? 95  ASN A CA  1 
ATOM   460  C C   . ASN A 1 60  ? -40.287 -17.578 39.198  1.00 54.23  ? 95  ASN A C   1 
ATOM   461  O O   . ASN A 1 60  ? -41.017 -17.850 38.242  1.00 56.35  ? 95  ASN A O   1 
ATOM   462  C CB  . ASN A 1 60  ? -39.906 -15.114 38.956  1.00 73.47  ? 95  ASN A CB  1 
ATOM   463  C CG  . ASN A 1 60  ? -38.894 -13.988 38.751  1.00 81.96  ? 95  ASN A CG  1 
ATOM   464  O OD1 . ASN A 1 60  ? -37.810 -14.007 39.336  1.00 81.96  ? 95  ASN A OD1 1 
ATOM   465  N ND2 . ASN A 1 60  ? -39.256 -13.002 37.932  1.00 81.96  ? 95  ASN A ND2 1 
ATOM   466  N N   . LEU A 1 61  ? -40.338 -18.231 40.354  1.00 51.57  ? 96  LEU A N   1 
ATOM   467  C CA  . LEU A 1 61  ? -41.332 -19.269 40.580  1.00 50.93  ? 96  LEU A CA  1 
ATOM   468  C C   . LEU A 1 61  ? -42.020 -19.045 41.924  1.00 51.61  ? 96  LEU A C   1 
ATOM   469  O O   . LEU A 1 61  ? -41.388 -19.089 42.976  1.00 53.07  ? 96  LEU A O   1 
ATOM   470  C CB  . LEU A 1 61  ? -40.671 -20.649 40.575  1.00 47.99  ? 96  LEU A CB  1 
ATOM   471  C CG  . LEU A 1 61  ? -41.587 -21.822 40.935  1.00 48.20  ? 96  LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 61  ? -42.728 -21.911 39.934  1.00 47.00  ? 96  LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 61  ? -40.788 -23.113 40.946  1.00 48.94  ? 96  LEU A CD2 1 
ATOM   474  N N   . THR A 1 62  ? -43.325 -18.807 41.875  1.00 46.59  ? 97  THR A N   1 
ATOM   475  C CA  . THR A 1 62  ? -44.090 -18.593 43.094  1.00 48.12  ? 97  THR A CA  1 
ATOM   476  C C   . THR A 1 62  ? -45.016 -19.766 43.367  1.00 48.67  ? 97  THR A C   1 
ATOM   477  O O   . THR A 1 62  ? -45.894 -20.063 42.560  1.00 48.67  ? 97  THR A O   1 
ATOM   478  C CB  . THR A 1 62  ? -44.905 -17.308 43.000  1.00 56.33  ? 97  THR A CB  1 
ATOM   479  O OG1 . THR A 1 62  ? -44.029 -16.217 42.691  1.00 62.62  ? 97  THR A OG1 1 
ATOM   480  C CG2 . THR A 1 62  ? -45.597 -17.030 44.312  1.00 62.62  ? 97  THR A CG2 1 
ATOM   481  N N   . ILE A 1 63  ? -44.801 -20.390 44.500  1.00 62.24  ? 98  ILE A N   1 
ATOM   482  C CA  . ILE A 1 63  ? -45.592 -21.522 44.957  1.00 62.24  ? 98  ILE A CA  1 
ATOM   483  C C   . ILE A 1 63  ? -46.065 -21.285 46.399  1.00 62.24  ? 98  ILE A C   1 
ATOM   484  O O   . ILE A 1 63  ? -46.443 -22.213 47.095  1.00 62.24  ? 98  ILE A O   1 
ATOM   485  C CB  . ILE A 1 63  ? -44.864 -22.872 44.774  1.00 31.53  ? 98  ILE A CB  1 
ATOM   486  C CG1 . ILE A 1 63  ? -44.474 -23.043 43.303  1.00 38.42  ? 98  ILE A CG1 1 
ATOM   487  C CG2 . ILE A 1 63  ? -45.805 -24.022 45.120  1.00 38.42  ? 98  ILE A CG2 1 
ATOM   488  C CD1 . ILE A 1 63  ? -43.847 -24.385 42.974  1.00 108.48 ? 98  ILE A CD1 1 
ATOM   489  N N   . VAL A 1 64  ? -46.290 -20.003 46.677  1.00 65.22  ? 99  VAL A N   1 
ATOM   490  C CA  . VAL A 1 64  ? -46.831 -19.566 47.950  1.00 72.38  ? 99  VAL A CA  1 
ATOM   491  C C   . VAL A 1 64  ? -48.307 -19.958 47.856  1.00 73.61  ? 99  VAL A C   1 
ATOM   492  O O   . VAL A 1 64  ? -48.804 -20.218 46.760  1.00 72.90  ? 99  VAL A O   1 
ATOM   493  C CB  . VAL A 1 64  ? -46.722 -18.031 48.107  1.00 122.35 ? 99  VAL A CB  1 
ATOM   494  C CG1 . VAL A 1 64  ? -47.418 -17.346 46.953  1.00 123.66 ? 99  VAL A CG1 1 
ATOM   495  C CG2 . VAL A 1 64  ? -47.346 -17.585 49.418  1.00 123.94 ? 99  VAL A CG2 1 
ATOM   496  N N   . LYS A 1 65  ? -48.994 -20.010 48.994  1.00 80.17  ? 100 LYS A N   1 
ATOM   497  C CA  . LYS A 1 65  ? -50.412 -20.364 49.033  1.00 82.71  ? 100 LYS A CA  1 
ATOM   498  C C   . LYS A 1 65  ? -50.690 -21.654 48.270  1.00 78.64  ? 100 LYS A C   1 
ATOM   499  O O   . LYS A 1 65  ? -50.883 -21.632 47.063  1.00 78.59  ? 100 LYS A O   1 
ATOM   500  C CB  . LYS A 1 65  ? -51.252 -19.235 48.432  1.00 75.03  ? 100 LYS A CB  1 
ATOM   501  C CG  . LYS A 1 65  ? -51.226 -17.920 49.199  1.00 79.70  ? 100 LYS A CG  1 
ATOM   502  C CD  . LYS A 1 65  ? -52.124 -17.962 50.425  1.00 87.43  ? 100 LYS A CD  1 
ATOM   503  C CE  . LYS A 1 65  ? -52.232 -16.587 51.066  1.00 90.69  ? 100 LYS A CE  1 
ATOM   504  N NZ  . LYS A 1 65  ? -53.178 -16.580 52.214  1.00 92.23  ? 100 LYS A NZ  1 
ATOM   505  N N   . SER A 1 66  ? -50.716 -22.772 48.984  1.00 27.28  ? 101 SER A N   1 
ATOM   506  C CA  . SER A 1 66  ? -50.969 -24.084 48.396  1.00 27.28  ? 101 SER A CA  1 
ATOM   507  C C   . SER A 1 66  ? -50.855 -25.130 49.485  1.00 27.28  ? 101 SER A C   1 
ATOM   508  O O   . SER A 1 66  ? -50.737 -24.797 50.662  1.00 27.28  ? 101 SER A O   1 
ATOM   509  C CB  . SER A 1 66  ? -49.949 -24.402 47.300  1.00 121.06 ? 101 SER A CB  1 
ATOM   510  O OG  . SER A 1 66  ? -50.190 -23.652 46.125  1.00 127.11 ? 101 SER A OG  1 
ATOM   511  N N   . GLY A 1 67  ? -50.886 -26.396 49.091  1.00 43.62  ? 102 GLY A N   1 
ATOM   512  C CA  . GLY A 1 67  ? -50.767 -27.465 50.064  1.00 43.43  ? 102 GLY A CA  1 
ATOM   513  C C   . GLY A 1 67  ? -49.319 -27.885 50.197  1.00 44.61  ? 102 GLY A C   1 
ATOM   514  O O   . GLY A 1 67  ? -48.887 -28.344 51.253  1.00 42.94  ? 102 GLY A O   1 
ATOM   515  N N   . LEU A 1 68  ? -48.577 -27.712 49.105  1.00 37.83  ? 103 LEU A N   1 
ATOM   516  C CA  . LEU A 1 68  ? -47.159 -28.051 49.015  1.00 41.12  ? 103 LEU A CA  1 
ATOM   517  C C   . LEU A 1 68  ? -46.510 -28.343 50.357  1.00 42.83  ? 103 LEU A C   1 
ATOM   518  O O   . LEU A 1 68  ? -45.930 -27.458 50.974  1.00 40.95  ? 103 LEU A O   1 
ATOM   519  C CB  . LEU A 1 68  ? -46.398 -26.918 48.321  1.00 56.92  ? 103 LEU A CB  1 
ATOM   520  C CG  . LEU A 1 68  ? -44.885 -27.108 48.190  1.00 63.79  ? 103 LEU A CG  1 
ATOM   521  C CD1 . LEU A 1 68  ? -44.600 -28.376 47.407  1.00 68.43  ? 103 LEU A CD1 1 
ATOM   522  C CD2 . LEU A 1 68  ? -44.268 -25.901 47.504  1.00 68.05  ? 103 LEU A CD2 1 
ATOM   523  N N   . ARG A 1 69  ? -46.607 -29.591 50.805  1.00 61.65  ? 104 ARG A N   1 
ATOM   524  C CA  . ARG A 1 69  ? -46.021 -29.991 52.075  1.00 61.65  ? 104 ARG A CA  1 
ATOM   525  C C   . ARG A 1 69  ? -44.627 -30.568 51.878  1.00 61.65  ? 104 ARG A C   1 
ATOM   526  O O   . ARG A 1 69  ? -43.743 -30.341 52.696  1.00 61.65  ? 104 ARG A O   1 
ATOM   527  C CB  . ARG A 1 69  ? -46.907 -31.021 52.781  1.00 156.54 ? 104 ARG A CB  1 
ATOM   528  C CG  . ARG A 1 69  ? -46.565 -31.193 54.254  1.00 171.96 ? 104 ARG A CG  1 
ATOM   529  C CD  . ARG A 1 69  ? -47.405 -32.267 54.925  1.00 188.99 ? 104 ARG A CD  1 
ATOM   530  N NE  . ARG A 1 69  ? -47.263 -32.237 56.381  1.00 200.00 ? 104 ARG A NE  1 
ATOM   531  C CZ  . ARG A 1 69  ? -46.108 -32.350 57.031  1.00 200.00 ? 104 ARG A CZ  1 
ATOM   532  N NH1 . ARG A 1 69  ? -44.974 -32.502 56.361  1.00 200.00 ? 104 ARG A NH1 1 
ATOM   533  N NH2 . ARG A 1 69  ? -46.085 -32.305 58.357  1.00 200.00 ? 104 ARG A NH2 1 
ATOM   534  N N   . PHE A 1 70  ? -44.427 -31.310 50.794  1.00 43.70  ? 105 PHE A N   1 
ATOM   535  C CA  . PHE A 1 70  ? -43.125 -31.907 50.516  1.00 48.70  ? 105 PHE A CA  1 
ATOM   536  C C   . PHE A 1 70  ? -42.574 -31.460 49.171  1.00 42.10  ? 105 PHE A C   1 
ATOM   537  O O   . PHE A 1 70  ? -43.325 -31.262 48.224  1.00 40.42  ? 105 PHE A O   1 
ATOM   538  C CB  . PHE A 1 70  ? -43.220 -33.437 50.520  1.00 94.32  ? 105 PHE A CB  1 
ATOM   539  C CG  . PHE A 1 70  ? -43.480 -34.036 51.875  1.00 119.76 ? 105 PHE A CG  1 
ATOM   540  C CD1 . PHE A 1 70  ? -44.656 -33.762 52.565  1.00 142.34 ? 105 PHE A CD1 1 
ATOM   541  C CD2 . PHE A 1 70  ? -42.551 -34.896 52.454  1.00 141.94 ? 105 PHE A CD2 1 
ATOM   542  C CE1 . PHE A 1 70  ? -44.905 -34.337 53.810  1.00 152.33 ? 105 PHE A CE1 1 
ATOM   543  C CE2 . PHE A 1 70  ? -42.790 -35.477 53.698  1.00 152.01 ? 105 PHE A CE2 1 
ATOM   544  C CZ  . PHE A 1 70  ? -43.970 -35.196 54.377  1.00 155.79 ? 105 PHE A CZ  1 
ATOM   545  N N   . VAL A 1 71  ? -41.257 -31.306 49.097  1.00 38.28  ? 106 VAL A N   1 
ATOM   546  C CA  . VAL A 1 71  ? -40.592 -30.907 47.861  1.00 34.97  ? 106 VAL A CA  1 
ATOM   547  C C   . VAL A 1 71  ? -39.405 -31.833 47.621  1.00 37.33  ? 106 VAL A C   1 
ATOM   548  O O   . VAL A 1 71  ? -38.287 -31.541 48.039  1.00 37.03  ? 106 VAL A O   1 
ATOM   549  C CB  . VAL A 1 71  ? -40.076 -29.452 47.929  1.00 25.59  ? 106 VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 71  ? -39.441 -29.061 46.602  1.00 18.98  ? 106 VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 71  ? -41.218 -28.510 48.261  1.00 20.08  ? 106 VAL A CG2 1 
ATOM   552  N N   . ALA A 1 72  ? -39.663 -32.952 46.952  1.00 66.67  ? 107 ALA A N   1 
ATOM   553  C CA  . ALA A 1 72  ? -38.633 -33.939 46.657  1.00 70.13  ? 107 ALA A CA  1 
ATOM   554  C C   . ALA A 1 72  ? -37.336 -33.285 46.212  1.00 68.58  ? 107 ALA A C   1 
ATOM   555  O O   . ALA A 1 72  ? -37.339 -32.399 45.363  1.00 67.85  ? 107 ALA A O   1 
ATOM   556  C CB  . ALA A 1 72  ? -39.126 -34.896 45.582  1.00 125.15 ? 107 ALA A CB  1 
ATOM   557  N N   . PRO A 1 73  ? -36.204 -33.717 46.788  1.00 54.76  ? 108 PRO A N   1 
ATOM   558  C CA  . PRO A 1 73  ? -34.892 -33.167 46.441  1.00 53.25  ? 108 PRO A CA  1 
ATOM   559  C C   . PRO A 1 73  ? -34.626 -33.485 44.986  1.00 50.02  ? 108 PRO A C   1 
ATOM   560  O O   . PRO A 1 73  ? -33.897 -34.417 44.665  1.00 49.21  ? 108 PRO A O   1 
ATOM   561  C CB  . PRO A 1 73  ? -33.952 -33.909 47.384  1.00 172.25 ? 108 PRO A CB  1 
ATOM   562  C CG  . PRO A 1 73  ? -34.614 -35.246 47.515  1.00 174.32 ? 108 PRO A CG  1 
ATOM   563  C CD  . PRO A 1 73  ? -36.063 -34.863 47.704  1.00 173.41 ? 108 PRO A CD  1 
ATOM   564  N N   . ASP A 1 74  ? -35.228 -32.698 44.109  1.00 53.10  ? 109 ASP A N   1 
ATOM   565  C CA  . ASP A 1 74  ? -35.105 -32.915 42.674  1.00 53.10  ? 109 ASP A CA  1 
ATOM   566  C C   . ASP A 1 74  ? -35.845 -31.802 41.940  1.00 53.10  ? 109 ASP A C   1 
ATOM   567  O O   . ASP A 1 74  ? -35.268 -31.086 41.130  1.00 53.10  ? 109 ASP A O   1 
ATOM   568  C CB  . ASP A 1 74  ? -35.715 -34.279 42.324  1.00 92.08  ? 109 ASP A CB  1 
ATOM   569  C CG  . ASP A 1 74  ? -35.800 -34.526 40.831  1.00 94.23  ? 109 ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 74  ? -36.267 -35.618 40.444  1.00 96.93  ? 109 ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 74  ? -35.410 -33.640 40.045  1.00 97.23  ? 109 ASP A OD2 1 
ATOM   572  N N   . ALA A 1 75  ? -37.128 -31.672 42.247  1.00 30.42  ? 110 ALA A N   1 
ATOM   573  C CA  . ALA A 1 75  ? -37.978 -30.664 41.651  1.00 30.42  ? 110 ALA A CA  1 
ATOM   574  C C   . ALA A 1 75  ? -37.205 -29.817 40.669  1.00 30.42  ? 110 ALA A C   1 
ATOM   575  O O   . ALA A 1 75  ? -37.110 -30.157 39.494  1.00 30.42  ? 110 ALA A O   1 
ATOM   576  C CB  . ALA A 1 75  ? -38.583 -29.785 42.737  1.00 118.61 ? 110 ALA A CB  1 
ATOM   577  N N   . PHE A 1 76  ? -36.626 -28.734 41.172  1.00 49.21  ? 111 PHE A N   1 
ATOM   578  C CA  . PHE A 1 76  ? -35.869 -27.779 40.369  1.00 57.52  ? 111 PHE A CA  1 
ATOM   579  C C   . PHE A 1 76  ? -34.702 -28.348 39.567  1.00 58.72  ? 111 PHE A C   1 
ATOM   580  O O   . PHE A 1 76  ? -33.745 -27.636 39.273  1.00 57.72  ? 111 PHE A O   1 
ATOM   581  C CB  . PHE A 1 76  ? -35.368 -26.657 41.279  1.00 80.85  ? 111 PHE A CB  1 
ATOM   582  C CG  . PHE A 1 76  ? -36.414 -26.144 42.227  1.00 97.57  ? 111 PHE A CG  1 
ATOM   583  C CD1 . PHE A 1 76  ? -37.554 -25.507 41.748  1.00 112.49 ? 111 PHE A CD1 1 
ATOM   584  C CD2 . PHE A 1 76  ? -36.280 -26.334 43.598  1.00 112.36 ? 111 PHE A CD2 1 
ATOM   585  C CE1 . PHE A 1 76  ? -38.546 -25.068 42.620  1.00 119.36 ? 111 PHE A CE1 1 
ATOM   586  C CE2 . PHE A 1 76  ? -37.267 -25.898 44.479  1.00 119.28 ? 111 PHE A CE2 1 
ATOM   587  C CZ  . PHE A 1 76  ? -38.403 -25.265 43.988  1.00 121.75 ? 111 PHE A CZ  1 
ATOM   588  N N   . HIS A 1 77  ? -34.781 -29.623 39.204  1.00 120.34 ? 112 HIS A N   1 
ATOM   589  C CA  . HIS A 1 77  ? -33.721 -30.250 38.428  1.00 124.75 ? 112 HIS A CA  1 
ATOM   590  C C   . HIS A 1 77  ? -33.773 -29.736 36.997  1.00 120.84 ? 112 HIS A C   1 
ATOM   591  O O   . HIS A 1 77  ? -32.738 -29.519 36.371  1.00 120.87 ? 112 HIS A O   1 
ATOM   592  C CB  . HIS A 1 77  ? -33.877 -31.773 38.439  1.00 137.05 ? 112 HIS A CB  1 
ATOM   593  C CG  . HIS A 1 77  ? -32.785 -32.500 37.716  1.00 152.35 ? 112 HIS A CG  1 
ATOM   594  N ND1 . HIS A 1 77  ? -31.453 -32.364 38.046  1.00 166.47 ? 112 HIS A ND1 1 
ATOM   595  C CD2 . HIS A 1 77  ? -32.829 -33.379 36.687  1.00 166.20 ? 112 HIS A CD2 1 
ATOM   596  C CE1 . HIS A 1 77  ? -30.725 -33.129 37.251  1.00 172.27 ? 112 HIS A CE1 1 
ATOM   597  N NE2 . HIS A 1 77  ? -31.535 -33.755 36.418  1.00 171.44 ? 112 HIS A NE2 1 
ATOM   598  N N   . PHE A 1 78  ? -34.982 -29.539 36.482  1.00 119.41 ? 113 PHE A N   1 
ATOM   599  C CA  . PHE A 1 78  ? -35.139 -29.045 35.122  1.00 117.66 ? 113 PHE A CA  1 
ATOM   600  C C   . PHE A 1 78  ? -34.664 -27.607 34.990  1.00 114.96 ? 113 PHE A C   1 
ATOM   601  O O   . PHE A 1 78  ? -33.706 -27.336 34.274  1.00 113.92 ? 113 PHE A O   1 
ATOM   602  C CB  . PHE A 1 78  ? -36.597 -29.154 34.670  1.00 93.57  ? 113 PHE A CB  1 
ATOM   603  C CG  . PHE A 1 78  ? -36.998 -30.539 34.256  1.00 96.44  ? 113 PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 78  ? -36.265 -31.227 33.295  1.00 96.95  ? 113 PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 78  ? -38.111 -31.153 34.815  1.00 97.14  ? 113 PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 78  ? -36.634 -32.509 32.898  1.00 98.14  ? 113 PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 78  ? -38.489 -32.437 34.423  1.00 97.96  ? 113 PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 78  ? -37.748 -33.114 33.463  1.00 98.23  ? 113 PHE A CZ  1 
ATOM   609  N N   . THR A 1 79  ? -35.333 -26.685 35.676  1.00 71.77  ? 114 THR A N   1 
ATOM   610  C CA  . THR A 1 79  ? -34.949 -25.281 35.620  1.00 70.73  ? 114 THR A CA  1 
ATOM   611  C C   . THR A 1 79  ? -33.526 -25.112 36.140  1.00 76.68  ? 114 THR A C   1 
ATOM   612  O O   . THR A 1 79  ? -33.290 -25.106 37.347  1.00 76.51  ? 114 THR A O   1 
ATOM   613  C CB  . THR A 1 79  ? -35.902 -24.405 36.456  1.00 75.70  ? 114 THR A CB  1 
ATOM   614  O OG1 . THR A 1 79  ? -35.356 -23.087 36.577  1.00 70.17  ? 114 THR A OG1 1 
ATOM   615  C CG2 . THR A 1 79  ? -36.109 -25.002 37.838  1.00 65.70  ? 114 THR A CG2 1 
ATOM   616  N N   . PRO A 1 80  ? -32.509 -24.858 35.150  1.00 121.11 ? 115 PRO A N   1 
ATOM   617  C CA  . PRO A 1 80  ? -31.060 -24.669 35.433  1.00 124.38 ? 115 PRO A CA  1 
ATOM   618  C C   . PRO A 1 80  ? -30.721 -23.365 36.134  1.00 125.98 ? 115 PRO A C   1 
ATOM   619  O O   . PRO A 1 80  ? -29.930 -23.352 37.082  1.00 125.48 ? 115 PRO A O   1 
ATOM   620  C CB  . PRO A 1 80  ? -30.438 -24.758 34.043  1.00 200.00 ? 115 PRO A CB  1 
ATOM   621  C CG  . PRO A 1 80  ? -31.481 -24.091 33.212  1.00 200.00 ? 115 PRO A CG  1 
ATOM   622  C CD  . PRO A 1 80  ? -32.759 -24.731 33.706  1.00 198.32 ? 115 PRO A CD  1 
ATOM   623  N N   . ARG A 1 81  ? -31.316 -22.272 35.667  1.00 135.41 ? 116 ARG A N   1 
ATOM   624  C CA  . ARG A 1 81  ? -31.073 -20.974 36.274  1.00 137.05 ? 116 ARG A CA  1 
ATOM   625  C C   . ARG A 1 81  ? -31.738 -20.830 37.640  1.00 127.49 ? 116 ARG A C   1 
ATOM   626  O O   . ARG A 1 81  ? -31.253 -21.371 38.638  1.00 128.93 ? 116 ARG A O   1 
ATOM   627  C CB  . ARG A 1 81  ? -31.546 -19.855 35.341  1.00 163.35 ? 116 ARG A CB  1 
ATOM   628  C CG  . ARG A 1 81  ? -30.548 -19.506 34.247  1.00 180.31 ? 116 ARG A CG  1 
ATOM   629  C CD  . ARG A 1 81  ? -29.246 -18.998 34.851  1.00 198.04 ? 116 ARG A CD  1 
ATOM   630  N NE  . ARG A 1 81  ? -28.252 -18.652 33.839  1.00 200.00 ? 116 ARG A NE  1 
ATOM   631  C CZ  . ARG A 1 81  ? -27.038 -18.188 34.116  1.00 200.00 ? 116 ARG A CZ  1 
ATOM   632  N NH1 . ARG A 1 81  ? -26.662 -18.013 35.376  1.00 200.00 ? 116 ARG A NH1 1 
ATOM   633  N NH2 . ARG A 1 81  ? -26.197 -17.899 33.132  1.00 200.00 ? 116 ARG A NH2 1 
ATOM   634  N N   . LEU A 1 82  ? -32.850 -20.099 37.666  1.00 107.21 ? 117 LEU A N   1 
ATOM   635  C CA  . LEU A 1 82  ? -33.611 -19.826 38.883  1.00 97.02  ? 117 LEU A CA  1 
ATOM   636  C C   . LEU A 1 82  ? -32.817 -18.994 39.889  1.00 94.21  ? 117 LEU A C   1 
ATOM   637  O O   . LEU A 1 82  ? -31.841 -19.446 40.482  1.00 93.10  ? 117 LEU A O   1 
ATOM   638  C CB  . LEU A 1 82  ? -34.085 -21.121 39.540  1.00 59.75  ? 117 LEU A CB  1 
ATOM   639  C CG  . LEU A 1 82  ? -35.612 -21.185 39.661  1.00 48.72  ? 117 LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 82  ? -36.018 -22.419 40.462  1.00 41.79  ? 117 LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 82  ? -36.132 -19.910 40.330  1.00 42.76  ? 117 LEU A CD2 1 
ATOM   642  N N   . SER A 1 83  ? -33.289 -17.770 40.061  1.00 80.04  ? 118 SER A N   1 
ATOM   643  C CA  . SER A 1 83  ? -32.757 -16.726 40.929  1.00 81.40  ? 118 SER A CA  1 
ATOM   644  C C   . SER A 1 83  ? -33.703 -16.441 42.090  1.00 81.61  ? 118 SER A C   1 
ATOM   645  O O   . SER A 1 83  ? -33.242 -16.040 43.163  1.00 81.57  ? 118 SER A O   1 
ATOM   646  C CB  . SER A 1 83  ? -32.532 -15.443 40.126  1.00 133.54 ? 118 SER A CB  1 
ATOM   647  O OG  . SER A 1 83  ? -33.750 -14.965 39.582  1.00 141.77 ? 118 SER A OG  1 
ATOM   648  N N   . ARG A 1 84  ? -34.982 -16.587 41.891  1.00 63.25  ? 119 ARG A N   1 
ATOM   649  C CA  . ARG A 1 84  ? -35.970 -16.306 42.922  1.00 62.85  ? 119 ARG A CA  1 
ATOM   650  C C   . ARG A 1 84  ? -37.021 -17.404 43.001  1.00 61.78  ? 119 ARG A C   1 
ATOM   651  O O   . ARG A 1 84  ? -37.602 -17.719 41.968  1.00 64.95  ? 119 ARG A O   1 
ATOM   652  C CB  . ARG A 1 84  ? -36.618 -14.953 42.631  1.00 116.84 ? 119 ARG A CB  1 
ATOM   653  C CG  . ARG A 1 84  ? -35.613 -13.968 42.057  1.00 120.13 ? 119 ARG A CG  1 
ATOM   654  C CD  . ARG A 1 84  ? -36.050 -12.525 42.142  1.00 126.20 ? 119 ARG A CD  1 
ATOM   655  N NE  . ARG A 1 84  ? -34.966 -11.650 41.706  1.00 123.26 ? 119 ARG A NE  1 
ATOM   656  C CZ  . ARG A 1 84  ? -34.888 -10.356 41.987  1.00 123.26 ? 119 ARG A CZ  1 
ATOM   657  N NH1 . ARG A 1 84  ? -35.835 -9.774  42.710  1.00 123.26 ? 119 ARG A NH1 1 
ATOM   658  N NH2 . ARG A 1 84  ? -33.858 -9.644  41.552  1.00 123.26 ? 119 ARG A NH2 1 
ATOM   659  N N   . LEU A 1 85  ? -37.177 -17.965 44.168  1.00 44.20  ? 120 LEU A N   1 
ATOM   660  C CA  . LEU A 1 85  ? -38.102 -19.056 44.387  1.00 45.07  ? 120 LEU A CA  1 
ATOM   661  C C   . LEU A 1 85  ? -38.931 -18.717 45.608  1.00 45.27  ? 120 LEU A C   1 
ATOM   662  O O   . LEU A 1 85  ? -38.411 -18.601 46.725  1.00 46.09  ? 120 LEU A O   1 
ATOM   663  C CB  . LEU A 1 85  ? -37.317 -20.336 44.619  1.00 33.88  ? 120 LEU A CB  1 
ATOM   664  C CG  . LEU A 1 85  ? -38.038 -21.409 45.413  1.00 33.88  ? 120 LEU A CG  1 
ATOM   665  C CD1 . LEU A 1 85  ? -39.321 -21.786 44.706  1.00 34.20  ? 120 LEU A CD1 1 
ATOM   666  C CD2 . LEU A 1 85  ? -37.128 -22.609 45.567  1.00 35.25  ? 120 LEU A CD2 1 
ATOM   667  N N   . ASN A 1 86  ? -40.219 -18.534 45.396  1.00 36.68  ? 121 ASN A N   1 
ATOM   668  C CA  . ASN A 1 86  ? -41.092 -18.208 46.503  1.00 36.08  ? 121 ASN A CA  1 
ATOM   669  C C   . ASN A 1 86  ? -42.049 -19.348 46.782  1.00 38.26  ? 121 ASN A C   1 
ATOM   670  O O   . ASN A 1 86  ? -42.914 -19.659 45.954  1.00 38.76  ? 121 ASN A O   1 
ATOM   671  C CB  . ASN A 1 86  ? -41.907 -16.942 46.263  1.00 31.39  ? 121 ASN A CB  1 
ATOM   672  C CG  . ASN A 1 86  ? -42.819 -16.611 47.451  1.00 29.95  ? 121 ASN A CG  1 
ATOM   673  O OD1 . ASN A 1 86  ? -43.473 -17.500 47.999  1.00 31.51  ? 121 ASN A OD1 1 
ATOM   674  N ND2 . ASN A 1 86  ? -42.874 -15.339 47.843  1.00 41.86  ? 121 ASN A ND2 1 
ATOM   675  N N   . LEU A 1 87  ? -41.826 -20.018 47.906  1.00 46.01  ? 122 LEU A N   1 
ATOM   676  C CA  . LEU A 1 87  ? -42.661 -21.127 48.357  1.00 46.19  ? 122 LEU A CA  1 
ATOM   677  C C   . LEU A 1 87  ? -43.426 -20.773 49.631  1.00 46.07  ? 122 LEU A C   1 
ATOM   678  O O   . LEU A 1 87  ? -43.980 -21.649 50.290  1.00 48.17  ? 122 LEU A O   1 
ATOM   679  C CB  . LEU A 1 87  ? -41.803 -22.368 48.604  1.00 46.84  ? 122 LEU A CB  1 
ATOM   680  C CG  . LEU A 1 87  ? -41.023 -22.891 47.399  1.00 48.98  ? 122 LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 87  ? -40.197 -24.099 47.804  1.00 50.97  ? 122 LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 87  ? -41.988 -23.256 46.292  1.00 49.48  ? 122 LEU A CD2 1 
ATOM   683  N N   . SER A 1 88  ? -43.507 -19.474 49.958  1.00 29.30  ? 123 SER A N   1 
ATOM   684  C CA  . SER A 1 88  ? -44.167 -18.948 51.183  1.00 29.30  ? 123 SER A CA  1 
ATOM   685  C C   . SER A 1 88  ? -45.646 -19.269 51.469  1.00 29.30  ? 123 SER A C   1 
ATOM   686  O O   . SER A 1 88  ? -46.323 -19.902 50.661  1.00 29.30  ? 123 SER A O   1 
ATOM   687  C CB  . SER A 1 88  ? -43.986 -17.430 51.247  1.00 113.63 ? 123 SER A CB  1 
ATOM   688  O OG  . SER A 1 88  ? -44.547 -16.800 50.110  1.00 120.35 ? 123 SER A OG  1 
ATOM   689  N N   . PHE A 1 89  ? -46.139 -18.816 52.626  1.00 104.83 ? 124 PHE A N   1 
ATOM   690  C CA  . PHE A 1 89  ? -47.529 -19.060 53.049  1.00 108.26 ? 124 PHE A CA  1 
ATOM   691  C C   . PHE A 1 89  ? -47.965 -20.384 52.443  1.00 97.78  ? 124 PHE A C   1 
ATOM   692  O O   . PHE A 1 89  ? -48.643 -20.412 51.417  1.00 98.06  ? 124 PHE A O   1 
ATOM   693  C CB  . PHE A 1 89  ? -48.445 -17.936 52.560  1.00 116.21 ? 124 PHE A CB  1 
ATOM   694  C CG  . PHE A 1 89  ? -48.081 -16.577 53.090  1.00 143.36 ? 124 PHE A CG  1 
ATOM   695  C CD1 . PHE A 1 89  ? -46.862 -15.989 52.764  1.00 166.37 ? 124 PHE A CD1 1 
ATOM   696  C CD2 . PHE A 1 89  ? -48.962 -15.878 53.908  1.00 167.07 ? 124 PHE A CD2 1 
ATOM   697  C CE1 . PHE A 1 89  ? -46.527 -14.726 53.244  1.00 177.05 ? 124 PHE A CE1 1 
ATOM   698  C CE2 . PHE A 1 89  ? -48.637 -14.614 54.394  1.00 177.58 ? 124 PHE A CE2 1 
ATOM   699  C CZ  . PHE A 1 89  ? -47.418 -14.037 54.060  1.00 181.23 ? 124 PHE A CZ  1 
ATOM   700  N N   . ASN A 1 90  ? -47.594 -21.481 53.097  1.00 33.29  ? 125 ASN A N   1 
ATOM   701  C CA  . ASN A 1 90  ? -47.861 -22.809 52.551  1.00 33.29  ? 125 ASN A CA  1 
ATOM   702  C C   . ASN A 1 90  ? -48.027 -23.871 53.644  1.00 33.29  ? 125 ASN A C   1 
ATOM   703  O O   . ASN A 1 90  ? -48.588 -23.602 54.701  1.00 33.29  ? 125 ASN A O   1 
ATOM   704  C CB  . ASN A 1 90  ? -46.684 -23.155 51.637  1.00 47.98  ? 125 ASN A CB  1 
ATOM   705  C CG  . ASN A 1 90  ? -47.014 -24.197 50.625  1.00 42.61  ? 125 ASN A CG  1 
ATOM   706  O OD1 . ASN A 1 90  ? -47.293 -25.337 50.969  1.00 34.57  ? 125 ASN A OD1 1 
ATOM   707  N ND2 . ASN A 1 90  ? -46.979 -23.818 49.356  1.00 36.11  ? 125 ASN A ND2 1 
ATOM   708  N N   . ALA A 1 91  ? -47.534 -25.075 53.394  1.00 30.46  ? 126 ALA A N   1 
ATOM   709  C CA  . ALA A 1 91  ? -47.640 -26.142 54.374  1.00 31.40  ? 126 ALA A CA  1 
ATOM   710  C C   . ALA A 1 91  ? -46.395 -27.020 54.367  1.00 26.87  ? 126 ALA A C   1 
ATOM   711  O O   . ALA A 1 91  ? -46.486 -28.235 54.546  1.00 25.61  ? 126 ALA A O   1 
ATOM   712  C CB  . ALA A 1 91  ? -48.871 -26.982 54.090  1.00 78.94  ? 126 ALA A CB  1 
ATOM   713  N N   . LEU A 1 92  ? -45.236 -26.392 54.162  1.00 22.54  ? 127 LEU A N   1 
ATOM   714  C CA  . LEU A 1 92  ? -43.940 -27.077 54.116  1.00 19.87  ? 127 LEU A CA  1 
ATOM   715  C C   . LEU A 1 92  ? -43.382 -27.322 55.506  1.00 23.92  ? 127 LEU A C   1 
ATOM   716  O O   . LEU A 1 92  ? -43.126 -26.388 56.255  1.00 21.26  ? 127 LEU A O   1 
ATOM   717  C CB  . LEU A 1 92  ? -42.915 -26.243 53.338  1.00 3.65   ? 127 LEU A CB  1 
ATOM   718  C CG  . LEU A 1 92  ? -42.543 -26.510 51.875  1.00 1.00   ? 127 LEU A CG  1 
ATOM   719  C CD1 . LEU A 1 92  ? -43.004 -27.885 51.463  1.00 1.00   ? 127 LEU A CD1 1 
ATOM   720  C CD2 . LEU A 1 92  ? -43.153 -25.451 50.993  1.00 1.00   ? 127 LEU A CD2 1 
ATOM   721  N N   . GLU A 1 93  ? -43.167 -28.580 55.850  1.00 53.03  ? 128 GLU A N   1 
ATOM   722  C CA  . GLU A 1 93  ? -42.634 -28.897 57.170  1.00 60.22  ? 128 GLU A CA  1 
ATOM   723  C C   . GLU A 1 93  ? -41.105 -28.810 57.197  1.00 56.28  ? 128 GLU A C   1 
ATOM   724  O O   . GLU A 1 93  ? -40.499 -28.709 58.266  1.00 55.19  ? 128 GLU A O   1 
ATOM   725  C CB  . GLU A 1 93  ? -43.080 -30.299 57.597  1.00 130.71 ? 128 GLU A CB  1 
ATOM   726  C CG  . GLU A 1 93  ? -42.773 -30.631 59.051  1.00 148.62 ? 128 GLU A CG  1 
ATOM   727  C CD  . GLU A 1 93  ? -43.552 -29.767 60.026  1.00 166.22 ? 128 GLU A CD  1 
ATOM   728  O OE1 . GLU A 1 93  ? -43.324 -29.889 61.248  1.00 174.44 ? 128 GLU A OE1 1 
ATOM   729  O OE2 . GLU A 1 93  ? -44.396 -28.968 59.573  1.00 175.38 ? 128 GLU A OE2 1 
ATOM   730  N N   . SER A 1 94  ? -40.493 -28.860 56.016  1.00 51.95  ? 129 SER A N   1 
ATOM   731  C CA  . SER A 1 94  ? -39.042 -28.780 55.885  1.00 49.89  ? 129 SER A CA  1 
ATOM   732  C C   . SER A 1 94  ? -38.651 -28.753 54.412  1.00 49.00  ? 129 SER A C   1 
ATOM   733  O O   . SER A 1 94  ? -39.400 -29.224 53.554  1.00 48.46  ? 129 SER A O   1 
ATOM   734  C CB  . SER A 1 94  ? -38.377 -29.980 56.568  1.00 72.05  ? 129 SER A CB  1 
ATOM   735  O OG  . SER A 1 94  ? -36.964 -29.921 56.448  1.00 72.52  ? 129 SER A OG  1 
ATOM   736  N N   . LEU A 1 95  ? -37.478 -28.197 54.125  1.00 56.63  ? 130 LEU A N   1 
ATOM   737  C CA  . LEU A 1 95  ? -36.981 -28.121 52.757  1.00 57.38  ? 130 LEU A CA  1 
ATOM   738  C C   . LEU A 1 95  ? -35.649 -28.855 52.642  1.00 61.19  ? 130 LEU A C   1 
ATOM   739  O O   . LEU A 1 95  ? -34.636 -28.393 53.158  1.00 60.69  ? 130 LEU A O   1 
ATOM   740  C CB  . LEU A 1 95  ? -36.802 -26.663 52.333  1.00 19.94  ? 130 LEU A CB  1 
ATOM   741  C CG  . LEU A 1 95  ? -36.356 -26.470 50.882  1.00 16.71  ? 130 LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 95  ? -37.355 -27.142 49.955  1.00 14.27  ? 130 LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 95  ? -36.245 -24.987 50.565  1.00 15.36  ? 130 LEU A CD2 1 
ATOM   744  N N   . SER A 1 96  ? -35.658 -30.002 51.969  1.00 88.85  ? 131 SER A N   1 
ATOM   745  C CA  . SER A 1 96  ? -34.450 -30.802 51.788  1.00 88.85  ? 131 SER A CA  1 
ATOM   746  C C   . SER A 1 96  ? -33.250 -29.936 51.459  1.00 88.85  ? 131 SER A C   1 
ATOM   747  O O   . SER A 1 96  ? -33.393 -28.827 50.957  1.00 88.85  ? 131 SER A O   1 
ATOM   748  C CB  . SER A 1 96  ? -34.660 -31.831 50.677  1.00 139.20 ? 131 SER A CB  1 
ATOM   749  O OG  . SER A 1 96  ? -35.686 -32.744 51.025  1.00 146.16 ? 131 SER A OG  1 
ATOM   750  N N   . TRP A 1 97  ? -32.065 -30.448 51.755  1.00 80.02  ? 132 TRP A N   1 
ATOM   751  C CA  . TRP A 1 97  ? -30.832 -29.715 51.496  1.00 80.02  ? 132 TRP A CA  1 
ATOM   752  C C   . TRP A 1 97  ? -30.552 -29.588 50.006  1.00 80.02  ? 132 TRP A C   1 
ATOM   753  O O   . TRP A 1 97  ? -30.398 -28.486 49.485  1.00 80.02  ? 132 TRP A O   1 
ATOM   754  C CB  . TRP A 1 97  ? -29.646 -30.413 52.172  1.00 74.73  ? 132 TRP A CB  1 
ATOM   755  C CG  . TRP A 1 97  ? -28.326 -29.997 51.601  1.00 70.01  ? 132 TRP A CG  1 
ATOM   756  C CD1 . TRP A 1 97  ? -27.773 -28.751 51.640  1.00 68.75  ? 132 TRP A CD1 1 
ATOM   757  C CD2 . TRP A 1 97  ? -27.430 -30.810 50.831  1.00 67.67  ? 132 TRP A CD2 1 
ATOM   758  N NE1 . TRP A 1 97  ? -26.592 -28.735 50.939  1.00 68.84  ? 132 TRP A NE1 1 
ATOM   759  C CE2 . TRP A 1 97  ? -26.358 -29.983 50.432  1.00 67.12  ? 132 TRP A CE2 1 
ATOM   760  C CE3 . TRP A 1 97  ? -27.433 -32.154 50.439  1.00 67.18  ? 132 TRP A CE3 1 
ATOM   761  C CZ2 . TRP A 1 97  ? -25.296 -30.459 49.656  1.00 66.41  ? 132 TRP A CZ2 1 
ATOM   762  C CZ3 . TRP A 1 97  ? -26.376 -32.626 49.667  1.00 67.06  ? 132 TRP A CZ3 1 
ATOM   763  C CH2 . TRP A 1 97  ? -25.323 -31.778 49.285  1.00 66.81  ? 132 TRP A CH2 1 
ATOM   764  N N   . LYS A 1 98  ? -30.476 -30.734 49.338  1.00 90.73  ? 133 LYS A N   1 
ATOM   765  C CA  . LYS A 1 98  ? -30.200 -30.790 47.908  1.00 96.43  ? 133 LYS A CA  1 
ATOM   766  C C   . LYS A 1 98  ? -31.083 -29.801 47.169  1.00 88.85  ? 133 LYS A C   1 
ATOM   767  O O   . LYS A 1 98  ? -30.619 -29.071 46.297  1.00 88.08  ? 133 LYS A O   1 
ATOM   768  C CB  . LYS A 1 98  ? -30.455 -32.206 47.383  1.00 156.33 ? 133 LYS A CB  1 
ATOM   769  C CG  . LYS A 1 98  ? -29.970 -32.450 45.960  1.00 181.19 ? 133 LYS A CG  1 
ATOM   770  C CD  . LYS A 1 98  ? -28.449 -32.447 45.876  1.00 200.00 ? 133 LYS A CD  1 
ATOM   771  C CE  . LYS A 1 98  ? -27.840 -33.590 46.676  1.00 200.00 ? 133 LYS A CE  1 
ATOM   772  N NZ  . LYS A 1 98  ? -28.288 -34.921 46.179  1.00 200.00 ? 133 LYS A NZ  1 
ATOM   773  N N   . THR A 1 99  ? -32.358 -29.791 47.540  1.00 59.72  ? 134 THR A N   1 
ATOM   774  C CA  . THR A 1 99  ? -33.359 -28.915 46.948  1.00 54.31  ? 134 THR A CA  1 
ATOM   775  C C   . THR A 1 99  ? -32.756 -27.763 46.160  1.00 57.57  ? 134 THR A C   1 
ATOM   776  O O   . THR A 1 99  ? -32.839 -27.745 44.933  1.00 56.25  ? 134 THR A O   1 
ATOM   777  C CB  . THR A 1 99  ? -34.296 -28.359 48.029  1.00 52.75  ? 134 THR A CB  1 
ATOM   778  O OG1 . THR A 1 99  ? -35.169 -29.404 48.479  1.00 50.15  ? 134 THR A OG1 1 
ATOM   779  C CG2 . THR A 1 99  ? -35.113 -27.206 47.487  1.00 50.15  ? 134 THR A CG2 1 
ATOM   780  N N   . VAL A 1 100 ? -32.143 -26.812 46.856  1.00 63.58  ? 135 VAL A N   1 
ATOM   781  C CA  . VAL A 1 100 ? -31.523 -25.672 46.190  1.00 68.66  ? 135 VAL A CA  1 
ATOM   782  C C   . VAL A 1 100 ? -30.530 -26.143 45.138  1.00 70.10  ? 135 VAL A C   1 
ATOM   783  O O   . VAL A 1 100 ? -30.743 -25.955 43.945  1.00 70.16  ? 135 VAL A O   1 
ATOM   784  C CB  . VAL A 1 100 ? -30.777 -24.773 47.196  1.00 123.32 ? 135 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 100 ? -30.048 -23.657 46.457  1.00 122.30 ? 135 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 100 ? -31.762 -24.193 48.198  1.00 122.03 ? 135 VAL A CG2 1 
ATOM   787  N N   . GLN A 1 101 ? -29.443 -26.753 45.590  1.00 35.67  ? 136 GLN A N   1 
ATOM   788  C CA  . GLN A 1 101 ? -28.412 -27.263 44.693  1.00 35.67  ? 136 GLN A CA  1 
ATOM   789  C C   . GLN A 1 101 ? -27.764 -26.180 43.837  1.00 35.67  ? 136 GLN A C   1 
ATOM   790  O O   . GLN A 1 101 ? -27.697 -26.293 42.608  1.00 35.67  ? 136 GLN A O   1 
ATOM   791  C CB  . GLN A 1 101 ? -28.985 -28.356 43.785  1.00 152.13 ? 136 GLN A CB  1 
ATOM   792  C CG  . GLN A 1 101 ? -28.278 -29.700 43.912  1.00 161.94 ? 136 GLN A CG  1 
ATOM   793  C CD  . GLN A 1 101 ? -26.820 -29.654 43.480  1.00 170.84 ? 136 GLN A CD  1 
ATOM   794  O OE1 . GLN A 1 101 ? -26.075 -30.615 43.676  1.00 175.25 ? 136 GLN A OE1 1 
ATOM   795  N NE2 . GLN A 1 101 ? -26.409 -28.542 42.883  1.00 175.25 ? 136 GLN A NE2 1 
ATOM   796  N N   . GLY A 1 102 ? -27.280 -25.140 44.509  1.00 142.24 ? 137 GLY A N   1 
ATOM   797  C CA  . GLY A 1 102 ? -26.624 -24.042 43.828  1.00 143.41 ? 137 GLY A CA  1 
ATOM   798  C C   . GLY A 1 102 ? -27.238 -23.686 42.491  1.00 141.92 ? 137 GLY A C   1 
ATOM   799  O O   . GLY A 1 102 ? -26.819 -24.186 41.446  1.00 143.73 ? 137 GLY A O   1 
ATOM   800  N N   . LEU A 1 103 ? -28.243 -22.821 42.527  1.00 56.08  ? 138 LEU A N   1 
ATOM   801  C CA  . LEU A 1 103 ? -28.908 -22.386 41.312  1.00 52.06  ? 138 LEU A CA  1 
ATOM   802  C C   . LEU A 1 103 ? -28.651 -20.905 41.203  1.00 54.17  ? 138 LEU A C   1 
ATOM   803  O O   . LEU A 1 103 ? -29.211 -20.235 40.342  1.00 53.65  ? 138 LEU A O   1 
ATOM   804  C CB  . LEU A 1 103 ? -30.412 -22.621 41.411  1.00 87.90  ? 138 LEU A CB  1 
ATOM   805  C CG  . LEU A 1 103 ? -30.862 -24.001 41.876  1.00 78.10  ? 138 LEU A CG  1 
ATOM   806  C CD1 . LEU A 1 103 ? -32.380 -24.046 41.928  1.00 70.01  ? 138 LEU A CD1 1 
ATOM   807  C CD2 . LEU A 1 103 ? -30.317 -25.064 40.938  1.00 73.61  ? 138 LEU A CD2 1 
ATOM   808  N N   . SER A 1 104 ? -27.790 -20.400 42.081  1.00 54.39  ? 139 SER A N   1 
ATOM   809  C CA  . SER A 1 104 ? -27.491 -18.976 42.120  1.00 57.47  ? 139 SER A CA  1 
ATOM   810  C C   . SER A 1 104 ? -28.804 -18.314 42.507  1.00 54.97  ? 139 SER A C   1 
ATOM   811  O O   . SER A 1 104 ? -28.989 -17.108 42.328  1.00 54.58  ? 139 SER A O   1 
ATOM   812  C CB  . SER A 1 104 ? -27.023 -18.473 40.751  1.00 126.27 ? 139 SER A CB  1 
ATOM   813  O OG  . SER A 1 104 ? -25.796 -19.077 40.379  1.00 131.96 ? 139 SER A OG  1 
ATOM   814  N N   . LEU A 1 105 ? -29.716 -19.139 43.023  1.00 94.26  ? 140 LEU A N   1 
ATOM   815  C CA  . LEU A 1 105 ? -31.028 -18.689 43.471  1.00 93.12  ? 140 LEU A CA  1 
ATOM   816  C C   . LEU A 1 105 ? -30.726 -17.455 44.281  1.00 92.89  ? 140 LEU A C   1 
ATOM   817  O O   . LEU A 1 105 ? -30.011 -17.523 45.280  1.00 92.05  ? 140 LEU A O   1 
ATOM   818  C CB  . LEU A 1 105 ? -31.682 -19.754 44.353  1.00 75.85  ? 140 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 105 ? -33.117 -19.497 44.813  1.00 76.33  ? 140 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 105 ? -34.031 -19.371 43.603  1.00 77.47  ? 140 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 105 ? -33.573 -20.638 45.711  1.00 76.11  ? 140 LEU A CD2 1 
ATOM   822  N N   . GLN A 1 106 ? -31.267 -16.320 43.866  1.00 78.57  ? 141 GLN A N   1 
ATOM   823  C CA  . GLN A 1 106 ? -30.928 -15.098 44.587  1.00 76.17  ? 141 GLN A CA  1 
ATOM   824  C C   . GLN A 1 106 ? -31.882 -14.863 45.752  1.00 76.46  ? 141 GLN A C   1 
ATOM   825  O O   . GLN A 1 106 ? -31.479 -14.286 46.760  1.00 76.66  ? 141 GLN A O   1 
ATOM   826  C CB  . GLN A 1 106 ? -30.956 -13.896 43.641  1.00 126.36 ? 141 GLN A CB  1 
ATOM   827  C CG  . GLN A 1 106 ? -29.911 -13.961 42.538  1.00 135.95 ? 141 GLN A CG  1 
ATOM   828  C CD  . GLN A 1 106 ? -29.910 -12.726 41.660  1.00 131.26 ? 141 GLN A CD  1 
ATOM   829  O OE1 . GLN A 1 106 ? -29.713 -11.609 42.140  1.00 131.26 ? 141 GLN A OE1 1 
ATOM   830  N NE2 . GLN A 1 106 ? -30.129 -12.921 40.364  1.00 145.16 ? 141 GLN A NE2 1 
ATOM   831  N N   . GLU A 1 107 ? -33.132 -15.215 45.586  1.00 52.81  ? 142 GLU A N   1 
ATOM   832  C CA  . GLU A 1 107 ? -34.115 -15.021 46.644  1.00 53.94  ? 142 GLU A CA  1 
ATOM   833  C C   . GLU A 1 107 ? -34.924 -16.290 46.882  1.00 53.11  ? 142 GLU A C   1 
ATOM   834  O O   . GLU A 1 107 ? -35.381 -16.907 45.924  1.00 55.36  ? 142 GLU A O   1 
ATOM   835  C CB  . GLU A 1 107 ? -35.091 -13.900 46.282  1.00 155.58 ? 142 GLU A CB  1 
ATOM   836  C CG  . GLU A 1 107 ? -34.461 -12.572 45.931  1.00 162.92 ? 142 GLU A CG  1 
ATOM   837  C CD  . GLU A 1 107 ? -35.505 -11.489 45.737  1.00 162.92 ? 142 GLU A CD  1 
ATOM   838  O OE1 . GLU A 1 107 ? -36.460 -11.713 44.961  1.00 162.92 ? 142 GLU A OE1 1 
ATOM   839  O OE2 . GLU A 1 107 ? -35.375 -10.415 46.361  1.00 162.92 ? 142 GLU A OE2 1 
ATOM   840  N N   . LEU A 1 108 ? -35.050 -16.663 48.136  1.00 32.61  ? 143 LEU A N   1 
ATOM   841  C CA  . LEU A 1 108 ? -35.783 -17.860 48.513  1.00 32.07  ? 143 LEU A CA  1 
ATOM   842  C C   . LEU A 1 108 ? -36.725 -17.507 49.646  1.00 32.64  ? 143 LEU A C   1 
ATOM   843  O O   . LEU A 1 108 ? -36.284 -17.185 50.740  1.00 33.14  ? 143 LEU A O   1 
ATOM   844  C CB  . LEU A 1 108 ? -34.817 -18.951 48.965  1.00 26.74  ? 143 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 108 ? -35.456 -20.180 49.609  1.00 26.41  ? 143 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 108 ? -36.525 -20.747 48.692  1.00 27.60  ? 143 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 108 ? -34.383 -21.219 49.892  1.00 29.73  ? 143 LEU A CD2 1 
ATOM   848  N N   . VAL A 1 109 ? -38.031 -17.546 49.362  1.00 58.12  ? 144 VAL A N   1 
ATOM   849  C CA  . VAL A 1 109 ? -39.023 -17.249 50.387  1.00 60.55  ? 144 VAL A CA  1 
ATOM   850  C C   . VAL A 1 109 ? -39.600 -18.533 50.972  1.00 61.85  ? 144 VAL A C   1 
ATOM   851  O O   . VAL A 1 109 ? -40.231 -19.282 50.246  1.00 61.90  ? 144 VAL A O   1 
ATOM   852  C CB  . VAL A 1 109 ? -40.162 -16.390 49.830  1.00 77.93  ? 144 VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 109 ? -41.059 -15.936 50.964  1.00 87.40  ? 144 VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 109 ? -39.590 -15.190 49.095  1.00 87.40  ? 144 VAL A CG2 1 
ATOM   855  N N   . LEU A 1 110 ? -39.372 -18.772 52.257  1.00 11.59  ? 145 LEU A N   1 
ATOM   856  C CA  . LEU A 1 110 ? -39.888 -19.956 52.958  1.00 11.89  ? 145 LEU A CA  1 
ATOM   857  C C   . LEU A 1 110 ? -40.584 -19.530 54.230  1.00 12.66  ? 145 LEU A C   1 
ATOM   858  O O   . LEU A 1 110 ? -39.908 -18.826 54.998  1.00 91.20  ? 145 LEU A O   1 
ATOM   859  C CB  . LEU A 1 110 ? -38.748 -20.918 53.307  1.00 76.15  ? 145 LEU A CB  1 
ATOM   860  C CG  . LEU A 1 110 ? -37.991 -21.603 52.168  1.00 79.36  ? 145 LEU A CG  1 
ATOM   861  C CD1 . LEU A 1 110 ? -36.868 -22.446 52.750  1.00 79.29  ? 145 LEU A CD1 1 
ATOM   862  C CD2 . LEU A 1 110 ? -38.941 -22.467 51.357  1.00 81.29  ? 145 LEU A CD2 1 
ATOM   863  N N   . SER A 1 111 ? -41.861 -19.262 53.987  1.00 40.71  ? 146 SER A N   1 
ATOM   864  C CA  . SER A 1 111 ? -42.614 -18.520 54.986  1.00 40.71  ? 146 SER A CA  1 
ATOM   865  C C   . SER A 1 111 ? -43.980 -18.918 55.377  1.00 40.71  ? 146 SER A C   1 
ATOM   866  O O   . SER A 1 111 ? -44.676 -19.640 54.651  1.00 40.71  ? 146 SER A O   1 
ATOM   867  C CB  . SER A 1 111 ? -42.718 -17.047 54.565  1.00 3.86   ? 146 SER A CB  1 
ATOM   868  O OG  . SER A 1 111 ? -41.599 -16.265 54.945  1.00 3.86   ? 146 SER A OG  1 
ATOM   869  N N   . GLY A 1 112 ? -44.397 -18.343 56.504  1.00 103.82 ? 147 GLY A N   1 
ATOM   870  C CA  . GLY A 1 112 ? -45.697 -18.671 57.030  1.00 104.23 ? 147 GLY A CA  1 
ATOM   871  C C   . GLY A 1 112 ? -45.720 -20.163 56.812  1.00 104.45 ? 147 GLY A C   1 
ATOM   872  O O   . GLY A 1 112 ? -46.747 -20.716 56.397  1.00 104.24 ? 147 GLY A O   1 
ATOM   873  N N   . ASN A 1 113 ? -44.565 -20.813 57.027  1.00 57.38  ? 148 ASN A N   1 
ATOM   874  C CA  . ASN A 1 113 ? -44.564 -22.258 56.811  1.00 57.43  ? 148 ASN A CA  1 
ATOM   875  C C   . ASN A 1 113 ? -44.341 -22.977 58.094  1.00 61.11  ? 148 ASN A C   1 
ATOM   876  O O   . ASN A 1 113 ? -43.649 -22.456 58.921  1.00 62.47  ? 148 ASN A O   1 
ATOM   877  C CB  . ASN A 1 113 ? -43.466 -22.623 55.816  1.00 24.60  ? 148 ASN A CB  1 
ATOM   878  C CG  . ASN A 1 113 ? -43.988 -22.782 54.416  1.00 24.60  ? 148 ASN A CG  1 
ATOM   879  O OD1 . ASN A 1 113 ? -44.588 -23.791 54.087  1.00 24.60  ? 148 ASN A OD1 1 
ATOM   880  N ND2 . ASN A 1 113 ? -43.784 -21.775 53.590  1.00 24.60  ? 148 ASN A ND2 1 
ATOM   881  N N   . PRO A 1 114 ? -44.885 -24.161 58.273  1.00 45.58  ? 149 PRO A N   1 
ATOM   882  C CA  . PRO A 1 114 ? -44.696 -24.930 59.514  1.00 45.58  ? 149 PRO A CA  1 
ATOM   883  C C   . PRO A 1 114 ? -43.246 -25.019 59.966  1.00 45.58  ? 149 PRO A C   1 
ATOM   884  O O   . PRO A 1 114 ? -43.018 -24.739 61.122  1.00 45.58  ? 149 PRO A O   1 
ATOM   885  C CB  . PRO A 1 114 ? -45.276 -26.289 59.161  1.00 76.29  ? 149 PRO A CB  1 
ATOM   886  C CG  . PRO A 1 114 ? -46.411 -25.919 58.262  1.00 72.54  ? 149 PRO A CG  1 
ATOM   887  C CD  . PRO A 1 114 ? -45.774 -24.887 57.346  1.00 70.46  ? 149 PRO A CD  1 
ATOM   888  N N   . LEU A 1 115 ? -42.306 -25.368 59.085  1.00 41.33  ? 150 LEU A N   1 
ATOM   889  C CA  . LEU A 1 115 ? -40.853 -25.198 59.322  1.00 41.33  ? 150 LEU A CA  1 
ATOM   890  C C   . LEU A 1 115 ? -40.350 -25.723 60.650  1.00 41.33  ? 150 LEU A C   1 
ATOM   891  O O   . LEU A 1 115 ? -39.872 -24.967 61.465  1.00 41.33  ? 150 LEU A O   1 
ATOM   892  C CB  . LEU A 1 115 ? -40.480 -23.722 59.212  1.00 80.89  ? 150 LEU A CB  1 
ATOM   893  C CG  . LEU A 1 115 ? -40.671 -23.096 57.834  1.00 94.59  ? 150 LEU A CG  1 
ATOM   894  C CD1 . LEU A 1 115 ? -40.254 -21.633 57.866  1.00 103.54 ? 150 LEU A CD1 1 
ATOM   895  C CD2 . LEU A 1 115 ? -39.844 -23.872 56.822  1.00 103.02 ? 150 LEU A CD2 1 
ATOM   896  N N   . HIS A 1 116 ? -40.447 -27.029 60.834  1.00 49.26  ? 151 HIS A N   1 
ATOM   897  C CA  . HIS A 1 116 ? -39.903 -27.694 62.008  1.00 49.26  ? 151 HIS A CA  1 
ATOM   898  C C   . HIS A 1 116 ? -38.368 -27.828 61.963  1.00 49.26  ? 151 HIS A C   1 
ATOM   899  O O   . HIS A 1 116 ? -37.790 -28.458 61.063  1.00 49.26  ? 151 HIS A O   1 
ATOM   900  C CB  . HIS A 1 116 ? -40.562 -29.084 62.164  1.00 137.27 ? 151 HIS A CB  1 
ATOM   901  C CG  . HIS A 1 116 ? -39.989 -29.934 63.260  1.00 160.67 ? 151 HIS A CG  1 
ATOM   902  N ND1 . HIS A 1 116 ? -38.673 -30.346 63.281  1.00 182.38 ? 151 HIS A ND1 1 
ATOM   903  C CD2 . HIS A 1 116 ? -40.578 -30.506 64.338  1.00 182.13 ? 151 HIS A CD2 1 
ATOM   904  C CE1 . HIS A 1 116 ? -38.478 -31.135 64.323  1.00 191.63 ? 151 HIS A CE1 1 
ATOM   905  N NE2 . HIS A 1 116 ? -39.618 -31.249 64.980  1.00 190.60 ? 151 HIS A NE2 1 
ATOM   906  N N   . CYS A 1 117 ? -37.727 -27.268 62.988  1.00 107.79 ? 152 CYS A N   1 
ATOM   907  C CA  . CYS A 1 117 ? -36.268 -27.183 63.041  1.00 105.32 ? 152 CYS A CA  1 
ATOM   908  C C   . CYS A 1 117 ? -35.523 -28.497 63.360  1.00 104.14 ? 152 CYS A C   1 
ATOM   909  O O   . CYS A 1 117 ? -35.410 -28.926 64.513  1.00 103.85 ? 152 CYS A O   1 
ATOM   910  C CB  . CYS A 1 117 ? -35.783 -26.046 63.942  1.00 53.06  ? 152 CYS A CB  1 
ATOM   911  S SG  . CYS A 1 117 ? -36.232 -24.431 63.225  1.00 51.20  ? 152 CYS A SG  1 
ATOM   912  N N   . SER A 1 118 ? -34.996 -29.107 62.301  1.00 87.07  ? 153 SER A N   1 
ATOM   913  C CA  . SER A 1 118 ? -34.158 -30.300 62.390  1.00 86.57  ? 153 SER A CA  1 
ATOM   914  C C   . SER A 1 118 ? -32.729 -29.887 62.115  1.00 86.57  ? 153 SER A C   1 
ATOM   915  O O   . SER A 1 118 ? -32.462 -28.713 61.819  1.00 86.57  ? 153 SER A O   1 
ATOM   916  C CB  . SER A 1 118 ? -34.602 -31.337 61.349  1.00 122.21 ? 153 SER A CB  1 
ATOM   917  O OG  . SER A 1 118 ? -34.490 -30.811 60.033  1.00 122.21 ? 153 SER A OG  1 
ATOM   918  N N   . CYS A 1 119 ? -31.820 -30.857 62.179  1.00 50.34  ? 154 CYS A N   1 
ATOM   919  C CA  . CYS A 1 119 ? -30.480 -30.663 61.615  1.00 50.34  ? 154 CYS A CA  1 
ATOM   920  C C   . CYS A 1 119 ? -30.520 -30.304 60.133  1.00 50.34  ? 154 CYS A C   1 
ATOM   921  O O   . CYS A 1 119 ? -29.780 -29.446 59.701  1.00 50.34  ? 154 CYS A O   1 
ATOM   922  C CB  . CYS A 1 119 ? -29.553 -31.874 61.850  1.00 89.30  ? 154 CYS A CB  1 
ATOM   923  S SG  . CYS A 1 119 ? -28.749 -31.888 63.501  1.00 94.55  ? 154 CYS A SG  1 
ATOM   924  N N   . ALA A 1 120 ? -31.422 -30.931 59.379  1.00 59.62  ? 155 ALA A N   1 
ATOM   925  C CA  . ALA A 1 120 ? -31.583 -30.677 57.943  1.00 59.62  ? 155 ALA A CA  1 
ATOM   926  C C   . ALA A 1 120 ? -31.866 -29.218 57.557  1.00 59.62  ? 155 ALA A C   1 
ATOM   927  O O   . ALA A 1 120 ? -32.122 -28.915 56.380  1.00 59.62  ? 155 ALA A O   1 
ATOM   928  C CB  . ALA A 1 120 ? -32.673 -31.552 57.397  1.00 119.79 ? 155 ALA A CB  1 
ATOM   929  N N   . LEU A 1 121 ? -31.859 -28.336 58.552  1.00 25.22  ? 156 LEU A N   1 
ATOM   930  C CA  . LEU A 1 121 ? -32.109 -26.921 58.353  1.00 25.22  ? 156 LEU A CA  1 
ATOM   931  C C   . LEU A 1 121 ? -30.901 -26.061 58.672  1.00 25.22  ? 156 LEU A C   1 
ATOM   932  O O   . LEU A 1 121 ? -30.944 -24.838 58.465  1.00 25.22  ? 156 LEU A O   1 
ATOM   933  C CB  . LEU A 1 121 ? -33.254 -26.461 59.242  1.00 53.53  ? 156 LEU A CB  1 
ATOM   934  C CG  . LEU A 1 121 ? -34.612 -26.587 58.584  1.00 50.48  ? 156 LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 121 ? -35.665 -25.883 59.426  1.00 49.80  ? 156 LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 121 ? -34.516 -25.957 57.202  1.00 49.51  ? 156 LEU A CD2 1 
ATOM   937  N N   . ARG A 1 122 ? -29.828 -26.688 59.175  1.00 37.38  ? 157 ARG A N   1 
ATOM   938  C CA  . ARG A 1 122 ? -28.587 -25.972 59.400  1.00 37.38  ? 157 ARG A CA  1 
ATOM   939  C C   . ARG A 1 122 ? -28.254 -25.234 58.128  1.00 37.38  ? 157 ARG A C   1 
ATOM   940  O O   . ARG A 1 122 ? -27.783 -24.113 58.203  1.00 37.38  ? 157 ARG A O   1 
ATOM   941  C CB  . ARG A 1 122 ? -27.454 -26.930 59.766  1.00 40.43  ? 157 ARG A CB  1 
ATOM   942  C CG  . ARG A 1 122 ? -26.169 -26.218 60.186  1.00 51.43  ? 157 ARG A CG  1 
ATOM   943  C CD  . ARG A 1 122 ? -26.360 -25.458 61.495  1.00 64.18  ? 157 ARG A CD  1 
ATOM   944  N NE  . ARG A 1 122 ? -25.812 -24.104 61.441  1.00 71.50  ? 157 ARG A NE  1 
ATOM   945  C CZ  . ARG A 1 122 ? -24.539 -23.811 61.200  1.00 76.83  ? 157 ARG A CZ  1 
ATOM   946  N NH1 . ARG A 1 122 ? -23.654 -24.778 60.986  1.00 79.87  ? 157 ARG A NH1 1 
ATOM   947  N NH2 . ARG A 1 122 ? -24.151 -22.544 61.174  1.00 77.90  ? 157 ARG A NH2 1 
ATOM   948  N N   . TRP A 1 123 ? -28.488 -25.828 56.954  1.00 28.87  ? 158 TRP A N   1 
ATOM   949  C CA  . TRP A 1 123 ? -28.148 -25.104 55.723  1.00 28.39  ? 158 TRP A CA  1 
ATOM   950  C C   . TRP A 1 123 ? -28.873 -23.788 55.640  1.00 28.72  ? 158 TRP A C   1 
ATOM   951  O O   . TRP A 1 123 ? -28.319 -22.782 55.267  1.00 28.20  ? 158 TRP A O   1 
ATOM   952  C CB  . TRP A 1 123 ? -28.443 -25.949 54.478  1.00 62.04  ? 158 TRP A CB  1 
ATOM   953  C CG  . TRP A 1 123 ? -29.874 -26.077 54.134  1.00 54.89  ? 158 TRP A CG  1 
ATOM   954  C CD1 . TRP A 1 123 ? -30.765 -26.965 54.652  1.00 52.00  ? 158 TRP A CD1 1 
ATOM   955  C CD2 . TRP A 1 123 ? -30.594 -25.287 53.184  1.00 50.19  ? 158 TRP A CD2 1 
ATOM   956  N NE1 . TRP A 1 123 ? -31.999 -26.781 54.081  1.00 49.36  ? 158 TRP A NE1 1 
ATOM   957  C CE2 . TRP A 1 123 ? -31.922 -25.756 53.177  1.00 49.03  ? 158 TRP A CE2 1 
ATOM   958  C CE3 . TRP A 1 123 ? -30.246 -24.227 52.339  1.00 48.89  ? 158 TRP A CE3 1 
ATOM   959  C CZ2 . TRP A 1 123 ? -32.906 -25.202 52.355  1.00 48.59  ? 158 TRP A CZ2 1 
ATOM   960  C CZ3 . TRP A 1 123 ? -31.224 -23.678 51.523  1.00 48.41  ? 158 TRP A CZ3 1 
ATOM   961  C CH2 . TRP A 1 123 ? -32.539 -24.167 51.538  1.00 48.70  ? 158 TRP A CH2 1 
ATOM   962  N N   . LEU A 1 124 ? -30.124 -23.800 56.035  1.00 49.83  ? 159 LEU A N   1 
ATOM   963  C CA  . LEU A 1 124 ? -30.912 -22.577 56.019  1.00 49.83  ? 159 LEU A CA  1 
ATOM   964  C C   . LEU A 1 124 ? -30.267 -21.659 57.017  1.00 49.83  ? 159 LEU A C   1 
ATOM   965  O O   . LEU A 1 124 ? -30.060 -20.470 56.764  1.00 49.83  ? 159 LEU A O   1 
ATOM   966  C CB  . LEU A 1 124 ? -32.342 -22.898 56.440  1.00 47.67  ? 159 LEU A CB  1 
ATOM   967  C CG  . LEU A 1 124 ? -33.372 -21.821 56.145  1.00 49.91  ? 159 LEU A CG  1 
ATOM   968  C CD1 . LEU A 1 124 ? -33.284 -21.480 54.674  1.00 51.78  ? 159 LEU A CD1 1 
ATOM   969  C CD2 . LEU A 1 124 ? -34.761 -22.312 56.511  1.00 51.71  ? 159 LEU A CD2 1 
ATOM   970  N N   . GLN A 1 125 ? -29.946 -22.268 58.150  1.00 47.74  ? 160 GLN A N   1 
ATOM   971  C CA  . GLN A 1 125 ? -29.311 -21.613 59.257  1.00 47.74  ? 160 GLN A CA  1 
ATOM   972  C C   . GLN A 1 125 ? -28.172 -20.778 58.716  1.00 47.74  ? 160 GLN A C   1 
ATOM   973  O O   . GLN A 1 125 ? -28.153 -19.573 58.919  1.00 47.74  ? 160 GLN A O   1 
ATOM   974  C CB  . GLN A 1 125 ? -28.814 -22.659 60.259  1.00 69.73  ? 160 GLN A CB  1 
ATOM   975  C CG  . GLN A 1 125 ? -28.069 -22.117 61.468  1.00 71.62  ? 160 GLN A CG  1 
ATOM   976  C CD  . GLN A 1 125 ? -28.968 -21.368 62.424  1.00 66.73  ? 160 GLN A CD  1 
ATOM   977  O OE1 . GLN A 1 125 ? -29.583 -20.362 62.058  1.00 66.08  ? 160 GLN A OE1 1 
ATOM   978  N NE2 . GLN A 1 125 ? -29.053 -21.856 63.660  1.00 62.40  ? 160 GLN A NE2 1 
ATOM   979  N N   . ARG A 1 126 ? -27.258 -21.435 57.993  1.00 112.59 ? 161 ARG A N   1 
ATOM   980  C CA  . ARG A 1 126 ? -26.073 -20.805 57.428  1.00 119.23 ? 161 ARG A CA  1 
ATOM   981  C C   . ARG A 1 126 ? -26.480 -19.727 56.451  1.00 112.04 ? 161 ARG A C   1 
ATOM   982  O O   . ARG A 1 126 ? -25.928 -18.647 56.467  1.00 111.89 ? 161 ARG A O   1 
ATOM   983  C CB  . ARG A 1 126 ? -25.214 -21.830 56.679  1.00 117.52 ? 161 ARG A CB  1 
ATOM   984  C CG  . ARG A 1 126 ? -24.493 -22.819 57.567  1.00 143.27 ? 161 ARG A CG  1 
ATOM   985  C CD  . ARG A 1 126 ? -23.532 -23.655 56.725  1.00 171.05 ? 161 ARG A CD  1 
ATOM   986  N NE  . ARG A 1 126 ? -22.527 -22.820 56.068  1.00 187.73 ? 161 ARG A NE  1 
ATOM   987  C CZ  . ARG A 1 126 ? -21.597 -22.121 56.712  1.00 200.00 ? 161 ARG A CZ  1 
ATOM   988  N NH1 . ARG A 1 126 ? -21.533 -22.156 58.037  1.00 200.00 ? 161 ARG A NH1 1 
ATOM   989  N NH2 . ARG A 1 126 ? -20.733 -21.380 56.034  1.00 200.00 ? 161 ARG A NH2 1 
ATOM   990  N N   . TRP A 1 127 ? -27.440 -20.006 55.583  1.00 67.50  ? 162 TRP A N   1 
ATOM   991  C CA  . TRP A 1 127 ? -27.800 -19.022 54.577  1.00 67.50  ? 162 TRP A CA  1 
ATOM   992  C C   . TRP A 1 127 ? -28.180 -17.725 55.262  1.00 67.50  ? 162 TRP A C   1 
ATOM   993  O O   . TRP A 1 127 ? -28.229 -16.677 54.633  1.00 67.50  ? 162 TRP A O   1 
ATOM   994  C CB  . TRP A 1 127 ? -28.981 -19.537 53.744  1.00 66.55  ? 162 TRP A CB  1 
ATOM   995  C CG  . TRP A 1 127 ? -28.583 -20.415 52.603  1.00 58.76  ? 162 TRP A CG  1 
ATOM   996  C CD1 . TRP A 1 127 ? -27.678 -21.432 52.629  1.00 55.20  ? 162 TRP A CD1 1 
ATOM   997  C CD2 . TRP A 1 127 ? -29.079 -20.352 51.264  1.00 52.97  ? 162 TRP A CD2 1 
ATOM   998  N NE1 . TRP A 1 127 ? -27.575 -22.007 51.387  1.00 53.73  ? 162 TRP A NE1 1 
ATOM   999  C CE2 . TRP A 1 127 ? -28.426 -21.364 50.529  1.00 52.52  ? 162 TRP A CE2 1 
ATOM   1000 C CE3 . TRP A 1 127 ? -30.013 -19.539 50.611  1.00 51.19  ? 162 TRP A CE3 1 
ATOM   1001 C CZ2 . TRP A 1 127 ? -28.674 -21.587 49.170  1.00 51.09  ? 162 TRP A CZ2 1 
ATOM   1002 C CZ3 . TRP A 1 127 ? -30.262 -19.759 49.260  1.00 49.82  ? 162 TRP A CZ3 1 
ATOM   1003 C CH2 . TRP A 1 127 ? -29.593 -20.777 48.555  1.00 50.18  ? 162 TRP A CH2 1 
ATOM   1004 N N   . GLU A 1 128 ? -28.499 -17.805 56.548  1.00 52.87  ? 163 GLU A N   1 
ATOM   1005 C CA  . GLU A 1 128 ? -28.943 -16.643 57.304  1.00 52.87  ? 163 GLU A CA  1 
ATOM   1006 C C   . GLU A 1 128 ? -27.744 -15.789 57.706  1.00 52.87  ? 163 GLU A C   1 
ATOM   1007 O O   . GLU A 1 128 ? -27.607 -14.628 57.301  1.00 52.87  ? 163 GLU A O   1 
ATOM   1008 C CB  . GLU A 1 128 ? -29.738 -17.070 58.512  1.00 114.07 ? 163 GLU A CB  1 
ATOM   1009 C CG  . GLU A 1 128 ? -30.351 -15.903 59.205  1.00 120.79 ? 163 GLU A CG  1 
ATOM   1010 C CD  . GLU A 1 128 ? -31.284 -16.349 60.277  1.00 124.30 ? 163 GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1 128 ? -30.828 -17.120 61.150  1.00 126.55 ? 163 GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1 128 ? -32.466 -15.942 60.242  1.00 125.97 ? 163 GLU A OE2 1 
ATOM   1013 N N   . GLU A 1 129 ? -26.868 -16.412 58.490  1.00 64.70  ? 164 GLU A N   1 
ATOM   1014 C CA  . GLU A 1 129 ? -25.643 -15.793 59.010  1.00 67.80  ? 164 GLU A CA  1 
ATOM   1015 C C   . GLU A 1 129 ? -24.774 -15.294 57.849  1.00 66.49  ? 164 GLU A C   1 
ATOM   1016 O O   . GLU A 1 129 ? -24.295 -14.163 57.848  1.00 66.37  ? 164 GLU A O   1 
ATOM   1017 C CB  . GLU A 1 129 ? -24.867 -16.832 59.809  1.00 107.04 ? 164 GLU A CB  1 
ATOM   1018 C CG  . GLU A 1 129 ? -25.668 -17.504 60.906  1.00 113.79 ? 164 GLU A CG  1 
ATOM   1019 C CD  . GLU A 1 129 ? -25.002 -18.763 61.421  1.00 120.45 ? 164 GLU A CD  1 
ATOM   1020 O OE1 . GLU A 1 129 ? -25.509 -19.351 62.400  1.00 123.76 ? 164 GLU A OE1 1 
ATOM   1021 O OE2 . GLU A 1 129 ? -23.975 -19.168 60.839  1.00 123.74 ? 164 GLU A OE2 1 
ATOM   1022 N N   . GLU A 1 130 ? -24.598 -16.170 56.865  1.00 60.62  ? 165 GLU A N   1 
ATOM   1023 C CA  . GLU A 1 130 ? -23.910 -15.861 55.629  1.00 60.17  ? 165 GLU A CA  1 
ATOM   1024 C C   . GLU A 1 130 ? -24.601 -14.698 54.969  1.00 59.07  ? 165 GLU A C   1 
ATOM   1025 O O   . GLU A 1 130 ? -23.994 -13.970 54.188  1.00 59.12  ? 165 GLU A O   1 
ATOM   1026 C CB  . GLU A 1 130 ? -23.963 -17.058 54.677  1.00 111.92 ? 165 GLU A CB  1 
ATOM   1027 C CG  . GLU A 1 130 ? -23.324 -18.323 55.201  1.00 114.13 ? 165 GLU A CG  1 
ATOM   1028 C CD  . GLU A 1 130 ? -21.820 -18.276 55.135  1.00 117.20 ? 165 GLU A CD  1 
ATOM   1029 O OE1 . GLU A 1 130 ? -21.283 -18.098 54.021  1.00 118.96 ? 165 GLU A OE1 1 
ATOM   1030 O OE2 . GLU A 1 130 ? -21.174 -18.416 56.195  1.00 118.39 ? 165 GLU A OE2 1 
ATOM   1031 N N   . GLY A 1 131 ? -25.890 -14.558 55.249  1.00 48.29  ? 166 GLY A N   1 
ATOM   1032 C CA  . GLY A 1 131 ? -26.676 -13.454 54.726  1.00 48.29  ? 166 GLY A CA  1 
ATOM   1033 C C   . GLY A 1 131 ? -26.826 -13.491 53.214  1.00 48.29  ? 166 GLY A C   1 
ATOM   1034 O O   . GLY A 1 131 ? -26.755 -12.449 52.575  1.00 48.29  ? 166 GLY A O   1 
ATOM   1035 N N   . LEU A 1 132 ? -27.083 -14.688 52.675  1.00 105.04 ? 167 LEU A N   1 
ATOM   1036 C CA  . LEU A 1 132 ? -26.909 -15.001 51.248  1.00 105.04 ? 167 LEU A CA  1 
ATOM   1037 C C   . LEU A 1 132 ? -28.183 -14.920 50.423  1.00 105.04 ? 167 LEU A C   1 
ATOM   1038 O O   . LEU A 1 132 ? -28.331 -14.021 49.590  1.00 105.04 ? 167 LEU A O   1 
ATOM   1039 C CB  . LEU A 1 132 ? -26.328 -16.411 51.080  1.00 165.49 ? 167 LEU A CB  1 
ATOM   1040 C CG  . LEU A 1 132 ? -24.927 -16.706 51.613  1.00 192.40 ? 167 LEU A CG  1 
ATOM   1041 C CD1 . LEU A 1 132 ? -24.662 -18.199 51.494  1.00 200.00 ? 167 LEU A CD1 1 
ATOM   1042 C CD2 . LEU A 1 132 ? -23.888 -15.907 50.844  1.00 200.00 ? 167 LEU A CD2 1 
ATOM   1043 N N   . GLY A 1 133 ? -29.091 -15.873 50.646  1.00 112.44 ? 168 GLY A N   1 
ATOM   1044 C CA  . GLY A 1 133 ? -30.252 -16.050 49.786  1.00 108.05 ? 168 GLY A CA  1 
ATOM   1045 C C   . GLY A 1 133 ? -31.318 -14.999 50.003  1.00 104.78 ? 168 GLY A C   1 
ATOM   1046 O O   . GLY A 1 133 ? -32.397 -15.029 49.397  1.00 103.57 ? 168 GLY A O   1 
ATOM   1047 N N   . GLY A 1 134 ? -30.997 -14.050 50.868  1.00 56.37  ? 169 GLY A N   1 
ATOM   1048 C CA  . GLY A 1 134 ? -31.933 -13.025 51.226  1.00 56.37  ? 169 GLY A CA  1 
ATOM   1049 C C   . GLY A 1 134 ? -32.885 -13.694 52.165  1.00 56.37  ? 169 GLY A C   1 
ATOM   1050 O O   . GLY A 1 134 ? -34.083 -13.554 52.047  1.00 56.37  ? 169 GLY A O   1 
ATOM   1051 N N   . VAL A 1 135 ? -32.334 -14.472 53.072  1.00 40.03  ? 170 VAL A N   1 
ATOM   1052 C CA  . VAL A 1 135 ? -33.111 -15.029 54.151  1.00 43.81  ? 170 VAL A CA  1 
ATOM   1053 C C   . VAL A 1 135 ? -33.262 -14.025 55.273  1.00 47.05  ? 170 VAL A C   1 
ATOM   1054 O O   . VAL A 1 135 ? -34.368 -13.733 55.679  1.00 46.07  ? 170 VAL A O   1 
ATOM   1055 C CB  . VAL A 1 135 ? -32.480 -16.323 54.722  1.00 51.55  ? 170 VAL A CB  1 
ATOM   1056 C CG1 . VAL A 1 135 ? -33.392 -16.880 55.823  1.00 52.67  ? 170 VAL A CG1 1 
ATOM   1057 C CG2 . VAL A 1 135 ? -32.296 -17.348 53.628  1.00 52.94  ? 170 VAL A CG2 1 
ATOM   1058 N N   . PRO A 1 136 ? -32.163 -13.460 55.749  1.00 41.15  ? 171 PRO A N   1 
ATOM   1059 C CA  . PRO A 1 136 ? -32.194 -12.676 56.978  1.00 41.15  ? 171 PRO A CA  1 
ATOM   1060 C C   . PRO A 1 136 ? -33.511 -11.963 57.214  1.00 41.15  ? 171 PRO A C   1 
ATOM   1061 O O   . PRO A 1 136 ? -34.238 -12.357 58.095  1.00 41.15  ? 171 PRO A O   1 
ATOM   1062 C CB  . PRO A 1 136 ? -31.028 -11.710 56.786  1.00 106.02 ? 171 PRO A CB  1 
ATOM   1063 C CG  . PRO A 1 136 ? -30.044 -12.569 56.085  1.00 110.92 ? 171 PRO A CG  1 
ATOM   1064 C CD  . PRO A 1 136 ? -30.885 -13.266 55.050  1.00 106.65 ? 171 PRO A CD  1 
ATOM   1065 N N   . GLU A 1 137 ? -33.816 -10.950 56.426  1.00 67.30  ? 172 GLU A N   1 
ATOM   1066 C CA  . GLU A 1 137 ? -34.965 -10.077 56.671  1.00 65.99  ? 172 GLU A CA  1 
ATOM   1067 C C   . GLU A 1 137 ? -36.332 -10.745 56.989  1.00 61.50  ? 172 GLU A C   1 
ATOM   1068 O O   . GLU A 1 137 ? -37.227 -10.091 57.549  1.00 61.34  ? 172 GLU A O   1 
ATOM   1069 C CB  . GLU A 1 137 ? -35.138 -9.100  55.503  1.00 112.01 ? 172 GLU A CB  1 
ATOM   1070 C CG  . GLU A 1 137 ? -35.119 -9.739  54.125  1.00 117.77 ? 172 GLU A CG  1 
ATOM   1071 C CD  . GLU A 1 137 ? -33.715 -10.012 53.630  1.00 123.49 ? 172 GLU A CD  1 
ATOM   1072 O OE1 . GLU A 1 137 ? -32.944 -9.042  53.473  1.00 126.22 ? 172 GLU A OE1 1 
ATOM   1073 O OE2 . GLU A 1 137 ? -33.385 -11.195 53.397  1.00 126.44 ? 172 GLU A OE2 1 
ATOM   1074 N N   . GLN A 1 138 ? -36.498 -12.025 56.665  1.00 52.85  ? 173 GLN A N   1 
ATOM   1075 C CA  . GLN A 1 138 ? -37.778 -12.702 56.880  1.00 52.85  ? 173 GLN A CA  1 
ATOM   1076 C C   . GLN A 1 138 ? -38.085 -13.129 58.321  1.00 52.85  ? 173 GLN A C   1 
ATOM   1077 O O   . GLN A 1 138 ? -39.240 -13.316 58.656  1.00 52.85  ? 173 GLN A O   1 
ATOM   1078 C CB  . GLN A 1 138 ? -37.859 -13.918 55.963  1.00 72.31  ? 173 GLN A CB  1 
ATOM   1079 C CG  . GLN A 1 138 ? -37.976 -13.544 54.514  1.00 68.02  ? 173 GLN A CG  1 
ATOM   1080 C CD  . GLN A 1 138 ? -37.859 -14.745 53.615  1.00 66.50  ? 173 GLN A CD  1 
ATOM   1081 O OE1 . GLN A 1 138 ? -38.531 -15.759 53.816  1.00 65.37  ? 173 GLN A OE1 1 
ATOM   1082 N NE2 . GLN A 1 138 ? -37.000 -14.644 52.610  1.00 66.08  ? 173 GLN A NE2 1 
ATOM   1083 N N   . LYS A 1 139 ? -37.083 -13.338 59.164  1.00 46.88  ? 174 LYS A N   1 
ATOM   1084 C CA  . LYS A 1 139 ? -37.344 -13.724 60.550  1.00 48.24  ? 174 LYS A CA  1 
ATOM   1085 C C   . LYS A 1 139 ? -37.956 -15.118 60.660  1.00 45.04  ? 174 LYS A C   1 
ATOM   1086 O O   . LYS A 1 139 ? -38.878 -15.356 61.436  1.00 44.02  ? 174 LYS A O   1 
ATOM   1087 C CB  . LYS A 1 139 ? -38.290 -12.728 61.229  1.00 36.53  ? 174 LYS A CB  1 
ATOM   1088 C CG  . LYS A 1 139 ? -37.617 -11.763 62.185  1.00 43.73  ? 174 LYS A CG  1 
ATOM   1089 C CD  . LYS A 1 139 ? -36.709 -10.792 61.460  1.00 47.33  ? 174 LYS A CD  1 
ATOM   1090 C CE  . LYS A 1 139 ? -36.160 -9.763  62.425  1.00 41.97  ? 174 LYS A CE  1 
ATOM   1091 N NZ  . LYS A 1 139 ? -37.264 -9.042  63.118  1.00 40.05  ? 174 LYS A NZ  1 
ATOM   1092 N N   . LEU A 1 140 ? -37.407 -16.056 59.922  1.00 20.49  ? 175 LEU A N   1 
ATOM   1093 C CA  . LEU A 1 140 ? -37.966 -17.394 59.942  1.00 20.49  ? 175 LEU A CA  1 
ATOM   1094 C C   . LEU A 1 140 ? -37.897 -18.004 61.329  1.00 20.49  ? 175 LEU A C   1 
ATOM   1095 O O   . LEU A 1 140 ? -36.953 -17.732 62.038  1.00 20.49  ? 175 LEU A O   1 
ATOM   1096 C CB  . LEU A 1 140 ? -37.224 -18.288 58.956  1.00 44.22  ? 175 LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 140 ? -37.542 -17.946 57.507  1.00 31.52  ? 175 LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 140 ? -36.830 -18.889 56.554  1.00 27.27  ? 175 LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 140 ? -39.046 -18.032 57.340  1.00 27.04  ? 175 LEU A CD2 1 
ATOM   1100 N N   . GLN A 1 141 ? -38.903 -18.792 61.725  1.00 41.47  ? 176 GLN A N   1 
ATOM   1101 C CA  . GLN A 1 141 ? -38.927 -19.442 63.059  1.00 41.47  ? 176 GLN A CA  1 
ATOM   1102 C C   . GLN A 1 141 ? -39.246 -20.944 63.009  1.00 41.47  ? 176 GLN A C   1 
ATOM   1103 O O   . GLN A 1 141 ? -39.755 -21.422 61.987  1.00 41.47  ? 176 GLN A O   1 
ATOM   1104 C CB  . GLN A 1 141 ? -40.008 -18.716 63.872  1.00 79.71  ? 176 GLN A CB  1 
ATOM   1105 C CG  . GLN A 1 141 ? -39.776 -17.218 63.992  1.00 72.37  ? 176 GLN A CG  1 
ATOM   1106 C CD  . GLN A 1 141 ? -40.282 -16.668 65.314  1.00 69.77  ? 176 GLN A CD  1 
ATOM   1107 O OE1 . GLN A 1 141 ? -41.401 -16.960 65.741  1.00 67.69  ? 176 GLN A OE1 1 
ATOM   1108 N NE2 . GLN A 1 141 ? -39.455 -15.872 65.971  1.00 67.25  ? 176 GLN A NE2 1 
ATOM   1109 N N   . CYS A 1 142 ? -39.124 -21.685 64.116  1.00 32.22  ? 177 CYS A N   1 
ATOM   1110 C CA  . CYS A 1 142 ? -39.466 -23.131 64.133  1.00 32.22  ? 177 CYS A CA  1 
ATOM   1111 C C   . CYS A 1 142 ? -40.916 -23.558 64.514  1.00 32.22  ? 177 CYS A C   1 
ATOM   1112 O O   . CYS A 1 142 ? -41.405 -23.161 65.569  1.00 32.22  ? 177 CYS A O   1 
ATOM   1113 C CB  . CYS A 1 142 ? -38.527 -23.855 65.061  1.00 72.05  ? 177 CYS A CB  1 
ATOM   1114 S SG  . CYS A 1 142 ? -36.805 -23.354 64.832  1.00 72.05  ? 177 CYS A SG  1 
ATOM   1115 N N   . HIS A 1 143 ? -41.559 -24.393 63.669  1.00 71.65  ? 178 HIS A N   1 
ATOM   1116 C CA  . HIS A 1 143 ? -42.932 -24.960 63.877  1.00 80.81  ? 178 HIS A CA  1 
ATOM   1117 C C   . HIS A 1 143 ? -43.008 -25.618 65.214  1.00 77.00  ? 178 HIS A C   1 
ATOM   1118 O O   . HIS A 1 143 ? -41.965 -25.931 65.792  1.00 77.74  ? 178 HIS A O   1 
ATOM   1119 C CB  . HIS A 1 143 ? -43.267 -26.067 62.877  1.00 200.00 ? 178 HIS A CB  1 
ATOM   1120 C CG  . HIS A 1 143 ? -44.557 -26.767 63.169  1.00 200.00 ? 178 HIS A CG  1 
ATOM   1121 N ND1 . HIS A 1 143 ? -45.742 -26.087 63.367  1.00 200.00 ? 178 HIS A ND1 1 
ATOM   1122 C CD2 . HIS A 1 143 ? -44.840 -28.076 63.367  1.00 200.00 ? 178 HIS A CD2 1 
ATOM   1123 C CE1 . HIS A 1 143 ? -46.694 -26.946 63.676  1.00 200.00 ? 178 HIS A CE1 1 
ATOM   1124 N NE2 . HIS A 1 143 ? -46.174 -28.162 63.684  1.00 200.00 ? 178 HIS A NE2 1 
ATOM   1125 N N   . GLY A 1 144 ? -44.236 -25.940 65.639  1.00 195.60 ? 179 GLY A N   1 
ATOM   1126 C CA  . GLY A 1 144 ? -44.443 -26.566 66.931  1.00 194.04 ? 179 GLY A CA  1 
ATOM   1127 C C   . GLY A 1 144 ? -43.957 -25.449 67.811  1.00 194.74 ? 179 GLY A C   1 
ATOM   1128 O O   . GLY A 1 144 ? -44.621 -24.999 68.745  1.00 191.42 ? 179 GLY A O   1 
ATOM   1129 N N   . GLN A 1 145 ? -42.762 -25.008 67.452  1.00 37.86  ? 180 GLN A N   1 
ATOM   1130 C CA  . GLN A 1 145 ? -42.073 -23.910 68.043  1.00 37.86  ? 180 GLN A CA  1 
ATOM   1131 C C   . GLN A 1 145 ? -41.087 -24.170 69.148  1.00 37.86  ? 180 GLN A C   1 
ATOM   1132 O O   . GLN A 1 145 ? -41.385 -24.688 70.221  1.00 37.86  ? 180 GLN A O   1 
ATOM   1133 C CB  . GLN A 1 145 ? -43.045 -22.810 68.465  1.00 173.97 ? 180 GLN A CB  1 
ATOM   1134 C CG  . GLN A 1 145 ? -43.086 -21.674 67.452  1.00 192.57 ? 180 GLN A CG  1 
ATOM   1135 C CD  . GLN A 1 145 ? -43.928 -20.507 67.908  1.00 200.00 ? 180 GLN A CD  1 
ATOM   1136 O OE1 . GLN A 1 145 ? -43.782 -19.388 67.410  1.00 200.00 ? 180 GLN A OE1 1 
ATOM   1137 N NE2 . GLN A 1 145 ? -44.825 -20.761 68.853  1.00 200.00 ? 180 GLN A NE2 1 
ATOM   1138 N N   . GLY A 1 146 ? -39.869 -23.830 68.756  1.00 139.80 ? 181 GLY A N   1 
ATOM   1139 C CA  . GLY A 1 146 ? -38.642 -23.836 69.533  1.00 138.56 ? 181 GLY A CA  1 
ATOM   1140 C C   . GLY A 1 146 ? -38.031 -22.772 68.625  1.00 139.79 ? 181 GLY A C   1 
ATOM   1141 O O   . GLY A 1 146 ? -36.837 -22.775 68.301  1.00 136.81 ? 181 GLY A O   1 
ATOM   1142 N N   . PRO A 1 147 ? -38.903 -21.835 68.201  1.00 78.81  ? 182 PRO A N   1 
ATOM   1143 C CA  . PRO A 1 147 ? -39.005 -20.659 67.362  1.00 80.76  ? 182 PRO A CA  1 
ATOM   1144 C C   . PRO A 1 147 ? -38.086 -20.111 66.354  1.00 80.95  ? 182 PRO A C   1 
ATOM   1145 O O   . PRO A 1 147 ? -38.605 -19.670 65.385  1.00 80.25  ? 182 PRO A O   1 
ATOM   1146 C CB  . PRO A 1 147 ? -39.581 -19.619 68.297  1.00 55.13  ? 182 PRO A CB  1 
ATOM   1147 C CG  . PRO A 1 147 ? -40.569 -20.401 68.949  1.00 56.61  ? 182 PRO A CG  1 
ATOM   1148 C CD  . PRO A 1 147 ? -39.743 -21.562 69.386  1.00 54.14  ? 182 PRO A CD  1 
ATOM   1149 N N   . LEU A 1 148 ? -36.774 -20.079 66.448  1.00 74.80  ? 183 LEU A N   1 
ATOM   1150 C CA  . LEU A 1 148 ? -36.206 -19.449 65.267  1.00 76.96  ? 183 LEU A CA  1 
ATOM   1151 C C   . LEU A 1 148 ? -34.782 -19.581 64.860  1.00 84.38  ? 183 LEU A C   1 
ATOM   1152 O O   . LEU A 1 148 ? -34.082 -20.521 65.204  1.00 82.97  ? 183 LEU A O   1 
ATOM   1153 C CB  . LEU A 1 148 ? -36.548 -17.947 65.291  1.00 41.06  ? 183 LEU A CB  1 
ATOM   1154 C CG  . LEU A 1 148 ? -35.721 -16.976 66.145  1.00 31.25  ? 183 LEU A CG  1 
ATOM   1155 C CD1 . LEU A 1 148 ? -36.379 -15.608 66.132  1.00 21.31  ? 183 LEU A CD1 1 
ATOM   1156 C CD2 . LEU A 1 148 ? -35.613 -17.467 67.558  1.00 21.29  ? 183 LEU A CD2 1 
ATOM   1157 N N   . ALA A 1 149 ? -34.401 -18.598 64.060  1.00 35.99  ? 184 ALA A N   1 
ATOM   1158 C CA  . ALA A 1 149 ? -33.077 -18.445 63.528  1.00 43.07  ? 184 ALA A CA  1 
ATOM   1159 C C   . ALA A 1 149 ? -32.137 -18.190 64.703  1.00 43.39  ? 184 ALA A C   1 
ATOM   1160 O O   . ALA A 1 149 ? -31.441 -17.179 64.784  1.00 44.81  ? 184 ALA A O   1 
ATOM   1161 C CB  . ALA A 1 149 ? -33.053 -17.284 62.577  1.00 133.17 ? 184 ALA A CB  1 
ATOM   1162 N N   . HIS A 1 150 ? -32.218 -19.128 65.635  1.00 99.54  ? 185 HIS A N   1 
ATOM   1163 C CA  . HIS A 1 150 ? -31.437 -19.270 66.861  1.00 102.20 ? 185 HIS A CA  1 
ATOM   1164 C C   . HIS A 1 150 ? -31.415 -20.758 66.609  1.00 98.85  ? 185 HIS A C   1 
ATOM   1165 O O   . HIS A 1 150 ? -31.760 -21.157 65.502  1.00 95.29  ? 185 HIS A O   1 
ATOM   1166 C CB  . HIS A 1 150 ? -32.275 -18.997 68.111  1.00 77.73  ? 185 HIS A CB  1 
ATOM   1167 C CG  . HIS A 1 150 ? -32.401 -17.548 68.462  1.00 94.24  ? 185 HIS A CG  1 
ATOM   1168 N ND1 . HIS A 1 150 ? -33.255 -17.097 69.447  1.00 109.71 ? 185 HIS A ND1 1 
ATOM   1169 C CD2 . HIS A 1 150 ? -31.770 -16.450 67.982  1.00 109.47 ? 185 HIS A CD2 1 
ATOM   1170 C CE1 . HIS A 1 150 ? -33.145 -15.787 69.557  1.00 115.93 ? 185 HIS A CE1 1 
ATOM   1171 N NE2 . HIS A 1 150 ? -32.250 -15.368 68.679  1.00 115.14 ? 185 HIS A NE2 1 
ATOM   1172 N N   . MET A 1 151 ? -31.046 -21.582 67.581  1.00 64.56  ? 186 MET A N   1 
ATOM   1173 C CA  . MET A 1 151 ? -31.082 -23.026 67.364  1.00 64.56  ? 186 MET A CA  1 
ATOM   1174 C C   . MET A 1 151 ? -29.902 -23.786 67.891  1.00 64.56  ? 186 MET A C   1 
ATOM   1175 O O   . MET A 1 151 ? -28.770 -23.304 67.835  1.00 64.56  ? 186 MET A O   1 
ATOM   1176 C CB  . MET A 1 151 ? -31.245 -23.410 65.890  1.00 113.99 ? 186 MET A CB  1 
ATOM   1177 C CG  . MET A 1 151 ? -31.930 -24.753 65.695  1.00 114.01 ? 186 MET A CG  1 
ATOM   1178 S SD  . MET A 1 151 ? -31.727 -25.475 64.058  1.00 112.10 ? 186 MET A SD  1 
ATOM   1179 C CE  . MET A 1 151 ? -31.958 -27.216 64.436  1.00 111.63 ? 186 MET A CE  1 
ATOM   1180 N N   . PRO A 1 152 ? -30.151 -24.990 68.433  1.00 71.39  ? 187 PRO A N   1 
ATOM   1181 C CA  . PRO A 1 152 ? -29.012 -25.755 68.926  1.00 74.24  ? 187 PRO A CA  1 
ATOM   1182 C C   . PRO A 1 152 ? -28.096 -25.679 67.723  1.00 72.58  ? 187 PRO A C   1 
ATOM   1183 O O   . PRO A 1 152 ? -28.552 -25.715 66.578  1.00 74.10  ? 187 PRO A O   1 
ATOM   1184 C CB  . PRO A 1 152 ? -29.604 -27.140 69.137  1.00 162.39 ? 187 PRO A CB  1 
ATOM   1185 C CG  . PRO A 1 152 ? -30.976 -26.816 69.633  1.00 164.02 ? 187 PRO A CG  1 
ATOM   1186 C CD  . PRO A 1 152 ? -31.416 -25.699 68.699  1.00 159.91 ? 187 PRO A CD  1 
ATOM   1187 N N   . ASN A 1 153 ? -26.808 -25.559 67.965  1.00 99.63  ? 188 ASN A N   1 
ATOM   1188 C CA  . ASN A 1 153 ? -25.919 -25.356 66.853  1.00 97.60  ? 188 ASN A CA  1 
ATOM   1189 C C   . ASN A 1 153 ? -24.894 -26.445 66.588  1.00 92.93  ? 188 ASN A C   1 
ATOM   1190 O O   . ASN A 1 153 ? -24.902 -27.085 65.536  1.00 92.06  ? 188 ASN A O   1 
ATOM   1191 C CB  . ASN A 1 153 ? -25.190 -24.019 67.029  1.00 125.93 ? 188 ASN A CB  1 
ATOM   1192 C CG  . ASN A 1 153 ? -24.912 -23.322 65.714  1.00 128.56 ? 188 ASN A CG  1 
ATOM   1193 O OD1 . ASN A 1 153 ? -25.803 -22.723 65.113  1.00 135.78 ? 188 ASN A OD1 1 
ATOM   1194 N ND2 . ASN A 1 153 ? -23.667 -23.412 65.256  1.00 126.33 ? 188 ASN A ND2 1 
ATOM   1195 N N   . ALA A 1 154 ? -24.012 -26.646 67.555  1.00 95.43  ? 189 ALA A N   1 
ATOM   1196 C CA  . ALA A 1 154 ? -22.954 -27.627 67.435  1.00 92.87  ? 189 ALA A CA  1 
ATOM   1197 C C   . ALA A 1 154 ? -23.433 -29.068 67.411  1.00 86.90  ? 189 ALA A C   1 
ATOM   1198 O O   . ALA A 1 154 ? -22.679 -29.956 67.023  1.00 85.99  ? 189 ALA A O   1 
ATOM   1199 C CB  . ALA A 1 154 ? -21.951 -27.437 68.566  1.00 133.55 ? 189 ALA A CB  1 
ATOM   1200 N N   . SER A 1 155 ? -24.678 -29.319 67.797  1.00 64.31  ? 190 SER A N   1 
ATOM   1201 C CA  . SER A 1 155 ? -25.130 -30.698 67.813  1.00 61.54  ? 190 SER A CA  1 
ATOM   1202 C C   . SER A 1 155 ? -25.332 -31.213 66.398  1.00 55.69  ? 190 SER A C   1 
ATOM   1203 O O   . SER A 1 155 ? -25.479 -32.417 66.202  1.00 54.30  ? 190 SER A O   1 
ATOM   1204 C CB  . SER A 1 155 ? -26.444 -30.813 68.591  1.00 121.21 ? 190 SER A CB  1 
ATOM   1205 O OG  . SER A 1 155 ? -26.942 -32.139 68.561  1.00 124.50 ? 190 SER A OG  1 
ATOM   1206 N N   . CYS A 1 156 ? -25.357 -30.282 65.431  1.00 97.71  ? 191 CYS A N   1 
ATOM   1207 C CA  . CYS A 1 156 ? -25.502 -30.564 63.988  1.00 94.15  ? 191 CYS A CA  1 
ATOM   1208 C C   . CYS A 1 156 ? -24.197 -30.460 63.242  1.00 92.26  ? 191 CYS A C   1 
ATOM   1209 O O   . CYS A 1 156 ? -23.538 -29.418 63.254  1.00 91.40  ? 191 CYS A O   1 
ATOM   1210 C CB  . CYS A 1 156 ? -26.572 -29.677 63.318  1.00 66.75  ? 191 CYS A CB  1 
ATOM   1211 S SG  . CYS A 1 156 ? -28.296 -29.937 63.883  1.00 64.28  ? 191 CYS A SG  1 
ATOM   1212 N N   . GLY A 1 157 ? -23.865 -31.539 62.546  1.00 66.76  ? 192 GLY A N   1 
ATOM   1213 C CA  . GLY A 1 157 ? -22.636 -31.605 61.793  1.00 66.13  ? 192 GLY A CA  1 
ATOM   1214 C C   . GLY A 1 157 ? -22.658 -32.471 60.534  1.00 66.03  ? 192 GLY A C   1 
ATOM   1215 O O   . GLY A 1 157 ? -23.289 -33.542 60.473  1.00 65.29  ? 192 GLY A O   1 
ATOM   1216 N N   . VAL A 1 158 ? -21.913 -31.974 59.539  1.00 76.96  ? 193 VAL A N   1 
ATOM   1217 C CA  . VAL A 1 158 ? -21.488 -32.711 58.339  1.00 76.41  ? 193 VAL A CA  1 
ATOM   1218 C C   . VAL A 1 158 ? -20.683 -33.955 58.751  1.00 80.20  ? 193 VAL A C   1 
ATOM   1219 O O   . VAL A 1 158 ? -20.487 -34.196 59.943  1.00 81.63  ? 193 VAL A O   1 
ATOM   1220 C CB  . VAL A 1 158 ? -20.593 -31.805 57.438  1.00 37.11  ? 193 VAL A CB  1 
ATOM   1221 C CG1 . VAL A 1 158 ? -21.110 -31.804 56.004  1.00 28.91  ? 193 VAL A CG1 1 
ATOM   1222 C CG2 . VAL A 1 158 ? -20.564 -30.385 57.996  1.00 34.57  ? 193 VAL A CG2 1 
ATOM   1223 N N   . PRO A 1 159 ? -20.222 -34.763 57.804  1.00 74.12  ? 194 PRO A N   1 
ATOM   1224 C CA  . PRO A 1 159 ? -19.463 -35.958 58.147  1.00 76.31  ? 194 PRO A CA  1 
ATOM   1225 C C   . PRO A 1 159 ? -17.931 -35.790 58.142  1.00 78.33  ? 194 PRO A C   1 
ATOM   1226 O O   . PRO A 1 159 ? -17.358 -34.915 57.482  1.00 79.93  ? 194 PRO A O   1 
ATOM   1227 C CB  . PRO A 1 159 ? -19.917 -36.952 57.090  1.00 20.01  ? 194 PRO A CB  1 
ATOM   1228 C CG  . PRO A 1 159 ? -19.982 -36.084 55.885  1.00 17.68  ? 194 PRO A CG  1 
ATOM   1229 C CD  . PRO A 1 159 ? -20.701 -34.851 56.409  1.00 17.64  ? 194 PRO A CD  1 
ATOM   1230 N N   . THR A 1 160 ? -17.304 -36.683 58.903  1.00 74.53  ? 195 THR A N   1 
ATOM   1231 C CA  . THR A 1 160 ? -15.883 -36.716 59.139  1.00 76.10  ? 195 THR A CA  1 
ATOM   1232 C C   . THR A 1 160 ? -15.229 -37.599 58.103  1.00 69.40  ? 195 THR A C   1 
ATOM   1233 O O   . THR A 1 160 ? -15.825 -38.594 57.701  1.00 68.04  ? 195 THR A O   1 
ATOM   1234 C CB  . THR A 1 160 ? -15.578 -37.281 60.540  1.00 111.51 ? 195 THR A CB  1 
ATOM   1235 O OG1 . THR A 1 160 ? -16.244 -36.485 61.529  1.00 116.30 ? 195 THR A OG1 1 
ATOM   1236 C CG2 . THR A 1 160 ? -14.081 -37.274 60.809  1.00 124.29 ? 195 THR A CG2 1 
ATOM   1237 N N   . LEU A 1 161 ? -13.990 -37.270 57.713  1.00 76.61  ? 196 LEU A N   1 
ATOM   1238 C CA  . LEU A 1 161 ? -13.324 -37.979 56.612  1.00 70.29  ? 196 LEU A CA  1 
ATOM   1239 C C   . LEU A 1 161 ? -11.806 -38.304 56.587  1.00 72.49  ? 196 LEU A C   1 
ATOM   1240 O O   . LEU A 1 161 ? -10.952 -37.421 56.423  1.00 72.67  ? 196 LEU A O   1 
ATOM   1241 C CB  . LEU A 1 161 ? -13.680 -37.298 55.304  1.00 27.49  ? 196 LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 161 ? -14.941 -37.868 54.683  1.00 27.49  ? 196 LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 161 ? -15.220 -37.178 53.356  1.00 27.49  ? 196 LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 161 ? -14.749 -39.360 54.491  1.00 27.49  ? 196 LEU A CD2 1 
ATOM   1245 N N   . LYS A 1 162 ? -11.506 -39.602 56.668  1.00 38.00  ? 197 LYS A N   1 
ATOM   1246 C CA  . LYS A 1 162 ? -10.146 -40.109 56.701  1.00 38.00  ? 197 LYS A CA  1 
ATOM   1247 C C   . LYS A 1 162 ? -10.025 -41.126 55.606  1.00 38.00  ? 197 LYS A C   1 
ATOM   1248 O O   . LYS A 1 162 ? -10.938 -41.901 55.383  1.00 38.00  ? 197 LYS A O   1 
ATOM   1249 C CB  . LYS A 1 162 ? -9.841  -40.754 58.053  1.00 76.51  ? 197 LYS A CB  1 
ATOM   1250 C CG  . LYS A 1 162 ? -9.836  -39.770 59.210  1.00 88.11  ? 197 LYS A CG  1 
ATOM   1251 C CD  . LYS A 1 162 ? -9.390  -40.421 60.507  1.00 100.55 ? 197 LYS A CD  1 
ATOM   1252 C CE  . LYS A 1 162 ? -10.411 -41.422 61.017  1.00 105.90 ? 197 LYS A CE  1 
ATOM   1253 N NZ  . LYS A 1 162 ? -9.982  -42.000 62.318  1.00 108.37 ? 197 LYS A NZ  1 
ATOM   1254 N N   . VAL A 1 163 ? -8.876  -41.134 54.941  1.00 55.36  ? 198 VAL A N   1 
ATOM   1255 C CA  . VAL A 1 163 ? -8.556  -42.129 53.914  1.00 54.49  ? 198 VAL A CA  1 
ATOM   1256 C C   . VAL A 1 163 ? -7.186  -42.703 54.223  1.00 61.15  ? 198 VAL A C   1 
ATOM   1257 O O   . VAL A 1 163 ? -6.212  -41.967 54.275  1.00 62.26  ? 198 VAL A O   1 
ATOM   1258 C CB  . VAL A 1 163 ? -8.479  -41.504 52.517  1.00 54.87  ? 198 VAL A CB  1 
ATOM   1259 C CG1 . VAL A 1 163 ? -8.228  -42.586 51.487  1.00 52.78  ? 198 VAL A CG1 1 
ATOM   1260 C CG2 . VAL A 1 163 ? -9.751  -40.760 52.207  1.00 52.78  ? 198 VAL A CG2 1 
ATOM   1261 N N   . GLN A 1 164 ? -7.102  -44.007 54.445  1.00 32.32  ? 199 GLN A N   1 
ATOM   1262 C CA  . GLN A 1 164 ? -5.847  -44.597 54.839  1.00 32.32  ? 199 GLN A CA  1 
ATOM   1263 C C   . GLN A 1 164 ? -5.207  -45.064 53.581  1.00 32.32  ? 199 GLN A C   1 
ATOM   1264 O O   . GLN A 1 164 ? -5.728  -45.943 52.936  1.00 32.32  ? 199 GLN A O   1 
ATOM   1265 C CB  . GLN A 1 164 ? -6.066  -45.774 55.791  1.00 141.92 ? 199 GLN A CB  1 
ATOM   1266 C CG  . GLN A 1 164 ? -6.684  -45.382 57.122  1.00 155.30 ? 199 GLN A CG  1 
ATOM   1267 C CD  . GLN A 1 164 ? -5.883  -44.312 57.839  1.00 168.04 ? 199 GLN A CD  1 
ATOM   1268 O OE1 . GLN A 1 164 ? -4.709  -44.504 58.152  1.00 174.68 ? 199 GLN A OE1 1 
ATOM   1269 N NE2 . GLN A 1 164 ? -6.517  -43.175 58.100  1.00 174.46 ? 199 GLN A NE2 1 
ATOM   1270 N N   . VAL A 1 165 ? -4.100  -44.427 53.221  1.00 53.38  ? 200 VAL A N   1 
ATOM   1271 C CA  . VAL A 1 165 ? -3.223  -44.908 52.155  1.00 57.82  ? 200 VAL A CA  1 
ATOM   1272 C C   . VAL A 1 165 ? -2.458  -46.114 52.711  1.00 57.89  ? 200 VAL A C   1 
ATOM   1273 O O   . VAL A 1 165 ? -2.444  -46.318 53.922  1.00 57.67  ? 200 VAL A O   1 
ATOM   1274 C CB  . VAL A 1 165 ? -2.203  -43.822 51.729  1.00 130.78 ? 200 VAL A CB  1 
ATOM   1275 C CG1 . VAL A 1 165 ? -2.937  -42.587 51.224  1.00 132.00 ? 200 VAL A CG1 1 
ATOM   1276 C CG2 . VAL A 1 165 ? -1.302  -43.462 52.902  1.00 131.98 ? 200 VAL A CG2 1 
ATOM   1277 N N   . PRO A 1 166 ? -1.827  -46.924 51.867  1.00 75.58  ? 201 PRO A N   1 
ATOM   1278 C CA  . PRO A 1 166 ? -1.014  -48.010 52.397  1.00 75.58  ? 201 PRO A CA  1 
ATOM   1279 C C   . PRO A 1 166 ? 0.077   -47.388 53.253  1.00 75.58  ? 201 PRO A C   1 
ATOM   1280 O O   . PRO A 1 166 ? 0.395   -46.204 53.055  1.00 75.58  ? 201 PRO A O   1 
ATOM   1281 C CB  . PRO A 1 166 ? -0.474  -48.675 51.135  1.00 102.59 ? 201 PRO A CB  1 
ATOM   1282 C CG  . PRO A 1 166 ? -0.351  -47.529 50.185  1.00 107.06 ? 201 PRO A CG  1 
ATOM   1283 C CD  . PRO A 1 166 ? -1.641  -46.783 50.414  1.00 104.89 ? 201 PRO A CD  1 
ATOM   1284 N N   . ASN A 1 167 ? 0.615   -48.159 54.200  1.00 80.75  ? 202 ASN A N   1 
ATOM   1285 C CA  . ASN A 1 167 ? 1.710   -47.710 55.085  1.00 79.72  ? 202 ASN A CA  1 
ATOM   1286 C C   . ASN A 1 167 ? 3.017   -47.578 54.314  1.00 71.91  ? 202 ASN A C   1 
ATOM   1287 O O   . ASN A 1 167 ? 3.788   -46.657 54.535  1.00 70.85  ? 202 ASN A O   1 
ATOM   1288 C CB  . ASN A 1 167 ? 1.868   -48.675 56.260  1.00 158.39 ? 202 ASN A CB  1 
ATOM   1289 C CG  . ASN A 1 167 ? 0.608   -48.770 57.105  1.00 168.76 ? 202 ASN A CG  1 
ATOM   1290 O OD1 . ASN A 1 167 ? 0.111   -47.767 57.622  1.00 182.31 ? 202 ASN A OD1 1 
ATOM   1291 N ND2 . ASN A 1 167 ? 0.085   -49.979 57.248  1.00 180.51 ? 202 ASN A ND2 1 
ATOM   1292 N N   . ALA A 1 168 ? 3.244   -48.526 53.409  1.00 26.50  ? 203 ALA A N   1 
ATOM   1293 C CA  . ALA A 1 168 ? 4.482   -48.653 52.677  1.00 22.21  ? 203 ALA A CA  1 
ATOM   1294 C C   . ALA A 1 168 ? 4.514   -47.839 51.395  1.00 13.40  ? 203 ALA A C   1 
ATOM   1295 O O   . ALA A 1 168 ? 3.521   -47.745 50.685  1.00 11.36  ? 203 ALA A O   1 
ATOM   1296 C CB  . ALA A 1 168 ? 4.753   -50.123 52.364  1.00 116.49 ? 203 ALA A CB  1 
ATOM   1297 N N   . SER A 1 169 ? 5.690   -47.286 51.094  1.00 23.76  ? 204 SER A N   1 
ATOM   1298 C CA  . SER A 1 169 ? 5.944   -46.565 49.848  1.00 23.76  ? 204 SER A CA  1 
ATOM   1299 C C   . SER A 1 169 ? 5.519   -47.443 48.744  1.00 23.76  ? 204 SER A C   1 
ATOM   1300 O O   . SER A 1 169 ? 5.371   -48.638 48.947  1.00 23.76  ? 204 SER A O   1 
ATOM   1301 C CB  . SER A 1 169 ? 7.429   -46.219 49.701  1.00 53.07  ? 204 SER A CB  1 
ATOM   1302 O OG  . SER A 1 169 ? 8.206   -47.366 49.410  1.00 54.76  ? 204 SER A OG  1 
ATOM   1303 N N   . VAL A 1 170 ? 5.357   -46.851 47.564  1.00 62.48  ? 205 VAL A N   1 
ATOM   1304 C CA  . VAL A 1 170 ? 4.867   -47.578 46.378  1.00 62.48  ? 205 VAL A CA  1 
ATOM   1305 C C   . VAL A 1 170 ? 5.841   -47.534 45.229  1.00 62.48  ? 205 VAL A C   1 
ATOM   1306 O O   . VAL A 1 170 ? 6.504   -46.507 45.008  1.00 62.48  ? 205 VAL A O   1 
ATOM   1307 C CB  . VAL A 1 170 ? 3.525   -47.022 45.873  1.00 35.75  ? 205 VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 170 ? 3.091   -47.785 44.650  1.00 35.75  ? 205 VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 170 ? 2.469   -47.142 46.946  1.00 35.75  ? 205 VAL A CG2 1 
ATOM   1310 N N   . ASP A 1 171 ? 5.916   -48.646 44.503  1.00 23.13  ? 206 ASP A N   1 
ATOM   1311 C CA  . ASP A 1 171 ? 6.759   -48.712 43.319  1.00 23.13  ? 206 ASP A CA  1 
ATOM   1312 C C   . ASP A 1 171 ? 5.901   -49.119 42.163  1.00 23.13  ? 206 ASP A C   1 
ATOM   1313 O O   . ASP A 1 171 ? 4.858   -49.741 42.332  1.00 23.13  ? 206 ASP A O   1 
ATOM   1314 C CB  . ASP A 1 171 ? 7.889   -49.722 43.519  1.00 68.10  ? 206 ASP A CB  1 
ATOM   1315 C CG  . ASP A 1 171 ? 8.746   -49.400 44.729  1.00 75.14  ? 206 ASP A CG  1 
ATOM   1316 O OD1 . ASP A 1 171 ? 9.340   -48.301 44.768  1.00 83.18  ? 206 ASP A OD1 1 
ATOM   1317 O OD2 . ASP A 1 171 ? 8.825   -50.248 45.645  1.00 83.81  ? 206 ASP A OD2 1 
ATOM   1318 N N   . VAL A 1 172 ? 6.311   -48.705 40.989  1.00 29.80  ? 207 VAL A N   1 
ATOM   1319 C CA  . VAL A 1 172 ? 5.484   -48.882 39.825  1.00 29.80  ? 207 VAL A CA  1 
ATOM   1320 C C   . VAL A 1 172 ? 5.082   -50.352 39.701  1.00 29.80  ? 207 VAL A C   1 
ATOM   1321 O O   . VAL A 1 172 ? 5.728   -51.241 40.261  1.00 29.80  ? 207 VAL A O   1 
ATOM   1322 C CB  . VAL A 1 172 ? 6.223   -48.434 38.543  1.00 42.78  ? 207 VAL A CB  1 
ATOM   1323 C CG1 . VAL A 1 172 ? 7.443   -49.311 38.310  1.00 45.91  ? 207 VAL A CG1 1 
ATOM   1324 C CG2 . VAL A 1 172 ? 5.286   -48.482 37.355  1.00 44.47  ? 207 VAL A CG2 1 
ATOM   1325 N N   . GLY A 1 173 ? 4.005   -50.604 38.964  1.00 27.76  ? 208 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 173 ? 3.498   -51.949 38.779  1.00 27.76  ? 208 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 173 ? 3.191   -52.689 40.062  1.00 27.76  ? 208 GLY A C   1 
ATOM   1328 O O   . GLY A 1 173 ? 3.399   -53.875 40.105  1.00 27.76  ? 208 GLY A O   1 
ATOM   1329 N N   . ASP A 1 174 ? 2.684   -51.976 41.075  1.00 47.36  ? 209 ASP A N   1 
ATOM   1330 C CA  . ASP A 1 174 ? 2.145   -52.541 42.303  1.00 47.36  ? 209 ASP A CA  1 
ATOM   1331 C C   . ASP A 1 174 ? 0.624   -52.370 42.334  1.00 47.36  ? 209 ASP A C   1 
ATOM   1332 O O   . ASP A 1 174 ? 0.036   -51.701 41.488  1.00 47.36  ? 209 ASP A O   1 
ATOM   1333 C CB  . ASP A 1 174 ? 2.723   -51.841 43.543  1.00 32.49  ? 209 ASP A CB  1 
ATOM   1334 C CG  . ASP A 1 174 ? 4.053   -52.416 43.990  1.00 31.07  ? 209 ASP A CG  1 
ATOM   1335 O OD1 . ASP A 1 174 ? 4.643   -51.869 44.937  1.00 31.07  ? 209 ASP A OD1 1 
ATOM   1336 O OD2 . ASP A 1 174 ? 4.516   -53.411 43.408  1.00 31.07  ? 209 ASP A OD2 1 
ATOM   1337 N N   . ASP A 1 175 ? -0.020  -52.941 43.336  1.00 28.47  ? 210 ASP A N   1 
ATOM   1338 C CA  . ASP A 1 175 ? -1.395  -52.577 43.611  1.00 34.80  ? 210 ASP A CA  1 
ATOM   1339 C C   . ASP A 1 175 ? -1.379  -51.572 44.763  1.00 33.34  ? 210 ASP A C   1 
ATOM   1340 O O   . ASP A 1 175 ? -0.450  -51.534 45.529  1.00 31.17  ? 210 ASP A O   1 
ATOM   1341 C CB  . ASP A 1 175 ? -2.194  -53.818 44.000  1.00 96.54  ? 210 ASP A CB  1 
ATOM   1342 C CG  . ASP A 1 175 ? -2.117  -54.908 42.949  1.00 106.77 ? 210 ASP A CG  1 
ATOM   1343 O OD1 . ASP A 1 175 ? -2.452  -54.626 41.780  1.00 119.66 ? 210 ASP A OD1 1 
ATOM   1344 O OD2 . ASP A 1 175 ? -1.721  -56.044 43.291  1.00 121.37 ? 210 ASP A OD2 1 
ATOM   1345 N N   . VAL A 1 176 ? -2.390  -50.719 44.829  1.00 14.39  ? 211 VAL A N   1 
ATOM   1346 C CA  . VAL A 1 176 ? -2.580  -49.792 45.931  1.00 14.39  ? 211 VAL A CA  1 
ATOM   1347 C C   . VAL A 1 176 ? -4.039  -49.756 46.321  1.00 14.39  ? 211 VAL A C   1 
ATOM   1348 O O   . VAL A 1 176 ? -4.870  -49.234 45.615  1.00 14.39  ? 211 VAL A O   1 
ATOM   1349 C CB  . VAL A 1 176 ? -2.163  -48.363 45.560  1.00 27.24  ? 211 VAL A CB  1 
ATOM   1350 C CG1 . VAL A 1 176 ? -2.361  -47.449 46.754  1.00 26.76  ? 211 VAL A CG1 1 
ATOM   1351 C CG2 . VAL A 1 176 ? -0.717  -48.341 45.112  1.00 26.50  ? 211 VAL A CG2 1 
ATOM   1352 N N   . LEU A 1 177 ? -4.331  -50.306 47.479  1.00 51.75  ? 212 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 177 ? -5.692  -50.401 47.958  1.00 61.14  ? 212 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 177 ? -5.861  -49.432 49.099  1.00 55.16  ? 212 LEU A C   1 
ATOM   1355 O O   . LEU A 1 177 ? -4.943  -49.201 49.886  1.00 53.37  ? 212 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 177 ? -5.996  -51.834 48.419  1.00 130.38 ? 212 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 177 ? -5.103  -52.484 49.484  1.00 161.06 ? 212 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 177 ? -5.690  -53.832 49.879  1.00 179.73 ? 212 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 177 ? -3.686  -52.660 48.957  1.00 179.66 ? 212 LEU A CD2 1 
ATOM   1360 N N   . LEU A 1 178 ? -7.047  -48.849 49.163  1.00 83.10  ? 213 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 178 ? -7.343  -47.865 50.186  1.00 79.89  ? 213 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 178 ? -8.818  -47.736 50.468  1.00 80.47  ? 213 LEU A C   1 
ATOM   1363 O O   . LEU A 1 178 ? -9.656  -48.083 49.633  1.00 80.68  ? 213 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 178 ? -6.765  -46.492 49.828  1.00 45.12  ? 213 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 178 ? -7.307  -45.764 48.601  1.00 42.99  ? 213 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 178 ? -6.773  -44.337 48.592  1.00 42.99  ? 213 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 178 ? -6.897  -46.513 47.335  1.00 42.99  ? 213 LEU A CD2 1 
ATOM   1368 N N   . ARG A 1 179 ? -9.109  -47.270 51.684  1.00 80.07  ? 214 ARG A N   1 
ATOM   1369 C CA  . ARG A 1 179 ? -10.467 -47.208 52.173  1.00 80.07  ? 214 ARG A CA  1 
ATOM   1370 C C   . ARG A 1 179 ? -10.802 -45.767 52.547  1.00 80.07  ? 214 ARG A C   1 
ATOM   1371 O O   . ARG A 1 179 ? -9.891  -44.993 52.894  1.00 80.07  ? 214 ARG A O   1 
ATOM   1372 C CB  . ARG A 1 179 ? -10.682 -48.169 53.344  1.00 88.82  ? 214 ARG A CB  1 
ATOM   1373 C CG  . ARG A 1 179 ? -10.953 -49.598 52.866  1.00 93.59  ? 214 ARG A CG  1 
ATOM   1374 C CD  . ARG A 1 179 ? -11.600 -50.470 53.936  1.00 98.78  ? 214 ARG A CD  1 
ATOM   1375 N NE  . ARG A 1 179 ? -11.954 -51.797 53.424  1.00 101.64 ? 214 ARG A NE  1 
ATOM   1376 C CZ  . ARG A 1 179 ? -12.942 -52.040 52.566  1.00 103.32 ? 214 ARG A CZ  1 
ATOM   1377 N NH1 . ARG A 1 179 ? -13.693 -51.045 52.117  1.00 104.14 ? 214 ARG A NH1 1 
ATOM   1378 N NH2 . ARG A 1 179 ? -13.176 -53.281 52.152  1.00 103.74 ? 214 ARG A NH2 1 
ATOM   1379 N N   . CYS A 1 180 ? -12.094 -45.414 52.396  1.00 63.21  ? 215 CYS A N   1 
ATOM   1380 C CA  . CYS A 1 180 ? -12.643 -44.117 52.776  1.00 64.03  ? 215 CYS A CA  1 
ATOM   1381 C C   . CYS A 1 180 ? -13.694 -44.395 53.838  1.00 68.58  ? 215 CYS A C   1 
ATOM   1382 O O   . CYS A 1 180 ? -14.701 -45.013 53.544  1.00 67.58  ? 215 CYS A O   1 
ATOM   1383 C CB  . CYS A 1 180 ? -13.295 -43.443 51.577  1.00 42.20  ? 215 CYS A CB  1 
ATOM   1384 S SG  . CYS A 1 180 ? -14.272 -41.931 51.920  1.00 41.18  ? 215 CYS A SG  1 
ATOM   1385 N N   . GLN A 1 181 ? -13.413 -43.971 55.076  1.00 63.00  ? 216 GLN A N   1 
ATOM   1386 C CA  . GLN A 1 181 ? -14.285 -44.181 56.238  1.00 68.48  ? 216 GLN A CA  1 
ATOM   1387 C C   . GLN A 1 181 ? -14.972 -42.861 56.572  1.00 67.30  ? 216 GLN A C   1 
ATOM   1388 O O   . GLN A 1 181 ? -14.327 -41.868 56.926  1.00 66.69  ? 216 GLN A O   1 
ATOM   1389 C CB  . GLN A 1 181 ? -13.459 -44.616 57.451  1.00 128.58 ? 216 GLN A CB  1 
ATOM   1390 C CG  . GLN A 1 181 ? -12.717 -45.920 57.275  1.00 139.11 ? 216 GLN A CG  1 
ATOM   1391 C CD  . GLN A 1 181 ? -11.805 -46.222 58.449  1.00 149.02 ? 216 GLN A CD  1 
ATOM   1392 O OE1 . GLN A 1 181 ? -10.827 -45.514 58.688  1.00 153.78 ? 216 GLN A OE1 1 
ATOM   1393 N NE2 . GLN A 1 181 ? -12.127 -47.272 59.196  1.00 154.03 ? 216 GLN A NE2 1 
ATOM   1394 N N   . VAL A 1 182 ? -16.290 -42.863 56.439  1.00 56.34  ? 217 VAL A N   1 
ATOM   1395 C CA  . VAL A 1 182 ? -17.098 -41.692 56.729  1.00 57.31  ? 217 VAL A CA  1 
ATOM   1396 C C   . VAL A 1 182 ? -17.848 -41.904 58.027  1.00 58.68  ? 217 VAL A C   1 
ATOM   1397 O O   . VAL A 1 182 ? -18.610 -42.860 58.158  1.00 57.38  ? 217 VAL A O   1 
ATOM   1398 C CB  . VAL A 1 182 ? -18.121 -41.420 55.611  1.00 78.98  ? 217 VAL A CB  1 
ATOM   1399 C CG1 . VAL A 1 182 ? -18.847 -40.114 55.882  1.00 79.49  ? 217 VAL A CG1 1 
ATOM   1400 C CG2 . VAL A 1 182 ? -17.421 -41.380 54.263  1.00 79.93  ? 217 VAL A CG2 1 
ATOM   1401 N N   . GLU A 1 183 ? -17.646 -41.007 58.982  1.00 67.65  ? 218 GLU A N   1 
ATOM   1402 C CA  . GLU A 1 183 ? -18.320 -41.127 60.263  1.00 72.16  ? 218 GLU A CA  1 
ATOM   1403 C C   . GLU A 1 183 ? -19.136 -39.879 60.518  1.00 69.87  ? 218 GLU A C   1 
ATOM   1404 O O   . GLU A 1 183 ? -18.646 -38.755 60.441  1.00 68.09  ? 218 GLU A O   1 
ATOM   1405 C CB  . GLU A 1 183 ? -17.298 -41.329 61.376  1.00 122.01 ? 218 GLU A CB  1 
ATOM   1406 C CG  . GLU A 1 183 ? -16.513 -42.607 61.213  1.00 134.65 ? 218 GLU A CG  1 
ATOM   1407 C CD  . GLU A 1 183 ? -15.553 -42.831 62.350  1.00 146.68 ? 218 GLU A CD  1 
ATOM   1408 O OE1 . GLU A 1 183 ? -16.020 -42.928 63.506  1.00 152.52 ? 218 GLU A OE1 1 
ATOM   1409 O OE2 . GLU A 1 183 ? -14.335 -42.904 62.088  1.00 153.26 ? 218 GLU A OE2 1 
ATOM   1410 N N   . GLY A 1 184 ? -20.413 -40.127 60.774  1.00 78.33  ? 219 GLY A N   1 
ATOM   1411 C CA  . GLY A 1 184 ? -21.383 -39.105 61.107  1.00 78.79  ? 219 GLY A CA  1 
ATOM   1412 C C   . GLY A 1 184 ? -22.690 -39.758 61.513  1.00 79.93  ? 219 GLY A C   1 
ATOM   1413 O O   . GLY A 1 184 ? -22.779 -40.993 61.594  1.00 79.49  ? 219 GLY A O   1 
ATOM   1414 N N   . ARG A 1 185 ? -23.705 -38.936 61.770  1.00 90.34  ? 220 ARG A N   1 
ATOM   1415 C CA  . ARG A 1 185 ? -25.011 -39.462 62.155  1.00 91.50  ? 220 ARG A CA  1 
ATOM   1416 C C   . ARG A 1 185 ? -26.145 -39.100 61.201  1.00 91.47  ? 220 ARG A C   1 
ATOM   1417 O O   . ARG A 1 185 ? -27.268 -39.577 61.388  1.00 92.47  ? 220 ARG A O   1 
ATOM   1418 C CB  . ARG A 1 185 ? -25.355 -39.027 63.584  1.00 142.92 ? 220 ARG A CB  1 
ATOM   1419 C CG  . ARG A 1 185 ? -24.460 -39.660 64.641  1.00 143.63 ? 220 ARG A CG  1 
ATOM   1420 C CD  . ARG A 1 185 ? -24.878 -39.288 66.047  1.00 144.54 ? 220 ARG A CD  1 
ATOM   1421 N NE  . ARG A 1 185 ? -23.999 -39.898 67.042  1.00 145.81 ? 220 ARG A NE  1 
ATOM   1422 C CZ  . ARG A 1 185 ? -24.148 -39.772 68.359  1.00 146.87 ? 220 ARG A CZ  1 
ATOM   1423 N NH1 . ARG A 1 185 ? -25.151 -39.053 68.852  1.00 147.26 ? 220 ARG A NH1 1 
ATOM   1424 N NH2 . ARG A 1 185 ? -23.294 -40.366 69.184  1.00 146.62 ? 220 ARG A NH2 1 
ATOM   1425 N N   . GLY A 1 186 ? -25.861 -38.297 60.176  1.00 68.88  ? 221 GLY A N   1 
ATOM   1426 C CA  . GLY A 1 186 ? -26.784 -38.166 59.067  1.00 68.88  ? 221 GLY A CA  1 
ATOM   1427 C C   . GLY A 1 186 ? -26.906 -39.477 58.312  1.00 68.88  ? 221 GLY A C   1 
ATOM   1428 O O   . GLY A 1 186 ? -27.790 -40.254 58.628  1.00 68.88  ? 221 GLY A O   1 
ATOM   1429 N N   . LEU A 1 187 ? -26.023 -39.703 57.330  1.00 72.55  ? 222 LEU A N   1 
ATOM   1430 C CA  . LEU A 1 187 ? -25.865 -40.976 56.580  1.00 80.83  ? 222 LEU A CA  1 
ATOM   1431 C C   . LEU A 1 187 ? -26.786 -41.145 55.372  1.00 79.67  ? 222 LEU A C   1 
ATOM   1432 O O   . LEU A 1 187 ? -27.898 -41.629 55.515  1.00 79.10  ? 222 LEU A O   1 
ATOM   1433 C CB  . LEU A 1 187 ? -26.048 -42.166 57.525  1.00 131.27 ? 222 LEU A CB  1 
ATOM   1434 C CG  . LEU A 1 187 ? -25.055 -42.247 58.686  1.00 151.90 ? 222 LEU A CG  1 
ATOM   1435 C CD1 . LEU A 1 187 ? -25.390 -43.435 59.571  1.00 164.32 ? 222 LEU A CD1 1 
ATOM   1436 C CD2 . LEU A 1 187 ? -23.641 -42.365 58.138  1.00 164.20 ? 222 LEU A CD2 1 
ATOM   1437 N N   . GLU A 1 188 ? -26.312 -40.804 54.180  1.00 63.27  ? 223 GLU A N   1 
ATOM   1438 C CA  . GLU A 1 188 ? -27.103 -40.990 52.955  1.00 66.40  ? 223 GLU A CA  1 
ATOM   1439 C C   . GLU A 1 188 ? -26.313 -41.691 51.821  1.00 63.26  ? 223 GLU A C   1 
ATOM   1440 O O   . GLU A 1 188 ? -26.194 -42.911 51.818  1.00 61.78  ? 223 GLU A O   1 
ATOM   1441 C CB  . GLU A 1 188 ? -27.618 -39.636 52.453  1.00 157.64 ? 223 GLU A CB  1 
ATOM   1442 C CG  . GLU A 1 188 ? -28.675 -38.996 53.341  1.00 170.65 ? 223 GLU A CG  1 
ATOM   1443 C CD  . GLU A 1 188 ? -29.952 -39.812 53.407  1.00 183.19 ? 223 GLU A CD  1 
ATOM   1444 O OE1 . GLU A 1 188 ? -30.583 -40.017 52.348  1.00 189.28 ? 223 GLU A OE1 1 
ATOM   1445 O OE2 . GLU A 1 188 ? -30.325 -40.248 54.516  1.00 189.78 ? 223 GLU A OE2 1 
ATOM   1446 N N   . GLN A 1 189 ? -25.795 -40.923 50.863  1.00 52.83  ? 224 GLN A N   1 
ATOM   1447 C CA  . GLN A 1 189 ? -25.084 -41.467 49.715  1.00 53.22  ? 224 GLN A CA  1 
ATOM   1448 C C   . GLN A 1 189 ? -23.595 -41.351 49.949  1.00 53.41  ? 224 GLN A C   1 
ATOM   1449 O O   . GLN A 1 189 ? -23.147 -40.535 50.749  1.00 52.28  ? 224 GLN A O   1 
ATOM   1450 C CB  . GLN A 1 189 ? -25.455 -40.699 48.442  1.00 125.92 ? 224 GLN A CB  1 
ATOM   1451 C CG  . GLN A 1 189 ? -26.927 -40.759 48.064  1.00 128.26 ? 224 GLN A CG  1 
ATOM   1452 C CD  . GLN A 1 189 ? -27.227 -40.023 46.767  1.00 130.92 ? 224 GLN A CD  1 
ATOM   1453 O OE1 . GLN A 1 189 ? -26.678 -40.348 45.714  1.00 132.68 ? 224 GLN A OE1 1 
ATOM   1454 N NE2 . GLN A 1 189 ? -28.106 -39.030 46.838  1.00 131.96 ? 224 GLN A NE2 1 
ATOM   1455 N N   . ALA A 1 190 ? -22.828 -42.138 49.200  1.00 130.38 ? 225 ALA A N   1 
ATOM   1456 C CA  . ALA A 1 190 ? -21.369 -42.001 49.150  1.00 132.04 ? 225 ALA A CA  1 
ATOM   1457 C C   . ALA A 1 190 ? -20.824 -42.522 47.809  1.00 129.54 ? 225 ALA A C   1 
ATOM   1458 O O   . ALA A 1 190 ? -21.556 -43.175 47.056  1.00 129.81 ? 225 ALA A O   1 
ATOM   1459 C CB  . ALA A 1 190 ? -20.734 -42.761 50.305  1.00 121.67 ? 225 ALA A CB  1 
ATOM   1460 N N   . GLY A 1 191 ? -19.551 -42.225 47.515  1.00 140.77 ? 226 GLY A N   1 
ATOM   1461 C CA  . GLY A 1 191 ? -18.914 -42.616 46.251  1.00 137.20 ? 226 GLY A CA  1 
ATOM   1462 C C   . GLY A 1 191 ? -17.619 -41.873 45.912  1.00 132.37 ? 226 GLY A C   1 
ATOM   1463 O O   . GLY A 1 191 ? -17.549 -40.670 46.089  1.00 133.10 ? 226 GLY A O   1 
ATOM   1464 N N   . TRP A 1 192 ? -16.602 -42.576 45.409  1.00 34.02  ? 227 TRP A N   1 
ATOM   1465 C CA  . TRP A 1 192 ? -15.320 -41.949 45.069  1.00 34.02  ? 227 TRP A CA  1 
ATOM   1466 C C   . TRP A 1 192 ? -15.427 -41.127 43.809  1.00 34.02  ? 227 TRP A C   1 
ATOM   1467 O O   . TRP A 1 192 ? -16.247 -41.425 42.961  1.00 34.02  ? 227 TRP A O   1 
ATOM   1468 C CB  . TRP A 1 192 ? -14.224 -43.008 44.875  1.00 41.96  ? 227 TRP A CB  1 
ATOM   1469 C CG  . TRP A 1 192 ? -13.994 -43.943 46.039  1.00 41.96  ? 227 TRP A CG  1 
ATOM   1470 C CD1 . TRP A 1 192 ? -14.690 -45.086 46.327  1.00 41.96  ? 227 TRP A CD1 1 
ATOM   1471 C CD2 . TRP A 1 192 ? -12.976 -43.833 47.040  1.00 41.96  ? 227 TRP A CD2 1 
ATOM   1472 N NE1 . TRP A 1 192 ? -14.164 -45.696 47.442  1.00 41.96  ? 227 TRP A NE1 1 
ATOM   1473 C CE2 . TRP A 1 192 ? -13.113 -44.949 47.901  1.00 41.96  ? 227 TRP A CE2 1 
ATOM   1474 C CE3 . TRP A 1 192 ? -11.961 -42.901 47.294  1.00 41.96  ? 227 TRP A CE3 1 
ATOM   1475 C CZ2 . TRP A 1 192 ? -12.270 -45.161 48.999  1.00 41.96  ? 227 TRP A CZ2 1 
ATOM   1476 C CZ3 . TRP A 1 192 ? -11.117 -43.113 48.394  1.00 41.96  ? 227 TRP A CZ3 1 
ATOM   1477 C CH2 . TRP A 1 192 ? -11.282 -44.240 49.231  1.00 41.96  ? 227 TRP A CH2 1 
ATOM   1478 N N   . ILE A 1 193 ? -14.566 -40.122 43.669  1.00 59.58  ? 228 ILE A N   1 
ATOM   1479 C CA  . ILE A 1 193 ? -14.392 -39.419 42.398  1.00 66.54  ? 228 ILE A CA  1 
ATOM   1480 C C   . ILE A 1 193 ? -12.977 -39.601 41.865  1.00 70.34  ? 228 ILE A C   1 
ATOM   1481 O O   . ILE A 1 193 ? -12.008 -39.147 42.472  1.00 69.25  ? 228 ILE A O   1 
ATOM   1482 C CB  . ILE A 1 193 ? -14.668 -37.909 42.541  1.00 146.40 ? 228 ILE A CB  1 
ATOM   1483 C CG1 . ILE A 1 193 ? -16.113 -37.681 42.984  1.00 153.74 ? 228 ILE A CG1 1 
ATOM   1484 C CG2 . ILE A 1 193 ? -14.416 -37.209 41.213  1.00 146.66 ? 228 ILE A CG2 1 
ATOM   1485 C CD1 . ILE A 1 193 ? -16.474 -36.218 43.159  1.00 166.24 ? 228 ILE A CD1 1 
ATOM   1486 N N   . LEU A 1 194 ? -12.884 -40.233 40.700  1.00 64.12  ? 229 LEU A N   1 
ATOM   1487 C CA  . LEU A 1 194 ? -11.631 -40.428 39.996  1.00 71.36  ? 229 LEU A CA  1 
ATOM   1488 C C   . LEU A 1 194 ? -11.577 -39.393 38.867  1.00 71.19  ? 229 LEU A C   1 
ATOM   1489 O O   . LEU A 1 194 ? -12.400 -39.421 37.957  1.00 70.17  ? 229 LEU A O   1 
ATOM   1490 C CB  . LEU A 1 194 ? -11.580 -41.839 39.397  1.00 151.51 ? 229 LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 194 ? -11.737 -43.063 40.310  1.00 168.70 ? 229 LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 194 ? -13.107 -43.065 40.974  1.00 179.20 ? 229 LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 194 ? -11.558 -44.329 39.483  1.00 179.38 ? 229 LEU A CD2 1 
ATOM   1494 N N   . THR A 1 195 ? -10.645 -38.452 38.942  1.00 68.25  ? 230 THR A N   1 
ATOM   1495 C CA  . THR A 1 195 ? -10.541 -37.421 37.918  1.00 72.69  ? 230 THR A CA  1 
ATOM   1496 C C   . THR A 1 195 ? -9.611  -37.935 36.855  1.00 74.81  ? 230 THR A C   1 
ATOM   1497 O O   . THR A 1 195 ? -8.443  -37.569 36.817  1.00 73.27  ? 230 THR A O   1 
ATOM   1498 C CB  . THR A 1 195 ? -9.995  -36.089 38.490  1.00 172.70 ? 230 THR A CB  1 
ATOM   1499 O OG1 . THR A 1 195 ? -8.676  -36.290 39.010  1.00 174.67 ? 230 THR A OG1 1 
ATOM   1500 C CG2 . THR A 1 195 ? -10.901 -35.574 39.602  1.00 179.48 ? 230 THR A CG2 1 
ATOM   1501 N N   . GLU A 1 196 ? -10.131 -38.802 35.998  1.00 101.57 ? 231 GLU A N   1 
ATOM   1502 C CA  . GLU A 1 196 ? -9.368  -39.370 34.891  1.00 107.84 ? 231 GLU A CA  1 
ATOM   1503 C C   . GLU A 1 196 ? -8.177  -40.184 35.354  1.00 110.88 ? 231 GLU A C   1 
ATOM   1504 O O   . GLU A 1 196 ? -7.051  -39.700 35.417  1.00 109.50 ? 231 GLU A O   1 
ATOM   1505 C CB  . GLU A 1 196 ? -8.906  -38.267 33.938  1.00 200.00 ? 231 GLU A CB  1 
ATOM   1506 C CG  . GLU A 1 196 ? -10.034 -37.654 33.127  1.00 200.00 ? 231 GLU A CG  1 
ATOM   1507 C CD  . GLU A 1 196 ? -10.773 -38.684 32.292  1.00 200.00 ? 231 GLU A CD  1 
ATOM   1508 O OE1 . GLU A 1 196 ? -10.130 -39.331 31.438  1.00 200.00 ? 231 GLU A OE1 1 
ATOM   1509 O OE2 . GLU A 1 196 ? -11.995 -38.848 32.492  1.00 200.00 ? 231 GLU A OE2 1 
ATOM   1510 N N   . LEU A 1 197 ? -8.451  -41.437 35.671  1.00 164.50 ? 232 LEU A N   1 
ATOM   1511 C CA  . LEU A 1 197 ? -7.409  -42.389 35.980  1.00 169.43 ? 232 LEU A CA  1 
ATOM   1512 C C   . LEU A 1 197 ? -7.290  -43.375 34.816  1.00 168.64 ? 232 LEU A C   1 
ATOM   1513 O O   . LEU A 1 197 ? -7.436  -44.592 34.980  1.00 169.54 ? 232 LEU A O   1 
ATOM   1514 C CB  . LEU A 1 197 ? -7.728  -43.144 37.273  1.00 151.91 ? 232 LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 197 ? -7.739  -42.321 38.564  1.00 160.89 ? 232 LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 197 ? -8.018  -43.234 39.749  1.00 166.26 ? 232 LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 197 ? -6.400  -41.621 38.737  1.00 166.47 ? 232 LEU A CD2 1 
ATOM   1518 N N   . GLU A 1 198 ? -7.030  -42.834 33.629  1.00 175.54 ? 233 GLU A N   1 
ATOM   1519 C CA  . GLU A 1 198 ? -6.818  -43.666 32.446  1.00 173.51 ? 233 GLU A CA  1 
ATOM   1520 C C   . GLU A 1 198 ? -5.578  -44.570 32.568  1.00 165.99 ? 233 GLU A C   1 
ATOM   1521 O O   . GLU A 1 198 ? -5.569  -45.669 32.005  1.00 166.32 ? 233 GLU A O   1 
ATOM   1522 C CB  . GLU A 1 198 ? -6.699  -42.769 31.215  1.00 194.50 ? 233 GLU A CB  1 
ATOM   1523 C CG  . GLU A 1 198 ? -5.690  -41.650 31.380  1.00 200.00 ? 233 GLU A CG  1 
ATOM   1524 C CD  . GLU A 1 198 ? -6.096  -40.395 30.636  1.00 200.00 ? 233 GLU A CD  1 
ATOM   1525 O OE1 . GLU A 1 198 ? -6.308  -40.471 29.409  1.00 200.00 ? 233 GLU A OE1 1 
ATOM   1526 O OE2 . GLU A 1 198 ? -6.205  -39.332 31.281  1.00 200.00 ? 233 GLU A OE2 1 
ATOM   1527 N N   . GLN A 1 199 ? -4.561  -44.120 33.320  1.00 142.08 ? 234 GLN A N   1 
ATOM   1528 C CA  . GLN A 1 199 ? -3.286  -44.854 33.464  1.00 135.67 ? 234 GLN A CA  1 
ATOM   1529 C C   . GLN A 1 199 ? -3.186  -45.671 34.768  1.00 124.12 ? 234 GLN A C   1 
ATOM   1530 O O   . GLN A 1 199 ? -2.406  -45.355 35.682  1.00 121.59 ? 234 GLN A O   1 
ATOM   1531 C CB  . GLN A 1 199 ? -2.117  -43.872 33.380  1.00 163.77 ? 234 GLN A CB  1 
ATOM   1532 C CG  . GLN A 1 199 ? -1.081  -44.233 32.323  1.00 174.40 ? 234 GLN A CG  1 
ATOM   1533 C CD  . GLN A 1 199 ? -1.649  -44.236 30.912  1.00 184.63 ? 234 GLN A CD  1 
ATOM   1534 O OE1 . GLN A 1 199 ? -0.952  -44.572 29.955  1.00 189.74 ? 234 GLN A OE1 1 
ATOM   1535 N NE2 . GLN A 1 199 ? -2.916  -43.859 30.776  1.00 190.00 ? 234 GLN A NE2 1 
ATOM   1536 N N   . SER A 1 200 ? -3.994  -46.741 34.780  1.00 141.93 ? 235 SER A N   1 
ATOM   1537 C CA  . SER A 1 200 ? -4.190  -47.706 35.893  1.00 132.66 ? 235 SER A CA  1 
ATOM   1538 C C   . SER A 1 200 ? -5.601  -48.389 35.761  1.00 126.89 ? 235 SER A C   1 
ATOM   1539 O O   . SER A 1 200 ? -6.517  -47.828 35.129  1.00 126.07 ? 235 SER A O   1 
ATOM   1540 C CB  . SER A 1 200 ? -4.093  -47.002 37.249  1.00 129.74 ? 235 SER A CB  1 
ATOM   1541 O OG  . SER A 1 200 ? -4.248  -47.933 38.307  1.00 125.56 ? 235 SER A OG  1 
ATOM   1542 N N   . ALA A 1 201 ? -5.758  -49.589 36.336  1.00 70.29  ? 236 ALA A N   1 
ATOM   1543 C CA  . ALA A 1 201 ? -7.058  -50.287 36.392  1.00 65.18  ? 236 ALA A CA  1 
ATOM   1544 C C   . ALA A 1 201 ? -7.698  -50.215 37.798  1.00 65.83  ? 236 ALA A C   1 
ATOM   1545 O O   . ALA A 1 201 ? -7.215  -50.880 38.724  1.00 64.66  ? 236 ALA A O   1 
ATOM   1546 C CB  . ALA A 1 201 ? -6.880  -51.741 35.994  1.00 23.41  ? 236 ALA A CB  1 
ATOM   1547 N N   . THR A 1 202 ? -8.786  -49.439 37.941  1.00 47.98  ? 237 THR A N   1 
ATOM   1548 C CA  . THR A 1 202 ? -9.429  -49.198 39.240  1.00 47.98  ? 237 THR A CA  1 
ATOM   1549 C C   . THR A 1 202 ? -10.541 -50.163 39.468  1.00 47.98  ? 237 THR A C   1 
ATOM   1550 O O   . THR A 1 202 ? -11.172 -50.605 38.527  1.00 47.98  ? 237 THR A O   1 
ATOM   1551 C CB  . THR A 1 202 ? -9.996  -47.768 39.338  1.00 77.12  ? 237 THR A CB  1 
ATOM   1552 O OG1 . THR A 1 202 ? -11.168 -47.657 38.523  1.00 78.01  ? 237 THR A OG1 1 
ATOM   1553 C CG2 . THR A 1 202 ? -8.968  -46.762 38.862  1.00 79.21  ? 237 THR A CG2 1 
ATOM   1554 N N   . VAL A 1 203 ? -10.792 -50.468 40.731  1.00 47.12  ? 238 VAL A N   1 
ATOM   1555 C CA  . VAL A 1 203 ? -11.810 -51.447 41.105  1.00 47.12  ? 238 VAL A CA  1 
ATOM   1556 C C   . VAL A 1 203 ? -12.369 -51.075 42.458  1.00 47.12  ? 238 VAL A C   1 
ATOM   1557 O O   . VAL A 1 203 ? -11.729 -51.292 43.488  1.00 47.12  ? 238 VAL A O   1 
ATOM   1558 C CB  . VAL A 1 203 ? -11.247 -52.892 41.173  1.00 168.52 ? 238 VAL A CB  1 
ATOM   1559 C CG1 . VAL A 1 203 ? -12.358 -53.857 41.573  1.00 177.35 ? 238 VAL A CG1 1 
ATOM   1560 C CG2 . VAL A 1 203 ? -10.667 -53.296 39.825  1.00 177.59 ? 238 VAL A CG2 1 
ATOM   1561 N N   . MET A 1 204 ? -13.570 -50.510 42.441  1.00 43.23  ? 239 MET A N   1 
ATOM   1562 C CA  . MET A 1 204 ? -14.183 -49.986 43.650  1.00 50.15  ? 239 MET A CA  1 
ATOM   1563 C C   . MET A 1 204 ? -15.310 -50.928 44.067  1.00 51.25  ? 239 MET A C   1 
ATOM   1564 O O   . MET A 1 204 ? -15.152 -52.152 43.963  1.00 49.71  ? 239 MET A O   1 
ATOM   1565 C CB  . MET A 1 204 ? -14.718 -48.573 43.404  1.00 131.51 ? 239 MET A CB  1 
ATOM   1566 C CG  . MET A 1 204 ? -15.589 -48.430 42.166  1.00 143.69 ? 239 MET A CG  1 
ATOM   1567 S SD  . MET A 1 204 ? -16.080 -46.715 41.876  1.00 160.43 ? 239 MET A SD  1 
ATOM   1568 C CE  . MET A 1 204 ? -17.664 -46.673 42.710  1.00 170.48 ? 239 MET A CE  1 
ATOM   1569 N N   . LYS A 1 205 ? -16.419 -50.368 44.563  1.00 139.64 ? 240 LYS A N   1 
ATOM   1570 C CA  . LYS A 1 205 ? -17.573 -51.138 45.036  1.00 143.10 ? 240 LYS A CA  1 
ATOM   1571 C C   . LYS A 1 205 ? -17.133 -52.151 46.084  1.00 139.72 ? 240 LYS A C   1 
ATOM   1572 O O   . LYS A 1 205 ? -17.878 -53.076 46.420  1.00 139.98 ? 240 LYS A O   1 
ATOM   1573 C CB  . LYS A 1 205 ? -18.226 -51.876 43.866  1.00 167.46 ? 240 LYS A CB  1 
ATOM   1574 C CG  . LYS A 1 205 ? -18.621 -50.977 42.706  1.00 179.46 ? 240 LYS A CG  1 
ATOM   1575 C CD  . LYS A 1 205 ? -19.188 -51.796 41.555  1.00 192.22 ? 240 LYS A CD  1 
ATOM   1576 C CE  . LYS A 1 205 ? -19.582 -50.914 40.383  1.00 197.74 ? 240 LYS A CE  1 
ATOM   1577 N NZ  . LYS A 1 205 ? -18.407 -50.231 39.775  1.00 200.00 ? 240 LYS A NZ  1 
ATOM   1578 N N   . SER A 1 206 ? -15.929 -51.958 46.623  1.00 96.65  ? 241 SER A N   1 
ATOM   1579 C CA  . SER A 1 206 ? -15.376 -52.893 47.575  1.00 95.47  ? 241 SER A CA  1 
ATOM   1580 C C   . SER A 1 206 ? -15.907 -52.595 48.984  1.00 92.59  ? 241 SER A C   1 
ATOM   1581 O O   . SER A 1 206 ? -15.428 -53.176 49.955  1.00 91.00  ? 241 SER A O   1 
ATOM   1582 C CB  . SER A 1 206 ? -13.847 -52.794 47.558  1.00 152.41 ? 241 SER A CB  1 
ATOM   1583 O OG  . SER A 1 206 ? -13.254 -53.687 48.484  1.00 155.83 ? 241 SER A OG  1 
ATOM   1584 N N   . GLY A 1 207 ? -16.918 -51.716 49.086  1.00 139.07 ? 242 GLY A N   1 
ATOM   1585 C CA  . GLY A 1 207 ? -17.522 -51.339 50.368  1.00 138.24 ? 242 GLY A CA  1 
ATOM   1586 C C   . GLY A 1 207 ? -18.984 -50.858 50.392  1.00 137.57 ? 242 GLY A C   1 
ATOM   1587 O O   . GLY A 1 207 ? -19.593 -50.583 49.355  1.00 137.04 ? 242 GLY A O   1 
ATOM   1588 N N   . GLY A 1 208 ? -19.537 -50.758 51.604  1.00 122.19 ? 243 GLY A N   1 
ATOM   1589 C CA  . GLY A 1 208 ? -20.877 -50.243 51.822  1.00 122.61 ? 243 GLY A CA  1 
ATOM   1590 C C   . GLY A 1 208 ? -20.843 -48.799 52.295  1.00 124.07 ? 243 GLY A C   1 
ATOM   1591 O O   . GLY A 1 208 ? -20.581 -47.883 51.517  1.00 123.22 ? 243 GLY A O   1 
ATOM   1592 N N   . LEU A 1 209 ? -21.132 -48.587 53.571  1.00 53.87  ? 244 LEU A N   1 
ATOM   1593 C CA  . LEU A 1 209 ? -21.162 -47.236 54.122  1.00 53.87  ? 244 LEU A CA  1 
ATOM   1594 C C   . LEU A 1 209 ? -20.217 -46.886 55.276  1.00 53.87  ? 244 LEU A C   1 
ATOM   1595 O O   . LEU A 1 209 ? -19.802 -45.743 55.356  1.00 53.87  ? 244 LEU A O   1 
ATOM   1596 C CB  . LEU A 1 209 ? -22.587 -46.887 54.561  1.00 172.09 ? 244 LEU A CB  1 
ATOM   1597 C CG  . LEU A 1 209 ? -23.634 -46.634 53.476  1.00 188.56 ? 244 LEU A CG  1 
ATOM   1598 C CD1 . LEU A 1 209 ? -23.177 -45.478 52.602  1.00 198.09 ? 244 LEU A CD1 1 
ATOM   1599 C CD2 . LEU A 1 209 ? -23.845 -47.890 52.648  1.00 198.81 ? 244 LEU A CD2 1 
ATOM   1600 N N   . PRO A 1 210 ? -19.880 -47.799 56.188  1.00 122.22 ? 245 PRO A N   1 
ATOM   1601 C CA  . PRO A 1 210 ? -18.848 -47.466 57.178  1.00 121.38 ? 245 PRO A CA  1 
ATOM   1602 C C   . PRO A 1 210 ? -17.478 -47.250 56.503  1.00 116.58 ? 245 PRO A C   1 
ATOM   1603 O O   . PRO A 1 210 ? -16.699 -46.389 56.936  1.00 116.51 ? 245 PRO A O   1 
ATOM   1604 C CB  . PRO A 1 210 ? -18.860 -48.680 58.103  1.00 177.93 ? 245 PRO A CB  1 
ATOM   1605 C CG  . PRO A 1 210 ? -19.255 -49.804 57.181  1.00 181.33 ? 245 PRO A CG  1 
ATOM   1606 C CD  . PRO A 1 210 ? -20.363 -49.180 56.364  1.00 179.05 ? 245 PRO A CD  1 
ATOM   1607 N N   . SER A 1 211 ? -17.209 -48.029 55.450  1.00 97.84  ? 246 SER A N   1 
ATOM   1608 C CA  . SER A 1 211 ? -15.962 -47.934 54.691  1.00 94.23  ? 246 SER A CA  1 
ATOM   1609 C C   . SER A 1 211 ? -16.185 -48.161 53.189  1.00 87.24  ? 246 SER A C   1 
ATOM   1610 O O   . SER A 1 211 ? -17.019 -48.983 52.807  1.00 86.05  ? 246 SER A O   1 
ATOM   1611 C CB  . SER A 1 211 ? -14.959 -48.970 55.203  1.00 149.03 ? 246 SER A CB  1 
ATOM   1612 O OG  . SER A 1 211 ? -14.711 -48.805 56.586  1.00 153.22 ? 246 SER A OG  1 
ATOM   1613 N N   . LEU A 1 212 ? -15.430 -47.434 52.355  1.00 89.04  ? 247 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 212 ? -15.503 -47.560 50.898  1.00 84.23  ? 247 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 212 ? -14.169 -48.018 50.337  1.00 84.15  ? 247 LEU A C   1 
ATOM   1616 O O   . LEU A 1 212 ? -13.193 -47.286 50.363  1.00 84.15  ? 247 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 212 ? -15.876 -46.227 50.250  1.00 116.75 ? 247 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 212 ? -17.304 -45.730 50.441  1.00 116.80 ? 247 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 212 ? -17.556 -45.402 51.903  1.00 118.07 ? 247 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 212 ? -17.512 -44.504 49.571  1.00 118.33 ? 247 LEU A CD2 1 
ATOM   1621 N N   . GLY A 1 213 ? -14.143 -49.222 49.792  1.00 122.31 ? 248 GLY A N   1 
ATOM   1622 C CA  . GLY A 1 213 ? -12.923 -49.763 49.235  1.00 116.98 ? 248 GLY A CA  1 
ATOM   1623 C C   . GLY A 1 213 ? -12.665 -49.297 47.818  1.00 111.53 ? 248 GLY A C   1 
ATOM   1624 O O   . GLY A 1 213 ? -13.556 -49.242 46.967  1.00 111.52 ? 248 GLY A O   1 
ATOM   1625 N N   . LEU A 1 214 ? -11.410 -48.983 47.573  1.00 63.75  ? 249 LEU A N   1 
ATOM   1626 C CA  . LEU A 1 214 ? -10.954 -48.613 46.269  1.00 58.31  ? 249 LEU A CA  1 
ATOM   1627 C C   . LEU A 1 214 ? -9.555  -49.153 46.094  1.00 58.07  ? 249 LEU A C   1 
ATOM   1628 O O   . LEU A 1 214 ? -8.720  -49.037 47.003  1.00 58.07  ? 249 LEU A O   1 
ATOM   1629 C CB  . LEU A 1 214 ? -10.950 -47.090 46.147  1.00 55.82  ? 249 LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 214 ? -10.521 -46.544 44.791  1.00 49.29  ? 249 LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 214 ? -9.018  -46.711 44.586  1.00 49.29  ? 249 LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 214 ? -11.304 -47.272 43.717  1.00 49.29  ? 249 LEU A CD2 1 
ATOM   1633 N N   . THR A 1 215 ? -9.278  -49.734 44.932  1.00 30.30  ? 250 THR A N   1 
ATOM   1634 C CA  . THR A 1 215 ? -7.968  -50.331 44.662  1.00 29.25  ? 250 THR A CA  1 
ATOM   1635 C C   . THR A 1 215 ? -7.513  -50.037 43.262  1.00 28.70  ? 250 THR A C   1 
ATOM   1636 O O   . THR A 1 215 ? -8.272  -50.238 42.334  1.00 27.79  ? 250 THR A O   1 
ATOM   1637 C CB  . THR A 1 215 ? -7.987  -51.848 44.856  1.00 49.47  ? 250 THR A CB  1 
ATOM   1638 O OG1 . THR A 1 215 ? -8.329  -52.150 46.213  1.00 50.19  ? 250 THR A OG1 1 
ATOM   1639 C CG2 . THR A 1 215 ? -6.619  -52.433 44.541  1.00 50.45  ? 250 THR A CG2 1 
ATOM   1640 N N   . LEU A 1 216 ? -6.260  -49.620 43.120  1.00 55.61  ? 251 LEU A N   1 
ATOM   1641 C CA  . LEU A 1 216 ? -5.655  -49.280 41.826  1.00 56.90  ? 251 LEU A CA  1 
ATOM   1642 C C   . LEU A 1 216 ? -4.635  -50.334 41.442  1.00 59.28  ? 251 LEU A C   1 
ATOM   1643 O O   . LEU A 1 216 ? -3.597  -50.458 42.071  1.00 58.50  ? 251 LEU A O   1 
ATOM   1644 C CB  . LEU A 1 216 ? -4.971  -47.914 41.917  1.00 42.50  ? 251 LEU A CB  1 
ATOM   1645 C CG  . LEU A 1 216 ? -5.823  -46.723 42.374  1.00 39.70  ? 251 LEU A CG  1 
ATOM   1646 C CD1 . LEU A 1 216 ? -4.932  -45.512 42.645  1.00 39.02  ? 251 LEU A CD1 1 
ATOM   1647 C CD2 . LEU A 1 216 ? -6.860  -46.399 41.314  1.00 38.44  ? 251 LEU A CD2 1 
ATOM   1648 N N   . ALA A 1 217 ? -4.918  -51.099 40.404  1.00 32.25  ? 252 ALA A N   1 
ATOM   1649 C CA  . ALA A 1 217 ? -4.117  -52.271 40.137  1.00 32.25  ? 252 ALA A CA  1 
ATOM   1650 C C   . ALA A 1 217 ? -3.154  -52.015 38.999  1.00 32.25  ? 252 ALA A C   1 
ATOM   1651 O O   . ALA A 1 217 ? -3.500  -51.286 38.069  1.00 32.25  ? 252 ALA A O   1 
ATOM   1652 C CB  . ALA A 1 217 ? -5.023  -53.467 39.816  1.00 97.23  ? 252 ALA A CB  1 
ATOM   1653 N N   . ASN A 1 218 ? -1.964  -52.631 39.084  1.00 26.65  ? 253 ASN A N   1 
ATOM   1654 C CA  . ASN A 1 218 ? -0.956  -52.598 38.025  1.00 26.65  ? 253 ASN A CA  1 
ATOM   1655 C C   . ASN A 1 218 ? -0.677  -51.114 37.753  1.00 26.65  ? 253 ASN A C   1 
ATOM   1656 O O   . ASN A 1 218 ? -0.858  -50.559 36.650  1.00 26.65  ? 253 ASN A O   1 
ATOM   1657 C CB  . ASN A 1 218 ? -1.485  -53.279 36.758  1.00 52.95  ? 253 ASN A CB  1 
ATOM   1658 C CG  . ASN A 1 218 ? -1.673  -54.776 36.930  1.00 58.50  ? 253 ASN A CG  1 
ATOM   1659 O OD1 . ASN A 1 218 ? -2.193  -55.455 36.043  1.00 66.01  ? 253 ASN A OD1 1 
ATOM   1660 N ND2 . ASN A 1 218 ? -1.246  -55.298 38.073  1.00 66.70  ? 253 ASN A ND2 1 
ATOM   1661 N N   . VAL A 1 219 ? -0.257  -50.474 38.825  1.00 18.36  ? 254 VAL A N   1 
ATOM   1662 C CA  . VAL A 1 219 ? -0.146  -49.038 38.900  1.00 18.36  ? 254 VAL A CA  1 
ATOM   1663 C C   . VAL A 1 219 ? 0.956   -48.532 37.970  1.00 18.36  ? 254 VAL A C   1 
ATOM   1664 O O   . VAL A 1 219 ? 2.071   -49.012 38.076  1.00 18.36  ? 254 VAL A O   1 
ATOM   1665 C CB  . VAL A 1 219 ? 0.165   -48.585 40.316  1.00 32.81  ? 254 VAL A CB  1 
ATOM   1666 C CG1 . VAL A 1 219 ? 0.367   -47.077 40.335  1.00 32.81  ? 254 VAL A CG1 1 
ATOM   1667 C CG2 . VAL A 1 219 ? -0.970  -48.992 41.246  1.00 32.81  ? 254 VAL A CG2 1 
ATOM   1668 N N   . THR A 1 220 ? 0.658   -47.582 37.067  1.00 33.70  ? 255 THR A N   1 
ATOM   1669 C CA  . THR A 1 220 ? 1.711   -46.900 36.249  1.00 36.76  ? 255 THR A CA  1 
ATOM   1670 C C   . THR A 1 220 ? 2.309   -45.794 37.052  1.00 34.37  ? 255 THR A C   1 
ATOM   1671 O O   . THR A 1 220 ? 1.905   -45.544 38.179  1.00 34.11  ? 255 THR A O   1 
ATOM   1672 C CB  . THR A 1 220 ? 1.140   -46.288 34.954  1.00 89.53  ? 255 THR A CB  1 
ATOM   1673 O OG1 . THR A 1 220 ? -0.041  -45.534 35.260  1.00 91.85  ? 255 THR A OG1 1 
ATOM   1674 C CG2 . THR A 1 220 ? 0.818   -47.374 33.943  1.00 97.84  ? 255 THR A CG2 1 
ATOM   1675 N N   . SER A 1 221 ? 3.251   -45.083 36.476  1.00 4.88   ? 256 SER A N   1 
ATOM   1676 C CA  . SER A 1 221 ? 3.654   -43.873 37.134  1.00 4.88   ? 256 SER A CA  1 
ATOM   1677 C C   . SER A 1 221 ? 2.696   -42.740 36.866  1.00 4.88   ? 256 SER A C   1 
ATOM   1678 O O   . SER A 1 221 ? 2.602   -41.838 37.654  1.00 4.88   ? 256 SER A O   1 
ATOM   1679 C CB  . SER A 1 221 ? 5.026   -43.420 36.668  1.00 1.00   ? 256 SER A CB  1 
ATOM   1680 O OG  . SER A 1 221 ? 5.192   -42.047 36.970  1.00 1.00   ? 256 SER A OG  1 
ATOM   1681 N N   . ASP A 1 222 ? 1.975   -42.760 35.758  1.00 62.82  ? 257 ASP A N   1 
ATOM   1682 C CA  . ASP A 1 222 ? 1.062   -41.643 35.440  1.00 68.08  ? 257 ASP A CA  1 
ATOM   1683 C C   . ASP A 1 222 ? -0.083  -41.546 36.464  1.00 62.32  ? 257 ASP A C   1 
ATOM   1684 O O   . ASP A 1 222 ? -1.166  -41.058 36.153  1.00 63.82  ? 257 ASP A O   1 
ATOM   1685 C CB  . ASP A 1 222 ? 0.477   -41.820 34.035  1.00 132.39 ? 257 ASP A CB  1 
ATOM   1686 C CG  . ASP A 1 222 ? 1.516   -41.652 32.944  1.00 144.35 ? 257 ASP A CG  1 
ATOM   1687 O OD1 . ASP A 1 222 ? 2.032   -40.525 32.785  1.00 156.33 ? 257 ASP A OD1 1 
ATOM   1688 O OD2 . ASP A 1 222 ? 1.815   -42.646 32.249  1.00 156.19 ? 257 ASP A OD2 1 
ATOM   1689 N N   . LEU A 1 223 ? 0.140   -42.060 37.666  1.00 23.47  ? 258 LEU A N   1 
ATOM   1690 C CA  . LEU A 1 223 ? -0.824  -41.947 38.740  1.00 23.47  ? 258 LEU A CA  1 
ATOM   1691 C C   . LEU A 1 223 ? -0.441  -40.789 39.574  1.00 23.47  ? 258 LEU A C   1 
ATOM   1692 O O   . LEU A 1 223 ? -1.159  -40.385 40.484  1.00 23.47  ? 258 LEU A O   1 
ATOM   1693 C CB  . LEU A 1 223 ? -0.839  -43.218 39.587  1.00 4.50   ? 258 LEU A CB  1 
ATOM   1694 C CG  . LEU A 1 223 ? -1.780  -43.249 40.792  1.00 4.50   ? 258 LEU A CG  1 
ATOM   1695 C CD1 . LEU A 1 223 ? -3.135  -42.685 40.422  1.00 4.50   ? 258 LEU A CD1 1 
ATOM   1696 C CD2 . LEU A 1 223 ? -1.912  -44.682 41.278  1.00 4.50   ? 258 LEU A CD2 1 
ATOM   1697 N N   . ASN A 1 224 ? 0.734   -40.274 39.289  1.00 25.80  ? 259 ASN A N   1 
ATOM   1698 C CA  . ASN A 1 224 ? 1.310   -39.295 40.158  1.00 25.26  ? 259 ASN A CA  1 
ATOM   1699 C C   . ASN A 1 224 ? 0.536   -37.995 39.996  1.00 28.57  ? 259 ASN A C   1 
ATOM   1700 O O   . ASN A 1 224 ? -0.074  -37.730 38.957  1.00 28.25  ? 259 ASN A O   1 
ATOM   1701 C CB  . ASN A 1 224 ? 2.786   -39.089 39.840  1.00 11.60  ? 259 ASN A CB  1 
ATOM   1702 C CG  . ASN A 1 224 ? 3.680   -39.978 40.670  1.00 11.60  ? 259 ASN A CG  1 
ATOM   1703 O OD1 . ASN A 1 224 ? 3.681   -39.889 41.889  1.00 11.60  ? 259 ASN A OD1 1 
ATOM   1704 N ND2 . ASN A 1 224 ? 4.444   -40.840 40.016  1.00 11.60  ? 259 ASN A ND2 1 
ATOM   1705 N N   . ARG A 1 225 ? 0.557   -37.203 41.053  1.00 27.10  ? 260 ARG A N   1 
ATOM   1706 C CA  . ARG A 1 225 ? -0.085  -35.920 41.052  1.00 31.00  ? 260 ARG A CA  1 
ATOM   1707 C C   . ARG A 1 225 ? -1.545  -36.016 40.566  1.00 30.30  ? 260 ARG A C   1 
ATOM   1708 O O   . ARG A 1 225 ? -1.996  -35.252 39.716  1.00 30.71  ? 260 ARG A O   1 
ATOM   1709 C CB  . ARG A 1 225 ? 0.718   -34.919 40.224  1.00 69.50  ? 260 ARG A CB  1 
ATOM   1710 C CG  . ARG A 1 225 ? 0.977   -33.607 40.970  1.00 75.89  ? 260 ARG A CG  1 
ATOM   1711 C CD  . ARG A 1 225 ? 2.435   -33.438 41.370  1.00 82.52  ? 260 ARG A CD  1 
ATOM   1712 N NE  . ARG A 1 225 ? 2.933   -34.583 42.123  1.00 86.41  ? 260 ARG A NE  1 
ATOM   1713 C CZ  . ARG A 1 225 ? 4.140   -34.652 42.676  1.00 89.71  ? 260 ARG A CZ  1 
ATOM   1714 N NH1 . ARG A 1 225 ? 4.984   -33.635 42.567  1.00 90.24  ? 260 ARG A NH1 1 
ATOM   1715 N NH2 . ARG A 1 225 ? 4.507   -35.744 43.332  1.00 91.55  ? 260 ARG A NH2 1 
ATOM   1716 N N   . LYS A 1 226 ? -2.284  -36.970 41.111  1.00 38.29  ? 261 LYS A N   1 
ATOM   1717 C CA  . LYS A 1 226 ? -3.663  -37.149 40.722  1.00 38.29  ? 261 LYS A CA  1 
ATOM   1718 C C   . LYS A 1 226 ? -4.549  -37.348 41.920  1.00 38.29  ? 261 LYS A C   1 
ATOM   1719 O O   . LYS A 1 226 ? -4.509  -38.389 42.577  1.00 38.29  ? 261 LYS A O   1 
ATOM   1720 C CB  . LYS A 1 226 ? -3.786  -38.291 39.726  1.00 67.63  ? 261 LYS A CB  1 
ATOM   1721 C CG  . LYS A 1 226 ? -3.383  -37.818 38.356  1.00 57.41  ? 261 LYS A CG  1 
ATOM   1722 C CD  . LYS A 1 226 ? -3.053  -38.927 37.409  1.00 49.59  ? 261 LYS A CD  1 
ATOM   1723 C CE  . LYS A 1 226 ? -2.468  -38.321 36.154  1.00 47.13  ? 261 LYS A CE  1 
ATOM   1724 N NZ  . LYS A 1 226 ? -1.346  -37.390 36.498  1.00 46.88  ? 261 LYS A NZ  1 
ATOM   1725 N N   . ASN A 1 227 ? -5.341  -36.322 42.193  1.00 23.74  ? 262 ASN A N   1 
ATOM   1726 C CA  . ASN A 1 227 ? -6.265  -36.328 43.282  1.00 23.74  ? 262 ASN A CA  1 
ATOM   1727 C C   . ASN A 1 227 ? -7.177  -37.537 43.197  1.00 23.74  ? 262 ASN A C   1 
ATOM   1728 O O   . ASN A 1 227 ? -7.740  -37.807 42.164  1.00 23.74  ? 262 ASN A O   1 
ATOM   1729 C CB  . ASN A 1 227 ? -7.089  -35.040 43.307  1.00 39.90  ? 262 ASN A CB  1 
ATOM   1730 C CG  . ASN A 1 227 ? -6.355  -33.889 43.989  1.00 46.95  ? 262 ASN A CG  1 
ATOM   1731 O OD1 . ASN A 1 227 ? -5.655  -34.095 44.984  1.00 45.63  ? 262 ASN A OD1 1 
ATOM   1732 N ND2 . ASN A 1 227 ? -6.529  -32.674 43.475  1.00 69.94  ? 262 ASN A ND2 1 
ATOM   1733 N N   . VAL A 1 228 ? -7.268  -38.276 44.292  1.00 21.16  ? 263 VAL A N   1 
ATOM   1734 C CA  . VAL A 1 228 ? -8.193  -39.372 44.443  1.00 21.16  ? 263 VAL A CA  1 
ATOM   1735 C C   . VAL A 1 228 ? -9.094  -38.994 45.617  1.00 21.16  ? 263 VAL A C   1 
ATOM   1736 O O   . VAL A 1 228 ? -8.674  -39.073 46.754  1.00 21.16  ? 263 VAL A O   1 
ATOM   1737 C CB  . VAL A 1 228 ? -7.459  -40.690 44.762  1.00 80.09  ? 263 VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 228 ? -8.462  -41.825 44.900  1.00 92.90  ? 263 VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 228 ? -6.448  -40.998 43.669  1.00 92.30  ? 263 VAL A CG2 1 
ATOM   1740 N N   . THR A 1 229 ? -10.329 -38.578 45.333  1.00 30.49  ? 264 THR A N   1 
ATOM   1741 C CA  . THR A 1 229 ? -11.254 -37.978 46.321  1.00 30.49  ? 264 THR A CA  1 
ATOM   1742 C C   . THR A 1 229 ? -12.349 -38.915 46.727  1.00 30.49  ? 264 THR A C   1 
ATOM   1743 O O   . THR A 1 229 ? -12.795 -39.674 45.894  1.00 30.49  ? 264 THR A O   1 
ATOM   1744 C CB  . THR A 1 229 ? -11.911 -36.697 45.764  1.00 31.24  ? 264 THR A CB  1 
ATOM   1745 O OG1 . THR A 1 229 ? -10.900 -35.821 45.250  1.00 32.27  ? 264 THR A OG1 1 
ATOM   1746 C CG2 . THR A 1 229 ? -12.687 -35.978 46.861  1.00 32.26  ? 264 THR A CG2 1 
ATOM   1747 N N   . CYS A 1 230 ? -12.833 -38.818 47.967  1.00 25.35  ? 265 CYS A N   1 
ATOM   1748 C CA  . CYS A 1 230 ? -14.088 -39.491 48.330  1.00 25.35  ? 265 CYS A CA  1 
ATOM   1749 C C   . CYS A 1 230 ? -15.216 -38.602 48.908  1.00 25.35  ? 265 CYS A C   1 
ATOM   1750 O O   . CYS A 1 230 ? -14.953 -37.598 49.538  1.00 25.35  ? 265 CYS A O   1 
ATOM   1751 C CB  . CYS A 1 230 ? -13.846 -40.714 49.219  1.00 74.47  ? 265 CYS A CB  1 
ATOM   1752 S SG  . CYS A 1 230 ? -13.248 -40.489 50.917  1.00 73.99  ? 265 CYS A SG  1 
ATOM   1753 N N   . TRP A 1 231 ? -16.462 -39.018 48.639  1.00 91.39  ? 266 TRP A N   1 
ATOM   1754 C CA  . TRP A 1 231 ? -17.726 -38.318 48.959  1.00 97.26  ? 266 TRP A CA  1 
ATOM   1755 C C   . TRP A 1 231 ? -18.227 -38.398 50.389  1.00 96.95  ? 266 TRP A C   1 
ATOM   1756 O O   . TRP A 1 231 ? -17.622 -39.019 51.243  1.00 97.51  ? 266 TRP A O   1 
ATOM   1757 C CB  . TRP A 1 231 ? -18.842 -38.912 48.104  1.00 68.07  ? 266 TRP A CB  1 
ATOM   1758 C CG  . TRP A 1 231 ? -19.086 -38.308 46.780  1.00 74.35  ? 266 TRP A CG  1 
ATOM   1759 C CD1 . TRP A 1 231 ? -18.178 -37.719 45.949  1.00 81.49  ? 266 TRP A CD1 1 
ATOM   1760 C CD2 . TRP A 1 231 ? -20.330 -38.312 46.083  1.00 82.58  ? 266 TRP A CD2 1 
ATOM   1761 N NE1 . TRP A 1 231 ? -18.786 -37.356 44.769  1.00 84.99  ? 266 TRP A NE1 1 
ATOM   1762 C CE2 . TRP A 1 231 ? -20.109 -37.709 44.826  1.00 85.78  ? 266 TRP A CE2 1 
ATOM   1763 C CE3 . TRP A 1 231 ? -21.614 -38.770 46.400  1.00 86.41  ? 266 TRP A CE3 1 
ATOM   1764 C CZ2 . TRP A 1 231 ? -21.129 -37.552 43.880  1.00 89.23  ? 266 TRP A CZ2 1 
ATOM   1765 C CZ3 . TRP A 1 231 ? -22.628 -38.616 45.464  1.00 90.17  ? 266 TRP A CZ3 1 
ATOM   1766 C CH2 . TRP A 1 231 ? -22.379 -38.010 44.217  1.00 91.24  ? 266 TRP A CH2 1 
ATOM   1767 N N   . ALA A 1 232 ? -19.406 -37.824 50.606  1.00 65.71  ? 267 ALA A N   1 
ATOM   1768 C CA  . ALA A 1 232 ? -20.165 -37.962 51.849  1.00 65.71  ? 267 ALA A CA  1 
ATOM   1769 C C   . ALA A 1 232 ? -21.266 -36.897 51.910  1.00 65.71  ? 267 ALA A C   1 
ATOM   1770 O O   . ALA A 1 232 ? -21.018 -35.692 51.740  1.00 65.71  ? 267 ALA A O   1 
ATOM   1771 C CB  . ALA A 1 232 ? -19.242 -37.818 53.056  1.00 96.96  ? 267 ALA A CB  1 
ATOM   1772 N N   . GLU A 1 233 ? -22.487 -37.348 52.149  1.00 90.90  ? 268 GLU A N   1 
ATOM   1773 C CA  . GLU A 1 233 ? -23.607 -36.431 52.302  1.00 89.33  ? 268 GLU A CA  1 
ATOM   1774 C C   . GLU A 1 233 ? -24.443 -36.917 53.485  1.00 89.91  ? 268 GLU A C   1 
ATOM   1775 O O   . GLU A 1 233 ? -24.874 -38.058 53.517  1.00 90.22  ? 268 GLU A O   1 
ATOM   1776 C CB  . GLU A 1 233 ? -24.411 -36.358 51.003  1.00 80.31  ? 268 GLU A CB  1 
ATOM   1777 C CG  . GLU A 1 233 ? -23.576 -35.793 49.842  1.00 76.92  ? 268 GLU A CG  1 
ATOM   1778 C CD  . GLU A 1 233 ? -24.363 -35.591 48.555  1.00 72.93  ? 268 GLU A CD  1 
ATOM   1779 O OE1 . GLU A 1 233 ? -25.031 -36.550 48.112  1.00 72.76  ? 268 GLU A OE1 1 
ATOM   1780 O OE2 . GLU A 1 233 ? -24.299 -34.478 47.978  1.00 67.89  ? 268 GLU A OE2 1 
ATOM   1781 N N   . ASN A 1 234 ? -24.613 -36.072 54.494  1.00 81.42  ? 269 ASN A N   1 
ATOM   1782 C CA  . ASN A 1 234 ? -25.495 -36.394 55.607  1.00 81.42  ? 269 ASN A CA  1 
ATOM   1783 C C   . ASN A 1 234 ? -26.810 -35.653 55.350  1.00 81.42  ? 269 ASN A C   1 
ATOM   1784 O O   . ASN A 1 234 ? -26.964 -34.988 54.305  1.00 81.42  ? 269 ASN A O   1 
ATOM   1785 C CB  . ASN A 1 234 ? -24.882 -35.934 56.933  1.00 90.79  ? 269 ASN A CB  1 
ATOM   1786 C CG  . ASN A 1 234 ? -24.708 -34.436 57.003  1.00 89.57  ? 269 ASN A CG  1 
ATOM   1787 O OD1 . ASN A 1 234 ? -24.031 -33.841 56.167  1.00 87.93  ? 269 ASN A OD1 1 
ATOM   1788 N ND2 . ASN A 1 234 ? -25.320 -33.815 58.000  1.00 89.37  ? 269 ASN A ND2 1 
ATOM   1789 N N   . ASP A 1 235 ? -27.755 -35.744 56.288  1.00 65.27  ? 270 ASP A N   1 
ATOM   1790 C CA  . ASP A 1 235 ? -29.054 -35.088 56.131  1.00 68.63  ? 270 ASP A CA  1 
ATOM   1791 C C   . ASP A 1 235 ? -28.941 -33.565 56.118  1.00 72.32  ? 270 ASP A C   1 
ATOM   1792 O O   . ASP A 1 235 ? -29.934 -32.912 56.343  1.00 71.69  ? 270 ASP A O   1 
ATOM   1793 C CB  . ASP A 1 235 ? -30.031 -35.531 57.231  1.00 117.32 ? 270 ASP A CB  1 
ATOM   1794 C CG  . ASP A 1 235 ? -29.647 -35.014 58.603  1.00 118.39 ? 270 ASP A CG  1 
ATOM   1795 O OD1 . ASP A 1 235 ? -30.415 -35.244 59.561  1.00 119.78 ? 270 ASP A OD1 1 
ATOM   1796 O OD2 . ASP A 1 235 ? -28.581 -34.378 58.729  1.00 120.53 ? 270 ASP A OD2 1 
ATOM   1797 N N   . VAL A 1 236 ? -27.756 -33.004 55.869  1.00 47.49  ? 271 VAL A N   1 
ATOM   1798 C CA  . VAL A 1 236 ? -27.615 -31.560 55.677  1.00 47.49  ? 271 VAL A CA  1 
ATOM   1799 C C   . VAL A 1 236 ? -26.207 -31.065 55.266  1.00 47.49  ? 271 VAL A C   1 
ATOM   1800 O O   . VAL A 1 236 ? -25.454 -30.513 56.072  1.00 47.49  ? 271 VAL A O   1 
ATOM   1801 C CB  . VAL A 1 236 ? -28.060 -30.792 56.948  1.00 163.55 ? 271 VAL A CB  1 
ATOM   1802 C CG1 . VAL A 1 236 ? -27.255 -31.252 58.150  1.00 173.58 ? 271 VAL A CG1 1 
ATOM   1803 C CG2 . VAL A 1 236 ? -27.910 -29.288 56.730  1.00 173.63 ? 271 VAL A CG2 1 
ATOM   1804 N N   . GLY A 1 237 ? -25.869 -31.242 53.995  1.00 188.93 ? 272 GLY A N   1 
ATOM   1805 C CA  . GLY A 1 237 ? -24.565 -30.835 53.485  1.00 187.30 ? 272 GLY A CA  1 
ATOM   1806 C C   . GLY A 1 237 ? -23.735 -32.000 52.959  1.00 183.14 ? 272 GLY A C   1 
ATOM   1807 O O   . GLY A 1 237 ? -24.203 -33.145 52.914  1.00 184.55 ? 272 GLY A O   1 
ATOM   1808 N N   . ARG A 1 238 ? -22.497 -31.703 52.560  1.00 71.86  ? 273 ARG A N   1 
ATOM   1809 C CA  . ARG A 1 238 ? -21.595 -32.704 51.974  1.00 65.89  ? 273 ARG A CA  1 
ATOM   1810 C C   . ARG A 1 238 ? -20.127 -32.402 52.272  1.00 63.31  ? 273 ARG A C   1 
ATOM   1811 O O   . ARG A 1 238 ? -19.718 -31.236 52.286  1.00 61.73  ? 273 ARG A O   1 
ATOM   1812 C CB  . ARG A 1 238 ? -21.823 -32.764 50.460  1.00 124.74 ? 273 ARG A CB  1 
ATOM   1813 C CG  . ARG A 1 238 ? -20.810 -33.589 49.695  1.00 119.82 ? 273 ARG A CG  1 
ATOM   1814 C CD  . ARG A 1 238 ? -21.168 -33.631 48.222  1.00 115.34 ? 273 ARG A CD  1 
ATOM   1815 N NE  . ARG A 1 238 ? -20.058 -34.096 47.397  1.00 113.65 ? 273 ARG A NE  1 
ATOM   1816 C CZ  . ARG A 1 238 ? -20.119 -34.241 46.077  1.00 113.49 ? 273 ARG A CZ  1 
ATOM   1817 N NH1 . ARG A 1 238 ? -21.242 -33.962 45.427  1.00 112.40 ? 273 ARG A NH1 1 
ATOM   1818 N NH2 . ARG A 1 238 ? -19.054 -34.655 45.400  1.00 114.32 ? 273 ARG A NH2 1 
ATOM   1819 N N   . ALA A 1 239 ? -19.352 -33.467 52.496  1.00 42.22  ? 274 ALA A N   1 
ATOM   1820 C CA  . ALA A 1 239 ? -17.901 -33.393 52.711  1.00 42.22  ? 274 ALA A CA  1 
ATOM   1821 C C   . ALA A 1 239 ? -17.180 -34.357 51.785  1.00 42.22  ? 274 ALA A C   1 
ATOM   1822 O O   . ALA A 1 239 ? -17.511 -35.527 51.708  1.00 42.22  ? 274 ALA A O   1 
ATOM   1823 C CB  . ALA A 1 239 ? -17.570 -33.724 54.168  1.00 119.73 ? 274 ALA A CB  1 
ATOM   1824 N N   . GLU A 1 240 ? -16.203 -33.842 51.063  1.00 50.71  ? 275 GLU A N   1 
ATOM   1825 C CA  . GLU A 1 240 ? -15.390 -34.653 50.187  1.00 49.36  ? 275 GLU A CA  1 
ATOM   1826 C C   . GLU A 1 240 ? -13.919 -34.405 50.566  1.00 45.30  ? 275 GLU A C   1 
ATOM   1827 O O   . GLU A 1 240 ? -13.521 -33.264 50.779  1.00 44.59  ? 275 GLU A O   1 
ATOM   1828 C CB  . GLU A 1 240 ? -15.634 -34.276 48.723  1.00 87.71  ? 275 GLU A CB  1 
ATOM   1829 C CG  . GLU A 1 240 ? -14.982 -32.973 48.275  1.00 81.82  ? 275 GLU A CG  1 
ATOM   1830 C CD  . GLU A 1 240 ? -15.269 -32.648 46.813  1.00 80.46  ? 275 GLU A CD  1 
ATOM   1831 O OE1 . GLU A 1 240 ? -14.528 -31.820 46.228  1.00 80.63  ? 275 GLU A OE1 1 
ATOM   1832 O OE2 . GLU A 1 240 ? -16.240 -33.216 46.256  1.00 77.88  ? 275 GLU A OE2 1 
ATOM   1833 N N   . VAL A 1 241 ? -13.136 -35.478 50.703  1.00 68.06  ? 276 VAL A N   1 
ATOM   1834 C CA  . VAL A 1 241 ? -11.699 -35.388 51.019  1.00 64.98  ? 276 VAL A CA  1 
ATOM   1835 C C   . VAL A 1 241 ? -10.874 -36.164 49.989  1.00 61.85  ? 276 VAL A C   1 
ATOM   1836 O O   . VAL A 1 241 ? -11.304 -37.252 49.559  1.00 62.25  ? 276 VAL A O   1 
ATOM   1837 C CB  . VAL A 1 241 ? -11.377 -35.980 52.400  1.00 24.54  ? 276 VAL A CB  1 
ATOM   1838 C CG1 . VAL A 1 241 ? -11.720 -37.465 52.426  1.00 25.72  ? 276 VAL A CG1 1 
ATOM   1839 C CG2 . VAL A 1 241 ? -9.899  -35.774 52.707  1.00 25.52  ? 276 VAL A CG2 1 
ATOM   1840 N N   . SER A 1 242 ? -9.695  -35.637 49.620  1.00 52.48  ? 277 SER A N   1 
ATOM   1841 C CA  . SER A 1 242 ? -8.883  -36.236 48.548  1.00 48.50  ? 277 SER A CA  1 
ATOM   1842 C C   . SER A 1 242 ? -7.383  -36.367 48.866  1.00 48.90  ? 277 SER A C   1 
ATOM   1843 O O   . SER A 1 242 ? -6.721  -35.398 49.276  1.00 48.60  ? 277 SER A O   1 
ATOM   1844 C CB  . SER A 1 242 ? -9.061  -35.448 47.251  1.00 15.96  ? 277 SER A CB  1 
ATOM   1845 O OG  . SER A 1 242 ? -8.943  -34.058 47.483  1.00 15.96  ? 277 SER A OG  1 
ATOM   1846 N N   . VAL A 1 243 ? -6.869  -37.582 48.621  1.00 31.75  ? 278 VAL A N   1 
ATOM   1847 C CA  . VAL A 1 243 ? -5.495  -37.985 48.907  1.00 31.99  ? 278 VAL A CA  1 
ATOM   1848 C C   . VAL A 1 243 ? -4.735  -38.163 47.627  1.00 30.13  ? 278 VAL A C   1 
ATOM   1849 O O   . VAL A 1 243 ? -5.314  -38.067 46.573  1.00 28.75  ? 278 VAL A O   1 
ATOM   1850 C CB  . VAL A 1 243 ? -5.461  -39.321 49.671  1.00 31.32  ? 278 VAL A CB  1 
ATOM   1851 C CG1 . VAL A 1 243 ? -6.217  -39.193 50.980  1.00 34.41  ? 278 VAL A CG1 1 
ATOM   1852 C CG2 . VAL A 1 243 ? -6.070  -40.421 48.814  1.00 33.75  ? 278 VAL A CG2 1 
ATOM   1853 N N   . GLN A 1 244 ? -3.431  -38.426 47.732  1.00 39.68  ? 279 GLN A N   1 
ATOM   1854 C CA  . GLN A 1 244 ? -2.588  -38.728 46.549  1.00 39.05  ? 279 GLN A CA  1 
ATOM   1855 C C   . GLN A 1 244 ? -1.679  -39.992 46.679  1.00 43.68  ? 279 GLN A C   1 
ATOM   1856 O O   . GLN A 1 244 ? -1.432  -40.516 47.788  1.00 43.31  ? 279 GLN A O   1 
ATOM   1857 C CB  . GLN A 1 244 ? -1.811  -37.476 46.104  1.00 63.95  ? 279 GLN A CB  1 
ATOM   1858 C CG  . GLN A 1 244 ? -2.635  -36.593 45.129  1.00 55.45  ? 279 GLN A CG  1 
ATOM   1859 C CD  . GLN A 1 244 ? -1.931  -35.324 44.659  1.00 46.25  ? 279 GLN A CD  1 
ATOM   1860 O OE1 . GLN A 1 244 ? -0.769  -35.355 44.269  1.00 41.67  ? 279 GLN A OE1 1 
ATOM   1861 N NE2 . GLN A 1 244 ? -2.650  -34.207 44.667  1.00 41.67  ? 279 GLN A NE2 1 
ATOM   1862 N N   . VAL A 1 245 ? -1.214  -40.499 45.539  1.00 48.45  ? 280 VAL A N   1 
ATOM   1863 C CA  . VAL A 1 245 ? -0.616  -41.825 45.537  1.00 53.98  ? 280 VAL A CA  1 
ATOM   1864 C C   . VAL A 1 245 ? 0.883   -41.840 45.735  1.00 47.49  ? 280 VAL A C   1 
ATOM   1865 O O   . VAL A 1 245 ? 1.376   -42.551 46.618  1.00 47.74  ? 280 VAL A O   1 
ATOM   1866 C CB  . VAL A 1 245 ? -0.936  -42.564 44.228  1.00 101.92 ? 280 VAL A CB  1 
ATOM   1867 C CG1 . VAL A 1 245 ? -0.371  -43.977 44.272  1.00 111.43 ? 280 VAL A CG1 1 
ATOM   1868 C CG2 . VAL A 1 245 ? -2.438  -42.592 44.007  1.00 111.84 ? 280 VAL A CG2 1 
ATOM   1869 N N   . ASN A 1 246 ? 1.616   -41.089 44.912  1.00 28.24  ? 281 ASN A N   1 
ATOM   1870 C CA  . ASN A 1 246 ? 3.090   -41.135 44.950  1.00 28.24  ? 281 ASN A CA  1 
ATOM   1871 C C   . ASN A 1 246 ? 3.598   -42.565 44.671  1.00 28.24  ? 281 ASN A C   1 
ATOM   1872 O O   . ASN A 1 246 ? 3.577   -43.465 45.553  1.00 28.24  ? 281 ASN A O   1 
ATOM   1873 C CB  . ASN A 1 246 ? 3.602   -40.699 46.326  1.00 58.14  ? 281 ASN A CB  1 
ATOM   1874 C CG  . ASN A 1 246 ? 4.437   -39.427 46.281  1.00 58.14  ? 281 ASN A CG  1 
ATOM   1875 O OD1 . ASN A 1 246 ? 4.968   -39.052 45.233  1.00 58.14  ? 281 ASN A OD1 1 
ATOM   1876 N ND2 . ASN A 1 246 ? 4.571   -38.789 47.444  1.00 58.14  ? 281 ASN A ND2 1 
ATOM   1877 N N   . VAL A 1 247 ? 3.993   -42.771 43.413  1.00 14.15  ? 282 VAL A N   1 
ATOM   1878 C CA  . VAL A 1 247 ? 4.509   -44.068 42.915  1.00 13.14  ? 282 VAL A CA  1 
ATOM   1879 C C   . VAL A 1 247 ? 5.855   -43.717 42.413  1.00 13.14  ? 282 VAL A C   1 
ATOM   1880 O O   . VAL A 1 247 ? 6.031   -42.577 41.940  1.00 13.14  ? 282 VAL A O   1 
ATOM   1881 C CB  . VAL A 1 247 ? 3.645   -44.618 41.759  1.00 14.42  ? 282 VAL A CB  1 
ATOM   1882 C CG1 . VAL A 1 247 ? 2.413   -45.300 42.309  1.00 14.42  ? 282 VAL A CG1 1 
ATOM   1883 C CG2 . VAL A 1 247 ? 3.222   -43.479 40.853  1.00 14.42  ? 282 VAL A CG2 1 
ATOM   1884 N N   . SER A 1 248 ? 6.819   -44.616 42.516  1.00 13.40  ? 283 SER A N   1 
ATOM   1885 C CA  . SER A 1 248 ? 8.191   -44.151 42.291  1.00 13.40  ? 283 SER A CA  1 
ATOM   1886 C C   . SER A 1 248 ? 8.892   -44.674 41.052  1.00 13.40  ? 283 SER A C   1 
ATOM   1887 O O   . SER A 1 248 ? 8.916   -45.900 40.750  1.00 13.40  ? 283 SER A O   1 
ATOM   1888 C CB  . SER A 1 248 ? 9.036   -44.463 43.515  1.00 12.56  ? 283 SER A CB  1 
ATOM   1889 O OG  . SER A 1 248 ? 8.993   -45.844 43.796  1.00 12.96  ? 283 SER A OG  1 
ATOM   1890 N N   . PHE A 1 249 ? 9.538   -43.749 40.347  1.00 15.04  ? 284 PHE A N   1 
ATOM   1891 C CA  . PHE A 1 249 ? 10.296  -44.057 39.147  1.00 15.04  ? 284 PHE A CA  1 
ATOM   1892 C C   . PHE A 1 249 ? 11.667  -43.383 39.212  1.00 15.04  ? 284 PHE A C   1 
ATOM   1893 O O   . PHE A 1 249 ? 11.863  -42.448 39.970  1.00 15.04  ? 284 PHE A O   1 
ATOM   1894 C CB  . PHE A 1 249 ? 9.533   -43.600 37.906  1.00 30.73  ? 284 PHE A CB  1 
ATOM   1895 C CG  . PHE A 1 249 ? 9.308   -42.118 37.838  1.00 30.73  ? 284 PHE A CG  1 
ATOM   1896 C CD1 . PHE A 1 249 ? 8.500   -41.479 38.772  1.00 31.04  ? 284 PHE A CD1 1 
ATOM   1897 C CD2 . PHE A 1 249 ? 9.889   -41.365 36.825  1.00 30.73  ? 284 PHE A CD2 1 
ATOM   1898 C CE1 . PHE A 1 249 ? 8.274   -40.112 38.696  1.00 33.99  ? 284 PHE A CE1 1 
ATOM   1899 C CE2 . PHE A 1 249 ? 9.671   -40.000 36.740  1.00 32.73  ? 284 PHE A CE2 1 
ATOM   1900 C CZ  . PHE A 1 249 ? 8.859   -39.370 37.678  1.00 33.19  ? 284 PHE A CZ  1 
ATOM   1901 N N   . PRO A 1 250 ? 12.633  -43.851 38.406  1.00 24.13  ? 285 PRO A N   1 
ATOM   1902 C CA  . PRO A 1 250 ? 14.009  -43.332 38.339  1.00 26.43  ? 285 PRO A CA  1 
ATOM   1903 C C   . PRO A 1 250 ? 14.269  -41.932 37.735  1.00 29.17  ? 285 PRO A C   1 
ATOM   1904 O O   . PRO A 1 250 ? 13.557  -41.476 36.830  1.00 30.46  ? 285 PRO A O   1 
ATOM   1905 C CB  . PRO A 1 250 ? 14.732  -44.426 37.564  1.00 67.76  ? 285 PRO A CB  1 
ATOM   1906 C CG  . PRO A 1 250 ? 13.685  -44.861 36.604  1.00 67.76  ? 285 PRO A CG  1 
ATOM   1907 C CD  . PRO A 1 250 ? 12.477  -44.993 37.491  1.00 67.76  ? 285 PRO A CD  1 
ATOM   1908 N N   . ALA A 1 251 ? 15.324  -41.280 38.227  1.00 24.69  ? 286 ALA A N   1 
ATOM   1909 C CA  . ALA A 1 251 ? 15.710  -39.943 37.793  1.00 24.69  ? 286 ALA A CA  1 
ATOM   1910 C C   . ALA A 1 251 ? 16.028  -39.850 36.314  1.00 24.69  ? 286 ALA A C   1 
ATOM   1911 O O   . ALA A 1 251 ? 16.462  -40.824 35.711  1.00 24.69  ? 286 ALA A O   1 
ATOM   1912 C CB  . ALA A 1 251 ? 16.901  -39.462 38.607  1.00 110.27 ? 286 ALA A CB  1 
ATOM   1913 N N   . SER A 1 252 ? 15.819  -38.657 35.754  1.00 39.71  ? 287 SER A N   1 
ATOM   1914 C CA  . SER A 1 252 ? 16.042  -38.365 34.349  1.00 39.71  ? 287 SER A CA  1 
ATOM   1915 C C   . SER A 1 252 ? 16.493  -36.915 34.413  1.00 39.71  ? 287 SER A C   1 
ATOM   1916 O O   . SER A 1 252 ? 16.003  -36.154 35.255  1.00 39.71  ? 287 SER A O   1 
ATOM   1917 C CB  . SER A 1 252 ? 14.772  -38.550 33.506  1.00 80.47  ? 287 SER A CB  1 
ATOM   1918 O OG  . SER A 1 252 ? 13.702  -37.744 33.948  1.00 80.47  ? 287 SER A OG  1 
ATOM   1919 N N   . VAL A 1 253 ? 17.405  -36.530 33.532  1.00 44.92  ? 288 VAL A N   1 
ATOM   1920 C CA  . VAL A 1 253 ? 17.944  -35.178 33.547  1.00 44.92  ? 288 VAL A CA  1 
ATOM   1921 C C   . VAL A 1 253 ? 18.360  -34.667 32.173  1.00 44.92  ? 288 VAL A C   1 
ATOM   1922 O O   . VAL A 1 253 ? 18.800  -35.433 31.306  1.00 44.92  ? 288 VAL A O   1 
ATOM   1923 C CB  . VAL A 1 253 ? 19.160  -35.052 34.467  1.00 39.18  ? 288 VAL A CB  1 
ATOM   1924 C CG1 . VAL A 1 253 ? 19.532  -33.588 34.629  1.00 39.18  ? 288 VAL A CG1 1 
ATOM   1925 C CG2 . VAL A 1 253 ? 18.862  -35.664 35.797  1.00 39.18  ? 288 VAL A CG2 1 
ATOM   1926 N N   . GLN A 1 254 ? 18.223  -33.360 31.982  1.00 29.18  ? 289 GLN A N   1 
ATOM   1927 C CA  . GLN A 1 254 ? 18.655  -32.763 30.745  1.00 29.18  ? 289 GLN A CA  1 
ATOM   1928 C C   . GLN A 1 254 ? 19.034  -31.291 30.960  1.00 29.18  ? 289 GLN A C   1 
ATOM   1929 O O   . GLN A 1 254 ? 18.477  -30.613 31.810  1.00 29.18  ? 289 GLN A O   1 
ATOM   1930 C CB  . GLN A 1 254 ? 17.571  -32.849 29.674  1.00 40.55  ? 289 GLN A CB  1 
ATOM   1931 C CG  . GLN A 1 254 ? 16.441  -31.867 29.862  1.00 40.55  ? 289 GLN A CG  1 
ATOM   1932 C CD  . GLN A 1 254 ? 15.412  -31.951 28.762  1.00 40.55  ? 289 GLN A CD  1 
ATOM   1933 O OE1 . GLN A 1 254 ? 14.872  -33.020 28.475  1.00 40.55  ? 289 GLN A OE1 1 
ATOM   1934 N NE2 . GLN A 1 254 ? 15.126  -30.818 28.144  1.00 40.55  ? 289 GLN A NE2 1 
ATOM   1935 N N   . LEU A 1 255 ? 20.035  -30.833 30.214  1.00 13.29  ? 290 LEU A N   1 
ATOM   1936 C CA  . LEU A 1 255 ? 20.528  -29.467 30.278  1.00 13.29  ? 290 LEU A CA  1 
ATOM   1937 C C   . LEU A 1 255 ? 20.288  -28.796 28.925  1.00 13.29  ? 290 LEU A C   1 
ATOM   1938 O O   . LEU A 1 255 ? 20.160  -29.455 27.888  1.00 13.29  ? 290 LEU A O   1 
ATOM   1939 C CB  . LEU A 1 255 ? 22.024  -29.449 30.597  1.00 44.37  ? 290 LEU A CB  1 
ATOM   1940 C CG  . LEU A 1 255 ? 22.425  -29.144 32.041  1.00 44.37  ? 290 LEU A CG  1 
ATOM   1941 C CD1 . LEU A 1 255 ? 21.666  -30.042 33.004  1.00 44.37  ? 290 LEU A CD1 1 
ATOM   1942 C CD2 . LEU A 1 255 ? 23.924  -29.340 32.190  1.00 44.37  ? 290 LEU A CD2 1 
ATOM   1943 N N   . HIS A 1 256 ? 20.226  -27.475 28.943  1.00 32.28  ? 291 HIS A N   1 
ATOM   1944 C CA  . HIS A 1 256 ? 20.010  -26.698 27.741  1.00 32.28  ? 291 HIS A CA  1 
ATOM   1945 C C   . HIS A 1 256 ? 21.174  -25.725 27.634  1.00 32.28  ? 291 HIS A C   1 
ATOM   1946 O O   . HIS A 1 256 ? 21.802  -25.389 28.646  1.00 32.28  ? 291 HIS A O   1 
ATOM   1947 C CB  . HIS A 1 256 ? 18.720  -25.895 27.842  1.00 32.55  ? 291 HIS A CB  1 
ATOM   1948 C CG  . HIS A 1 256 ? 17.487  -26.733 27.811  1.00 32.55  ? 291 HIS A CG  1 
ATOM   1949 N ND1 . HIS A 1 256 ? 16.955  -27.223 26.641  1.00 32.55  ? 291 HIS A ND1 1 
ATOM   1950 C CD2 . HIS A 1 256 ? 16.698  -27.193 28.810  1.00 32.55  ? 291 HIS A CD2 1 
ATOM   1951 C CE1 . HIS A 1 256 ? 15.888  -27.949 26.920  1.00 32.55  ? 291 HIS A CE1 1 
ATOM   1952 N NE2 . HIS A 1 256 ? 15.711  -27.947 28.229  1.00 32.55  ? 291 HIS A NE2 1 
ATOM   1953 N N   . THR A 1 257 ? 21.457  -25.273 26.415  1.00 18.61  ? 292 THR A N   1 
ATOM   1954 C CA  . THR A 1 257 ? 22.558  -24.351 26.180  1.00 18.61  ? 292 THR A CA  1 
ATOM   1955 C C   . THR A 1 257 ? 22.363  -23.028 26.930  1.00 18.61  ? 292 THR A C   1 
ATOM   1956 O O   . THR A 1 257 ? 21.321  -22.382 26.801  1.00 18.61  ? 292 THR A O   1 
ATOM   1957 C CB  . THR A 1 257 ? 22.745  -24.090 24.703  1.00 20.66  ? 292 THR A CB  1 
ATOM   1958 O OG1 . THR A 1 257 ? 21.491  -23.744 24.128  1.00 20.66  ? 292 THR A OG1 1 
ATOM   1959 C CG2 . THR A 1 257 ? 23.247  -25.328 24.020  1.00 20.66  ? 292 THR A CG2 1 
ATOM   1960 N N   . ALA A 1 258 ? 23.371  -22.652 27.721  1.00 23.35  ? 293 ALA A N   1 
ATOM   1961 C CA  . ALA A 1 258 ? 23.358  -21.425 28.532  1.00 23.35  ? 293 ALA A CA  1 
ATOM   1962 C C   . ALA A 1 258 ? 22.877  -20.171 27.805  1.00 23.35  ? 293 ALA A C   1 
ATOM   1963 O O   . ALA A 1 258 ? 23.231  -19.927 26.640  1.00 23.35  ? 293 ALA A O   1 
ATOM   1964 C CB  . ALA A 1 258 ? 24.744  -21.178 29.109  1.00 60.35  ? 293 ALA A CB  1 
ATOM   1965 N N   . VAL A 1 259 ? 22.071  -19.377 28.509  1.00 66.26  ? 294 VAL A N   1 
ATOM   1966 C CA  . VAL A 1 259 ? 21.542  -18.145 27.943  1.00 66.26  ? 294 VAL A CA  1 
ATOM   1967 C C   . VAL A 1 259 ? 21.641  -16.962 28.923  1.00 66.26  ? 294 VAL A C   1 
ATOM   1968 O O   . VAL A 1 259 ? 21.610  -17.133 30.150  1.00 66.26  ? 294 VAL A O   1 
ATOM   1969 C CB  . VAL A 1 259 ? 20.042  -18.344 27.590  1.00 22.43  ? 294 VAL A CB  1 
ATOM   1970 C CG1 . VAL A 1 259 ? 19.425  -19.350 28.528  1.00 22.43  ? 294 VAL A CG1 1 
ATOM   1971 C CG2 . VAL A 1 259 ? 19.282  -17.040 27.731  1.00 22.43  ? 294 VAL A CG2 1 
ATOM   1972 N N   . GLU A 1 260 ? 21.783  -15.763 28.360  1.00 55.17  ? 295 GLU A N   1 
ATOM   1973 C CA  . GLU A 1 260 ? 21.940  -14.538 29.142  1.00 55.17  ? 295 GLU A CA  1 
ATOM   1974 C C   . GLU A 1 260 ? 20.673  -13.708 29.255  1.00 55.17  ? 295 GLU A C   1 
ATOM   1975 O O   . GLU A 1 260 ? 20.214  -13.127 28.274  1.00 55.17  ? 295 GLU A O   1 
ATOM   1976 C CB  . GLU A 1 260 ? 23.065  -13.658 28.569  1.00 115.43 ? 295 GLU A CB  1 
ATOM   1977 C CG  . GLU A 1 260 ? 23.275  -12.344 29.348  1.00 115.43 ? 295 GLU A CG  1 
ATOM   1978 C CD  . GLU A 1 260 ? 24.372  -11.446 28.770  1.00 115.43 ? 295 GLU A CD  1 
ATOM   1979 O OE1 . GLU A 1 260 ? 24.341  -11.177 27.550  1.00 115.43 ? 295 GLU A OE1 1 
ATOM   1980 O OE2 . GLU A 1 260 ? 25.256  -10.998 29.539  1.00 115.43 ? 295 GLU A OE2 1 
ATOM   1981 N N   . MET A 1 261 ? 20.102  -13.666 30.450  1.00 72.33  ? 296 MET A N   1 
ATOM   1982 C CA  . MET A 1 261 ? 18.915  -12.857 30.661  1.00 72.33  ? 296 MET A CA  1 
ATOM   1983 C C   . MET A 1 261 ? 19.464  -11.804 31.588  1.00 72.33  ? 296 MET A C   1 
ATOM   1984 O O   . MET A 1 261 ? 20.526  -11.250 31.319  1.00 72.33  ? 296 MET A O   1 
ATOM   1985 C CB  . MET A 1 261 ? 17.795  -13.711 31.254  1.00 18.77  ? 296 MET A CB  1 
ATOM   1986 C CG  . MET A 1 261 ? 17.226  -14.648 30.186  1.00 18.77  ? 296 MET A CG  1 
ATOM   1987 S SD  . MET A 1 261 ? 15.781  -15.609 30.638  1.00 18.77  ? 296 MET A SD  1 
ATOM   1988 C CE  . MET A 1 261 ? 16.488  -17.229 30.676  1.00 18.77  ? 296 MET A CE  1 
ATOM   1989 N N   . HIS A 1 262 ? 18.769  -11.528 32.685  1.00 26.20  ? 297 HIS A N   1 
ATOM   1990 C CA  . HIS A 1 262 ? 19.272  -10.554 33.628  1.00 26.20  ? 297 HIS A CA  1 
ATOM   1991 C C   . HIS A 1 262 ? 20.580  -11.121 34.175  1.00 26.20  ? 297 HIS A C   1 
ATOM   1992 O O   . HIS A 1 262 ? 21.559  -10.399 34.360  1.00 26.20  ? 297 HIS A O   1 
ATOM   1993 C CB  . HIS A 1 262 ? 18.254  -10.373 34.760  1.00 18.66  ? 297 HIS A CB  1 
ATOM   1994 C CG  . HIS A 1 262 ? 18.833  -9.816  36.024  1.00 18.66  ? 297 HIS A CG  1 
ATOM   1995 N ND1 . HIS A 1 262 ? 19.434  -8.578  36.088  1.00 18.66  ? 297 HIS A ND1 1 
ATOM   1996 C CD2 . HIS A 1 262 ? 18.891  -10.328 37.276  1.00 18.66  ? 297 HIS A CD2 1 
ATOM   1997 C CE1 . HIS A 1 262 ? 19.838  -8.352  37.326  1.00 18.66  ? 297 HIS A CE1 1 
ATOM   1998 N NE2 . HIS A 1 262 ? 19.521  -9.398  38.066  1.00 18.66  ? 297 HIS A NE2 1 
ATOM   1999 N N   . HIS A 1 263 ? 20.567  -12.417 34.468  1.00 53.95  ? 298 HIS A N   1 
ATOM   2000 C CA  . HIS A 1 263 ? 21.744  -13.139 34.955  1.00 53.95  ? 298 HIS A CA  1 
ATOM   2001 C C   . HIS A 1 263 ? 21.910  -14.169 33.866  1.00 53.95  ? 298 HIS A C   1 
ATOM   2002 O O   . HIS A 1 263 ? 21.013  -14.324 33.032  1.00 53.95  ? 298 HIS A O   1 
ATOM   2003 C CB  . HIS A 1 263 ? 21.401  -14.001 36.187  1.00 50.27  ? 298 HIS A CB  1 
ATOM   2004 C CG  . HIS A 1 263 ? 21.423  -13.299 37.506  1.00 50.27  ? 298 HIS A CG  1 
ATOM   2005 N ND1 . HIS A 1 263 ? 21.176  -13.967 38.686  1.00 50.27  ? 298 HIS A ND1 1 
ATOM   2006 C CD2 . HIS A 1 263 ? 21.680  -12.016 37.848  1.00 50.27  ? 298 HIS A CD2 1 
ATOM   2007 C CE1 . HIS A 1 263 ? 21.281  -13.129 39.698  1.00 50.27  ? 298 HIS A CE1 1 
ATOM   2008 N NE2 . HIS A 1 263 ? 21.586  -11.938 39.218  1.00 50.27  ? 298 HIS A NE2 1 
ATOM   2009 N N   . TRP A 1 264 ? 23.028  -14.887 33.877  1.00 9.65   ? 299 TRP A N   1 
ATOM   2010 C CA  . TRP A 1 264 ? 23.220  -15.949 32.896  1.00 9.65   ? 299 TRP A CA  1 
ATOM   2011 C C   . TRP A 1 264 ? 22.498  -17.168 33.485  1.00 9.65   ? 299 TRP A C   1 
ATOM   2012 O O   . TRP A 1 264 ? 22.378  -17.309 34.704  1.00 9.65   ? 299 TRP A O   1 
ATOM   2013 C CB  . TRP A 1 264 ? 24.703  -16.268 32.687  1.00 38.22  ? 299 TRP A CB  1 
ATOM   2014 C CG  . TRP A 1 264 ? 25.339  -15.494 31.573  1.00 38.22  ? 299 TRP A CG  1 
ATOM   2015 C CD1 . TRP A 1 264 ? 25.937  -14.280 31.662  1.00 38.22  ? 299 TRP A CD1 1 
ATOM   2016 C CD2 . TRP A 1 264 ? 25.404  -15.874 30.195  1.00 38.22  ? 299 TRP A CD2 1 
ATOM   2017 N NE1 . TRP A 1 264 ? 26.375  -13.873 30.425  1.00 38.22  ? 299 TRP A NE1 1 
ATOM   2018 C CE2 . TRP A 1 264 ? 26.059  -14.835 29.507  1.00 38.22  ? 299 TRP A CE2 1 
ATOM   2019 C CE3 . TRP A 1 264 ? 24.973  -16.994 29.476  1.00 38.22  ? 299 TRP A CE3 1 
ATOM   2020 C CZ2 . TRP A 1 264 ? 26.293  -14.879 28.133  1.00 38.22  ? 299 TRP A CZ2 1 
ATOM   2021 C CZ3 . TRP A 1 264 ? 25.208  -17.038 28.107  1.00 38.22  ? 299 TRP A CZ3 1 
ATOM   2022 C CH2 . TRP A 1 264 ? 25.861  -15.987 27.452  1.00 38.22  ? 299 TRP A CH2 1 
ATOM   2023 N N   . CYS A 1 265 ? 22.000  -18.044 32.630  1.00 37.34  ? 300 CYS A N   1 
ATOM   2024 C CA  . CYS A 1 265 ? 21.330  -19.217 33.145  1.00 37.34  ? 300 CYS A CA  1 
ATOM   2025 C C   . CYS A 1 265 ? 21.523  -20.469 32.291  1.00 37.34  ? 300 CYS A C   1 
ATOM   2026 O O   . CYS A 1 265 ? 21.403  -20.426 31.057  1.00 37.34  ? 300 CYS A O   1 
ATOM   2027 C CB  . CYS A 1 265 ? 19.837  -18.949 33.250  1.00 35.19  ? 300 CYS A CB  1 
ATOM   2028 S SG  . CYS A 1 265 ? 18.936  -20.494 32.969  1.00 35.19  ? 300 CYS A SG  1 
ATOM   2029 N N   . ILE A 1 266 ? 21.865  -21.572 32.966  1.00 17.83  ? 301 ILE A N   1 
ATOM   2030 C CA  . ILE A 1 266 ? 22.021  -22.875 32.333  1.00 17.83  ? 301 ILE A CA  1 
ATOM   2031 C C   . ILE A 1 266 ? 20.714  -23.566 32.706  1.00 17.83  ? 301 ILE A C   1 
ATOM   2032 O O   . ILE A 1 266 ? 20.556  -24.074 33.822  1.00 17.83  ? 301 ILE A O   1 
ATOM   2033 C CB  . ILE A 1 266 ? 23.173  -23.654 32.905  1.00 1.00   ? 301 ILE A CB  1 
ATOM   2034 C CG1 . ILE A 1 266 ? 24.451  -22.819 32.823  1.00 1.00   ? 301 ILE A CG1 1 
ATOM   2035 C CG2 . ILE A 1 266 ? 23.324  -24.946 32.131  1.00 1.00   ? 301 ILE A CG2 1 
ATOM   2036 C CD1 . ILE A 1 266 ? 25.662  -23.477 33.459  1.00 11.33  ? 301 ILE A CD1 1 
ATOM   2037 N N   . PRO A 1 267 ? 19.757  -23.597 31.768  1.00 24.48  ? 302 PRO A N   1 
ATOM   2038 C CA  . PRO A 1 267 ? 18.447  -24.219 32.000  1.00 24.48  ? 302 PRO A CA  1 
ATOM   2039 C C   . PRO A 1 267 ? 18.472  -25.746 32.168  1.00 24.48  ? 302 PRO A C   1 
ATOM   2040 O O   . PRO A 1 267 ? 19.142  -26.475 31.417  1.00 24.48  ? 302 PRO A O   1 
ATOM   2041 C CB  . PRO A 1 267 ? 17.648  -23.836 30.757  1.00 1.00   ? 302 PRO A CB  1 
ATOM   2042 C CG  . PRO A 1 267 ? 18.362  -22.667 30.195  1.00 1.00   ? 302 PRO A CG  1 
ATOM   2043 C CD  . PRO A 1 267 ? 19.805  -23.032 30.412  1.00 1.00   ? 302 PRO A CD  1 
ATOM   2044 N N   . PHE A 1 268 ? 17.736  -26.231 33.161  1.00 8.07   ? 303 PHE A N   1 
ATOM   2045 C CA  . PHE A 1 268 ? 17.692  -27.660 33.404  1.00 8.07   ? 303 PHE A CA  1 
ATOM   2046 C C   . PHE A 1 268 ? 16.283  -28.168 33.637  1.00 8.07   ? 303 PHE A C   1 
ATOM   2047 O O   . PHE A 1 268 ? 15.392  -27.419 34.018  1.00 8.07   ? 303 PHE A O   1 
ATOM   2048 C CB  . PHE A 1 268 ? 18.579  -28.036 34.591  1.00 6.28   ? 303 PHE A CB  1 
ATOM   2049 C CG  . PHE A 1 268 ? 17.983  -27.700 35.924  1.00 6.28   ? 303 PHE A CG  1 
ATOM   2050 C CD1 . PHE A 1 268 ? 17.024  -28.526 36.497  1.00 6.28   ? 303 PHE A CD1 1 
ATOM   2051 C CD2 . PHE A 1 268 ? 18.366  -26.552 36.596  1.00 6.28   ? 303 PHE A CD2 1 
ATOM   2052 C CE1 . PHE A 1 268 ? 16.451  -28.214 37.716  1.00 6.28   ? 303 PHE A CE1 1 
ATOM   2053 C CE2 . PHE A 1 268 ? 17.799  -26.225 37.822  1.00 6.28   ? 303 PHE A CE2 1 
ATOM   2054 C CZ  . PHE A 1 268 ? 16.839  -27.057 38.384  1.00 6.28   ? 303 PHE A CZ  1 
ATOM   2055 N N   . SER A 1 269 ? 16.105  -29.453 33.373  1.00 34.89  ? 304 SER A N   1 
ATOM   2056 C CA  . SER A 1 269 ? 14.846  -30.154 33.583  1.00 34.89  ? 304 SER A CA  1 
ATOM   2057 C C   . SER A 1 269 ? 15.223  -31.530 34.153  1.00 34.89  ? 304 SER A C   1 
ATOM   2058 O O   . SER A 1 269 ? 16.114  -32.239 33.644  1.00 34.89  ? 304 SER A O   1 
ATOM   2059 C CB  . SER A 1 269 ? 14.110  -30.332 32.261  1.00 19.21  ? 304 SER A CB  1 
ATOM   2060 O OG  . SER A 1 269 ? 13.871  -29.080 31.650  1.00 19.21  ? 304 SER A OG  1 
ATOM   2061 N N   . VAL A 1 270 ? 14.562  -31.881 35.245  1.00 31.26  ? 305 VAL A N   1 
ATOM   2062 C CA  . VAL A 1 270 ? 14.826  -33.130 35.927  1.00 31.26  ? 305 VAL A CA  1 
ATOM   2063 C C   . VAL A 1 270 ? 13.513  -33.790 36.332  1.00 31.26  ? 305 VAL A C   1 
ATOM   2064 O O   . VAL A 1 270 ? 12.543  -33.114 36.654  1.00 31.26  ? 305 VAL A O   1 
ATOM   2065 C CB  . VAL A 1 270 ? 15.727  -32.895 37.164  1.00 10.15  ? 305 VAL A CB  1 
ATOM   2066 C CG1 . VAL A 1 270 ? 14.967  -32.129 38.231  1.00 10.15  ? 305 VAL A CG1 1 
ATOM   2067 C CG2 . VAL A 1 270 ? 16.235  -34.217 37.686  1.00 10.15  ? 305 VAL A CG2 1 
ATOM   2068 N N   . ASP A 1 271 ? 13.471  -35.111 36.273  1.00 34.31  ? 306 ASP A N   1 
ATOM   2069 C CA  . ASP A 1 271 ? 12.281  -35.823 36.687  1.00 34.31  ? 306 ASP A CA  1 
ATOM   2070 C C   . ASP A 1 271 ? 12.741  -36.925 37.624  1.00 34.31  ? 306 ASP A C   1 
ATOM   2071 O O   . ASP A 1 271 ? 13.947  -37.117 37.837  1.00 34.31  ? 306 ASP A O   1 
ATOM   2072 C CB  . ASP A 1 271 ? 11.478  -36.403 35.524  1.00 55.17  ? 306 ASP A CB  1 
ATOM   2073 C CG  . ASP A 1 271 ? 9.980   -36.548 35.866  1.00 55.17  ? 306 ASP A CG  1 
ATOM   2074 O OD1 . ASP A 1 271 ? 9.655   -36.642 37.064  1.00 55.17  ? 306 ASP A OD1 1 
ATOM   2075 O OD2 . ASP A 1 271 ? 9.128   -36.581 34.952  1.00 55.17  ? 306 ASP A OD2 1 
ATOM   2076 N N   . GLY A 1 272 ? 11.772  -37.635 38.188  1.00 22.61  ? 307 GLY A N   1 
ATOM   2077 C CA  . GLY A 1 272 ? 12.071  -38.700 39.124  1.00 22.61  ? 307 GLY A CA  1 
ATOM   2078 C C   . GLY A 1 272 ? 11.187  -38.543 40.344  1.00 22.61  ? 307 GLY A C   1 
ATOM   2079 O O   . GLY A 1 272 ? 10.682  -37.455 40.621  1.00 22.61  ? 307 GLY A O   1 
ATOM   2080 N N   . GLN A 1 273 ? 10.983  -39.646 41.051  1.00 26.03  ? 308 GLN A N   1 
ATOM   2081 C CA  . GLN A 1 273 ? 10.162  -39.681 42.260  1.00 26.03  ? 308 GLN A CA  1 
ATOM   2082 C C   . GLN A 1 273 ? 10.611  -40.917 43.064  1.00 26.03  ? 308 GLN A C   1 
ATOM   2083 O O   . GLN A 1 273 ? 10.486  -42.060 42.612  1.00 26.03  ? 308 GLN A O   1 
ATOM   2084 C CB  . GLN A 1 273 ? 8.672   -39.813 41.921  1.00 87.65  ? 308 GLN A CB  1 
ATOM   2085 C CG  . GLN A 1 273 ? 7.830   -40.400 43.052  1.00 87.65  ? 308 GLN A CG  1 
ATOM   2086 C CD  . GLN A 1 273 ? 7.902   -39.593 44.339  1.00 87.65  ? 308 GLN A CD  1 
ATOM   2087 O OE1 . GLN A 1 273 ? 7.455   -40.048 45.394  1.00 87.65  ? 308 GLN A OE1 1 
ATOM   2088 N NE2 . GLN A 1 273 ? 8.457   -38.388 44.257  1.00 87.65  ? 308 GLN A NE2 1 
ATOM   2089 N N   . PRO A 1 274 ? 11.170  -40.699 44.259  1.00 14.79  ? 309 PRO A N   1 
ATOM   2090 C CA  . PRO A 1 274 ? 11.406  -39.408 44.920  1.00 14.79  ? 309 PRO A CA  1 
ATOM   2091 C C   . PRO A 1 274 ? 12.146  -38.409 44.053  1.00 14.79  ? 309 PRO A C   1 
ATOM   2092 O O   . PRO A 1 274 ? 12.925  -38.794 43.169  1.00 14.79  ? 309 PRO A O   1 
ATOM   2093 C CB  . PRO A 1 274 ? 12.210  -39.799 46.150  1.00 59.64  ? 309 PRO A CB  1 
ATOM   2094 C CG  . PRO A 1 274 ? 11.643  -41.120 46.489  1.00 59.64  ? 309 PRO A CG  1 
ATOM   2095 C CD  . PRO A 1 274 ? 11.573  -41.801 45.142  1.00 59.64  ? 309 PRO A CD  1 
ATOM   2096 N N   . ALA A 1 275 ? 11.910  -37.125 44.309  1.00 9.17   ? 310 ALA A N   1 
ATOM   2097 C CA  . ALA A 1 275 ? 12.565  -36.091 43.537  1.00 9.17   ? 310 ALA A CA  1 
ATOM   2098 C C   . ALA A 1 275 ? 14.054  -36.203 43.779  1.00 9.17   ? 310 ALA A C   1 
ATOM   2099 O O   . ALA A 1 275 ? 14.489  -36.336 44.921  1.00 9.17   ? 310 ALA A O   1 
ATOM   2100 C CB  . ALA A 1 275 ? 12.072  -34.724 43.974  1.00 56.97  ? 310 ALA A CB  1 
ATOM   2101 N N   . PRO A 1 276 ? 14.861  -36.178 42.697  1.00 22.18  ? 311 PRO A N   1 
ATOM   2102 C CA  . PRO A 1 276 ? 16.319  -36.276 42.820  1.00 22.18  ? 311 PRO A CA  1 
ATOM   2103 C C   . PRO A 1 276 ? 16.939  -35.053 43.478  1.00 22.18  ? 311 PRO A C   1 
ATOM   2104 O O   . PRO A 1 276 ? 16.360  -33.960 43.488  1.00 22.18  ? 311 PRO A O   1 
ATOM   2105 C CB  . PRO A 1 276 ? 16.767  -36.461 41.372  1.00 29.15  ? 311 PRO A CB  1 
ATOM   2106 C CG  . PRO A 1 276 ? 15.753  -35.690 40.616  1.00 29.15  ? 311 PRO A CG  1 
ATOM   2107 C CD  . PRO A 1 276 ? 14.467  -36.111 41.280  1.00 29.15  ? 311 PRO A CD  1 
ATOM   2108 N N   . SER A 1 277 ? 18.116  -35.262 44.043  1.00 22.41  ? 312 SER A N   1 
ATOM   2109 C CA  . SER A 1 277 ? 18.860  -34.207 44.677  1.00 22.41  ? 312 SER A CA  1 
ATOM   2110 C C   . SER A 1 277 ? 19.793  -33.740 43.587  1.00 22.41  ? 312 SER A C   1 
ATOM   2111 O O   . SER A 1 277 ? 20.379  -34.566 42.889  1.00 22.41  ? 312 SER A O   1 
ATOM   2112 C CB  . SER A 1 277 ? 19.663  -34.764 45.854  1.00 60.19  ? 312 SER A CB  1 
ATOM   2113 O OG  . SER A 1 277 ? 18.835  -35.513 46.727  1.00 60.19  ? 312 SER A OG  1 
ATOM   2114 N N   . LEU A 1 278 ? 19.924  -32.428 43.434  1.00 18.26  ? 313 LEU A N   1 
ATOM   2115 C CA  . LEU A 1 278 ? 20.786  -31.870 42.409  1.00 18.26  ? 313 LEU A CA  1 
ATOM   2116 C C   . LEU A 1 278 ? 22.190  -31.571 42.933  1.00 18.26  ? 313 LEU A C   1 
ATOM   2117 O O   . LEU A 1 278 ? 22.375  -31.285 44.115  1.00 18.26  ? 313 LEU A O   1 
ATOM   2118 C CB  . LEU A 1 278 ? 20.154  -30.621 41.798  1.00 26.77  ? 313 LEU A CB  1 
ATOM   2119 C CG  . LEU A 1 278 ? 18.811  -30.869 41.091  1.00 26.77  ? 313 LEU A CG  1 
ATOM   2120 C CD1 . LEU A 1 278 ? 18.465  -29.640 40.242  1.00 26.77  ? 313 LEU A CD1 1 
ATOM   2121 C CD2 . LEU A 1 278 ? 18.883  -32.132 40.211  1.00 26.77  ? 313 LEU A CD2 1 
ATOM   2122 N N   . ARG A 1 279 ? 23.171  -31.637 42.034  1.00 8.46   ? 314 ARG A N   1 
ATOM   2123 C CA  . ARG A 1 279 ? 24.576  -31.416 42.366  1.00 8.46   ? 314 ARG A CA  1 
ATOM   2124 C C   . ARG A 1 279 ? 25.260  -30.985 41.085  1.00 8.46   ? 314 ARG A C   1 
ATOM   2125 O O   . ARG A 1 279 ? 25.046  -31.601 40.044  1.00 8.46   ? 314 ARG A O   1 
ATOM   2126 C CB  . ARG A 1 279 ? 25.231  -32.688 42.906  1.00 174.40 ? 314 ARG A CB  1 
ATOM   2127 C CG  . ARG A 1 279 ? 26.633  -32.445 43.448  1.00 174.40 ? 314 ARG A CG  1 
ATOM   2128 C CD  . ARG A 1 279 ? 27.289  -33.714 43.963  1.00 174.40 ? 314 ARG A CD  1 
ATOM   2129 N NE  . ARG A 1 279 ? 27.565  -34.667 42.892  1.00 174.40 ? 314 ARG A NE  1 
ATOM   2130 C CZ  . ARG A 1 279 ? 28.233  -35.805 43.060  1.00 174.40 ? 314 ARG A CZ  1 
ATOM   2131 N NH1 . ARG A 1 279 ? 28.698  -36.135 44.258  1.00 174.40 ? 314 ARG A NH1 1 
ATOM   2132 N NH2 . ARG A 1 279 ? 28.438  -36.615 42.030  1.00 174.40 ? 314 ARG A NH2 1 
ATOM   2133 N N   . TRP A 1 280 ? 26.072  -29.937 41.140  1.00 24.83  ? 315 TRP A N   1 
ATOM   2134 C CA  . TRP A 1 280 ? 26.775  -29.506 39.934  1.00 24.83  ? 315 TRP A CA  1 
ATOM   2135 C C   . TRP A 1 280 ? 28.272  -29.774 40.034  1.00 24.83  ? 315 TRP A C   1 
ATOM   2136 O O   . TRP A 1 280 ? 28.857  -29.866 41.119  1.00 24.83  ? 315 TRP A O   1 
ATOM   2137 C CB  . TRP A 1 280 ? 26.567  -28.011 39.682  1.00 13.40  ? 315 TRP A CB  1 
ATOM   2138 C CG  . TRP A 1 280 ? 25.193  -27.643 39.242  1.00 13.40  ? 315 TRP A CG  1 
ATOM   2139 C CD1 . TRP A 1 280 ? 24.108  -27.436 40.035  1.00 13.40  ? 315 TRP A CD1 1 
ATOM   2140 C CD2 . TRP A 1 280 ? 24.753  -27.447 37.896  1.00 13.40  ? 315 TRP A CD2 1 
ATOM   2141 N NE1 . TRP A 1 280 ? 23.017  -27.121 39.269  1.00 13.40  ? 315 TRP A NE1 1 
ATOM   2142 C CE2 . TRP A 1 280 ? 23.385  -27.122 37.950  1.00 13.40  ? 315 TRP A CE2 1 
ATOM   2143 C CE3 . TRP A 1 280 ? 25.384  -27.516 36.647  1.00 13.40  ? 315 TRP A CE3 1 
ATOM   2144 C CZ2 . TRP A 1 280 ? 22.632  -26.864 36.803  1.00 13.40  ? 315 TRP A CZ2 1 
ATOM   2145 C CZ3 . TRP A 1 280 ? 24.637  -27.260 35.507  1.00 13.40  ? 315 TRP A CZ3 1 
ATOM   2146 C CH2 . TRP A 1 280 ? 23.274  -26.938 35.593  1.00 13.40  ? 315 TRP A CH2 1 
ATOM   2147 N N   . LEU A 1 281 ? 28.881  -29.895 38.866  1.00 56.79  ? 316 LEU A N   1 
ATOM   2148 C CA  . LEU A 1 281 ? 30.293  -30.124 38.754  1.00 56.79  ? 316 LEU A CA  1 
ATOM   2149 C C   . LEU A 1 281 ? 30.734  -29.149 37.693  1.00 56.79  ? 316 LEU A C   1 
ATOM   2150 O O   . LEU A 1 281 ? 30.007  -28.891 36.722  1.00 56.79  ? 316 LEU A O   1 
ATOM   2151 C CB  . LEU A 1 281 ? 30.593  -31.548 38.278  1.00 34.17  ? 316 LEU A CB  1 
ATOM   2152 C CG  . LEU A 1 281 ? 30.232  -32.735 39.174  1.00 34.17  ? 316 LEU A CG  1 
ATOM   2153 C CD1 . LEU A 1 281 ? 30.568  -34.024 38.438  1.00 34.17  ? 316 LEU A CD1 1 
ATOM   2154 C CD2 . LEU A 1 281 ? 30.987  -32.665 40.497  1.00 34.17  ? 316 LEU A CD2 1 
ATOM   2155 N N   . PHE A 1 282 ? 31.898  -28.555 37.911  1.00 74.89  ? 317 PHE A N   1 
ATOM   2156 C CA  . PHE A 1 282 ? 32.448  -27.641 36.934  1.00 74.89  ? 317 PHE A CA  1 
ATOM   2157 C C   . PHE A 1 282 ? 33.753  -28.311 36.547  1.00 74.89  ? 317 PHE A C   1 
ATOM   2158 O O   . PHE A 1 282 ? 34.630  -28.510 37.383  1.00 74.89  ? 317 PHE A O   1 
ATOM   2159 C CB  . PHE A 1 282 ? 32.741  -26.268 37.535  1.00 47.38  ? 317 PHE A CB  1 
ATOM   2160 C CG  . PHE A 1 282 ? 33.407  -25.316 36.566  1.00 47.38  ? 317 PHE A CG  1 
ATOM   2161 C CD1 . PHE A 1 282 ? 33.028  -25.282 35.226  1.00 47.38  ? 317 PHE A CD1 1 
ATOM   2162 C CD2 . PHE A 1 282 ? 34.382  -24.428 36.996  1.00 47.38  ? 317 PHE A CD2 1 
ATOM   2163 C CE1 . PHE A 1 282 ? 33.607  -24.383 34.341  1.00 47.38  ? 317 PHE A CE1 1 
ATOM   2164 C CE2 . PHE A 1 282 ? 34.963  -23.523 36.106  1.00 47.38  ? 317 PHE A CE2 1 
ATOM   2165 C CZ  . PHE A 1 282 ? 34.570  -23.505 34.781  1.00 47.38  ? 317 PHE A CZ  1 
ATOM   2166 N N   . ASN A 1 283 ? 33.849  -28.687 35.280  1.00 65.80  ? 318 ASN A N   1 
ATOM   2167 C CA  . ASN A 1 283 ? 35.015  -29.383 34.750  1.00 65.80  ? 318 ASN A CA  1 
ATOM   2168 C C   . ASN A 1 283 ? 35.320  -30.684 35.533  1.00 65.80  ? 318 ASN A C   1 
ATOM   2169 O O   . ASN A 1 283 ? 36.479  -31.039 35.776  1.00 65.80  ? 318 ASN A O   1 
ATOM   2170 C CB  . ASN A 1 283 ? 36.239  -28.473 34.738  1.00 44.84  ? 318 ASN A CB  1 
ATOM   2171 C CG  . ASN A 1 283 ? 36.231  -27.501 33.561  1.00 44.84  ? 318 ASN A CG  1 
ATOM   2172 O OD1 . ASN A 1 283 ? 35.844  -27.861 32.446  1.00 44.84  ? 318 ASN A OD1 1 
ATOM   2173 N ND2 . ASN A 1 283 ? 36.682  -26.269 33.801  1.00 44.84  ? 318 ASN A ND2 1 
ATOM   2174 N N   . GLY A 1 284 ? 34.256  -31.386 35.918  1.00 82.67  ? 319 GLY A N   1 
ATOM   2175 C CA  . GLY A 1 284 ? 34.413  -32.655 36.611  1.00 82.67  ? 319 GLY A CA  1 
ATOM   2176 C C   . GLY A 1 284 ? 34.579  -32.610 38.116  1.00 82.67  ? 319 GLY A C   1 
ATOM   2177 O O   . GLY A 1 284 ? 34.597  -33.651 38.786  1.00 82.67  ? 319 GLY A O   1 
ATOM   2178 N N   . SER A 1 285 ? 34.709  -31.412 38.659  1.00 55.27  ? 320 SER A N   1 
ATOM   2179 C CA  . SER A 1 285 ? 34.877  -31.290 40.090  1.00 55.27  ? 320 SER A CA  1 
ATOM   2180 C C   . SER A 1 285 ? 33.726  -30.496 40.628  1.00 55.27  ? 320 SER A C   1 
ATOM   2181 O O   . SER A 1 285 ? 33.239  -29.582 39.968  1.00 55.27  ? 320 SER A O   1 
ATOM   2182 C CB  . SER A 1 285 ? 36.197  -30.584 40.405  1.00 125.69 ? 320 SER A CB  1 
ATOM   2183 O OG  . SER A 1 285 ? 36.397  -30.481 41.802  1.00 125.69 ? 320 SER A OG  1 
ATOM   2184 N N   . VAL A 1 286 ? 33.310  -30.839 41.839  1.00 29.00  ? 321 VAL A N   1 
ATOM   2185 C CA  . VAL A 1 286 ? 32.190  -30.181 42.497  1.00 29.00  ? 321 VAL A CA  1 
ATOM   2186 C C   . VAL A 1 286 ? 32.199  -28.657 42.484  1.00 29.00  ? 321 VAL A C   1 
ATOM   2187 O O   . VAL A 1 286 ? 33.215  -28.026 42.771  1.00 29.00  ? 321 VAL A O   1 
ATOM   2188 C CB  . VAL A 1 286 ? 32.083  -30.661 43.981  1.00 57.77  ? 321 VAL A CB  1 
ATOM   2189 C CG1 . VAL A 1 286 ? 32.708  -32.042 44.131  1.00 57.77  ? 321 VAL A CG1 1 
ATOM   2190 C CG2 . VAL A 1 286 ? 32.759  -29.676 44.920  1.00 57.77  ? 321 VAL A CG2 1 
ATOM   2191 N N   . LEU A 1 287 ? 31.040  -28.085 42.160  1.00 39.07  ? 322 LEU A N   1 
ATOM   2192 C CA  . LEU A 1 287 ? 30.848  -26.640 42.112  1.00 39.07  ? 322 LEU A CA  1 
ATOM   2193 C C   . LEU A 1 287 ? 30.100  -26.254 43.383  1.00 39.07  ? 322 LEU A C   1 
ATOM   2194 O O   . LEU A 1 287 ? 28.982  -26.702 43.610  1.00 39.07  ? 322 LEU A O   1 
ATOM   2195 C CB  . LEU A 1 287 ? 30.013  -26.268 40.887  1.00 16.47  ? 322 LEU A CB  1 
ATOM   2196 C CG  . LEU A 1 287 ? 29.528  -24.823 40.822  1.00 16.47  ? 322 LEU A CG  1 
ATOM   2197 C CD1 . LEU A 1 287 ? 30.719  -23.878 40.868  1.00 16.47  ? 322 LEU A CD1 1 
ATOM   2198 C CD2 . LEU A 1 287 ? 28.720  -24.618 39.551  1.00 16.47  ? 322 LEU A CD2 1 
ATOM   2199 N N   . ASN A 1 288 ? 30.727  -25.447 44.231  1.00 68.23  ? 323 ASN A N   1 
ATOM   2200 C CA  . ASN A 1 288 ? 30.072  -25.009 45.460  1.00 68.23  ? 323 ASN A CA  1 
ATOM   2201 C C   . ASN A 1 288 ? 29.238  -23.781 45.137  1.00 68.23  ? 323 ASN A C   1 
ATOM   2202 O O   . ASN A 1 288 ? 29.752  -22.786 44.621  1.00 68.23  ? 323 ASN A O   1 
ATOM   2203 C CB  . ASN A 1 288 ? 31.107  -24.663 46.532  1.00 168.32 ? 323 ASN A CB  1 
ATOM   2204 C CG  . ASN A 1 288 ? 31.899  -25.870 46.988  1.00 168.32 ? 323 ASN A CG  1 
ATOM   2205 O OD1 . ASN A 1 288 ? 31.332  -26.865 47.437  1.00 168.32 ? 323 ASN A OD1 1 
ATOM   2206 N ND2 . ASN A 1 288 ? 33.220  -25.786 46.881  1.00 168.32 ? 323 ASN A ND2 1 
ATOM   2207 N N   . GLU A 1 289 ? 27.947  -23.853 45.419  1.00 73.54  ? 324 GLU A N   1 
ATOM   2208 C CA  . GLU A 1 289 ? 27.094  -22.723 45.142  1.00 73.54  ? 324 GLU A CA  1 
ATOM   2209 C C   . GLU A 1 289 ? 27.387  -21.619 46.139  1.00 73.54  ? 324 GLU A C   1 
ATOM   2210 O O   . GLU A 1 289 ? 27.765  -21.879 47.285  1.00 73.54  ? 324 GLU A O   1 
ATOM   2211 C CB  . GLU A 1 289 ? 25.626  -23.148 45.256  1.00 77.61  ? 324 GLU A CB  1 
ATOM   2212 C CG  . GLU A 1 289 ? 25.184  -24.148 44.200  1.00 77.61  ? 324 GLU A CG  1 
ATOM   2213 C CD  . GLU A 1 289 ? 23.795  -24.710 44.476  1.00 77.61  ? 324 GLU A CD  1 
ATOM   2214 O OE1 . GLU A 1 289 ? 22.897  -23.923 44.857  1.00 77.61  ? 324 GLU A OE1 1 
ATOM   2215 O OE2 . GLU A 1 289 ? 23.601  -25.938 44.305  1.00 77.61  ? 324 GLU A OE2 1 
ATOM   2216 N N   . THR A 1 290 ? 27.251  -20.388 45.666  1.00 74.99  ? 325 THR A N   1 
ATOM   2217 C CA  . THR A 1 290 ? 27.474  -19.200 46.461  1.00 74.99  ? 325 THR A CA  1 
ATOM   2218 C C   . THR A 1 290 ? 26.319  -18.303 46.075  1.00 74.99  ? 325 THR A C   1 
ATOM   2219 O O   . THR A 1 290 ? 25.427  -18.714 45.341  1.00 74.99  ? 325 THR A O   1 
ATOM   2220 C CB  . THR A 1 290 ? 28.791  -18.504 46.074  1.00 66.45  ? 325 THR A CB  1 
ATOM   2221 O OG1 . THR A 1 290 ? 28.687  -17.998 44.737  1.00 66.45  ? 325 THR A OG1 1 
ATOM   2222 C CG2 . THR A 1 290 ? 29.950  -19.484 46.137  1.00 66.45  ? 325 THR A CG2 1 
ATOM   2223 N N   . SER A 1 291 ? 26.347  -17.067 46.535  1.00 51.91  ? 326 SER A N   1 
ATOM   2224 C CA  . SER A 1 291 ? 25.274  -16.156 46.202  1.00 51.91  ? 326 SER A CA  1 
ATOM   2225 C C   . SER A 1 291 ? 25.309  -15.727 44.736  1.00 51.91  ? 326 SER A C   1 
ATOM   2226 O O   . SER A 1 291 ? 24.339  -15.154 44.238  1.00 51.91  ? 326 SER A O   1 
ATOM   2227 C CB  . SER A 1 291 ? 25.349  -14.923 47.096  1.00 45.91  ? 326 SER A CB  1 
ATOM   2228 O OG  . SER A 1 291 ? 26.650  -14.373 47.064  1.00 45.91  ? 326 SER A OG  1 
ATOM   2229 N N   . PHE A 1 292 ? 26.407  -16.016 44.039  1.00 11.10  ? 327 PHE A N   1 
ATOM   2230 C CA  . PHE A 1 292 ? 26.555  -15.622 42.628  1.00 11.10  ? 327 PHE A CA  1 
ATOM   2231 C C   . PHE A 1 292 ? 26.378  -16.761 41.646  1.00 11.10  ? 327 PHE A C   1 
ATOM   2232 O O   . PHE A 1 292 ? 26.075  -16.532 40.471  1.00 11.10  ? 327 PHE A O   1 
ATOM   2233 C CB  . PHE A 1 292 ? 27.913  -14.967 42.412  1.00 37.92  ? 327 PHE A CB  1 
ATOM   2234 C CG  . PHE A 1 292 ? 28.097  -13.701 43.188  1.00 37.92  ? 327 PHE A CG  1 
ATOM   2235 C CD1 . PHE A 1 292 ? 27.292  -12.598 42.939  1.00 37.92  ? 327 PHE A CD1 1 
ATOM   2236 C CD2 . PHE A 1 292 ? 29.063  -13.615 44.185  1.00 37.92  ? 327 PHE A CD2 1 
ATOM   2237 C CE1 . PHE A 1 292 ? 27.442  -11.427 43.672  1.00 37.92  ? 327 PHE A CE1 1 
ATOM   2238 C CE2 . PHE A 1 292 ? 29.222  -12.448 44.926  1.00 37.92  ? 327 PHE A CE2 1 
ATOM   2239 C CZ  . PHE A 1 292 ? 28.406  -11.351 44.667  1.00 37.92  ? 327 PHE A CZ  1 
ATOM   2240 N N   . ILE A 1 293 ? 26.597  -17.983 42.120  1.00 44.60  ? 328 ILE A N   1 
ATOM   2241 C CA  . ILE A 1 293 ? 26.406  -19.169 41.290  1.00 44.60  ? 328 ILE A CA  1 
ATOM   2242 C C   . ILE A 1 293 ? 25.592  -20.105 42.146  1.00 44.60  ? 328 ILE A C   1 
ATOM   2243 O O   . ILE A 1 293 ? 26.111  -20.699 43.086  1.00 44.60  ? 328 ILE A O   1 
ATOM   2244 C CB  . ILE A 1 293 ? 27.746  -19.827 40.917  1.00 29.34  ? 328 ILE A CB  1 
ATOM   2245 C CG1 . ILE A 1 293 ? 28.591  -18.847 40.103  1.00 29.34  ? 328 ILE A CG1 1 
ATOM   2246 C CG2 . ILE A 1 293 ? 27.497  -21.088 40.110  1.00 29.34  ? 328 ILE A CG2 1 
ATOM   2247 C CD1 . ILE A 1 293 ? 29.910  -19.412 39.637  1.00 43.90  ? 328 ILE A CD1 1 
ATOM   2248 N N   . PHE A 1 294 ? 24.306  -20.221 41.827  1.00 9.28   ? 329 PHE A N   1 
ATOM   2249 C CA  . PHE A 1 294 ? 23.416  -21.072 42.603  1.00 9.28   ? 329 PHE A CA  1 
ATOM   2250 C C   . PHE A 1 294 ? 22.347  -21.707 41.749  1.00 9.28   ? 329 PHE A C   1 
ATOM   2251 O O   . PHE A 1 294 ? 22.010  -21.186 40.705  1.00 9.28   ? 329 PHE A O   1 
ATOM   2252 C CB  . PHE A 1 294 ? 22.760  -20.255 43.712  1.00 46.13  ? 329 PHE A CB  1 
ATOM   2253 C CG  . PHE A 1 294 ? 22.073  -19.015 43.221  1.00 46.13  ? 329 PHE A CG  1 
ATOM   2254 C CD1 . PHE A 1 294 ? 22.807  -17.908 42.841  1.00 46.13  ? 329 PHE A CD1 1 
ATOM   2255 C CD2 . PHE A 1 294 ? 20.688  -18.961 43.128  1.00 46.13  ? 329 PHE A CD2 1 
ATOM   2256 C CE1 . PHE A 1 294 ? 22.173  -16.766 42.377  1.00 46.13  ? 329 PHE A CE1 1 
ATOM   2257 C CE2 . PHE A 1 294 ? 20.047  -17.824 42.667  1.00 46.13  ? 329 PHE A CE2 1 
ATOM   2258 C CZ  . PHE A 1 294 ? 20.792  -16.725 42.291  1.00 46.13  ? 329 PHE A CZ  1 
ATOM   2259 N N   . THR A 1 295 ? 21.800  -22.823 42.219  1.00 24.38  ? 330 THR A N   1 
ATOM   2260 C CA  . THR A 1 295 ? 20.750  -23.535 41.491  1.00 24.38  ? 330 THR A CA  1 
ATOM   2261 C C   . THR A 1 295 ? 19.405  -22.907 41.828  1.00 24.38  ? 330 THR A C   1 
ATOM   2262 O O   . THR A 1 295 ? 19.146  -22.555 42.972  1.00 24.38  ? 330 THR A O   1 
ATOM   2263 C CB  . THR A 1 295 ? 20.713  -25.022 41.887  1.00 138.13 ? 330 THR A CB  1 
ATOM   2264 O OG1 . THR A 1 295 ? 21.946  -25.647 41.512  1.00 138.13 ? 330 THR A OG1 1 
ATOM   2265 C CG2 . THR A 1 295 ? 19.558  -25.730 41.197  1.00 138.13 ? 330 THR A CG2 1 
ATOM   2266 N N   . GLU A 1 296 ? 18.540  -22.783 40.830  1.00 25.49  ? 331 GLU A N   1 
ATOM   2267 C CA  . GLU A 1 296 ? 17.235  -22.200 41.071  1.00 25.49  ? 331 GLU A CA  1 
ATOM   2268 C C   . GLU A 1 296 ? 16.096  -22.886 40.333  1.00 25.49  ? 331 GLU A C   1 
ATOM   2269 O O   . GLU A 1 296 ? 16.115  -23.041 39.123  1.00 25.49  ? 331 GLU A O   1 
ATOM   2270 C CB  . GLU A 1 296 ? 17.204  -20.699 40.780  1.00 56.38  ? 331 GLU A CB  1 
ATOM   2271 C CG  . GLU A 1 296 ? 15.794  -20.120 40.990  1.00 56.38  ? 331 GLU A CG  1 
ATOM   2272 C CD  . GLU A 1 296 ? 15.767  -18.635 41.346  1.00 56.38  ? 331 GLU A CD  1 
ATOM   2273 O OE1 . GLU A 1 296 ? 16.154  -17.801 40.498  1.00 56.38  ? 331 GLU A OE1 1 
ATOM   2274 O OE2 . GLU A 1 296 ? 15.344  -18.308 42.480  1.00 56.38  ? 331 GLU A OE2 1 
ATOM   2275 N N   . PHE A 1 297 ? 15.087  -23.268 41.099  1.00 9.69   ? 332 PHE A N   1 
ATOM   2276 C CA  . PHE A 1 297 ? 13.918  -23.961 40.586  1.00 9.69   ? 332 PHE A CA  1 
ATOM   2277 C C   . PHE A 1 297 ? 12.772  -22.990 40.330  1.00 9.69   ? 332 PHE A C   1 
ATOM   2278 O O   . PHE A 1 297 ? 12.593  -22.016 41.066  1.00 9.69   ? 332 PHE A O   1 
ATOM   2279 C CB  . PHE A 1 297 ? 13.378  -24.998 41.585  1.00 25.18  ? 332 PHE A CB  1 
ATOM   2280 C CG  . PHE A 1 297 ? 14.224  -26.230 41.736  1.00 25.18  ? 332 PHE A CG  1 
ATOM   2281 C CD1 . PHE A 1 297 ? 15.361  -26.221 42.535  1.00 25.18  ? 332 PHE A CD1 1 
ATOM   2282 C CD2 . PHE A 1 297 ? 13.863  -27.411 41.106  1.00 25.18  ? 332 PHE A CD2 1 
ATOM   2283 C CE1 . PHE A 1 297 ? 16.123  -27.374 42.705  1.00 25.18  ? 332 PHE A CE1 1 
ATOM   2284 C CE2 . PHE A 1 297 ? 14.618  -28.571 41.269  1.00 25.18  ? 332 PHE A CE2 1 
ATOM   2285 C CZ  . PHE A 1 297 ? 15.751  -28.553 42.071  1.00 25.18  ? 332 PHE A CZ  1 
ATOM   2286 N N   . LEU A 1 298 ? 11.982  -23.268 39.302  1.00 12.98  ? 333 LEU A N   1 
ATOM   2287 C CA  . LEU A 1 298 ? 10.814  -22.454 39.038  1.00 12.98  ? 333 LEU A CA  1 
ATOM   2288 C C   . LEU A 1 298 ? 9.715   -23.091 39.913  1.00 12.98  ? 333 LEU A C   1 
ATOM   2289 O O   . LEU A 1 298 ? 9.885   -24.204 40.437  1.00 12.98  ? 333 LEU A O   1 
ATOM   2290 C CB  . LEU A 1 298 ? 10.441  -22.555 37.565  1.00 26.32  ? 333 LEU A CB  1 
ATOM   2291 C CG  . LEU A 1 298 ? 11.441  -21.929 36.578  1.00 26.32  ? 333 LEU A CG  1 
ATOM   2292 C CD1 . LEU A 1 298 ? 11.239  -22.483 35.161  1.00 26.32  ? 333 LEU A CD1 1 
ATOM   2293 C CD2 . LEU A 1 298 ? 11.274  -20.409 36.593  1.00 26.32  ? 333 LEU A CD2 1 
ATOM   2294 N N   . GLU A 1 299 ? 8.608   -22.375 40.085  1.00 37.03  ? 334 GLU A N   1 
ATOM   2295 C CA  . GLU A 1 299 ? 7.478   -22.863 40.869  1.00 37.03  ? 334 GLU A CA  1 
ATOM   2296 C C   . GLU A 1 299 ? 7.021   -24.217 40.285  1.00 37.03  ? 334 GLU A C   1 
ATOM   2297 O O   . GLU A 1 299 ? 7.015   -24.411 39.063  1.00 37.03  ? 334 GLU A O   1 
ATOM   2298 C CB  . GLU A 1 299 ? 6.327   -21.856 40.802  1.00 172.17 ? 334 GLU A CB  1 
ATOM   2299 C CG  . GLU A 1 299 ? 5.247   -22.061 41.849  1.00 172.17 ? 334 GLU A CG  1 
ATOM   2300 C CD  . GLU A 1 299 ? 5.733   -21.749 43.251  1.00 172.17 ? 334 GLU A CD  1 
ATOM   2301 O OE1 . GLU A 1 299 ? 6.131   -20.591 43.499  1.00 172.17 ? 334 GLU A OE1 1 
ATOM   2302 O OE2 . GLU A 1 299 ? 5.718   -22.660 44.105  1.00 172.17 ? 334 GLU A OE2 1 
ATOM   2303 N N   . PRO A 1 300 ? 6.627   -25.175 41.148  1.00 55.62  ? 335 PRO A N   1 
ATOM   2304 C CA  . PRO A 1 300 ? 6.190   -26.468 40.605  1.00 55.62  ? 335 PRO A CA  1 
ATOM   2305 C C   . PRO A 1 300 ? 4.827   -26.378 39.903  1.00 55.62  ? 335 PRO A C   1 
ATOM   2306 O O   . PRO A 1 300 ? 3.908   -25.692 40.366  1.00 55.62  ? 335 PRO A O   1 
ATOM   2307 C CB  . PRO A 1 300 ? 6.138   -27.351 41.843  1.00 120.74 ? 335 PRO A CB  1 
ATOM   2308 C CG  . PRO A 1 300 ? 5.706   -26.386 42.904  1.00 120.74 ? 335 PRO A CG  1 
ATOM   2309 C CD  . PRO A 1 300 ? 6.582   -25.183 42.620  1.00 120.74 ? 335 PRO A CD  1 
ATOM   2310 N N   . ALA A 1 301 ? 4.705   -27.080 38.780  1.00 56.17  ? 336 ALA A N   1 
ATOM   2311 C CA  . ALA A 1 301 ? 3.462   -27.090 38.029  1.00 56.17  ? 336 ALA A CA  1 
ATOM   2312 C C   . ALA A 1 301 ? 2.514   -28.122 38.650  1.00 56.17  ? 336 ALA A C   1 
ATOM   2313 O O   . ALA A 1 301 ? 2.962   -29.122 39.235  1.00 56.17  ? 336 ALA A O   1 
ATOM   2314 C CB  . ALA A 1 301 ? 3.733   -27.431 36.565  1.00 127.70 ? 336 ALA A CB  1 
ATOM   2315 N N   . ALA A 1 302 ? 1.209   -27.877 38.540  1.00 138.82 ? 337 ALA A N   1 
ATOM   2316 C CA  . ALA A 1 302 ? 0.235   -28.814 39.084  1.00 138.82 ? 337 ALA A CA  1 
ATOM   2317 C C   . ALA A 1 302 ? 0.253   -30.107 38.261  1.00 138.82 ? 337 ALA A C   1 
ATOM   2318 O O   . ALA A 1 302 ? 0.516   -30.082 37.056  1.00 138.82 ? 337 ALA A O   1 
ATOM   2319 C CB  . ALA A 1 302 ? -1.155  -28.196 39.060  1.00 141.47 ? 337 ALA A CB  1 
ATOM   2320 N N   . ASN A 1 303 ? 0.000   -31.232 38.927  1.00 50.26  ? 338 ASN A N   1 
ATOM   2321 C CA  . ASN A 1 303 ? -0.049  -32.551 38.281  1.00 50.26  ? 338 ASN A CA  1 
ATOM   2322 C C   . ASN A 1 303 ? 1.175   -33.024 37.510  1.00 50.26  ? 338 ASN A C   1 
ATOM   2323 O O   . ASN A 1 303 ? 1.047   -33.714 36.498  1.00 50.26  ? 338 ASN A O   1 
ATOM   2324 C CB  . ASN A 1 303 ? -1.275  -32.654 37.358  1.00 128.76 ? 338 ASN A CB  1 
ATOM   2325 C CG  . ASN A 1 303 ? -2.194  -31.452 37.456  1.00 128.76 ? 338 ASN A CG  1 
ATOM   2326 O OD1 . ASN A 1 303 ? -2.005  -30.452 36.764  1.00 128.76 ? 338 ASN A OD1 1 
ATOM   2327 N ND2 . ASN A 1 303 ? -3.194  -31.543 38.325  1.00 128.76 ? 338 ASN A ND2 1 
ATOM   2328 N N   . GLU A 1 304 ? 2.362   -32.656 37.968  1.00 25.89  ? 339 GLU A N   1 
ATOM   2329 C CA  . GLU A 1 304 ? 3.561   -33.108 37.291  1.00 25.89  ? 339 GLU A CA  1 
ATOM   2330 C C   . GLU A 1 304 ? 4.686   -33.214 38.307  1.00 25.89  ? 339 GLU A C   1 
ATOM   2331 O O   . GLU A 1 304 ? 4.703   -32.458 39.279  1.00 25.89  ? 339 GLU A O   1 
ATOM   2332 C CB  . GLU A 1 304 ? 3.930   -32.332 36.024  1.00 107.27 ? 339 GLU A CB  1 
ATOM   2333 C CG  . GLU A 1 304 ? 4.008   -30.862 36.035  1.00 107.27 ? 339 GLU A CG  1 
ATOM   2334 C CD  . GLU A 1 304 ? 4.266   -30.381 34.618  1.00 107.27 ? 339 GLU A CD  1 
ATOM   2335 O OE1 . GLU A 1 304 ? 3.435   -30.693 33.734  1.00 107.27 ? 339 GLU A OE1 1 
ATOM   2336 O OE2 . GLU A 1 304 ? 5.300   -29.717 34.383  1.00 107.27 ? 339 GLU A OE2 1 
ATOM   2337 N N   . THR A 1 305 ? 5.578   -34.192 38.110  1.00 43.48  ? 340 THR A N   1 
ATOM   2338 C CA  . THR A 1 305 ? 6.713   -34.414 39.009  1.00 43.48  ? 340 THR A CA  1 
ATOM   2339 C C   . THR A 1 305 ? 7.951   -33.736 38.447  1.00 43.48  ? 340 THR A C   1 
ATOM   2340 O O   . THR A 1 305 ? 8.891   -33.462 39.192  1.00 43.48  ? 340 THR A O   1 
ATOM   2341 C CB  . THR A 1 305 ? 6.974   -35.921 39.195  1.00 34.98  ? 340 THR A CB  1 
ATOM   2342 O OG1 . THR A 1 305 ? 7.015   -36.561 37.914  1.00 34.98  ? 340 THR A OG1 1 
ATOM   2343 C CG2 . THR A 1 305 ? 5.869   -36.550 40.035  1.00 34.98  ? 340 THR A CG2 1 
ATOM   2344 N N   . VAL A 1 306 ? 7.943   -33.468 37.140  1.00 18.76  ? 341 VAL A N   1 
ATOM   2345 C CA  . VAL A 1 306 ? 9.059   -32.813 36.447  1.00 18.76  ? 341 VAL A CA  1 
ATOM   2346 C C   . VAL A 1 306 ? 9.320   -31.408 36.990  1.00 18.76  ? 341 VAL A C   1 
ATOM   2347 O O   . VAL A 1 306 ? 8.390   -30.636 37.205  1.00 18.76  ? 341 VAL A O   1 
ATOM   2348 C CB  . VAL A 1 306 ? 8.798   -32.719 34.945  1.00 21.35  ? 341 VAL A CB  1 
ATOM   2349 C CG1 . VAL A 1 306 ? 7.649   -31.768 34.682  1.00 21.35  ? 341 VAL A CG1 1 
ATOM   2350 C CG2 . VAL A 1 306 ? 10.058  -32.275 34.233  1.00 21.35  ? 341 VAL A CG2 1 
ATOM   2351 N N   . ARG A 1 307 ? 10.598  -31.082 37.188  1.00 24.92  ? 342 ARG A N   1 
ATOM   2352 C CA  . ARG A 1 307 ? 11.002  -29.788 37.719  1.00 24.92  ? 342 ARG A CA  1 
ATOM   2353 C C   . ARG A 1 307 ? 11.847  -29.048 36.686  1.00 24.92  ? 342 ARG A C   1 
ATOM   2354 O O   . ARG A 1 307 ? 12.638  -29.664 35.964  1.00 24.92  ? 342 ARG A O   1 
ATOM   2355 C CB  . ARG A 1 307 ? 11.801  -29.988 39.002  1.00 87.33  ? 342 ARG A CB  1 
ATOM   2356 C CG  . ARG A 1 307 ? 10.969  -30.549 40.141  1.00 87.33  ? 342 ARG A CG  1 
ATOM   2357 C CD  . ARG A 1 307 ? 10.044  -29.482 40.693  1.00 87.33  ? 342 ARG A CD  1 
ATOM   2358 N NE  . ARG A 1 307 ? 10.794  -28.506 41.478  1.00 87.33  ? 342 ARG A NE  1 
ATOM   2359 C CZ  . ARG A 1 307 ? 10.340  -27.305 41.826  1.00 87.33  ? 342 ARG A CZ  1 
ATOM   2360 N NH1 . ARG A 1 307 ? 9.126   -26.906 41.456  1.00 87.33  ? 342 ARG A NH1 1 
ATOM   2361 N NH2 . ARG A 1 307 ? 11.102  -26.503 42.559  1.00 87.33  ? 342 ARG A NH2 1 
ATOM   2362 N N   . HIS A 1 308 ? 11.674  -27.727 36.626  1.00 14.36  ? 343 HIS A N   1 
ATOM   2363 C CA  . HIS A 1 308 ? 12.439  -26.881 35.705  1.00 14.36  ? 343 HIS A CA  1 
ATOM   2364 C C   . HIS A 1 308 ? 13.170  -25.823 36.526  1.00 14.36  ? 343 HIS A C   1 
ATOM   2365 O O   . HIS A 1 308 ? 12.681  -25.433 37.578  1.00 14.36  ? 343 HIS A O   1 
ATOM   2366 C CB  . HIS A 1 308 ? 11.504  -26.238 34.693  1.00 25.81  ? 343 HIS A CB  1 
ATOM   2367 C CG  . HIS A 1 308 ? 10.643  -27.228 33.979  1.00 25.81  ? 343 HIS A CG  1 
ATOM   2368 N ND1 . HIS A 1 308 ? 11.162  -28.215 33.173  1.00 25.81  ? 343 HIS A ND1 1 
ATOM   2369 C CD2 . HIS A 1 308 ? 9.303   -27.420 33.996  1.00 25.81  ? 343 HIS A CD2 1 
ATOM   2370 C CE1 . HIS A 1 308 ? 10.180  -28.974 32.725  1.00 25.81  ? 343 HIS A CE1 1 
ATOM   2371 N NE2 . HIS A 1 308 ? 9.041   -28.513 33.210  1.00 25.81  ? 343 HIS A NE2 1 
ATOM   2372 N N   . GLY A 1 309 ? 14.344  -25.394 36.059  1.00 34.48  ? 344 GLY A N   1 
ATOM   2373 C CA  . GLY A 1 309 ? 15.131  -24.400 36.776  1.00 34.48  ? 344 GLY A CA  1 
ATOM   2374 C C   . GLY A 1 309 ? 16.381  -23.968 36.030  1.00 34.48  ? 344 GLY A C   1 
ATOM   2375 O O   . GLY A 1 309 ? 16.518  -24.249 34.841  1.00 34.48  ? 344 GLY A O   1 
ATOM   2376 N N   . CYS A 1 310 ? 17.302  -23.306 36.730  1.00 28.64  ? 345 CYS A N   1 
ATOM   2377 C CA  . CYS A 1 310 ? 18.546  -22.796 36.137  1.00 28.64  ? 345 CYS A CA  1 
ATOM   2378 C C   . CYS A 1 310 ? 19.735  -22.896 37.050  1.00 28.64  ? 345 CYS A C   1 
ATOM   2379 O O   . CYS A 1 310 ? 19.592  -22.840 38.281  1.00 28.64  ? 345 CYS A O   1 
ATOM   2380 C CB  . CYS A 1 310 ? 18.447  -21.286 35.860  1.00 39.69  ? 345 CYS A CB  1 
ATOM   2381 S SG  . CYS A 1 310 ? 17.559  -20.560 34.448  1.00 39.69  ? 345 CYS A SG  1 
ATOM   2382 N N   . LEU A 1 311 ? 20.919  -23.027 36.460  1.00 10.50  ? 346 LEU A N   1 
ATOM   2383 C CA  . LEU A 1 311 ? 22.086  -22.889 37.305  1.00 10.50  ? 346 LEU A CA  1 
ATOM   2384 C C   . LEU A 1 311 ? 22.156  -21.372 37.003  1.00 10.50  ? 346 LEU A C   1 
ATOM   2385 O O   . LEU A 1 311 ? 22.208  -20.960 35.844  1.00 10.50  ? 346 LEU A O   1 
ATOM   2386 C CB  . LEU A 1 311 ? 23.331  -23.540 36.729  1.00 31.04  ? 346 LEU A CB  1 
ATOM   2387 C CG  . LEU A 1 311 ? 24.568  -22.885 37.354  1.00 31.04  ? 346 LEU A CG  1 
ATOM   2388 C CD1 . LEU A 1 311 ? 24.448  -22.915 38.871  1.00 31.04  ? 346 LEU A CD1 1 
ATOM   2389 C CD2 . LEU A 1 311 ? 25.835  -23.601 36.897  1.00 31.04  ? 346 LEU A CD2 1 
ATOM   2390 N N   . ARG A 1 312 ? 22.083  -20.538 38.031  1.00 36.62  ? 347 ARG A N   1 
ATOM   2391 C CA  . ARG A 1 312 ? 22.125  -19.098 37.832  1.00 36.62  ? 347 ARG A CA  1 
ATOM   2392 C C   . ARG A 1 312 ? 23.499  -18.504 38.087  1.00 36.62  ? 347 ARG A C   1 
ATOM   2393 O O   . ARG A 1 312 ? 24.056  -18.666 39.176  1.00 36.62  ? 347 ARG A O   1 
ATOM   2394 C CB  . ARG A 1 312 ? 21.097  -18.380 38.708  1.00 45.85  ? 347 ARG A CB  1 
ATOM   2395 C CG  . ARG A 1 312 ? 19.673  -18.529 38.225  1.00 45.85  ? 347 ARG A CG  1 
ATOM   2396 C CD  . ARG A 1 312 ? 18.717  -17.606 38.982  1.00 45.85  ? 347 ARG A CD  1 
ATOM   2397 N NE  . ARG A 1 312 ? 18.959  -16.189 38.709  1.00 45.85  ? 347 ARG A NE  1 
ATOM   2398 C CZ  . ARG A 1 312 ? 18.222  -15.192 39.193  1.00 45.85  ? 347 ARG A CZ  1 
ATOM   2399 N NH1 . ARG A 1 312 ? 17.188  -15.448 39.980  1.00 45.85  ? 347 ARG A NH1 1 
ATOM   2400 N NH2 . ARG A 1 312 ? 18.519  -13.937 38.890  1.00 45.85  ? 347 ARG A NH2 1 
ATOM   2401 N N   . LEU A 1 313 ? 24.032  -17.811 37.079  1.00 29.17  ? 348 LEU A N   1 
ATOM   2402 C CA  . LEU A 1 313 ? 25.344  -17.167 37.176  1.00 29.17  ? 348 LEU A CA  1 
ATOM   2403 C C   . LEU A 1 313 ? 25.188  -15.639 37.101  1.00 29.17  ? 348 LEU A C   1 
ATOM   2404 O O   . LEU A 1 313 ? 24.793  -15.080 36.065  1.00 29.17  ? 348 LEU A O   1 
ATOM   2405 C CB  . LEU A 1 313 ? 26.246  -17.631 36.023  1.00 48.72  ? 348 LEU A CB  1 
ATOM   2406 C CG  . LEU A 1 313 ? 26.462  -19.123 35.734  1.00 48.72  ? 348 LEU A CG  1 
ATOM   2407 C CD1 . LEU A 1 313 ? 27.063  -19.803 36.948  1.00 48.72  ? 348 LEU A CD1 1 
ATOM   2408 C CD2 . LEU A 1 313 ? 25.148  -19.779 35.353  1.00 48.72  ? 348 LEU A CD2 1 
ATOM   2409 N N   . ASN A 1 314 ? 25.503  -14.980 38.211  1.00 52.56  ? 349 ASN A N   1 
ATOM   2410 C CA  . ASN A 1 314 ? 25.437  -13.525 38.323  1.00 52.56  ? 349 ASN A CA  1 
ATOM   2411 C C   . ASN A 1 314 ? 26.747  -12.942 37.800  1.00 52.56  ? 349 ASN A C   1 
ATOM   2412 O O   . ASN A 1 314 ? 27.746  -12.922 38.499  1.00 52.56  ? 349 ASN A O   1 
ATOM   2413 C CB  . ASN A 1 314 ? 25.277  -13.169 39.793  1.00 46.66  ? 349 ASN A CB  1 
ATOM   2414 C CG  . ASN A 1 314 ? 24.948  -11.731 40.005  1.00 46.66  ? 349 ASN A CG  1 
ATOM   2415 O OD1 . ASN A 1 314 ? 25.448  -10.864 39.295  1.00 46.66  ? 349 ASN A OD1 1 
ATOM   2416 N ND2 . ASN A 1 314 ? 24.112  -11.456 40.997  1.00 46.66  ? 349 ASN A ND2 1 
ATOM   2417 N N   . GLN A 1 315 ? 26.725  -12.485 36.556  1.00 23.97  ? 350 GLN A N   1 
ATOM   2418 C CA  . GLN A 1 315 ? 27.883  -11.892 35.939  1.00 23.97  ? 350 GLN A CA  1 
ATOM   2419 C C   . GLN A 1 315 ? 29.100  -12.790 36.062  1.00 23.97  ? 350 GLN A C   1 
ATOM   2420 O O   . GLN A 1 315 ? 30.027  -12.505 36.823  1.00 23.97  ? 350 GLN A O   1 
ATOM   2421 C CB  . GLN A 1 315 ? 28.143  -10.520 36.564  1.00 63.51  ? 350 GLN A CB  1 
ATOM   2422 C CG  . GLN A 1 315 ? 26.981  -9.565  36.320  1.00 63.51  ? 350 GLN A CG  1 
ATOM   2423 C CD  . GLN A 1 315 ? 27.250  -8.155  36.779  1.00 63.51  ? 350 GLN A CD  1 
ATOM   2424 O OE1 . GLN A 1 315 ? 27.249  -7.865  37.967  1.00 63.51  ? 350 GLN A OE1 1 
ATOM   2425 N NE2 . GLN A 1 315 ? 27.489  -7.267  35.830  1.00 63.51  ? 350 GLN A NE2 1 
ATOM   2426 N N   . PRO A 1 316 ? 29.110  -13.904 35.327  1.00 37.02  ? 351 PRO A N   1 
ATOM   2427 C CA  . PRO A 1 316 ? 30.266  -14.799 35.396  1.00 37.02  ? 351 PRO A CA  1 
ATOM   2428 C C   . PRO A 1 316 ? 31.304  -14.197 34.451  1.00 37.02  ? 351 PRO A C   1 
ATOM   2429 O O   . PRO A 1 316 ? 30.975  -13.296 33.674  1.00 37.02  ? 351 PRO A O   1 
ATOM   2430 C CB  . PRO A 1 316 ? 29.697  -16.105 34.866  1.00 43.43  ? 351 PRO A CB  1 
ATOM   2431 C CG  . PRO A 1 316 ? 28.770  -15.619 33.784  1.00 43.43  ? 351 PRO A CG  1 
ATOM   2432 C CD  . PRO A 1 316 ? 28.070  -14.442 34.433  1.00 43.43  ? 351 PRO A CD  1 
ATOM   2433 N N   . THR A 1 317 ? 32.545  -14.667 34.526  1.00 89.89  ? 352 THR A N   1 
ATOM   2434 C CA  . THR A 1 317 ? 33.590  -14.166 33.640  1.00 89.89  ? 352 THR A CA  1 
ATOM   2435 C C   . THR A 1 317 ? 34.165  -15.365 32.908  1.00 89.89  ? 352 THR A C   1 
ATOM   2436 O O   . THR A 1 317 ? 33.667  -16.482 33.048  1.00 89.89  ? 352 THR A O   1 
ATOM   2437 C CB  . THR A 1 317 ? 34.674  -13.511 34.468  1.00 31.12  ? 352 THR A CB  1 
ATOM   2438 O OG1 . THR A 1 317 ? 34.761  -14.192 35.727  1.00 31.12  ? 352 THR A OG1 1 
ATOM   2439 C CG2 . THR A 1 317 ? 34.343  -12.040 34.711  1.00 31.12  ? 352 THR A CG2 1 
ATOM   2440 N N   . HIS A 1 318 ? 35.221  -15.132 32.138  1.00 41.67  ? 353 HIS A N   1 
ATOM   2441 C CA  . HIS A 1 318 ? 35.861  -16.195 31.379  1.00 41.67  ? 353 HIS A CA  1 
ATOM   2442 C C   . HIS A 1 318 ? 36.289  -17.304 32.334  1.00 41.67  ? 353 HIS A C   1 
ATOM   2443 O O   . HIS A 1 318 ? 36.464  -18.444 31.929  1.00 41.67  ? 353 HIS A O   1 
ATOM   2444 C CB  . HIS A 1 318 ? 37.103  -15.667 30.690  1.00 57.04  ? 353 HIS A CB  1 
ATOM   2445 C CG  . HIS A 1 318 ? 38.165  -15.200 31.638  1.00 57.04  ? 353 HIS A CG  1 
ATOM   2446 N ND1 . HIS A 1 318 ? 38.071  -14.016 32.338  1.00 57.04  ? 353 HIS A ND1 1 
ATOM   2447 C CD2 . HIS A 1 318 ? 39.351  -15.751 31.991  1.00 57.04  ? 353 HIS A CD2 1 
ATOM   2448 C CE1 . HIS A 1 318 ? 39.156  -13.855 33.076  1.00 57.04  ? 353 HIS A CE1 1 
ATOM   2449 N NE2 . HIS A 1 318 ? 39.949  -14.894 32.883  1.00 57.04  ? 353 HIS A NE2 1 
ATOM   2450 N N   . VAL A 1 319 ? 36.477  -16.965 33.600  1.00 52.02  ? 354 VAL A N   1 
ATOM   2451 C CA  . VAL A 1 319 ? 36.899  -17.966 34.571  1.00 52.02  ? 354 VAL A CA  1 
ATOM   2452 C C   . VAL A 1 319 ? 35.784  -18.961 34.894  1.00 52.02  ? 354 VAL A C   1 
ATOM   2453 O O   . VAL A 1 319 ? 36.001  -19.956 35.583  1.00 52.02  ? 354 VAL A O   1 
ATOM   2454 C CB  . VAL A 1 319 ? 37.401  -17.328 35.882  1.00 36.31  ? 354 VAL A CB  1 
ATOM   2455 C CG1 . VAL A 1 319 ? 38.589  -16.445 35.608  1.00 36.31  ? 354 VAL A CG1 1 
ATOM   2456 C CG2 . VAL A 1 319 ? 36.298  -16.534 36.523  1.00 36.31  ? 354 VAL A CG2 1 
ATOM   2457 N N   . ASN A 1 320 ? 34.588  -18.705 34.390  1.00 24.80  ? 355 ASN A N   1 
ATOM   2458 C CA  . ASN A 1 320 ? 33.481  -19.616 34.636  1.00 24.80  ? 355 ASN A CA  1 
ATOM   2459 C C   . ASN A 1 320 ? 33.181  -20.424 33.370  1.00 24.80  ? 355 ASN A C   1 
ATOM   2460 O O   . ASN A 1 320 ? 32.270  -21.253 33.332  1.00 24.80  ? 355 ASN A O   1 
ATOM   2461 C CB  . ASN A 1 320 ? 32.283  -18.820 35.127  1.00 36.60  ? 355 ASN A CB  1 
ATOM   2462 C CG  . ASN A 1 320 ? 32.598  -18.045 36.386  1.00 36.60  ? 355 ASN A CG  1 
ATOM   2463 O OD1 . ASN A 1 320 ? 32.820  -16.838 36.347  1.00 36.60  ? 355 ASN A OD1 1 
ATOM   2464 N ND2 . ASN A 1 320 ? 32.649  -18.743 37.507  1.00 36.60  ? 355 ASN A ND2 1 
ATOM   2465 N N   . ASN A 1 321 ? 33.978  -20.180 32.338  1.00 33.12  ? 356 ASN A N   1 
ATOM   2466 C CA  . ASN A 1 321 ? 33.863  -20.905 31.086  1.00 33.12  ? 356 ASN A CA  1 
ATOM   2467 C C   . ASN A 1 321 ? 34.274  -22.363 31.360  1.00 33.12  ? 356 ASN A C   1 
ATOM   2468 O O   . ASN A 1 321 ? 35.267  -22.628 32.031  1.00 33.12  ? 356 ASN A O   1 
ATOM   2469 C CB  . ASN A 1 321 ? 34.810  -20.306 30.049  1.00 25.35  ? 356 ASN A CB  1 
ATOM   2470 C CG  . ASN A 1 321 ? 34.340  -18.966 29.545  1.00 25.35  ? 356 ASN A CG  1 
ATOM   2471 O OD1 . ASN A 1 321 ? 33.695  -18.205 30.275  1.00 25.35  ? 356 ASN A OD1 1 
ATOM   2472 N ND2 . ASN A 1 321 ? 34.665  -18.662 28.294  1.00 25.35  ? 356 ASN A ND2 1 
ATOM   2473 N N   . GLY A 1 322 ? 33.508  -23.313 30.850  1.00 76.18  ? 357 GLY A N   1 
ATOM   2474 C CA  . GLY A 1 322 ? 33.846  -24.697 31.098  1.00 76.18  ? 357 GLY A CA  1 
ATOM   2475 C C   . GLY A 1 322 ? 32.650  -25.610 30.950  1.00 76.18  ? 357 GLY A C   1 
ATOM   2476 O O   . GLY A 1 322 ? 31.569  -25.187 30.517  1.00 76.18  ? 357 GLY A O   1 
ATOM   2477 N N   . ASN A 1 323 ? 32.857  -26.870 31.328  1.00 26.63  ? 358 ASN A N   1 
ATOM   2478 C CA  . ASN A 1 323 ? 31.842  -27.915 31.248  1.00 26.63  ? 358 ASN A CA  1 
ATOM   2479 C C   . ASN A 1 323 ? 31.069  -28.053 32.550  1.00 26.63  ? 358 ASN A C   1 
ATOM   2480 O O   . ASN A 1 323 ? 31.628  -28.362 33.603  1.00 26.63  ? 358 ASN A O   1 
ATOM   2481 C CB  . ASN A 1 323 ? 32.471  -29.267 30.887  1.00 137.61 ? 358 ASN A CB  1 
ATOM   2482 C CG  . ASN A 1 323 ? 31.438  -30.391 30.797  1.00 137.61 ? 358 ASN A CG  1 
ATOM   2483 O OD1 . ASN A 1 323 ? 30.309  -30.167 30.357  1.00 137.61 ? 358 ASN A OD1 1 
ATOM   2484 N ND2 . ASN A 1 323 ? 31.825  -31.603 31.192  1.00 137.61 ? 358 ASN A ND2 1 
ATOM   2485 N N   . TYR A 1 324 ? 29.770  -27.820 32.466  1.00 27.08  ? 359 TYR A N   1 
ATOM   2486 C CA  . TYR A 1 324 ? 28.892  -27.905 33.622  1.00 27.08  ? 359 TYR A CA  1 
ATOM   2487 C C   . TYR A 1 324 ? 28.086  -29.204 33.602  1.00 27.08  ? 359 TYR A C   1 
ATOM   2488 O O   . TYR A 1 324 ? 27.358  -29.488 32.639  1.00 27.08  ? 359 TYR A O   1 
ATOM   2489 C CB  . TYR A 1 324 ? 27.985  -26.680 33.682  1.00 40.12  ? 359 TYR A CB  1 
ATOM   2490 C CG  . TYR A 1 324 ? 28.743  -25.427 34.070  1.00 40.12  ? 359 TYR A CG  1 
ATOM   2491 C CD1 . TYR A 1 324 ? 29.509  -24.725 33.134  1.00 40.12  ? 359 TYR A CD1 1 
ATOM   2492 C CD2 . TYR A 1 324 ? 28.722  -24.963 35.385  1.00 40.12  ? 359 TYR A CD2 1 
ATOM   2493 C CE1 . TYR A 1 324 ? 30.231  -23.590 33.500  1.00 40.12  ? 359 TYR A CE1 1 
ATOM   2494 C CE2 . TYR A 1 324 ? 29.442  -23.832 35.761  1.00 40.12  ? 359 TYR A CE2 1 
ATOM   2495 C CZ  . TYR A 1 324 ? 30.191  -23.151 34.816  1.00 40.12  ? 359 TYR A CZ  1 
ATOM   2496 O OH  . TYR A 1 324 ? 30.884  -22.027 35.201  1.00 40.12  ? 359 TYR A OH  1 
ATOM   2497 N N   . THR A 1 325 ? 28.233  -29.984 34.672  1.00 43.63  ? 360 THR A N   1 
ATOM   2498 C CA  . THR A 1 325 ? 27.529  -31.251 34.827  1.00 43.63  ? 360 THR A CA  1 
ATOM   2499 C C   . THR A 1 325 ? 26.479  -31.159 35.950  1.00 43.63  ? 360 THR A C   1 
ATOM   2500 O O   . THR A 1 325 ? 26.779  -30.716 37.064  1.00 43.63  ? 360 THR A O   1 
ATOM   2501 C CB  . THR A 1 325 ? 28.469  -32.413 35.162  1.00 42.00  ? 360 THR A CB  1 
ATOM   2502 O OG1 . THR A 1 325 ? 29.418  -32.577 34.109  1.00 42.00  ? 360 THR A OG1 1 
ATOM   2503 C CG2 . THR A 1 325 ? 27.683  -33.693 35.305  1.00 42.00  ? 360 THR A CG2 1 
ATOM   2504 N N   . LEU A 1 326 ? 25.250  -31.573 35.650  1.00 10.71  ? 361 LEU A N   1 
ATOM   2505 C CA  . LEU A 1 326 ? 24.193  -31.558 36.656  1.00 10.71  ? 361 LEU A CA  1 
ATOM   2506 C C   . LEU A 1 326 ? 24.001  -33.008 36.994  1.00 10.71  ? 361 LEU A C   1 
ATOM   2507 O O   . LEU A 1 326 ? 23.827  -33.821 36.099  1.00 10.71  ? 361 LEU A O   1 
ATOM   2508 C CB  . LEU A 1 326 ? 22.897  -30.988 36.085  1.00 51.57  ? 361 LEU A CB  1 
ATOM   2509 C CG  . LEU A 1 326 ? 21.630  -31.251 36.911  1.00 51.57  ? 361 LEU A CG  1 
ATOM   2510 C CD1 . LEU A 1 326 ? 21.835  -30.814 38.355  1.00 51.57  ? 361 LEU A CD1 1 
ATOM   2511 C CD2 . LEU A 1 326 ? 20.456  -30.515 36.288  1.00 51.57  ? 361 LEU A CD2 1 
ATOM   2512 N N   . LEU A 1 327 ? 24.043  -33.322 38.280  1.00 20.84  ? 362 LEU A N   1 
ATOM   2513 C CA  . LEU A 1 327 ? 23.887  -34.682 38.762  1.00 20.84  ? 362 LEU A CA  1 
ATOM   2514 C C   . LEU A 1 327 ? 22.549  -34.768 39.501  1.00 20.84  ? 362 LEU A C   1 
ATOM   2515 O O   . LEU A 1 327 ? 22.315  -33.997 40.432  1.00 20.84  ? 362 LEU A O   1 
ATOM   2516 C CB  . LEU A 1 327 ? 25.005  -35.085 39.738  1.00 16.51  ? 362 LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 327 ? 26.482  -35.234 39.343  1.00 16.51  ? 362 LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 327 ? 26.588  -36.069 38.078  1.00 16.51  ? 362 LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 327 ? 27.120  -33.871 39.151  1.00 16.51  ? 362 LEU A CD2 1 
ATOM   2520 N N   . ALA A 1 328 ? 21.681  -35.692 39.091  1.00 6.75   ? 363 ALA A N   1 
ATOM   2521 C CA  . ALA A 1 328 ? 20.385  -35.841 39.728  1.00 6.75   ? 363 ALA A CA  1 
ATOM   2522 C C   . ALA A 1 328 ? 20.294  -37.227 40.328  1.00 6.75   ? 363 ALA A C   1 
ATOM   2523 O O   . ALA A 1 328 ? 20.300  -38.221 39.605  1.00 6.75   ? 363 ALA A O   1 
ATOM   2524 C CB  . ALA A 1 328 ? 19.277  -35.631 38.733  1.00 95.09  ? 363 ALA A CB  1 
ATOM   2525 N N   . ALA A 1 329 ? 20.179  -37.291 41.652  1.00 27.07  ? 364 ALA A N   1 
ATOM   2526 C CA  . ALA A 1 329 ? 20.133  -38.571 42.335  1.00 27.07  ? 364 ALA A CA  1 
ATOM   2527 C C   . ALA A 1 329 ? 18.951  -38.862 43.255  1.00 27.07  ? 364 ALA A C   1 
ATOM   2528 O O   . ALA A 1 329 ? 18.491  -37.986 43.986  1.00 27.07  ? 364 ALA A O   1 
ATOM   2529 C CB  . ALA A 1 329 ? 21.431  -38.777 43.101  1.00 139.79 ? 364 ALA A CB  1 
ATOM   2530 N N   . ASN A 1 330 ? 18.470  -40.112 43.190  1.00 39.42  ? 365 ASN A N   1 
ATOM   2531 C CA  . ASN A 1 330 ? 17.410  -40.624 44.056  1.00 39.42  ? 365 ASN A CA  1 
ATOM   2532 C C   . ASN A 1 330 ? 17.721  -42.112 44.308  1.00 39.42  ? 365 ASN A C   1 
ATOM   2533 O O   . ASN A 1 330 ? 18.696  -42.641 43.780  1.00 39.42  ? 365 ASN A O   1 
ATOM   2534 C CB  . ASN A 1 330 ? 16.046  -40.432 43.375  1.00 58.63  ? 365 ASN A CB  1 
ATOM   2535 C CG  . ASN A 1 330 ? 15.802  -41.416 42.250  1.00 58.63  ? 365 ASN A CG  1 
ATOM   2536 O OD1 . ASN A 1 330 ? 16.700  -41.727 41.468  1.00 58.63  ? 365 ASN A OD1 1 
ATOM   2537 N ND2 . ASN A 1 330 ? 14.571  -41.906 42.158  1.00 58.63  ? 365 ASN A ND2 1 
ATOM   2538 N N   . PRO A 1 331 ? 16.926  -42.799 45.138  1.00 23.47  ? 366 PRO A N   1 
ATOM   2539 C CA  . PRO A 1 331 ? 17.192  -44.219 45.427  1.00 23.47  ? 366 PRO A CA  1 
ATOM   2540 C C   . PRO A 1 331 ? 17.428  -45.239 44.287  1.00 23.47  ? 366 PRO A C   1 
ATOM   2541 O O   . PRO A 1 331 ? 17.833  -46.364 44.560  1.00 23.47  ? 366 PRO A O   1 
ATOM   2542 C CB  . PRO A 1 331 ? 15.995  -44.611 46.288  1.00 128.74 ? 366 PRO A CB  1 
ATOM   2543 C CG  . PRO A 1 331 ? 15.702  -43.344 47.032  1.00 128.74 ? 366 PRO A CG  1 
ATOM   2544 C CD  . PRO A 1 331 ? 15.795  -42.305 45.942  1.00 128.74 ? 366 PRO A CD  1 
ATOM   2545 N N   . PHE A 1 332 ? 17.179  -44.874 43.029  1.00 44.59  ? 367 PHE A N   1 
ATOM   2546 C CA  . PHE A 1 332 ? 17.389  -45.811 41.920  1.00 44.59  ? 367 PHE A CA  1 
ATOM   2547 C C   . PHE A 1 332 ? 18.772  -45.690 41.301  1.00 44.59  ? 367 PHE A C   1 
ATOM   2548 O O   . PHE A 1 332 ? 19.238  -46.584 40.589  1.00 44.59  ? 367 PHE A O   1 
ATOM   2549 C CB  . PHE A 1 332 ? 16.354  -45.570 40.814  1.00 27.45  ? 367 PHE A CB  1 
ATOM   2550 C CG  . PHE A 1 332 ? 14.930  -45.846 41.218  1.00 27.45  ? 367 PHE A CG  1 
ATOM   2551 C CD1 . PHE A 1 332 ? 14.088  -44.813 41.592  1.00 27.45  ? 367 PHE A CD1 1 
ATOM   2552 C CD2 . PHE A 1 332 ? 14.427  -47.136 41.204  1.00 27.45  ? 367 PHE A CD2 1 
ATOM   2553 C CE1 . PHE A 1 332 ? 12.770  -45.059 41.940  1.00 27.45  ? 367 PHE A CE1 1 
ATOM   2554 C CE2 . PHE A 1 332 ? 13.105  -47.389 41.552  1.00 27.45  ? 367 PHE A CE2 1 
ATOM   2555 C CZ  . PHE A 1 332 ? 12.279  -46.352 41.919  1.00 27.45  ? 367 PHE A CZ  1 
ATOM   2556 N N   . GLY A 1 333 ? 19.425  -44.572 41.570  1.00 7.53   ? 368 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 333 ? 20.724  -44.332 40.991  1.00 7.53   ? 368 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 333 ? 20.864  -42.852 40.656  1.00 7.53   ? 368 GLY A C   1 
ATOM   2559 O O   . GLY A 1 333 ? 20.321  -41.983 41.343  1.00 7.53   ? 368 GLY A O   1 
ATOM   2560 N N   . GLN A 1 334 ? 21.551  -42.557 39.563  1.00 28.75  ? 369 GLN A N   1 
ATOM   2561 C CA  . GLN A 1 334 ? 21.796  -41.174 39.232  1.00 28.75  ? 369 GLN A CA  1 
ATOM   2562 C C   . GLN A 1 334 ? 21.743  -40.900 37.743  1.00 28.75  ? 369 GLN A C   1 
ATOM   2563 O O   . GLN A 1 334 ? 22.162  -41.725 36.948  1.00 28.75  ? 369 GLN A O   1 
ATOM   2564 C CB  . GLN A 1 334 ? 23.154  -40.797 39.823  1.00 81.04  ? 369 GLN A CB  1 
ATOM   2565 C CG  . GLN A 1 334 ? 23.870  -39.642 39.190  1.00 81.04  ? 369 GLN A CG  1 
ATOM   2566 C CD  . GLN A 1 334 ? 25.230  -39.445 39.817  1.00 81.04  ? 369 GLN A CD  1 
ATOM   2567 O OE1 . GLN A 1 334 ? 26.004  -40.392 39.946  1.00 81.04  ? 369 GLN A OE1 1 
ATOM   2568 N NE2 . GLN A 1 334 ? 25.529  -38.214 40.213  1.00 81.04  ? 369 GLN A NE2 1 
ATOM   2569 N N   . ALA A 1 335 ? 21.219  -39.727 37.386  1.00 27.25  ? 370 ALA A N   1 
ATOM   2570 C CA  . ALA A 1 335 ? 21.103  -39.288 36.000  1.00 27.25  ? 370 ALA A CA  1 
ATOM   2571 C C   . ALA A 1 335 ? 22.071  -38.131 35.872  1.00 27.25  ? 370 ALA A C   1 
ATOM   2572 O O   . ALA A 1 335 ? 22.304  -37.383 36.815  1.00 27.25  ? 370 ALA A O   1 
ATOM   2573 C CB  . ALA A 1 335 ? 19.682  -38.828 35.706  1.00 44.61  ? 370 ALA A CB  1 
ATOM   2574 N N   . SER A 1 336 ? 22.640  -37.977 34.694  1.00 32.59  ? 371 SER A N   1 
ATOM   2575 C CA  . SER A 1 336 ? 23.641  -36.957 34.512  1.00 32.59  ? 371 SER A CA  1 
ATOM   2576 C C   . SER A 1 336 ? 23.520  -36.290 33.172  1.00 32.59  ? 371 SER A C   1 
ATOM   2577 O O   . SER A 1 336 ? 23.152  -36.928 32.186  1.00 32.59  ? 371 SER A O   1 
ATOM   2578 C CB  . SER A 1 336 ? 25.034  -37.579 34.679  1.00 34.34  ? 371 SER A CB  1 
ATOM   2579 O OG  . SER A 1 336 ? 26.061  -36.611 34.590  1.00 34.34  ? 371 SER A OG  1 
ATOM   2580 N N   . ALA A 1 337 ? 23.823  -34.995 33.157  1.00 43.38  ? 372 ALA A N   1 
ATOM   2581 C CA  . ALA A 1 337 ? 23.785  -34.181 31.948  1.00 43.38  ? 372 ALA A CA  1 
ATOM   2582 C C   . ALA A 1 337 ? 24.885  -33.101 32.021  1.00 43.38  ? 372 ALA A C   1 
ATOM   2583 O O   . ALA A 1 337 ? 25.110  -32.477 33.062  1.00 43.38  ? 372 ALA A O   1 
ATOM   2584 C CB  . ALA A 1 337 ? 22.425  -33.531 31.806  1.00 43.71  ? 372 ALA A CB  1 
ATOM   2585 N N   . SER A 1 338 ? 25.576  -32.896 30.904  1.00 34.52  ? 373 SER A N   1 
ATOM   2586 C CA  . SER A 1 338 ? 26.649  -31.916 30.859  1.00 34.52  ? 373 SER A CA  1 
ATOM   2587 C C   . SER A 1 338 ? 26.515  -30.931 29.711  1.00 34.52  ? 373 SER A C   1 
ATOM   2588 O O   . SER A 1 338 ? 25.886  -31.227 28.702  1.00 34.52  ? 373 SER A O   1 
ATOM   2589 C CB  . SER A 1 338 ? 28.011  -32.620 30.792  1.00 79.87  ? 373 SER A CB  1 
ATOM   2590 O OG  . SER A 1 338 ? 28.317  -33.225 32.042  1.00 79.87  ? 373 SER A OG  1 
ATOM   2591 N N   . ILE A 1 339 ? 27.110  -29.753 29.866  1.00 46.82  ? 374 ILE A N   1 
ATOM   2592 C CA  . ILE A 1 339 ? 27.079  -28.758 28.803  1.00 46.82  ? 374 ILE A CA  1 
ATOM   2593 C C   . ILE A 1 339 ? 28.261  -27.801 28.889  1.00 46.82  ? 374 ILE A C   1 
ATOM   2594 O O   . ILE A 1 339 ? 28.756  -27.495 29.969  1.00 46.82  ? 374 ILE A O   1 
ATOM   2595 C CB  . ILE A 1 339 ? 25.764  -27.951 28.808  1.00 41.51  ? 374 ILE A CB  1 
ATOM   2596 C CG1 . ILE A 1 339 ? 25.784  -26.920 27.677  1.00 41.51  ? 374 ILE A CG1 1 
ATOM   2597 C CG2 . ILE A 1 339 ? 25.590  -27.246 30.139  1.00 41.51  ? 374 ILE A CG2 1 
ATOM   2598 C CD1 . ILE A 1 339 ? 26.088  -27.504 26.309  1.00 63.10  ? 374 ILE A CD1 1 
ATOM   2599 N N   . MET A 1 340 ? 28.736  -27.360 27.734  1.00 69.11  ? 375 MET A N   1 
ATOM   2600 C CA  . MET A 1 340 ? 29.850  -26.423 27.684  1.00 69.11  ? 375 MET A CA  1 
ATOM   2601 C C   . MET A 1 340 ? 29.246  -25.011 27.713  1.00 69.11  ? 375 MET A C   1 
ATOM   2602 O O   . MET A 1 340 ? 28.267  -24.722 27.013  1.00 69.11  ? 375 MET A O   1 
ATOM   2603 C CB  . MET A 1 340 ? 30.632  -26.627 26.382  1.00 36.30  ? 375 MET A CB  1 
ATOM   2604 C CG  . MET A 1 340 ? 31.457  -27.892 26.349  1.00 36.30  ? 375 MET A CG  1 
ATOM   2605 S SD  . MET A 1 340 ? 32.735  -27.862 27.610  1.00 36.30  ? 375 MET A SD  1 
ATOM   2606 C CE  . MET A 1 340 ? 33.380  -26.233 27.407  1.00 36.30  ? 375 MET A CE  1 
ATOM   2607 N N   . ALA A 1 341 ? 29.816  -24.124 28.517  1.00 67.26  ? 376 ALA A N   1 
ATOM   2608 C CA  . ALA A 1 341 ? 29.298  -22.767 28.555  1.00 67.26  ? 376 ALA A CA  1 
ATOM   2609 C C   . ALA A 1 341 ? 30.456  -21.777 28.506  1.00 67.26  ? 376 ALA A C   1 
ATOM   2610 O O   . ALA A 1 341 ? 31.489  -21.989 29.146  1.00 67.26  ? 376 ALA A O   1 
ATOM   2611 C CB  . ALA A 1 341 ? 28.485  -22.557 29.821  1.00 69.77  ? 376 ALA A CB  1 
ATOM   2612 N N   . ALA A 1 342 ? 30.273  -20.717 27.717  1.00 54.87  ? 377 ALA A N   1 
ATOM   2613 C CA  . ALA A 1 342 ? 31.267  -19.648 27.566  1.00 54.87  ? 377 ALA A CA  1 
ATOM   2614 C C   . ALA A 1 342 ? 30.568  -18.323 27.782  1.00 54.87  ? 377 ALA A C   1 
ATOM   2615 O O   . ALA A 1 342 ? 29.719  -17.928 26.995  1.00 54.87  ? 377 ALA A O   1 
ATOM   2616 C CB  . ALA A 1 342 ? 31.889  -19.698 26.173  1.00 153.79 ? 377 ALA A CB  1 
ATOM   2617 N N   . PHE A 1 343 ? 30.918  -17.633 28.853  1.00 39.74  ? 378 PHE A N   1 
ATOM   2618 C CA  . PHE A 1 343 ? 30.287  -16.356 29.124  1.00 39.74  ? 378 PHE A CA  1 
ATOM   2619 C C   . PHE A 1 343 ? 31.154  -15.189 28.694  1.00 39.74  ? 378 PHE A C   1 
ATOM   2620 O O   . PHE A 1 343 ? 30.664  -14.076 28.520  1.00 39.74  ? 378 PHE A O   1 
ATOM   2621 C CB  . PHE A 1 343 ? 29.990  -16.243 30.609  1.00 72.82  ? 378 PHE A CB  1 
ATOM   2622 C CG  . PHE A 1 343 ? 29.634  -17.543 31.242  1.00 72.82  ? 378 PHE A CG  1 
ATOM   2623 C CD1 . PHE A 1 343 ? 28.497  -18.236 30.835  1.00 72.82  ? 378 PHE A CD1 1 
ATOM   2624 C CD2 . PHE A 1 343 ? 30.436  -18.079 32.255  1.00 72.82  ? 378 PHE A CD2 1 
ATOM   2625 C CE1 . PHE A 1 343 ? 28.155  -19.461 31.434  1.00 72.82  ? 378 PHE A CE1 1 
ATOM   2626 C CE2 . PHE A 1 343 ? 30.108  -19.299 32.863  1.00 72.82  ? 378 PHE A CE2 1 
ATOM   2627 C CZ  . PHE A 1 343 ? 28.966  -19.992 32.455  1.00 72.82  ? 378 PHE A CZ  1 
ATOM   2628 N N   . MET A 1 344 ? 32.440  -15.444 28.498  1.00 52.03  ? 379 MET A N   1 
ATOM   2629 C CA  . MET A 1 344 ? 33.352  -14.372 28.159  1.00 52.03  ? 379 MET A CA  1 
ATOM   2630 C C   . MET A 1 344 ? 34.648  -14.931 27.591  1.00 52.03  ? 379 MET A C   1 
ATOM   2631 O O   . MET A 1 344 ? 35.073  -16.009 27.985  1.00 52.03  ? 379 MET A O   1 
ATOM   2632 C CB  . MET A 1 344 ? 33.625  -13.579 29.432  1.00 35.96  ? 379 MET A CB  1 
ATOM   2633 C CG  . MET A 1 344 ? 34.016  -12.133 29.252  1.00 35.96  ? 379 MET A CG  1 
ATOM   2634 S SD  . MET A 1 344 ? 34.068  -11.330 30.894  1.00 35.96  ? 379 MET A SD  1 
ATOM   2635 C CE  . MET A 1 344 ? 32.372  -10.705 31.043  1.00 35.96  ? 379 MET A CE  1 
ATOM   2636 N N   . ASP A 1 345 ? 35.270  -14.196 26.673  1.00 73.95  ? 380 ASP A N   1 
ATOM   2637 C CA  . ASP A 1 345 ? 36.544  -14.615 26.094  1.00 73.95  ? 380 ASP A CA  1 
ATOM   2638 C C   . ASP A 1 345 ? 37.589  -14.373 27.181  1.00 73.95  ? 380 ASP A C   1 
ATOM   2639 O O   . ASP A 1 345 ? 37.237  -13.890 28.252  1.00 73.95  ? 380 ASP A O   1 
ATOM   2640 C CB  . ASP A 1 345 ? 36.854  -13.811 24.844  1.00 80.46  ? 380 ASP A CB  1 
ATOM   2641 C CG  . ASP A 1 345 ? 35.806  -13.999 23.792  1.00 80.46  ? 380 ASP A CG  1 
ATOM   2642 O OD1 . ASP A 1 345 ? 35.410  -15.163 23.576  1.00 80.46  ? 380 ASP A OD1 1 
ATOM   2643 O OD2 . ASP A 1 345 ? 35.375  -12.996 23.189  1.00 80.46  ? 380 ASP A OD2 1 
ATOM   2644 N N   . ASN A 1 346 ? 38.864  -14.671 26.945  1.00 141.40 ? 381 ASN A N   1 
ATOM   2645 C CA  . ASN A 1 346 ? 39.816  -14.501 28.041  1.00 141.40 ? 381 ASN A CA  1 
ATOM   2646 C C   . ASN A 1 346 ? 41.290  -14.270 27.743  1.00 141.40 ? 381 ASN A C   1 
ATOM   2647 O O   . ASN A 1 346 ? 42.120  -15.141 28.005  1.00 141.40 ? 381 ASN A O   1 
ATOM   2648 C CB  . ASN A 1 346 ? 39.721  -15.724 28.945  1.00 178.59 ? 381 ASN A CB  1 
ATOM   2649 C CG  . ASN A 1 346 ? 40.008  -17.021 28.206  1.00 178.59 ? 381 ASN A CG  1 
ATOM   2650 O OD1 . ASN A 1 346 ? 39.823  -18.111 28.748  1.00 178.59 ? 381 ASN A OD1 1 
ATOM   2651 N ND2 . ASN A 1 346 ? 40.469  -16.908 26.965  1.00 178.59 ? 381 ASN A ND2 1 
ATOM   2652 N N   . PRO A 1 347 ? 41.646  -13.086 27.234  1.00 140.72 ? 382 PRO A N   1 
ATOM   2653 C CA  . PRO A 1 347 ? 43.052  -12.782 26.924  1.00 140.72 ? 382 PRO A CA  1 
ATOM   2654 C C   . PRO A 1 347 ? 43.959  -12.815 28.155  1.00 140.72 ? 382 PRO A C   1 
ATOM   2655 O O   . PRO A 1 347 ? 44.470  -11.750 28.572  1.00 106.11 ? 382 PRO A O   1 
ATOM   2656 C CB  . PRO A 1 347 ? 42.964  -11.392 26.312  1.00 134.66 ? 382 PRO A CB  1 
ATOM   2657 C CG  . PRO A 1 347 ? 41.866  -10.768 27.121  1.00 134.66 ? 382 PRO A CG  1 
ATOM   2658 C CD  . PRO A 1 347 ? 40.819  -11.869 27.158  1.00 134.66 ? 382 PRO A CD  1 
ATOM   2659 O OXT . PRO A 1 347 ? 44.169  -13.927 28.686  1.00 149.32 ? 382 PRO A OXT 1 
ATOM   2660 N N   . CYS B 1 1   ? -50.711 20.229  6.497   1.00 200.00 ? 36  CYS B N   1 
ATOM   2661 C CA  . CYS B 1 1   ? -50.082 18.897  6.727   1.00 200.00 ? 36  CYS B CA  1 
ATOM   2662 C C   . CYS B 1 1   ? -51.056 17.877  7.312   1.00 200.00 ? 36  CYS B C   1 
ATOM   2663 O O   . CYS B 1 1   ? -51.443 17.971  8.479   1.00 200.00 ? 36  CYS B O   1 
ATOM   2664 C CB  . CYS B 1 1   ? -48.876 19.036  7.661   1.00 188.37 ? 36  CYS B CB  1 
ATOM   2665 S SG  . CYS B 1 1   ? -48.284 17.455  8.349   1.00 177.14 ? 36  CYS B SG  1 
ATOM   2666 N N   . PRO B 1 2   ? -51.467 16.885  6.504   1.00 200.00 ? 37  PRO B N   1 
ATOM   2667 C CA  . PRO B 1 2   ? -51.053 16.713  5.104   1.00 200.00 ? 37  PRO B CA  1 
ATOM   2668 C C   . PRO B 1 2   ? -51.818 17.645  4.162   1.00 200.00 ? 37  PRO B C   1 
ATOM   2669 O O   . PRO B 1 2   ? -52.997 17.928  4.378   1.00 200.00 ? 37  PRO B O   1 
ATOM   2670 C CB  . PRO B 1 2   ? -51.369 15.241  4.825   1.00 200.00 ? 37  PRO B CB  1 
ATOM   2671 C CG  . PRO B 1 2   ? -51.323 14.605  6.188   1.00 188.84 ? 37  PRO B CG  1 
ATOM   2672 C CD  . PRO B 1 2   ? -52.036 15.631  7.025   1.00 191.22 ? 37  PRO B CD  1 
ATOM   2673 N N   . ASP B 1 3   ? -51.142 18.116  3.119   1.00 200.00 ? 38  ASP B N   1 
ATOM   2674 C CA  . ASP B 1 3   ? -51.756 19.008  2.139   1.00 200.00 ? 38  ASP B CA  1 
ATOM   2675 C C   . ASP B 1 3   ? -50.850 19.122  0.917   1.00 198.13 ? 38  ASP B C   1 
ATOM   2676 O O   . ASP B 1 3   ? -51.324 19.240  -0.215  1.00 198.23 ? 38  ASP B O   1 
ATOM   2677 C CB  . ASP B 1 3   ? -51.982 20.394  2.754   1.00 183.99 ? 38  ASP B CB  1 
ATOM   2678 C CG  . ASP B 1 3   ? -52.758 21.323  1.837   1.00 189.35 ? 38  ASP B CG  1 
ATOM   2679 O OD1 . ASP B 1 3   ? -52.270 21.616  0.725   1.00 196.07 ? 38  ASP B OD1 1 
ATOM   2680 O OD2 . ASP B 1 3   ? -53.859 21.762  2.231   1.00 195.75 ? 38  ASP B OD2 1 
ATOM   2681 N N   . ALA B 1 4   ? -49.543 19.080  1.161   1.00 199.42 ? 39  ALA B N   1 
ATOM   2682 C CA  . ALA B 1 4   ? -48.549 19.175  0.097   1.00 196.47 ? 39  ALA B CA  1 
ATOM   2683 C C   . ALA B 1 4   ? -47.184 18.706  0.593   1.00 194.48 ? 39  ALA B C   1 
ATOM   2684 O O   . ALA B 1 4   ? -46.228 18.627  -0.182  1.00 193.26 ? 39  ALA B O   1 
ATOM   2685 C CB  . ALA B 1 4   ? -48.457 20.614  -0.406  1.00 159.18 ? 39  ALA B CB  1 
ATOM   2686 N N   . CYS B 1 5   ? -47.098 18.396  1.886   1.00 171.01 ? 40  CYS B N   1 
ATOM   2687 C CA  . CYS B 1 5   ? -45.842 17.936  2.467   1.00 171.78 ? 40  CYS B CA  1 
ATOM   2688 C C   . CYS B 1 5   ? -46.006 17.154  3.767   1.00 175.95 ? 40  CYS B C   1 
ATOM   2689 O O   . CYS B 1 5   ? -47.088 16.662  4.088   1.00 174.55 ? 40  CYS B O   1 
ATOM   2690 C CB  . CYS B 1 5   ? -44.913 19.123  2.734   1.00 200.00 ? 40  CYS B CB  1 
ATOM   2691 S SG  . CYS B 1 5   ? -43.167 18.618  2.729   1.00 196.62 ? 40  CYS B SG  1 
ATOM   2692 N N   . CYS B 1 6   ? -44.890 17.044  4.486   1.00 180.06 ? 41  CYS B N   1 
ATOM   2693 C CA  . CYS B 1 6   ? -44.775 16.377  5.781   1.00 185.74 ? 41  CYS B CA  1 
ATOM   2694 C C   . CYS B 1 6   ? -44.954 14.857  5.874   1.00 189.39 ? 41  CYS B C   1 
ATOM   2695 O O   . CYS B 1 6   ? -45.279 14.342  6.944   1.00 189.57 ? 41  CYS B O   1 
ATOM   2696 C CB  . CYS B 1 6   ? -45.706 17.050  6.799   1.00 200.00 ? 41  CYS B CB  1 
ATOM   2697 S SG  . CYS B 1 6   ? -47.448 16.515  6.755   1.00 200.00 ? 41  CYS B SG  1 
ATOM   2698 N N   . PRO B 1 7   ? -44.740 14.114  4.774   1.00 190.37 ? 42  PRO B N   1 
ATOM   2699 C CA  . PRO B 1 7   ? -44.916 12.664  4.909   1.00 193.35 ? 42  PRO B CA  1 
ATOM   2700 C C   . PRO B 1 7   ? -43.737 12.020  5.642   1.00 196.55 ? 42  PRO B C   1 
ATOM   2701 O O   . PRO B 1 7   ? -43.607 12.156  6.858   1.00 194.93 ? 42  PRO B O   1 
ATOM   2702 C CB  . PRO B 1 7   ? -45.039 12.199  3.461   1.00 179.79 ? 42  PRO B CB  1 
ATOM   2703 C CG  . PRO B 1 7   ? -44.146 13.144  2.743   1.00 180.13 ? 42  PRO B CG  1 
ATOM   2704 C CD  . PRO B 1 7   ? -44.489 14.479  3.370   1.00 177.56 ? 42  PRO B CD  1 
ATOM   2705 N N   . HIS B 1 8   ? -42.882 11.324  4.899   1.00 200.00 ? 43  HIS B N   1 
ATOM   2706 C CA  . HIS B 1 8   ? -41.714 10.670  5.482   1.00 200.00 ? 43  HIS B CA  1 
ATOM   2707 C C   . HIS B 1 8   ? -42.123 9.838   6.700   1.00 200.00 ? 43  HIS B C   1 
ATOM   2708 O O   . HIS B 1 8   ? -43.193 9.230   6.717   1.00 200.00 ? 43  HIS B O   1 
ATOM   2709 C CB  . HIS B 1 8   ? -40.678 11.727  5.891   1.00 200.00 ? 43  HIS B CB  1 
ATOM   2710 C CG  . HIS B 1 8   ? -39.286 11.192  6.045   1.00 200.00 ? 43  HIS B CG  1 
ATOM   2711 N ND1 . HIS B 1 8   ? -38.976 10.143  6.884   1.00 200.00 ? 43  HIS B ND1 1 
ATOM   2712 C CD2 . HIS B 1 8   ? -38.118 11.573  5.475   1.00 200.00 ? 43  HIS B CD2 1 
ATOM   2713 C CE1 . HIS B 1 8   ? -37.679 9.900   6.823   1.00 200.00 ? 43  HIS B CE1 1 
ATOM   2714 N NE2 . HIS B 1 8   ? -37.135 10.754  5.975   1.00 200.00 ? 43  HIS B NE2 1 
ATOM   2715 N N   . GLY B 1 9   ? -41.265 9.820   7.715   1.00 200.00 ? 44  GLY B N   1 
ATOM   2716 C CA  . GLY B 1 9   ? -41.541 9.070   8.927   1.00 200.00 ? 44  GLY B CA  1 
ATOM   2717 C C   . GLY B 1 9   ? -40.761 9.650   10.090  1.00 200.00 ? 44  GLY B C   1 
ATOM   2718 O O   . GLY B 1 9   ? -41.342 10.105  11.076  1.00 200.00 ? 44  GLY B O   1 
ATOM   2719 N N   . SER B 1 10  ? -39.437 9.636   9.974   1.00 200.00 ? 45  SER B N   1 
ATOM   2720 C CA  . SER B 1 10  ? -38.569 10.174  11.014  1.00 200.00 ? 45  SER B CA  1 
ATOM   2721 C C   . SER B 1 10  ? -38.523 11.693  10.883  1.00 200.00 ? 45  SER B C   1 
ATOM   2722 O O   . SER B 1 10  ? -39.518 12.321  10.517  1.00 200.00 ? 45  SER B O   1 
ATOM   2723 C CB  . SER B 1 10  ? -37.159 9.596   10.873  1.00 178.39 ? 45  SER B CB  1 
ATOM   2724 O OG  . SER B 1 10  ? -37.177 8.181   10.951  1.00 179.85 ? 45  SER B OG  1 
ATOM   2725 N N   . SER B 1 11  ? -37.370 12.280  11.185  1.00 188.33 ? 46  SER B N   1 
ATOM   2726 C CA  . SER B 1 11  ? -37.200 13.725  11.082  1.00 186.84 ? 46  SER B CA  1 
ATOM   2727 C C   . SER B 1 11  ? -37.084 14.080  9.603   1.00 187.21 ? 46  SER B C   1 
ATOM   2728 O O   . SER B 1 11  ? -36.013 14.441  9.114   1.00 188.32 ? 46  SER B O   1 
ATOM   2729 C CB  . SER B 1 11  ? -35.940 14.167  11.830  1.00 75.21  ? 46  SER B CB  1 
ATOM   2730 O OG  . SER B 1 11  ? -35.790 15.575  11.785  1.00 83.58  ? 46  SER B OG  1 
ATOM   2731 N N   . GLY B 1 12  ? -38.208 13.971  8.902   1.00 145.65 ? 47  GLY B N   1 
ATOM   2732 C CA  . GLY B 1 12  ? -38.252 14.244  7.476   1.00 143.53 ? 47  GLY B CA  1 
ATOM   2733 C C   . GLY B 1 12  ? -39.404 15.133  7.037   1.00 144.27 ? 47  GLY B C   1 
ATOM   2734 O O   . GLY B 1 12  ? -40.538 14.938  7.483   1.00 146.37 ? 47  GLY B O   1 
ATOM   2735 N N   . LEU B 1 13  ? -39.098 16.102  6.257   1.00 192.94 ? 48  LEU B N   1 
ATOM   2736 C CA  . LEU B 1 13  ? -40.111 16.910  5.573   1.00 192.34 ? 48  LEU B CA  1 
ATOM   2737 C C   . LEU B 1 13  ? -40.059 16.721  4.055   1.00 194.57 ? 48  LEU B C   1 
ATOM   2738 O O   . LEU B 1 13  ? -39.034 17.073  3.466   1.00 195.14 ? 48  LEU B O   1 
ATOM   2739 C CB  . LEU B 1 13  ? -39.920 18.394  5.906   1.00 186.25 ? 48  LEU B CB  1 
ATOM   2740 C CG  . LEU B 1 13  ? -40.097 18.827  7.365   1.00 195.10 ? 48  LEU B CG  1 
ATOM   2741 C CD1 . LEU B 1 13  ? -39.746 20.301  7.508   1.00 195.10 ? 48  LEU B CD1 1 
ATOM   2742 C CD2 . LEU B 1 13  ? -41.530 18.570  7.807   1.00 195.10 ? 48  LEU B CD2 1 
ATOM   2743 N N   . ARG B 1 14  ? -41.024 16.023  3.558   1.00 159.47 ? 49  ARG B N   1 
ATOM   2744 C CA  . ARG B 1 14  ? -40.987 15.617  2.161   1.00 157.86 ? 49  ARG B CA  1 
ATOM   2745 C C   . ARG B 1 14  ? -42.044 16.342  1.342   1.00 160.26 ? 49  ARG B C   1 
ATOM   2746 O O   . ARG B 1 14  ? -43.246 16.170  1.568   1.00 160.30 ? 49  ARG B O   1 
ATOM   2747 C CB  . ARG B 1 14  ? -41.179 14.103  2.034   1.00 166.55 ? 49  ARG B CB  1 
ATOM   2748 C CG  . ARG B 1 14  ? -40.039 13.277  2.607   1.00 170.23 ? 49  ARG B CG  1 
ATOM   2749 C CD  . ARG B 1 14  ? -40.257 11.789  2.366   1.00 170.23 ? 49  ARG B CD  1 
ATOM   2750 N NE  . ARG B 1 14  ? -39.132 10.989  2.842   1.00 170.23 ? 49  ARG B NE  1 
ATOM   2751 C CZ  . ARG B 1 14  ? -39.069 9.663   2.773   1.00 170.23 ? 49  ARG B CZ  1 
ATOM   2752 N NH1 . ARG B 1 14  ? -40.072 8.975   2.245   1.00 170.23 ? 49  ARG B NH1 1 
ATOM   2753 N NH2 . ARG B 1 14  ? -38.003 9.024   3.235   1.00 170.23 ? 49  ARG B NH2 1 
ATOM   2754 N N   . CYS B 1 15  ? -41.590 17.123  0.352   1.00 174.17 ? 50  CYS B N   1 
ATOM   2755 C CA  . CYS B 1 15  ? -42.513 17.847  -0.528  1.00 175.69 ? 50  CYS B CA  1 
ATOM   2756 C C   . CYS B 1 15  ? -42.041 17.778  -1.986  1.00 174.83 ? 50  CYS B C   1 
ATOM   2757 O O   . CYS B 1 15  ? -42.040 18.787  -2.693  1.00 175.16 ? 50  CYS B O   1 
ATOM   2758 C CB  . CYS B 1 15  ? -42.591 19.343  -0.187  1.00 153.52 ? 50  CYS B CB  1 
ATOM   2759 S SG  . CYS B 1 15  ? -42.274 19.960  1.500   1.00 155.58 ? 50  CYS B SG  1 
ATOM   2760 N N   . THR B 1 16  ? -41.762 16.569  -2.462  1.00 200.00 ? 51  THR B N   1 
ATOM   2761 C CA  . THR B 1 16  ? -41.345 16.366  -3.849  1.00 200.00 ? 51  THR B CA  1 
ATOM   2762 C C   . THR B 1 16  ? -42.418 16.900  -4.818  1.00 200.00 ? 51  THR B C   1 
ATOM   2763 O O   . THR B 1 16  ? -43.136 16.121  -5.454  1.00 200.00 ? 51  THR B O   1 
ATOM   2764 C CB  . THR B 1 16  ? -41.118 14.863  -4.141  1.00 194.20 ? 51  THR B CB  1 
ATOM   2765 O OG1 . THR B 1 16  ? -40.135 14.340  -3.237  1.00 191.07 ? 51  THR B OG1 1 
ATOM   2766 C CG2 . THR B 1 16  ? -40.644 14.660  -5.577  1.00 188.30 ? 51  THR B CG2 1 
ATOM   2767 N N   . ARG B 1 17  ? -42.524 18.226  -4.918  1.00 200.00 ? 52  ARG B N   1 
ATOM   2768 C CA  . ARG B 1 17  ? -43.493 18.883  -5.800  1.00 200.00 ? 52  ARG B CA  1 
ATOM   2769 C C   . ARG B 1 17  ? -43.460 20.406  -5.616  1.00 200.00 ? 52  ARG B C   1 
ATOM   2770 O O   . ARG B 1 17  ? -42.679 20.924  -4.816  1.00 200.00 ? 52  ARG B O   1 
ATOM   2771 C CB  . ARG B 1 17  ? -44.912 18.365  -5.527  1.00 160.76 ? 52  ARG B CB  1 
ATOM   2772 C CG  . ARG B 1 17  ? -45.942 18.819  -6.556  1.00 176.74 ? 52  ARG B CG  1 
ATOM   2773 C CD  . ARG B 1 17  ? -47.352 18.379  -6.191  1.00 194.28 ? 52  ARG B CD  1 
ATOM   2774 N NE  . ARG B 1 17  ? -48.335 18.870  -7.154  1.00 200.00 ? 52  ARG B NE  1 
ATOM   2775 C CZ  . ARG B 1 17  ? -49.645 18.662  -7.063  1.00 200.00 ? 52  ARG B CZ  1 
ATOM   2776 N NH1 . ARG B 1 17  ? -50.142 17.969  -6.047  1.00 200.00 ? 52  ARG B NH1 1 
ATOM   2777 N NH2 . ARG B 1 17  ? -50.461 19.149  -7.989  1.00 200.00 ? 52  ARG B NH2 1 
ATOM   2778 N N   . ASP B 1 18  ? -44.315 21.104  -6.364  1.00 200.00 ? 53  ASP B N   1 
ATOM   2779 C CA  . ASP B 1 18  ? -44.426 22.566  -6.336  1.00 200.00 ? 53  ASP B CA  1 
ATOM   2780 C C   . ASP B 1 18  ? -44.085 23.223  -4.998  1.00 200.00 ? 53  ASP B C   1 
ATOM   2781 O O   . ASP B 1 18  ? -44.326 22.656  -3.931  1.00 200.00 ? 53  ASP B O   1 
ATOM   2782 C CB  . ASP B 1 18  ? -45.838 22.984  -6.762  1.00 159.64 ? 53  ASP B CB  1 
ATOM   2783 C CG  . ASP B 1 18  ? -46.017 24.490  -6.796  1.00 164.65 ? 53  ASP B CG  1 
ATOM   2784 O OD1 . ASP B 1 18  ? -45.284 25.161  -7.552  1.00 170.83 ? 53  ASP B OD1 1 
ATOM   2785 O OD2 . ASP B 1 18  ? -46.892 25.003  -6.066  1.00 171.18 ? 53  ASP B OD2 1 
ATOM   2786 N N   . GLY B 1 19  ? -43.536 24.433  -5.073  1.00 199.82 ? 54  GLY B N   1 
ATOM   2787 C CA  . GLY B 1 19  ? -43.154 25.165  -3.878  1.00 200.00 ? 54  GLY B CA  1 
ATOM   2788 C C   . GLY B 1 19  ? -44.313 25.693  -3.056  1.00 200.00 ? 54  GLY B C   1 
ATOM   2789 O O   . GLY B 1 19  ? -45.284 26.227  -3.594  1.00 200.00 ? 54  GLY B O   1 
ATOM   2790 N N   . ALA B 1 20  ? -44.201 25.542  -1.740  1.00 198.64 ? 55  ALA B N   1 
ATOM   2791 C CA  . ALA B 1 20  ? -45.228 25.997  -0.812  1.00 200.00 ? 55  ALA B CA  1 
ATOM   2792 C C   . ALA B 1 20  ? -44.586 26.271  0.544   1.00 200.00 ? 55  ALA B C   1 
ATOM   2793 O O   . ALA B 1 20  ? -45.076 25.818  1.578   1.00 200.00 ? 55  ALA B O   1 
ATOM   2794 C CB  . ALA B 1 20  ? -46.318 24.939  -0.677  1.00 196.26 ? 55  ALA B CB  1 
ATOM   2795 N N   . LEU B 1 21  ? -43.487 27.019  0.527   1.00 200.00 ? 56  LEU B N   1 
ATOM   2796 C CA  . LEU B 1 21  ? -42.755 27.355  1.743   1.00 200.00 ? 56  LEU B CA  1 
ATOM   2797 C C   . LEU B 1 21  ? -43.269 28.645  2.373   1.00 200.00 ? 56  LEU B C   1 
ATOM   2798 O O   . LEU B 1 21  ? -42.837 29.027  3.461   1.00 200.00 ? 56  LEU B O   1 
ATOM   2799 C CB  . LEU B 1 21  ? -41.265 27.504  1.427   1.00 195.83 ? 56  LEU B CB  1 
ATOM   2800 C CG  . LEU B 1 21  ? -40.603 26.350  0.669   1.00 200.00 ? 56  LEU B CG  1 
ATOM   2801 C CD1 . LEU B 1 21  ? -39.168 26.718  0.334   1.00 200.00 ? 56  LEU B CD1 1 
ATOM   2802 C CD2 . LEU B 1 21  ? -40.653 25.083  1.505   1.00 200.00 ? 56  LEU B CD2 1 
ATOM   2803 N N   . ASP B 1 22  ? -44.190 29.312  1.684   1.00 200.00 ? 57  ASP B N   1 
ATOM   2804 C CA  . ASP B 1 22  ? -44.761 30.566  2.166   1.00 200.00 ? 57  ASP B CA  1 
ATOM   2805 C C   . ASP B 1 22  ? -45.282 30.467  3.600   1.00 200.00 ? 57  ASP B C   1 
ATOM   2806 O O   . ASP B 1 22  ? -45.144 31.407  4.383   1.00 200.00 ? 57  ASP B O   1 
ATOM   2807 C CB  . ASP B 1 22  ? -45.897 31.018  1.242   1.00 197.34 ? 57  ASP B CB  1 
ATOM   2808 C CG  . ASP B 1 22  ? -45.425 31.300  -0.173  1.00 198.64 ? 57  ASP B CG  1 
ATOM   2809 O OD1 . ASP B 1 22  ? -44.546 32.171  -0.346  1.00 200.00 ? 57  ASP B OD1 1 
ATOM   2810 O OD2 . ASP B 1 22  ? -45.933 30.652  -1.112  1.00 200.00 ? 57  ASP B OD2 1 
ATOM   2811 N N   . SER B 1 23  ? -45.878 29.327  3.939   1.00 199.59 ? 58  SER B N   1 
ATOM   2812 C CA  . SER B 1 23  ? -46.422 29.118  5.278   1.00 198.56 ? 58  SER B CA  1 
ATOM   2813 C C   . SER B 1 23  ? -45.734 27.968  6.006   1.00 197.86 ? 58  SER B C   1 
ATOM   2814 O O   . SER B 1 23  ? -46.209 27.508  7.045   1.00 198.17 ? 58  SER B O   1 
ATOM   2815 C CB  . SER B 1 23  ? -47.925 28.841  5.196   1.00 174.15 ? 58  SER B CB  1 
ATOM   2816 O OG  . SER B 1 23  ? -48.610 29.913  4.573   1.00 169.09 ? 58  SER B OG  1 
ATOM   2817 N N   . LEU B 1 24  ? -44.616 27.505  5.456   1.00 200.00 ? 59  LEU B N   1 
ATOM   2818 C CA  . LEU B 1 24  ? -43.867 26.410  6.061   1.00 200.00 ? 59  LEU B CA  1 
ATOM   2819 C C   . LEU B 1 24  ? -42.821 26.969  7.022   1.00 200.00 ? 59  LEU B C   1 
ATOM   2820 O O   . LEU B 1 24  ? -41.944 26.246  7.497   1.00 200.00 ? 59  LEU B O   1 
ATOM   2821 C CB  . LEU B 1 24  ? -43.186 25.569  4.975   1.00 194.55 ? 59  LEU B CB  1 
ATOM   2822 C CG  . LEU B 1 24  ? -42.556 24.242  5.411   1.00 188.80 ? 59  LEU B CG  1 
ATOM   2823 C CD1 . LEU B 1 24  ? -43.627 23.326  5.987   1.00 185.97 ? 59  LEU B CD1 1 
ATOM   2824 C CD2 . LEU B 1 24  ? -41.882 23.580  4.223   1.00 186.11 ? 59  LEU B CD2 1 
ATOM   2825 N N   . HIS B 1 25  ? -42.923 28.265  7.302   1.00 200.00 ? 60  HIS B N   1 
ATOM   2826 C CA  . HIS B 1 25  ? -41.998 28.934  8.211   1.00 200.00 ? 60  HIS B CA  1 
ATOM   2827 C C   . HIS B 1 25  ? -42.756 29.539  9.389   1.00 200.00 ? 60  HIS B C   1 
ATOM   2828 O O   . HIS B 1 25  ? -42.221 29.652  10.493  1.00 200.00 ? 60  HIS B O   1 
ATOM   2829 C CB  . HIS B 1 25  ? -41.231 30.036  7.474   1.00 200.00 ? 60  HIS B CB  1 
ATOM   2830 C CG  . HIS B 1 25  ? -40.406 29.536  6.328   1.00 200.00 ? 60  HIS B CG  1 
ATOM   2831 N ND1 . HIS B 1 25  ? -39.424 28.581  6.479   1.00 200.00 ? 60  HIS B ND1 1 
ATOM   2832 C CD2 . HIS B 1 25  ? -40.416 29.861  5.014   1.00 200.00 ? 60  HIS B CD2 1 
ATOM   2833 C CE1 . HIS B 1 25  ? -38.864 28.340  5.307   1.00 200.00 ? 60  HIS B CE1 1 
ATOM   2834 N NE2 . HIS B 1 25  ? -39.447 29.104  4.401   1.00 200.00 ? 60  HIS B NE2 1 
ATOM   2835 N N   . HIS B 1 26  ? -44.006 29.925  9.144   1.00 200.00 ? 61  HIS B N   1 
ATOM   2836 C CA  . HIS B 1 26  ? -44.849 30.515  10.179  1.00 200.00 ? 61  HIS B CA  1 
ATOM   2837 C C   . HIS B 1 26  ? -45.445 29.429  11.070  1.00 200.00 ? 61  HIS B C   1 
ATOM   2838 O O   . HIS B 1 26  ? -45.271 29.448  12.290  1.00 200.00 ? 61  HIS B O   1 
ATOM   2839 C CB  . HIS B 1 26  ? -45.975 31.334  9.542   1.00 194.60 ? 61  HIS B CB  1 
ATOM   2840 C CG  . HIS B 1 26  ? -45.494 32.492  8.725   1.00 196.60 ? 61  HIS B CG  1 
ATOM   2841 N ND1 . HIS B 1 26  ? -44.683 32.339  7.621   1.00 197.33 ? 61  HIS B ND1 1 
ATOM   2842 C CD2 . HIS B 1 26  ? -45.710 33.823  8.851   1.00 197.33 ? 61  HIS B CD2 1 
ATOM   2843 C CE1 . HIS B 1 26  ? -44.420 33.525  7.103   1.00 197.33 ? 61  HIS B CE1 1 
ATOM   2844 N NE2 . HIS B 1 26  ? -45.030 34.443  7.830   1.00 197.33 ? 61  HIS B NE2 1 
ATOM   2845 N N   . LEU B 1 27  ? -46.150 28.484  10.454  1.00 200.00 ? 62  LEU B N   1 
ATOM   2846 C CA  . LEU B 1 27  ? -46.769 27.387  11.187  1.00 200.00 ? 62  LEU B CA  1 
ATOM   2847 C C   . LEU B 1 27  ? -46.631 26.075  10.418  1.00 200.00 ? 62  LEU B C   1 
ATOM   2848 O O   . LEU B 1 27  ? -47.620 25.504  9.957   1.00 200.00 ? 62  LEU B O   1 
ATOM   2849 C CB  . LEU B 1 27  ? -48.250 27.690  11.439  1.00 200.00 ? 62  LEU B CB  1 
ATOM   2850 C CG  . LEU B 1 27  ? -49.038 26.674  12.272  1.00 200.00 ? 62  LEU B CG  1 
ATOM   2851 C CD1 . LEU B 1 27  ? -48.406 26.531  13.649  1.00 200.00 ? 62  LEU B CD1 1 
ATOM   2852 C CD2 . LEU B 1 27  ? -50.484 27.126  12.393  1.00 200.00 ? 62  LEU B CD2 1 
ATOM   2853 N N   . PRO B 1 28  ? -45.390 25.583  10.263  1.00 200.00 ? 63  PRO B N   1 
ATOM   2854 C CA  . PRO B 1 28  ? -45.132 24.332  9.546   1.00 200.00 ? 63  PRO B CA  1 
ATOM   2855 C C   . PRO B 1 28  ? -45.463 23.107  10.397  1.00 200.00 ? 63  PRO B C   1 
ATOM   2856 O O   . PRO B 1 28  ? -46.054 22.142  9.913   1.00 200.00 ? 63  PRO B O   1 
ATOM   2857 C CB  . PRO B 1 28  ? -43.646 24.429  9.226   1.00 200.00 ? 63  PRO B CB  1 
ATOM   2858 C CG  . PRO B 1 28  ? -43.108 25.127  10.433  1.00 200.00 ? 63  PRO B CG  1 
ATOM   2859 C CD  . PRO B 1 28  ? -44.124 26.231  10.654  1.00 200.00 ? 63  PRO B CD  1 
ATOM   2860 N N   . GLY B 1 29  ? -45.075 23.161  11.669  1.00 194.69 ? 64  GLY B N   1 
ATOM   2861 C CA  . GLY B 1 29  ? -45.331 22.056  12.574  1.00 191.68 ? 64  GLY B CA  1 
ATOM   2862 C C   . GLY B 1 29  ? -44.115 21.718  13.415  1.00 188.17 ? 64  GLY B C   1 
ATOM   2863 O O   . GLY B 1 29  ? -44.245 21.306  14.567  1.00 188.23 ? 64  GLY B O   1 
ATOM   2864 N N   . ALA B 1 30  ? -42.930 21.895  12.837  1.00 200.00 ? 65  ALA B N   1 
ATOM   2865 C CA  . ALA B 1 30  ? -41.682 21.606  13.535  1.00 198.06 ? 65  ALA B CA  1 
ATOM   2866 C C   . ALA B 1 30  ? -40.474 22.184  12.799  1.00 194.79 ? 65  ALA B C   1 
ATOM   2867 O O   . ALA B 1 30  ? -40.108 21.708  11.721  1.00 193.63 ? 65  ALA B O   1 
ATOM   2868 C CB  . ALA B 1 30  ? -41.518 20.099  13.701  1.00 198.39 ? 65  ALA B CB  1 
ATOM   2869 N N   . GLU B 1 31  ? -39.858 23.207  13.389  1.00 189.79 ? 66  GLU B N   1 
ATOM   2870 C CA  . GLU B 1 31  ? -38.687 23.847  12.795  1.00 187.47 ? 66  GLU B CA  1 
ATOM   2871 C C   . GLU B 1 31  ? -37.572 22.821  12.664  1.00 182.64 ? 66  GLU B C   1 
ATOM   2872 O O   . GLU B 1 31  ? -36.571 23.055  11.986  1.00 182.73 ? 66  GLU B O   1 
ATOM   2873 C CB  . GLU B 1 31  ? -38.198 25.011  13.664  1.00 176.78 ? 66  GLU B CB  1 
ATOM   2874 C CG  . GLU B 1 31  ? -39.254 26.055  13.997  1.00 180.64 ? 66  GLU B CG  1 
ATOM   2875 C CD  . GLU B 1 31  ? -40.155 25.636  15.144  1.00 184.16 ? 66  GLU B CD  1 
ATOM   2876 O OE1 . GLU B 1 31  ? -41.091 26.395  15.473  1.00 185.72 ? 66  GLU B OE1 1 
ATOM   2877 O OE2 . GLU B 1 31  ? -39.925 24.552  15.721  1.00 185.78 ? 66  GLU B OE2 1 
ATOM   2878 N N   . ASN B 1 32  ? -37.755 21.685  13.329  1.00 200.00 ? 67  ASN B N   1 
ATOM   2879 C CA  . ASN B 1 32  ? -36.780 20.606  13.299  1.00 200.00 ? 67  ASN B CA  1 
ATOM   2880 C C   . ASN B 1 32  ? -37.036 19.748  12.062  1.00 199.31 ? 67  ASN B C   1 
ATOM   2881 O O   . ASN B 1 32  ? -38.176 19.615  11.611  1.00 197.73 ? 67  ASN B O   1 
ATOM   2882 C CB  . ASN B 1 32  ? -36.899 19.759  14.570  1.00 193.13 ? 67  ASN B CB  1 
ATOM   2883 C CG  . ASN B 1 32  ? -35.716 18.831  14.769  1.00 191.85 ? 67  ASN B CG  1 
ATOM   2884 O OD1 . ASN B 1 32  ? -34.570 19.275  14.840  1.00 192.24 ? 67  ASN B OD1 1 
ATOM   2885 N ND2 . ASN B 1 32  ? -35.989 17.536  14.865  1.00 191.43 ? 67  ASN B ND2 1 
ATOM   2886 N N   . LEU B 1 33  ? -35.967 19.179  11.515  1.00 175.52 ? 68  LEU B N   1 
ATOM   2887 C CA  . LEU B 1 33  ? -36.046 18.337  10.325  1.00 175.85 ? 68  LEU B CA  1 
ATOM   2888 C C   . LEU B 1 33  ? -34.646 17.800  10.062  1.00 170.87 ? 68  LEU B C   1 
ATOM   2889 O O   . LEU B 1 33  ? -33.683 18.279  10.661  1.00 169.73 ? 68  LEU B O   1 
ATOM   2890 C CB  . LEU B 1 33  ? -36.518 19.161  9.124   1.00 176.69 ? 68  LEU B CB  1 
ATOM   2891 C CG  . LEU B 1 33  ? -35.559 20.219  8.567   1.00 188.25 ? 68  LEU B CG  1 
ATOM   2892 C CD1 . LEU B 1 33  ? -36.265 20.981  7.465   1.00 194.03 ? 68  LEU B CD1 1 
ATOM   2893 C CD2 . LEU B 1 33  ? -35.112 21.179  9.660   1.00 194.21 ? 68  LEU B CD2 1 
ATOM   2894 N N   . THR B 1 34  ? -34.515 16.816  9.176   1.00 196.52 ? 69  THR B N   1 
ATOM   2895 C CA  . THR B 1 34  ? -33.186 16.284  8.916   1.00 197.92 ? 69  THR B CA  1 
ATOM   2896 C C   . THR B 1 34  ? -32.980 16.034  7.432   1.00 197.11 ? 69  THR B C   1 
ATOM   2897 O O   . THR B 1 34  ? -31.875 15.981  6.911   1.00 196.20 ? 69  THR B O   1 
ATOM   2898 C CB  . THR B 1 34  ? -32.952 14.963  9.683   1.00 182.74 ? 69  THR B CB  1 
ATOM   2899 O OG1 . THR B 1 34  ? -33.129 15.188  11.087  1.00 112.68 ? 69  THR B OG1 1 
ATOM   2900 C CG2 . THR B 1 34  ? -31.541 14.443  9.437   1.00 112.68 ? 69  THR B CG2 1 
ATOM   2901 N N   . GLU B 1 35  ? -34.097 15.879  6.743   1.00 71.42  ? 70  GLU B N   1 
ATOM   2902 C CA  . GLU B 1 35  ? -34.092 15.684  5.299   1.00 70.86  ? 70  GLU B CA  1 
ATOM   2903 C C   . GLU B 1 35  ? -35.161 16.538  4.625   1.00 70.06  ? 70  GLU B C   1 
ATOM   2904 O O   . GLU B 1 35  ? -36.294 16.583  5.125   1.00 72.22  ? 70  GLU B O   1 
ATOM   2905 C CB  . GLU B 1 35  ? -34.318 14.209  4.970   1.00 160.23 ? 70  GLU B CB  1 
ATOM   2906 C CG  . GLU B 1 35  ? -33.279 13.283  5.580   1.00 162.60 ? 70  GLU B CG  1 
ATOM   2907 C CD  . GLU B 1 35  ? -33.486 11.835  5.189   1.00 166.54 ? 70  GLU B CD  1 
ATOM   2908 O OE1 . GLU B 1 35  ? -33.423 11.533  3.980   1.00 168.76 ? 70  GLU B OE1 1 
ATOM   2909 O OE2 . GLU B 1 35  ? -33.712 11.000  6.090   1.00 168.76 ? 70  GLU B OE2 1 
ATOM   2910 N N   . LEU B 1 36  ? -34.790 17.245  3.625   1.00 163.53 ? 71  LEU B N   1 
ATOM   2911 C CA  . LEU B 1 36  ? -35.736 18.045  2.841   1.00 164.29 ? 71  LEU B CA  1 
ATOM   2912 C C   . LEU B 1 36  ? -35.661 17.710  1.351   1.00 165.13 ? 71  LEU B C   1 
ATOM   2913 O O   . LEU B 1 36  ? -34.567 17.783  0.783   1.00 163.83 ? 71  LEU B O   1 
ATOM   2914 C CB  . LEU B 1 36  ? -35.460 19.541  3.022   1.00 182.99 ? 71  LEU B CB  1 
ATOM   2915 C CG  . LEU B 1 36  ? -35.993 20.245  4.270   1.00 191.41 ? 71  LEU B CG  1 
ATOM   2916 C CD1 . LEU B 1 36  ? -35.510 21.689  4.280   1.00 182.04 ? 71  LEU B CD1 1 
ATOM   2917 C CD2 . LEU B 1 36  ? -37.515 20.194  4.283   1.00 191.41 ? 71  LEU B CD2 1 
ATOM   2918 N N   . TYR B 1 37  ? -36.752 17.253  0.800   1.00 157.95 ? 72  TYR B N   1 
ATOM   2919 C CA  . TYR B 1 37  ? -36.775 16.860  -0.604  1.00 159.29 ? 72  TYR B CA  1 
ATOM   2920 C C   . TYR B 1 37  ? -37.606 17.838  -1.425  1.00 161.10 ? 72  TYR B C   1 
ATOM   2921 O O   . TYR B 1 37  ? -38.833 17.862  -1.294  1.00 160.72 ? 72  TYR B O   1 
ATOM   2922 C CB  . TYR B 1 37  ? -37.375 15.460  -0.755  1.00 186.76 ? 72  TYR B CB  1 
ATOM   2923 C CG  . TYR B 1 37  ? -36.612 14.358  -0.058  1.00 189.24 ? 72  TYR B CG  1 
ATOM   2924 C CD1 . TYR B 1 37  ? -36.463 14.351  1.329   1.00 193.87 ? 72  TYR B CD1 1 
ATOM   2925 C CD2 . TYR B 1 37  ? -36.058 13.305  -0.785  1.00 191.94 ? 72  TYR B CD2 1 
ATOM   2926 C CE1 . TYR B 1 37  ? -35.782 13.320  1.975   1.00 193.20 ? 72  TYR B CE1 1 
ATOM   2927 C CE2 . TYR B 1 37  ? -35.375 12.272  -0.151  1.00 193.93 ? 72  TYR B CE2 1 
ATOM   2928 C CZ  . TYR B 1 37  ? -35.242 12.285  1.228   1.00 191.54 ? 72  TYR B CZ  1 
ATOM   2929 O OH  . TYR B 1 37  ? -34.577 11.257  1.855   1.00 194.02 ? 72  TYR B OH  1 
ATOM   2930 N N   . ILE B 1 38  ? -36.932 18.649  -2.233  1.00 195.49 ? 73  ILE B N   1 
ATOM   2931 C CA  . ILE B 1 38  ? -37.619 19.647  -3.043  1.00 196.66 ? 73  ILE B CA  1 
ATOM   2932 C C   . ILE B 1 38  ? -37.243 19.476  -4.522  1.00 195.45 ? 73  ILE B C   1 
ATOM   2933 O O   . ILE B 1 38  ? -37.392 20.394  -5.299  1.00 195.66 ? 73  ILE B O   1 
ATOM   2934 C CB  . ILE B 1 38  ? -37.242 21.076  -2.585  1.00 132.54 ? 73  ILE B CB  1 
ATOM   2935 C CG1 . ILE B 1 38  ? -37.360 21.182  -1.061  1.00 139.90 ? 73  ILE B CG1 1 
ATOM   2936 C CG2 . ILE B 1 38  ? -38.164 22.095  -3.236  1.00 139.90 ? 73  ILE B CG2 1 
ATOM   2937 C CD1 . ILE B 1 38  ? -36.934 22.525  -0.500  1.00 200.00 ? 73  ILE B CD1 1 
ATOM   2938 N N   . GLU B 1 39  ? -36.870 18.256  -4.893  1.00 193.44 ? 74  GLU B N   1 
ATOM   2939 C CA  . GLU B 1 39  ? -36.501 17.944  -6.267  1.00 199.15 ? 74  GLU B CA  1 
ATOM   2940 C C   . GLU B 1 39  ? -37.649 18.104  -7.266  1.00 200.00 ? 74  GLU B C   1 
ATOM   2941 O O   . GLU B 1 39  ? -37.844 17.244  -8.126  1.00 199.65 ? 74  GLU B O   1 
ATOM   2942 C CB  . GLU B 1 39  ? -35.955 16.514  -6.353  1.00 192.16 ? 74  GLU B CB  1 
ATOM   2943 C CG  . GLU B 1 39  ? -35.941 15.754  -5.033  1.00 200.00 ? 74  GLU B CG  1 
ATOM   2944 C CD  . GLU B 1 39  ? -37.310 15.250  -4.628  1.00 200.00 ? 74  GLU B CD  1 
ATOM   2945 O OE1 . GLU B 1 39  ? -37.839 14.355  -5.319  1.00 200.00 ? 74  GLU B OE1 1 
ATOM   2946 O OE2 . GLU B 1 39  ? -37.855 15.748  -3.621  1.00 200.00 ? 74  GLU B OE2 1 
ATOM   2947 N N   . ASN B 1 40  ? -38.400 19.199  -7.156  1.00 115.26 ? 75  ASN B N   1 
ATOM   2948 C CA  . ASN B 1 40  ? -39.514 19.465  -8.066  1.00 119.29 ? 75  ASN B CA  1 
ATOM   2949 C C   . ASN B 1 40  ? -40.333 20.673  -7.618  1.00 118.58 ? 75  ASN B C   1 
ATOM   2950 O O   . ASN B 1 40  ? -40.933 20.654  -6.547  1.00 119.78 ? 75  ASN B O   1 
ATOM   2951 C CB  . ASN B 1 40  ? -40.432 18.242  -8.158  1.00 200.00 ? 75  ASN B CB  1 
ATOM   2952 C CG  . ASN B 1 40  ? -40.936 17.995  -9.568  1.00 200.00 ? 75  ASN B CG  1 
ATOM   2953 O OD1 . ASN B 1 40  ? -40.156 17.701  -10.474 1.00 200.00 ? 75  ASN B OD1 1 
ATOM   2954 N ND2 . ASN B 1 40  ? -42.244 18.114  -9.761  1.00 200.00 ? 75  ASN B ND2 1 
ATOM   2955 N N   . GLN B 1 41  ? -40.349 21.716  -8.445  1.00 142.93 ? 76  GLN B N   1 
ATOM   2956 C CA  . GLN B 1 41  ? -41.098 22.942  -8.162  1.00 142.76 ? 76  GLN B CA  1 
ATOM   2957 C C   . GLN B 1 41  ? -41.208 23.817  -9.410  1.00 152.59 ? 76  GLN B C   1 
ATOM   2958 O O   . GLN B 1 41  ? -40.664 23.481  -10.462 1.00 151.51 ? 76  GLN B O   1 
ATOM   2959 C CB  . GLN B 1 41  ? -40.429 23.750  -7.045  1.00 196.09 ? 76  GLN B CB  1 
ATOM   2960 C CG  . GLN B 1 41  ? -40.708 23.245  -5.638  1.00 182.63 ? 76  GLN B CG  1 
ATOM   2961 C CD  . GLN B 1 41  ? -40.218 24.200  -4.566  1.00 169.84 ? 76  GLN B CD  1 
ATOM   2962 O OE1 . GLN B 1 41  ? -40.400 23.957  -3.373  1.00 164.63 ? 76  GLN B OE1 1 
ATOM   2963 N NE2 . GLN B 1 41  ? -39.596 25.295  -4.986  1.00 161.95 ? 76  GLN B NE2 1 
ATOM   2964 N N   . GLN B 1 42  ? -41.914 24.939  -9.283  1.00 167.09 ? 77  GLN B N   1 
ATOM   2965 C CA  . GLN B 1 42  ? -42.099 25.871  -10.394 1.00 177.29 ? 77  GLN B CA  1 
ATOM   2966 C C   . GLN B 1 42  ? -41.408 27.205  -10.128 1.00 179.60 ? 77  GLN B C   1 
ATOM   2967 O O   . GLN B 1 42  ? -40.938 27.865  -11.054 1.00 180.91 ? 77  GLN B O   1 
ATOM   2968 C CB  . GLN B 1 42  ? -43.591 26.111  -10.642 1.00 179.24 ? 77  GLN B CB  1 
ATOM   2969 C CG  . GLN B 1 42  ? -44.119 25.522  -11.944 1.00 189.39 ? 77  GLN B CG  1 
ATOM   2970 C CD  . GLN B 1 42  ? -43.966 24.014  -12.018 1.00 198.75 ? 77  GLN B CD  1 
ATOM   2971 O OE1 . GLN B 1 42  ? -42.854 23.487  -12.001 1.00 200.00 ? 77  GLN B OE1 1 
ATOM   2972 N NE2 . GLN B 1 42  ? -45.090 23.309  -12.102 1.00 200.00 ? 77  GLN B NE2 1 
ATOM   2973 N N   . HIS B 1 43  ? -41.358 27.599  -8.860  1.00 200.00 ? 78  HIS B N   1 
ATOM   2974 C CA  . HIS B 1 43  ? -40.718 28.851  -8.470  1.00 200.00 ? 78  HIS B CA  1 
ATOM   2975 C C   . HIS B 1 43  ? -39.241 28.632  -8.152  1.00 199.89 ? 78  HIS B C   1 
ATOM   2976 O O   . HIS B 1 43  ? -38.501 28.063  -8.956  1.00 200.00 ? 78  HIS B O   1 
ATOM   2977 C CB  . HIS B 1 43  ? -41.420 29.451  -7.247  1.00 192.70 ? 78  HIS B CB  1 
ATOM   2978 C CG  . HIS B 1 43  ? -42.765 30.039  -7.545  1.00 200.00 ? 78  HIS B CG  1 
ATOM   2979 N ND1 . HIS B 1 43  ? -42.942 31.074  -8.437  1.00 200.00 ? 78  HIS B ND1 1 
ATOM   2980 C CD2 . HIS B 1 43  ? -43.994 29.748  -7.057  1.00 200.00 ? 78  HIS B CD2 1 
ATOM   2981 C CE1 . HIS B 1 43  ? -44.223 31.396  -8.486  1.00 200.00 ? 78  HIS B CE1 1 
ATOM   2982 N NE2 . HIS B 1 43  ? -44.882 30.606  -7.657  1.00 200.00 ? 78  HIS B NE2 1 
ATOM   2983 N N   . LEU B 1 44  ? -38.824 29.089  -6.975  1.00 122.71 ? 79  LEU B N   1 
ATOM   2984 C CA  . LEU B 1 44  ? -37.443 28.957  -6.522  1.00 118.40 ? 79  LEU B CA  1 
ATOM   2985 C C   . LEU B 1 44  ? -36.431 29.366  -7.588  1.00 111.87 ? 79  LEU B C   1 
ATOM   2986 O O   . LEU B 1 44  ? -36.045 28.561  -8.435  1.00 109.77 ? 79  LEU B O   1 
ATOM   2987 C CB  . LEU B 1 44  ? -37.166 27.517  -6.082  1.00 154.09 ? 79  LEU B CB  1 
ATOM   2988 C CG  . LEU B 1 44  ? -35.764 27.238  -5.534  1.00 158.87 ? 79  LEU B CG  1 
ATOM   2989 C CD1 . LEU B 1 44  ? -35.513 28.092  -4.299  1.00 146.09 ? 79  LEU B CD1 1 
ATOM   2990 C CD2 . LEU B 1 44  ? -35.632 25.762  -5.198  1.00 170.09 ? 79  LEU B CD2 1 
ATOM   2991 N N   . GLN B 1 45  ? -36.007 30.624  -7.533  1.00 161.34 ? 80  GLN B N   1 
ATOM   2992 C CA  . GLN B 1 45  ? -35.031 31.162  -8.475  1.00 158.69 ? 80  GLN B CA  1 
ATOM   2993 C C   . GLN B 1 45  ? -33.854 31.728  -7.688  1.00 153.95 ? 80  GLN B C   1 
ATOM   2994 O O   . GLN B 1 45  ? -32.691 31.443  -7.984  1.00 152.21 ? 80  GLN B O   1 
ATOM   2995 C CB  . GLN B 1 45  ? -35.670 32.264  -9.325  1.00 196.22 ? 80  GLN B CB  1 
ATOM   2996 C CG  . GLN B 1 45  ? -34.718 32.949  -10.297 1.00 200.00 ? 80  GLN B CG  1 
ATOM   2997 C CD  . GLN B 1 45  ? -34.093 31.987  -11.290 1.00 197.65 ? 80  GLN B CD  1 
ATOM   2998 O OE1 . GLN B 1 45  ? -33.324 31.101  -10.916 1.00 195.57 ? 80  GLN B OE1 1 
ATOM   2999 N NE2 . GLN B 1 45  ? -34.422 32.157  -12.566 1.00 196.46 ? 80  GLN B NE2 1 
ATOM   3000 N N   . HIS B 1 46  ? -34.175 32.526  -6.676  1.00 173.42 ? 81  HIS B N   1 
ATOM   3001 C CA  . HIS B 1 46  ? -33.169 33.143  -5.823  1.00 172.07 ? 81  HIS B CA  1 
ATOM   3002 C C   . HIS B 1 46  ? -33.219 32.499  -4.441  1.00 168.63 ? 81  HIS B C   1 
ATOM   3003 O O   . HIS B 1 46  ? -34.157 32.732  -3.675  1.00 167.29 ? 81  HIS B O   1 
ATOM   3004 C CB  . HIS B 1 46  ? -33.438 34.645  -5.692  1.00 189.40 ? 81  HIS B CB  1 
ATOM   3005 C CG  . HIS B 1 46  ? -33.587 35.352  -7.003  1.00 191.34 ? 81  HIS B CG  1 
ATOM   3006 N ND1 . HIS B 1 46  ? -32.567 35.436  -7.926  1.00 185.05 ? 81  HIS B ND1 1 
ATOM   3007 C CD2 . HIS B 1 46  ? -34.638 36.012  -7.545  1.00 194.32 ? 81  HIS B CD2 1 
ATOM   3008 C CE1 . HIS B 1 46  ? -32.983 36.117  -8.980  1.00 184.37 ? 81  HIS B CE1 1 
ATOM   3009 N NE2 . HIS B 1 46  ? -34.236 36.478  -8.774  1.00 187.15 ? 81  HIS B NE2 1 
ATOM   3010 N N   . LEU B 1 47  ? -32.216 31.685  -4.127  1.00 160.83 ? 82  LEU B N   1 
ATOM   3011 C CA  . LEU B 1 47  ? -32.160 31.021  -2.830  1.00 160.52 ? 82  LEU B CA  1 
ATOM   3012 C C   . LEU B 1 47  ? -31.225 31.766  -1.883  1.00 164.27 ? 82  LEU B C   1 
ATOM   3013 O O   . LEU B 1 47  ? -30.006 31.778  -2.075  1.00 163.01 ? 82  LEU B O   1 
ATOM   3014 C CB  . LEU B 1 47  ? -31.687 29.572  -2.988  1.00 200.00 ? 82  LEU B CB  1 
ATOM   3015 C CG  . LEU B 1 47  ? -31.621 28.734  -1.705  1.00 192.51 ? 82  LEU B CG  1 
ATOM   3016 C CD1 . LEU B 1 47  ? -32.995 28.673  -1.057  1.00 175.82 ? 82  LEU B CD1 1 
ATOM   3017 C CD2 . LEU B 1 47  ? -31.124 27.334  -2.030  1.00 176.24 ? 82  LEU B CD2 1 
ATOM   3018 N N   . GLU B 1 48  ? -31.808 32.387  -0.863  1.00 135.83 ? 83  GLU B N   1 
ATOM   3019 C CA  . GLU B 1 48  ? -31.045 33.139  0.124   1.00 142.22 ? 83  GLU B CA  1 
ATOM   3020 C C   . GLU B 1 48  ? -31.206 32.526  1.512   1.00 143.06 ? 83  GLU B C   1 
ATOM   3021 O O   . GLU B 1 48  ? -31.919 31.536  1.686   1.00 141.85 ? 83  GLU B O   1 
ATOM   3022 C CB  . GLU B 1 48  ? -31.506 34.599  0.136   1.00 153.59 ? 83  GLU B CB  1 
ATOM   3023 C CG  . GLU B 1 48  ? -32.996 34.777  0.369   1.00 164.07 ? 83  GLU B CG  1 
ATOM   3024 C CD  . GLU B 1 48  ? -33.441 36.216  0.200   1.00 171.81 ? 83  GLU B CD  1 
ATOM   3025 O OE1 . GLU B 1 48  ? -32.928 37.089  0.929   1.00 175.92 ? 83  GLU B OE1 1 
ATOM   3026 O OE2 . GLU B 1 48  ? -34.305 36.473  -0.664  1.00 175.38 ? 83  GLU B OE2 1 
ATOM   3027 N N   . LEU B 1 49  ? -30.537 33.117  2.496   1.00 151.72 ? 84  LEU B N   1 
ATOM   3028 C CA  . LEU B 1 49  ? -30.600 32.629  3.868   1.00 155.78 ? 84  LEU B CA  1 
ATOM   3029 C C   . LEU B 1 49  ? -32.016 32.702  4.430   1.00 159.29 ? 84  LEU B C   1 
ATOM   3030 O O   . LEU B 1 49  ? -32.384 31.922  5.309   1.00 158.51 ? 84  LEU B O   1 
ATOM   3031 C CB  . LEU B 1 49  ? -29.654 33.439  4.756   1.00 147.63 ? 84  LEU B CB  1 
ATOM   3032 C CG  . LEU B 1 49  ? -29.605 33.050  6.236   1.00 145.29 ? 84  LEU B CG  1 
ATOM   3033 C CD1 . LEU B 1 49  ? -29.204 31.592  6.369   1.00 137.12 ? 84  LEU B CD1 1 
ATOM   3034 C CD2 . LEU B 1 49  ? -28.618 33.945  6.969   1.00 136.89 ? 84  LEU B CD2 1 
ATOM   3035 N N   . ARG B 1 50  ? -32.803 33.645  3.919   1.00 187.61 ? 85  ARG B N   1 
ATOM   3036 C CA  . ARG B 1 50  ? -34.181 33.827  4.364   1.00 191.43 ? 85  ARG B CA  1 
ATOM   3037 C C   . ARG B 1 50  ? -35.021 32.608  3.990   1.00 186.16 ? 85  ARG B C   1 
ATOM   3038 O O   . ARG B 1 50  ? -35.899 32.191  4.746   1.00 187.29 ? 85  ARG B O   1 
ATOM   3039 C CB  . ARG B 1 50  ? -34.771 35.094  3.730   1.00 167.76 ? 85  ARG B CB  1 
ATOM   3040 C CG  . ARG B 1 50  ? -36.137 35.518  4.270   1.00 181.92 ? 85  ARG B CG  1 
ATOM   3041 C CD  . ARG B 1 50  ? -37.267 34.641  3.746   1.00 196.97 ? 85  ARG B CD  1 
ATOM   3042 N NE  . ARG B 1 50  ? -37.396 34.714  2.293   1.00 200.00 ? 85  ARG B NE  1 
ATOM   3043 C CZ  . ARG B 1 50  ? -37.713 35.817  1.621   1.00 200.00 ? 85  ARG B CZ  1 
ATOM   3044 N NH1 . ARG B 1 50  ? -37.937 36.952  2.270   1.00 200.00 ? 85  ARG B NH1 1 
ATOM   3045 N NH2 . ARG B 1 50  ? -37.806 35.786  0.299   1.00 200.00 ? 85  ARG B NH2 1 
ATOM   3046 N N   . ASP B 1 51  ? -34.745 32.041  2.819   1.00 159.94 ? 86  ASP B N   1 
ATOM   3047 C CA  . ASP B 1 51  ? -35.470 30.868  2.347   1.00 154.91 ? 86  ASP B CA  1 
ATOM   3048 C C   . ASP B 1 51  ? -35.263 29.694  3.294   1.00 153.63 ? 86  ASP B C   1 
ATOM   3049 O O   . ASP B 1 51  ? -36.046 28.744  3.299   1.00 151.93 ? 86  ASP B O   1 
ATOM   3050 C CB  . ASP B 1 51  ? -35.001 30.489  0.943   1.00 139.69 ? 86  ASP B CB  1 
ATOM   3051 C CG  . ASP B 1 51  ? -35.294 31.567  -0.077  1.00 136.58 ? 86  ASP B CG  1 
ATOM   3052 O OD1 . ASP B 1 51  ? -36.483 31.894  -0.270  1.00 132.21 ? 86  ASP B OD1 1 
ATOM   3053 O OD2 . ASP B 1 51  ? -34.337 32.091  -0.684  1.00 133.95 ? 86  ASP B OD2 1 
ATOM   3054 N N   . LEU B 1 52  ? -34.201 29.766  4.092   1.00 127.45 ? 87  LEU B N   1 
ATOM   3055 C CA  . LEU B 1 52  ? -33.887 28.717  5.056   1.00 130.12 ? 87  LEU B CA  1 
ATOM   3056 C C   . LEU B 1 52  ? -34.153 29.204  6.475   1.00 131.42 ? 87  LEU B C   1 
ATOM   3057 O O   . LEU B 1 52  ? -33.810 28.527  7.444   1.00 128.61 ? 87  LEU B O   1 
ATOM   3058 C CB  . LEU B 1 52  ? -32.421 28.290  4.930   1.00 175.27 ? 87  LEU B CB  1 
ATOM   3059 C CG  . LEU B 1 52  ? -31.981 27.595  3.638   1.00 181.68 ? 87  LEU B CG  1 
ATOM   3060 C CD1 . LEU B 1 52  ? -32.075 28.556  2.462   1.00 186.12 ? 87  LEU B CD1 1 
ATOM   3061 C CD2 . LEU B 1 52  ? -30.555 27.097  3.802   1.00 186.15 ? 87  LEU B CD2 1 
ATOM   3062 N N   . ARG B 1 53  ? -34.763 30.381  6.584   1.00 157.38 ? 88  ARG B N   1 
ATOM   3063 C CA  . ARG B 1 53  ? -35.085 30.975  7.877   1.00 161.53 ? 88  ARG B CA  1 
ATOM   3064 C C   . ARG B 1 53  ? -35.766 29.951  8.776   1.00 157.14 ? 88  ARG B C   1 
ATOM   3065 O O   . ARG B 1 53  ? -36.986 29.794  8.739   1.00 157.60 ? 88  ARG B O   1 
ATOM   3066 C CB  . ARG B 1 53  ? -36.008 32.181  7.686   1.00 163.58 ? 88  ARG B CB  1 
ATOM   3067 C CG  . ARG B 1 53  ? -36.347 32.932  8.966   1.00 178.81 ? 88  ARG B CG  1 
ATOM   3068 C CD  . ARG B 1 53  ? -35.128 33.638  9.542   1.00 195.12 ? 88  ARG B CD  1 
ATOM   3069 N NE  . ARG B 1 53  ? -35.470 34.461  10.700  1.00 200.00 ? 88  ARG B NE  1 
ATOM   3070 C CZ  . ARG B 1 53  ? -34.609 35.245  11.342  1.00 200.00 ? 88  ARG B CZ  1 
ATOM   3071 N NH1 . ARG B 1 53  ? -33.347 35.317  10.940  1.00 200.00 ? 88  ARG B NH1 1 
ATOM   3072 N NH2 . ARG B 1 53  ? -35.010 35.960  12.384  1.00 200.00 ? 88  ARG B NH2 1 
ATOM   3073 N N   . GLY B 1 54  ? -34.969 29.258  9.582   1.00 175.77 ? 89  GLY B N   1 
ATOM   3074 C CA  . GLY B 1 54  ? -35.512 28.252  10.476  1.00 174.28 ? 89  GLY B CA  1 
ATOM   3075 C C   . GLY B 1 54  ? -34.445 27.304  10.987  1.00 175.65 ? 89  GLY B C   1 
ATOM   3076 O O   . GLY B 1 54  ? -34.031 26.380  10.282  1.00 173.25 ? 89  GLY B O   1 
ATOM   3077 N N   . LEU B 1 55  ? -33.999 27.536  12.217  1.00 200.00 ? 90  LEU B N   1 
ATOM   3078 C CA  . LEU B 1 55  ? -32.971 26.709  12.840  1.00 200.00 ? 90  LEU B CA  1 
ATOM   3079 C C   . LEU B 1 55  ? -33.321 25.228  12.706  1.00 200.00 ? 90  LEU B C   1 
ATOM   3080 O O   . LEU B 1 55  ? -34.431 24.812  13.045  1.00 200.00 ? 90  LEU B O   1 
ATOM   3081 C CB  . LEU B 1 55  ? -32.833 27.074  14.322  1.00 176.00 ? 90  LEU B CB  1 
ATOM   3082 C CG  . LEU B 1 55  ? -32.576 28.548  14.657  1.00 192.80 ? 90  LEU B CG  1 
ATOM   3083 C CD1 . LEU B 1 55  ? -32.559 28.731  16.167  1.00 200.00 ? 90  LEU B CD1 1 
ATOM   3084 C CD2 . LEU B 1 55  ? -31.258 28.999  14.047  1.00 200.00 ? 90  LEU B CD2 1 
ATOM   3085 N N   . GLY B 1 56  ? -32.375 24.438  12.206  1.00 150.16 ? 91  GLY B N   1 
ATOM   3086 C CA  . GLY B 1 56  ? -32.622 23.017  12.043  1.00 145.22 ? 91  GLY B CA  1 
ATOM   3087 C C   . GLY B 1 56  ? -31.369 22.189  11.838  1.00 143.09 ? 91  GLY B C   1 
ATOM   3088 O O   . GLY B 1 56  ? -30.367 22.675  11.309  1.00 140.63 ? 91  GLY B O   1 
ATOM   3089 N N   . GLU B 1 57  ? -31.427 20.933  12.271  1.00 137.33 ? 92  GLU B N   1 
ATOM   3090 C CA  . GLU B 1 57  ? -30.307 20.009  12.129  1.00 139.37 ? 92  GLU B CA  1 
ATOM   3091 C C   . GLU B 1 57  ? -30.573 19.096  10.938  1.00 139.17 ? 92  GLU B C   1 
ATOM   3092 O O   . GLU B 1 57  ? -31.036 17.965  11.092  1.00 137.64 ? 92  GLU B O   1 
ATOM   3093 C CB  . GLU B 1 57  ? -30.139 19.177  13.405  1.00 167.30 ? 92  GLU B CB  1 
ATOM   3094 C CG  . GLU B 1 57  ? -29.117 18.052  13.295  1.00 171.25 ? 92  GLU B CG  1 
ATOM   3095 C CD  . GLU B 1 57  ? -27.769 18.528  12.790  1.00 176.27 ? 92  GLU B CD  1 
ATOM   3096 O OE1 . GLU B 1 57  ? -27.181 19.433  13.420  1.00 179.15 ? 92  GLU B OE1 1 
ATOM   3097 O OE2 . GLU B 1 57  ? -27.297 17.995  11.763  1.00 178.01 ? 92  GLU B OE2 1 
ATOM   3098 N N   . LEU B 1 58  ? -30.277 19.602  9.746   1.00 160.84 ? 93  LEU B N   1 
ATOM   3099 C CA  . LEU B 1 58  ? -30.491 18.854  8.517   1.00 164.95 ? 93  LEU B CA  1 
ATOM   3100 C C   . LEU B 1 58  ? -29.185 18.290  7.970   1.00 160.47 ? 93  LEU B C   1 
ATOM   3101 O O   . LEU B 1 58  ? -28.165 18.979  7.923   1.00 158.74 ? 93  LEU B O   1 
ATOM   3102 C CB  . LEU B 1 58  ? -31.158 19.761  7.476   1.00 146.06 ? 93  LEU B CB  1 
ATOM   3103 C CG  . LEU B 1 58  ? -31.496 19.207  6.090   1.00 165.91 ? 93  LEU B CG  1 
ATOM   3104 C CD1 . LEU B 1 58  ? -32.499 20.127  5.415   1.00 177.90 ? 93  LEU B CD1 1 
ATOM   3105 C CD2 . LEU B 1 58  ? -30.235 19.079  5.251   1.00 178.09 ? 93  LEU B CD2 1 
ATOM   3106 N N   . ARG B 1 59  ? -29.232 17.029  7.557   1.00 177.49 ? 94  ARG B N   1 
ATOM   3107 C CA  . ARG B 1 59  ? -28.076 16.338  7.006   1.00 177.52 ? 94  ARG B CA  1 
ATOM   3108 C C   . ARG B 1 59  ? -28.249 16.062  5.520   1.00 177.75 ? 94  ARG B C   1 
ATOM   3109 O O   . ARG B 1 59  ? -27.246 15.880  4.832   1.00 176.26 ? 94  ARG B O   1 
ATOM   3110 C CB  . ARG B 1 59  ? -27.838 15.040  7.779   1.00 197.41 ? 94  ARG B CB  1 
ATOM   3111 C CG  . ARG B 1 59  ? -27.562 15.283  9.258   1.00 200.00 ? 94  ARG B CG  1 
ATOM   3112 C CD  . ARG B 1 59  ? -27.321 13.996  10.024  1.00 200.00 ? 94  ARG B CD  1 
ATOM   3113 N NE  . ARG B 1 59  ? -26.954 14.264  11.412  1.00 200.00 ? 94  ARG B NE  1 
ATOM   3114 C CZ  . ARG B 1 59  ? -26.668 13.324  12.307  1.00 200.00 ? 94  ARG B CZ  1 
ATOM   3115 N NH1 . ARG B 1 59  ? -26.705 12.044  11.964  1.00 200.00 ? 94  ARG B NH1 1 
ATOM   3116 N NH2 . ARG B 1 59  ? -26.340 13.665  13.546  1.00 200.00 ? 94  ARG B NH2 1 
ATOM   3117 N N   . ASN B 1 60  ? -29.483 16.013  5.021   1.00 172.96 ? 95  ASN B N   1 
ATOM   3118 C CA  . ASN B 1 60  ? -29.719 15.767  3.616   1.00 173.42 ? 95  ASN B CA  1 
ATOM   3119 C C   . ASN B 1 60  ? -30.646 16.818  3.038   1.00 172.63 ? 95  ASN B C   1 
ATOM   3120 O O   . ASN B 1 60  ? -31.740 17.036  3.563   1.00 174.75 ? 95  ASN B O   1 
ATOM   3121 C CB  . ASN B 1 60  ? -30.330 14.374  3.416   1.00 165.62 ? 95  ASN B CB  1 
ATOM   3122 C CG  . ASN B 1 60  ? -29.531 13.276  4.105   1.00 174.11 ? 95  ASN B CG  1 
ATOM   3123 O OD1 . ASN B 1 60  ? -28.324 13.137  3.885   1.00 174.11 ? 95  ASN B OD1 1 
ATOM   3124 N ND2 . ASN B 1 60  ? -30.211 12.493  4.939   1.00 174.11 ? 95  ASN B ND2 1 
ATOM   3125 N N   . LEU B 1 61  ? -30.201 17.498  1.986   1.00 115.47 ? 96  LEU B N   1 
ATOM   3126 C CA  . LEU B 1 61  ? -31.032 18.502  1.342   1.00 114.83 ? 96  LEU B CA  1 
ATOM   3127 C C   . LEU B 1 61  ? -31.030 18.286  -0.169  1.00 115.51 ? 96  LEU B C   1 
ATOM   3128 O O   . LEU B 1 61  ? -29.994 18.383  -0.822  1.00 116.97 ? 96  LEU B O   1 
ATOM   3129 C CB  . LEU B 1 61  ? -30.532 19.914  1.659   1.00 148.39 ? 96  LEU B CB  1 
ATOM   3130 C CG  . LEU B 1 61  ? -31.245 21.050  0.914   1.00 148.60 ? 96  LEU B CG  1 
ATOM   3131 C CD1 . LEU B 1 61  ? -32.753 20.930  1.085   1.00 147.40 ? 96  LEU B CD1 1 
ATOM   3132 C CD2 . LEU B 1 61  ? -30.752 22.389  1.436   1.00 149.34 ? 96  LEU B CD2 1 
ATOM   3133 N N   . THR B 1 62  ? -32.204 17.997  -0.716  1.00 117.16 ? 97  THR B N   1 
ATOM   3134 C CA  . THR B 1 62  ? -32.327 17.785  -2.150  1.00 118.69 ? 97  THR B CA  1 
ATOM   3135 C C   . THR B 1 62  ? -33.084 18.928  -2.805  1.00 119.24 ? 97  THR B C   1 
ATOM   3136 O O   . THR B 1 62  ? -34.244 19.170  -2.480  1.00 119.24 ? 97  THR B O   1 
ATOM   3137 C CB  . THR B 1 62  ? -33.056 16.463  -2.446  1.00 129.43 ? 97  THR B CB  1 
ATOM   3138 O OG1 . THR B 1 62  ? -32.479 15.412  -1.659  1.00 135.72 ? 97  THR B OG1 1 
ATOM   3139 C CG2 . THR B 1 62  ? -32.921 16.103  -3.910  1.00 135.72 ? 97  THR B CG2 1 
ATOM   3140 N N   . ILE B 1 63  ? -32.410 19.589  -3.716  1.00 133.98 ? 98  ILE B N   1 
ATOM   3141 C CA  . ILE B 1 63  ? -32.962 20.701  -4.474  1.00 132.41 ? 98  ILE B CA  1 
ATOM   3142 C C   . ILE B 1 63  ? -32.722 20.483  -5.976  1.00 132.27 ? 98  ILE B C   1 
ATOM   3143 O O   . ILE B 1 63  ? -32.787 21.415  -6.762  1.00 134.18 ? 98  ILE B O   1 
ATOM   3144 C CB  . ILE B 1 63  ? -32.341 22.043  -4.024  1.00 128.67 ? 98  ILE B CB  1 
ATOM   3145 C CG1 . ILE B 1 63  ? -32.440 22.169  -2.500  1.00 135.56 ? 98  ILE B CG1 1 
ATOM   3146 C CG2 . ILE B 1 63  ? -33.080 23.208  -4.671  1.00 135.56 ? 98  ILE B CG2 1 
ATOM   3147 C CD1 . ILE B 1 63  ? -31.841 23.444  -1.941  1.00 199.21 ? 98  ILE B CD1 1 
ATOM   3148 N N   . VAL B 1 64  ? -32.563 19.220  -6.356  1.00 168.19 ? 99  VAL B N   1 
ATOM   3149 C CA  . VAL B 1 64  ? -32.416 18.872  -7.760  1.00 175.35 ? 99  VAL B CA  1 
ATOM   3150 C C   . VAL B 1 64  ? -33.797 19.158  -8.359  1.00 176.58 ? 99  VAL B C   1 
ATOM   3151 O O   . VAL B 1 64  ? -34.736 19.447  -7.618  1.00 175.87 ? 99  VAL B O   1 
ATOM   3152 C CB  . VAL B 1 64  ? -32.055 17.370  -7.931  1.00 173.67 ? 99  VAL B CB  1 
ATOM   3153 C CG1 . VAL B 1 64  ? -32.943 16.520  -7.057  1.00 174.98 ? 99  VAL B CG1 1 
ATOM   3154 C CG2 . VAL B 1 64  ? -32.215 16.946  -9.377  1.00 175.26 ? 99  VAL B CG2 1 
ATOM   3155 N N   . LYS B 1 65  ? -33.923 19.104  -9.682  1.00 166.46 ? 100 LYS B N   1 
ATOM   3156 C CA  . LYS B 1 65  ? -35.206 19.358  -10.342 1.00 169.00 ? 100 LYS B CA  1 
ATOM   3157 C C   . LYS B 1 65  ? -35.967 20.540  -9.732  1.00 164.93 ? 100 LYS B C   1 
ATOM   3158 O O   . LYS B 1 65  ? -36.779 20.360  -8.826  1.00 164.88 ? 100 LYS B O   1 
ATOM   3159 C CB  . LYS B 1 65  ? -36.085 18.104  -10.277 1.00 174.76 ? 100 LYS B CB  1 
ATOM   3160 C CG  . LYS B 1 65  ? -35.641 16.956  -11.172 1.00 179.43 ? 100 LYS B CG  1 
ATOM   3161 C CD  . LYS B 1 65  ? -35.925 17.254  -12.638 1.00 187.16 ? 100 LYS B CD  1 
ATOM   3162 C CE  . LYS B 1 65  ? -35.616 16.051  -13.519 1.00 190.42 ? 100 LYS B CE  1 
ATOM   3163 N NZ  . LYS B 1 65  ? -35.957 16.299  -14.949 1.00 191.96 ? 100 LYS B NZ  1 
ATOM   3164 N N   . SER B 1 66  ? -35.705 21.744  -10.232 1.00 167.16 ? 101 SER B N   1 
ATOM   3165 C CA  . SER B 1 66  ? -36.377 22.941  -9.732  1.00 166.21 ? 101 SER B CA  1 
ATOM   3166 C C   . SER B 1 66  ? -36.200 24.110  -10.695 1.00 161.20 ? 101 SER B C   1 
ATOM   3167 O O   . SER B 1 66  ? -36.609 24.036  -11.854 1.00 158.62 ? 101 SER B O   1 
ATOM   3168 C CB  . SER B 1 66  ? -35.830 23.324  -8.352  1.00 135.43 ? 101 SER B CB  1 
ATOM   3169 O OG  . SER B 1 66  ? -36.107 22.322  -7.389  1.00 141.48 ? 101 SER B OG  1 
ATOM   3170 N N   . GLY B 1 67  ? -35.590 25.188  -10.208 1.00 164.97 ? 102 GLY B N   1 
ATOM   3171 C CA  . GLY B 1 67  ? -35.370 26.357  -11.043 1.00 164.78 ? 102 GLY B CA  1 
ATOM   3172 C C   . GLY B 1 67  ? -34.249 27.253  -10.547 1.00 165.96 ? 102 GLY B C   1 
ATOM   3173 O O   . GLY B 1 67  ? -33.836 28.184  -11.241 1.00 164.29 ? 102 GLY B O   1 
ATOM   3174 N N   . LEU B 1 68  ? -33.756 26.970  -9.345  1.00 76.82  ? 103 LEU B N   1 
ATOM   3175 C CA  . LEU B 1 68  ? -32.679 27.751  -8.742  1.00 80.11  ? 103 LEU B CA  1 
ATOM   3176 C C   . LEU B 1 68  ? -31.551 28.019  -9.731  1.00 81.82  ? 103 LEU B C   1 
ATOM   3177 O O   . LEU B 1 68  ? -31.214 27.161  -10.543 1.00 79.94  ? 103 LEU B O   1 
ATOM   3178 C CB  . LEU B 1 68  ? -32.129 27.015  -7.519  1.00 136.23 ? 103 LEU B CB  1 
ATOM   3179 C CG  . LEU B 1 68  ? -30.954 27.658  -6.780  1.00 143.10 ? 103 LEU B CG  1 
ATOM   3180 C CD1 . LEU B 1 68  ? -31.305 29.082  -6.366  1.00 147.74 ? 103 LEU B CD1 1 
ATOM   3181 C CD2 . LEU B 1 68  ? -30.611 26.808  -5.565  1.00 147.36 ? 103 LEU B CD2 1 
ATOM   3182 N N   . ARG B 1 69  ? -30.967 29.209  -9.660  1.00 87.06  ? 104 ARG B N   1 
ATOM   3183 C CA  . ARG B 1 69  ? -29.884 29.558  -10.569 1.00 92.65  ? 104 ARG B CA  1 
ATOM   3184 C C   . ARG B 1 69  ? -28.842 30.454  -9.905  1.00 92.14  ? 104 ARG B C   1 
ATOM   3185 O O   . ARG B 1 69  ? -27.679 30.477  -10.317 1.00 90.44  ? 104 ARG B O   1 
ATOM   3186 C CB  . ARG B 1 69  ? -30.451 30.249  -11.812 1.00 157.91 ? 104 ARG B CB  1 
ATOM   3187 C CG  . ARG B 1 69  ? -29.463 30.377  -12.963 1.00 173.33 ? 104 ARG B CG  1 
ATOM   3188 C CD  . ARG B 1 69  ? -30.142 30.936  -14.203 1.00 190.36 ? 104 ARG B CD  1 
ATOM   3189 N NE  . ARG B 1 69  ? -29.273 30.907  -15.376 1.00 200.00 ? 104 ARG B NE  1 
ATOM   3190 C CZ  . ARG B 1 69  ? -28.131 31.577  -15.482 1.00 200.00 ? 104 ARG B CZ  1 
ATOM   3191 N NH1 . ARG B 1 69  ? -27.708 32.338  -14.481 1.00 200.00 ? 104 ARG B NH1 1 
ATOM   3192 N NH2 . ARG B 1 69  ? -27.410 31.490  -16.591 1.00 200.00 ? 104 ARG B NH2 1 
ATOM   3193 N N   . PHE B 1 70  ? -29.260 31.189  -8.877  1.00 181.91 ? 105 PHE B N   1 
ATOM   3194 C CA  . PHE B 1 70  ? -28.355 32.083  -8.160  1.00 186.91 ? 105 PHE B CA  1 
ATOM   3195 C C   . PHE B 1 70  ? -28.376 31.827  -6.656  1.00 180.31 ? 105 PHE B C   1 
ATOM   3196 O O   . PHE B 1 70  ? -29.320 32.215  -5.968  1.00 178.63 ? 105 PHE B O   1 
ATOM   3197 C CB  . PHE B 1 70  ? -28.727 33.549  -8.417  1.00 152.81 ? 105 PHE B CB  1 
ATOM   3198 C CG  . PHE B 1 70  ? -28.607 33.969  -9.856  1.00 178.25 ? 105 PHE B CG  1 
ATOM   3199 C CD1 . PHE B 1 70  ? -29.502 33.499  -10.813 1.00 200.00 ? 105 PHE B CD1 1 
ATOM   3200 C CD2 . PHE B 1 70  ? -27.598 34.841  -10.254 1.00 200.00 ? 105 PHE B CD2 1 
ATOM   3201 C CE1 . PHE B 1 70  ? -29.395 33.892  -12.146 1.00 200.00 ? 105 PHE B CE1 1 
ATOM   3202 C CE2 . PHE B 1 70  ? -27.481 35.240  -11.584 1.00 200.00 ? 105 PHE B CE2 1 
ATOM   3203 C CZ  . PHE B 1 70  ? -28.382 34.764  -12.532 1.00 200.00 ? 105 PHE B CZ  1 
ATOM   3204 N N   . VAL B 1 71  ? -27.337 31.173  -6.147  1.00 100.71 ? 106 VAL B N   1 
ATOM   3205 C CA  . VAL B 1 71  ? -27.253 30.896  -4.720  1.00 97.40  ? 106 VAL B CA  1 
ATOM   3206 C C   . VAL B 1 71  ? -26.166 31.765  -4.101  1.00 99.76  ? 106 VAL B C   1 
ATOM   3207 O O   . VAL B 1 71  ? -24.981 31.433  -4.155  1.00 99.46  ? 106 VAL B O   1 
ATOM   3208 C CB  . VAL B 1 71  ? -26.917 29.416  -4.443  1.00 95.47  ? 106 VAL B CB  1 
ATOM   3209 C CG1 . VAL B 1 71  ? -26.988 29.138  -2.948  1.00 88.86  ? 106 VAL B CG1 1 
ATOM   3210 C CG2 . VAL B 1 71  ? -27.877 28.519  -5.193  1.00 89.96  ? 106 VAL B CG2 1 
ATOM   3211 N N   . ALA B 1 72  ? -26.585 32.885  -3.521  1.00 111.56 ? 107 ALA B N   1 
ATOM   3212 C CA  . ALA B 1 72  ? -25.670 33.824  -2.883  1.00 115.02 ? 107 ALA B CA  1 
ATOM   3213 C C   . ALA B 1 72  ? -24.906 33.184  -1.718  1.00 113.47 ? 107 ALA B C   1 
ATOM   3214 O O   . ALA B 1 72  ? -25.469 32.415  -0.928  1.00 112.74 ? 107 ALA B O   1 
ATOM   3215 C CB  . ALA B 1 72  ? -26.441 35.050  -2.393  1.00 138.67 ? 107 ALA B CB  1 
ATOM   3216 N N   . PRO B 1 73  ? -23.606 33.505  -1.599  1.00 125.87 ? 108 PRO B N   1 
ATOM   3217 C CA  . PRO B 1 73  ? -22.749 32.972  -0.538  1.00 124.36 ? 108 PRO B CA  1 
ATOM   3218 C C   . PRO B 1 73  ? -23.312 33.273  0.844   1.00 121.13 ? 108 PRO B C   1 
ATOM   3219 O O   . PRO B 1 73  ? -23.041 34.326  1.422   1.00 120.32 ? 108 PRO B O   1 
ATOM   3220 C CB  . PRO B 1 73  ? -21.415 33.669  -0.793  1.00 155.09 ? 108 PRO B CB  1 
ATOM   3221 C CG  . PRO B 1 73  ? -21.829 34.977  -1.388  1.00 157.16 ? 108 PRO B CG  1 
ATOM   3222 C CD  . PRO B 1 73  ? -22.897 34.548  -2.361  1.00 156.25 ? 108 PRO B CD  1 
ATOM   3223 N N   . ASP B 1 74  ? -24.102 32.337  1.359   1.00 130.80 ? 109 ASP B N   1 
ATOM   3224 C CA  . ASP B 1 74  ? -24.728 32.473  2.668   1.00 131.15 ? 109 ASP B CA  1 
ATOM   3225 C C   . ASP B 1 74  ? -25.623 31.263  2.881   1.00 132.44 ? 109 ASP B C   1 
ATOM   3226 O O   . ASP B 1 74  ? -25.327 30.387  3.696   1.00 129.80 ? 109 ASP B O   1 
ATOM   3227 C CB  . ASP B 1 74  ? -25.568 33.754  2.723   1.00 186.44 ? 109 ASP B CB  1 
ATOM   3228 C CG  . ASP B 1 74  ? -26.258 33.946  4.062   1.00 188.59 ? 109 ASP B CG  1 
ATOM   3229 O OD1 . ASP B 1 74  ? -26.974 34.957  4.222   1.00 191.29 ? 109 ASP B OD1 1 
ATOM   3230 O OD2 . ASP B 1 74  ? -26.084 33.089  4.953   1.00 191.59 ? 109 ASP B OD2 1 
ATOM   3231 N N   . ALA B 1 75  ? -26.718 31.236  2.127   1.00 112.61 ? 110 ALA B N   1 
ATOM   3232 C CA  . ALA B 1 75  ? -27.704 30.162  2.167   1.00 118.68 ? 110 ALA B CA  1 
ATOM   3233 C C   . ALA B 1 75  ? -27.656 29.289  3.426   1.00 122.08 ? 110 ALA B C   1 
ATOM   3234 O O   . ALA B 1 75  ? -28.007 29.731  4.524   1.00 120.45 ? 110 ALA B O   1 
ATOM   3235 C CB  . ALA B 1 75  ? -27.558 29.290  0.918   1.00 91.20  ? 110 ALA B CB  1 
ATOM   3236 N N   . PHE B 1 76  ? -27.211 28.049  3.246   1.00 111.62 ? 111 PHE B N   1 
ATOM   3237 C CA  . PHE B 1 76  ? -27.119 27.054  4.311   1.00 119.93 ? 111 PHE B CA  1 
ATOM   3238 C C   . PHE B 1 76  ? -26.518 27.547  5.624   1.00 121.13 ? 111 PHE B C   1 
ATOM   3239 O O   . PHE B 1 76  ? -26.393 26.776  6.574   1.00 120.13 ? 111 PHE B O   1 
ATOM   3240 C CB  . PHE B 1 76  ? -26.318 25.853  3.804   1.00 173.51 ? 111 PHE B CB  1 
ATOM   3241 C CG  . PHE B 1 76  ? -26.652 25.463  2.393   1.00 190.23 ? 111 PHE B CG  1 
ATOM   3242 C CD1 . PHE B 1 76  ? -27.933 25.038  2.058   1.00 200.00 ? 111 PHE B CD1 1 
ATOM   3243 C CD2 . PHE B 1 76  ? -25.694 25.557  1.388   1.00 200.00 ? 111 PHE B CD2 1 
ATOM   3244 C CE1 . PHE B 1 76  ? -28.257 24.712  0.743   1.00 200.00 ? 111 PHE B CE1 1 
ATOM   3245 C CE2 . PHE B 1 76  ? -26.007 25.234  0.071   1.00 200.00 ? 111 PHE B CE2 1 
ATOM   3246 C CZ  . PHE B 1 76  ? -27.293 24.813  -0.252  1.00 200.00 ? 111 PHE B CZ  1 
ATOM   3247 N N   . HIS B 1 77  ? -26.149 28.823  5.674   1.00 140.29 ? 112 HIS B N   1 
ATOM   3248 C CA  . HIS B 1 77  ? -25.562 29.410  6.871   1.00 144.70 ? 112 HIS B CA  1 
ATOM   3249 C C   . HIS B 1 77  ? -26.159 28.813  8.144   1.00 140.79 ? 112 HIS B C   1 
ATOM   3250 O O   . HIS B 1 77  ? -25.433 28.514  9.093   1.00 140.82 ? 112 HIS B O   1 
ATOM   3251 C CB  . HIS B 1 77  ? -25.762 30.927  6.867   1.00 180.94 ? 112 HIS B CB  1 
ATOM   3252 C CG  . HIS B 1 77  ? -25.051 31.634  7.980   1.00 196.24 ? 112 HIS B CG  1 
ATOM   3253 N ND1 . HIS B 1 77  ? -23.685 31.570  8.150   1.00 200.00 ? 112 HIS B ND1 1 
ATOM   3254 C CD2 . HIS B 1 77  ? -25.517 32.424  8.978   1.00 200.00 ? 112 HIS B CD2 1 
ATOM   3255 C CE1 . HIS B 1 77  ? -23.339 32.289  9.203   1.00 200.00 ? 112 HIS B CE1 1 
ATOM   3256 N NE2 . HIS B 1 77  ? -24.432 32.817  9.724   1.00 200.00 ? 112 HIS B NE2 1 
ATOM   3257 N N   . PHE B 1 78  ? -27.478 28.633  8.163   1.00 162.23 ? 113 PHE B N   1 
ATOM   3258 C CA  . PHE B 1 78  ? -28.144 28.064  9.332   1.00 160.48 ? 113 PHE B CA  1 
ATOM   3259 C C   . PHE B 1 78  ? -27.615 26.675  9.665   1.00 157.78 ? 113 PHE B C   1 
ATOM   3260 O O   . PHE B 1 78  ? -26.838 26.515  10.606  1.00 156.74 ? 113 PHE B O   1 
ATOM   3261 C CB  . PHE B 1 78  ? -29.660 28.001  9.118   1.00 164.02 ? 113 PHE B CB  1 
ATOM   3262 C CG  . PHE B 1 78  ? -30.364 29.302  9.381   1.00 166.89 ? 113 PHE B CG  1 
ATOM   3263 C CD1 . PHE B 1 78  ? -30.231 29.942  10.611  1.00 167.40 ? 113 PHE B CD1 1 
ATOM   3264 C CD2 . PHE B 1 78  ? -31.161 29.889  8.404   1.00 167.59 ? 113 PHE B CD2 1 
ATOM   3265 C CE1 . PHE B 1 78  ? -30.882 31.147  10.864  1.00 168.59 ? 113 PHE B CE1 1 
ATOM   3266 C CE2 . PHE B 1 78  ? -31.817 31.095  8.648   1.00 168.41 ? 113 PHE B CE2 1 
ATOM   3267 C CZ  . PHE B 1 78  ? -31.677 31.725  9.879   1.00 168.68 ? 113 PHE B CZ  1 
ATOM   3268 N N   . THR B 1 79  ? -28.037 25.675  8.895   1.00 178.39 ? 114 THR B N   1 
ATOM   3269 C CA  . THR B 1 79  ? -27.593 24.303  9.122   1.00 177.35 ? 114 THR B CA  1 
ATOM   3270 C C   . THR B 1 79  ? -26.080 24.254  9.337   1.00 183.30 ? 114 THR B C   1 
ATOM   3271 O O   . THR B 1 79  ? -25.299 24.532  8.426   1.00 183.13 ? 114 THR B O   1 
ATOM   3272 C CB  . THR B 1 79  ? -27.966 23.383  7.937   1.00 117.20 ? 114 THR B CB  1 
ATOM   3273 O OG1 . THR B 1 79  ? -27.378 22.090  8.133   1.00 111.67 ? 114 THR B OG1 1 
ATOM   3274 C CG2 . THR B 1 79  ? -27.479 23.974  6.621   1.00 107.20 ? 114 THR B CG2 1 
ATOM   3275 N N   . PRO B 1 80  ? -25.693 24.161  10.519  1.00 171.30 ? 115 PRO B N   1 
ATOM   3276 C CA  . PRO B 1 80  ? -24.276 24.117  10.789  1.00 174.57 ? 115 PRO B CA  1 
ATOM   3277 C C   . PRO B 1 80  ? -23.634 22.857  10.221  1.00 176.17 ? 115 PRO B C   1 
ATOM   3278 O O   . PRO B 1 80  ? -22.524 22.901  9.682   1.00 175.67 ? 115 PRO B O   1 
ATOM   3279 C CB  . PRO B 1 80  ? -24.216 24.166  12.310  1.00 184.73 ? 115 PRO B CB  1 
ATOM   3280 C CG  . PRO B 1 80  ? -25.439 23.399  12.720  1.00 185.47 ? 115 PRO B CG  1 
ATOM   3281 C CD  . PRO B 1 80  ? -26.485 23.913  11.746  1.00 182.29 ? 115 PRO B CD  1 
ATOM   3282 N N   . ARG B 1 81  ? -24.340 21.740  10.339  1.00 175.61 ? 116 ARG B N   1 
ATOM   3283 C CA  . ARG B 1 81  ? -23.818 20.473  9.859   1.00 177.25 ? 116 ARG B CA  1 
ATOM   3284 C C   . ARG B 1 81  ? -23.806 20.347  8.339   1.00 167.69 ? 116 ARG B C   1 
ATOM   3285 O O   . ARG B 1 81  ? -22.954 20.926  7.660   1.00 169.13 ? 116 ARG B O   1 
ATOM   3286 C CB  . ARG B 1 81  ? -24.604 19.309  10.472  1.00 182.49 ? 116 ARG B CB  1 
ATOM   3287 C CG  . ARG B 1 81  ? -24.171 18.955  11.887  1.00 199.45 ? 116 ARG B CG  1 
ATOM   3288 C CD  . ARG B 1 81  ? -22.715 18.505  11.911  1.00 200.00 ? 116 ARG B CD  1 
ATOM   3289 N NE  . ARG B 1 81  ? -22.259 18.161  13.254  1.00 200.00 ? 116 ARG B NE  1 
ATOM   3290 C CZ  . ARG B 1 81  ? -21.028 17.749  13.543  1.00 200.00 ? 116 ARG B CZ  1 
ATOM   3291 N NH1 . ARG B 1 81  ? -20.124 17.627  12.581  1.00 200.00 ? 116 ARG B NH1 1 
ATOM   3292 N NH2 . ARG B 1 81  ? -20.702 17.457  14.794  1.00 200.00 ? 116 ARG B NH2 1 
ATOM   3293 N N   . LEU B 1 82  ? -24.765 19.587  7.819   1.00 169.65 ? 117 LEU B N   1 
ATOM   3294 C CA  . LEU B 1 82  ? -24.902 19.319  6.387   1.00 159.46 ? 117 LEU B CA  1 
ATOM   3295 C C   . LEU B 1 82  ? -23.716 18.530  5.828   1.00 156.65 ? 117 LEU B C   1 
ATOM   3296 O O   . LEU B 1 82  ? -22.585 19.018  5.756   1.00 155.54 ? 117 LEU B O   1 
ATOM   3297 C CB  . LEU B 1 82  ? -25.091 20.614  5.597   1.00 144.16 ? 117 LEU B CB  1 
ATOM   3298 C CG  . LEU B 1 82  ? -26.447 20.669  4.885   1.00 133.13 ? 117 LEU B CG  1 
ATOM   3299 C CD1 . LEU B 1 82  ? -26.511 21.897  3.996   1.00 126.20 ? 117 LEU B CD1 1 
ATOM   3300 C CD2 . LEU B 1 82  ? -26.643 19.408  4.056   1.00 127.17 ? 117 LEU B CD2 1 
ATOM   3301 N N   . SER B 1 83  ? -24.028 17.302  5.428   1.00 154.54 ? 118 SER B N   1 
ATOM   3302 C CA  . SER B 1 83  ? -23.114 16.302  4.888   1.00 155.90 ? 118 SER B CA  1 
ATOM   3303 C C   . SER B 1 83  ? -23.421 16.011  3.423   1.00 156.11 ? 118 SER B C   1 
ATOM   3304 O O   . SER B 1 83  ? -22.508 15.656  2.672   1.00 156.07 ? 118 SER B O   1 
ATOM   3305 C CB  . SER B 1 83  ? -23.213 15.007  5.700   1.00 150.65 ? 118 SER B CB  1 
ATOM   3306 O OG  . SER B 1 83  ? -24.523 14.467  5.648   1.00 158.88 ? 118 SER B OG  1 
ATOM   3307 N N   . ARG B 1 84  ? -24.657 16.103  3.024   1.00 136.73 ? 119 ARG B N   1 
ATOM   3308 C CA  . ARG B 1 84  ? -25.060 15.810  1.657   1.00 136.33 ? 119 ARG B CA  1 
ATOM   3309 C C   . ARG B 1 84  ? -26.012 16.868  1.118   1.00 135.26 ? 119 ARG B C   1 
ATOM   3310 O O   . ARG B 1 84  ? -27.010 17.133  1.779   1.00 138.43 ? 119 ARG B O   1 
ATOM   3311 C CB  . ARG B 1 84  ? -25.721 14.431  1.604   1.00 180.86 ? 119 ARG B CB  1 
ATOM   3312 C CG  . ARG B 1 84  ? -24.836 13.320  2.152   1.00 184.15 ? 119 ARG B CG  1 
ATOM   3313 C CD  . ARG B 1 84  ? -25.573 11.995  2.264   1.00 190.22 ? 119 ARG B CD  1 
ATOM   3314 N NE  . ARG B 1 84  ? -24.709 10.950  2.811   1.00 187.28 ? 119 ARG B NE  1 
ATOM   3315 C CZ  . ARG B 1 84  ? -25.101 9.705   3.060   1.00 187.28 ? 119 ARG B CZ  1 
ATOM   3316 N NH1 . ARG B 1 84  ? -26.351 9.337   2.812   1.00 187.28 ? 119 ARG B NH1 1 
ATOM   3317 N NH2 . ARG B 1 84  ? -24.242 8.825   3.558   1.00 187.28 ? 119 ARG B NH2 1 
ATOM   3318 N N   . LEU B 1 85  ? -25.651 17.453  0.009   1.00 94.31  ? 120 LEU B N   1 
ATOM   3319 C CA  . LEU B 1 85  ? -26.428 18.513  -0.598  1.00 95.18  ? 120 LEU B CA  1 
ATOM   3320 C C   . LEU B 1 85  ? -26.600 18.174  -2.063  1.00 95.38  ? 120 LEU B C   1 
ATOM   3321 O O   . LEU B 1 85  ? -25.627 18.107  -2.826  1.00 96.20  ? 120 LEU B O   1 
ATOM   3322 C CB  . LEU B 1 85  ? -25.699 19.849  -0.464  1.00 128.65 ? 120 LEU B CB  1 
ATOM   3323 C CG  . LEU B 1 85  ? -26.306 21.012  -1.250  1.00 128.65 ? 120 LEU B CG  1 
ATOM   3324 C CD1 . LEU B 1 85  ? -27.684 21.348  -0.698  1.00 128.97 ? 120 LEU B CD1 1 
ATOM   3325 C CD2 . LEU B 1 85  ? -25.382 22.214  -1.166  1.00 130.02 ? 120 LEU B CD2 1 
ATOM   3326 N N   . ASN B 1 86  ? -27.835 17.935  -2.457  1.00 111.25 ? 121 ASN B N   1 
ATOM   3327 C CA  . ASN B 1 86  ? -28.100 17.605  -3.841  1.00 110.46 ? 121 ASN B CA  1 
ATOM   3328 C C   . ASN B 1 86  ? -28.880 18.714  -4.515  1.00 112.83 ? 121 ASN B C   1 
ATOM   3329 O O   . ASN B 1 86  ? -30.038 18.969  -4.165  1.00 113.33 ? 121 ASN B O   1 
ATOM   3330 C CB  . ASN B 1 86  ? -28.883 16.292  -3.936  1.00 129.55 ? 121 ASN B CB  1 
ATOM   3331 C CG  . ASN B 1 86  ? -29.056 15.816  -5.371  1.00 128.11 ? 121 ASN B CG  1 
ATOM   3332 O OD1 . ASN B 1 86  ? -29.349 16.613  -6.261  1.00 129.67 ? 121 ASN B OD1 1 
ATOM   3333 N ND2 . ASN B 1 86  ? -28.890 14.513  -5.595  1.00 140.02 ? 121 ASN B ND2 1 
ATOM   3334 N N   . LEU B 1 87  ? -28.205 19.421  -5.414  1.00 168.15 ? 122 LEU B N   1 
ATOM   3335 C CA  . LEU B 1 87  ? -28.797 20.508  -6.187  1.00 168.33 ? 122 LEU B CA  1 
ATOM   3336 C C   . LEU B 1 87  ? -28.889 20.159  -7.670  1.00 168.21 ? 122 LEU B C   1 
ATOM   3337 O O   . LEU B 1 87  ? -29.126 21.029  -8.504  1.00 170.31 ? 122 LEU B O   1 
ATOM   3338 C CB  . LEU B 1 87  ? -27.970 21.786  -6.013  1.00 90.30  ? 122 LEU B CB  1 
ATOM   3339 C CG  . LEU B 1 87  ? -27.760 22.301  -4.585  1.00 92.44  ? 122 LEU B CG  1 
ATOM   3340 C CD1 . LEU B 1 87  ? -26.819 23.497  -4.608  1.00 94.43  ? 122 LEU B CD1 1 
ATOM   3341 C CD2 . LEU B 1 87  ? -29.094 22.683  -3.970  1.00 92.94  ? 122 LEU B CD2 1 
ATOM   3342 N N   . SER B 1 88  ? -28.651 18.892  -8.002  1.00 106.64 ? 123 SER B N   1 
ATOM   3343 C CA  . SER B 1 88  ? -28.654 18.436  -9.393  1.00 112.05 ? 123 SER B CA  1 
ATOM   3344 C C   . SER B 1 88  ? -29.860 18.841  -10.238 1.00 112.38 ? 123 SER B C   1 
ATOM   3345 O O   . SER B 1 88  ? -30.779 19.490  -9.754  1.00 110.49 ? 123 SER B O   1 
ATOM   3346 C CB  . SER B 1 88  ? -28.482 16.914  -9.447  1.00 167.61 ? 123 SER B CB  1 
ATOM   3347 O OG  . SER B 1 88  ? -29.535 16.243  -8.782  1.00 174.33 ? 123 SER B OG  1 
ATOM   3348 N N   . PHE B 1 89  ? -29.832 18.454  -11.511 1.00 180.34 ? 124 PHE B N   1 
ATOM   3349 C CA  . PHE B 1 89  ? -30.906 18.754  -12.459 1.00 183.77 ? 124 PHE B CA  1 
ATOM   3350 C C   . PHE B 1 89  ? -31.645 20.050  -12.124 1.00 173.29 ? 124 PHE B C   1 
ATOM   3351 O O   . PHE B 1 89  ? -32.808 20.016  -11.729 1.00 173.57 ? 124 PHE B O   1 
ATOM   3352 C CB  . PHE B 1 89  ? -31.922 17.605  -12.499 1.00 149.54 ? 124 PHE B CB  1 
ATOM   3353 C CG  . PHE B 1 89  ? -31.321 16.260  -12.809 1.00 176.69 ? 124 PHE B CG  1 
ATOM   3354 C CD1 . PHE B 1 89  ? -30.437 15.652  -11.922 1.00 199.70 ? 124 PHE B CD1 1 
ATOM   3355 C CD2 . PHE B 1 89  ? -31.656 15.590  -13.982 1.00 200.00 ? 124 PHE B CD2 1 
ATOM   3356 C CE1 . PHE B 1 89  ? -29.895 14.398  -12.198 1.00 200.00 ? 124 PHE B CE1 1 
ATOM   3357 C CE2 . PHE B 1 89  ? -31.120 14.336  -14.269 1.00 200.00 ? 124 PHE B CE2 1 
ATOM   3358 C CZ  . PHE B 1 89  ? -30.239 13.739  -13.373 1.00 200.00 ? 124 PHE B CZ  1 
ATOM   3359 N N   . ASN B 1 90  ? -30.981 21.189  -12.289 1.00 131.25 ? 125 ASN B N   1 
ATOM   3360 C CA  . ASN B 1 90  ? -31.611 22.469  -11.982 1.00 122.78 ? 125 ASN B CA  1 
ATOM   3361 C C   . ASN B 1 90  ? -31.369 23.474  -13.104 1.00 120.20 ? 125 ASN B C   1 
ATOM   3362 O O   . ASN B 1 90  ? -31.367 23.115  -14.280 1.00 117.70 ? 125 ASN B O   1 
ATOM   3363 C CB  . ASN B 1 90  ? -31.059 23.013  -10.661 1.00 127.99 ? 125 ASN B CB  1 
ATOM   3364 C CG  . ASN B 1 90  ? -32.024 23.955  -9.968  1.00 122.62 ? 125 ASN B CG  1 
ATOM   3365 O OD1 . ASN B 1 90  ? -32.468 24.943  -10.546 1.00 114.58 ? 125 ASN B OD1 1 
ATOM   3366 N ND2 . ASN B 1 90  ? -32.352 23.650  -8.718  1.00 116.12 ? 125 ASN B ND2 1 
ATOM   3367 N N   . ALA B 1 91  ? -31.171 24.734  -12.730 1.00 153.30 ? 126 ALA B N   1 
ATOM   3368 C CA  . ALA B 1 91  ? -30.921 25.806  -13.689 1.00 154.24 ? 126 ALA B CA  1 
ATOM   3369 C C   . ALA B 1 91  ? -29.711 26.611  -13.228 1.00 149.71 ? 126 ALA B C   1 
ATOM   3370 O O   . ALA B 1 91  ? -29.229 27.499  -13.934 1.00 148.45 ? 126 ALA B O   1 
ATOM   3371 C CB  . ALA B 1 91  ? -32.142 26.712  -13.791 1.00 57.28  ? 126 ALA B CB  1 
ATOM   3372 N N   . LEU B 1 92  ? -29.234 26.282  -12.031 1.00 107.99 ? 127 LEU B N   1 
ATOM   3373 C CA  . LEU B 1 92  ? -28.086 26.942  -11.421 1.00 105.12 ? 127 LEU B CA  1 
ATOM   3374 C C   . LEU B 1 92  ? -26.924 27.083  -12.400 1.00 109.37 ? 127 LEU B C   1 
ATOM   3375 O O   . LEU B 1 92  ? -26.275 26.100  -12.759 1.00 106.71 ? 127 LEU B O   1 
ATOM   3376 C CB  . LEU B 1 92  ? -27.634 26.149  -10.190 1.00 187.84 ? 127 LEU B CB  1 
ATOM   3377 C CG  . LEU B 1 92  ? -26.481 26.696  -9.344  1.00 177.60 ? 127 LEU B CG  1 
ATOM   3378 C CD1 . LEU B 1 92  ? -26.863 28.043  -8.751  1.00 172.58 ? 127 LEU B CD1 1 
ATOM   3379 C CD2 . LEU B 1 92  ? -26.154 25.704  -8.236  1.00 170.60 ? 127 LEU B CD2 1 
ATOM   3380 N N   . GLU B 1 93  ? -26.669 28.314  -12.831 1.00 141.44 ? 128 GLU B N   1 
ATOM   3381 C CA  . GLU B 1 93  ? -25.583 28.579  -13.763 1.00 150.13 ? 128 GLU B CA  1 
ATOM   3382 C C   . GLU B 1 93  ? -24.243 28.336  -13.074 1.00 146.19 ? 128 GLU B C   1 
ATOM   3383 O O   . GLU B 1 93  ? -23.347 27.713  -13.642 1.00 145.10 ? 128 GLU B O   1 
ATOM   3384 C CB  . GLU B 1 93  ? -25.654 30.023  -14.263 1.00 172.28 ? 128 GLU B CB  1 
ATOM   3385 C CG  . GLU B 1 93  ? -24.766 30.301  -15.465 1.00 190.19 ? 128 GLU B CG  1 
ATOM   3386 C CD  . GLU B 1 93  ? -25.202 29.535  -16.703 1.00 200.00 ? 128 GLU B CD  1 
ATOM   3387 O OE1 . GLU B 1 93  ? -24.504 29.622  -17.736 1.00 200.00 ? 128 GLU B OE1 1 
ATOM   3388 O OE2 . GLU B 1 93  ? -26.244 28.848  -16.644 1.00 200.00 ? 128 GLU B OE2 1 
ATOM   3389 N N   . SER B 1 94  ? -24.116 28.833  -11.846 1.00 126.30 ? 129 SER B N   1 
ATOM   3390 C CA  . SER B 1 94  ? -22.894 28.666  -11.066 1.00 124.24 ? 129 SER B CA  1 
ATOM   3391 C C   . SER B 1 94  ? -23.181 28.707  -9.571  1.00 123.35 ? 129 SER B C   1 
ATOM   3392 O O   . SER B 1 94  ? -24.122 29.365  -9.124  1.00 122.81 ? 129 SER B O   1 
ATOM   3393 C CB  . SER B 1 94  ? -21.882 29.757  -11.415 1.00 99.85  ? 129 SER B CB  1 
ATOM   3394 O OG  . SER B 1 94  ? -20.735 29.659  -10.589 1.00 100.32 ? 129 SER B OG  1 
ATOM   3395 N N   . LEU B 1 95  ? -22.356 28.005  -8.802  1.00 94.01  ? 130 LEU B N   1 
ATOM   3396 C CA  . LEU B 1 95  ? -22.515 27.947  -7.354  1.00 94.76  ? 130 LEU B CA  1 
ATOM   3397 C C   . LEU B 1 95  ? -21.331 28.606  -6.644  1.00 98.57  ? 130 LEU B C   1 
ATOM   3398 O O   . LEU B 1 95  ? -20.224 28.065  -6.627  1.00 98.07  ? 130 LEU B O   1 
ATOM   3399 C CB  . LEU B 1 95  ? -22.647 26.489  -6.903  1.00 90.59  ? 130 LEU B CB  1 
ATOM   3400 C CG  . LEU B 1 95  ? -23.017 26.246  -5.438  1.00 87.36  ? 130 LEU B CG  1 
ATOM   3401 C CD1 . LEU B 1 95  ? -24.375 26.865  -5.144  1.00 84.92  ? 130 LEU B CD1 1 
ATOM   3402 C CD2 . LEU B 1 95  ? -23.041 24.752  -5.157  1.00 86.01  ? 130 LEU B CD2 1 
ATOM   3403 N N   . SER B 1 96  ? -21.577 29.774  -6.057  1.00 107.94 ? 131 SER B N   1 
ATOM   3404 C CA  . SER B 1 96  ? -20.547 30.528  -5.347  1.00 112.94 ? 131 SER B CA  1 
ATOM   3405 C C   . SER B 1 96  ? -19.744 29.680  -4.359  1.00 112.29 ? 131 SER B C   1 
ATOM   3406 O O   . SER B 1 96  ? -20.284 28.802  -3.684  1.00 110.85 ? 131 SER B O   1 
ATOM   3407 C CB  . SER B 1 96  ? -21.182 31.709  -4.604  1.00 129.41 ? 131 SER B CB  1 
ATOM   3408 O OG  . SER B 1 96  ? -21.818 32.600  -5.505  1.00 136.37 ? 131 SER B OG  1 
ATOM   3409 N N   . TRP B 1 97  ? -18.449 29.960  -4.279  1.00 70.29  ? 132 TRP B N   1 
ATOM   3410 C CA  . TRP B 1 97  ? -17.555 29.242  -3.382  1.00 73.13  ? 132 TRP B CA  1 
ATOM   3411 C C   . TRP B 1 97  ? -18.031 29.258  -1.931  1.00 75.41  ? 132 TRP B C   1 
ATOM   3412 O O   . TRP B 1 97  ? -18.432 28.229  -1.390  1.00 73.51  ? 132 TRP B O   1 
ATOM   3413 C CB  . TRP B 1 97  ? -16.150 29.843  -3.459  1.00 137.02 ? 132 TRP B CB  1 
ATOM   3414 C CG  . TRP B 1 97  ? -15.297 29.500  -2.280  1.00 132.30 ? 132 TRP B CG  1 
ATOM   3415 C CD1 . TRP B 1 97  ? -14.827 28.265  -1.937  1.00 131.04 ? 132 TRP B CD1 1 
ATOM   3416 C CD2 . TRP B 1 97  ? -14.857 30.397  -1.256  1.00 129.96 ? 132 TRP B CD2 1 
ATOM   3417 N NE1 . TRP B 1 97  ? -14.122 28.337  -0.759  1.00 131.13 ? 132 TRP B NE1 1 
ATOM   3418 C CE2 . TRP B 1 97  ? -14.125 29.635  -0.319  1.00 129.41 ? 132 TRP B CE2 1 
ATOM   3419 C CE3 . TRP B 1 97  ? -15.010 31.772  -1.037  1.00 129.47 ? 132 TRP B CE3 1 
ATOM   3420 C CZ2 . TRP B 1 97  ? -13.547 30.202  0.822   1.00 128.70 ? 132 TRP B CZ2 1 
ATOM   3421 C CZ3 . TRP B 1 97  ? -14.436 32.337  0.097   1.00 129.35 ? 132 TRP B CZ3 1 
ATOM   3422 C CH2 . TRP B 1 97  ? -13.713 31.551  1.012   1.00 129.10 ? 132 TRP B CH2 1 
ATOM   3423 N N   . LYS B 1 98  ? -17.972 30.437  -1.317  1.00 160.49 ? 133 LYS B N   1 
ATOM   3424 C CA  . LYS B 1 98  ? -18.362 30.648  0.078   1.00 166.19 ? 133 LYS B CA  1 
ATOM   3425 C C   . LYS B 1 98  ? -19.535 29.795  0.566   1.00 158.61 ? 133 LYS B C   1 
ATOM   3426 O O   . LYS B 1 98  ? -19.697 29.581  1.769   1.00 157.84 ? 133 LYS B O   1 
ATOM   3427 C CB  . LYS B 1 98  ? -18.683 32.132  0.299   1.00 143.35 ? 133 LYS B CB  1 
ATOM   3428 C CG  . LYS B 1 98  ? -19.030 32.507  1.739   1.00 168.21 ? 133 LYS B CG  1 
ATOM   3429 C CD  . LYS B 1 98  ? -17.819 32.423  2.659   1.00 194.51 ? 133 LYS B CD  1 
ATOM   3430 C CE  . LYS B 1 98  ? -16.770 33.466  2.302   1.00 200.00 ? 133 LYS B CE  1 
ATOM   3431 N NZ  . LYS B 1 98  ? -17.295 34.855  2.423   1.00 200.00 ? 133 LYS B NZ  1 
ATOM   3432 N N   . THR B 1 99  ? -20.349 29.310  -0.363  1.00 111.44 ? 134 THR B N   1 
ATOM   3433 C CA  . THR B 1 99  ? -21.501 28.489  -0.017  1.00 106.03 ? 134 THR B CA  1 
ATOM   3434 C C   . THR B 1 99  ? -21.177 27.365  0.965   1.00 109.29 ? 134 THR B C   1 
ATOM   3435 O O   . THR B 1 99  ? -21.767 27.281  2.043   1.00 107.97 ? 134 THR B O   1 
ATOM   3436 C CB  . THR B 1 99  ? -22.121 27.866  -1.272  1.00 124.98 ? 134 THR B CB  1 
ATOM   3437 O OG1 . THR B 1 99  ? -22.535 28.909  -2.164  1.00 118.06 ? 134 THR B OG1 1 
ATOM   3438 C CG2 . THR B 1 99  ? -23.320 27.005  -0.900  1.00 116.83 ? 134 THR B CG2 1 
ATOM   3439 N N   . VAL B 1 100 ? -20.244 26.499  0.582   1.00 148.59 ? 135 VAL B N   1 
ATOM   3440 C CA  . VAL B 1 100 ? -19.846 25.374  1.425   1.00 153.67 ? 135 VAL B CA  1 
ATOM   3441 C C   . VAL B 1 100 ? -19.124 25.831  2.689   1.00 155.11 ? 135 VAL B C   1 
ATOM   3442 O O   . VAL B 1 100 ? -19.382 25.311  3.774   1.00 155.17 ? 135 VAL B O   1 
ATOM   3443 C CB  . VAL B 1 100 ? -18.922 24.396  0.660   1.00 101.67 ? 135 VAL B CB  1 
ATOM   3444 C CG1 . VAL B 1 100 ? -18.509 23.246  1.568   1.00 100.65 ? 135 VAL B CG1 1 
ATOM   3445 C CG2 . VAL B 1 100 ? -19.634 23.866  -0.574  1.00 100.38 ? 135 VAL B CG2 1 
ATOM   3446 N N   . GLN B 1 101 ? -18.223 26.799  2.545   1.00 104.73 ? 136 GLN B N   1 
ATOM   3447 C CA  . GLN B 1 101 ? -17.464 27.314  3.679   1.00 109.68 ? 136 GLN B CA  1 
ATOM   3448 C C   . GLN B 1 101 ? -17.211 26.172  4.658   1.00 110.28 ? 136 GLN B C   1 
ATOM   3449 O O   . GLN B 1 101 ? -17.679 26.197  5.797   1.00 107.68 ? 136 GLN B O   1 
ATOM   3450 C CB  . GLN B 1 101 ? -18.242 28.439  4.371   1.00 186.60 ? 136 GLN B CB  1 
ATOM   3451 C CG  . GLN B 1 101 ? -17.401 29.664  4.737   1.00 196.41 ? 136 GLN B CG  1 
ATOM   3452 C CD  . GLN B 1 101 ? -16.437 29.424  5.890   1.00 200.00 ? 136 GLN B CD  1 
ATOM   3453 O OE1 . GLN B 1 101 ? -15.626 30.290  6.223   1.00 200.00 ? 136 GLN B OE1 1 
ATOM   3454 N NE2 . GLN B 1 101 ? -16.526 28.254  6.509   1.00 200.00 ? 136 GLN B NE2 1 
ATOM   3455 N N   . GLY B 1 102 ? -16.492 25.160  4.184   1.00 188.12 ? 137 GLY B N   1 
ATOM   3456 C CA  . GLY B 1 102 ? -16.173 24.008  5.006   1.00 189.29 ? 137 GLY B CA  1 
ATOM   3457 C C   . GLY B 1 102 ? -17.261 23.584  5.974   1.00 187.80 ? 137 GLY B C   1 
ATOM   3458 O O   . GLY B 1 102 ? -17.111 23.737  7.186   1.00 189.61 ? 137 GLY B O   1 
ATOM   3459 N N   . LEU B 1 103 ? -18.361 23.060  5.446   1.00 133.79 ? 138 LEU B N   1 
ATOM   3460 C CA  . LEU B 1 103 ? -19.459 22.601  6.291   1.00 129.77 ? 138 LEU B CA  1 
ATOM   3461 C C   . LEU B 1 103 ? -19.355 21.095  6.485   1.00 131.88 ? 138 LEU B C   1 
ATOM   3462 O O   . LEU B 1 103 ? -20.268 20.463  7.021   1.00 131.36 ? 138 LEU B O   1 
ATOM   3463 C CB  . LEU B 1 103 ? -20.813 22.941  5.660   1.00 133.15 ? 138 LEU B CB  1 
ATOM   3464 C CG  . LEU B 1 103 ? -21.267 24.404  5.670   1.00 123.35 ? 138 LEU B CG  1 
ATOM   3465 C CD1 . LEU B 1 103 ? -22.630 24.516  4.998   1.00 115.26 ? 138 LEU B CD1 1 
ATOM   3466 C CD2 . LEU B 1 103 ? -21.333 24.920  7.102   1.00 118.86 ? 138 LEU B CD2 1 
ATOM   3467 N N   . SER B 1 104 ? -18.234 20.529  6.048   1.00 183.87 ? 139 SER B N   1 
ATOM   3468 C CA  . SER B 1 104 ? -17.995 19.095  6.151   1.00 186.95 ? 139 SER B CA  1 
ATOM   3469 C C   . SER B 1 104 ? -18.949 18.320  5.246   1.00 184.45 ? 139 SER B C   1 
ATOM   3470 O O   . SER B 1 104 ? -19.092 17.102  5.377   1.00 184.06 ? 139 SER B O   1 
ATOM   3471 C CB  . SER B 1 104 ? -18.154 18.626  7.601   1.00 141.32 ? 139 SER B CB  1 
ATOM   3472 O OG  . SER B 1 104 ? -17.176 19.217  8.438   1.00 147.01 ? 139 SER B OG  1 
ATOM   3473 N N   . LEU B 1 105 ? -19.605 19.037  4.334   1.00 118.98 ? 140 LEU B N   1 
ATOM   3474 C CA  . LEU B 1 105 ? -20.535 18.427  3.388   1.00 117.84 ? 140 LEU B CA  1 
ATOM   3475 C C   . LEU B 1 105 ? -19.827 17.205  2.827   1.00 117.61 ? 140 LEU B C   1 
ATOM   3476 O O   . LEU B 1 105 ? -18.720 17.324  2.297   1.00 116.77 ? 140 LEU B O   1 
ATOM   3477 C CB  . LEU B 1 105 ? -20.850 19.416  2.262   1.00 104.55 ? 140 LEU B CB  1 
ATOM   3478 C CG  . LEU B 1 105 ? -21.806 18.985  1.149   1.00 105.03 ? 140 LEU B CG  1 
ATOM   3479 C CD1 . LEU B 1 105 ? -23.178 18.685  1.726   1.00 106.17 ? 140 LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 1 105 ? -21.900 20.094  0.112   1.00 104.81 ? 140 LEU B CD2 1 
ATOM   3481 N N   . GLN B 1 106 ? -20.443 16.030  2.937   1.00 145.78 ? 141 GLN B N   1 
ATOM   3482 C CA  . GLN B 1 106 ? -19.759 14.842  2.440   1.00 143.38 ? 141 GLN B CA  1 
ATOM   3483 C C   . GLN B 1 106 ? -20.074 14.600  0.969   1.00 143.67 ? 141 GLN B C   1 
ATOM   3484 O O   . GLN B 1 106 ? -19.233 14.066  0.248   1.00 143.87 ? 141 GLN B O   1 
ATOM   3485 C CB  . GLN B 1 106 ? -20.142 13.623  3.283   1.00 194.11 ? 141 GLN B CB  1 
ATOM   3486 C CG  . GLN B 1 106 ? -19.690 13.731  4.736   1.00 200.00 ? 141 GLN B CG  1 
ATOM   3487 C CD  . GLN B 1 106 ? -20.022 12.500  5.557   1.00 199.01 ? 141 GLN B CD  1 
ATOM   3488 O OE1 . GLN B 1 106 ? -19.587 11.393  5.240   1.00 199.01 ? 141 GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 1 106 ? -20.793 12.690  6.623   1.00 200.00 ? 141 GLN B NE2 1 
ATOM   3490 N N   . GLU B 1 107 ? -21.279 14.900  0.555   1.00 140.95 ? 142 GLU B N   1 
ATOM   3491 C CA  . GLU B 1 107 ? -21.669 14.695  -0.834  1.00 142.08 ? 142 GLU B CA  1 
ATOM   3492 C C   . GLU B 1 107 ? -22.342 15.938  -1.405  1.00 141.25 ? 142 GLU B C   1 
ATOM   3493 O O   . GLU B 1 107 ? -23.210 16.511  -0.753  1.00 143.50 ? 142 GLU B O   1 
ATOM   3494 C CB  . GLU B 1 107 ? -22.614 13.498  -0.947  1.00 186.90 ? 142 GLU B CB  1 
ATOM   3495 C CG  . GLU B 1 107 ? -22.024 12.192  -0.438  1.00 194.24 ? 142 GLU B CG  1 
ATOM   3496 C CD  . GLU B 1 107 ? -22.931 11.003  -0.696  1.00 194.24 ? 142 GLU B CD  1 
ATOM   3497 O OE1 . GLU B 1 107 ? -24.102 11.040  -0.264  1.00 194.24 ? 142 GLU B OE1 1 
ATOM   3498 O OE2 . GLU B 1 107 ? -22.471 10.029  -1.330  1.00 194.24 ? 142 GLU B OE2 1 
ATOM   3499 N N   . LEU B 1 108 ? -21.906 16.337  -2.578  1.00 105.77 ? 143 LEU B N   1 
ATOM   3500 C CA  . LEU B 1 108 ? -22.444 17.515  -3.238  1.00 105.23 ? 143 LEU B CA  1 
ATOM   3501 C C   . LEU B 1 108 ? -22.757 17.155  -4.677  1.00 105.80 ? 143 LEU B C   1 
ATOM   3502 O O   . LEU B 1 108 ? -21.857 16.879  -5.456  1.00 106.30 ? 143 LEU B O   1 
ATOM   3503 C CB  . LEU B 1 108 ? -21.425 18.657  -3.199  1.00 45.41  ? 143 LEU B CB  1 
ATOM   3504 C CG  . LEU B 1 108 ? -21.785 19.936  -3.961  1.00 45.08  ? 143 LEU B CG  1 
ATOM   3505 C CD1 . LEU B 1 108 ? -23.065 20.539  -3.400  1.00 46.27  ? 143 LEU B CD1 1 
ATOM   3506 C CD2 . LEU B 1 108 ? -20.636 20.925  -3.856  1.00 48.40  ? 143 LEU B CD2 1 
ATOM   3507 N N   . VAL B 1 109 ? -24.051 17.136  -5.013  1.00 97.07  ? 144 VAL B N   1 
ATOM   3508 C CA  . VAL B 1 109 ? -24.460 16.827  -6.377  1.00 99.50  ? 144 VAL B CA  1 
ATOM   3509 C C   . VAL B 1 109 ? -24.769 18.103  -7.152  1.00 100.80 ? 144 VAL B C   1 
ATOM   3510 O O   . VAL B 1 109 ? -25.694 18.809  -6.786  1.00 100.85 ? 144 VAL B O   1 
ATOM   3511 C CB  . VAL B 1 109 ? -25.703 15.922  -6.378  1.00 149.21 ? 144 VAL B CB  1 
ATOM   3512 C CG1 . VAL B 1 109 ? -25.902 15.312  -7.759  1.00 158.68 ? 144 VAL B CG1 1 
ATOM   3513 C CG2 . VAL B 1 109 ? -25.551 14.838  -5.319  1.00 158.68 ? 144 VAL B CG2 1 
ATOM   3514 N N   . LEU B 1 110 ? -23.998 18.384  -8.195  1.00 100.55 ? 145 LEU B N   1 
ATOM   3515 C CA  . LEU B 1 110 ? -24.197 19.566  -9.046  1.00 100.85 ? 145 LEU B CA  1 
ATOM   3516 C C   . LEU B 1 110 ? -24.225 19.146  -10.498 1.00 101.62 ? 145 LEU B C   1 
ATOM   3517 O O   . LEU B 1 110 ? -23.243 18.489  -10.882 1.00 166.69 ? 145 LEU B O   1 
ATOM   3518 C CB  . LEU B 1 110 ? -23.066 20.574  -8.824  1.00 121.98 ? 145 LEU B CB  1 
ATOM   3519 C CG  . LEU B 1 110 ? -22.878 21.113  -7.402  1.00 125.19 ? 145 LEU B CG  1 
ATOM   3520 C CD1 . LEU B 1 110 ? -21.671 22.038  -7.369  1.00 125.12 ? 145 LEU B CD1 1 
ATOM   3521 C CD2 . LEU B 1 110 ? -24.133 21.850  -6.952  1.00 127.12 ? 145 LEU B CD2 1 
ATOM   3522 N N   . SER B 1 111 ? -25.344 19.180  -11.198 1.00 167.20 ? 146 SER B N   1 
ATOM   3523 C CA  . SER B 1 111 ? -25.260 18.572  -12.520 1.00 162.97 ? 146 SER B CA  1 
ATOM   3524 C C   . SER B 1 111 ? -26.484 18.613  -13.368 1.00 162.08 ? 146 SER B C   1 
ATOM   3525 O O   . SER B 1 111 ? -27.567 19.017  -12.933 1.00 160.09 ? 146 SER B O   1 
ATOM   3526 C CB  . SER B 1 111 ? -24.833 17.098  -12.413 1.00 110.50 ? 146 SER B CB  1 
ATOM   3527 O OG  . SER B 1 111 ? -25.835 16.302  -11.804 1.00 108.54 ? 146 SER B OG  1 
ATOM   3528 N N   . GLY B 1 112 ? -26.300 18.133  -14.593 1.00 143.51 ? 147 GLY B N   1 
ATOM   3529 C CA  . GLY B 1 112 ? -27.376 18.203  -15.540 1.00 143.92 ? 147 GLY B CA  1 
ATOM   3530 C C   . GLY B 1 112 ? -27.567 19.691  -15.395 1.00 144.14 ? 147 GLY B C   1 
ATOM   3531 O O   . GLY B 1 112 ? -28.583 20.249  -15.809 1.00 143.93 ? 147 GLY B O   1 
ATOM   3532 N N   . ASN B 1 113 ? -26.572 20.346  -14.783 1.00 102.92 ? 148 ASN B N   1 
ATOM   3533 C CA  . ASN B 1 113 ? -26.735 21.784  -14.582 1.00 102.97 ? 148 ASN B CA  1 
ATOM   3534 C C   . ASN B 1 113 ? -25.991 22.544  -15.622 1.00 106.65 ? 148 ASN B C   1 
ATOM   3535 O O   . ASN B 1 113 ? -24.977 22.072  -16.051 1.00 108.01 ? 148 ASN B O   1 
ATOM   3536 C CB  . ASN B 1 113 ? -26.262 22.183  -13.179 1.00 134.48 ? 148 ASN B CB  1 
ATOM   3537 C CG  . ASN B 1 113 ? -27.387 22.159  -12.153 1.00 127.68 ? 148 ASN B CG  1 
ATOM   3538 O OD1 . ASN B 1 113 ? -28.252 23.043  -12.131 1.00 118.25 ? 148 ASN B OD1 1 
ATOM   3539 N ND2 . ASN B 1 113 ? -27.394 21.130  -11.314 1.00 115.49 ? 148 ASN B ND2 1 
ATOM   3540 N N   . PRO B 1 114 ? -26.450 23.710  -16.021 1.00 84.35  ? 149 PRO B N   1 
ATOM   3541 C CA  . PRO B 1 114 ? -25.758 24.518  -17.038 1.00 88.68  ? 149 PRO B CA  1 
ATOM   3542 C C   . PRO B 1 114 ? -24.265 24.675  -16.786 1.00 93.89  ? 149 PRO B C   1 
ATOM   3543 O O   . PRO B 1 114 ? -23.528 24.434  -17.717 1.00 94.12  ? 149 PRO B O   1 
ATOM   3544 C CB  . PRO B 1 114 ? -26.500 25.845  -16.978 1.00 129.73 ? 149 PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 114 ? -27.904 25.404  -16.692 1.00 125.98 ? 149 PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 114 ? -27.692 24.379  -15.587 1.00 123.90 ? 149 PRO B CD  1 
ATOM   3547 N N   . LEU B 1 115 ? -24.251 24.920  -15.410 1.00 96.14  ? 150 LEU B N   1 
ATOM   3548 C CA  . LEU B 1 115 ? -22.887 24.908  -14.881 1.00 95.40  ? 150 LEU B CA  1 
ATOM   3549 C C   . LEU B 1 115 ? -21.854 25.597  -15.752 1.00 95.65  ? 150 LEU B C   1 
ATOM   3550 O O   . LEU B 1 115 ? -20.795 25.032  -16.028 1.00 94.77  ? 150 LEU B O   1 
ATOM   3551 C CB  . LEU B 1 115 ? -22.437 23.466  -14.607 1.00 140.38 ? 150 LEU B CB  1 
ATOM   3552 C CG  . LEU B 1 115 ? -23.147 22.689  -13.492 1.00 138.48 ? 150 LEU B CG  1 
ATOM   3553 C CD1 . LEU B 1 115 ? -22.600 21.272  -13.444 1.00 138.15 ? 150 LEU B CD1 1 
ATOM   3554 C CD2 . LEU B 1 115 ? -22.952 23.380  -12.148 1.00 137.72 ? 150 LEU B CD2 1 
ATOM   3555 N N   . HIS B 1 116 ? -22.144 26.822  -16.173 1.00 74.50  ? 151 HIS B N   1 
ATOM   3556 C CA  . HIS B 1 116 ? -21.173 27.554  -16.953 1.00 77.69  ? 151 HIS B CA  1 
ATOM   3557 C C   . HIS B 1 116 ? -19.852 27.538  -16.206 1.00 75.50  ? 151 HIS B C   1 
ATOM   3558 O O   . HIS B 1 116 ? -19.755 28.048  -15.094 1.00 74.38  ? 151 HIS B O   1 
ATOM   3559 C CB  . HIS B 1 116 ? -21.639 28.986  -17.141 1.00 178.01 ? 151 HIS B CB  1 
ATOM   3560 C CG  . HIS B 1 116 ? -20.705 29.807  -17.971 1.00 190.28 ? 151 HIS B CG  1 
ATOM   3561 N ND1 . HIS B 1 116 ? -19.439 30.144  -17.543 1.00 200.00 ? 151 HIS B ND1 1 
ATOM   3562 C CD2 . HIS B 1 116 ? -20.822 30.309  -19.223 1.00 200.00 ? 151 HIS B CD2 1 
ATOM   3563 C CE1 . HIS B 1 116 ? -18.816 30.817  -18.493 1.00 200.00 ? 151 HIS B CE1 1 
ATOM   3564 N NE2 . HIS B 1 116 ? -19.633 30.931  -19.524 1.00 200.00 ? 151 HIS B NE2 1 
ATOM   3565 N N   . CYS B 1 117 ? -18.844 26.931  -16.822 1.00 140.76 ? 152 CYS B N   1 
ATOM   3566 C CA  . CYS B 1 117 ? -17.527 26.845  -16.220 1.00 139.69 ? 152 CYS B CA  1 
ATOM   3567 C C   . CYS B 1 117 ? -16.865 28.186  -16.225 1.00 137.45 ? 152 CYS B C   1 
ATOM   3568 O O   . CYS B 1 117 ? -16.693 28.809  -17.276 1.00 138.11 ? 152 CYS B O   1 
ATOM   3569 C CB  . CYS B 1 117 ? -16.662 25.837  -16.952 1.00 139.95 ? 152 CYS B CB  1 
ATOM   3570 S SG  . CYS B 1 117 ? -17.182 24.129  -16.647 1.00 139.10 ? 152 CYS B SG  1 
ATOM   3571 N N   . SER B 1 118 ? -16.502 28.618  -15.026 1.00 83.01  ? 153 SER B N   1 
ATOM   3572 C CA  . SER B 1 118 ? -15.823 29.874  -14.839 1.00 80.81  ? 153 SER B CA  1 
ATOM   3573 C C   . SER B 1 118 ? -14.567 29.618  -14.029 1.00 77.92  ? 153 SER B C   1 
ATOM   3574 O O   . SER B 1 118 ? -14.236 28.471  -13.718 1.00 76.75  ? 153 SER B O   1 
ATOM   3575 C CB  . SER B 1 118 ? -16.730 30.839  -14.086 1.00 103.51 ? 153 SER B CB  1 
ATOM   3576 O OG  . SER B 1 118 ? -17.209 30.233  -12.898 1.00 100.83 ? 153 SER B OG  1 
ATOM   3577 N N   . CYS B 1 119 ? -13.858 30.694  -13.723 1.00 83.49  ? 154 CYS B N   1 
ATOM   3578 C CA  . CYS B 1 119 ? -12.894 30.675  -12.657 1.00 82.34  ? 154 CYS B CA  1 
ATOM   3579 C C   . CYS B 1 119 ? -13.610 30.407  -11.319 1.00 79.79  ? 154 CYS B C   1 
ATOM   3580 O O   . CYS B 1 119 ? -13.066 29.750  -10.430 1.00 79.54  ? 154 CYS B O   1 
ATOM   3581 C CB  . CYS B 1 119 ? -12.091 31.967  -12.592 1.00 115.43 ? 154 CYS B CB  1 
ATOM   3582 S SG  . CYS B 1 119 ? -10.521 31.907  -13.525 1.00 120.21 ? 154 CYS B SG  1 
ATOM   3583 N N   . ALA B 1 120 ? -14.846 30.894  -11.193 1.00 50.60  ? 155 ALA B N   1 
ATOM   3584 C CA  . ALA B 1 120 ? -15.670 30.692  -9.995  1.00 49.29  ? 155 ALA B CA  1 
ATOM   3585 C C   . ALA B 1 120 ? -16.186 29.277  -9.828  1.00 44.35  ? 155 ALA B C   1 
ATOM   3586 O O   . ALA B 1 120 ? -17.230 29.060  -9.215  1.00 43.07  ? 155 ALA B O   1 
ATOM   3587 C CB  . ALA B 1 120 ? -16.852 31.695  -9.996  1.00 161.26 ? 155 ALA B CB  1 
ATOM   3588 N N   . LEU B 1 121 ? -15.472 28.332  -10.426 1.00 94.58  ? 156 LEU B N   1 
ATOM   3589 C CA  . LEU B 1 121 ? -15.661 26.914  -10.185 1.00 91.73  ? 156 LEU B CA  1 
ATOM   3590 C C   . LEU B 1 121 ? -14.332 26.175  -10.037 1.00 91.07  ? 156 LEU B C   1 
ATOM   3591 O O   . LEU B 1 121 ? -14.316 24.963  -9.952  1.00 89.83  ? 156 LEU B O   1 
ATOM   3592 C CB  . LEU B 1 121 ? -16.478 26.257  -11.317 1.00 57.23  ? 156 LEU B CB  1 
ATOM   3593 C CG  . LEU B 1 121 ? -18.011 26.361  -11.413 1.00 49.00  ? 156 LEU B CG  1 
ATOM   3594 C CD1 . LEU B 1 121 ? -18.448 25.703  -12.709 1.00 45.97  ? 156 LEU B CD1 1 
ATOM   3595 C CD2 . LEU B 1 121 ? -18.699 25.679  -10.236 1.00 45.09  ? 156 LEU B CD2 1 
ATOM   3596 N N   . ARG B 1 122 ? -13.213 26.882  -9.962  1.00 43.78  ? 157 ARG B N   1 
ATOM   3597 C CA  . ARG B 1 122 ? -11.969 26.191  -9.714  1.00 45.19  ? 157 ARG B CA  1 
ATOM   3598 C C   . ARG B 1 122 ? -12.133 25.394  -8.446  1.00 48.83  ? 157 ARG B C   1 
ATOM   3599 O O   . ARG B 1 122 ? -11.474 24.398  -8.295  1.00 48.03  ? 157 ARG B O   1 
ATOM   3600 C CB  . ARG B 1 122 ? -10.806 27.169  -9.532  1.00 68.83  ? 157 ARG B CB  1 
ATOM   3601 C CG  . ARG B 1 122 ? -9.471  26.464  -9.319  1.00 67.38  ? 157 ARG B CG  1 
ATOM   3602 C CD  . ARG B 1 122 ? -9.035  25.740  -10.588 1.00 66.94  ? 157 ARG B CD  1 
ATOM   3603 N NE  . ARG B 1 122 ? -8.454  24.417  -10.351 1.00 66.67  ? 157 ARG B NE  1 
ATOM   3604 C CZ  . ARG B 1 122 ? -7.346  24.190  -9.651  1.00 67.11  ? 157 ARG B CZ  1 
ATOM   3605 N NH1 . ARG B 1 122 ? -6.682  25.198  -9.105  1.00 67.57  ? 157 ARG B NH1 1 
ATOM   3606 N NH2 . ARG B 1 122 ? -6.894  22.951  -9.505  1.00 67.05  ? 157 ARG B NH2 1 
ATOM   3607 N N   . TRP B 1 123 ? -13.000 25.825  -7.528  1.00 128.34 ? 158 TRP B N   1 
ATOM   3608 C CA  . TRP B 1 123 ? -13.167 25.120  -6.245  1.00 134.09 ? 158 TRP B CA  1 
ATOM   3609 C C   . TRP B 1 123 ? -13.771 23.716  -6.386  1.00 129.51 ? 158 TRP B C   1 
ATOM   3610 O O   . TRP B 1 123 ? -13.381 22.787  -5.673  1.00 129.34 ? 158 TRP B O   1 
ATOM   3611 C CB  . TRP B 1 123 ? -13.998 25.960  -5.265  1.00 19.88  ? 158 TRP B CB  1 
ATOM   3612 C CG  . TRP B 1 123 ? -15.461 26.022  -5.580  1.00 41.14  ? 158 TRP B CG  1 
ATOM   3613 C CD1 . TRP B 1 123 ? -16.084 26.860  -6.460  1.00 58.34  ? 158 TRP B CD1 1 
ATOM   3614 C CD2 . TRP B 1 123 ? -16.482 25.191  -5.025  1.00 62.49  ? 158 TRP B CD2 1 
ATOM   3615 N NE1 . TRP B 1 123 ? -17.433 26.600  -6.487  1.00 65.62  ? 158 TRP B NE1 1 
ATOM   3616 C CE2 . TRP B 1 123 ? -17.704 25.578  -5.615  1.00 68.39  ? 158 TRP B CE2 1 
ATOM   3617 C CE3 . TRP B 1 123 ? -16.482 24.152  -4.084  1.00 71.39  ? 158 TRP B CE3 1 
ATOM   3618 C CZ2 . TRP B 1 123 ? -18.918 24.963  -5.294  1.00 75.07  ? 158 TRP B CZ2 1 
ATOM   3619 C CZ3 . TRP B 1 123 ? -17.686 23.540  -3.765  1.00 75.07  ? 158 TRP B CZ3 1 
ATOM   3620 C CH2 . TRP B 1 123 ? -18.889 23.949  -4.370  1.00 75.07  ? 158 TRP B CH2 1 
ATOM   3621 N N   . LEU B 1 124 ? -14.711 23.567  -7.310  1.00 64.77  ? 159 LEU B N   1 
ATOM   3622 C CA  . LEU B 1 124 ? -15.290 22.265  -7.636  1.00 63.36  ? 159 LEU B CA  1 
ATOM   3623 C C   . LEU B 1 124 ? -14.282 21.460  -8.430  1.00 63.27  ? 159 LEU B C   1 
ATOM   3624 O O   . LEU B 1 124 ? -14.234 20.247  -8.359  1.00 60.83  ? 159 LEU B O   1 
ATOM   3625 C CB  . LEU B 1 124 ? -16.592 22.458  -8.441  1.00 49.43  ? 159 LEU B CB  1 
ATOM   3626 C CG  . LEU B 1 124 ? -17.552 21.309  -8.800  1.00 51.82  ? 159 LEU B CG  1 
ATOM   3627 C CD1 . LEU B 1 124 ? -18.285 20.773  -7.570  1.00 53.90  ? 159 LEU B CD1 1 
ATOM   3628 C CD2 . LEU B 1 124 ? -18.569 21.841  -9.801  1.00 54.20  ? 159 LEU B CD2 1 
ATOM   3629 N N   . GLN B 1 125 ? -13.482 22.169  -9.202  1.00 91.44  ? 160 GLN B N   1 
ATOM   3630 C CA  . GLN B 1 125 ? -12.366 21.582  -9.888  1.00 94.44  ? 160 GLN B CA  1 
ATOM   3631 C C   . GLN B 1 125 ? -11.531 20.840  -8.861  1.00 98.89  ? 160 GLN B C   1 
ATOM   3632 O O   . GLN B 1 125 ? -11.361 19.639  -8.969  1.00 98.86  ? 160 GLN B O   1 
ATOM   3633 C CB  . GLN B 1 125 ? -11.511 22.679  -10.529 1.00 123.08 ? 160 GLN B CB  1 
ATOM   3634 C CG  . GLN B 1 125 ? -10.314 22.168  -11.293 1.00 119.78 ? 160 GLN B CG  1 
ATOM   3635 C CD  . GLN B 1 125 ? -10.709 21.481  -12.573 1.00 110.31 ? 160 GLN B CD  1 
ATOM   3636 O OE1 . GLN B 1 125 ? -11.411 20.474  -12.558 1.00 106.49 ? 160 GLN B OE1 1 
ATOM   3637 N NE2 . GLN B 1 125 ? -10.263 22.024  -13.694 1.00 105.49 ? 160 GLN B NE2 1 
ATOM   3638 N N   . ARG B 1 126 ? -11.030 21.568  -7.859  1.00 133.20 ? 161 ARG B N   1 
ATOM   3639 C CA  . ARG B 1 126 ? -10.215 20.997  -6.797  1.00 138.88 ? 161 ARG B CA  1 
ATOM   3640 C C   . ARG B 1 126 ? -10.981 19.834  -6.249  1.00 136.67 ? 161 ARG B C   1 
ATOM   3641 O O   . ARG B 1 126 ? -10.476 18.726  -6.215  1.00 136.40 ? 161 ARG B O   1 
ATOM   3642 C CB  . ARG B 1 126 ? -9.913  22.028  -5.711  1.00 138.23 ? 161 ARG B CB  1 
ATOM   3643 C CG  . ARG B 1 126 ? -8.905  23.098  -6.129  1.00 153.98 ? 161 ARG B CG  1 
ATOM   3644 C CD  . ARG B 1 126 ? -8.341  23.865  -4.947  1.00 170.86 ? 161 ARG B CD  1 
ATOM   3645 N NE  . ARG B 1 126 ? -7.605  23.011  -4.017  1.00 181.26 ? 161 ARG B NE  1 
ATOM   3646 C CZ  . ARG B 1 126 ? -6.476  22.372  -4.311  1.00 189.09 ? 161 ARG B CZ  1 
ATOM   3647 N NH1 . ARG B 1 126 ? -5.940  22.483  -5.519  1.00 189.09 ? 161 ARG B NH1 1 
ATOM   3648 N NH2 . ARG B 1 126 ? -5.878  21.623  -3.393  1.00 189.09 ? 161 ARG B NH2 1 
ATOM   3649 N N   . TRP B 1 127 ? -12.227 20.081  -5.866  1.00 84.98  ? 162 TRP B N   1 
ATOM   3650 C CA  . TRP B 1 127 ? -13.003 19.070  -5.173  1.00 84.95  ? 162 TRP B CA  1 
ATOM   3651 C C   . TRP B 1 127 ? -13.076 17.768  -5.951  1.00 86.74  ? 162 TRP B C   1 
ATOM   3652 O O   . TRP B 1 127 ? -13.265 16.721  -5.346  1.00 85.96  ? 162 TRP B O   1 
ATOM   3653 C CB  . TRP B 1 127 ? -14.415 19.589  -4.906  1.00 86.27  ? 162 TRP B CB  1 
ATOM   3654 C CG  . TRP B 1 127 ? -14.538 20.388  -3.641  1.00 80.57  ? 162 TRP B CG  1 
ATOM   3655 C CD1 . TRP B 1 127 ? -13.720 21.397  -3.225  1.00 77.38  ? 162 TRP B CD1 1 
ATOM   3656 C CD2 . TRP B 1 127 ? -15.540 20.240  -2.628  1.00 76.50  ? 162 TRP B CD2 1 
ATOM   3657 N NE1 . TRP B 1 127 ? -14.148 21.887  -2.015  1.00 76.20  ? 162 TRP B NE1 1 
ATOM   3658 C CE2 . TRP B 1 127 ? -15.264 21.194  -1.625  1.00 75.89  ? 162 TRP B CE2 1 
ATOM   3659 C CE3 . TRP B 1 127 ? -16.647 19.392  -2.470  1.00 75.09  ? 162 TRP B CE3 1 
ATOM   3660 C CZ2 . TRP B 1 127 ? -16.053 21.326  -0.478  1.00 75.32  ? 162 TRP B CZ2 1 
ATOM   3661 C CZ3 . TRP B 1 127 ? -17.434 19.522  -1.329  1.00 74.00  ? 162 TRP B CZ3 1 
ATOM   3662 C CH2 . TRP B 1 127 ? -17.131 20.483  -0.348  1.00 74.31  ? 162 TRP B CH2 1 
ATOM   3663 N N   . GLU B 1 128 ? -12.902 17.830  -7.274  1.00 119.22 ? 163 GLU B N   1 
ATOM   3664 C CA  . GLU B 1 128 ? -12.897 16.639  -8.132  1.00 122.56 ? 163 GLU B CA  1 
ATOM   3665 C C   . GLU B 1 128 ? -11.560 15.930  -8.144  1.00 122.32 ? 163 GLU B C   1 
ATOM   3666 O O   . GLU B 1 128 ? -11.502 14.716  -8.003  1.00 122.16 ? 163 GLU B O   1 
ATOM   3667 C CB  . GLU B 1 128 ? -13.225 17.021  -9.557  1.00 131.07 ? 163 GLU B CB  1 
ATOM   3668 C CG  . GLU B 1 128 ? -13.214 15.835  -10.470 1.00 136.68 ? 163 GLU B CG  1 
ATOM   3669 C CD  . GLU B 1 128 ? -13.515 16.226  -11.877 1.00 139.25 ? 163 GLU B CD  1 
ATOM   3670 O OE1 . GLU B 1 128 ? -12.746 17.038  -12.431 1.00 140.62 ? 163 GLU B OE1 1 
ATOM   3671 O OE2 . GLU B 1 128 ? -14.520 15.730  -12.426 1.00 141.02 ? 163 GLU B OE2 1 
ATOM   3672 N N   . GLU B 1 129 ? -10.495 16.686  -8.362  1.00 135.03 ? 164 GLU B N   1 
ATOM   3673 C CA  . GLU B 1 129 ? -9.144  16.145  -8.308  1.00 136.56 ? 164 GLU B CA  1 
ATOM   3674 C C   . GLU B 1 129 ? -8.904  15.512  -6.935  1.00 136.35 ? 164 GLU B C   1 
ATOM   3675 O O   . GLU B 1 129 ? -8.626  14.319  -6.824  1.00 135.48 ? 164 GLU B O   1 
ATOM   3676 C CB  . GLU B 1 129 ? -8.113  17.252  -8.561  1.00 131.87 ? 164 GLU B CB  1 
ATOM   3677 C CG  . GLU B 1 129 ? -8.259  17.917  -9.924  1.00 135.97 ? 164 GLU B CG  1 
ATOM   3678 C CD  . GLU B 1 129 ? -7.338  19.113  -10.089 1.00 139.88 ? 164 GLU B CD  1 
ATOM   3679 O OE1 . GLU B 1 129 ? -7.313  19.694  -11.195 1.00 142.15 ? 164 GLU B OE1 1 
ATOM   3680 O OE2 . GLU B 1 129 ? -6.642  19.476  -9.115  1.00 141.32 ? 164 GLU B OE2 1 
ATOM   3681 N N   . GLU B 1 130 ? -9.046  16.331  -5.895  1.00 121.49 ? 165 GLU B N   1 
ATOM   3682 C CA  . GLU B 1 130 ? -8.810  15.931  -4.509  1.00 124.30 ? 165 GLU B CA  1 
ATOM   3683 C C   . GLU B 1 130 ? -9.730  14.789  -4.105  1.00 122.63 ? 165 GLU B C   1 
ATOM   3684 O O   . GLU B 1 130 ? -9.480  14.110  -3.118  1.00 121.25 ? 165 GLU B O   1 
ATOM   3685 C CB  . GLU B 1 130 ? -9.065  17.126  -3.581  1.00 181.38 ? 165 GLU B CB  1 
ATOM   3686 C CG  . GLU B 1 130 ? -8.266  18.393  -3.891  1.00 190.87 ? 165 GLU B CG  1 
ATOM   3687 C CD  . GLU B 1 130 ? -7.004  18.515  -3.055  1.00 199.89 ? 165 GLU B CD  1 
ATOM   3688 O OE1 . GLU B 1 130 ? -7.106  18.425  -1.813  1.00 200.00 ? 165 GLU B OE1 1 
ATOM   3689 O OE2 . GLU B 1 130 ? -5.914  18.710  -3.635  1.00 200.00 ? 165 GLU B OE2 1 
ATOM   3690 N N   . GLY B 1 131 ? -10.811 14.602  -4.855  1.00 161.44 ? 166 GLY B N   1 
ATOM   3691 C CA  . GLY B 1 131 ? -11.717 13.487  -4.643  1.00 161.64 ? 166 GLY B CA  1 
ATOM   3692 C C   . GLY B 1 131 ? -12.380 13.585  -3.290  1.00 161.56 ? 166 GLY B C   1 
ATOM   3693 O O   . GLY B 1 131 ? -12.438 12.602  -2.549  1.00 161.57 ? 166 GLY B O   1 
ATOM   3694 N N   . LEU B 1 132 ? -12.878 14.780  -2.983  1.00 101.51 ? 167 LEU B N   1 
ATOM   3695 C CA  . LEU B 1 132 ? -13.308 15.110  -1.641  1.00 103.49 ? 167 LEU B CA  1 
ATOM   3696 C C   . LEU B 1 132 ? -14.792 14.853  -1.428  1.00 100.82 ? 167 LEU B C   1 
ATOM   3697 O O   . LEU B 1 132 ? -15.180 13.899  -0.748  1.00 99.31  ? 167 LEU B O   1 
ATOM   3698 C CB  . LEU B 1 132 ? -12.974 16.569  -1.326  1.00 138.06 ? 167 LEU B CB  1 
ATOM   3699 C CG  . LEU B 1 132 ? -11.485 16.919  -1.222  1.00 150.58 ? 167 LEU B CG  1 
ATOM   3700 C CD1 . LEU B 1 132 ? -11.313 18.403  -0.948  1.00 158.16 ? 167 LEU B CD1 1 
ATOM   3701 C CD2 . LEU B 1 132 ? -10.846 16.097  -0.111  1.00 158.54 ? 167 LEU B CD2 1 
ATOM   3702 N N   . GLY B 1 133 ? -15.629 15.701  -2.011  1.00 136.08 ? 168 GLY B N   1 
ATOM   3703 C CA  . GLY B 1 133 ? -17.053 15.658  -1.735  1.00 136.45 ? 168 GLY B CA  1 
ATOM   3704 C C   . GLY B 1 133 ? -17.809 14.629  -2.543  1.00 137.82 ? 168 GLY B C   1 
ATOM   3705 O O   . GLY B 1 133 ? -19.028 14.759  -2.718  1.00 137.45 ? 168 GLY B O   1 
ATOM   3706 N N   . GLY B 1 134 ? -17.104 13.609  -3.026  1.00 173.66 ? 169 GLY B N   1 
ATOM   3707 C CA  . GLY B 1 134 ? -17.705 12.651  -3.927  1.00 175.78 ? 169 GLY B CA  1 
ATOM   3708 C C   . GLY B 1 134 ? -18.102 13.415  -5.169  1.00 177.73 ? 169 GLY B C   1 
ATOM   3709 O O   . GLY B 1 134 ? -19.241 13.339  -5.642  1.00 178.02 ? 169 GLY B O   1 
ATOM   3710 N N   . VAL B 1 135 ? -17.169 14.217  -5.659  1.00 149.71 ? 170 VAL B N   1 
ATOM   3711 C CA  . VAL B 1 135 ? -17.355 14.884  -6.928  1.00 150.48 ? 170 VAL B CA  1 
ATOM   3712 C C   . VAL B 1 135 ? -16.950 13.987  -8.093  1.00 151.83 ? 170 VAL B C   1 
ATOM   3713 O O   . VAL B 1 135 ? -17.666 13.933  -9.089  1.00 152.69 ? 170 VAL B O   1 
ATOM   3714 C CB  . VAL B 1 135 ? -16.529 16.181  -6.966  1.00 159.81 ? 170 VAL B CB  1 
ATOM   3715 C CG1 . VAL B 1 135 ? -16.604 16.836  -8.327  1.00 158.80 ? 170 VAL B CG1 1 
ATOM   3716 C CG2 . VAL B 1 135 ? -17.036 17.142  -5.889  1.00 158.49 ? 170 VAL B CG2 1 
ATOM   3717 N N   . PRO B 1 136 ? -15.831 13.273  -7.979  1.00 114.84 ? 171 PRO B N   1 
ATOM   3718 C CA  . PRO B 1 136 ? -15.305 12.495  -9.110  1.00 115.25 ? 171 PRO B CA  1 
ATOM   3719 C C   . PRO B 1 136 ? -16.350 11.797  -10.013 1.00 116.07 ? 171 PRO B C   1 
ATOM   3720 O O   . PRO B 1 136 ? -16.573 12.249  -11.137 1.00 114.96 ? 171 PRO B O   1 
ATOM   3721 C CB  . PRO B 1 136 ? -14.385 11.496  -8.431  1.00 154.64 ? 171 PRO B CB  1 
ATOM   3722 C CG  . PRO B 1 136 ? -13.796 12.305  -7.322  1.00 154.92 ? 171 PRO B CG  1 
ATOM   3723 C CD  . PRO B 1 136 ? -15.020 13.032  -6.763  1.00 154.31 ? 171 PRO B CD  1 
ATOM   3724 N N   . GLU B 1 137 ? -16.976 10.728  -9.523  1.00 161.61 ? 172 GLU B N   1 
ATOM   3725 C CA  . GLU B 1 137 ? -17.890 9.893   -10.320 1.00 163.09 ? 172 GLU B CA  1 
ATOM   3726 C C   . GLU B 1 137 ? -18.947 10.610  -11.163 1.00 158.52 ? 172 GLU B C   1 
ATOM   3727 O O   . GLU B 1 137 ? -19.430 10.038  -12.139 1.00 159.32 ? 172 GLU B O   1 
ATOM   3728 C CB  . GLU B 1 137 ? -18.600 8.869   -9.423  1.00 195.37 ? 172 GLU B CB  1 
ATOM   3729 C CG  . GLU B 1 137 ? -19.248 9.449   -8.179  1.00 200.00 ? 172 GLU B CG  1 
ATOM   3730 C CD  . GLU B 1 137 ? -18.236 9.747   -7.091  1.00 200.00 ? 172 GLU B CD  1 
ATOM   3731 O OE1 . GLU B 1 137 ? -17.570 8.799   -6.624  1.00 200.00 ? 172 GLU B OE1 1 
ATOM   3732 O OE2 . GLU B 1 137 ? -18.104 10.925  -6.702  1.00 200.00 ? 172 GLU B OE2 1 
ATOM   3733 N N   . GLN B 1 138 ? -19.315 11.833  -10.794 1.00 89.79  ? 173 GLN B N   1 
ATOM   3734 C CA  . GLN B 1 138 ? -20.434 12.510  -11.442 1.00 86.44  ? 173 GLN B CA  1 
ATOM   3735 C C   . GLN B 1 138 ? -20.207 12.936  -12.878 1.00 87.52  ? 173 GLN B C   1 
ATOM   3736 O O   . GLN B 1 138 ? -21.181 13.153  -13.604 1.00 85.67  ? 173 GLN B O   1 
ATOM   3737 C CB  . GLN B 1 138 ? -20.892 13.709  -10.603 1.00 144.33 ? 173 GLN B CB  1 
ATOM   3738 C CG  . GLN B 1 138 ? -21.700 13.337  -9.353  1.00 138.73 ? 173 GLN B CG  1 
ATOM   3739 C CD  . GLN B 1 138 ? -22.167 14.547  -8.556  1.00 134.32 ? 173 GLN B CD  1 
ATOM   3740 O OE1 . GLN B 1 138 ? -22.851 15.427  -9.082  1.00 131.39 ? 173 GLN B OE1 1 
ATOM   3741 N NE2 . GLN B 1 138 ? -21.808 14.588  -7.275  1.00 131.84 ? 173 GLN B NE2 1 
ATOM   3742 N N   . LYS B 1 139 ? -18.944 13.082  -13.279 1.00 167.74 ? 174 LYS B N   1 
ATOM   3743 C CA  . LYS B 1 139 ? -18.595 13.422  -14.661 1.00 171.04 ? 174 LYS B CA  1 
ATOM   3744 C C   . LYS B 1 139 ? -19.194 14.763  -15.085 1.00 167.88 ? 174 LYS B C   1 
ATOM   3745 O O   . LYS B 1 139 ? -19.788 14.875  -16.163 1.00 168.44 ? 174 LYS B O   1 
ATOM   3746 C CB  . LYS B 1 139 ? -19.107 12.327  -15.606 1.00 174.87 ? 174 LYS B CB  1 
ATOM   3747 C CG  . LYS B 1 139 ? -18.035 11.465  -16.259 1.00 185.43 ? 174 LYS B CG  1 
ATOM   3748 C CD  . LYS B 1 139 ? -17.349 10.547  -15.267 1.00 195.74 ? 174 LYS B CD  1 
ATOM   3749 C CE  . LYS B 1 139 ? -16.416 9.593   -15.991 1.00 198.56 ? 174 LYS B CE  1 
ATOM   3750 N NZ  . LYS B 1 139 ? -17.146 8.835   -17.045 1.00 200.00 ? 174 LYS B NZ  1 
ATOM   3751 N N   . LEU B 1 140 ? -19.037 15.783  -14.249 1.00 134.44 ? 175 LEU B N   1 
ATOM   3752 C CA  . LEU B 1 140 ? -19.648 17.073  -14.546 1.00 132.05 ? 175 LEU B CA  1 
ATOM   3753 C C   . LEU B 1 140 ? -19.056 17.675  -15.807 1.00 129.45 ? 175 LEU B C   1 
ATOM   3754 O O   . LEU B 1 140 ? -17.895 17.430  -16.118 1.00 128.69 ? 175 LEU B O   1 
ATOM   3755 C CB  . LEU B 1 140 ? -19.387 18.039  -13.398 1.00 137.90 ? 175 LEU B CB  1 
ATOM   3756 C CG  . LEU B 1 140 ? -20.224 17.666  -12.192 1.00 132.91 ? 175 LEU B CG  1 
ATOM   3757 C CD1 . LEU B 1 140 ? -20.036 18.673  -11.072 1.00 131.30 ? 175 LEU B CD1 1 
ATOM   3758 C CD2 . LEU B 1 140 ? -21.666 17.611  -12.646 1.00 131.38 ? 175 LEU B CD2 1 
ATOM   3759 N N   . GLN B 1 141 ? -19.860 18.441  -16.537 1.00 100.51 ? 176 GLN B N   1 
ATOM   3760 C CA  . GLN B 1 141 ? -19.387 19.093  -17.747 1.00 98.78  ? 176 GLN B CA  1 
ATOM   3761 C C   . GLN B 1 141 ? -19.904 20.504  -17.849 1.00 99.11  ? 176 GLN B C   1 
ATOM   3762 O O   . GLN B 1 141 ? -20.881 20.861  -17.212 1.00 98.74  ? 176 GLN B O   1 
ATOM   3763 C CB  . GLN B 1 141 ? -19.866 18.297  -18.961 1.00 111.70 ? 176 GLN B CB  1 
ATOM   3764 C CG  . GLN B 1 141 ? -19.414 16.844  -18.986 1.00 97.53  ? 176 GLN B CG  1 
ATOM   3765 C CD  . GLN B 1 141 ? -19.327 16.260  -20.384 1.00 87.08  ? 176 GLN B CD  1 
ATOM   3766 O OE1 . GLN B 1 141 ? -20.283 16.316  -21.160 1.00 81.10  ? 176 GLN B OE1 1 
ATOM   3767 N NE2 . GLN B 1 141 ? -18.174 15.674  -20.706 1.00 82.14  ? 176 GLN B NE2 1 
ATOM   3768 N N   . CYS B 1 142 ? -19.228 21.347  -18.629 1.00 137.35 ? 177 CYS B N   1 
ATOM   3769 C CA  . CYS B 1 142 ? -19.616 22.777  -18.755 1.00 137.32 ? 177 CYS B CA  1 
ATOM   3770 C C   . CYS B 1 142 ? -20.839 23.169  -19.621 1.00 138.16 ? 177 CYS B C   1 
ATOM   3771 O O   . CYS B 1 142 ? -21.098 22.539  -20.619 1.00 138.89 ? 177 CYS B O   1 
ATOM   3772 C CB  . CYS B 1 142 ? -18.429 23.564  -19.290 1.00 111.67 ? 177 CYS B CB  1 
ATOM   3773 S SG  . CYS B 1 142 ? -16.867 23.256  -18.441 1.00 110.40 ? 177 CYS B SG  1 
ATOM   3774 N N   . HIS B 1 143 ? -21.589 24.201  -19.237 1.00 168.29 ? 178 HIS B N   1 
ATOM   3775 C CA  . HIS B 1 143 ? -22.715 24.616  -20.082 1.00 177.45 ? 178 HIS B CA  1 
ATOM   3776 C C   . HIS B 1 143 ? -22.218 25.402  -21.300 1.00 173.64 ? 178 HIS B C   1 
ATOM   3777 O O   . HIS B 1 143 ? -21.083 25.885  -21.282 1.00 174.38 ? 178 HIS B O   1 
ATOM   3778 C CB  . HIS B 1 143 ? -23.650 25.610  -19.383 1.00 186.02 ? 178 HIS B CB  1 
ATOM   3779 C CG  . HIS B 1 143 ? -24.598 26.350  -20.287 1.00 200.00 ? 178 HIS B CG  1 
ATOM   3780 N ND1 . HIS B 1 143 ? -25.544 25.718  -21.075 1.00 200.00 ? 178 HIS B ND1 1 
ATOM   3781 C CD2 . HIS B 1 143 ? -24.767 27.678  -20.508 1.00 200.00 ? 178 HIS B CD2 1 
ATOM   3782 C CE1 . HIS B 1 143 ? -26.244 26.620  -21.734 1.00 200.00 ? 178 HIS B CE1 1 
ATOM   3783 N NE2 . HIS B 1 143 ? -25.793 27.823  -21.408 1.00 200.00 ? 178 HIS B NE2 1 
ATOM   3784 N N   . GLY B 1 144 ? -23.107 25.672  -22.271 1.00 200.00 ? 179 GLY B N   1 
ATOM   3785 C CA  . GLY B 1 144 ? -22.674 26.378  -23.477 1.00 200.00 ? 179 GLY B CA  1 
ATOM   3786 C C   . GLY B 1 144 ? -21.801 25.299  -24.114 1.00 200.00 ? 179 GLY B C   1 
ATOM   3787 O O   . GLY B 1 144 ? -21.927 24.820  -25.276 1.00 200.00 ? 179 GLY B O   1 
ATOM   3788 N N   . GLN B 1 145 ? -20.887 24.915  -23.239 1.00 72.31  ? 180 GLN B N   1 
ATOM   3789 C CA  . GLN B 1 145 ? -19.952 23.860  -23.416 1.00 78.01  ? 180 GLN B CA  1 
ATOM   3790 C C   . GLN B 1 145 ? -18.587 24.126  -23.961 1.00 72.96  ? 180 GLN B C   1 
ATOM   3791 O O   . GLN B 1 145 ? -18.375 24.601  -25.074 1.00 72.88  ? 180 GLN B O   1 
ATOM   3792 C CB  . GLN B 1 145 ? -20.579 22.676  -24.152 1.00 139.17 ? 180 GLN B CB  1 
ATOM   3793 C CG  . GLN B 1 145 ? -20.881 21.544  -23.180 1.00 157.77 ? 180 GLN B CG  1 
ATOM   3794 C CD  . GLN B 1 145 ? -21.495 20.333  -23.831 1.00 175.30 ? 180 GLN B CD  1 
ATOM   3795 O OE1 . GLN B 1 145 ? -21.894 19.389  -23.151 1.00 183.97 ? 180 GLN B OE1 1 
ATOM   3796 N NE2 . GLN B 1 145 ? -21.574 20.347  -25.154 1.00 184.27 ? 180 GLN B NE2 1 
ATOM   3797 N N   . GLY B 1 146 ? -17.674 23.844  -23.050 1.00 135.58 ? 181 GLY B N   1 
ATOM   3798 C CA  . GLY B 1 146 ? -16.243 23.881  -23.232 1.00 134.34 ? 181 GLY B CA  1 
ATOM   3799 C C   . GLY B 1 146 ? -16.165 22.743  -22.231 1.00 135.57 ? 181 GLY B C   1 
ATOM   3800 O O   . GLY B 1 146 ? -15.386 22.761  -21.278 1.00 132.59 ? 181 GLY B O   1 
ATOM   3801 N N   . PRO B 1 147 ? -17.028 21.730  -22.453 1.00 160.59 ? 182 PRO B N   1 
ATOM   3802 C CA  . PRO B 1 147 ? -17.365 20.477  -21.792 1.00 162.54 ? 182 PRO B CA  1 
ATOM   3803 C C   . PRO B 1 147 ? -17.094 20.028  -20.358 1.00 162.73 ? 182 PRO B C   1 
ATOM   3804 O O   . PRO B 1 147 ? -18.052 19.637  -19.758 1.00 162.03 ? 182 PRO B O   1 
ATOM   3805 C CB  . PRO B 1 147 ? -16.858 19.454  -22.787 1.00 127.09 ? 182 PRO B CB  1 
ATOM   3806 C CG  . PRO B 1 147 ? -17.451 19.999  -24.014 1.00 128.57 ? 182 PRO B CG  1 
ATOM   3807 C CD  . PRO B 1 147 ? -17.202 21.513  -23.905 1.00 126.10 ? 182 PRO B CD  1 
ATOM   3808 N N   . LEU B 1 148 ? -15.926 20.081  -19.725 1.00 78.99  ? 183 LEU B N   1 
ATOM   3809 C CA  . LEU B 1 148 ? -15.983 19.512  -18.359 1.00 81.15  ? 183 LEU B CA  1 
ATOM   3810 C C   . LEU B 1 148 ? -14.854 19.610  -17.346 1.00 88.57  ? 183 LEU B C   1 
ATOM   3811 O O   . LEU B 1 148 ? -14.033 20.518  -17.346 1.00 87.16  ? 183 LEU B O   1 
ATOM   3812 C CB  . LEU B 1 148 ? -16.310 18.021  -18.481 1.00 139.20 ? 183 LEU B CB  1 
ATOM   3813 C CG  . LEU B 1 148 ? -15.059 17.173  -18.760 1.00 129.39 ? 183 LEU B CG  1 
ATOM   3814 C CD1 . LEU B 1 148 ? -15.448 15.721  -19.007 1.00 119.45 ? 183 LEU B CD1 1 
ATOM   3815 C CD2 . LEU B 1 148 ? -14.285 17.768  -19.935 1.00 119.43 ? 183 LEU B CD2 1 
ATOM   3816 N N   . ALA B 1 149 ? -14.864 18.598  -16.483 1.00 44.98  ? 184 ALA B N   1 
ATOM   3817 C CA  . ALA B 1 149 ? -13.891 18.378  -15.437 1.00 52.06  ? 184 ALA B CA  1 
ATOM   3818 C C   . ALA B 1 149 ? -12.526 18.160  -16.089 1.00 52.38  ? 184 ALA B C   1 
ATOM   3819 O O   . ALA B 1 149 ? -11.842 17.152  -15.886 1.00 53.80  ? 184 ALA B O   1 
ATOM   3820 C CB  . ALA B 1 149 ? -14.290 17.172  -14.646 1.00 151.33 ? 184 ALA B CB  1 
ATOM   3821 N N   . HIS B 1 150 ? -12.212 19.125  -16.936 1.00 86.09  ? 185 HIS B N   1 
ATOM   3822 C CA  . HIS B 1 150 ? -10.977 19.301  -17.682 1.00 88.75  ? 185 HIS B CA  1 
ATOM   3823 C C   . HIS B 1 150 ? -11.123 20.777  -17.434 1.00 85.40  ? 185 HIS B C   1 
ATOM   3824 O O   . HIS B 1 150 ? -11.981 21.154  -16.633 1.00 81.84  ? 185 HIS B O   1 
ATOM   3825 C CB  . HIS B 1 150 ? -11.161 19.021  -19.173 1.00 73.48  ? 185 HIS B CB  1 
ATOM   3826 C CG  . HIS B 1 150 ? -10.979 17.586  -19.553 1.00 89.99  ? 185 HIS B CG  1 
ATOM   3827 N ND1 . HIS B 1 150 ? -11.255 17.115  -20.819 1.00 105.46 ? 185 HIS B ND1 1 
ATOM   3828 C CD2 . HIS B 1 150 ? -10.538 16.520  -18.844 1.00 105.22 ? 185 HIS B CD2 1 
ATOM   3829 C CE1 . HIS B 1 150 ? -10.994 15.822  -20.872 1.00 111.68 ? 185 HIS B CE1 1 
ATOM   3830 N NE2 . HIS B 1 150 ? -10.557 15.436  -19.686 1.00 110.89 ? 185 HIS B NE2 1 
ATOM   3831 N N   . MET B 1 151 ? -10.330 21.615  -18.090 1.00 73.15  ? 186 MET B N   1 
ATOM   3832 C CA  . MET B 1 151 ? -10.488 23.057  -17.910 1.00 76.26  ? 186 MET B CA  1 
ATOM   3833 C C   . MET B 1 151 ? -9.215  23.846  -17.846 1.00 81.39  ? 186 MET B C   1 
ATOM   3834 O O   . MET B 1 151 ? -8.217  23.391  -17.293 1.00 79.61  ? 186 MET B O   1 
ATOM   3835 C CB  . MET B 1 151 ? -11.297 23.415  -16.661 1.00 136.51 ? 186 MET B CB  1 
ATOM   3836 C CG  . MET B 1 151 ? -12.028 24.740  -16.776 1.00 136.53 ? 186 MET B CG  1 
ATOM   3837 S SD  . MET B 1 151 ? -12.505 25.459  -15.204 1.00 134.62 ? 186 MET B SD  1 
ATOM   3838 C CE  . MET B 1 151 ? -12.581 27.189  -15.658 1.00 134.15 ? 186 MET B CE  1 
ATOM   3839 N N   . PRO B 1 152 ? -9.217  25.048  -18.445 1.00 164.24 ? 187 PRO B N   1 
ATOM   3840 C CA  . PRO B 1 152 ? -7.994  25.834  -18.366 1.00 167.09 ? 187 PRO B CA  1 
ATOM   3841 C C   . PRO B 1 152 ? -7.750  25.766  -16.861 1.00 165.43 ? 187 PRO B C   1 
ATOM   3842 O O   . PRO B 1 152 ? -8.733  25.868  -16.077 1.00 166.95 ? 187 PRO B O   1 
ATOM   3843 C CB  . PRO B 1 152 ? -8.448  27.215  -18.829 1.00 162.91 ? 187 PRO B CB  1 
ATOM   3844 C CG  . PRO B 1 152 ? -9.473  26.868  -19.868 1.00 164.54 ? 187 PRO B CG  1 
ATOM   3845 C CD  . PRO B 1 152 ? -10.261 25.763  -19.205 1.00 160.43 ? 187 PRO B CD  1 
ATOM   3846 N N   . ASN B 1 153 ? -6.506  25.512  -16.426 1.00 157.80 ? 188 ASN B N   1 
ATOM   3847 C CA  . ASN B 1 153 ? -6.195  25.385  -14.973 1.00 155.77 ? 188 ASN B CA  1 
ATOM   3848 C C   . ASN B 1 153 ? -5.392  26.598  -14.397 1.00 151.10 ? 188 ASN B C   1 
ATOM   3849 O O   . ASN B 1 153 ? -5.824  27.202  -13.414 1.00 150.23 ? 188 ASN B O   1 
ATOM   3850 C CB  . ASN B 1 153 ? -5.411  24.105  -14.718 1.00 165.64 ? 188 ASN B CB  1 
ATOM   3851 C CG  . ASN B 1 153 ? -5.787  23.461  -13.415 1.00 168.27 ? 188 ASN B CG  1 
ATOM   3852 O OD1 . ASN B 1 153 ? -6.741  22.665  -13.338 1.00 175.49 ? 188 ASN B OD1 1 
ATOM   3853 N ND2 . ASN B 1 153 ? -5.063  23.802  -12.355 1.00 166.04 ? 188 ASN B ND2 1 
ATOM   3854 N N   . ALA B 1 154 ? -4.292  26.949  -15.075 1.00 190.82 ? 189 ALA B N   1 
ATOM   3855 C CA  . ALA B 1 154 ? -3.420  28.021  -14.645 1.00 190.14 ? 189 ALA B CA  1 
ATOM   3856 C C   . ALA B 1 154 ? -4.062  29.369  -14.740 1.00 186.99 ? 189 ALA B C   1 
ATOM   3857 O O   . ALA B 1 154 ? -3.566  30.335  -14.172 1.00 187.11 ? 189 ALA B O   1 
ATOM   3858 C CB  . ALA B 1 154 ? -2.123  27.997  -15.457 1.00 184.83 ? 189 ALA B CB  1 
ATOM   3859 N N   . SER B 1 155 ? -5.199  29.446  -15.406 1.00 170.70 ? 190 SER B N   1 
ATOM   3860 C CA  . SER B 1 155 ? -5.801  30.780  -15.522 1.00 167.74 ? 190 SER B CA  1 
ATOM   3861 C C   . SER B 1 155 ? -6.764  31.110  -14.370 1.00 162.26 ? 190 SER B C   1 
ATOM   3862 O O   . SER B 1 155 ? -7.495  32.114  -14.432 1.00 162.61 ? 190 SER B O   1 
ATOM   3863 C CB  . SER B 1 155 ? -6.540  30.898  -16.858 1.00 200.00 ? 190 SER B CB  1 
ATOM   3864 O OG  . SER B 1 155 ? -7.083  32.195  -17.031 1.00 200.00 ? 190 SER B OG  1 
ATOM   3865 N N   . CYS B 1 156 ? -6.789  30.256  -13.344 1.00 112.78 ? 191 CYS B N   1 
ATOM   3866 C CA  . CYS B 1 156 ? -7.529  30.541  -12.120 1.00 108.28 ? 191 CYS B CA  1 
ATOM   3867 C C   . CYS B 1 156 ? -6.669  30.259  -10.898 1.00 108.66 ? 191 CYS B C   1 
ATOM   3868 O O   . CYS B 1 156 ? -6.117  29.165  -10.742 1.00 107.24 ? 191 CYS B O   1 
ATOM   3869 C CB  . CYS B 1 156 ? -8.843  29.750  -12.065 1.00 146.08 ? 191 CYS B CB  1 
ATOM   3870 S SG  . CYS B 1 156 ? -9.932  29.957  -13.520 1.00 141.68 ? 191 CYS B SG  1 
ATOM   3871 N N   . GLY B 1 157 ? -6.569  31.271  -10.037 1.00 180.11 ? 192 GLY B N   1 
ATOM   3872 C CA  . GLY B 1 157 ? -5.782  31.192  -8.819  1.00 180.75 ? 192 GLY B CA  1 
ATOM   3873 C C   . GLY B 1 157 ? -6.290  32.068  -7.680  1.00 180.75 ? 192 GLY B C   1 
ATOM   3874 O O   . GLY B 1 157 ? -7.103  32.992  -7.861  1.00 181.03 ? 192 GLY B O   1 
ATOM   3875 N N   . VAL B 1 158 ? -5.778  31.765  -6.490  1.00 178.71 ? 193 VAL B N   1 
ATOM   3876 C CA  . VAL B 1 158 ? -6.089  32.518  -5.275  1.00 178.67 ? 193 VAL B CA  1 
ATOM   3877 C C   . VAL B 1 158 ? -5.252  33.803  -5.315  1.00 177.59 ? 193 VAL B C   1 
ATOM   3878 O O   . VAL B 1 158 ? -4.307  33.879  -6.092  1.00 177.34 ? 193 VAL B O   1 
ATOM   3879 C CB  . VAL B 1 158 ? -5.706  31.723  -4.008  1.00 155.40 ? 193 VAL B CB  1 
ATOM   3880 C CG1 . VAL B 1 158 ? -6.832  31.782  -2.992  1.00 153.62 ? 193 VAL B CG1 1 
ATOM   3881 C CG2 . VAL B 1 158 ? -5.385  30.281  -4.371  1.00 158.04 ? 193 VAL B CG2 1 
ATOM   3882 N N   . PRO B 1 159 ? -5.596  34.825  -4.531  1.00 109.32 ? 194 PRO B N   1 
ATOM   3883 C CA  . PRO B 1 159 ? -4.773  36.041  -4.484  1.00 109.48 ? 194 PRO B CA  1 
ATOM   3884 C C   . PRO B 1 159 ? -3.426  35.866  -3.772  1.00 110.72 ? 194 PRO B C   1 
ATOM   3885 O O   . PRO B 1 159 ? -3.281  35.042  -2.866  1.00 110.15 ? 194 PRO B O   1 
ATOM   3886 C CB  . PRO B 1 159 ? -5.683  37.031  -3.766  1.00 126.87 ? 194 PRO B CB  1 
ATOM   3887 C CG  . PRO B 1 159 ? -6.405  36.153  -2.802  1.00 126.37 ? 194 PRO B CG  1 
ATOM   3888 C CD  . PRO B 1 159 ? -6.774  34.960  -3.658  1.00 126.81 ? 194 PRO B CD  1 
ATOM   3889 N N   . THR B 1 160 ? -2.454  36.657  -4.218  1.00 162.69 ? 195 THR B N   1 
ATOM   3890 C CA  . THR B 1 160 ? -1.089  36.649  -3.693  1.00 164.61 ? 195 THR B CA  1 
ATOM   3891 C C   . THR B 1 160 ? -0.990  37.559  -2.455  1.00 160.78 ? 195 THR B C   1 
ATOM   3892 O O   . THR B 1 160 ? -1.767  38.510  -2.322  1.00 161.28 ? 195 THR B O   1 
ATOM   3893 C CB  . THR B 1 160 ? -0.078  37.132  -4.751  1.00 176.79 ? 195 THR B CB  1 
ATOM   3894 O OG1 . THR B 1 160 ? -0.165  36.296  -5.913  1.00 179.22 ? 195 THR B OG1 1 
ATOM   3895 C CG2 . THR B 1 160 ? 1.338   37.068  -4.201  1.00 183.77 ? 195 THR B CG2 1 
ATOM   3896 N N   . LEU B 1 161 ? -0.036  37.289  -1.560  1.00 123.09 ? 196 LEU B N   1 
ATOM   3897 C CA  . LEU B 1 161 ? 0.060   38.069  -0.329  1.00 118.30 ? 196 LEU B CA  1 
ATOM   3898 C C   . LEU B 1 161 ? 1.454   38.213  0.284   1.00 117.79 ? 196 LEU B C   1 
ATOM   3899 O O   . LEU B 1 161 ? 2.125   37.223  0.591   1.00 117.64 ? 196 LEU B O   1 
ATOM   3900 C CB  . LEU B 1 161 ? -0.878  37.486  0.731   1.00 104.68 ? 196 LEU B CB  1 
ATOM   3901 C CG  . LEU B 1 161 ? -2.359  37.851  0.639   1.00 96.64  ? 196 LEU B CG  1 
ATOM   3902 C CD1 . LEU B 1 161 ? -3.148  37.047  1.659   1.00 91.91  ? 196 LEU B CD1 1 
ATOM   3903 C CD2 . LEU B 1 161 ? -2.528  39.337  0.885   1.00 91.64  ? 196 LEU B CD2 1 
ATOM   3904 N N   . LYS B 1 162 ? 1.856   39.475  0.467   1.00 139.88 ? 197 LYS B N   1 
ATOM   3905 C CA  . LYS B 1 162 ? 3.063   39.871  1.222   1.00 138.72 ? 197 LYS B CA  1 
ATOM   3906 C C   . LYS B 1 162 ? 2.665   40.967  2.231   1.00 138.20 ? 197 LYS B C   1 
ATOM   3907 O O   . LYS B 1 162 ? 1.839   41.838  1.928   1.00 138.33 ? 197 LYS B O   1 
ATOM   3908 C CB  . LYS B 1 162 ? 4.109   40.427  0.249   1.00 148.16 ? 197 LYS B CB  1 
ATOM   3909 C CG  . LYS B 1 162 ? 4.406   39.513  -0.939  1.00 147.03 ? 197 LYS B CG  1 
ATOM   3910 C CD  . LYS B 1 162 ? 5.305   40.179  -1.981  1.00 145.19 ? 197 LYS B CD  1 
ATOM   3911 C CE  . LYS B 1 162 ? 4.634   41.391  -2.614  1.00 144.15 ? 197 LYS B CE  1 
ATOM   3912 N NZ  . LYS B 1 162 ? 5.485   42.052  -3.644  1.00 142.89 ? 197 LYS B NZ  1 
ATOM   3913 N N   . VAL B 1 163 ? 3.239   40.933  3.426   1.00 97.28  ? 198 VAL B N   1 
ATOM   3914 C CA  . VAL B 1 163 ? 2.950   41.960  4.424   1.00 96.79  ? 198 VAL B CA  1 
ATOM   3915 C C   . VAL B 1 163 ? 4.254   42.507  4.963   1.00 101.04 ? 198 VAL B C   1 
ATOM   3916 O O   . VAL B 1 163 ? 5.069   41.752  5.490   1.00 100.71 ? 198 VAL B O   1 
ATOM   3917 C CB  . VAL B 1 163 ? 2.129   41.380  5.589   1.00 105.81 ? 198 VAL B CB  1 
ATOM   3918 C CG1 . VAL B 1 163 ? 1.829   42.463  6.606   1.00 102.25 ? 198 VAL B CG1 1 
ATOM   3919 C CG2 . VAL B 1 163 ? 0.841   40.773  5.059   1.00 102.09 ? 198 VAL B CG2 1 
ATOM   3920 N N   . GLN B 1 164 ? 4.447   43.819  4.830   1.00 129.94 ? 199 GLN B N   1 
ATOM   3921 C CA  . GLN B 1 164 ? 5.742   44.440  5.107   1.00 135.68 ? 199 GLN B CA  1 
ATOM   3922 C C   . GLN B 1 164 ? 5.852   44.890  6.557   1.00 135.70 ? 199 GLN B C   1 
ATOM   3923 O O   . GLN B 1 164 ? 5.183   45.829  6.990   1.00 135.26 ? 199 GLN B O   1 
ATOM   3924 C CB  . GLN B 1 164 ? 5.952   45.641  4.180   1.00 200.00 ? 199 GLN B CB  1 
ATOM   3925 C CG  . GLN B 1 164 ? 5.956   45.294  2.698   1.00 200.00 ? 199 GLN B CG  1 
ATOM   3926 C CD  . GLN B 1 164 ? 7.060   44.322  2.328   1.00 200.00 ? 199 GLN B CD  1 
ATOM   3927 O OE1 . GLN B 1 164 ? 8.240   44.592  2.550   1.00 200.00 ? 199 GLN B OE1 1 
ATOM   3928 N NE2 . GLN B 1 164 ? 6.681   43.183  1.758   1.00 200.00 ? 199 GLN B NE2 1 
ATOM   3929 N N   . VAL B 1 165 ? 6.708   44.198  7.297   1.00 115.48 ? 200 VAL B N   1 
ATOM   3930 C CA  . VAL B 1 165 ? 7.045   44.600  8.647   1.00 116.82 ? 200 VAL B CA  1 
ATOM   3931 C C   . VAL B 1 165 ? 7.974   45.807  8.561   1.00 115.19 ? 200 VAL B C   1 
ATOM   3932 O O   . VAL B 1 165 ? 8.597   46.038  7.522   1.00 115.06 ? 200 VAL B O   1 
ATOM   3933 C CB  . VAL B 1 165 ? 7.765   43.468  9.400   1.00 178.97 ? 200 VAL B CB  1 
ATOM   3934 C CG1 . VAL B 1 165 ? 6.871   42.242  9.472   1.00 179.81 ? 200 VAL B CG1 1 
ATOM   3935 C CG2 . VAL B 1 165 ? 9.078   43.135  8.707   1.00 179.86 ? 200 VAL B CG2 1 
ATOM   3936 N N   . PRO B 1 166 ? 8.082   46.578  9.639   1.00 77.57  ? 201 PRO B N   1 
ATOM   3937 C CA  . PRO B 1 166 ? 9.040   47.673  9.658   1.00 74.96  ? 201 PRO B CA  1 
ATOM   3938 C C   . PRO B 1 166 ? 10.382  47.070  9.429   1.00 70.77  ? 201 PRO B C   1 
ATOM   3939 O O   . PRO B 1 166 ? 10.686  46.028  9.995   1.00 68.11  ? 201 PRO B O   1 
ATOM   3940 C CB  . PRO B 1 166 ? 8.888   48.246  11.063  1.00 188.23 ? 201 PRO B CB  1 
ATOM   3941 C CG  . PRO B 1 166 ? 8.483   47.048  11.868  1.00 191.77 ? 201 PRO B CG  1 
ATOM   3942 C CD  . PRO B 1 166 ? 7.452   46.420  10.961  1.00 191.07 ? 201 PRO B CD  1 
ATOM   3943 N N   . ASN B 1 167 ? 11.167  47.711  8.588   1.00 127.32 ? 202 ASN B N   1 
ATOM   3944 C CA  . ASN B 1 167 ? 12.448  47.165  8.195   1.00 126.49 ? 202 ASN B CA  1 
ATOM   3945 C C   . ASN B 1 167 ? 13.396  47.190  9.388   1.00 119.91 ? 202 ASN B C   1 
ATOM   3946 O O   . ASN B 1 167 ? 14.040  46.187  9.698   1.00 119.97 ? 202 ASN B O   1 
ATOM   3947 C CB  . ASN B 1 167 ? 13.054  48.002  7.062   1.00 199.92 ? 202 ASN B CB  1 
ATOM   3948 C CG  . ASN B 1 167 ? 12.083  48.241  5.923   1.00 200.00 ? 202 ASN B CG  1 
ATOM   3949 O OD1 . ASN B 1 167 ? 11.642  47.302  5.261   1.00 200.00 ? 202 ASN B OD1 1 
ATOM   3950 N ND2 . ASN B 1 167 ? 11.747  49.507  5.685   1.00 200.00 ? 202 ASN B ND2 1 
ATOM   3951 N N   . ALA B 1 168 ? 13.431  48.326  10.081  1.00 143.26 ? 203 ALA B N   1 
ATOM   3952 C CA  . ALA B 1 168 ? 14.230  48.483  11.299  1.00 136.86 ? 203 ALA B CA  1 
ATOM   3953 C C   . ALA B 1 168 ? 13.691  47.640  12.445  1.00 124.96 ? 203 ALA B C   1 
ATOM   3954 O O   . ALA B 1 168 ? 12.478  47.391  12.527  1.00 125.15 ? 203 ALA B O   1 
ATOM   3955 C CB  . ALA B 1 168 ? 14.266  49.950  11.705  1.00 154.57 ? 203 ALA B CB  1 
ATOM   3956 N N   . SER B 1 169 ? 14.585  47.231  13.345  1.00 73.98  ? 204 SER B N   1 
ATOM   3957 C CA  . SER B 1 169 ? 14.162  46.525  14.560  1.00 63.14  ? 204 SER B CA  1 
ATOM   3958 C C   . SER B 1 169 ? 13.108  47.355  15.275  1.00 56.51  ? 204 SER B C   1 
ATOM   3959 O O   . SER B 1 169 ? 12.717  48.433  14.797  1.00 54.28  ? 204 SER B O   1 
ATOM   3960 C CB  . SER B 1 169 ? 15.344  46.301  15.499  1.00 51.35  ? 204 SER B CB  1 
ATOM   3961 O OG  . SER B 1 169 ? 15.650  47.488  16.203  1.00 46.08  ? 204 SER B OG  1 
ATOM   3962 N N   . VAL B 1 170 ? 12.639  46.840  16.411  1.00 54.84  ? 205 VAL B N   1 
ATOM   3963 C CA  . VAL B 1 170 ? 11.690  47.563  17.263  1.00 49.84  ? 205 VAL B CA  1 
ATOM   3964 C C   . VAL B 1 170 ? 12.099  47.492  18.731  1.00 50.24  ? 205 VAL B C   1 
ATOM   3965 O O   . VAL B 1 170 ? 12.786  46.545  19.151  1.00 49.36  ? 205 VAL B O   1 
ATOM   3966 C CB  . VAL B 1 170 ? 10.285  46.986  17.110  1.00 31.29  ? 205 VAL B CB  1 
ATOM   3967 C CG1 . VAL B 1 170 ? 9.321   47.711  18.023  1.00 28.00  ? 205 VAL B CG1 1 
ATOM   3968 C CG2 . VAL B 1 170 ? 9.836   47.121  15.668  1.00 27.71  ? 205 VAL B CG2 1 
ATOM   3969 N N   . ASP B 1 171 ? 11.689  48.524  19.479  1.00 61.07  ? 206 ASP B N   1 
ATOM   3970 C CA  . ASP B 1 171 ? 11.728  48.530  20.941  1.00 63.06  ? 206 ASP B CA  1 
ATOM   3971 C C   . ASP B 1 171 ? 10.404  48.913  21.531  1.00 62.91  ? 206 ASP B C   1 
ATOM   3972 O O   . ASP B 1 171 ? 9.595   49.595  20.923  1.00 60.82  ? 206 ASP B O   1 
ATOM   3973 C CB  . ASP B 1 171 ? 12.791  49.517  21.432  1.00 86.14  ? 206 ASP B CB  1 
ATOM   3974 C CG  . ASP B 1 171 ? 14.139  49.297  20.783  1.00 90.38  ? 206 ASP B CG  1 
ATOM   3975 O OD1 . ASP B 1 171 ? 14.724  48.214  20.980  1.00 95.95  ? 206 ASP B OD1 1 
ATOM   3976 O OD2 . ASP B 1 171 ? 14.613  50.208  20.072  1.00 96.65  ? 206 ASP B OD2 1 
ATOM   3977 N N   . VAL B 1 172 ? 10.244  48.483  22.770  1.00 56.98  ? 207 VAL B N   1 
ATOM   3978 C CA  . VAL B 1 172 ? 9.027   48.673  23.535  1.00 59.94  ? 207 VAL B CA  1 
ATOM   3979 C C   . VAL B 1 172 ? 8.594   50.119  23.506  1.00 57.94  ? 207 VAL B C   1 
ATOM   3980 O O   . VAL B 1 172 ? 9.424   51.044  23.404  1.00 56.31  ? 207 VAL B O   1 
ATOM   3981 C CB  . VAL B 1 172 ? 9.214   48.232  24.998  1.00 111.00 ? 207 VAL B CB  1 
ATOM   3982 C CG1 . VAL B 1 172 ? 10.271  49.090  25.671  1.00 116.28 ? 207 VAL B CG1 1 
ATOM   3983 C CG2 . VAL B 1 172 ? 7.893   48.322  25.738  1.00 115.79 ? 207 VAL B CG2 1 
ATOM   3984 N N   . GLY B 1 173 ? 7.277   50.287  23.572  1.00 68.33  ? 208 GLY B N   1 
ATOM   3985 C CA  . GLY B 1 173 ? 6.645   51.587  23.410  1.00 69.10  ? 208 GLY B CA  1 
ATOM   3986 C C   . GLY B 1 173 ? 6.948   52.345  22.115  1.00 70.82  ? 208 GLY B C   1 
ATOM   3987 O O   . GLY B 1 173 ? 7.264   53.531  22.157  1.00 69.43  ? 208 GLY B O   1 
ATOM   3988 N N   . ASP B 1 174 ? 6.843   51.657  20.977  1.00 43.62  ? 209 ASP B N   1 
ATOM   3989 C CA  . ASP B 1 174 ? 6.958   52.276  19.672  1.00 43.62  ? 209 ASP B CA  1 
ATOM   3990 C C   . ASP B 1 174 ? 5.653   52.164  18.934  1.00 43.62  ? 209 ASP B C   1 
ATOM   3991 O O   . ASP B 1 174 ? 4.667   51.643  19.441  1.00 43.62  ? 209 ASP B O   1 
ATOM   3992 C CB  . ASP B 1 174 ? 8.074   51.613  18.868  1.00 64.85  ? 209 ASP B CB  1 
ATOM   3993 C CG  . ASP B 1 174 ? 9.446   52.064  19.305  1.00 59.99  ? 209 ASP B CG  1 
ATOM   3994 O OD1 . ASP B 1 174 ? 10.446  51.529  18.789  1.00 54.22  ? 209 ASP B OD1 1 
ATOM   3995 O OD2 . ASP B 1 174 ? 9.524   52.963  20.161  1.00 55.61  ? 209 ASP B OD2 1 
ATOM   3996 N N   . ASP B 1 175 ? 5.641   52.703  17.734  1.00 111.10 ? 210 ASP B N   1 
ATOM   3997 C CA  . ASP B 1 175 ? 4.501   52.551  16.873  1.00 121.26 ? 210 ASP B CA  1 
ATOM   3998 C C   . ASP B 1 175 ? 4.924   51.598  15.760  1.00 123.16 ? 210 ASP B C   1 
ATOM   3999 O O   . ASP B 1 175 ? 5.904   51.851  15.057  1.00 124.11 ? 210 ASP B O   1 
ATOM   4000 C CB  . ASP B 1 175 ? 4.080   53.903  16.289  1.00 118.04 ? 210 ASP B CB  1 
ATOM   4001 C CG  . ASP B 1 175 ? 3.725   54.917  17.361  1.00 126.47 ? 210 ASP B CG  1 
ATOM   4002 O OD1 . ASP B 1 175 ? 2.888   54.600  18.230  1.00 137.50 ? 210 ASP B OD1 1 
ATOM   4003 O OD2 . ASP B 1 175 ? 4.280   56.035  17.333  1.00 137.23 ? 210 ASP B OD2 1 
ATOM   4004 N N   . VAL B 1 176 ? 4.224   50.475  15.640  1.00 42.46  ? 211 VAL B N   1 
ATOM   4005 C CA  . VAL B 1 176 ? 4.502   49.522  14.592  1.00 46.11  ? 211 VAL B CA  1 
ATOM   4006 C C   . VAL B 1 176 ? 3.356   49.560  13.623  1.00 48.86  ? 211 VAL B C   1 
ATOM   4007 O O   . VAL B 1 176 ? 2.254   49.138  13.951  1.00 47.21  ? 211 VAL B O   1 
ATOM   4008 C CB  . VAL B 1 176 ? 4.627   48.099  15.169  1.00 122.15 ? 211 VAL B CB  1 
ATOM   4009 C CG1 . VAL B 1 176 ? 4.905   47.102  14.059  1.00 125.11 ? 211 VAL B CG1 1 
ATOM   4010 C CG2 . VAL B 1 176 ? 5.731   48.059  16.214  1.00 125.08 ? 211 VAL B CG2 1 
ATOM   4011 N N   . LEU B 1 177 ? 3.649   50.068  12.428  1.00 133.81 ? 212 LEU B N   1 
ATOM   4012 C CA  . LEU B 1 177 ? 2.677   50.267  11.355  1.00 138.78 ? 212 LEU B CA  1 
ATOM   4013 C C   . LEU B 1 177 ? 3.046   49.362  10.206  1.00 133.39 ? 212 LEU B C   1 
ATOM   4014 O O   . LEU B 1 177 ? 4.231   49.149  9.947   1.00 133.32 ? 212 LEU B O   1 
ATOM   4015 C CB  . LEU B 1 177 ? 2.674   51.724  10.885  1.00 177.97 ? 212 LEU B CB  1 
ATOM   4016 C CG  . LEU B 1 177 ? 3.944   52.272  10.227  1.00 198.26 ? 212 LEU B CG  1 
ATOM   4017 C CD1 . LEU B 1 177 ? 3.643   53.632  9.617   1.00 200.00 ? 212 LEU B CD1 1 
ATOM   4018 C CD2 . LEU B 1 177 ? 5.066   52.375  11.249  1.00 200.00 ? 212 LEU B CD2 1 
ATOM   4019 N N   . LEU B 1 178 ? 2.042   48.847  9.505   1.00 63.63  ? 213 LEU B N   1 
ATOM   4020 C CA  . LEU B 1 178 ? 2.288   47.892  8.430   1.00 61.25  ? 213 LEU B CA  1 
ATOM   4021 C C   . LEU B 1 178 ? 1.101   47.717  7.478   1.00 59.60  ? 213 LEU B C   1 
ATOM   4022 O O   . LEU B 1 178 ? -0.049  47.920  7.859   1.00 57.91  ? 213 LEU B O   1 
ATOM   4023 C CB  . LEU B 1 178 ? 2.719   46.530  8.995   1.00 68.56  ? 213 LEU B CB  1 
ATOM   4024 C CG  . LEU B 1 178 ? 1.773   45.709  9.871   1.00 70.23  ? 213 LEU B CG  1 
ATOM   4025 C CD1 . LEU B 1 178 ? 2.379   44.332  10.093  1.00 70.83  ? 213 LEU B CD1 1 
ATOM   4026 C CD2 . LEU B 1 178 ? 1.537   46.408  11.195  1.00 72.05  ? 213 LEU B CD2 1 
ATOM   4027 N N   . ARG B 1 179 ? 1.414   47.333  6.236   1.00 124.14 ? 214 ARG B N   1 
ATOM   4028 C CA  . ARG B 1 179 ? 0.425   47.129  5.178   1.00 125.39 ? 214 ARG B CA  1 
ATOM   4029 C C   . ARG B 1 179 ? 0.426   45.694  4.623   1.00 126.40 ? 214 ARG B C   1 
ATOM   4030 O O   . ARG B 1 179 ? 1.455   44.997  4.633   1.00 125.50 ? 214 ARG B O   1 
ATOM   4031 C CB  . ARG B 1 179 ? 0.642   48.127  4.038   1.00 139.49 ? 214 ARG B CB  1 
ATOM   4032 C CG  . ARG B 1 179 ? 0.155   49.533  4.358   1.00 141.51 ? 214 ARG B CG  1 
ATOM   4033 C CD  . ARG B 1 179 ? 0.191   50.439  3.138   1.00 143.81 ? 214 ARG B CD  1 
ATOM   4034 N NE  . ARG B 1 179 ? -0.400  51.746  3.415   1.00 145.92 ? 214 ARG B NE  1 
ATOM   4035 C CZ  . ARG B 1 179 ? -1.663  51.934  3.784   1.00 148.14 ? 214 ARG B CZ  1 
ATOM   4036 N NH1 . ARG B 1 179 ? -2.480  50.899  3.923   1.00 148.59 ? 214 ARG B NH1 1 
ATOM   4037 N NH2 . ARG B 1 179 ? -2.113  53.159  4.015   1.00 149.51 ? 214 ARG B NH2 1 
ATOM   4038 N N   . CYS B 1 180 ? -0.748  45.292  4.123   1.00 101.13 ? 215 CYS B N   1 
ATOM   4039 C CA  . CYS B 1 180 ? -1.015  43.949  3.621   1.00 103.13 ? 215 CYS B CA  1 
ATOM   4040 C C   . CYS B 1 180 ? -1.451  44.089  2.169   1.00 107.65 ? 215 CYS B C   1 
ATOM   4041 O O   . CYS B 1 180 ? -2.563  44.529  1.898   1.00 107.21 ? 215 CYS B O   1 
ATOM   4042 C CB  . CYS B 1 180 ? -2.134  43.304  4.454   1.00 112.39 ? 215 CYS B CB  1 
ATOM   4043 S SG  . CYS B 1 180 ? -2.901  41.773  3.815   1.00 109.39 ? 215 CYS B SG  1 
ATOM   4044 N N   . GLN B 1 181 ? -0.554  43.747  1.244   1.00 92.95  ? 216 GLN B N   1 
ATOM   4045 C CA  . GLN B 1 181 ? -0.816  43.873  -0.193  1.00 99.08  ? 216 GLN B CA  1 
ATOM   4046 C C   . GLN B 1 181 ? -1.346  42.593  -0.818  1.00 100.87 ? 216 GLN B C   1 
ATOM   4047 O O   . GLN B 1 181 ? -0.636  41.581  -0.916  1.00 99.88  ? 216 GLN B O   1 
ATOM   4048 C CB  . GLN B 1 181 ? 0.450   44.343  -0.911  1.00 180.11 ? 216 GLN B CB  1 
ATOM   4049 C CG  . GLN B 1 181 ? 0.902   45.742  -0.494  1.00 188.61 ? 216 GLN B CG  1 
ATOM   4050 C CD  . GLN B 1 181 ? 2.222   46.150  -1.120  1.00 196.77 ? 216 GLN B CD  1 
ATOM   4051 O OE1 . GLN B 1 181 ? 3.257   45.531  -0.872  1.00 200.00 ? 216 GLN B OE1 1 
ATOM   4052 N NE2 . GLN B 1 181 ? 2.192   47.201  -1.933  1.00 200.00 ? 216 GLN B NE2 1 
ATOM   4053 N N   . VAL B 1 182 ? -2.595  42.675  -1.271  1.00 158.80 ? 217 VAL B N   1 
ATOM   4054 C CA  . VAL B 1 182 ? -3.275  41.571  -1.929  1.00 162.19 ? 217 VAL B CA  1 
ATOM   4055 C C   . VAL B 1 182 ? -3.272  41.815  -3.425  1.00 160.01 ? 217 VAL B C   1 
ATOM   4056 O O   . VAL B 1 182 ? -3.884  42.773  -3.904  1.00 160.07 ? 217 VAL B O   1 
ATOM   4057 C CB  . VAL B 1 182 ? -4.747  41.464  -1.469  1.00 199.49 ? 217 VAL B CB  1 
ATOM   4058 C CG1 . VAL B 1 182 ? -5.382  40.208  -2.045  1.00 200.00 ? 217 VAL B CG1 1 
ATOM   4059 C CG2 . VAL B 1 182 ? -4.826  41.466  0.047   1.00 200.00 ? 217 VAL B CG2 1 
ATOM   4060 N N   . GLU B 1 183 ? -2.596  40.931  -4.156  1.00 92.97  ? 218 GLU B N   1 
ATOM   4061 C CA  . GLU B 1 183 ? -2.435  41.076  -5.595  1.00 90.93  ? 218 GLU B CA  1 
ATOM   4062 C C   . GLU B 1 183 ? -3.031  39.915  -6.402  1.00 92.39  ? 218 GLU B C   1 
ATOM   4063 O O   . GLU B 1 183 ? -2.449  38.830  -6.502  1.00 91.95  ? 218 GLU B O   1 
ATOM   4064 C CB  . GLU B 1 183 ? -0.959  41.282  -5.957  1.00 141.97 ? 218 GLU B CB  1 
ATOM   4065 C CG  . GLU B 1 183 ? -0.386  42.628  -5.497  1.00 136.32 ? 218 GLU B CG  1 
ATOM   4066 C CD  . GLU B 1 183 ? 0.926   42.992  -6.176  1.00 131.11 ? 218 GLU B CD  1 
ATOM   4067 O OE1 . GLU B 1 183 ? 0.963   43.031  -7.422  1.00 128.50 ? 218 GLU B OE1 1 
ATOM   4068 O OE2 . GLU B 1 183 ? 1.918   43.257  -5.467  1.00 128.37 ? 218 GLU B OE2 1 
ATOM   4069 N N   . GLY B 1 184 ? -4.213  40.175  -6.962  1.00 171.62 ? 219 GLY B N   1 
ATOM   4070 C CA  . GLY B 1 184 ? -4.922  39.230  -7.810  1.00 171.74 ? 219 GLY B CA  1 
ATOM   4071 C C   . GLY B 1 184 ? -5.999  39.888  -8.666  1.00 170.38 ? 219 GLY B C   1 
ATOM   4072 O O   . GLY B 1 184 ? -5.957  41.105  -8.905  1.00 171.44 ? 219 GLY B O   1 
ATOM   4073 N N   . ARG B 1 185 ? -6.975  39.086  -9.110  1.00 113.46 ? 220 ARG B N   1 
ATOM   4074 C CA  . ARG B 1 185 ? -7.974  39.546  -10.081 1.00 112.04 ? 220 ARG B CA  1 
ATOM   4075 C C   . ARG B 1 185 ? -9.444  39.334  -9.705  1.00 110.11 ? 220 ARG B C   1 
ATOM   4076 O O   . ARG B 1 185 ? -10.312 40.058  -10.205 1.00 108.65 ? 220 ARG B O   1 
ATOM   4077 C CB  . ARG B 1 185 ? -7.677  38.948  -11.459 1.00 145.12 ? 220 ARG B CB  1 
ATOM   4078 C CG  . ARG B 1 185 ? -6.379  39.493  -12.036 1.00 148.72 ? 220 ARG B CG  1 
ATOM   4079 C CD  . ARG B 1 185 ? -6.196  39.163  -13.504 1.00 152.72 ? 220 ARG B CD  1 
ATOM   4080 N NE  . ARG B 1 185 ? -5.000  39.811  -14.032 1.00 155.09 ? 220 ARG B NE  1 
ATOM   4081 C CZ  . ARG B 1 185 ? -4.596  39.728  -15.294 1.00 157.35 ? 220 ARG B CZ  1 
ATOM   4082 N NH1 . ARG B 1 185 ? -5.294  39.020  -16.170 1.00 157.56 ? 220 ARG B NH1 1 
ATOM   4083 N NH2 . ARG B 1 185 ? -3.494  40.355  -15.681 1.00 158.61 ? 220 ARG B NH2 1 
ATOM   4084 N N   . GLY B 1 186 ? -9.717  38.365  -8.831  1.00 101.58 ? 221 GLY B N   1 
ATOM   4085 C CA  . GLY B 1 186 ? -11.066 38.096  -8.357  1.00 102.61 ? 221 GLY B CA  1 
ATOM   4086 C C   . GLY B 1 186 ? -11.630 39.208  -7.489  1.00 105.42 ? 221 GLY B C   1 
ATOM   4087 O O   . GLY B 1 186 ? -12.733 39.675  -7.761  1.00 104.51 ? 221 GLY B O   1 
ATOM   4088 N N   . LEU B 1 187 ? -10.897 39.599  -6.439  1.00 79.01  ? 222 LEU B N   1 
ATOM   4089 C CA  . LEU B 1 187 ? -11.140 40.837  -5.673  1.00 84.82  ? 222 LEU B CA  1 
ATOM   4090 C C   . LEU B 1 187 ? -12.513 40.988  -4.998  1.00 84.82  ? 222 LEU B C   1 
ATOM   4091 O O   . LEU B 1 187 ? -13.440 41.554  -5.577  1.00 84.17  ? 222 LEU B O   1 
ATOM   4092 C CB  . LEU B 1 187 ? -10.884 42.053  -6.571  1.00 183.02 ? 222 LEU B CB  1 
ATOM   4093 C CG  . LEU B 1 187 ? -9.482  42.196  -7.175  1.00 197.08 ? 222 LEU B CG  1 
ATOM   4094 C CD1 . LEU B 1 187 ? -9.444  43.408  -8.095  1.00 200.00 ? 222 LEU B CD1 1 
ATOM   4095 C CD2 . LEU B 1 187 ? -8.445  42.335  -6.069  1.00 200.00 ? 222 LEU B CD2 1 
ATOM   4096 N N   . GLU B 1 188 ? -12.632 40.532  -3.755  1.00 141.96 ? 223 GLU B N   1 
ATOM   4097 C CA  . GLU B 1 188 ? -13.899 40.646  -3.027  1.00 144.91 ? 223 GLU B CA  1 
ATOM   4098 C C   . GLU B 1 188 ? -13.722 41.314  -1.651  1.00 143.57 ? 223 GLU B C   1 
ATOM   4099 O O   . GLU B 1 188 ? -13.705 42.541  -1.563  1.00 143.06 ? 223 GLU B O   1 
ATOM   4100 C CB  . GLU B 1 188 ? -14.541 39.270  -2.864  1.00 183.49 ? 223 GLU B CB  1 
ATOM   4101 C CG  . GLU B 1 188 ? -15.165 38.745  -4.142  1.00 192.30 ? 223 GLU B CG  1 
ATOM   4102 C CD  . GLU B 1 188 ? -16.279 39.643  -4.648  1.00 200.00 ? 223 GLU B CD  1 
ATOM   4103 O OE1 . GLU B 1 188 ? -17.274 39.827  -3.915  1.00 200.00 ? 223 GLU B OE1 1 
ATOM   4104 O OE2 . GLU B 1 188 ? -16.159 40.167  -5.775  1.00 200.00 ? 223 GLU B OE2 1 
ATOM   4105 N N   . GLN B 1 189 ? -13.590 40.519  -0.587  1.00 142.45 ? 224 GLN B N   1 
ATOM   4106 C CA  . GLN B 1 189 ? -13.453 41.053  0.765   1.00 143.05 ? 224 GLN B CA  1 
ATOM   4107 C C   . GLN B 1 189 ? -12.031 40.924  1.302   1.00 141.89 ? 224 GLN B C   1 
ATOM   4108 O O   . GLN B 1 189 ? -11.219 40.137  0.818   1.00 141.06 ? 224 GLN B O   1 
ATOM   4109 C CB  . GLN B 1 189 ? -14.420 40.349  1.714   1.00 114.10 ? 224 GLN B CB  1 
ATOM   4110 C CG  . GLN B 1 189 ? -15.881 40.548  1.367   1.00 118.10 ? 224 GLN B CG  1 
ATOM   4111 C CD  . GLN B 1 189 ? -16.798 39.903  2.380   1.00 121.70 ? 224 GLN B CD  1 
ATOM   4112 O OE1 . GLN B 1 189 ? -16.794 40.268  3.555   1.00 123.60 ? 224 GLN B OE1 1 
ATOM   4113 N NE2 . GLN B 1 189 ? -17.587 38.935  1.932   1.00 123.68 ? 224 GLN B NE2 1 
ATOM   4114 N N   . ALA B 1 190 ? -11.756 41.719  2.325   1.00 185.08 ? 225 ALA B N   1 
ATOM   4115 C CA  . ALA B 1 190 ? -10.460 41.736  2.995   1.00 184.33 ? 225 ALA B CA  1 
ATOM   4116 C C   . ALA B 1 190 ? -10.608 42.331  4.411   1.00 179.75 ? 225 ALA B C   1 
ATOM   4117 O O   . ALA B 1 190 ? -11.608 42.987  4.732   1.00 180.46 ? 225 ALA B O   1 
ATOM   4118 C CB  . ALA B 1 190 ? -9.466  42.556  2.181   1.00 158.65 ? 225 ALA B CB  1 
ATOM   4119 N N   . GLY B 1 191 ? -9.616  42.097  5.262   1.00 133.11 ? 226 GLY B N   1 
ATOM   4120 C CA  . GLY B 1 191 ? -9.728  42.465  6.662   1.00 127.60 ? 226 GLY B CA  1 
ATOM   4121 C C   . GLY B 1 191 ? -8.799  41.642  7.524   1.00 121.94 ? 226 GLY B C   1 
ATOM   4122 O O   . GLY B 1 191 ? -8.709  40.431  7.365   1.00 121.60 ? 226 GLY B O   1 
ATOM   4123 N N   . TRP B 1 192 ? -8.127  42.306  8.457   1.00 59.10  ? 227 TRP B N   1 
ATOM   4124 C CA  . TRP B 1 192 ? -7.133  41.663  9.293   1.00 54.18  ? 227 TRP B CA  1 
ATOM   4125 C C   . TRP B 1 192 ? -7.780  40.774  10.321  1.00 60.48  ? 227 TRP B C   1 
ATOM   4126 O O   . TRP B 1 192 ? -8.969  40.895  10.578  1.00 59.08  ? 227 TRP B O   1 
ATOM   4127 C CB  . TRP B 1 192 ? -6.289  42.706  10.026  1.00 102.57 ? 227 TRP B CB  1 
ATOM   4128 C CG  . TRP B 1 192 ? -5.575  43.659  9.139   1.00 81.08  ? 227 TRP B CG  1 
ATOM   4129 C CD1 . TRP B 1 192 ? -6.106  44.732  8.491   1.00 65.44  ? 227 TRP B CD1 1 
ATOM   4130 C CD2 . TRP B 1 192 ? -4.187  43.632  8.803   1.00 61.09  ? 227 TRP B CD2 1 
ATOM   4131 N NE1 . TRP B 1 192 ? -5.133  45.381  7.774   1.00 59.48  ? 227 TRP B NE1 1 
ATOM   4132 C CE2 . TRP B 1 192 ? -3.943  44.725  7.948   1.00 56.56  ? 227 TRP B CE2 1 
ATOM   4133 C CE3 . TRP B 1 192 ? -3.122  42.788  9.143   1.00 53.76  ? 227 TRP B CE3 1 
ATOM   4134 C CZ2 . TRP B 1 192 ? -2.679  44.998  7.426   1.00 50.87  ? 227 TRP B CZ2 1 
ATOM   4135 C CZ3 . TRP B 1 192 ? -1.863  43.060  8.623   1.00 50.04  ? 227 TRP B CZ3 1 
ATOM   4136 C CH2 . TRP B 1 192 ? -1.654  44.158  7.773   1.00 48.50  ? 227 TRP B CH2 1 
ATOM   4137 N N   . ILE B 1 193 ? -6.983  39.900  10.924  1.00 138.70 ? 228 ILE B N   1 
ATOM   4138 C CA  . ILE B 1 193 ? -7.414  39.135  12.082  1.00 146.93 ? 228 ILE B CA  1 
ATOM   4139 C C   . ILE B 1 193 ? -6.412  39.324  13.220  1.00 148.65 ? 228 ILE B C   1 
ATOM   4140 O O   . ILE B 1 193 ? -5.249  38.951  13.111  1.00 148.37 ? 228 ILE B O   1 
ATOM   4141 C CB  . ILE B 1 193 ? -7.532  37.627  11.760  1.00 182.87 ? 228 ILE B CB  1 
ATOM   4142 C CG1 . ILE B 1 193 ? -8.658  37.396  10.749  1.00 192.05 ? 228 ILE B CG1 1 
ATOM   4143 C CG2 . ILE B 1 193 ? -7.802  36.840  13.038  1.00 186.30 ? 228 ILE B CG2 1 
ATOM   4144 C CD1 . ILE B 1 193 ? -8.914  35.933  10.431  1.00 200.00 ? 228 ILE B CD1 1 
ATOM   4145 N N   . LEU B 1 194 ? -6.892  39.904  14.312  1.00 110.68 ? 229 LEU B N   1 
ATOM   4146 C CA  . LEU B 1 194 ? -6.106  40.097  15.509  1.00 115.53 ? 229 LEU B CA  1 
ATOM   4147 C C   . LEU B 1 194 ? -6.384  38.940  16.469  1.00 115.27 ? 229 LEU B C   1 
ATOM   4148 O O   . LEU B 1 194 ? -7.522  38.729  16.892  1.00 113.85 ? 229 LEU B O   1 
ATOM   4149 C CB  . LEU B 1 194 ? -6.454  41.431  16.169  1.00 144.57 ? 229 LEU B CB  1 
ATOM   4150 C CG  . LEU B 1 194 ? -6.073  42.684  15.377  1.00 158.23 ? 229 LEU B CG  1 
ATOM   4151 C CD1 . LEU B 1 194 ? -6.876  42.756  14.088  1.00 166.71 ? 229 LEU B CD1 1 
ATOM   4152 C CD2 . LEU B 1 194 ? -6.330  43.913  16.228  1.00 166.76 ? 229 LEU B CD2 1 
ATOM   4153 N N   . THR B 1 195 ? -5.346  38.182  16.803  1.00 151.15 ? 230 THR B N   1 
ATOM   4154 C CA  . THR B 1 195 ? -5.458  37.121  17.807  1.00 154.51 ? 230 THR B CA  1 
ATOM   4155 C C   . THR B 1 195 ? -5.179  37.699  19.193  1.00 155.02 ? 230 THR B C   1 
ATOM   4156 O O   . THR B 1 195 ? -4.111  37.476  19.764  1.00 154.15 ? 230 THR B O   1 
ATOM   4157 C CB  . THR B 1 195 ? -4.448  35.999  17.529  1.00 188.62 ? 230 THR B CB  1 
ATOM   4158 O OG1 . THR B 1 195 ? -3.134  36.559  17.404  1.00 190.19 ? 230 THR B OG1 1 
ATOM   4159 C CG2 . THR B 1 195 ? -4.806  35.272  16.249  1.00 194.13 ? 230 THR B CG2 1 
ATOM   4160 N N   . GLU B 1 196 ? -6.147  38.449  19.717  1.00 74.00  ? 231 GLU B N   1 
ATOM   4161 C CA  . GLU B 1 196 ? -6.046  39.075  21.038  1.00 77.69  ? 231 GLU B CA  1 
ATOM   4162 C C   . GLU B 1 196 ? -4.787  39.907  21.228  1.00 79.06  ? 231 GLU B C   1 
ATOM   4163 O O   . GLU B 1 196 ? -3.763  39.419  21.685  1.00 77.43  ? 231 GLU B O   1 
ATOM   4164 C CB  . GLU B 1 196 ? -6.113  38.003  22.130  1.00 200.00 ? 231 GLU B CB  1 
ATOM   4165 C CG  . GLU B 1 196 ? -7.474  37.340  22.277  1.00 200.00 ? 231 GLU B CG  1 
ATOM   4166 C CD  . GLU B 1 196 ? -8.543  38.306  22.753  1.00 200.00 ? 231 GLU B CD  1 
ATOM   4167 O OE1 . GLU B 1 196 ? -8.374  38.889  23.844  1.00 200.00 ? 231 GLU B OE1 1 
ATOM   4168 O OE2 . GLU B 1 196 ? -9.552  38.481  22.038  1.00 200.00 ? 231 GLU B OE2 1 
ATOM   4169 N N   . LEU B 1 197 ? -4.883  41.175  20.877  1.00 186.49 ? 232 LEU B N   1 
ATOM   4170 C CA  . LEU B 1 197 ? -3.829  42.119  21.173  1.00 190.75 ? 232 LEU B CA  1 
ATOM   4171 C C   . LEU B 1 197 ? -4.334  43.055  22.276  1.00 191.68 ? 232 LEU B C   1 
ATOM   4172 O O   . LEU B 1 197 ? -4.450  44.272  22.093  1.00 191.83 ? 232 LEU B O   1 
ATOM   4173 C CB  . LEU B 1 197 ? -3.479  42.916  19.915  1.00 159.51 ? 232 LEU B CB  1 
ATOM   4174 C CG  . LEU B 1 197 ? -3.082  42.084  18.692  1.00 165.98 ? 232 LEU B CG  1 
ATOM   4175 C CD1 . LEU B 1 197 ? -2.847  43.004  17.508  1.00 170.04 ? 232 LEU B CD1 1 
ATOM   4176 C CD2 . LEU B 1 197 ? -1.831  41.273  18.998  1.00 170.07 ? 232 LEU B CD2 1 
ATOM   4177 N N   . GLU B 1 198 ? -4.643  42.459  23.428  1.00 182.35 ? 233 GLU B N   1 
ATOM   4178 C CA  . GLU B 1 198 ? -5.079  43.206  24.615  1.00 182.98 ? 233 GLU B CA  1 
ATOM   4179 C C   . GLU B 1 198 ? -3.984  44.116  25.173  1.00 179.28 ? 233 GLU B C   1 
ATOM   4180 O O   . GLU B 1 198 ? -4.275  45.039  25.932  1.00 179.59 ? 233 GLU B O   1 
ATOM   4181 C CB  . GLU B 1 198 ? -5.556  42.217  25.684  1.00 200.00 ? 233 GLU B CB  1 
ATOM   4182 C CG  . GLU B 1 198 ? -4.562  41.101  25.992  1.00 200.00 ? 233 GLU B CG  1 
ATOM   4183 C CD  . GLU B 1 198 ? -5.237  39.815  26.443  1.00 200.00 ? 233 GLU B CD  1 
ATOM   4184 O OE1 . GLU B 1 198 ? -5.992  39.845  27.435  1.00 200.00 ? 233 GLU B OE1 1 
ATOM   4185 O OE2 . GLU B 1 198 ? -5.007  38.767  25.803  1.00 200.00 ? 233 GLU B OE2 1 
ATOM   4186 N N   . GLN B 1 199 ? -2.734  43.843  24.792  1.00 175.36 ? 234 GLN B N   1 
ATOM   4187 C CA  . GLN B 1 199 ? -1.572  44.602  25.259  1.00 171.94 ? 234 GLN B CA  1 
ATOM   4188 C C   . GLN B 1 199 ? -0.880  45.355  24.115  1.00 164.07 ? 234 GLN B C   1 
ATOM   4189 O O   . GLN B 1 199 ? 0.212   44.984  23.659  1.00 163.37 ? 234 GLN B O   1 
ATOM   4190 C CB  . GLN B 1 199 ? -0.567  43.664  25.932  1.00 186.26 ? 234 GLN B CB  1 
ATOM   4191 C CG  . GLN B 1 199 ? -0.142  44.096  27.329  1.00 193.97 ? 234 GLN B CG  1 
ATOM   4192 C CD  . GLN B 1 199 ? -1.241  43.921  28.363  1.00 200.00 ? 234 GLN B CD  1 
ATOM   4193 O OE1 . GLN B 1 199 ? -1.046  44.204  29.547  1.00 200.00 ? 234 GLN B OE1 1 
ATOM   4194 N NE2 . GLN B 1 199 ? -2.401  43.450  27.922  1.00 200.00 ? 234 GLN B NE2 1 
ATOM   4195 N N   . SER B 1 200 ? -1.555  46.427  23.686  1.00 200.00 ? 235 SER B N   1 
ATOM   4196 C CA  . SER B 1 200 ? -1.153  47.308  22.569  1.00 200.00 ? 235 SER B CA  1 
ATOM   4197 C C   . SER B 1 200 ? -2.408  48.057  22.049  1.00 199.85 ? 235 SER B C   1 
ATOM   4198 O O   . SER B 1 200 ? -3.543  47.589  22.246  1.00 199.43 ? 235 SER B O   1 
ATOM   4199 C CB  . SER B 1 200 ? -0.555  46.470  21.437  1.00 113.34 ? 235 SER B CB  1 
ATOM   4200 O OG  . SER B 1 200 ? -0.227  47.271  20.320  1.00 109.93 ? 235 SER B OG  1 
ATOM   4201 N N   . ALA B 1 201 ? -2.213  49.212  21.408  1.00 86.25  ? 236 ALA B N   1 
ATOM   4202 C CA  . ALA B 1 201 ? -3.333  49.997  20.883  1.00 82.05  ? 236 ALA B CA  1 
ATOM   4203 C C   . ALA B 1 201 ? -3.323  49.965  19.351  1.00 85.09  ? 236 ALA B C   1 
ATOM   4204 O O   . ALA B 1 201 ? -2.534  50.653  18.720  1.00 84.01  ? 236 ALA B O   1 
ATOM   4205 C CB  . ALA B 1 201 ? -3.245  51.434  21.384  1.00 94.66  ? 236 ALA B CB  1 
ATOM   4206 N N   . THR B 1 202 ? -4.205  49.153  18.765  1.00 97.62  ? 237 THR B N   1 
ATOM   4207 C CA  . THR B 1 202 ? -4.203  48.889  17.320  1.00 101.81 ? 237 THR B CA  1 
ATOM   4208 C C   . THR B 1 202 ? -4.937  49.965  16.601  1.00 104.79 ? 237 THR B C   1 
ATOM   4209 O O   . THR B 1 202 ? -5.872  50.535  17.155  1.00 104.38 ? 237 THR B O   1 
ATOM   4210 C CB  . THR B 1 202 ? -4.895  47.552  17.001  1.00 156.63 ? 237 THR B CB  1 
ATOM   4211 O OG1 . THR B 1 202 ? -6.283  47.642  17.347  1.00 157.76 ? 237 THR B OG1 1 
ATOM   4212 C CG2 . THR B 1 202 ? -4.263  46.420  17.793  1.00 160.40 ? 237 THR B CG2 1 
ATOM   4213 N N   . VAL B 1 203 ? -4.564  50.195  15.346  1.00 77.77  ? 238 VAL B N   1 
ATOM   4214 C CA  . VAL B 1 203 ? -5.217  51.215  14.538  1.00 84.12  ? 238 VAL B CA  1 
ATOM   4215 C C   . VAL B 1 203 ? -5.318  50.796  13.073  1.00 86.15  ? 238 VAL B C   1 
ATOM   4216 O O   . VAL B 1 203 ? -4.368  50.957  12.295  1.00 84.28  ? 238 VAL B O   1 
ATOM   4217 C CB  . VAL B 1 203 ? -4.436  52.544  14.615  1.00 199.67 ? 238 VAL B CB  1 
ATOM   4218 C CG1 . VAL B 1 203 ? -5.062  53.580  13.699  1.00 200.00 ? 238 VAL B CG1 1 
ATOM   4219 C CG2 . VAL B 1 203 ? -4.408  53.050  16.050  1.00 200.00 ? 238 VAL B CG2 1 
ATOM   4220 N N   . MET B 1 204 ? -6.495  50.275  12.718  1.00 137.25 ? 239 MET B N   1 
ATOM   4221 C CA  . MET B 1 204 ? -6.782  49.787  11.373  1.00 142.12 ? 239 MET B CA  1 
ATOM   4222 C C   . MET B 1 204 ? -7.801  50.688  10.670  1.00 142.20 ? 239 MET B C   1 
ATOM   4223 O O   . MET B 1 204 ? -8.020  51.828  11.090  1.00 142.22 ? 239 MET B O   1 
ATOM   4224 C CB  . MET B 1 204 ? -7.323  48.354  11.428  1.00 152.97 ? 239 MET B CB  1 
ATOM   4225 C CG  . MET B 1 204 ? -8.694  48.227  12.075  1.00 160.73 ? 239 MET B CG  1 
ATOM   4226 S SD  . MET B 1 204 ? -9.331  46.537  12.053  1.00 171.42 ? 239 MET B SD  1 
ATOM   4227 C CE  . MET B 1 204 ? -10.197 46.518  10.484  1.00 177.10 ? 239 MET B CE  1 
ATOM   4228 N N   . LYS B 1 205 ? -8.390  50.163  9.590   1.00 169.70 ? 240 LYS B N   1 
ATOM   4229 C CA  . LYS B 1 205 ? -9.258  50.910  8.674   1.00 170.31 ? 240 LYS B CA  1 
ATOM   4230 C C   . LYS B 1 205 ? -8.469  51.894  7.796   1.00 165.53 ? 240 LYS B C   1 
ATOM   4231 O O   . LYS B 1 205 ? -9.061  52.652  7.020   1.00 165.47 ? 240 LYS B O   1 
ATOM   4232 C CB  . LYS B 1 205 ? -10.341 51.658  9.460   1.00 165.61 ? 240 LYS B CB  1 
ATOM   4233 C CG  . LYS B 1 205 ? -11.235 50.751  10.296  1.00 174.99 ? 240 LYS B CG  1 
ATOM   4234 C CD  . LYS B 1 205 ? -12.300 51.539  11.040  1.00 184.96 ? 240 LYS B CD  1 
ATOM   4235 C CE  . LYS B 1 205 ? -13.144 50.628  11.920  1.00 189.24 ? 240 LYS B CE  1 
ATOM   4236 N NZ  . LYS B 1 205 ? -12.309 49.878  12.901  1.00 191.49 ? 240 LYS B NZ  1 
ATOM   4237 N N   . SER B 1 206 ? -7.137  51.843  7.887   1.00 172.18 ? 241 SER B N   1 
ATOM   4238 C CA  . SER B 1 206 ? -6.254  52.752  7.153   1.00 169.05 ? 241 SER B CA  1 
ATOM   4239 C C   . SER B 1 206 ? -6.034  52.303  5.702   1.00 164.81 ? 241 SER B C   1 
ATOM   4240 O O   . SER B 1 206 ? -5.102  52.770  5.039   1.00 163.04 ? 241 SER B O   1 
ATOM   4241 C CB  . SER B 1 206 ? -4.899  52.861  7.854   1.00 173.52 ? 241 SER B CB  1 
ATOM   4242 O OG  . SER B 1 206 ? -4.034  53.732  7.145   1.00 176.12 ? 241 SER B OG  1 
ATOM   4243 N N   . GLY B 1 207 ? -6.896  51.402  5.217   1.00 114.06 ? 242 GLY B N   1 
ATOM   4244 C CA  . GLY B 1 207 ? -6.794  50.872  3.866   1.00 112.80 ? 242 GLY B CA  1 
ATOM   4245 C C   . GLY B 1 207 ? -8.114  50.558  3.173   1.00 113.18 ? 242 GLY B C   1 
ATOM   4246 O O   . GLY B 1 207 ? -9.176  50.491  3.797   1.00 111.54 ? 242 GLY B O   1 
ATOM   4247 N N   . GLY B 1 208 ? -8.023  50.388  1.855   1.00 185.59 ? 243 GLY B N   1 
ATOM   4248 C CA  . GLY B 1 208 ? -9.154  50.024  1.022   1.00 187.51 ? 243 GLY B CA  1 
ATOM   4249 C C   . GLY B 1 208 ? -8.999  48.589  0.565   1.00 189.20 ? 243 GLY B C   1 
ATOM   4250 O O   . GLY B 1 208 ? -9.146  47.675  1.367   1.00 189.54 ? 243 GLY B O   1 
ATOM   4251 N N   . LEU B 1 209 ? -8.720  48.384  -0.717  1.00 80.48  ? 244 LEU B N   1 
ATOM   4252 C CA  . LEU B 1 209 ? -8.510  47.040  -1.243  1.00 83.82  ? 244 LEU B CA  1 
ATOM   4253 C C   . LEU B 1 209 ? -7.105  46.719  -1.751  1.00 82.89  ? 244 LEU B C   1 
ATOM   4254 O O   . LEU B 1 209 ? -6.623  45.609  -1.509  1.00 81.96  ? 244 LEU B O   1 
ATOM   4255 C CB  . LEU B 1 209 ? -9.544  46.733  -2.330  1.00 168.59 ? 244 LEU B CB  1 
ATOM   4256 C CG  . LEU B 1 209 ? -10.984 46.447  -1.871  1.00 179.28 ? 244 LEU B CG  1 
ATOM   4257 C CD1 . LEU B 1 209 ? -10.990 45.264  -0.911  1.00 185.50 ? 244 LEU B CD1 1 
ATOM   4258 C CD2 . LEU B 1 209 ? -11.587 47.674  -1.204  1.00 185.91 ? 244 LEU B CD2 1 
ATOM   4259 N N   . PRO B 1 210 ? -6.440  47.638  -2.454  1.00 119.96 ? 245 PRO B N   1 
ATOM   4260 C CA  . PRO B 1 210 ? -5.097  47.332  -2.968  1.00 118.50 ? 245 PRO B CA  1 
ATOM   4261 C C   . PRO B 1 210 ? -4.098  47.147  -1.821  1.00 114.03 ? 245 PRO B C   1 
ATOM   4262 O O   . PRO B 1 210 ? -3.110  46.414  -1.974  1.00 113.55 ? 245 PRO B O   1 
ATOM   4263 C CB  . PRO B 1 210 ? -4.779  48.548  -3.833  1.00 200.00 ? 245 PRO B CB  1 
ATOM   4264 C CG  . PRO B 1 210 ? -5.482  49.648  -3.104  1.00 200.00 ? 245 PRO B CG  1 
ATOM   4265 C CD  . PRO B 1 210 ? -6.822  49.019  -2.794  1.00 200.00 ? 245 PRO B CD  1 
ATOM   4266 N N   . SER B 1 211 ? -4.373  47.825  -0.700  1.00 77.66  ? 246 SER B N   1 
ATOM   4267 C CA  . SER B 1 211 ? -3.604  47.699  0.534   1.00 74.78  ? 246 SER B CA  1 
ATOM   4268 C C   . SER B 1 211 ? -4.491  47.912  1.763   1.00 69.80  ? 246 SER B C   1 
ATOM   4269 O O   . SER B 1 211 ? -5.480  48.645  1.695   1.00 68.22  ? 246 SER B O   1 
ATOM   4270 C CB  . SER B 1 211 ? -2.454  48.710  0.542   1.00 161.67 ? 246 SER B CB  1 
ATOM   4271 O OG  . SER B 1 211 ? -1.603  48.525  -0.578  1.00 164.91 ? 246 SER B OG  1 
ATOM   4272 N N   . LEU B 1 212 ? -4.127  47.253  2.871   1.00 132.65 ? 247 LEU B N   1 
ATOM   4273 C CA  . LEU B 1 212 ? -4.818  47.373  4.168   1.00 130.73 ? 247 LEU B CA  1 
ATOM   4274 C C   . LEU B 1 212 ? -3.842  47.789  5.278   1.00 126.90 ? 247 LEU B C   1 
ATOM   4275 O O   . LEU B 1 212 ? -2.927  47.040  5.607   1.00 125.38 ? 247 LEU B O   1 
ATOM   4276 C CB  . LEU B 1 212 ? -5.480  46.039  4.542   1.00 142.72 ? 247 LEU B CB  1 
ATOM   4277 C CG  . LEU B 1 212 ? -6.613  45.485  3.668   1.00 144.31 ? 247 LEU B CG  1 
ATOM   4278 C CD1 . LEU B 1 212 ? -6.093  45.132  2.284   1.00 146.56 ? 247 LEU B CD1 1 
ATOM   4279 C CD2 . LEU B 1 212 ? -7.203  44.249  4.333   1.00 146.38 ? 247 LEU B CD2 1 
ATOM   4280 N N   . GLY B 1 213 ? -4.049  48.970  5.862   1.00 176.01 ? 248 GLY B N   1 
ATOM   4281 C CA  . GLY B 1 213 ? -3.090  49.554  6.794   1.00 174.32 ? 248 GLY B CA  1 
ATOM   4282 C C   . GLY B 1 213 ? -3.423  49.271  8.245   1.00 173.11 ? 248 GLY B C   1 
ATOM   4283 O O   . GLY B 1 213 ? -4.555  49.487  8.677   1.00 173.07 ? 248 GLY B O   1 
ATOM   4284 N N   . LEU B 1 214 ? -2.428  48.813  8.999   1.00 83.89  ? 249 LEU B N   1 
ATOM   4285 C CA  . LEU B 1 214 ? -2.618  48.366  10.376  1.00 84.02  ? 249 LEU B CA  1 
ATOM   4286 C C   . LEU B 1 214 ? -1.484  48.890  11.193  1.00 82.33  ? 249 LEU B C   1 
ATOM   4287 O O   . LEU B 1 214 ? -0.331  48.625  10.883  1.00 81.56  ? 249 LEU B O   1 
ATOM   4288 C CB  . LEU B 1 214 ? -2.651  46.835  10.444  1.00 113.88 ? 249 LEU B CB  1 
ATOM   4289 C CG  . LEU B 1 214 ? -2.913  46.147  11.792  1.00 117.79 ? 249 LEU B CG  1 
ATOM   4290 C CD1 . LEU B 1 214 ? -1.702  46.272  12.703  1.00 120.41 ? 249 LEU B CD1 1 
ATOM   4291 C CD2 . LEU B 1 214 ? -4.148  46.751  12.439  1.00 120.69 ? 249 LEU B CD2 1 
ATOM   4292 N N   . THR B 1 215 ? -1.793  49.612  12.253  1.00 104.96 ? 250 THR B N   1 
ATOM   4293 C CA  . THR B 1 215 ? -0.734  50.170  13.057  1.00 104.38 ? 250 THR B CA  1 
ATOM   4294 C C   . THR B 1 215 ? -1.003  49.931  14.527  1.00 104.48 ? 250 THR B C   1 
ATOM   4295 O O   . THR B 1 215 ? -2.120  50.131  15.016  1.00 104.07 ? 250 THR B O   1 
ATOM   4296 C CB  . THR B 1 215 ? -0.573  51.680  12.805  1.00 113.77 ? 250 THR B CB  1 
ATOM   4297 O OG1 . THR B 1 215 ? -0.208  51.898  11.437  1.00 113.16 ? 250 THR B OG1 1 
ATOM   4298 C CG2 . THR B 1 215 ? 0.507   52.255  13.701  1.00 113.79 ? 250 THR B CG2 1 
ATOM   4299 N N   . LEU B 1 216 ? 0.055   49.490  15.204  1.00 71.92  ? 251 LEU B N   1 
ATOM   4300 C CA  . LEU B 1 216 ? 0.079   49.245  16.631  1.00 72.15  ? 251 LEU B CA  1 
ATOM   4301 C C   . LEU B 1 216 ? 0.916   50.339  17.263  1.00 68.78  ? 251 LEU B C   1 
ATOM   4302 O O   . LEU B 1 216 ? 2.065   50.541  16.884  1.00 68.57  ? 251 LEU B O   1 
ATOM   4303 C CB  . LEU B 1 216 ? 0.734   47.893  16.919  1.00 120.84 ? 251 LEU B CB  1 
ATOM   4304 C CG  . LEU B 1 216 ? 0.215   46.682  16.144  1.00 124.46 ? 251 LEU B CG  1 
ATOM   4305 C CD1 . LEU B 1 216 ? 1.162   45.511  16.341  1.00 127.63 ? 251 LEU B CD1 1 
ATOM   4306 C CD2 . LEU B 1 216 ? -1.184  46.333  16.609  1.00 126.84 ? 251 LEU B CD2 1 
ATOM   4307 N N   . ALA B 1 217 ? 0.340   51.041  18.229  1.00 31.01  ? 252 ALA B N   1 
ATOM   4308 C CA  . ALA B 1 217 ? 1.036   52.130  18.873  1.00 29.50  ? 252 ALA B CA  1 
ATOM   4309 C C   . ALA B 1 217 ? 1.211   51.862  20.352  1.00 24.48  ? 252 ALA B C   1 
ATOM   4310 O O   . ALA B 1 217 ? 0.404   51.151  20.975  1.00 22.58  ? 252 ALA B O   1 
ATOM   4311 C CB  . ALA B 1 217 ? 0.258   53.415  18.678  1.00 142.24 ? 252 ALA B CB  1 
ATOM   4312 N N   . ASN B 1 218 ? 2.256   52.477  20.905  1.00 49.84  ? 253 ASN B N   1 
ATOM   4313 C CA  . ASN B 1 218 ? 2.580   52.358  22.316  1.00 48.55  ? 253 ASN B CA  1 
ATOM   4314 C C   . ASN B 1 218 ? 2.537   50.866  22.625  1.00 40.46  ? 253 ASN B C   1 
ATOM   4315 O O   . ASN B 1 218 ? 1.627   50.344  23.282  1.00 38.86  ? 253 ASN B O   1 
ATOM   4316 C CB  . ASN B 1 218 ? 1.543   53.105  23.163  1.00 95.06  ? 253 ASN B CB  1 
ATOM   4317 C CG  . ASN B 1 218 ? 1.502   54.599  22.862  1.00 104.73 ? 253 ASN B CG  1 
ATOM   4318 O OD1 . ASN B 1 218 ? 0.669   55.331  23.400  1.00 116.85 ? 253 ASN B OD1 1 
ATOM   4319 N ND2 . ASN B 1 218 ? 2.404   55.055  22.003  1.00 116.51 ? 253 ASN B ND2 1 
ATOM   4320 N N   . VAL B 1 219 ? 3.544   50.197  22.080  1.00 79.99  ? 254 VAL B N   1 
ATOM   4321 C CA  . VAL B 1 219 ? 3.579   48.742  21.954  1.00 74.65  ? 254 VAL B CA  1 
ATOM   4322 C C   . VAL B 1 219 ? 4.242   48.154  23.189  1.00 73.57  ? 254 VAL B C   1 
ATOM   4323 O O   . VAL B 1 219 ? 5.364   48.560  23.538  1.00 71.94  ? 254 VAL B O   1 
ATOM   4324 C CB  . VAL B 1 219 ? 4.369   48.313  20.710  1.00 67.87  ? 254 VAL B CB  1 
ATOM   4325 C CG1 . VAL B 1 219 ? 4.577   46.814  20.724  1.00 64.83  ? 254 VAL B CG1 1 
ATOM   4326 C CG2 . VAL B 1 219 ? 3.608   48.708  19.454  1.00 64.72  ? 254 VAL B CG2 1 
ATOM   4327 N N   . THR B 1 220 ? 3.555   47.198  23.837  1.00 46.86  ? 255 THR B N   1 
ATOM   4328 C CA  . THR B 1 220 ? 4.112   46.480  25.009  1.00 47.14  ? 255 THR B CA  1 
ATOM   4329 C C   . THR B 1 220 ? 4.839   45.224  24.607  1.00 44.99  ? 255 THR B C   1 
ATOM   4330 O O   . THR B 1 220 ? 4.543   44.627  23.588  1.00 44.84  ? 255 THR B O   1 
ATOM   4331 C CB  . THR B 1 220 ? 3.014   46.110  26.032  1.00 50.76  ? 255 THR B CB  1 
ATOM   4332 O OG1 . THR B 1 220 ? 1.980   45.361  25.382  1.00 51.52  ? 255 THR B OG1 1 
ATOM   4333 C CG2 . THR B 1 220 ? 2.422   47.363  26.651  1.00 54.86  ? 255 THR B CG2 1 
ATOM   4334 N N   . SER B 1 221 ? 5.757   44.780  25.439  1.00 18.29  ? 256 SER B N   1 
ATOM   4335 C CA  . SER B 1 221 ? 6.404   43.516  25.166  1.00 17.58  ? 256 SER B CA  1 
ATOM   4336 C C   . SER B 1 221 ? 5.431   42.361  24.977  1.00 18.91  ? 256 SER B C   1 
ATOM   4337 O O   . SER B 1 221 ? 5.785   41.337  24.441  1.00 16.69  ? 256 SER B O   1 
ATOM   4338 C CB  . SER B 1 221 ? 7.370   43.203  26.312  1.00 82.38  ? 256 SER B CB  1 
ATOM   4339 O OG  . SER B 1 221 ? 7.911   41.902  26.203  1.00 80.89  ? 256 SER B OG  1 
ATOM   4340 N N   . ASP B 1 222 ? 4.200   42.514  25.412  1.00 48.80  ? 257 ASP B N   1 
ATOM   4341 C CA  . ASP B 1 222 ? 3.253   41.410  25.288  1.00 53.65  ? 257 ASP B CA  1 
ATOM   4342 C C   . ASP B 1 222 ? 2.690   41.293  23.840  1.00 48.68  ? 257 ASP B C   1 
ATOM   4343 O O   . ASP B 1 222 ? 1.576   40.788  23.591  1.00 47.86  ? 257 ASP B O   1 
ATOM   4344 C CB  . ASP B 1 222 ? 2.110   41.576  26.292  1.00 165.30 ? 257 ASP B CB  1 
ATOM   4345 C CG  . ASP B 1 222 ? 2.540   41.274  27.718  1.00 177.82 ? 257 ASP B CG  1 
ATOM   4346 O OD1 . ASP B 1 222 ? 2.917   40.115  27.992  1.00 191.63 ? 257 ASP B OD1 1 
ATOM   4347 O OD2 . ASP B 1 222 ? 2.504   42.194  28.563  1.00 192.31 ? 257 ASP B OD2 1 
ATOM   4348 N N   . LEU B 1 223 ? 3.482   41.766  22.887  1.00 37.09  ? 258 LEU B N   1 
ATOM   4349 C CA  . LEU B 1 223 ? 3.163   41.620  21.478  1.00 34.09  ? 258 LEU B CA  1 
ATOM   4350 C C   . LEU B 1 223 ? 3.889   40.446  20.926  1.00 36.43  ? 258 LEU B C   1 
ATOM   4351 O O   . LEU B 1 223 ? 3.569   39.976  19.869  1.00 35.06  ? 258 LEU B O   1 
ATOM   4352 C CB  . LEU B 1 223 ? 3.545   42.894  20.721  1.00 17.44  ? 258 LEU B CB  1 
ATOM   4353 C CG  . LEU B 1 223 ? 3.160   42.988  19.245  1.00 8.87   ? 258 LEU B CG  1 
ATOM   4354 C CD1 . LEU B 1 223 ? 1.690   42.660  19.067  1.00 4.41   ? 258 LEU B CD1 1 
ATOM   4355 C CD2 . LEU B 1 223 ? 3.454   44.384  18.736  1.00 4.67   ? 258 LEU B CD2 1 
ATOM   4356 N N   . ASN B 1 224 ? 4.893   39.982  21.635  1.00 19.39  ? 259 ASN B N   1 
ATOM   4357 C CA  . ASN B 1 224 ? 5.769   38.995  21.072  1.00 22.68  ? 259 ASN B CA  1 
ATOM   4358 C C   . ASN B 1 224 ? 5.030   37.688  20.870  1.00 29.84  ? 259 ASN B C   1 
ATOM   4359 O O   . ASN B 1 224 ? 4.223   37.285  21.703  1.00 30.00  ? 259 ASN B O   1 
ATOM   4360 C CB  . ASN B 1 224 ? 6.960   38.756  21.996  1.00 44.65  ? 259 ASN B CB  1 
ATOM   4361 C CG  . ASN B 1 224 ? 8.036   39.786  21.825  1.00 38.34  ? 259 ASN B CG  1 
ATOM   4362 O OD1 . ASN B 1 224 ? 8.663   39.867  20.776  1.00 33.28  ? 259 ASN B OD1 1 
ATOM   4363 N ND2 . ASN B 1 224 ? 8.259   40.586  22.854  1.00 28.59  ? 259 ASN B ND2 1 
ATOM   4364 N N   . ARG B 1 225 ? 5.316   37.027  19.756  1.00 47.22  ? 260 ARG B N   1 
ATOM   4365 C CA  . ARG B 1 225 ? 4.725   35.738  19.459  1.00 55.12  ? 260 ARG B CA  1 
ATOM   4366 C C   . ARG B 1 225 ? 3.221   35.839  19.577  1.00 54.24  ? 260 ARG B C   1 
ATOM   4367 O O   . ARG B 1 225 ? 2.609   35.221  20.441  1.00 53.59  ? 260 ARG B O   1 
ATOM   4368 C CB  . ARG B 1 225 ? 5.251   34.686  20.435  1.00 132.32 ? 260 ARG B CB  1 
ATOM   4369 C CG  . ARG B 1 225 ? 5.790   33.439  19.765  1.00 146.16 ? 260 ARG B CG  1 
ATOM   4370 C CD  . ARG B 1 225 ? 7.235   33.200  20.168  1.00 161.56 ? 260 ARG B CD  1 
ATOM   4371 N NE  . ARG B 1 225 ? 8.085   34.340  19.839  1.00 170.22 ? 260 ARG B NE  1 
ATOM   4372 C CZ  . ARG B 1 225 ? 9.396   34.378  20.053  1.00 177.56 ? 260 ARG B CZ  1 
ATOM   4373 N NH1 . ARG B 1 225 ? 10.010  33.337  20.596  1.00 180.19 ? 260 ARG B NH1 1 
ATOM   4374 N NH2 . ARG B 1 225 ? 10.093  35.455  19.721  1.00 180.27 ? 260 ARG B NH2 1 
ATOM   4375 N N   . LYS B 1 226 ? 2.653   36.666  18.709  1.00 68.64  ? 261 LYS B N   1 
ATOM   4376 C CA  . LYS B 1 226 ? 1.216   36.810  18.550  1.00 70.78  ? 261 LYS B CA  1 
ATOM   4377 C C   . LYS B 1 226 ? 0.980   37.041  17.083  1.00 68.84  ? 261 LYS B C   1 
ATOM   4378 O O   . LYS B 1 226 ? 1.213   38.123  16.595  1.00 67.84  ? 261 LYS B O   1 
ATOM   4379 C CB  . LYS B 1 226 ? 0.695   37.952  19.423  1.00 95.46  ? 261 LYS B CB  1 
ATOM   4380 C CG  . LYS B 1 226 ? 0.605   37.533  20.888  1.00 99.59  ? 261 LYS B CG  1 
ATOM   4381 C CD  . LYS B 1 226 ? 0.332   38.678  21.839  1.00 105.91 ? 261 LYS B CD  1 
ATOM   4382 C CE  . LYS B 1 226 ? 0.282   38.166  23.275  1.00 108.88 ? 261 LYS B CE  1 
ATOM   4383 N NZ  . LYS B 1 226 ? 1.471   37.326  23.609  1.00 110.88 ? 261 LYS B NZ  1 
ATOM   4384 N N   . ASN B 1 227 ? 0.552   36.014  16.372  1.00 50.72  ? 262 ASN B N   1 
ATOM   4385 C CA  . ASN B 1 227 ? 0.327   36.112  14.940  1.00 52.66  ? 262 ASN B CA  1 
ATOM   4386 C C   . ASN B 1 227 ? -0.516  37.311  14.591  1.00 53.63  ? 262 ASN B C   1 
ATOM   4387 O O   . ASN B 1 227 ? -1.559  37.518  15.193  1.00 51.22  ? 262 ASN B O   1 
ATOM   4388 C CB  . ASN B 1 227 ? -0.343  34.845  14.402  1.00 92.67  ? 262 ASN B CB  1 
ATOM   4389 C CG  . ASN B 1 227 ? 0.640   33.711  14.180  1.00 98.99  ? 262 ASN B CG  1 
ATOM   4390 O OD1 . ASN B 1 227 ? 1.708   33.911  13.601  1.00 97.23  ? 262 ASN B OD1 1 
ATOM   4391 N ND2 . ASN B 1 227 ? 0.268   32.513  14.617  1.00 119.52 ? 262 ASN B ND2 1 
ATOM   4392 N N   . VAL B 1 228 ? -0.053  38.084  13.612  1.00 52.45  ? 263 VAL B N   1 
ATOM   4393 C CA  . VAL B 1 228 ? -0.822  39.173  13.012  1.00 58.16  ? 263 VAL B CA  1 
ATOM   4394 C C   . VAL B 1 228 ? -1.117  38.851  11.520  1.00 54.45  ? 263 VAL B C   1 
ATOM   4395 O O   . VAL B 1 228 ? -0.251  39.005  10.657  1.00 52.65  ? 263 VAL B O   1 
ATOM   4396 C CB  . VAL B 1 228 ? -0.052  40.505  13.093  1.00 71.05  ? 263 VAL B CB  1 
ATOM   4397 C CG1 . VAL B 1 228 ? -0.889  41.627  12.497  1.00 81.14  ? 263 VAL B CG1 1 
ATOM   4398 C CG2 . VAL B 1 228 ? 0.301   40.813  14.538  1.00 80.46  ? 263 VAL B CG2 1 
ATOM   4399 N N   . THR B 1 229 ? -2.359  38.407  11.264  1.00 60.65  ? 264 THR B N   1 
ATOM   4400 C CA  . THR B 1 229 ? -2.835  37.851  9.984   1.00 60.31  ? 264 THR B CA  1 
ATOM   4401 C C   . THR B 1 229 ? -3.676  38.847  9.185   1.00 60.16  ? 264 THR B C   1 
ATOM   4402 O O   . THR B 1 229 ? -4.214  39.790  9.760   1.00 58.81  ? 264 THR B O   1 
ATOM   4403 C CB  . THR B 1 229 ? -3.711  36.598  10.226  1.00 104.13 ? 264 THR B CB  1 
ATOM   4404 O OG1 . THR B 1 229 ? -3.037  35.702  11.118  1.00 104.24 ? 264 THR B OG1 1 
ATOM   4405 C CG2 . THR B 1 229 ? -3.991  35.879  8.919   1.00 105.95 ? 264 THR B CG2 1 
ATOM   4406 N N   . CYS B 1 230 ? -3.800  38.622  7.868   1.00 70.58  ? 265 CYS B N   1 
ATOM   4407 C CA  . CYS B 1 230 ? -4.723  39.396  7.007   1.00 73.01  ? 265 CYS B CA  1 
ATOM   4408 C C   . CYS B 1 230 ? -5.439  38.584  5.924   1.00 76.05  ? 265 CYS B C   1 
ATOM   4409 O O   . CYS B 1 230 ? -4.908  37.617  5.399   1.00 74.77  ? 265 CYS B O   1 
ATOM   4410 C CB  . CYS B 1 230 ? -4.014  40.623  6.394   1.00 140.39 ? 265 CYS B CB  1 
ATOM   4411 S SG  . CYS B 1 230 ? -2.588  40.394  5.278   1.00 142.96 ? 265 CYS B SG  1 
ATOM   4412 N N   . TRP B 1 231 ? -6.653  39.024  5.606   1.00 115.58 ? 266 TRP B N   1 
ATOM   4413 C CA  . TRP B 1 231 ? -7.571  38.295  4.738   1.00 120.87 ? 266 TRP B CA  1 
ATOM   4414 C C   . TRP B 1 231 ? -7.227  38.404  3.272   1.00 124.66 ? 266 TRP B C   1 
ATOM   4415 O O   . TRP B 1 231 ? -6.227  39.011  2.883   1.00 124.85 ? 266 TRP B O   1 
ATOM   4416 C CB  . TRP B 1 231 ? -8.997  38.824  4.916   1.00 132.55 ? 266 TRP B CB  1 
ATOM   4417 C CG  . TRP B 1 231 ? -9.770  38.210  6.027   1.00 130.33 ? 266 TRP B CG  1 
ATOM   4418 C CD1 . TRP B 1 231 ? -9.266  37.614  7.142   1.00 131.01 ? 266 TRP B CD1 1 
ATOM   4419 C CD2 . TRP B 1 231 ? -11.198 38.171  6.159   1.00 131.29 ? 266 TRP B CD2 1 
ATOM   4420 N NE1 . TRP B 1 231 ? -10.288 37.205  7.965   1.00 132.02 ? 266 TRP B NE1 1 
ATOM   4421 C CE2 . TRP B 1 231 ? -11.485 37.535  7.385   1.00 132.24 ? 266 TRP B CE2 1 
ATOM   4422 C CE3 . TRP B 1 231 ? -12.262 38.613  5.361   1.00 131.69 ? 266 TRP B CE3 1 
ATOM   4423 C CZ2 . TRP B 1 231 ? -12.793 37.327  7.835   1.00 132.19 ? 266 TRP B CZ2 1 
ATOM   4424 C CZ3 . TRP B 1 231 ? -13.566 38.407  5.810   1.00 132.00 ? 266 TRP B CZ3 1 
ATOM   4425 C CH2 . TRP B 1 231 ? -13.817 37.769  7.036   1.00 132.02 ? 266 TRP B CH2 1 
ATOM   4426 N N   . ALA B 1 232 ? -8.109  37.803  2.476   1.00 147.78 ? 267 ALA B N   1 
ATOM   4427 C CA  . ALA B 1 232 ? -8.153  37.924  1.024   1.00 151.59 ? 267 ALA B CA  1 
ATOM   4428 C C   . ALA B 1 232 ? -9.151  36.878  0.531   1.00 151.24 ? 267 ALA B C   1 
ATOM   4429 O O   . ALA B 1 232 ? -9.107  35.715  0.939   1.00 151.77 ? 267 ALA B O   1 
ATOM   4430 C CB  . ALA B 1 232 ? -6.773  37.660  0.426   1.00 147.07 ? 267 ALA B CB  1 
ATOM   4431 N N   . GLU B 1 233 ? -10.069 37.297  -0.322  1.00 168.46 ? 268 GLU B N   1 
ATOM   4432 C CA  . GLU B 1 233 ? -11.034 36.381  -0.888  1.00 168.12 ? 268 GLU B CA  1 
ATOM   4433 C C   . GLU B 1 233 ? -11.299 36.794  -2.327  1.00 170.15 ? 268 GLU B C   1 
ATOM   4434 O O   . GLU B 1 233 ? -11.918 37.828  -2.563  1.00 170.05 ? 268 GLU B O   1 
ATOM   4435 C CB  . GLU B 1 233 ? -12.342 36.392  -0.095  1.00 85.04  ? 268 GLU B CB  1 
ATOM   4436 C CG  . GLU B 1 233 ? -12.225 35.801  1.294   1.00 81.41  ? 268 GLU B CG  1 
ATOM   4437 C CD  . GLU B 1 233 ? -13.576 35.511  1.913   1.00 77.44  ? 268 GLU B CD  1 
ATOM   4438 O OE1 . GLU B 1 233 ? -14.411 36.436  1.983   1.00 75.00  ? 268 GLU B OE1 1 
ATOM   4439 O OE2 . GLU B 1 233 ? -13.804 34.357  2.329   1.00 75.19  ? 268 GLU B OE2 1 
ATOM   4440 N N   . ASN B 1 234 ? -10.822 36.012  -3.294  1.00 154.89 ? 269 ASN B N   1 
ATOM   4441 C CA  . ASN B 1 234 ? -11.194 36.262  -4.692  1.00 158.48 ? 269 ASN B CA  1 
ATOM   4442 C C   . ASN B 1 234 ? -12.603 35.710  -4.975  1.00 160.94 ? 269 ASN B C   1 
ATOM   4443 O O   . ASN B 1 234 ? -13.264 35.206  -4.065  1.00 159.79 ? 269 ASN B O   1 
ATOM   4444 C CB  . ASN B 1 234 ? -10.168 35.640  -5.646  1.00 176.43 ? 269 ASN B CB  1 
ATOM   4445 C CG  . ASN B 1 234 ? -10.105 34.133  -5.541  1.00 179.86 ? 269 ASN B CG  1 
ATOM   4446 O OD1 . ASN B 1 234 ? -9.909  33.580  -4.460  1.00 184.52 ? 269 ASN B OD1 1 
ATOM   4447 N ND2 . ASN B 1 234 ? -10.260 33.459  -6.671  1.00 184.06 ? 269 ASN B ND2 1 
ATOM   4448 N N   . ASP B 1 235 ? -13.085 35.834  -6.209  1.00 129.11 ? 270 ASP B N   1 
ATOM   4449 C CA  . ASP B 1 235 ? -14.412 35.306  -6.555  1.00 133.14 ? 270 ASP B CA  1 
ATOM   4450 C C   . ASP B 1 235 ? -14.514 33.795  -6.338  1.00 135.72 ? 270 ASP B C   1 
ATOM   4451 O O   . ASP B 1 235 ? -15.605 33.238  -6.364  1.00 135.88 ? 270 ASP B O   1 
ATOM   4452 C CB  . ASP B 1 235 ? -14.743 35.633  -8.013  1.00 193.87 ? 270 ASP B CB  1 
ATOM   4453 C CG  . ASP B 1 235 ? -13.746 35.032  -8.987  1.00 195.52 ? 270 ASP B CG  1 
ATOM   4454 O OD1 . ASP B 1 235 ? -13.922 35.224  -10.209 1.00 197.17 ? 270 ASP B OD1 1 
ATOM   4455 O OD2 . ASP B 1 235 ? -12.790 34.371  -8.528  1.00 197.48 ? 270 ASP B OD2 1 
ATOM   4456 N N   . VAL B 1 236 ? -13.371 33.149  -6.110  1.00 167.66 ? 271 VAL B N   1 
ATOM   4457 C CA  . VAL B 1 236 ? -13.317 31.714  -5.896  1.00 170.75 ? 271 VAL B CA  1 
ATOM   4458 C C   . VAL B 1 236 ? -12.211 31.343  -4.892  1.00 168.43 ? 271 VAL B C   1 
ATOM   4459 O O   . VAL B 1 236 ? -11.076 31.058  -5.282  1.00 168.59 ? 271 VAL B O   1 
ATOM   4460 C CB  . VAL B 1 236 ? -13.106 30.971  -7.243  1.00 160.21 ? 271 VAL B CB  1 
ATOM   4461 C CG1 . VAL B 1 236 ? -11.854 31.483  -7.939  1.00 164.89 ? 271 VAL B CG1 1 
ATOM   4462 C CG2 . VAL B 1 236 ? -13.026 29.473  -7.014  1.00 165.12 ? 271 VAL B CG2 1 
ATOM   4463 N N   . GLY B 1 237 ? -12.547 31.363  -3.600  1.00 188.22 ? 272 GLY B N   1 
ATOM   4464 C CA  . GLY B 1 237 ? -11.630 30.918  -2.552  1.00 184.84 ? 272 GLY B CA  1 
ATOM   4465 C C   . GLY B 1 237 ? -11.184 31.986  -1.557  1.00 179.96 ? 272 GLY B C   1 
ATOM   4466 O O   . GLY B 1 237 ? -11.681 33.118  -1.578  1.00 180.72 ? 272 GLY B O   1 
ATOM   4467 N N   . ARG B 1 238 ? -10.248 31.611  -0.679  1.00 95.50  ? 273 ARG B N   1 
ATOM   4468 C CA  . ARG B 1 238 ? -9.683  32.527  0.314   1.00 89.33  ? 273 ARG B CA  1 
ATOM   4469 C C   . ARG B 1 238 ? -8.207  32.226  0.548   1.00 85.70  ? 273 ARG B C   1 
ATOM   4470 O O   . ARG B 1 238 ? -7.774  31.082  0.441   1.00 84.93  ? 273 ARG B O   1 
ATOM   4471 C CB  . ARG B 1 238 ? -10.453 32.416  1.630   1.00 142.91 ? 273 ARG B CB  1 
ATOM   4472 C CG  . ARG B 1 238 ? -9.858  33.204  2.783   1.00 139.14 ? 273 ARG B CG  1 
ATOM   4473 C CD  . ARG B 1 238 ? -10.762 33.157  4.003   1.00 135.30 ? 273 ARG B CD  1 
ATOM   4474 N NE  . ARG B 1 238 ? -10.100 33.682  5.195   1.00 132.82 ? 273 ARG B NE  1 
ATOM   4475 C CZ  . ARG B 1 238 ? -10.686 33.814  6.383   1.00 131.33 ? 273 ARG B CZ  1 
ATOM   4476 N NH1 . ARG B 1 238 ? -11.955 33.463  6.545   1.00 131.07 ? 273 ARG B NH1 1 
ATOM   4477 N NH2 . ARG B 1 238 ? -9.999  34.290  7.413   1.00 130.26 ? 273 ARG B NH2 1 
ATOM   4478 N N   . ALA B 1 239 ? -7.442  33.270  0.846   1.00 90.49  ? 274 ALA B N   1 
ATOM   4479 C CA  . ALA B 1 239 ? -6.063  33.133  1.282   1.00 88.04  ? 274 ALA B CA  1 
ATOM   4480 C C   . ALA B 1 239 ? -5.847  34.034  2.487   1.00 81.82  ? 274 ALA B C   1 
ATOM   4481 O O   . ALA B 1 239 ? -6.180  35.207  2.421   1.00 81.49  ? 274 ALA B O   1 
ATOM   4482 C CB  . ALA B 1 239 ? -5.117  33.521  0.157   1.00 135.87 ? 274 ALA B CB  1 
ATOM   4483 N N   . GLU B 1 240 ? -5.335  33.482  3.592   1.00 77.74  ? 275 GLU B N   1 
ATOM   4484 C CA  . GLU B 1 240 ? -4.891  34.284  4.731   1.00 72.86  ? 275 GLU B CA  1 
ATOM   4485 C C   . GLU B 1 240 ? -3.372  34.105  4.866   1.00 65.49  ? 275 GLU B C   1 
ATOM   4486 O O   . GLU B 1 240 ? -2.872  32.989  4.730   1.00 64.25  ? 275 GLU B O   1 
ATOM   4487 C CB  . GLU B 1 240 ? -5.634  33.889  6.020   1.00 112.38 ? 275 GLU B CB  1 
ATOM   4488 C CG  . GLU B 1 240 ? -5.196  32.607  6.719   1.00 109.09 ? 275 GLU B CG  1 
ATOM   4489 C CD  . GLU B 1 240 ? -6.034  32.312  7.962   1.00 108.70 ? 275 GLU B CD  1 
ATOM   4490 O OE1 . GLU B 1 240 ? -5.629  31.453  8.772   1.00 107.68 ? 275 GLU B OE1 1 
ATOM   4491 O OE2 . GLU B 1 240 ? -7.105  32.934  8.128   1.00 107.28 ? 275 GLU B OE2 1 
ATOM   4492 N N   . VAL B 1 241 ? -2.652  35.217  5.064   1.00 95.72  ? 276 VAL B N   1 
ATOM   4493 C CA  . VAL B 1 241 ? -1.203  35.217  5.362   1.00 89.27  ? 276 VAL B CA  1 
ATOM   4494 C C   . VAL B 1 241 ? -0.888  35.977  6.660   1.00 85.98  ? 276 VAL B C   1 
ATOM   4495 O O   . VAL B 1 241 ? -1.435  37.063  6.862   1.00 86.09  ? 276 VAL B O   1 
ATOM   4496 C CB  . VAL B 1 241 ? -0.416  35.855  4.192   1.00 56.90  ? 276 VAL B CB  1 
ATOM   4497 C CG1 . VAL B 1 241 ? -0.748  37.334  4.089   1.00 54.61  ? 276 VAL B CG1 1 
ATOM   4498 C CG2 . VAL B 1 241 ? 1.075   35.647  4.376   1.00 54.74  ? 276 VAL B CG2 1 
ATOM   4499 N N   . SER B 1 242 ? 0.011   35.460  7.507   1.00 47.34  ? 277 SER B N   1 
ATOM   4500 C CA  . SER B 1 242 ? 0.258   36.096  8.801   1.00 44.85  ? 277 SER B CA  1 
ATOM   4501 C C   . SER B 1 242 ? 1.727   36.196  9.178   1.00 45.74  ? 277 SER B C   1 
ATOM   4502 O O   . SER B 1 242 ? 2.473   35.247  9.003   1.00 44.30  ? 277 SER B O   1 
ATOM   4503 C CB  . SER B 1 242 ? -0.492  35.331  9.880   1.00 49.07  ? 277 SER B CB  1 
ATOM   4504 O OG  . SER B 1 242 ? -0.257  33.947  9.750   1.00 46.81  ? 277 SER B OG  1 
ATOM   4505 N N   . VAL B 1 243 ? 2.108   37.346  9.740   1.00 48.85  ? 278 VAL B N   1 
ATOM   4506 C CA  . VAL B 1 243 ? 3.496   37.658  10.127  1.00 51.32  ? 278 VAL B CA  1 
ATOM   4507 C C   . VAL B 1 243 ? 3.574   38.015  11.613  1.00 49.17  ? 278 VAL B C   1 
ATOM   4508 O O   . VAL B 1 243 ? 2.529   38.053  12.265  1.00 48.65  ? 278 VAL B O   1 
ATOM   4509 C CB  . VAL B 1 243 ? 4.051   38.841  9.297   1.00 37.51  ? 278 VAL B CB  1 
ATOM   4510 C CG1 . VAL B 1 243 ? 3.815   38.585  7.814   1.00 41.86  ? 278 VAL B CG1 1 
ATOM   4511 C CG2 . VAL B 1 243 ? 3.395   40.142  9.724   1.00 41.74  ? 278 VAL B CG2 1 
ATOM   4512 N N   . GLN B 1 244 ? 4.782   38.294  12.137  1.00 47.28  ? 279 GLN B N   1 
ATOM   4513 C CA  . GLN B 1 244 ? 4.943   38.743  13.548  1.00 45.96  ? 279 GLN B CA  1 
ATOM   4514 C C   . GLN B 1 244 ? 5.876   39.949  13.793  1.00 47.56  ? 279 GLN B C   1 
ATOM   4515 O O   . GLN B 1 244 ? 6.540   40.458  12.880  1.00 46.92  ? 279 GLN B O   1 
ATOM   4516 C CB  . GLN B 1 244 ? 5.382   37.566  14.415  1.00 75.18  ? 279 GLN B CB  1 
ATOM   4517 C CG  . GLN B 1 244 ? 4.259   36.594  14.678  1.00 71.08  ? 279 GLN B CG  1 
ATOM   4518 C CD  . GLN B 1 244 ? 4.737   35.334  15.343  1.00 67.39  ? 279 GLN B CD  1 
ATOM   4519 O OE1 . GLN B 1 244 ? 5.419   35.379  16.363  1.00 68.97  ? 279 GLN B OE1 1 
ATOM   4520 N NE2 . GLN B 1 244 ? 4.385   34.195  14.770  1.00 63.26  ? 279 GLN B NE2 1 
ATOM   4521 N N   . VAL B 1 245 ? 5.895   40.406  15.047  1.00 66.79  ? 280 VAL B N   1 
ATOM   4522 C CA  . VAL B 1 245 ? 6.450   41.719  15.379  1.00 69.78  ? 280 VAL B CA  1 
ATOM   4523 C C   . VAL B 1 245 ? 7.847   41.738  16.000  1.00 64.05  ? 280 VAL B C   1 
ATOM   4524 O O   . VAL B 1 245 ? 8.725   42.416  15.472  1.00 63.70  ? 280 VAL B O   1 
ATOM   4525 C CB  . VAL B 1 245 ? 5.503   42.491  16.322  1.00 114.61 ? 280 VAL B CB  1 
ATOM   4526 C CG1 . VAL B 1 245 ? 6.000   43.919  16.499  1.00 120.86 ? 280 VAL B CG1 1 
ATOM   4527 C CG2 . VAL B 1 245 ? 4.090   42.480  15.764  1.00 121.29 ? 280 VAL B CG2 1 
ATOM   4528 N N   . ASN B 1 246 ? 8.043   41.060  17.132  1.00 59.88  ? 281 ASN B N   1 
ATOM   4529 C CA  . ASN B 1 246 ? 9.365   41.006  17.777  1.00 55.87  ? 281 ASN B CA  1 
ATOM   4530 C C   . ASN B 1 246 ? 9.876   42.337  18.426  1.00 50.04  ? 281 ASN B C   1 
ATOM   4531 O O   . ASN B 1 246 ? 10.731  43.044  17.861  1.00 49.74  ? 281 ASN B O   1 
ATOM   4532 C CB  . ASN B 1 246 ? 10.407  40.534  16.758  1.00 52.25  ? 281 ASN B CB  1 
ATOM   4533 C CG  . ASN B 1 246 ? 10.843  39.104  16.979  1.00 60.05  ? 281 ASN B CG  1 
ATOM   4534 O OD1 . ASN B 1 246 ? 10.183  38.348  17.684  1.00 58.67  ? 281 ASN B OD1 1 
ATOM   4535 N ND2 . ASN B 1 246 ? 11.961  38.729  16.364  1.00 79.10  ? 281 ASN B ND2 1 
ATOM   4536 N N   . VAL B 1 247 ? 9.361   42.649  19.628  1.00 23.06  ? 282 VAL B N   1 
ATOM   4537 C CA  . VAL B 1 247 ? 9.773   43.836  20.432  1.00 17.67  ? 282 VAL B CA  1 
ATOM   4538 C C   . VAL B 1 247 ? 10.780  43.413  21.499  1.00 15.39  ? 282 VAL B C   1 
ATOM   4539 O O   . VAL B 1 247 ? 10.671  42.318  22.068  1.00 13.84  ? 282 VAL B O   1 
ATOM   4540 C CB  . VAL B 1 247 ? 8.566   44.496  21.124  1.00 26.24  ? 282 VAL B CB  1 
ATOM   4541 C CG1 . VAL B 1 247 ? 7.603   45.034  20.090  1.00 24.77  ? 282 VAL B CG1 1 
ATOM   4542 C CG2 . VAL B 1 247 ? 7.865   43.498  22.007  1.00 24.28  ? 282 VAL B CG2 1 
ATOM   4543 N N   . SER B 1 248 ? 11.783  44.248  21.733  1.00 33.17  ? 283 SER B N   1 
ATOM   4544 C CA  . SER B 1 248 ? 12.982  43.775  22.438  1.00 32.10  ? 283 SER B CA  1 
ATOM   4545 C C   . SER B 1 248 ? 12.901  44.330  23.790  1.00 32.02  ? 283 SER B C   1 
ATOM   4546 O O   . SER B 1 248 ? 12.227  45.356  23.943  1.00 32.73  ? 283 SER B O   1 
ATOM   4547 C CB  . SER B 1 248 ? 14.234  44.270  21.711  1.00 41.49  ? 283 SER B CB  1 
ATOM   4548 O OG  . SER B 1 248 ? 14.102  45.628  21.346  1.00 40.82  ? 283 SER B OG  1 
ATOM   4549 N N   . PHE B 1 249 ? 13.521  43.664  24.766  1.00 22.97  ? 284 PHE B N   1 
ATOM   4550 C CA  . PHE B 1 249 ? 13.563  44.047  26.173  1.00 22.97  ? 284 PHE B CA  1 
ATOM   4551 C C   . PHE B 1 249 ? 14.686  43.273  26.838  1.00 22.97  ? 284 PHE B C   1 
ATOM   4552 O O   . PHE B 1 249 ? 14.996  42.176  26.455  1.00 22.97  ? 284 PHE B O   1 
ATOM   4553 C CB  . PHE B 1 249 ? 12.236  43.737  26.866  1.00 20.61  ? 284 PHE B CB  1 
ATOM   4554 C CG  . PHE B 1 249 ? 11.794  42.311  26.727  1.00 21.43  ? 284 PHE B CG  1 
ATOM   4555 C CD1 . PHE B 1 249 ? 11.082  41.897  25.611  1.00 23.22  ? 284 PHE B CD1 1 
ATOM   4556 C CD2 . PHE B 1 249 ? 12.093  41.379  27.712  1.00 24.47  ? 284 PHE B CD2 1 
ATOM   4557 C CE1 . PHE B 1 249 ? 10.673  40.578  25.478  1.00 25.05  ? 284 PHE B CE1 1 
ATOM   4558 C CE2 . PHE B 1 249 ? 11.690  40.060  27.589  1.00 25.07  ? 284 PHE B CE2 1 
ATOM   4559 C CZ  . PHE B 1 249 ? 10.977  39.657  26.468  1.00 25.81  ? 284 PHE B CZ  1 
ATOM   4560 N N   . PRO B 1 250 ? 15.268  43.809  27.896  1.00 32.09  ? 285 PRO B N   1 
ATOM   4561 C CA  . PRO B 1 250 ? 16.370  43.137  28.586  1.00 34.20  ? 285 PRO B CA  1 
ATOM   4562 C C   . PRO B 1 250 ? 16.255  41.707  29.131  1.00 36.74  ? 285 PRO B C   1 
ATOM   4563 O O   . PRO B 1 250 ? 15.183  41.202  29.459  1.00 36.51  ? 285 PRO B O   1 
ATOM   4564 C CB  . PRO B 1 250 ? 16.731  44.132  29.688  1.00 50.70  ? 285 PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 250 ? 15.426  44.786  29.986  1.00 50.07  ? 285 PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 250 ? 14.880  45.039  28.607  1.00 48.97  ? 285 PRO B CD  1 
ATOM   4567 N N   . ALA B 1 251 ? 17.412  41.073  29.247  1.00 36.11  ? 286 ALA B N   1 
ATOM   4568 C CA  . ALA B 1 251 ? 17.506  39.717  29.734  1.00 36.11  ? 286 ALA B CA  1 
ATOM   4569 C C   . ALA B 1 251 ? 17.259  39.613  31.221  1.00 36.11  ? 286 ALA B C   1 
ATOM   4570 O O   . ALA B 1 251 ? 17.647  40.475  31.990  1.00 36.11  ? 286 ALA B O   1 
ATOM   4571 C CB  . ALA B 1 251 ? 18.872  39.144  29.399  1.00 108.00 ? 286 ALA B CB  1 
ATOM   4572 N N   . SER B 1 252 ? 16.608  38.525  31.602  1.00 23.48  ? 287 SER B N   1 
ATOM   4573 C CA  . SER B 1 252 ? 16.278  38.184  32.984  1.00 23.48  ? 287 SER B CA  1 
ATOM   4574 C C   . SER B 1 252 ? 16.699  36.721  33.112  1.00 23.48  ? 287 SER B C   1 
ATOM   4575 O O   . SER B 1 252 ? 16.640  35.966  32.125  1.00 23.48  ? 287 SER B O   1 
ATOM   4576 C CB  . SER B 1 252 ? 14.779  38.348  33.246  1.00 91.64  ? 287 SER B CB  1 
ATOM   4577 O OG  . SER B 1 252 ? 14.006  37.591  32.332  1.00 91.64  ? 287 SER B OG  1 
ATOM   4578 N N   . VAL B 1 253 ? 17.149  36.315  34.300  1.00 31.04  ? 288 VAL B N   1 
ATOM   4579 C CA  . VAL B 1 253 ? 17.613  34.933  34.468  1.00 31.04  ? 288 VAL B CA  1 
ATOM   4580 C C   . VAL B 1 253 ? 17.575  34.372  35.885  1.00 31.04  ? 288 VAL B C   1 
ATOM   4581 O O   . VAL B 1 253 ? 17.852  35.085  36.858  1.00 31.04  ? 288 VAL B O   1 
ATOM   4582 C CB  . VAL B 1 253 ? 19.078  34.785  34.020  1.00 52.47  ? 288 VAL B CB  1 
ATOM   4583 C CG1 . VAL B 1 253 ? 19.475  33.325  34.007  1.00 52.47  ? 288 VAL B CG1 1 
ATOM   4584 C CG2 . VAL B 1 253 ? 19.278  35.403  32.675  1.00 52.47  ? 288 VAL B CG2 1 
ATOM   4585 N N   . GLN B 1 254 ? 17.229  33.090  36.000  1.00 22.62  ? 289 GLN B N   1 
ATOM   4586 C CA  . GLN B 1 254 ? 17.211  32.461  37.312  1.00 22.62  ? 289 GLN B CA  1 
ATOM   4587 C C   . GLN B 1 254 ? 17.614  30.985  37.253  1.00 22.62  ? 289 GLN B C   1 
ATOM   4588 O O   . GLN B 1 254 ? 17.391  30.301  36.249  1.00 22.62  ? 289 GLN B O   1 
ATOM   4589 C CB  . GLN B 1 254 ? 15.836  32.613  37.980  1.00 75.92  ? 289 GLN B CB  1 
ATOM   4590 C CG  . GLN B 1 254 ? 14.690  31.915  37.275  1.00 75.92  ? 289 GLN B CG  1 
ATOM   4591 C CD  . GLN B 1 254 ? 13.356  32.174  37.945  1.00 75.92  ? 289 GLN B CD  1 
ATOM   4592 O OE1 . GLN B 1 254 ? 13.112  31.724  39.060  1.00 75.92  ? 289 GLN B OE1 1 
ATOM   4593 N NE2 . GLN B 1 254 ? 12.489  32.911  37.266  1.00 75.92  ? 289 GLN B NE2 1 
ATOM   4594 N N   . LEU B 1 255 ? 18.205  30.514  38.348  1.00 8.12   ? 290 LEU B N   1 
ATOM   4595 C CA  . LEU B 1 255 ? 18.653  29.140  38.469  1.00 8.12   ? 290 LEU B CA  1 
ATOM   4596 C C   . LEU B 1 255 ? 17.930  28.505  39.644  1.00 8.12   ? 290 LEU B C   1 
ATOM   4597 O O   . LEU B 1 255 ? 17.576  29.190  40.595  1.00 8.12   ? 290 LEU B O   1 
ATOM   4598 C CB  . LEU B 1 255 ? 20.167  29.079  38.694  1.00 49.02  ? 290 LEU B CB  1 
ATOM   4599 C CG  . LEU B 1 255 ? 21.068  28.994  37.459  1.00 49.02  ? 290 LEU B CG  1 
ATOM   4600 C CD1 . LEU B 1 255 ? 20.794  30.159  36.532  1.00 49.02  ? 290 LEU B CD1 1 
ATOM   4601 C CD2 . LEU B 1 255 ? 22.521  28.987  37.895  1.00 49.02  ? 290 LEU B CD2 1 
ATOM   4602 N N   . HIS B 1 256 ? 17.716  27.189  39.569  1.00 25.97  ? 291 HIS B N   1 
ATOM   4603 C CA  . HIS B 1 256 ? 17.031  26.447  40.622  1.00 25.97  ? 291 HIS B CA  1 
ATOM   4604 C C   . HIS B 1 256 ? 17.975  25.421  41.257  1.00 25.97  ? 291 HIS B C   1 
ATOM   4605 O O   . HIS B 1 256 ? 18.992  25.037  40.660  1.00 25.97  ? 291 HIS B O   1 
ATOM   4606 C CB  . HIS B 1 256 ? 15.831  25.684  40.068  1.00 47.17  ? 291 HIS B CB  1 
ATOM   4607 C CG  . HIS B 1 256 ? 14.747  26.554  39.523  1.00 47.17  ? 291 HIS B CG  1 
ATOM   4608 N ND1 . HIS B 1 256 ? 13.583  26.807  40.212  1.00 47.17  ? 291 HIS B ND1 1 
ATOM   4609 C CD2 . HIS B 1 256 ? 14.647  27.226  38.353  1.00 47.17  ? 291 HIS B CD2 1 
ATOM   4610 C CE1 . HIS B 1 256 ? 12.812  27.597  39.489  1.00 47.17  ? 291 HIS B CE1 1 
ATOM   4611 N NE2 . HIS B 1 256 ? 13.435  27.867  38.357  1.00 47.17  ? 291 HIS B NE2 1 
ATOM   4612 N N   . THR B 1 257 ? 17.635  24.996  42.474  1.00 9.69   ? 292 THR B N   1 
ATOM   4613 C CA  . THR B 1 257 ? 18.411  23.997  43.203  1.00 9.69   ? 292 THR B CA  1 
ATOM   4614 C C   . THR B 1 257 ? 18.721  22.823  42.266  1.00 9.69   ? 292 THR B C   1 
ATOM   4615 O O   . THR B 1 257 ? 17.841  22.340  41.554  1.00 9.69   ? 292 THR B O   1 
ATOM   4616 C CB  . THR B 1 257 ? 17.626  23.474  44.388  1.00 51.16  ? 292 THR B CB  1 
ATOM   4617 O OG1 . THR B 1 257 ? 17.429  24.537  45.317  1.00 51.16  ? 292 THR B OG1 1 
ATOM   4618 C CG2 . THR B 1 257 ? 18.364  22.351  45.057  1.00 51.16  ? 292 THR B CG2 1 
ATOM   4619 N N   . ALA B 1 258 ? 19.970  22.368  42.273  1.00 19.25  ? 293 ALA B N   1 
ATOM   4620 C CA  . ALA B 1 258 ? 20.379  21.254  41.424  1.00 19.25  ? 293 ALA B CA  1 
ATOM   4621 C C   . ALA B 1 258 ? 19.563  20.023  41.776  1.00 19.25  ? 293 ALA B C   1 
ATOM   4622 O O   . ALA B 1 258 ? 19.299  19.770  42.944  1.00 19.25  ? 293 ALA B O   1 
ATOM   4623 C CB  . ALA B 1 258 ? 21.854  20.969  41.609  1.00 88.29  ? 293 ALA B CB  1 
ATOM   4624 N N   . VAL B 1 259 ? 19.175  19.246  40.776  1.00 36.54  ? 294 VAL B N   1 
ATOM   4625 C CA  . VAL B 1 259 ? 18.390  18.060  41.044  1.00 36.54  ? 294 VAL B CA  1 
ATOM   4626 C C   . VAL B 1 259 ? 18.938  16.833  40.311  1.00 36.54  ? 294 VAL B C   1 
ATOM   4627 O O   . VAL B 1 259 ? 19.297  16.905  39.139  1.00 36.54  ? 294 VAL B O   1 
ATOM   4628 C CB  . VAL B 1 259 ? 16.879  18.297  40.726  1.00 46.47  ? 294 VAL B CB  1 
ATOM   4629 C CG1 . VAL B 1 259 ? 16.720  19.202  39.533  1.00 46.47  ? 294 VAL B CG1 1 
ATOM   4630 C CG2 . VAL B 1 259 ? 16.192  16.988  40.473  1.00 46.47  ? 294 VAL B CG2 1 
ATOM   4631 N N   . GLU B 1 260 ? 19.024  15.706  41.010  1.00 74.84  ? 295 GLU B N   1 
ATOM   4632 C CA  . GLU B 1 260 ? 19.519  14.480  40.394  1.00 74.84  ? 295 GLU B CA  1 
ATOM   4633 C C   . GLU B 1 260 ? 18.360  13.651  39.843  1.00 74.84  ? 295 GLU B C   1 
ATOM   4634 O O   . GLU B 1 260 ? 17.481  13.223  40.601  1.00 74.84  ? 295 GLU B O   1 
ATOM   4635 C CB  . GLU B 1 260 ? 20.300  13.645  41.413  1.00 74.22  ? 295 GLU B CB  1 
ATOM   4636 C CG  . GLU B 1 260 ? 20.643  12.240  40.930  1.00 74.22  ? 295 GLU B CG  1 
ATOM   4637 C CD  . GLU B 1 260 ? 21.515  11.474  41.908  1.00 74.22  ? 295 GLU B CD  1 
ATOM   4638 O OE1 . GLU B 1 260 ? 21.182  11.450  43.111  1.00 74.22  ? 295 GLU B OE1 1 
ATOM   4639 O OE2 . GLU B 1 260 ? 22.528  10.888  41.471  1.00 74.22  ? 295 GLU B OE2 1 
ATOM   4640 N N   . MET B 1 261 ? 18.349  13.456  38.525  1.00 37.28  ? 296 MET B N   1 
ATOM   4641 C CA  . MET B 1 261 ? 17.335  12.642  37.855  1.00 37.28  ? 296 MET B CA  1 
ATOM   4642 C C   . MET B 1 261 ? 18.155  11.533  37.175  1.00 37.28  ? 296 MET B C   1 
ATOM   4643 O O   . MET B 1 261 ? 18.963  10.873  37.835  1.00 37.28  ? 296 MET B O   1 
ATOM   4644 C CB  . MET B 1 261 ? 16.590  13.466  36.800  1.00 21.72  ? 296 MET B CB  1 
ATOM   4645 C CG  . MET B 1 261 ? 15.612  14.483  37.378  1.00 21.72  ? 296 MET B CG  1 
ATOM   4646 S SD  . MET B 1 261 ? 14.711  15.447  36.138  1.00 21.72  ? 296 MET B SD  1 
ATOM   4647 C CE  . MET B 1 261 ? 15.359  17.054  36.457  1.00 21.72  ? 296 MET B CE  1 
ATOM   4648 N N   . HIS B 1 262 ? 17.967  11.301  35.880  1.00 23.67  ? 297 HIS B N   1 
ATOM   4649 C CA  . HIS B 1 262 ? 18.791  10.287  35.211  1.00 23.67  ? 297 HIS B CA  1 
ATOM   4650 C C   . HIS B 1 262 ? 20.194  10.892  35.265  1.00 23.67  ? 297 HIS B C   1 
ATOM   4651 O O   . HIS B 1 262 ? 21.186  10.244  35.634  1.00 23.67  ? 297 HIS B O   1 
ATOM   4652 C CB  . HIS B 1 262 ? 18.398  10.100  33.752  1.00 29.59  ? 297 HIS B CB  1 
ATOM   4653 C CG  . HIS B 1 262 ? 19.484  9.488   32.925  1.00 29.59  ? 297 HIS B CG  1 
ATOM   4654 N ND1 . HIS B 1 262 ? 20.144  8.340   33.302  1.00 29.59  ? 297 HIS B ND1 1 
ATOM   4655 C CD2 . HIS B 1 262 ? 20.048  9.881   31.761  1.00 29.59  ? 297 HIS B CD2 1 
ATOM   4656 C CE1 . HIS B 1 262 ? 21.071  8.053   32.407  1.00 29.59  ? 297 HIS B CE1 1 
ATOM   4657 N NE2 . HIS B 1 262 ? 21.034  8.973   31.462  1.00 29.59  ? 297 HIS B NE2 1 
ATOM   4658 N N   . HIS B 1 263 ? 20.238  12.170  34.908  1.00 49.04  ? 298 HIS B N   1 
ATOM   4659 C CA  . HIS B 1 263 ? 21.454  12.953  34.911  1.00 49.04  ? 298 HIS B CA  1 
ATOM   4660 C C   . HIS B 1 263 ? 21.170  14.004  35.950  1.00 49.04  ? 298 HIS B C   1 
ATOM   4661 O O   . HIS B 1 263 ? 20.021  14.193  36.332  1.00 49.04  ? 298 HIS B O   1 
ATOM   4662 C CB  . HIS B 1 263 ? 21.584  13.758  33.611  1.00 42.65  ? 298 HIS B CB  1 
ATOM   4663 C CG  . HIS B 1 263 ? 22.423  13.134  32.544  1.00 42.65  ? 298 HIS B CG  1 
ATOM   4664 N ND1 . HIS B 1 263 ? 22.173  11.884  32.025  1.00 42.65  ? 298 HIS B ND1 1 
ATOM   4665 C CD2 . HIS B 1 263 ? 23.448  13.642  31.820  1.00 42.65  ? 298 HIS B CD2 1 
ATOM   4666 C CE1 . HIS B 1 263 ? 23.005  11.648  31.027  1.00 42.65  ? 298 HIS B CE1 1 
ATOM   4667 N NE2 . HIS B 1 263 ? 23.789  12.700  30.882  1.00 42.65  ? 298 HIS B NE2 1 
ATOM   4668 N N   . TRP B 1 264 ? 22.215  14.681  36.408  1.00 29.74  ? 299 TRP B N   1 
ATOM   4669 C CA  . TRP B 1 264 ? 22.045  15.765  37.350  1.00 29.74  ? 299 TRP B CA  1 
ATOM   4670 C C   . TRP B 1 264 ? 21.644  16.963  36.494  1.00 29.74  ? 299 TRP B C   1 
ATOM   4671 O O   . TRP B 1 264 ? 21.989  17.051  35.304  1.00 29.74  ? 299 TRP B O   1 
ATOM   4672 C CB  . TRP B 1 264 ? 23.339  16.089  38.100  1.00 37.12  ? 299 TRP B CB  1 
ATOM   4673 C CG  . TRP B 1 264 ? 23.505  15.330  39.377  1.00 37.12  ? 299 TRP B CG  1 
ATOM   4674 C CD1 . TRP B 1 264 ? 23.959  14.060  39.515  1.00 37.12  ? 299 TRP B CD1 1 
ATOM   4675 C CD2 . TRP B 1 264 ? 23.201  15.793  40.700  1.00 37.12  ? 299 TRP B CD2 1 
ATOM   4676 N NE1 . TRP B 1 264 ? 23.962  13.698  40.836  1.00 37.12  ? 299 TRP B NE1 1 
ATOM   4677 C CE2 . TRP B 1 264 ? 23.502  14.744  41.586  1.00 37.12  ? 299 TRP B CE2 1 
ATOM   4678 C CE3 . TRP B 1 264 ? 22.707  16.993  41.220  1.00 37.12  ? 299 TRP B CE3 1 
ATOM   4679 C CZ2 . TRP B 1 264 ? 23.321  14.852  42.966  1.00 37.12  ? 299 TRP B CZ2 1 
ATOM   4680 C CZ3 . TRP B 1 264 ? 22.528  17.100  42.598  1.00 37.12  ? 299 TRP B CZ3 1 
ATOM   4681 C CH2 . TRP B 1 264 ? 22.837  16.035  43.452  1.00 37.12  ? 299 TRP B CH2 1 
ATOM   4682 N N   . CYS B 1 265 ? 20.939  17.908  37.088  1.00 32.87  ? 300 CYS B N   1 
ATOM   4683 C CA  . CYS B 1 265 ? 20.525  19.048  36.317  1.00 32.87  ? 300 CYS B CA  1 
ATOM   4684 C C   . CYS B 1 265 ? 20.404  20.277  37.185  1.00 32.87  ? 300 CYS B C   1 
ATOM   4685 O O   . CYS B 1 265 ? 19.912  20.224  38.320  1.00 32.87  ? 300 CYS B O   1 
ATOM   4686 C CB  . CYS B 1 265 ? 19.156  18.767  35.684  1.00 46.97  ? 300 CYS B CB  1 
ATOM   4687 S SG  . CYS B 1 265 ? 18.137  20.268  35.505  1.00 46.97  ? 300 CYS B SG  1 
ATOM   4688 N N   . ILE B 1 266 ? 20.896  21.385  36.653  1.00 39.75  ? 301 ILE B N   1 
ATOM   4689 C CA  . ILE B 1 266 ? 20.793  22.666  37.343  1.00 39.75  ? 301 ILE B CA  1 
ATOM   4690 C C   . ILE B 1 266 ? 19.776  23.357  36.451  1.00 39.75  ? 301 ILE B C   1 
ATOM   4691 O O   . ILE B 1 266 ? 20.109  23.844  35.383  1.00 39.75  ? 301 ILE B O   1 
ATOM   4692 C CB  . ILE B 1 266 ? 22.123  23.467  37.348  1.00 1.00   ? 301 ILE B CB  1 
ATOM   4693 C CG1 . ILE B 1 266 ? 23.205  22.697  38.107  1.00 1.00   ? 301 ILE B CG1 1 
ATOM   4694 C CG2 . ILE B 1 266 ? 21.907  24.808  38.016  1.00 1.00   ? 301 ILE B CG2 1 
ATOM   4695 C CD1 . ILE B 1 266 ? 24.535  23.407  38.169  1.00 57.14  ? 301 ILE B CD1 1 
ATOM   4696 N N   . PRO B 1 267 ? 18.510  23.385  36.877  1.00 38.80  ? 302 PRO B N   1 
ATOM   4697 C CA  . PRO B 1 267 ? 17.468  24.016  36.066  1.00 38.80  ? 302 PRO B CA  1 
ATOM   4698 C C   . PRO B 1 267 ? 17.628  25.541  35.935  1.00 38.80  ? 302 PRO B C   1 
ATOM   4699 O O   . PRO B 1 267 ? 18.063  26.214  36.867  1.00 38.80  ? 302 PRO B O   1 
ATOM   4700 C CB  . PRO B 1 267 ? 16.204  23.674  36.818  1.00 6.73   ? 302 PRO B CB  1 
ATOM   4701 C CG  . PRO B 1 267 ? 16.533  22.404  37.471  1.00 6.73   ? 302 PRO B CG  1 
ATOM   4702 C CD  . PRO B 1 267 ? 17.907  22.657  37.996  1.00 6.73   ? 302 PRO B CD  1 
ATOM   4703 N N   . PHE B 1 268 ? 17.283  26.077  34.767  1.00 17.14  ? 303 PHE B N   1 
ATOM   4704 C CA  . PHE B 1 268 ? 17.379  27.500  34.549  1.00 17.14  ? 303 PHE B CA  1 
ATOM   4705 C C   . PHE B 1 268 ? 16.221  28.002  33.697  1.00 17.14  ? 303 PHE B C   1 
ATOM   4706 O O   . PHE B 1 268 ? 15.650  27.264  32.890  1.00 17.14  ? 303 PHE B O   1 
ATOM   4707 C CB  . PHE B 1 268 ? 18.704  27.824  33.859  1.00 16.40  ? 303 PHE B CB  1 
ATOM   4708 C CG  . PHE B 1 268 ? 18.736  27.480  32.391  1.00 16.40  ? 303 PHE B CG  1 
ATOM   4709 C CD1 . PHE B 1 268 ? 18.218  28.359  31.439  1.00 16.40  ? 303 PHE B CD1 1 
ATOM   4710 C CD2 . PHE B 1 268 ? 19.304  26.290  31.955  1.00 16.40  ? 303 PHE B CD2 1 
ATOM   4711 C CE1 . PHE B 1 268 ? 18.267  28.056  30.083  1.00 16.40  ? 303 PHE B CE1 1 
ATOM   4712 C CE2 . PHE B 1 268 ? 19.357  25.982  30.597  1.00 16.40  ? 303 PHE B CE2 1 
ATOM   4713 C CZ  . PHE B 1 268 ? 18.839  26.867  29.663  1.00 16.40  ? 303 PHE B CZ  1 
ATOM   4714 N N   . SER B 1 269 ? 15.867  29.263  33.902  1.00 86.61  ? 304 SER B N   1 
ATOM   4715 C CA  . SER B 1 269 ? 14.809  29.894  33.138  1.00 86.61  ? 304 SER B CA  1 
ATOM   4716 C C   . SER B 1 269 ? 15.392  31.236  32.731  1.00 86.61  ? 304 SER B C   1 
ATOM   4717 O O   . SER B 1 269 ? 15.915  31.974  33.575  1.00 86.61  ? 304 SER B O   1 
ATOM   4718 C CB  . SER B 1 269 ? 13.579  30.093  34.007  1.00 15.02  ? 304 SER B CB  1 
ATOM   4719 O OG  . SER B 1 269 ? 13.027  28.845  34.346  1.00 15.02  ? 304 SER B OG  1 
ATOM   4720 N N   . VAL B 1 270 ? 15.311  31.540  31.438  1.00 18.93  ? 305 VAL B N   1 
ATOM   4721 C CA  . VAL B 1 270 ? 15.868  32.783  30.904  1.00 18.93  ? 305 VAL B CA  1 
ATOM   4722 C C   . VAL B 1 270 ? 14.946  33.455  29.874  1.00 18.93  ? 305 VAL B C   1 
ATOM   4723 O O   . VAL B 1 270 ? 14.388  32.791  29.006  1.00 18.93  ? 305 VAL B O   1 
ATOM   4724 C CB  . VAL B 1 270 ? 17.261  32.540  30.283  1.00 24.80  ? 305 VAL B CB  1 
ATOM   4725 C CG1 . VAL B 1 270 ? 17.154  31.582  29.108  1.00 24.80  ? 305 VAL B CG1 1 
ATOM   4726 C CG2 . VAL B 1 270 ? 17.876  33.859  29.858  1.00 24.80  ? 305 VAL B CG2 1 
ATOM   4727 N N   . ASP B 1 271 ? 14.785  34.771  29.983  1.00 55.66  ? 306 ASP B N   1 
ATOM   4728 C CA  . ASP B 1 271 ? 13.941  35.538  29.057  1.00 55.66  ? 306 ASP B CA  1 
ATOM   4729 C C   . ASP B 1 271 ? 14.734  36.722  28.512  1.00 55.66  ? 306 ASP B C   1 
ATOM   4730 O O   . ASP B 1 271 ? 15.847  36.992  28.961  1.00 55.66  ? 306 ASP B O   1 
ATOM   4731 C CB  . ASP B 1 271 ? 12.714  36.051  29.820  1.00 78.89  ? 306 ASP B CB  1 
ATOM   4732 C CG  . ASP B 1 271 ? 11.566  36.445  28.912  1.00 78.89  ? 306 ASP B CG  1 
ATOM   4733 O OD1 . ASP B 1 271 ? 11.816  36.996  27.828  1.00 78.89  ? 306 ASP B OD1 1 
ATOM   4734 O OD2 . ASP B 1 271 ? 10.401  36.221  29.294  1.00 78.89  ? 306 ASP B OD2 1 
ATOM   4735 N N   . GLY B 1 272 ? 14.145  37.444  27.566  1.00 37.16  ? 307 GLY B N   1 
ATOM   4736 C CA  . GLY B 1 272 ? 14.822  38.586  26.981  1.00 37.16  ? 307 GLY B CA  1 
ATOM   4737 C C   . GLY B 1 272 ? 14.581  38.655  25.490  1.00 37.16  ? 307 GLY B C   1 
ATOM   4738 O O   . GLY B 1 272 ? 14.461  37.628  24.830  1.00 37.16  ? 307 GLY B O   1 
ATOM   4739 N N   . GLN B 1 273 ? 14.494  39.865  24.951  1.00 37.70  ? 308 GLN B N   1 
ATOM   4740 C CA  . GLN B 1 273 ? 14.278  40.040  23.520  1.00 37.70  ? 308 GLN B CA  1 
ATOM   4741 C C   . GLN B 1 273 ? 15.078  41.231  23.066  1.00 37.70  ? 308 GLN B C   1 
ATOM   4742 O O   . GLN B 1 273 ? 14.857  42.339  23.545  1.00 37.70  ? 308 GLN B O   1 
ATOM   4743 C CB  . GLN B 1 273 ? 12.802  40.243  23.199  1.00 79.48  ? 308 GLN B CB  1 
ATOM   4744 C CG  . GLN B 1 273 ? 12.281  39.283  22.147  1.00 79.48  ? 308 GLN B CG  1 
ATOM   4745 C CD  . GLN B 1 273 ? 13.150  39.253  20.908  1.00 79.48  ? 308 GLN B CD  1 
ATOM   4746 O OE1 . GLN B 1 273 ? 13.330  40.265  20.236  1.00 79.48  ? 308 GLN B OE1 1 
ATOM   4747 N NE2 . GLN B 1 273 ? 13.697  38.087  20.600  1.00 79.48  ? 308 GLN B NE2 1 
ATOM   4748 N N   . PRO B 1 274 ? 16.057  41.017  22.165  1.00 85.10  ? 309 PRO B N   1 
ATOM   4749 C CA  . PRO B 1 274 ? 16.423  39.714  21.584  1.00 85.10  ? 309 PRO B CA  1 
ATOM   4750 C C   . PRO B 1 274 ? 16.737  38.604  22.607  1.00 85.10  ? 309 PRO B C   1 
ATOM   4751 O O   . PRO B 1 274 ? 17.104  38.872  23.749  1.00 85.10  ? 309 PRO B O   1 
ATOM   4752 C CB  . PRO B 1 274 ? 17.644  40.046  20.730  1.00 58.54  ? 309 PRO B CB  1 
ATOM   4753 C CG  . PRO B 1 274 ? 17.398  41.434  20.327  1.00 58.54  ? 309 PRO B CG  1 
ATOM   4754 C CD  . PRO B 1 274 ? 16.927  42.066  21.613  1.00 58.54  ? 309 PRO B CD  1 
ATOM   4755 N N   . ALA B 1 275 ? 16.583  37.353  22.189  1.00 48.48  ? 310 ALA B N   1 
ATOM   4756 C CA  . ALA B 1 275 ? 16.880  36.229  23.068  1.00 48.48  ? 310 ALA B CA  1 
ATOM   4757 C C   . ALA B 1 275 ? 18.361  36.328  23.412  1.00 48.48  ? 310 ALA B C   1 
ATOM   4758 O O   . ALA B 1 275 ? 19.206  36.609  22.538  1.00 48.48  ? 310 ALA B O   1 
ATOM   4759 C CB  . ALA B 1 275 ? 16.600  34.923  22.355  1.00 15.70  ? 310 ALA B CB  1 
ATOM   4760 N N   . PRO B 1 276 ? 18.711  36.101  24.687  1.00 41.33  ? 311 PRO B N   1 
ATOM   4761 C CA  . PRO B 1 276 ? 20.128  36.197  25.045  1.00 41.33  ? 311 PRO B CA  1 
ATOM   4762 C C   . PRO B 1 276 ? 21.024  34.980  24.723  1.00 41.33  ? 311 PRO B C   1 
ATOM   4763 O O   . PRO B 1 276 ? 20.548  33.838  24.556  1.00 41.33  ? 311 PRO B O   1 
ATOM   4764 C CB  . PRO B 1 276 ? 20.071  36.467  26.542  1.00 42.98  ? 311 PRO B CB  1 
ATOM   4765 C CG  . PRO B 1 276 ? 18.913  35.623  26.960  1.00 42.98  ? 311 PRO B CG  1 
ATOM   4766 C CD  . PRO B 1 276 ? 17.879  35.912  25.888  1.00 42.98  ? 311 PRO B CD  1 
ATOM   4767 N N   . SER B 1 277 ? 22.326  35.239  24.604  1.00 47.76  ? 312 SER B N   1 
ATOM   4768 C CA  . SER B 1 277 ? 23.270  34.168  24.358  1.00 47.76  ? 312 SER B CA  1 
ATOM   4769 C C   . SER B 1 277 ? 23.628  33.752  25.786  1.00 47.76  ? 312 SER B C   1 
ATOM   4770 O O   . SER B 1 277 ? 23.650  34.592  26.690  1.00 47.76  ? 312 SER B O   1 
ATOM   4771 C CB  . SER B 1 277 ? 24.510  34.706  23.648  1.00 149.27 ? 312 SER B CB  1 
ATOM   4772 O OG  . SER B 1 277 ? 25.120  35.729  24.416  1.00 149.27 ? 312 SER B OG  1 
ATOM   4773 N N   . LEU B 1 278 ? 23.891  32.463  25.981  1.00 47.64  ? 313 LEU B N   1 
ATOM   4774 C CA  . LEU B 1 278 ? 24.192  31.938  27.296  1.00 47.64  ? 313 LEU B CA  1 
ATOM   4775 C C   . LEU B 1 278 ? 25.625  31.524  27.456  1.00 47.64  ? 313 LEU B C   1 
ATOM   4776 O O   . LEU B 1 278 ? 26.266  31.091  26.497  1.00 47.64  ? 313 LEU B O   1 
ATOM   4777 C CB  . LEU B 1 278 ? 23.305  30.734  27.630  1.00 10.77  ? 313 LEU B CB  1 
ATOM   4778 C CG  . LEU B 1 278 ? 22.034  30.980  28.442  1.00 10.77  ? 313 LEU B CG  1 
ATOM   4779 C CD1 . LEU B 1 278 ? 20.995  31.667  27.578  1.00 10.77  ? 313 LEU B CD1 1 
ATOM   4780 C CD2 . LEU B 1 278 ? 21.499  29.655  28.957  1.00 10.77  ? 313 LEU B CD2 1 
ATOM   4781 N N   . ARG B 1 279 ? 26.115  31.650  28.684  1.00 22.77  ? 314 ARG B N   1 
ATOM   4782 C CA  . ARG B 1 279 ? 27.473  31.240  29.039  1.00 22.77  ? 314 ARG B CA  1 
ATOM   4783 C C   . ARG B 1 279 ? 27.454  30.885  30.526  1.00 22.77  ? 314 ARG B C   1 
ATOM   4784 O O   . ARG B 1 279 ? 26.762  31.537  31.320  1.00 22.77  ? 314 ARG B O   1 
ATOM   4785 C CB  . ARG B 1 279 ? 28.444  32.397  28.793  1.00 200.00 ? 314 ARG B CB  1 
ATOM   4786 C CG  . ARG B 1 279 ? 29.886  32.107  29.170  1.00 200.00 ? 314 ARG B CG  1 
ATOM   4787 C CD  . ARG B 1 279 ? 30.744  33.359  29.036  1.00 200.00 ? 314 ARG B CD  1 
ATOM   4788 N NE  . ARG B 1 279 ? 30.288  34.428  29.922  1.00 200.00 ? 314 ARG B NE  1 
ATOM   4789 C CZ  . ARG B 1 279 ? 30.848  35.631  29.995  1.00 200.00 ? 314 ARG B CZ  1 
ATOM   4790 N NH1 . ARG B 1 279 ? 31.892  35.930  29.233  1.00 200.00 ? 314 ARG B NH1 1 
ATOM   4791 N NH2 . ARG B 1 279 ? 30.364  36.538  30.833  1.00 200.00 ? 314 ARG B NH2 1 
ATOM   4792 N N   . TRP B 1 280 ? 28.215  29.852  30.892  1.00 41.78  ? 315 TRP B N   1 
ATOM   4793 C CA  . TRP B 1 280 ? 28.285  29.369  32.273  1.00 41.78  ? 315 TRP B CA  1 
ATOM   4794 C C   . TRP B 1 280 ? 29.642  29.609  32.923  1.00 41.78  ? 315 TRP B C   1 
ATOM   4795 O O   . TRP B 1 280 ? 30.672  29.692  32.253  1.00 41.78  ? 315 TRP B O   1 
ATOM   4796 C CB  . TRP B 1 280 ? 27.979  27.869  32.337  1.00 32.08  ? 315 TRP B CB  1 
ATOM   4797 C CG  . TRP B 1 280 ? 26.531  27.520  32.227  1.00 32.08  ? 315 TRP B CG  1 
ATOM   4798 C CD1 . TRP B 1 280 ? 25.800  27.403  31.085  1.00 32.08  ? 315 TRP B CD1 1 
ATOM   4799 C CD2 . TRP B 1 280 ? 25.631  27.260  33.309  1.00 32.08  ? 315 TRP B CD2 1 
ATOM   4800 N NE1 . TRP B 1 280 ? 24.498  27.086  31.387  1.00 32.08  ? 315 TRP B NE1 1 
ATOM   4801 C CE2 . TRP B 1 280 ? 24.367  26.993  32.746  1.00 32.08  ? 315 TRP B CE2 1 
ATOM   4802 C CE3 . TRP B 1 280 ? 25.770  27.229  34.702  1.00 32.08  ? 315 TRP B CE3 1 
ATOM   4803 C CZ2 . TRP B 1 280 ? 23.247  26.697  33.527  1.00 32.08  ? 315 TRP B CZ2 1 
ATOM   4804 C CZ3 . TRP B 1 280 ? 24.657  26.935  35.478  1.00 32.08  ? 315 TRP B CZ3 1 
ATOM   4805 C CH2 . TRP B 1 280 ? 23.412  26.673  34.887  1.00 32.08  ? 315 TRP B CH2 1 
ATOM   4806 N N   . LEU B 1 281 ? 29.640  29.714  34.240  1.00 68.21  ? 316 LEU B N   1 
ATOM   4807 C CA  . LEU B 1 281 ? 30.893  29.861  34.963  1.00 68.21  ? 316 LEU B CA  1 
ATOM   4808 C C   . LEU B 1 281 ? 30.874  28.822  36.066  1.00 68.21  ? 316 LEU B C   1 
ATOM   4809 O O   . LEU B 1 281 ? 29.807  28.475  36.595  1.00 68.21  ? 316 LEU B O   1 
ATOM   4810 C CB  . LEU B 1 281 ? 31.020  31.262  35.570  1.00 63.73  ? 316 LEU B CB  1 
ATOM   4811 C CG  . LEU B 1 281 ? 31.219  32.439  34.609  1.00 63.73  ? 316 LEU B CG  1 
ATOM   4812 C CD1 . LEU B 1 281 ? 31.335  33.727  35.405  1.00 63.73  ? 316 LEU B CD1 1 
ATOM   4813 C CD2 . LEU B 1 281 ? 32.470  32.224  33.772  1.00 63.73  ? 316 LEU B CD2 1 
ATOM   4814 N N   . PHE B 1 282 ? 32.051  28.311  36.398  1.00 72.59  ? 317 PHE B N   1 
ATOM   4815 C CA  . PHE B 1 282 ? 32.160  27.385  37.501  1.00 72.59  ? 317 PHE B CA  1 
ATOM   4816 C C   . PHE B 1 282 ? 33.229  27.989  38.411  1.00 72.59  ? 317 PHE B C   1 
ATOM   4817 O O   . PHE B 1 282 ? 34.417  28.054  38.063  1.00 72.59  ? 317 PHE B O   1 
ATOM   4818 C CB  . PHE B 1 282 ? 32.610  26.007  37.009  1.00 61.86  ? 317 PHE B CB  1 
ATOM   4819 C CG  . PHE B 1 282 ? 32.946  25.045  38.116  1.00 61.86  ? 317 PHE B CG  1 
ATOM   4820 C CD1 . PHE B 1 282 ? 32.081  24.869  39.192  1.00 61.86  ? 317 PHE B CD1 1 
ATOM   4821 C CD2 . PHE B 1 282 ? 34.122  24.302  38.075  1.00 61.86  ? 317 PHE B CD2 1 
ATOM   4822 C CE1 . PHE B 1 282 ? 32.383  23.967  40.209  1.00 61.86  ? 317 PHE B CE1 1 
ATOM   4823 C CE2 . PHE B 1 282 ? 34.431  23.396  39.089  1.00 61.86  ? 317 PHE B CE2 1 
ATOM   4824 C CZ  . PHE B 1 282 ? 33.561  23.230  40.155  1.00 61.86  ? 317 PHE B CZ  1 
ATOM   4825 N N   . ASN B 1 283 ? 32.775  28.464  39.567  1.00 98.45  ? 318 ASN B N   1 
ATOM   4826 C CA  . ASN B 1 283 ? 33.632  29.092  40.561  1.00 98.45  ? 318 ASN B CA  1 
ATOM   4827 C C   . ASN B 1 283 ? 34.248  30.369  40.007  1.00 98.45  ? 318 ASN B C   1 
ATOM   4828 O O   . ASN B 1 283 ? 35.418  30.648  40.250  1.00 98.45  ? 318 ASN B O   1 
ATOM   4829 C CB  . ASN B 1 283 ? 34.771  28.150  40.987  1.00 58.77  ? 318 ASN B CB  1 
ATOM   4830 C CG  . ASN B 1 283 ? 34.366  27.193  42.085  1.00 58.77  ? 318 ASN B CG  1 
ATOM   4831 O OD1 . ASN B 1 283 ? 33.915  27.609  43.146  1.00 58.77  ? 318 ASN B OD1 1 
ATOM   4832 N ND2 . ASN B 1 283 ? 34.539  25.904  41.839  1.00 58.77  ? 318 ASN B ND2 1 
ATOM   4833 N N   . GLY B 1 284 ? 33.450  31.123  39.249  1.00 66.75  ? 319 GLY B N   1 
ATOM   4834 C CA  . GLY B 1 284 ? 33.906  32.384  38.681  1.00 66.75  ? 319 GLY B CA  1 
ATOM   4835 C C   . GLY B 1 284 ? 34.682  32.359  37.378  1.00 66.75  ? 319 GLY B C   1 
ATOM   4836 O O   . GLY B 1 284 ? 34.937  33.397  36.788  1.00 66.75  ? 319 GLY B O   1 
ATOM   4837 N N   . SER B 1 285 ? 35.046  31.181  36.908  1.00 38.81  ? 320 SER B N   1 
ATOM   4838 C CA  . SER B 1 285 ? 35.800  31.079  35.668  1.00 38.81  ? 320 SER B CA  1 
ATOM   4839 C C   . SER B 1 285 ? 34.995  30.370  34.573  1.00 38.81  ? 320 SER B C   1 
ATOM   4840 O O   . SER B 1 285 ? 34.074  29.597  34.864  1.00 38.81  ? 320 SER B O   1 
ATOM   4841 C CB  . SER B 1 285 ? 37.105  30.314  35.914  1.00 117.03 ? 320 SER B CB  1 
ATOM   4842 O OG  . SER B 1 285 ? 37.829  30.121  34.710  1.00 117.03 ? 320 SER B OG  1 
ATOM   4843 N N   . VAL B 1 286 ? 35.348  30.626  33.315  1.00 35.15  ? 321 VAL B N   1 
ATOM   4844 C CA  . VAL B 1 286 ? 34.635  30.011  32.206  1.00 35.15  ? 321 VAL B CA  1 
ATOM   4845 C C   . VAL B 1 286 ? 34.563  28.495  32.317  1.00 35.15  ? 321 VAL B C   1 
ATOM   4846 O O   . VAL B 1 286 ? 35.557  27.818  32.607  1.00 35.15  ? 321 VAL B O   1 
ATOM   4847 C CB  . VAL B 1 286 ? 35.283  30.379  30.851  1.00 35.62  ? 321 VAL B CB  1 
ATOM   4848 C CG1 . VAL B 1 286 ? 35.420  31.885  30.734  1.00 35.62  ? 321 VAL B CG1 1 
ATOM   4849 C CG2 . VAL B 1 286 ? 36.635  29.704  30.708  1.00 35.62  ? 321 VAL B CG2 1 
ATOM   4850 N N   . LEU B 1 287 ? 33.359  27.978  32.093  1.00 52.12  ? 322 LEU B N   1 
ATOM   4851 C CA  . LEU B 1 287 ? 33.100  26.552  32.133  1.00 52.12  ? 322 LEU B CA  1 
ATOM   4852 C C   . LEU B 1 287 ? 32.869  26.142  30.687  1.00 52.12  ? 322 LEU B C   1 
ATOM   4853 O O   . LEU B 1 287 ? 31.915  26.596  30.059  1.00 52.12  ? 322 LEU B O   1 
ATOM   4854 C CB  . LEU B 1 287 ? 31.849  26.246  32.955  1.00 48.25  ? 322 LEU B CB  1 
ATOM   4855 C CG  . LEU B 1 287 ? 31.362  24.796  32.872  1.00 48.25  ? 322 LEU B CG  1 
ATOM   4856 C CD1 . LEU B 1 287 ? 32.465  23.855  33.327  1.00 48.25  ? 322 LEU B CD1 1 
ATOM   4857 C CD2 . LEU B 1 287 ? 30.123  24.619  33.730  1.00 48.25  ? 322 LEU B CD2 1 
ATOM   4858 N N   . ASN B 1 288 ? 33.747  25.311  30.135  1.00 59.94  ? 323 ASN B N   1 
ATOM   4859 C CA  . ASN B 1 288 ? 33.574  24.870  28.751  1.00 59.94  ? 323 ASN B CA  1 
ATOM   4860 C C   . ASN B 1 288 ? 32.760  23.595  28.732  1.00 59.94  ? 323 ASN B C   1 
ATOM   4861 O O   . ASN B 1 288 ? 33.119  22.596  29.370  1.00 59.94  ? 323 ASN B O   1 
ATOM   4862 C CB  . ASN B 1 288 ? 34.938  24.613  28.110  1.00 195.19 ? 323 ASN B CB  1 
ATOM   4863 C CG  . ASN B 1 288 ? 35.889  25.780  28.279  1.00 195.19 ? 323 ASN B CG  1 
ATOM   4864 O OD1 . ASN B 1 288 ? 35.621  26.887  27.813  1.00 195.19 ? 323 ASN B OD1 1 
ATOM   4865 N ND2 . ASN B 1 288 ? 37.007  25.538  28.953  1.00 195.19 ? 323 ASN B ND2 1 
ATOM   4866 N N   . GLU B 1 289 ? 31.666  23.623  27.986  1.00 54.54  ? 324 GLU B N   1 
ATOM   4867 C CA  . GLU B 1 289 ? 30.800  22.467  27.931  1.00 54.54  ? 324 GLU B CA  1 
ATOM   4868 C C   . GLU B 1 289 ? 31.474  21.299  27.209  1.00 54.54  ? 324 GLU B C   1 
ATOM   4869 O O   . GLU B 1 289 ? 32.314  21.508  26.330  1.00 54.54  ? 324 GLU B O   1 
ATOM   4870 C CB  . GLU B 1 289 ? 29.502  22.828  27.205  1.00 70.06  ? 324 GLU B CB  1 
ATOM   4871 C CG  . GLU B 1 289 ? 28.626  23.816  27.950  1.00 70.06  ? 324 GLU B CG  1 
ATOM   4872 C CD  . GLU B 1 289 ? 27.526  24.379  27.082  1.00 70.06  ? 324 GLU B CD  1 
ATOM   4873 O OE1 . GLU B 1 289 ? 26.832  23.586  26.415  1.00 70.06  ? 324 GLU B OE1 1 
ATOM   4874 O OE2 . GLU B 1 289 ? 27.356  25.615  27.071  1.00 70.06  ? 324 GLU B OE2 1 
ATOM   4875 N N   . THR B 1 290 ? 31.134  20.081  27.632  1.00 46.17  ? 325 THR B N   1 
ATOM   4876 C CA  . THR B 1 290 ? 31.701  18.844  27.083  1.00 46.17  ? 325 THR B CA  1 
ATOM   4877 C C   . THR B 1 290 ? 30.551  17.899  26.748  1.00 46.17  ? 325 THR B C   1 
ATOM   4878 O O   . THR B 1 290 ? 29.393  18.312  26.670  1.00 46.17  ? 325 THR B O   1 
ATOM   4879 C CB  . THR B 1 290 ? 32.623  18.173  28.101  1.00 67.16  ? 325 THR B CB  1 
ATOM   4880 O OG1 . THR B 1 290 ? 31.844  17.553  29.131  1.00 67.16  ? 325 THR B OG1 1 
ATOM   4881 C CG2 . THR B 1 290 ? 33.516  19.212  28.740  1.00 67.16  ? 325 THR B CG2 1 
ATOM   4882 N N   . SER B 1 291 ? 30.868  16.628  26.539  1.00 31.22  ? 326 SER B N   1 
ATOM   4883 C CA  . SER B 1 291 ? 29.828  15.648  26.254  1.00 31.22  ? 326 SER B CA  1 
ATOM   4884 C C   . SER B 1 291 ? 29.176  15.239  27.587  1.00 31.22  ? 326 SER B C   1 
ATOM   4885 O O   . SER B 1 291 ? 28.071  14.693  27.608  1.00 31.22  ? 326 SER B O   1 
ATOM   4886 C CB  . SER B 1 291 ? 30.429  14.417  25.571  1.00 16.37  ? 326 SER B CB  1 
ATOM   4887 O OG  . SER B 1 291 ? 31.388  13.785  26.398  1.00 16.37  ? 326 SER B OG  1 
ATOM   4888 N N   . PHE B 1 292 ? 29.856  15.528  28.695  1.00 28.57  ? 327 PHE B N   1 
ATOM   4889 C CA  . PHE B 1 292 ? 29.344  15.188  30.017  1.00 28.57  ? 327 PHE B CA  1 
ATOM   4890 C C   . PHE B 1 292 ? 28.788  16.359  30.834  1.00 28.57  ? 327 PHE B C   1 
ATOM   4891 O O   . PHE B 1 292 ? 28.096  16.143  31.838  1.00 28.57  ? 327 PHE B O   1 
ATOM   4892 C CB  . PHE B 1 292 ? 30.441  14.465  30.792  1.00 72.77  ? 327 PHE B CB  1 
ATOM   4893 C CG  . PHE B 1 292 ? 30.997  13.284  30.056  1.00 72.77  ? 327 PHE B CG  1 
ATOM   4894 C CD1 . PHE B 1 292 ? 30.177  12.212  29.732  1.00 72.77  ? 327 PHE B CD1 1 
ATOM   4895 C CD2 . PHE B 1 292 ? 32.323  13.264  29.646  1.00 72.77  ? 327 PHE B CD2 1 
ATOM   4896 C CE1 . PHE B 1 292 ? 30.663  11.135  29.009  1.00 72.77  ? 327 PHE B CE1 1 
ATOM   4897 C CE2 . PHE B 1 292 ? 32.826  12.193  28.921  1.00 72.77  ? 327 PHE B CE2 1 
ATOM   4898 C CZ  . PHE B 1 292 ? 31.994  11.124  28.600  1.00 72.77  ? 327 PHE B CZ  1 
ATOM   4899 N N   . ILE B 1 293 ? 29.117  17.588  30.438  1.00 48.73  ? 328 ILE B N   1 
ATOM   4900 C CA  . ILE B 1 293 ? 28.570  18.758  31.114  1.00 48.73  ? 328 ILE B CA  1 
ATOM   4901 C C   . ILE B 1 293 ? 28.221  19.782  30.058  1.00 48.73  ? 328 ILE B C   1 
ATOM   4902 O O   . ILE B 1 293 ? 29.092  20.442  29.494  1.00 48.73  ? 328 ILE B O   1 
ATOM   4903 C CB  . ILE B 1 293 ? 29.580  19.394  32.088  1.00 35.41  ? 328 ILE B CB  1 
ATOM   4904 C CG1 . ILE B 1 293 ? 29.850  18.448  33.266  1.00 35.41  ? 328 ILE B CG1 1 
ATOM   4905 C CG2 . ILE B 1 293 ? 29.037  20.725  32.591  1.00 35.41  ? 328 ILE B CG2 1 
ATOM   4906 C CD1 . ILE B 1 293 ? 30.806  19.008  34.306  1.00 105.41 ? 328 ILE B CD1 1 
ATOM   4907 N N   . PHE B 1 294 ? 26.932  19.910  29.793  1.00 27.09  ? 329 PHE B N   1 
ATOM   4908 C CA  . PHE B 1 294 ? 26.471  20.812  28.761  1.00 27.09  ? 329 PHE B CA  1 
ATOM   4909 C C   . PHE B 1 294 ? 25.072  21.321  29.057  1.00 27.09  ? 329 PHE B C   1 
ATOM   4910 O O   . PHE B 1 294 ? 24.328  20.754  29.868  1.00 27.09  ? 329 PHE B O   1 
ATOM   4911 C CB  . PHE B 1 294 ? 26.403  20.048  27.447  1.00 55.17  ? 329 PHE B CB  1 
ATOM   4912 C CG  . PHE B 1 294 ? 25.500  18.847  27.518  1.00 55.17  ? 329 PHE B CG  1 
ATOM   4913 C CD1 . PHE B 1 294 ? 25.976  17.627  27.992  1.00 55.17  ? 329 PHE B CD1 1 
ATOM   4914 C CD2 . PHE B 1 294 ? 24.147  18.954  27.199  1.00 55.17  ? 329 PHE B CD2 1 
ATOM   4915 C CE1 . PHE B 1 294 ? 25.111  16.528  28.152  1.00 55.17  ? 329 PHE B CE1 1 
ATOM   4916 C CE2 . PHE B 1 294 ? 23.276  17.863  27.356  1.00 55.17  ? 329 PHE B CE2 1 
ATOM   4917 C CZ  . PHE B 1 294 ? 23.760  16.650  27.835  1.00 55.17  ? 329 PHE B CZ  1 
ATOM   4918 N N   . THR B 1 295 ? 24.729  22.385  28.337  1.00 49.50  ? 330 THR B N   1 
ATOM   4919 C CA  . THR B 1 295 ? 23.449  23.061  28.427  1.00 49.50  ? 330 THR B CA  1 
ATOM   4920 C C   . THR B 1 295 ? 22.426  22.394  27.531  1.00 49.50  ? 330 THR B C   1 
ATOM   4921 O O   . THR B 1 295 ? 22.697  22.055  26.388  1.00 49.50  ? 330 THR B O   1 
ATOM   4922 C CB  . THR B 1 295 ? 23.569  24.541  28.012  1.00 79.03  ? 330 THR B CB  1 
ATOM   4923 O OG1 . THR B 1 295 ? 24.519  25.201  28.858  1.00 79.03  ? 330 THR B OG1 1 
ATOM   4924 C CG2 . THR B 1 295 ? 22.220  25.238  28.129  1.00 79.03  ? 330 THR B CG2 1 
ATOM   4925 N N   . GLU B 1 296 ? 21.235  22.197  28.044  1.00 28.92  ? 331 GLU B N   1 
ATOM   4926 C CA  . GLU B 1 296 ? 20.219  21.610  27.229  1.00 28.92  ? 331 GLU B CA  1 
ATOM   4927 C C   . GLU B 1 296 ? 18.926  22.373  27.426  1.00 28.92  ? 331 GLU B C   1 
ATOM   4928 O O   . GLU B 1 296 ? 18.493  22.617  28.554  1.00 28.92  ? 331 GLU B O   1 
ATOM   4929 C CB  . GLU B 1 296 ? 20.006  20.129  27.544  1.00 121.38 ? 331 GLU B CB  1 
ATOM   4930 C CG  . GLU B 1 296 ? 19.226  19.426  26.433  1.00 121.38 ? 331 GLU B CG  1 
ATOM   4931 C CD  . GLU B 1 296 ? 18.971  17.956  26.697  1.00 121.38 ? 331 GLU B CD  1 
ATOM   4932 O OE1 . GLU B 1 296 ? 19.942  17.214  26.949  1.00 121.38 ? 331 GLU B OE1 1 
ATOM   4933 O OE2 . GLU B 1 296 ? 17.794  17.542  26.639  1.00 121.38 ? 331 GLU B OE2 1 
ATOM   4934 N N   . PHE B 1 297 ? 18.320  22.754  26.306  1.00 14.05  ? 332 PHE B N   1 
ATOM   4935 C CA  . PHE B 1 297 ? 17.077  23.510  26.291  1.00 14.05  ? 332 PHE B CA  1 
ATOM   4936 C C   . PHE B 1 297 ? 15.887  22.592  26.187  1.00 14.05  ? 332 PHE B C   1 
ATOM   4937 O O   . PHE B 1 297 ? 15.943  21.591  25.480  1.00 14.05  ? 332 PHE B O   1 
ATOM   4938 C CB  . PHE B 1 297 ? 17.056  24.495  25.122  1.00 46.78  ? 332 PHE B CB  1 
ATOM   4939 C CG  . PHE B 1 297 ? 17.791  25.777  25.394  1.00 46.78  ? 332 PHE B CG  1 
ATOM   4940 C CD1 . PHE B 1 297 ? 17.352  26.645  26.375  1.00 46.78  ? 332 PHE B CD1 1 
ATOM   4941 C CD2 . PHE B 1 297 ? 18.916  26.118  24.664  1.00 46.78  ? 332 PHE B CD2 1 
ATOM   4942 C CE1 . PHE B 1 297 ? 18.022  27.831  26.625  1.00 46.78  ? 332 PHE B CE1 1 
ATOM   4943 C CE2 . PHE B 1 297 ? 19.590  27.303  24.911  1.00 46.78  ? 332 PHE B CE2 1 
ATOM   4944 C CZ  . PHE B 1 297 ? 19.142  28.159  25.892  1.00 46.78  ? 332 PHE B CZ  1 
ATOM   4945 N N   . LEU B 1 298 ? 14.813  22.923  26.895  1.00 15.81  ? 333 LEU B N   1 
ATOM   4946 C CA  . LEU B 1 298 ? 13.603  22.132  26.803  1.00 15.81  ? 333 LEU B CA  1 
ATOM   4947 C C   . LEU B 1 298 ? 12.935  22.773  25.583  1.00 15.81  ? 333 LEU B C   1 
ATOM   4948 O O   . LEU B 1 298 ? 13.384  23.820  25.126  1.00 15.81  ? 333 LEU B O   1 
ATOM   4949 C CB  . LEU B 1 298 ? 12.707  22.342  28.012  1.00 15.03  ? 333 LEU B CB  1 
ATOM   4950 C CG  . LEU B 1 298 ? 13.011  21.533  29.254  1.00 15.03  ? 333 LEU B CG  1 
ATOM   4951 C CD1 . LEU B 1 298 ? 12.168  22.062  30.394  1.00 15.03  ? 333 LEU B CD1 1 
ATOM   4952 C CD2 . LEU B 1 298 ? 12.721  20.072  28.997  1.00 15.03  ? 333 LEU B CD2 1 
ATOM   4953 N N   . GLU B 1 299 ? 11.888  22.150  25.051  1.00 44.06  ? 334 GLU B N   1 
ATOM   4954 C CA  . GLU B 1 299 ? 11.187  22.696  23.889  1.00 44.06  ? 334 GLU B CA  1 
ATOM   4955 C C   . GLU B 1 299 ? 10.436  23.965  24.293  1.00 44.06  ? 334 GLU B C   1 
ATOM   4956 O O   . GLU B 1 299 ? 9.749   23.982  25.315  1.00 44.06  ? 334 GLU B O   1 
ATOM   4957 C CB  . GLU B 1 299 ? 10.190  21.664  23.358  1.00 191.45 ? 334 GLU B CB  1 
ATOM   4958 C CG  . GLU B 1 299 ? 9.657   21.951  21.968  1.00 191.45 ? 334 GLU B CG  1 
ATOM   4959 C CD  . GLU B 1 299 ? 10.673  21.644  20.886  1.00 191.45 ? 334 GLU B CD  1 
ATOM   4960 O OE1 . GLU B 1 299 ? 11.101  20.473  20.789  1.00 191.45 ? 334 GLU B OE1 1 
ATOM   4961 O OE2 . GLU B 1 299 ? 11.044  22.568  20.134  1.00 191.45 ? 334 GLU B OE2 1 
ATOM   4962 N N   . PRO B 1 300 ? 10.566  25.044  23.498  1.00 80.35  ? 335 PRO B N   1 
ATOM   4963 C CA  . PRO B 1 300 ? 9.890   26.309  23.802  1.00 80.35  ? 335 PRO B CA  1 
ATOM   4964 C C   . PRO B 1 300 ? 8.381   26.158  23.800  1.00 80.35  ? 335 PRO B C   1 
ATOM   4965 O O   . PRO B 1 300 ? 7.813   25.565  22.885  1.00 80.35  ? 335 PRO B O   1 
ATOM   4966 C CB  . PRO B 1 300 ? 10.352  27.213  22.679  1.00 44.84  ? 335 PRO B CB  1 
ATOM   4967 C CG  . PRO B 1 300 ? 10.398  26.265  21.527  1.00 44.84  ? 335 PRO B CG  1 
ATOM   4968 C CD  . PRO B 1 300 ? 11.104  25.063  22.130  1.00 44.84  ? 335 PRO B CD  1 
ATOM   4969 N N   . ALA B 1 301 ? 7.733   26.698  24.824  1.00 161.93 ? 336 ALA B N   1 
ATOM   4970 C CA  . ALA B 1 301 ? 6.284   26.608  24.924  1.00 161.93 ? 336 ALA B CA  1 
ATOM   4971 C C   . ALA B 1 301 ? 5.586   27.629  24.031  1.00 161.93 ? 336 ALA B C   1 
ATOM   4972 O O   . ALA B 1 301 ? 6.202   28.577  23.528  1.00 161.93 ? 336 ALA B O   1 
ATOM   4973 C CB  . ALA B 1 301 ? 5.851   26.799  26.377  1.00 131.02 ? 336 ALA B CB  1 
ATOM   4974 N N   . ALA B 1 302 ? 4.286   27.433  23.861  1.00 200.00 ? 337 ALA B N   1 
ATOM   4975 C CA  . ALA B 1 302 ? 3.474   28.304  23.027  1.00 200.00 ? 337 ALA B CA  1 
ATOM   4976 C C   . ALA B 1 302 ? 3.464   29.774  23.442  1.00 200.00 ? 337 ALA B C   1 
ATOM   4977 O O   . ALA B 1 302 ? 3.185   30.113  24.594  1.00 200.00 ? 337 ALA B O   1 
ATOM   4978 C CB  . ALA B 1 302 ? 2.042   27.772  22.967  1.00 161.90 ? 337 ALA B CB  1 
ATOM   4979 N N   . ASN B 1 303 ? 3.764   30.634  22.471  1.00 54.68  ? 338 ASN B N   1 
ATOM   4980 C CA  . ASN B 1 303 ? 3.770   32.087  22.649  1.00 54.68  ? 338 ASN B CA  1 
ATOM   4981 C C   . ASN B 1 303 ? 4.182   32.642  24.010  1.00 54.68  ? 338 ASN B C   1 
ATOM   4982 O O   . ASN B 1 303 ? 3.362   33.101  24.820  1.00 54.68  ? 338 ASN B O   1 
ATOM   4983 C CB  . ASN B 1 303 ? 2.399   32.644  22.260  1.00 105.06 ? 338 ASN B CB  1 
ATOM   4984 C CG  . ASN B 1 303 ? 1.289   31.618  22.406  1.00 105.06 ? 338 ASN B CG  1 
ATOM   4985 O OD1 . ASN B 1 303 ? 1.018   31.127  23.501  1.00 105.06 ? 338 ASN B OD1 1 
ATOM   4986 N ND2 . ASN B 1 303 ? 0.642   31.288  21.294  1.00 105.06 ? 338 ASN B ND2 1 
ATOM   4987 N N   . GLU B 1 304 ? 5.490   32.600  24.215  1.00 49.60  ? 339 GLU B N   1 
ATOM   4988 C CA  . GLU B 1 304 ? 6.148   33.079  25.410  1.00 49.60  ? 339 GLU B CA  1 
ATOM   4989 C C   . GLU B 1 304 ? 7.622   32.965  25.042  1.00 49.60  ? 339 GLU B C   1 
ATOM   4990 O O   . GLU B 1 304 ? 8.085   31.919  24.559  1.00 49.60  ? 339 GLU B O   1 
ATOM   4991 C CB  . GLU B 1 304 ? 5.789   32.227  26.638  1.00 60.18  ? 339 GLU B CB  1 
ATOM   4992 C CG  . GLU B 1 304 ? 6.019   30.735  26.520  1.00 60.18  ? 339 GLU B CG  1 
ATOM   4993 C CD  . GLU B 1 304 ? 5.559   29.993  27.762  1.00 60.18  ? 339 GLU B CD  1 
ATOM   4994 O OE1 . GLU B 1 304 ? 4.360   30.082  28.098  1.00 60.18  ? 339 GLU B OE1 1 
ATOM   4995 O OE2 . GLU B 1 304 ? 6.394   29.326  28.403  1.00 60.18  ? 339 GLU B OE2 1 
ATOM   4996 N N   . THR B 1 305 ? 8.341   34.069  25.225  1.00 35.28  ? 340 THR B N   1 
ATOM   4997 C CA  . THR B 1 305 ? 9.753   34.136  24.886  1.00 35.28  ? 340 THR B CA  1 
ATOM   4998 C C   . THR B 1 305 ? 10.653  33.454  25.915  1.00 35.28  ? 340 THR B C   1 
ATOM   4999 O O   . THR B 1 305 ? 11.825  33.204  25.629  1.00 35.28  ? 340 THR B O   1 
ATOM   5000 C CB  . THR B 1 305 ? 10.178  35.598  24.708  1.00 38.02  ? 340 THR B CB  1 
ATOM   5001 O OG1 . THR B 1 305 ? 9.534   36.405  25.700  1.00 38.02  ? 340 THR B OG1 1 
ATOM   5002 C CG2 . THR B 1 305 ? 9.777   36.099  23.334  1.00 38.02  ? 340 THR B CG2 1 
ATOM   5003 N N   . VAL B 1 306 ? 10.119  33.149  27.099  1.00 14.13  ? 341 VAL B N   1 
ATOM   5004 C CA  . VAL B 1 306 ? 10.924  32.515  28.141  1.00 14.13  ? 341 VAL B CA  1 
ATOM   5005 C C   . VAL B 1 306 ? 11.346  31.119  27.735  1.00 14.13  ? 341 VAL B C   1 
ATOM   5006 O O   . VAL B 1 306 ? 10.556  30.373  27.165  1.00 14.13  ? 341 VAL B O   1 
ATOM   5007 C CB  . VAL B 1 306 ? 10.128  32.456  29.452  1.00 15.75  ? 341 VAL B CB  1 
ATOM   5008 C CG1 . VAL B 1 306 ? 8.920   31.582  29.272  1.00 15.75  ? 341 VAL B CG1 1 
ATOM   5009 C CG2 . VAL B 1 306 ? 11.011  31.962  30.582  1.00 15.75  ? 341 VAL B CG2 1 
ATOM   5010 N N   . ARG B 1 307 ? 12.609  30.789  28.018  1.00 47.06  ? 342 ARG B N   1 
ATOM   5011 C CA  . ARG B 1 307 ? 13.188  29.477  27.730  1.00 47.06  ? 342 ARG B CA  1 
ATOM   5012 C C   . ARG B 1 307 ? 13.578  28.787  29.041  1.00 47.06  ? 342 ARG B C   1 
ATOM   5013 O O   . ARG B 1 307 ? 14.035  29.430  29.983  1.00 47.06  ? 342 ARG B O   1 
ATOM   5014 C CB  . ARG B 1 307 ? 14.430  29.648  26.857  1.00 69.83  ? 342 ARG B CB  1 
ATOM   5015 C CG  . ARG B 1 307 ? 14.151  30.271  25.505  1.00 69.83  ? 342 ARG B CG  1 
ATOM   5016 C CD  . ARG B 1 307 ? 13.598  29.238  24.544  1.00 69.83  ? 342 ARG B CD  1 
ATOM   5017 N NE  . ARG B 1 307 ? 14.611  28.245  24.200  1.00 69.83  ? 342 ARG B NE  1 
ATOM   5018 C CZ  . ARG B 1 307 ? 14.386  27.177  23.441  1.00 69.83  ? 342 ARG B CZ  1 
ATOM   5019 N NH1 . ARG B 1 307 ? 13.179  26.957  22.943  1.00 69.83  ? 342 ARG B NH1 1 
ATOM   5020 N NH2 . ARG B 1 307 ? 15.371  26.332  23.172  1.00 69.83  ? 342 ARG B NH2 1 
ATOM   5021 N N   . HIS B 1 308 ? 13.391  27.473  29.091  1.00 24.25  ? 343 HIS B N   1 
ATOM   5022 C CA  . HIS B 1 308 ? 13.734  26.688  30.273  1.00 24.25  ? 343 HIS B CA  1 
ATOM   5023 C C   . HIS B 1 308 ? 14.706  25.605  29.848  1.00 24.25  ? 343 HIS B C   1 
ATOM   5024 O O   . HIS B 1 308 ? 14.765  25.259  28.678  1.00 24.25  ? 343 HIS B O   1 
ATOM   5025 C CB  . HIS B 1 308 ? 12.467  26.061  30.860  1.00 28.69  ? 343 HIS B CB  1 
ATOM   5026 C CG  . HIS B 1 308 ? 11.399  27.058  31.193  1.00 28.69  ? 343 HIS B CG  1 
ATOM   5027 N ND1 . HIS B 1 308 ? 11.609  28.117  32.047  1.00 28.69  ? 343 HIS B ND1 1 
ATOM   5028 C CD2 . HIS B 1 308 ? 10.112  27.151  30.788  1.00 28.69  ? 343 HIS B CD2 1 
ATOM   5029 C CE1 . HIS B 1 308 ? 10.497  28.820  32.155  1.00 28.69  ? 343 HIS B CE1 1 
ATOM   5030 N NE2 . HIS B 1 308 ? 9.573   28.255  31.401  1.00 28.69  ? 343 HIS B NE2 1 
ATOM   5031 N N   . GLY B 1 309 ? 15.458  25.063  30.802  1.00 53.54  ? 344 GLY B N   1 
ATOM   5032 C CA  . GLY B 1 309 ? 16.411  24.023  30.484  1.00 53.54  ? 344 GLY B CA  1 
ATOM   5033 C C   . GLY B 1 309 ? 17.200  23.632  31.709  1.00 53.54  ? 344 GLY B C   1 
ATOM   5034 O O   . GLY B 1 309 ? 16.757  23.868  32.833  1.00 53.54  ? 344 GLY B O   1 
ATOM   5035 N N   . CYS B 1 310 ? 18.370  23.043  31.479  1.00 25.50  ? 345 CYS B N   1 
ATOM   5036 C CA  . CYS B 1 310 ? 19.267  22.570  32.535  1.00 25.50  ? 345 CYS B CA  1 
ATOM   5037 C C   . CYS B 1 310 ? 20.701  22.662  32.086  1.00 25.50  ? 345 CYS B C   1 
ATOM   5038 O O   . CYS B 1 310 ? 20.984  22.690  30.888  1.00 25.50  ? 345 CYS B O   1 
ATOM   5039 C CB  . CYS B 1 310 ? 19.091  21.071  32.778  1.00 34.03  ? 345 CYS B CB  1 
ATOM   5040 S SG  . CYS B 1 310 ? 17.624  20.326  33.542  1.00 34.03  ? 345 CYS B SG  1 
ATOM   5041 N N   . LEU B 1 311 ? 21.603  22.685  33.063  1.00 35.88  ? 346 LEU B N   1 
ATOM   5042 C CA  . LEU B 1 311 ? 23.005  22.527  32.750  1.00 35.88  ? 346 LEU B CA  1 
ATOM   5043 C C   . LEU B 1 311 ? 22.919  21.039  33.140  1.00 35.88  ? 346 LEU B C   1 
ATOM   5044 O O   . LEU B 1 311 ? 22.557  20.715  34.279  1.00 35.88  ? 346 LEU B O   1 
ATOM   5045 C CB  . LEU B 1 311 ? 23.900  23.235  33.754  1.00 8.33   ? 346 LEU B CB  1 
ATOM   5046 C CG  . LEU B 1 311 ? 25.325  22.681  33.736  1.00 8.33   ? 346 LEU B CG  1 
ATOM   5047 C CD1 . LEU B 1 311 ? 25.912  22.796  32.345  1.00 8.33   ? 346 LEU B CD1 1 
ATOM   5048 C CD2 . LEU B 1 311 ? 26.170  23.424  34.731  1.00 8.33   ? 346 LEU B CD2 1 
ATOM   5049 N N   . ARG B 1 312 ? 23.175  20.147  32.190  1.00 49.27  ? 347 ARG B N   1 
ATOM   5050 C CA  . ARG B 1 312 ? 23.120  18.716  32.445  1.00 49.27  ? 347 ARG B CA  1 
ATOM   5051 C C   . ARG B 1 312 ? 24.497  18.206  32.832  1.00 49.27  ? 347 ARG B C   1 
ATOM   5052 O O   . ARG B 1 312 ? 25.475  18.516  32.168  1.00 49.27  ? 347 ARG B O   1 
ATOM   5053 C CB  . ARG B 1 312 ? 22.578  17.958  31.237  1.00 44.74  ? 347 ARG B CB  1 
ATOM   5054 C CG  . ARG B 1 312 ? 21.079  18.169  31.049  1.00 44.74  ? 347 ARG B CG  1 
ATOM   5055 C CD  . ARG B 1 312 ? 20.469  17.261  29.984  1.00 44.74  ? 347 ARG B CD  1 
ATOM   5056 N NE  . ARG B 1 312 ? 20.626  15.841  30.299  1.00 44.74  ? 347 ARG B NE  1 
ATOM   5057 C CZ  . ARG B 1 312 ? 20.058  14.852  29.614  1.00 44.74  ? 347 ARG B CZ  1 
ATOM   5058 N NH1 . ARG B 1 312 ? 19.282  15.118  28.570  1.00 44.74  ? 347 ARG B NH1 1 
ATOM   5059 N NH2 . ARG B 1 312 ? 20.276  13.593  29.969  1.00 44.74  ? 347 ARG B NH2 1 
ATOM   5060 N N   . LEU B 1 313 ? 24.581  17.431  33.907  1.00 20.41  ? 348 LEU B N   1 
ATOM   5061 C CA  . LEU B 1 313 ? 25.868  16.883  34.356  1.00 20.41  ? 348 LEU B CA  1 
ATOM   5062 C C   . LEU B 1 313 ? 25.759  15.362  34.340  1.00 20.41  ? 348 LEU B C   1 
ATOM   5063 O O   . LEU B 1 313 ? 24.983  14.778  35.111  1.00 20.41  ? 348 LEU B O   1 
ATOM   5064 C CB  . LEU B 1 313 ? 26.191  17.352  35.779  1.00 82.04  ? 348 LEU B CB  1 
ATOM   5065 C CG  . LEU B 1 313 ? 26.302  18.852  36.070  1.00 82.04  ? 348 LEU B CG  1 
ATOM   5066 C CD1 . LEU B 1 313 ? 27.326  19.476  35.145  1.00 82.04  ? 348 LEU B CD1 1 
ATOM   5067 C CD2 . LEU B 1 313 ? 24.949  19.518  35.894  1.00 82.04  ? 348 LEU B CD2 1 
ATOM   5068 N N   . ASN B 1 314 ? 26.540  14.724  33.474  1.00 44.02  ? 349 ASN B N   1 
ATOM   5069 C CA  . ASN B 1 314 ? 26.507  13.266  33.358  1.00 44.02  ? 349 ASN B CA  1 
ATOM   5070 C C   . ASN B 1 314 ? 27.436  12.626  34.377  1.00 44.02  ? 349 ASN B C   1 
ATOM   5071 O O   . ASN B 1 314 ? 28.646  12.608  34.193  1.00 44.02  ? 349 ASN B O   1 
ATOM   5072 C CB  . ASN B 1 314 ? 26.949  12.925  31.935  1.00 27.87  ? 349 ASN B CB  1 
ATOM   5073 C CG  . ASN B 1 314 ? 26.889  11.472  31.646  1.00 27.87  ? 349 ASN B CG  1 
ATOM   5074 O OD1 . ASN B 1 314 ? 27.519  10.676  32.324  1.00 27.87  ? 349 ASN B OD1 1 
ATOM   5075 N ND2 . ASN B 1 314 ? 26.134  11.106  30.626  1.00 27.87  ? 349 ASN B ND2 1 
ATOM   5076 N N   . GLN B 1 315 ? 26.862  12.089  35.446  1.00 32.96  ? 350 GLN B N   1 
ATOM   5077 C CA  . GLN B 1 315 ? 27.641  11.460  36.502  1.00 32.96  ? 350 GLN B CA  1 
ATOM   5078 C C   . GLN B 1 315 ? 28.780  12.348  37.025  1.00 32.96  ? 350 GLN B C   1 
ATOM   5079 O O   . GLN B 1 315 ? 29.961  12.008  36.885  1.00 32.96  ? 350 GLN B O   1 
ATOM   5080 C CB  . GLN B 1 315 ? 28.222  10.124  36.018  1.00 51.24  ? 350 GLN B CB  1 
ATOM   5081 C CG  . GLN B 1 315 ? 27.178  9.045   35.763  1.00 51.24  ? 350 GLN B CG  1 
ATOM   5082 C CD  . GLN B 1 315 ? 27.784  7.662   35.636  1.00 51.24  ? 350 GLN B CD  1 
ATOM   5083 O OE1 . GLN B 1 315 ? 28.571  7.395   34.731  1.00 51.24  ? 350 GLN B OE1 1 
ATOM   5084 N NE2 . GLN B 1 315 ? 27.421  6.774   36.550  1.00 51.24  ? 350 GLN B NE2 1 
ATOM   5085 N N   . PRO B 1 316 ? 28.434  13.514  37.621  1.00 44.04  ? 351 PRO B N   1 
ATOM   5086 C CA  . PRO B 1 316 ? 29.434  14.444  38.169  1.00 44.04  ? 351 PRO B CA  1 
ATOM   5087 C C   . PRO B 1 316 ? 29.937  13.943  39.536  1.00 44.04  ? 351 PRO B C   1 
ATOM   5088 O O   . PRO B 1 316 ? 29.228  13.219  40.230  1.00 44.04  ? 351 PRO B O   1 
ATOM   5089 C CB  . PRO B 1 316 ? 28.651  15.739  38.281  1.00 67.31  ? 351 PRO B CB  1 
ATOM   5090 C CG  . PRO B 1 316 ? 27.309  15.248  38.697  1.00 67.31  ? 351 PRO B CG  1 
ATOM   5091 C CD  . PRO B 1 316 ? 27.076  14.065  37.778  1.00 67.31  ? 351 PRO B CD  1 
ATOM   5092 N N   . THR B 1 317 ? 31.157  14.300  39.916  1.00 90.15  ? 352 THR B N   1 
ATOM   5093 C CA  . THR B 1 317 ? 31.673  13.867  41.211  1.00 90.15  ? 352 THR B CA  1 
ATOM   5094 C C   . THR B 1 317 ? 31.864  15.085  42.097  1.00 90.15  ? 352 THR B C   1 
ATOM   5095 O O   . THR B 1 317 ? 31.379  16.167  41.797  1.00 90.15  ? 352 THR B O   1 
ATOM   5096 C CB  . THR B 1 317 ? 33.012  13.147  41.041  1.00 65.42  ? 352 THR B CB  1 
ATOM   5097 O OG1 . THR B 1 317 ? 33.888  13.955  40.248  1.00 65.42  ? 352 THR B OG1 1 
ATOM   5098 C CG2 . THR B 1 317 ? 32.810  11.811  40.353  1.00 65.42  ? 352 THR B CG2 1 
ATOM   5099 N N   . HIS B 1 318 ? 32.583  14.910  43.191  1.00 43.49  ? 353 HIS B N   1 
ATOM   5100 C CA  . HIS B 1 318 ? 32.837  15.992  44.114  1.00 43.49  ? 353 HIS B CA  1 
ATOM   5101 C C   . HIS B 1 318 ? 33.694  17.084  43.483  1.00 43.49  ? 353 HIS B C   1 
ATOM   5102 O O   . HIS B 1 318 ? 33.718  18.213  43.971  1.00 43.49  ? 353 HIS B O   1 
ATOM   5103 C CB  . HIS B 1 318 ? 33.572  15.463  45.348  1.00 50.95  ? 353 HIS B CB  1 
ATOM   5104 C CG  . HIS B 1 318 ? 34.982  15.045  45.069  1.00 50.95  ? 353 HIS B CG  1 
ATOM   5105 N ND1 . HIS B 1 318 ? 35.293  13.939  44.309  1.00 50.95  ? 353 HIS B ND1 1 
ATOM   5106 C CD2 . HIS B 1 318 ? 36.163  15.615  45.402  1.00 50.95  ? 353 HIS B CD2 1 
ATOM   5107 C CE1 . HIS B 1 318 ? 36.605  13.846  44.184  1.00 50.95  ? 353 HIS B CE1 1 
ATOM   5108 N NE2 . HIS B 1 318 ? 37.156  14.852  44.838  1.00 50.95  ? 353 HIS B NE2 1 
ATOM   5109 N N   . VAL B 1 319 ? 34.414  16.752  42.414  1.00 46.75  ? 354 VAL B N   1 
ATOM   5110 C CA  . VAL B 1 319 ? 35.250  17.764  41.758  1.00 46.75  ? 354 VAL B CA  1 
ATOM   5111 C C   . VAL B 1 319 ? 34.384  18.763  40.987  1.00 46.75  ? 354 VAL B C   1 
ATOM   5112 O O   . VAL B 1 319 ? 34.872  19.790  40.516  1.00 46.75  ? 354 VAL B O   1 
ATOM   5113 C CB  . VAL B 1 319 ? 36.253  17.133  40.763  1.00 25.63  ? 354 VAL B CB  1 
ATOM   5114 C CG1 . VAL B 1 319 ? 36.987  15.984  41.426  1.00 25.63  ? 354 VAL B CG1 1 
ATOM   5115 C CG2 . VAL B 1 319 ? 35.536  16.670  39.508  1.00 25.63  ? 354 VAL B CG2 1 
ATOM   5116 N N   . ASN B 1 320 ? 33.092  18.461  40.885  1.00 15.95  ? 355 ASN B N   1 
ATOM   5117 C CA  . ASN B 1 320 ? 32.161  19.330  40.201  1.00 15.95  ? 355 ASN B CA  1 
ATOM   5118 C C   . ASN B 1 320 ? 31.377  20.164  41.193  1.00 15.95  ? 355 ASN B C   1 
ATOM   5119 O O   . ASN B 1 320 ? 30.570  21.002  40.809  1.00 15.95  ? 355 ASN B O   1 
ATOM   5120 C CB  . ASN B 1 320 ? 31.266  18.477  39.310  1.00 34.89  ? 355 ASN B CB  1 
ATOM   5121 C CG  . ASN B 1 320 ? 32.053  17.788  38.209  1.00 34.89  ? 355 ASN B CG  1 
ATOM   5122 O OD1 . ASN B 1 320 ? 31.721  16.685  37.791  1.00 34.89  ? 355 ASN B OD1 1 
ATOM   5123 N ND2 . ASN B 1 320 ? 33.106  18.445  37.734  1.00 34.89  ? 355 ASN B ND2 1 
ATOM   5124 N N   . ASN B 1 321 ? 31.623  19.936  42.478  1.00 11.65  ? 356 ASN B N   1 
ATOM   5125 C CA  . ASN B 1 321 ? 30.957  20.689  43.540  1.00 11.65  ? 356 ASN B CA  1 
ATOM   5126 C C   . ASN B 1 321 ? 31.454  22.131  43.463  1.00 11.65  ? 356 ASN B C   1 
ATOM   5127 O O   . ASN B 1 321 ? 32.653  22.369  43.314  1.00 11.65  ? 356 ASN B O   1 
ATOM   5128 C CB  . ASN B 1 321 ? 31.349  20.111  44.900  1.00 67.65  ? 356 ASN B CB  1 
ATOM   5129 C CG  . ASN B 1 321 ? 30.965  18.658  45.052  1.00 67.65  ? 356 ASN B CG  1 
ATOM   5130 O OD1 . ASN B 1 321 ? 30.760  17.959  44.070  1.00 67.65  ? 356 ASN B OD1 1 
ATOM   5131 N ND2 . ASN B 1 321 ? 30.881  18.194  46.288  1.00 67.65  ? 356 ASN B ND2 1 
ATOM   5132 N N   . GLY B 1 322 ? 30.552  23.098  43.568  1.00 115.10 ? 357 GLY B N   1 
ATOM   5133 C CA  . GLY B 1 322 ? 30.993  24.470  43.478  1.00 115.10 ? 357 GLY B CA  1 
ATOM   5134 C C   . GLY B 1 322 ? 29.876  25.403  43.080  1.00 115.10 ? 357 GLY B C   1 
ATOM   5135 O O   . GLY B 1 322 ? 28.709  25.017  43.060  1.00 115.10 ? 357 GLY B O   1 
ATOM   5136 N N   . ASN B 1 323 ? 30.253  26.634  42.765  1.00 7.62   ? 358 ASN B N   1 
ATOM   5137 C CA  . ASN B 1 323 ? 29.313  27.677  42.394  1.00 7.62   ? 358 ASN B CA  1 
ATOM   5138 C C   . ASN B 1 323 ? 29.176  27.747  40.887  1.00 7.62   ? 358 ASN B C   1 
ATOM   5139 O O   . ASN B 1 323 ? 30.156  27.961  40.166  1.00 7.62   ? 358 ASN B O   1 
ATOM   5140 C CB  . ASN B 1 323 ? 29.923  28.966  42.958  1.00 129.47 ? 358 ASN B CB  1 
ATOM   5141 C CG  . ASN B 1 323 ? 29.031  30.178  42.848  1.00 129.47 ? 358 ASN B CG  1 
ATOM   5142 O OD1 . ASN B 1 323 ? 27.893  30.122  42.386  1.00 129.47 ? 358 ASN B OD1 1 
ATOM   5143 N ND2 . ASN B 1 323 ? 29.602  31.293  43.303  1.00 129.47 ? 358 ASN B ND2 1 
ATOM   5144 N N   . TYR B 1 324 ? 27.947  27.570  40.421  1.00 30.03  ? 359 TYR B N   1 
ATOM   5145 C CA  . TYR B 1 324 ? 27.652  27.599  39.008  1.00 30.03  ? 359 TYR B CA  1 
ATOM   5146 C C   . TYR B 1 324 ? 26.950  28.902  38.679  1.00 30.03  ? 359 TYR B C   1 
ATOM   5147 O O   . TYR B 1 324 ? 25.968  29.282  39.315  1.00 30.03  ? 359 TYR B O   1 
ATOM   5148 C CB  . TYR B 1 324 ? 26.830  26.376  38.595  1.00 38.55  ? 359 TYR B CB  1 
ATOM   5149 C CG  . TYR B 1 324 ? 27.686  25.131  38.515  1.00 38.55  ? 359 TYR B CG  1 
ATOM   5150 C CD1 . TYR B 1 324 ? 28.096  24.466  39.668  1.00 38.55  ? 359 TYR B CD1 1 
ATOM   5151 C CD2 . TYR B 1 324 ? 28.150  24.662  37.288  1.00 38.55  ? 359 TYR B CD2 1 
ATOM   5152 C CE1 . TYR B 1 324 ? 28.951  23.369  39.602  1.00 38.55  ? 359 TYR B CE1 1 
ATOM   5153 C CE2 . TYR B 1 324 ? 29.007  23.567  37.211  1.00 38.55  ? 359 TYR B CE2 1 
ATOM   5154 C CZ  . TYR B 1 324 ? 29.403  22.928  38.370  1.00 38.55  ? 359 TYR B CZ  1 
ATOM   5155 O OH  . TYR B 1 324 ? 30.264  21.857  38.297  1.00 38.55  ? 359 TYR B OH  1 
ATOM   5156 N N   . THR B 1 325 ? 27.456  29.590  37.675  1.00 38.43  ? 360 THR B N   1 
ATOM   5157 C CA  . THR B 1 325 ? 26.863  30.849  37.282  1.00 38.43  ? 360 THR B CA  1 
ATOM   5158 C C   . THR B 1 325 ? 26.424  30.860  35.822  1.00 38.43  ? 360 THR B C   1 
ATOM   5159 O O   . THR B 1 325 ? 27.200  30.510  34.926  1.00 38.43  ? 360 THR B O   1 
ATOM   5160 C CB  . THR B 1 325 ? 27.840  32.006  37.495  1.00 22.25  ? 360 THR B CB  1 
ATOM   5161 O OG1 . THR B 1 325 ? 28.224  32.055  38.873  1.00 22.25  ? 360 THR B OG1 1 
ATOM   5162 C CG2 . THR B 1 325 ? 27.194  33.323  37.105  1.00 22.25  ? 360 THR B CG2 1 
ATOM   5163 N N   . LEU B 1 326 ? 25.176  31.259  35.601  1.00 15.08  ? 361 LEU B N   1 
ATOM   5164 C CA  . LEU B 1 326 ? 24.639  31.384  34.250  1.00 15.08  ? 361 LEU B CA  1 
ATOM   5165 C C   . LEU B 1 326 ? 24.583  32.881  33.877  1.00 15.08  ? 361 LEU B C   1 
ATOM   5166 O O   . LEU B 1 326 ? 24.063  33.703  34.650  1.00 15.08  ? 361 LEU B O   1 
ATOM   5167 C CB  . LEU B 1 326 ? 23.234  30.782  34.175  1.00 36.49  ? 361 LEU B CB  1 
ATOM   5168 C CG  . LEU B 1 326 ? 22.449  30.987  32.874  1.00 36.49  ? 361 LEU B CG  1 
ATOM   5169 C CD1 . LEU B 1 326 ? 23.283  30.550  31.685  1.00 36.49  ? 361 LEU B CD1 1 
ATOM   5170 C CD2 . LEU B 1 326 ? 21.152  30.199  32.932  1.00 36.49  ? 361 LEU B CD2 1 
ATOM   5171 N N   . LEU B 1 327 ? 25.137  33.214  32.705  1.00 17.55  ? 362 LEU B N   1 
ATOM   5172 C CA  . LEU B 1 327 ? 25.191  34.575  32.197  1.00 17.55  ? 362 LEU B CA  1 
ATOM   5173 C C   . LEU B 1 327 ? 24.392  34.693  30.925  1.00 17.55  ? 362 LEU B C   1 
ATOM   5174 O O   . LEU B 1 327 ? 24.745  34.067  29.931  1.00 17.55  ? 362 LEU B O   1 
ATOM   5175 C CB  . LEU B 1 327 ? 26.637  35.007  31.924  1.00 20.28  ? 362 LEU B CB  1 
ATOM   5176 C CG  . LEU B 1 327 ? 27.643  35.084  33.080  1.00 20.28  ? 362 LEU B CG  1 
ATOM   5177 C CD1 . LEU B 1 327 ? 27.049  35.884  34.229  1.00 20.28  ? 362 LEU B CD1 1 
ATOM   5178 C CD2 . LEU B 1 327 ? 28.011  33.686  33.546  1.00 20.28  ? 362 LEU B CD2 1 
ATOM   5179 N N   . ALA B 1 328 ? 23.334  35.513  30.970  1.00 13.76  ? 363 ALA B N   1 
ATOM   5180 C CA  . ALA B 1 328 ? 22.422  35.749  29.846  1.00 13.76  ? 363 ALA B CA  1 
ATOM   5181 C C   . ALA B 1 328 ? 22.665  37.152  29.290  1.00 13.76  ? 363 ALA B C   1 
ATOM   5182 O O   . ALA B 1 328 ? 22.403  38.145  29.969  1.00 13.76  ? 363 ALA B O   1 
ATOM   5183 C CB  . ALA B 1 328 ? 20.993  35.611  30.285  1.00 122.10 ? 363 ALA B CB  1 
ATOM   5184 N N   . ALA B 1 329 ? 23.143  37.233  28.049  1.00 29.09  ? 364 ALA B N   1 
ATOM   5185 C CA  . ALA B 1 329 ? 23.454  38.527  27.460  1.00 29.09  ? 364 ALA B CA  1 
ATOM   5186 C C   . ALA B 1 329 ? 22.727  38.898  26.178  1.00 29.09  ? 364 ALA B C   1 
ATOM   5187 O O   . ALA B 1 329 ? 22.511  38.070  25.291  1.00 29.09  ? 364 ALA B O   1 
ATOM   5188 C CB  . ALA B 1 329 ? 24.960  38.633  27.238  1.00 143.03 ? 364 ALA B CB  1 
ATOM   5189 N N   . ASN B 1 330 ? 22.348  40.162  26.089  1.00 36.54  ? 365 ASN B N   1 
ATOM   5190 C CA  . ASN B 1 330 ? 21.746  40.662  24.873  1.00 36.54  ? 365 ASN B CA  1 
ATOM   5191 C C   . ASN B 1 330 ? 22.148  42.125  24.724  1.00 36.54  ? 365 ASN B C   1 
ATOM   5192 O O   . ASN B 1 330 ? 22.955  42.631  25.507  1.00 36.54  ? 365 ASN B O   1 
ATOM   5193 C CB  . ASN B 1 330 ? 20.229  40.430  24.891  1.00 58.32  ? 365 ASN B CB  1 
ATOM   5194 C CG  . ASN B 1 330 ? 19.482  41.488  25.625  1.00 58.32  ? 365 ASN B CG  1 
ATOM   5195 O OD1 . ASN B 1 330 ? 19.876  41.906  26.708  1.00 58.32  ? 365 ASN B OD1 1 
ATOM   5196 N ND2 . ASN B 1 330 ? 18.376  41.926  25.048  1.00 58.32  ? 365 ASN B ND2 1 
ATOM   5197 N N   . PRO B 1 331 ? 21.657  42.801  23.681  1.00 60.40  ? 366 PRO B N   1 
ATOM   5198 C CA  . PRO B 1 331 ? 21.995  44.212  23.463  1.00 60.40  ? 366 PRO B CA  1 
ATOM   5199 C C   . PRO B 1 331 ? 21.888  45.127  24.681  1.00 60.40  ? 366 PRO B C   1 
ATOM   5200 O O   . PRO B 1 331 ? 22.745  45.980  24.884  1.00 60.40  ? 366 PRO B O   1 
ATOM   5201 C CB  . PRO B 1 331 ? 21.027  44.620  22.362  1.00 48.18  ? 366 PRO B CB  1 
ATOM   5202 C CG  . PRO B 1 331 ? 20.979  43.391  21.525  1.00 48.18  ? 366 PRO B CG  1 
ATOM   5203 C CD  . PRO B 1 331 ? 20.859  42.284  22.556  1.00 48.18  ? 366 PRO B CD  1 
ATOM   5204 N N   . PHE B 1 332 ? 20.851  44.937  25.491  1.00 42.10  ? 367 PHE B N   1 
ATOM   5205 C CA  . PHE B 1 332 ? 20.618  45.768  26.673  1.00 42.10  ? 367 PHE B CA  1 
ATOM   5206 C C   . PHE B 1 332 ? 21.677  45.608  27.727  1.00 42.10  ? 367 PHE B C   1 
ATOM   5207 O O   . PHE B 1 332 ? 21.953  46.529  28.489  1.00 42.10  ? 367 PHE B O   1 
ATOM   5208 C CB  . PHE B 1 332 ? 19.235  45.451  27.240  1.00 42.07  ? 367 PHE B CB  1 
ATOM   5209 C CG  . PHE B 1 332 ? 18.113  45.697  26.264  1.00 42.07  ? 367 PHE B CG  1 
ATOM   5210 C CD1 . PHE B 1 332 ? 17.589  46.964  26.089  1.00 42.07  ? 367 PHE B CD1 1 
ATOM   5211 C CD2 . PHE B 1 332 ? 17.611  44.664  25.490  1.00 42.07  ? 367 PHE B CD2 1 
ATOM   5212 C CE1 . PHE B 1 332 ? 16.584  47.192  25.158  1.00 42.07  ? 367 PHE B CE1 1 
ATOM   5213 C CE2 . PHE B 1 332 ? 16.611  44.887  24.562  1.00 42.07  ? 367 PHE B CE2 1 
ATOM   5214 C CZ  . PHE B 1 332 ? 16.099  46.149  24.395  1.00 42.07  ? 367 PHE B CZ  1 
ATOM   5215 N N   . GLY B 1 333 ? 22.262  44.426  27.783  1.00 40.93  ? 368 GLY B N   1 
ATOM   5216 C CA  . GLY B 1 333 ? 23.271  44.175  28.792  1.00 40.93  ? 368 GLY B CA  1 
ATOM   5217 C C   . GLY B 1 333 ? 23.252  42.713  29.162  1.00 40.93  ? 368 GLY B C   1 
ATOM   5218 O O   . GLY B 1 333 ? 22.974  41.866  28.306  1.00 40.93  ? 368 GLY B O   1 
ATOM   5219 N N   . GLN B 1 334 ? 23.500  42.408  30.434  1.00 29.21  ? 369 GLN B N   1 
ATOM   5220 C CA  . GLN B 1 334 ? 23.547  41.019  30.864  1.00 29.21  ? 369 GLN B CA  1 
ATOM   5221 C C   . GLN B 1 334 ? 22.959  40.695  32.238  1.00 29.21  ? 369 GLN B C   1 
ATOM   5222 O O   . GLN B 1 334 ? 23.107  41.458  33.189  1.00 29.21  ? 369 GLN B O   1 
ATOM   5223 C CB  . GLN B 1 334 ? 25.005  40.557  30.830  1.00 90.37  ? 369 GLN B CB  1 
ATOM   5224 C CG  . GLN B 1 334 ? 25.341  39.423  31.783  1.00 90.37  ? 369 GLN B CG  1 
ATOM   5225 C CD  . GLN B 1 334 ? 26.829  39.325  32.062  1.00 90.37  ? 369 GLN B CD  1 
ATOM   5226 O OE1 . GLN B 1 334 ? 27.434  40.257  32.591  1.00 90.37  ? 369 GLN B OE1 1 
ATOM   5227 N NE2 . GLN B 1 334 ? 27.427  38.194  31.708  1.00 90.37  ? 369 GLN B NE2 1 
ATOM   5228 N N   . ALA B 1 335 ? 22.308  39.545  32.338  1.00 30.34  ? 370 ALA B N   1 
ATOM   5229 C CA  . ALA B 1 335 ? 21.741  39.107  33.602  1.00 30.34  ? 370 ALA B CA  1 
ATOM   5230 C C   . ALA B 1 335 ? 22.567  37.914  34.097  1.00 30.34  ? 370 ALA B C   1 
ATOM   5231 O O   . ALA B 1 335 ? 23.086  37.128  33.313  1.00 30.34  ? 370 ALA B O   1 
ATOM   5232 C CB  . ALA B 1 335 ? 20.290  38.700  33.415  1.00 15.48  ? 370 ALA B CB  1 
ATOM   5233 N N   . SER B 1 336 ? 22.653  37.756  35.407  1.00 39.86  ? 371 SER B N   1 
ATOM   5234 C CA  . SER B 1 336 ? 23.439  36.679  35.961  1.00 39.86  ? 371 SER B CA  1 
ATOM   5235 C C   . SER B 1 336 ? 22.757  36.034  37.161  1.00 39.86  ? 371 SER B C   1 
ATOM   5236 O O   . SER B 1 336 ? 22.001  36.678  37.904  1.00 39.86  ? 371 SER B O   1 
ATOM   5237 C CB  . SER B 1 336 ? 24.801  37.212  36.404  1.00 24.27  ? 371 SER B CB  1 
ATOM   5238 O OG  . SER B 1 336 ? 25.432  36.320  37.304  1.00 24.27  ? 371 SER B OG  1 
ATOM   5239 N N   . ALA B 1 337 ? 23.025  34.746  37.343  1.00 45.58  ? 372 ALA B N   1 
ATOM   5240 C CA  . ALA B 1 337 ? 22.455  34.014  38.452  1.00 45.58  ? 372 ALA B CA  1 
ATOM   5241 C C   . ALA B 1 337 ? 23.418  32.909  38.842  1.00 45.58  ? 372 ALA B C   1 
ATOM   5242 O O   . ALA B 1 337 ? 23.992  32.228  37.994  1.00 45.58  ? 372 ALA B O   1 
ATOM   5243 C CB  . ALA B 1 337 ? 21.123  33.417  38.052  1.00 4.53   ? 372 ALA B CB  1 
ATOM   5244 N N   . SER B 1 338 ? 23.595  32.725  40.139  1.00 38.64  ? 373 SER B N   1 
ATOM   5245 C CA  . SER B 1 338 ? 24.507  31.708  40.610  1.00 38.64  ? 373 SER B CA  1 
ATOM   5246 C C   . SER B 1 338 ? 23.865  30.765  41.596  1.00 38.64  ? 373 SER B C   1 
ATOM   5247 O O   . SER B 1 338 ? 22.894  31.108  42.266  1.00 38.64  ? 373 SER B O   1 
ATOM   5248 C CB  . SER B 1 338 ? 25.691  32.373  41.292  1.00 73.82  ? 373 SER B CB  1 
ATOM   5249 O OG  . SER B 1 338 ? 26.053  33.562  40.626  1.00 73.82  ? 373 SER B OG  1 
ATOM   5250 N N   . ILE B 1 339 ? 24.425  29.568  41.682  1.00 28.56  ? 374 ILE B N   1 
ATOM   5251 C CA  . ILE B 1 339 ? 23.948  28.564  42.608  1.00 28.56  ? 374 ILE B CA  1 
ATOM   5252 C C   . ILE B 1 339 ? 25.061  27.574  42.935  1.00 28.56  ? 374 ILE B C   1 
ATOM   5253 O O   . ILE B 1 339 ? 25.882  27.226  42.086  1.00 28.56  ? 374 ILE B O   1 
ATOM   5254 C CB  . ILE B 1 339 ? 22.721  27.813  42.042  1.00 30.79  ? 374 ILE B CB  1 
ATOM   5255 C CG1 . ILE B 1 339 ? 22.210  26.800  43.069  1.00 30.79  ? 374 ILE B CG1 1 
ATOM   5256 C CG2 . ILE B 1 339 ? 23.085  27.122  40.741  1.00 30.79  ? 374 ILE B CG2 1 
ATOM   5257 C CD1 . ILE B 1 339 ? 21.870  27.405  44.419  1.00 43.03  ? 374 ILE B CD1 1 
ATOM   5258 N N   . MET B 1 340 ? 25.094  27.148  44.189  1.00 40.89  ? 375 MET B N   1 
ATOM   5259 C CA  . MET B 1 340 ? 26.078  26.188  44.661  1.00 40.89  ? 375 MET B CA  1 
ATOM   5260 C C   . MET B 1 340 ? 25.526  24.781  44.460  1.00 40.89  ? 375 MET B C   1 
ATOM   5261 O O   . MET B 1 340 ? 24.368  24.509  44.776  1.00 40.89  ? 375 MET B O   1 
ATOM   5262 C CB  . MET B 1 340 ? 26.328  26.378  46.157  1.00 40.18  ? 375 MET B CB  1 
ATOM   5263 C CG  . MET B 1 340 ? 27.051  27.644  46.553  1.00 40.18  ? 375 MET B CG  1 
ATOM   5264 S SD  . MET B 1 340 ? 28.748  27.624  46.014  1.00 40.18  ? 375 MET B SD  1 
ATOM   5265 C CE  . MET B 1 340 ? 29.249  26.026  46.583  1.00 40.18  ? 375 MET B CE  1 
ATOM   5266 N N   . ALA B 1 341 ? 26.356  23.891  43.933  1.00 79.45  ? 376 ALA B N   1 
ATOM   5267 C CA  . ALA B 1 341 ? 25.942  22.518  43.734  1.00 79.45  ? 376 ALA B CA  1 
ATOM   5268 C C   . ALA B 1 341 ? 26.979  21.525  44.286  1.00 79.45  ? 376 ALA B C   1 
ATOM   5269 O O   . ALA B 1 341 ? 28.178  21.628  44.000  1.00 79.45  ? 376 ALA B O   1 
ATOM   5270 C CB  . ALA B 1 341 ? 25.704  22.257  42.253  1.00 89.73  ? 376 ALA B CB  1 
ATOM   5271 N N   . ALA B 1 342 ? 26.487  20.583  45.096  1.00 38.63  ? 377 ALA B N   1 
ATOM   5272 C CA  . ALA B 1 342 ? 27.283  19.509  45.688  1.00 38.63  ? 377 ALA B CA  1 
ATOM   5273 C C   . ALA B 1 342 ? 26.706  18.214  45.085  1.00 38.63  ? 377 ALA B C   1 
ATOM   5274 O O   . ALA B 1 342 ? 25.514  17.960  45.145  1.00 38.63  ? 377 ALA B O   1 
ATOM   5275 C CB  . ALA B 1 342 ? 27.119  19.505  47.199  1.00 144.83 ? 377 ALA B CB  1 
ATOM   5276 N N   . PHE B 1 343 ? 27.562  17.417  44.465  1.00 67.62  ? 378 PHE B N   1 
ATOM   5277 C CA  . PHE B 1 343 ? 27.122  16.195  43.822  1.00 67.62  ? 378 PHE B CA  1 
ATOM   5278 C C   . PHE B 1 343 ? 27.563  14.962  44.566  1.00 67.62  ? 378 PHE B C   1 
ATOM   5279 O O   . PHE B 1 343 ? 27.007  13.890  44.362  1.00 67.62  ? 378 PHE B O   1 
ATOM   5280 C CB  . PHE B 1 343 ? 27.651  16.146  42.388  1.00 48.73  ? 378 PHE B CB  1 
ATOM   5281 C CG  . PHE B 1 343 ? 27.402  17.405  41.610  1.00 48.73  ? 378 PHE B CG  1 
ATOM   5282 C CD1 . PHE B 1 343 ? 26.111  17.835  41.349  1.00 48.73  ? 378 PHE B CD1 1 
ATOM   5283 C CD2 . PHE B 1 343 ? 28.459  18.169  41.149  1.00 48.73  ? 378 PHE B CD2 1 
ATOM   5284 C CE1 . PHE B 1 343 ? 25.879  19.007  40.641  1.00 48.73  ? 378 PHE B CE1 1 
ATOM   5285 C CE2 . PHE B 1 343 ? 28.234  19.342  40.440  1.00 48.73  ? 378 PHE B CE2 1 
ATOM   5286 C CZ  . PHE B 1 343 ? 26.944  19.761  40.187  1.00 48.73  ? 378 PHE B CZ  1 
ATOM   5287 N N   . MET B 1 344 ? 28.546  15.135  45.442  1.00 91.11  ? 379 MET B N   1 
ATOM   5288 C CA  . MET B 1 344 ? 29.138  14.029  46.168  1.00 91.11  ? 379 MET B CA  1 
ATOM   5289 C C   . MET B 1 344 ? 30.093  14.564  47.219  1.00 91.11  ? 379 MET B C   1 
ATOM   5290 O O   . MET B 1 344 ? 30.797  15.545  46.975  1.00 91.11  ? 379 MET B O   1 
ATOM   5291 C CB  . MET B 1 344 ? 29.901  13.187  45.144  1.00 49.90  ? 379 MET B CB  1 
ATOM   5292 C CG  . MET B 1 344 ? 30.278  11.791  45.535  1.00 49.90  ? 379 MET B CG  1 
ATOM   5293 S SD  . MET B 1 344 ? 31.071  11.039  44.108  1.00 49.90  ? 379 MET B SD  1 
ATOM   5294 C CE  . MET B 1 344 ? 29.692  10.927  42.979  1.00 49.90  ? 379 MET B CE  1 
ATOM   5295 N N   . ASP B 1 345 ? 30.132  13.917  48.376  1.00 57.08  ? 380 ASP B N   1 
ATOM   5296 C CA  . ASP B 1 345 ? 31.057  14.329  49.429  1.00 57.08  ? 380 ASP B CA  1 
ATOM   5297 C C   . ASP B 1 345 ? 32.476  13.928  48.981  1.00 57.08  ? 380 ASP B C   1 
ATOM   5298 O O   . ASP B 1 345 ? 32.644  12.904  48.316  1.00 57.08  ? 380 ASP B O   1 
ATOM   5299 C CB  . ASP B 1 345 ? 30.712  13.630  50.744  1.00 157.90 ? 380 ASP B CB  1 
ATOM   5300 C CG  . ASP B 1 345 ? 29.330  13.989  51.247  1.00 157.90 ? 380 ASP B CG  1 
ATOM   5301 O OD1 . ASP B 1 345 ? 29.086  15.182  51.516  1.00 157.90 ? 380 ASP B OD1 1 
ATOM   5302 O OD2 . ASP B 1 345 ? 28.486  13.077  51.373  1.00 157.90 ? 380 ASP B OD2 1 
ATOM   5303 N N   . ASN B 1 346 ? 33.494  14.723  49.317  1.00 90.59  ? 381 ASN B N   1 
ATOM   5304 C CA  . ASN B 1 346 ? 34.860  14.369  48.921  1.00 90.59  ? 381 ASN B CA  1 
ATOM   5305 C C   . ASN B 1 346 ? 35.521  13.457  49.934  1.00 90.59  ? 381 ASN B C   1 
ATOM   5306 O O   . ASN B 1 346 ? 35.054  13.308  51.065  1.00 90.59  ? 381 ASN B O   1 
ATOM   5307 C CB  . ASN B 1 346 ? 35.699  15.641  48.732  1.00 145.06 ? 381 ASN B CB  1 
ATOM   5308 C CG  . ASN B 1 346 ? 35.243  16.785  49.624  1.00 145.06 ? 381 ASN B CG  1 
ATOM   5309 O OD1 . ASN B 1 346 ? 34.207  17.403  49.376  1.00 145.06 ? 381 ASN B OD1 1 
ATOM   5310 N ND2 . ASN B 1 346 ? 36.012  17.066  50.669  1.00 145.06 ? 381 ASN B ND2 1 
ATOM   5311 N N   . PRO B 1 347 ? 36.627  12.828  49.528  1.00 100.43 ? 382 PRO B N   1 
ATOM   5312 C CA  . PRO B 1 347 ? 37.390  11.916  50.391  1.00 100.43 ? 382 PRO B CA  1 
ATOM   5313 C C   . PRO B 1 347 ? 38.035  12.650  51.583  1.00 100.43 ? 382 PRO B C   1 
ATOM   5314 O O   . PRO B 1 347 ? 37.849  13.881  51.684  1.00 98.45  ? 382 PRO B O   1 
ATOM   5315 C CB  . PRO B 1 347 ? 38.429  11.335  49.439  1.00 84.56  ? 382 PRO B CB  1 
ATOM   5316 C CG  . PRO B 1 347 ? 37.697  11.308  48.135  1.00 84.56  ? 382 PRO B CG  1 
ATOM   5317 C CD  . PRO B 1 347 ? 37.052  12.675  48.123  1.00 84.56  ? 382 PRO B CD  1 
ATOM   5318 O OXT . PRO B 1 347 ? 38.718  11.977  52.387  1.00 99.22  ? 382 PRO B OXT 1 
ATOM   5319 N N   . SER C 2 2   ? 15.145  -24.665 21.727  1.00 200.00 ? 2   SER E N   1 
ATOM   5320 C CA  . SER C 2 2   ? 14.085  -25.425 22.453  1.00 200.00 ? 2   SER E CA  1 
ATOM   5321 C C   . SER C 2 2   ? 13.218  -24.513 23.323  1.00 200.00 ? 2   SER E C   1 
ATOM   5322 O O   . SER C 2 2   ? 13.599  -23.385 23.640  1.00 200.00 ? 2   SER E O   1 
ATOM   5323 C CB  . SER C 2 2   ? 14.719  -26.512 23.329  1.00 122.69 ? 2   SER E CB  1 
ATOM   5324 O OG  . SER C 2 2   ? 15.405  -27.474 22.544  1.00 122.69 ? 2   SER E OG  1 
ATOM   5325 N N   . SER C 2 3   ? 12.051  -25.024 23.697  1.00 160.92 ? 3   SER E N   1 
ATOM   5326 C CA  . SER C 2 3   ? 11.082  -24.301 24.516  1.00 160.92 ? 3   SER E CA  1 
ATOM   5327 C C   . SER C 2 3   ? 11.226  -24.654 26.009  1.00 160.92 ? 3   SER E C   1 
ATOM   5328 O O   . SER C 2 3   ? 10.799  -25.727 26.453  1.00 160.92 ? 3   SER E O   1 
ATOM   5329 C CB  . SER C 2 3   ? 9.654   -24.593 24.072  1.00 56.31  ? 3   SER E CB  1 
ATOM   5330 O OG  . SER C 2 3   ? 8.754   -24.300 25.127  1.00 56.31  ? 3   SER E OG  1 
ATOM   5331 N N   . HIS C 2 4   ? 11.836  -23.760 26.781  1.00 41.69  ? 4   HIS E N   1 
ATOM   5332 C CA  . HIS C 2 4   ? 12.006  -23.993 28.207  1.00 41.69  ? 4   HIS E CA  1 
ATOM   5333 C C   . HIS C 2 4   ? 11.212  -22.950 28.995  1.00 41.69  ? 4   HIS E C   1 
ATOM   5334 O O   . HIS C 2 4   ? 11.245  -21.760 28.674  1.00 41.69  ? 4   HIS E O   1 
ATOM   5335 C CB  . HIS C 2 4   ? 13.479  -23.935 28.582  1.00 34.44  ? 4   HIS E CB  1 
ATOM   5336 C CG  . HIS C 2 4   ? 13.757  -24.454 29.951  1.00 34.44  ? 4   HIS E CG  1 
ATOM   5337 N ND1 . HIS C 2 4   ? 13.666  -23.667 31.076  1.00 34.44  ? 4   HIS E ND1 1 
ATOM   5338 C CD2 . HIS C 2 4   ? 14.065  -25.698 30.383  1.00 34.44  ? 4   HIS E CD2 1 
ATOM   5339 C CE1 . HIS C 2 4   ? 13.906  -24.405 32.144  1.00 34.44  ? 4   HIS E CE1 1 
ATOM   5340 N NE2 . HIS C 2 4   ? 14.150  -25.641 31.751  1.00 34.44  ? 4   HIS E NE2 1 
ATOM   5341 N N   . PRO C 2 5   ? 10.460  -23.385 30.021  1.00 68.54  ? 5   PRO E N   1 
ATOM   5342 C CA  . PRO C 2 5   ? 9.646   -22.492 30.863  1.00 68.54  ? 5   PRO E CA  1 
ATOM   5343 C C   . PRO C 2 5   ? 10.309  -21.173 31.259  1.00 68.54  ? 5   PRO E C   1 
ATOM   5344 O O   . PRO C 2 5   ? 9.633   -20.161 31.428  1.00 68.54  ? 5   PRO E O   1 
ATOM   5345 C CB  . PRO C 2 5   ? 9.287   -23.378 32.057  1.00 18.93  ? 5   PRO E CB  1 
ATOM   5346 C CG  . PRO C 2 5   ? 10.122  -24.665 31.854  1.00 18.93  ? 5   PRO E CG  1 
ATOM   5347 C CD  . PRO C 2 5   ? 10.262  -24.788 30.397  1.00 18.93  ? 5   PRO E CD  1 
ATOM   5348 N N   . ILE C 2 6   ? 11.629  -21.190 31.397  1.00 45.14  ? 6   ILE E N   1 
ATOM   5349 C CA  . ILE C 2 6   ? 12.385  -20.010 31.794  1.00 45.14  ? 6   ILE E CA  1 
ATOM   5350 C C   . ILE C 2 6   ? 12.275  -18.816 30.839  1.00 45.14  ? 6   ILE E C   1 
ATOM   5351 O O   . ILE C 2 6   ? 12.319  -17.663 31.268  1.00 45.14  ? 6   ILE E O   1 
ATOM   5352 C CB  . ILE C 2 6   ? 13.851  -20.387 31.993  1.00 1.00   ? 6   ILE E CB  1 
ATOM   5353 C CG1 . ILE C 2 6   ? 14.410  -19.632 33.201  1.00 1.00   ? 6   ILE E CG1 1 
ATOM   5354 C CG2 . ILE C 2 6   ? 14.635  -20.148 30.705  1.00 1.00   ? 6   ILE E CG2 1 
ATOM   5355 C CD1 . ILE C 2 6   ? 14.465  -18.136 33.049  1.00 69.66  ? 6   ILE E CD1 1 
ATOM   5356 N N   . PHE C 2 7   ? 12.130  -19.073 29.545  1.00 40.74  ? 7   PHE E N   1 
ATOM   5357 C CA  . PHE C 2 7   ? 12.018  -17.975 28.596  1.00 40.74  ? 7   PHE E CA  1 
ATOM   5358 C C   . PHE C 2 7   ? 10.765  -17.185 28.856  1.00 40.74  ? 7   PHE E C   1 
ATOM   5359 O O   . PHE C 2 7   ? 10.583  -16.095 28.333  1.00 40.74  ? 7   PHE E O   1 
ATOM   5360 C CB  . PHE C 2 7   ? 11.979  -18.520 27.178  1.00 1.00   ? 7   PHE E CB  1 
ATOM   5361 C CG  . PHE C 2 7   ? 13.201  -19.282 26.812  1.00 1.00   ? 7   PHE E CG  1 
ATOM   5362 C CD1 . PHE C 2 7   ? 14.449  -18.680 26.903  1.00 1.00   ? 7   PHE E CD1 1 
ATOM   5363 C CD2 . PHE C 2 7   ? 13.117  -20.609 26.434  1.00 1.00   ? 7   PHE E CD2 1 
ATOM   5364 C CE1 . PHE C 2 7   ? 15.595  -19.393 26.630  1.00 1.00   ? 7   PHE E CE1 1 
ATOM   5365 C CE2 . PHE C 2 7   ? 14.255  -21.333 26.158  1.00 1.00   ? 7   PHE E CE2 1 
ATOM   5366 C CZ  . PHE C 2 7   ? 15.497  -20.727 26.257  1.00 1.00   ? 7   PHE E CZ  1 
ATOM   5367 N N   . HIS C 2 8   ? 9.886   -17.748 29.665  1.00 51.48  ? 8   HIS E N   1 
ATOM   5368 C CA  . HIS C 2 8   ? 8.668   -17.056 29.979  1.00 51.48  ? 8   HIS E CA  1 
ATOM   5369 C C   . HIS C 2 8   ? 8.618   -16.621 31.429  1.00 51.48  ? 8   HIS E C   1 
ATOM   5370 O O   . HIS C 2 8   ? 8.184   -15.505 31.739  1.00 51.48  ? 8   HIS E O   1 
ATOM   5371 C CB  . HIS C 2 8   ? 7.490   -17.985 29.676  1.00 91.62  ? 8   HIS E CB  1 
ATOM   5372 C CG  . HIS C 2 8   ? 6.179   -17.283 29.521  1.00 91.62  ? 8   HIS E CG  1 
ATOM   5373 N ND1 . HIS C 2 8   ? 5.894   -16.469 28.447  1.00 91.62  ? 8   HIS E ND1 1 
ATOM   5374 C CD2 . HIS C 2 8   ? 5.068   -17.289 30.295  1.00 91.62  ? 8   HIS E CD2 1 
ATOM   5375 C CE1 . HIS C 2 8   ? 4.663   -16.004 28.565  1.00 91.62  ? 8   HIS E CE1 1 
ATOM   5376 N NE2 . HIS C 2 8   ? 4.140   -16.487 29.678  1.00 91.62  ? 8   HIS E NE2 1 
ATOM   5377 N N   . ARG C 2 9   ? 9.089   -17.491 32.314  1.00 41.72  ? 9   ARG E N   1 
ATOM   5378 C CA  . ARG C 2 9   ? 9.039   -17.213 33.745  1.00 41.72  ? 9   ARG E CA  1 
ATOM   5379 C C   . ARG C 2 9   ? 10.296  -16.681 34.434  1.00 41.72  ? 9   ARG E C   1 
ATOM   5380 O O   . ARG C 2 9   ? 10.295  -16.478 35.659  1.00 41.72  ? 9   ARG E O   1 
ATOM   5381 C CB  . ARG C 2 9   ? 8.560   -18.463 34.479  1.00 92.00  ? 9   ARG E CB  1 
ATOM   5382 C CG  . ARG C 2 9   ? 7.108   -18.789 34.211  1.00 92.00  ? 9   ARG E CG  1 
ATOM   5383 C CD  . ARG C 2 9   ? 6.929   -20.228 33.774  1.00 92.00  ? 9   ARG E CD  1 
ATOM   5384 N NE  . ARG C 2 9   ? 7.392   -21.175 34.782  1.00 92.00  ? 9   ARG E NE  1 
ATOM   5385 C CZ  . ARG C 2 9   ? 6.937   -21.220 36.030  1.00 92.00  ? 9   ARG E CZ  1 
ATOM   5386 N NH1 . ARG C 2 9   ? 6.003   -20.367 36.435  1.00 92.00  ? 9   ARG E NH1 1 
ATOM   5387 N NH2 . ARG C 2 9   ? 7.410   -22.126 36.877  1.00 92.00  ? 9   ARG E NH2 1 
ATOM   5388 N N   . GLY C 2 10  ? 11.359  -16.445 33.666  1.00 29.02  ? 10  GLY E N   1 
ATOM   5389 C CA  . GLY C 2 10  ? 12.596  -15.948 34.251  1.00 29.02  ? 10  GLY E CA  1 
ATOM   5390 C C   . GLY C 2 10  ? 12.689  -14.440 34.454  1.00 29.02  ? 10  GLY E C   1 
ATOM   5391 O O   . GLY C 2 10  ? 11.785  -13.675 34.082  1.00 29.02  ? 10  GLY E O   1 
ATOM   5392 N N   . GLU C 2 11  ? 13.786  -13.999 35.064  1.00 49.22  ? 11  GLU E N   1 
ATOM   5393 C CA  . GLU C 2 11  ? 13.984  -12.573 35.292  1.00 49.22  ? 11  GLU E CA  1 
ATOM   5394 C C   . GLU C 2 11  ? 14.838  -12.019 34.169  1.00 49.22  ? 11  GLU E C   1 
ATOM   5395 O O   . GLU C 2 11  ? 15.985  -12.444 33.955  1.00 49.22  ? 11  GLU E O   1 
ATOM   5396 C CB  . GLU C 2 11  ? 14.531  -12.396 36.713  1.00 37.83  ? 11  GLU E CB  1 
ATOM   5397 C CG  . GLU C 2 11  ? 13.454  -12.878 37.719  1.00 37.83  ? 11  GLU E CG  1 
ATOM   5398 C CD  . GLU C 2 11  ? 13.864  -12.879 39.188  1.00 37.83  ? 11  GLU E CD  1 
ATOM   5399 O OE1 . GLU C 2 11  ? 14.593  -13.801 39.621  1.00 37.83  ? 11  GLU E OE1 1 
ATOM   5400 O OE2 . GLU C 2 11  ? 13.434  -11.961 39.923  1.00 37.83  ? 11  GLU E OE2 1 
ATOM   5401 N N   . PHE C 2 12  ? 14.245  -11.075 33.448  1.00 10.10  ? 12  PHE E N   1 
ATOM   5402 C CA  . PHE C 2 12  ? 14.872  -10.455 32.299  1.00 10.10  ? 12  PHE E CA  1 
ATOM   5403 C C   . PHE C 2 12  ? 15.308  -9.043  32.628  1.00 10.10  ? 12  PHE E C   1 
ATOM   5404 O O   . PHE C 2 12  ? 14.957  -8.507  33.684  1.00 10.10  ? 12  PHE E O   1 
ATOM   5405 C CB  . PHE C 2 12  ? 13.868  -10.367 31.151  1.00 43.13  ? 12  PHE E CB  1 
ATOM   5406 C CG  . PHE C 2 12  ? 13.065  -11.618 30.927  1.00 43.13  ? 12  PHE E CG  1 
ATOM   5407 C CD1 . PHE C 2 12  ? 13.684  -12.827 30.602  1.00 43.13  ? 12  PHE E CD1 1 
ATOM   5408 C CD2 . PHE C 2 12  ? 11.678  -11.577 30.978  1.00 43.13  ? 12  PHE E CD2 1 
ATOM   5409 C CE1 . PHE C 2 12  ? 12.928  -13.978 30.324  1.00 43.13  ? 12  PHE E CE1 1 
ATOM   5410 C CE2 . PHE C 2 12  ? 10.918  -12.721 30.702  1.00 43.13  ? 12  PHE E CE2 1 
ATOM   5411 C CZ  . PHE C 2 12  ? 11.550  -13.920 30.375  1.00 43.13  ? 12  PHE E CZ  1 
ATOM   5412 N N   . SER C 2 13  ? 16.073  -8.462  31.704  1.00 25.42  ? 13  SER E N   1 
ATOM   5413 C CA  . SER C 2 13  ? 16.593  -7.099  31.806  1.00 25.42  ? 13  SER E CA  1 
ATOM   5414 C C   . SER C 2 13  ? 15.666  -6.223  30.996  1.00 25.42  ? 13  SER E C   1 
ATOM   5415 O O   . SER C 2 13  ? 15.023  -6.723  30.061  1.00 25.42  ? 13  SER E O   1 
ATOM   5416 C CB  . SER C 2 13  ? 18.001  -7.030  31.218  1.00 122.34 ? 13  SER E CB  1 
ATOM   5417 O OG  . SER C 2 13  ? 18.847  -7.994  31.813  1.00 122.34 ? 13  SER E OG  1 
ATOM   5418 N N   . VAL C 2 14  ? 15.578  -4.937  31.352  1.00 8.69   ? 14  VAL E N   1 
ATOM   5419 C CA  . VAL C 2 14  ? 14.759  -4.015  30.579  1.00 8.69   ? 14  VAL E CA  1 
ATOM   5420 C C   . VAL C 2 14  ? 15.667  -3.605  29.417  1.00 8.69   ? 14  VAL E C   1 
ATOM   5421 O O   . VAL C 2 14  ? 15.207  -3.287  28.326  1.00 8.69   ? 14  VAL E O   1 
ATOM   5422 C CB  . VAL C 2 14  ? 14.380  -2.789  31.448  1.00 32.30  ? 14  VAL E CB  1 
ATOM   5423 C CG1 . VAL C 2 14  ? 15.617  -2.228  32.133  1.00 32.30  ? 14  VAL E CG1 1 
ATOM   5424 C CG2 . VAL C 2 14  ? 13.720  -1.734  30.603  1.00 32.30  ? 14  VAL E CG2 1 
ATOM   5425 N N   . CYS C 2 15  ? 16.972  -3.640  29.664  1.00 43.17  ? 15  CYS E N   1 
ATOM   5426 C CA  . CYS C 2 15  ? 17.949  -3.287  28.646  1.00 43.17  ? 15  CYS E CA  1 
ATOM   5427 C C   . CYS C 2 15  ? 19.043  -4.341  28.585  1.00 43.17  ? 15  CYS E C   1 
ATOM   5428 O O   . CYS C 2 15  ? 19.579  -4.741  29.613  1.00 43.17  ? 15  CYS E O   1 
ATOM   5429 C CB  . CYS C 2 15  ? 18.587  -1.937  28.950  1.00 23.45  ? 15  CYS E CB  1 
ATOM   5430 S SG  . CYS C 2 15  ? 17.512  -0.487  28.787  1.00 23.45  ? 15  CYS E SG  1 
ATOM   5431 N N   . ASP C 2 16  ? 19.380  -4.769  27.372  1.00 49.71  ? 16  ASP E N   1 
ATOM   5432 C CA  . ASP C 2 16  ? 20.417  -5.774  27.163  1.00 49.71  ? 16  ASP E CA  1 
ATOM   5433 C C   . ASP C 2 16  ? 21.808  -5.184  27.014  1.00 49.71  ? 16  ASP E C   1 
ATOM   5434 O O   . ASP C 2 16  ? 22.017  -4.242  26.253  1.00 49.71  ? 16  ASP E O   1 
ATOM   5435 C CB  . ASP C 2 16  ? 20.097  -6.631  25.932  1.00 104.32 ? 16  ASP E CB  1 
ATOM   5436 C CG  . ASP C 2 16  ? 18.814  -7.433  26.091  1.00 104.32 ? 16  ASP E CG  1 
ATOM   5437 O OD1 . ASP C 2 16  ? 18.614  -8.039  27.167  1.00 104.32 ? 16  ASP E OD1 1 
ATOM   5438 O OD2 . ASP C 2 16  ? 18.010  -7.469  25.135  1.00 104.32 ? 16  ASP E OD2 1 
ATOM   5439 N N   . SER C 2 17  ? 22.762  -5.791  27.711  1.00 24.96  ? 17  SER E N   1 
ATOM   5440 C CA  . SER C 2 17  ? 24.139  -5.337  27.709  1.00 24.96  ? 17  SER E CA  1 
ATOM   5441 C C   . SER C 2 17  ? 25.104  -6.448  27.317  1.00 24.96  ? 17  SER E C   1 
ATOM   5442 O O   . SER C 2 17  ? 24.699  -7.556  27.002  1.00 24.96  ? 17  SER E O   1 
ATOM   5443 C CB  . SER C 2 17  ? 24.505  -4.774  29.085  1.00 74.77  ? 17  SER E CB  1 
ATOM   5444 O OG  . SER C 2 17  ? 24.261  -5.722  30.108  1.00 74.77  ? 17  SER E OG  1 
ATOM   5445 N N   . VAL C 2 18  ? 26.393  -6.138  27.354  1.00 28.19  ? 18  VAL E N   1 
ATOM   5446 C CA  . VAL C 2 18  ? 27.422  -7.086  26.988  1.00 28.19  ? 18  VAL E CA  1 
ATOM   5447 C C   . VAL C 2 18  ? 28.699  -6.681  27.691  1.00 28.19  ? 18  VAL E C   1 
ATOM   5448 O O   . VAL C 2 18  ? 29.104  -5.527  27.610  1.00 28.19  ? 18  VAL E O   1 
ATOM   5449 C CB  . VAL C 2 18  ? 27.658  -7.038  25.462  1.00 21.06  ? 18  VAL E CB  1 
ATOM   5450 C CG1 . VAL C 2 18  ? 27.877  -5.612  25.018  1.00 21.06  ? 18  VAL E CG1 1 
ATOM   5451 C CG2 . VAL C 2 18  ? 28.856  -7.871  25.090  1.00 21.06  ? 18  VAL E CG2 1 
ATOM   5452 N N   . SER C 2 19  ? 29.316  -7.626  28.399  1.00 52.19  ? 19  SER E N   1 
ATOM   5453 C CA  . SER C 2 19  ? 30.565  -7.372  29.119  1.00 52.19  ? 19  SER E CA  1 
ATOM   5454 C C   . SER C 2 19  ? 31.735  -7.956  28.347  1.00 52.19  ? 19  SER E C   1 
ATOM   5455 O O   . SER C 2 19  ? 31.644  -9.062  27.807  1.00 52.19  ? 19  SER E O   1 
ATOM   5456 C CB  . SER C 2 19  ? 30.507  -7.993  30.518  1.00 116.40 ? 19  SER E CB  1 
ATOM   5457 O OG  . SER C 2 19  ? 29.428  -7.466  31.271  1.00 116.40 ? 19  SER E OG  1 
ATOM   5458 N N   . VAL C 2 20  ? 32.829  -7.202  28.303  1.00 67.67  ? 20  VAL E N   1 
ATOM   5459 C CA  . VAL C 2 20  ? 34.042  -7.615  27.620  1.00 67.67  ? 20  VAL E CA  1 
ATOM   5460 C C   . VAL C 2 20  ? 35.227  -7.105  28.416  1.00 67.67  ? 20  VAL E C   1 
ATOM   5461 O O   . VAL C 2 20  ? 35.074  -6.284  29.314  1.00 67.67  ? 20  VAL E O   1 
ATOM   5462 C CB  . VAL C 2 20  ? 34.116  -7.028  26.192  1.00 138.25 ? 20  VAL E CB  1 
ATOM   5463 C CG1 . VAL C 2 20  ? 32.958  -7.550  25.352  1.00 138.25 ? 20  VAL E CG1 1 
ATOM   5464 C CG2 . VAL C 2 20  ? 34.090  -5.505  26.254  1.00 138.25 ? 20  VAL E CG2 1 
ATOM   5465 N N   . TRP C 2 21  ? 36.409  -7.601  28.065  1.00 60.05  ? 21  TRP E N   1 
ATOM   5466 C CA  . TRP C 2 21  ? 37.663  -7.223  28.718  1.00 60.05  ? 21  TRP E CA  1 
ATOM   5467 C C   . TRP C 2 21  ? 38.453  -6.342  27.752  1.00 60.05  ? 21  TRP E C   1 
ATOM   5468 O O   . TRP C 2 21  ? 38.883  -6.818  26.710  1.00 60.05  ? 21  TRP E O   1 
ATOM   5469 C CB  . TRP C 2 21  ? 38.523  -8.441  29.090  1.00 4.88   ? 21  TRP E CB  1 
ATOM   5470 C CG  . TRP C 2 21  ? 38.142  -9.216  30.350  1.00 4.88   ? 21  TRP E CG  1 
ATOM   5471 C CD1 . TRP C 2 21  ? 37.671  -10.495 30.406  1.00 4.88   ? 21  TRP E CD1 1 
ATOM   5472 C CD2 . TRP C 2 21  ? 38.323  -8.802  31.715  1.00 4.88   ? 21  TRP E CD2 1 
ATOM   5473 N NE1 . TRP C 2 21  ? 37.557  -10.907 31.712  1.00 4.88   ? 21  TRP E NE1 1 
ATOM   5474 C CE2 . TRP C 2 21  ? 37.950  -9.888  32.536  1.00 4.88   ? 21  TRP E CE2 1 
ATOM   5475 C CE3 . TRP C 2 21  ? 38.768  -7.623  32.323  1.00 4.88   ? 21  TRP E CE3 1 
ATOM   5476 C CZ2 . TRP C 2 21  ? 38.009  -9.829  33.934  1.00 4.88   ? 21  TRP E CZ2 1 
ATOM   5477 C CZ3 . TRP C 2 21  ? 38.828  -7.566  33.725  1.00 4.88   ? 21  TRP E CZ3 1 
ATOM   5478 C CH2 . TRP C 2 21  ? 38.451  -8.661  34.506  1.00 4.88   ? 21  TRP E CH2 1 
ATOM   5479 N N   . VAL C 2 22  ? 38.651  -5.071  28.093  1.00 57.98  ? 22  VAL E N   1 
ATOM   5480 C CA  . VAL C 2 22  ? 39.388  -4.150  27.227  1.00 57.98  ? 22  VAL E CA  1 
ATOM   5481 C C   . VAL C 2 22  ? 40.844  -3.955  27.630  1.00 57.98  ? 22  VAL E C   1 
ATOM   5482 O O   . VAL C 2 22  ? 41.143  -3.390  28.679  1.00 57.98  ? 22  VAL E O   1 
ATOM   5483 C CB  . VAL C 2 22  ? 38.744  -2.750  27.248  1.00 42.26  ? 22  VAL E CB  1 
ATOM   5484 C CG1 . VAL C 2 22  ? 39.530  -1.801  26.368  1.00 42.26  ? 22  VAL E CG1 1 
ATOM   5485 C CG2 . VAL C 2 22  ? 37.307  -2.836  26.799  1.00 42.26  ? 22  VAL E CG2 1 
ATOM   5486 N N   . GLY C 2 23  ? 41.758  -4.409  26.783  1.00 56.43  ? 23  GLY E N   1 
ATOM   5487 C CA  . GLY C 2 23  ? 43.169  -4.262  27.086  1.00 56.43  ? 23  GLY E CA  1 
ATOM   5488 C C   . GLY C 2 23  ? 43.942  -3.454  26.060  1.00 56.43  ? 23  GLY E C   1 
ATOM   5489 O O   . GLY C 2 23  ? 45.174  -3.391  26.122  1.00 56.43  ? 23  GLY E O   1 
ATOM   5490 N N   . ASP C 2 24  ? 43.224  -2.830  25.124  1.00 84.79  ? 24  ASP E N   1 
ATOM   5491 C CA  . ASP C 2 24  ? 43.844  -2.023  24.070  1.00 84.79  ? 24  ASP E CA  1 
ATOM   5492 C C   . ASP C 2 24  ? 43.466  -0.556  24.201  1.00 84.79  ? 24  ASP E C   1 
ATOM   5493 O O   . ASP C 2 24  ? 43.547  0.207   23.235  1.00 84.79  ? 24  ASP E O   1 
ATOM   5494 C CB  . ASP C 2 24  ? 43.420  -2.536  22.689  1.00 67.90  ? 24  ASP E CB  1 
ATOM   5495 C CG  . ASP C 2 24  ? 41.919  -2.459  22.473  1.00 67.90  ? 24  ASP E CG  1 
ATOM   5496 O OD1 . ASP C 2 24  ? 41.175  -3.130  23.218  1.00 67.90  ? 24  ASP E OD1 1 
ATOM   5497 O OD2 . ASP C 2 24  ? 41.484  -1.729  21.559  1.00 67.90  ? 24  ASP E OD2 1 
ATOM   5498 N N   . LYS C 2 25  ? 43.039  -0.180  25.399  1.00 94.56  ? 25  LYS E N   1 
ATOM   5499 C CA  . LYS C 2 25  ? 42.650  1.190   25.690  1.00 94.56  ? 25  LYS E CA  1 
ATOM   5500 C C   . LYS C 2 25  ? 43.931  2.020   25.697  1.00 94.56  ? 25  LYS E C   1 
ATOM   5501 O O   . LYS C 2 25  ? 44.925  1.598   26.293  1.00 94.56  ? 25  LYS E O   1 
ATOM   5502 C CB  . LYS C 2 25  ? 41.945  1.275   27.046  1.00 60.94  ? 25  LYS E CB  1 
ATOM   5503 C CG  . LYS C 2 25  ? 41.399  2.655   27.359  1.00 60.94  ? 25  LYS E CG  1 
ATOM   5504 C CD  . LYS C 2 25  ? 40.454  2.625   28.546  1.00 60.94  ? 25  LYS E CD  1 
ATOM   5505 C CE  . LYS C 2 25  ? 39.228  1.773   28.261  1.00 60.94  ? 25  LYS E CE  1 
ATOM   5506 N NZ  . LYS C 2 25  ? 38.447  2.283   27.104  1.00 60.94  ? 25  LYS E NZ  1 
ATOM   5507 N N   . THR C 2 26  ? 43.929  3.175   25.026  1.00 72.69  ? 26  THR E N   1 
ATOM   5508 C CA  . THR C 2 26  ? 45.120  4.039   25.014  1.00 72.69  ? 26  THR E CA  1 
ATOM   5509 C C   . THR C 2 26  ? 44.774  5.456   25.430  1.00 72.69  ? 26  THR E C   1 
ATOM   5510 O O   . THR C 2 26  ? 45.648  6.230   25.800  1.00 72.69  ? 26  THR E O   1 
ATOM   5511 C CB  . THR C 2 26  ? 45.703  4.088   23.602  1.00 106.96 ? 26  THR E CB  1 
ATOM   5512 O OG1 . THR C 2 26  ? 44.719  4.627   22.707  1.00 106.96 ? 26  THR E OG1 1 
ATOM   5513 C CG2 . THR C 2 26  ? 46.085  2.685   23.135  1.00 106.96 ? 26  THR E CG2 1 
ATOM   5514 N N   . THR C 2 27  ? 43.496  5.797   25.343  1.00 132.16 ? 27  THR E N   1 
ATOM   5515 C CA  . THR C 2 27  ? 43.028  7.113   25.748  1.00 132.16 ? 27  THR E CA  1 
ATOM   5516 C C   . THR C 2 27  ? 41.760  6.890   26.564  1.00 132.16 ? 27  THR E C   1 
ATOM   5517 O O   . THR C 2 27  ? 41.153  5.829   26.495  1.00 132.16 ? 27  THR E O   1 
ATOM   5518 C CB  . THR C 2 27  ? 42.668  7.979   24.517  1.00 61.63  ? 27  THR E CB  1 
ATOM   5519 O OG1 . THR C 2 27  ? 41.410  7.551   23.976  1.00 61.63  ? 27  THR E OG1 1 
ATOM   5520 C CG2 . THR C 2 27  ? 43.735  7.834   23.438  1.00 61.63  ? 27  THR E CG2 1 
ATOM   5521 N N   . ALA C 2 28  ? 41.373  7.890   27.343  1.00 125.60 ? 28  ALA E N   1 
ATOM   5522 C CA  . ALA C 2 28  ? 40.172  7.832   28.179  1.00 125.60 ? 28  ALA E CA  1 
ATOM   5523 C C   . ALA C 2 28  ? 40.051  9.247   28.704  1.00 125.60 ? 28  ALA E C   1 
ATOM   5524 O O   . ALA C 2 28  ? 40.964  10.043  28.512  1.00 125.60 ? 28  ALA E O   1 
ATOM   5525 C CB  . ALA C 2 28  ? 40.369  6.850   29.327  1.00 132.92 ? 28  ALA E CB  1 
ATOM   5526 N N   . THR C 2 29  ? 38.943  9.586   29.338  1.00 62.51  ? 29  THR E N   1 
ATOM   5527 C CA  . THR C 2 29  ? 38.838  10.928  29.886  1.00 62.51  ? 29  THR E CA  1 
ATOM   5528 C C   . THR C 2 29  ? 38.942  10.787  31.404  1.00 62.51  ? 29  THR E C   1 
ATOM   5529 O O   . THR C 2 29  ? 38.400  9.846   31.989  1.00 62.51  ? 29  THR E O   1 
ATOM   5530 C CB  . THR C 2 29  ? 37.499  11.595  29.520  1.00 76.88  ? 29  THR E CB  1 
ATOM   5531 O OG1 . THR C 2 29  ? 36.417  10.713  29.855  1.00 76.88  ? 29  THR E OG1 1 
ATOM   5532 C CG2 . THR C 2 29  ? 37.456  11.924  28.026  1.00 76.88  ? 29  THR E CG2 1 
ATOM   5533 N N   . ASP C 2 30  ? 39.671  11.691  32.049  1.00 49.89  ? 30  ASP E N   1 
ATOM   5534 C CA  . ASP C 2 30  ? 39.825  11.601  33.493  1.00 49.89  ? 30  ASP E CA  1 
ATOM   5535 C C   . ASP C 2 30  ? 38.623  12.183  34.212  1.00 49.89  ? 30  ASP E C   1 
ATOM   5536 O O   . ASP C 2 30  ? 37.606  12.472  33.589  1.00 49.89  ? 30  ASP E O   1 
ATOM   5537 C CB  . ASP C 2 30  ? 41.071  12.372  33.909  1.00 108.17 ? 30  ASP E CB  1 
ATOM   5538 C CG  . ASP C 2 30  ? 41.125  13.752  33.282  1.00 108.17 ? 30  ASP E CG  1 
ATOM   5539 O OD1 . ASP C 2 30  ? 40.155  14.521  33.441  1.00 108.17 ? 30  ASP E OD1 1 
ATOM   5540 O OD2 . ASP C 2 30  ? 42.136  14.067  32.625  1.00 108.17 ? 30  ASP E OD2 1 
ATOM   5541 N N   . ILE C 2 31  ? 38.734  12.366  35.518  1.00 25.54  ? 31  ILE E N   1 
ATOM   5542 C CA  . ILE C 2 31  ? 37.614  12.876  36.285  1.00 25.54  ? 31  ILE E CA  1 
ATOM   5543 C C   . ILE C 2 31  ? 37.384  14.363  36.033  1.00 25.54  ? 31  ILE E C   1 
ATOM   5544 O O   . ILE C 2 31  ? 36.308  14.898  36.295  1.00 25.54  ? 31  ILE E O   1 
ATOM   5545 C CB  . ILE C 2 31  ? 37.858  12.659  37.797  1.00 38.16  ? 31  ILE E CB  1 
ATOM   5546 C CG1 . ILE C 2 31  ? 36.543  12.749  38.565  1.00 38.16  ? 31  ILE E CG1 1 
ATOM   5547 C CG2 . ILE C 2 31  ? 38.827  13.701  38.321  1.00 38.16  ? 31  ILE E CG2 1 
ATOM   5548 C CD1 . ILE C 2 31  ? 35.621  11.575  38.321  1.00 103.48 ? 31  ILE E CD1 1 
ATOM   5549 N N   . LYS C 2 32  ? 38.394  15.039  35.504  1.00 47.50  ? 32  LYS E N   1 
ATOM   5550 C CA  . LYS C 2 32  ? 38.239  16.454  35.209  1.00 47.50  ? 32  LYS E CA  1 
ATOM   5551 C C   . LYS C 2 32  ? 37.708  16.574  33.789  1.00 47.50  ? 32  LYS E C   1 
ATOM   5552 O O   . LYS C 2 32  ? 37.658  17.659  33.225  1.00 47.50  ? 32  LYS E O   1 
ATOM   5553 C CB  . LYS C 2 32  ? 39.592  17.142  35.351  1.00 74.61  ? 32  LYS E CB  1 
ATOM   5554 C CG  . LYS C 2 32  ? 40.250  16.840  36.690  1.00 74.61  ? 32  LYS E CG  1 
ATOM   5555 C CD  . LYS C 2 32  ? 41.760  17.026  36.657  1.00 74.61  ? 32  LYS E CD  1 
ATOM   5556 C CE  . LYS C 2 32  ? 42.393  16.517  37.949  1.00 74.61  ? 32  LYS E CE  1 
ATOM   5557 N NZ  . LYS C 2 32  ? 43.881  16.581  37.934  1.00 74.61  ? 32  LYS E NZ  1 
ATOM   5558 N N   . GLY C 2 33  ? 37.326  15.446  33.202  1.00 29.98  ? 33  GLY E N   1 
ATOM   5559 C CA  . GLY C 2 33  ? 36.791  15.468  31.854  1.00 29.98  ? 33  GLY E CA  1 
ATOM   5560 C C   . GLY C 2 33  ? 37.863  15.706  30.811  1.00 29.98  ? 33  GLY E C   1 
ATOM   5561 O O   . GLY C 2 33  ? 37.566  15.931  29.631  1.00 29.98  ? 33  GLY E O   1 
ATOM   5562 N N   . LYS C 2 34  ? 39.112  15.665  31.257  1.00 70.11  ? 34  LYS E N   1 
ATOM   5563 C CA  . LYS C 2 34  ? 40.260  15.867  30.388  1.00 70.11  ? 34  LYS E CA  1 
ATOM   5564 C C   . LYS C 2 34  ? 40.567  14.551  29.675  1.00 70.11  ? 34  LYS E C   1 
ATOM   5565 O O   . LYS C 2 34  ? 40.374  13.475  30.246  1.00 70.11  ? 34  LYS E O   1 
ATOM   5566 C CB  . LYS C 2 34  ? 41.487  16.328  31.184  1.00 149.33 ? 34  LYS E CB  1 
ATOM   5567 C CG  . LYS C 2 34  ? 42.743  16.481  30.328  1.00 149.33 ? 34  LYS E CG  1 
ATOM   5568 C CD  . LYS C 2 34  ? 43.972  16.850  31.149  1.00 149.33 ? 34  LYS E CD  1 
ATOM   5569 C CE  . LYS C 2 34  ? 43.871  18.251  31.728  1.00 149.33 ? 34  LYS E CE  1 
ATOM   5570 N NZ  . LYS C 2 34  ? 45.104  18.624  32.476  1.00 149.33 ? 34  LYS E NZ  1 
ATOM   5571 N N   . GLU C 2 35  ? 41.031  14.629  28.427  1.00 82.10  ? 35  GLU E N   1 
ATOM   5572 C CA  . GLU C 2 35  ? 41.404  13.423  27.693  1.00 82.10  ? 35  GLU E CA  1 
ATOM   5573 C C   . GLU C 2 35  ? 42.803  13.042  28.148  1.00 82.10  ? 35  GLU E C   1 
ATOM   5574 O O   . GLU C 2 35  ? 43.706  13.857  28.154  1.00 82.10  ? 35  GLU E O   1 
ATOM   5575 C CB  . GLU C 2 35  ? 41.401  13.687  26.187  1.00 158.24 ? 35  GLU E CB  1 
ATOM   5576 C CG  . GLU C 2 35  ? 42.197  12.670  25.386  1.00 158.24 ? 35  GLU E CG  1 
ATOM   5577 C CD  . GLU C 2 35  ? 42.081  12.886  23.895  1.00 158.24 ? 35  GLU E CD  1 
ATOM   5578 O OE1 . GLU C 2 35  ? 40.993  12.622  23.343  1.00 158.24 ? 35  GLU E OE1 1 
ATOM   5579 O OE2 . GLU C 2 35  ? 43.073  13.326  23.277  1.00 158.24 ? 35  GLU E OE2 1 
ATOM   5580 N N   . VAL C 2 36  ? 43.000  11.792  28.509  1.00 82.79  ? 36  VAL E N   1 
ATOM   5581 C CA  . VAL C 2 36  ? 44.295  11.375  29.000  1.00 82.79  ? 36  VAL E CA  1 
ATOM   5582 C C   . VAL C 2 36  ? 44.780  10.083  28.343  1.00 82.79  ? 36  VAL E C   1 
ATOM   5583 O O   . VAL C 2 36  ? 43.981  9.317   27.800  1.00 82.79  ? 36  VAL E O   1 
ATOM   5584 C CB  . VAL C 2 36  ? 44.280  11.175  30.524  1.00 88.24  ? 36  VAL E CB  1 
ATOM   5585 C CG1 . VAL C 2 36  ? 44.201  12.520  31.219  1.00 88.24  ? 36  VAL E CG1 1 
ATOM   5586 C CG2 . VAL C 2 36  ? 43.101  10.295  30.919  1.00 88.24  ? 36  VAL E CG2 1 
ATOM   5587 N N   . MET C 2 37  ? 46.089  9.855   28.395  1.00 103.45 ? 37  MET E N   1 
ATOM   5588 C CA  . MET C 2 37  ? 46.690  8.662   27.806  1.00 103.45 ? 37  MET E CA  1 
ATOM   5589 C C   . MET C 2 37  ? 46.829  7.556   28.853  1.00 103.45 ? 37  MET E C   1 
ATOM   5590 O O   . MET C 2 37  ? 47.309  7.790   29.964  1.00 103.45 ? 37  MET E O   1 
ATOM   5591 C CB  . MET C 2 37  ? 48.055  8.990   27.199  1.00 184.56 ? 37  MET E CB  1 
ATOM   5592 C CG  . MET C 2 37  ? 47.976  9.885   25.975  1.00 184.56 ? 37  MET E CG  1 
ATOM   5593 S SD  . MET C 2 37  ? 49.569  10.081  25.160  1.00 184.56 ? 37  MET E SD  1 
ATOM   5594 C CE  . MET C 2 37  ? 50.229  11.497  26.038  1.00 184.56 ? 37  MET E CE  1 
ATOM   5595 N N   . VAL C 2 38  ? 46.424  6.348   28.465  1.00 97.51  ? 38  VAL E N   1 
ATOM   5596 C CA  . VAL C 2 38  ? 46.436  5.158   29.325  1.00 97.51  ? 38  VAL E CA  1 
ATOM   5597 C C   . VAL C 2 38  ? 47.638  4.266   29.016  1.00 97.51  ? 38  VAL E C   1 
ATOM   5598 O O   . VAL C 2 38  ? 47.815  3.840   27.873  1.00 97.51  ? 38  VAL E O   1 
ATOM   5599 C CB  . VAL C 2 38  ? 45.150  4.328   29.139  1.00 86.00  ? 38  VAL E CB  1 
ATOM   5600 C CG1 . VAL C 2 38  ? 45.086  3.231   30.193  1.00 86.00  ? 38  VAL E CG1 1 
ATOM   5601 C CG2 . VAL C 2 38  ? 43.931  5.231   29.223  1.00 86.00  ? 38  VAL E CG2 1 
ATOM   5602 N N   . LEU C 2 39  ? 48.458  3.979   30.029  1.00 110.73 ? 39  LEU E N   1 
ATOM   5603 C CA  . LEU C 2 39  ? 49.638  3.129   29.835  1.00 110.73 ? 39  LEU E CA  1 
ATOM   5604 C C   . LEU C 2 39  ? 49.206  1.707   29.539  1.00 110.73 ? 39  LEU E C   1 
ATOM   5605 O O   . LEU C 2 39  ? 48.285  1.190   30.161  1.00 110.73 ? 39  LEU E O   1 
ATOM   5606 C CB  . LEU C 2 39  ? 50.539  3.177   31.072  1.00 110.01 ? 39  LEU E CB  1 
ATOM   5607 C CG  . LEU C 2 39  ? 51.305  4.489   31.296  1.00 110.01 ? 39  LEU E CG  1 
ATOM   5608 C CD1 . LEU C 2 39  ? 52.170  4.783   30.077  1.00 110.01 ? 39  LEU E CD1 1 
ATOM   5609 C CD2 . LEU C 2 39  ? 50.337  5.637   31.546  1.00 110.01 ? 39  LEU E CD2 1 
ATOM   5610 N N   . GLY C 2 40  ? 49.869  1.072   28.586  1.00 111.81 ? 40  GLY E N   1 
ATOM   5611 C CA  . GLY C 2 40  ? 49.508  -0.285  28.244  1.00 111.81 ? 40  GLY E CA  1 
ATOM   5612 C C   . GLY C 2 40  ? 49.901  -1.227  29.358  1.00 111.81 ? 40  GLY E C   1 
ATOM   5613 O O   . GLY C 2 40  ? 49.335  -2.315  29.507  1.00 111.81 ? 40  GLY E O   1 
ATOM   5614 N N   . GLU C 2 41  ? 50.868  -0.803  30.154  1.00 62.67  ? 41  GLU E N   1 
ATOM   5615 C CA  . GLU C 2 41  ? 51.335  -1.634  31.241  1.00 62.67  ? 41  GLU E CA  1 
ATOM   5616 C C   . GLU C 2 41  ? 51.614  -0.836  32.490  1.00 62.67  ? 41  GLU E C   1 
ATOM   5617 O O   . GLU C 2 41  ? 51.656  0.389   32.469  1.00 62.67  ? 41  GLU E O   1 
ATOM   5618 C CB  . GLU C 2 41  ? 52.590  -2.381  30.789  1.00 153.15 ? 41  GLU E CB  1 
ATOM   5619 C CG  . GLU C 2 41  ? 52.450  -2.965  29.386  1.00 153.15 ? 41  GLU E CG  1 
ATOM   5620 C CD  . GLU C 2 41  ? 53.738  -3.547  28.844  1.00 153.15 ? 41  GLU E CD  1 
ATOM   5621 O OE1 . GLU C 2 41  ? 54.773  -2.851  28.889  1.00 153.15 ? 41  GLU E OE1 1 
ATOM   5622 O OE2 . GLU C 2 41  ? 53.712  -4.698  28.359  1.00 153.15 ? 41  GLU E OE2 1 
ATOM   5623 N N   . VAL C 2 42  ? 51.802  -1.557  33.583  1.00 134.82 ? 42  VAL E N   1 
ATOM   5624 C CA  . VAL C 2 42  ? 52.093  -0.979  34.887  1.00 134.82 ? 42  VAL E CA  1 
ATOM   5625 C C   . VAL C 2 42  ? 52.947  -2.033  35.586  1.00 134.82 ? 42  VAL E C   1 
ATOM   5626 O O   . VAL C 2 42  ? 52.995  -3.172  35.130  1.00 134.82 ? 42  VAL E O   1 
ATOM   5627 C CB  . VAL C 2 42  ? 50.787  -0.740  35.693  1.00 159.40 ? 42  VAL E CB  1 
ATOM   5628 C CG1 . VAL C 2 42  ? 49.960  -2.016  35.732  1.00 159.40 ? 42  VAL E CG1 1 
ATOM   5629 C CG2 . VAL C 2 42  ? 51.117  -0.273  37.107  1.00 159.40 ? 42  VAL E CG2 1 
ATOM   5630 N N   . ASN C 2 43  ? 53.634  -1.681  36.664  1.00 173.49 ? 43  ASN E N   1 
ATOM   5631 C CA  . ASN C 2 43  ? 54.440  -2.692  37.334  1.00 173.49 ? 43  ASN E CA  1 
ATOM   5632 C C   . ASN C 2 43  ? 54.587  -2.431  38.820  1.00 173.49 ? 43  ASN E C   1 
ATOM   5633 O O   . ASN C 2 43  ? 54.999  -1.344  39.238  1.00 173.49 ? 43  ASN E O   1 
ATOM   5634 C CB  . ASN C 2 43  ? 55.835  -2.795  36.701  1.00 194.85 ? 43  ASN E CB  1 
ATOM   5635 C CG  . ASN C 2 43  ? 56.722  -1.609  37.036  1.00 194.85 ? 43  ASN E CG  1 
ATOM   5636 O OD1 . ASN C 2 43  ? 56.596  -0.537  36.444  1.00 194.85 ? 43  ASN E OD1 1 
ATOM   5637 N ND2 . ASN C 2 43  ? 57.618  -1.795  38.003  1.00 194.85 ? 43  ASN E ND2 1 
ATOM   5638 N N   . ILE C 2 44  ? 54.237  -3.440  39.613  1.00 181.63 ? 44  ILE E N   1 
ATOM   5639 C CA  . ILE C 2 44  ? 54.305  -3.343  41.065  1.00 181.63 ? 44  ILE E CA  1 
ATOM   5640 C C   . ILE C 2 44  ? 55.590  -3.931  41.619  1.00 181.63 ? 44  ILE E C   1 
ATOM   5641 O O   . ILE C 2 44  ? 55.794  -5.148  41.601  1.00 181.63 ? 44  ILE E O   1 
ATOM   5642 C CB  . ILE C 2 44  ? 53.087  -4.033  41.706  1.00 189.64 ? 44  ILE E CB  1 
ATOM   5643 C CG1 . ILE C 2 44  ? 51.817  -3.607  40.959  1.00 190.45 ? 44  ILE E CG1 1 
ATOM   5644 C CG2 . ILE C 2 44  ? 52.979  -3.640  43.173  1.00 189.64 ? 44  ILE E CG2 1 
ATOM   5645 C CD1 . ILE C 2 44  ? 50.564  -4.336  41.376  1.00 146.97 ? 44  ILE E CD1 1 
ATOM   5646 N N   . ASN C 2 45  ? 56.437  -3.036  42.122  1.00 196.89 ? 45  ASN E N   1 
ATOM   5647 C CA  . ASN C 2 45  ? 57.738  -3.385  42.691  1.00 196.89 ? 45  ASN E CA  1 
ATOM   5648 C C   . ASN C 2 45  ? 58.224  -4.737  42.194  1.00 197.70 ? 45  ASN E C   1 
ATOM   5649 O O   . ASN C 2 45  ? 58.802  -5.514  42.953  1.00 197.70 ? 45  ASN E O   1 
ATOM   5650 C CB  . ASN C 2 45  ? 57.649  -3.359  44.220  1.00 188.55 ? 45  ASN E CB  1 
ATOM   5651 C CG  . ASN C 2 45  ? 56.218  -3.428  44.721  1.00 188.55 ? 45  ASN E CG  1 
ATOM   5652 O OD1 . ASN C 2 45  ? 55.617  -4.501  44.782  1.00 187.74 ? 45  ASN E OD1 1 
ATOM   5653 N ND2 . ASN C 2 45  ? 55.657  -2.273  45.063  1.00 188.55 ? 45  ASN E ND2 1 
ATOM   5654 N N   . ASN C 2 46  ? 58.029  -4.984  40.900  1.00 200.00 ? 46  ASN E N   1 
ATOM   5655 C CA  . ASN C 2 46  ? 58.397  -6.259  40.292  1.00 200.00 ? 46  ASN E CA  1 
ATOM   5656 C C   . ASN C 2 46  ? 58.177  -6.265  38.779  1.00 200.00 ? 46  ASN E C   1 
ATOM   5657 O O   . ASN C 2 46  ? 58.607  -5.354  38.061  1.00 200.00 ? 46  ASN E O   1 
ATOM   5658 C CB  . ASN C 2 46  ? 57.595  -7.419  40.907  1.00 180.80 ? 46  ASN E CB  1 
ATOM   5659 C CG  . ASN C 2 46  ? 58.176  -7.915  42.220  1.00 180.80 ? 46  ASN E CG  1 
ATOM   5660 O OD1 . ASN C 2 46  ? 59.364  -8.230  42.311  1.00 180.80 ? 46  ASN E OD1 1 
ATOM   5661 N ND2 . ASN C 2 46  ? 57.334  -7.999  43.243  1.00 180.80 ? 46  ASN E ND2 1 
ATOM   5662 N N   . SER C 2 47  ? 57.497  -7.312  38.311  1.00 193.58 ? 47  SER E N   1 
ATOM   5663 C CA  . SER C 2 47  ? 57.192  -7.483  36.901  1.00 193.58 ? 47  SER E CA  1 
ATOM   5664 C C   . SER C 2 47  ? 55.989  -6.625  36.513  1.00 193.58 ? 47  SER E C   1 
ATOM   5665 O O   . SER C 2 47  ? 55.359  -5.995  37.386  1.00 193.58 ? 47  SER E O   1 
ATOM   5666 C CB  . SER C 2 47  ? 56.909  -8.964  36.589  1.00 75.74  ? 47  SER E CB  1 
ATOM   5667 O OG  . SER C 2 47  ? 55.844  -9.488  37.373  1.00 75.74  ? 47  SER E OG  1 
ATOM   5668 N N   . VAL C 2 48  ? 55.649  -6.651  35.215  1.00 154.90 ? 48  VAL E N   1 
ATOM   5669 C CA  . VAL C 2 48  ? 54.544  -5.837  34.704  1.00 154.90 ? 48  VAL E CA  1 
ATOM   5670 C C   . VAL C 2 48  ? 53.198  -6.540  34.471  1.00 154.90 ? 48  VAL E C   1 
ATOM   5671 O O   . VAL C 2 48  ? 53.135  -7.665  33.977  1.00 154.90 ? 48  VAL E O   1 
ATOM   5672 C CB  . VAL C 2 48  ? 54.937  -5.151  33.371  1.00 116.31 ? 48  VAL E CB  1 
ATOM   5673 C CG1 . VAL C 2 48  ? 56.168  -4.279  33.573  1.00 116.31 ? 48  VAL E CG1 1 
ATOM   5674 C CG2 . VAL C 2 48  ? 55.186  -6.203  32.295  1.00 116.31 ? 48  VAL E CG2 1 
ATOM   5675 N N   . PHE C 2 49  ? 52.132  -5.833  34.818  1.00 200.00 ? 49  PHE E N   1 
ATOM   5676 C CA  . PHE C 2 49  ? 50.771  -6.293  34.656  1.00 200.00 ? 49  PHE E CA  1 
ATOM   5677 C C   . PHE C 2 49  ? 50.229  -5.511  33.480  1.00 200.00 ? 49  PHE E C   1 
ATOM   5678 O O   . PHE C 2 49  ? 50.115  -4.304  33.579  1.00 200.00 ? 49  PHE E O   1 
ATOM   5679 C CB  . PHE C 2 49  ? 49.936  -5.987  35.907  1.00 200.00 ? 49  PHE E CB  1 
ATOM   5680 C CG  . PHE C 2 49  ? 50.359  -6.751  37.138  1.00 200.00 ? 49  PHE E CG  1 
ATOM   5681 C CD1 . PHE C 2 49  ? 51.600  -6.526  37.730  1.00 200.00 ? 49  PHE E CD1 1 
ATOM   5682 C CD2 . PHE C 2 49  ? 49.500  -7.683  37.718  1.00 200.00 ? 49  PHE E CD2 1 
ATOM   5683 C CE1 . PHE C 2 49  ? 51.980  -7.219  38.884  1.00 200.00 ? 49  PHE E CE1 1 
ATOM   5684 C CE2 . PHE C 2 49  ? 49.869  -8.380  38.870  1.00 200.00 ? 49  PHE E CE2 1 
ATOM   5685 C CZ  . PHE C 2 49  ? 51.112  -8.147  39.454  1.00 200.00 ? 49  PHE E CZ  1 
ATOM   5686 N N   . LYS C 2 50  ? 49.898  -6.166  32.373  1.00 94.87  ? 50  LYS E N   1 
ATOM   5687 C CA  . LYS C 2 50  ? 49.329  -5.437  31.239  1.00 94.87  ? 50  LYS E CA  1 
ATOM   5688 C C   . LYS C 2 50  ? 47.956  -4.918  31.701  1.00 94.87  ? 50  LYS E C   1 
ATOM   5689 O O   . LYS C 2 50  ? 47.125  -5.684  32.201  1.00 94.87  ? 50  LYS E O   1 
ATOM   5690 C CB  . LYS C 2 50  ? 49.121  -6.341  30.021  1.00 53.01  ? 50  LYS E CB  1 
ATOM   5691 C CG  . LYS C 2 50  ? 48.261  -5.666  28.962  1.00 53.01  ? 50  LYS E CG  1 
ATOM   5692 C CD  . LYS C 2 50  ? 48.031  -6.519  27.736  1.00 53.01  ? 50  LYS E CD  1 
ATOM   5693 C CE  . LYS C 2 50  ? 47.160  -5.753  26.743  1.00 53.01  ? 50  LYS E CE  1 
ATOM   5694 N NZ  . LYS C 2 50  ? 46.929  -6.474  25.458  1.00 53.01  ? 50  LYS E NZ  1 
ATOM   5695 N N   . GLN C 2 51  ? 47.727  -3.616  31.541  1.00 86.26  ? 51  GLN E N   1 
ATOM   5696 C CA  . GLN C 2 51  ? 46.490  -2.974  31.988  1.00 86.26  ? 51  GLN E CA  1 
ATOM   5697 C C   . GLN C 2 51  ? 45.219  -3.389  31.238  1.00 86.26  ? 51  GLN E C   1 
ATOM   5698 O O   . GLN C 2 51  ? 45.061  -3.104  30.052  1.00 86.26  ? 51  GLN E O   1 
ATOM   5699 C CB  . GLN C 2 51  ? 46.669  -1.456  31.898  1.00 111.16 ? 51  GLN E CB  1 
ATOM   5700 C CG  . GLN C 2 51  ? 45.852  -0.660  32.898  1.00 111.16 ? 51  GLN E CG  1 
ATOM   5701 C CD  . GLN C 2 51  ? 46.554  0.622   33.324  1.00 111.16 ? 51  GLN E CD  1 
ATOM   5702 O OE1 . GLN C 2 51  ? 45.998  1.426   34.069  1.00 111.16 ? 51  GLN E OE1 1 
ATOM   5703 N NE2 . GLN C 2 51  ? 47.786  0.812   32.858  1.00 111.16 ? 51  GLN E NE2 1 
ATOM   5704 N N   . TYR C 2 52  ? 44.307  -4.051  31.943  1.00 64.13  ? 52  TYR E N   1 
ATOM   5705 C CA  . TYR C 2 52  ? 43.042  -4.517  31.360  1.00 64.13  ? 52  TYR E CA  1 
ATOM   5706 C C   . TYR C 2 52  ? 41.859  -3.894  32.091  1.00 64.13  ? 52  TYR E C   1 
ATOM   5707 O O   . TYR C 2 52  ? 41.941  -3.626  33.284  1.00 64.13  ? 52  TYR E O   1 
ATOM   5708 C CB  . TYR C 2 52  ? 42.917  -6.037  31.521  1.00 48.07  ? 52  TYR E CB  1 
ATOM   5709 C CG  . TYR C 2 52  ? 43.740  -6.912  30.583  1.00 48.07  ? 52  TYR E CG  1 
ATOM   5710 C CD1 . TYR C 2 52  ? 43.462  -6.957  29.213  1.00 48.07  ? 52  TYR E CD1 1 
ATOM   5711 C CD2 . TYR C 2 52  ? 44.738  -7.760  31.080  1.00 48.07  ? 52  TYR E CD2 1 
ATOM   5712 C CE1 . TYR C 2 52  ? 44.148  -7.830  28.364  1.00 48.07  ? 52  TYR E CE1 1 
ATOM   5713 C CE2 . TYR C 2 52  ? 45.426  -8.631  30.242  1.00 48.07  ? 52  TYR E CE2 1 
ATOM   5714 C CZ  . TYR C 2 52  ? 45.124  -8.665  28.886  1.00 48.07  ? 52  TYR E CZ  1 
ATOM   5715 O OH  . TYR C 2 52  ? 45.781  -9.546  28.051  1.00 48.07  ? 52  TYR E OH  1 
ATOM   5716 N N   . PHE C 2 53  ? 40.750  -3.698  31.385  1.00 50.87  ? 53  PHE E N   1 
ATOM   5717 C CA  . PHE C 2 53  ? 39.564  -3.113  31.991  1.00 50.87  ? 53  PHE E CA  1 
ATOM   5718 C C   . PHE C 2 53  ? 38.278  -3.897  31.736  1.00 50.87  ? 53  PHE E C   1 
ATOM   5719 O O   . PHE C 2 53  ? 38.038  -4.399  30.632  1.00 50.87  ? 53  PHE E O   1 
ATOM   5720 C CB  . PHE C 2 53  ? 39.354  -1.684  31.472  1.00 70.89  ? 53  PHE E CB  1 
ATOM   5721 C CG  . PHE C 2 53  ? 40.469  -0.730  31.812  1.00 70.89  ? 53  PHE E CG  1 
ATOM   5722 C CD1 . PHE C 2 53  ? 40.807  -0.471  33.137  1.00 70.89  ? 53  PHE E CD1 1 
ATOM   5723 C CD2 . PHE C 2 53  ? 41.159  -0.064  30.803  1.00 70.89  ? 53  PHE E CD2 1 
ATOM   5724 C CE1 . PHE C 2 53  ? 41.814  0.439   33.452  1.00 70.89  ? 53  PHE E CE1 1 
ATOM   5725 C CE2 . PHE C 2 53  ? 42.166  0.846   31.108  1.00 70.89  ? 53  PHE E CE2 1 
ATOM   5726 C CZ  . PHE C 2 53  ? 42.494  1.099   32.435  1.00 70.89  ? 53  PHE E CZ  1 
ATOM   5727 N N   . PHE C 2 54  ? 37.456  -4.019  32.774  1.00 57.07  ? 54  PHE E N   1 
ATOM   5728 C CA  . PHE C 2 54  ? 36.187  -4.721  32.631  1.00 57.07  ? 54  PHE E CA  1 
ATOM   5729 C C   . PHE C 2 54  ? 35.116  -3.748  32.197  1.00 57.07  ? 54  PHE E C   1 
ATOM   5730 O O   . PHE C 2 54  ? 34.742  -2.846  32.956  1.00 57.07  ? 54  PHE E O   1 
ATOM   5731 C CB  . PHE C 2 54  ? 35.803  -5.314  33.979  1.00 39.99  ? 54  PHE E CB  1 
ATOM   5732 C CG  . PHE C 2 54  ? 34.640  -6.241  33.930  1.00 39.99  ? 54  PHE E CG  1 
ATOM   5733 C CD1 . PHE C 2 54  ? 34.771  -7.507  33.375  1.00 39.99  ? 54  PHE E CD1 1 
ATOM   5734 C CD2 . PHE C 2 54  ? 33.422  -5.869  34.479  1.00 39.99  ? 54  PHE E CD2 1 
ATOM   5735 C CE1 . PHE C 2 54  ? 33.706  -8.400  33.371  1.00 39.99  ? 54  PHE E CE1 1 
ATOM   5736 C CE2 . PHE C 2 54  ? 32.345  -6.751  34.481  1.00 39.99  ? 54  PHE E CE2 1 
ATOM   5737 C CZ  . PHE C 2 54  ? 32.488  -8.023  33.926  1.00 39.99  ? 54  PHE E CZ  1 
ATOM   5738 N N   . GLU C 2 55  ? 34.609  -3.925  30.986  1.00 29.85  ? 55  GLU E N   1 
ATOM   5739 C CA  . GLU C 2 55  ? 33.588  -3.017  30.501  1.00 29.85  ? 55  GLU E CA  1 
ATOM   5740 C C   . GLU C 2 55  ? 32.263  -3.656  30.096  1.00 29.85  ? 55  GLU E C   1 
ATOM   5741 O O   . GLU C 2 55  ? 32.227  -4.759  29.556  1.00 29.85  ? 55  GLU E O   1 
ATOM   5742 C CB  . GLU C 2 55  ? 34.145  -2.212  29.332  1.00 41.07  ? 55  GLU E CB  1 
ATOM   5743 C CG  . GLU C 2 55  ? 35.583  -1.779  29.530  1.00 41.07  ? 55  GLU E CG  1 
ATOM   5744 C CD  . GLU C 2 55  ? 35.795  -0.309  29.264  1.00 41.07  ? 55  GLU E CD  1 
ATOM   5745 O OE1 . GLU C 2 55  ? 35.293  0.204   28.239  1.00 41.07  ? 55  GLU E OE1 1 
ATOM   5746 O OE2 . GLU C 2 55  ? 36.479  0.332   30.082  1.00 41.07  ? 55  GLU E OE2 1 
ATOM   5747 N N   . THR C 2 56  ? 31.176  -2.943  30.385  1.00 31.57  ? 56  THR E N   1 
ATOM   5748 C CA  . THR C 2 56  ? 29.828  -3.377  30.042  1.00 31.57  ? 56  THR E CA  1 
ATOM   5749 C C   . THR C 2 56  ? 29.136  -2.197  29.367  1.00 31.57  ? 56  THR E C   1 
ATOM   5750 O O   . THR C 2 56  ? 29.074  -1.103  29.935  1.00 31.57  ? 56  THR E O   1 
ATOM   5751 C CB  . THR C 2 56  ? 29.067  -3.760  31.302  1.00 31.93  ? 56  THR E CB  1 
ATOM   5752 O OG1 . THR C 2 56  ? 29.922  -4.533  32.151  1.00 31.93  ? 56  THR E OG1 1 
ATOM   5753 C CG2 . THR C 2 56  ? 27.848  -4.577  30.947  1.00 31.93  ? 56  THR E CG2 1 
ATOM   5754 N N   . LYS C 2 57  ? 28.633  -2.419  28.156  1.00 41.75  ? 57  LYS E N   1 
ATOM   5755 C CA  . LYS C 2 57  ? 27.935  -1.374  27.412  1.00 41.75  ? 57  LYS E CA  1 
ATOM   5756 C C   . LYS C 2 57  ? 26.634  -1.938  26.884  1.00 41.75  ? 57  LYS E C   1 
ATOM   5757 O O   . LYS C 2 57  ? 26.340  -3.113  27.077  1.00 41.75  ? 57  LYS E O   1 
ATOM   5758 C CB  . LYS C 2 57  ? 28.764  -0.920  26.213  1.00 49.25  ? 57  LYS E CB  1 
ATOM   5759 C CG  . LYS C 2 57  ? 28.890  -2.010  25.140  1.00 49.25  ? 57  LYS E CG  1 
ATOM   5760 C CD  . LYS C 2 57  ? 29.464  -1.488  23.835  1.00 49.25  ? 57  LYS E CD  1 
ATOM   5761 C CE  . LYS C 2 57  ? 30.908  -0.997  23.985  1.00 49.25  ? 57  LYS E CE  1 
ATOM   5762 N NZ  . LYS C 2 57  ? 31.869  -2.085  24.331  1.00 49.25  ? 57  LYS E NZ  1 
ATOM   5763 N N   . CYS C 2 58  ? 25.841  -1.108  26.230  1.00 59.25  ? 58  CYS E N   1 
ATOM   5764 C CA  . CYS C 2 58  ? 24.589  -1.604  25.695  1.00 59.25  ? 58  CYS E CA  1 
ATOM   5765 C C   . CYS C 2 58  ? 24.844  -2.541  24.519  1.00 59.25  ? 58  CYS E C   1 
ATOM   5766 O O   . CYS C 2 58  ? 25.658  -2.264  23.631  1.00 59.25  ? 58  CYS E O   1 
ATOM   5767 C CB  . CYS C 2 58  ? 23.663  -0.457  25.298  1.00 112.29 ? 58  CYS E CB  1 
ATOM   5768 S SG  . CYS C 2 58  ? 23.036  0.533   26.701  1.00 112.29 ? 58  CYS E SG  1 
ATOM   5769 N N   . ARG C 2 59  ? 24.151  -3.669  24.553  1.00 93.54  ? 59  ARG E N   1 
ATOM   5770 C CA  . ARG C 2 59  ? 24.243  -4.678  23.518  1.00 93.54  ? 59  ARG E CA  1 
ATOM   5771 C C   . ARG C 2 59  ? 23.368  -4.159  22.394  1.00 93.54  ? 59  ARG E C   1 
ATOM   5772 O O   . ARG C 2 59  ? 22.242  -3.732  22.627  1.00 93.54  ? 59  ARG E O   1 
ATOM   5773 C CB  . ARG C 2 59  ? 23.720  -6.038  23.982  1.00 135.63 ? 59  ARG E CB  1 
ATOM   5774 C CG  . ARG C 2 59  ? 23.366  -6.951  22.814  1.00 135.63 ? 59  ARG E CG  1 
ATOM   5775 C CD  . ARG C 2 59  ? 23.369  -8.406  23.204  1.00 135.63 ? 59  ARG E CD  1 
ATOM   5776 N NE  . ARG C 2 59  ? 24.707  -8.849  23.579  1.00 135.63 ? 59  ARG E NE  1 
ATOM   5777 C CZ  . ARG C 2 59  ? 25.015  -10.099 23.909  1.00 135.63 ? 59  ARG E CZ  1 
ATOM   5778 N NH1 . ARG C 2 59  ? 24.076  -11.036 23.910  1.00 135.63 ? 59  ARG E NH1 1 
ATOM   5779 N NH2 . ARG C 2 59  ? 26.260  -10.413 24.242  1.00 135.63 ? 59  ARG E NH2 1 
ATOM   5780 N N   . ASP C 2 60  ? 23.904  -4.173  21.183  1.00 169.78 ? 60  ASP E N   1 
ATOM   5781 C CA  . ASP C 2 60  ? 23.188  -3.695  20.007  1.00 169.78 ? 60  ASP E CA  1 
ATOM   5782 C C   . ASP C 2 60  ? 21.680  -3.554  20.194  1.00 169.78 ? 60  ASP E C   1 
ATOM   5783 O O   . ASP C 2 60  ? 20.895  -4.223  19.521  1.00 169.78 ? 60  ASP E O   1 
ATOM   5784 C CB  . ASP C 2 60  ? 23.501  -4.563  18.785  1.00 200.00 ? 60  ASP E CB  1 
ATOM   5785 C CG  . ASP C 2 60  ? 24.328  -3.819  17.747  1.00 200.00 ? 60  ASP E CG  1 
ATOM   5786 O OD1 . ASP C 2 60  ? 23.858  -2.772  17.252  1.00 200.00 ? 60  ASP E OD1 1 
ATOM   5787 O OD2 . ASP C 2 60  ? 25.449  -4.275  17.433  1.00 200.00 ? 60  ASP E OD2 1 
ATOM   5788 N N   . GLY C 2 67  ? 12.439  1.097   22.299  1.00 65.03  ? 67  GLY E N   1 
ATOM   5789 C CA  . GLY C 2 67  ? 12.590  1.479   23.717  1.00 65.03  ? 67  GLY E CA  1 
ATOM   5790 C C   . GLY C 2 67  ? 13.066  0.323   24.575  1.00 65.03  ? 67  GLY E C   1 
ATOM   5791 O O   . GLY C 2 67  ? 13.664  -0.632  24.074  1.00 65.03  ? 67  GLY E O   1 
ATOM   5792 N N   . CYS C 2 68  ? 12.800  0.408   25.873  1.00 40.41  ? 68  CYS E N   1 
ATOM   5793 C CA  . CYS C 2 68  ? 13.204  -0.633  26.800  1.00 40.41  ? 68  CYS E CA  1 
ATOM   5794 C C   . CYS C 2 68  ? 12.123  -1.690  26.939  1.00 40.41  ? 68  CYS E C   1 
ATOM   5795 O O   . CYS C 2 68  ? 10.970  -1.466  26.586  1.00 40.41  ? 68  CYS E O   1 
ATOM   5796 C CB  . CYS C 2 68  ? 13.459  -0.010  28.183  1.00 46.17  ? 68  CYS E CB  1 
ATOM   5797 S SG  . CYS C 2 68  ? 14.299  1.609   28.189  1.00 46.17  ? 68  CYS E SG  1 
ATOM   5798 N N   . ARG C 2 69  ? 12.501  -2.843  27.474  1.00 27.30  ? 69  ARG E N   1 
ATOM   5799 C CA  . ARG C 2 69  ? 11.572  -3.934  27.679  1.00 27.30  ? 69  ARG E CA  1 
ATOM   5800 C C   . ARG C 2 69  ? 10.660  -3.654  28.882  1.00 27.30  ? 69  ARG E C   1 
ATOM   5801 O O   . ARG C 2 69  ? 11.094  -3.115  29.903  1.00 27.30  ? 69  ARG E O   1 
ATOM   5802 C CB  . ARG C 2 69  ? 12.349  -5.230  27.919  1.00 52.00  ? 69  ARG E CB  1 
ATOM   5803 C CG  . ARG C 2 69  ? 11.629  -6.500  27.495  1.00 52.00  ? 69  ARG E CG  1 
ATOM   5804 C CD  . ARG C 2 69  ? 12.405  -7.731  27.953  1.00 52.00  ? 69  ARG E CD  1 
ATOM   5805 N NE  . ARG C 2 69  ? 13.847  -7.580  27.749  1.00 52.00  ? 69  ARG E NE  1 
ATOM   5806 C CZ  . ARG C 2 69  ? 14.444  -7.523  26.562  1.00 52.00  ? 69  ARG E CZ  1 
ATOM   5807 N NH1 . ARG C 2 69  ? 13.731  -7.608  25.448  1.00 52.00  ? 69  ARG E NH1 1 
ATOM   5808 N NH2 . ARG C 2 69  ? 15.760  -7.377  26.490  1.00 52.00  ? 69  ARG E NH2 1 
ATOM   5809 N N   . GLY C 2 70  ? 9.396   -4.040  28.751  1.00 42.91  ? 70  GLY E N   1 
ATOM   5810 C CA  . GLY C 2 70  ? 8.415   -3.861  29.811  1.00 42.91  ? 70  GLY E CA  1 
ATOM   5811 C C   . GLY C 2 70  ? 7.983   -2.453  30.184  1.00 42.91  ? 70  GLY E C   1 
ATOM   5812 O O   . GLY C 2 70  ? 7.467   -2.242  31.281  1.00 42.91  ? 70  GLY E O   1 
ATOM   5813 N N   . ILE C 2 71  ? 8.178   -1.491  29.288  1.00 64.04  ? 71  ILE E N   1 
ATOM   5814 C CA  . ILE C 2 71  ? 7.801   -0.104  29.567  1.00 64.04  ? 71  ILE E CA  1 
ATOM   5815 C C   . ILE C 2 71  ? 6.340   0.166   29.189  1.00 64.04  ? 71  ILE E C   1 
ATOM   5816 O O   . ILE C 2 71  ? 5.855   -0.319  28.164  1.00 64.04  ? 71  ILE E O   1 
ATOM   5817 C CB  . ILE C 2 71  ? 8.726   0.893   28.832  1.00 48.84  ? 71  ILE E CB  1 
ATOM   5818 C CG1 . ILE C 2 71  ? 10.174  0.669   29.272  1.00 48.84  ? 71  ILE E CG1 1 
ATOM   5819 C CG2 . ILE C 2 71  ? 8.326   2.327   29.156  1.00 48.84  ? 71  ILE E CG2 1 
ATOM   5820 C CD1 . ILE C 2 71  ? 10.396  0.825   30.764  1.00 122.27 ? 71  ILE E CD1 1 
ATOM   5821 N N   . ASP C 2 72  ? 5.644   0.931   30.028  1.00 64.84  ? 72  ASP E N   1 
ATOM   5822 C CA  . ASP C 2 72  ? 4.267   1.296   29.747  1.00 64.84  ? 72  ASP E CA  1 
ATOM   5823 C C   . ASP C 2 72  ? 4.328   2.409   28.690  1.00 64.84  ? 72  ASP E C   1 
ATOM   5824 O O   . ASP C 2 72  ? 4.390   3.600   29.006  1.00 64.84  ? 72  ASP E O   1 
ATOM   5825 C CB  . ASP C 2 72  ? 3.517   1.809   30.967  1.00 55.12  ? 72  ASP E CB  1 
ATOM   5826 C CG  . ASP C 2 72  ? 2.160   2.378   30.595  1.00 55.12  ? 72  ASP E CG  1 
ATOM   5827 O OD1 . ASP C 2 72  ? 1.512   1.809   29.691  1.00 55.12  ? 72  ASP E OD1 1 
ATOM   5828 O OD2 . ASP C 2 72  ? 1.737   3.384   31.198  1.00 55.12  ? 72  ASP E OD2 1 
ATOM   5829 N N   . SER C 2 73  ? 4.320   1.995   27.428  1.00 76.19  ? 73  SER E N   1 
ATOM   5830 C CA  . SER C 2 73  ? 4.394   2.899   26.286  1.00 76.19  ? 73  SER E CA  1 
ATOM   5831 C C   . SER C 2 73  ? 3.256   3.903   26.133  1.00 76.19  ? 73  SER E C   1 
ATOM   5832 O O   . SER C 2 73  ? 3.262   4.701   25.201  1.00 76.19  ? 73  SER E O   1 
ATOM   5833 C CB  . SER C 2 73  ? 4.519   2.102   24.986  1.00 89.68  ? 73  SER E CB  1 
ATOM   5834 O OG  . SER C 2 73  ? 5.779   1.466   24.904  1.00 89.68  ? 73  SER E OG  1 
ATOM   5835 N N   . LYS C 2 74  ? 2.277   3.864   27.023  1.00 88.23  ? 74  LYS E N   1 
ATOM   5836 C CA  . LYS C 2 74  ? 1.156   4.781   26.916  1.00 88.23  ? 74  LYS E CA  1 
ATOM   5837 C C   . LYS C 2 74  ? 1.470   6.131   27.553  1.00 88.23  ? 74  LYS E C   1 
ATOM   5838 O O   . LYS C 2 74  ? 0.907   7.171   27.173  1.00 88.23  ? 74  LYS E O   1 
ATOM   5839 C CB  . LYS C 2 74  ? -0.086  4.156   27.562  1.00 200.00 ? 74  LYS E CB  1 
ATOM   5840 C CG  . LYS C 2 74  ? -1.407  4.771   27.121  1.00 200.00 ? 74  LYS E CG  1 
ATOM   5841 C CD  . LYS C 2 74  ? -2.589  3.988   27.681  1.00 200.00 ? 74  LYS E CD  1 
ATOM   5842 C CE  . LYS C 2 74  ? -3.915  4.551   27.188  1.00 200.00 ? 74  LYS E CE  1 
ATOM   5843 N NZ  . LYS C 2 74  ? -5.080  3.804   27.742  1.00 200.00 ? 74  LYS E NZ  1 
ATOM   5844 N N   . HIS C 2 75  ? 2.379   6.115   28.521  1.00 79.01  ? 75  HIS E N   1 
ATOM   5845 C CA  . HIS C 2 75  ? 2.731   7.332   29.220  1.00 79.01  ? 75  HIS E CA  1 
ATOM   5846 C C   . HIS C 2 75  ? 4.197   7.670   29.108  1.00 79.01  ? 75  HIS E C   1 
ATOM   5847 O O   . HIS C 2 75  ? 4.609   8.783   29.429  1.00 79.01  ? 75  HIS E O   1 
ATOM   5848 C CB  . HIS C 2 75  ? 2.322   7.211   30.696  1.00 70.52  ? 75  HIS E CB  1 
ATOM   5849 C CG  . HIS C 2 75  ? 0.876   6.866   30.903  1.00 70.52  ? 75  HIS E CG  1 
ATOM   5850 N ND1 . HIS C 2 75  ? 0.315   6.731   32.155  1.00 70.52  ? 75  HIS E ND1 1 
ATOM   5851 C CD2 . HIS C 2 75  ? -0.123  6.627   30.020  1.00 70.52  ? 75  HIS E CD2 1 
ATOM   5852 C CE1 . HIS C 2 75  ? -0.964  6.423   32.034  1.00 70.52  ? 75  HIS E CE1 1 
ATOM   5853 N NE2 . HIS C 2 75  ? -1.254  6.353   30.748  1.00 70.52  ? 75  HIS E NE2 1 
ATOM   5854 N N   . TRP C 2 76  ? 4.988   6.719   28.630  1.00 33.30  ? 76  TRP E N   1 
ATOM   5855 C CA  . TRP C 2 76  ? 6.423   6.929   28.550  1.00 33.30  ? 76  TRP E CA  1 
ATOM   5856 C C   . TRP C 2 76  ? 7.147   6.568   27.292  1.00 33.30  ? 76  TRP E C   1 
ATOM   5857 O O   . TRP C 2 76  ? 6.887   5.543   26.674  1.00 33.30  ? 76  TRP E O   1 
ATOM   5858 C CB  . TRP C 2 76  ? 7.128   6.169   29.673  1.00 26.94  ? 76  TRP E CB  1 
ATOM   5859 C CG  . TRP C 2 76  ? 6.618   6.443   31.024  1.00 26.94  ? 76  TRP E CG  1 
ATOM   5860 C CD1 . TRP C 2 76  ? 5.676   5.734   31.707  1.00 26.94  ? 76  TRP E CD1 1 
ATOM   5861 C CD2 . TRP C 2 76  ? 7.023   7.508   31.879  1.00 26.94  ? 76  TRP E CD2 1 
ATOM   5862 N NE1 . TRP C 2 76  ? 5.469   6.291   32.941  1.00 26.94  ? 76  TRP E NE1 1 
ATOM   5863 C CE2 . TRP C 2 76  ? 6.286   7.383   33.075  1.00 26.94  ? 76  TRP E CE2 1 
ATOM   5864 C CE3 . TRP C 2 76  ? 7.940   8.559   31.752  1.00 26.94  ? 76  TRP E CE3 1 
ATOM   5865 C CZ2 . TRP C 2 76  ? 6.437   8.272   34.143  1.00 26.94  ? 76  TRP E CZ2 1 
ATOM   5866 C CZ3 . TRP C 2 76  ? 8.092   9.444   32.811  1.00 26.94  ? 76  TRP E CZ3 1 
ATOM   5867 C CH2 . TRP C 2 76  ? 7.343   9.294   33.994  1.00 26.94  ? 76  TRP E CH2 1 
ATOM   5868 N N   . ASN C 2 77  ? 8.106   7.411   26.952  1.00 45.95  ? 77  ASN E N   1 
ATOM   5869 C CA  . ASN C 2 77  ? 8.968   7.153   25.824  1.00 45.95  ? 77  ASN E CA  1 
ATOM   5870 C C   . ASN C 2 77  ? 10.137  6.529   26.550  1.00 45.95  ? 77  ASN E C   1 
ATOM   5871 O O   . ASN C 2 77  ? 10.233  6.645   27.766  1.00 45.95  ? 77  ASN E O   1 
ATOM   5872 C CB  . ASN C 2 77  ? 9.456   8.481   25.249  1.00 104.86 ? 77  ASN E CB  1 
ATOM   5873 C CG  . ASN C 2 77  ? 9.012   8.720   23.829  1.00 104.86 ? 77  ASN E CG  1 
ATOM   5874 O OD1 . ASN C 2 77  ? 9.060   7.825   22.987  1.00 104.86 ? 77  ASN E OD1 1 
ATOM   5875 N ND2 . ASN C 2 77  ? 8.603   9.951   23.543  1.00 104.86 ? 77  ASN E ND2 1 
ATOM   5876 N N   . SER C 2 78  ? 11.025  5.860   25.836  1.00 59.76  ? 78  SER E N   1 
ATOM   5877 C CA  . SER C 2 78  ? 12.158  5.283   26.523  1.00 59.76  ? 78  SER E CA  1 
ATOM   5878 C C   . SER C 2 78  ? 13.256  4.839   25.587  1.00 59.76  ? 78  SER E C   1 
ATOM   5879 O O   . SER C 2 78  ? 13.051  4.674   24.383  1.00 59.76  ? 78  SER E O   1 
ATOM   5880 C CB  . SER C 2 78  ? 11.706  4.088   27.368  1.00 88.82  ? 78  SER E CB  1 
ATOM   5881 O OG  . SER C 2 78  ? 11.111  3.086   26.560  1.00 88.82  ? 78  SER E OG  1 
ATOM   5882 N N   . TYR C 2 79  ? 14.444  4.686   26.151  1.00 29.07  ? 79  TYR E N   1 
ATOM   5883 C CA  . TYR C 2 79  ? 15.595  4.227   25.396  1.00 29.07  ? 79  TYR E CA  1 
ATOM   5884 C C   . TYR C 2 79  ? 16.664  3.657   26.331  1.00 29.07  ? 79  TYR E C   1 
ATOM   5885 O O   . TYR C 2 79  ? 16.704  3.953   27.527  1.00 29.07  ? 79  TYR E O   1 
ATOM   5886 C CB  . TYR C 2 79  ? 16.177  5.344   24.520  1.00 52.78  ? 79  TYR E CB  1 
ATOM   5887 C CG  . TYR C 2 79  ? 16.873  6.464   25.254  1.00 52.78  ? 79  TYR E CG  1 
ATOM   5888 C CD1 . TYR C 2 79  ? 16.149  7.479   25.877  1.00 52.78  ? 79  TYR E CD1 1 
ATOM   5889 C CD2 . TYR C 2 79  ? 18.262  6.525   25.298  1.00 52.78  ? 79  TYR E CD2 1 
ATOM   5890 C CE1 . TYR C 2 79  ? 16.795  8.528   26.518  1.00 52.78  ? 79  TYR E CE1 1 
ATOM   5891 C CE2 . TYR C 2 79  ? 18.915  7.565   25.938  1.00 52.78  ? 79  TYR E CE2 1 
ATOM   5892 C CZ  . TYR C 2 79  ? 18.180  8.563   26.545  1.00 52.78  ? 79  TYR E CZ  1 
ATOM   5893 O OH  . TYR C 2 79  ? 18.837  9.588   27.185  1.00 52.78  ? 79  TYR E OH  1 
ATOM   5894 N N   . CYS C 2 80  ? 17.499  2.789   25.781  1.00 64.93  ? 80  CYS E N   1 
ATOM   5895 C CA  . CYS C 2 80  ? 18.547  2.175   26.559  1.00 64.93  ? 80  CYS E CA  1 
ATOM   5896 C C   . CYS C 2 80  ? 19.788  2.972   26.255  1.00 64.93  ? 80  CYS E C   1 
ATOM   5897 O O   . CYS C 2 80  ? 19.969  3.468   25.139  1.00 64.93  ? 80  CYS E O   1 
ATOM   5898 C CB  . CYS C 2 80  ? 18.696  0.700   26.219  1.00 41.75  ? 80  CYS E CB  1 
ATOM   5899 S SG  . CYS C 2 80  ? 17.264  -0.289  26.784  1.00 41.75  ? 80  CYS E SG  1 
ATOM   5900 N N   . THR C 2 81  ? 20.650  3.099   27.250  1.00 28.09  ? 81  THR E N   1 
ATOM   5901 C CA  . THR C 2 81  ? 21.864  3.866   27.062  1.00 28.09  ? 81  THR E CA  1 
ATOM   5902 C C   . THR C 2 81  ? 22.956  3.388   28.007  1.00 28.09  ? 81  THR E C   1 
ATOM   5903 O O   . THR C 2 81  ? 22.667  2.872   29.095  1.00 28.09  ? 81  THR E O   1 
ATOM   5904 C CB  . THR C 2 81  ? 21.596  5.375   27.295  1.00 30.81  ? 81  THR E CB  1 
ATOM   5905 O OG1 . THR C 2 81  ? 22.733  6.142   26.875  1.00 30.81  ? 81  THR E OG1 1 
ATOM   5906 C CG2 . THR C 2 81  ? 21.319  5.644   28.761  1.00 30.81  ? 81  THR E CG2 1 
ATOM   5907 N N   . THR C 2 82  ? 24.206  3.551   27.577  1.00 20.49  ? 82  THR E N   1 
ATOM   5908 C CA  . THR C 2 82  ? 25.355  3.136   28.371  1.00 20.49  ? 82  THR E CA  1 
ATOM   5909 C C   . THR C 2 82  ? 25.757  4.165   29.401  1.00 20.49  ? 82  THR E C   1 
ATOM   5910 O O   . THR C 2 82  ? 25.969  5.327   29.076  1.00 20.49  ? 82  THR E O   1 
ATOM   5911 C CB  . THR C 2 82  ? 26.540  2.804   27.474  1.00 43.43  ? 82  THR E CB  1 
ATOM   5912 O OG1 . THR C 2 82  ? 26.092  1.946   26.413  1.00 43.43  ? 82  THR E OG1 1 
ATOM   5913 C CG2 . THR C 2 82  ? 27.634  2.088   28.274  1.00 43.43  ? 82  THR E CG2 1 
ATOM   5914 N N   . THR C 2 83  ? 25.865  3.737   30.652  1.00 44.16  ? 83  THR E N   1 
ATOM   5915 C CA  . THR C 2 83  ? 26.296  4.637   31.704  1.00 44.16  ? 83  THR E CA  1 
ATOM   5916 C C   . THR C 2 83  ? 27.726  4.236   32.054  1.00 44.16  ? 83  THR E C   1 
ATOM   5917 O O   . THR C 2 83  ? 28.196  3.176   31.644  1.00 44.16  ? 83  THR E O   1 
ATOM   5918 C CB  . THR C 2 83  ? 25.473  4.486   32.999  1.00 31.89  ? 83  THR E CB  1 
ATOM   5919 O OG1 . THR C 2 83  ? 25.746  3.214   33.591  1.00 31.89  ? 83  THR E OG1 1 
ATOM   5920 C CG2 . THR C 2 83  ? 23.998  4.600   32.709  1.00 31.89  ? 83  THR E CG2 1 
ATOM   5921 N N   . HIS C 2 84  ? 28.427  5.078   32.801  1.00 31.42  ? 84  HIS E N   1 
ATOM   5922 C CA  . HIS C 2 84  ? 29.805  4.791   33.140  1.00 31.42  ? 84  HIS E CA  1 
ATOM   5923 C C   . HIS C 2 84  ? 30.137  4.646   34.615  1.00 31.42  ? 84  HIS E C   1 
ATOM   5924 O O   . HIS C 2 84  ? 29.264  4.663   35.473  1.00 31.42  ? 84  HIS E O   1 
ATOM   5925 C CB  . HIS C 2 84  ? 30.651  5.852   32.465  1.00 33.16  ? 84  HIS E CB  1 
ATOM   5926 C CG  . HIS C 2 84  ? 30.099  6.253   31.135  1.00 33.16  ? 84  HIS E CG  1 
ATOM   5927 N ND1 . HIS C 2 84  ? 29.354  7.399   30.956  1.00 33.16  ? 84  HIS E ND1 1 
ATOM   5928 C CD2 . HIS C 2 84  ? 30.075  5.598   29.950  1.00 33.16  ? 84  HIS E CD2 1 
ATOM   5929 C CE1 . HIS C 2 84  ? 28.896  7.433   29.718  1.00 33.16  ? 84  HIS E CE1 1 
ATOM   5930 N NE2 . HIS C 2 84  ? 29.318  6.350   29.087  1.00 33.16  ? 84  HIS E NE2 1 
ATOM   5931 N N   . THR C 2 85  ? 31.421  4.476   34.891  1.00 39.28  ? 85  THR E N   1 
ATOM   5932 C CA  . THR C 2 85  ? 31.924  4.374   36.252  1.00 39.28  ? 85  THR E CA  1 
ATOM   5933 C C   . THR C 2 85  ? 33.342  4.923   36.231  1.00 39.28  ? 85  THR E C   1 
ATOM   5934 O O   . THR C 2 85  ? 33.953  5.030   35.168  1.00 39.28  ? 85  THR E O   1 
ATOM   5935 C CB  . THR C 2 85  ? 31.987  2.915   36.748  1.00 44.13  ? 85  THR E CB  1 
ATOM   5936 O OG1 . THR C 2 85  ? 32.472  2.890   38.100  1.00 44.13  ? 85  THR E OG1 1 
ATOM   5937 C CG2 . THR C 2 85  ? 32.925  2.092   35.868  1.00 44.13  ? 85  THR E CG2 1 
ATOM   5938 N N   . PHE C 2 86  ? 33.866  5.284   37.399  1.00 63.34  ? 86  PHE E N   1 
ATOM   5939 C CA  . PHE C 2 86  ? 35.221  5.804   37.468  1.00 63.34  ? 86  PHE E CA  1 
ATOM   5940 C C   . PHE C 2 86  ? 36.127  4.769   38.098  1.00 63.34  ? 86  PHE E C   1 
ATOM   5941 O O   . PHE C 2 86  ? 35.888  4.297   39.216  1.00 63.34  ? 86  PHE E O   1 
ATOM   5942 C CB  . PHE C 2 86  ? 35.247  7.158   38.166  1.00 44.89  ? 86  PHE E CB  1 
ATOM   5943 C CG  . PHE C 2 86  ? 34.734  8.280   37.289  1.00 44.89  ? 86  PHE E CG  1 
ATOM   5944 C CD1 . PHE C 2 86  ? 35.466  8.700   36.172  1.00 44.89  ? 86  PHE E CD1 1 
ATOM   5945 C CD2 . PHE C 2 86  ? 33.493  8.873   37.530  1.00 44.89  ? 86  PHE E CD2 1 
ATOM   5946 C CE1 . PHE C 2 86  ? 34.966  9.690   35.307  1.00 44.89  ? 86  PHE E CE1 1 
ATOM   5947 C CE2 . PHE C 2 86  ? 32.989  9.861   36.670  1.00 44.89  ? 86  PHE E CE2 1 
ATOM   5948 C CZ  . PHE C 2 86  ? 33.727  10.267  35.559  1.00 44.89  ? 86  PHE E CZ  1 
ATOM   5949 N N   . VAL C 2 87  ? 37.182  4.431   37.364  1.00 48.05  ? 87  VAL E N   1 
ATOM   5950 C CA  . VAL C 2 87  ? 38.134  3.439   37.808  1.00 48.05  ? 87  VAL E CA  1 
ATOM   5951 C C   . VAL C 2 87  ? 39.577  3.961   37.748  1.00 48.05  ? 87  VAL E C   1 
ATOM   5952 O O   . VAL C 2 87  ? 39.956  4.694   36.842  1.00 48.05  ? 87  VAL E O   1 
ATOM   5953 C CB  . VAL C 2 87  ? 38.031  2.141   36.967  1.00 141.45 ? 87  VAL E CB  1 
ATOM   5954 C CG1 . VAL C 2 87  ? 39.121  1.160   37.378  1.00 141.45 ? 87  VAL E CG1 1 
ATOM   5955 C CG2 . VAL C 2 87  ? 36.664  1.505   37.163  1.00 141.45 ? 87  VAL E CG2 1 
ATOM   5956 N N   . LYS C 2 88  ? 40.380  3.594   38.732  1.00 69.28  ? 88  LYS E N   1 
ATOM   5957 C CA  . LYS C 2 88  ? 41.756  4.052   38.773  1.00 69.28  ? 88  LYS E CA  1 
ATOM   5958 C C   . LYS C 2 88  ? 42.541  3.412   37.625  1.00 69.28  ? 88  LYS E C   1 
ATOM   5959 O O   . LYS C 2 88  ? 42.191  2.321   37.167  1.00 69.28  ? 88  LYS E O   1 
ATOM   5960 C CB  . LYS C 2 88  ? 42.399  3.676   40.105  1.00 137.15 ? 88  LYS E CB  1 
ATOM   5961 C CG  . LYS C 2 88  ? 43.584  4.545   40.488  1.00 137.15 ? 88  LYS E CG  1 
ATOM   5962 C CD  . LYS C 2 88  ? 43.135  5.953   40.865  1.00 137.15 ? 88  LYS E CD  1 
ATOM   5963 C CE  . LYS C 2 88  ? 44.283  6.780   41.425  1.00 137.15 ? 88  LYS E CE  1 
ATOM   5964 N NZ  . LYS C 2 88  ? 43.842  8.115   41.918  1.00 137.15 ? 88  LYS E NZ  1 
ATOM   5965 N N   . ALA C 2 89  ? 43.584  4.099   37.149  1.00 74.97  ? 89  ALA E N   1 
ATOM   5966 C CA  . ALA C 2 89  ? 44.407  3.592   36.045  1.00 74.97  ? 89  ALA E CA  1 
ATOM   5967 C C   . ALA C 2 89  ? 45.721  4.367   35.903  1.00 74.97  ? 89  ALA E C   1 
ATOM   5968 O O   . ALA C 2 89  ? 45.794  5.543   36.255  1.00 74.97  ? 89  ALA E O   1 
ATOM   5969 C CB  . ALA C 2 89  ? 43.618  3.670   34.741  1.00 80.48  ? 89  ALA E CB  1 
ATOM   5970 N N   . LEU C 2 90  ? 46.765  3.712   35.399  1.00 92.01  ? 90  LEU E N   1 
ATOM   5971 C CA  . LEU C 2 90  ? 48.041  4.398   35.193  1.00 92.01  ? 90  LEU E CA  1 
ATOM   5972 C C   . LEU C 2 90  ? 47.916  5.191   33.876  1.00 92.01  ? 90  LEU E C   1 
ATOM   5973 O O   . LEU C 2 90  ? 47.785  4.618   32.780  1.00 92.01  ? 90  LEU E O   1 
ATOM   5974 C CB  . LEU C 2 90  ? 49.185  3.389   35.080  1.00 74.37  ? 90  LEU E CB  1 
ATOM   5975 C CG  . LEU C 2 90  ? 50.584  3.985   34.891  1.00 74.37  ? 90  LEU E CG  1 
ATOM   5976 C CD1 . LEU C 2 90  ? 50.914  4.907   36.060  1.00 74.37  ? 90  LEU E CD1 1 
ATOM   5977 C CD2 . LEU C 2 90  ? 51.609  2.864   34.786  1.00 74.37  ? 90  LEU E CD2 1 
ATOM   5978 N N   . THR C 2 91  ? 47.953  6.515   34.012  1.00 85.11  ? 91  THR E N   1 
ATOM   5979 C CA  . THR C 2 91  ? 47.762  7.439   32.892  1.00 85.11  ? 91  THR E CA  1 
ATOM   5980 C C   . THR C 2 91  ? 48.867  8.468   32.729  1.00 85.11  ? 91  THR E C   1 
ATOM   5981 O O   . THR C 2 91  ? 49.678  8.654   33.633  1.00 85.11  ? 91  THR E O   1 
ATOM   5982 C CB  . THR C 2 91  ? 46.418  8.187   33.002  1.00 124.57 ? 91  THR E CB  1 
ATOM   5983 O OG1 . THR C 2 91  ? 46.446  9.060   34.137  1.00 124.57 ? 91  THR E OG1 1 
ATOM   5984 C CG2 . THR C 2 91  ? 45.273  7.199   33.156  1.00 124.57 ? 91  THR E CG2 1 
ATOM   5985 N N   . MET C 2 92  ? 48.889  9.134   31.573  1.00 136.69 ? 92  MET E N   1 
ATOM   5986 C CA  . MET C 2 92  ? 49.862  10.189  31.291  1.00 136.69 ? 92  MET E CA  1 
ATOM   5987 C C   . MET C 2 92  ? 49.054  11.483  31.202  1.00 136.69 ? 92  MET E C   1 
ATOM   5988 O O   . MET C 2 92  ? 48.476  11.812  30.157  1.00 136.69 ? 92  MET E O   1 
ATOM   5989 C CB  . MET C 2 92  ? 50.576  9.907   29.970  1.00 162.86 ? 92  MET E CB  1 
ATOM   5990 C CG  . MET C 2 92  ? 52.035  10.317  29.981  1.00 162.86 ? 92  MET E CG  1 
ATOM   5991 S SD  . MET C 2 92  ? 52.980  9.394   31.221  1.00 162.86 ? 92  MET E SD  1 
ATOM   5992 C CE  . MET C 2 92  ? 54.137  8.487   30.157  1.00 162.86 ? 92  MET E CE  1 
ATOM   5993 N N   . ASP C 2 93  ? 49.017  12.193  32.327  1.00 199.97 ? 93  ASP E N   1 
ATOM   5994 C CA  . ASP C 2 93  ? 48.265  13.438  32.497  1.00 199.97 ? 93  ASP E CA  1 
ATOM   5995 C C   . ASP C 2 93  ? 48.493  14.565  31.483  1.00 199.97 ? 93  ASP E C   1 
ATOM   5996 O O   . ASP C 2 93  ? 47.895  15.636  31.606  1.00 199.97 ? 93  ASP E O   1 
ATOM   5997 C CB  . ASP C 2 93  ? 48.489  13.955  33.932  1.00 159.33 ? 93  ASP E CB  1 
ATOM   5998 C CG  . ASP C 2 93  ? 49.179  15.310  33.981  1.00 159.33 ? 93  ASP E CG  1 
ATOM   5999 O OD1 . ASP C 2 93  ? 48.494  16.342  33.807  1.00 159.33 ? 93  ASP E OD1 1 
ATOM   6000 O OD2 . ASP C 2 93  ? 50.409  15.341  34.194  1.00 159.33 ? 93  ASP E OD2 1 
ATOM   6001 N N   . GLY C 2 94  ? 49.327  14.323  30.477  1.00 200.00 ? 94  GLY E N   1 
ATOM   6002 C CA  . GLY C 2 94  ? 49.613  15.360  29.504  1.00 200.00 ? 94  GLY E CA  1 
ATOM   6003 C C   . GLY C 2 94  ? 50.867  16.070  29.980  1.00 200.00 ? 94  GLY E C   1 
ATOM   6004 O O   . GLY C 2 94  ? 51.206  17.169  29.518  1.00 200.00 ? 94  GLY E O   1 
ATOM   6005 N N   . LYS C 2 95  ? 51.553  15.417  30.920  1.00 160.21 ? 95  LYS E N   1 
ATOM   6006 C CA  . LYS C 2 95  ? 52.782  15.932  31.510  1.00 160.21 ? 95  LYS E CA  1 
ATOM   6007 C C   . LYS C 2 95  ? 53.606  14.834  32.200  1.00 160.21 ? 95  LYS E C   1 
ATOM   6008 O O   . LYS C 2 95  ? 54.777  14.650  31.874  1.00 160.21 ? 95  LYS E O   1 
ATOM   6009 C CB  . LYS C 2 95  ? 52.467  17.078  32.479  1.00 200.00 ? 95  LYS E CB  1 
ATOM   6010 C CG  . LYS C 2 95  ? 53.686  17.720  33.151  1.00 200.00 ? 95  LYS E CG  1 
ATOM   6011 C CD  . LYS C 2 95  ? 54.885  17.840  32.211  1.00 200.00 ? 95  LYS E CD  1 
ATOM   6012 C CE  . LYS C 2 95  ? 54.615  18.724  31.009  1.00 200.00 ? 95  LYS E CE  1 
ATOM   6013 N NZ  . LYS C 2 95  ? 55.782  18.705  30.075  1.00 200.00 ? 95  LYS E NZ  1 
ATOM   6014 N N   . GLN C 2 96  ? 53.002  14.115  33.150  1.00 198.14 ? 96  GLN E N   1 
ATOM   6015 C CA  . GLN C 2 96  ? 53.694  13.031  33.863  1.00 198.14 ? 96  GLN E CA  1 
ATOM   6016 C C   . GLN C 2 96  ? 52.818  11.807  34.173  1.00 198.14 ? 96  GLN E C   1 
ATOM   6017 O O   . GLN C 2 96  ? 51.591  11.894  34.138  1.00 198.14 ? 96  GLN E O   1 
ATOM   6018 C CB  . GLN C 2 96  ? 54.248  13.550  35.200  1.00 200.00 ? 96  GLN E CB  1 
ATOM   6019 C CG  . GLN C 2 96  ? 55.020  14.869  35.151  1.00 200.00 ? 96  GLN E CG  1 
ATOM   6020 C CD  . GLN C 2 96  ? 56.505  14.689  34.891  1.00 200.00 ? 96  GLN E CD  1 
ATOM   6021 O OE1 . GLN C 2 96  ? 57.189  13.955  35.606  1.00 200.00 ? 96  GLN E OE1 1 
ATOM   6022 N NE2 . GLN C 2 96  ? 57.013  15.371  33.871  1.00 200.00 ? 96  GLN E NE2 1 
ATOM   6023 N N   . ALA C 2 97  ? 53.461  10.673  34.473  1.00 96.32  ? 97  ALA E N   1 
ATOM   6024 C CA  . ALA C 2 97  ? 52.762  9.419   34.770  1.00 96.32  ? 97  ALA E CA  1 
ATOM   6025 C C   . ALA C 2 97  ? 52.078  9.433   36.130  1.00 96.32  ? 97  ALA E C   1 
ATOM   6026 O O   . ALA C 2 97  ? 52.715  9.686   37.159  1.00 96.32  ? 97  ALA E O   1 
ATOM   6027 C CB  . ALA C 2 97  ? 53.742  8.252   34.691  1.00 78.43  ? 97  ALA E CB  1 
ATOM   6028 N N   . ALA C 2 98  ? 50.782  9.129   36.131  1.00 54.09  ? 98  ALA E N   1 
ATOM   6029 C CA  . ALA C 2 98  ? 50.014  9.156   37.363  1.00 54.09  ? 98  ALA E CA  1 
ATOM   6030 C C   . ALA C 2 98  ? 48.817  8.213   37.443  1.00 54.09  ? 98  ALA E C   1 
ATOM   6031 O O   . ALA C 2 98  ? 48.173  7.874   36.456  1.00 54.09  ? 98  ALA E O   1 
ATOM   6032 C CB  . ALA C 2 98  ? 49.558  10.586  37.645  1.00 135.13 ? 98  ALA E CB  1 
ATOM   6033 N N   . TRP C 2 99  ? 48.540  7.819   38.673  1.00 89.01  ? 99  TRP E N   1 
ATOM   6034 C CA  . TRP C 2 99  ? 47.443  6.950   39.020  1.00 89.01  ? 99  TRP E CA  1 
ATOM   6035 C C   . TRP C 2 99  ? 46.235  7.876   39.059  1.00 89.01  ? 99  TRP E C   1 
ATOM   6036 O O   . TRP C 2 99  ? 46.099  8.691   39.974  1.00 89.01  ? 99  TRP E O   1 
ATOM   6037 C CB  . TRP C 2 99  ? 47.687  6.365   40.416  1.00 144.43 ? 99  TRP E CB  1 
ATOM   6038 C CG  . TRP C 2 99  ? 47.137  4.989   40.658  1.00 144.43 ? 99  TRP E CG  1 
ATOM   6039 C CD1 . TRP C 2 99  ? 46.540  4.537   41.802  1.00 144.43 ? 99  TRP E CD1 1 
ATOM   6040 C CD2 . TRP C 2 99  ? 47.192  3.870   39.767  1.00 144.43 ? 99  TRP E CD2 1 
ATOM   6041 N NE1 . TRP C 2 99  ? 46.220  3.207   41.678  1.00 144.43 ? 99  TRP E NE1 1 
ATOM   6042 C CE2 . TRP C 2 99  ? 46.610  2.772   40.439  1.00 144.43 ? 99  TRP E CE2 1 
ATOM   6043 C CE3 . TRP C 2 99  ? 47.680  3.685   38.467  1.00 144.43 ? 99  TRP E CE3 1 
ATOM   6044 C CZ2 . TRP C 2 99  ? 46.502  1.505   39.852  1.00 144.43 ? 99  TRP E CZ2 1 
ATOM   6045 C CZ3 . TRP C 2 99  ? 47.573  2.424   37.885  1.00 144.43 ? 99  TRP E CZ3 1 
ATOM   6046 C CH2 . TRP C 2 99  ? 46.987  1.352   38.579  1.00 144.43 ? 99  TRP E CH2 1 
ATOM   6047 N N   . ARG C 2 100 ? 45.361  7.750   38.068  1.00 152.53 ? 100 ARG E N   1 
ATOM   6048 C CA  . ARG C 2 100 ? 44.177  8.604   37.981  1.00 152.53 ? 100 ARG E CA  1 
ATOM   6049 C C   . ARG C 2 100 ? 42.907  7.833   37.633  1.00 152.53 ? 100 ARG E C   1 
ATOM   6050 O O   . ARG C 2 100 ? 42.962  6.800   36.970  1.00 152.53 ? 100 ARG E O   1 
ATOM   6051 C CB  . ARG C 2 100 ? 44.414  9.707   36.949  1.00 134.86 ? 100 ARG E CB  1 
ATOM   6052 C CG  . ARG C 2 100 ? 45.887  10.037  36.744  1.00 134.86 ? 100 ARG E CG  1 
ATOM   6053 C CD  . ARG C 2 100 ? 46.170  11.530  36.800  1.00 134.86 ? 100 ARG E CD  1 
ATOM   6054 N NE  . ARG C 2 100 ? 46.027  12.057  38.154  1.00 134.86 ? 100 ARG E NE  1 
ATOM   6055 C CZ  . ARG C 2 100 ? 46.372  13.288  38.517  1.00 134.86 ? 100 ARG E CZ  1 
ATOM   6056 N NH1 . ARG C 2 100 ? 46.884  14.124  37.624  1.00 134.86 ? 100 ARG E NH1 1 
ATOM   6057 N NH2 . ARG C 2 100 ? 46.208  13.682  39.773  1.00 134.86 ? 100 ARG E NH2 1 
ATOM   6058 N N   . PHE C 2 101 ? 41.769  8.368   38.069  1.00 82.22  ? 101 PHE E N   1 
ATOM   6059 C CA  . PHE C 2 101 ? 40.459  7.778   37.826  1.00 82.22  ? 101 PHE E CA  1 
ATOM   6060 C C   . PHE C 2 101 ? 39.963  8.088   36.413  1.00 82.22  ? 101 PHE E C   1 
ATOM   6061 O O   . PHE C 2 101 ? 39.764  9.240   36.073  1.00 82.22  ? 101 PHE E O   1 
ATOM   6062 C CB  . PHE C 2 101 ? 39.463  8.267   38.879  1.00 42.54  ? 101 PHE E CB  1 
ATOM   6063 C CG  . PHE C 2 101 ? 39.650  7.619   40.218  1.00 42.54  ? 101 PHE E CG  1 
ATOM   6064 C CD1 . PHE C 2 101 ? 39.403  6.260   40.381  1.00 42.54  ? 101 PHE E CD1 1 
ATOM   6065 C CD2 . PHE C 2 101 ? 40.107  8.350   41.305  1.00 42.54  ? 101 PHE E CD2 1 
ATOM   6066 C CE1 . PHE C 2 101 ? 39.610  5.639   41.607  1.00 42.54  ? 101 PHE E CE1 1 
ATOM   6067 C CE2 . PHE C 2 101 ? 40.317  7.737   42.535  1.00 42.54  ? 101 PHE E CE2 1 
ATOM   6068 C CZ  . PHE C 2 101 ? 40.069  6.379   42.685  1.00 42.54  ? 101 PHE E CZ  1 
ATOM   6069 N N   . ILE C 2 102 ? 39.754  7.071   35.589  1.00 55.76  ? 102 ILE E N   1 
ATOM   6070 C CA  . ILE C 2 102 ? 39.254  7.297   34.227  1.00 55.76  ? 102 ILE E CA  1 
ATOM   6071 C C   . ILE C 2 102 ? 37.827  6.774   34.027  1.00 55.76  ? 102 ILE E C   1 
ATOM   6072 O O   . ILE C 2 102 ? 37.372  5.869   34.733  1.00 55.76  ? 102 ILE E O   1 
ATOM   6073 C CB  . ILE C 2 102 ? 40.177  6.642   33.176  1.00 62.53  ? 102 ILE E CB  1 
ATOM   6074 C CG1 . ILE C 2 102 ? 40.303  5.141   33.449  1.00 62.53  ? 102 ILE E CG1 1 
ATOM   6075 C CG2 . ILE C 2 102 ? 41.541  7.313   33.201  1.00 62.53  ? 102 ILE E CG2 1 
ATOM   6076 C CD1 . ILE C 2 102 ? 41.134  4.396   32.424  1.00 67.40  ? 102 ILE E CD1 1 
ATOM   6077 N N   . ARG C 2 103 ? 37.128  7.346   33.057  1.00 41.92  ? 103 ARG E N   1 
ATOM   6078 C CA  . ARG C 2 103 ? 35.758  6.942   32.770  1.00 41.92  ? 103 ARG E CA  1 
ATOM   6079 C C   . ARG C 2 103 ? 35.660  5.760   31.774  1.00 41.92  ? 103 ARG E C   1 
ATOM   6080 O O   . ARG C 2 103 ? 36.188  5.832   30.656  1.00 41.92  ? 103 ARG E O   1 
ATOM   6081 C CB  . ARG C 2 103 ? 34.979  8.156   32.233  1.00 53.46  ? 103 ARG E CB  1 
ATOM   6082 C CG  . ARG C 2 103 ? 33.458  7.991   32.221  1.00 53.46  ? 103 ARG E CG  1 
ATOM   6083 C CD  . ARG C 2 103 ? 32.796  9.042   31.321  1.00 53.46  ? 103 ARG E CD  1 
ATOM   6084 N NE  . ARG C 2 103 ? 32.387  10.262  32.018  1.00 53.46  ? 103 ARG E NE  1 
ATOM   6085 C CZ  . ARG C 2 103 ? 31.145  10.488  32.443  1.00 53.46  ? 103 ARG E CZ  1 
ATOM   6086 N NH1 . ARG C 2 103 ? 30.194  9.580   32.245  1.00 53.46  ? 103 ARG E NH1 1 
ATOM   6087 N NH2 . ARG C 2 103 ? 30.842  11.626  33.052  1.00 53.46  ? 103 ARG E NH2 1 
ATOM   6088 N N   . ILE C 2 104 ? 34.998  4.671   32.188  1.00 21.80  ? 104 ILE E N   1 
ATOM   6089 C CA  . ILE C 2 104 ? 34.809  3.479   31.339  1.00 21.80  ? 104 ILE E CA  1 
ATOM   6090 C C   . ILE C 2 104 ? 33.354  2.992   31.360  1.00 21.80  ? 104 ILE E C   1 
ATOM   6091 O O   . ILE C 2 104 ? 32.619  3.222   32.325  1.00 21.80  ? 104 ILE E O   1 
ATOM   6092 C CB  . ILE C 2 104 ? 35.729  2.351   31.809  1.00 22.14  ? 104 ILE E CB  1 
ATOM   6093 C CG1 . ILE C 2 104 ? 35.395  1.963   33.253  1.00 22.14  ? 104 ILE E CG1 1 
ATOM   6094 C CG2 . ILE C 2 104 ? 37.179  2.799   31.701  1.00 22.14  ? 104 ILE E CG2 1 
ATOM   6095 C CD1 . ILE C 2 104 ? 35.768  3.003   34.290  1.00 91.97  ? 104 ILE E CD1 1 
ATOM   6096 N N   . ASP C 2 105 ? 32.927  2.328   30.294  1.00 48.50  ? 105 ASP E N   1 
ATOM   6097 C CA  . ASP C 2 105 ? 31.558  1.822   30.242  1.00 48.50  ? 105 ASP E CA  1 
ATOM   6098 C C   . ASP C 2 105 ? 31.388  0.832   31.363  1.00 48.50  ? 105 ASP E C   1 
ATOM   6099 O O   . ASP C 2 105 ? 32.299  0.058   31.637  1.00 48.50  ? 105 ASP E O   1 
ATOM   6100 C CB  . ASP C 2 105 ? 31.281  1.159   28.899  1.00 85.44  ? 105 ASP E CB  1 
ATOM   6101 C CG  . ASP C 2 105 ? 31.515  2.096   27.742  1.00 85.44  ? 105 ASP E CG  1 
ATOM   6102 O OD1 . ASP C 2 105 ? 31.382  3.322   27.950  1.00 85.44  ? 105 ASP E OD1 1 
ATOM   6103 O OD2 . ASP C 2 105 ? 31.828  1.613   26.633  1.00 85.44  ? 105 ASP E OD2 1 
ATOM   6104 N N   . THR C 2 106 ? 30.227  0.834   32.007  1.00 35.57  ? 106 THR E N   1 
ATOM   6105 C CA  . THR C 2 106 ? 30.025  -0.081  33.118  1.00 35.57  ? 106 THR E CA  1 
ATOM   6106 C C   . THR C 2 106 ? 28.654  -0.746  33.240  1.00 35.57  ? 106 THR E C   1 
ATOM   6107 O O   . THR C 2 106 ? 28.478  -1.684  34.024  1.00 35.57  ? 106 THR E O   1 
ATOM   6108 C CB  . THR C 2 106 ? 30.316  0.595   34.447  1.00 48.59  ? 106 THR E CB  1 
ATOM   6109 O OG1 . THR C 2 106 ? 30.583  -0.407  35.428  1.00 48.59  ? 106 THR E OG1 1 
ATOM   6110 C CG2 . THR C 2 106 ? 29.125  1.408   34.901  1.00 48.59  ? 106 THR E CG2 1 
ATOM   6111 N N   . ALA C 2 107 ? 27.690  -0.263  32.471  1.00 37.22  ? 107 ALA E N   1 
ATOM   6112 C CA  . ALA C 2 107 ? 26.346  -0.822  32.509  1.00 37.22  ? 107 ALA E CA  1 
ATOM   6113 C C   . ALA C 2 107 ? 25.492  -0.277  31.373  1.00 37.22  ? 107 ALA E C   1 
ATOM   6114 O O   . ALA C 2 107 ? 25.924  0.577   30.601  1.00 37.22  ? 107 ALA E O   1 
ATOM   6115 C CB  . ALA C 2 107 ? 25.698  -0.512  33.837  1.00 1.00   ? 107 ALA E CB  1 
ATOM   6116 N N   . CYS C 2 108 ? 24.275  -0.793  31.262  1.00 13.95  ? 108 CYS E N   1 
ATOM   6117 C CA  . CYS C 2 108 ? 23.352  -0.330  30.237  1.00 13.95  ? 108 CYS E CA  1 
ATOM   6118 C C   . CYS C 2 108 ? 21.998  -0.153  30.928  1.00 13.95  ? 108 CYS E C   1 
ATOM   6119 O O   . CYS C 2 108 ? 21.408  -1.125  31.400  1.00 13.95  ? 108 CYS E O   1 
ATOM   6120 C CB  . CYS C 2 108 ? 23.188  -1.341  29.100  1.00 30.63  ? 108 CYS E CB  1 
ATOM   6121 S SG  . CYS C 2 108 ? 21.974  -0.762  27.864  1.00 30.63  ? 108 CYS E SG  1 
ATOM   6122 N N   . VAL C 2 109 ? 21.518  1.091   30.991  1.00 32.95  ? 109 VAL E N   1 
ATOM   6123 C CA  . VAL C 2 109 ? 20.252  1.397   31.647  1.00 32.95  ? 109 VAL E CA  1 
ATOM   6124 C C   . VAL C 2 109 ? 19.175  1.997   30.753  1.00 32.95  ? 109 VAL E C   1 
ATOM   6125 O O   . VAL C 2 109 ? 19.436  2.458   29.638  1.00 32.95  ? 109 VAL E O   1 
ATOM   6126 C CB  . VAL C 2 109 ? 20.493  2.373   32.780  1.00 1.00   ? 109 VAL E CB  1 
ATOM   6127 C CG1 . VAL C 2 109 ? 21.552  1.823   33.715  1.00 1.00   ? 109 VAL E CG1 1 
ATOM   6128 C CG2 . VAL C 2 109 ? 20.937  3.697   32.216  1.00 1.00   ? 109 VAL E CG2 1 
ATOM   6129 N N   . CYS C 2 110 ? 17.956  2.003   31.286  1.00 21.71  ? 110 CYS E N   1 
ATOM   6130 C CA  . CYS C 2 110 ? 16.788  2.523   30.599  1.00 21.71  ? 110 CYS E CA  1 
ATOM   6131 C C   . CYS C 2 110 ? 16.507  3.951   31.005  1.00 21.71  ? 110 CYS E C   1 
ATOM   6132 O O   . CYS C 2 110 ? 16.509  4.245   32.201  1.00 21.71  ? 110 CYS E O   1 
ATOM   6133 C CB  . CYS C 2 110 ? 15.562  1.683   30.914  1.00 28.58  ? 110 CYS E CB  1 
ATOM   6134 S SG  . CYS C 2 110 ? 14.084  2.316   30.081  1.00 28.58  ? 110 CYS E SG  1 
ATOM   6135 N N   . VAL C 2 111 ? 16.246  4.812   30.016  1.00 33.10  ? 111 VAL E N   1 
ATOM   6136 C CA  . VAL C 2 111 ? 15.925  6.247   30.221  1.00 33.10  ? 111 VAL E CA  1 
ATOM   6137 C C   . VAL C 2 111 ? 14.458  6.577   29.881  1.00 33.10  ? 111 VAL E C   1 
ATOM   6138 O O   . VAL C 2 111 ? 13.999  6.358   28.760  1.00 33.10  ? 111 VAL E O   1 
ATOM   6139 C CB  . VAL C 2 111 ? 16.848  7.160   29.414  1.00 8.48   ? 111 VAL E CB  1 
ATOM   6140 C CG1 . VAL C 2 111 ? 16.556  8.608   29.756  1.00 8.48   ? 111 VAL E CG1 1 
ATOM   6141 C CG2 . VAL C 2 111 ? 18.290  6.835   29.727  1.00 8.48   ? 111 VAL E CG2 1 
ATOM   6142 N N   . LEU C 2 112 ? 13.745  7.134   30.855  1.00 38.20  ? 112 LEU E N   1 
ATOM   6143 C CA  . LEU C 2 112 ? 12.336  7.501   30.711  1.00 38.20  ? 112 LEU E CA  1 
ATOM   6144 C C   . LEU C 2 112 ? 12.118  8.973   30.319  1.00 38.20  ? 112 LEU E C   1 
ATOM   6145 O O   . LEU C 2 112 ? 12.869  9.859   30.721  1.00 38.20  ? 112 LEU E O   1 
ATOM   6146 C CB  . LEU C 2 112 ? 11.574  7.196   32.002  1.00 53.81  ? 112 LEU E CB  1 
ATOM   6147 C CG  . LEU C 2 112 ? 11.384  5.714   32.338  1.00 53.81  ? 112 LEU E CG  1 
ATOM   6148 C CD1 . LEU C 2 112 ? 12.729  5.068   32.634  1.00 53.81  ? 112 LEU E CD1 1 
ATOM   6149 C CD2 . LEU C 2 112 ? 10.456  5.580   33.534  1.00 53.81  ? 112 LEU E CD2 1 
ATOM   6150 N N   . SER C 2 113 ? 11.073  9.231   29.545  1.00 64.97  ? 113 SER E N   1 
ATOM   6151 C CA  . SER C 2 113 ? 10.728  10.590  29.147  1.00 64.97  ? 113 SER E CA  1 
ATOM   6152 C C   . SER C 2 113 ? 9.218   10.568  28.891  1.00 64.97  ? 113 SER E C   1 
ATOM   6153 O O   . SER C 2 113 ? 8.718   9.739   28.131  1.00 64.97  ? 113 SER E O   1 
ATOM   6154 C CB  . SER C 2 113 ? 11.461  10.963  27.862  1.00 66.09  ? 113 SER E CB  1 
ATOM   6155 O OG  . SER C 2 113 ? 10.951  12.167  27.325  1.00 66.09  ? 113 SER E OG  1 
ATOM   6156 N N   . ARG C 2 114 ? 8.490   11.459  29.554  1.00 54.91  ? 114 ARG E N   1 
ATOM   6157 C CA  . ARG C 2 114 ? 7.040   11.502  29.413  1.00 54.91  ? 114 ARG E CA  1 
ATOM   6158 C C   . ARG C 2 114 ? 6.504   11.769  28.020  1.00 54.91  ? 114 ARG E C   1 
ATOM   6159 O O   . ARG C 2 114 ? 7.175   12.377  27.175  1.00 54.91  ? 114 ARG E O   1 
ATOM   6160 C CB  . ARG C 2 114 ? 6.458   12.527  30.383  1.00 42.93  ? 114 ARG E CB  1 
ATOM   6161 C CG  . ARG C 2 114 ? 5.624   11.900  31.476  1.00 42.93  ? 114 ARG E CG  1 
ATOM   6162 C CD  . ARG C 2 114 ? 5.753   12.668  32.768  1.00 42.93  ? 114 ARG E CD  1 
ATOM   6163 N NE  . ARG C 2 114 ? 4.981   12.049  33.837  1.00 42.93  ? 114 ARG E NE  1 
ATOM   6164 C CZ  . ARG C 2 114 ? 5.093   12.374  35.119  1.00 42.93  ? 114 ARG E CZ  1 
ATOM   6165 N NH1 . ARG C 2 114 ? 5.952   13.313  35.493  1.00 42.93  ? 114 ARG E NH1 1 
ATOM   6166 N NH2 . ARG C 2 114 ? 4.344   11.762  36.027  1.00 42.93  ? 114 ARG E NH2 1 
ATOM   6167 N N   . LYS C 2 115 ? 5.285   11.303  27.765  1.00 74.57  ? 115 LYS E N   1 
ATOM   6168 C CA  . LYS C 2 115 ? 4.631   11.474  26.467  1.00 74.57  ? 115 LYS E CA  1 
ATOM   6169 C C   . LYS C 2 115 ? 3.564   12.572  26.471  1.00 74.57  ? 115 LYS E C   1 
ATOM   6170 O O   . LYS C 2 115 ? 2.384   12.257  26.201  1.00 83.91  ? 115 LYS E O   1 
ATOM   6171 C CB  . LYS C 2 115 ? 3.993   10.154  26.027  1.00 99.92  ? 115 LYS E CB  1 
ATOM   6172 C CG  . LYS C 2 115 ? 4.875   9.275   25.163  1.00 99.92  ? 115 LYS E CG  1 
ATOM   6173 C CD  . LYS C 2 115 ? 5.112   9.917   23.807  1.00 99.92  ? 115 LYS E CD  1 
ATOM   6174 C CE  . LYS C 2 115 ? 5.718   8.929   22.826  1.00 99.92  ? 115 LYS E CE  1 
ATOM   6175 N NZ  . LYS C 2 115 ? 4.820   7.763   22.607  1.00 99.92  ? 115 LYS E NZ  1 
ATOM   6176 N N   . SER D 2 2   ? 9.751   23.727  42.688  1.00 200.00 ? 2   SER F N   1 
ATOM   6177 C CA  . SER D 2 2   ? 9.473   22.427  42.007  1.00 200.00 ? 2   SER F CA  1 
ATOM   6178 C C   . SER D 2 2   ? 8.439   22.614  40.907  1.00 200.00 ? 2   SER F C   1 
ATOM   6179 O O   . SER D 2 2   ? 7.792   21.659  40.467  1.00 200.00 ? 2   SER F O   1 
ATOM   6180 C CB  . SER D 2 2   ? 8.821   21.512  43.034  1.00 134.28 ? 2   SER F CB  1 
ATOM   6181 O OG  . SER D 2 2   ? 8.676   20.174  42.569  1.00 134.28 ? 2   SER F OG  1 
ATOM   6182 N N   . SER D 2 3   ? 8.284   23.857  40.471  1.00 114.17 ? 3   SER F N   1 
ATOM   6183 C CA  . SER D 2 3   ? 7.333   24.160  39.415  1.00 114.17 ? 3   SER F CA  1 
ATOM   6184 C C   . SER D 2 3   ? 8.049   24.223  38.062  1.00 114.17 ? 3   SER F C   1 
ATOM   6185 O O   . SER D 2 3   ? 7.432   24.538  37.041  1.00 114.17 ? 3   SER F O   1 
ATOM   6186 C CB  . SER D 2 3   ? 6.620   25.486  39.680  1.00 120.09 ? 3   SER F CB  1 
ATOM   6187 O OG  . SER D 2 3   ? 5.608   25.711  38.712  1.00 120.09 ? 3   SER F OG  1 
ATOM   6188 N N   . HIS D 2 4   ? 9.348   23.913  38.050  1.00 46.27  ? 4   HIS F N   1 
ATOM   6189 C CA  . HIS D 2 4   ? 10.103  23.961  36.808  1.00 46.27  ? 4   HIS F CA  1 
ATOM   6190 C C   . HIS D 2 4   ? 9.642   22.877  35.869  1.00 46.27  ? 4   HIS F C   1 
ATOM   6191 O O   . HIS D 2 4   ? 9.418   21.738  36.266  1.00 46.27  ? 4   HIS F O   1 
ATOM   6192 C CB  . HIS D 2 4   ? 11.607  23.878  37.024  1.00 32.82  ? 4   HIS F CB  1 
ATOM   6193 C CG  . HIS D 2 4   ? 12.390  24.363  35.847  1.00 32.82  ? 4   HIS F CG  1 
ATOM   6194 N ND1 . HIS D 2 4   ? 12.678  23.563  34.765  1.00 32.82  ? 4   HIS F ND1 1 
ATOM   6195 C CD2 . HIS D 2 4   ? 12.881  25.587  35.549  1.00 32.82  ? 4   HIS F CD2 1 
ATOM   6196 C CE1 . HIS D 2 4   ? 13.313  24.273  33.851  1.00 32.82  ? 4   HIS F CE1 1 
ATOM   6197 N NE2 . HIS D 2 4   ? 13.448  25.505  34.303  1.00 32.82  ? 4   HIS F NE2 1 
ATOM   6198 N N   . PRO D 2 5   ? 9.483   23.230  34.597  1.00 37.68  ? 5   PRO F N   1 
ATOM   6199 C CA  . PRO D 2 5   ? 9.038   22.294  33.564  1.00 37.68  ? 5   PRO F CA  1 
ATOM   6200 C C   . PRO D 2 5   ? 9.789   20.975  33.581  1.00 37.68  ? 5   PRO F C   1 
ATOM   6201 O O   . PRO D 2 5   ? 9.190   19.921  33.384  1.00 37.68  ? 5   PRO F O   1 
ATOM   6202 C CB  . PRO D 2 5   ? 9.267   23.078  32.275  1.00 15.70  ? 5   PRO F CB  1 
ATOM   6203 C CG  . PRO D 2 5   ? 8.949   24.478  32.697  1.00 15.70  ? 5   PRO F CG  1 
ATOM   6204 C CD  . PRO D 2 5   ? 9.674   24.577  34.027  1.00 15.70  ? 5   PRO F CD  1 
ATOM   6205 N N   . ILE D 2 6   ? 11.097  21.044  33.809  1.00 49.37  ? 6   ILE F N   1 
ATOM   6206 C CA  . ILE D 2 6   ? 11.940  19.852  33.837  1.00 49.37  ? 6   ILE F CA  1 
ATOM   6207 C C   . ILE D 2 6   ? 11.462  18.785  34.816  1.00 49.37  ? 6   ILE F C   1 
ATOM   6208 O O   . ILE D 2 6   ? 11.665  17.589  34.588  1.00 49.37  ? 6   ILE F O   1 
ATOM   6209 C CB  . ILE D 2 6   ? 13.375  20.319  34.114  1.00 1.00   ? 6   ILE F CB  1 
ATOM   6210 C CG1 . ILE D 2 6   ? 14.345  19.590  33.186  1.00 1.00   ? 6   ILE F CG1 1 
ATOM   6211 C CG2 . ILE D 2 6   ? 13.689  20.208  35.594  1.00 1.00   ? 6   ILE F CG2 1 
ATOM   6212 C CD1 . ILE D 2 6   ? 14.495  18.124  33.464  1.00 37.58  ? 6   ILE F CD1 1 
ATOM   6213 N N   . PHE D 2 7   ? 10.832  19.205  35.907  1.00 20.70  ? 7   PHE F N   1 
ATOM   6214 C CA  . PHE D 2 7   ? 10.338  18.235  36.867  1.00 20.70  ? 7   PHE F CA  1 
ATOM   6215 C C   . PHE D 2 7   ? 9.244   17.416  36.218  1.00 20.70  ? 7   PHE F C   1 
ATOM   6216 O O   . PHE D 2 7   ? 8.782   16.431  36.772  1.00 20.70  ? 7   PHE F O   1 
ATOM   6217 C CB  . PHE D 2 7   ? 9.814   18.910  38.126  1.00 28.76  ? 7   PHE F CB  1 
ATOM   6218 C CG  . PHE D 2 7   ? 10.893  19.461  38.969  1.00 28.76  ? 7   PHE F CG  1 
ATOM   6219 C CD1 . PHE D 2 7   ? 11.959  18.655  39.336  1.00 28.76  ? 7   PHE F CD1 1 
ATOM   6220 C CD2 . PHE D 2 7   ? 10.910  20.798  39.314  1.00 28.76  ? 7   PHE F CD2 1 
ATOM   6221 C CE1 . PHE D 2 7   ? 13.033  19.173  40.022  1.00 28.76  ? 7   PHE F CE1 1 
ATOM   6222 C CE2 . PHE D 2 7   ? 11.987  21.333  40.006  1.00 28.76  ? 7   PHE F CE2 1 
ATOM   6223 C CZ  . PHE D 2 7   ? 13.049  20.522  40.358  1.00 28.76  ? 7   PHE F CZ  1 
ATOM   6224 N N   . HIS D 2 8   ? 8.852   17.816  35.019  1.00 22.94  ? 8   HIS F N   1 
ATOM   6225 C CA  . HIS D 2 8   ? 7.819   17.106  34.295  1.00 22.94  ? 8   HIS F CA  1 
ATOM   6226 C C   . HIS D 2 8   ? 8.313   16.559  32.937  1.00 22.94  ? 8   HIS F C   1 
ATOM   6227 O O   . HIS D 2 8   ? 8.070   15.401  32.590  1.00 22.94  ? 8   HIS F O   1 
ATOM   6228 C CB  . HIS D 2 8   ? 6.604   17.985  34.056  1.00 101.23 ? 8   HIS F CB  1 
ATOM   6229 C CG  . HIS D 2 8   ? 5.413   17.222  33.572  1.00 101.23 ? 8   HIS F CG  1 
ATOM   6230 N ND1 . HIS D 2 8   ? 4.658   16.422  34.401  1.00 101.23 ? 8   HIS F ND1 1 
ATOM   6231 C CD2 . HIS D 2 8   ? 4.876   17.096  32.335  1.00 101.23 ? 8   HIS F CD2 1 
ATOM   6232 C CE1 . HIS D 2 8   ? 3.706   15.836  33.697  1.00 101.23 ? 8   HIS F CE1 1 
ATOM   6233 N NE2 . HIS D 2 8   ? 3.816   16.227  32.440  1.00 101.23 ? 8   HIS F NE2 1 
ATOM   6234 N N   . ARG D 2 9   ? 9.040   17.373  32.189  1.00 26.92  ? 9   ARG F N   1 
ATOM   6235 C CA  . ARG D 2 9   ? 9.521   16.967  30.876  1.00 26.92  ? 9   ARG F CA  1 
ATOM   6236 C C   . ARG D 2 9   ? 10.953  16.460  30.826  1.00 26.92  ? 9   ARG F C   1 
ATOM   6237 O O   . ARG D 2 9   ? 11.509  16.307  29.736  1.00 26.92  ? 9   ARG F O   1 
ATOM   6238 C CB  . ARG D 2 9   ? 9.331   18.132  29.903  1.00 80.94  ? 9   ARG F CB  1 
ATOM   6239 C CG  . ARG D 2 9   ? 7.921   18.713  29.984  1.00 80.94  ? 9   ARG F CG  1 
ATOM   6240 C CD  . ARG D 2 9   ? 7.570   19.549  28.771  1.00 80.94  ? 9   ARG F CD  1 
ATOM   6241 N NE  . ARG D 2 9   ? 8.298   20.808  28.740  1.00 80.94  ? 9   ARG F NE  1 
ATOM   6242 C CZ  . ARG D 2 9   ? 8.628   21.437  27.618  1.00 80.94  ? 9   ARG F CZ  1 
ATOM   6243 N NH1 . ARG D 2 9   ? 8.295   20.912  26.445  1.00 80.94  ? 9   ARG F NH1 1 
ATOM   6244 N NH2 . ARG D 2 9   ? 9.286   22.589  27.665  1.00 80.94  ? 9   ARG F NH2 1 
ATOM   6245 N N   . GLY D 2 10  ? 11.541  16.210  32.000  1.00 35.19  ? 10  GLY F N   1 
ATOM   6246 C CA  . GLY D 2 10  ? 12.917  15.741  32.092  1.00 35.19  ? 10  GLY F CA  1 
ATOM   6247 C C   . GLY D 2 10  ? 13.101  14.257  31.829  1.00 35.19  ? 10  GLY F C   1 
ATOM   6248 O O   . GLY D 2 10  ? 12.133  13.498  31.732  1.00 35.19  ? 10  GLY F O   1 
ATOM   6249 N N   . GLU D 2 11  ? 14.357  13.843  31.689  1.00 41.51  ? 11  GLU F N   1 
ATOM   6250 C CA  . GLU D 2 11  ? 14.658  12.445  31.456  1.00 41.51  ? 11  GLU F CA  1 
ATOM   6251 C C   . GLU D 2 11  ? 14.905  11.835  32.833  1.00 41.51  ? 11  GLU F C   1 
ATOM   6252 O O   . GLU D 2 11  ? 15.771  12.291  33.588  1.00 41.51  ? 11  GLU F O   1 
ATOM   6253 C CB  . GLU D 2 11  ? 15.862  12.287  30.527  1.00 34.59  ? 11  GLU F CB  1 
ATOM   6254 C CG  . GLU D 2 11  ? 15.516  12.688  29.104  1.00 34.59  ? 11  GLU F CG  1 
ATOM   6255 C CD  . GLU D 2 11  ? 16.552  12.282  28.094  1.00 34.59  ? 11  GLU F CD  1 
ATOM   6256 O OE1 . GLU D 2 11  ? 17.684  12.797  28.158  1.00 34.59  ? 11  GLU F OE1 1 
ATOM   6257 O OE2 . GLU D 2 11  ? 16.230  11.446  27.231  1.00 34.59  ? 11  GLU F OE2 1 
ATOM   6258 N N   . PHE D 2 12  ? 14.109  10.823  33.157  1.00 51.82  ? 12  PHE F N   1 
ATOM   6259 C CA  . PHE D 2 12  ? 14.182  10.164  34.451  1.00 51.82  ? 12  PHE F CA  1 
ATOM   6260 C C   . PHE D 2 12  ? 14.809  8.789   34.399  1.00 51.82  ? 12  PHE F C   1 
ATOM   6261 O O   . PHE D 2 12  ? 14.881  8.159   33.343  1.00 51.82  ? 12  PHE F O   1 
ATOM   6262 C CB  . PHE D 2 12  ? 12.781  10.036  35.050  1.00 70.53  ? 12  PHE F CB  1 
ATOM   6263 C CG  . PHE D 2 12  ? 11.981  11.305  35.005  1.00 70.53  ? 12  PHE F CG  1 
ATOM   6264 C CD1 . PHE D 2 12  ? 12.430  12.453  35.647  1.00 70.53  ? 12  PHE F CD1 1 
ATOM   6265 C CD2 . PHE D 2 12  ? 10.769  11.351  34.325  1.00 70.53  ? 12  PHE F CD2 1 
ATOM   6266 C CE1 . PHE D 2 12  ? 11.680  13.629  35.616  1.00 70.53  ? 12  PHE F CE1 1 
ATOM   6267 C CE2 . PHE D 2 12  ? 10.014  12.521  34.288  1.00 70.53  ? 12  PHE F CE2 1 
ATOM   6268 C CZ  . PHE D 2 12  ? 10.472  13.662  34.935  1.00 70.53  ? 12  PHE F CZ  1 
ATOM   6269 N N   . SER D 2 13  ? 15.257  8.338   35.565  1.00 43.72  ? 13  SER F N   1 
ATOM   6270 C CA  . SER D 2 13  ? 15.863  7.025   35.723  1.00 43.72  ? 13  SER F CA  1 
ATOM   6271 C C   . SER D 2 13  ? 14.724  6.057   35.966  1.00 43.72  ? 13  SER F C   1 
ATOM   6272 O O   . SER D 2 13  ? 13.691  6.439   36.505  1.00 43.72  ? 13  SER F O   1 
ATOM   6273 C CB  . SER D 2 13  ? 16.815  7.014   36.920  1.00 134.68 ? 13  SER F CB  1 
ATOM   6274 O OG  . SER D 2 13  ? 17.892  7.911   36.725  1.00 134.68 ? 13  SER F OG  1 
ATOM   6275 N N   . VAL D 2 14  ? 14.922  4.808   35.571  1.00 9.01   ? 14  VAL F N   1 
ATOM   6276 C CA  . VAL D 2 14  ? 13.924  3.779   35.777  1.00 9.01   ? 14  VAL F CA  1 
ATOM   6277 C C   . VAL D 2 14  ? 14.158  3.329   37.213  1.00 9.01   ? 14  VAL F C   1 
ATOM   6278 O O   . VAL D 2 14  ? 13.236  3.008   37.964  1.00 9.01   ? 14  VAL F O   1 
ATOM   6279 C CB  . VAL D 2 14  ? 14.134  2.617   34.786  1.00 30.00  ? 14  VAL F CB  1 
ATOM   6280 C CG1 . VAL D 2 14  ? 15.558  2.114   34.869  1.00 30.00  ? 14  VAL F CG1 1 
ATOM   6281 C CG2 . VAL D 2 14  ? 13.157  1.505   35.074  1.00 30.00  ? 14  VAL F CG2 1 
ATOM   6282 N N   . CYS D 2 15  ? 15.428  3.355   37.594  1.00 44.87  ? 15  CYS F N   1 
ATOM   6283 C CA  . CYS D 2 15  ? 15.850  2.983   38.935  1.00 44.87  ? 15  CYS F CA  1 
ATOM   6284 C C   . CYS D 2 15  ? 16.787  4.056   39.442  1.00 44.87  ? 15  CYS F C   1 
ATOM   6285 O O   . CYS D 2 15  ? 17.703  4.476   38.729  1.00 44.87  ? 15  CYS F O   1 
ATOM   6286 C CB  . CYS D 2 15  ? 16.559  1.630   38.926  1.00 41.47  ? 15  CYS F CB  1 
ATOM   6287 S SG  . CYS D 2 15  ? 15.459  0.195   38.713  1.00 41.47  ? 15  CYS F SG  1 
ATOM   6288 N N   . ASP D 2 16  ? 16.562  4.489   40.678  1.00 40.66  ? 16  ASP F N   1 
ATOM   6289 C CA  . ASP D 2 16  ? 17.390  5.526   41.271  1.00 40.66  ? 16  ASP F CA  1 
ATOM   6290 C C   . ASP D 2 16  ? 18.612  4.985   42.018  1.00 40.66  ? 16  ASP F C   1 
ATOM   6291 O O   . ASP D 2 16  ? 18.531  4.016   42.778  1.00 40.66  ? 16  ASP F O   1 
ATOM   6292 C CB  . ASP D 2 16  ? 16.551  6.385   42.230  1.00 39.93  ? 16  ASP F CB  1 
ATOM   6293 C CG  . ASP D 2 16  ? 15.267  6.904   41.595  1.00 39.93  ? 16  ASP F CG  1 
ATOM   6294 O OD1 . ASP D 2 16  ? 15.270  7.210   40.387  1.00 39.93  ? 16  ASP F OD1 1 
ATOM   6295 O OD2 . ASP D 2 16  ? 14.254  7.022   42.311  1.00 39.93  ? 16  ASP F OD2 1 
ATOM   6296 N N   . SER D 2 17  ? 19.744  5.639   41.779  1.00 52.85  ? 17  SER F N   1 
ATOM   6297 C CA  . SER D 2 17  ? 21.006  5.256   42.372  1.00 52.85  ? 17  SER F CA  1 
ATOM   6298 C C   . SER D 2 17  ? 21.653  6.392   43.147  1.00 52.85  ? 17  SER F C   1 
ATOM   6299 O O   . SER D 2 17  ? 21.190  7.532   43.149  1.00 52.85  ? 17  SER F O   1 
ATOM   6300 C CB  . SER D 2 17  ? 21.961  4.769   41.280  1.00 121.61 ? 17  SER F CB  1 
ATOM   6301 O OG  . SER D 2 17  ? 22.135  5.757   40.278  1.00 121.61 ? 17  SER F OG  1 
ATOM   6302 N N   . VAL D 2 18  ? 22.742  6.054   43.810  1.00 22.57  ? 18  VAL F N   1 
ATOM   6303 C CA  . VAL D 2 18  ? 23.499  7.018   44.571  1.00 22.57  ? 18  VAL F CA  1 
ATOM   6304 C C   . VAL D 2 18  ? 24.937  6.592   44.333  1.00 22.57  ? 18  VAL F C   1 
ATOM   6305 O O   . VAL D 2 18  ? 25.208  5.388   44.220  1.00 22.57  ? 18  VAL F O   1 
ATOM   6306 C CB  . VAL D 2 18  ? 23.165  6.901   46.066  1.00 15.58  ? 18  VAL F CB  1 
ATOM   6307 C CG1 . VAL D 2 18  ? 23.312  5.477   46.515  1.00 15.58  ? 18  VAL F CG1 1 
ATOM   6308 C CG2 . VAL D 2 18  ? 24.077  7.794   46.874  1.00 15.58  ? 18  VAL F CG2 1 
ATOM   6309 N N   . SER D 2 19  ? 25.837  7.573   44.213  1.00 45.09  ? 19  SER F N   1 
ATOM   6310 C CA  . SER D 2 19  ? 27.276  7.331   43.982  1.00 45.09  ? 19  SER F CA  1 
ATOM   6311 C C   . SER D 2 19  ? 28.142  7.875   45.118  1.00 45.09  ? 19  SER F C   1 
ATOM   6312 O O   . SER D 2 19  ? 27.984  9.011   45.560  1.00 45.09  ? 19  SER F O   1 
ATOM   6313 C CB  . SER D 2 19  ? 27.713  7.940   42.650  1.00 59.97  ? 19  SER F CB  1 
ATOM   6314 O OG  . SER D 2 19  ? 27.183  7.205   41.562  1.00 59.97  ? 19  SER F OG  1 
ATOM   6315 N N   . VAL D 2 20  ? 29.078  7.062   45.578  1.00 42.27  ? 20  VAL F N   1 
ATOM   6316 C CA  . VAL D 2 20  ? 29.941  7.483   46.659  1.00 42.27  ? 20  VAL F CA  1 
ATOM   6317 C C   . VAL D 2 20  ? 31.334  6.925   46.478  1.00 42.27  ? 20  VAL F C   1 
ATOM   6318 O O   . VAL D 2 20  ? 31.551  5.983   45.712  1.00 42.27  ? 20  VAL F O   1 
ATOM   6319 C CB  . VAL D 2 20  ? 29.408  7.012   48.030  1.00 61.87  ? 20  VAL F CB  1 
ATOM   6320 C CG1 . VAL D 2 20  ? 28.043  7.618   48.298  1.00 61.87  ? 20  VAL F CG1 1 
ATOM   6321 C CG2 . VAL D 2 20  ? 29.336  5.496   48.065  1.00 61.87  ? 20  VAL F CG2 1 
ATOM   6322 N N   . TRP D 2 21  ? 32.278  7.522   47.194  1.00 45.36  ? 21  TRP F N   1 
ATOM   6323 C CA  . TRP D 2 21  ? 33.655  7.072   47.168  1.00 45.36  ? 21  TRP F CA  1 
ATOM   6324 C C   . TRP D 2 21  ? 33.738  6.136   48.357  1.00 45.36  ? 21  TRP F C   1 
ATOM   6325 O O   . TRP D 2 21  ? 33.412  6.526   49.474  1.00 45.36  ? 21  TRP F O   1 
ATOM   6326 C CB  . TRP D 2 21  ? 34.644  8.221   47.283  1.00 1.00   ? 21  TRP F CB  1 
ATOM   6327 C CG  . TRP D 2 21  ? 34.819  8.985   46.002  1.00 1.00   ? 21  TRP F CG  1 
ATOM   6328 C CD1 . TRP D 2 21  ? 34.462  10.281  45.772  1.00 1.00   ? 21  TRP F CD1 1 
ATOM   6329 C CD2 . TRP D 2 21  ? 35.432  8.518   44.791  1.00 1.00   ? 21  TRP F CD2 1 
ATOM   6330 N NE1 . TRP D 2 21  ? 34.819  10.655  44.500  1.00 1.00   ? 21  TRP F NE1 1 
ATOM   6331 C CE2 . TRP D 2 21  ? 35.417  9.595   43.874  1.00 1.00   ? 21  TRP F CE2 1 
ATOM   6332 C CE3 . TRP D 2 21  ? 35.995  7.301   44.393  1.00 1.00   ? 21  TRP F CE3 1 
ATOM   6333 C CZ2 . TRP D 2 21  ? 35.943  9.492   42.580  1.00 1.00   ? 21  TRP F CZ2 1 
ATOM   6334 C CZ3 . TRP D 2 21  ? 36.521  7.199   43.097  1.00 1.00   ? 21  TRP F CZ3 1 
ATOM   6335 C CH2 . TRP D 2 21  ? 36.489  8.292   42.212  1.00 1.00   ? 21  TRP F CH2 1 
ATOM   6336 N N   . VAL D 2 22  ? 34.140  4.895   48.130  1.00 48.63  ? 22  VAL F N   1 
ATOM   6337 C CA  . VAL D 2 22  ? 34.239  3.956   49.229  1.00 48.63  ? 22  VAL F CA  1 
ATOM   6338 C C   . VAL D 2 22  ? 35.719  3.801   49.539  1.00 48.63  ? 22  VAL F C   1 
ATOM   6339 O O   . VAL D 2 22  ? 36.514  3.448   48.667  1.00 48.63  ? 22  VAL F O   1 
ATOM   6340 C CB  . VAL D 2 22  ? 33.654  2.590   48.883  1.00 81.33  ? 22  VAL F CB  1 
ATOM   6341 C CG1 . VAL D 2 22  ? 33.926  1.613   50.017  1.00 81.33  ? 22  VAL F CG1 1 
ATOM   6342 C CG2 . VAL D 2 22  ? 32.152  2.723   48.656  1.00 81.33  ? 22  VAL F CG2 1 
ATOM   6343 N N   . GLY D 2 23  ? 36.088  4.099   50.782  1.00 90.22  ? 23  GLY F N   1 
ATOM   6344 C CA  . GLY D 2 23  ? 37.480  4.010   51.178  1.00 90.22  ? 23  GLY F CA  1 
ATOM   6345 C C   . GLY D 2 23  ? 37.722  3.184   52.422  1.00 90.22  ? 23  GLY F C   1 
ATOM   6346 O O   . GLY D 2 23  ? 38.852  3.061   52.882  1.00 90.22  ? 23  GLY F O   1 
ATOM   6347 N N   . ASP D 2 24  ? 36.670  2.607   52.975  1.00 78.11  ? 24  ASP F N   1 
ATOM   6348 C CA  . ASP D 2 24  ? 36.833  1.799   54.171  1.00 78.11  ? 24  ASP F CA  1 
ATOM   6349 C C   . ASP D 2 24  ? 36.639  0.327   53.854  1.00 78.11  ? 24  ASP F C   1 
ATOM   6350 O O   . ASP D 2 24  ? 36.476  -0.484  54.762  1.00 78.11  ? 24  ASP F O   1 
ATOM   6351 C CB  . ASP D 2 24  ? 35.811  2.218   55.223  1.00 102.71 ? 24  ASP F CB  1 
ATOM   6352 C CG  . ASP D 2 24  ? 34.383  1.974   54.773  1.00 102.71 ? 24  ASP F CG  1 
ATOM   6353 O OD1 . ASP D 2 24  ? 33.981  2.535   53.731  1.00 102.71 ? 24  ASP F OD1 1 
ATOM   6354 O OD2 . ASP D 2 24  ? 33.663  1.220   55.461  1.00 102.71 ? 24  ASP F OD2 1 
ATOM   6355 N N   . LYS D 2 25  ? 36.654  -0.013  52.568  1.00 48.18  ? 25  LYS F N   1 
ATOM   6356 C CA  . LYS D 2 25  ? 36.475  -1.395  52.145  1.00 48.18  ? 25  LYS F CA  1 
ATOM   6357 C C   . LYS D 2 25  ? 37.637  -2.291  52.628  1.00 48.18  ? 25  LYS F C   1 
ATOM   6358 O O   . LYS D 2 25  ? 38.821  -2.016  52.351  1.00 48.18  ? 25  LYS F O   1 
ATOM   6359 C CB  . LYS D 2 25  ? 36.367  -1.465  50.620  1.00 79.17  ? 25  LYS F CB  1 
ATOM   6360 C CG  . LYS D 2 25  ? 36.071  -2.855  50.076  1.00 79.17  ? 25  LYS F CG  1 
ATOM   6361 C CD  . LYS D 2 25  ? 35.705  -2.804  48.598  1.00 79.17  ? 25  LYS F CD  1 
ATOM   6362 C CE  . LYS D 2 25  ? 34.474  -1.936  48.372  1.00 79.17  ? 25  LYS F CE  1 
ATOM   6363 N NZ  . LYS D 2 25  ? 33.330  -2.360  49.234  1.00 79.17  ? 25  LYS F NZ  1 
ATOM   6364 N N   . THR D 2 26  ? 37.284  -3.361  53.352  1.00 99.44  ? 26  THR F N   1 
ATOM   6365 C CA  . THR D 2 26  ? 38.265  -4.301  53.905  1.00 99.44  ? 26  THR F CA  1 
ATOM   6366 C C   . THR D 2 26  ? 38.218  -5.685  53.280  1.00 99.44  ? 26  THR F C   1 
ATOM   6367 O O   . THR D 2 26  ? 39.236  -6.343  53.131  1.00 99.44  ? 26  THR F O   1 
ATOM   6368 C CB  . THR D 2 26  ? 38.082  -4.501  55.426  1.00 68.33  ? 26  THR F CB  1 
ATOM   6369 O OG1 . THR D 2 26  ? 36.889  -5.252  55.669  1.00 68.33  ? 26  THR F OG1 1 
ATOM   6370 C CG2 . THR D 2 26  ? 37.983  -3.169  56.135  1.00 68.33  ? 26  THR F CG2 1 
ATOM   6371 N N   . THR D 2 27  ? 37.028  -6.134  52.919  1.00 80.08  ? 27  THR F N   1 
ATOM   6372 C CA  . THR D 2 27  ? 36.878  -7.436  52.296  1.00 80.08  ? 27  THR F CA  1 
ATOM   6373 C C   . THR D 2 27  ? 36.135  -7.272  50.982  1.00 80.08  ? 27  THR F C   1 
ATOM   6374 O O   . THR D 2 27  ? 35.484  -6.260  50.754  1.00 80.08  ? 27  THR F O   1 
ATOM   6375 C CB  . THR D 2 27  ? 36.082  -8.398  53.188  1.00 82.69  ? 27  THR F CB  1 
ATOM   6376 O OG1 . THR D 2 27  ? 34.717  -7.971  53.255  1.00 82.69  ? 27  THR F OG1 1 
ATOM   6377 C CG2 . THR D 2 27  ? 36.661  -8.416  54.587  1.00 82.69  ? 27  THR F CG2 1 
ATOM   6378 N N   . ALA D 2 28  ? 36.232  -8.278  50.123  1.00 96.31  ? 28  ALA F N   1 
ATOM   6379 C CA  . ALA D 2 28  ? 35.572  -8.253  48.829  1.00 96.31  ? 28  ALA F CA  1 
ATOM   6380 C C   . ALA D 2 28  ? 35.676  -9.659  48.291  1.00 96.31  ? 28  ALA F C   1 
ATOM   6381 O O   . ALA D 2 28  ? 36.302  -10.503 48.912  1.00 96.31  ? 28  ALA F O   1 
ATOM   6382 C CB  . ALA D 2 28  ? 36.274  -7.276  47.900  1.00 131.31 ? 28  ALA F CB  1 
ATOM   6383 N N   . THR D 2 29  ? 35.047  -9.924  47.154  1.00 53.10  ? 29  THR F N   1 
ATOM   6384 C CA  . THR D 2 29  ? 35.139  -11.251 46.563  1.00 53.10  ? 29  THR F CA  1 
ATOM   6385 C C   . THR D 2 29  ? 35.803  -11.065 45.213  1.00 53.10  ? 29  THR F C   1 
ATOM   6386 O O   . THR D 2 29  ? 35.479  -10.136 44.490  1.00 53.10  ? 29  THR F O   1 
ATOM   6387 C CB  . THR D 2 29  ? 33.756  -11.871 46.340  1.00 30.68  ? 29  THR F CB  1 
ATOM   6388 O OG1 . THR D 2 29  ? 32.969  -10.998 45.524  1.00 30.68  ? 29  THR F OG1 1 
ATOM   6389 C CG2 . THR D 2 29  ? 33.055  -12.092 47.665  1.00 30.68  ? 29  THR F CG2 1 
ATOM   6390 N N   . ASP D 2 30  ? 36.751  -11.939 44.894  1.00 57.97  ? 30  ASP F N   1 
ATOM   6391 C CA  . ASP D 2 30  ? 37.472  -11.827 43.644  1.00 57.97  ? 30  ASP F CA  1 
ATOM   6392 C C   . ASP D 2 30  ? 36.747  -12.409 42.438  1.00 57.97  ? 30  ASP F C   1 
ATOM   6393 O O   . ASP D 2 30  ? 35.588  -12.819 42.522  1.00 57.97  ? 30  ASP F O   1 
ATOM   6394 C CB  . ASP D 2 30  ? 38.840  -12.498 43.771  1.00 110.43 ? 30  ASP F CB  1 
ATOM   6395 C CG  . ASP D 2 30  ? 38.741  -13.933 44.245  1.00 110.43 ? 30  ASP F CG  1 
ATOM   6396 O OD1 . ASP D 2 30  ? 37.954  -14.702 43.654  1.00 110.43 ? 30  ASP F OD1 1 
ATOM   6397 O OD2 . ASP D 2 30  ? 39.452  -14.295 45.205  1.00 110.43 ? 30  ASP F OD2 1 
ATOM   6398 N N   . ILE D 2 31  ? 37.453  -12.433 41.315  1.00 16.91  ? 31  ILE F N   1 
ATOM   6399 C CA  . ILE D 2 31  ? 36.926  -12.940 40.066  1.00 16.91  ? 31  ILE F CA  1 
ATOM   6400 C C   . ILE D 2 31  ? 36.572  -14.417 40.152  1.00 16.91  ? 31  ILE F C   1 
ATOM   6401 O O   . ILE D 2 31  ? 35.814  -14.941 39.328  1.00 16.91  ? 31  ILE F O   1 
ATOM   6402 C CB  . ILE D 2 31  ? 37.949  -12.721 38.936  1.00 27.19  ? 31  ILE F CB  1 
ATOM   6403 C CG1 . ILE D 2 31  ? 37.239  -12.657 37.587  1.00 27.19  ? 31  ILE F CG1 1 
ATOM   6404 C CG2 . ILE D 2 31  ? 38.960  -13.841 38.930  1.00 27.19  ? 31  ILE F CG2 1 
ATOM   6405 C CD1 . ILE D 2 31  ? 36.317  -11.467 37.448  1.00 65.85  ? 31  ILE F CD1 1 
ATOM   6406 N N   . LYS D 2 32  ? 37.129  -15.093 41.146  1.00 29.38  ? 32  LYS F N   1 
ATOM   6407 C CA  . LYS D 2 32  ? 36.845  -16.501 41.317  1.00 29.38  ? 32  LYS F CA  1 
ATOM   6408 C C   . LYS D 2 32  ? 35.731  -16.713 42.336  1.00 29.38  ? 32  LYS F C   1 
ATOM   6409 O O   . LYS D 2 32  ? 35.335  -17.835 42.600  1.00 29.38  ? 32  LYS F O   1 
ATOM   6410 C CB  . LYS D 2 32  ? 38.115  -17.220 41.776  1.00 86.87  ? 32  LYS F CB  1 
ATOM   6411 C CG  . LYS D 2 32  ? 39.336  -16.899 40.919  1.00 86.87  ? 32  LYS F CG  1 
ATOM   6412 C CD  . LYS D 2 32  ? 40.635  -17.045 41.702  1.00 86.87  ? 32  LYS F CD  1 
ATOM   6413 C CE  . LYS D 2 32  ? 41.808  -16.451 40.935  1.00 86.87  ? 32  LYS F CE  1 
ATOM   6414 N NZ  . LYS D 2 32  ? 43.054  -16.425 41.747  1.00 86.87  ? 32  LYS F NZ  1 
ATOM   6415 N N   . GLY D 2 33  ? 35.223  -15.632 42.907  1.00 63.95  ? 33  GLY F N   1 
ATOM   6416 C CA  . GLY D 2 33  ? 34.151  -15.756 43.873  1.00 63.95  ? 33  GLY F CA  1 
ATOM   6417 C C   . GLY D 2 33  ? 34.631  -15.981 45.290  1.00 63.95  ? 33  GLY F C   1 
ATOM   6418 O O   . GLY D 2 33  ? 33.822  -16.220 46.180  1.00 63.95  ? 33  GLY F O   1 
ATOM   6419 N N   . LYS D 2 34  ? 35.941  -15.898 45.502  1.00 64.48  ? 34  LYS F N   1 
ATOM   6420 C CA  . LYS D 2 34  ? 36.531  -16.096 46.822  1.00 64.48  ? 34  LYS F CA  1 
ATOM   6421 C C   . LYS D 2 34  ? 36.656  -14.836 47.640  1.00 64.48  ? 34  LYS F C   1 
ATOM   6422 O O   . LYS D 2 34  ? 37.112  -13.812 47.153  1.00 64.48  ? 34  LYS F O   1 
ATOM   6423 C CB  . LYS D 2 34  ? 37.928  -16.709 46.686  1.00 113.01 ? 34  LYS F CB  1 
ATOM   6424 C CG  . LYS D 2 34  ? 38.746  -16.654 47.984  1.00 113.01 ? 34  LYS F CG  1 
ATOM   6425 C CD  . LYS D 2 34  ? 40.211  -17.061 47.807  1.00 113.01 ? 34  LYS F CD  1 
ATOM   6426 C CE  . LYS D 2 34  ? 40.367  -18.551 47.562  1.00 113.01 ? 34  LYS F CE  1 
ATOM   6427 N NZ  . LYS D 2 34  ? 41.801  -18.943 47.494  1.00 113.01 ? 34  LYS F NZ  1 
ATOM   6428 N N   . GLU D 2 35  ? 36.272  -14.931 48.904  1.00 100.45 ? 35  GLU F N   1 
ATOM   6429 C CA  . GLU D 2 35  ? 36.341  -13.802 49.806  1.00 100.45 ? 35  GLU F CA  1 
ATOM   6430 C C   . GLU D 2 35  ? 37.790  -13.456 50.087  1.00 100.45 ? 35  GLU F C   1 
ATOM   6431 O O   . GLU D 2 35  ? 38.509  -14.238 50.703  1.00 100.45 ? 35  GLU F O   1 
ATOM   6432 C CB  . GLU D 2 35  ? 35.633  -14.104 51.128  1.00 148.09 ? 35  GLU F CB  1 
ATOM   6433 C CG  . GLU D 2 35  ? 35.916  -13.061 52.206  1.00 148.09 ? 35  GLU F CG  1 
ATOM   6434 C CD  . GLU D 2 35  ? 35.072  -13.244 53.449  1.00 148.09 ? 35  GLU F CD  1 
ATOM   6435 O OE1 . GLU D 2 35  ? 33.838  -13.071 53.360  1.00 148.09 ? 35  GLU F OE1 1 
ATOM   6436 O OE2 . GLU D 2 35  ? 35.641  -13.561 54.516  1.00 148.09 ? 35  GLU F OE2 1 
ATOM   6437 N N   . VAL D 2 36  ? 38.218  -12.284 49.639  1.00 88.51  ? 36  VAL F N   1 
ATOM   6438 C CA  . VAL D 2 36  ? 39.591  -11.850 49.861  1.00 88.51  ? 36  VAL F CA  1 
ATOM   6439 C C   . VAL D 2 36  ? 39.688  -10.533 50.637  1.00 88.51  ? 36  VAL F C   1 
ATOM   6440 O O   . VAL D 2 36  ? 38.710  -9.791  50.759  1.00 88.51  ? 36  VAL F O   1 
ATOM   6441 C CB  . VAL D 2 36  ? 40.402  -11.700 48.556  1.00 44.77  ? 36  VAL F CB  1 
ATOM   6442 C CG1 . VAL D 2 36  ? 40.427  -13.018 47.816  1.00 44.77  ? 36  VAL F CG1 1 
ATOM   6443 C CG2 . VAL D 2 36  ? 39.832  -10.575 47.706  1.00 44.77  ? 36  VAL F CG2 1 
ATOM   6444 N N   . MET D 2 37  ? 40.878  -10.256 51.161  1.00 47.00  ? 37  MET F N   1 
ATOM   6445 C CA  . MET D 2 37  ? 41.121  -9.042  51.933  1.00 47.00  ? 37  MET F CA  1 
ATOM   6446 C C   . MET D 2 37  ? 41.590  -7.893  51.062  1.00 47.00  ? 37  MET F C   1 
ATOM   6447 O O   . MET D 2 37  ? 42.448  -8.049  50.192  1.00 47.00  ? 37  MET F O   1 
ATOM   6448 C CB  . MET D 2 37  ? 42.152  -9.303  53.034  1.00 200.00 ? 37  MET F CB  1 
ATOM   6449 C CG  . MET D 2 37  ? 41.672  -10.252 54.120  1.00 200.00 ? 37  MET F CG  1 
ATOM   6450 S SD  . MET D 2 37  ? 42.808  -10.346 55.520  1.00 200.00 ? 37  MET F SD  1 
ATOM   6451 C CE  . MET D 2 37  ? 43.850  -11.717 55.027  1.00 200.00 ? 37  MET F CE  1 
ATOM   6452 N N   . VAL D 2 38  ? 41.016  -6.730  51.313  1.00 90.21  ? 38  VAL F N   1 
ATOM   6453 C CA  . VAL D 2 38  ? 41.342  -5.534  50.562  1.00 90.21  ? 38  VAL F CA  1 
ATOM   6454 C C   . VAL D 2 38  ? 42.191  -4.622  51.433  1.00 90.21  ? 38  VAL F C   1 
ATOM   6455 O O   . VAL D 2 38  ? 41.756  -4.222  52.519  1.00 90.21  ? 38  VAL F O   1 
ATOM   6456 C CB  . VAL D 2 38  ? 40.068  -4.786  50.123  1.00 131.86 ? 38  VAL F CB  1 
ATOM   6457 C CG1 . VAL D 2 38  ? 40.435  -3.609  49.233  1.00 131.86 ? 38  VAL F CG1 1 
ATOM   6458 C CG2 . VAL D 2 38  ? 39.139  -5.737  49.389  1.00 131.86 ? 38  VAL F CG2 1 
ATOM   6459 N N   . LEU D 2 39  ? 43.401  -4.307  50.972  1.00 36.96  ? 39  LEU F N   1 
ATOM   6460 C CA  . LEU D 2 39  ? 44.278  -3.412  51.728  1.00 36.96  ? 39  LEU F CA  1 
ATOM   6461 C C   . LEU D 2 39  ? 43.774  -1.954  51.649  1.00 36.96  ? 39  LEU F C   1 
ATOM   6462 O O   . LEU D 2 39  ? 42.933  -1.610  50.802  1.00 36.96  ? 39  LEU F O   1 
ATOM   6463 C CB  . LEU D 2 39  ? 45.703  -3.438  51.158  1.00 92.63  ? 39  LEU F CB  1 
ATOM   6464 C CG  . LEU D 2 39  ? 46.553  -4.707  51.120  1.00 92.63  ? 39  LEU F CG  1 
ATOM   6465 C CD1 . LEU D 2 39  ? 46.782  -5.219  52.529  1.00 92.63  ? 39  LEU F CD1 1 
ATOM   6466 C CD2 . LEU D 2 39  ? 45.874  -5.749  50.273  1.00 92.63  ? 39  LEU F CD2 1 
ATOM   6467 N N   . GLY D 2 40  ? 44.287  -1.092  52.524  1.00 97.17  ? 40  GLY F N   1 
ATOM   6468 C CA  . GLY D 2 40  ? 43.851  0.299   52.521  1.00 97.17  ? 40  GLY F CA  1 
ATOM   6469 C C   . GLY D 2 40  ? 44.758  1.262   51.773  1.00 97.17  ? 40  GLY F C   1 
ATOM   6470 O O   . GLY D 2 40  ? 44.400  2.418   51.555  1.00 97.17  ? 40  GLY F O   1 
ATOM   6471 N N   . GLU D 2 41  ? 45.932  0.785   51.376  1.00 90.13  ? 41  GLU F N   1 
ATOM   6472 C CA  . GLU D 2 41  ? 46.892  1.607   50.658  1.00 90.13  ? 41  GLU F CA  1 
ATOM   6473 C C   . GLU D 2 41  ? 47.574  0.722   49.644  1.00 90.13  ? 41  GLU F C   1 
ATOM   6474 O O   . GLU D 2 41  ? 47.518  -0.493  49.758  1.00 90.13  ? 41  GLU F O   1 
ATOM   6475 C CB  . GLU D 2 41  ? 47.908  2.190   51.642  1.00 199.58 ? 41  GLU F CB  1 
ATOM   6476 C CG  . GLU D 2 41  ? 47.252  2.875   52.836  1.00 199.58 ? 41  GLU F CG  1 
ATOM   6477 C CD  . GLU D 2 41  ? 48.250  3.481   53.800  1.00 199.58 ? 41  GLU F CD  1 
ATOM   6478 O OE1 . GLU D 2 41  ? 49.136  2.746   54.285  1.00 199.58 ? 41  GLU F OE1 1 
ATOM   6479 O OE2 . GLU D 2 41  ? 48.142  4.694   54.080  1.00 199.58 ? 41  GLU F OE2 1 
ATOM   6480 N N   . VAL D 2 42  ? 48.236  1.323   48.666  1.00 45.23  ? 42  VAL F N   1 
ATOM   6481 C CA  . VAL D 2 42  ? 48.917  0.551   47.636  1.00 45.23  ? 42  VAL F CA  1 
ATOM   6482 C C   . VAL D 2 42  ? 50.101  1.357   47.134  1.00 45.23  ? 42  VAL F C   1 
ATOM   6483 O O   . VAL D 2 42  ? 50.059  2.575   47.136  1.00 45.23  ? 42  VAL F O   1 
ATOM   6484 C CB  . VAL D 2 42  ? 47.957  0.234   46.467  1.00 163.47 ? 42  VAL F CB  1 
ATOM   6485 C CG1 . VAL D 2 42  ? 47.272  1.505   45.999  1.00 163.47 ? 42  VAL F CG1 1 
ATOM   6486 C CG2 . VAL D 2 42  ? 48.719  -0.423  45.323  1.00 163.47 ? 42  VAL F CG2 1 
ATOM   6487 N N   . ASN D 2 43  ? 51.162  0.680   46.713  1.00 133.81 ? 43  ASN F N   1 
ATOM   6488 C CA  . ASN D 2 43  ? 52.355  1.372   46.232  1.00 133.81 ? 43  ASN F CA  1 
ATOM   6489 C C   . ASN D 2 43  ? 52.503  1.340   44.706  1.00 133.81 ? 43  ASN F C   1 
ATOM   6490 O O   . ASN D 2 43  ? 53.051  0.398   44.136  1.00 133.81 ? 43  ASN F O   1 
ATOM   6491 C CB  . ASN D 2 43  ? 53.612  0.784   46.874  1.00 172.21 ? 43  ASN F CB  1 
ATOM   6492 C CG  . ASN D 2 43  ? 54.661  1.838   47.159  1.00 172.21 ? 43  ASN F CG  1 
ATOM   6493 O OD1 . ASN D 2 43  ? 54.531  2.617   48.104  1.00 172.21 ? 43  ASN F OD1 1 
ATOM   6494 N ND2 . ASN D 2 43  ? 55.699  1.883   46.332  1.00 172.21 ? 43  ASN F ND2 1 
ATOM   6495 N N   . ILE D 2 44  ? 52.011  2.389   44.056  1.00 127.79 ? 44  ILE F N   1 
ATOM   6496 C CA  . ILE D 2 44  ? 52.091  2.509   42.607  1.00 127.79 ? 44  ILE F CA  1 
ATOM   6497 C C   . ILE D 2 44  ? 53.307  3.366   42.292  1.00 127.79 ? 44  ILE F C   1 
ATOM   6498 O O   . ILE D 2 44  ? 53.268  4.592   42.433  1.00 127.79 ? 44  ILE F O   1 
ATOM   6499 C CB  . ILE D 2 44  ? 50.845  3.221   42.015  1.00 194.13 ? 44  ILE F CB  1 
ATOM   6500 C CG1 . ILE D 2 44  ? 49.571  2.449   42.357  1.00 194.13 ? 44  ILE F CG1 1 
ATOM   6501 C CG2 . ILE D 2 44  ? 50.990  3.361   40.511  1.00 194.13 ? 44  ILE F CG2 1 
ATOM   6502 C CD1 . ILE D 2 44  ? 48.960  2.850   43.671  1.00 154.41 ? 44  ILE F CD1 1 
ATOM   6503 N N   . ASN D 2 45  ? 54.393  2.709   41.895  1.00 169.83 ? 45  ASN F N   1 
ATOM   6504 C CA  . ASN D 2 45  ? 55.631  3.395   41.539  1.00 169.83 ? 45  ASN F CA  1 
ATOM   6505 C C   . ASN D 2 45  ? 56.175  4.348   42.608  1.00 169.83 ? 45  ASN F C   1 
ATOM   6506 O O   . ASN D 2 45  ? 56.334  5.544   42.360  1.00 169.83 ? 45  ASN F O   1 
ATOM   6507 C CB  . ASN D 2 45  ? 55.478  4.141   40.209  1.00 162.31 ? 45  ASN F CB  1 
ATOM   6508 C CG  . ASN D 2 45  ? 56.155  3.418   39.056  1.00 162.31 ? 45  ASN F CG  1 
ATOM   6509 O OD1 . ASN D 2 45  ? 56.285  3.956   37.954  1.00 162.31 ? 45  ASN F OD1 1 
ATOM   6510 N ND2 . ASN D 2 45  ? 56.587  2.188   39.306  1.00 162.31 ? 45  ASN F ND2 1 
ATOM   6511 N N   . ASN D 2 46  ? 56.459  3.821   43.792  1.00 200.00 ? 46  ASN F N   1 
ATOM   6512 C CA  . ASN D 2 46  ? 57.012  4.632   44.881  1.00 200.00 ? 46  ASN F CA  1 
ATOM   6513 C C   . ASN D 2 46  ? 56.016  5.625   45.470  1.00 200.00 ? 46  ASN F C   1 
ATOM   6514 O O   . ASN D 2 46  ? 56.349  6.382   46.388  1.00 200.00 ? 46  ASN F O   1 
ATOM   6515 C CB  . ASN D 2 46  ? 58.315  5.342   44.440  1.00 200.00 ? 46  ASN F CB  1 
ATOM   6516 C CG  . ASN D 2 46  ? 58.105  6.769   43.913  1.00 200.00 ? 46  ASN F CG  1 
ATOM   6517 O OD1 . ASN D 2 46  ? 59.072  7.431   43.526  1.00 200.00 ? 46  ASN F OD1 1 
ATOM   6518 N ND2 . ASN D 2 46  ? 56.866  7.244   43.900  1.00 200.00 ? 46  ASN F ND2 1 
ATOM   6519 N N   . SER D 2 47  ? 54.801  5.638   44.940  1.00 117.40 ? 47  SER F N   1 
ATOM   6520 C CA  . SER D 2 47  ? 53.791  6.549   45.448  1.00 117.40 ? 47  SER F CA  1 
ATOM   6521 C C   . SER D 2 47  ? 52.709  5.807   46.209  1.00 117.40 ? 47  SER F C   1 
ATOM   6522 O O   . SER D 2 47  ? 51.900  5.082   45.639  1.00 117.40 ? 47  SER F O   1 
ATOM   6523 C CB  . SER D 2 47  ? 53.190  7.335   44.285  1.00 138.45 ? 47  SER F CB  1 
ATOM   6524 O OG  . SER D 2 47  ? 53.094  8.716   44.594  1.00 138.45 ? 47  SER F OG  1 
ATOM   6525 N N   . VAL D 2 48  ? 52.718  5.999   47.516  1.00 191.64 ? 48  VAL F N   1 
ATOM   6526 C CA  . VAL D 2 48  ? 51.761  5.372   48.396  1.00 191.64 ? 48  VAL F CA  1 
ATOM   6527 C C   . VAL D 2 48  ? 50.361  5.922   48.127  1.00 191.64 ? 48  VAL F C   1 
ATOM   6528 O O   . VAL D 2 48  ? 50.152  7.130   48.186  1.00 191.64 ? 48  VAL F O   1 
ATOM   6529 C CB  . VAL D 2 48  ? 52.128  5.633   49.880  1.00 86.29  ? 48  VAL F CB  1 
ATOM   6530 C CG1 . VAL D 2 48  ? 53.557  5.195   50.139  1.00 86.29  ? 48  VAL F CG1 1 
ATOM   6531 C CG2 . VAL D 2 48  ? 51.975  7.108   50.214  1.00 86.29  ? 48  VAL F CG2 1 
ATOM   6532 N N   . PHE D 2 49  ? 49.407  5.038   47.836  1.00 97.10  ? 49  PHE F N   1 
ATOM   6533 C CA  . PHE D 2 49  ? 48.021  5.434   47.556  1.00 97.10  ? 49  PHE F CA  1 
ATOM   6534 C C   . PHE D 2 49  ? 47.021  4.818   48.536  1.00 97.10  ? 49  PHE F C   1 
ATOM   6535 O O   . PHE D 2 49  ? 47.171  3.668   48.954  1.00 97.10  ? 49  PHE F O   1 
ATOM   6536 C CB  . PHE D 2 49  ? 47.633  5.089   46.116  1.00 170.85 ? 49  PHE F CB  1 
ATOM   6537 C CG  . PHE D 2 49  ? 48.192  6.043   45.102  1.00 170.85 ? 49  PHE F CG  1 
ATOM   6538 C CD1 . PHE D 2 49  ? 49.556  6.099   44.864  1.00 170.85 ? 49  PHE F CD1 1 
ATOM   6539 C CD2 . PHE D 2 49  ? 47.359  6.916   44.411  1.00 170.85 ? 49  PHE F CD2 1 
ATOM   6540 C CE1 . PHE D 2 49  ? 50.087  7.007   43.958  1.00 170.85 ? 49  PHE F CE1 1 
ATOM   6541 C CE2 . PHE D 2 49  ? 47.884  7.831   43.500  1.00 170.85 ? 49  PHE F CE2 1 
ATOM   6542 C CZ  . PHE D 2 49  ? 49.253  7.875   43.275  1.00 170.85 ? 49  PHE F CZ  1 
ATOM   6543 N N   . LYS D 2 50  ? 46.009  5.593   48.913  1.00 102.50 ? 50  LYS F N   1 
ATOM   6544 C CA  . LYS D 2 50  ? 44.969  5.097   49.809  1.00 102.50 ? 50  LYS F CA  1 
ATOM   6545 C C   . LYS D 2 50  ? 43.961  4.463   48.847  1.00 102.50 ? 50  LYS F C   1 
ATOM   6546 O O   . LYS D 2 50  ? 43.528  5.124   47.900  1.00 102.50 ? 50  LYS F O   1 
ATOM   6547 C CB  . LYS D 2 50  ? 44.264  6.189   50.606  1.00 67.58  ? 50  LYS F CB  1 
ATOM   6548 C CG  . LYS D 2 50  ? 43.032  5.608   51.296  1.00 67.58  ? 50  LYS F CG  1 
ATOM   6549 C CD  . LYS D 2 50  ? 42.664  6.279   52.598  1.00 67.58  ? 50  LYS F CD  1 
ATOM   6550 C CE  . LYS D 2 50  ? 41.540  5.499   53.264  1.00 67.58  ? 50  LYS F CE  1 
ATOM   6551 N NZ  . LYS D 2 50  ? 41.097  6.094   54.548  1.00 67.58  ? 50  LYS F NZ  1 
ATOM   6552 N N   . GLN D 2 51  ? 43.606  3.195   49.059  1.00 91.02  ? 51  GLN F N   1 
ATOM   6553 C CA  . GLN D 2 51  ? 42.678  2.533   48.154  1.00 91.02  ? 51  GLN F CA  1 
ATOM   6554 C C   . GLN D 2 51  ? 41.234  3.042   48.281  1.00 91.02  ? 51  GLN F C   1 
ATOM   6555 O O   . GLN D 2 51  ? 40.589  2.907   49.331  1.00 91.02  ? 51  GLN F O   1 
ATOM   6556 C CB  . GLN D 2 51  ? 42.746  1.015   48.330  1.00 70.80  ? 51  GLN F CB  1 
ATOM   6557 C CG  . GLN D 2 51  ? 42.522  0.265   47.016  1.00 70.80  ? 51  GLN F CG  1 
ATOM   6558 C CD  . GLN D 2 51  ? 43.556  -0.821  46.751  1.00 70.80  ? 51  GLN F CD  1 
ATOM   6559 O OE1 . GLN D 2 51  ? 43.597  -1.397  45.666  1.00 70.80  ? 51  GLN F OE1 1 
ATOM   6560 N NE2 . GLN D 2 51  ? 44.390  -1.106  47.743  1.00 70.80  ? 51  GLN F NE2 1 
ATOM   6561 N N   . TYR D 2 52  ? 40.743  3.636   47.193  1.00 97.32  ? 52  TYR F N   1 
ATOM   6562 C CA  . TYR D 2 52  ? 39.399  4.216   47.123  1.00 97.32  ? 52  TYR F CA  1 
ATOM   6563 C C   . TYR D 2 52  ? 38.646  3.616   45.936  1.00 97.32  ? 52  TYR F C   1 
ATOM   6564 O O   . TYR D 2 52  ? 39.256  3.244   44.939  1.00 97.32  ? 52  TYR F O   1 
ATOM   6565 C CB  . TYR D 2 52  ? 39.465  5.733   46.910  1.00 57.60  ? 52  TYR F CB  1 
ATOM   6566 C CG  . TYR D 2 52  ? 39.644  6.574   48.152  1.00 57.60  ? 52  TYR F CG  1 
ATOM   6567 C CD1 . TYR D 2 52  ? 38.755  6.476   49.219  1.00 57.60  ? 52  TYR F CD1 1 
ATOM   6568 C CD2 . TYR D 2 52  ? 40.672  7.513   48.236  1.00 57.60  ? 52  TYR F CD2 1 
ATOM   6569 C CE1 . TYR D 2 52  ? 38.881  7.297   50.339  1.00 57.60  ? 52  TYR F CE1 1 
ATOM   6570 C CE2 . TYR D 2 52  ? 40.807  8.337   49.350  1.00 57.60  ? 52  TYR F CE2 1 
ATOM   6571 C CZ  . TYR D 2 52  ? 39.907  8.225   50.397  1.00 57.60  ? 52  TYR F CZ  1 
ATOM   6572 O OH  . TYR D 2 52  ? 40.026  9.044   51.496  1.00 57.60  ? 52  TYR F OH  1 
ATOM   6573 N N   . PHE D 2 53  ? 37.322  3.544   46.028  1.00 54.71  ? 53  PHE F N   1 
ATOM   6574 C CA  . PHE D 2 53  ? 36.527  3.002   44.932  1.00 54.71  ? 53  PHE F CA  1 
ATOM   6575 C C   . PHE D 2 53  ? 35.296  3.841   44.615  1.00 54.71  ? 53  PHE F C   1 
ATOM   6576 O O   . PHE D 2 53  ? 34.643  4.351   45.507  1.00 54.71  ? 53  PHE F O   1 
ATOM   6577 C CB  . PHE D 2 53  ? 36.106  1.569   45.260  1.00 52.02  ? 53  PHE F CB  1 
ATOM   6578 C CG  . PHE D 2 53  ? 37.263  0.638   45.492  1.00 52.02  ? 53  PHE F CG  1 
ATOM   6579 C CD1 . PHE D 2 53  ? 38.146  0.334   44.460  1.00 52.02  ? 53  PHE F CD1 1 
ATOM   6580 C CD2 . PHE D 2 53  ? 37.473  0.068   46.743  1.00 52.02  ? 53  PHE F CD2 1 
ATOM   6581 C CE1 . PHE D 2 53  ? 39.222  -0.523  44.671  1.00 52.02  ? 53  PHE F CE1 1 
ATOM   6582 C CE2 . PHE D 2 53  ? 38.545  -0.789  46.965  1.00 52.02  ? 53  PHE F CE2 1 
ATOM   6583 C CZ  . PHE D 2 53  ? 39.421  -1.086  45.926  1.00 52.02  ? 53  PHE F CZ  1 
ATOM   6584 N N   . PHE D 2 54  ? 34.984  3.972   43.332  1.00 44.72  ? 54  PHE F N   1 
ATOM   6585 C CA  . PHE D 2 54  ? 33.789  4.686   42.934  1.00 44.72  ? 54  PHE F CA  1 
ATOM   6586 C C   . PHE D 2 54  ? 32.696  3.630   42.861  1.00 44.72  ? 54  PHE F C   1 
ATOM   6587 O O   . PHE D 2 54  ? 32.750  2.720   42.032  1.00 44.72  ? 54  PHE F O   1 
ATOM   6588 C CB  . PHE D 2 54  ? 33.998  5.315   41.561  1.00 68.33  ? 54  PHE F CB  1 
ATOM   6589 C CG  . PHE D 2 54  ? 32.868  6.188   41.113  1.00 68.33  ? 54  PHE F CG  1 
ATOM   6590 C CD1 . PHE D 2 54  ? 32.625  7.406   41.735  1.00 68.33  ? 54  PHE F CD1 1 
ATOM   6591 C CD2 . PHE D 2 54  ? 32.062  5.806   40.050  1.00 68.33  ? 54  PHE F CD2 1 
ATOM   6592 C CE1 . PHE D 2 54  ? 31.597  8.234   41.300  1.00 68.33  ? 54  PHE F CE1 1 
ATOM   6593 C CE2 . PHE D 2 54  ? 31.030  6.626   39.607  1.00 68.33  ? 54  PHE F CE2 1 
ATOM   6594 C CZ  . PHE D 2 54  ? 30.797  7.844   40.233  1.00 68.33  ? 54  PHE F CZ  1 
ATOM   6595 N N   . GLU D 2 55  ? 31.710  3.738   43.744  1.00 71.79  ? 55  GLU F N   1 
ATOM   6596 C CA  . GLU D 2 55  ? 30.634  2.771   43.758  1.00 71.79  ? 55  GLU F CA  1 
ATOM   6597 C C   . GLU D 2 55  ? 29.251  3.398   43.639  1.00 71.79  ? 55  GLU F C   1 
ATOM   6598 O O   . GLU D 2 55  ? 28.974  4.444   44.226  1.00 71.79  ? 55  GLU F O   1 
ATOM   6599 C CB  . GLU D 2 55  ? 30.713  1.932   45.037  1.00 51.21  ? 55  GLU F CB  1 
ATOM   6600 C CG  . GLU D 2 55  ? 32.133  1.625   45.468  1.00 51.21  ? 55  GLU F CG  1 
ATOM   6601 C CD  . GLU D 2 55  ? 32.228  0.362   46.290  1.00 51.21  ? 55  GLU F CD  1 
ATOM   6602 O OE1 . GLU D 2 55  ? 31.302  0.096   47.083  1.00 51.21  ? 55  GLU F OE1 1 
ATOM   6603 O OE2 . GLU D 2 55  ? 33.232  -0.363  46.147  1.00 51.21  ? 55  GLU F OE2 1 
ATOM   6604 N N   . THR D 2 56  ? 28.404  2.738   42.855  1.00 45.69  ? 56  THR F N   1 
ATOM   6605 C CA  . THR D 2 56  ? 27.030  3.163   42.621  1.00 45.69  ? 56  THR F CA  1 
ATOM   6606 C C   . THR D 2 56  ? 26.111  2.012   43.001  1.00 45.69  ? 56  THR F C   1 
ATOM   6607 O O   . THR D 2 56  ? 26.323  0.871   42.594  1.00 45.69  ? 56  THR F O   1 
ATOM   6608 C CB  . THR D 2 56  ? 26.852  3.488   41.159  1.00 45.33  ? 56  THR F CB  1 
ATOM   6609 O OG1 . THR D 2 56  ? 28.070  4.069   40.667  1.00 45.33  ? 56  THR F OG1 1 
ATOM   6610 C CG2 . THR D 2 56  ? 25.718  4.473   40.969  1.00 45.33  ? 56  THR F CG2 1 
ATOM   6611 N N   . LYS D 2 57  ? 25.094  2.315   43.795  1.00 47.73  ? 57  LYS F N   1 
ATOM   6612 C CA  . LYS D 2 57  ? 24.161  1.300   44.236  1.00 47.73  ? 57  LYS F CA  1 
ATOM   6613 C C   . LYS D 2 57  ? 22.754  1.861   44.251  1.00 47.73  ? 57  LYS F C   1 
ATOM   6614 O O   . LYS D 2 57  ? 22.566  3.077   44.219  1.00 47.73  ? 57  LYS F O   1 
ATOM   6615 C CB  . LYS D 2 57  ? 24.517  0.777   45.629  1.00 68.17  ? 57  LYS F CB  1 
ATOM   6616 C CG  . LYS D 2 57  ? 24.399  1.791   46.744  1.00 68.17  ? 57  LYS F CG  1 
ATOM   6617 C CD  . LYS D 2 57  ? 24.249  1.084   48.078  1.00 68.17  ? 57  LYS F CD  1 
ATOM   6618 C CE  . LYS D 2 57  ? 24.883  1.879   49.196  1.00 68.17  ? 57  LYS F CE  1 
ATOM   6619 N NZ  . LYS D 2 57  ? 26.355  1.982   48.994  1.00 68.17  ? 57  LYS F NZ  1 
ATOM   6620 N N   . CYS D 2 58  ? 21.766  0.975   44.306  1.00 47.02  ? 58  CYS F N   1 
ATOM   6621 C CA  . CYS D 2 58  ? 20.369  1.402   44.337  1.00 47.02  ? 58  CYS F CA  1 
ATOM   6622 C C   . CYS D 2 58  ? 20.123  2.284   45.544  1.00 47.02  ? 58  CYS F C   1 
ATOM   6623 O O   . CYS D 2 58  ? 20.616  2.006   46.632  1.00 47.02  ? 58  CYS F O   1 
ATOM   6624 C CB  . CYS D 2 58  ? 19.446  0.195   44.386  1.00 75.28  ? 58  CYS F CB  1 
ATOM   6625 S SG  . CYS D 2 58  ? 19.537  -0.874  42.922  1.00 75.28  ? 58  CYS F SG  1 
ATOM   6626 N N   . ARG D 2 59  ? 19.358  3.347   45.342  1.00 39.03  ? 59  ARG F N   1 
ATOM   6627 C CA  . ARG D 2 59  ? 19.049  4.287   46.404  1.00 39.03  ? 59  ARG F CA  1 
ATOM   6628 C C   . ARG D 2 59  ? 18.146  3.720   47.498  1.00 39.03  ? 59  ARG F C   1 
ATOM   6629 O O   . ARG D 2 59  ? 17.706  4.448   48.383  1.00 39.03  ? 59  ARG F O   1 
ATOM   6630 C CB  . ARG D 2 59  ? 18.437  5.564   45.808  1.00 146.15 ? 59  ARG F CB  1 
ATOM   6631 C CG  . ARG D 2 59  ? 17.986  6.599   46.838  1.00 146.15 ? 59  ARG F CG  1 
ATOM   6632 C CD  . ARG D 2 59  ? 18.069  8.030   46.319  1.00 146.15 ? 59  ARG F CD  1 
ATOM   6633 N NE  . ARG D 2 59  ? 19.446  8.523   46.295  1.00 146.15 ? 59  ARG F NE  1 
ATOM   6634 C CZ  . ARG D 2 59  ? 19.788  9.784   46.040  1.00 146.15 ? 59  ARG F CZ  1 
ATOM   6635 N NH1 . ARG D 2 59  ? 18.853  10.690  45.785  1.00 146.15 ? 59  ARG F NH1 1 
ATOM   6636 N NH2 . ARG D 2 59  ? 21.067  10.141  46.045  1.00 146.15 ? 59  ARG F NH2 1 
ATOM   6637 N N   . ASP D 2 60  ? 17.867  2.426   47.445  1.00 102.37 ? 60  ASP F N   1 
ATOM   6638 C CA  . ASP D 2 60  ? 17.019  1.796   48.450  1.00 102.37 ? 60  ASP F CA  1 
ATOM   6639 C C   . ASP D 2 60  ? 15.906  2.737   48.914  1.00 102.37 ? 60  ASP F C   1 
ATOM   6640 O O   . ASP D 2 60  ? 14.746  2.590   48.521  1.00 102.37 ? 60  ASP F O   1 
ATOM   6641 C CB  . ASP D 2 60  ? 17.873  1.360   49.649  1.00 165.31 ? 60  ASP F CB  1 
ATOM   6642 C CG  . ASP D 2 60  ? 17.470  2.047   50.941  1.00 165.31 ? 60  ASP F CG  1 
ATOM   6643 O OD1 . ASP D 2 60  ? 16.386  1.724   51.473  1.00 165.31 ? 60  ASP F OD1 1 
ATOM   6644 O OD2 . ASP D 2 60  ? 18.235  2.915   51.417  1.00 165.31 ? 60  ASP F OD2 1 
ATOM   6645 N N   . GLY D 2 67  ? 9.016   -2.133  42.917  1.00 86.44  ? 67  GLY F N   1 
ATOM   6646 C CA  . GLY D 2 67  ? 8.968   -2.044  41.421  1.00 86.44  ? 67  GLY F CA  1 
ATOM   6647 C C   . GLY D 2 67  ? 9.654   -0.816  40.828  1.00 86.44  ? 67  GLY F C   1 
ATOM   6648 O O   . GLY D 2 67  ? 9.749   0.224   41.472  1.00 86.44  ? 67  GLY F O   1 
ATOM   6649 N N   . CYS D 2 68  ? 10.124  -0.934  39.587  1.00 24.17  ? 68  CYS F N   1 
ATOM   6650 C CA  . CYS D 2 68  ? 10.795  0.175   38.922  1.00 24.17  ? 68  CYS F CA  1 
ATOM   6651 C C   . CYS D 2 68  ? 9.832   1.155   38.255  1.00 24.17  ? 68  CYS F C   1 
ATOM   6652 O O   . CYS D 2 68  ? 8.700   0.806   37.925  1.00 24.17  ? 68  CYS F O   1 
ATOM   6653 C CB  . CYS D 2 68  ? 11.767  -0.307  37.859  1.00 73.95  ? 68  CYS F CB  1 
ATOM   6654 S SG  . CYS D 2 68  ? 12.436  -1.965  38.117  1.00 73.95  ? 68  CYS F SG  1 
ATOM   6655 N N   . ARG D 2 69  ? 10.320  2.373   38.033  1.00 51.69  ? 69  ARG F N   1 
ATOM   6656 C CA  . ARG D 2 69  ? 9.551   3.461   37.426  1.00 51.69  ? 69  ARG F CA  1 
ATOM   6657 C C   . ARG D 2 69  ? 9.249   3.271   35.952  1.00 51.69  ? 69  ARG F C   1 
ATOM   6658 O O   . ARG D 2 69  ? 10.107  2.830   35.189  1.00 51.69  ? 69  ARG F O   1 
ATOM   6659 C CB  . ARG D 2 69  ? 10.269  4.804   37.620  1.00 43.02  ? 69  ARG F CB  1 
ATOM   6660 C CG  . ARG D 2 69  ? 9.402   6.003   37.273  1.00 43.02  ? 69  ARG F CG  1 
ATOM   6661 C CD  . ARG D 2 69  ? 10.128  7.338   37.411  1.00 43.02  ? 69  ARG F CD  1 
ATOM   6662 N NE  . ARG D 2 69  ? 10.505  7.655   38.787  1.00 43.02  ? 69  ARG F NE  1 
ATOM   6663 C CZ  . ARG D 2 69  ? 11.655  7.312   39.352  1.00 43.02  ? 69  ARG F CZ  1 
ATOM   6664 N NH1 . ARG D 2 69  ? 12.551  6.637   38.661  1.00 43.02  ? 69  ARG F NH1 1 
ATOM   6665 N NH2 . ARG D 2 69  ? 11.910  7.649   40.607  1.00 43.02  ? 69  ARG F NH2 1 
ATOM   6666 N N   . GLY D 2 70  ? 8.027   3.620   35.556  1.00 42.86  ? 70  GLY F N   1 
ATOM   6667 C CA  . GLY D 2 70  ? 7.628   3.505   34.163  1.00 42.86  ? 70  GLY F CA  1 
ATOM   6668 C C   . GLY D 2 70  ? 7.264   2.122   33.650  1.00 42.86  ? 70  GLY F C   1 
ATOM   6669 O O   . GLY D 2 70  ? 6.877   1.992   32.479  1.00 42.86  ? 70  GLY F O   1 
ATOM   6670 N N   . ILE D 2 71  ? 7.374   1.098   34.499  1.00 52.45  ? 71  ILE F N   1 
ATOM   6671 C CA  . ILE D 2 71  ? 7.060   -0.290  34.100  1.00 52.45  ? 71  ILE F CA  1 
ATOM   6672 C C   . ILE D 2 71  ? 5.563   -0.509  33.905  1.00 52.45  ? 71  ILE F C   1 
ATOM   6673 O O   . ILE D 2 71  ? 4.740   0.130   34.567  1.00 52.45  ? 71  ILE F O   1 
ATOM   6674 C CB  . ILE D 2 71  ? 7.618   -1.300  35.130  1.00 15.32  ? 71  ILE F CB  1 
ATOM   6675 C CG1 . ILE D 2 71  ? 9.115   -1.505  34.894  1.00 15.32  ? 71  ILE F CG1 1 
ATOM   6676 C CG2 . ILE D 2 71  ? 6.911   -2.636  35.011  1.00 15.32  ? 71  ILE F CG2 1 
ATOM   6677 C CD1 . ILE D 2 71  ? 9.941   -0.251  35.006  1.00 47.98  ? 71  ILE F CD1 1 
ATOM   6678 N N   . ASP D 2 72  ? 5.210   -1.408  32.992  1.00 30.01  ? 72  ASP F N   1 
ATOM   6679 C CA  . ASP D 2 72  ? 3.803   -1.724  32.775  1.00 30.01  ? 72  ASP F CA  1 
ATOM   6680 C C   . ASP D 2 72  ? 3.462   -2.705  33.884  1.00 30.01  ? 72  ASP F C   1 
ATOM   6681 O O   . ASP D 2 72  ? 3.653   -3.900  33.723  1.00 30.01  ? 72  ASP F O   1 
ATOM   6682 C CB  . ASP D 2 72  ? 3.569   -2.369  31.418  1.00 76.94  ? 72  ASP F CB  1 
ATOM   6683 C CG  . ASP D 2 72  ? 2.094   -2.494  31.103  1.00 76.94  ? 72  ASP F CG  1 
ATOM   6684 O OD1 . ASP D 2 72  ? 1.343   -2.922  32.016  1.00 76.94  ? 72  ASP F OD1 1 
ATOM   6685 O OD2 . ASP D 2 72  ? 1.695   -2.160  29.959  1.00 76.94  ? 72  ASP F OD2 1 
ATOM   6686 N N   . SER D 2 73  ? 2.965   -2.199  35.006  1.00 83.24  ? 73  SER F N   1 
ATOM   6687 C CA  . SER D 2 73  ? 2.658   -3.061  36.131  1.00 83.24  ? 73  SER F CA  1 
ATOM   6688 C C   . SER D 2 73  ? 1.448   -3.954  35.930  1.00 83.24  ? 73  SER F C   1 
ATOM   6689 O O   . SER D 2 73  ? 1.172   -4.838  36.747  1.00 83.24  ? 73  SER F O   1 
ATOM   6690 C CB  . SER D 2 73  ? 2.455   -2.223  37.395  1.00 148.46 ? 73  SER F CB  1 
ATOM   6691 O OG  . SER D 2 73  ? 2.188   -3.055  38.512  1.00 148.46 ? 73  SER F OG  1 
ATOM   6692 N N   . LYS D 2 74  ? 0.711   -3.732  34.850  1.00 65.19  ? 74  LYS F N   1 
ATOM   6693 C CA  . LYS D 2 74  ? -0.418  -4.593  34.583  1.00 65.19  ? 74  LYS F CA  1 
ATOM   6694 C C   . LYS D 2 74  ? 0.186   -5.969  34.260  1.00 65.19  ? 74  LYS F C   1 
ATOM   6695 O O   . LYS D 2 74  ? -0.207  -6.979  34.841  1.00 65.19  ? 74  LYS F O   1 
ATOM   6696 C CB  . LYS D 2 74  ? -1.209  -4.075  33.380  1.00 149.80 ? 74  LYS F CB  1 
ATOM   6697 C CG  . LYS D 2 74  ? -2.450  -4.888  33.061  1.00 149.80 ? 74  LYS F CG  1 
ATOM   6698 C CD  . LYS D 2 74  ? -3.263  -4.233  31.956  1.00 149.80 ? 74  LYS F CD  1 
ATOM   6699 C CE  . LYS D 2 74  ? -4.536  -5.014  31.673  1.00 149.80 ? 74  LYS F CE  1 
ATOM   6700 N NZ  . LYS D 2 74  ? -5.385  -4.339  30.652  1.00 149.80 ? 74  LYS F NZ  1 
ATOM   6701 N N   . HIS D 2 75  ? 1.175   -5.983  33.367  1.00 117.70 ? 75  HIS F N   1 
ATOM   6702 C CA  . HIS D 2 75  ? 1.840   -7.212  32.930  1.00 117.70 ? 75  HIS F CA  1 
ATOM   6703 C C   . HIS D 2 75  ? 3.181   -7.613  33.573  1.00 117.70 ? 75  HIS F C   1 
ATOM   6704 O O   . HIS D 2 75  ? 3.672   -8.718  33.305  1.00 117.70 ? 75  HIS F O   1 
ATOM   6705 C CB  . HIS D 2 75  ? 2.089   -7.156  31.421  1.00 85.24  ? 75  HIS F CB  1 
ATOM   6706 C CG  . HIS D 2 75  ? 0.845   -7.056  30.594  1.00 85.24  ? 75  HIS F CG  1 
ATOM   6707 N ND1 . HIS D 2 75  ? 0.873   -7.051  29.215  1.00 85.24  ? 75  HIS F ND1 1 
ATOM   6708 C CD2 . HIS D 2 75  ? -0.461  -6.962  30.945  1.00 85.24  ? 75  HIS F CD2 1 
ATOM   6709 C CE1 . HIS D 2 75  ? -0.362  -6.957  28.753  1.00 85.24  ? 75  HIS F CE1 1 
ATOM   6710 N NE2 . HIS D 2 75  ? -1.190  -6.902  29.781  1.00 85.24  ? 75  HIS F NE2 1 
ATOM   6711 N N   . TRP D 2 76  ? 3.785   -6.762  34.401  1.00 37.50  ? 76  TRP F N   1 
ATOM   6712 C CA  . TRP D 2 76  ? 5.089   -7.124  34.964  1.00 37.50  ? 76  TRP F CA  1 
ATOM   6713 C C   . TRP D 2 76  ? 5.403   -6.819  36.415  1.00 37.50  ? 76  TRP F C   1 
ATOM   6714 O O   . TRP D 2 76  ? 5.135   -5.734  36.923  1.00 37.50  ? 76  TRP F O   1 
ATOM   6715 C CB  . TRP D 2 76  ? 6.229   -6.516  34.134  1.00 33.34  ? 76  TRP F CB  1 
ATOM   6716 C CG  . TRP D 2 76  ? 6.211   -6.781  32.647  1.00 33.34  ? 76  TRP F CG  1 
ATOM   6717 C CD1 . TRP D 2 76  ? 5.571   -6.043  31.692  1.00 33.34  ? 76  TRP F CD1 1 
ATOM   6718 C CD2 . TRP D 2 76  ? 6.917   -7.820  31.940  1.00 33.34  ? 76  TRP F CD2 1 
ATOM   6719 N NE1 . TRP D 2 76  ? 5.839   -6.550  30.431  1.00 33.34  ? 76  TRP F NE1 1 
ATOM   6720 C CE2 . TRP D 2 76  ? 6.661   -7.640  30.556  1.00 33.34  ? 76  TRP F CE2 1 
ATOM   6721 C CE3 . TRP D 2 76  ? 7.744   -8.887  32.340  1.00 33.34  ? 76  TRP F CE3 1 
ATOM   6722 C CZ2 . TRP D 2 76  ? 7.201   -8.488  29.571  1.00 33.34  ? 76  TRP F CZ2 1 
ATOM   6723 C CZ3 . TRP D 2 76  ? 8.282   -9.734  31.352  1.00 33.34  ? 76  TRP F CZ3 1 
ATOM   6724 C CH2 . TRP D 2 76  ? 8.005   -9.525  29.988  1.00 33.34  ? 76  TRP F CH2 1 
ATOM   6725 N N   . ASN D 2 77  ? 6.004   -7.796  37.069  1.00 40.98  ? 77  ASN F N   1 
ATOM   6726 C CA  . ASN D 2 77  ? 6.459   -7.617  38.431  1.00 40.98  ? 77  ASN F CA  1 
ATOM   6727 C C   . ASN D 2 77  ? 7.825   -7.025  38.104  1.00 40.98  ? 77  ASN F C   1 
ATOM   6728 O O   . ASN D 2 77  ? 8.349   -7.225  36.997  1.00 40.98  ? 77  ASN F O   1 
ATOM   6729 C CB  . ASN D 2 77  ? 6.578   -8.960  39.147  1.00 98.55  ? 77  ASN F CB  1 
ATOM   6730 C CG  . ASN D 2 77  ? 5.231   -9.535  39.497  1.00 98.55  ? 77  ASN F CG  1 
ATOM   6731 O OD1 . ASN D 2 77  ? 4.443   -9.861  38.619  1.00 98.55  ? 77  ASN F OD1 1 
ATOM   6732 N ND2 . ASN D 2 77  ? 4.952   -9.646  40.786  1.00 98.55  ? 77  ASN F ND2 1 
ATOM   6733 N N   . SER D 2 78  ? 8.396   -6.274  39.032  1.00 55.86  ? 78  SER F N   1 
ATOM   6734 C CA  . SER D 2 78  ? 9.712   -5.718  38.784  1.00 55.86  ? 78  SER F CA  1 
ATOM   6735 C C   . SER D 2 78  ? 10.271  -5.103  40.044  1.00 55.86  ? 78  SER F C   1 
ATOM   6736 O O   . SER D 2 78  ? 9.540   -4.845  41.010  1.00 55.86  ? 78  SER F O   1 
ATOM   6737 C CB  . SER D 2 78  ? 9.604   -4.663  37.714  1.00 11.71  ? 78  SER F CB  1 
ATOM   6738 O OG  . SER D 2 78  ? 8.603   -3.759  38.101  1.00 11.71  ? 78  SER F OG  1 
ATOM   6739 N N   . TYR D 2 79  ? 11.582  -4.913  40.050  1.00 19.13  ? 79  TYR F N   1 
ATOM   6740 C CA  . TYR D 2 79  ? 12.254  -4.309  41.191  1.00 19.13  ? 79  TYR F CA  1 
ATOM   6741 C C   . TYR D 2 79  ? 13.618  -3.816  40.740  1.00 19.13  ? 79  TYR F C   1 
ATOM   6742 O O   . TYR D 2 79  ? 14.119  -4.214  39.687  1.00 19.13  ? 79  TYR F O   1 
ATOM   6743 C CB  . TYR D 2 79  ? 12.430  -5.327  42.322  1.00 57.69  ? 79  TYR F CB  1 
ATOM   6744 C CG  . TYR D 2 79  ? 13.299  -6.514  41.958  1.00 57.69  ? 79  TYR F CG  1 
ATOM   6745 C CD1 . TYR D 2 79  ? 12.831  -7.512  41.106  1.00 57.69  ? 79  TYR F CD1 1 
ATOM   6746 C CD2 . TYR D 2 79  ? 14.598  -6.626  42.450  1.00 57.69  ? 79  TYR F CD2 1 
ATOM   6747 C CE1 . TYR D 2 79  ? 13.633  -8.590  40.752  1.00 57.69  ? 79  TYR F CE1 1 
ATOM   6748 C CE2 . TYR D 2 79  ? 15.407  -7.698  42.100  1.00 57.69  ? 79  TYR F CE2 1 
ATOM   6749 C CZ  . TYR D 2 79  ? 14.921  -8.676  41.251  1.00 57.69  ? 79  TYR F CZ  1 
ATOM   6750 O OH  . TYR D 2 79  ? 15.725  -9.735  40.894  1.00 57.69  ? 79  TYR F OH  1 
ATOM   6751 N N   . CYS D 2 80  ? 14.213  -2.943  41.535  1.00 34.07  ? 80  CYS F N   1 
ATOM   6752 C CA  . CYS D 2 80  ? 15.508  -2.397  41.188  1.00 34.07  ? 80  CYS F CA  1 
ATOM   6753 C C   . CYS D 2 80  ? 16.585  -3.115  41.939  1.00 34.07  ? 80  CYS F C   1 
ATOM   6754 O O   . CYS D 2 80  ? 16.404  -3.480  43.096  1.00 34.07  ? 80  CYS F O   1 
ATOM   6755 C CB  . CYS D 2 80  ? 15.544  -0.905  41.510  1.00 42.01  ? 80  CYS F CB  1 
ATOM   6756 S SG  . CYS D 2 80  ? 14.451  0.106   40.466  1.00 42.01  ? 80  CYS F SG  1 
ATOM   6757 N N   . THR D 2 81  ? 17.721  -3.316  41.294  1.00 17.06  ? 81  THR F N   1 
ATOM   6758 C CA  . THR D 2 81  ? 18.786  -4.006  41.976  1.00 17.06  ? 81  THR F CA  1 
ATOM   6759 C C   . THR D 2 81  ? 20.166  -3.530  41.577  1.00 17.06  ? 81  THR F C   1 
ATOM   6760 O O   . THR D 2 81  ? 20.388  -3.077  40.459  1.00 17.06  ? 81  THR F O   1 
ATOM   6761 C CB  . THR D 2 81  ? 18.709  -5.519  41.745  1.00 51.04  ? 81  THR F CB  1 
ATOM   6762 O OG1 . THR D 2 81  ? 19.622  -6.180  42.630  1.00 51.04  ? 81  THR F OG1 1 
ATOM   6763 C CG2 . THR D 2 81  ? 19.076  -5.856  40.310  1.00 51.04  ? 81  THR F CG2 1 
ATOM   6764 N N   . THR D 2 82  ? 21.086  -3.635  42.524  1.00 28.67  ? 82  THR F N   1 
ATOM   6765 C CA  . THR D 2 82  ? 22.467  -3.217  42.337  1.00 28.67  ? 82  THR F CA  1 
ATOM   6766 C C   . THR D 2 82  ? 23.312  -4.223  41.552  1.00 28.67  ? 82  THR F C   1 
ATOM   6767 O O   . THR D 2 82  ? 23.426  -5.387  41.955  1.00 28.67  ? 82  THR F O   1 
ATOM   6768 C CB  . THR D 2 82  ? 23.136  -2.971  43.683  1.00 26.42  ? 82  THR F CB  1 
ATOM   6769 O OG1 . THR D 2 82  ? 22.250  -2.218  44.519  1.00 26.42  ? 82  THR F OG1 1 
ATOM   6770 C CG2 . THR D 2 82  ? 24.420  -2.193  43.493  1.00 26.42  ? 82  THR F CG2 1 
ATOM   6771 N N   . THR D 2 83  ? 23.895  -3.778  40.439  1.00 30.93  ? 83  THR F N   1 
ATOM   6772 C CA  . THR D 2 83  ? 24.762  -4.643  39.645  1.00 30.93  ? 83  THR F CA  1 
ATOM   6773 C C   . THR D 2 83  ? 26.216  -4.212  39.842  1.00 30.93  ? 83  THR F C   1 
ATOM   6774 O O   . THR D 2 83  ? 26.483  -3.091  40.278  1.00 30.93  ? 83  THR F O   1 
ATOM   6775 C CB  . THR D 2 83  ? 24.433  -4.554  38.151  1.00 47.66  ? 83  THR F CB  1 
ATOM   6776 O OG1 . THR D 2 83  ? 24.639  -3.211  37.692  1.00 47.66  ? 83  THR F OG1 1 
ATOM   6777 C CG2 . THR D 2 83  ? 22.982  -4.960  37.907  1.00 47.66  ? 83  THR F CG2 1 
ATOM   6778 N N   . HIS D 2 84  ? 27.151  -5.106  39.521  1.00 29.86  ? 84  HIS F N   1 
ATOM   6779 C CA  . HIS D 2 84  ? 28.565  -4.837  39.734  1.00 29.86  ? 84  HIS F CA  1 
ATOM   6780 C C   . HIS D 2 84  ? 29.484  -4.730  38.542  1.00 29.86  ? 84  HIS F C   1 
ATOM   6781 O O   . HIS D 2 84  ? 29.089  -4.912  37.395  1.00 29.86  ? 84  HIS F O   1 
ATOM   6782 C CB  . HIS D 2 84  ? 29.106  -5.876  40.717  1.00 57.14  ? 84  HIS F CB  1 
ATOM   6783 C CG  . HIS D 2 84  ? 28.118  -6.267  41.775  1.00 57.14  ? 84  HIS F CG  1 
ATOM   6784 N ND1 . HIS D 2 84  ? 27.029  -7.069  41.514  1.00 57.14  ? 84  HIS F ND1 1 
ATOM   6785 C CD2 . HIS D 2 84  ? 28.035  -5.938  43.086  1.00 57.14  ? 84  HIS F CD2 1 
ATOM   6786 C CE1 . HIS D 2 84  ? 26.318  -7.219  42.617  1.00 57.14  ? 84  HIS F CE1 1 
ATOM   6787 N NE2 . HIS D 2 84  ? 26.907  -6.542  43.586  1.00 57.14  ? 84  HIS F NE2 1 
ATOM   6788 N N   . THR D 2 85  ? 30.733  -4.414  38.850  1.00 10.84  ? 85  THR F N   1 
ATOM   6789 C CA  . THR D 2 85  ? 31.795  -4.296  37.863  1.00 10.84  ? 85  THR F CA  1 
ATOM   6790 C C   . THR D 2 85  ? 32.972  -4.937  38.568  1.00 10.84  ? 85  THR F C   1 
ATOM   6791 O O   . THR D 2 85  ? 32.931  -5.119  39.781  1.00 10.84  ? 85  THR F O   1 
ATOM   6792 C CB  . THR D 2 85  ? 32.129  -2.846  37.506  1.00 22.96  ? 85  THR F CB  1 
ATOM   6793 O OG1 . THR D 2 85  ? 32.940  -2.833  36.326  1.00 22.96  ? 85  THR F OG1 1 
ATOM   6794 C CG2 . THR D 2 85  ? 32.880  -2.171  38.642  1.00 22.96  ? 85  THR F CG2 1 
ATOM   6795 N N   . PHE D 2 86  ? 34.002  -5.294  37.810  1.00 44.35  ? 86  PHE F N   1 
ATOM   6796 C CA  . PHE D 2 86  ? 35.201  -5.893  38.380  1.00 44.35  ? 86  PHE F CA  1 
ATOM   6797 C C   . PHE D 2 86  ? 36.314  -4.888  38.245  1.00 44.35  ? 86  PHE F C   1 
ATOM   6798 O O   . PHE D 2 86  ? 36.548  -4.361  37.157  1.00 44.35  ? 86  PHE F O   1 
ATOM   6799 C CB  . PHE D 2 86  ? 35.519  -7.217  37.694  1.00 40.57  ? 86  PHE F CB  1 
ATOM   6800 C CG  . PHE D 2 86  ? 34.689  -8.359  38.208  1.00 40.57  ? 86  PHE F CG  1 
ATOM   6801 C CD1 . PHE D 2 86  ? 34.809  -8.770  39.531  1.00 40.57  ? 86  PHE F CD1 1 
ATOM   6802 C CD2 . PHE D 2 86  ? 33.758  -8.994  37.396  1.00 40.57  ? 86  PHE F CD2 1 
ATOM   6803 C CE1 . PHE D 2 86  ? 34.016  -9.795  40.040  1.00 40.57  ? 86  PHE F CE1 1 
ATOM   6804 C CE2 . PHE D 2 86  ? 32.958  -10.021 37.897  1.00 40.57  ? 86  PHE F CE2 1 
ATOM   6805 C CZ  . PHE D 2 86  ? 33.088  -10.420 39.222  1.00 40.57  ? 86  PHE F CZ  1 
ATOM   6806 N N   . VAL D 2 87  ? 36.994  -4.602  39.349  1.00 64.09  ? 87  VAL F N   1 
ATOM   6807 C CA  . VAL D 2 87  ? 38.082  -3.631  39.305  1.00 64.09  ? 87  VAL F CA  1 
ATOM   6808 C C   . VAL D 2 87  ? 39.322  -4.149  40.033  1.00 64.09  ? 87  VAL F C   1 
ATOM   6809 O O   . VAL D 2 87  ? 39.214  -4.802  41.086  1.00 64.09  ? 87  VAL F O   1 
ATOM   6810 C CB  . VAL D 2 87  ? 37.662  -2.277  39.918  1.00 61.68  ? 87  VAL F CB  1 
ATOM   6811 C CG1 . VAL D 2 87  ? 38.858  -1.334  39.975  1.00 61.68  ? 87  VAL F CG1 1 
ATOM   6812 C CG2 . VAL D 2 87  ? 36.556  -1.656  39.081  1.00 61.68  ? 87  VAL F CG2 1 
ATOM   6813 N N   . LYS D 2 88  ? 40.495  -3.868  39.462  1.00 76.71  ? 88  LYS F N   1 
ATOM   6814 C CA  . LYS D 2 88  ? 41.750  -4.310  40.058  1.00 76.71  ? 88  LYS F CA  1 
ATOM   6815 C C   . LYS D 2 88  ? 41.977  -3.664  41.421  1.00 76.71  ? 88  LYS F C   1 
ATOM   6816 O O   . LYS D 2 88  ? 41.695  -2.490  41.611  1.00 76.71  ? 88  LYS F O   1 
ATOM   6817 C CB  . LYS D 2 88  ? 42.917  -3.991  39.123  1.00 161.06 ? 88  LYS F CB  1 
ATOM   6818 C CG  . LYS D 2 88  ? 43.923  -5.125  39.008  1.00 161.06 ? 88  LYS F CG  1 
ATOM   6819 C CD  . LYS D 2 88  ? 43.229  -6.420  38.604  1.00 161.06 ? 88  LYS F CD  1 
ATOM   6820 C CE  . LYS D 2 88  ? 44.209  -7.567  38.407  1.00 161.06 ? 88  LYS F CE  1 
ATOM   6821 N NZ  . LYS D 2 88  ? 45.159  -7.328  37.283  1.00 161.06 ? 88  LYS F NZ  1 
ATOM   6822 N N   . ALA D 2 89  ? 42.474  -4.443  42.377  1.00 90.11  ? 89  ALA F N   1 
ATOM   6823 C CA  . ALA D 2 89  ? 42.728  -3.934  43.719  1.00 90.11  ? 89  ALA F CA  1 
ATOM   6824 C C   . ALA D 2 89  ? 43.790  -4.763  44.429  1.00 90.11  ? 89  ALA F C   1 
ATOM   6825 O O   . ALA D 2 89  ? 43.942  -5.957  44.189  1.00 90.11  ? 89  ALA F O   1 
ATOM   6826 C CB  . ALA D 2 89  ? 41.433  -3.939  44.521  1.00 52.94  ? 89  ALA F CB  1 
ATOM   6827 N N   . LEU D 2 90  ? 44.539  -4.101  45.300  1.00 62.60  ? 90  LEU F N   1 
ATOM   6828 C CA  . LEU D 2 90  ? 45.562  -4.752  46.083  1.00 62.60  ? 90  LEU F CA  1 
ATOM   6829 C C   . LEU D 2 90  ? 44.826  -5.437  47.209  1.00 62.60  ? 90  LEU F C   1 
ATOM   6830 O O   . LEU D 2 90  ? 44.222  -4.802  48.085  1.00 62.60  ? 90  LEU F O   1 
ATOM   6831 C CB  . LEU D 2 90  ? 46.546  -3.714  46.628  1.00 77.66  ? 90  LEU F CB  1 
ATOM   6832 C CG  . LEU D 2 90  ? 47.916  -4.221  47.083  1.00 77.66  ? 90  LEU F CG  1 
ATOM   6833 C CD1 . LEU D 2 90  ? 48.629  -4.874  45.914  1.00 77.66  ? 90  LEU F CD1 1 
ATOM   6834 C CD2 . LEU D 2 90  ? 48.741  -3.065  47.617  1.00 77.66  ? 90  LEU F CD2 1 
ATOM   6835 N N   . THR D 2 91  ? 44.903  -6.754  47.179  1.00 59.56  ? 91  THR F N   1 
ATOM   6836 C CA  . THR D 2 91  ? 44.217  -7.606  48.128  1.00 59.56  ? 91  THR F CA  1 
ATOM   6837 C C   . THR D 2 91  ? 45.148  -8.558  48.890  1.00 59.56  ? 91  THR F C   1 
ATOM   6838 O O   . THR D 2 91  ? 46.373  -8.523  48.742  1.00 59.56  ? 91  THR F O   1 
ATOM   6839 C CB  . THR D 2 91  ? 43.149  -8.459  47.418  1.00 138.17 ? 91  THR F CB  1 
ATOM   6840 O OG1 . THR D 2 91  ? 43.779  -9.290  46.436  1.00 138.17 ? 91  THR F OG1 1 
ATOM   6841 C CG2 . THR D 2 91  ? 42.120  -7.567  46.738  1.00 138.17 ? 91  THR F CG2 1 
ATOM   6842 N N   . MET D 2 92  ? 44.550  -9.423  49.702  1.00 160.77 ? 92  MET F N   1 
ATOM   6843 C CA  . MET D 2 92  ? 45.326  -10.369 50.481  1.00 160.77 ? 92  MET F CA  1 
ATOM   6844 C C   . MET D 2 92  ? 44.711  -11.754 50.586  1.00 160.77 ? 92  MET F C   1 
ATOM   6845 O O   . MET D 2 92  ? 43.546  -11.929 50.951  1.00 160.77 ? 92  MET F O   1 
ATOM   6846 C CB  . MET D 2 92  ? 45.595  -9.816  51.884  1.00 63.28  ? 92  MET F CB  1 
ATOM   6847 C CG  . MET D 2 92  ? 46.857  -8.974  51.979  1.00 63.28  ? 92  MET F CG  1 
ATOM   6848 S SD  . MET D 2 92  ? 48.357  -9.950  51.769  1.00 63.28  ? 92  MET F SD  1 
ATOM   6849 C CE  . MET D 2 92  ? 49.103  -9.785  53.369  1.00 63.28  ? 92  MET F CE  1 
ATOM   6850 N N   . ASP D 2 93  ? 45.526  -12.740 50.244  1.00 142.23 ? 93  ASP F N   1 
ATOM   6851 C CA  . ASP D 2 93  ? 45.166  -14.148 50.314  1.00 142.23 ? 93  ASP F CA  1 
ATOM   6852 C C   . ASP D 2 93  ? 46.414  -14.777 50.941  1.00 142.23 ? 93  ASP F C   1 
ATOM   6853 O O   . ASP D 2 93  ? 47.368  -15.139 50.245  1.00 142.23 ? 93  ASP F O   1 
ATOM   6854 C CB  . ASP D 2 93  ? 44.936  -14.685 48.897  1.00 133.22 ? 93  ASP F CB  1 
ATOM   6855 C CG  . ASP D 2 93  ? 45.417  -16.113 48.720  1.00 133.22 ? 93  ASP F CG  1 
ATOM   6856 O OD1 . ASP D 2 93  ? 44.743  -17.042 49.208  1.00 133.22 ? 93  ASP F OD1 1 
ATOM   6857 O OD2 . ASP D 2 93  ? 46.480  -16.300 48.091  1.00 133.22 ? 93  ASP F OD2 1 
ATOM   6858 N N   . GLY D 2 94  ? 46.410  -14.871 52.268  1.00 149.40 ? 94  GLY F N   1 
ATOM   6859 C CA  . GLY D 2 94  ? 47.559  -15.409 52.973  1.00 149.40 ? 94  GLY F CA  1 
ATOM   6860 C C   . GLY D 2 94  ? 48.628  -14.333 53.043  1.00 149.40 ? 94  GLY F C   1 
ATOM   6861 O O   . GLY D 2 94  ? 48.320  -13.155 53.218  1.00 149.40 ? 94  GLY F O   1 
ATOM   6862 N N   . LYS D 2 95  ? 49.887  -14.725 52.904  1.00 150.21 ? 95  LYS F N   1 
ATOM   6863 C CA  . LYS D 2 95  ? 50.982  -13.763 52.940  1.00 150.21 ? 95  LYS F CA  1 
ATOM   6864 C C   . LYS D 2 95  ? 51.158  -13.293 51.507  1.00 150.21 ? 95  LYS F C   1 
ATOM   6865 O O   . LYS D 2 95  ? 52.242  -12.879 51.083  1.00 150.21 ? 95  LYS F O   1 
ATOM   6866 C CB  . LYS D 2 95  ? 52.251  -14.459 53.432  1.00 195.17 ? 95  LYS F CB  1 
ATOM   6867 C CG  . LYS D 2 95  ? 52.059  -15.963 53.663  1.00 195.17 ? 95  LYS F CG  1 
ATOM   6868 C CD  . LYS D 2 95  ? 51.703  -16.691 52.362  1.00 195.17 ? 95  LYS F CD  1 
ATOM   6869 C CE  . LYS D 2 95  ? 50.587  -17.707 52.572  1.00 195.17 ? 95  LYS F CE  1 
ATOM   6870 N NZ  . LYS D 2 95  ? 51.004  -18.833 53.447  1.00 195.17 ? 95  LYS F NZ  1 
ATOM   6871 N N   . GLN D 2 96  ? 50.067  -13.368 50.763  1.00 192.17 ? 96  GLN F N   1 
ATOM   6872 C CA  . GLN D 2 96  ? 50.092  -12.985 49.378  1.00 192.17 ? 96  GLN F CA  1 
ATOM   6873 C C   . GLN D 2 96  ? 49.318  -11.724 49.081  1.00 192.17 ? 96  GLN F C   1 
ATOM   6874 O O   . GLN D 2 96  ? 48.106  -11.756 48.877  1.00 192.17 ? 96  GLN F O   1 
ATOM   6875 C CB  . GLN D 2 96  ? 49.621  -14.141 48.500  1.00 191.45 ? 96  GLN F CB  1 
ATOM   6876 C CG  . GLN D 2 96  ? 50.602  -15.300 48.522  1.00 191.45 ? 96  GLN F CG  1 
ATOM   6877 C CD  . GLN D 2 96  ? 52.036  -14.826 48.726  1.00 191.45 ? 96  GLN F CD  1 
ATOM   6878 O OE1 . GLN D 2 96  ? 52.538  -13.982 47.983  1.00 192.26 ? 96  GLN F OE1 1 
ATOM   6879 N NE2 . GLN D 2 96  ? 52.696  -15.363 49.746  1.00 192.26 ? 96  GLN F NE2 1 
ATOM   6880 N N   . ALA D 2 97  ? 50.026  -10.603 49.094  1.00 85.49  ? 97  ALA F N   1 
ATOM   6881 C CA  . ALA D 2 97  ? 49.413  -9.340  48.742  1.00 85.49  ? 97  ALA F CA  1 
ATOM   6882 C C   . ALA D 2 97  ? 49.435  -9.437  47.213  1.00 85.49  ? 97  ALA F C   1 
ATOM   6883 O O   . ALA D 2 97  ? 50.494  -9.707  46.624  1.00 85.49  ? 97  ALA F O   1 
ATOM   6884 C CB  . ALA D 2 97  ? 50.280  -8.187  49.211  1.00 110.34 ? 97  ALA F CB  1 
ATOM   6885 N N   . ALA D 2 98  ? 48.284  -9.262  46.567  1.00 96.26  ? 98  ALA F N   1 
ATOM   6886 C CA  . ALA D 2 98  ? 48.245  -9.364  45.115  1.00 96.26  ? 98  ALA F CA  1 
ATOM   6887 C C   . ALA D 2 98  ? 47.374  -8.319  44.463  1.00 96.26  ? 98  ALA F C   1 
ATOM   6888 O O   . ALA D 2 98  ? 46.539  -7.694  45.114  1.00 96.26  ? 98  ALA F O   1 
ATOM   6889 C CB  . ALA D 2 98  ? 47.784  -10.755 44.706  1.00 157.89 ? 98  ALA F CB  1 
ATOM   6890 N N   . TRP D 2 99  ? 47.584  -8.154  43.162  1.00 107.88 ? 99  TRP F N   1 
ATOM   6891 C CA  . TRP D 2 99  ? 46.857  -7.204  42.319  1.00 107.88 ? 99  TRP F CA  1 
ATOM   6892 C C   . TRP D 2 99  ? 45.729  -7.993  41.659  1.00 107.88 ? 99  TRP F C   1 
ATOM   6893 O O   . TRP D 2 99  ? 45.884  -8.441  40.521  1.00 107.88 ? 99  TRP F O   1 
ATOM   6894 C CB  . TRP D 2 99  ? 47.801  -6.646  41.253  1.00 168.43 ? 99  TRP F CB  1 
ATOM   6895 C CG  . TRP D 2 99  ? 47.423  -5.298  40.741  1.00 168.43 ? 99  TRP F CG  1 
ATOM   6896 C CD1 . TRP D 2 99  ? 47.430  -4.887  39.440  1.00 168.43 ? 99  TRP F CD1 1 
ATOM   6897 C CD2 . TRP D 2 99  ? 47.021  -4.163  41.519  1.00 168.43 ? 99  TRP F CD2 1 
ATOM   6898 N NE1 . TRP D 2 99  ? 47.057  -3.567  39.357  1.00 168.43 ? 99  TRP F NE1 1 
ATOM   6899 C CE2 . TRP D 2 99  ? 46.800  -3.098  40.618  1.00 168.43 ? 99  TRP F CE2 1 
ATOM   6900 C CE3 . TRP D 2 99  ? 46.827  -3.942  42.889  1.00 168.43 ? 99  TRP F CE3 1 
ATOM   6901 C CZ2 . TRP D 2 99  ? 46.394  -1.829  41.043  1.00 168.43 ? 99  TRP F CZ2 1 
ATOM   6902 C CZ3 . TRP D 2 99  ? 46.423  -2.679  43.312  1.00 168.43 ? 99  TRP F CZ3 1 
ATOM   6903 C CH2 . TRP D 2 99  ? 46.211  -1.639  42.389  1.00 168.43 ? 99  TRP F CH2 1 
ATOM   6904 N N   . ARG D 2 100 ? 44.604  -8.159  42.364  1.00 73.91  ? 100 ARG F N   1 
ATOM   6905 C CA  . ARG D 2 100 ? 43.465  -8.933  41.842  1.00 73.91  ? 100 ARG F CA  1 
ATOM   6906 C C   . ARG D 2 100 ? 42.173  -8.145  41.597  1.00 73.91  ? 100 ARG F C   1 
ATOM   6907 O O   . ARG D 2 100 ? 41.931  -7.126  42.230  1.00 73.91  ? 100 ARG F O   1 
ATOM   6908 C CB  . ARG D 2 100 ? 43.160  -10.097 42.789  1.00 88.15  ? 100 ARG F CB  1 
ATOM   6909 C CG  . ARG D 2 100 ? 44.295  -10.439 43.738  1.00 88.15  ? 100 ARG F CG  1 
ATOM   6910 C CD  . ARG D 2 100 ? 44.684  -11.899 43.640  1.00 88.15  ? 100 ARG F CD  1 
ATOM   6911 N NE  . ARG D 2 100 ? 45.165  -12.235 42.305  1.00 88.15  ? 100 ARG F NE  1 
ATOM   6912 C CZ  . ARG D 2 100 ? 45.655  -13.422 41.965  1.00 88.15  ? 100 ARG F CZ  1 
ATOM   6913 N NH1 . ARG D 2 100 ? 45.731  -14.392 42.864  1.00 88.15  ? 100 ARG F NH1 1 
ATOM   6914 N NH2 . ARG D 2 100 ? 46.067  -13.638 40.725  1.00 88.15  ? 100 ARG F NH2 1 
ATOM   6915 N N   . PHE D 2 101 ? 41.345  -8.642  40.678  1.00 49.33  ? 101 PHE F N   1 
ATOM   6916 C CA  . PHE D 2 101 ? 40.062  -8.015  40.339  1.00 49.33  ? 101 PHE F CA  1 
ATOM   6917 C C   . PHE D 2 101 ? 39.016  -8.362  41.370  1.00 49.33  ? 101 PHE F C   1 
ATOM   6918 O O   . PHE D 2 101 ? 38.823  -9.537  41.681  1.00 49.33  ? 101 PHE F O   1 
ATOM   6919 C CB  . PHE D 2 101 ? 39.588  -8.502  38.972  1.00 42.93  ? 101 PHE F CB  1 
ATOM   6920 C CG  . PHE D 2 101 ? 40.216  -7.782  37.808  1.00 42.93  ? 101 PHE F CG  1 
ATOM   6921 C CD1 . PHE D 2 101 ? 39.881  -6.465  37.526  1.00 42.93  ? 101 PHE F CD1 1 
ATOM   6922 C CD2 . PHE D 2 101 ? 41.115  -8.429  36.980  1.00 42.93  ? 101 PHE F CD2 1 
ATOM   6923 C CE1 . PHE D 2 101 ? 40.427  -5.806  36.439  1.00 42.93  ? 101 PHE F CE1 1 
ATOM   6924 C CE2 . PHE D 2 101 ? 41.667  -7.774  35.890  1.00 42.93  ? 101 PHE F CE2 1 
ATOM   6925 C CZ  . PHE D 2 101 ? 41.319  -6.457  35.620  1.00 42.93  ? 101 PHE F CZ  1 
ATOM   6926 N N   . ILE D 2 102 ? 38.328  -7.360  41.894  1.00 61.48  ? 102 ILE F N   1 
ATOM   6927 C CA  . ILE D 2 102 ? 37.295  -7.638  42.866  1.00 61.48  ? 102 ILE F CA  1 
ATOM   6928 C C   . ILE D 2 102 ? 35.964  -7.136  42.351  1.00 61.48  ? 102 ILE F C   1 
ATOM   6929 O O   . ILE D 2 102 ? 35.896  -6.356  41.392  1.00 61.48  ? 102 ILE F O   1 
ATOM   6930 C CB  . ILE D 2 102 ? 37.621  -6.954  44.203  1.00 41.62  ? 102 ILE F CB  1 
ATOM   6931 C CG1 . ILE D 2 102 ? 37.853  -5.458  43.976  1.00 41.62  ? 102 ILE F CG1 1 
ATOM   6932 C CG2 . ILE D 2 102 ? 38.858  -7.592  44.820  1.00 41.62  ? 102 ILE F CG2 1 
ATOM   6933 C CD1 . ILE D 2 102 ? 38.205  -4.687  45.231  1.00 45.18  ? 102 ILE F CD1 1 
ATOM   6934 N N   . ARG D 2 103 ? 34.911  -7.604  43.007  1.00 49.85  ? 103 ARG F N   1 
ATOM   6935 C CA  . ARG D 2 103 ? 33.538  -7.257  42.669  1.00 49.85  ? 103 ARG F CA  1 
ATOM   6936 C C   . ARG D 2 103 ? 33.099  -6.008  43.448  1.00 49.85  ? 103 ARG F C   1 
ATOM   6937 O O   . ARG D 2 103 ? 33.205  -5.998  44.671  1.00 49.85  ? 103 ARG F O   1 
ATOM   6938 C CB  . ARG D 2 103 ? 32.616  -8.434  43.002  1.00 87.67  ? 103 ARG F CB  1 
ATOM   6939 C CG  . ARG D 2 103 ? 31.260  -8.405  42.319  1.00 87.67  ? 103 ARG F CG  1 
ATOM   6940 C CD  . ARG D 2 103 ? 30.376  -9.506  42.874  1.00 87.67  ? 103 ARG F CD  1 
ATOM   6941 N NE  . ARG D 2 103 ? 30.038  -10.532 41.890  1.00 87.67  ? 103 ARG F NE  1 
ATOM   6942 C CZ  . ARG D 2 103 ? 29.107  -10.401 40.950  1.00 87.67  ? 103 ARG F CZ  1 
ATOM   6943 N NH1 . ARG D 2 103 ? 28.407  -9.286  40.850  1.00 87.67  ? 103 ARG F NH1 1 
ATOM   6944 N NH2 . ARG D 2 103 ? 28.870  -11.394 40.112  1.00 87.67  ? 103 ARG F NH2 1 
ATOM   6945 N N   . ILE D 2 104 ? 32.634  -4.957  42.760  1.00 30.44  ? 104 ILE F N   1 
ATOM   6946 C CA  . ILE D 2 104 ? 32.153  -3.737  43.445  1.00 30.44  ? 104 ILE F CA  1 
ATOM   6947 C C   . ILE D 2 104 ? 30.913  -3.182  42.774  1.00 30.44  ? 104 ILE F C   1 
ATOM   6948 O O   . ILE D 2 104 ? 30.740  -3.326  41.569  1.00 30.44  ? 104 ILE F O   1 
ATOM   6949 C CB  . ILE D 2 104 ? 33.238  -2.642  43.452  1.00 47.06  ? 104 ILE F CB  1 
ATOM   6950 C CG1 . ILE D 2 104 ? 33.742  -2.405  42.027  1.00 47.06  ? 104 ILE F CG1 1 
ATOM   6951 C CG2 . ILE D 2 104 ? 34.384  -3.048  44.369  1.00 47.06  ? 104 ILE F CG2 1 
ATOM   6952 C CD1 . ILE D 2 104 ? 34.774  -1.301  41.911  1.00 73.12  ? 104 ILE F CD1 1 
ATOM   6953 N N   . ASP D 2 105 ? 30.064  -2.530  43.563  1.00 67.90  ? 105 ASP F N   1 
ATOM   6954 C CA  . ASP D 2 105 ? 28.828  -1.935  43.049  1.00 67.90  ? 105 ASP F CA  1 
ATOM   6955 C C   . ASP D 2 105 ? 29.125  -0.916  41.950  1.00 67.90  ? 105 ASP F C   1 
ATOM   6956 O O   . ASP D 2 105 ? 30.010  -0.066  42.118  1.00 67.90  ? 105 ASP F O   1 
ATOM   6957 C CB  . ASP D 2 105 ? 28.061  -1.281  44.196  1.00 72.09  ? 105 ASP F CB  1 
ATOM   6958 C CG  . ASP D 2 105 ? 27.841  -2.231  45.358  1.00 72.09  ? 105 ASP F CG  1 
ATOM   6959 O OD1 . ASP D 2 105 ? 27.314  -3.336  45.128  1.00 72.09  ? 105 ASP F OD1 1 
ATOM   6960 O OD2 . ASP D 2 105 ? 28.192  -1.879  46.501  1.00 72.09  ? 105 ASP F OD2 1 
ATOM   6961 N N   . THR D 2 106 ? 28.387  -0.994  40.838  1.00 30.53  ? 106 THR F N   1 
ATOM   6962 C CA  . THR D 2 106 ? 28.596  -0.078  39.720  1.00 30.53  ? 106 THR F CA  1 
ATOM   6963 C C   . THR D 2 106 ? 27.331  0.537   39.064  1.00 30.53  ? 106 THR F C   1 
ATOM   6964 O O   . THR D 2 106 ? 27.420  1.520   38.311  1.00 30.53  ? 106 THR F O   1 
ATOM   6965 C CB  . THR D 2 106 ? 29.419  -0.735  38.626  1.00 16.16  ? 106 THR F CB  1 
ATOM   6966 O OG1 . THR D 2 106 ? 29.844  0.268   37.698  1.00 16.16  ? 106 THR F OG1 1 
ATOM   6967 C CG2 . THR D 2 106 ? 28.593  -1.763  37.898  1.00 16.16  ? 106 THR F CG2 1 
ATOM   6968 N N   . ALA D 2 107 ? 26.163  -0.036  39.352  1.00 9.25   ? 107 ALA F N   1 
ATOM   6969 C CA  . ALA D 2 107 ? 24.899  0.472   38.812  1.00 9.25   ? 107 ALA F CA  1 
ATOM   6970 C C   . ALA D 2 107 ? 23.700  -0.141  39.531  1.00 9.25   ? 107 ALA F C   1 
ATOM   6971 O O   . ALA D 2 107 ? 23.831  -1.032  40.354  1.00 9.25   ? 107 ALA F O   1 
ATOM   6972 C CB  . ALA D 2 107 ? 24.820  0.167   37.333  1.00 1.00   ? 107 ALA F CB  1 
ATOM   6973 N N   . CYS D 2 108 ? 22.523  0.352   39.191  1.00 18.56  ? 108 CYS F N   1 
ATOM   6974 C CA  . CYS D 2 108 ? 21.269  -0.140  39.753  1.00 18.56  ? 108 CYS F CA  1 
ATOM   6975 C C   . CYS D 2 108 ? 20.384  -0.333  38.527  1.00 18.56  ? 108 CYS F C   1 
ATOM   6976 O O   . CYS D 2 108 ? 20.114  0.632   37.818  1.00 18.56  ? 108 CYS F O   1 
ATOM   6977 C CB  . CYS D 2 108 ? 20.653  0.892   40.705  1.00 46.85  ? 108 CYS F CB  1 
ATOM   6978 S SG  . CYS D 2 108 ? 19.056  0.345   41.376  1.00 46.85  ? 108 CYS F SG  1 
ATOM   6979 N N   . VAL D 2 109 ? 19.984  -1.573  38.248  1.00 11.38  ? 109 VAL F N   1 
ATOM   6980 C CA  . VAL D 2 109 ? 19.141  -1.849  37.090  1.00 11.38  ? 109 VAL F CA  1 
ATOM   6981 C C   . VAL D 2 109 ? 17.795  -2.441  37.491  1.00 11.38  ? 109 VAL F C   1 
ATOM   6982 O O   . VAL D 2 109 ? 17.617  -2.932  38.606  1.00 11.38  ? 109 VAL F O   1 
ATOM   6983 C CB  . VAL D 2 109 ? 19.832  -2.797  36.122  1.00 15.93  ? 109 VAL F CB  1 
ATOM   6984 C CG1 . VAL D 2 109 ? 21.178  -2.216  35.719  1.00 15.93  ? 109 VAL F CG1 1 
ATOM   6985 C CG2 . VAL D 2 109 ? 19.988  -4.162  36.758  1.00 15.93  ? 109 VAL F CG2 1 
ATOM   6986 N N   . CYS D 2 110 ? 16.863  -2.383  36.548  1.00 13.78  ? 110 CYS F N   1 
ATOM   6987 C CA  . CYS D 2 110 ? 15.516  -2.883  36.716  1.00 13.78  ? 110 CYS F CA  1 
ATOM   6988 C C   . CYS D 2 110 ? 15.441  -4.330  36.248  1.00 13.78  ? 110 CYS F C   1 
ATOM   6989 O O   . CYS D 2 110 ? 15.852  -4.658  35.130  1.00 13.78  ? 110 CYS F O   1 
ATOM   6990 C CB  . CYS D 2 110 ? 14.513  -2.050  35.920  1.00 24.84  ? 110 CYS F CB  1 
ATOM   6991 S SG  . CYS D 2 110 ? 12.791  -2.564  36.216  1.00 24.84  ? 110 CYS F SG  1 
ATOM   6992 N N   . VAL D 2 111 ? 14.929  -5.191  37.120  1.00 42.98  ? 111 VAL F N   1 
ATOM   6993 C CA  . VAL D 2 111 ? 14.778  -6.610  36.820  1.00 42.98  ? 111 VAL F CA  1 
ATOM   6994 C C   . VAL D 2 111 ? 13.305  -6.859  36.474  1.00 42.98  ? 111 VAL F C   1 
ATOM   6995 O O   . VAL D 2 111 ? 12.400  -6.602  37.286  1.00 42.98  ? 111 VAL F O   1 
ATOM   6996 C CB  . VAL D 2 111 ? 15.173  -7.490  38.017  1.00 94.01  ? 111 VAL F CB  1 
ATOM   6997 C CG1 . VAL D 2 111 ? 15.041  -8.958  37.647  1.00 94.01  ? 111 VAL F CG1 1 
ATOM   6998 C CG2 . VAL D 2 111 ? 16.597  -7.175  38.439  1.00 94.01  ? 111 VAL F CG2 1 
ATOM   6999 N N   . LEU D 2 112 ? 13.083  -7.349  35.259  1.00 34.04  ? 112 LEU F N   1 
ATOM   7000 C CA  . LEU D 2 112 ? 11.758  -7.639  34.742  1.00 34.04  ? 112 LEU F CA  1 
ATOM   7001 C C   . LEU D 2 112 ? 11.306  -9.068  35.042  1.00 34.04  ? 112 LEU F C   1 
ATOM   7002 O O   . LEU D 2 112 ? 12.100  -10.010 35.007  1.00 34.04  ? 112 LEU F O   1 
ATOM   7003 C CB  . LEU D 2 112 ? 11.685  -7.399  33.230  1.00 78.13  ? 112 LEU F CB  1 
ATOM   7004 C CG  . LEU D 2 112 ? 11.417  -5.970  32.755  1.00 78.13  ? 112 LEU F CG  1 
ATOM   7005 C CD1 . LEU D 2 112 ? 12.635  -5.101  33.014  1.00 78.13  ? 112 LEU F CD1 1 
ATOM   7006 C CD2 . LEU D 2 112 ? 11.079  -5.990  31.273  1.00 78.13  ? 112 LEU F CD2 1 
ATOM   7007 N N   . SER D 2 113 ? 10.012  -9.225  35.304  1.00 33.77  ? 113 SER F N   1 
ATOM   7008 C CA  . SER D 2 113 ? 9.447   -10.531 35.602  1.00 33.77  ? 113 SER F CA  1 
ATOM   7009 C C   . SER D 2 113 ? 7.944   -10.623 35.261  1.00 33.77  ? 113 SER F C   1 
ATOM   7010 O O   . SER D 2 113 ? 7.124   -9.887  35.808  1.00 33.77  ? 113 SER F O   1 
ATOM   7011 C CB  . SER D 2 113 ? 9.648   -10.868 37.079  1.00 35.88  ? 113 SER F CB  1 
ATOM   7012 O OG  . SER D 2 113 ? 8.973   -12.067 37.416  1.00 35.88  ? 113 SER F OG  1 
ATOM   7013 N N   . ARG D 2 114 ? 7.595   -11.522 34.344  1.00 73.36  ? 114 ARG F N   1 
ATOM   7014 C CA  . ARG D 2 114 ? 6.205   -11.735 33.960  1.00 73.36  ? 114 ARG F CA  1 
ATOM   7015 C C   . ARG D 2 114 ? 5.398   -12.259 35.139  1.00 73.36  ? 114 ARG F C   1 
ATOM   7016 O O   . ARG D 2 114 ? 5.913   -12.991 35.977  1.00 73.36  ? 114 ARG F O   1 
ATOM   7017 C CB  . ARG D 2 114 ? 6.070   -12.747 32.818  1.00 51.87  ? 114 ARG F CB  1 
ATOM   7018 C CG  . ARG D 2 114 ? 6.068   -12.180 31.398  1.00 51.87  ? 114 ARG F CG  1 
ATOM   7019 C CD  . ARG D 2 114 ? 5.541   -13.225 30.400  1.00 51.87  ? 114 ARG F CD  1 
ATOM   7020 N NE  . ARG D 2 114 ? 5.797   -12.871 29.005  1.00 51.87  ? 114 ARG F NE  1 
ATOM   7021 C CZ  . ARG D 2 114 ? 6.971   -13.009 28.398  1.00 51.87  ? 114 ARG F CZ  1 
ATOM   7022 N NH1 . ARG D 2 114 ? 8.007   -13.498 29.061  1.00 51.87  ? 114 ARG F NH1 1 
ATOM   7023 N NH2 . ARG D 2 114 ? 7.112   -12.653 27.128  1.00 51.87  ? 114 ARG F NH2 1 
ATOM   7024 N N   . LYS D 2 115 ? 4.126   -11.855 35.162  1.00 100.09 ? 115 LYS F N   1 
ATOM   7025 C CA  . LYS D 2 115 ? 3.178   -12.228 36.214  1.00 100.09 ? 115 LYS F CA  1 
ATOM   7026 C C   . LYS D 2 115 ? 2.039   -13.118 35.732  1.00 100.09 ? 115 LYS F C   1 
ATOM   7027 O O   . LYS D 2 115 ? 1.783   -13.227 34.531  1.00 100.09 ? 115 LYS F O   1 
ATOM   7028 C CB  . LYS D 2 115 ? 2.580   -10.978 36.856  1.00 92.17  ? 115 LYS F CB  1 
ATOM   7029 C CG  . LYS D 2 115 ? 1.748   -10.134 35.912  1.00 92.17  ? 115 LYS F CG  1 
ATOM   7030 C CD  . LYS D 2 115 ? 1.020   -9.037  36.675  1.00 92.17  ? 115 LYS F CD  1 
ATOM   7031 C CE  . LYS D 2 115 ? 1.989   -8.089  37.375  1.00 92.17  ? 115 LYS F CE  1 
ATOM   7032 N NZ  . LYS D 2 115 ? 1.276   -7.049  38.173  1.00 92.17  ? 115 LYS F NZ  1 
ATOM   7033 N N   . ALA D 2 116 ? 1.343   -13.715 36.697  1.00 151.58 ? 116 ALA F N   1 
ATOM   7034 C CA  . ALA D 2 116 ? 0.221   -14.622 36.456  1.00 151.58 ? 116 ALA F CA  1 
ATOM   7035 C C   . ALA D 2 116 ? 0.768   -16.025 36.185  1.00 151.58 ? 116 ALA F C   1 
ATOM   7036 O O   . ALA D 2 116 ? 1.989   -16.220 36.388  1.00 170.21 ? 116 ALA F O   1 
ATOM   7037 C CB  . ALA D 2 116 ? -0.638  -14.133 35.275  1.00 87.36  ? 116 ALA F CB  1 
HETATM 7038 C C1  . NAG E 3 .   ? -22.677 -22.397 65.575  1.00 81.98  ? 1   NAG C C1  1 
HETATM 7039 C C2  . NAG E 3 .   ? -21.458 -22.530 64.643  1.00 83.15  ? 1   NAG C C2  1 
HETATM 7040 C C3  . NAG E 3 .   ? -20.438 -21.405 64.891  1.00 85.99  ? 1   NAG C C3  1 
HETATM 7041 C C4  . NAG E 3 .   ? -21.091 -20.018 65.022  1.00 87.37  ? 1   NAG C C4  1 
HETATM 7042 C C5  . NAG E 3 .   ? -22.340 -20.068 65.915  1.00 86.47  ? 1   NAG C C5  1 
HETATM 7043 C C6  . NAG E 3 .   ? -23.107 -18.756 65.907  1.00 90.62  ? 1   NAG C C6  1 
HETATM 7044 C C7  . NAG E 3 .   ? -20.643 -24.664 63.857  1.00 85.18  ? 1   NAG C C7  1 
HETATM 7045 C C8  . NAG E 3 .   ? -21.613 -25.831 63.762  1.00 84.32  ? 1   NAG C C8  1 
HETATM 7046 N N2  . NAG E 3 .   ? -20.814 -23.813 64.865  1.00 82.64  ? 1   NAG C N2  1 
HETATM 7047 O O3  . NAG E 3 .   ? -19.497 -21.373 63.829  1.00 86.72  ? 1   NAG C O3  1 
HETATM 7048 O O4  . NAG E 3 .   ? -20.149 -19.056 65.571  1.00 90.41  ? 1   NAG C O4  1 
HETATM 7049 O O5  . NAG E 3 .   ? -23.242 -21.093 65.455  1.00 83.53  ? 1   NAG C O5  1 
HETATM 7050 O O6  . NAG E 3 .   ? -23.181 -18.200 67.212  1.00 97.77  ? 1   NAG C O6  1 
HETATM 7051 O O7  . NAG E 3 .   ? -19.746 -24.542 63.019  1.00 87.91  ? 1   NAG C O7  1 
HETATM 7052 C C1  . NDG E 3 .   ? -19.056 -19.472 66.341  1.00 165.95 ? 2   NDG C C1  1 
HETATM 7053 C C2  . NDG E 3 .   ? -19.504 -20.388 67.497  1.00 167.54 ? 2   NDG C C2  1 
HETATM 7054 C C3  . NDG E 3 .   ? -18.313 -20.738 68.393  1.00 170.93 ? 2   NDG C C3  1 
HETATM 7055 C C4  . NDG E 3 .   ? -17.590 -19.472 68.850  1.00 175.66 ? 2   NDG C C4  1 
HETATM 7056 C C5  . NDG E 3 .   ? -17.233 -18.572 67.659  1.00 173.74 ? 2   NDG C C5  1 
HETATM 7057 C C6  . NDG E 3 .   ? -16.151 -19.131 66.744  1.00 173.79 ? 2   NDG C C6  1 
HETATM 7058 C C7  . NDG E 3 .   ? -21.310 -20.507 69.084  1.00 170.36 ? 2   NDG C C7  1 
HETATM 7059 C C8  . NDG E 3 .   ? -21.153 -20.284 70.580  1.00 171.25 ? 2   NDG C C8  1 
HETATM 7060 O O5  . NDG E 3 .   ? -18.410 -18.294 66.856  1.00 168.37 ? 2   NDG C O5  1 
HETATM 7061 O O3  . NDG E 3 .   ? -17.409 -21.575 67.686  1.00 168.00 ? 2   NDG C O3  1 
HETATM 7062 O O4  . NDG E 3 .   ? -18.412 -18.756 69.759  1.00 186.60 ? 2   NDG C O4  1 
HETATM 7063 O O6  . NDG E 3 .   ? -14.863 -18.676 67.134  1.00 175.42 ? 2   NDG C O6  1 
HETATM 7064 O O7  . NDG E 3 .   ? -22.104 -21.357 68.669  1.00 171.60 ? 2   NDG C O7  1 
HETATM 7065 N N2  . NDG E 3 .   ? -20.557 -19.765 68.276  1.00 169.20 ? 2   NDG C N2  1 
HETATM 7066 C C1  . NAG F 4 .   ? -7.298  -31.682 44.205  1.00 116.70 ? 1   NAG D C1  1 
HETATM 7067 C C2  . NAG F 4 .   ? -6.564  -31.269 45.491  1.00 116.70 ? 1   NAG D C2  1 
HETATM 7068 C C3  . NAG F 4 .   ? -6.893  -29.823 45.841  1.00 116.70 ? 1   NAG D C3  1 
HETATM 7069 C C4  . NAG F 4 .   ? -6.403  -28.885 44.735  1.00 116.70 ? 1   NAG D C4  1 
HETATM 7070 C C5  . NAG F 4 .   ? -6.587  -29.512 43.345  1.00 116.70 ? 1   NAG D C5  1 
HETATM 7071 C C6  . NAG F 4 .   ? -5.318  -30.117 42.767  1.00 116.70 ? 1   NAG D C6  1 
HETATM 7072 C C7  . NAG F 4 .   ? -6.098  -32.422 47.558  1.00 116.70 ? 1   NAG D C7  1 
HETATM 7073 C C8  . NAG F 4 .   ? -6.276  -31.686 48.877  1.00 116.70 ? 1   NAG D C8  1 
HETATM 7074 N N2  . NAG F 4 .   ? -6.956  -32.141 46.582  1.00 116.70 ? 1   NAG D N2  1 
HETATM 7075 O O3  . NAG F 4 .   ? -6.276  -29.472 47.069  1.00 116.70 ? 1   NAG D O3  1 
HETATM 7076 O O4  . NAG F 4 .   ? -7.129  -27.641 44.798  1.00 116.70 ? 1   NAG D O4  1 
HETATM 7077 O O5  . NAG F 4 .   ? -7.614  -30.542 43.372  1.00 116.70 ? 1   NAG D O5  1 
HETATM 7078 O O6  . NAG F 4 .   ? -5.591  -30.827 41.568  1.00 116.70 ? 1   NAG D O6  1 
HETATM 7079 O O7  . NAG F 4 .   ? -5.184  -33.239 47.432  1.00 116.70 ? 1   NAG D O7  1 
HETATM 7080 C C1  . NDG F 4 .   ? -6.734  -26.741 45.777  1.00 198.79 ? 2   NDG D C1  1 
HETATM 7081 C C2  . NDG F 4 .   ? -7.826  -25.688 45.989  1.00 198.79 ? 2   NDG D C2  1 
HETATM 7082 C C3  . NDG F 4 .   ? -7.328  -24.586 46.933  1.00 198.79 ? 2   NDG D C3  1 
HETATM 7083 C C4  . NDG F 4 .   ? -5.932  -24.921 47.485  1.00 198.79 ? 2   NDG D C4  1 
HETATM 7084 C C5  . NDG F 4 .   ? -4.936  -25.229 46.346  1.00 198.79 ? 2   NDG D C5  1 
HETATM 7085 C C6  . NDG F 4 .   ? -3.671  -25.904 46.840  1.00 198.79 ? 2   NDG D C6  1 
HETATM 7086 C C7  . NDG F 4 .   ? -9.481  -25.030 44.364  1.00 198.79 ? 2   NDG D C7  1 
HETATM 7087 C C8  . NDG F 4 .   ? -10.046 -26.168 43.528  1.00 198.79 ? 2   NDG D C8  1 
HETATM 7088 O O5  . NDG F 4 .   ? -5.521  -26.105 45.345  1.00 198.79 ? 2   NDG D O5  1 
HETATM 7089 O O3  . NDG F 4 .   ? -8.241  -24.438 48.011  1.00 198.79 ? 2   NDG D O3  1 
HETATM 7090 O O4  . NDG F 4 .   ? -5.434  -23.837 48.306  1.00 198.79 ? 2   NDG D O4  1 
HETATM 7091 O O6  . NDG F 4 .   ? -2.527  -25.416 46.156  1.00 198.79 ? 2   NDG D O6  1 
HETATM 7092 O O7  . NDG F 4 .   ? -10.206 -24.088 44.687  1.00 198.79 ? 2   NDG D O7  1 
HETATM 7093 N N2  . NDG F 4 .   ? -8.201  -25.107 44.713  1.00 198.79 ? 2   NDG D N2  1 
HETATM 7094 C C1  . MAN F 4 .   ? -5.236  -22.594 47.712  1.00 200.00 ? 3   MAN D C1  1 
HETATM 7095 C C2  . MAN F 4 .   ? -3.929  -21.968 48.234  1.00 200.00 ? 3   MAN D C2  1 
HETATM 7096 C C3  . MAN F 4 .   ? -4.082  -20.456 48.431  1.00 200.00 ? 3   MAN D C3  1 
HETATM 7097 C C4  . MAN F 4 .   ? -5.206  -20.150 49.431  1.00 200.00 ? 3   MAN D C4  1 
HETATM 7098 C C5  . MAN F 4 .   ? -6.328  -21.194 49.340  1.00 200.00 ? 3   MAN D C5  1 
HETATM 7099 C C6  . MAN F 4 .   ? -7.696  -20.602 49.622  1.00 200.00 ? 3   MAN D C6  1 
HETATM 7100 O O2  . MAN F 4 .   ? -2.876  -22.224 47.315  1.00 200.00 ? 3   MAN D O2  1 
HETATM 7101 O O3  . MAN F 4 .   ? -4.368  -19.836 47.186  1.00 200.00 ? 3   MAN D O3  1 
HETATM 7102 O O4  . MAN F 4 .   ? -4.679  -20.131 50.750  1.00 200.00 ? 3   MAN D O4  1 
HETATM 7103 O O5  . MAN F 4 .   ? -6.375  -21.763 48.011  1.00 200.00 ? 3   MAN D O5  1 
HETATM 7104 O O6  . MAN F 4 .   ? -8.479  -21.476 50.422  1.00 200.00 ? 3   MAN D O6  1 
HETATM 7105 C C1  . NAG G 5 .   ? 4.783   -37.352 47.508  1.00 65.86  ? 1   NAG G C1  1 
HETATM 7106 C C2  . NAG G 5 .   ? 5.388   -36.972 48.861  1.00 67.03  ? 1   NAG G C2  1 
HETATM 7107 C C3  . NAG G 5 .   ? 5.602   -35.461 48.941  1.00 69.87  ? 1   NAG G C3  1 
HETATM 7108 C C4  . NAG G 5 .   ? 6.365   -34.927 47.710  1.00 71.25  ? 1   NAG G C4  1 
HETATM 7109 C C5  . NAG G 5 .   ? 5.764   -35.476 46.408  1.00 70.35  ? 1   NAG G C5  1 
HETATM 7110 C C6  . NAG G 5 .   ? 6.607   -35.138 45.191  1.00 74.50  ? 1   NAG G C6  1 
HETATM 7111 C C7  . NAG G 5 .   ? 4.290   -38.690 50.154  1.00 69.06  ? 1   NAG G C7  1 
HETATM 7112 C C8  . NAG G 5 .   ? 2.854   -39.167 49.992  1.00 68.20  ? 1   NAG G C8  1 
HETATM 7113 N N2  . NAG G 5 .   ? 4.524   -37.396 49.946  1.00 66.52  ? 1   NAG G N2  1 
HETATM 7114 O O3  . NAG G 5 .   ? 6.341   -35.169 50.115  1.00 70.60  ? 1   NAG G O3  1 
HETATM 7115 O O4  . NAG G 5 .   ? 6.313   -33.480 47.657  1.00 74.29  ? 1   NAG G O4  1 
HETATM 7116 O O5  . NAG G 5 .   ? 5.656   -36.913 46.464  1.00 67.41  ? 1   NAG G O5  1 
HETATM 7117 O O6  . NAG G 5 .   ? 7.952   -35.567 45.356  1.00 81.65  ? 1   NAG G O6  1 
HETATM 7118 O O7  . NAG G 5 .   ? 5.176   -39.494 50.460  1.00 71.79  ? 1   NAG G O7  1 
HETATM 7119 C C1  . NDG G 5 .   ? 6.338   -32.743 48.831  1.00 116.78 ? 2   NDG G C1  1 
HETATM 7120 C C2  . NDG G 5 .   ? 5.867   -31.323 48.550  1.00 118.37 ? 2   NDG G C2  1 
HETATM 7121 C C3  . NDG G 5 .   ? 5.880   -30.535 49.855  1.00 121.76 ? 2   NDG G C3  1 
HETATM 7122 C C4  . NDG G 5 .   ? 7.252   -30.621 50.550  1.00 126.49 ? 2   NDG G C4  1 
HETATM 7123 C C5  . NDG G 5 .   ? 7.804   -32.056 50.614  1.00 124.57 ? 2   NDG G C5  1 
HETATM 7124 C C6  . NDG G 5 .   ? 7.124   -32.921 51.661  1.00 124.62 ? 2   NDG G C6  1 
HETATM 7125 C C7  . NDG G 5 .   ? 6.547   -30.915 46.271  1.00 121.19 ? 2   NDG G C7  1 
HETATM 7126 C C8  . NDG G 5 .   ? 7.567   -31.800 45.570  1.00 122.08 ? 2   NDG G C8  1 
HETATM 7127 O O5  . NDG G 5 .   ? 7.684   -32.721 49.329  1.00 119.20 ? 2   NDG G O5  1 
HETATM 7128 O O3  . NDG G 5 .   ? 4.873   -31.037 50.723  1.00 118.83 ? 2   NDG G O3  1 
HETATM 7129 O O4  . NDG G 5 .   ? 8.206   -29.760 49.899  1.00 137.43 ? 2   NDG G O4  1 
HETATM 7130 O O6  . NDG G 5 .   ? 7.413   -32.457 52.971  1.00 126.25 ? 2   NDG G O6  1 
HETATM 7131 O O7  . NDG G 5 .   ? 5.603   -30.442 45.633  1.00 122.43 ? 2   NDG G O7  1 
HETATM 7132 N N2  . NDG G 5 .   ? 6.729   -30.690 47.570  1.00 120.03 ? 2   NDG G N2  1 
HETATM 7133 C C1  . BMA G 5 .   ? 8.439   -28.554 50.541  1.00 197.57 ? 3   BMA G C1  1 
HETATM 7134 C C2  . BMA G 5 .   ? 9.910   -28.156 50.399  1.00 197.57 ? 3   BMA G C2  1 
HETATM 7135 C C3  . BMA G 5 .   ? 10.134  -26.794 51.061  1.00 197.57 ? 3   BMA G C3  1 
HETATM 7136 C C4  . BMA G 5 .   ? 9.155   -25.758 50.495  1.00 197.57 ? 3   BMA G C4  1 
HETATM 7137 C C5  . BMA G 5 .   ? 7.713   -26.275 50.599  1.00 197.57 ? 3   BMA G C5  1 
HETATM 7138 C C6  . BMA G 5 .   ? 6.714   -25.344 49.939  1.00 197.57 ? 3   BMA G C6  1 
HETATM 7139 O O2  . BMA G 5 .   ? 10.260  -28.087 49.023  1.00 197.57 ? 3   BMA G O2  1 
HETATM 7140 O O3  . BMA G 5 .   ? 11.470  -26.364 50.837  1.00 197.57 ? 3   BMA G O3  1 
HETATM 7141 O O4  . BMA G 5 .   ? 9.278   -24.541 51.216  1.00 197.57 ? 3   BMA G O4  1 
HETATM 7142 O O5  . BMA G 5 .   ? 7.596   -27.558 49.946  1.00 197.57 ? 3   BMA G O5  1 
HETATM 7143 O O6  . BMA G 5 .   ? 5.452   -25.976 49.774  1.00 197.57 ? 3   BMA G O6  1 
HETATM 7144 C C1  . NAG H 5 .   ? 32.911  -32.278 30.502  1.00 89.72  ? 1   NAG H C1  1 
HETATM 7145 C C2  . NAG H 5 .   ? 32.507  -32.703 29.076  1.00 90.89  ? 1   NAG H C2  1 
HETATM 7146 C C3  . NAG H 5 .   ? 31.575  -33.921 29.102  1.00 93.73  ? 1   NAG H C3  1 
HETATM 7147 C C4  . NAG H 5 .   ? 32.230  -35.035 29.916  1.00 95.11  ? 1   NAG H C4  1 
HETATM 7148 C C5  . NAG H 5 .   ? 32.537  -34.530 31.325  1.00 94.21  ? 1   NAG H C5  1 
HETATM 7149 C C6  . NAG H 5 .   ? 33.230  -35.594 32.160  1.00 98.36  ? 1   NAG H C6  1 
HETATM 7150 C C7  . NAG H 5 .   ? 31.468  -31.742 27.130  1.00 92.92  ? 1   NAG H C7  1 
HETATM 7151 C C8  . NAG H 5 .   ? 29.967  -31.823 26.894  1.00 92.06  ? 1   NAG H C8  1 
HETATM 7152 N N2  . NAG H 5 .   ? 31.869  -31.599 28.387  1.00 90.38  ? 1   NAG H N2  1 
HETATM 7153 O O3  . NAG H 5 .   ? 31.347  -34.373 27.773  1.00 94.46  ? 1   NAG H O3  1 
HETATM 7154 O O4  . NAG H 5 .   ? 31.366  -36.190 29.986  1.00 98.15  ? 1   NAG H O4  1 
HETATM 7155 O O5  . NAG H 5 .   ? 33.432  -33.390 31.262  1.00 91.27  ? 1   NAG H O5  1 
HETATM 7156 O O6  . NAG H 5 .   ? 32.595  -35.757 33.418  1.00 105.51 ? 1   NAG H O6  1 
HETATM 7157 O O7  . NAG H 5 .   ? 32.250  -31.819 26.180  1.00 95.65  ? 1   NAG H O7  1 
HETATM 7158 C C1  . NDG H 5 .   ? 31.418  -37.124 28.950  1.00 184.76 ? 2   NDG H C1  1 
HETATM 7159 C C2  . NDG H 5 .   ? 31.055  -38.505 29.491  1.00 185.32 ? 2   NDG H C2  1 
HETATM 7160 C C3  . NDG H 5 .   ? 31.115  -39.529 28.358  1.00 185.32 ? 2   NDG H C3  1 
HETATM 7161 C C4  . NDG H 5 .   ? 32.490  -39.499 27.670  1.00 185.32 ? 2   NDG H C4  1 
HETATM 7162 C C5  . NDG H 5 .   ? 32.901  -38.067 27.278  1.00 185.32 ? 2   NDG H C5  1 
HETATM 7163 C C6  . NDG H 5 .   ? 32.168  -37.483 26.072  1.00 185.32 ? 2   NDG H C6  1 
HETATM 7164 C C7  . NDG H 5 .   ? 31.551  -39.524 31.616  1.00 185.32 ? 2   NDG H C7  1 
HETATM 7165 C C8  . NDG H 5 .   ? 31.564  -41.044 31.569  1.00 185.32 ? 2   NDG H C8  1 
HETATM 7166 O O5  . NDG H 5 .   ? 32.750  -37.151 28.399  1.00 185.32 ? 2   NDG H O5  1 
HETATM 7167 O O3  . NDG H 5 .   ? 30.094  -39.258 27.409  1.00 185.32 ? 2   NDG H O3  1 
HETATM 7168 O O4  . NDG H 5 .   ? 33.494  -40.067 28.540  1.00 185.32 ? 2   NDG H O4  1 
HETATM 7169 O O6  . NDG H 5 .   ? 30.792  -37.252 26.339  1.00 185.32 ? 2   NDG H O6  1 
HETATM 7170 O O7  . NDG H 5 .   ? 31.149  -38.944 32.625  1.00 185.32 ? 2   NDG H O7  1 
HETATM 7171 N N2  . NDG H 5 .   ? 31.985  -38.879 30.539  1.00 185.32 ? 2   NDG H N2  1 
HETATM 7172 C C1  . BMA H 5 .   ? 33.566  -41.455 28.600  1.00 194.53 ? 3   BMA H C1  1 
HETATM 7173 C C2  . BMA H 5 .   ? 34.256  -42.005 27.343  1.00 194.53 ? 3   BMA H C2  1 
HETATM 7174 C C3  . BMA H 5 .   ? 34.442  -43.523 27.463  1.00 194.53 ? 3   BMA H C3  1 
HETATM 7175 C C4  . BMA H 5 .   ? 35.162  -43.869 28.768  1.00 194.53 ? 3   BMA H C4  1 
HETATM 7176 C C5  . BMA H 5 .   ? 34.425  -43.239 29.955  1.00 194.53 ? 3   BMA H C5  1 
HETATM 7177 C C6  . BMA H 5 .   ? 35.141  -43.468 31.272  1.00 194.53 ? 3   BMA H C6  1 
HETATM 7178 O O2  . BMA H 5 .   ? 35.520  -41.379 27.177  1.00 194.53 ? 3   BMA H O2  1 
HETATM 7179 O O3  . BMA H 5 .   ? 35.196  -44.005 26.361  1.00 194.53 ? 3   BMA H O3  1 
HETATM 7180 O O4  . BMA H 5 .   ? 35.213  -45.279 28.926  1.00 194.53 ? 3   BMA H O4  1 
HETATM 7181 O O5  . BMA H 5 .   ? 34.319  -41.808 29.771  1.00 194.53 ? 3   BMA H O5  1 
HETATM 7182 O O6  . BMA H 5 .   ? 35.469  -44.838 31.450  1.00 194.53 ? 3   BMA H O6  1 
HETATM 7183 C C1  . NAG I 4 .   ? -38.299 -11.979 37.554  1.00 177.82 ? 1   NAG I C1  1 
HETATM 7184 C C2  . NAG I 4 .   ? -37.878 -11.168 38.772  1.00 177.82 ? 1   NAG I C2  1 
HETATM 7185 C C3  . NAG I 4 .   ? -36.772 -10.204 38.352  1.00 177.82 ? 1   NAG I C3  1 
HETATM 7186 C C4  . NAG I 4 .   ? -37.225 -9.322  37.176  1.00 177.82 ? 1   NAG I C4  1 
HETATM 7187 C C5  . NAG I 4 .   ? -37.875 -10.146 36.042  1.00 177.82 ? 1   NAG I C5  1 
HETATM 7188 C C6  . NAG I 4 .   ? -36.872 -10.919 35.199  1.00 177.82 ? 1   NAG I C6  1 
HETATM 7189 C C7  . NAG I 4 .   ? -39.250 -10.387 40.592  1.00 177.82 ? 1   NAG I C7  1 
HETATM 7190 C C8  . NAG I 4 .   ? -38.736 -9.174  41.351  1.00 177.82 ? 1   NAG I C8  1 
HETATM 7191 N N2  . NAG I 4 .   ? -39.016 -10.430 39.284  1.00 177.82 ? 1   NAG I N2  1 
HETATM 7192 O O3  . NAG I 4 .   ? -35.615 -10.937 37.978  1.00 177.82 ? 1   NAG I O3  1 
HETATM 7193 O O4  . NAG I 4 .   ? -38.136 -8.299  37.635  1.00 177.82 ? 1   NAG I O4  1 
HETATM 7194 O O5  . NAG I 4 .   ? -38.845 -11.097 36.560  1.00 177.82 ? 1   NAG I O5  1 
HETATM 7195 O O6  . NAG I 4 .   ? -35.926 -10.046 34.599  1.00 177.82 ? 1   NAG I O6  1 
HETATM 7196 O O7  . NAG I 4 .   ? -39.855 -11.276 41.191  1.00 177.82 ? 1   NAG I O7  1 
HETATM 7197 C C1  . NDG I 4 .   ? -37.558 -7.201  38.263  1.00 188.83 ? 2   NDG I C1  1 
HETATM 7198 C C2  . NDG I 4 .   ? -38.629 -6.353  38.947  1.00 188.83 ? 2   NDG I C2  1 
HETATM 7199 C C3  . NDG I 4 .   ? -37.952 -5.168  39.638  1.00 188.83 ? 2   NDG I C3  1 
HETATM 7200 C C4  . NDG I 4 .   ? -37.093 -4.373  38.644  1.00 188.83 ? 2   NDG I C4  1 
HETATM 7201 C C5  . NDG I 4 .   ? -36.149 -5.289  37.840  1.00 188.83 ? 2   NDG I C5  1 
HETATM 7202 C C6  . NDG I 4 .   ? -34.985 -5.838  38.650  1.00 188.83 ? 2   NDG I C6  1 
HETATM 7203 C C7  . NDG I 4 .   ? -40.839 -5.613  38.329  1.00 188.83 ? 2   NDG I C7  1 
HETATM 7204 C C8  . NDG I 4 .   ? -41.141 -4.211  38.831  1.00 188.83 ? 2   NDG I C8  1 
HETATM 7205 O O5  . NDG I 4 .   ? -36.870 -6.416  37.275  1.00 188.83 ? 2   NDG I O5  1 
HETATM 7206 O O3  . NDG I 4 .   ? -37.140 -5.636  40.704  1.00 188.83 ? 2   NDG I O3  1 
HETATM 7207 O O4  . NDG I 4 .   ? -37.940 -3.633  37.745  1.00 188.83 ? 2   NDG I O4  1 
HETATM 7208 O O6  . NDG I 4 .   ? -34.370 -4.818  39.423  1.00 188.83 ? 2   NDG I O6  1 
HETATM 7209 O O7  . NDG I 4 .   ? -41.740 -6.449  38.269  1.00 188.83 ? 2   NDG I O7  1 
HETATM 7210 N N2  . NDG I 4 .   ? -39.586 -5.875  37.967  1.00 188.83 ? 2   NDG I N2  1 
HETATM 7211 C C1  . MAN I 4 .   ? -37.941 -2.256  37.910  1.00 200.00 ? 3   MAN I C1  1 
HETATM 7212 C C2  . MAN I 4 .   ? -39.345 -1.694  37.627  1.00 200.00 ? 3   MAN I C2  1 
HETATM 7213 C C3  . MAN I 4 .   ? -39.264 -0.383  36.840  1.00 200.00 ? 3   MAN I C3  1 
HETATM 7214 C C4  . MAN I 4 .   ? -38.540 -0.597  35.505  1.00 200.00 ? 3   MAN I C4  1 
HETATM 7215 C C5  . MAN I 4 .   ? -37.402 -1.620  35.648  1.00 200.00 ? 3   MAN I C5  1 
HETATM 7216 C C6  . MAN I 4 .   ? -36.194 -1.263  34.803  1.00 200.00 ? 3   MAN I C6  1 
HETATM 7217 O O2  . MAN I 4 .   ? -40.024 -1.469  38.854  1.00 200.00 ? 3   MAN I O2  1 
HETATM 7218 O O3  . MAN I 4 .   ? -38.577 0.596   37.606  1.00 200.00 ? 3   MAN I O3  1 
HETATM 7219 O O4  . MAN I 4 .   ? -39.464 -1.048  34.526  1.00 200.00 ? 3   MAN I O4  1 
HETATM 7220 O O5  . MAN I 4 .   ? -36.957 -1.690  37.023  1.00 200.00 ? 3   MAN I O5  1 
HETATM 7221 O O6  . MAN I 4 .   ? -35.952 0.137   34.813  1.00 200.00 ? 3   MAN I O6  1 
HETATM 7222 C C1  . NAG J 5 .   ? -43.722 -14.405 47.130  1.00 107.01 ? 1   NAG J C1  1 
HETATM 7223 C C2  . NAG J 5 .   ? -42.939 -13.150 46.705  1.00 108.18 ? 1   NAG J C2  1 
HETATM 7224 C C3  . NAG J 5 .   ? -42.668 -12.243 47.905  1.00 111.02 ? 1   NAG J C3  1 
HETATM 7225 C C4  . NAG J 5 .   ? -43.996 -11.912 48.573  1.00 112.40 ? 1   NAG J C4  1 
HETATM 7226 C C5  . NAG J 5 .   ? -44.653 -13.221 49.026  1.00 111.50 ? 1   NAG J C5  1 
HETATM 7227 C C6  . NAG J 5 .   ? -45.988 -13.000 49.715  1.00 115.65 ? 1   NAG J C6  1 
HETATM 7228 C C7  . NAG J 5 .   ? -41.416 -13.123 44.845  1.00 110.21 ? 1   NAG J C7  1 
HETATM 7229 C C8  . NAG J 5 .   ? -40.495 -11.921 44.702  1.00 109.35 ? 1   NAG J C8  1 
HETATM 7230 N N2  . NAG J 5 .   ? -41.689 -13.533 46.079  1.00 107.67 ? 1   NAG J N2  1 
HETATM 7231 O O3  . NAG J 5 .   ? -42.032 -11.049 47.474  1.00 111.75 ? 1   NAG J O3  1 
HETATM 7232 O O4  . NAG J 5 .   ? -43.790 -11.020 49.688  1.00 115.44 ? 1   NAG J O4  1 
HETATM 7233 O O5  . NAG J 5 .   ? -44.907 -14.069 47.878  1.00 108.56 ? 1   NAG J O5  1 
HETATM 7234 O O6  . NAG J 5 .   ? -47.070 -13.200 48.817  1.00 122.80 ? 1   NAG J O6  1 
HETATM 7235 O O7  . NAG J 5 .   ? -41.878 -13.667 43.841  1.00 112.94 ? 1   NAG J O7  1 
HETATM 7236 C C1  . NDG J 5 .   ? -44.000 -9.674  49.415  1.00 191.45 ? 2   NDG J C1  1 
HETATM 7237 C C2  . NDG J 5 .   ? -43.445 -8.801  50.541  1.00 191.45 ? 2   NDG J C2  1 
HETATM 7238 C C3  . NDG J 5 .   ? -43.708 -7.325  50.218  1.00 191.45 ? 2   NDG J C3  1 
HETATM 7239 C C4  . NDG J 5 .   ? -45.185 -7.070  49.870  1.00 191.45 ? 2   NDG J C4  1 
HETATM 7240 C C5  . NDG J 5 .   ? -45.737 -8.099  48.862  1.00 191.45 ? 2   NDG J C5  1 
HETATM 7241 C C6  . NDG J 5 .   ? -45.227 -7.903  47.442  1.00 191.45 ? 2   NDG J C6  1 
HETATM 7242 C C7  . NDG J 5 .   ? -43.501 -8.753  52.947  1.00 191.45 ? 2   NDG J C7  1 
HETATM 7243 C C8  . NDG J 5 .   ? -44.011 -7.457  53.558  1.00 191.45 ? 2   NDG J C8  1 
HETATM 7244 O O5  . NDG J 5 .   ? -45.412 -9.453  49.271  1.00 191.45 ? 2   NDG J O5  1 
HETATM 7245 O O3  . NDG J 5 .   ? -42.889 -6.919  49.132  1.00 191.45 ? 2   NDG J O3  1 
HETATM 7246 O O4  . NDG J 5 .   ? -45.990 -7.074  51.066  1.00 191.45 ? 2   NDG J O4  1 
HETATM 7247 O O6  . NDG J 5 .   ? -46.300 -7.864  46.512  1.00 191.45 ? 2   NDG J O6  1 
HETATM 7248 O O7  . NDG J 5 .   ? -42.606 -9.383  53.508  1.00 191.45 ? 2   NDG J O7  1 
HETATM 7249 N N2  . NDG J 5 .   ? -44.058 -9.152  51.808  1.00 191.45 ? 2   NDG J N2  1 
HETATM 7250 C C1  . BMA J 5 .   ? -46.910 -6.041  51.176  1.00 200.00 ? 3   BMA J C1  1 
HETATM 7251 C C2  . BMA J 5 .   ? -48.317 -6.551  50.836  1.00 200.00 ? 3   BMA J C2  1 
HETATM 7252 C C3  . BMA J 5 .   ? -49.346 -5.434  51.046  1.00 200.00 ? 3   BMA J C3  1 
HETATM 7253 C C4  . BMA J 5 .   ? -49.213 -4.840  52.454  1.00 200.00 ? 3   BMA J C4  1 
HETATM 7254 C C5  . BMA J 5 .   ? -47.760 -4.421  52.718  1.00 200.00 ? 3   BMA J C5  1 
HETATM 7255 C C6  . BMA J 5 .   ? -47.545 -3.922  54.134  1.00 200.00 ? 3   BMA J C6  1 
HETATM 7256 O O2  . BMA J 5 .   ? -48.641 -7.660  51.663  1.00 200.00 ? 3   BMA J O2  1 
HETATM 7257 O O3  . BMA J 5 .   ? -50.658 -5.950  50.868  1.00 200.00 ? 3   BMA J O3  1 
HETATM 7258 O O4  . BMA J 5 .   ? -50.065 -3.710  52.578  1.00 200.00 ? 3   BMA J O4  1 
HETATM 7259 O O5  . BMA J 5 .   ? -46.876 -5.547  52.523  1.00 200.00 ? 3   BMA J O5  1 
HETATM 7260 O O6  . BMA J 5 .   ? -46.344 -3.171  54.237  1.00 200.00 ? 3   BMA J O6  1 
HETATM 7261 C C1  . NAG K 3 .   ? -3.848  23.080  -12.027 1.00 170.70 ? 1   NAG K C1  1 
HETATM 7262 C C2  . NAG K 3 .   ? -3.663  23.025  -10.508 1.00 170.70 ? 1   NAG K C2  1 
HETATM 7263 C C3  . NAG K 3 .   ? -2.386  22.254  -10.170 1.00 170.70 ? 1   NAG K C3  1 
HETATM 7264 C C4  . NAG K 3 .   ? -2.400  20.880  -10.843 1.00 170.70 ? 1   NAG K C4  1 
HETATM 7265 C C5  . NAG K 3 .   ? -2.667  21.016  -12.347 1.00 170.70 ? 1   NAG K C5  1 
HETATM 7266 C C6  . NAG K 3 .   ? -2.836  19.672  -13.034 1.00 170.70 ? 1   NAG K C6  1 
HETATM 7267 C C7  . NAG K 3 .   ? -2.674  25.225  -10.383 1.00 170.70 ? 1   NAG K C7  1 
HETATM 7268 C C8  . NAG K 3 .   ? -3.130  26.276  -11.382 1.00 170.70 ? 1   NAG K C8  1 
HETATM 7269 N N2  . NAG K 3 .   ? -3.588  24.361  -9.946  1.00 170.70 ? 1   NAG K N2  1 
HETATM 7270 O O3  . NAG K 3 .   ? -2.280  22.095  -8.761  1.00 170.70 ? 1   NAG K O3  1 
HETATM 7271 O O4  . NAG K 3 .   ? -1.137  20.230  -10.624 1.00 170.70 ? 1   NAG K O4  1 
HETATM 7272 O O5  . NAG K 3 .   ? -3.891  21.751  -12.563 1.00 170.70 ? 1   NAG K O5  1 
HETATM 7273 O O6  . NAG K 3 .   ? -1.729  18.822  -12.784 1.00 170.70 ? 1   NAG K O6  1 
HETATM 7274 O O7  . NAG K 3 .   ? -1.499  25.202  -10.017 1.00 170.70 ? 1   NAG K O7  1 
HETATM 7275 C C1  . NDG K 3 .   ? -1.104  19.376  -9.536  1.00 191.04 ? 2   NDG K C1  1 
HETATM 7276 C C2  . NDG K 3 .   ? 0.323   19.246  -9.005  1.00 191.32 ? 2   NDG K C2  1 
HETATM 7277 C C3  . NDG K 3 .   ? 0.322   18.283  -7.813  1.00 191.32 ? 2   NDG K C3  1 
HETATM 7278 C C4  . NDG K 3 .   ? -0.329  16.943  -8.188  1.00 191.32 ? 2   NDG K C4  1 
HETATM 7279 C C5  . NDG K 3 .   ? -1.697  17.136  -8.870  1.00 191.32 ? 2   NDG K C5  1 
HETATM 7280 C C6  . NDG K 3 .   ? -2.809  17.592  -7.937  1.00 191.32 ? 2   NDG K C6  1 
HETATM 7281 C C7  . NDG K 3 .   ? 2.523   18.905  -9.928  1.00 191.32 ? 2   NDG K C7  1 
HETATM 7282 C C8  . NDG K 3 .   ? 3.293   17.743  -9.322  1.00 191.32 ? 2   NDG K C8  1 
HETATM 7283 O O5  . NDG K 3 .   ? -1.602  18.095  -9.954  1.00 191.32 ? 2   NDG K O5  1 
HETATM 7284 O O3  . NDG K 3 .   ? -0.384  18.870  -6.728  1.00 191.32 ? 2   NDG K O3  1 
HETATM 7285 O O4  . NDG K 3 .   ? 0.535   16.213  -9.047  1.00 191.32 ? 2   NDG K O4  1 
HETATM 7286 O O6  . NDG K 3 .   ? -4.034  16.941  -8.241  1.00 191.32 ? 2   NDG K O6  1 
HETATM 7287 O O7  . NDG K 3 .   ? 3.124   19.920  -10.281 1.00 191.32 ? 2   NDG K O7  1 
HETATM 7288 N N2  . NDG K 3 .   ? 1.207   18.764  -10.051 1.00 191.32 ? 2   NDG K N2  1 
HETATM 7289 C C1  . NAG L 4 .   ? -0.456  31.621  13.732  1.00 116.21 ? 1   NAG L C1  1 
HETATM 7290 C C2  . NAG L 4 .   ? 0.508   30.925  12.765  1.00 116.21 ? 1   NAG L C2  1 
HETATM 7291 C C3  . NAG L 4 .   ? 0.389   29.402  12.858  1.00 116.21 ? 1   NAG L C3  1 
HETATM 7292 C C4  . NAG L 4 .   ? 0.493   28.936  14.317  1.00 116.21 ? 1   NAG L C4  1 
HETATM 7293 C C5  . NAG L 4 .   ? -0.488  29.700  15.221  1.00 116.21 ? 1   NAG L C5  1 
HETATM 7294 C C6  . NAG L 4 .   ? 0.175   30.418  16.384  1.00 116.21 ? 1   NAG L C6  1 
HETATM 7295 C C7  . NAG L 4 .   ? 0.987   30.931  10.399  1.00 116.21 ? 1   NAG L C7  1 
HETATM 7296 C C8  . NAG L 4 .   ? 0.403   29.842  9.514   1.00 116.21 ? 1   NAG L C8  1 
HETATM 7297 N N2  . NAG L 4 .   ? 0.236   31.362  11.408  1.00 116.21 ? 1   NAG L N2  1 
HETATM 7298 O O3  . NAG L 4 .   ? 1.429   28.805  12.097  1.00 116.21 ? 1   NAG L O3  1 
HETATM 7299 O O4  . NAG L 4 .   ? 0.213   27.521  14.412  1.00 116.21 ? 1   NAG L O4  1 
HETATM 7300 O O5  . NAG L 4 .   ? -1.257  30.674  14.466  1.00 116.21 ? 1   NAG L O5  1 
HETATM 7301 O O6  . NAG L 4 .   ? -0.750  30.654  17.437  1.00 116.21 ? 1   NAG L O6  1 
HETATM 7302 O O7  . NAG L 4 .   ? 2.113   31.373  10.165  1.00 116.21 ? 1   NAG L O7  1 
HETATM 7303 C C1  . NDG L 4 .   ? 1.110   26.649  13.811  1.00 166.93 ? 2   NDG L C1  1 
HETATM 7304 C C2  . NDG L 4 .   ? 0.526   26.139  12.490  1.00 166.93 ? 2   NDG L C2  1 
HETATM 7305 C C3  . NDG L 4 .   ? 1.475   25.120  11.861  1.00 166.93 ? 2   NDG L C3  1 
HETATM 7306 C C4  . NDG L 4 .   ? 1.824   24.002  12.860  1.00 166.93 ? 2   NDG L C4  1 
HETATM 7307 C C5  . NDG L 4 .   ? 2.296   24.584  14.204  1.00 166.93 ? 2   NDG L C5  1 
HETATM 7308 C C6  . NDG L 4 .   ? 3.662   25.253  14.152  1.00 166.93 ? 2   NDG L C6  1 
HETATM 7309 C C7  . NDG L 4 .   ? -1.792  25.833  11.913  1.00 166.93 ? 2   NDG L C7  1 
HETATM 7310 C C8  . NDG L 4 .   ? -2.012  24.937  10.704  1.00 166.93 ? 2   NDG L C8  1 
HETATM 7311 O O5  . NDG L 4 .   ? 1.340   25.552  14.710  1.00 166.93 ? 2   NDG L O5  1 
HETATM 7312 O O3  . NDG L 4 .   ? 2.663   25.772  11.437  1.00 166.93 ? 2   NDG L O3  1 
HETATM 7313 O O4  . NDG L 4 .   ? 0.682   23.142  13.083  1.00 166.93 ? 2   NDG L O4  1 
HETATM 7314 O O6  . NDG L 4 .   ? 4.215   25.393  15.452  1.00 166.93 ? 2   NDG L O6  1 
HETATM 7315 O O7  . NDG L 4 .   ? -2.544  26.786  12.113  1.00 166.93 ? 2   NDG L O7  1 
HETATM 7316 N N2  . NDG L 4 .   ? -0.774  25.536  12.715  1.00 166.93 ? 2   NDG L N2  1 
HETATM 7317 C C1  . MAN L 4 .   ? 0.113   22.498  11.989  1.00 193.24 ? 3   MAN L C1  1 
HETATM 7318 C C2  . MAN L 4 .   ? -1.063  21.620  12.456  1.00 193.24 ? 3   MAN L C2  1 
HETATM 7319 C C3  . MAN L 4 .   ? -1.142  20.327  11.641  1.00 193.24 ? 3   MAN L C3  1 
HETATM 7320 C C4  . MAN L 4 .   ? 0.153   19.516  11.784  1.00 193.24 ? 3   MAN L C4  1 
HETATM 7321 C C5  . MAN L 4 .   ? 1.368   20.438  11.966  1.00 193.24 ? 3   MAN L C5  1 
HETATM 7322 C C6  . MAN L 4 .   ? 2.629   19.862  11.349  1.00 193.24 ? 3   MAN L C6  1 
HETATM 7323 O O2  . MAN L 4 .   ? -2.280  22.340  12.325  1.00 193.24 ? 3   MAN L O2  1 
HETATM 7324 O O3  . MAN L 4 .   ? -1.365  20.633  10.273  1.00 193.24 ? 3   MAN L O3  1 
HETATM 7325 O O4  . MAN L 4 .   ? 0.049   18.642  12.899  1.00 193.24 ? 3   MAN L O4  1 
HETATM 7326 O O5  . MAN L 4 .   ? 1.128   21.714  11.330  1.00 193.24 ? 3   MAN L O5  1 
HETATM 7327 O O6  . MAN L 4 .   ? 2.670   20.093  9.948   1.00 193.24 ? 3   MAN L O6  1 
HETATM 7328 C C1  . NAG M 5 .   ? 11.990  37.508  15.580  1.00 116.61 ? 1   NAG M C1  1 
HETATM 7329 C C2  . NAG M 5 .   ? 13.442  37.019  15.423  1.00 117.78 ? 1   NAG M C2  1 
HETATM 7330 C C3  . NAG M 5 .   ? 13.757  35.912  16.434  1.00 120.62 ? 1   NAG M C3  1 
HETATM 7331 C C4  . NAG M 5 .   ? 12.808  34.716  16.260  1.00 122.00 ? 1   NAG M C4  1 
HETATM 7332 C C5  . NAG M 5 .   ? 11.445  35.169  15.727  1.00 121.10 ? 1   NAG M C5  1 
HETATM 7333 C C6  . NAG M 5 .   ? 10.317  34.279  16.212  1.00 123.16 ? 1   NAG M C6  1 
HETATM 7334 C C7  . NAG M 5 .   ? 14.071  37.366  13.124  1.00 119.81 ? 1   NAG M C7  1 
HETATM 7335 C C8  . NAG M 5 .   ? 13.002  37.966  12.224  1.00 118.95 ? 1   NAG M C8  1 
HETATM 7336 N N2  . NAG M 5 .   ? 13.665  36.531  14.075  1.00 117.27 ? 1   NAG M N2  1 
HETATM 7337 O O3  . NAG M 5 .   ? 13.638  36.423  17.753  1.00 121.35 ? 1   NAG M O3  1 
HETATM 7338 O O4  . NAG M 5 .   ? 13.391  33.751  15.364  1.00 123.16 ? 1   NAG M O4  1 
HETATM 7339 O O5  . NAG M 5 .   ? 11.158  36.504  16.189  1.00 118.16 ? 1   NAG M O5  1 
HETATM 7340 O O6  . NAG M 5 .   ? 9.901   33.376  15.198  1.00 123.16 ? 1   NAG M O6  1 
HETATM 7341 O O7  . NAG M 5 .   ? 15.254  37.661  12.953  1.00 122.54 ? 1   NAG M O7  1 
HETATM 7342 C C1  . NDG M 5 .   ? 14.336  32.916  15.935  1.00 146.05 ? 2   NDG M C1  1 
HETATM 7343 C C2  . NDG M 5 .   ? 15.608  32.907  15.102  1.00 146.05 ? 2   NDG M C2  1 
HETATM 7344 C C3  . NDG M 5 .   ? 16.637  32.008  15.788  1.00 146.05 ? 2   NDG M C3  1 
HETATM 7345 C C4  . NDG M 5 .   ? 16.063  30.612  16.098  1.00 146.05 ? 2   NDG M C4  1 
HETATM 7346 C C5  . NDG M 5 .   ? 14.655  30.672  16.729  1.00 146.05 ? 2   NDG M C5  1 
HETATM 7347 C C6  . NDG M 5 .   ? 14.657  31.086  18.191  1.00 146.05 ? 2   NDG M C6  1 
HETATM 7348 C C7  . NDG M 5 .   ? 15.631  33.165  12.708  1.00 146.05 ? 2   NDG M C7  1 
HETATM 7349 C C8  . NDG M 5 .   ? 14.535  34.052  12.140  1.00 146.05 ? 2   NDG M C8  1 
HETATM 7350 O O5  . NDG M 5 .   ? 13.794  31.593  16.010  1.00 146.05 ? 2   NDG M O5  1 
HETATM 7351 O O3  . NDG M 5 .   ? 17.069  32.618  16.994  1.00 146.05 ? 2   NDG M O3  1 
HETATM 7352 O O4  . NDG M 5 .   ? 16.031  29.800  14.905  1.00 146.05 ? 2   NDG M O4  1 
HETATM 7353 O O6  . NDG M 5 .   ? 13.420  31.680  18.556  1.00 146.05 ? 2   NDG M O6  1 
HETATM 7354 O O7  . NDG M 5 .   ? 16.747  33.159  12.186  1.00 146.05 ? 2   NDG M O7  1 
HETATM 7355 N N2  . NDG M 5 .   ? 15.326  32.420  13.766  1.00 146.05 ? 2   NDG M N2  1 
HETATM 7356 C C1  . BMA M 5 .   ? 17.026  28.836  14.781  1.00 180.12 ? 3   BMA M C1  1 
HETATM 7357 C C2  . BMA M 5 .   ? 16.833  27.730  15.832  1.00 180.12 ? 3   BMA M C2  1 
HETATM 7358 C C3  . BMA M 5 .   ? 17.881  26.634  15.631  1.00 180.12 ? 3   BMA M C3  1 
HETATM 7359 C C4  . BMA M 5 .   ? 17.829  26.118  14.192  1.00 180.12 ? 3   BMA M C4  1 
HETATM 7360 C C5  . BMA M 5 .   ? 17.972  27.289  13.212  1.00 180.12 ? 3   BMA M C5  1 
HETATM 7361 C C6  . BMA M 5 .   ? 17.839  26.857  11.763  1.00 180.12 ? 3   BMA M C6  1 
HETATM 7362 O O2  . BMA M 5 .   ? 15.531  27.174  15.710  1.00 180.12 ? 3   BMA M O2  1 
HETATM 7363 O O3  . BMA M 5 .   ? 17.638  25.565  16.533  1.00 180.12 ? 3   BMA M O3  1 
HETATM 7364 O O4  . BMA M 5 .   ? 18.877  25.185  13.982  1.00 180.12 ? 3   BMA M O4  1 
HETATM 7365 O O5  . BMA M 5 .   ? 16.945  28.277  13.461  1.00 180.12 ? 3   BMA M O5  1 
HETATM 7366 O O6  . BMA M 5 .   ? 16.503  26.488  11.453  1.00 180.12 ? 3   BMA M O6  1 
HETATM 7367 C C1  . NAG N 5 .   ? 28.922  32.572  43.273  1.00 75.17  ? 1   NAG N C1  1 
HETATM 7368 C C2  . NAG N 5 .   ? 28.258  32.836  44.623  1.00 76.34  ? 1   NAG N C2  1 
HETATM 7369 C C3  . NAG N 5 .   ? 27.550  34.195  44.593  1.00 79.18  ? 1   NAG N C3  1 
HETATM 7370 C C4  . NAG N 5 .   ? 28.504  35.314  44.139  1.00 80.56  ? 1   NAG N C4  1 
HETATM 7371 C C5  . NAG N 5 .   ? 29.229  34.908  42.844  1.00 79.66  ? 1   NAG N C5  1 
HETATM 7372 C C6  . NAG N 5 .   ? 30.311  35.895  42.441  1.00 83.81  ? 1   NAG N C6  1 
HETATM 7373 C C7  . NAG N 5 .   ? 26.810  31.651  46.142  1.00 78.37  ? 1   NAG N C7  1 
HETATM 7374 C C8  . NAG N 5 .   ? 25.379  32.110  46.357  1.00 77.51  ? 1   NAG N C8  1 
HETATM 7375 N N2  . NAG N 5 .   ? 27.310  31.779  44.918  1.00 75.83  ? 1   NAG N N2  1 
HETATM 7376 O O3  . NAG N 5 .   ? 27.052  34.495  45.886  1.00 79.91  ? 1   NAG N O3  1 
HETATM 7377 O O4  . NAG N 5 .   ? 27.744  36.518  43.887  1.00 83.60  ? 1   NAG N O4  1 
HETATM 7378 O O5  . NAG N 5 .   ? 29.861  33.620  42.995  1.00 76.72  ? 1   NAG N O5  1 
HETATM 7379 O O6  . NAG N 5 .   ? 31.610  35.369  42.675  1.00 85.81  ? 1   NAG N O6  1 
HETATM 7380 O O7  . NAG N 5 .   ? 27.453  31.184  47.081  1.00 81.10  ? 1   NAG N O7  1 
HETATM 7381 C C1  . NDG N 5 .   ? 27.468  37.420  44.914  1.00 131.67 ? 2   NDG N C1  1 
HETATM 7382 C C2  . NDG N 5 .   ? 28.146  38.755  44.650  1.00 132.23 ? 2   NDG N C2  1 
HETATM 7383 C C3  . NDG N 5 .   ? 27.658  39.743  45.706  1.00 132.23 ? 2   NDG N C3  1 
HETATM 7384 C C4  . NDG N 5 .   ? 27.865  39.203  47.133  1.00 132.23 ? 2   NDG N C4  1 
HETATM 7385 C C5  . NDG N 5 .   ? 27.469  37.713  47.299  1.00 132.23 ? 2   NDG N C5  1 
HETATM 7386 C C6  . NDG N 5 .   ? 25.970  37.511  47.456  1.00 132.23 ? 2   NDG N C6  1 
HETATM 7387 C C7  . NDG N 5 .   ? 30.391  39.515  44.195  1.00 132.23 ? 2   NDG N C7  1 
HETATM 7388 C C8  . NDG N 5 .   ? 30.970  40.567  45.124  1.00 132.23 ? 2   NDG N C8  1 
HETATM 7389 O O5  . NDG N 5 .   ? 27.913  36.904  46.175  1.00 132.23 ? 2   NDG N O5  1 
HETATM 7390 O O3  . NDG N 5 .   ? 26.281  40.020  45.503  1.00 132.23 ? 2   NDG N O3  1 
HETATM 7391 O O4  . NDG N 5 .   ? 29.224  39.418  47.564  1.00 132.23 ? 2   NDG N O4  1 
HETATM 7392 O O6  . NDG N 5 .   ? 25.543  36.304  46.843  1.00 132.23 ? 2   NDG N O6  1 
HETATM 7393 O O7  . NDG N 5 .   ? 30.675  39.533  42.998  1.00 132.23 ? 2   NDG N O7  1 
HETATM 7394 N N2  . NDG N 5 .   ? 29.587  38.602  44.733  1.00 132.23 ? 2   NDG N N2  1 
HETATM 7395 C C1  . BMA N 5 .   ? 29.421  40.535  48.368  1.00 200.00 ? 3   BMA N C1  1 
HETATM 7396 C C2  . BMA N 5 .   ? 30.816  40.495  49.004  1.00 200.00 ? 3   BMA N C2  1 
HETATM 7397 C C3  . BMA N 5 .   ? 31.059  41.774  49.814  1.00 200.00 ? 3   BMA N C3  1 
HETATM 7398 C C4  . BMA N 5 .   ? 30.804  43.013  48.948  1.00 200.00 ? 3   BMA N C4  1 
HETATM 7399 C C5  . BMA N 5 .   ? 29.411  42.933  48.314  1.00 200.00 ? 3   BMA N C5  1 
HETATM 7400 C C6  . BMA N 5 .   ? 29.137  44.084  47.364  1.00 200.00 ? 3   BMA N C6  1 
HETATM 7401 O O2  . BMA N 5 .   ? 31.804  40.374  47.992  1.00 200.00 ? 3   BMA N O2  1 
HETATM 7402 O O3  . BMA N 5 .   ? 32.396  41.792  50.291  1.00 200.00 ? 3   BMA N O3  1 
HETATM 7403 O O4  . BMA N 5 .   ? 30.901  44.185  49.746  1.00 200.00 ? 3   BMA N O4  1 
HETATM 7404 O O5  . BMA N 5 .   ? 29.282  41.711  47.553  1.00 200.00 ? 3   BMA N O5  1 
HETATM 7405 O O6  . BMA N 5 .   ? 30.133  44.169  46.356  1.00 200.00 ? 3   BMA N O6  1 
HETATM 7406 C C1  . NAG O 4 .   ? -29.694 11.187  5.308   1.00 200.00 ? 1   NAG O C1  1 
HETATM 7407 C C2  . NAG O 4 .   ? -29.970 10.172  4.186   1.00 200.00 ? 1   NAG O C2  1 
HETATM 7408 C C3  . NAG O 4 .   ? -30.306 8.790   4.763   1.00 200.00 ? 1   NAG O C3  1 
HETATM 7409 C C4  . NAG O 4 .   ? -29.434 8.491   5.987   1.00 200.00 ? 1   NAG O C4  1 
HETATM 7410 C C5  . NAG O 4 .   ? -29.658 9.548   7.082   1.00 200.00 ? 1   NAG O C5  1 
HETATM 7411 C C6  . NAG O 4 .   ? -28.376 9.975   7.773   1.00 200.00 ? 1   NAG O C6  1 
HETATM 7412 C C7  . NAG O 4 .   ? -30.871 10.852  2.056   1.00 200.00 ? 1   NAG O C7  1 
HETATM 7413 C C8  . NAG O 4 .   ? -31.100 9.680   1.115   1.00 200.00 ? 1   NAG O C8  1 
HETATM 7414 N N2  . NAG O 4 .   ? -31.064 10.635  3.354   1.00 200.00 ? 1   NAG O N2  1 
HETATM 7415 O O3  . NAG O 4 .   ? -30.097 7.793   3.773   1.00 200.00 ? 1   NAG O O3  1 
HETATM 7416 O O4  . NAG O 4 .   ? -29.759 7.186   6.509   1.00 200.00 ? 1   NAG O O4  1 
HETATM 7417 O O5  . NAG O 4 .   ? -30.281 10.743  6.542   1.00 200.00 ? 1   NAG O O5  1 
HETATM 7418 O O6  . NAG O 4 .   ? -28.652 10.656  8.988   1.00 200.00 ? 1   NAG O O6  1 
HETATM 7419 O O7  . NAG O 4 .   ? -30.524 11.943  1.604   1.00 200.00 ? 1   NAG O O7  1 
HETATM 7420 C C1  . NDG O 4 .   ? -28.935 6.134   6.132   1.00 197.88 ? 2   NDG O C1  1 
HETATM 7421 C C2  . NDG O 4 .   ? -29.559 4.801   6.574   1.00 197.88 ? 2   NDG O C2  1 
HETATM 7422 C C3  . NDG O 4 .   ? -28.495 3.694   6.632   1.00 197.88 ? 2   NDG O C3  1 
HETATM 7423 C C4  . NDG O 4 .   ? -27.270 4.068   5.784   1.00 197.88 ? 2   NDG O C4  1 
HETATM 7424 C C5  . NDG O 4 .   ? -26.643 5.392   6.271   1.00 197.88 ? 2   NDG O C5  1 
HETATM 7425 C C6  . NDG O 4 .   ? -25.883 6.118   5.176   1.00 197.88 ? 2   NDG O C6  1 
HETATM 7426 C C7  . NDG O 4 .   ? -31.139 4.122   8.266   1.00 197.88 ? 2   NDG O C7  1 
HETATM 7427 C C8  . NDG O 4 .   ? -32.575 4.553   8.012   1.00 197.88 ? 2   NDG O C8  1 
HETATM 7428 O O5  . NDG O 4 .   ? -27.657 6.308   6.765   1.00 197.88 ? 2   NDG O O5  1 
HETATM 7429 O O3  . NDG O 4 .   ? -29.048 2.474   6.159   1.00 197.88 ? 2   NDG O O3  1 
HETATM 7430 O O4  . NDG O 4 .   ? -26.287 3.005   5.807   1.00 197.88 ? 2   NDG O O4  1 
HETATM 7431 O O6  . NDG O 4 .   ? -25.688 7.485   5.505   1.00 197.88 ? 2   NDG O O6  1 
HETATM 7432 O O7  . NDG O 4 .   ? -30.911 3.043   8.812   1.00 197.88 ? 2   NDG O O7  1 
HETATM 7433 N N2  . NDG O 4 .   ? -30.176 4.954   7.879   1.00 197.88 ? 2   NDG O N2  1 
HETATM 7434 C C1  . MAN O 4 .   ? -25.836 2.545   7.041   1.00 166.63 ? 3   MAN O C1  1 
HETATM 7435 C C2  . MAN O 4 .   ? -24.365 2.949   7.248   1.00 166.63 ? 3   MAN O C2  1 
HETATM 7436 C C3  . MAN O 4 .   ? -23.574 1.819   7.918   1.00 166.63 ? 3   MAN O C3  1 
HETATM 7437 C C4  . MAN O 4 .   ? -23.620 0.540   7.071   1.00 166.63 ? 3   MAN O C4  1 
HETATM 7438 C C5  . MAN O 4 .   ? -24.965 0.411   6.344   1.00 166.63 ? 3   MAN O C5  1 
HETATM 7439 C C6  . MAN O 4 .   ? -25.413 -1.029  6.209   1.00 166.63 ? 3   MAN O C6  1 
HETATM 7440 O O2  . MAN O 4 .   ? -24.301 4.116   8.054   1.00 166.63 ? 3   MAN O O2  1 
HETATM 7441 O O3  . MAN O 4 .   ? -24.113 1.556   9.206   1.00 166.63 ? 3   MAN O O3  1 
HETATM 7442 O O4  . MAN O 4 .   ? -22.564 0.554   6.122   1.00 166.63 ? 3   MAN O O4  1 
HETATM 7443 O O5  . MAN O 4 .   ? -25.996 1.113   7.073   1.00 166.63 ? 3   MAN O O5  1 
HETATM 7444 O O6  . MAN O 4 .   ? -25.490 -1.417  4.845   1.00 166.63 ? 3   MAN O O6  1 
HETATM 7445 C C1  . NAG P 5 .   ? -29.937 13.576  -5.224  1.00 200.00 ? 1   NAG P C1  1 
HETATM 7446 C C2  . NAG P 5 .   ? -29.349 12.198  -4.880  1.00 200.00 ? 1   NAG P C2  1 
HETATM 7447 C C3  . NAG P 5 .   ? -28.824 11.505  -6.141  1.00 200.00 ? 1   NAG P C3  1 
HETATM 7448 C C4  . NAG P 5 .   ? -29.929 11.448  -7.202  1.00 200.00 ? 1   NAG P C4  1 
HETATM 7449 C C5  . NAG P 5 .   ? -30.431 12.871  -7.475  1.00 200.00 ? 1   NAG P C5  1 
HETATM 7450 C C6  . NAG P 5 .   ? -31.558 12.915  -8.491  1.00 200.00 ? 1   NAG P C6  1 
HETATM 7451 C C7  . NAG P 5 .   ? -28.131 11.432  -2.948  1.00 200.00 ? 1   NAG P C7  1 
HETATM 7452 C C8  . NAG P 5 .   ? -28.803 11.718  -1.615  1.00 200.00 ? 1   NAG P C8  1 
HETATM 7453 N N2  . NAG P 5 .   ? -28.278 12.337  -3.912  1.00 200.00 ? 1   NAG P N2  1 
HETATM 7454 O O3  . NAG P 5 .   ? -28.395 10.190  -5.818  1.00 200.00 ? 1   NAG P O3  1 
HETATM 7455 O O4  . NAG P 5 .   ? -29.421 10.857  -8.421  1.00 200.00 ? 1   NAG P O4  1 
HETATM 7456 O O5  . NAG P 5 .   ? -30.936 13.463  -6.255  1.00 200.00 ? 1   NAG P O5  1 
HETATM 7457 O O6  . NAG P 5 .   ? -32.635 12.074  -8.104  1.00 200.00 ? 1   NAG P O6  1 
HETATM 7458 O O7  . NAG P 5 .   ? -27.484 10.394  -3.098  1.00 200.00 ? 1   NAG P O7  1 
HETATM 7459 C C1  . NDG P 5 .   ? -29.297 9.473   -8.440  1.00 200.00 ? 2   NDG P C1  1 
HETATM 7460 C C2  . NDG P 5 .   ? -28.381 9.034   -9.577  1.00 200.00 ? 2   NDG P C2  1 
HETATM 7461 C C3  . NDG P 5 .   ? -28.206 7.521   -9.482  1.00 200.00 ? 2   NDG P C3  1 
HETATM 7462 C C4  . NDG P 5 .   ? -29.572 6.813   -9.516  1.00 200.00 ? 2   NDG P C4  1 
HETATM 7463 C C5  . NDG P 5 .   ? -30.586 7.435   -8.529  1.00 200.00 ? 2   NDG P C5  1 
HETATM 7464 C C6  . NDG P 5 .   ? -30.337 7.059   -7.077  1.00 200.00 ? 2   NDG P C6  1 
HETATM 7465 C C7  . NDG P 5 .   ? -28.910 10.627  -11.313 1.00 200.00 ? 2   NDG P C7  1 
HETATM 7466 C C8  . NDG P 5 .   ? -27.682 11.009  -12.125 1.00 200.00 ? 2   NDG P C8  1 
HETATM 7467 O O5  . NDG P 5 .   ? -30.596 8.888   -8.617  1.00 200.00 ? 2   NDG P O5  1 
HETATM 7468 O O3  . NDG P 5 .   ? -27.525 7.190   -8.280  1.00 200.00 ? 2   NDG P O3  1 
HETATM 7469 O O4  . NDG P 5 .   ? -30.111 6.835   -10.854 1.00 200.00 ? 2   NDG P O4  1 
HETATM 7470 O O6  . NDG P 5 .   ? -30.917 5.800   -6.766  1.00 200.00 ? 2   NDG P O6  1 
HETATM 7471 O O7  . NDG P 5 .   ? -29.794 11.459  -11.110 1.00 200.00 ? 2   NDG P O7  1 
HETATM 7472 N N2  . NDG P 5 .   ? -28.974 9.380   -10.857 1.00 200.00 ? 2   NDG P N2  1 
HETATM 7473 C C1  . BMA P 5 .   ? -29.537 5.952   -11.758 1.00 200.00 ? 3   BMA P C1  1 
HETATM 7474 C C2  . BMA P 5 .   ? -29.964 4.514   -11.439 1.00 200.00 ? 3   BMA P C2  1 
HETATM 7475 C C3  . BMA P 5 .   ? -29.403 3.554   -12.493 1.00 200.00 ? 3   BMA P C3  1 
HETATM 7476 C C4  . BMA P 5 .   ? -29.777 4.025   -13.903 1.00 200.00 ? 3   BMA P C4  1 
HETATM 7477 C C5  . BMA P 5 .   ? -29.366 5.490   -14.098 1.00 200.00 ? 3   BMA P C5  1 
HETATM 7478 C C6  . BMA P 5 .   ? -29.792 6.051   -15.442 1.00 200.00 ? 3   BMA P C6  1 
HETATM 7479 O O2  . BMA P 5 .   ? -31.381 4.429   -11.417 1.00 200.00 ? 3   BMA P O2  1 
HETATM 7480 O O3  . BMA P 5 .   ? -29.917 2.249   -12.274 1.00 200.00 ? 3   BMA P O3  1 
HETATM 7481 O O4  . BMA P 5 .   ? -29.122 3.213   -14.868 1.00 200.00 ? 3   BMA P O4  1 
HETATM 7482 O O5  . BMA P 5 .   ? -29.970 6.315   -13.077 1.00 200.00 ? 3   BMA P O5  1 
HETATM 7483 O O6  . BMA P 5 .   ? -31.045 5.522   -15.851 1.00 200.00 ? 3   BMA P O6  1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'NAG H 1 HAS WRONG CHIRALITY AT ATOM C1' 
2 'NAG I 1 HAS WRONG CHIRALITY AT ATOM C1' 
3 'NAG J 1 HAS WRONG CHIRALITY AT ATOM C1' 
4 'NAG O 1 HAS WRONG CHIRALITY AT ATOM C1' 
5 'NAG P 1 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   36  36  CYS CYS A . n 
A 1 2   PRO 2   37  37  PRO PRO A . n 
A 1 3   ASP 3   38  38  ASP ASP A . n 
A 1 4   ALA 4   39  39  ALA ALA A . n 
A 1 5   CYS 5   40  40  CYS CYS A . n 
A 1 6   CYS 6   41  41  CYS CYS A . n 
A 1 7   PRO 7   42  42  PRO PRO A . n 
A 1 8   HIS 8   43  43  HIS HIS A . n 
A 1 9   GLY 9   44  44  GLY GLY A . n 
A 1 10  SER 10  45  45  SER SER A . n 
A 1 11  SER 11  46  46  SER SER A . n 
A 1 12  GLY 12  47  47  GLY GLY A . n 
A 1 13  LEU 13  48  48  LEU LEU A . n 
A 1 14  ARG 14  49  49  ARG ARG A . n 
A 1 15  CYS 15  50  50  CYS CYS A . n 
A 1 16  THR 16  51  51  THR THR A . n 
A 1 17  ARG 17  52  52  ARG ARG A . n 
A 1 18  ASP 18  53  53  ASP ASP A . n 
A 1 19  GLY 19  54  54  GLY GLY A . n 
A 1 20  ALA 20  55  55  ALA ALA A . n 
A 1 21  LEU 21  56  56  LEU LEU A . n 
A 1 22  ASP 22  57  57  ASP ASP A . n 
A 1 23  SER 23  58  58  SER SER A . n 
A 1 24  LEU 24  59  59  LEU LEU A . n 
A 1 25  HIS 25  60  60  HIS HIS A . n 
A 1 26  HIS 26  61  61  HIS HIS A . n 
A 1 27  LEU 27  62  62  LEU LEU A . n 
A 1 28  PRO 28  63  63  PRO PRO A . n 
A 1 29  GLY 29  64  64  GLY GLY A . n 
A 1 30  ALA 30  65  65  ALA ALA A . n 
A 1 31  GLU 31  66  66  GLU GLU A . n 
A 1 32  ASN 32  67  67  ASN ASN A . n 
A 1 33  LEU 33  68  68  LEU LEU A . n 
A 1 34  THR 34  69  69  THR THR A . n 
A 1 35  GLU 35  70  70  GLU GLU A . n 
A 1 36  LEU 36  71  71  LEU LEU A . n 
A 1 37  TYR 37  72  72  TYR TYR A . n 
A 1 38  ILE 38  73  73  ILE ILE A . n 
A 1 39  GLU 39  74  74  GLU GLU A . n 
A 1 40  ASN 40  75  75  ASN ASN A . n 
A 1 41  GLN 41  76  76  GLN GLN A . n 
A 1 42  GLN 42  77  77  GLN GLN A . n 
A 1 43  HIS 43  78  78  HIS HIS A . n 
A 1 44  LEU 44  79  79  LEU LEU A . n 
A 1 45  GLN 45  80  80  GLN GLN A . n 
A 1 46  HIS 46  81  81  HIS HIS A . n 
A 1 47  LEU 47  82  82  LEU LEU A . n 
A 1 48  GLU 48  83  83  GLU GLU A . n 
A 1 49  LEU 49  84  84  LEU LEU A . n 
A 1 50  ARG 50  85  85  ARG ARG A . n 
A 1 51  ASP 51  86  86  ASP ASP A . n 
A 1 52  LEU 52  87  87  LEU LEU A . n 
A 1 53  ARG 53  88  88  ARG ARG A . n 
A 1 54  GLY 54  89  89  GLY GLY A . n 
A 1 55  LEU 55  90  90  LEU LEU A . n 
A 1 56  GLY 56  91  91  GLY GLY A . n 
A 1 57  GLU 57  92  92  GLU GLU A . n 
A 1 58  LEU 58  93  93  LEU LEU A . n 
A 1 59  ARG 59  94  94  ARG ARG A . n 
A 1 60  ASN 60  95  95  ASN ASN A . n 
A 1 61  LEU 61  96  96  LEU LEU A . n 
A 1 62  THR 62  97  97  THR THR A . n 
A 1 63  ILE 63  98  98  ILE ILE A . n 
A 1 64  VAL 64  99  99  VAL VAL A . n 
A 1 65  LYS 65  100 100 LYS LYS A . n 
A 1 66  SER 66  101 101 SER SER A . n 
A 1 67  GLY 67  102 102 GLY GLY A . n 
A 1 68  LEU 68  103 103 LEU LEU A . n 
A 1 69  ARG 69  104 104 ARG ARG A . n 
A 1 70  PHE 70  105 105 PHE PHE A . n 
A 1 71  VAL 71  106 106 VAL VAL A . n 
A 1 72  ALA 72  107 107 ALA ALA A . n 
A 1 73  PRO 73  108 108 PRO PRO A . n 
A 1 74  ASP 74  109 109 ASP ASP A . n 
A 1 75  ALA 75  110 110 ALA ALA A . n 
A 1 76  PHE 76  111 111 PHE PHE A . n 
A 1 77  HIS 77  112 112 HIS HIS A . n 
A 1 78  PHE 78  113 113 PHE PHE A . n 
A 1 79  THR 79  114 114 THR THR A . n 
A 1 80  PRO 80  115 115 PRO PRO A . n 
A 1 81  ARG 81  116 116 ARG ARG A . n 
A 1 82  LEU 82  117 117 LEU LEU A . n 
A 1 83  SER 83  118 118 SER SER A . n 
A 1 84  ARG 84  119 119 ARG ARG A . n 
A 1 85  LEU 85  120 120 LEU LEU A . n 
A 1 86  ASN 86  121 121 ASN ASN A . n 
A 1 87  LEU 87  122 122 LEU LEU A . n 
A 1 88  SER 88  123 123 SER SER A . n 
A 1 89  PHE 89  124 124 PHE PHE A . n 
A 1 90  ASN 90  125 125 ASN ASN A . n 
A 1 91  ALA 91  126 126 ALA ALA A . n 
A 1 92  LEU 92  127 127 LEU LEU A . n 
A 1 93  GLU 93  128 128 GLU GLU A . n 
A 1 94  SER 94  129 129 SER SER A . n 
A 1 95  LEU 95  130 130 LEU LEU A . n 
A 1 96  SER 96  131 131 SER SER A . n 
A 1 97  TRP 97  132 132 TRP TRP A . n 
A 1 98  LYS 98  133 133 LYS LYS A . n 
A 1 99  THR 99  134 134 THR THR A . n 
A 1 100 VAL 100 135 135 VAL VAL A . n 
A 1 101 GLN 101 136 136 GLN GLN A . n 
A 1 102 GLY 102 137 137 GLY GLY A . n 
A 1 103 LEU 103 138 138 LEU LEU A . n 
A 1 104 SER 104 139 139 SER SER A . n 
A 1 105 LEU 105 140 140 LEU LEU A . n 
A 1 106 GLN 106 141 141 GLN GLN A . n 
A 1 107 GLU 107 142 142 GLU GLU A . n 
A 1 108 LEU 108 143 143 LEU LEU A . n 
A 1 109 VAL 109 144 144 VAL VAL A . n 
A 1 110 LEU 110 145 145 LEU LEU A . n 
A 1 111 SER 111 146 146 SER SER A . n 
A 1 112 GLY 112 147 147 GLY GLY A . n 
A 1 113 ASN 113 148 148 ASN ASN A . n 
A 1 114 PRO 114 149 149 PRO PRO A . n 
A 1 115 LEU 115 150 150 LEU LEU A . n 
A 1 116 HIS 116 151 151 HIS HIS A . n 
A 1 117 CYS 117 152 152 CYS CYS A . n 
A 1 118 SER 118 153 153 SER SER A . n 
A 1 119 CYS 119 154 154 CYS CYS A . n 
A 1 120 ALA 120 155 155 ALA ALA A . n 
A 1 121 LEU 121 156 156 LEU LEU A . n 
A 1 122 ARG 122 157 157 ARG ARG A . n 
A 1 123 TRP 123 158 158 TRP TRP A . n 
A 1 124 LEU 124 159 159 LEU LEU A . n 
A 1 125 GLN 125 160 160 GLN GLN A . n 
A 1 126 ARG 126 161 161 ARG ARG A . n 
A 1 127 TRP 127 162 162 TRP TRP A . n 
A 1 128 GLU 128 163 163 GLU GLU A . n 
A 1 129 GLU 129 164 164 GLU GLU A . n 
A 1 130 GLU 130 165 165 GLU GLU A . n 
A 1 131 GLY 131 166 166 GLY GLY A . n 
A 1 132 LEU 132 167 167 LEU LEU A . n 
A 1 133 GLY 133 168 168 GLY GLY A . n 
A 1 134 GLY 134 169 169 GLY GLY A . n 
A 1 135 VAL 135 170 170 VAL VAL A . n 
A 1 136 PRO 136 171 171 PRO PRO A . n 
A 1 137 GLU 137 172 172 GLU GLU A . n 
A 1 138 GLN 138 173 173 GLN GLN A . n 
A 1 139 LYS 139 174 174 LYS LYS A . n 
A 1 140 LEU 140 175 175 LEU LEU A . n 
A 1 141 GLN 141 176 176 GLN GLN A . n 
A 1 142 CYS 142 177 177 CYS CYS A . n 
A 1 143 HIS 143 178 178 HIS HIS A . n 
A 1 144 GLY 144 179 179 GLY GLY A . n 
A 1 145 GLN 145 180 180 GLN GLN A . n 
A 1 146 GLY 146 181 181 GLY GLY A . n 
A 1 147 PRO 147 182 182 PRO PRO A . n 
A 1 148 LEU 148 183 183 LEU LEU A . n 
A 1 149 ALA 149 184 184 ALA ALA A . n 
A 1 150 HIS 150 185 185 HIS HIS A . n 
A 1 151 MET 151 186 186 MET MET A . n 
A 1 152 PRO 152 187 187 PRO PRO A . n 
A 1 153 ASN 153 188 188 ASN ASN A . n 
A 1 154 ALA 154 189 189 ALA ALA A . n 
A 1 155 SER 155 190 190 SER SER A . n 
A 1 156 CYS 156 191 191 CYS CYS A . n 
A 1 157 GLY 157 192 192 GLY GLY A . n 
A 1 158 VAL 158 193 193 VAL VAL A . n 
A 1 159 PRO 159 194 194 PRO PRO A . n 
A 1 160 THR 160 195 195 THR THR A . n 
A 1 161 LEU 161 196 196 LEU LEU A . n 
A 1 162 LYS 162 197 197 LYS LYS A . n 
A 1 163 VAL 163 198 198 VAL VAL A . n 
A 1 164 GLN 164 199 199 GLN GLN A . n 
A 1 165 VAL 165 200 200 VAL VAL A . n 
A 1 166 PRO 166 201 201 PRO PRO A . n 
A 1 167 ASN 167 202 202 ASN ASN A . n 
A 1 168 ALA 168 203 203 ALA ALA A . n 
A 1 169 SER 169 204 204 SER SER A . n 
A 1 170 VAL 170 205 205 VAL VAL A . n 
A 1 171 ASP 171 206 206 ASP ASP A . n 
A 1 172 VAL 172 207 207 VAL VAL A . n 
A 1 173 GLY 173 208 208 GLY GLY A . n 
A 1 174 ASP 174 209 209 ASP ASP A . n 
A 1 175 ASP 175 210 210 ASP ASP A . n 
A 1 176 VAL 176 211 211 VAL VAL A . n 
A 1 177 LEU 177 212 212 LEU LEU A . n 
A 1 178 LEU 178 213 213 LEU LEU A . n 
A 1 179 ARG 179 214 214 ARG ARG A . n 
A 1 180 CYS 180 215 215 CYS CYS A . n 
A 1 181 GLN 181 216 216 GLN GLN A . n 
A 1 182 VAL 182 217 217 VAL VAL A . n 
A 1 183 GLU 183 218 218 GLU GLU A . n 
A 1 184 GLY 184 219 219 GLY GLY A . n 
A 1 185 ARG 185 220 220 ARG ARG A . n 
A 1 186 GLY 186 221 221 GLY GLY A . n 
A 1 187 LEU 187 222 222 LEU LEU A . n 
A 1 188 GLU 188 223 223 GLU GLU A . n 
A 1 189 GLN 189 224 224 GLN GLN A . n 
A 1 190 ALA 190 225 225 ALA ALA A . n 
A 1 191 GLY 191 226 226 GLY GLY A . n 
A 1 192 TRP 192 227 227 TRP TRP A . n 
A 1 193 ILE 193 228 228 ILE ILE A . n 
A 1 194 LEU 194 229 229 LEU LEU A . n 
A 1 195 THR 195 230 230 THR THR A . n 
A 1 196 GLU 196 231 231 GLU GLU A . n 
A 1 197 LEU 197 232 232 LEU LEU A . n 
A 1 198 GLU 198 233 233 GLU GLU A . n 
A 1 199 GLN 199 234 234 GLN GLN A . n 
A 1 200 SER 200 235 235 SER SER A . n 
A 1 201 ALA 201 236 236 ALA ALA A . n 
A 1 202 THR 202 237 237 THR THR A . n 
A 1 203 VAL 203 238 238 VAL VAL A . n 
A 1 204 MET 204 239 239 MET MET A . n 
A 1 205 LYS 205 240 240 LYS LYS A . n 
A 1 206 SER 206 241 241 SER SER A . n 
A 1 207 GLY 207 242 242 GLY GLY A . n 
A 1 208 GLY 208 243 243 GLY GLY A . n 
A 1 209 LEU 209 244 244 LEU LEU A . n 
A 1 210 PRO 210 245 245 PRO PRO A . n 
A 1 211 SER 211 246 246 SER SER A . n 
A 1 212 LEU 212 247 247 LEU LEU A . n 
A 1 213 GLY 213 248 248 GLY GLY A . n 
A 1 214 LEU 214 249 249 LEU LEU A . n 
A 1 215 THR 215 250 250 THR THR A . n 
A 1 216 LEU 216 251 251 LEU LEU A . n 
A 1 217 ALA 217 252 252 ALA ALA A . n 
A 1 218 ASN 218 253 253 ASN ASN A . n 
A 1 219 VAL 219 254 254 VAL VAL A . n 
A 1 220 THR 220 255 255 THR THR A . n 
A 1 221 SER 221 256 256 SER SER A . n 
A 1 222 ASP 222 257 257 ASP ASP A . n 
A 1 223 LEU 223 258 258 LEU LEU A . n 
A 1 224 ASN 224 259 259 ASN ASN A . n 
A 1 225 ARG 225 260 260 ARG ARG A . n 
A 1 226 LYS 226 261 261 LYS LYS A . n 
A 1 227 ASN 227 262 262 ASN ASN A . n 
A 1 228 VAL 228 263 263 VAL VAL A . n 
A 1 229 THR 229 264 264 THR THR A . n 
A 1 230 CYS 230 265 265 CYS CYS A . n 
A 1 231 TRP 231 266 266 TRP TRP A . n 
A 1 232 ALA 232 267 267 ALA ALA A . n 
A 1 233 GLU 233 268 268 GLU GLU A . n 
A 1 234 ASN 234 269 269 ASN ASN A . n 
A 1 235 ASP 235 270 270 ASP ASP A . n 
A 1 236 VAL 236 271 271 VAL VAL A . n 
A 1 237 GLY 237 272 272 GLY GLY A . n 
A 1 238 ARG 238 273 273 ARG ARG A . n 
A 1 239 ALA 239 274 274 ALA ALA A . n 
A 1 240 GLU 240 275 275 GLU GLU A . n 
A 1 241 VAL 241 276 276 VAL VAL A . n 
A 1 242 SER 242 277 277 SER SER A . n 
A 1 243 VAL 243 278 278 VAL VAL A . n 
A 1 244 GLN 244 279 279 GLN GLN A . n 
A 1 245 VAL 245 280 280 VAL VAL A . n 
A 1 246 ASN 246 281 281 ASN ASN A . n 
A 1 247 VAL 247 282 282 VAL VAL A . n 
A 1 248 SER 248 283 283 SER SER A . n 
A 1 249 PHE 249 284 284 PHE PHE A . n 
A 1 250 PRO 250 285 285 PRO PRO A . n 
A 1 251 ALA 251 286 286 ALA ALA A . n 
A 1 252 SER 252 287 287 SER SER A . n 
A 1 253 VAL 253 288 288 VAL VAL A . n 
A 1 254 GLN 254 289 289 GLN GLN A . n 
A 1 255 LEU 255 290 290 LEU LEU A . n 
A 1 256 HIS 256 291 291 HIS HIS A . n 
A 1 257 THR 257 292 292 THR THR A . n 
A 1 258 ALA 258 293 293 ALA ALA A . n 
A 1 259 VAL 259 294 294 VAL VAL A . n 
A 1 260 GLU 260 295 295 GLU GLU A . n 
A 1 261 MET 261 296 296 MET MET A . n 
A 1 262 HIS 262 297 297 HIS HIS A . n 
A 1 263 HIS 263 298 298 HIS HIS A . n 
A 1 264 TRP 264 299 299 TRP TRP A . n 
A 1 265 CYS 265 300 300 CYS CYS A . n 
A 1 266 ILE 266 301 301 ILE ILE A . n 
A 1 267 PRO 267 302 302 PRO PRO A . n 
A 1 268 PHE 268 303 303 PHE PHE A . n 
A 1 269 SER 269 304 304 SER SER A . n 
A 1 270 VAL 270 305 305 VAL VAL A . n 
A 1 271 ASP 271 306 306 ASP ASP A . n 
A 1 272 GLY 272 307 307 GLY GLY A . n 
A 1 273 GLN 273 308 308 GLN GLN A . n 
A 1 274 PRO 274 309 309 PRO PRO A . n 
A 1 275 ALA 275 310 310 ALA ALA A . n 
A 1 276 PRO 276 311 311 PRO PRO A . n 
A 1 277 SER 277 312 312 SER SER A . n 
A 1 278 LEU 278 313 313 LEU LEU A . n 
A 1 279 ARG 279 314 314 ARG ARG A . n 
A 1 280 TRP 280 315 315 TRP TRP A . n 
A 1 281 LEU 281 316 316 LEU LEU A . n 
A 1 282 PHE 282 317 317 PHE PHE A . n 
A 1 283 ASN 283 318 318 ASN ASN A . n 
A 1 284 GLY 284 319 319 GLY GLY A . n 
A 1 285 SER 285 320 320 SER SER A . n 
A 1 286 VAL 286 321 321 VAL VAL A . n 
A 1 287 LEU 287 322 322 LEU LEU A . n 
A 1 288 ASN 288 323 323 ASN ASN A . n 
A 1 289 GLU 289 324 324 GLU GLU A . n 
A 1 290 THR 290 325 325 THR THR A . n 
A 1 291 SER 291 326 326 SER SER A . n 
A 1 292 PHE 292 327 327 PHE PHE A . n 
A 1 293 ILE 293 328 328 ILE ILE A . n 
A 1 294 PHE 294 329 329 PHE PHE A . n 
A 1 295 THR 295 330 330 THR THR A . n 
A 1 296 GLU 296 331 331 GLU GLU A . n 
A 1 297 PHE 297 332 332 PHE PHE A . n 
A 1 298 LEU 298 333 333 LEU LEU A . n 
A 1 299 GLU 299 334 334 GLU GLU A . n 
A 1 300 PRO 300 335 335 PRO PRO A . n 
A 1 301 ALA 301 336 336 ALA ALA A . n 
A 1 302 ALA 302 337 337 ALA ALA A . n 
A 1 303 ASN 303 338 338 ASN ASN A . n 
A 1 304 GLU 304 339 339 GLU GLU A . n 
A 1 305 THR 305 340 340 THR THR A . n 
A 1 306 VAL 306 341 341 VAL VAL A . n 
A 1 307 ARG 307 342 342 ARG ARG A . n 
A 1 308 HIS 308 343 343 HIS HIS A . n 
A 1 309 GLY 309 344 344 GLY GLY A . n 
A 1 310 CYS 310 345 345 CYS CYS A . n 
A 1 311 LEU 311 346 346 LEU LEU A . n 
A 1 312 ARG 312 347 347 ARG ARG A . n 
A 1 313 LEU 313 348 348 LEU LEU A . n 
A 1 314 ASN 314 349 349 ASN ASN A . n 
A 1 315 GLN 315 350 350 GLN GLN A . n 
A 1 316 PRO 316 351 351 PRO PRO A . n 
A 1 317 THR 317 352 352 THR THR A . n 
A 1 318 HIS 318 353 353 HIS HIS A . n 
A 1 319 VAL 319 354 354 VAL VAL A . n 
A 1 320 ASN 320 355 355 ASN ASN A . n 
A 1 321 ASN 321 356 356 ASN ASN A . n 
A 1 322 GLY 322 357 357 GLY GLY A . n 
A 1 323 ASN 323 358 358 ASN ASN A . n 
A 1 324 TYR 324 359 359 TYR TYR A . n 
A 1 325 THR 325 360 360 THR THR A . n 
A 1 326 LEU 326 361 361 LEU LEU A . n 
A 1 327 LEU 327 362 362 LEU LEU A . n 
A 1 328 ALA 328 363 363 ALA ALA A . n 
A 1 329 ALA 329 364 364 ALA ALA A . n 
A 1 330 ASN 330 365 365 ASN ASN A . n 
A 1 331 PRO 331 366 366 PRO PRO A . n 
A 1 332 PHE 332 367 367 PHE PHE A . n 
A 1 333 GLY 333 368 368 GLY GLY A . n 
A 1 334 GLN 334 369 369 GLN GLN A . n 
A 1 335 ALA 335 370 370 ALA ALA A . n 
A 1 336 SER 336 371 371 SER SER A . n 
A 1 337 ALA 337 372 372 ALA ALA A . n 
A 1 338 SER 338 373 373 SER SER A . n 
A 1 339 ILE 339 374 374 ILE ILE A . n 
A 1 340 MET 340 375 375 MET MET A . n 
A 1 341 ALA 341 376 376 ALA ALA A . n 
A 1 342 ALA 342 377 377 ALA ALA A . n 
A 1 343 PHE 343 378 378 PHE PHE A . n 
A 1 344 MET 344 379 379 MET MET A . n 
A 1 345 ASP 345 380 380 ASP ASP A . n 
A 1 346 ASN 346 381 381 ASN ASN A . n 
A 1 347 PRO 347 382 382 PRO PRO A . n 
B 1 1   CYS 1   36  36  CYS CYS B . n 
B 1 2   PRO 2   37  37  PRO PRO B . n 
B 1 3   ASP 3   38  38  ASP ASP B . n 
B 1 4   ALA 4   39  39  ALA ALA B . n 
B 1 5   CYS 5   40  40  CYS CYS B . n 
B 1 6   CYS 6   41  41  CYS CYS B . n 
B 1 7   PRO 7   42  42  PRO PRO B . n 
B 1 8   HIS 8   43  43  HIS HIS B . n 
B 1 9   GLY 9   44  44  GLY GLY B . n 
B 1 10  SER 10  45  45  SER SER B . n 
B 1 11  SER 11  46  46  SER SER B . n 
B 1 12  GLY 12  47  47  GLY GLY B . n 
B 1 13  LEU 13  48  48  LEU LEU B . n 
B 1 14  ARG 14  49  49  ARG ARG B . n 
B 1 15  CYS 15  50  50  CYS CYS B . n 
B 1 16  THR 16  51  51  THR THR B . n 
B 1 17  ARG 17  52  52  ARG ARG B . n 
B 1 18  ASP 18  53  53  ASP ASP B . n 
B 1 19  GLY 19  54  54  GLY GLY B . n 
B 1 20  ALA 20  55  55  ALA ALA B . n 
B 1 21  LEU 21  56  56  LEU LEU B . n 
B 1 22  ASP 22  57  57  ASP ASP B . n 
B 1 23  SER 23  58  58  SER SER B . n 
B 1 24  LEU 24  59  59  LEU LEU B . n 
B 1 25  HIS 25  60  60  HIS HIS B . n 
B 1 26  HIS 26  61  61  HIS HIS B . n 
B 1 27  LEU 27  62  62  LEU LEU B . n 
B 1 28  PRO 28  63  63  PRO PRO B . n 
B 1 29  GLY 29  64  64  GLY GLY B . n 
B 1 30  ALA 30  65  65  ALA ALA B . n 
B 1 31  GLU 31  66  66  GLU GLU B . n 
B 1 32  ASN 32  67  67  ASN ASN B . n 
B 1 33  LEU 33  68  68  LEU LEU B . n 
B 1 34  THR 34  69  69  THR THR B . n 
B 1 35  GLU 35  70  70  GLU GLU B . n 
B 1 36  LEU 36  71  71  LEU LEU B . n 
B 1 37  TYR 37  72  72  TYR TYR B . n 
B 1 38  ILE 38  73  73  ILE ILE B . n 
B 1 39  GLU 39  74  74  GLU GLU B . n 
B 1 40  ASN 40  75  75  ASN ASN B . n 
B 1 41  GLN 41  76  76  GLN GLN B . n 
B 1 42  GLN 42  77  77  GLN GLN B . n 
B 1 43  HIS 43  78  78  HIS HIS B . n 
B 1 44  LEU 44  79  79  LEU LEU B . n 
B 1 45  GLN 45  80  80  GLN GLN B . n 
B 1 46  HIS 46  81  81  HIS HIS B . n 
B 1 47  LEU 47  82  82  LEU LEU B . n 
B 1 48  GLU 48  83  83  GLU GLU B . n 
B 1 49  LEU 49  84  84  LEU LEU B . n 
B 1 50  ARG 50  85  85  ARG ARG B . n 
B 1 51  ASP 51  86  86  ASP ASP B . n 
B 1 52  LEU 52  87  87  LEU LEU B . n 
B 1 53  ARG 53  88  88  ARG ARG B . n 
B 1 54  GLY 54  89  89  GLY GLY B . n 
B 1 55  LEU 55  90  90  LEU LEU B . n 
B 1 56  GLY 56  91  91  GLY GLY B . n 
B 1 57  GLU 57  92  92  GLU GLU B . n 
B 1 58  LEU 58  93  93  LEU LEU B . n 
B 1 59  ARG 59  94  94  ARG ARG B . n 
B 1 60  ASN 60  95  95  ASN ASN B . n 
B 1 61  LEU 61  96  96  LEU LEU B . n 
B 1 62  THR 62  97  97  THR THR B . n 
B 1 63  ILE 63  98  98  ILE ILE B . n 
B 1 64  VAL 64  99  99  VAL VAL B . n 
B 1 65  LYS 65  100 100 LYS LYS B . n 
B 1 66  SER 66  101 101 SER SER B . n 
B 1 67  GLY 67  102 102 GLY GLY B . n 
B 1 68  LEU 68  103 103 LEU LEU B . n 
B 1 69  ARG 69  104 104 ARG ARG B . n 
B 1 70  PHE 70  105 105 PHE PHE B . n 
B 1 71  VAL 71  106 106 VAL VAL B . n 
B 1 72  ALA 72  107 107 ALA ALA B . n 
B 1 73  PRO 73  108 108 PRO PRO B . n 
B 1 74  ASP 74  109 109 ASP ASP B . n 
B 1 75  ALA 75  110 110 ALA ALA B . n 
B 1 76  PHE 76  111 111 PHE PHE B . n 
B 1 77  HIS 77  112 112 HIS HIS B . n 
B 1 78  PHE 78  113 113 PHE PHE B . n 
B 1 79  THR 79  114 114 THR THR B . n 
B 1 80  PRO 80  115 115 PRO PRO B . n 
B 1 81  ARG 81  116 116 ARG ARG B . n 
B 1 82  LEU 82  117 117 LEU LEU B . n 
B 1 83  SER 83  118 118 SER SER B . n 
B 1 84  ARG 84  119 119 ARG ARG B . n 
B 1 85  LEU 85  120 120 LEU LEU B . n 
B 1 86  ASN 86  121 121 ASN ASN B . n 
B 1 87  LEU 87  122 122 LEU LEU B . n 
B 1 88  SER 88  123 123 SER SER B . n 
B 1 89  PHE 89  124 124 PHE PHE B . n 
B 1 90  ASN 90  125 125 ASN ASN B . n 
B 1 91  ALA 91  126 126 ALA ALA B . n 
B 1 92  LEU 92  127 127 LEU LEU B . n 
B 1 93  GLU 93  128 128 GLU GLU B . n 
B 1 94  SER 94  129 129 SER SER B . n 
B 1 95  LEU 95  130 130 LEU LEU B . n 
B 1 96  SER 96  131 131 SER SER B . n 
B 1 97  TRP 97  132 132 TRP TRP B . n 
B 1 98  LYS 98  133 133 LYS LYS B . n 
B 1 99  THR 99  134 134 THR THR B . n 
B 1 100 VAL 100 135 135 VAL VAL B . n 
B 1 101 GLN 101 136 136 GLN GLN B . n 
B 1 102 GLY 102 137 137 GLY GLY B . n 
B 1 103 LEU 103 138 138 LEU LEU B . n 
B 1 104 SER 104 139 139 SER SER B . n 
B 1 105 LEU 105 140 140 LEU LEU B . n 
B 1 106 GLN 106 141 141 GLN GLN B . n 
B 1 107 GLU 107 142 142 GLU GLU B . n 
B 1 108 LEU 108 143 143 LEU LEU B . n 
B 1 109 VAL 109 144 144 VAL VAL B . n 
B 1 110 LEU 110 145 145 LEU LEU B . n 
B 1 111 SER 111 146 146 SER SER B . n 
B 1 112 GLY 112 147 147 GLY GLY B . n 
B 1 113 ASN 113 148 148 ASN ASN B . n 
B 1 114 PRO 114 149 149 PRO PRO B . n 
B 1 115 LEU 115 150 150 LEU LEU B . n 
B 1 116 HIS 116 151 151 HIS HIS B . n 
B 1 117 CYS 117 152 152 CYS CYS B . n 
B 1 118 SER 118 153 153 SER SER B . n 
B 1 119 CYS 119 154 154 CYS CYS B . n 
B 1 120 ALA 120 155 155 ALA ALA B . n 
B 1 121 LEU 121 156 156 LEU LEU B . n 
B 1 122 ARG 122 157 157 ARG ARG B . n 
B 1 123 TRP 123 158 158 TRP TRP B . n 
B 1 124 LEU 124 159 159 LEU LEU B . n 
B 1 125 GLN 125 160 160 GLN GLN B . n 
B 1 126 ARG 126 161 161 ARG ARG B . n 
B 1 127 TRP 127 162 162 TRP TRP B . n 
B 1 128 GLU 128 163 163 GLU GLU B . n 
B 1 129 GLU 129 164 164 GLU GLU B . n 
B 1 130 GLU 130 165 165 GLU GLU B . n 
B 1 131 GLY 131 166 166 GLY GLY B . n 
B 1 132 LEU 132 167 167 LEU LEU B . n 
B 1 133 GLY 133 168 168 GLY GLY B . n 
B 1 134 GLY 134 169 169 GLY GLY B . n 
B 1 135 VAL 135 170 170 VAL VAL B . n 
B 1 136 PRO 136 171 171 PRO PRO B . n 
B 1 137 GLU 137 172 172 GLU GLU B . n 
B 1 138 GLN 138 173 173 GLN GLN B . n 
B 1 139 LYS 139 174 174 LYS LYS B . n 
B 1 140 LEU 140 175 175 LEU LEU B . n 
B 1 141 GLN 141 176 176 GLN GLN B . n 
B 1 142 CYS 142 177 177 CYS CYS B . n 
B 1 143 HIS 143 178 178 HIS HIS B . n 
B 1 144 GLY 144 179 179 GLY GLY B . n 
B 1 145 GLN 145 180 180 GLN GLN B . n 
B 1 146 GLY 146 181 181 GLY GLY B . n 
B 1 147 PRO 147 182 182 PRO PRO B . n 
B 1 148 LEU 148 183 183 LEU LEU B . n 
B 1 149 ALA 149 184 184 ALA ALA B . n 
B 1 150 HIS 150 185 185 HIS HIS B . n 
B 1 151 MET 151 186 186 MET MET B . n 
B 1 152 PRO 152 187 187 PRO PRO B . n 
B 1 153 ASN 153 188 188 ASN ASN B . n 
B 1 154 ALA 154 189 189 ALA ALA B . n 
B 1 155 SER 155 190 190 SER SER B . n 
B 1 156 CYS 156 191 191 CYS CYS B . n 
B 1 157 GLY 157 192 192 GLY GLY B . n 
B 1 158 VAL 158 193 193 VAL VAL B . n 
B 1 159 PRO 159 194 194 PRO PRO B . n 
B 1 160 THR 160 195 195 THR THR B . n 
B 1 161 LEU 161 196 196 LEU LEU B . n 
B 1 162 LYS 162 197 197 LYS LYS B . n 
B 1 163 VAL 163 198 198 VAL VAL B . n 
B 1 164 GLN 164 199 199 GLN GLN B . n 
B 1 165 VAL 165 200 200 VAL VAL B . n 
B 1 166 PRO 166 201 201 PRO PRO B . n 
B 1 167 ASN 167 202 202 ASN ASN B . n 
B 1 168 ALA 168 203 203 ALA ALA B . n 
B 1 169 SER 169 204 204 SER SER B . n 
B 1 170 VAL 170 205 205 VAL VAL B . n 
B 1 171 ASP 171 206 206 ASP ASP B . n 
B 1 172 VAL 172 207 207 VAL VAL B . n 
B 1 173 GLY 173 208 208 GLY GLY B . n 
B 1 174 ASP 174 209 209 ASP ASP B . n 
B 1 175 ASP 175 210 210 ASP ASP B . n 
B 1 176 VAL 176 211 211 VAL VAL B . n 
B 1 177 LEU 177 212 212 LEU LEU B . n 
B 1 178 LEU 178 213 213 LEU LEU B . n 
B 1 179 ARG 179 214 214 ARG ARG B . n 
B 1 180 CYS 180 215 215 CYS CYS B . n 
B 1 181 GLN 181 216 216 GLN GLN B . n 
B 1 182 VAL 182 217 217 VAL VAL B . n 
B 1 183 GLU 183 218 218 GLU GLU B . n 
B 1 184 GLY 184 219 219 GLY GLY B . n 
B 1 185 ARG 185 220 220 ARG ARG B . n 
B 1 186 GLY 186 221 221 GLY GLY B . n 
B 1 187 LEU 187 222 222 LEU LEU B . n 
B 1 188 GLU 188 223 223 GLU GLU B . n 
B 1 189 GLN 189 224 224 GLN GLN B . n 
B 1 190 ALA 190 225 225 ALA ALA B . n 
B 1 191 GLY 191 226 226 GLY GLY B . n 
B 1 192 TRP 192 227 227 TRP TRP B . n 
B 1 193 ILE 193 228 228 ILE ILE B . n 
B 1 194 LEU 194 229 229 LEU LEU B . n 
B 1 195 THR 195 230 230 THR THR B . n 
B 1 196 GLU 196 231 231 GLU GLU B . n 
B 1 197 LEU 197 232 232 LEU LEU B . n 
B 1 198 GLU 198 233 233 GLU GLU B . n 
B 1 199 GLN 199 234 234 GLN GLN B . n 
B 1 200 SER 200 235 235 SER SER B . n 
B 1 201 ALA 201 236 236 ALA ALA B . n 
B 1 202 THR 202 237 237 THR THR B . n 
B 1 203 VAL 203 238 238 VAL VAL B . n 
B 1 204 MET 204 239 239 MET MET B . n 
B 1 205 LYS 205 240 240 LYS LYS B . n 
B 1 206 SER 206 241 241 SER SER B . n 
B 1 207 GLY 207 242 242 GLY GLY B . n 
B 1 208 GLY 208 243 243 GLY GLY B . n 
B 1 209 LEU 209 244 244 LEU LEU B . n 
B 1 210 PRO 210 245 245 PRO PRO B . n 
B 1 211 SER 211 246 246 SER SER B . n 
B 1 212 LEU 212 247 247 LEU LEU B . n 
B 1 213 GLY 213 248 248 GLY GLY B . n 
B 1 214 LEU 214 249 249 LEU LEU B . n 
B 1 215 THR 215 250 250 THR THR B . n 
B 1 216 LEU 216 251 251 LEU LEU B . n 
B 1 217 ALA 217 252 252 ALA ALA B . n 
B 1 218 ASN 218 253 253 ASN ASN B . n 
B 1 219 VAL 219 254 254 VAL VAL B . n 
B 1 220 THR 220 255 255 THR THR B . n 
B 1 221 SER 221 256 256 SER SER B . n 
B 1 222 ASP 222 257 257 ASP ASP B . n 
B 1 223 LEU 223 258 258 LEU LEU B . n 
B 1 224 ASN 224 259 259 ASN ASN B . n 
B 1 225 ARG 225 260 260 ARG ARG B . n 
B 1 226 LYS 226 261 261 LYS LYS B . n 
B 1 227 ASN 227 262 262 ASN ASN B . n 
B 1 228 VAL 228 263 263 VAL VAL B . n 
B 1 229 THR 229 264 264 THR THR B . n 
B 1 230 CYS 230 265 265 CYS CYS B . n 
B 1 231 TRP 231 266 266 TRP TRP B . n 
B 1 232 ALA 232 267 267 ALA ALA B . n 
B 1 233 GLU 233 268 268 GLU GLU B . n 
B 1 234 ASN 234 269 269 ASN ASN B . n 
B 1 235 ASP 235 270 270 ASP ASP B . n 
B 1 236 VAL 236 271 271 VAL VAL B . n 
B 1 237 GLY 237 272 272 GLY GLY B . n 
B 1 238 ARG 238 273 273 ARG ARG B . n 
B 1 239 ALA 239 274 274 ALA ALA B . n 
B 1 240 GLU 240 275 275 GLU GLU B . n 
B 1 241 VAL 241 276 276 VAL VAL B . n 
B 1 242 SER 242 277 277 SER SER B . n 
B 1 243 VAL 243 278 278 VAL VAL B . n 
B 1 244 GLN 244 279 279 GLN GLN B . n 
B 1 245 VAL 245 280 280 VAL VAL B . n 
B 1 246 ASN 246 281 281 ASN ASN B . n 
B 1 247 VAL 247 282 282 VAL VAL B . n 
B 1 248 SER 248 283 283 SER SER B . n 
B 1 249 PHE 249 284 284 PHE PHE B . n 
B 1 250 PRO 250 285 285 PRO PRO B . n 
B 1 251 ALA 251 286 286 ALA ALA B . n 
B 1 252 SER 252 287 287 SER SER B . n 
B 1 253 VAL 253 288 288 VAL VAL B . n 
B 1 254 GLN 254 289 289 GLN GLN B . n 
B 1 255 LEU 255 290 290 LEU LEU B . n 
B 1 256 HIS 256 291 291 HIS HIS B . n 
B 1 257 THR 257 292 292 THR THR B . n 
B 1 258 ALA 258 293 293 ALA ALA B . n 
B 1 259 VAL 259 294 294 VAL VAL B . n 
B 1 260 GLU 260 295 295 GLU GLU B . n 
B 1 261 MET 261 296 296 MET MET B . n 
B 1 262 HIS 262 297 297 HIS HIS B . n 
B 1 263 HIS 263 298 298 HIS HIS B . n 
B 1 264 TRP 264 299 299 TRP TRP B . n 
B 1 265 CYS 265 300 300 CYS CYS B . n 
B 1 266 ILE 266 301 301 ILE ILE B . n 
B 1 267 PRO 267 302 302 PRO PRO B . n 
B 1 268 PHE 268 303 303 PHE PHE B . n 
B 1 269 SER 269 304 304 SER SER B . n 
B 1 270 VAL 270 305 305 VAL VAL B . n 
B 1 271 ASP 271 306 306 ASP ASP B . n 
B 1 272 GLY 272 307 307 GLY GLY B . n 
B 1 273 GLN 273 308 308 GLN GLN B . n 
B 1 274 PRO 274 309 309 PRO PRO B . n 
B 1 275 ALA 275 310 310 ALA ALA B . n 
B 1 276 PRO 276 311 311 PRO PRO B . n 
B 1 277 SER 277 312 312 SER SER B . n 
B 1 278 LEU 278 313 313 LEU LEU B . n 
B 1 279 ARG 279 314 314 ARG ARG B . n 
B 1 280 TRP 280 315 315 TRP TRP B . n 
B 1 281 LEU 281 316 316 LEU LEU B . n 
B 1 282 PHE 282 317 317 PHE PHE B . n 
B 1 283 ASN 283 318 318 ASN ASN B . n 
B 1 284 GLY 284 319 319 GLY GLY B . n 
B 1 285 SER 285 320 320 SER SER B . n 
B 1 286 VAL 286 321 321 VAL VAL B . n 
B 1 287 LEU 287 322 322 LEU LEU B . n 
B 1 288 ASN 288 323 323 ASN ASN B . n 
B 1 289 GLU 289 324 324 GLU GLU B . n 
B 1 290 THR 290 325 325 THR THR B . n 
B 1 291 SER 291 326 326 SER SER B . n 
B 1 292 PHE 292 327 327 PHE PHE B . n 
B 1 293 ILE 293 328 328 ILE ILE B . n 
B 1 294 PHE 294 329 329 PHE PHE B . n 
B 1 295 THR 295 330 330 THR THR B . n 
B 1 296 GLU 296 331 331 GLU GLU B . n 
B 1 297 PHE 297 332 332 PHE PHE B . n 
B 1 298 LEU 298 333 333 LEU LEU B . n 
B 1 299 GLU 299 334 334 GLU GLU B . n 
B 1 300 PRO 300 335 335 PRO PRO B . n 
B 1 301 ALA 301 336 336 ALA ALA B . n 
B 1 302 ALA 302 337 337 ALA ALA B . n 
B 1 303 ASN 303 338 338 ASN ASN B . n 
B 1 304 GLU 304 339 339 GLU GLU B . n 
B 1 305 THR 305 340 340 THR THR B . n 
B 1 306 VAL 306 341 341 VAL VAL B . n 
B 1 307 ARG 307 342 342 ARG ARG B . n 
B 1 308 HIS 308 343 343 HIS HIS B . n 
B 1 309 GLY 309 344 344 GLY GLY B . n 
B 1 310 CYS 310 345 345 CYS CYS B . n 
B 1 311 LEU 311 346 346 LEU LEU B . n 
B 1 312 ARG 312 347 347 ARG ARG B . n 
B 1 313 LEU 313 348 348 LEU LEU B . n 
B 1 314 ASN 314 349 349 ASN ASN B . n 
B 1 315 GLN 315 350 350 GLN GLN B . n 
B 1 316 PRO 316 351 351 PRO PRO B . n 
B 1 317 THR 317 352 352 THR THR B . n 
B 1 318 HIS 318 353 353 HIS HIS B . n 
B 1 319 VAL 319 354 354 VAL VAL B . n 
B 1 320 ASN 320 355 355 ASN ASN B . n 
B 1 321 ASN 321 356 356 ASN ASN B . n 
B 1 322 GLY 322 357 357 GLY GLY B . n 
B 1 323 ASN 323 358 358 ASN ASN B . n 
B 1 324 TYR 324 359 359 TYR TYR B . n 
B 1 325 THR 325 360 360 THR THR B . n 
B 1 326 LEU 326 361 361 LEU LEU B . n 
B 1 327 LEU 327 362 362 LEU LEU B . n 
B 1 328 ALA 328 363 363 ALA ALA B . n 
B 1 329 ALA 329 364 364 ALA ALA B . n 
B 1 330 ASN 330 365 365 ASN ASN B . n 
B 1 331 PRO 331 366 366 PRO PRO B . n 
B 1 332 PHE 332 367 367 PHE PHE B . n 
B 1 333 GLY 333 368 368 GLY GLY B . n 
B 1 334 GLN 334 369 369 GLN GLN B . n 
B 1 335 ALA 335 370 370 ALA ALA B . n 
B 1 336 SER 336 371 371 SER SER B . n 
B 1 337 ALA 337 372 372 ALA ALA B . n 
B 1 338 SER 338 373 373 SER SER B . n 
B 1 339 ILE 339 374 374 ILE ILE B . n 
B 1 340 MET 340 375 375 MET MET B . n 
B 1 341 ALA 341 376 376 ALA ALA B . n 
B 1 342 ALA 342 377 377 ALA ALA B . n 
B 1 343 PHE 343 378 378 PHE PHE B . n 
B 1 344 MET 344 379 379 MET MET B . n 
B 1 345 ASP 345 380 380 ASP ASP B . n 
B 1 346 ASN 346 381 381 ASN ASN B . n 
B 1 347 PRO 347 382 382 PRO PRO B . n 
C 2 1   SER 1   1   ?   ?   ?   E . n 
C 2 2   SER 2   2   2   SER SER E . n 
C 2 3   SER 3   3   3   SER SER E . n 
C 2 4   HIS 4   4   4   HIS HIS E . n 
C 2 5   PRO 5   5   5   PRO PRO E . n 
C 2 6   ILE 6   6   6   ILE ILE E . n 
C 2 7   PHE 7   7   7   PHE PHE E . n 
C 2 8   HIS 8   8   8   HIS HIS E . n 
C 2 9   ARG 9   9   9   ARG ARG E . n 
C 2 10  GLY 10  10  10  GLY GLY E . n 
C 2 11  GLU 11  11  11  GLU GLU E . n 
C 2 12  PHE 12  12  12  PHE PHE E . n 
C 2 13  SER 13  13  13  SER SER E . n 
C 2 14  VAL 14  14  14  VAL VAL E . n 
C 2 15  CYS 15  15  15  CYS CYS E . n 
C 2 16  ASP 16  16  16  ASP ASP E . n 
C 2 17  SER 17  17  17  SER SER E . n 
C 2 18  VAL 18  18  18  VAL VAL E . n 
C 2 19  SER 19  19  19  SER SER E . n 
C 2 20  VAL 20  20  20  VAL VAL E . n 
C 2 21  TRP 21  21  21  TRP TRP E . n 
C 2 22  VAL 22  22  22  VAL VAL E . n 
C 2 23  GLY 23  23  23  GLY GLY E . n 
C 2 24  ASP 24  24  24  ASP ASP E . n 
C 2 25  LYS 25  25  25  LYS LYS E . n 
C 2 26  THR 26  26  26  THR THR E . n 
C 2 27  THR 27  27  27  THR THR E . n 
C 2 28  ALA 28  28  28  ALA ALA E . n 
C 2 29  THR 29  29  29  THR THR E . n 
C 2 30  ASP 30  30  30  ASP ASP E . n 
C 2 31  ILE 31  31  31  ILE ILE E . n 
C 2 32  LYS 32  32  32  LYS LYS E . n 
C 2 33  GLY 33  33  33  GLY GLY E . n 
C 2 34  LYS 34  34  34  LYS LYS E . n 
C 2 35  GLU 35  35  35  GLU GLU E . n 
C 2 36  VAL 36  36  36  VAL VAL E . n 
C 2 37  MET 37  37  37  MET MET E . n 
C 2 38  VAL 38  38  38  VAL VAL E . n 
C 2 39  LEU 39  39  39  LEU LEU E . n 
C 2 40  GLY 40  40  40  GLY GLY E . n 
C 2 41  GLU 41  41  41  GLU GLU E . n 
C 2 42  VAL 42  42  42  VAL VAL E . n 
C 2 43  ASN 43  43  43  ASN ASN E . n 
C 2 44  ILE 44  44  44  ILE ILE E . n 
C 2 45  ASN 45  45  45  ASN ASN E . n 
C 2 46  ASN 46  46  46  ASN ASN E . n 
C 2 47  SER 47  47  47  SER SER E . n 
C 2 48  VAL 48  48  48  VAL VAL E . n 
C 2 49  PHE 49  49  49  PHE PHE E . n 
C 2 50  LYS 50  50  50  LYS LYS E . n 
C 2 51  GLN 51  51  51  GLN GLN E . n 
C 2 52  TYR 52  52  52  TYR TYR E . n 
C 2 53  PHE 53  53  53  PHE PHE E . n 
C 2 54  PHE 54  54  54  PHE PHE E . n 
C 2 55  GLU 55  55  55  GLU GLU E . n 
C 2 56  THR 56  56  56  THR THR E . n 
C 2 57  LYS 57  57  57  LYS LYS E . n 
C 2 58  CYS 58  58  58  CYS CYS E . n 
C 2 59  ARG 59  59  59  ARG ARG E . n 
C 2 60  ASP 60  60  60  ASP ASP E . n 
C 2 61  PRO 61  61  ?   ?   ?   E . n 
C 2 62  ASN 62  62  ?   ?   ?   E . n 
C 2 63  PRO 63  63  ?   ?   ?   E . n 
C 2 64  VAL 64  64  ?   ?   ?   E . n 
C 2 65  ASP 65  65  ?   ?   ?   E . n 
C 2 66  SER 66  66  ?   ?   ?   E . n 
C 2 67  GLY 67  67  67  GLY GLY E . n 
C 2 68  CYS 68  68  68  CYS CYS E . n 
C 2 69  ARG 69  69  69  ARG ARG E . n 
C 2 70  GLY 70  70  70  GLY GLY E . n 
C 2 71  ILE 71  71  71  ILE ILE E . n 
C 2 72  ASP 72  72  72  ASP ASP E . n 
C 2 73  SER 73  73  73  SER SER E . n 
C 2 74  LYS 74  74  74  LYS LYS E . n 
C 2 75  HIS 75  75  75  HIS HIS E . n 
C 2 76  TRP 76  76  76  TRP TRP E . n 
C 2 77  ASN 77  77  77  ASN ASN E . n 
C 2 78  SER 78  78  78  SER SER E . n 
C 2 79  TYR 79  79  79  TYR TYR E . n 
C 2 80  CYS 80  80  80  CYS CYS E . n 
C 2 81  THR 81  81  81  THR THR E . n 
C 2 82  THR 82  82  82  THR THR E . n 
C 2 83  THR 83  83  83  THR THR E . n 
C 2 84  HIS 84  84  84  HIS HIS E . n 
C 2 85  THR 85  85  85  THR THR E . n 
C 2 86  PHE 86  86  86  PHE PHE E . n 
C 2 87  VAL 87  87  87  VAL VAL E . n 
C 2 88  LYS 88  88  88  LYS LYS E . n 
C 2 89  ALA 89  89  89  ALA ALA E . n 
C 2 90  LEU 90  90  90  LEU LEU E . n 
C 2 91  THR 91  91  91  THR THR E . n 
C 2 92  MET 92  92  92  MET MET E . n 
C 2 93  ASP 93  93  93  ASP ASP E . n 
C 2 94  GLY 94  94  94  GLY GLY E . n 
C 2 95  LYS 95  95  95  LYS LYS E . n 
C 2 96  GLN 96  96  96  GLN GLN E . n 
C 2 97  ALA 97  97  97  ALA ALA E . n 
C 2 98  ALA 98  98  98  ALA ALA E . n 
C 2 99  TRP 99  99  99  TRP TRP E . n 
C 2 100 ARG 100 100 100 ARG ARG E . n 
C 2 101 PHE 101 101 101 PHE PHE E . n 
C 2 102 ILE 102 102 102 ILE ILE E . n 
C 2 103 ARG 103 103 103 ARG ARG E . n 
C 2 104 ILE 104 104 104 ILE ILE E . n 
C 2 105 ASP 105 105 105 ASP ASP E . n 
C 2 106 THR 106 106 106 THR THR E . n 
C 2 107 ALA 107 107 107 ALA ALA E . n 
C 2 108 CYS 108 108 108 CYS CYS E . n 
C 2 109 VAL 109 109 109 VAL VAL E . n 
C 2 110 CYS 110 110 110 CYS CYS E . n 
C 2 111 VAL 111 111 111 VAL VAL E . n 
C 2 112 LEU 112 112 112 LEU LEU E . n 
C 2 113 SER 113 113 113 SER SER E . n 
C 2 114 ARG 114 114 114 ARG ARG E . n 
C 2 115 LYS 115 115 115 LYS LYS E . n 
C 2 116 ALA 116 116 ?   ?   ?   E . n 
C 2 117 VAL 117 117 ?   ?   ?   E . n 
C 2 118 ARG 118 118 ?   ?   ?   E . n 
C 2 119 ARG 119 119 ?   ?   ?   E . n 
C 2 120 ALA 120 120 ?   ?   ?   E . n 
D 2 1   SER 1   1   ?   ?   ?   F . n 
D 2 2   SER 2   2   2   SER SER F . n 
D 2 3   SER 3   3   3   SER SER F . n 
D 2 4   HIS 4   4   4   HIS HIS F . n 
D 2 5   PRO 5   5   5   PRO PRO F . n 
D 2 6   ILE 6   6   6   ILE ILE F . n 
D 2 7   PHE 7   7   7   PHE PHE F . n 
D 2 8   HIS 8   8   8   HIS HIS F . n 
D 2 9   ARG 9   9   9   ARG ARG F . n 
D 2 10  GLY 10  10  10  GLY GLY F . n 
D 2 11  GLU 11  11  11  GLU GLU F . n 
D 2 12  PHE 12  12  12  PHE PHE F . n 
D 2 13  SER 13  13  13  SER SER F . n 
D 2 14  VAL 14  14  14  VAL VAL F . n 
D 2 15  CYS 15  15  15  CYS CYS F . n 
D 2 16  ASP 16  16  16  ASP ASP F . n 
D 2 17  SER 17  17  17  SER SER F . n 
D 2 18  VAL 18  18  18  VAL VAL F . n 
D 2 19  SER 19  19  19  SER SER F . n 
D 2 20  VAL 20  20  20  VAL VAL F . n 
D 2 21  TRP 21  21  21  TRP TRP F . n 
D 2 22  VAL 22  22  22  VAL VAL F . n 
D 2 23  GLY 23  23  23  GLY GLY F . n 
D 2 24  ASP 24  24  24  ASP ASP F . n 
D 2 25  LYS 25  25  25  LYS LYS F . n 
D 2 26  THR 26  26  26  THR THR F . n 
D 2 27  THR 27  27  27  THR THR F . n 
D 2 28  ALA 28  28  28  ALA ALA F . n 
D 2 29  THR 29  29  29  THR THR F . n 
D 2 30  ASP 30  30  30  ASP ASP F . n 
D 2 31  ILE 31  31  31  ILE ILE F . n 
D 2 32  LYS 32  32  32  LYS LYS F . n 
D 2 33  GLY 33  33  33  GLY GLY F . n 
D 2 34  LYS 34  34  34  LYS LYS F . n 
D 2 35  GLU 35  35  35  GLU GLU F . n 
D 2 36  VAL 36  36  36  VAL VAL F . n 
D 2 37  MET 37  37  37  MET MET F . n 
D 2 38  VAL 38  38  38  VAL VAL F . n 
D 2 39  LEU 39  39  39  LEU LEU F . n 
D 2 40  GLY 40  40  40  GLY GLY F . n 
D 2 41  GLU 41  41  41  GLU GLU F . n 
D 2 42  VAL 42  42  42  VAL VAL F . n 
D 2 43  ASN 43  43  43  ASN ASN F . n 
D 2 44  ILE 44  44  44  ILE ILE F . n 
D 2 45  ASN 45  45  45  ASN ASN F . n 
D 2 46  ASN 46  46  46  ASN ASN F . n 
D 2 47  SER 47  47  47  SER SER F . n 
D 2 48  VAL 48  48  48  VAL VAL F . n 
D 2 49  PHE 49  49  49  PHE PHE F . n 
D 2 50  LYS 50  50  50  LYS LYS F . n 
D 2 51  GLN 51  51  51  GLN GLN F . n 
D 2 52  TYR 52  52  52  TYR TYR F . n 
D 2 53  PHE 53  53  53  PHE PHE F . n 
D 2 54  PHE 54  54  54  PHE PHE F . n 
D 2 55  GLU 55  55  55  GLU GLU F . n 
D 2 56  THR 56  56  56  THR THR F . n 
D 2 57  LYS 57  57  57  LYS LYS F . n 
D 2 58  CYS 58  58  58  CYS CYS F . n 
D 2 59  ARG 59  59  59  ARG ARG F . n 
D 2 60  ASP 60  60  60  ASP ASP F . n 
D 2 61  PRO 61  61  ?   ?   ?   F . n 
D 2 62  ASN 62  62  ?   ?   ?   F . n 
D 2 63  PRO 63  63  ?   ?   ?   F . n 
D 2 64  VAL 64  64  ?   ?   ?   F . n 
D 2 65  ASP 65  65  ?   ?   ?   F . n 
D 2 66  SER 66  66  ?   ?   ?   F . n 
D 2 67  GLY 67  67  67  GLY GLY F . n 
D 2 68  CYS 68  68  68  CYS CYS F . n 
D 2 69  ARG 69  69  69  ARG ARG F . n 
D 2 70  GLY 70  70  70  GLY GLY F . n 
D 2 71  ILE 71  71  71  ILE ILE F . n 
D 2 72  ASP 72  72  72  ASP ASP F . n 
D 2 73  SER 73  73  73  SER SER F . n 
D 2 74  LYS 74  74  74  LYS LYS F . n 
D 2 75  HIS 75  75  75  HIS HIS F . n 
D 2 76  TRP 76  76  76  TRP TRP F . n 
D 2 77  ASN 77  77  77  ASN ASN F . n 
D 2 78  SER 78  78  78  SER SER F . n 
D 2 79  TYR 79  79  79  TYR TYR F . n 
D 2 80  CYS 80  80  80  CYS CYS F . n 
D 2 81  THR 81  81  81  THR THR F . n 
D 2 82  THR 82  82  82  THR THR F . n 
D 2 83  THR 83  83  83  THR THR F . n 
D 2 84  HIS 84  84  84  HIS HIS F . n 
D 2 85  THR 85  85  85  THR THR F . n 
D 2 86  PHE 86  86  86  PHE PHE F . n 
D 2 87  VAL 87  87  87  VAL VAL F . n 
D 2 88  LYS 88  88  88  LYS LYS F . n 
D 2 89  ALA 89  89  89  ALA ALA F . n 
D 2 90  LEU 90  90  90  LEU LEU F . n 
D 2 91  THR 91  91  91  THR THR F . n 
D 2 92  MET 92  92  92  MET MET F . n 
D 2 93  ASP 93  93  93  ASP ASP F . n 
D 2 94  GLY 94  94  94  GLY GLY F . n 
D 2 95  LYS 95  95  95  LYS LYS F . n 
D 2 96  GLN 96  96  96  GLN GLN F . n 
D 2 97  ALA 97  97  97  ALA ALA F . n 
D 2 98  ALA 98  98  98  ALA ALA F . n 
D 2 99  TRP 99  99  99  TRP TRP F . n 
D 2 100 ARG 100 100 100 ARG ARG F . n 
D 2 101 PHE 101 101 101 PHE PHE F . n 
D 2 102 ILE 102 102 102 ILE ILE F . n 
D 2 103 ARG 103 103 103 ARG ARG F . n 
D 2 104 ILE 104 104 104 ILE ILE F . n 
D 2 105 ASP 105 105 105 ASP ASP F . n 
D 2 106 THR 106 106 106 THR THR F . n 
D 2 107 ALA 107 107 107 ALA ALA F . n 
D 2 108 CYS 108 108 108 CYS CYS F . n 
D 2 109 VAL 109 109 109 VAL VAL F . n 
D 2 110 CYS 110 110 110 CYS CYS F . n 
D 2 111 VAL 111 111 111 VAL VAL F . n 
D 2 112 LEU 112 112 112 LEU LEU F . n 
D 2 113 SER 113 113 113 SER SER F . n 
D 2 114 ARG 114 114 114 ARG ARG F . n 
D 2 115 LYS 115 115 115 LYS LYS F . n 
D 2 116 ALA 116 116 116 ALA ALA F . n 
D 2 117 VAL 117 117 ?   ?   ?   F . n 
D 2 118 ARG 118 118 ?   ?   ?   F . n 
D 2 119 ARG 119 119 ?   ?   ?   F . n 
D 2 120 ALA 120 120 ?   ?   ?   F . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A ASN 60  A ASN 95  ? ASN 'GLYCOSYLATION SITE' 
2  A ASN 86  A ASN 121 ? ASN 'GLYCOSYLATION SITE' 
3  A ASN 153 A ASN 188 ? ASN 'GLYCOSYLATION SITE' 
4  A ASN 227 A ASN 262 ? ASN 'GLYCOSYLATION SITE' 
5  A ASN 246 A ASN 281 ? ASN 'GLYCOSYLATION SITE' 
6  A ASN 323 A ASN 358 ? ASN 'GLYCOSYLATION SITE' 
7  B ASN 60  B ASN 95  ? ASN 'GLYCOSYLATION SITE' 
8  B ASN 86  B ASN 121 ? ASN 'GLYCOSYLATION SITE' 
9  B ASN 153 B ASN 188 ? ASN 'GLYCOSYLATION SITE' 
10 B ASN 227 B ASN 262 ? ASN 'GLYCOSYLATION SITE' 
11 B ASN 246 B ASN 281 ? ASN 'GLYCOSYLATION SITE' 
12 B ASN 323 B ASN 358 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14290 ? 
1 MORE         46    ? 
1 'SSA (A^2)'  52550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' pdbx_validate_chiral          
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
18 4 'Structure model' '_struct_conn.pdbx_role'                 
19 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP    phasing          . ? 1 
CNS       refinement       . ? 2 
HKL-2000  'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B PRO 149 ? ? CB B HIS 178 ? ? 2.04 
2 1 O A HIS 178 ? ? N  A GLN 180 ? ? 2.06 
3 1 O A SER 118 ? ? N  A GLN 141 ? ? 2.12 
4 1 O B SER 118 ? ? N  B GLN 141 ? ? 2.12 
5 1 O B HIS 178 ? ? N  B GLN 180 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A CYS 50  ? ? CB A CYS 50  ? ? SG A CYS 50  ? ? 122.75 114.20 8.55   1.10 N 
2  1 N  A GLY 181 ? ? CA A GLY 181 ? ? C  A GLY 181 ? ? 90.98  113.10 -22.12 2.50 N 
3  1 C  A GLY 181 ? ? N  A PRO 182 ? ? CA A PRO 182 ? ? 142.37 119.30 23.07  1.50 Y 
4  1 C  A GLY 181 ? ? N  A PRO 182 ? ? CD A PRO 182 ? ? 104.11 128.40 -24.29 2.10 Y 
5  1 N  A PRO 182 ? ? CA A PRO 182 ? ? C  A PRO 182 ? ? 130.99 112.10 18.89  2.60 N 
6  1 N  A HIS 185 ? ? CA A HIS 185 ? ? C  A HIS 185 ? ? 87.91  111.00 -23.09 2.70 N 
7  1 CA A CYS 345 ? ? CB A CYS 345 ? ? SG A CYS 345 ? ? 124.26 114.20 10.06  1.10 N 
8  1 N  A LEU 346 ? ? CA A LEU 346 ? ? C  A LEU 346 ? ? 90.92  111.00 -20.08 2.70 N 
9  1 CA B CYS 50  ? ? CB B CYS 50  ? ? SG B CYS 50  ? ? 121.72 114.20 7.52   1.10 N 
10 1 N  B GLY 147 ? ? CA B GLY 147 ? ? C  B GLY 147 ? ? 94.57  113.10 -18.53 2.50 N 
11 1 CA B PRO 149 ? ? C  B PRO 149 ? ? N  B LEU 150 ? ? 101.00 117.20 -16.20 2.20 Y 
12 1 O  B PRO 149 ? ? C  B PRO 149 ? ? N  B LEU 150 ? ? 141.74 122.70 19.04  1.60 Y 
13 1 N  B GLY 181 ? ? CA B GLY 181 ? ? C  B GLY 181 ? ? 87.05  113.10 -26.05 2.50 N 
14 1 C  B GLY 181 ? ? N  B PRO 182 ? ? CA B PRO 182 ? ? 136.01 119.30 16.71  1.50 Y 
15 1 C  B GLY 181 ? ? N  B PRO 182 ? ? CD B PRO 182 ? ? 110.31 128.40 -18.09 2.10 Y 
16 1 N  B PRO 182 ? ? CA B PRO 182 ? ? C  B PRO 182 ? ? 129.66 112.10 17.56  2.60 N 
17 1 N  B HIS 185 ? ? CA B HIS 185 ? ? C  B HIS 185 ? ? 87.23  111.00 -23.77 2.70 N 
18 1 CA B CYS 345 ? ? CB B CYS 345 ? ? SG B CYS 345 ? ? 124.25 114.20 10.05  1.10 N 
19 1 N  B LEU 346 ? ? CA B LEU 346 ? ? C  B LEU 346 ? ? 89.81  111.00 -21.19 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 38  ? ? 172.34  -30.27  
2   1 ALA A 39  ? ? -162.43 18.89   
3   1 CYS A 40  ? ? 179.13  -166.71 
4   1 PRO A 42  ? ? -70.95  -97.22  
5   1 HIS A 43  ? ? 43.94   -124.43 
6   1 SER A 45  ? ? -82.13  -151.89 
7   1 SER A 46  ? ? -63.63  87.60   
8   1 ARG A 52  ? ? -143.20 -74.19  
9   1 ALA A 55  ? ? -168.60 37.76   
10  1 SER A 58  ? ? -149.03 24.34   
11  1 LEU A 68  ? ? -178.41 -157.50 
12  1 THR A 69  ? ? -169.23 -22.63  
13  1 ASN A 75  ? ? 62.00   104.73  
14  1 GLN A 76  ? ? -171.94 121.46  
15  1 GLN A 77  ? ? -52.11  -73.06  
16  1 HIS A 78  ? ? -59.51  -161.25 
17  1 LEU A 79  ? ? 69.03   77.46   
18  1 ARG A 88  ? ? -57.51  81.44   
19  1 LEU A 90  ? ? -3.46   84.69   
20  1 LYS A 100 ? ? 50.77   95.01   
21  1 SER A 101 ? ? 177.16  -171.60 
22  1 LEU A 103 ? ? -12.52  86.16   
23  1 PRO A 108 ? ? -63.42  79.28   
24  1 ASP A 109 ? ? -176.85 -57.09  
25  1 ALA A 110 ? ? -0.16   -90.03  
26  1 PHE A 111 ? ? -56.44  27.17   
27  1 ARG A 116 ? ? -72.41  -103.35 
28  1 LEU A 117 ? ? 64.43   111.75  
29  1 SER A 123 ? ? -56.99  176.56  
30  1 PHE A 124 ? ? 29.75   82.05   
31  1 ASN A 125 ? ? -151.30 -142.73 
32  1 ALA A 126 ? ? -143.52 36.76   
33  1 SER A 131 ? ? -42.25  155.92  
34  1 THR A 134 ? ? -16.08  -70.13  
35  1 ALA A 155 ? ? -56.63  3.67    
36  1 LEU A 167 ? ? -97.60  -70.37  
37  1 PRO A 171 ? ? -31.17  -70.15  
38  1 GLU A 172 ? ? -47.61  -18.50  
39  1 GLN A 180 ? ? 94.13   115.52  
40  1 PRO A 182 ? ? 12.93   -39.27  
41  1 LEU A 183 ? ? -162.18 -158.54 
42  1 ALA A 184 ? ? -64.72  54.69   
43  1 MET A 186 ? ? 137.51  142.20  
44  1 VAL A 193 ? ? -58.12  179.24  
45  1 LEU A 222 ? ? 86.06   95.09   
46  1 GLU A 223 ? ? -131.32 -99.53  
47  1 GLU A 231 ? ? 62.00   84.21   
48  1 LEU A 232 ? ? -107.70 57.83   
49  1 SER A 235 ? ? 155.47  155.90  
50  1 MET A 239 ? ? -106.98 -141.95 
51  1 LYS A 240 ? ? 54.63   16.03   
52  1 ASP A 257 ? ? -65.19  24.18   
53  1 ALA A 267 ? ? 164.96  127.57  
54  1 ASP A 270 ? ? -65.56  18.52   
55  1 VAL A 271 ? ? -174.52 77.42   
56  1 ASN A 281 ? ? 59.11   98.84   
57  1 MET A 296 ? ? -112.77 -131.72 
58  1 GLN A 350 ? ? 51.77   71.08   
59  1 ASN A 381 ? ? -155.32 71.45   
60  1 ASP B 38  ? ? -167.39 -34.46  
61  1 ALA B 39  ? ? -163.80 -4.76   
62  1 PRO B 42  ? ? -75.85  -105.64 
63  1 HIS B 43  ? ? 49.81   -143.23 
64  1 SER B 45  ? ? -79.69  -145.47 
65  1 THR B 51  ? ? -58.19  72.95   
66  1 ARG B 52  ? ? 175.31  -179.37 
67  1 ASP B 53  ? ? -29.99  147.72  
68  1 ALA B 55  ? ? -154.53 49.01   
69  1 ALA B 65  ? ? -166.83 110.47  
70  1 GLU B 74  ? ? -64.10  44.59   
71  1 ASN B 75  ? ? 172.08  116.69  
72  1 HIS B 78  ? ? -90.35  -127.62 
73  1 LEU B 79  ? ? 47.20   94.18   
74  1 ARG B 88  ? ? -48.29  92.70   
75  1 LYS B 100 ? ? 41.87   88.49   
76  1 SER B 101 ? ? -164.53 -120.06 
77  1 ARG B 104 ? ? -145.62 -25.04  
78  1 PRO B 108 ? ? -56.50  92.02   
79  1 ASP B 109 ? ? 176.35  -70.67  
80  1 ALA B 110 ? ? 18.76   -109.67 
81  1 PHE B 111 ? ? -45.24  0.46    
82  1 PHE B 113 ? ? -59.01  -76.58  
83  1 THR B 114 ? ? -46.07  100.69  
84  1 ARG B 116 ? ? -72.87  -103.63 
85  1 LEU B 117 ? ? 64.45   113.13  
86  1 SER B 123 ? ? -49.44  178.09  
87  1 PHE B 124 ? ? 28.99   69.47   
88  1 ASN B 125 ? ? -133.58 -142.98 
89  1 LEU B 127 ? ? -46.85  108.96  
90  1 LYS B 133 ? ? -34.62  -21.79  
91  1 GLN B 136 ? ? 33.69   61.86   
92  1 ALA B 155 ? ? -71.77  24.46   
93  1 LEU B 167 ? ? -93.20  -72.83  
94  1 PRO B 171 ? ? -37.58  -72.85  
95  1 GLN B 180 ? ? 92.96   115.88  
96  1 PRO B 182 ? ? 18.71   -50.02  
97  1 LEU B 183 ? ? -171.38 -152.41 
98  1 ALA B 184 ? ? -62.47  52.46   
99  1 MET B 186 ? ? 140.49  141.88  
100 1 SER B 204 ? ? -53.49  -179.31 
101 1 LEU B 222 ? ? 59.55   90.25   
102 1 GLU B 223 ? ? -127.38 -96.17  
103 1 GLU B 231 ? ? 52.75   89.40   
104 1 LEU B 232 ? ? -108.68 61.28   
105 1 GLN B 234 ? ? -115.16 73.63   
106 1 SER B 235 ? ? 158.43  156.35  
107 1 MET B 239 ? ? -111.25 -163.54 
108 1 ASN B 253 ? ? 48.58   70.65   
109 1 ASP B 257 ? ? -78.61  26.35   
110 1 ALA B 267 ? ? 170.03  131.05  
111 1 ASN B 281 ? ? 69.79   78.73   
112 1 MET B 296 ? ? -120.24 -128.36 
113 1 ASN B 338 ? ? 33.21   76.21   
114 1 GLU B 339 ? ? -172.74 127.91  
115 1 THR B 352 ? ? -114.26 -166.11 
116 1 MET B 379 ? ? -172.36 142.84  
117 1 ASN E 45  ? ? 21.11   41.63   
118 1 ASN E 46  ? ? -175.57 -130.37 
119 1 ASP E 93  ? ? -52.93  2.47    
120 1 LYS E 95  ? ? -161.27 -55.90  
121 1 THR E 106 ? ? -140.46 -11.53  
122 1 ASN F 46  ? ? 70.25   -0.09   
123 1 ARG F 59  ? ? -68.53  7.10    
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             LEU 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              145 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   20.38 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? H NAG 1 ? 'WRONG HAND' . 
2 1 C1 ? I NAG 1 ? 'WRONG HAND' . 
3 1 C1 ? J NAG 1 ? 'WRONG HAND' . 
4 1 C1 ? O NAG 1 ? 'WRONG HAND' . 
5 1 C1 ? P NAG 1 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 E SER 1   ? C SER 1   
2  1 Y 1 E PRO 61  ? C PRO 61  
3  1 Y 1 E ASN 62  ? C ASN 62  
4  1 Y 1 E PRO 63  ? C PRO 63  
5  1 Y 1 E VAL 64  ? C VAL 64  
6  1 Y 1 E ASP 65  ? C ASP 65  
7  1 Y 1 E SER 66  ? C SER 66  
8  1 Y 1 E ALA 116 ? C ALA 116 
9  1 Y 1 E VAL 117 ? C VAL 117 
10 1 Y 1 E ARG 118 ? C ARG 118 
11 1 Y 1 E ARG 119 ? C ARG 119 
12 1 Y 1 E ALA 120 ? C ALA 120 
13 1 Y 1 F SER 1   ? D SER 1   
14 1 Y 1 F PRO 61  ? D PRO 61  
15 1 Y 1 F ASN 62  ? D ASN 62  
16 1 Y 1 F PRO 63  ? D PRO 63  
17 1 Y 1 F VAL 64  ? D VAL 64  
18 1 Y 1 F ASP 65  ? D ASP 65  
19 1 Y 1 F SER 66  ? D SER 66  
20 1 Y 1 F VAL 117 ? D VAL 117 
21 1 Y 1 F ARG 118 ? D ARG 118 
22 1 Y 1 F ARG 119 ? D ARG 119 
23 1 Y 1 F ALA 120 ? D ALA 120 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
E 3 NAG 1 C NAG 1 U NAG 1 n 
E 3 NDG 2 C NDG 2 U NDG 2 n 
F 4 NAG 1 D NAG 1 V NAG 1 n 
F 4 NDG 2 D NDG 2 V NDG 2 n 
F 4 MAN 3 D MAN 3 V MAN 3 n 
G 5 NAG 1 G NAG 1 W NAG 1 n 
G 5 NDG 2 G NDG 2 W NDG 2 n 
G 5 BMA 3 G BMA 3 W BMA 3 n 
H 5 NAG 1 H NAG 1 X NDG 1 n 
H 5 NDG 2 H NDG 2 X NDG 2 n 
H 5 BMA 3 H BMA 3 X BMA 3 n 
I 4 NAG 1 I NAG 1 Y NDG 1 n 
I 4 NDG 2 I NDG 2 Y NDG 2 n 
I 4 MAN 3 I MAN 3 Y MAN 3 n 
J 5 NAG 1 J NAG 1 Z NDG 1 n 
J 5 NDG 2 J NDG 2 Z NDG 2 n 
J 5 BMA 3 J BMA 3 Z BMA 3 n 
K 3 NAG 1 K NAG 1 H NAG 1 n 
K 3 NDG 2 K NDG 2 H NDG 2 n 
L 4 NAG 1 L NAG 1 I NAG 1 n 
L 4 NDG 2 L NDG 2 I NDG 2 n 
L 4 MAN 3 L MAN 3 I MAN 3 n 
M 5 NAG 1 M NAG 1 J NAG 1 n 
M 5 NDG 2 M NDG 2 J NDG 2 n 
M 5 BMA 3 M BMA 3 J BMA 3 n 
N 5 NAG 1 N NAG 1 K NAG 1 n 
N 5 NDG 2 N NDG 2 K NDG 2 n 
N 5 BMA 3 N BMA 3 K BMA 3 n 
O 4 NAG 1 O NAG 1 L NDG 1 n 
O 4 NDG 2 O NDG 2 L NDG 2 n 
O 4 MAN 3 O MAN 3 L MAN 3 n 
P 5 NAG 1 P NAG 1 M NDG 1 n 
P 5 NDG 2 P NDG 2 M NDG 2 n 
P 5 BMA 3 P BMA 3 M BMA 3 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAca                      
NDG 'COMMON NAME'                         GMML     1.0 N-acetyl-a-D-glucopyranosamine 
NDG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-GlcpNAc                    
NDG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
3 oligosaccharide 
4 oligosaccharide 
5 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DGlcpNAca1-4DGlcpNAcb1-                                                                               
'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a2122h-1a_1-5_2*NCC/3=O]/1-2/a4-b1'                        WURCS PDB2Glycan 1.1.0 
3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{}}}'                                                    LINUCS PDB-CARE   ?     
4 4 DManpa1-4DGlcpNAca1-4DGlcpNAcb1-                                                                      
'Glycam Condensed Sequence' GMML       1.0   
5 4 'WURCS=2.0/3,3,2/[a2122h-1b_1-5_2*NCC/3=O][a2122h-1a_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-2-3/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 
6 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{[(4+1)][a-D-Manp]{}}}}'                                 LINUCS PDB-CARE   ?     
7 5 DManpb1-4DGlcpNAca1-4DGlcpNAcb1-                                                                      
'Glycam Condensed Sequence' GMML       1.0   
8 5 'WURCS=2.0/3,3,2/[a2122h-1b_1-5_2*NCC/3=O][a2122h-1a_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-2-3/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 
9 5 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}'                                 LINUCS PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 3 2 NDG C1 O1 1 NAG O4 HO4 sing ? 
2 4 2 NDG C1 O1 1 NAG O4 HO4 sing ? 
3 4 3 MAN C1 O1 2 NDG O4 HO4 sing ? 
4 5 2 NDG C1 O1 1 NAG O4 HO4 sing ? 
5 5 3 BMA C1 O1 2 NDG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 NAG 1 n 
3 NDG 2 n 
4 NAG 1 n 
4 NDG 2 n 
4 MAN 3 n 
5 NAG 1 n 
5 NDG 2 n 
5 BMA 3 n 
#