data_2IL1
# 
_entry.id   2IL1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IL1         
RCSB  RCSB039703   
WWPDB D_1000039703 
# 
_pdbx_database_status.entry_id                        2IL1 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, J.'                             1  
'Shen, Y.'                             2  
'Tempel, W.'                           3  
'Landry, R.'                           4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Sundstrom, M.'                        7  
'Weigelt, J.'                          8  
'Bochkarev, A.'                        9  
'Park, H.'                             10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of a predicted human GTPase in complex with GDP' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, J.'         1  
primary 'Shen, Y.'         2  
primary 'Tempel, W.'       3  
primary 'Landry, R.'       4  
primary 'Arrowsmith, C.H.' 5  
primary 'Edwards, A.M.'    6  
primary 'Sundstrom, M.'    7  
primary 'Weigelt, J.'      8  
primary 'Bochkarev, A.'    9  
primary 'Park, H.'         10 
# 
_cell.entry_id           2IL1 
_cell.length_a           45.463 
_cell.length_b           45.463 
_cell.length_c           315.454 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IL1 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Rab12                      21930.199 1  ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'            24.305    1  ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'              40.078    1  ? ? ? ? 
4 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201   1  ? ? ? ? 
5 non-polymer syn 'UNKNOWN ATOM OR ION'      ?         6  ? ? ? ? 
6 water       nat water                      18.015    24 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIW
DTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQ
ITGMRFCEASAKDNFNVDEIFLKLVDDILKKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIW
DTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQ
ITGMRFCEASAKDNFNVDEIFLKLVDDILKKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  PRO n 
1 21  ARG n 
1 22  PRO n 
1 23  ALA n 
1 24  ASP n 
1 25  PHE n 
1 26  LYS n 
1 27  LEU n 
1 28  GLN n 
1 29  VAL n 
1 30  ILE n 
1 31  ILE n 
1 32  ILE n 
1 33  GLY n 
1 34  SER n 
1 35  ARG n 
1 36  GLY n 
1 37  VAL n 
1 38  GLY n 
1 39  LYS n 
1 40  THR n 
1 41  SER n 
1 42  LEU n 
1 43  MET n 
1 44  GLU n 
1 45  ARG n 
1 46  PHE n 
1 47  THR n 
1 48  ASP n 
1 49  ASP n 
1 50  THR n 
1 51  PHE n 
1 52  CYS n 
1 53  GLU n 
1 54  ALA n 
1 55  CYS n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  VAL n 
1 60  GLY n 
1 61  VAL n 
1 62  ASP n 
1 63  PHE n 
1 64  LYS n 
1 65  ILE n 
1 66  LYS n 
1 67  THR n 
1 68  VAL n 
1 69  GLU n 
1 70  LEU n 
1 71  ARG n 
1 72  GLY n 
1 73  LYS n 
1 74  LYS n 
1 75  ILE n 
1 76  ARG n 
1 77  LEU n 
1 78  GLN n 
1 79  ILE n 
1 80  TRP n 
1 81  ASP n 
1 82  THR n 
1 83  ALA n 
1 84  GLY n 
1 85  GLN n 
1 86  GLU n 
1 87  ARG n 
1 88  PHE n 
1 89  ASN n 
1 90  SER n 
1 91  ILE n 
1 92  THR n 
1 93  SER n 
1 94  ALA n 
1 95  TYR n 
1 96  TYR n 
1 97  ARG n 
1 98  SER n 
1 99  ALA n 
1 100 LYS n 
1 101 GLY n 
1 102 ILE n 
1 103 ILE n 
1 104 LEU n 
1 105 VAL n 
1 106 TYR n 
1 107 ASP n 
1 108 ILE n 
1 109 THR n 
1 110 LYS n 
1 111 LYS n 
1 112 GLU n 
1 113 THR n 
1 114 PHE n 
1 115 ASP n 
1 116 ASP n 
1 117 LEU n 
1 118 PRO n 
1 119 LYS n 
1 120 TRP n 
1 121 MET n 
1 122 LYS n 
1 123 MET n 
1 124 ILE n 
1 125 ASP n 
1 126 LYS n 
1 127 TYR n 
1 128 ALA n 
1 129 SER n 
1 130 GLU n 
1 131 ASP n 
1 132 ALA n 
1 133 GLU n 
1 134 LEU n 
1 135 LEU n 
1 136 LEU n 
1 137 VAL n 
1 138 GLY n 
1 139 ASN n 
1 140 LYS n 
1 141 LEU n 
1 142 ASP n 
1 143 CYS n 
1 144 GLU n 
1 145 THR n 
1 146 ASP n 
1 147 ARG n 
1 148 GLU n 
1 149 ILE n 
1 150 THR n 
1 151 ARG n 
1 152 GLN n 
1 153 GLN n 
1 154 GLY n 
1 155 GLU n 
1 156 LYS n 
1 157 PHE n 
1 158 ALA n 
1 159 GLN n 
1 160 GLN n 
1 161 ILE n 
1 162 THR n 
1 163 GLY n 
1 164 MET n 
1 165 ARG n 
1 166 PHE n 
1 167 CYS n 
1 168 GLU n 
1 169 ALA n 
1 170 SER n 
1 171 ALA n 
1 172 LYS n 
1 173 ASP n 
1 174 ASN n 
1 175 PHE n 
1 176 ASN n 
1 177 VAL n 
1 178 ASP n 
1 179 GLU n 
1 180 ILE n 
1 181 PHE n 
1 182 LEU n 
1 183 LYS n 
1 184 LEU n 
1 185 VAL n 
1 186 ASP n 
1 187 ASP n 
1 188 ILE n 
1 189 LEU n 
1 190 LYS n 
1 191 LYS n 
1 192 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Rab12 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus(DE-3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAB43_HUMAN 
_struct_ref.pdbx_db_accession          Q86YS6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2IL1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 192 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q86YS6 
_struct_ref_seq.db_align_beg                  16 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  165 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       132 
_struct_ref_seq.pdbx_auth_seq_align_end       304 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IL1 MET A 1  ? UNP Q86YS6 ? ? 'INITIATING METHIONINE' 113 1  
1 2IL1 GLY A 2  ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      114 2  
1 2IL1 SER A 3  ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      115 3  
1 2IL1 SER A 4  ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      116 4  
1 2IL1 HIS A 5  ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        117 5  
1 2IL1 HIS A 6  ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        118 6  
1 2IL1 HIS A 7  ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        119 7  
1 2IL1 HIS A 8  ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        120 8  
1 2IL1 HIS A 9  ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        121 9  
1 2IL1 HIS A 10 ? UNP Q86YS6 ? ? 'EXPRESSION TAG'        122 10 
1 2IL1 SER A 11 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      123 11 
1 2IL1 SER A 12 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      124 12 
1 2IL1 GLY A 13 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      125 13 
1 2IL1 LEU A 14 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      126 14 
1 2IL1 VAL A 15 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      127 15 
1 2IL1 PRO A 16 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      128 16 
1 2IL1 ARG A 17 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      129 17 
1 2IL1 GLY A 18 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      130 18 
1 2IL1 SER A 19 ? UNP Q86YS6 ? ? 'CLONING ARTIFACT'      131 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'              ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'      ? ?                   ?       
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2IL1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   51.1 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'22% PEG4000, 0.2M calcium acetate, 0.1M sodium cacodylate, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength_list        0.97625 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     2IL1 
_reflns.d_resolution_high            2.000 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   13543 
_reflns.pdbx_Rmerge_I_obs            0.052 
_reflns.pdbx_netI_over_sigmaI        13.100 
_reflns.pdbx_chi_squared             1.218 
_reflns.pdbx_redundancy              13.900 
_reflns.percent_possible_obs         94.200 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.00 2.07  ? ? 730  0.43  ? ? 1.605 2.10  52.30  ? ? 1  1 
2.07 2.15  ? ? 1243 0.314 ? ? 0.575 4.90  91.50  ? ? 2  1 
2.15 2.25  ? ? 1360 0.266 ? ? 0.633 9.90  98.80  ? ? 3  1 
2.25 2.37  ? ? 1386 0.207 ? ? 0.566 14.50 99.60  ? ? 4  1 
2.37 2.52  ? ? 1398 0.153 ? ? 0.577 16.90 100.00 ? ? 5  1 
2.52 2.71  ? ? 1401 0.105 ? ? 0.697 17.80 100.00 ? ? 6  1 
2.71 2.99  ? ? 1420 0.079 ? ? 1.034 17.70 100.00 ? ? 7  1 
2.99 3.42  ? ? 1458 0.052 ? ? 1.401 17.30 99.70  ? ? 8  1 
3.42 4.31  ? ? 1475 0.047 ? ? 2.175 16.20 99.90  ? ? 9  1 
4.31 50.00 ? ? 1672 0.039 ? ? 2.439 14.30 98.60  ? ? 10 1 
# 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.B_iso_mean                               39.449 
_refine.aniso_B[1][1]                            -0.056 
_refine.aniso_B[2][2]                            -0.056 
_refine.aniso_B[3][3]                            0.085 
_refine.aniso_B[1][2]                            -0.028 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'MASK BULK SOLVENT' 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             30.000 
_refine.ls_number_reflns_R_free                  615 
_refine.ls_number_reflns_obs                     12316 
_refine.ls_R_factor_R_work                       0.2412 
_refine.ls_R_factor_R_free                       0.2661 
_refine.ls_wR_factor_R_work                      0.246 
_refine.ls_wR_factor_R_free                      0.263 
_refine.ls_percent_reflns_obs                    99.467 
_refine.ls_percent_reflns_R_free                 4.994 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.pdbx_overall_ESU_R                       0.240 
_refine.pdbx_overall_ESU_R_Free                  0.194 
_refine.entry_id                                 2IL1 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1G17, chain A' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1278 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               1338 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             1344 0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1817 1.415  1.991  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       167  5.825  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       56   37.483 24.821 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       252  13.407 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       7    15.609 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr               209  0.094  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         966  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined                562  0.206  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              945  0.294  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        54   0.143  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          1    0.221  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       29   0.241  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     6    0.154  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 1    0.092  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it                  853  2.439  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1324 3.245  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it                  584  2.740  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it                 491  3.600  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
20 2.154  2.100 884 95.249  800 0.283 42 0.328 . . . . . 'X-RAY DIFFRACTION' 
20 2.213  2.154 832 98.438  767 0.249 52 0.283 . . . . . 'X-RAY DIFFRACTION' 
20 2.277  2.213 866 99.885  816 0.239 49 0.343 . . . . . 'X-RAY DIFFRACTION' 
20 2.347  2.277 782 99.872  745 0.237 36 0.266 . . . . . 'X-RAY DIFFRACTION' 
20 2.423  2.347 786 100.000 751 0.226 35 0.321 . . . . . 'X-RAY DIFFRACTION' 
20 2.507  2.423 790 100.000 751 0.239 39 0.304 . . . . . 'X-RAY DIFFRACTION' 
20 2.601  2.507 714 100.000 679 0.237 35 0.341 . . . . . 'X-RAY DIFFRACTION' 
20 2.707  2.601 721 100.000 676 0.23  45 0.227 . . . . . 'X-RAY DIFFRACTION' 
20 2.826  2.707 708 100.000 679 0.248 29 0.227 . . . . . 'X-RAY DIFFRACTION' 
20 2.963  2.826 644 100.000 617 0.235 27 0.271 . . . . . 'X-RAY DIFFRACTION' 
20 3.121  2.963 638 100.000 599 0.225 39 0.342 . . . . . 'X-RAY DIFFRACTION' 
20 3.308  3.121 621 99.839  588 0.245 32 0.272 . . . . . 'X-RAY DIFFRACTION' 
20 3.534  3.308 571 99.650  548 0.22  21 0.32  . . . . . 'X-RAY DIFFRACTION' 
20 3.812  3.534 547 100.000 516 0.21  31 0.22  . . . . . 'X-RAY DIFFRACTION' 
20 4.170  3.812 502 100.000 478 0.22  24 0.258 . . . . . 'X-RAY DIFFRACTION' 
20 4.651  4.170 467 99.572  435 0.201 30 0.2   . . . . . 'X-RAY DIFFRACTION' 
20 5.349  4.651 409 100.000 396 0.23  13 0.162 . . . . . 'X-RAY DIFFRACTION' 
20 6.499  5.349 385 100.000 370 0.301 15 0.27  . . . . . 'X-RAY DIFFRACTION' 
20 8.983  6.499 303 100.000 291 0.293 12 0.353 . . . . . 'X-RAY DIFFRACTION' 
20 30.000 8.983 212 98.113  199 0.323 9  0.297 . . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2IL1 
_struct.title                     'Crystal structure of a predicted human GTPase in complex with GDP' 
_struct.pdbx_descriptor           'predicted human GTPase in complex with GDP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
'G-PROTEIN, RAB, GDP, GTPASE, PREDICTED, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN TRANSPORT' 
_struct_keywords.entry_id        2IL1 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'not known' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 38  ? THR A 47  ? GLY A 150 THR A 159 1 ? 10 
HELX_P HELX_P2 2 GLN A 85  ? ARG A 87  ? GLN A 197 ARG A 199 5 ? 3  
HELX_P HELX_P3 3 PHE A 88  ? ALA A 99  ? PHE A 200 ALA A 211 1 ? 12 
HELX_P HELX_P4 4 LYS A 110 ? ASP A 116 ? LYS A 222 ASP A 228 1 ? 7  
HELX_P HELX_P5 5 ASP A 116 ? ALA A 128 ? ASP A 228 ALA A 240 1 ? 13 
HELX_P HELX_P6 6 LYS A 140 ? ARG A 147 ? LYS A 252 ARG A 259 5 ? 8  
HELX_P HELX_P7 7 THR A 150 ? GLN A 160 ? THR A 262 GLN A 272 1 ? 11 
HELX_P HELX_P8 8 ASN A 176 ? LYS A 191 ? ASN A 288 LYS A 303 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B MG . MG ? ? ? 1_555 D GDP .   O3B ? ? A MG 402 A GDP 401  1_555  ? ? ? ? ? ? ? 2.431 ? 
metalc2  metalc ? ? B MG . MG ? ? ? 1_555 A THR 40  OG1 ? ? A MG 402 A THR 152  1_555  ? ? ? ? ? ? ? 2.345 ? 
metalc3  metalc ? ? B MG . MG ? ? ? 1_555 K HOH .   O   ? ? A MG 402 A HOH 1013 1_555  ? ? ? ? ? ? ? 2.020 ? 
metalc4  metalc ? ? B MG . MG ? ? ? 1_555 K HOH .   O   ? ? A MG 402 A HOH 1014 1_555  ? ? ? ? ? ? ? 2.500 ? 
metalc5  metalc ? ? B MG . MG ? ? ? 1_555 K HOH .   O   ? ? A MG 402 A HOH 1015 1_555  ? ? ? ? ? ? ? 2.423 ? 
metalc6  metalc ? ? C CA . CA ? ? ? 1_555 K HOH .   O   ? ? A CA 501 A HOH 1001 1_555  ? ? ? ? ? ? ? 2.586 ? 
metalc7  metalc ? ? C CA . CA ? ? ? 1_555 A ASP 178 OD2 ? ? A CA 501 A ASP 290  1_555  ? ? ? ? ? ? ? 2.199 ? 
metalc8  metalc ? ? C CA . CA ? ? ? 1_555 A GLU 179 OE1 ? ? A CA 501 A GLU 291  1_555  ? ? ? ? ? ? ? 2.484 ? 
metalc9  metalc ? ? C CA . CA ? ? ? 1_555 A GLU 179 OE2 ? ? A CA 501 A GLU 291  1_555  ? ? ? ? ? ? ? 2.559 ? 
metalc10 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 178 OD2 ? ? A CA 501 A ASP 290  10_665 ? ? ? ? ? ? ? 2.328 ? 
metalc11 metalc ? ? C CA . CA ? ? ? 1_555 K HOH .   O   ? ? A CA 501 A HOH 1001 10_665 ? ? ? ? ? ? ? 2.497 ? 
metalc12 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 179 OE1 ? ? A CA 501 A GLU 291  10_665 ? ? ? ? ? ? ? 2.584 ? 
metalc13 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 179 OE2 ? ? A CA 501 A GLU 291  10_665 ? ? ? ? ? ? ? 2.722 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 61  ? LEU A 70  ? VAL A 173 LEU A 182 
A 2 LYS A 73  ? THR A 82  ? LYS A 185 THR A 194 
A 3 PHE A 25  ? ILE A 32  ? PHE A 137 ILE A 144 
A 4 GLY A 101 ? ASP A 107 ? GLY A 213 ASP A 219 
A 5 GLU A 133 ? ASN A 139 ? GLU A 245 ASN A 251 
A 6 ARG A 165 ? GLU A 168 ? ARG A 277 GLU A 280 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 66  ? N LYS A 178 O LEU A 77  ? O LEU A 189 
A 2 3 O ARG A 76  ? O ARG A 188 N PHE A 25  ? N PHE A 137 
A 3 4 N ILE A 32  ? N ILE A 144 O ILE A 103 ? O ILE A 215 
A 4 5 N TYR A 106 ? N TYR A 218 O ASN A 139 ? O ASN A 251 
A 5 6 N LEU A 136 ? N LEU A 248 O ARG A 165 ? O ARG A 277 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 402'   
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 501'   
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE GDP A 401'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 1401' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE UNX A 1402' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 1403' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 1404' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNX A 1405' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNX A 1406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  THR A 40  ? THR A 152  . ? 1_555  ? 
2  AC1 5  GDP D .   ? GDP A 401  . ? 1_555  ? 
3  AC1 5  HOH K .   ? HOH A 1013 . ? 1_555  ? 
4  AC1 5  HOH K .   ? HOH A 1014 . ? 1_555  ? 
5  AC1 5  HOH K .   ? HOH A 1015 . ? 1_555  ? 
6  AC2 6  ASP A 178 ? ASP A 290  . ? 10_665 ? 
7  AC2 6  ASP A 178 ? ASP A 290  . ? 1_555  ? 
8  AC2 6  GLU A 179 ? GLU A 291  . ? 1_555  ? 
9  AC2 6  GLU A 179 ? GLU A 291  . ? 10_665 ? 
10 AC2 6  HOH K .   ? HOH A 1001 . ? 10_665 ? 
11 AC2 6  HOH K .   ? HOH A 1001 . ? 1_555  ? 
12 AC3 17 ARG A 35  ? ARG A 147  . ? 1_555  ? 
13 AC3 17 GLY A 36  ? GLY A 148  . ? 1_555  ? 
14 AC3 17 VAL A 37  ? VAL A 149  . ? 1_555  ? 
15 AC3 17 GLY A 38  ? GLY A 150  . ? 1_555  ? 
16 AC3 17 LYS A 39  ? LYS A 151  . ? 1_555  ? 
17 AC3 17 THR A 40  ? THR A 152  . ? 1_555  ? 
18 AC3 17 SER A 41  ? SER A 153  . ? 1_555  ? 
19 AC3 17 ASN A 139 ? ASN A 251  . ? 1_555  ? 
20 AC3 17 LYS A 140 ? LYS A 252  . ? 1_555  ? 
21 AC3 17 ASP A 142 ? ASP A 254  . ? 1_555  ? 
22 AC3 17 CYS A 143 ? CYS A 255  . ? 1_555  ? 
23 AC3 17 SER A 170 ? SER A 282  . ? 1_555  ? 
24 AC3 17 ALA A 171 ? ALA A 283  . ? 1_555  ? 
25 AC3 17 LYS A 172 ? LYS A 284  . ? 1_555  ? 
26 AC3 17 MG  B .   ? MG  A 402  . ? 1_555  ? 
27 AC3 17 HOH K .   ? HOH A 1014 . ? 1_555  ? 
28 AC3 17 UNX H .   ? UNX A 1404 . ? 1_555  ? 
29 AC4 2  CYS A 167 ? CYS A 279  . ? 1_555  ? 
30 AC4 2  ASN A 176 ? ASN A 288  . ? 1_555  ? 
31 AC5 5  ARG A 87  ? ARG A 199  . ? 8_665  ? 
32 AC5 5  PHE A 88  ? PHE A 200  . ? 8_665  ? 
33 AC5 5  SER A 90  ? SER A 202  . ? 8_665  ? 
34 AC5 5  ILE A 91  ? ILE A 203  . ? 8_665  ? 
35 AC5 5  GLN A 160 ? GLN A 272  . ? 1_555  ? 
36 AC6 2  ASP A 142 ? ASP A 254  . ? 1_555  ? 
37 AC6 2  ASP A 173 ? ASP A 285  . ? 1_555  ? 
38 AC7 2  CYS A 143 ? CYS A 255  . ? 1_555  ? 
39 AC7 2  GDP D .   ? GDP A 401  . ? 1_555  ? 
40 AC8 3  ALA A 83  ? ALA A 195  . ? 8_665  ? 
41 AC8 3  LYS A 122 ? LYS A 234  . ? 1_555  ? 
42 AC8 3  ASP A 125 ? ASP A 237  . ? 1_555  ? 
43 AC9 3  ASP A 142 ? ASP A 254  . ? 1_555  ? 
44 AC9 3  GLU A 144 ? GLU A 256  . ? 1_555  ? 
45 AC9 3  THR A 145 ? THR A 257  . ? 1_555  ? 
# 
_atom_sites.entry_id                    2IL1 
_atom_sites.fract_transf_matrix[1][1]   0.021996 
_atom_sites.fract_transf_matrix[1][2]   0.012699 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025399 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003170 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 22  ? 1.102   49.431 17.642 1.00 51.97 ? 134  PRO A N     1 
ATOM   2    C  CA    . PRO A 1 22  ? 1.346   48.719 16.391 1.00 51.07 ? 134  PRO A CA    1 
ATOM   3    C  C     . PRO A 1 22  ? 2.398   47.617 16.564 1.00 50.53 ? 134  PRO A C     1 
ATOM   4    O  O     . PRO A 1 22  ? 3.147   47.611 17.547 1.00 52.28 ? 134  PRO A O     1 
ATOM   5    C  CB    . PRO A 1 22  ? 1.853   49.821 15.444 1.00 50.96 ? 134  PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 22  ? 1.329   51.087 16.015 1.00 52.54 ? 134  PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 22  ? 1.308   50.884 17.508 1.00 52.83 ? 134  PRO A CD    1 
ATOM   8    N  N     . ALA A 1 23  ? 2.444   46.686 15.621 1.00 50.26 ? 135  ALA A N     1 
ATOM   9    C  CA    . ALA A 1 23  ? 3.311   45.514 15.751 1.00 48.27 ? 135  ALA A CA    1 
ATOM   10   C  C     . ALA A 1 23  ? 4.775   45.873 15.487 1.00 47.19 ? 135  ALA A C     1 
ATOM   11   O  O     . ALA A 1 23  ? 5.063   46.776 14.703 1.00 47.04 ? 135  ALA A O     1 
ATOM   12   C  CB    . ALA A 1 23  ? 2.844   44.407 14.829 1.00 48.20 ? 135  ALA A CB    1 
ATOM   13   N  N     . ASP A 1 24  ? 5.688   45.187 16.172 1.00 43.80 ? 136  ASP A N     1 
ATOM   14   C  CA    . ASP A 1 24  ? 7.120   45.346 15.908 1.00 44.23 ? 136  ASP A CA    1 
ATOM   15   C  C     . ASP A 1 24  ? 7.521   44.534 14.667 1.00 44.86 ? 136  ASP A C     1 
ATOM   16   O  O     . ASP A 1 24  ? 8.398   44.956 13.903 1.00 46.41 ? 136  ASP A O     1 
ATOM   17   C  CB    . ASP A 1 24  ? 7.972   44.931 17.118 1.00 42.12 ? 136  ASP A CB    1 
ATOM   18   C  CG    . ASP A 1 24  ? 7.651   45.731 18.371 1.00 43.23 ? 136  ASP A CG    1 
ATOM   19   O  OD1   . ASP A 1 24  ? 7.878   46.968 18.387 1.00 43.98 ? 136  ASP A OD1   1 
ATOM   20   O  OD2   . ASP A 1 24  ? 7.178   45.115 19.350 1.00 42.03 ? 136  ASP A OD2   1 
ATOM   21   N  N     . PHE A 1 25  ? 6.871   43.376 14.482 1.00 42.02 ? 137  PHE A N     1 
ATOM   22   C  CA    . PHE A 1 25  ? 7.120   42.494 13.333 1.00 41.31 ? 137  PHE A CA    1 
ATOM   23   C  C     . PHE A 1 25  ? 5.829   41.924 12.750 1.00 36.96 ? 137  PHE A C     1 
ATOM   24   O  O     . PHE A 1 25  ? 4.862   41.673 13.475 1.00 35.64 ? 137  PHE A O     1 
ATOM   25   C  CB    . PHE A 1 25  ? 8.039   41.318 13.720 1.00 43.78 ? 137  PHE A CB    1 
ATOM   26   C  CG    . PHE A 1 25  ? 9.390   41.734 14.214 1.00 44.89 ? 137  PHE A CG    1 
ATOM   27   C  CD1   . PHE A 1 25  ? 10.396  42.084 13.315 1.00 47.14 ? 137  PHE A CD1   1 
ATOM   28   C  CD2   . PHE A 1 25  ? 9.661   41.783 15.583 1.00 45.27 ? 137  PHE A CD2   1 
ATOM   29   C  CE1   . PHE A 1 25  ? 11.656  42.471 13.771 1.00 46.00 ? 137  PHE A CE1   1 
ATOM   30   C  CE2   . PHE A 1 25  ? 10.908  42.165 16.054 1.00 47.17 ? 137  PHE A CE2   1 
ATOM   31   C  CZ    . PHE A 1 25  ? 11.913  42.516 15.145 1.00 47.04 ? 137  PHE A CZ    1 
ATOM   32   N  N     . LYS A 1 26  ? 5.829   41.721 11.436 1.00 34.88 ? 138  LYS A N     1 
ATOM   33   C  CA    . LYS A 1 26  ? 4.847   40.856 10.779 1.00 34.84 ? 138  LYS A CA    1 
ATOM   34   C  C     . LYS A 1 26  ? 5.589   39.629 10.271 1.00 37.85 ? 138  LYS A C     1 
ATOM   35   O  O     . LYS A 1 26  ? 6.640   39.752 9.631  1.00 38.91 ? 138  LYS A O     1 
ATOM   36   C  CB    . LYS A 1 26  ? 4.142   41.591 9.626  1.00 37.71 ? 138  LYS A CB    1 
ATOM   37   C  CG    . LYS A 1 26  ? 3.307   42.802 10.081 1.00 38.04 ? 138  LYS A CG    1 
ATOM   38   C  CD    . LYS A 1 26  ? 2.362   43.300 8.981  1.00 36.84 ? 138  LYS A CD    1 
ATOM   39   C  CE    . LYS A 1 26  ? 1.691   44.635 9.395  1.00 40.07 ? 138  LYS A CE    1 
ATOM   40   N  N     . LEU A 1 27  ? 5.069   38.447 10.589 1.00 38.53 ? 139  LEU A N     1 
ATOM   41   C  CA    . LEU A 1 27  ? 5.713   37.191 10.196 1.00 40.43 ? 139  LEU A CA    1 
ATOM   42   C  C     . LEU A 1 27  ? 4.702   36.244 9.615  1.00 36.79 ? 139  LEU A C     1 
ATOM   43   O  O     . LEU A 1 27  ? 3.580   36.158 10.106 1.00 36.97 ? 139  LEU A O     1 
ATOM   44   C  CB    . LEU A 1 27  ? 6.418   36.505 11.393 1.00 40.15 ? 139  LEU A CB    1 
ATOM   45   C  CG    . LEU A 1 27  ? 7.479   37.242 12.223 1.00 41.86 ? 139  LEU A CG    1 
ATOM   46   C  CD1   . LEU A 1 27  ? 7.925   36.365 13.374 1.00 43.91 ? 139  LEU A CD1   1 
ATOM   47   C  CD2   . LEU A 1 27  ? 8.691   37.683 11.402 1.00 41.21 ? 139  LEU A CD2   1 
ATOM   48   N  N     . GLN A 1 28  ? 5.111   35.522 8.575  1.00 36.89 ? 140  GLN A N     1 
ATOM   49   C  CA    . GLN A 1 28  ? 4.318   34.429 8.037  1.00 37.22 ? 140  GLN A CA    1 
ATOM   50   C  C     . GLN A 1 28  ? 4.910   33.096 8.396  1.00 39.61 ? 140  GLN A C     1 
ATOM   51   O  O     . GLN A 1 28  ? 6.106   32.896 8.313  1.00 38.54 ? 140  GLN A O     1 
ATOM   52   C  CB    . GLN A 1 28  ? 4.210   34.501 6.510  1.00 37.91 ? 140  GLN A CB    1 
ATOM   53   C  CG    . GLN A 1 28  ? 3.373   35.638 5.978  1.00 42.06 ? 140  GLN A CG    1 
ATOM   54   C  CD    . GLN A 1 28  ? 3.368   35.665 4.472  1.00 42.85 ? 140  GLN A CD    1 
ATOM   55   O  OE1   . GLN A 1 28  ? 2.882   34.736 3.826  1.00 42.69 ? 140  GLN A OE1   1 
ATOM   56   N  NE2   . GLN A 1 28  ? 3.921   36.720 3.900  1.00 43.83 ? 140  GLN A NE2   1 
ATOM   57   N  N     . VAL A 1 29  ? 4.033   32.186 8.791  1.00 40.06 ? 141  VAL A N     1 
ATOM   58   C  CA    . VAL A 1 29  ? 4.387   30.816 9.048  1.00 40.73 ? 141  VAL A CA    1 
ATOM   59   C  C     . VAL A 1 29  ? 3.359   29.991 8.319  1.00 38.98 ? 141  VAL A C     1 
ATOM   60   O  O     . VAL A 1 29  ? 2.259   30.473 8.067  1.00 37.69 ? 141  VAL A O     1 
ATOM   61   C  CB    . VAL A 1 29  ? 4.449   30.462 10.570 1.00 39.12 ? 141  VAL A CB    1 
ATOM   62   C  CG1   . VAL A 1 29  ? 5.499   31.331 11.275 1.00 39.18 ? 141  VAL A CG1   1 
ATOM   63   C  CG2   . VAL A 1 29  ? 3.124   30.629 11.254 1.00 38.14 ? 141  VAL A CG2   1 
ATOM   64   N  N     . ILE A 1 30  ? 3.768   28.789 7.926  1.00 34.83 ? 142  ILE A N     1 
ATOM   65   C  CA    A ILE A 1 30  ? 2.892   27.847 7.234  0.50 37.15 ? 142  ILE A CA    1 
ATOM   66   C  CA    B ILE A 1 30  ? 2.910   27.857 7.226  0.50 37.09 ? 142  ILE A CA    1 
ATOM   67   C  C     . ILE A 1 30  ? 2.869   26.509 7.968  1.00 38.58 ? 142  ILE A C     1 
ATOM   68   O  O     . ILE A 1 30  ? 3.869   26.092 8.578  1.00 40.43 ? 142  ILE A O     1 
ATOM   69   C  CB    A ILE A 1 30  ? 3.266   27.663 5.694  0.50 34.16 ? 142  ILE A CB    1 
ATOM   70   C  CB    B ILE A 1 30  ? 3.379   27.720 5.731  0.50 33.59 ? 142  ILE A CB    1 
ATOM   71   C  CG1   A ILE A 1 30  ? 4.615   26.974 5.510  0.50 37.65 ? 142  ILE A CG1   1 
ATOM   72   C  CG1   B ILE A 1 30  ? 2.297   27.098 4.863  0.50 33.42 ? 142  ILE A CG1   1 
ATOM   73   C  CG2   A ILE A 1 30  ? 3.264   29.003 4.964  0.50 35.63 ? 142  ILE A CG2   1 
ATOM   74   C  CG2   B ILE A 1 30  ? 4.708   26.988 5.613  0.50 38.05 ? 142  ILE A CG2   1 
ATOM   75   C  CD1   A ILE A 1 30  ? 4.866   26.457 4.094  0.50 35.79 ? 142  ILE A CD1   1 
ATOM   76   C  CD1   B ILE A 1 30  ? 2.571   27.299 3.361  0.50 36.58 ? 142  ILE A CD1   1 
ATOM   77   N  N     . ILE A 1 31  ? 1.720   25.847 7.940  1.00 36.34 ? 143  ILE A N     1 
ATOM   78   C  CA    . ILE A 1 31  ? 1.583   24.539 8.558  1.00 37.19 ? 143  ILE A CA    1 
ATOM   79   C  C     . ILE A 1 31  ? 1.348   23.529 7.454  1.00 38.09 ? 143  ILE A C     1 
ATOM   80   O  O     . ILE A 1 31  ? 0.388   23.652 6.684  1.00 35.96 ? 143  ILE A O     1 
ATOM   81   C  CB    . ILE A 1 31  ? 0.391   24.461 9.538  1.00 39.96 ? 143  ILE A CB    1 
ATOM   82   C  CG1   . ILE A 1 31  ? 0.382   25.650 10.522 1.00 40.75 ? 143  ILE A CG1   1 
ATOM   83   C  CG2   . ILE A 1 31  ? 0.446   23.138 10.265 1.00 37.94 ? 143  ILE A CG2   1 
ATOM   84   C  CD1   . ILE A 1 31  ? -0.932  25.788 11.344 1.00 40.84 ? 143  ILE A CD1   1 
ATOM   85   N  N     . ILE A 1 32  ? 2.227   22.539 7.379  1.00 38.09 ? 144  ILE A N     1 
ATOM   86   C  CA    . ILE A 1 32  ? 2.178   21.513 6.308  1.00 36.18 ? 144  ILE A CA    1 
ATOM   87   C  C     . ILE A 1 32  ? 2.186   20.116 6.914  1.00 37.09 ? 144  ILE A C     1 
ATOM   88   O  O     . ILE A 1 32  ? 2.434   19.943 8.110  1.00 36.88 ? 144  ILE A O     1 
ATOM   89   C  CB    . ILE A 1 32  ? 3.382   21.659 5.306  1.00 38.61 ? 144  ILE A CB    1 
ATOM   90   C  CG1   . ILE A 1 32  ? 4.748   21.444 6.024  1.00 33.27 ? 144  ILE A CG1   1 
ATOM   91   C  CG2   . ILE A 1 32  ? 3.367   23.020 4.652  1.00 37.05 ? 144  ILE A CG2   1 
ATOM   92   C  CD1   . ILE A 1 32  ? 5.992   21.420 5.052  1.00 30.48 ? 144  ILE A CD1   1 
ATOM   93   N  N     . GLY A 1 33  ? 1.919   19.117 6.084  1.00 36.23 ? 145  GLY A N     1 
ATOM   94   C  CA    . GLY A 1 33  ? 1.760   17.765 6.558  1.00 35.22 ? 145  GLY A CA    1 
ATOM   95   C  C     . GLY A 1 33  ? 0.580   17.078 5.900  1.00 35.39 ? 145  GLY A C     1 
ATOM   96   O  O     . GLY A 1 33  ? -0.288  17.715 5.319  1.00 36.67 ? 145  GLY A O     1 
ATOM   97   N  N     . SER A 1 34  ? 0.540   15.771 6.041  1.00 36.86 ? 146  SER A N     1 
ATOM   98   C  CA    . SER A 1 34  ? -0.458  14.951 5.348  1.00 40.39 ? 146  SER A CA    1 
ATOM   99   C  C     . SER A 1 34  ? -1.833  15.198 5.921  1.00 39.76 ? 146  SER A C     1 
ATOM   100  O  O     . SER A 1 34  ? -1.977  15.753 6.989  1.00 36.01 ? 146  SER A O     1 
ATOM   101  C  CB    . SER A 1 34  ? -0.084  13.493 5.468  1.00 39.15 ? 146  SER A CB    1 
ATOM   102  O  OG    . SER A 1 34  ? 1.191   13.303 4.904  1.00 42.61 ? 146  SER A OG    1 
ATOM   103  N  N     . ARG A 1 35  ? -2.855  14.799 5.188  1.00 42.89 ? 147  ARG A N     1 
ATOM   104  C  CA    . ARG A 1 35  ? -4.206  15.061 5.611  1.00 40.23 ? 147  ARG A CA    1 
ATOM   105  C  C     . ARG A 1 35  ? -4.507  14.293 6.899  1.00 39.21 ? 147  ARG A C     1 
ATOM   106  O  O     . ARG A 1 35  ? -4.082  13.139 7.065  1.00 37.11 ? 147  ARG A O     1 
ATOM   107  C  CB    . ARG A 1 35  ? -5.185  14.666 4.493  1.00 46.46 ? 147  ARG A CB    1 
ATOM   108  C  CG    . ARG A 1 35  ? -5.384  13.173 4.340  1.00 52.61 ? 147  ARG A CG    1 
ATOM   109  C  CD    . ARG A 1 35  ? -6.829  12.728 4.680  1.00 52.19 ? 147  ARG A CD    1 
ATOM   110  N  NE    . ARG A 1 35  ? -7.706  13.255 3.664  1.00 51.75 ? 147  ARG A NE    1 
ATOM   111  C  CZ    . ARG A 1 35  ? -8.229  12.583 2.643  1.00 49.70 ? 147  ARG A CZ    1 
ATOM   112  N  NH1   . ARG A 1 35  ? -8.994  13.237 1.806  1.00 44.91 ? 147  ARG A NH1   1 
ATOM   113  N  NH2   . ARG A 1 35  ? -8.023  11.276 2.457  1.00 53.51 ? 147  ARG A NH2   1 
ATOM   114  N  N     . GLY A 1 36  ? -5.242  14.936 7.798  1.00 35.48 ? 148  GLY A N     1 
ATOM   115  C  CA    . GLY A 1 36  ? -5.808  14.258 8.976  1.00 38.04 ? 148  GLY A CA    1 
ATOM   116  C  C     . GLY A 1 36  ? -4.869  14.251 10.186 1.00 37.25 ? 148  GLY A C     1 
ATOM   117  O  O     . GLY A 1 36  ? -5.174  13.657 11.223 1.00 36.45 ? 148  GLY A O     1 
ATOM   118  N  N     . VAL A 1 37  ? -3.739  14.929 10.066 1.00 38.78 ? 149  VAL A N     1 
ATOM   119  C  CA    . VAL A 1 37  ? -2.763  14.964 11.174 1.00 38.35 ? 149  VAL A CA    1 
ATOM   120  C  C     . VAL A 1 37  ? -3.115  15.989 12.264 1.00 38.98 ? 149  VAL A C     1 
ATOM   121  O  O     . VAL A 1 37  ? -2.627  15.863 13.394 1.00 39.99 ? 149  VAL A O     1 
ATOM   122  C  CB    . VAL A 1 37  ? -1.306  15.130 10.682 1.00 36.35 ? 149  VAL A CB    1 
ATOM   123  C  CG1   . VAL A 1 37  ? -0.954  13.968 9.755  1.00 37.86 ? 149  VAL A CG1   1 
ATOM   124  C  CG2   . VAL A 1 37  ? -1.097  16.470 9.960  1.00 33.63 ? 149  VAL A CG2   1 
ATOM   125  N  N     . GLY A 1 38  ? -3.954  16.986 11.912 1.00 37.21 ? 150  GLY A N     1 
ATOM   126  C  CA    . GLY A 1 38  ? -4.458  18.009 12.868 1.00 33.46 ? 150  GLY A CA    1 
ATOM   127  C  C     . GLY A 1 38  ? -3.905  19.405 12.650 1.00 34.17 ? 150  GLY A C     1 
ATOM   128  O  O     . GLY A 1 38  ? -3.857  20.215 13.588 1.00 34.90 ? 150  GLY A O     1 
ATOM   129  N  N     . LYS A 1 39  ? -3.476  19.691 11.422 1.00 35.04 ? 151  LYS A N     1 
ATOM   130  C  CA    . LYS A 1 39  ? -2.923  21.013 11.050 1.00 37.29 ? 151  LYS A CA    1 
ATOM   131  C  C     . LYS A 1 39  ? -3.947  22.140 11.300 1.00 36.40 ? 151  LYS A C     1 
ATOM   132  O  O     . LYS A 1 39  ? -3.620  23.199 11.860 1.00 37.59 ? 151  LYS A O     1 
ATOM   133  C  CB    . LYS A 1 39  ? -2.524  21.041 9.562  1.00 36.40 ? 151  LYS A CB    1 
ATOM   134  C  CG    . LYS A 1 39  ? -1.442  20.089 9.117  1.00 37.61 ? 151  LYS A CG    1 
ATOM   135  C  CD    . LYS A 1 39  ? -1.108  20.240 7.599  1.00 32.41 ? 151  LYS A CD    1 
ATOM   136  C  CE    . LYS A 1 39  ? -2.301  20.150 6.696  1.00 35.43 ? 151  LYS A CE    1 
ATOM   137  N  NZ    . LYS A 1 39  ? -2.740  18.752 6.596  1.00 33.11 ? 151  LYS A NZ    1 
ATOM   138  N  N     . THR A 1 40  ? -5.172  21.929 10.852 1.00 37.08 ? 152  THR A N     1 
ATOM   139  C  CA    . THR A 1 40  ? -6.242  22.916 11.064 1.00 35.63 ? 152  THR A CA    1 
ATOM   140  C  C     . THR A 1 40  ? -6.602  22.981 12.531 1.00 35.89 ? 152  THR A C     1 
ATOM   141  O  O     . THR A 1 40  ? -6.766  24.090 13.087 1.00 35.68 ? 152  THR A O     1 
ATOM   142  C  CB    . THR A 1 40  ? -7.485  22.648 10.153 1.00 33.43 ? 152  THR A CB    1 
ATOM   143  O  OG1   . THR A 1 40  ? -7.084  22.849 8.787  1.00 38.23 ? 152  THR A OG1   1 
ATOM   144  C  CG2   . THR A 1 40  ? -8.636  23.623 10.456 1.00 31.79 ? 152  THR A CG2   1 
ATOM   145  N  N     . SER A 1 41  ? -6.670  21.822 13.191 1.00 36.75 ? 153  SER A N     1 
ATOM   146  C  CA    . SER A 1 41  ? -7.028  21.815 14.620 1.00 37.10 ? 153  SER A CA    1 
ATOM   147  C  C     . SER A 1 41  ? -5.989  22.555 15.461 1.00 36.54 ? 153  SER A C     1 
ATOM   148  O  O     . SER A 1 41  ? -6.336  23.252 16.423 1.00 36.99 ? 153  SER A O     1 
ATOM   149  C  CB    . SER A 1 41  ? -7.212  20.397 15.137 1.00 38.29 ? 153  SER A CB    1 
ATOM   150  O  OG    . SER A 1 41  ? -8.180  19.711 14.381 1.00 36.30 ? 153  SER A OG    1 
ATOM   151  N  N     . LEU A 1 42  ? -4.712  22.382 15.109 1.00 39.29 ? 154  LEU A N     1 
ATOM   152  C  CA    . LEU A 1 42  ? -3.651  23.036 15.816 1.00 36.55 ? 154  LEU A CA    1 
ATOM   153  C  C     . LEU A 1 42  ? -3.756  24.545 15.643 1.00 35.53 ? 154  LEU A C     1 
ATOM   154  O  O     . LEU A 1 42  ? -3.691  25.286 16.624 1.00 35.38 ? 154  LEU A O     1 
ATOM   155  C  CB    . LEU A 1 42  ? -2.277  22.521 15.382 1.00 37.42 ? 154  LEU A CB    1 
ATOM   156  C  CG    . LEU A 1 42  ? -1.814  21.189 16.011 1.00 37.64 ? 154  LEU A CG    1 
ATOM   157  C  CD1   . LEU A 1 42  ? -0.569  20.636 15.266 1.00 39.32 ? 154  LEU A CD1   1 
ATOM   158  C  CD2   . LEU A 1 42  ? -1.535  21.359 17.495 1.00 35.84 ? 154  LEU A CD2   1 
ATOM   159  N  N     . MET A 1 43  ? -3.930  24.989 14.402 1.00 36.33 ? 155  MET A N     1 
ATOM   160  C  CA    . MET A 1 43  ? -4.094  26.416 14.117 1.00 38.77 ? 155  MET A CA    1 
ATOM   161  C  C     . MET A 1 43  ? -5.321  27.001 14.821 1.00 35.66 ? 155  MET A C     1 
ATOM   162  O  O     . MET A 1 43  ? -5.235  28.083 15.414 1.00 36.91 ? 155  MET A O     1 
ATOM   163  C  CB    . MET A 1 43  ? -4.167  26.687 12.609 1.00 39.87 ? 155  MET A CB    1 
ATOM   164  C  CG    . MET A 1 43  ? -4.300  28.201 12.277 1.00 42.96 ? 155  MET A CG    1 
ATOM   165  S  SD    . MET A 1 43  ? -4.508  28.581 10.515 1.00 42.42 ? 155  MET A SD    1 
ATOM   166  C  CE    . MET A 1 43  ? -6.197  27.971 10.223 1.00 43.06 ? 155  MET A CE    1 
ATOM   167  N  N     . GLU A 1 44  ? -6.461  26.302 14.757 1.00 35.27 ? 156  GLU A N     1 
ATOM   168  C  CA    . GLU A 1 44  ? -7.690  26.808 15.402 1.00 39.34 ? 156  GLU A CA    1 
ATOM   169  C  C     . GLU A 1 44  ? -7.647  26.803 16.934 1.00 35.90 ? 156  GLU A C     1 
ATOM   170  O  O     . GLU A 1 44  ? -8.190  27.701 17.554 1.00 36.87 ? 156  GLU A O     1 
ATOM   171  C  CB    . GLU A 1 44  ? -8.949  26.099 14.883 1.00 41.24 ? 156  GLU A CB    1 
ATOM   172  C  CG    . GLU A 1 44  ? -9.177  26.386 13.399 1.00 47.10 ? 156  GLU A CG    1 
ATOM   173  C  CD    . GLU A 1 44  ? -10.373 25.680 12.804 1.00 48.69 ? 156  GLU A CD    1 
ATOM   174  O  OE1   . GLU A 1 44  ? -10.857 24.676 13.390 1.00 49.47 ? 156  GLU A OE1   1 
ATOM   175  O  OE2   . GLU A 1 44  ? -10.811 26.131 11.719 1.00 51.94 ? 156  GLU A OE2   1 
ATOM   176  N  N     . ARG A 1 45  ? -7.009  25.806 17.540 1.00 36.04 ? 157  ARG A N     1 
ATOM   177  C  CA    . ARG A 1 45  ? -6.820  25.815 19.006 1.00 38.94 ? 157  ARG A CA    1 
ATOM   178  C  C     . ARG A 1 45  ? -5.979  27.026 19.479 1.00 39.20 ? 157  ARG A C     1 
ATOM   179  O  O     . ARG A 1 45  ? -6.220  27.588 20.553 1.00 36.55 ? 157  ARG A O     1 
ATOM   180  C  CB    . ARG A 1 45  ? -6.171  24.510 19.497 1.00 40.75 ? 157  ARG A CB    1 
ATOM   181  C  CG    . ARG A 1 45  ? -6.247  24.307 21.042 1.00 47.41 ? 157  ARG A CG    1 
ATOM   182  C  CD    . ARG A 1 45  ? -7.726  24.144 21.488 1.00 55.67 ? 157  ARG A CD    1 
ATOM   183  N  NE    . ARG A 1 45  ? -7.949  23.070 22.466 1.00 60.92 ? 157  ARG A NE    1 
ATOM   184  C  CZ    . ARG A 1 45  ? -8.297  23.257 23.740 1.00 62.15 ? 157  ARG A CZ    1 
ATOM   185  N  NH1   . ARG A 1 45  ? -8.472  24.486 24.221 1.00 64.07 ? 157  ARG A NH1   1 
ATOM   186  N  NH2   . ARG A 1 45  ? -8.476  22.206 24.541 1.00 62.29 ? 157  ARG A NH2   1 
ATOM   187  N  N     . PHE A 1 46  ? -5.001  27.417 18.665 1.00 37.51 ? 158  PHE A N     1 
ATOM   188  C  CA    . PHE A 1 46  ? -4.115  28.522 18.987 1.00 38.22 ? 158  PHE A CA    1 
ATOM   189  C  C     . PHE A 1 46  ? -4.772  29.877 18.760 1.00 40.94 ? 158  PHE A C     1 
ATOM   190  O  O     . PHE A 1 46  ? -4.541  30.811 19.527 1.00 39.61 ? 158  PHE A O     1 
ATOM   191  C  CB    . PHE A 1 46  ? -2.827  28.409 18.170 1.00 38.91 ? 158  PHE A CB    1 
ATOM   192  C  CG    . PHE A 1 46  ? -1.817  29.508 18.448 1.00 37.83 ? 158  PHE A CG    1 
ATOM   193  C  CD1   . PHE A 1 46  ? -1.294  29.695 19.734 1.00 40.71 ? 158  PHE A CD1   1 
ATOM   194  C  CD2   . PHE A 1 46  ? -1.349  30.322 17.411 1.00 37.85 ? 158  PHE A CD2   1 
ATOM   195  C  CE1   . PHE A 1 46  ? -0.333  30.707 19.989 1.00 42.71 ? 158  PHE A CE1   1 
ATOM   196  C  CE2   . PHE A 1 46  ? -0.394  31.316 17.655 1.00 39.48 ? 158  PHE A CE2   1 
ATOM   197  C  CZ    . PHE A 1 46  ? 0.103   31.522 18.941 1.00 39.05 ? 158  PHE A CZ    1 
ATOM   198  N  N     . THR A 1 47  ? -5.593  29.972 17.708 1.00 39.81 ? 159  THR A N     1 
ATOM   199  C  CA    . THR A 1 47  ? -6.305  31.193 17.363 1.00 42.29 ? 159  THR A CA    1 
ATOM   200  C  C     . THR A 1 47  ? -7.805  31.113 17.757 1.00 46.96 ? 159  THR A C     1 
ATOM   201  O  O     . THR A 1 47  ? -8.143  31.147 18.931 1.00 46.71 ? 159  THR A O     1 
ATOM   202  C  CB    . THR A 1 47  ? -6.170  31.496 15.858 1.00 40.94 ? 159  THR A CB    1 
ATOM   203  O  OG1   . THR A 1 47  ? -6.767  30.434 15.112 1.00 42.56 ? 159  THR A OG1   1 
ATOM   204  C  CG2   . THR A 1 47  ? -4.681  31.621 15.443 1.00 43.24 ? 159  THR A CG2   1 
ATOM   205  N  N     . ASP A 1 48  ? -8.685  31.017 16.755 1.00 52.57 ? 160  ASP A N     1 
ATOM   206  C  CA    . ASP A 1 48  ? -10.128 30.815 16.959 1.00 52.93 ? 160  ASP A CA    1 
ATOM   207  C  C     . ASP A 1 48  ? -10.716 29.848 15.910 1.00 54.15 ? 160  ASP A C     1 
ATOM   208  O  O     . ASP A 1 48  ? -10.059 29.516 14.904 1.00 51.05 ? 160  ASP A O     1 
ATOM   209  C  CB    . ASP A 1 48  ? -10.878 32.154 16.935 1.00 58.16 ? 160  ASP A CB    1 
ATOM   210  C  CG    . ASP A 1 48  ? -10.608 32.961 15.667 1.00 61.97 ? 160  ASP A CG    1 
ATOM   211  O  OD1   . ASP A 1 48  ? -9.889  33.980 15.758 1.00 64.21 ? 160  ASP A OD1   1 
ATOM   212  O  OD2   . ASP A 1 48  ? -11.114 32.580 14.580 1.00 64.15 ? 160  ASP A OD2   1 
ATOM   213  N  N     . SER A 1 57  ? -12.622 33.488 -0.960 1.00 47.83 ? 169  SER A N     1 
ATOM   214  C  CA    . SER A 1 57  ? -11.906 32.222 -0.821 1.00 48.80 ? 169  SER A CA    1 
ATOM   215  C  C     . SER A 1 57  ? -10.743 32.056 -1.796 1.00 48.23 ? 169  SER A C     1 
ATOM   216  O  O     . SER A 1 57  ? -10.782 32.528 -2.939 1.00 48.11 ? 169  SER A O     1 
ATOM   217  C  CB    . SER A 1 57  ? -12.863 31.037 -0.941 1.00 48.04 ? 169  SER A CB    1 
ATOM   218  O  OG    . SER A 1 57  ? -13.737 31.191 -2.050 1.00 53.19 ? 169  SER A OG    1 
ATOM   219  N  N     . THR A 1 58  ? -9.715  31.362 -1.321 1.00 46.08 ? 170  THR A N     1 
ATOM   220  C  CA    . THR A 1 58  ? -8.513  31.095 -2.076 1.00 46.49 ? 170  THR A CA    1 
ATOM   221  C  C     . THR A 1 58  ? -8.257  29.588 -2.036 1.00 42.33 ? 170  THR A C     1 
ATOM   222  O  O     . THR A 1 58  ? -8.234  28.984 -0.975 1.00 36.32 ? 170  THR A O     1 
ATOM   223  C  CB    . THR A 1 58  ? -7.290  31.864 -1.472 1.00 49.89 ? 170  THR A CB    1 
ATOM   224  O  OG1   . THR A 1 58  ? -7.333  31.787 -0.036 1.00 55.59 ? 170  THR A OG1   1 
ATOM   225  C  CG2   . THR A 1 58  ? -7.321  33.333 -1.878 1.00 52.10 ? 170  THR A CG2   1 
ATOM   226  N  N     . VAL A 1 59  ? -8.061  28.981 -3.190 1.00 39.88 ? 171  VAL A N     1 
ATOM   227  C  CA    . VAL A 1 59  ? -7.940  27.521 -3.247 1.00 41.20 ? 171  VAL A CA    1 
ATOM   228  C  C     . VAL A 1 59  ? -6.682  27.003 -2.559 1.00 40.49 ? 171  VAL A C     1 
ATOM   229  O  O     . VAL A 1 59  ? -5.587  27.598 -2.655 1.00 40.15 ? 171  VAL A O     1 
ATOM   230  C  CB    . VAL A 1 59  ? -8.113  26.949 -4.718 1.00 42.07 ? 171  VAL A CB    1 
ATOM   231  C  CG1   . VAL A 1 59  ? -7.172  27.615 -5.675 1.00 42.90 ? 171  VAL A CG1   1 
ATOM   232  C  CG2   . VAL A 1 59  ? -7.949  25.437 -4.742 1.00 41.32 ? 171  VAL A CG2   1 
ATOM   233  N  N     . GLY A 1 60  ? -6.846  25.913 -1.819 1.00 38.25 ? 172  GLY A N     1 
ATOM   234  C  CA    . GLY A 1 60  ? -5.688  25.196 -1.284 1.00 32.70 ? 172  GLY A CA    1 
ATOM   235  C  C     . GLY A 1 60  ? -5.082  25.773 -0.018 1.00 36.30 ? 172  GLY A C     1 
ATOM   236  O  O     . GLY A 1 60  ? -4.208  25.146 0.581  1.00 33.99 ? 172  GLY A O     1 
ATOM   237  N  N     . VAL A 1 61  ? -5.551  26.955 0.409  1.00 37.23 ? 173  VAL A N     1 
ATOM   238  C  CA    . VAL A 1 61  ? -5.033  27.605 1.625  1.00 38.94 ? 173  VAL A CA    1 
ATOM   239  C  C     . VAL A 1 61  ? -6.097  28.427 2.347  1.00 40.59 ? 173  VAL A C     1 
ATOM   240  O  O     . VAL A 1 61  ? -7.020  28.976 1.723  1.00 41.10 ? 173  VAL A O     1 
ATOM   241  C  CB    . VAL A 1 61  ? -3.818  28.561 1.365  1.00 40.62 ? 173  VAL A CB    1 
ATOM   242  C  CG1   . VAL A 1 61  ? -2.629  27.822 0.834  1.00 44.82 ? 173  VAL A CG1   1 
ATOM   243  C  CG2   . VAL A 1 61  ? -4.204  29.726 0.452  1.00 42.13 ? 173  VAL A CG2   1 
ATOM   244  N  N     . ASP A 1 62  ? -5.965  28.469 3.664  1.00 42.08 ? 174  ASP A N     1 
ATOM   245  C  CA    . ASP A 1 62  ? -6.687  29.387 4.537  1.00 44.41 ? 174  ASP A CA    1 
ATOM   246  C  C     . ASP A 1 62  ? -5.599  30.045 5.368  1.00 39.96 ? 174  ASP A C     1 
ATOM   247  O  O     . ASP A 1 62  ? -4.458  29.601 5.341  1.00 36.99 ? 174  ASP A O     1 
ATOM   248  C  CB    . ASP A 1 62  ? -7.626  28.639 5.491  1.00 49.13 ? 174  ASP A CB    1 
ATOM   249  C  CG    . ASP A 1 62  ? -8.645  27.785 4.775  1.00 53.95 ? 174  ASP A CG    1 
ATOM   250  O  OD1   . ASP A 1 62  ? -9.695  28.320 4.360  1.00 53.34 ? 174  ASP A OD1   1 
ATOM   251  O  OD2   . ASP A 1 62  ? -8.410  26.562 4.659  1.00 58.01 ? 174  ASP A OD2   1 
ATOM   252  N  N     . PHE A 1 63  ? -5.950  31.099 6.099  1.00 36.60 ? 175  PHE A N     1 
ATOM   253  C  CA    . PHE A 1 63  ? -5.038  31.743 7.027  1.00 42.82 ? 175  PHE A CA    1 
ATOM   254  C  C     . PHE A 1 63  ? -5.825  32.335 8.178  1.00 43.45 ? 175  PHE A C     1 
ATOM   255  O  O     . PHE A 1 63  ? -7.005  32.678 8.007  1.00 42.18 ? 175  PHE A O     1 
ATOM   256  C  CB    . PHE A 1 63  ? -4.175  32.826 6.346  1.00 43.39 ? 175  PHE A CB    1 
ATOM   257  C  CG    . PHE A 1 63  ? -4.906  34.125 6.080  1.00 47.21 ? 175  PHE A CG    1 
ATOM   258  C  CD1   . PHE A 1 63  ? -4.978  35.122 7.064  1.00 47.49 ? 175  PHE A CD1   1 
ATOM   259  C  CD2   . PHE A 1 63  ? -5.519  34.354 4.844  1.00 46.01 ? 175  PHE A CD2   1 
ATOM   260  C  CE1   . PHE A 1 63  ? -5.660  36.319 6.830  1.00 47.81 ? 175  PHE A CE1   1 
ATOM   261  C  CE2   . PHE A 1 63  ? -6.205  35.547 4.599  1.00 50.97 ? 175  PHE A CE2   1 
ATOM   262  C  CZ    . PHE A 1 63  ? -6.276  36.534 5.594  1.00 47.55 ? 175  PHE A CZ    1 
ATOM   263  N  N     . LYS A 1 64  ? -5.163  32.417 9.343  1.00 46.42 ? 176  LYS A N     1 
ATOM   264  C  CA    . LYS A 1 64  ? -5.616  33.184 10.531 1.00 43.25 ? 176  LYS A CA    1 
ATOM   265  C  C     . LYS A 1 64  ? -4.518  34.188 10.900 1.00 45.73 ? 176  LYS A C     1 
ATOM   266  O  O     . LYS A 1 64  ? -3.321  33.931 10.687 1.00 40.68 ? 176  LYS A O     1 
ATOM   267  C  CB    . LYS A 1 64  ? -5.829  32.275 11.736 1.00 45.51 ? 176  LYS A CB    1 
ATOM   268  C  CG    . LYS A 1 64  ? -6.956  31.250 11.671 1.00 48.66 ? 176  LYS A CG    1 
ATOM   269  C  CD    . LYS A 1 64  ? -8.321  31.829 11.989 1.00 50.42 ? 176  LYS A CD    1 
ATOM   270  C  CE    . LYS A 1 64  ? -9.393  30.732 11.922 1.00 54.24 ? 176  LYS A CE    1 
ATOM   271  N  NZ    . LYS A 1 64  ? -10.743 31.218 11.446 1.00 56.53 ? 176  LYS A NZ    1 
ATOM   272  N  N     . ILE A 1 65  ? -4.920  35.323 11.455 1.00 43.60 ? 177  ILE A N     1 
ATOM   273  C  CA    . ILE A 1 65  ? -3.990  36.342 11.915 1.00 44.72 ? 177  ILE A CA    1 
ATOM   274  C  C     . ILE A 1 65  ? -4.074  36.412 13.430 1.00 46.95 ? 177  ILE A C     1 
ATOM   275  O  O     . ILE A 1 65  ? -5.175  36.520 13.998 1.00 48.15 ? 177  ILE A O     1 
ATOM   276  C  CB    . ILE A 1 65  ? -4.325  37.733 11.313 1.00 45.43 ? 177  ILE A CB    1 
ATOM   277  C  CG1   . ILE A 1 65  ? -4.283  37.689 9.774  1.00 42.45 ? 177  ILE A CG1   1 
ATOM   278  C  CG2   . ILE A 1 65  ? -3.419  38.839 11.920 1.00 45.51 ? 177  ILE A CG2   1 
ATOM   279  C  CD1   . ILE A 1 65  ? -2.917  37.924 9.133  1.00 41.59 ? 177  ILE A CD1   1 
ATOM   280  N  N     . LYS A 1 66  ? -2.917  36.347 14.084 1.00 45.05 ? 178  LYS A N     1 
ATOM   281  C  CA    . LYS A 1 66  ? -2.838  36.397 15.539 1.00 45.34 ? 178  LYS A CA    1 
ATOM   282  C  C     . LYS A 1 66  ? -1.701  37.347 15.964 1.00 45.70 ? 178  LYS A C     1 
ATOM   283  O  O     . LYS A 1 66  ? -0.573  37.222 15.494 1.00 43.70 ? 178  LYS A O     1 
ATOM   284  C  CB    . LYS A 1 66  ? -2.650  34.976 16.091 1.00 47.26 ? 178  LYS A CB    1 
ATOM   285  C  CG    . LYS A 1 66  ? -2.465  34.845 17.618 1.00 50.03 ? 178  LYS A CG    1 
ATOM   286  C  CD    . LYS A 1 66  ? -3.775  34.778 18.340 1.00 51.84 ? 178  LYS A CD    1 
ATOM   287  C  CE    . LYS A 1 66  ? -3.582  34.608 19.843 1.00 54.16 ? 178  LYS A CE    1 
ATOM   288  N  NZ    . LYS A 1 66  ? -3.026  33.272 20.196 1.00 54.30 ? 178  LYS A NZ    1 
ATOM   289  N  N     . THR A 1 67  ? -2.019  38.299 16.836 1.00 41.43 ? 179  THR A N     1 
ATOM   290  C  CA    . THR A 1 67  ? -1.026  39.184 17.403 1.00 44.35 ? 179  THR A CA    1 
ATOM   291  C  C     . THR A 1 67  ? -0.502  38.597 18.712 1.00 44.29 ? 179  THR A C     1 
ATOM   292  O  O     . THR A 1 67  ? -1.258  38.421 19.683 1.00 46.59 ? 179  THR A O     1 
ATOM   293  C  CB    . THR A 1 67  ? -1.585  40.604 17.651 1.00 43.38 ? 179  THR A CB    1 
ATOM   294  O  OG1   . THR A 1 67  ? -1.894  41.226 16.397 1.00 47.84 ? 179  THR A OG1   1 
ATOM   295  C  CG2   . THR A 1 67  ? -0.562  41.469 18.397 1.00 42.92 ? 179  THR A CG2   1 
ATOM   296  N  N     . VAL A 1 68  ? 0.787   38.276 18.734 1.00 43.71 ? 180  VAL A N     1 
ATOM   297  C  CA    . VAL A 1 68  ? 1.375   37.680 19.920 1.00 43.61 ? 180  VAL A CA    1 
ATOM   298  C  C     . VAL A 1 68  ? 2.365   38.643 20.595 1.00 45.55 ? 180  VAL A C     1 
ATOM   299  O  O     . VAL A 1 68  ? 3.027   39.454 19.932 1.00 43.77 ? 180  VAL A O     1 
ATOM   300  C  CB    . VAL A 1 68  ? 2.002   36.268 19.655 1.00 43.72 ? 180  VAL A CB    1 
ATOM   301  C  CG1   . VAL A 1 68  ? 0.982   35.324 19.005 1.00 44.33 ? 180  VAL A CG1   1 
ATOM   302  C  CG2   . VAL A 1 68  ? 3.277   36.345 18.811 1.00 43.46 ? 180  VAL A CG2   1 
ATOM   303  N  N     . GLU A 1 69  ? 2.406   38.592 21.920 1.00 47.67 ? 181  GLU A N     1 
ATOM   304  C  CA    . GLU A 1 69  ? 3.386   39.349 22.686 1.00 49.47 ? 181  GLU A CA    1 
ATOM   305  C  C     . GLU A 1 69  ? 4.417   38.337 23.128 1.00 49.41 ? 181  GLU A C     1 
ATOM   306  O  O     . GLU A 1 69  ? 4.071   37.321 23.723 1.00 54.82 ? 181  GLU A O     1 
ATOM   307  C  CB    . GLU A 1 69  ? 2.736   40.049 23.874 1.00 51.86 ? 181  GLU A CB    1 
ATOM   308  C  CG    . GLU A 1 69  ? 2.257   41.480 23.576 1.00 54.87 ? 181  GLU A CG    1 
ATOM   309  N  N     . LEU A 1 70  ? 5.670   38.586 22.772 1.00 46.91 ? 182  LEU A N     1 
ATOM   310  C  CA    . LEU A 1 70  ? 6.750   37.654 23.004 1.00 47.76 ? 182  LEU A CA    1 
ATOM   311  C  C     . LEU A 1 70  ? 8.022   38.427 23.344 1.00 46.22 ? 182  LEU A C     1 
ATOM   312  O  O     . LEU A 1 70  ? 8.532   39.181 22.506 1.00 44.51 ? 182  LEU A O     1 
ATOM   313  C  CB    . LEU A 1 70  ? 6.983   36.807 21.762 1.00 49.28 ? 182  LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 70  ? 8.016   35.684 21.870 1.00 55.91 ? 182  LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 70  ? 7.347   34.356 22.257 1.00 54.87 ? 182  LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 70  ? 8.763   35.517 20.560 1.00 56.57 ? 182  LEU A CD2   1 
ATOM   317  N  N     . ARG A 1 71  ? 8.536   38.211 24.560 1.00 45.69 ? 183  ARG A N     1 
ATOM   318  C  CA    . ARG A 1 71  ? 9.730   38.915 25.077 1.00 43.42 ? 183  ARG A CA    1 
ATOM   319  C  C     . ARG A 1 71  ? 9.631   40.422 24.883 1.00 40.90 ? 183  ARG A C     1 
ATOM   320  O  O     . ARG A 1 71  ? 10.587  41.064 24.442 1.00 43.03 ? 183  ARG A O     1 
ATOM   321  C  CB    . ARG A 1 71  ? 11.009  38.397 24.410 1.00 46.33 ? 183  ARG A CB    1 
ATOM   322  C  CG    . ARG A 1 71  ? 11.327  36.942 24.644 1.00 44.50 ? 183  ARG A CG    1 
ATOM   323  C  CD    . ARG A 1 71  ? 12.399  36.476 23.673 1.00 46.85 ? 183  ARG A CD    1 
ATOM   324  N  N     . GLY A 1 72  ? 8.461   40.976 25.190 1.00 38.76 ? 184  GLY A N     1 
ATOM   325  C  CA    . GLY A 1 72  ? 8.214   42.408 25.071 1.00 40.21 ? 184  GLY A CA    1 
ATOM   326  C  C     . GLY A 1 72  ? 7.910   42.935 23.676 1.00 39.63 ? 184  GLY A C     1 
ATOM   327  O  O     . GLY A 1 72  ? 7.619   44.127 23.519 1.00 41.57 ? 184  GLY A O     1 
ATOM   328  N  N     . LYS A 1 73  ? 8.005   42.055 22.674 1.00 39.53 ? 185  LYS A N     1 
ATOM   329  C  CA    . LYS A 1 73  ? 7.747   42.384 21.262 1.00 39.15 ? 185  LYS A CA    1 
ATOM   330  C  C     . LYS A 1 73  ? 6.346   41.954 20.817 1.00 37.54 ? 185  LYS A C     1 
ATOM   331  O  O     . LYS A 1 73  ? 5.885   40.856 21.135 1.00 39.67 ? 185  LYS A O     1 
ATOM   332  C  CB    . LYS A 1 73  ? 8.801   41.746 20.341 1.00 39.99 ? 185  LYS A CB    1 
ATOM   333  C  CG    . LYS A 1 73  ? 10.198  42.364 20.474 1.00 43.09 ? 185  LYS A CG    1 
ATOM   334  N  N     . LYS A 1 74  ? 5.680   42.856 20.107 1.00 36.49 ? 186  LYS A N     1 
ATOM   335  C  CA    . LYS A 1 74  ? 4.374   42.630 19.529 1.00 34.89 ? 186  LYS A CA    1 
ATOM   336  C  C     . LYS A 1 74  ? 4.622   42.109 18.124 1.00 34.60 ? 186  LYS A C     1 
ATOM   337  O  O     . LYS A 1 74  ? 5.308   42.756 17.335 1.00 34.28 ? 186  LYS A O     1 
ATOM   338  C  CB    . LYS A 1 74  ? 3.597   43.959 19.478 1.00 35.65 ? 186  LYS A CB    1 
ATOM   339  C  CG    . LYS A 1 74  ? 2.198   43.844 18.957 1.00 34.85 ? 186  LYS A CG    1 
ATOM   340  C  CD    . LYS A 1 74  ? 1.347   45.028 19.345 1.00 34.98 ? 186  LYS A CD    1 
ATOM   341  N  N     . ILE A 1 75  ? 4.089   40.932 17.825 1.00 33.25 ? 187  ILE A N     1 
ATOM   342  C  CA    . ILE A 1 75  ? 4.323   40.285 16.553 1.00 34.82 ? 187  ILE A CA    1 
ATOM   343  C  C     . ILE A 1 75  ? 2.987   39.953 15.912 1.00 33.52 ? 187  ILE A C     1 
ATOM   344  O  O     . ILE A 1 75  ? 2.200   39.166 16.456 1.00 31.60 ? 187  ILE A O     1 
ATOM   345  C  CB    . ILE A 1 75  ? 5.109   38.920 16.706 1.00 38.66 ? 187  ILE A CB    1 
ATOM   346  C  CG1   . ILE A 1 75  ? 6.353   39.022 17.621 1.00 42.00 ? 187  ILE A CG1   1 
ATOM   347  C  CG2   . ILE A 1 75  ? 5.396   38.291 15.325 1.00 39.69 ? 187  ILE A CG2   1 
ATOM   348  C  CD1   . ILE A 1 75  ? 7.506   39.835 17.071 1.00 45.65 ? 187  ILE A CD1   1 
ATOM   349  N  N     . ARG A 1 76  ? 2.737   40.513 14.736 1.00 32.93 ? 188  ARG A N     1 
ATOM   350  C  CA    . ARG A 1 76  ? 1.533   40.145 13.994 1.00 34.76 ? 188  ARG A CA    1 
ATOM   351  C  C     . ARG A 1 76  ? 1.794   38.876 13.172 1.00 33.35 ? 188  ARG A C     1 
ATOM   352  O  O     . ARG A 1 76  ? 2.521   38.903 12.191 1.00 35.34 ? 188  ARG A O     1 
ATOM   353  C  CB    . ARG A 1 76  ? 1.083   41.309 13.110 1.00 35.31 ? 188  ARG A CB    1 
ATOM   354  C  CG    . ARG A 1 76  ? -0.178  41.048 12.358 1.00 35.64 ? 188  ARG A CG    1 
ATOM   355  C  CD    . ARG A 1 76  ? -0.397  42.142 11.337 1.00 43.93 ? 188  ARG A CD    1 
ATOM   356  N  NE    . ARG A 1 76  ? -1.731  42.081 10.750 1.00 49.79 ? 188  ARG A NE    1 
ATOM   357  C  CZ    . ARG A 1 76  ? -2.008  41.561 9.552  1.00 53.94 ? 188  ARG A CZ    1 
ATOM   358  N  NH1   . ARG A 1 76  ? -1.038  41.049 8.792  1.00 54.17 ? 188  ARG A NH1   1 
ATOM   359  N  NH2   . ARG A 1 76  ? -3.266  41.565 9.108  1.00 54.13 ? 188  ARG A NH2   1 
ATOM   360  N  N     . LEU A 1 77  ? 1.208   37.765 13.580 1.00 35.05 ? 189  LEU A N     1 
ATOM   361  C  CA    . LEU A 1 77  ? 1.536   36.481 12.984 1.00 37.28 ? 189  LEU A CA    1 
ATOM   362  C  C     . LEU A 1 77  ? 0.469   36.064 11.997 1.00 39.60 ? 189  LEU A C     1 
ATOM   363  O  O     . LEU A 1 77  ? -0.724  36.015 12.355 1.00 37.80 ? 189  LEU A O     1 
ATOM   364  C  CB    . LEU A 1 77  ? 1.685   35.417 14.082 1.00 42.27 ? 189  LEU A CB    1 
ATOM   365  C  CG    . LEU A 1 77  ? 2.276   34.032 13.795 1.00 42.83 ? 189  LEU A CG    1 
ATOM   366  C  CD1   . LEU A 1 77  ? 3.710   34.141 13.328 1.00 44.85 ? 189  LEU A CD1   1 
ATOM   367  C  CD2   . LEU A 1 77  ? 2.211   33.146 15.070 1.00 43.94 ? 189  LEU A CD2   1 
ATOM   368  N  N     . GLN A 1 78  ? 0.883   35.789 10.752 1.00 36.65 ? 190  GLN A N     1 
ATOM   369  C  CA    . GLN A 1 78  ? -0.041  35.256 9.737  1.00 39.38 ? 190  GLN A CA    1 
ATOM   370  C  C     . GLN A 1 78  ? 0.254   33.777 9.571  1.00 39.37 ? 190  GLN A C     1 
ATOM   371  O  O     . GLN A 1 78  ? 1.373   33.395 9.209  1.00 42.03 ? 190  GLN A O     1 
ATOM   372  C  CB    . GLN A 1 78  ? 0.104   35.980 8.407  1.00 37.42 ? 190  GLN A CB    1 
ATOM   373  C  CG    . GLN A 1 78  ? -0.826  35.431 7.325  1.00 41.43 ? 190  GLN A CG    1 
ATOM   374  C  CD    . GLN A 1 78  ? -0.867  36.282 6.069  1.00 41.94 ? 190  GLN A CD    1 
ATOM   375  O  OE1   . GLN A 1 78  ? 0.163   36.745 5.568  1.00 43.17 ? 190  GLN A OE1   1 
ATOM   376  N  NE2   . GLN A 1 78  ? -2.067  36.466 5.532  1.00 43.19 ? 190  GLN A NE2   1 
ATOM   377  N  N     . ILE A 1 79  ? -0.736  32.950 9.867  1.00 36.38 ? 191  ILE A N     1 
ATOM   378  C  CA    . ILE A 1 79  ? -0.558  31.521 9.869  1.00 39.64 ? 191  ILE A CA    1 
ATOM   379  C  C     . ILE A 1 79  ? -1.310  30.987 8.691  1.00 40.73 ? 191  ILE A C     1 
ATOM   380  O  O     . ILE A 1 79  ? -2.515  31.120 8.643  1.00 38.33 ? 191  ILE A O     1 
ATOM   381  C  CB    . ILE A 1 79  ? -1.097  30.880 11.176 1.00 40.97 ? 191  ILE A CB    1 
ATOM   382  C  CG1   . ILE A 1 79  ? -0.389  31.487 12.425 1.00 42.44 ? 191  ILE A CG1   1 
ATOM   383  C  CG2   . ILE A 1 79  ? -0.954  29.339 11.131 1.00 37.80 ? 191  ILE A CG2   1 
ATOM   384  C  CD1   . ILE A 1 79  ? -1.048  31.098 13.749 1.00 39.73 ? 191  ILE A CD1   1 
ATOM   385  N  N     . TRP A 1 80  ? -0.579  30.413 7.719  1.00 41.31 ? 192  TRP A N     1 
ATOM   386  C  CA    . TRP A 1 80  ? -1.203  29.763 6.564  1.00 40.66 ? 192  TRP A CA    1 
ATOM   387  C  C     . TRP A 1 80  ? -1.446  28.291 6.811  1.00 38.86 ? 192  TRP A C     1 
ATOM   388  O  O     . TRP A 1 80  ? -0.548  27.537 7.210  1.00 38.86 ? 192  TRP A O     1 
ATOM   389  C  CB    . TRP A 1 80  ? -0.338  29.884 5.311  1.00 41.43 ? 192  TRP A CB    1 
ATOM   390  C  CG    . TRP A 1 80  ? -0.120  31.262 4.857  1.00 41.48 ? 192  TRP A CG    1 
ATOM   391  C  CD1   . TRP A 1 80  ? 0.980   32.038 5.088  1.00 40.40 ? 192  TRP A CD1   1 
ATOM   392  C  CD2   . TRP A 1 80  ? -1.006  32.040 4.065  1.00 41.16 ? 192  TRP A CD2   1 
ATOM   393  N  NE1   . TRP A 1 80  ? 0.836   33.251 4.483  1.00 40.03 ? 192  TRP A NE1   1 
ATOM   394  C  CE2   . TRP A 1 80  ? -0.378  33.291 3.848  1.00 42.25 ? 192  TRP A CE2   1 
ATOM   395  C  CE3   . TRP A 1 80  ? -2.266  31.811 3.512  1.00 41.00 ? 192  TRP A CE3   1 
ATOM   396  C  CZ2   . TRP A 1 80  ? -0.976  34.316 3.099  1.00 39.51 ? 192  TRP A CZ2   1 
ATOM   397  C  CZ3   . TRP A 1 80  ? -2.868  32.843 2.759  1.00 41.78 ? 192  TRP A CZ3   1 
ATOM   398  C  CH2   . TRP A 1 80  ? -2.218  34.071 2.566  1.00 41.39 ? 192  TRP A CH2   1 
ATOM   399  N  N     . ASP A 1 81  ? -2.652  27.882 6.522  1.00 39.48 ? 193  ASP A N     1 
ATOM   400  C  CA    . ASP A 1 81  ? -3.058  26.515 6.665  1.00 40.80 ? 193  ASP A CA    1 
ATOM   401  C  C     . ASP A 1 81  ? -3.265  25.956 5.251  1.00 42.80 ? 193  ASP A C     1 
ATOM   402  O  O     . ASP A 1 81  ? -4.152  26.402 4.525  1.00 43.44 ? 193  ASP A O     1 
ATOM   403  C  CB    . ASP A 1 81  ? -4.367  26.504 7.457  1.00 38.52 ? 193  ASP A CB    1 
ATOM   404  C  CG    . ASP A 1 81  ? -4.835  25.105 7.828  1.00 42.12 ? 193  ASP A CG    1 
ATOM   405  O  OD1   . ASP A 1 81  ? -4.039  24.158 7.730  1.00 44.10 ? 193  ASP A OD1   1 
ATOM   406  O  OD2   . ASP A 1 81  ? -6.036  24.960 8.212  1.00 42.32 ? 193  ASP A OD2   1 
ATOM   407  N  N     . THR A 1 82  ? -2.460  24.964 4.891  1.00 41.56 ? 194  THR A N     1 
ATOM   408  C  CA    . THR A 1 82  ? -2.387  24.438 3.527  1.00 41.67 ? 194  THR A CA    1 
ATOM   409  C  C     . THR A 1 82  ? -3.080  23.083 3.367  1.00 42.19 ? 194  THR A C     1 
ATOM   410  O  O     . THR A 1 82  ? -3.263  22.346 4.336  1.00 43.62 ? 194  THR A O     1 
ATOM   411  C  CB    . THR A 1 82  ? -0.892  24.308 3.071  1.00 42.69 ? 194  THR A CB    1 
ATOM   412  O  OG1   . THR A 1 82  ? -0.211  23.346 3.901  1.00 43.77 ? 194  THR A OG1   1 
ATOM   413  C  CG2   . THR A 1 82  ? -0.195  25.670 3.188  1.00 41.08 ? 194  THR A CG2   1 
ATOM   414  N  N     . ALA A 1 83  ? -3.522  22.805 2.148  1.00 39.86 ? 195  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 83  ? -4.058  21.498 1.781  1.00 43.10 ? 195  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 83  ? -3.005  20.377 1.885  1.00 41.92 ? 195  ALA A C     1 
ATOM   417  O  O     . ALA A 1 83  ? -1.804  20.600 1.678  1.00 41.56 ? 195  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 83  ? -4.665  21.545 0.379  1.00 39.14 ? 195  ALA A CB    1 
ATOM   419  N  N     . GLY A 1 84  ? -3.483  19.170 2.190  1.00 40.05 ? 196  GLY A N     1 
ATOM   420  C  CA    . GLY A 1 84  ? -2.628  18.033 2.487  1.00 38.50 ? 196  GLY A CA    1 
ATOM   421  C  C     . GLY A 1 84  ? -2.373  17.105 1.320  1.00 38.26 ? 196  GLY A C     1 
ATOM   422  O  O     . GLY A 1 84  ? -1.349  16.434 1.284  1.00 41.42 ? 196  GLY A O     1 
ATOM   423  N  N     . GLN A 1 85  ? -3.287  17.046 0.363  1.00 37.32 ? 197  GLN A N     1 
ATOM   424  C  CA    . GLN A 1 85  ? -3.121  16.098 -0.745 1.00 37.86 ? 197  GLN A CA    1 
ATOM   425  C  C     . GLN A 1 85  ? -2.130  16.611 -1.761 1.00 37.14 ? 197  GLN A C     1 
ATOM   426  O  O     . GLN A 1 85  ? -2.003  17.825 -1.952 1.00 39.73 ? 197  GLN A O     1 
ATOM   427  C  CB    . GLN A 1 85  ? -4.451  15.755 -1.432 1.00 36.41 ? 197  GLN A CB    1 
ATOM   428  C  CG    . GLN A 1 85  ? -5.407  14.948 -0.577 1.00 39.35 ? 197  GLN A CG    1 
ATOM   429  C  CD    . GLN A 1 85  ? -6.633  14.501 -1.358 1.00 41.35 ? 197  GLN A CD    1 
ATOM   430  O  OE1   . GLN A 1 85  ? -6.761  14.772 -2.545 1.00 45.86 ? 197  GLN A OE1   1 
ATOM   431  N  NE2   . GLN A 1 85  ? -7.527  13.802 -0.695 1.00 46.05 ? 197  GLN A NE2   1 
ATOM   432  N  N     . GLU A 1 86  ? -1.456  15.663 -2.421 1.00 34.65 ? 198  GLU A N     1 
ATOM   433  C  CA    . GLU A 1 86  ? -0.362  15.921 -3.357 1.00 43.62 ? 198  GLU A CA    1 
ATOM   434  C  C     . GLU A 1 86  ? -0.776  16.767 -4.549 1.00 39.37 ? 198  GLU A C     1 
ATOM   435  O  O     . GLU A 1 86  ? 0.043   17.519 -5.077 1.00 37.90 ? 198  GLU A O     1 
ATOM   436  C  CB    . GLU A 1 86  ? 0.198   14.577 -3.863 1.00 48.88 ? 198  GLU A CB    1 
ATOM   437  C  CG    . GLU A 1 86  ? 1.443   14.651 -4.773 1.00 55.22 ? 198  GLU A CG    1 
ATOM   438  C  CD    . GLU A 1 86  ? 1.996   13.258 -5.093 1.00 57.18 ? 198  GLU A CD    1 
ATOM   439  O  OE1   . GLU A 1 86  ? 2.022   12.411 -4.151 1.00 63.40 ? 198  GLU A OE1   1 
ATOM   440  O  OE2   . GLU A 1 86  ? 2.386   13.001 -6.274 1.00 59.80 ? 198  GLU A OE2   1 
ATOM   441  N  N     . ARG A 1 87  ? -2.026  16.606 -5.004 1.00 37.34 ? 199  ARG A N     1 
ATOM   442  C  CA    . ARG A 1 87  ? -2.562  17.371 -6.141 1.00 37.32 ? 199  ARG A CA    1 
ATOM   443  C  C     . ARG A 1 87  ? -2.539  18.891 -5.844 1.00 35.15 ? 199  ARG A C     1 
ATOM   444  O  O     . ARG A 1 87  ? -2.599  19.719 -6.762 1.00 34.84 ? 199  ARG A O     1 
ATOM   445  C  CB    . ARG A 1 87  ? -3.998  16.910 -6.477 1.00 35.88 ? 199  ARG A CB    1 
ATOM   446  C  CG    . ARG A 1 87  ? -5.013  17.234 -5.387 1.00 37.74 ? 199  ARG A CG    1 
ATOM   447  C  CD    . ARG A 1 87  ? -6.400  16.738 -5.705 1.00 39.26 ? 199  ARG A CD    1 
ATOM   448  N  NE    . ARG A 1 87  ? -6.770  15.455 -5.100 1.00 38.00 ? 199  ARG A NE    1 
ATOM   449  C  CZ    . ARG A 1 87  ? -7.065  14.343 -5.790 1.00 37.16 ? 199  ARG A CZ    1 
ATOM   450  N  NH1   . ARG A 1 87  ? -7.013  14.316 -7.109 1.00 33.46 ? 199  ARG A NH1   1 
ATOM   451  N  NH2   . ARG A 1 87  ? -7.425  13.241 -5.144 1.00 39.68 ? 199  ARG A NH2   1 
ATOM   452  N  N     . PHE A 1 88  ? -2.437  19.228 -4.561 1.00 32.61 ? 200  PHE A N     1 
ATOM   453  C  CA    . PHE A 1 88  ? -2.392  20.625 -4.123 1.00 38.11 ? 200  PHE A CA    1 
ATOM   454  C  C     . PHE A 1 88  ? -0.968  21.143 -3.897 1.00 38.54 ? 200  PHE A C     1 
ATOM   455  O  O     . PHE A 1 88  ? -0.804  22.277 -3.502 1.00 41.54 ? 200  PHE A O     1 
ATOM   456  C  CB    . PHE A 1 88  ? -3.211  20.849 -2.850 1.00 34.25 ? 200  PHE A CB    1 
ATOM   457  C  CG    . PHE A 1 88  ? -4.691  20.580 -3.012 1.00 37.37 ? 200  PHE A CG    1 
ATOM   458  C  CD1   . PHE A 1 88  ? -5.506  21.467 -3.716 1.00 36.24 ? 200  PHE A CD1   1 
ATOM   459  C  CD2   . PHE A 1 88  ? -5.278  19.442 -2.439 1.00 36.94 ? 200  PHE A CD2   1 
ATOM   460  C  CE1   . PHE A 1 88  ? -6.905  21.226 -3.843 1.00 37.25 ? 200  PHE A CE1   1 
ATOM   461  C  CE2   . PHE A 1 88  ? -6.671  19.190 -2.583 1.00 35.66 ? 200  PHE A CE2   1 
ATOM   462  C  CZ    . PHE A 1 88  ? -7.471  20.086 -3.279 1.00 33.47 ? 200  PHE A CZ    1 
ATOM   463  N  N     . ASN A 1 89  ? 0.049   20.328 -4.159 1.00 39.51 ? 201  ASN A N     1 
ATOM   464  C  CA    . ASN A 1 89  ? 1.456   20.770 -3.935 1.00 41.30 ? 201  ASN A CA    1 
ATOM   465  C  C     . ASN A 1 89  ? 1.801   21.993 -4.783 1.00 41.47 ? 201  ASN A C     1 
ATOM   466  O  O     . ASN A 1 89  ? 2.394   22.955 -4.291 1.00 42.10 ? 201  ASN A O     1 
ATOM   467  C  CB    . ASN A 1 89  ? 2.450   19.636 -4.212 1.00 42.55 ? 201  ASN A CB    1 
ATOM   468  C  CG    . ASN A 1 89  ? 2.414   18.569 -3.139 1.00 43.48 ? 201  ASN A CG    1 
ATOM   469  O  OD1   . ASN A 1 89  ? 1.767   18.738 -2.091 1.00 43.68 ? 201  ASN A OD1   1 
ATOM   470  N  ND2   . ASN A 1 89  ? 3.088   17.455 -3.393 1.00 44.19 ? 201  ASN A ND2   1 
ATOM   471  N  N     . SER A 1 90  ? 1.403   21.958 -6.044 1.00 40.79 ? 202  SER A N     1 
ATOM   472  C  CA    . SER A 1 90  ? 1.620   23.072 -6.962 1.00 43.00 ? 202  SER A CA    1 
ATOM   473  C  C     . SER A 1 90  ? 1.076   24.400 -6.425 1.00 43.25 ? 202  SER A C     1 
ATOM   474  O  O     . SER A 1 90  ? 1.857   25.348 -6.298 1.00 45.38 ? 202  SER A O     1 
ATOM   475  C  CB    . SER A 1 90  ? 1.112   22.733 -8.369 1.00 46.76 ? 202  SER A CB    1 
ATOM   476  O  OG    . SER A 1 90  ? 1.326   23.795 -9.273 1.00 51.95 ? 202  SER A OG    1 
ATOM   477  N  N     . ILE A 1 91  ? -0.216  24.456 -6.036 1.00 40.06 ? 203  ILE A N     1 
ATOM   478  C  CA    . ILE A 1 91  ? -0.807  25.693 -5.435 1.00 37.53 ? 203  ILE A CA    1 
ATOM   479  C  C     . ILE A 1 91  ? -0.150  26.142 -4.158 1.00 37.25 ? 203  ILE A C     1 
ATOM   480  O  O     . ILE A 1 91  ? 0.105   27.338 -3.971 1.00 40.29 ? 203  ILE A O     1 
ATOM   481  C  CB    . ILE A 1 91  ? -2.364  25.589 -5.165 1.00 37.04 ? 203  ILE A CB    1 
ATOM   482  C  CG1   . ILE A 1 91  ? -3.119  25.756 -6.451 1.00 35.47 ? 203  ILE A CG1   1 
ATOM   483  C  CG2   . ILE A 1 91  ? -2.843  26.696 -4.206 1.00 37.87 ? 203  ILE A CG2   1 
ATOM   484  C  CD1   . ILE A 1 91  ? -4.544  25.248 -6.393 1.00 41.67 ? 203  ILE A CD1   1 
ATOM   485  N  N     . THR A 1 92  ? 0.104   25.194 -3.256 1.00 34.76 ? 204  THR A N     1 
ATOM   486  C  CA    . THR A 1 92  ? 0.564   25.536 -1.939 1.00 32.75 ? 204  THR A CA    1 
ATOM   487  C  C     . THR A 1 92  ? 2.035   25.963 -1.972 1.00 33.38 ? 204  THR A C     1 
ATOM   488  O  O     . THR A 1 92  ? 2.462   26.697 -1.112 1.00 32.46 ? 204  THR A O     1 
ATOM   489  C  CB    . THR A 1 92  ? 0.331   24.387 -0.922 1.00 34.26 ? 204  THR A CB    1 
ATOM   490  O  OG1   . THR A 1 92  ? 1.093   23.245 -1.316 1.00 34.90 ? 204  THR A OG1   1 
ATOM   491  C  CG2   . THR A 1 92  ? -1.171  24.009 -0.882 1.00 30.45 ? 204  THR A CG2   1 
ATOM   492  N  N     . SER A 1 93  ? 2.776   25.521 -2.997 1.00 32.05 ? 205  SER A N     1 
ATOM   493  C  CA    . SER A 1 93  ? 4.200   25.831 -3.136 1.00 35.14 ? 205  SER A CA    1 
ATOM   494  C  C     . SER A 1 93  ? 4.522   27.347 -3.041 1.00 36.14 ? 205  SER A C     1 
ATOM   495  O  O     . SER A 1 93  ? 5.549   27.738 -2.466 1.00 35.79 ? 205  SER A O     1 
ATOM   496  C  CB    . SER A 1 93  ? 4.782   25.223 -4.412 1.00 32.66 ? 205  SER A CB    1 
ATOM   497  O  OG    . SER A 1 93  ? 4.245   25.831 -5.588 1.00 38.88 ? 205  SER A OG    1 
ATOM   498  N  N     . ALA A 1 94  ? 3.640   28.162 -3.591 1.00 36.85 ? 206  ALA A N     1 
ATOM   499  C  CA    . ALA A 1 94  ? 3.742   29.624 -3.561 1.00 41.92 ? 206  ALA A CA    1 
ATOM   500  C  C     . ALA A 1 94  ? 3.867   30.197 -2.175 1.00 43.08 ? 206  ALA A C     1 
ATOM   501  O  O     . ALA A 1 94  ? 4.562   31.197 -1.964 1.00 48.74 ? 206  ALA A O     1 
ATOM   502  C  CB    . ALA A 1 94  ? 2.545   30.225 -4.246 1.00 44.92 ? 206  ALA A CB    1 
ATOM   503  N  N     . TYR A 1 95  ? 3.179   29.568 -1.221 1.00 42.96 ? 207  TYR A N     1 
ATOM   504  C  CA    . TYR A 1 95  ? 3.160   30.027 0.155  1.00 38.75 ? 207  TYR A CA    1 
ATOM   505  C  C     . TYR A 1 95  ? 4.382   29.604 0.947  1.00 39.97 ? 207  TYR A C     1 
ATOM   506  O  O     . TYR A 1 95  ? 4.634   30.122 2.032  1.00 37.66 ? 207  TYR A O     1 
ATOM   507  C  CB    . TYR A 1 95  ? 1.864   29.594 0.832  1.00 41.51 ? 207  TYR A CB    1 
ATOM   508  C  CG    . TYR A 1 95  ? 0.640   30.161 0.122  1.00 42.05 ? 207  TYR A CG    1 
ATOM   509  C  CD1   . TYR A 1 95  ? 0.106   31.404 0.482  1.00 39.69 ? 207  TYR A CD1   1 
ATOM   510  C  CD2   . TYR A 1 95  ? 0.047   29.474 -0.939 1.00 41.83 ? 207  TYR A CD2   1 
ATOM   511  C  CE1   . TYR A 1 95  ? -0.993  31.936 -0.186 1.00 40.44 ? 207  TYR A CE1   1 
ATOM   512  C  CE2   . TYR A 1 95  ? -1.056  30.000 -1.618 1.00 42.07 ? 207  TYR A CE2   1 
ATOM   513  C  CZ    . TYR A 1 95  ? -1.575  31.224 -1.225 1.00 42.72 ? 207  TYR A CZ    1 
ATOM   514  O  OH    . TYR A 1 95  ? -2.672  31.736 -1.899 1.00 45.62 ? 207  TYR A OH    1 
ATOM   515  N  N     . TYR A 1 96  ? 5.159   28.661 0.406  1.00 43.08 ? 208  TYR A N     1 
ATOM   516  C  CA    . TYR A 1 96  ? 6.390   28.228 1.067  1.00 39.96 ? 208  TYR A CA    1 
ATOM   517  C  C     . TYR A 1 96  ? 7.443   29.305 1.034  1.00 40.79 ? 208  TYR A C     1 
ATOM   518  O  O     . TYR A 1 96  ? 8.117   29.506 2.025  1.00 42.14 ? 208  TYR A O     1 
ATOM   519  C  CB    . TYR A 1 96  ? 6.973   26.984 0.411  1.00 39.54 ? 208  TYR A CB    1 
ATOM   520  C  CG    . TYR A 1 96  ? 6.342   25.669 0.790  1.00 38.99 ? 208  TYR A CG    1 
ATOM   521  C  CD1   . TYR A 1 96  ? 7.122   24.627 1.340  1.00 41.05 ? 208  TYR A CD1   1 
ATOM   522  C  CD2   . TYR A 1 96  ? 4.988   25.432 0.560  1.00 38.57 ? 208  TYR A CD2   1 
ATOM   523  C  CE1   . TYR A 1 96  ? 6.538   23.381 1.656  1.00 37.65 ? 208  TYR A CE1   1 
ATOM   524  C  CE2   . TYR A 1 96  ? 4.410   24.226 0.863  1.00 36.46 ? 208  TYR A CE2   1 
ATOM   525  C  CZ    . TYR A 1 96  ? 5.200   23.195 1.414  1.00 37.71 ? 208  TYR A CZ    1 
ATOM   526  O  OH    . TYR A 1 96  ? 4.600   21.988 1.713  1.00 38.37 ? 208  TYR A OH    1 
ATOM   527  N  N     . ARG A 1 97  ? 7.602   29.999 -0.104 1.00 41.47 ? 209  ARG A N     1 
ATOM   528  C  CA    . ARG A 1 97  ? 8.723   30.934 -0.253 1.00 42.77 ? 209  ARG A CA    1 
ATOM   529  C  C     . ARG A 1 97  ? 8.614   32.079 0.720  1.00 41.96 ? 209  ARG A C     1 
ATOM   530  O  O     . ARG A 1 97  ? 9.618   32.515 1.279  1.00 43.80 ? 209  ARG A O     1 
ATOM   531  C  CB    . ARG A 1 97  ? 8.866   31.468 -1.693 1.00 43.75 ? 209  ARG A CB    1 
ATOM   532  C  CG    . ARG A 1 97  ? 10.045  32.436 -1.881 1.00 44.18 ? 209  ARG A CG    1 
ATOM   533  C  CD    . ARG A 1 97  ? 10.020  33.099 -3.246 1.00 47.98 ? 209  ARG A CD    1 
ATOM   534  N  N     . SER A 1 98  ? 7.391   32.543 0.934  1.00 43.19 ? 210  SER A N     1 
ATOM   535  C  CA    . SER A 1 98  ? 7.120   33.656 1.849  1.00 43.90 ? 210  SER A CA    1 
ATOM   536  C  C     . SER A 1 98  ? 7.243   33.293 3.346  1.00 41.24 ? 210  SER A C     1 
ATOM   537  O  O     . SER A 1 98  ? 7.446   34.182 4.190  1.00 41.63 ? 210  SER A O     1 
ATOM   538  C  CB    . SER A 1 98  ? 5.737   34.279 1.538  1.00 45.20 ? 210  SER A CB    1 
ATOM   539  O  OG    . SER A 1 98  ? 4.679   33.308 1.515  1.00 43.81 ? 210  SER A OG    1 
ATOM   540  N  N     . ALA A 1 99  ? 7.139   32.000 3.667  1.00 40.09 ? 211  ALA A N     1 
ATOM   541  C  CA    . ALA A 1 99  ? 7.162   31.535 5.077  1.00 38.49 ? 211  ALA A CA    1 
ATOM   542  C  C     . ALA A 1 99  ? 8.500   31.750 5.737  1.00 39.87 ? 211  ALA A C     1 
ATOM   543  O  O     . ALA A 1 99  ? 9.536   31.386 5.208  1.00 37.03 ? 211  ALA A O     1 
ATOM   544  C  CB    . ALA A 1 99  ? 6.745   30.082 5.182  1.00 41.30 ? 211  ALA A CB    1 
ATOM   545  N  N     . LYS A 1 100 ? 8.473   32.370 6.910  1.00 38.81 ? 212  LYS A N     1 
ATOM   546  C  CA    . LYS A 1 100 ? 9.663   32.500 7.706  1.00 37.42 ? 212  LYS A CA    1 
ATOM   547  C  C     . LYS A 1 100 ? 9.828   31.280 8.631  1.00 34.82 ? 212  LYS A C     1 
ATOM   548  O  O     . LYS A 1 100 ? 10.912  30.969 9.081  1.00 36.85 ? 212  LYS A O     1 
ATOM   549  C  CB    . LYS A 1 100 ? 9.647   33.830 8.466  1.00 42.72 ? 212  LYS A CB    1 
ATOM   550  C  CG    . LYS A 1 100 ? 10.055  35.032 7.568  1.00 45.08 ? 212  LYS A CG    1 
ATOM   551  C  CD    . LYS A 1 100 ? 9.724   36.355 8.229  1.00 50.18 ? 212  LYS A CD    1 
ATOM   552  C  CE    . LYS A 1 100 ? 10.149  37.568 7.384  1.00 50.27 ? 212  LYS A CE    1 
ATOM   553  N  NZ    . LYS A 1 100 ? 9.397   38.819 7.784  1.00 52.05 ? 212  LYS A NZ    1 
ATOM   554  N  N     . GLY A 1 101 ? 8.740   30.595 8.881  1.00 34.61 ? 213  GLY A N     1 
ATOM   555  C  CA    . GLY A 1 101 ? 8.767   29.371 9.640  1.00 33.59 ? 213  GLY A CA    1 
ATOM   556  C  C     . GLY A 1 101 ? 7.776   28.398 9.057  1.00 32.33 ? 213  GLY A C     1 
ATOM   557  O  O     . GLY A 1 101 ? 6.748   28.781 8.489  1.00 32.80 ? 213  GLY A O     1 
ATOM   558  N  N     . ILE A 1 102 ? 8.086   27.131 9.227  1.00 32.17 ? 214  ILE A N     1 
ATOM   559  C  CA    . ILE A 1 102 ? 7.298   26.051 8.683  1.00 34.57 ? 214  ILE A CA    1 
ATOM   560  C  C     . ILE A 1 102 ? 7.136   25.035 9.802  1.00 34.99 ? 214  ILE A C     1 
ATOM   561  O  O     . ILE A 1 102 ? 8.131   24.611 10.476 1.00 31.87 ? 214  ILE A O     1 
ATOM   562  C  CB    . ILE A 1 102 ? 8.010   25.377 7.450  1.00 34.45 ? 214  ILE A CB    1 
ATOM   563  C  CG1   . ILE A 1 102 ? 8.235   26.409 6.332  1.00 32.43 ? 214  ILE A CG1   1 
ATOM   564  C  CG2   . ILE A 1 102 ? 7.172   24.151 6.948  1.00 34.01 ? 214  ILE A CG2   1 
ATOM   565  C  CD1   . ILE A 1 102 ? 9.086   25.949 5.139  1.00 36.41 ? 214  ILE A CD1   1 
ATOM   566  N  N     . ILE A 1 103 ? 5.895   24.683 10.028 1.00 34.29 ? 215  ILE A N     1 
ATOM   567  C  CA    . ILE A 1 103 ? 5.541   23.665 10.989 1.00 37.38 ? 215  ILE A CA    1 
ATOM   568  C  C     . ILE A 1 103 ? 5.108   22.448 10.165 1.00 36.52 ? 215  ILE A C     1 
ATOM   569  O  O     . ILE A 1 103 ? 4.145   22.505 9.424  1.00 37.61 ? 215  ILE A O     1 
ATOM   570  C  CB    . ILE A 1 103 ? 4.393   24.149 11.952 1.00 33.83 ? 215  ILE A CB    1 
ATOM   571  C  CG1   . ILE A 1 103 ? 4.876   25.347 12.790 1.00 41.02 ? 215  ILE A CG1   1 
ATOM   572  C  CG2   . ILE A 1 103 ? 3.956   23.018 12.863 1.00 35.12 ? 215  ILE A CG2   1 
ATOM   573  C  CD1   . ILE A 1 103 ? 3.789   26.235 13.368 1.00 38.28 ? 215  ILE A CD1   1 
ATOM   574  N  N     . LEU A 1 104 ? 5.852   21.363 10.296 1.00 34.72 ? 216  LEU A N     1 
ATOM   575  C  CA    . LEU A 1 104 ? 5.534   20.108 9.628  1.00 31.52 ? 216  LEU A CA    1 
ATOM   576  C  C     . LEU A 1 104 ? 4.926   19.111 10.668 1.00 34.15 ? 216  LEU A C     1 
ATOM   577  O  O     . LEU A 1 104 ? 5.524   18.810 11.706 1.00 33.89 ? 216  LEU A O     1 
ATOM   578  C  CB    . LEU A 1 104 ? 6.800   19.566 8.940  1.00 29.10 ? 216  LEU A CB    1 
ATOM   579  C  CG    . LEU A 1 104 ? 6.768   18.171 8.313  1.00 33.75 ? 216  LEU A CG    1 
ATOM   580  C  CD1   . LEU A 1 104 ? 5.611   17.946 7.314  1.00 30.46 ? 216  LEU A CD1   1 
ATOM   581  C  CD2   . LEU A 1 104 ? 8.116   17.913 7.639  1.00 31.87 ? 216  LEU A CD2   1 
ATOM   582  N  N     . VAL A 1 105 ? 3.704   18.662 10.406 1.00 33.38 ? 217  VAL A N     1 
ATOM   583  C  CA    . VAL A 1 105 ? 2.951   17.919 11.405 1.00 38.48 ? 217  VAL A CA    1 
ATOM   584  C  C     . VAL A 1 105 ? 2.744   16.474 10.950 1.00 38.05 ? 217  VAL A C     1 
ATOM   585  O  O     . VAL A 1 105 ? 2.447   16.224 9.768  1.00 32.34 ? 217  VAL A O     1 
ATOM   586  C  CB    . VAL A 1 105 ? 1.557   18.581 11.660 1.00 36.46 ? 217  VAL A CB    1 
ATOM   587  C  CG1   . VAL A 1 105 ? 0.796   17.879 12.766 1.00 34.18 ? 217  VAL A CG1   1 
ATOM   588  C  CG2   . VAL A 1 105 ? 1.693   20.105 11.995 1.00 33.10 ? 217  VAL A CG2   1 
ATOM   589  N  N     . TYR A 1 106 ? 2.898   15.519 11.877 1.00 35.60 ? 218  TYR A N     1 
ATOM   590  C  CA    . TYR A 1 106 ? 2.428   14.141 11.610 1.00 35.99 ? 218  TYR A CA    1 
ATOM   591  C  C     . TYR A 1 106 ? 1.534   13.710 12.778 1.00 38.19 ? 218  TYR A C     1 
ATOM   592  O  O     . TYR A 1 106 ? 1.393   14.430 13.790 1.00 34.23 ? 218  TYR A O     1 
ATOM   593  C  CB    . TYR A 1 106 ? 3.598   13.143 11.310 1.00 34.82 ? 218  TYR A CB    1 
ATOM   594  C  CG    . TYR A 1 106 ? 4.516   12.935 12.474 1.00 35.34 ? 218  TYR A CG    1 
ATOM   595  C  CD1   . TYR A 1 106 ? 4.316   11.867 13.351 1.00 32.70 ? 218  TYR A CD1   1 
ATOM   596  C  CD2   . TYR A 1 106 ? 5.583   13.832 12.731 1.00 34.08 ? 218  TYR A CD2   1 
ATOM   597  C  CE1   . TYR A 1 106 ? 5.139   11.676 14.426 1.00 32.18 ? 218  TYR A CE1   1 
ATOM   598  C  CE2   . TYR A 1 106 ? 6.410   13.646 13.812 1.00 32.54 ? 218  TYR A CE2   1 
ATOM   599  C  CZ    . TYR A 1 106 ? 6.188   12.580 14.660 1.00 32.69 ? 218  TYR A CZ    1 
ATOM   600  O  OH    . TYR A 1 106 ? 7.011   12.379 15.741 1.00 36.99 ? 218  TYR A OH    1 
ATOM   601  N  N     . ASP A 1 107 ? 0.902   12.564 12.615 1.00 37.06 ? 219  ASP A N     1 
ATOM   602  C  CA    . ASP A 1 107 ? -0.003  12.031 13.596 1.00 36.12 ? 219  ASP A CA    1 
ATOM   603  C  C     . ASP A 1 107 ? 0.737   10.856 14.221 1.00 35.02 ? 219  ASP A C     1 
ATOM   604  O  O     . ASP A 1 107 ? 1.037   9.894  13.543 1.00 36.14 ? 219  ASP A O     1 
ATOM   605  C  CB    . ASP A 1 107 ? -1.291  11.605 12.868 1.00 38.34 ? 219  ASP A CB    1 
ATOM   606  C  CG    . ASP A 1 107 ? -2.327  10.947 13.773 1.00 41.15 ? 219  ASP A CG    1 
ATOM   607  O  OD1   . ASP A 1 107 ? -2.054  10.635 14.955 1.00 41.73 ? 219  ASP A OD1   1 
ATOM   608  O  OD2   . ASP A 1 107 ? -3.446  10.748 13.266 1.00 37.96 ? 219  ASP A OD2   1 
ATOM   609  N  N     . ILE A 1 108 ? 1.066   10.959 15.511 1.00 33.18 ? 220  ILE A N     1 
ATOM   610  C  CA    . ILE A 1 108 ? 1.769   9.874  16.216 1.00 35.94 ? 220  ILE A CA    1 
ATOM   611  C  C     . ILE A 1 108 ? 1.036   8.517  16.179 1.00 38.66 ? 220  ILE A C     1 
ATOM   612  O  O     . ILE A 1 108 ? 1.675   7.479  16.382 1.00 35.58 ? 220  ILE A O     1 
ATOM   613  C  CB    . ILE A 1 108 ? 2.089   10.213 17.717 1.00 35.42 ? 220  ILE A CB    1 
ATOM   614  C  CG1   . ILE A 1 108 ? 0.801   10.222 18.569 1.00 35.26 ? 220  ILE A CG1   1 
ATOM   615  C  CG2   . ILE A 1 108 ? 2.900   11.529 17.843 1.00 35.13 ? 220  ILE A CG2   1 
ATOM   616  C  CD1   . ILE A 1 108 ? 1.043   10.268 20.080 1.00 36.93 ? 220  ILE A CD1   1 
ATOM   617  N  N     . THR A 1 109 ? -0.288  8.531  15.946 1.00 36.81 ? 221  THR A N     1 
ATOM   618  C  CA    . THR A 1 109 ? -1.083  7.279  15.836 1.00 39.01 ? 221  THR A CA    1 
ATOM   619  C  C     . THR A 1 109 ? -1.260  6.719  14.405 1.00 39.75 ? 221  THR A C     1 
ATOM   620  O  O     . THR A 1 109 ? -1.874  5.687  14.233 1.00 37.69 ? 221  THR A O     1 
ATOM   621  C  CB    . THR A 1 109 ? -2.501  7.402  16.510 1.00 42.01 ? 221  THR A CB    1 
ATOM   622  O  OG1   . THR A 1 109 ? -3.391  8.157  15.662 1.00 43.23 ? 221  THR A OG1   1 
ATOM   623  C  CG2   . THR A 1 109 ? -2.389  8.059  17.893 1.00 35.19 ? 221  THR A CG2   1 
ATOM   624  N  N     . LYS A 1 110 ? -0.729  7.411  13.399 1.00 39.21 ? 222  LYS A N     1 
ATOM   625  C  CA    . LYS A 1 110 ? -0.855  6.998  12.013 1.00 41.91 ? 222  LYS A CA    1 
ATOM   626  C  C     . LYS A 1 110 ? 0.522   6.991  11.363 1.00 42.12 ? 222  LYS A C     1 
ATOM   627  O  O     . LYS A 1 110 ? 0.974   8.007  10.841 1.00 43.54 ? 222  LYS A O     1 
ATOM   628  C  CB    . LYS A 1 110 ? -1.861  7.894  11.236 1.00 44.44 ? 222  LYS A CB    1 
ATOM   629  C  CG    . LYS A 1 110 ? -2.003  7.530  9.736  1.00 48.16 ? 222  LYS A CG    1 
ATOM   630  C  CD    . LYS A 1 110 ? -3.332  7.983  9.072  1.00 48.08 ? 222  LYS A CD    1 
ATOM   631  C  CE    . LYS A 1 110 ? -3.252  7.824  7.522  1.00 47.84 ? 222  LYS A CE    1 
ATOM   632  N  NZ    . LYS A 1 110 ? -4.604  7.787  6.837  1.00 49.88 ? 222  LYS A NZ    1 
ATOM   633  N  N     . LYS A 1 111 ? 1.177   5.827  11.387 1.00 41.72 ? 223  LYS A N     1 
ATOM   634  C  CA    . LYS A 1 111 ? 2.563   5.701  10.923 1.00 41.22 ? 223  LYS A CA    1 
ATOM   635  C  C     . LYS A 1 111 ? 2.830   6.211  9.495  1.00 41.60 ? 223  LYS A C     1 
ATOM   636  O  O     . LYS A 1 111 ? 3.925   6.756  9.212  1.00 38.03 ? 223  LYS A O     1 
ATOM   637  C  CB    . LYS A 1 111 ? 3.106   4.273  11.135 1.00 42.47 ? 223  LYS A CB    1 
ATOM   638  C  CG    . LYS A 1 111 ? 2.435   3.189  10.368 1.00 45.65 ? 223  LYS A CG    1 
ATOM   639  C  CD    . LYS A 1 111 ? 3.326   1.952  10.304 1.00 48.55 ? 223  LYS A CD    1 
ATOM   640  N  N     . GLU A 1 112 ? 1.850   6.056  8.601  1.00 36.64 ? 224  GLU A N     1 
ATOM   641  C  CA    . GLU A 1 112 ? 2.003   6.574  7.227  1.00 37.87 ? 224  GLU A CA    1 
ATOM   642  C  C     . GLU A 1 112 ? 2.145   8.103  7.131  1.00 34.53 ? 224  GLU A C     1 
ATOM   643  O  O     . GLU A 1 112 ? 2.727   8.588  6.190  1.00 33.15 ? 224  GLU A O     1 
ATOM   644  C  CB    . GLU A 1 112 ? 0.905   6.085  6.285  1.00 43.29 ? 224  GLU A CB    1 
ATOM   645  C  CG    . GLU A 1 112 ? -0.458  6.066  6.895  1.00 49.27 ? 224  GLU A CG    1 
ATOM   646  C  CD    . GLU A 1 112 ? -0.794  4.717  7.506  1.00 52.32 ? 224  GLU A CD    1 
ATOM   647  O  OE1   . GLU A 1 112 ? -0.971  3.746  6.727  1.00 57.02 ? 224  GLU A OE1   1 
ATOM   648  O  OE2   . GLU A 1 112 ? -0.884  4.630  8.754  1.00 51.62 ? 224  GLU A OE2   1 
ATOM   649  N  N     . THR A 1 113 ? 1.600   8.850  8.080  1.00 34.79 ? 225  THR A N     1 
ATOM   650  C  CA    . THR A 1 113 ? 1.824   10.298 8.081  1.00 36.29 ? 225  THR A CA    1 
ATOM   651  C  C     . THR A 1 113 ? 3.271   10.656 8.481  1.00 36.06 ? 225  THR A C     1 
ATOM   652  O  O     . THR A 1 113 ? 3.757   11.761 8.171  1.00 38.93 ? 225  THR A O     1 
ATOM   653  C  CB    . THR A 1 113 ? 0.828   11.033 8.979  1.00 34.17 ? 225  THR A CB    1 
ATOM   654  O  OG1   . THR A 1 113 ? 1.118   10.764 10.357 1.00 33.57 ? 225  THR A OG1   1 
ATOM   655  C  CG2   . THR A 1 113 ? -0.646  10.609 8.627  1.00 32.93 ? 225  THR A CG2   1 
ATOM   656  N  N     . PHE A 1 114 ? 3.932   9.730  9.186  1.00 34.56 ? 226  PHE A N     1 
ATOM   657  C  CA    . PHE A 1 114 ? 5.340   9.854  9.545  1.00 34.58 ? 226  PHE A CA    1 
ATOM   658  C  C     . PHE A 1 114 ? 6.185   9.368  8.357  1.00 35.73 ? 226  PHE A C     1 
ATOM   659  O  O     . PHE A 1 114 ? 7.263   9.923  8.058  1.00 32.41 ? 226  PHE A O     1 
ATOM   660  C  CB    . PHE A 1 114 ? 5.653   9.017  10.801 1.00 37.22 ? 226  PHE A CB    1 
ATOM   661  C  CG    . PHE A 1 114 ? 7.093   9.116  11.263 1.00 37.89 ? 226  PHE A CG    1 
ATOM   662  C  CD1   . PHE A 1 114 ? 7.512   10.198 12.066 1.00 39.10 ? 226  PHE A CD1   1 
ATOM   663  C  CD2   . PHE A 1 114 ? 8.029   8.147  10.899 1.00 39.77 ? 226  PHE A CD2   1 
ATOM   664  C  CE1   . PHE A 1 114 ? 8.841   10.311 12.491 1.00 40.28 ? 226  PHE A CE1   1 
ATOM   665  C  CE2   . PHE A 1 114 ? 9.376   8.246  11.323 1.00 39.80 ? 226  PHE A CE2   1 
ATOM   666  C  CZ    . PHE A 1 114 ? 9.770   9.343  12.122 1.00 40.23 ? 226  PHE A CZ    1 
ATOM   667  N  N     . ASP A 1 115 ? 5.673   8.346  7.673  1.00 35.72 ? 227  ASP A N     1 
ATOM   668  C  CA    . ASP A 1 115 ? 6.311   7.796  6.480  1.00 37.74 ? 227  ASP A CA    1 
ATOM   669  C  C     . ASP A 1 115 ? 6.307   8.766  5.310  1.00 35.60 ? 227  ASP A C     1 
ATOM   670  O  O     . ASP A 1 115 ? 7.128   8.648  4.422  1.00 35.00 ? 227  ASP A O     1 
ATOM   671  C  CB    . ASP A 1 115 ? 5.642   6.486  6.068  1.00 42.67 ? 227  ASP A CB    1 
ATOM   672  C  CG    . ASP A 1 115 ? 6.018   5.336  6.967  1.00 45.71 ? 227  ASP A CG    1 
ATOM   673  O  OD1   . ASP A 1 115 ? 6.928   5.510  7.816  1.00 45.09 ? 227  ASP A OD1   1 
ATOM   674  O  OD2   . ASP A 1 115 ? 5.397   4.263  6.828  1.00 48.79 ? 227  ASP A OD2   1 
ATOM   675  N  N     . ASP A 1 116 ? 5.364   9.709  5.324  1.00 34.94 ? 228  ASP A N     1 
ATOM   676  C  CA    . ASP A 1 116 ? 5.268   10.756 4.318  1.00 36.29 ? 228  ASP A CA    1 
ATOM   677  C  C     . ASP A 1 116 ? 6.283   11.898 4.499  1.00 37.16 ? 228  ASP A C     1 
ATOM   678  O  O     . ASP A 1 116 ? 6.449   12.730 3.596  1.00 37.31 ? 228  ASP A O     1 
ATOM   679  C  CB    . ASP A 1 116 ? 3.886   11.399 4.396  1.00 38.35 ? 228  ASP A CB    1 
ATOM   680  C  CG    . ASP A 1 116 ? 2.796   10.517 3.834  1.00 41.51 ? 228  ASP A CG    1 
ATOM   681  O  OD1   . ASP A 1 116 ? 3.121   9.522  3.118  1.00 39.74 ? 228  ASP A OD1   1 
ATOM   682  O  OD2   . ASP A 1 116 ? 1.611   10.835 4.108  1.00 39.00 ? 228  ASP A OD2   1 
ATOM   683  N  N     . LEU A 1 117 ? 6.918   11.969 5.664  1.00 35.68 ? 229  LEU A N     1 
ATOM   684  C  CA    . LEU A 1 117 ? 7.780   13.135 5.988  1.00 38.18 ? 229  LEU A CA    1 
ATOM   685  C  C     . LEU A 1 117 ? 8.881   13.455 4.942  1.00 35.34 ? 229  LEU A C     1 
ATOM   686  O  O     . LEU A 1 117 ? 9.104   14.639 4.658  1.00 37.39 ? 229  LEU A O     1 
ATOM   687  C  CB    . LEU A 1 117 ? 8.342   13.052 7.419  1.00 34.23 ? 229  LEU A CB    1 
ATOM   688  C  CG    . LEU A 1 117 ? 7.324   13.193 8.574  1.00 36.97 ? 229  LEU A CG    1 
ATOM   689  C  CD1   . LEU A 1 117 ? 8.014   13.034 9.912  1.00 34.58 ? 229  LEU A CD1   1 
ATOM   690  C  CD2   . LEU A 1 117 ? 6.485   14.479 8.518  1.00 37.46 ? 229  LEU A CD2   1 
ATOM   691  N  N     . PRO A 1 118 ? 9.550   12.415 4.345  1.00 32.23 ? 230  PRO A N     1 
ATOM   692  C  CA    . PRO A 1 118 ? 10.522  12.715 3.286  1.00 31.93 ? 230  PRO A CA    1 
ATOM   693  C  C     . PRO A 1 118 ? 9.932   13.458 2.076  1.00 34.94 ? 230  PRO A C     1 
ATOM   694  O  O     . PRO A 1 118 ? 10.591  14.290 1.505  1.00 34.88 ? 230  PRO A O     1 
ATOM   695  C  CB    . PRO A 1 118 ? 11.004  11.319 2.827  1.00 35.05 ? 230  PRO A CB    1 
ATOM   696  C  CG    . PRO A 1 118 ? 10.824  10.459 3.975  1.00 34.54 ? 230  PRO A CG    1 
ATOM   697  C  CD    . PRO A 1 118 ? 9.529   10.969 4.640  1.00 33.51 ? 230  PRO A CD    1 
ATOM   698  N  N     . LYS A 1 119 ? 8.698   13.140 1.697  1.00 37.89 ? 231  LYS A N     1 
ATOM   699  C  CA    . LYS A 1 119 ? 7.978   13.907 0.692  1.00 42.16 ? 231  LYS A CA    1 
ATOM   700  C  C     . LYS A 1 119 ? 7.768   15.372 1.095  1.00 38.98 ? 231  LYS A C     1 
ATOM   701  O  O     . LYS A 1 119 ? 7.958   16.265 0.275  1.00 37.19 ? 231  LYS A O     1 
ATOM   702  C  CB    . LYS A 1 119 ? 6.627   13.215 0.350  1.00 45.32 ? 231  LYS A CB    1 
ATOM   703  C  CG    . LYS A 1 119 ? 5.491   14.152 0.012  1.00 46.69 ? 231  LYS A CG    1 
ATOM   704  C  CD    . LYS A 1 119 ? 4.156   13.392 -0.245 1.00 51.63 ? 231  LYS A CD    1 
ATOM   705  C  CE    . LYS A 1 119 ? 3.389   13.157 1.015  1.00 52.07 ? 231  LYS A CE    1 
ATOM   706  N  NZ    . LYS A 1 119 ? 2.019   12.614 0.729  1.00 56.38 ? 231  LYS A NZ    1 
ATOM   707  N  N     . TRP A 1 120 ? 7.346   15.612 2.339  1.00 34.45 ? 232  TRP A N     1 
ATOM   708  C  CA    . TRP A 1 120 ? 7.252   16.962 2.859  1.00 36.21 ? 232  TRP A CA    1 
ATOM   709  C  C     . TRP A 1 120 ? 8.590   17.698 2.899  1.00 34.35 ? 232  TRP A C     1 
ATOM   710  O  O     . TRP A 1 120 ? 8.635   18.892 2.580  1.00 40.40 ? 232  TRP A O     1 
ATOM   711  C  CB    . TRP A 1 120 ? 6.534   16.979 4.219  1.00 35.47 ? 232  TRP A CB    1 
ATOM   712  C  CG    . TRP A 1 120 ? 5.122   16.556 4.040  1.00 37.60 ? 232  TRP A CG    1 
ATOM   713  C  CD1   . TRP A 1 120 ? 4.519   15.453 4.565  1.00 35.91 ? 232  TRP A CD1   1 
ATOM   714  C  CD2   . TRP A 1 120 ? 4.150   17.177 3.185  1.00 36.67 ? 232  TRP A CD2   1 
ATOM   715  N  NE1   . TRP A 1 120 ? 3.219   15.374 4.131  1.00 35.17 ? 232  TRP A NE1   1 
ATOM   716  C  CE2   . TRP A 1 120 ? 2.968   16.418 3.281  1.00 37.40 ? 232  TRP A CE2   1 
ATOM   717  C  CE3   . TRP A 1 120 ? 4.157   18.329 2.377  1.00 37.69 ? 232  TRP A CE3   1 
ATOM   718  C  CZ2   . TRP A 1 120 ? 1.784   16.761 2.576  1.00 36.80 ? 232  TRP A CZ2   1 
ATOM   719  C  CZ3   . TRP A 1 120 ? 2.994   18.672 1.690  1.00 39.09 ? 232  TRP A CZ3   1 
ATOM   720  C  CH2   . TRP A 1 120 ? 1.825   17.887 1.794  1.00 37.01 ? 232  TRP A CH2   1 
ATOM   721  N  N     . MET A 1 121 ? 9.668   16.982 3.253  1.00 34.19 ? 233  MET A N     1 
ATOM   722  C  CA    . MET A 1 121 ? 11.040  17.553 3.268  1.00 35.98 ? 233  MET A CA    1 
ATOM   723  C  C     . MET A 1 121 ? 11.505  17.918 1.866  1.00 38.21 ? 233  MET A C     1 
ATOM   724  O  O     . MET A 1 121 ? 12.257  18.883 1.670  1.00 36.93 ? 233  MET A O     1 
ATOM   725  C  CB    . MET A 1 121 ? 12.045  16.574 3.893  1.00 37.35 ? 233  MET A CB    1 
ATOM   726  C  CG    . MET A 1 121 ? 11.883  16.345 5.419  1.00 37.24 ? 233  MET A CG    1 
ATOM   727  S  SD    . MET A 1 121 ? 11.466  17.803 6.388  1.00 40.53 ? 233  MET A SD    1 
ATOM   728  C  CE    . MET A 1 121 ? 12.874  18.869 6.085  1.00 34.70 ? 233  MET A CE    1 
ATOM   729  N  N     . LYS A 1 122 ? 11.062  17.141 0.885  1.00 35.45 ? 234  LYS A N     1 
ATOM   730  C  CA    . LYS A 1 122 ? 11.341  17.459 -0.503 1.00 36.45 ? 234  LYS A CA    1 
ATOM   731  C  C     . LYS A 1 122 ? 10.609  18.742 -0.950 1.00 34.42 ? 234  LYS A C     1 
ATOM   732  O  O     . LYS A 1 122 ? 11.187  19.564 -1.650 1.00 32.54 ? 234  LYS A O     1 
ATOM   733  C  CB    . LYS A 1 122 ? 10.995  16.253 -1.405 1.00 42.33 ? 234  LYS A CB    1 
ATOM   734  C  CG    . LYS A 1 122 ? 12.096  15.212 -1.385 1.00 47.14 ? 234  LYS A CG    1 
ATOM   735  C  CD    . LYS A 1 122 ? 11.673  13.749 -1.609 1.00 47.37 ? 234  LYS A CD    1 
ATOM   736  C  CE    . LYS A 1 122 ? 12.921  12.851 -1.358 1.00 46.59 ? 234  LYS A CE    1 
ATOM   737  N  NZ    . LYS A 1 122 ? 12.583  11.446 -1.054 1.00 48.62 ? 234  LYS A NZ    1 
ATOM   738  N  N     . MET A 1 123 ? 9.352   18.913 -0.517 1.00 35.31 ? 235  MET A N     1 
ATOM   739  C  CA    . MET A 1 123 ? 8.603   20.158 -0.754 1.00 36.30 ? 235  MET A CA    1 
ATOM   740  C  C     . MET A 1 123 ? 9.366   21.358 -0.171 1.00 38.40 ? 235  MET A C     1 
ATOM   741  O  O     . MET A 1 123 ? 9.564   22.377 -0.849 1.00 39.57 ? 235  MET A O     1 
ATOM   742  C  CB    . MET A 1 123 ? 7.168   20.082 -0.159 1.00 39.39 ? 235  MET A CB    1 
ATOM   743  C  CG    . MET A 1 123 ? 6.148   19.308 -1.010 1.00 40.76 ? 235  MET A CG    1 
ATOM   744  S  SD    . MET A 1 123 ? 5.759   20.196 -2.550 1.00 44.05 ? 235  MET A SD    1 
ATOM   745  C  CE    . MET A 1 123 ? 4.870   21.601 -1.920 1.00 38.11 ? 235  MET A CE    1 
ATOM   746  N  N     . ILE A 1 124 ? 9.834   21.215 1.067  1.00 38.45 ? 236  ILE A N     1 
ATOM   747  C  CA    . ILE A 1 124 ? 10.679  22.230 1.692  1.00 34.29 ? 236  ILE A CA    1 
ATOM   748  C  C     . ILE A 1 124 ? 11.974  22.569 0.896  1.00 36.81 ? 236  ILE A C     1 
ATOM   749  O  O     . ILE A 1 124 ? 12.291  23.741 0.679  1.00 35.12 ? 236  ILE A O     1 
ATOM   750  C  CB    . ILE A 1 124 ? 10.988  21.873 3.190  1.00 35.76 ? 236  ILE A CB    1 
ATOM   751  C  CG1   . ILE A 1 124 ? 9.718   21.999 4.049  1.00 35.74 ? 236  ILE A CG1   1 
ATOM   752  C  CG2   . ILE A 1 124 ? 12.126  22.779 3.768  1.00 34.12 ? 236  ILE A CG2   1 
ATOM   753  C  CD1   . ILE A 1 124 ? 9.800   21.177 5.350  1.00 34.84 ? 236  ILE A CD1   1 
ATOM   754  N  N     . ASP A 1 125 ? 12.708  21.555 0.451  1.00 37.65 ? 237  ASP A N     1 
ATOM   755  C  CA    . ASP A 1 125 ? 13.927  21.793 -0.345 1.00 37.87 ? 237  ASP A CA    1 
ATOM   756  C  C     . ASP A 1 125 ? 13.674  22.594 -1.629 1.00 37.26 ? 237  ASP A C     1 
ATOM   757  O  O     . ASP A 1 125 ? 14.479  23.464 -2.014 1.00 34.73 ? 237  ASP A O     1 
ATOM   758  C  CB    . ASP A 1 125 ? 14.603  20.478 -0.725 1.00 34.18 ? 237  ASP A CB    1 
ATOM   759  C  CG    . ASP A 1 125 ? 15.974  20.693 -1.283 1.00 37.41 ? 237  ASP A CG    1 
ATOM   760  O  OD1   . ASP A 1 125 ? 16.786  21.308 -0.565 1.00 36.64 ? 237  ASP A OD1   1 
ATOM   761  O  OD2   . ASP A 1 125 ? 16.237  20.270 -2.445 1.00 33.33 ? 237  ASP A OD2   1 
ATOM   762  N  N     . LYS A 1 126 ? 12.585  22.268 -2.300 1.00 36.04 ? 238  LYS A N     1 
ATOM   763  C  CA    . LYS A 1 126 ? 12.229  22.912 -3.561 1.00 41.48 ? 238  LYS A CA    1 
ATOM   764  C  C     . LYS A 1 126 ? 11.770  24.351 -3.415 1.00 39.49 ? 238  LYS A C     1 
ATOM   765  O  O     . LYS A 1 126 ? 12.118  25.196 -4.233 1.00 38.61 ? 238  LYS A O     1 
ATOM   766  C  CB    . LYS A 1 126 ? 11.141  22.115 -4.285 1.00 41.14 ? 238  LYS A CB    1 
ATOM   767  C  CG    . LYS A 1 126 ? 11.625  20.792 -4.851 1.00 51.48 ? 238  LYS A CG    1 
ATOM   768  C  CD    . LYS A 1 126 ? 10.522  20.043 -5.566 1.00 53.49 ? 238  LYS A CD    1 
ATOM   769  C  CE    . LYS A 1 126 ? 10.347  20.499 -6.984 1.00 56.08 ? 238  LYS A CE    1 
ATOM   770  N  NZ    . LYS A 1 126 ? 9.465   19.517 -7.698 1.00 57.20 ? 238  LYS A NZ    1 
ATOM   771  N  N     . TYR A 1 127 ? 10.995  24.631 -2.366 1.00 41.57 ? 239  TYR A N     1 
ATOM   772  C  CA    . TYR A 1 127 ? 10.203  25.851 -2.338 1.00 40.29 ? 239  TYR A CA    1 
ATOM   773  C  C     . TYR A 1 127 ? 10.439  26.797 -1.172 1.00 39.06 ? 239  TYR A C     1 
ATOM   774  O  O     . TYR A 1 127 ? 10.219  28.009 -1.310 1.00 38.30 ? 239  TYR A O     1 
ATOM   775  C  CB    . TYR A 1 127 ? 8.721   25.488 -2.390 1.00 42.66 ? 239  TYR A CB    1 
ATOM   776  C  CG    . TYR A 1 127 ? 8.321   24.721 -3.625 1.00 43.95 ? 239  TYR A CG    1 
ATOM   777  C  CD1   . TYR A 1 127 ? 8.392   25.315 -4.895 1.00 43.37 ? 239  TYR A CD1   1 
ATOM   778  C  CD2   . TYR A 1 127 ? 7.847   23.414 -3.528 1.00 41.53 ? 239  TYR A CD2   1 
ATOM   779  C  CE1   . TYR A 1 127 ? 7.998   24.617 -6.038 1.00 44.33 ? 239  TYR A CE1   1 
ATOM   780  C  CE2   . TYR A 1 127 ? 7.445   22.709 -4.664 1.00 45.42 ? 239  TYR A CE2   1 
ATOM   781  C  CZ    . TYR A 1 127 ? 7.523   23.317 -5.914 1.00 44.50 ? 239  TYR A CZ    1 
ATOM   782  O  OH    . TYR A 1 127 ? 7.122   22.615 -7.031 1.00 44.86 ? 239  TYR A OH    1 
ATOM   783  N  N     . ALA A 1 128 ? 10.852  26.262 -0.028 1.00 37.11 ? 240  ALA A N     1 
ATOM   784  C  CA    . ALA A 1 128 ? 11.104  27.104 1.146  1.00 35.80 ? 240  ALA A CA    1 
ATOM   785  C  C     . ALA A 1 128 ? 12.325  27.995 0.937  1.00 39.37 ? 240  ALA A C     1 
ATOM   786  O  O     . ALA A 1 128 ? 13.198  27.693 0.101  1.00 38.68 ? 240  ALA A O     1 
ATOM   787  C  CB    . ALA A 1 128 ? 11.285  26.240 2.389  1.00 33.48 ? 240  ALA A CB    1 
ATOM   788  N  N     . SER A 1 129 ? 12.402  29.090 1.687  1.00 34.96 ? 241  SER A N     1 
ATOM   789  C  CA    . SER A 1 129 ? 13.668  29.817 1.810  1.00 40.75 ? 241  SER A CA    1 
ATOM   790  C  C     . SER A 1 129 ? 14.720  28.990 2.533  1.00 39.38 ? 241  SER A C     1 
ATOM   791  O  O     . SER A 1 129 ? 14.402  28.224 3.423  1.00 35.04 ? 241  SER A O     1 
ATOM   792  C  CB    . SER A 1 129 ? 13.470  31.137 2.544  1.00 40.34 ? 241  SER A CB    1 
ATOM   793  O  OG    . SER A 1 129 ? 12.414  31.842 1.922  1.00 46.68 ? 241  SER A OG    1 
ATOM   794  N  N     . GLU A 1 130 ? 15.980  29.171 2.142  1.00 39.27 ? 242  GLU A N     1 
ATOM   795  C  CA    . GLU A 1 130 ? 17.117  28.545 2.836  1.00 43.49 ? 242  GLU A CA    1 
ATOM   796  C  C     . GLU A 1 130 ? 17.152  28.918 4.330  1.00 42.56 ? 242  GLU A C     1 
ATOM   797  O  O     . GLU A 1 130 ? 17.555  28.109 5.175  1.00 43.94 ? 242  GLU A O     1 
ATOM   798  C  CB    . GLU A 1 130 ? 18.444  28.923 2.131  1.00 42.37 ? 242  GLU A CB    1 
ATOM   799  N  N     A ASP A 1 131 ? 16.687  30.124 4.646  0.50 41.76 ? 243  ASP A N     1 
ATOM   800  N  N     B ASP A 1 131 ? 16.702  30.134 4.647  0.50 42.73 ? 243  ASP A N     1 
ATOM   801  C  CA    A ASP A 1 131 ? 16.688  30.617 6.022  0.50 41.84 ? 243  ASP A CA    1 
ATOM   802  C  CA    B ASP A 1 131 ? 16.676  30.632 6.033  0.50 43.55 ? 243  ASP A CA    1 
ATOM   803  C  C     A ASP A 1 131 ? 15.397  30.341 6.819  0.50 42.31 ? 243  ASP A C     1 
ATOM   804  C  C     B ASP A 1 131 ? 15.324  30.476 6.764  0.50 43.51 ? 243  ASP A C     1 
ATOM   805  O  O     A ASP A 1 131 ? 15.316  30.686 8.002  0.50 41.99 ? 243  ASP A O     1 
ATOM   806  O  O     B ASP A 1 131 ? 15.123  31.056 7.835  0.50 44.29 ? 243  ASP A O     1 
ATOM   807  C  CB    A ASP A 1 131 ? 17.035  32.111 6.039  0.50 42.24 ? 243  ASP A CB    1 
ATOM   808  C  CB    B ASP A 1 131 ? 17.137  32.096 6.080  0.50 45.32 ? 243  ASP A CB    1 
ATOM   809  C  CG    A ASP A 1 131 ? 18.404  32.397 5.427  0.50 42.28 ? 243  ASP A CG    1 
ATOM   810  C  CG    B ASP A 1 131 ? 16.389  32.976 5.098  0.50 46.35 ? 243  ASP A CG    1 
ATOM   811  O  OD1   A ASP A 1 131 ? 19.388  31.721 5.816  0.50 41.84 ? 243  ASP A OD1   1 
ATOM   812  O  OD1   B ASP A 1 131 ? 15.145  33.043 5.179  0.50 45.90 ? 243  ASP A OD1   1 
ATOM   813  O  OD2   A ASP A 1 131 ? 18.490  33.295 4.558  0.50 41.78 ? 243  ASP A OD2   1 
ATOM   814  O  OD2   B ASP A 1 131 ? 17.054  33.609 4.246  0.50 48.01 ? 243  ASP A OD2   1 
ATOM   815  N  N     . ALA A 1 132 ? 14.407  29.702 6.187  1.00 41.25 ? 244  ALA A N     1 
ATOM   816  C  CA    . ALA A 1 132 ? 13.172  29.318 6.895  1.00 41.14 ? 244  ALA A CA    1 
ATOM   817  C  C     . ALA A 1 132 ? 13.528  28.473 8.104  1.00 39.23 ? 244  ALA A C     1 
ATOM   818  O  O     . ALA A 1 132 ? 14.425  27.608 8.023  1.00 39.59 ? 244  ALA A O     1 
ATOM   819  C  CB    . ALA A 1 132 ? 12.217  28.536 5.990  1.00 35.85 ? 244  ALA A CB    1 
ATOM   820  N  N     . GLU A 1 133 ? 12.856  28.747 9.218  1.00 36.39 ? 245  GLU A N     1 
ATOM   821  C  CA    . GLU A 1 133 ? 12.987  27.931 10.436 1.00 38.62 ? 245  GLU A CA    1 
ATOM   822  C  C     . GLU A 1 133 ? 11.975  26.822 10.422 1.00 36.02 ? 245  GLU A C     1 
ATOM   823  O  O     . GLU A 1 133 ? 10.861  27.009 9.966  1.00 35.98 ? 245  GLU A O     1 
ATOM   824  C  CB    . GLU A 1 133 ? 12.854  28.770 11.719 1.00 37.73 ? 245  GLU A CB    1 
ATOM   825  C  CG    . GLU A 1 133 ? 14.070  29.678 12.014 1.00 43.13 ? 245  GLU A CG    1 
ATOM   826  C  CD    . GLU A 1 133 ? 15.369  28.893 12.300 1.00 48.42 ? 245  GLU A CD    1 
ATOM   827  O  OE1   . GLU A 1 133 ? 15.373  28.008 13.193 1.00 51.50 ? 245  GLU A OE1   1 
ATOM   828  O  OE2   . GLU A 1 133 ? 16.384  29.171 11.631 1.00 51.46 ? 245  GLU A OE2   1 
ATOM   829  N  N     . LEU A 1 134 ? 12.371  25.646 10.903 1.00 37.66 ? 246  LEU A N     1 
ATOM   830  C  CA    . LEU A 1 134 ? 11.520  24.479 10.776 1.00 38.06 ? 246  LEU A CA    1 
ATOM   831  C  C     . LEU A 1 134 ? 11.243  23.874 12.130 1.00 37.03 ? 246  LEU A C     1 
ATOM   832  O  O     . LEU A 1 134 ? 12.127  23.840 13.011 1.00 32.96 ? 246  LEU A O     1 
ATOM   833  C  CB    . LEU A 1 134 ? 12.200  23.428 9.897  1.00 37.99 ? 246  LEU A CB    1 
ATOM   834  C  CG    . LEU A 1 134 ? 12.663  23.772 8.478  1.00 40.17 ? 246  LEU A CG    1 
ATOM   835  C  CD1   . LEU A 1 134 ? 13.136  22.490 7.812  1.00 32.88 ? 246  LEU A CD1   1 
ATOM   836  C  CD2   . LEU A 1 134 ? 11.528  24.367 7.698  1.00 34.49 ? 246  LEU A CD2   1 
ATOM   837  N  N     . LEU A 1 135 ? 10.030  23.374 12.280 1.00 37.64 ? 247  LEU A N     1 
ATOM   838  C  CA    . LEU A 1 135 ? 9.632   22.670 13.488 1.00 39.94 ? 247  LEU A CA    1 
ATOM   839  C  C     . LEU A 1 135 ? 8.804   21.427 13.125 1.00 35.86 ? 247  LEU A C     1 
ATOM   840  O  O     . LEU A 1 135 ? 7.809   21.525 12.429 1.00 35.40 ? 247  LEU A O     1 
ATOM   841  C  CB    . LEU A 1 135 ? 8.864   23.608 14.457 1.00 38.05 ? 247  LEU A CB    1 
ATOM   842  C  CG    . LEU A 1 135 ? 8.596   23.096 15.892 1.00 41.27 ? 247  LEU A CG    1 
ATOM   843  C  CD1   . LEU A 1 135 ? 8.698   24.218 16.932 1.00 47.21 ? 247  LEU A CD1   1 
ATOM   844  C  CD2   . LEU A 1 135 ? 7.253   22.526 15.966 1.00 44.07 ? 247  LEU A CD2   1 
ATOM   845  N  N     . LEU A 1 136 ? 9.239   20.270 13.619 1.00 33.31 ? 248  LEU A N     1 
ATOM   846  C  CA    . LEU A 1 136 ? 8.529   19.015 13.427 1.00 32.17 ? 248  LEU A CA    1 
ATOM   847  C  C     . LEU A 1 136 ? 7.624   18.764 14.643 1.00 35.62 ? 248  LEU A C     1 
ATOM   848  O  O     . LEU A 1 136 ? 8.072   18.871 15.785 1.00 35.15 ? 248  LEU A O     1 
ATOM   849  C  CB    . LEU A 1 136 ? 9.531   17.849 13.267 1.00 31.00 ? 248  LEU A CB    1 
ATOM   850  C  CG    . LEU A 1 136 ? 8.880   16.470 12.993 1.00 32.67 ? 248  LEU A CG    1 
ATOM   851  C  CD1   . LEU A 1 136 ? 8.216   16.447 11.611 1.00 30.03 ? 248  LEU A CD1   1 
ATOM   852  C  CD2   . LEU A 1 136 ? 9.983   15.379 13.069 1.00 30.73 ? 248  LEU A CD2   1 
ATOM   853  N  N     . VAL A 1 137 ? 6.365   18.435 14.380 1.00 33.25 ? 249  VAL A N     1 
ATOM   854  C  CA    . VAL A 1 137 ? 5.377   18.208 15.423 1.00 38.27 ? 249  VAL A CA    1 
ATOM   855  C  C     . VAL A 1 137 ? 4.748   16.849 15.291 1.00 37.79 ? 249  VAL A C     1 
ATOM   856  O  O     . VAL A 1 137 ? 4.120   16.567 14.260 1.00 36.72 ? 249  VAL A O     1 
ATOM   857  C  CB    . VAL A 1 137 ? 4.220   19.270 15.369 1.00 35.34 ? 249  VAL A CB    1 
ATOM   858  C  CG1   . VAL A 1 137 ? 3.201   19.012 16.487 1.00 43.63 ? 249  VAL A CG1   1 
ATOM   859  C  CG2   . VAL A 1 137 ? 4.813   20.658 15.564 1.00 40.82 ? 249  VAL A CG2   1 
ATOM   860  N  N     . GLY A 1 138 ? 4.880   16.016 16.332 1.00 35.03 ? 250  GLY A N     1 
ATOM   861  C  CA    . GLY A 1 138 ? 4.016   14.809 16.433 1.00 33.99 ? 250  GLY A CA    1 
ATOM   862  C  C     . GLY A 1 138 ? 2.709   15.131 17.172 1.00 37.35 ? 250  GLY A C     1 
ATOM   863  O  O     . GLY A 1 138 ? 2.710   15.240 18.398 1.00 33.76 ? 250  GLY A O     1 
ATOM   864  N  N     . ASN A 1 139 ? 1.600   15.300 16.434 1.00 35.99 ? 251  ASN A N     1 
ATOM   865  C  CA    . ASN A 1 139 ? 0.328   15.704 17.040 1.00 36.28 ? 251  ASN A CA    1 
ATOM   866  C  C     . ASN A 1 139 ? -0.485  14.466 17.486 1.00 38.16 ? 251  ASN A C     1 
ATOM   867  O  O     . ASN A 1 139 ? -0.168  13.331 17.081 1.00 36.87 ? 251  ASN A O     1 
ATOM   868  C  CB    . ASN A 1 139 ? -0.491  16.594 16.077 1.00 38.84 ? 251  ASN A CB    1 
ATOM   869  C  CG    . ASN A 1 139 ? -1.749  17.198 16.738 1.00 39.70 ? 251  ASN A CG    1 
ATOM   870  O  OD1   . ASN A 1 139 ? -1.727  17.560 17.905 1.00 39.64 ? 251  ASN A OD1   1 
ATOM   871  N  ND2   . ASN A 1 139 ? -2.850  17.264 15.988 1.00 34.95 ? 251  ASN A ND2   1 
ATOM   872  N  N     . LYS A 1 140 ? -1.522  14.712 18.303 1.00 34.91 ? 252  LYS A N     1 
ATOM   873  C  CA    . LYS A 1 140 ? -2.422  13.680 18.911 1.00 37.37 ? 252  LYS A CA    1 
ATOM   874  C  C     . LYS A 1 140 ? -1.780  12.905 20.077 1.00 35.60 ? 252  LYS A C     1 
ATOM   875  O  O     . LYS A 1 140 ? -2.053  11.732 20.280 1.00 36.99 ? 252  LYS A O     1 
ATOM   876  C  CB    . LYS A 1 140 ? -3.061  12.743 17.864 1.00 39.79 ? 252  LYS A CB    1 
ATOM   877  C  CG    . LYS A 1 140 ? -3.634  13.478 16.670 1.00 41.28 ? 252  LYS A CG    1 
ATOM   878  C  CD    . LYS A 1 140 ? -4.741  12.710 15.939 1.00 39.38 ? 252  LYS A CD    1 
ATOM   879  C  CE    . LYS A 1 140 ? -4.991  13.409 14.619 1.00 39.20 ? 252  LYS A CE    1 
ATOM   880  N  NZ    . LYS A 1 140 ? -5.757  12.610 13.617 1.00 37.97 ? 252  LYS A NZ    1 
ATOM   881  N  N     . LEU A 1 141 ? -0.946  13.606 20.846 1.00 39.01 ? 253  LEU A N     1 
ATOM   882  C  CA    . LEU A 1 141 ? -0.338  13.090 22.087 1.00 40.43 ? 253  LEU A CA    1 
ATOM   883  C  C     . LEU A 1 141 ? -1.360  12.563 23.097 1.00 39.87 ? 253  LEU A C     1 
ATOM   884  O  O     . LEU A 1 141 ? -1.039  11.671 23.895 1.00 40.79 ? 253  LEU A O     1 
ATOM   885  C  CB    . LEU A 1 141 ? 0.513   14.177 22.771 1.00 38.69 ? 253  LEU A CB    1 
ATOM   886  C  CG    . LEU A 1 141 ? 1.427   13.712 23.918 1.00 40.04 ? 253  LEU A CG    1 
ATOM   887  C  CD1   . LEU A 1 141 ? 2.301   12.534 23.493 1.00 40.05 ? 253  LEU A CD1   1 
ATOM   888  C  CD2   . LEU A 1 141 ? 2.289   14.847 24.458 1.00 40.30 ? 253  LEU A CD2   1 
ATOM   889  N  N     . ASP A 1 142 ? -2.577  13.111 23.068 1.00 37.61 ? 254  ASP A N     1 
ATOM   890  C  CA    . ASP A 1 142 ? -3.674  12.617 23.927 1.00 39.93 ? 254  ASP A CA    1 
ATOM   891  C  C     . ASP A 1 142 ? -4.077  11.164 23.591 1.00 43.27 ? 254  ASP A C     1 
ATOM   892  O  O     . ASP A 1 142 ? -4.684  10.452 24.435 1.00 41.49 ? 254  ASP A O     1 
ATOM   893  C  CB    . ASP A 1 142 ? -4.897  13.527 23.810 1.00 40.83 ? 254  ASP A CB    1 
ATOM   894  C  CG    . ASP A 1 142 ? -5.417  13.631 22.378 1.00 43.77 ? 254  ASP A CG    1 
ATOM   895  O  OD1   . ASP A 1 142 ? -4.691  14.177 21.525 1.00 44.98 ? 254  ASP A OD1   1 
ATOM   896  O  OD2   . ASP A 1 142 ? -6.549  13.158 22.104 1.00 42.72 ? 254  ASP A OD2   1 
ATOM   897  N  N     . CYS A 1 143 ? -3.760  10.742 22.359 1.00 42.03 ? 255  CYS A N     1 
ATOM   898  C  CA    . CYS A 1 143 ? -4.071  9.386  21.873 1.00 44.46 ? 255  CYS A CA    1 
ATOM   899  C  C     . CYS A 1 143 ? -2.885  8.448  22.042 1.00 45.50 ? 255  CYS A C     1 
ATOM   900  O  O     . CYS A 1 143 ? -2.650  7.568  21.211 1.00 46.06 ? 255  CYS A O     1 
ATOM   901  C  CB    . CYS A 1 143 ? -4.470  9.415  20.395 1.00 45.61 ? 255  CYS A CB    1 
ATOM   902  S  SG    . CYS A 1 143 ? -5.871  10.459 19.992 1.00 50.63 ? 255  CYS A SG    1 
ATOM   903  N  N     . GLU A 1 144 ? -2.154  8.648  23.125 1.00 46.98 ? 256  GLU A N     1 
ATOM   904  C  CA    . GLU A 1 144 ? -0.971  7.877  23.476 1.00 51.24 ? 256  GLU A CA    1 
ATOM   905  C  C     . GLU A 1 144 ? -1.140  6.342  23.416 1.00 52.54 ? 256  GLU A C     1 
ATOM   906  O  O     . GLU A 1 144 ? -0.171  5.631  23.110 1.00 55.49 ? 256  GLU A O     1 
ATOM   907  C  CB    . GLU A 1 144 ? -0.481  8.324  24.865 1.00 53.83 ? 256  GLU A CB    1 
ATOM   908  C  CG    . GLU A 1 144 ? 0.711   7.577  25.436 1.00 56.82 ? 256  GLU A CG    1 
ATOM   909  C  CD    . GLU A 1 144 ? 2.008   7.877  24.710 1.00 58.40 ? 256  GLU A CD    1 
ATOM   910  O  OE1   . GLU A 1 144 ? 2.347   9.069  24.553 1.00 59.08 ? 256  GLU A OE1   1 
ATOM   911  O  OE2   . GLU A 1 144 ? 2.696   6.905  24.311 1.00 58.59 ? 256  GLU A OE2   1 
ATOM   912  N  N     . THR A 1 145 ? -2.347  5.831  23.691 1.00 50.98 ? 257  THR A N     1 
ATOM   913  C  CA    . THR A 1 145 ? -2.562  4.374  23.664 1.00 51.12 ? 257  THR A CA    1 
ATOM   914  C  C     . THR A 1 145 ? -2.569  3.813  22.239 1.00 48.29 ? 257  THR A C     1 
ATOM   915  O  O     . THR A 1 145 ? -2.288  2.637  22.026 1.00 50.62 ? 257  THR A O     1 
ATOM   916  C  CB    . THR A 1 145 ? -3.837  3.912  24.449 1.00 50.75 ? 257  THR A CB    1 
ATOM   917  O  OG1   . THR A 1 145 ? -5.000  4.578  23.946 1.00 49.79 ? 257  THR A OG1   1 
ATOM   918  C  CG2   . THR A 1 145 ? -3.685  4.205  25.924 1.00 54.11 ? 257  THR A CG2   1 
ATOM   919  N  N     . ASP A 1 146 ? -2.887  4.672  21.275 1.00 45.68 ? 258  ASP A N     1 
ATOM   920  C  CA    . ASP A 1 146 ? -2.884  4.313  19.865 1.00 43.86 ? 258  ASP A CA    1 
ATOM   921  C  C     . ASP A 1 146 ? -1.580  4.681  19.151 1.00 40.24 ? 258  ASP A C     1 
ATOM   922  O  O     . ASP A 1 146 ? -1.509  4.615  17.935 1.00 37.29 ? 258  ASP A O     1 
ATOM   923  C  CB    . ASP A 1 146 ? -4.094  4.947  19.157 1.00 44.83 ? 258  ASP A CB    1 
ATOM   924  C  CG    . ASP A 1 146 ? -5.417  4.401  19.673 1.00 46.39 ? 258  ASP A CG    1 
ATOM   925  O  OD1   . ASP A 1 146 ? -5.517  3.167  19.860 1.00 47.66 ? 258  ASP A OD1   1 
ATOM   926  O  OD2   . ASP A 1 146 ? -6.353  5.203  19.903 1.00 49.01 ? 258  ASP A OD2   1 
ATOM   927  N  N     . ARG A 1 147 ? -0.561  5.074  19.917 1.00 42.11 ? 259  ARG A N     1 
ATOM   928  C  CA    . ARG A 1 147 ? 0.742   5.497  19.361 1.00 42.23 ? 259  ARG A CA    1 
ATOM   929  C  C     . ARG A 1 147 ? 1.338   4.435  18.408 1.00 43.52 ? 259  ARG A C     1 
ATOM   930  O  O     . ARG A 1 147 ? 1.516   3.272  18.787 1.00 42.42 ? 259  ARG A O     1 
ATOM   931  C  CB    . ARG A 1 147 ? 1.716   5.820  20.495 1.00 42.97 ? 259  ARG A CB    1 
ATOM   932  C  CG    . ARG A 1 147 ? 3.074   6.288  20.046 1.00 44.96 ? 259  ARG A CG    1 
ATOM   933  C  CD    . ARG A 1 147 ? 4.061   6.373  21.198 1.00 43.45 ? 259  ARG A CD    1 
ATOM   934  N  NE    . ARG A 1 147 ? 3.888   7.565  22.040 1.00 46.70 ? 259  ARG A NE    1 
ATOM   935  C  CZ    . ARG A 1 147 ? 4.369   8.777  21.754 1.00 44.83 ? 259  ARG A CZ    1 
ATOM   936  N  NH1   . ARG A 1 147 ? 5.030   8.995  20.618 1.00 46.62 ? 259  ARG A NH1   1 
ATOM   937  N  NH2   . ARG A 1 147 ? 4.170   9.775  22.587 1.00 43.43 ? 259  ARG A NH2   1 
ATOM   938  N  N     . GLU A 1 148 ? 1.602   4.855  17.170 1.00 41.23 ? 260  GLU A N     1 
ATOM   939  C  CA    . GLU A 1 148 ? 2.274   4.038  16.172 1.00 42.67 ? 260  GLU A CA    1 
ATOM   940  C  C     . GLU A 1 148 ? 3.744   4.446  15.981 1.00 41.37 ? 260  GLU A C     1 
ATOM   941  O  O     . GLU A 1 148 ? 4.563   3.622  15.614 1.00 42.44 ? 260  GLU A O     1 
ATOM   942  C  CB    . GLU A 1 148 ? 1.514   4.084  14.842 1.00 42.52 ? 260  GLU A CB    1 
ATOM   943  C  CG    . GLU A 1 148 ? 0.182   3.317  14.891 1.00 45.38 ? 260  GLU A CG    1 
ATOM   944  C  CD    . GLU A 1 148 ? -0.526  3.200  13.540 1.00 45.02 ? 260  GLU A CD    1 
ATOM   945  O  OE1   . GLU A 1 148 ? -0.001  3.717  12.520 1.00 41.86 ? 260  GLU A OE1   1 
ATOM   946  O  OE2   . GLU A 1 148 ? -1.627  2.595  13.514 1.00 44.96 ? 260  GLU A OE2   1 
ATOM   947  N  N     . ILE A 1 149 ? 4.065   5.713  16.256 1.00 38.32 ? 261  ILE A N     1 
ATOM   948  C  CA    . ILE A 1 149 ? 5.425   6.254  16.087 1.00 38.31 ? 261  ILE A CA    1 
ATOM   949  C  C     . ILE A 1 149 ? 5.983   6.714  17.459 1.00 36.14 ? 261  ILE A C     1 
ATOM   950  O  O     . ILE A 1 149 ? 5.327   7.444  18.156 1.00 35.37 ? 261  ILE A O     1 
ATOM   951  C  CB    . ILE A 1 149 ? 5.409   7.489  15.116 1.00 40.30 ? 261  ILE A CB    1 
ATOM   952  C  CG1   . ILE A 1 149 ? 4.873   7.108  13.720 1.00 39.64 ? 261  ILE A CG1   1 
ATOM   953  C  CG2   . ILE A 1 149 ? 6.773   8.239  15.093 1.00 36.36 ? 261  ILE A CG2   1 
ATOM   954  C  CD1   . ILE A 1 149 ? 5.657   5.965  12.973 1.00 42.79 ? 261  ILE A CD1   1 
ATOM   955  N  N     . THR A 1 150 ? 7.194   6.303  17.818 1.00 36.33 ? 262  THR A N     1 
ATOM   956  C  CA    . THR A 1 150 ? 7.752   6.685  19.124 1.00 37.80 ? 262  THR A CA    1 
ATOM   957  C  C     . THR A 1 150 ? 8.300   8.115  19.122 1.00 39.56 ? 262  THR A C     1 
ATOM   958  O  O     . THR A 1 150 ? 8.498   8.719  18.064 1.00 37.47 ? 262  THR A O     1 
ATOM   959  C  CB    . THR A 1 150 ? 8.846   5.714  19.624 1.00 37.42 ? 262  THR A CB    1 
ATOM   960  O  OG1   . THR A 1 150 ? 10.096  6.042  19.007 1.00 38.04 ? 262  THR A OG1   1 
ATOM   961  C  CG2   . THR A 1 150 ? 8.467   4.223  19.344 1.00 40.22 ? 262  THR A CG2   1 
ATOM   962  N  N     . ARG A 1 151 ? 8.539   8.648  20.316 1.00 39.09 ? 263  ARG A N     1 
ATOM   963  C  CA    . ARG A 1 151 ? 9.054   10.008 20.459 1.00 39.93 ? 263  ARG A CA    1 
ATOM   964  C  C     . ARG A 1 151 ? 10.492  10.054 19.912 1.00 39.45 ? 263  ARG A C     1 
ATOM   965  O  O     . ARG A 1 151 ? 10.891  11.027 19.274 1.00 36.10 ? 263  ARG A O     1 
ATOM   966  C  CB    . ARG A 1 151 ? 8.989   10.451 21.916 1.00 40.33 ? 263  ARG A CB    1 
ATOM   967  C  CG    . ARG A 1 151 ? 9.146   11.941 22.100 1.00 41.88 ? 263  ARG A CG    1 
ATOM   968  C  CD    . ARG A 1 151 ? 9.745   12.308 23.445 1.00 48.24 ? 263  ARG A CD    1 
ATOM   969  N  NE    . ARG A 1 151 ? 10.493  13.561 23.296 1.00 52.73 ? 263  ARG A NE    1 
ATOM   970  C  CZ    . ARG A 1 151 ? 9.950   14.777 23.214 1.00 54.49 ? 263  ARG A CZ    1 
ATOM   971  N  NH1   . ARG A 1 151 ? 8.628   14.936 23.310 1.00 54.46 ? 263  ARG A NH1   1 
ATOM   972  N  NH2   . ARG A 1 151 ? 10.741  15.843 23.050 1.00 53.54 ? 263  ARG A NH2   1 
ATOM   973  N  N     . GLN A 1 152 ? 11.230  8.956  20.095 1.00 39.60 ? 264  GLN A N     1 
ATOM   974  C  CA    A GLN A 1 152 ? 12.621  8.866  19.648 0.50 38.52 ? 264  GLN A CA    1 
ATOM   975  C  CA    B GLN A 1 152 ? 12.618  8.877  19.647 0.50 39.06 ? 264  GLN A CA    1 
ATOM   976  C  C     . GLN A 1 152 ? 12.701  8.938  18.131 1.00 38.59 ? 264  GLN A C     1 
ATOM   977  O  O     . GLN A 1 152 ? 13.607  9.576  17.582 1.00 38.58 ? 264  GLN A O     1 
ATOM   978  C  CB    A GLN A 1 152 ? 13.281  7.588  20.169 0.50 39.21 ? 264  GLN A CB    1 
ATOM   979  C  CB    B GLN A 1 152 ? 13.299  7.622  20.188 0.50 40.38 ? 264  GLN A CB    1 
ATOM   980  C  CG    A GLN A 1 152 ? 14.790  7.518  19.942 0.50 38.31 ? 264  GLN A CG    1 
ATOM   981  C  CG    B GLN A 1 152 ? 13.573  7.665  21.685 0.50 41.29 ? 264  GLN A CG    1 
ATOM   982  N  N     . GLN A 1 153 ? 11.749  8.281  17.466 1.00 35.93 ? 265  GLN A N     1 
ATOM   983  C  CA    . GLN A 1 153 ? 11.617  8.329  16.021 1.00 37.27 ? 265  GLN A CA    1 
ATOM   984  C  C     . GLN A 1 153 ? 11.454  9.771  15.553 1.00 35.16 ? 265  GLN A C     1 
ATOM   985  O  O     . GLN A 1 153 ? 12.163  10.208 14.667 1.00 34.94 ? 265  GLN A O     1 
ATOM   986  C  CB    . GLN A 1 153 ? 10.412  7.510  15.568 1.00 37.79 ? 265  GLN A CB    1 
ATOM   987  C  CG    . GLN A 1 153 ? 10.636  6.004  15.631 1.00 38.83 ? 265  GLN A CG    1 
ATOM   988  C  CD    . GLN A 1 153 ? 9.479   5.233  15.068 1.00 38.27 ? 265  GLN A CD    1 
ATOM   989  O  OE1   . GLN A 1 153 ? 8.502   4.977  15.756 1.00 39.73 ? 265  GLN A OE1   1 
ATOM   990  N  NE2   . GLN A 1 153 ? 9.586   4.850  13.813 1.00 36.94 ? 265  GLN A NE2   1 
ATOM   991  N  N     . GLY A 1 154 ? 10.538  10.516 16.175 1.00 33.87 ? 266  GLY A N     1 
ATOM   992  C  CA    . GLY A 1 154 ? 10.357  11.926 15.832 1.00 34.01 ? 266  GLY A CA    1 
ATOM   993  C  C     . GLY A 1 154 ? 11.588  12.755 16.121 1.00 35.27 ? 266  GLY A C     1 
ATOM   994  O  O     . GLY A 1 154 ? 11.977  13.621 15.322 1.00 34.52 ? 266  GLY A O     1 
ATOM   995  N  N     . GLU A 1 155 ? 12.208  12.498 17.279 1.00 34.71 ? 267  GLU A N     1 
ATOM   996  C  CA    . GLU A 1 155 ? 13.429  13.224 17.680 1.00 35.29 ? 267  GLU A CA    1 
ATOM   997  C  C     . GLU A 1 155 ? 14.595  12.933 16.729 1.00 33.43 ? 267  GLU A C     1 
ATOM   998  O  O     . GLU A 1 155 ? 15.311  13.829 16.325 1.00 34.12 ? 267  GLU A O     1 
ATOM   999  C  CB    . GLU A 1 155 ? 13.848  12.839 19.104 1.00 36.13 ? 267  GLU A CB    1 
ATOM   1000 C  CG    . GLU A 1 155 ? 12.859  13.261 20.180 1.00 39.11 ? 267  GLU A CG    1 
ATOM   1001 C  CD    . GLU A 1 155 ? 13.304  12.865 21.586 1.00 44.03 ? 267  GLU A CD    1 
ATOM   1002 O  OE1   . GLU A 1 155 ? 14.236  12.037 21.730 1.00 48.17 ? 267  GLU A OE1   1 
ATOM   1003 O  OE2   . GLU A 1 155 ? 12.732  13.407 22.558 1.00 46.43 ? 267  GLU A OE2   1 
ATOM   1004 N  N     . LYS A 1 156 ? 14.778  11.670 16.385 1.00 33.14 ? 268  LYS A N     1 
ATOM   1005 C  CA    . LYS A 1 156 ? 15.826  11.296 15.489 1.00 33.77 ? 268  LYS A CA    1 
ATOM   1006 C  C     . LYS A 1 156 ? 15.602  11.887 14.089 1.00 34.28 ? 268  LYS A C     1 
ATOM   1007 O  O     . LYS A 1 156 ? 16.560  12.319 13.432 1.00 36.21 ? 268  LYS A O     1 
ATOM   1008 C  CB    . LYS A 1 156 ? 15.935  9.780  15.408 1.00 36.81 ? 268  LYS A CB    1 
ATOM   1009 C  CG    . LYS A 1 156 ? 16.545  9.109  16.639 1.00 44.32 ? 268  LYS A CG    1 
ATOM   1010 N  N     . PHE A 1 157 ? 14.354  11.897 13.629 1.00 34.88 ? 269  PHE A N     1 
ATOM   1011 C  CA    . PHE A 1 157 ? 14.048  12.515 12.330 1.00 36.27 ? 269  PHE A CA    1 
ATOM   1012 C  C     . PHE A 1 157 ? 14.465  13.982 12.316 1.00 35.27 ? 269  PHE A C     1 
ATOM   1013 O  O     . PHE A 1 157 ? 15.136  14.421 11.392 1.00 34.47 ? 269  PHE A O     1 
ATOM   1014 C  CB    . PHE A 1 157 ? 12.557  12.401 11.961 1.00 35.08 ? 269  PHE A CB    1 
ATOM   1015 C  CG    . PHE A 1 157 ? 12.276  12.723 10.509 1.00 34.85 ? 269  PHE A CG    1 
ATOM   1016 C  CD1   . PHE A 1 157 ? 12.328  11.719 9.555  1.00 34.45 ? 269  PHE A CD1   1 
ATOM   1017 C  CD2   . PHE A 1 157 ? 12.041  14.037 10.092 1.00 33.96 ? 269  PHE A CD2   1 
ATOM   1018 C  CE1   . PHE A 1 157 ? 12.098  11.999 8.193  1.00 36.48 ? 269  PHE A CE1   1 
ATOM   1019 C  CE2   . PHE A 1 157 ? 11.812  14.328 8.731  1.00 34.47 ? 269  PHE A CE2   1 
ATOM   1020 C  CZ    . PHE A 1 157 ? 11.839  13.296 7.794  1.00 36.07 ? 269  PHE A CZ    1 
ATOM   1021 N  N     . ALA A 1 158 ? 14.038  14.749 13.332 1.00 37.48 ? 270  ALA A N     1 
ATOM   1022 C  CA    . ALA A 1 158 ? 14.344  16.183 13.373 1.00 36.45 ? 270  ALA A CA    1 
ATOM   1023 C  C     . ALA A 1 158 ? 15.838  16.419 13.451 1.00 36.35 ? 270  ALA A C     1 
ATOM   1024 O  O     . ALA A 1 158 ? 16.354  17.351 12.823 1.00 36.43 ? 270  ALA A O     1 
ATOM   1025 C  CB    . ALA A 1 158 ? 13.633  16.868 14.540 1.00 37.46 ? 270  ALA A CB    1 
ATOM   1026 N  N     . GLN A 1 159 ? 16.527  15.549 14.210 1.00 35.64 ? 271  GLN A N     1 
ATOM   1027 C  CA    . GLN A 1 159 ? 17.963  15.669 14.502 1.00 37.95 ? 271  GLN A CA    1 
ATOM   1028 C  C     . GLN A 1 159 ? 18.820  15.572 13.214 1.00 36.22 ? 271  GLN A C     1 
ATOM   1029 O  O     . GLN A 1 159 ? 19.878  16.223 13.116 1.00 30.49 ? 271  GLN A O     1 
ATOM   1030 C  CB    . GLN A 1 159 ? 18.376  14.598 15.529 1.00 38.97 ? 271  GLN A CB    1 
ATOM   1031 C  CG    . GLN A 1 159 ? 19.830  14.673 16.010 1.00 43.20 ? 271  GLN A CG    1 
ATOM   1032 C  CD    . GLN A 1 159 ? 20.161  13.590 17.030 1.00 45.35 ? 271  GLN A CD    1 
ATOM   1033 N  N     . GLN A 1 160 ? 18.330  14.781 12.243 1.00 35.12 ? 272  GLN A N     1 
ATOM   1034 C  CA    . GLN A 1 160 ? 18.957  14.588 10.919 1.00 38.27 ? 272  GLN A CA    1 
ATOM   1035 C  C     . GLN A 1 160 ? 18.910  15.889 10.085 1.00 36.22 ? 272  GLN A C     1 
ATOM   1036 O  O     . GLN A 1 160 ? 19.691  16.051 9.166  1.00 35.71 ? 272  GLN A O     1 
ATOM   1037 C  CB    . GLN A 1 160 ? 18.207  13.509 10.105 1.00 42.43 ? 272  GLN A CB    1 
ATOM   1038 C  CG    . GLN A 1 160 ? 18.218  12.040 10.561 1.00 43.51 ? 272  GLN A CG    1 
ATOM   1039 C  CD    . GLN A 1 160 ? 17.399  11.108 9.578  1.00 45.67 ? 272  GLN A CD    1 
ATOM   1040 O  OE1   . GLN A 1 160 ? 16.154  11.164 9.506  1.00 46.48 ? 272  GLN A OE1   1 
ATOM   1041 N  NE2   . GLN A 1 160 ? 18.113  10.273 8.835  1.00 47.72 ? 272  GLN A NE2   1 
ATOM   1042 N  N     . ILE A 1 161 ? 17.957  16.776 10.383 1.00 33.35 ? 273  ILE A N     1 
ATOM   1043 C  CA    . ILE A 1 161 ? 17.788  18.049 9.649  1.00 36.88 ? 273  ILE A CA    1 
ATOM   1044 C  C     . ILE A 1 161 ? 18.320  19.222 10.466 1.00 35.10 ? 273  ILE A C     1 
ATOM   1045 O  O     . ILE A 1 161 ? 17.764  19.545 11.495 1.00 34.24 ? 273  ILE A O     1 
ATOM   1046 C  CB    . ILE A 1 161 ? 16.294  18.341 9.278  1.00 34.48 ? 273  ILE A CB    1 
ATOM   1047 C  CG1   . ILE A 1 161 ? 15.595  17.096 8.710  1.00 38.19 ? 273  ILE A CG1   1 
ATOM   1048 C  CG2   . ILE A 1 161 ? 16.179  19.507 8.284  1.00 33.70 ? 273  ILE A CG2   1 
ATOM   1049 C  CD1   . ILE A 1 161 ? 16.225  16.566 7.496  1.00 34.79 ? 273  ILE A CD1   1 
ATOM   1050 N  N     . THR A 1 162 ? 19.381  19.866 9.983  1.00 36.39 ? 274  THR A N     1 
ATOM   1051 C  CA    . THR A 1 162 ? 20.113  20.873 10.775 1.00 34.81 ? 274  THR A CA    1 
ATOM   1052 C  C     . THR A 1 162 ? 19.228  22.050 11.124 1.00 36.79 ? 274  THR A C     1 
ATOM   1053 O  O     . THR A 1 162 ? 18.689  22.729 10.232 1.00 38.05 ? 274  THR A O     1 
ATOM   1054 C  CB    . THR A 1 162 ? 21.408  21.365 10.063 1.00 36.25 ? 274  THR A CB    1 
ATOM   1055 O  OG1   . THR A 1 162 ? 22.063  20.254 9.451  1.00 39.53 ? 274  THR A OG1   1 
ATOM   1056 C  CG2   . THR A 1 162 ? 22.387  22.007 11.094 1.00 39.95 ? 274  THR A CG2   1 
ATOM   1057 N  N     . GLY A 1 163 ? 19.056  22.283 12.424 1.00 37.63 ? 275  GLY A N     1 
ATOM   1058 C  CA    . GLY A 1 163 ? 18.209  23.379 12.901 1.00 38.38 ? 275  GLY A CA    1 
ATOM   1059 C  C     . GLY A 1 163 ? 16.751  23.056 13.176 1.00 38.84 ? 275  GLY A C     1 
ATOM   1060 O  O     . GLY A 1 163 ? 16.027  23.880 13.734 1.00 38.39 ? 275  GLY A O     1 
ATOM   1061 N  N     . MET A 1 164 ? 16.295  21.869 12.781 1.00 37.57 ? 276  MET A N     1 
ATOM   1062 C  CA    . MET A 1 164 ? 14.861  21.577 12.890 1.00 36.55 ? 276  MET A CA    1 
ATOM   1063 C  C     . MET A 1 164 ? 14.527  21.220 14.353 1.00 40.21 ? 276  MET A C     1 
ATOM   1064 O  O     . MET A 1 164 ? 15.167  20.348 14.948 1.00 37.07 ? 276  MET A O     1 
ATOM   1065 C  CB    . MET A 1 164 ? 14.447  20.460 11.932 1.00 35.41 ? 276  MET A CB    1 
ATOM   1066 C  CG    . MET A 1 164 ? 12.984  19.932 12.145 1.00 36.16 ? 276  MET A CG    1 
ATOM   1067 S  SD    . MET A 1 164 ? 12.586  18.662 10.935 1.00 39.81 ? 276  MET A SD    1 
ATOM   1068 C  CE    . MET A 1 164 ? 11.479  19.567 9.924  1.00 40.14 ? 276  MET A CE    1 
ATOM   1069 N  N     . ARG A 1 165 ? 13.559  21.923 14.925 1.00 35.91 ? 277  ARG A N     1 
ATOM   1070 C  CA    . ARG A 1 165 ? 13.090  21.632 16.272 1.00 40.73 ? 277  ARG A CA    1 
ATOM   1071 C  C     . ARG A 1 165 ? 12.051  20.493 16.252 1.00 40.10 ? 277  ARG A C     1 
ATOM   1072 O  O     . ARG A 1 165 ? 11.468  20.205 15.192 1.00 38.66 ? 277  ARG A O     1 
ATOM   1073 C  CB    . ARG A 1 165 ? 12.459  22.883 16.878 1.00 43.51 ? 277  ARG A CB    1 
ATOM   1074 C  CG    . ARG A 1 165 ? 12.363  22.847 18.404 1.00 51.52 ? 277  ARG A CG    1 
ATOM   1075 C  CD    . ARG A 1 165 ? 12.057  24.251 18.996 1.00 51.93 ? 277  ARG A CD    1 
ATOM   1076 N  NE    . ARG A 1 165 ? 13.201  25.155 18.930 1.00 54.04 ? 277  ARG A NE    1 
ATOM   1077 C  CZ    . ARG A 1 165 ? 14.156  25.233 19.856 1.00 59.03 ? 277  ARG A CZ    1 
ATOM   1078 N  NH1   . ARG A 1 165 ? 14.119  24.436 20.920 1.00 60.86 ? 277  ARG A NH1   1 
ATOM   1079 N  NH2   . ARG A 1 165 ? 15.167  26.098 19.712 1.00 59.36 ? 277  ARG A NH2   1 
ATOM   1080 N  N     . PHE A 1 166 ? 11.816  19.850 17.414 1.00 37.40 ? 278  PHE A N     1 
ATOM   1081 C  CA    . PHE A 1 166 ? 10.779  18.820 17.508 1.00 38.54 ? 278  PHE A CA    1 
ATOM   1082 C  C     . PHE A 1 166 ? 10.028  18.921 18.798 1.00 37.53 ? 278  PHE A C     1 
ATOM   1083 O  O     . PHE A 1 166 ? 10.624  19.209 19.819 1.00 33.93 ? 278  PHE A O     1 
ATOM   1084 C  CB    . PHE A 1 166 ? 11.402  17.431 17.414 1.00 35.60 ? 278  PHE A CB    1 
ATOM   1085 C  CG    . PHE A 1 166 ? 10.455  16.315 17.720 1.00 34.88 ? 278  PHE A CG    1 
ATOM   1086 C  CD1   . PHE A 1 166 ? 9.466   15.933 16.808 1.00 31.86 ? 278  PHE A CD1   1 
ATOM   1087 C  CD2   . PHE A 1 166 ? 10.559  15.623 18.907 1.00 35.80 ? 278  PHE A CD2   1 
ATOM   1088 C  CE1   . PHE A 1 166 ? 8.625   14.905 17.096 1.00 32.67 ? 278  PHE A CE1   1 
ATOM   1089 C  CE2   . PHE A 1 166 ? 9.693   14.572 19.188 1.00 39.08 ? 278  PHE A CE2   1 
ATOM   1090 C  CZ    . PHE A 1 166 ? 8.733   14.218 18.276 1.00 33.08 ? 278  PHE A CZ    1 
ATOM   1091 N  N     . CYS A 1 167 ? 8.720   18.665 18.748 1.00 33.20 ? 279  CYS A N     1 
ATOM   1092 C  CA    . CYS A 1 167 ? 7.970   18.307 19.972 1.00 34.87 ? 279  CYS A CA    1 
ATOM   1093 C  C     . CYS A 1 167 ? 6.746   17.533 19.674 1.00 38.45 ? 279  CYS A C     1 
ATOM   1094 O  O     . CYS A 1 167 ? 6.347   17.405 18.524 1.00 36.15 ? 279  CYS A O     1 
ATOM   1095 C  CB    . CYS A 1 167 ? 7.554   19.537 20.737 1.00 43.14 ? 279  CYS A CB    1 
ATOM   1096 S  SG    . CYS A 1 167 ? 6.366   20.400 19.864 1.00 51.56 ? 279  CYS A SG    1 
ATOM   1097 N  N     . GLU A 1 168 ? 6.122   17.006 20.722 1.00 37.84 ? 280  GLU A N     1 
ATOM   1098 C  CA    . GLU A 1 168 ? 4.842   16.349 20.544 1.00 38.80 ? 280  GLU A CA    1 
ATOM   1099 C  C     . GLU A 1 168 ? 3.791   17.292 21.125 1.00 40.63 ? 280  GLU A C     1 
ATOM   1100 O  O     . GLU A 1 168 ? 4.097   18.109 21.988 1.00 36.62 ? 280  GLU A O     1 
ATOM   1101 C  CB    . GLU A 1 168 ? 4.862   14.963 21.186 1.00 37.93 ? 280  GLU A CB    1 
ATOM   1102 C  CG    . GLU A 1 168 ? 5.721   13.944 20.357 1.00 39.55 ? 280  GLU A CG    1 
ATOM   1103 C  CD    . GLU A 1 168 ? 5.675   12.502 20.858 1.00 40.12 ? 280  GLU A CD    1 
ATOM   1104 O  OE1   . GLU A 1 168 ? 5.511   12.290 22.057 1.00 41.40 ? 280  GLU A OE1   1 
ATOM   1105 O  OE2   . GLU A 1 168 ? 5.838   11.563 20.044 1.00 38.25 ? 280  GLU A OE2   1 
ATOM   1106 N  N     . ALA A 1 169 ? 2.576   17.207 20.612 1.00 37.65 ? 281  ALA A N     1 
ATOM   1107 C  CA    . ALA A 1 169 ? 1.504   18.130 20.987 1.00 38.49 ? 281  ALA A CA    1 
ATOM   1108 C  C     . ALA A 1 169 ? 0.180   17.422 20.902 1.00 35.78 ? 281  ALA A C     1 
ATOM   1109 O  O     . ALA A 1 169 ? 0.088   16.400 20.276 1.00 33.18 ? 281  ALA A O     1 
ATOM   1110 C  CB    . ALA A 1 169 ? 1.495   19.331 20.043 1.00 41.22 ? 281  ALA A CB    1 
ATOM   1111 N  N     . SER A 1 170 ? -0.835  18.001 21.545 1.00 37.97 ? 282  SER A N     1 
ATOM   1112 C  CA    . SER A 1 170 ? -2.218  17.614 21.389 1.00 38.24 ? 282  SER A CA    1 
ATOM   1113 C  C     . SER A 1 170 ? -3.095  18.854 21.203 1.00 38.31 ? 282  SER A C     1 
ATOM   1114 O  O     . SER A 1 170 ? -3.343  19.592 22.145 1.00 36.41 ? 282  SER A O     1 
ATOM   1115 C  CB    . SER A 1 170 ? -2.719  16.829 22.608 1.00 35.53 ? 282  SER A CB    1 
ATOM   1116 O  OG    . SER A 1 170 ? -4.113  16.604 22.529 1.00 36.96 ? 282  SER A OG    1 
ATOM   1117 N  N     . ALA A 1 171 ? -3.601  19.043 19.988 1.00 38.58 ? 283  ALA A N     1 
ATOM   1118 C  CA    . ALA A 1 171 ? -4.582  20.105 19.723 1.00 39.49 ? 283  ALA A CA    1 
ATOM   1119 C  C     . ALA A 1 171 ? -5.809  19.922 20.595 1.00 40.31 ? 283  ALA A C     1 
ATOM   1120 O  O     . ALA A 1 171 ? -6.347  20.888 21.158 1.00 42.91 ? 283  ALA A O     1 
ATOM   1121 C  CB    . ALA A 1 171 ? -4.973  20.109 18.242 1.00 38.99 ? 283  ALA A CB    1 
ATOM   1122 N  N     . LYS A 1 172 ? -6.235  18.671 20.725 1.00 40.81 ? 284  LYS A N     1 
ATOM   1123 C  CA    . LYS A 1 172 ? -7.411  18.323 21.532 1.00 37.03 ? 284  LYS A CA    1 
ATOM   1124 C  C     . LYS A 1 172 ? -7.253  18.701 23.016 1.00 39.31 ? 284  LYS A C     1 
ATOM   1125 O  O     . LYS A 1 172 ? -8.143  19.355 23.604 1.00 34.03 ? 284  LYS A O     1 
ATOM   1126 C  CB    . LYS A 1 172 ? -7.710  16.833 21.352 1.00 37.47 ? 284  LYS A CB    1 
ATOM   1127 C  CG    . LYS A 1 172 ? -9.000  16.328 22.031 1.00 37.13 ? 284  LYS A CG    1 
ATOM   1128 C  CD    . LYS A 1 172 ? -9.194  14.875 21.710 1.00 39.58 ? 284  LYS A CD    1 
ATOM   1129 N  N     . ASP A 1 173 ? -6.118  18.317 23.617 1.00 37.29 ? 285  ASP A N     1 
ATOM   1130 C  CA    . ASP A 1 173 ? -5.873  18.606 25.040 1.00 37.53 ? 285  ASP A CA    1 
ATOM   1131 C  C     . ASP A 1 173 ? -5.174  19.956 25.318 1.00 36.50 ? 285  ASP A C     1 
ATOM   1132 O  O     . ASP A 1 173 ? -4.830  20.235 26.474 1.00 33.31 ? 285  ASP A O     1 
ATOM   1133 C  CB    . ASP A 1 173 ? -5.053  17.468 25.680 1.00 39.42 ? 285  ASP A CB    1 
ATOM   1134 C  CG    . ASP A 1 173 ? -5.881  16.201 25.946 1.00 41.58 ? 285  ASP A CG    1 
ATOM   1135 O  OD1   . ASP A 1 173 ? -7.088  16.158 25.595 1.00 35.62 ? 285  ASP A OD1   1 
ATOM   1136 O  OD2   . ASP A 1 173 ? -5.303  15.247 26.521 1.00 42.41 ? 285  ASP A OD2   1 
ATOM   1137 N  N     . ASN A 1 174 ? -4.949  20.766 24.266 1.00 38.30 ? 286  ASN A N     1 
ATOM   1138 C  CA    . ASN A 1 174 ? -4.241  22.062 24.363 1.00 37.22 ? 286  ASN A CA    1 
ATOM   1139 C  C     . ASN A 1 174 ? -2.872  21.894 25.022 1.00 37.96 ? 286  ASN A C     1 
ATOM   1140 O  O     . ASN A 1 174 ? -2.484  22.667 25.906 1.00 38.20 ? 286  ASN A O     1 
ATOM   1141 C  CB    . ASN A 1 174 ? -5.094  23.145 25.080 1.00 38.36 ? 286  ASN A CB    1 
ATOM   1142 C  CG    . ASN A 1 174 ? -4.534  24.564 24.906 1.00 39.68 ? 286  ASN A CG    1 
ATOM   1143 O  OD1   . ASN A 1 174 ? -3.767  24.848 23.968 1.00 41.49 ? 286  ASN A OD1   1 
ATOM   1144 N  ND2   . ASN A 1 174 ? -4.889  25.454 25.834 1.00 40.04 ? 286  ASN A ND2   1 
ATOM   1145 N  N     . PHE A 1 175 ? -2.147  20.860 24.580 1.00 38.08 ? 287  PHE A N     1 
ATOM   1146 C  CA    . PHE A 1 175 ? -0.817  20.590 25.095 1.00 34.08 ? 287  PHE A CA    1 
ATOM   1147 C  C     . PHE A 1 175 ? 0.196   20.953 24.025 1.00 34.98 ? 287  PHE A C     1 
ATOM   1148 O  O     . PHE A 1 175 ? 0.163   20.404 22.895 1.00 36.09 ? 287  PHE A O     1 
ATOM   1149 C  CB    . PHE A 1 175 ? -0.676  19.121 25.551 1.00 35.93 ? 287  PHE A CB    1 
ATOM   1150 C  CG    . PHE A 1 175 ? 0.596   18.843 26.317 1.00 38.18 ? 287  PHE A CG    1 
ATOM   1151 C  CD1   . PHE A 1 175 ? 0.636   18.990 27.723 1.00 37.16 ? 287  PHE A CD1   1 
ATOM   1152 C  CD2   . PHE A 1 175 ? 1.773   18.501 25.643 1.00 38.56 ? 287  PHE A CD2   1 
ATOM   1153 C  CE1   . PHE A 1 175 ? 1.817   18.762 28.434 1.00 38.00 ? 287  PHE A CE1   1 
ATOM   1154 C  CE2   . PHE A 1 175 ? 2.966   18.286 26.347 1.00 39.39 ? 287  PHE A CE2   1 
ATOM   1155 C  CZ    . PHE A 1 175 ? 2.989   18.430 27.758 1.00 35.64 ? 287  PHE A CZ    1 
ATOM   1156 N  N     . ASN A 1 176 ? 1.100   21.872 24.380 1.00 35.49 ? 288  ASN A N     1 
ATOM   1157 C  CA    . ASN A 1 176 ? 2.166   22.384 23.481 1.00 35.41 ? 288  ASN A CA    1 
ATOM   1158 C  C     . ASN A 1 176 ? 1.658   23.164 22.272 1.00 35.36 ? 288  ASN A C     1 
ATOM   1159 O  O     . ASN A 1 176 ? 2.413   23.422 21.337 1.00 40.47 ? 288  ASN A O     1 
ATOM   1160 C  CB    . ASN A 1 176 ? 3.118   21.274 23.027 1.00 34.53 ? 288  ASN A CB    1 
ATOM   1161 C  CG    . ASN A 1 176 ? 4.281   21.083 23.977 1.00 40.04 ? 288  ASN A CG    1 
ATOM   1162 O  OD1   . ASN A 1 176 ? 4.506   21.912 24.843 1.00 35.62 ? 288  ASN A OD1   1 
ATOM   1163 N  ND2   . ASN A 1 176 ? 5.032   19.987 23.811 1.00 33.70 ? 288  ASN A ND2   1 
ATOM   1164 N  N     . VAL A 1 177 ? 0.391   23.546 22.298 1.00 38.37 ? 289  VAL A N     1 
ATOM   1165 C  CA    . VAL A 1 177 ? -0.211  24.273 21.174 1.00 38.79 ? 289  VAL A CA    1 
ATOM   1166 C  C     . VAL A 1 177 ? 0.353   25.695 20.998 1.00 38.60 ? 289  VAL A C     1 
ATOM   1167 O  O     . VAL A 1 177 ? 0.825   26.058 19.909 1.00 38.73 ? 289  VAL A O     1 
ATOM   1168 C  CB    . VAL A 1 177 ? -1.725  24.206 21.222 1.00 40.69 ? 289  VAL A CB    1 
ATOM   1169 C  CG1   . VAL A 1 177 ? -2.348  25.050 20.089 1.00 43.23 ? 289  VAL A CG1   1 
ATOM   1170 C  CG2   . VAL A 1 177 ? -2.162  22.745 21.079 1.00 36.40 ? 289  VAL A CG2   1 
ATOM   1171 N  N     . ASP A 1 178 ? 0.366   26.472 22.070 1.00 38.08 ? 290  ASP A N     1 
ATOM   1172 C  CA    . ASP A 1 178 ? 0.964   27.800 22.046 1.00 38.52 ? 290  ASP A CA    1 
ATOM   1173 C  C     . ASP A 1 178 ? 2.420   27.691 21.726 1.00 39.72 ? 290  ASP A C     1 
ATOM   1174 O  O     . ASP A 1 178 ? 2.967   28.505 20.983 1.00 40.74 ? 290  ASP A O     1 
ATOM   1175 C  CB    . ASP A 1 178 ? 0.871   28.481 23.409 1.00 35.95 ? 290  ASP A CB    1 
ATOM   1176 C  CG    . ASP A 1 178 ? -0.483  28.333 24.050 1.00 41.23 ? 290  ASP A CG    1 
ATOM   1177 O  OD1   . ASP A 1 178 ? -1.414  29.089 23.675 1.00 40.62 ? 290  ASP A OD1   1 
ATOM   1178 O  OD2   . ASP A 1 178 ? -0.597  27.484 24.983 1.00 40.76 ? 290  ASP A OD2   1 
ATOM   1179 N  N     . GLU A 1 179 ? 3.049   26.672 22.310 1.00 39.41 ? 291  GLU A N     1 
ATOM   1180 C  CA    . GLU A 1 179 ? 4.486   26.525 22.308 1.00 36.95 ? 291  GLU A CA    1 
ATOM   1181 C  C     . GLU A 1 179 ? 5.084   26.256 20.933 1.00 35.46 ? 291  GLU A C     1 
ATOM   1182 O  O     . GLU A 1 179 ? 6.171   26.738 20.639 1.00 38.79 ? 291  GLU A O     1 
ATOM   1183 C  CB    . GLU A 1 179 ? 4.890   25.440 23.305 1.00 38.85 ? 291  GLU A CB    1 
ATOM   1184 C  CG    . GLU A 1 179 ? 4.676   25.885 24.803 1.00 36.23 ? 291  GLU A CG    1 
ATOM   1185 C  CD    . GLU A 1 179 ? 3.200   26.087 25.172 1.00 38.31 ? 291  GLU A CD    1 
ATOM   1186 O  OE1   . GLU A 1 179 ? 2.302   25.373 24.647 1.00 36.14 ? 291  GLU A OE1   1 
ATOM   1187 O  OE2   . GLU A 1 179 ? 2.908   26.950 26.010 1.00 36.31 ? 291  GLU A OE2   1 
ATOM   1188 N  N     . ILE A 1 180 ? 4.376   25.510 20.084 1.00 36.53 ? 292  ILE A N     1 
ATOM   1189 C  CA    . ILE A 1 180 ? 4.901   25.250 18.747 1.00 37.76 ? 292  ILE A CA    1 
ATOM   1190 C  C     . ILE A 1 180 ? 4.974   26.565 17.954 1.00 41.71 ? 292  ILE A C     1 
ATOM   1191 O  O     . ILE A 1 180 ? 5.967   26.815 17.297 1.00 42.20 ? 292  ILE A O     1 
ATOM   1192 C  CB    . ILE A 1 180 ? 4.145   24.101 17.975 1.00 39.68 ? 292  ILE A CB    1 
ATOM   1193 C  CG1   . ILE A 1 180 ? 2.631   24.382 17.869 1.00 43.68 ? 292  ILE A CG1   1 
ATOM   1194 C  CG2   . ILE A 1 180 ? 4.392   22.724 18.668 1.00 40.14 ? 292  ILE A CG2   1 
ATOM   1195 C  CD1   . ILE A 1 180 ? 1.799   23.249 17.176 1.00 44.00 ? 292  ILE A CD1   1 
ATOM   1196 N  N     . PHE A 1 181 ? 3.939   27.412 18.048 1.00 38.68 ? 293  PHE A N     1 
ATOM   1197 C  CA    . PHE A 1 181 ? 3.981   28.730 17.371 1.00 37.48 ? 293  PHE A CA    1 
ATOM   1198 C  C     . PHE A 1 181 ? 4.949   29.715 18.036 1.00 39.66 ? 293  PHE A C     1 
ATOM   1199 O  O     . PHE A 1 181 ? 5.745   30.394 17.355 1.00 38.53 ? 293  PHE A O     1 
ATOM   1200 C  CB    . PHE A 1 181 ? 2.584   29.335 17.240 1.00 34.10 ? 293  PHE A CB    1 
ATOM   1201 C  CG    . PHE A 1 181 ? 1.646   28.520 16.422 1.00 37.21 ? 293  PHE A CG    1 
ATOM   1202 C  CD1   . PHE A 1 181 ? 1.663   28.606 15.019 1.00 36.49 ? 293  PHE A CD1   1 
ATOM   1203 C  CD2   . PHE A 1 181 ? 0.722   27.664 17.034 1.00 35.76 ? 293  PHE A CD2   1 
ATOM   1204 C  CE1   . PHE A 1 181 ? 0.780   27.848 14.251 1.00 40.48 ? 293  PHE A CE1   1 
ATOM   1205 C  CE2   . PHE A 1 181 ? -0.137  26.910 16.293 1.00 38.18 ? 293  PHE A CE2   1 
ATOM   1206 C  CZ    . PHE A 1 181 ? -0.124  26.998 14.877 1.00 38.43 ? 293  PHE A CZ    1 
ATOM   1207 N  N     . LEU A 1 182 ? 4.906   29.794 19.361 1.00 38.42 ? 294  LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 182 ? 5.769   30.737 20.091 1.00 39.38 ? 294  LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 182 ? 7.273   30.416 19.988 1.00 35.72 ? 294  LEU A C     1 
ATOM   1210 O  O     . LEU A 1 182 ? 8.114   31.332 19.872 1.00 34.86 ? 294  LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 182 ? 5.345   30.854 21.567 1.00 41.26 ? 294  LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 182 ? 3.961   31.450 21.858 1.00 46.39 ? 294  LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 182 ? 3.690   31.446 23.391 1.00 42.11 ? 294  LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 182 ? 3.782   32.875 21.276 1.00 45.86 ? 294  LEU A CD2   1 
ATOM   1215 N  N     . LYS A 1 183 ? 7.609   29.134 20.049 1.00 35.18 ? 295  LYS A N     1 
ATOM   1216 C  CA    . LYS A 1 183 ? 9.007   28.709 19.929 1.00 39.19 ? 295  LYS A CA    1 
ATOM   1217 C  C     . LYS A 1 183 ? 9.579   28.960 18.519 1.00 39.08 ? 295  LYS A C     1 
ATOM   1218 O  O     . LYS A 1 183 ? 10.704  29.444 18.369 1.00 37.29 ? 295  LYS A O     1 
ATOM   1219 C  CB    . LYS A 1 183 ? 9.182   27.228 20.299 1.00 41.39 ? 295  LYS A CB    1 
ATOM   1220 C  CG    . LYS A 1 183 ? 10.626  26.856 20.670 1.00 46.49 ? 295  LYS A CG    1 
ATOM   1221 C  CD    . LYS A 1 183 ? 11.164  27.770 21.810 1.00 47.34 ? 295  LYS A CD    1 
ATOM   1222 C  CE    . LYS A 1 183 ? 12.488  27.313 22.344 1.00 49.66 ? 295  LYS A CE    1 
ATOM   1223 N  NZ    . LYS A 1 183 ? 12.957  28.192 23.511 1.00 51.62 ? 295  LYS A NZ    1 
ATOM   1224 N  N     . LEU A 1 184 ? 8.789   28.609 17.513 1.00 38.87 ? 296  LEU A N     1 
ATOM   1225 C  CA    . LEU A 1 184 ? 9.112   28.903 16.132 1.00 37.47 ? 296  LEU A CA    1 
ATOM   1226 C  C     . LEU A 1 184 ? 9.312   30.418 15.934 1.00 34.30 ? 296  LEU A C     1 
ATOM   1227 O  O     . LEU A 1 184 ? 10.305  30.833 15.368 1.00 35.28 ? 296  LEU A O     1 
ATOM   1228 C  CB    . LEU A 1 184 ? 8.019   28.363 15.193 1.00 35.06 ? 296  LEU A CB    1 
ATOM   1229 C  CG    . LEU A 1 184 ? 8.359   28.452 13.678 1.00 39.12 ? 296  LEU A CG    1 
ATOM   1230 C  CD1   . LEU A 1 184 ? 9.650   27.699 13.315 1.00 39.16 ? 296  LEU A CD1   1 
ATOM   1231 C  CD2   . LEU A 1 184 ? 7.186   27.987 12.818 1.00 39.80 ? 296  LEU A CD2   1 
ATOM   1232 N  N     . VAL A 1 185 ? 8.374   31.232 16.413 1.00 32.93 ? 297  VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 185 ? 8.558   32.716 16.343 1.00 36.39 ? 297  VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 185 ? 9.873   33.150 17.003 1.00 40.54 ? 297  VAL A C     1 
ATOM   1235 O  O     . VAL A 1 185 ? 10.599  34.026 16.471 1.00 41.42 ? 297  VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 185 ? 7.326   33.448 16.925 1.00 34.98 ? 297  VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 185 ? 7.525   34.925 16.991 1.00 35.53 ? 297  VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 185 ? 6.100   33.133 16.065 1.00 33.55 ? 297  VAL A CG2   1 
ATOM   1239 N  N     . ASP A 1 186 ? 10.194  32.534 18.155 1.00 37.93 ? 298  ASP A N     1 
ATOM   1240 C  CA    . ASP A 1 186 ? 11.421  32.875 18.916 1.00 36.14 ? 298  ASP A CA    1 
ATOM   1241 C  C     . ASP A 1 186 ? 12.682  32.575 18.096 1.00 37.87 ? 298  ASP A C     1 
ATOM   1242 O  O     . ASP A 1 186 ? 13.588  33.424 17.970 1.00 37.96 ? 298  ASP A O     1 
ATOM   1243 C  CB    . ASP A 1 186 ? 11.450  32.128 20.272 1.00 35.66 ? 298  ASP A CB    1 
ATOM   1244 C  CG    . ASP A 1 186 ? 12.580  32.598 21.196 1.00 40.52 ? 298  ASP A CG    1 
ATOM   1245 O  OD1   . ASP A 1 186 ? 12.817  33.821 21.300 1.00 40.19 ? 298  ASP A OD1   1 
ATOM   1246 O  OD2   . ASP A 1 186 ? 13.223  31.734 21.830 1.00 42.55 ? 298  ASP A OD2   1 
ATOM   1247 N  N     . ASP A 1 187 ? 12.726  31.370 17.546 1.00 39.34 ? 299  ASP A N     1 
ATOM   1248 C  CA    . ASP A 1 187 ? 13.747  30.961 16.591 1.00 41.66 ? 299  ASP A CA    1 
ATOM   1249 C  C     . ASP A 1 187 ? 13.904  31.906 15.390 1.00 39.95 ? 299  ASP A C     1 
ATOM   1250 O  O     . ASP A 1 187 ? 15.026  32.195 14.969 1.00 44.52 ? 299  ASP A O     1 
ATOM   1251 C  CB    . ASP A 1 187 ? 13.426  29.556 16.082 1.00 47.25 ? 299  ASP A CB    1 
ATOM   1252 C  CG    . ASP A 1 187 ? 13.708  28.484 17.109 1.00 50.15 ? 299  ASP A CG    1 
ATOM   1253 O  OD1   . ASP A 1 187 ? 14.310  28.791 18.143 1.00 49.04 ? 299  ASP A OD1   1 
ATOM   1254 O  OD2   . ASP A 1 187 ? 13.332  27.324 16.867 1.00 55.04 ? 299  ASP A OD2   1 
ATOM   1255 N  N     . ILE A 1 188 ? 12.784  32.354 14.825 1.00 37.97 ? 300  ILE A N     1 
ATOM   1256 C  CA    . ILE A 1 188 ? 12.823  33.272 13.669 1.00 39.22 ? 300  ILE A CA    1 
ATOM   1257 C  C     . ILE A 1 188 ? 13.481  34.589 14.067 1.00 39.59 ? 300  ILE A C     1 
ATOM   1258 O  O     . ILE A 1 188 ? 14.470  35.014 13.447 1.00 38.80 ? 300  ILE A O     1 
ATOM   1259 C  CB    . ILE A 1 188 ? 11.413  33.503 13.053 1.00 37.87 ? 300  ILE A CB    1 
ATOM   1260 C  CG1   . ILE A 1 188 ? 10.871  32.184 12.458 1.00 36.26 ? 300  ILE A CG1   1 
ATOM   1261 C  CG2   . ILE A 1 188 ? 11.459  34.619 12.002 1.00 37.45 ? 300  ILE A CG2   1 
ATOM   1262 C  CD1   . ILE A 1 188 ? 9.400   32.210 12.132 1.00 33.48 ? 300  ILE A CD1   1 
ATOM   1263 N  N     . LEU A 1 189 ? 12.969  35.201 15.136 1.00 38.97 ? 301  LEU A N     1 
ATOM   1264 C  CA    . LEU A 1 189 ? 13.452  36.516 15.602 1.00 40.06 ? 301  LEU A CA    1 
ATOM   1265 C  C     . LEU A 1 189 ? 14.931  36.546 15.974 1.00 42.26 ? 301  LEU A C     1 
ATOM   1266 O  O     . LEU A 1 189 ? 15.596  37.555 15.774 1.00 40.95 ? 301  LEU A O     1 
ATOM   1267 C  CB    . LEU A 1 189 ? 12.613  37.023 16.785 1.00 39.47 ? 301  LEU A CB    1 
ATOM   1268 C  CG    . LEU A 1 189 ? 11.121  37.248 16.501 1.00 39.73 ? 301  LEU A CG    1 
ATOM   1269 C  CD1   . LEU A 1 189 ? 10.375  37.480 17.794 1.00 41.63 ? 301  LEU A CD1   1 
ATOM   1270 C  CD2   . LEU A 1 189 ? 10.905  38.404 15.510 1.00 39.16 ? 301  LEU A CD2   1 
ATOM   1271 N  N     . LYS A 1 190 ? 15.430  35.438 16.514 1.00 45.56 ? 302  LYS A N     1 
ATOM   1272 C  CA    . LYS A 1 190 ? 16.840  35.298 16.877 1.00 50.82 ? 302  LYS A CA    1 
ATOM   1273 C  C     . LYS A 1 190 ? 17.771  35.431 15.671 1.00 52.38 ? 302  LYS A C     1 
ATOM   1274 O  O     . LYS A 1 190 ? 18.838  36.019 15.775 1.00 54.78 ? 302  LYS A O     1 
ATOM   1275 C  CB    . LYS A 1 190 ? 17.085  33.943 17.558 1.00 50.55 ? 302  LYS A CB    1 
ATOM   1276 C  CG    . LYS A 1 190 ? 16.533  33.842 18.963 1.00 52.48 ? 302  LYS A CG    1 
ATOM   1277 C  CD    . LYS A 1 190 ? 16.998  32.564 19.648 1.00 54.19 ? 302  LYS A CD    1 
ATOM   1278 C  CE    . LYS A 1 190 ? 16.340  32.395 21.002 1.00 53.70 ? 302  LYS A CE    1 
ATOM   1279 N  NZ    . LYS A 1 190 ? 16.516  33.604 21.856 1.00 54.65 ? 302  LYS A NZ    1 
ATOM   1280 N  N     . LYS A 1 191 ? 17.345  34.873 14.539 1.00 58.03 ? 303  LYS A N     1 
ATOM   1281 C  CA    . LYS A 1 191 ? 18.169  34.750 13.334 1.00 61.81 ? 303  LYS A CA    1 
ATOM   1282 C  C     . LYS A 1 191 ? 18.079  35.953 12.374 1.00 65.54 ? 303  LYS A C     1 
ATOM   1283 O  O     . LYS A 1 191 ? 18.714  35.951 11.308 1.00 67.23 ? 303  LYS A O     1 
ATOM   1284 C  CB    . LYS A 1 191 ? 17.842  33.445 12.595 1.00 61.05 ? 303  LYS A CB    1 
ATOM   1285 C  CG    . LYS A 1 191 ? 18.332  32.192 13.301 1.00 62.45 ? 303  LYS A CG    1 
ATOM   1286 N  N     . MET A 1 192 ? 17.294  36.965 12.742 1.00 67.16 ? 304  MET A N     1 
ATOM   1287 C  CA    . MET A 1 192 ? 17.343  38.262 12.045 1.00 69.22 ? 304  MET A CA    1 
ATOM   1288 C  C     . MET A 1 192 ? 18.064  39.321 12.892 1.00 69.92 ? 304  MET A C     1 
ATOM   1289 O  O     . MET A 1 192 ? 18.216  39.158 14.113 1.00 69.51 ? 304  MET A O     1 
ATOM   1290 C  CB    . MET A 1 192 ? 15.945  38.739 11.597 1.00 69.72 ? 304  MET A CB    1 
ATOM   1291 C  CG    . MET A 1 192 ? 14.823  38.612 12.634 1.00 69.85 ? 304  MET A CG    1 
ATOM   1292 S  SD    . MET A 1 192 ? 13.148  38.917 11.976 1.00 69.98 ? 304  MET A SD    1 
ATOM   1293 C  CE    . MET A 1 192 ? 13.035  37.699 10.671 1.00 69.70 ? 304  MET A CE    1 
ATOM   1294 O  OXT   . MET A 1 192 ? 18.533  40.353 12.383 1.00 70.82 ? 304  MET A OXT   1 
HETATM 1295 MG MG    . MG  B 2 .   ? -7.160  21.306 7.023  1.00 35.70 ? 402  MG  A MG    1 
HETATM 1296 CA CA    . CA  C 3 .   ? 0.519   26.061 26.234 0.50 30.28 ? 501  CA  A CA    1 
HETATM 1297 P  PB    . GDP D 4 .   ? -5.777  18.326 8.875  1.00 38.14 ? 401  GDP A PB    1 
HETATM 1298 O  O1B   . GDP D 4 .   ? -6.177  17.507 7.639  1.00 36.92 ? 401  GDP A O1B   1 
HETATM 1299 O  O2B   . GDP D 4 .   ? -4.352  18.127 9.122  1.00 34.37 ? 401  GDP A O2B   1 
HETATM 1300 O  O3B   . GDP D 4 .   ? -6.261  19.768 8.677  1.00 36.83 ? 401  GDP A O3B   1 
HETATM 1301 O  O3A   . GDP D 4 .   ? -6.518  17.694 10.154 1.00 35.56 ? 401  GDP A O3A   1 
HETATM 1302 P  PA    . GDP D 4 .   ? -7.758  18.242 10.953 1.00 39.00 ? 401  GDP A PA    1 
HETATM 1303 O  O1A   . GDP D 4 .   ? -7.463  19.456 11.774 1.00 40.11 ? 401  GDP A O1A   1 
HETATM 1304 O  O2A   . GDP D 4 .   ? -8.937  18.485 9.997  1.00 34.17 ? 401  GDP A O2A   1 
HETATM 1305 O  "O5'" . GDP D 4 .   ? -7.966  16.976 11.903 1.00 37.33 ? 401  GDP A "O5'" 1 
HETATM 1306 C  "C5'" . GDP D 4 .   ? -8.534  15.758 11.391 1.00 38.58 ? 401  GDP A "C5'" 1 
HETATM 1307 C  "C4'" . GDP D 4 .   ? -9.157  14.946 12.527 1.00 36.23 ? 401  GDP A "C4'" 1 
HETATM 1308 O  "O4'" . GDP D 4 .   ? -8.212  14.800 13.585 1.00 35.61 ? 401  GDP A "O4'" 1 
HETATM 1309 C  "C3'" . GDP D 4 .   ? -10.349 15.645 13.156 1.00 36.19 ? 401  GDP A "C3'" 1 
HETATM 1310 O  "O3'" . GDP D 4 .   ? -11.319 14.640 13.499 1.00 40.96 ? 401  GDP A "O3'" 1 
HETATM 1311 C  "C2'" . GDP D 4 .   ? -9.817  16.307 14.421 1.00 33.91 ? 401  GDP A "C2'" 1 
HETATM 1312 O  "O2'" . GDP D 4 .   ? -10.851 16.541 15.389 1.00 32.72 ? 401  GDP A "O2'" 1 
HETATM 1313 C  "C1'" . GDP D 4 .   ? -8.771  15.278 14.839 1.00 33.51 ? 401  GDP A "C1'" 1 
HETATM 1314 N  N9    . GDP D 4 .   ? -7.648  15.814 15.673 1.00 33.42 ? 401  GDP A N9    1 
HETATM 1315 C  C8    . GDP D 4 .   ? -6.861  16.866 15.408 1.00 32.75 ? 401  GDP A C8    1 
HETATM 1316 N  N7    . GDP D 4 .   ? -5.955  17.053 16.388 1.00 34.80 ? 401  GDP A N7    1 
HETATM 1317 C  C5    . GDP D 4 .   ? -6.143  16.095 17.291 1.00 32.94 ? 401  GDP A C5    1 
HETATM 1318 C  C6    . GDP D 4 .   ? -5.522  15.706 18.567 1.00 31.41 ? 401  GDP A C6    1 
HETATM 1319 O  O6    . GDP D 4 .   ? -4.574  16.346 19.011 1.00 31.51 ? 401  GDP A O6    1 
HETATM 1320 N  N1    . GDP D 4 .   ? -6.011  14.638 19.216 1.00 31.70 ? 401  GDP A N1    1 
HETATM 1321 C  C2    . GDP D 4 .   ? -7.054  13.912 18.718 1.00 32.46 ? 401  GDP A C2    1 
HETATM 1322 N  N2    . GDP D 4 .   ? -7.521  12.847 19.403 1.00 31.19 ? 401  GDP A N2    1 
HETATM 1323 N  N3    . GDP D 4 .   ? -7.669  14.224 17.562 1.00 32.45 ? 401  GDP A N3    1 
HETATM 1324 C  C4    . GDP D 4 .   ? -7.250  15.278 16.815 1.00 33.56 ? 401  GDP A C4    1 
HETATM 1325 X  UNK   . UNX E 5 .   ? 7.025   22.407 21.921 0.01 2.00  ? 1401 UNX A UNK   1 
HETATM 1326 X  UNK   . UNX F 5 .   ? 20.881  17.020 7.027  0.01 2.00  ? 1402 UNX A UNK   1 
HETATM 1327 X  UNK   . UNX G 5 .   ? -2.206  14.861 26.283 0.01 2.11  ? 1403 UNX A UNK   1 
HETATM 1328 X  UNK   . UNX H 5 .   ? -7.618  9.468  20.761 0.01 2.24  ? 1404 UNX A UNK   1 
HETATM 1329 X  UNK   . UNX I 5 .   ? 14.943  17.306 -2.018 0.01 2.00  ? 1405 UNX A UNK   1 
HETATM 1330 X  UNK   . UNX J 5 .   ? -4.522  7.575  25.361 0.01 16.38 ? 1406 UNX A UNK   1 
HETATM 1331 O  O     . HOH K 6 .   ? -1.164  24.670 24.849 1.00 26.36 ? 1001 HOH A O     1 
HETATM 1332 O  O     . HOH K 6 .   ? 6.448   10.665 17.664 1.00 33.62 ? 1002 HOH A O     1 
HETATM 1333 O  O     . HOH K 6 .   ? 7.523   16.053 -2.521 1.00 36.10 ? 1003 HOH A O     1 
HETATM 1334 O  O     . HOH K 6 .   ? -2.941  27.941 26.265 0.50 30.04 ? 1004 HOH A O     1 
HETATM 1335 O  O     . HOH K 6 .   ? 2.452   14.355 7.588  1.00 36.70 ? 1006 HOH A O     1 
HETATM 1336 O  O     . HOH K 6 .   ? 13.293  14.510 1.349  1.00 41.44 ? 1007 HOH A O     1 
HETATM 1337 O  O     . HOH K 6 .   ? -3.463  27.341 22.829 1.00 40.58 ? 1008 HOH A O     1 
HETATM 1338 O  O     . HOH K 6 .   ? 15.207  25.185 11.150 1.00 33.94 ? 1009 HOH A O     1 
HETATM 1339 O  O     . HOH K 6 .   ? 7.465   10.187 1.468  1.00 49.34 ? 1010 HOH A O     1 
HETATM 1340 O  O     . HOH K 6 .   ? -0.298  19.986 -0.818 1.00 46.12 ? 1011 HOH A O     1 
HETATM 1341 O  O     . HOH K 6 .   ? 13.574  8.566  12.832 1.00 45.56 ? 1012 HOH A O     1 
HETATM 1342 O  O     . HOH K 6 .   ? -5.306  22.052 6.731  1.00 49.02 ? 1013 HOH A O     1 
HETATM 1343 O  O     . HOH K 6 .   ? -8.993  20.239 8.346  1.00 39.90 ? 1014 HOH A O     1 
HETATM 1344 O  O     . HOH K 6 .   ? -8.401  23.030 5.857  1.00 40.71 ? 1015 HOH A O     1 
HETATM 1345 O  O     . HOH K 6 .   ? 16.261  23.222 9.527  1.00 41.20 ? 1016 HOH A O     1 
HETATM 1346 O  O     . HOH K 6 .   ? -9.396  28.139 21.223 1.00 57.49 ? 1017 HOH A O     1 
HETATM 1347 O  O     . HOH K 6 .   ? 17.468  19.425 14.462 1.00 36.83 ? 1018 HOH A O     1 
HETATM 1348 O  O     . HOH K 6 .   ? 0.538   20.737 3.457  1.00 38.09 ? 1019 HOH A O     1 
HETATM 1349 O  O     . HOH K 6 .   ? -3.200  11.085 5.427  1.00 41.21 ? 1020 HOH A O     1 
HETATM 1350 O  O     . HOH K 6 .   ? 2.231   22.268 1.281  1.00 41.73 ? 1021 HOH A O     1 
HETATM 1351 O  O     . HOH K 6 .   ? -2.004  13.675 2.484  1.00 40.42 ? 1022 HOH A O     1 
HETATM 1352 O  O     . HOH K 6 .   ? 7.682   17.488 23.285 1.00 40.14 ? 1023 HOH A O     1 
HETATM 1353 O  O     . HOH K 6 .   ? 9.835   9.381  8.018  1.00 48.56 ? 1024 HOH A O     1 
HETATM 1354 O  O     . HOH K 6 .   ? 0.635   18.931 -7.134 1.00 41.14 ? 1025 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   113 ?   ?   ?   A . n 
A 1 2   GLY 2   114 ?   ?   ?   A . n 
A 1 3   SER 3   115 ?   ?   ?   A . n 
A 1 4   SER 4   116 ?   ?   ?   A . n 
A 1 5   HIS 5   117 ?   ?   ?   A . n 
A 1 6   HIS 6   118 ?   ?   ?   A . n 
A 1 7   HIS 7   119 ?   ?   ?   A . n 
A 1 8   HIS 8   120 ?   ?   ?   A . n 
A 1 9   HIS 9   121 ?   ?   ?   A . n 
A 1 10  HIS 10  122 ?   ?   ?   A . n 
A 1 11  SER 11  123 ?   ?   ?   A . n 
A 1 12  SER 12  124 ?   ?   ?   A . n 
A 1 13  GLY 13  125 ?   ?   ?   A . n 
A 1 14  LEU 14  126 ?   ?   ?   A . n 
A 1 15  VAL 15  127 ?   ?   ?   A . n 
A 1 16  PRO 16  128 ?   ?   ?   A . n 
A 1 17  ARG 17  129 ?   ?   ?   A . n 
A 1 18  GLY 18  130 ?   ?   ?   A . n 
A 1 19  SER 19  131 ?   ?   ?   A . n 
A 1 20  PRO 20  132 ?   ?   ?   A . n 
A 1 21  ARG 21  133 ?   ?   ?   A . n 
A 1 22  PRO 22  134 134 PRO PRO A . n 
A 1 23  ALA 23  135 135 ALA ALA A . n 
A 1 24  ASP 24  136 136 ASP ASP A . n 
A 1 25  PHE 25  137 137 PHE PHE A . n 
A 1 26  LYS 26  138 138 LYS LYS A . n 
A 1 27  LEU 27  139 139 LEU LEU A . n 
A 1 28  GLN 28  140 140 GLN GLN A . n 
A 1 29  VAL 29  141 141 VAL VAL A . n 
A 1 30  ILE 30  142 142 ILE ILE A . n 
A 1 31  ILE 31  143 143 ILE ILE A . n 
A 1 32  ILE 32  144 144 ILE ILE A . n 
A 1 33  GLY 33  145 145 GLY GLY A . n 
A 1 34  SER 34  146 146 SER SER A . n 
A 1 35  ARG 35  147 147 ARG ARG A . n 
A 1 36  GLY 36  148 148 GLY GLY A . n 
A 1 37  VAL 37  149 149 VAL VAL A . n 
A 1 38  GLY 38  150 150 GLY GLY A . n 
A 1 39  LYS 39  151 151 LYS LYS A . n 
A 1 40  THR 40  152 152 THR THR A . n 
A 1 41  SER 41  153 153 SER SER A . n 
A 1 42  LEU 42  154 154 LEU LEU A . n 
A 1 43  MET 43  155 155 MET MET A . n 
A 1 44  GLU 44  156 156 GLU GLU A . n 
A 1 45  ARG 45  157 157 ARG ARG A . n 
A 1 46  PHE 46  158 158 PHE PHE A . n 
A 1 47  THR 47  159 159 THR THR A . n 
A 1 48  ASP 48  160 160 ASP ASP A . n 
A 1 49  ASP 49  161 ?   ?   ?   A . n 
A 1 50  THR 50  162 ?   ?   ?   A . n 
A 1 51  PHE 51  163 ?   ?   ?   A . n 
A 1 52  CYS 52  164 ?   ?   ?   A . n 
A 1 53  GLU 53  165 ?   ?   ?   A . n 
A 1 54  ALA 54  166 ?   ?   ?   A . n 
A 1 55  CYS 55  167 ?   ?   ?   A . n 
A 1 56  LYS 56  168 ?   ?   ?   A . n 
A 1 57  SER 57  169 169 SER SER A . n 
A 1 58  THR 58  170 170 THR THR A . n 
A 1 59  VAL 59  171 171 VAL VAL A . n 
A 1 60  GLY 60  172 172 GLY GLY A . n 
A 1 61  VAL 61  173 173 VAL VAL A . n 
A 1 62  ASP 62  174 174 ASP ASP A . n 
A 1 63  PHE 63  175 175 PHE PHE A . n 
A 1 64  LYS 64  176 176 LYS LYS A . n 
A 1 65  ILE 65  177 177 ILE ILE A . n 
A 1 66  LYS 66  178 178 LYS LYS A . n 
A 1 67  THR 67  179 179 THR THR A . n 
A 1 68  VAL 68  180 180 VAL VAL A . n 
A 1 69  GLU 69  181 181 GLU GLU A . n 
A 1 70  LEU 70  182 182 LEU LEU A . n 
A 1 71  ARG 71  183 183 ARG ARG A . n 
A 1 72  GLY 72  184 184 GLY GLY A . n 
A 1 73  LYS 73  185 185 LYS LYS A . n 
A 1 74  LYS 74  186 186 LYS LYS A . n 
A 1 75  ILE 75  187 187 ILE ILE A . n 
A 1 76  ARG 76  188 188 ARG ARG A . n 
A 1 77  LEU 77  189 189 LEU LEU A . n 
A 1 78  GLN 78  190 190 GLN GLN A . n 
A 1 79  ILE 79  191 191 ILE ILE A . n 
A 1 80  TRP 80  192 192 TRP TRP A . n 
A 1 81  ASP 81  193 193 ASP ASP A . n 
A 1 82  THR 82  194 194 THR THR A . n 
A 1 83  ALA 83  195 195 ALA ALA A . n 
A 1 84  GLY 84  196 196 GLY GLY A . n 
A 1 85  GLN 85  197 197 GLN GLN A . n 
A 1 86  GLU 86  198 198 GLU GLU A . n 
A 1 87  ARG 87  199 199 ARG ARG A . n 
A 1 88  PHE 88  200 200 PHE PHE A . n 
A 1 89  ASN 89  201 201 ASN ASN A . n 
A 1 90  SER 90  202 202 SER SER A . n 
A 1 91  ILE 91  203 203 ILE ILE A . n 
A 1 92  THR 92  204 204 THR THR A . n 
A 1 93  SER 93  205 205 SER SER A . n 
A 1 94  ALA 94  206 206 ALA ALA A . n 
A 1 95  TYR 95  207 207 TYR TYR A . n 
A 1 96  TYR 96  208 208 TYR TYR A . n 
A 1 97  ARG 97  209 209 ARG ARG A . n 
A 1 98  SER 98  210 210 SER SER A . n 
A 1 99  ALA 99  211 211 ALA ALA A . n 
A 1 100 LYS 100 212 212 LYS LYS A . n 
A 1 101 GLY 101 213 213 GLY GLY A . n 
A 1 102 ILE 102 214 214 ILE ILE A . n 
A 1 103 ILE 103 215 215 ILE ILE A . n 
A 1 104 LEU 104 216 216 LEU LEU A . n 
A 1 105 VAL 105 217 217 VAL VAL A . n 
A 1 106 TYR 106 218 218 TYR TYR A . n 
A 1 107 ASP 107 219 219 ASP ASP A . n 
A 1 108 ILE 108 220 220 ILE ILE A . n 
A 1 109 THR 109 221 221 THR THR A . n 
A 1 110 LYS 110 222 222 LYS LYS A . n 
A 1 111 LYS 111 223 223 LYS LYS A . n 
A 1 112 GLU 112 224 224 GLU GLU A . n 
A 1 113 THR 113 225 225 THR THR A . n 
A 1 114 PHE 114 226 226 PHE PHE A . n 
A 1 115 ASP 115 227 227 ASP ASP A . n 
A 1 116 ASP 116 228 228 ASP ASP A . n 
A 1 117 LEU 117 229 229 LEU LEU A . n 
A 1 118 PRO 118 230 230 PRO PRO A . n 
A 1 119 LYS 119 231 231 LYS LYS A . n 
A 1 120 TRP 120 232 232 TRP TRP A . n 
A 1 121 MET 121 233 233 MET MET A . n 
A 1 122 LYS 122 234 234 LYS LYS A . n 
A 1 123 MET 123 235 235 MET MET A . n 
A 1 124 ILE 124 236 236 ILE ILE A . n 
A 1 125 ASP 125 237 237 ASP ASP A . n 
A 1 126 LYS 126 238 238 LYS LYS A . n 
A 1 127 TYR 127 239 239 TYR TYR A . n 
A 1 128 ALA 128 240 240 ALA ALA A . n 
A 1 129 SER 129 241 241 SER SER A . n 
A 1 130 GLU 130 242 242 GLU GLU A . n 
A 1 131 ASP 131 243 243 ASP ASP A . n 
A 1 132 ALA 132 244 244 ALA ALA A . n 
A 1 133 GLU 133 245 245 GLU GLU A . n 
A 1 134 LEU 134 246 246 LEU LEU A . n 
A 1 135 LEU 135 247 247 LEU LEU A . n 
A 1 136 LEU 136 248 248 LEU LEU A . n 
A 1 137 VAL 137 249 249 VAL VAL A . n 
A 1 138 GLY 138 250 250 GLY GLY A . n 
A 1 139 ASN 139 251 251 ASN ASN A . n 
A 1 140 LYS 140 252 252 LYS LYS A . n 
A 1 141 LEU 141 253 253 LEU LEU A . n 
A 1 142 ASP 142 254 254 ASP ASP A . n 
A 1 143 CYS 143 255 255 CYS CYS A . n 
A 1 144 GLU 144 256 256 GLU GLU A . n 
A 1 145 THR 145 257 257 THR THR A . n 
A 1 146 ASP 146 258 258 ASP ASP A . n 
A 1 147 ARG 147 259 259 ARG ARG A . n 
A 1 148 GLU 148 260 260 GLU GLU A . n 
A 1 149 ILE 149 261 261 ILE ILE A . n 
A 1 150 THR 150 262 262 THR THR A . n 
A 1 151 ARG 151 263 263 ARG ARG A . n 
A 1 152 GLN 152 264 264 GLN GLN A . n 
A 1 153 GLN 153 265 265 GLN GLN A . n 
A 1 154 GLY 154 266 266 GLY GLY A . n 
A 1 155 GLU 155 267 267 GLU GLU A . n 
A 1 156 LYS 156 268 268 LYS LYS A . n 
A 1 157 PHE 157 269 269 PHE PHE A . n 
A 1 158 ALA 158 270 270 ALA ALA A . n 
A 1 159 GLN 159 271 271 GLN GLN A . n 
A 1 160 GLN 160 272 272 GLN GLN A . n 
A 1 161 ILE 161 273 273 ILE ILE A . n 
A 1 162 THR 162 274 274 THR THR A . n 
A 1 163 GLY 163 275 275 GLY GLY A . n 
A 1 164 MET 164 276 276 MET MET A . n 
A 1 165 ARG 165 277 277 ARG ARG A . n 
A 1 166 PHE 166 278 278 PHE PHE A . n 
A 1 167 CYS 167 279 279 CYS CYS A . n 
A 1 168 GLU 168 280 280 GLU GLU A . n 
A 1 169 ALA 169 281 281 ALA ALA A . n 
A 1 170 SER 170 282 282 SER SER A . n 
A 1 171 ALA 171 283 283 ALA ALA A . n 
A 1 172 LYS 172 284 284 LYS LYS A . n 
A 1 173 ASP 173 285 285 ASP ASP A . n 
A 1 174 ASN 174 286 286 ASN ASN A . n 
A 1 175 PHE 175 287 287 PHE PHE A . n 
A 1 176 ASN 176 288 288 ASN ASN A . n 
A 1 177 VAL 177 289 289 VAL VAL A . n 
A 1 178 ASP 178 290 290 ASP ASP A . n 
A 1 179 GLU 179 291 291 GLU GLU A . n 
A 1 180 ILE 180 292 292 ILE ILE A . n 
A 1 181 PHE 181 293 293 PHE PHE A . n 
A 1 182 LEU 182 294 294 LEU LEU A . n 
A 1 183 LYS 183 295 295 LYS LYS A . n 
A 1 184 LEU 184 296 296 LEU LEU A . n 
A 1 185 VAL 185 297 297 VAL VAL A . n 
A 1 186 ASP 186 298 298 ASP ASP A . n 
A 1 187 ASP 187 299 299 ASP ASP A . n 
A 1 188 ILE 188 300 300 ILE ILE A . n 
A 1 189 LEU 189 301 301 LEU LEU A . n 
A 1 190 LYS 190 302 302 LYS LYS A . n 
A 1 191 LYS 191 303 303 LYS LYS A . n 
A 1 192 MET 192 304 304 MET MET A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  402  402  MG  MG  A . 
C 3 CA  1  501  501  CA  CA  A . 
D 4 GDP 1  401  401  GDP GDP A . 
E 5 UNX 1  1401 1401 UNX UNX A . 
F 5 UNX 1  1402 1402 UNX UNX A . 
G 5 UNX 1  1403 1403 UNX UNX A . 
H 5 UNX 1  1404 1404 UNX UNX A . 
I 5 UNX 1  1405 1405 UNX UNX A . 
J 5 UNX 1  1406 1406 UNX UNX A . 
K 6 HOH 1  1001 1001 HOH HOH A . 
K 6 HOH 2  1002 1002 HOH HOH A . 
K 6 HOH 3  1003 1003 HOH HOH A . 
K 6 HOH 4  1004 1004 HOH HOH A . 
K 6 HOH 5  1006 1006 HOH HOH A . 
K 6 HOH 6  1007 1007 HOH HOH A . 
K 6 HOH 7  1008 1008 HOH HOH A . 
K 6 HOH 8  1009 1009 HOH HOH A . 
K 6 HOH 9  1010 1010 HOH HOH A . 
K 6 HOH 10 1011 1011 HOH HOH A . 
K 6 HOH 11 1012 1012 HOH HOH A . 
K 6 HOH 12 1013 1013 HOH HOH A . 
K 6 HOH 13 1014 1014 HOH HOH A . 
K 6 HOH 14 1015 1015 HOH HOH A . 
K 6 HOH 15 1016 1016 HOH HOH A . 
K 6 HOH 16 1017 1017 HOH HOH A . 
K 6 HOH 17 1018 1018 HOH HOH A . 
K 6 HOH 18 1019 1019 HOH HOH A . 
K 6 HOH 19 1020 1020 HOH HOH A . 
K 6 HOH 20 1021 1021 HOH HOH A . 
K 6 HOH 21 1022 1022 HOH HOH A . 
K 6 HOH 22 1023 1023 HOH HOH A . 
K 6 HOH 23 1024 1024 HOH HOH A . 
K 6 HOH 24 1025 1025 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K 
2 1,2 A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2990  ? 
2 MORE         -72   ? 
2 'SSA (A^2)'  15180 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 22.7315000000 -0.8660254038 
-0.5000000000 0.0000000000 39.3721129323 0.0000000000 0.0000000000 -1.0000000000 52.5756666667 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CA  501  ? C CA  . 
2 1 A HOH 1004 ? K HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3B ? D GDP .   ? A GDP 401  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 OG1 ? A THR 40  ? A THR 152  ? 1_555  83.8  ? 
2  O3B ? D GDP .   ? A GDP 401  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1013 ? 1_555  89.6  ? 
3  OG1 ? A THR 40  ? A THR 152  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1013 ? 1_555  80.6  ? 
4  O3B ? D GDP .   ? A GDP 401  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1014 ? 1_555  69.0  ? 
5  OG1 ? A THR 40  ? A THR 152  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1014 ? 1_555  84.6  ? 
6  O   ? K HOH .   ? A HOH 1013 ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1014 ? 1_555  155.1 ? 
7  O3B ? D GDP .   ? A GDP 401  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1015 ? 1_555  165.2 ? 
8  OG1 ? A THR 40  ? A THR 152  ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1015 ? 1_555  84.9  ? 
9  O   ? K HOH .   ? A HOH 1013 ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1015 ? 1_555  97.9  ? 
10 O   ? K HOH .   ? A HOH 1014 ? 1_555  MG ? B MG . ? A MG 402 ? 1_555 O   ? K HOH .   ? A HOH 1015 ? 1_555  100.5 ? 
11 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  73.3  ? 
12 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  88.6  ? 
13 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  100.4 ? 
14 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  138.4 ? 
15 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  101.5 ? 
16 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  51.0  ? 
17 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 78.7  ? 
18 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 84.1  ? 
19 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 164.9 ? 
20 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 142.7 ? 
21 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 O   ? K HOH .   ? A HOH 1001 ? 10_665 144.8 ? 
22 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 O   ? K HOH .   ? A HOH 1001 ? 10_665 83.1  ? 
23 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 O   ? K HOH .   ? A HOH 1001 ? 10_665 121.7 ? 
24 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 O   ? K HOH .   ? A HOH 1001 ? 10_665 71.2  ? 
25 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 O   ? K HOH .   ? A HOH 1001 ? 10_665 73.0  ? 
26 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 114.6 ? 
27 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 171.4 ? 
28 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 83.5  ? 
29 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 74.9  ? 
30 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 94.2  ? 
31 O   ? K HOH .   ? A HOH 1001 ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 88.4  ? 
32 O   ? K HOH .   ? A HOH 1001 ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 67.3  ? 
33 OD2 ? A ASP 178 ? A ASP 290  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 140.2 ? 
34 OE1 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 73.7  ? 
35 OE2 ? A GLU 179 ? A GLU 291  ? 1_555  CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 103.9 ? 
36 OD2 ? A ASP 178 ? A ASP 290  ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 93.6  ? 
37 O   ? K HOH .   ? A HOH 1001 ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 134.2 ? 
38 OE1 ? A GLU 179 ? A GLU 291  ? 10_665 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 179 ? A GLU 291  ? 10_665 48.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-10-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
5 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 3.8095  23.2461 11.3459 -0.2301 -0.0191 -0.0760 -0.0138 -0.0221 -0.1146 1.6386 1.9427  4.9988  -0.2771 -0.4221 0.5848 
-0.0241 -0.1986 0.2227  0.3424 0.0314  -0.0880 0.0954 -0.1169 -0.2105 'X-RAY DIFFRACTION' 
2 ? refined -7.5146 16.3399 13.9992 -0.1618 0.2999  0.0993  -0.2522 0.0727  -0.3249 4.9557 14.2746 19.2001 -6.2115 6.2350  0.7689 
0.7446  -0.2816 -0.4630 0.1702 -0.2873 0.8937  1.0879 0.4352  -0.7670 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 22 A 192 ALL A 134 A 304 'X-RAY DIFFRACTION' ? 
2 2 D 1  D 1   ALL A 401 A 401 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     2IL1 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           39.350 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        39.350 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   mr 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?   ? 1 
SCALEPACK   .        ?              package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?   ? 2 
PHASER      .        ?              program 'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?   ? 3 
PDB_EXTRACT 1.701    'Nov. 1, 2005' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++ ? 4 
HKL-2000    .        ?              ?       ?                    ?                           'data scaling'    ? ?   ? 5 
REFMAC      5.2.0019 ?              ?       ?                    ?                           refinement        ? ?   ? 6 
ARP/wARP    .        ?              ?       ?                    ?                           'model building'  ? ?   ? 7 
MolProbity  .        ?              ?       ?                    ?                           'model building'  ? ?   ? 8 
Coot        .        ?              ?       ?                    ?                           'model building'  ? ?   ? 9 
# 
_pdbx_database_remark.id     300 
_pdbx_database_remark.text   
;BIOMOLECULE: 1
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT 
WHICH CONSISTS OF 1 CHAIN(S). THE BIOLOGICAL UNIT OF THE 
PROTEIN IS NOT KNOWN
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    255 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   UNK 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   UNX 
_pdbx_validate_close_contact.auth_seq_id_2    1404 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             279 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             279 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.708 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.104 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 159 ? ? -103.96 -109.24 
2 1 LYS A 252 ? ? 75.23   34.68   
3 1 CYS A 255 ? ? -95.70  35.65   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 138 ? NZ  ? A LYS 26  NZ  
2  1 Y 1 A GLU 181 ? CD  ? A GLU 69  CD  
3  1 Y 1 A GLU 181 ? OE1 ? A GLU 69  OE1 
4  1 Y 1 A GLU 181 ? OE2 ? A GLU 69  OE2 
5  1 Y 1 A ARG 183 ? NE  ? A ARG 71  NE  
6  1 Y 1 A ARG 183 ? CZ  ? A ARG 71  CZ  
7  1 Y 1 A ARG 183 ? NH1 ? A ARG 71  NH1 
8  1 Y 1 A ARG 183 ? NH2 ? A ARG 71  NH2 
9  1 Y 1 A LYS 185 ? CD  ? A LYS 73  CD  
10 1 Y 1 A LYS 185 ? CE  ? A LYS 73  CE  
11 1 Y 1 A LYS 185 ? NZ  ? A LYS 73  NZ  
12 1 Y 1 A LYS 186 ? CE  ? A LYS 74  CE  
13 1 Y 1 A LYS 186 ? NZ  ? A LYS 74  NZ  
14 1 Y 1 A ARG 209 ? NE  ? A ARG 97  NE  
15 1 Y 1 A ARG 209 ? CZ  ? A ARG 97  CZ  
16 1 Y 1 A ARG 209 ? NH1 ? A ARG 97  NH1 
17 1 Y 1 A ARG 209 ? NH2 ? A ARG 97  NH2 
18 1 Y 1 A LYS 223 ? CE  ? A LYS 111 CE  
19 1 Y 1 A LYS 223 ? NZ  ? A LYS 111 NZ  
20 1 Y 1 A GLU 242 ? CG  ? A GLU 130 CG  
21 1 Y 1 A GLU 242 ? CD  ? A GLU 130 CD  
22 1 Y 1 A GLU 242 ? OE1 ? A GLU 130 OE1 
23 1 Y 1 A GLU 242 ? OE2 ? A GLU 130 OE2 
24 1 Y 1 A GLN 264 ? CD  ? A GLN 152 CD  
25 1 Y 1 A GLN 264 ? OE1 ? A GLN 152 OE1 
26 1 Y 1 A GLN 264 ? NE2 ? A GLN 152 NE2 
27 1 Y 1 A LYS 268 ? CD  ? A LYS 156 CD  
28 1 Y 1 A LYS 268 ? CE  ? A LYS 156 CE  
29 1 Y 1 A LYS 268 ? NZ  ? A LYS 156 NZ  
30 1 Y 1 A GLN 271 ? OE1 ? A GLN 159 OE1 
31 1 Y 1 A GLN 271 ? NE2 ? A GLN 159 NE2 
32 1 Y 1 A LYS 284 ? CE  ? A LYS 172 CE  
33 1 Y 1 A LYS 284 ? NZ  ? A LYS 172 NZ  
34 1 Y 1 A LYS 303 ? CD  ? A LYS 191 CD  
35 1 Y 1 A LYS 303 ? CE  ? A LYS 191 CE  
36 1 Y 1 A LYS 303 ? NZ  ? A LYS 191 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 113 ? A MET 1  
2  1 Y 1 A GLY 114 ? A GLY 2  
3  1 Y 1 A SER 115 ? A SER 3  
4  1 Y 1 A SER 116 ? A SER 4  
5  1 Y 1 A HIS 117 ? A HIS 5  
6  1 Y 1 A HIS 118 ? A HIS 6  
7  1 Y 1 A HIS 119 ? A HIS 7  
8  1 Y 1 A HIS 120 ? A HIS 8  
9  1 Y 1 A HIS 121 ? A HIS 9  
10 1 Y 1 A HIS 122 ? A HIS 10 
11 1 Y 1 A SER 123 ? A SER 11 
12 1 Y 1 A SER 124 ? A SER 12 
13 1 Y 1 A GLY 125 ? A GLY 13 
14 1 Y 1 A LEU 126 ? A LEU 14 
15 1 Y 1 A VAL 127 ? A VAL 15 
16 1 Y 1 A PRO 128 ? A PRO 16 
17 1 Y 1 A ARG 129 ? A ARG 17 
18 1 Y 1 A GLY 130 ? A GLY 18 
19 1 Y 1 A SER 131 ? A SER 19 
20 1 Y 1 A PRO 132 ? A PRO 20 
21 1 Y 1 A ARG 133 ? A ARG 21 
22 1 Y 1 A ASP 161 ? A ASP 49 
23 1 Y 1 A THR 162 ? A THR 50 
24 1 Y 1 A PHE 163 ? A PHE 51 
25 1 Y 1 A CYS 164 ? A CYS 52 
26 1 Y 1 A GLU 165 ? A GLU 53 
27 1 Y 1 A ALA 166 ? A ALA 54 
28 1 Y 1 A CYS 167 ? A CYS 55 
29 1 Y 1 A LYS 168 ? A LYS 56 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 'CALCIUM ION'              CA  
4 "GUANOSINE-5'-DIPHOSPHATE" GDP 
5 'UNKNOWN ATOM OR ION'      UNX 
6 water                      HOH 
#