data_2IPG
# 
_entry.id   2IPG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.304 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IPG         
RCSB  RCSB039853   
WWPDB D_1000039853 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2IPJ . unspecified 
PDB 2IPF . unspecified 
# 
_pdbx_database_status.entry_id                        2IPG 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-12 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Faucher, F.'               1 
'Cantin, L.'                2 
'Pereira de Jesus-Tran, K.' 3 
'Lemieux, M.'               4 
'Luu-the, V.'               5 
'Labrie, F.'                6 
'Breton, R.'                7 
# 
_citation.id                        primary 
_citation.title                     
;Mouse 17alpha-Hydroxysteroid Dehydrogenase (AKR1C21) Binds Steroids Differently from other Aldo-keto Reductases: Identification and Characterization of Amino Acid Residues Critical for Substrate Binding.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            369 
_citation.page_first                525 
_citation.page_last                 540 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17442338 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.03.058 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Faucher, F.'               1 ? 
primary 'Cantin, L.'                2 ? 
primary 'Pereira de Jesus-Tran, K.' 3 ? 
primary 'Lemieux, M.'               4 ? 
primary 'Luu-The, V.'               5 ? 
primary 'Labrie, F.'                6 ? 
primary 'Breton, R.'                7 ? 
# 
_cell.entry_id           2IPG 
_cell.length_a           74.030 
_cell.length_b           53.340 
_cell.length_c           85.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.46 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2IPG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '3(17)alpha-hydroxysteroid dehydrogenase'                       36404.930 2   1.1.1.-,1.1.1.209 K31A ? ? 
2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE'              743.405   2   ?                 K31A ? ? 
3 non-polymer syn '(10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE' 288.424   2   ?                 ?    ? ? 
4 non-polymer syn BETA-MERCAPTOETHANOL                                            78.133    4   ?                 ?    ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                  62.068    3   ?                 ?    ? ? 
6 water       nat water                                                           18.015    481 ?                 ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CHCVILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRREDIFYTSK
VWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIG
VSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSM
AKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDEY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CHCVILNDGNFIPVLGFGTALPLECPASKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRREDIFYTSK
VWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIG
VSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSM
AKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDEY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   HIS n 
1 3   CYS n 
1 4   VAL n 
1 5   ILE n 
1 6   LEU n 
1 7   ASN n 
1 8   ASP n 
1 9   GLY n 
1 10  ASN n 
1 11  PHE n 
1 12  ILE n 
1 13  PRO n 
1 14  VAL n 
1 15  LEU n 
1 16  GLY n 
1 17  PHE n 
1 18  GLY n 
1 19  THR n 
1 20  ALA n 
1 21  LEU n 
1 22  PRO n 
1 23  LEU n 
1 24  GLU n 
1 25  CYS n 
1 26  PRO n 
1 27  ALA n 
1 28  SER n 
1 29  LYS n 
1 30  ALA n 
1 31  LYS n 
1 32  GLU n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  ILE n 
1 37  ALA n 
1 38  ILE n 
1 39  ASP n 
1 40  ALA n 
1 41  GLY n 
1 42  PHE n 
1 43  HIS n 
1 44  HIS n 
1 45  PHE n 
1 46  ASP n 
1 47  SER n 
1 48  ALA n 
1 49  SER n 
1 50  VAL n 
1 51  TYR n 
1 52  ASN n 
1 53  THR n 
1 54  GLU n 
1 55  ASP n 
1 56  HIS n 
1 57  VAL n 
1 58  GLY n 
1 59  GLU n 
1 60  ALA n 
1 61  ILE n 
1 62  ARG n 
1 63  SER n 
1 64  LYS n 
1 65  ILE n 
1 66  ALA n 
1 67  ASP n 
1 68  GLY n 
1 69  THR n 
1 70  VAL n 
1 71  ARG n 
1 72  ARG n 
1 73  GLU n 
1 74  ASP n 
1 75  ILE n 
1 76  PHE n 
1 77  TYR n 
1 78  THR n 
1 79  SER n 
1 80  LYS n 
1 81  VAL n 
1 82  TRP n 
1 83  CYS n 
1 84  THR n 
1 85  SER n 
1 86  LEU n 
1 87  HIS n 
1 88  PRO n 
1 89  GLU n 
1 90  LEU n 
1 91  VAL n 
1 92  ARG n 
1 93  ALA n 
1 94  SER n 
1 95  LEU n 
1 96  GLU n 
1 97  ARG n 
1 98  SER n 
1 99  LEU n 
1 100 GLN n 
1 101 LYS n 
1 102 LEU n 
1 103 GLN n 
1 104 PHE n 
1 105 ASP n 
1 106 TYR n 
1 107 VAL n 
1 108 ASP n 
1 109 LEU n 
1 110 TYR n 
1 111 LEU n 
1 112 ILE n 
1 113 HIS n 
1 114 TYR n 
1 115 PRO n 
1 116 MET n 
1 117 ALA n 
1 118 LEU n 
1 119 LYS n 
1 120 PRO n 
1 121 GLY n 
1 122 GLU n 
1 123 GLU n 
1 124 ASN n 
1 125 PHE n 
1 126 PRO n 
1 127 VAL n 
1 128 ASP n 
1 129 GLU n 
1 130 HIS n 
1 131 GLY n 
1 132 LYS n 
1 133 LEU n 
1 134 ILE n 
1 135 PHE n 
1 136 ASP n 
1 137 ARG n 
1 138 VAL n 
1 139 ASP n 
1 140 LEU n 
1 141 CYS n 
1 142 ALA n 
1 143 THR n 
1 144 TRP n 
1 145 GLU n 
1 146 ALA n 
1 147 MET n 
1 148 GLU n 
1 149 LYS n 
1 150 CYS n 
1 151 LYS n 
1 152 ASP n 
1 153 ALA n 
1 154 GLY n 
1 155 LEU n 
1 156 THR n 
1 157 LYS n 
1 158 SER n 
1 159 ILE n 
1 160 GLY n 
1 161 VAL n 
1 162 SER n 
1 163 ASN n 
1 164 PHE n 
1 165 ASN n 
1 166 TYR n 
1 167 ARG n 
1 168 GLN n 
1 169 LEU n 
1 170 GLU n 
1 171 MET n 
1 172 ILE n 
1 173 LEU n 
1 174 ASN n 
1 175 LYS n 
1 176 PRO n 
1 177 GLY n 
1 178 LEU n 
1 179 LYS n 
1 180 TYR n 
1 181 LYS n 
1 182 PRO n 
1 183 VAL n 
1 184 CYS n 
1 185 ASN n 
1 186 GLN n 
1 187 VAL n 
1 188 GLU n 
1 189 CYS n 
1 190 HIS n 
1 191 PRO n 
1 192 TYR n 
1 193 LEU n 
1 194 ASN n 
1 195 GLN n 
1 196 MET n 
1 197 LYS n 
1 198 LEU n 
1 199 LEU n 
1 200 ASP n 
1 201 PHE n 
1 202 CYS n 
1 203 LYS n 
1 204 SER n 
1 205 LYS n 
1 206 ASP n 
1 207 ILE n 
1 208 VAL n 
1 209 LEU n 
1 210 VAL n 
1 211 ALA n 
1 212 TYR n 
1 213 GLY n 
1 214 VAL n 
1 215 LEU n 
1 216 GLY n 
1 217 THR n 
1 218 GLN n 
1 219 ARG n 
1 220 TYR n 
1 221 GLY n 
1 222 GLY n 
1 223 TRP n 
1 224 VAL n 
1 225 ASP n 
1 226 GLN n 
1 227 ASN n 
1 228 SER n 
1 229 PRO n 
1 230 VAL n 
1 231 LEU n 
1 232 LEU n 
1 233 ASP n 
1 234 GLU n 
1 235 PRO n 
1 236 VAL n 
1 237 LEU n 
1 238 GLY n 
1 239 SER n 
1 240 MET n 
1 241 ALA n 
1 242 LYS n 
1 243 LYS n 
1 244 TYR n 
1 245 ASN n 
1 246 ARG n 
1 247 THR n 
1 248 PRO n 
1 249 ALA n 
1 250 LEU n 
1 251 ILE n 
1 252 ALA n 
1 253 LEU n 
1 254 ARG n 
1 255 TYR n 
1 256 GLN n 
1 257 LEU n 
1 258 GLN n 
1 259 ARG n 
1 260 GLY n 
1 261 ILE n 
1 262 VAL n 
1 263 VAL n 
1 264 LEU n 
1 265 ASN n 
1 266 THR n 
1 267 SER n 
1 268 LEU n 
1 269 LYS n 
1 270 GLU n 
1 271 GLU n 
1 272 ARG n 
1 273 ILE n 
1 274 LYS n 
1 275 GLU n 
1 276 ASN n 
1 277 MET n 
1 278 GLN n 
1 279 VAL n 
1 280 PHE n 
1 281 GLU n 
1 282 PHE n 
1 283 GLN n 
1 284 LEU n 
1 285 SER n 
1 286 SER n 
1 287 GLU n 
1 288 ASP n 
1 289 MET n 
1 290 LYS n 
1 291 VAL n 
1 292 LEU n 
1 293 ASP n 
1 294 GLY n 
1 295 LEU n 
1 296 ASN n 
1 297 ARG n 
1 298 ASN n 
1 299 MET n 
1 300 ARG n 
1 301 TYR n 
1 302 ILE n 
1 303 PRO n 
1 304 ALA n 
1 305 ALA n 
1 306 ILE n 
1 307 PHE n 
1 308 LYS n 
1 309 GLY n 
1 310 HIS n 
1 311 PRO n 
1 312 ASN n 
1 313 TRP n 
1 314 PRO n 
1 315 PHE n 
1 316 LEU n 
1 317 ASP n 
1 318 GLU n 
1 319 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   319 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 Akr1c21 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLys' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX1lT 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AK1CL_MOUSE 
_struct_ref.pdbx_db_accession          Q91WR5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CHCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRREDIFYTSK
VWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSIG
VSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSM
AKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDEY
;
_struct_ref.pdbx_align_begin           5 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IPG A 1 ? 319 ? Q91WR5 5 ? 323 ? 5 323 
2 1 2IPG B 1 ? 319 ? Q91WR5 5 ? 323 ? 5 323 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IPG ALA A 27 ? UNP Q91WR5 LYS 31 'engineered mutation' 31 1 
2 2IPG ALA B 27 ? UNP Q91WR5 LYS 31 'engineered mutation' 31 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                         ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                        ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ? 'C4 H7 N O4'        133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL                                            ? 'C2 H6 O S'         78.133  
CYS 'L-peptide linking' y CYSTEINE                                                        ? 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                  'ETHYLENE GLYCOL' 'C2 H6 O2'          
62.068  
FFA non-polymer         . '(10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE' EPI-TESTOSTERONE 'C19 H28 O2'        
288.424 
GLN 'L-peptide linking' y GLUTAMINE                                                       ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                         ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                       ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                           ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                      ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                          ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                      ? 'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE'              
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                         ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                          ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                       ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                          ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2IPG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_details    'PEG-4000 24%, 0.1M MES, O.1M Li2SO4, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' 'RIGAKU RAXIS IIC' 2006-08-06 mirrors 
2 ?             ?                  ?          ?       
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? ?                   x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 'ROTATING ANODE' RIGAKU ? ? ? 1.5418 
2 ?                ?      ? ? ? ?      
# 
_reflns.entry_id                     2IPG 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.56 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   43065 
_reflns.number_all                   45224 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            0.117 
_reflns.pdbx_Rsym_value              0.172 
_reflns.pdbx_netI_over_sigmaI        7.120 
_reflns.B_iso_Wilson_estimate        9.5 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.10 
_reflns_shell.percent_possible_all   92.1 
_reflns_shell.Rmerge_I_obs           0.191 
_reflns_shell.pdbx_Rsym_value        0.262 
_reflns_shell.meanI_over_sigI_obs    4.93 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 2IPG 
_refine.ls_number_reflns_obs                     49676 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1754729.91 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.55 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    94.5 
_refine.ls_R_factor_obs                          0.182 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.214 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2514 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               17.2 
_refine.aniso_B[1][1]                            4.27 
_refine.aniso_B[2][2]                            -1.30 
_refine.aniso_B[3][3]                            -2.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.92 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.337572 
_refine.solvent_model_param_bsol                 43.1045 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2IPF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2IPG 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5114 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         166 
_refine_hist.number_atoms_solvent             481 
_refine_hist.number_atoms_total               5761 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        19.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.79  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.11  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.56  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.78  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.49  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             7568 
_refine_ls_shell.R_factor_R_work                  0.198 
_refine_ls_shell.percent_reflns_obs               91.9 
_refine_ls_shell.R_factor_R_free                  0.232 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             364 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top  'X-RAY DIFFRACTION' 
2 ligands_.param    ligands_.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top    'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 1.0000 0.0000  0.0000 0.0000  1.0000  0.0000  0.0000 0.0000  1.0000  0.0000  0.0000   0.0000   
2 given ? 0.8677 -0.4846 0.1106 -0.4840 -0.8744 -0.0342 0.1132 -0.0239 -0.9933 -9.9137 -12.6378 106.0711 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2IPG 
_struct.title                     
'Crystal structure of 17alpha-hydroxysteroid dehydrogenase mutant K31A in complex with NADP+ and epi-testosterone' 
_struct.pdbx_descriptor           
'Crystal structure of 17alpha-hydroxysteroid dehydrogenase mutant K31A in complex with NADP+ and epi-testosterone' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IPG 
_struct_keywords.text            
'17a-HSD, AKR1C21, AKR, aldo-keto reductase, HSD, hydroxysteroid dehydrogenase, open conformation, epi-testosterone, Oxidoreductase' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 28  ? GLY A 41  ? SER A 32  GLY A 45  1 ? 14 
HELX_P HELX_P2  2  ALA A 48  ? ASN A 52  ? ALA A 52  ASN A 56  5 ? 5  
HELX_P HELX_P3  3  THR A 53  ? ASP A 67  ? THR A 57  ASP A 71  1 ? 15 
HELX_P HELX_P4  4  ARG A 71  ? ILE A 75  ? ARG A 75  ILE A 79  5 ? 5  
HELX_P HELX_P5  5  TRP A 82  ? LEU A 86  ? TRP A 86  LEU A 90  5 ? 5  
HELX_P HELX_P6  6  LEU A 90  ? GLN A 103 ? LEU A 94  GLN A 107 1 ? 14 
HELX_P HELX_P7  7  ASP A 139 ? ALA A 153 ? ASP A 143 ALA A 157 1 ? 15 
HELX_P HELX_P8  8  ASN A 165 ? ASN A 174 ? ASN A 169 ASN A 178 1 ? 10 
HELX_P HELX_P9  9  GLN A 195 ? LYS A 205 ? GLN A 199 LYS A 209 1 ? 11 
HELX_P HELX_P10 10 VAL A 230 ? ASP A 233 ? VAL A 234 ASP A 237 5 ? 4  
HELX_P HELX_P11 11 GLU A 234 ? ASN A 245 ? GLU A 238 ASN A 249 1 ? 12 
HELX_P HELX_P12 12 THR A 247 ? GLN A 258 ? THR A 251 GLN A 262 1 ? 12 
HELX_P HELX_P13 13 LYS A 269 ? MET A 277 ? LYS A 273 MET A 281 1 ? 9  
HELX_P HELX_P14 14 GLN A 278 ? PHE A 282 ? GLN A 282 PHE A 286 5 ? 5  
HELX_P HELX_P15 15 SER A 285 ? GLY A 294 ? SER A 289 GLY A 298 1 ? 10 
HELX_P HELX_P16 16 ALA A 304 ? LYS A 308 ? ALA A 308 LYS A 312 5 ? 5  
HELX_P HELX_P17 17 SER B 28  ? GLY B 41  ? SER B 32  GLY B 45  1 ? 14 
HELX_P HELX_P18 18 ALA B 48  ? ASN B 52  ? ALA B 52  ASN B 56  5 ? 5  
HELX_P HELX_P19 19 THR B 53  ? ASP B 67  ? THR B 57  ASP B 71  1 ? 15 
HELX_P HELX_P20 20 ARG B 71  ? ILE B 75  ? ARG B 75  ILE B 79  5 ? 5  
HELX_P HELX_P21 21 TRP B 82  ? LEU B 86  ? TRP B 86  LEU B 90  5 ? 5  
HELX_P HELX_P22 22 HIS B 87  ? GLU B 89  ? HIS B 91  GLU B 93  5 ? 3  
HELX_P HELX_P23 23 LEU B 90  ? GLN B 103 ? LEU B 94  GLN B 107 1 ? 14 
HELX_P HELX_P24 24 ASP B 139 ? ALA B 153 ? ASP B 143 ALA B 157 1 ? 15 
HELX_P HELX_P25 25 ASN B 165 ? ASN B 174 ? ASN B 169 ASN B 178 1 ? 10 
HELX_P HELX_P26 26 GLN B 195 ? LYS B 205 ? GLN B 199 LYS B 209 1 ? 11 
HELX_P HELX_P27 27 VAL B 230 ? ASP B 233 ? VAL B 234 ASP B 237 5 ? 4  
HELX_P HELX_P28 28 GLU B 234 ? ASN B 245 ? GLU B 238 ASN B 249 1 ? 12 
HELX_P HELX_P29 29 THR B 247 ? GLN B 258 ? THR B 251 GLN B 262 1 ? 12 
HELX_P HELX_P30 30 LYS B 269 ? MET B 277 ? LYS B 273 MET B 281 1 ? 9  
HELX_P HELX_P31 31 GLN B 278 ? PHE B 282 ? GLN B 282 PHE B 286 5 ? 5  
HELX_P HELX_P32 32 SER B 285 ? GLY B 294 ? SER B 289 GLY B 298 1 ? 10 
HELX_P HELX_P33 33 ALA B 304 ? LYS B 308 ? ALA B 308 LYS B 312 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 3 SG ? ? A CYS 5 A CYS 7 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? B CYS 1 SG ? ? ? 1_555 B CYS 3 SG ? ? B CYS 5 B CYS 7 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 9 ? 
C ? 2 ? 
D ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
B 8 9 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? parallel      
D 8 9 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 3   ? ILE A 5   ? CYS A 7   ILE A 9   
A 2 PHE A 11  ? PRO A 13  ? PHE A 15  PRO A 17  
B 1 LEU A 15  ? GLY A 18  ? LEU A 19  GLY A 22  
B 2 HIS A 44  ? ASP A 46  ? HIS A 48  ASP A 50  
B 3 PHE A 76  ? VAL A 81  ? PHE A 80  VAL A 85  
B 4 VAL A 107 ? ILE A 112 ? VAL A 111 ILE A 116 
B 5 THR A 156 ? SER A 162 ? THR A 160 SER A 166 
B 6 CYS A 184 ? GLU A 188 ? CYS A 188 GLU A 192 
B 7 VAL A 208 ? TYR A 212 ? VAL A 212 TYR A 216 
B 8 VAL A 262 ? ASN A 265 ? VAL A 266 ASN A 269 
B 9 LEU A 15  ? GLY A 18  ? LEU A 19  GLY A 22  
C 1 CYS B 3   ? ILE B 5   ? CYS B 7   ILE B 9   
C 2 PHE B 11  ? PRO B 13  ? PHE B 15  PRO B 17  
D 1 LEU B 15  ? GLY B 18  ? LEU B 19  GLY B 22  
D 2 HIS B 44  ? ASP B 46  ? HIS B 48  ASP B 50  
D 3 PHE B 76  ? VAL B 81  ? PHE B 80  VAL B 85  
D 4 VAL B 107 ? ILE B 112 ? VAL B 111 ILE B 116 
D 5 THR B 156 ? SER B 162 ? THR B 160 SER B 166 
D 6 CYS B 184 ? GLU B 188 ? CYS B 188 GLU B 192 
D 7 VAL B 208 ? TYR B 212 ? VAL B 212 TYR B 216 
D 8 VAL B 262 ? ASN B 265 ? VAL B 266 ASN B 269 
D 9 LEU B 15  ? GLY B 18  ? LEU B 19  GLY B 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4   ? N VAL A 8   O ILE A 12  ? O ILE A 16  
B 1 2 N PHE A 17  ? N PHE A 21  O HIS A 44  ? O HIS A 48  
B 2 3 N PHE A 45  ? N PHE A 49  O PHE A 76  ? O PHE A 80  
B 3 4 N VAL A 81  ? N VAL A 85  O LEU A 111 ? O LEU A 115 
B 4 5 N TYR A 110 ? N TYR A 114 O GLY A 160 ? O GLY A 164 
B 5 6 N VAL A 161 ? N VAL A 165 O CYS A 184 ? O CYS A 188 
B 6 7 N ASN A 185 ? N ASN A 189 O VAL A 208 ? O VAL A 212 
B 7 8 N ALA A 211 ? N ALA A 215 O VAL A 262 ? O VAL A 266 
B 8 9 O VAL A 263 ? O VAL A 267 N GLY A 16  ? N GLY A 20  
C 1 2 N VAL B 4   ? N VAL B 8   O ILE B 12  ? O ILE B 16  
D 1 2 N PHE B 17  ? N PHE B 21  O HIS B 44  ? O HIS B 48  
D 2 3 N PHE B 45  ? N PHE B 49  O PHE B 76  ? O PHE B 80  
D 3 4 N VAL B 81  ? N VAL B 85  O LEU B 111 ? O LEU B 115 
D 4 5 N TYR B 110 ? N TYR B 114 O GLY B 160 ? O GLY B 164 
D 5 6 N VAL B 161 ? N VAL B 165 O CYS B 184 ? O CYS B 188 
D 6 7 N VAL B 187 ? N VAL B 191 O VAL B 210 ? O VAL B 214 
D 7 8 N ALA B 211 ? N ALA B 215 O VAL B 262 ? O VAL B 266 
D 8 9 O VAL B 263 ? O VAL B 267 N GLY B 16  ? N GLY B 20  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 37 'BINDING SITE FOR RESIDUE NAP A 1'   
AC2 Software ? ? ? ? 36 'BINDING SITE FOR RESIDUE NAP B 2'   
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FFA A 3'   
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FFA B 4'   
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE BME A 324' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BME A 325' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE BME B 324' 
AC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE BME B 325' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 326' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 326' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 327' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 37 FFA D .   ? FFA A 3   . ? 1_555 ? 
2   AC1 37 GLY A 18  ? GLY A 22  . ? 1_555 ? 
3   AC1 37 THR A 19  ? THR A 23  . ? 1_555 ? 
4   AC1 37 ALA A 20  ? ALA A 24  . ? 1_555 ? 
5   AC1 37 ASP A 46  ? ASP A 50  . ? 1_555 ? 
6   AC1 37 TYR A 51  ? TYR A 55  . ? 1_555 ? 
7   AC1 37 LYS A 80  ? LYS A 84  . ? 1_555 ? 
8   AC1 37 HIS A 113 ? HIS A 117 . ? 1_555 ? 
9   AC1 37 SER A 162 ? SER A 166 . ? 1_555 ? 
10  AC1 37 ASN A 163 ? ASN A 167 . ? 1_555 ? 
11  AC1 37 GLN A 186 ? GLN A 190 . ? 1_555 ? 
12  AC1 37 TYR A 212 ? TYR A 216 . ? 1_555 ? 
13  AC1 37 GLY A 213 ? GLY A 217 . ? 1_555 ? 
14  AC1 37 VAL A 214 ? VAL A 218 . ? 1_555 ? 
15  AC1 37 LEU A 215 ? LEU A 219 . ? 1_555 ? 
16  AC1 37 GLY A 216 ? GLY A 220 . ? 1_555 ? 
17  AC1 37 THR A 217 ? THR A 221 . ? 1_555 ? 
18  AC1 37 GLN A 218 ? GLN A 222 . ? 1_555 ? 
19  AC1 37 TYR A 220 ? TYR A 224 . ? 1_555 ? 
20  AC1 37 LEU A 232 ? LEU A 236 . ? 1_555 ? 
21  AC1 37 ALA A 249 ? ALA A 253 . ? 1_555 ? 
22  AC1 37 ASN A 265 ? ASN A 269 . ? 1_555 ? 
23  AC1 37 THR A 266 ? THR A 270 . ? 1_555 ? 
24  AC1 37 SER A 267 ? SER A 271 . ? 1_555 ? 
25  AC1 37 LEU A 268 ? LEU A 272 . ? 1_555 ? 
26  AC1 37 LYS A 269 ? LYS A 273 . ? 1_555 ? 
27  AC1 37 ARG A 272 ? ARG A 276 . ? 1_555 ? 
28  AC1 37 GLU A 275 ? GLU A 279 . ? 1_555 ? 
29  AC1 37 ASN A 276 ? ASN A 280 . ? 1_555 ? 
30  AC1 37 ILE A 302 ? ILE A 306 . ? 1_555 ? 
31  AC1 37 EDO G .   ? EDO A 326 . ? 1_555 ? 
32  AC1 37 HOH N .   ? HOH A 330 . ? 1_555 ? 
33  AC1 37 HOH N .   ? HOH A 352 . ? 1_555 ? 
34  AC1 37 HOH N .   ? HOH A 354 . ? 1_555 ? 
35  AC1 37 HOH N .   ? HOH A 364 . ? 1_555 ? 
36  AC1 37 HOH N .   ? HOH A 405 . ? 1_555 ? 
37  AC1 37 HOH N .   ? HOH A 407 . ? 1_555 ? 
38  AC2 36 FFA J .   ? FFA B 4   . ? 1_555 ? 
39  AC2 36 GLY B 18  ? GLY B 22  . ? 1_555 ? 
40  AC2 36 THR B 19  ? THR B 23  . ? 1_555 ? 
41  AC2 36 ALA B 20  ? ALA B 24  . ? 1_555 ? 
42  AC2 36 ASP B 46  ? ASP B 50  . ? 1_555 ? 
43  AC2 36 TYR B 51  ? TYR B 55  . ? 1_555 ? 
44  AC2 36 LYS B 80  ? LYS B 84  . ? 1_555 ? 
45  AC2 36 HIS B 113 ? HIS B 117 . ? 1_555 ? 
46  AC2 36 SER B 162 ? SER B 166 . ? 1_555 ? 
47  AC2 36 ASN B 163 ? ASN B 167 . ? 1_555 ? 
48  AC2 36 GLN B 186 ? GLN B 190 . ? 1_555 ? 
49  AC2 36 TYR B 212 ? TYR B 216 . ? 1_555 ? 
50  AC2 36 GLY B 213 ? GLY B 217 . ? 1_555 ? 
51  AC2 36 VAL B 214 ? VAL B 218 . ? 1_555 ? 
52  AC2 36 LEU B 215 ? LEU B 219 . ? 1_555 ? 
53  AC2 36 GLY B 216 ? GLY B 220 . ? 1_555 ? 
54  AC2 36 THR B 217 ? THR B 221 . ? 1_555 ? 
55  AC2 36 GLN B 218 ? GLN B 222 . ? 1_555 ? 
56  AC2 36 TYR B 220 ? TYR B 224 . ? 1_555 ? 
57  AC2 36 LEU B 232 ? LEU B 236 . ? 1_555 ? 
58  AC2 36 ALA B 249 ? ALA B 253 . ? 1_555 ? 
59  AC2 36 ASN B 265 ? ASN B 269 . ? 1_555 ? 
60  AC2 36 THR B 266 ? THR B 270 . ? 1_555 ? 
61  AC2 36 SER B 267 ? SER B 271 . ? 1_555 ? 
62  AC2 36 LEU B 268 ? LEU B 272 . ? 1_555 ? 
63  AC2 36 LYS B 269 ? LYS B 273 . ? 1_555 ? 
64  AC2 36 ARG B 272 ? ARG B 276 . ? 1_555 ? 
65  AC2 36 GLU B 275 ? GLU B 279 . ? 1_555 ? 
66  AC2 36 ASN B 276 ? ASN B 280 . ? 1_555 ? 
67  AC2 36 HOH O .   ? HOH B 327 . ? 1_555 ? 
68  AC2 36 HOH O .   ? HOH B 331 . ? 1_555 ? 
69  AC2 36 HOH O .   ? HOH B 370 . ? 1_555 ? 
70  AC2 36 HOH O .   ? HOH B 381 . ? 1_555 ? 
71  AC2 36 HOH O .   ? HOH B 389 . ? 1_555 ? 
72  AC2 36 HOH O .   ? HOH B 422 . ? 1_555 ? 
73  AC2 36 HOH O .   ? HOH B 461 . ? 1_555 ? 
74  AC3 8  NAP C .   ? NAP A 1   . ? 1_555 ? 
75  AC3 8  LEU A 21  ? LEU A 25  . ? 1_555 ? 
76  AC3 8  LEU A 23  ? LEU A 27  . ? 1_555 ? 
77  AC3 8  TYR A 51  ? TYR A 55  . ? 1_555 ? 
78  AC3 8  HIS A 113 ? HIS A 117 . ? 1_555 ? 
79  AC3 8  TYR A 114 ? TYR A 118 . ? 1_555 ? 
80  AC3 8  PHE A 125 ? PHE A 129 . ? 1_555 ? 
81  AC3 8  TRP A 223 ? TRP A 227 . ? 1_555 ? 
82  AC4 8  NAP I .   ? NAP B 2   . ? 1_555 ? 
83  AC4 8  LEU B 21  ? LEU B 25  . ? 1_555 ? 
84  AC4 8  LEU B 23  ? LEU B 27  . ? 1_555 ? 
85  AC4 8  TYR B 51  ? TYR B 55  . ? 1_555 ? 
86  AC4 8  HIS B 113 ? HIS B 117 . ? 1_555 ? 
87  AC4 8  TYR B 114 ? TYR B 118 . ? 1_555 ? 
88  AC4 8  TYR B 220 ? TYR B 224 . ? 1_555 ? 
89  AC4 8  TRP B 223 ? TRP B 227 . ? 1_555 ? 
90  AC5 1  CYS A 25  ? CYS A 29  . ? 1_555 ? 
91  AC6 4  ASP A 139 ? ASP A 143 . ? 1_555 ? 
92  AC6 4  LEU A 140 ? LEU A 144 . ? 1_555 ? 
93  AC6 4  CYS A 141 ? CYS A 145 . ? 1_555 ? 
94  AC6 4  MET A 171 ? MET A 175 . ? 1_555 ? 
95  AC7 2  GLU B 24  ? GLU B 28  . ? 1_555 ? 
96  AC7 2  CYS B 25  ? CYS B 29  . ? 1_555 ? 
97  AC8 1  CYS B 141 ? CYS B 145 . ? 1_555 ? 
98  AC9 5  NAP C .   ? NAP A 1   . ? 1_555 ? 
99  AC9 5  LYS A 269 ? LYS A 273 . ? 1_555 ? 
100 AC9 5  ARG A 272 ? ARG A 276 . ? 1_555 ? 
101 AC9 5  HOH N .   ? HOH A 352 . ? 1_555 ? 
102 AC9 5  HOH N .   ? HOH A 364 . ? 1_555 ? 
103 BC1 5  ASP B 8   ? ASP B 12  . ? 1_555 ? 
104 BC1 5  TYR B 180 ? TYR B 184 . ? 1_555 ? 
105 BC1 5  LYS B 181 ? LYS B 185 . ? 1_555 ? 
106 BC1 5  HOH O .   ? HOH B 366 . ? 1_555 ? 
107 BC1 5  HOH O .   ? HOH B 491 . ? 1_555 ? 
108 BC2 6  ASP A 8   ? ASP A 12  . ? 1_555 ? 
109 BC2 6  TYR A 180 ? TYR A 184 . ? 1_555 ? 
110 BC2 6  LYS A 181 ? LYS A 185 . ? 1_555 ? 
111 BC2 6  HOH N .   ? HOH A 379 . ? 1_555 ? 
112 BC2 6  HOH N .   ? HOH A 520 . ? 1_555 ? 
113 BC2 6  HOH N .   ? HOH A 552 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IPG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    2IPG 
_atom_sites.fract_transf_matrix[1][1]   0.013508 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000817 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018748 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011770 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 1   ? 5.104   2.557   48.573  0.50 22.92 ? 5   CYS A N   1 
ATOM   2    C CA  . CYS A 1 1   ? 6.261   2.803   47.665  0.50 22.92 ? 5   CYS A CA  1 
ATOM   3    C C   . CYS A 1 1   ? 7.364   1.796   47.942  0.50 22.18 ? 5   CYS A C   1 
ATOM   4    O O   . CYS A 1 1   ? 8.240   2.056   48.766  0.50 22.69 ? 5   CYS A O   1 
ATOM   5    C CB  . CYS A 1 1   ? 6.837   4.208   47.892  0.50 23.14 ? 5   CYS A CB  1 
ATOM   6    S SG  . CYS A 1 1   ? 7.710   5.040   46.509  0.50 24.13 ? 5   CYS A SG  1 
ATOM   7    N N   . HIS A 1 2   ? 7.306   0.635   47.298  1.00 21.86 ? 6   HIS A N   1 
ATOM   8    C CA  . HIS A 1 2   ? 8.380   -0.342  47.450  1.00 20.01 ? 6   HIS A CA  1 
ATOM   9    C C   . HIS A 1 2   ? 9.485   0.386   46.688  1.00 17.22 ? 6   HIS A C   1 
ATOM   10   O O   . HIS A 1 2   ? 9.815   0.020   45.562  1.00 13.03 ? 6   HIS A O   1 
ATOM   11   C CB  . HIS A 1 2   ? 8.041   -1.651  46.730  1.00 22.46 ? 6   HIS A CB  1 
ATOM   12   C CG  . HIS A 1 2   ? 7.321   -2.651  47.579  1.00 25.68 ? 6   HIS A CG  1 
ATOM   13   N ND1 . HIS A 1 2   ? 7.890   -3.227  48.694  1.00 28.19 ? 6   HIS A ND1 1 
ATOM   14   C CD2 . HIS A 1 2   ? 6.093   -3.208  47.453  1.00 27.51 ? 6   HIS A CD2 1 
ATOM   15   C CE1 . HIS A 1 2   ? 7.046   -4.098  49.217  1.00 29.49 ? 6   HIS A CE1 1 
ATOM   16   N NE2 . HIS A 1 2   ? 5.948   -4.105  48.483  1.00 28.61 ? 6   HIS A NE2 1 
ATOM   17   N N   . CYS A 1 3   ? 10.035  1.427   47.305  1.00 17.21 ? 7   CYS A N   1 
ATOM   18   C CA  . CYS A 1 3   ? 11.046  2.256   46.661  1.00 17.40 ? 7   CYS A CA  1 
ATOM   19   C C   . CYS A 1 3   ? 12.317  2.475   47.470  1.00 16.75 ? 7   CYS A C   1 
ATOM   20   O O   . CYS A 1 3   ? 12.368  2.195   48.666  1.00 17.11 ? 7   CYS A O   1 
ATOM   21   C CB  . CYS A 1 3   ? 10.446  3.637   46.348  1.00 20.83 ? 7   CYS A CB  1 
ATOM   22   S SG  . CYS A 1 3   ? 8.813   3.632   45.538  1.00 25.08 ? 7   CYS A SG  1 
ATOM   23   N N   . VAL A 1 4   ? 13.338  2.985   46.789  1.00 14.11 ? 8   VAL A N   1 
ATOM   24   C CA  . VAL A 1 4   ? 14.609  3.327   47.416  1.00 14.61 ? 8   VAL A CA  1 
ATOM   25   C C   . VAL A 1 4   ? 14.853  4.801   47.098  1.00 12.88 ? 8   VAL A C   1 
ATOM   26   O O   . VAL A 1 4   ? 14.251  5.351   46.171  1.00 10.84 ? 8   VAL A O   1 
ATOM   27   C CB  . VAL A 1 4   ? 15.782  2.469   46.885  1.00 15.27 ? 8   VAL A CB  1 
ATOM   28   C CG1 . VAL A 1 4   ? 15.730  1.080   47.507  1.00 16.90 ? 8   VAL A CG1 1 
ATOM   29   C CG2 . VAL A 1 4   ? 15.719  2.366   45.375  1.00 17.27 ? 8   VAL A CG2 1 
ATOM   30   N N   . ILE A 1 5   ? 15.726  5.442   47.866  1.00 11.16 ? 9   ILE A N   1 
ATOM   31   C CA  . ILE A 1 5   ? 16.002  6.861   47.667  1.00 11.80 ? 9   ILE A CA  1 
ATOM   32   C C   . ILE A 1 5   ? 17.286  7.121   46.881  1.00 12.56 ? 9   ILE A C   1 
ATOM   33   O O   . ILE A 1 5   ? 18.365  6.637   47.248  1.00 12.66 ? 9   ILE A O   1 
ATOM   34   C CB  . ILE A 1 5   ? 16.085  7.588   49.026  1.00 11.41 ? 9   ILE A CB  1 
ATOM   35   C CG1 . ILE A 1 5   ? 14.844  7.253   49.858  1.00 11.51 ? 9   ILE A CG1 1 
ATOM   36   C CG2 . ILE A 1 5   ? 16.171  9.103   48.813  1.00 10.37 ? 9   ILE A CG2 1 
ATOM   37   C CD1 . ILE A 1 5   ? 14.875  7.816   51.270  1.00 11.70 ? 9   ILE A CD1 1 
ATOM   38   N N   . LEU A 1 6   ? 17.150  7.882   45.797  1.00 11.77 ? 10  LEU A N   1 
ATOM   39   C CA  . LEU A 1 6   ? 18.266  8.241   44.926  1.00 12.52 ? 10  LEU A CA  1 
ATOM   40   C C   . LEU A 1 6   ? 19.101  9.348   45.576  1.00 13.01 ? 10  LEU A C   1 
ATOM   41   O O   . LEU A 1 6   ? 18.641  10.016  46.505  1.00 13.28 ? 10  LEU A O   1 
ATOM   42   C CB  . LEU A 1 6   ? 17.729  8.706   43.564  1.00 11.45 ? 10  LEU A CB  1 
ATOM   43   C CG  . LEU A 1 6   ? 16.885  7.667   42.805  1.00 11.31 ? 10  LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 6   ? 16.192  8.314   41.610  1.00 9.60  ? 10  LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 6   ? 17.777  6.518   42.348  1.00 10.61 ? 10  LEU A CD2 1 
ATOM   46   N N   . ASN A 1 7   ? 20.323  9.554   45.093  1.00 14.40 ? 11  ASN A N   1 
ATOM   47   C CA  . ASN A 1 7   ? 21.178  10.568  45.698  1.00 15.02 ? 11  ASN A CA  1 
ATOM   48   C C   . ASN A 1 7   ? 20.724  12.017  45.502  1.00 15.48 ? 11  ASN A C   1 
ATOM   49   O O   . ASN A 1 7   ? 21.354  12.936  46.026  1.00 14.81 ? 11  ASN A O   1 
ATOM   50   C CB  . ASN A 1 7   ? 22.638  10.406  45.244  1.00 14.75 ? 11  ASN A CB  1 
ATOM   51   C CG  . ASN A 1 7   ? 22.814  10.537  43.745  1.00 13.92 ? 11  ASN A CG  1 
ATOM   52   O OD1 . ASN A 1 7   ? 22.183  11.373  43.106  1.00 15.90 ? 11  ASN A OD1 1 
ATOM   53   N ND2 . ASN A 1 7   ? 23.697  9.718   43.181  1.00 14.84 ? 11  ASN A ND2 1 
ATOM   54   N N   . ASP A 1 8   ? 19.641  12.234  44.757  1.00 12.54 ? 12  ASP A N   1 
ATOM   55   C CA  . ASP A 1 8   ? 19.140  13.593  44.572  1.00 13.29 ? 12  ASP A CA  1 
ATOM   56   C C   . ASP A 1 8   ? 17.843  13.771  45.360  1.00 14.11 ? 12  ASP A C   1 
ATOM   57   O O   . ASP A 1 8   ? 17.133  14.762  45.200  1.00 13.31 ? 12  ASP A O   1 
ATOM   58   C CB  . ASP A 1 8   ? 18.917  13.920  43.082  1.00 13.04 ? 12  ASP A CB  1 
ATOM   59   C CG  . ASP A 1 8   ? 17.774  13.138  42.468  1.00 12.16 ? 12  ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 8   ? 17.210  12.262  43.152  1.00 11.85 ? 12  ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 8   ? 17.444  13.401  41.291  1.00 12.48 ? 12  ASP A OD2 1 
ATOM   62   N N   . GLY A 1 9   ? 17.538  12.793  46.211  1.00 13.79 ? 13  GLY A N   1 
ATOM   63   C CA  . GLY A 1 9   ? 16.347  12.873  47.038  1.00 14.93 ? 13  GLY A CA  1 
ATOM   64   C C   . GLY A 1 9   ? 15.083  12.242  46.492  1.00 15.52 ? 13  GLY A C   1 
ATOM   65   O O   . GLY A 1 9   ? 14.134  12.018  47.243  1.00 16.10 ? 13  GLY A O   1 
ATOM   66   N N   . ASN A 1 10  ? 15.052  11.951  45.196  1.00 15.57 ? 14  ASN A N   1 
ATOM   67   C CA  . ASN A 1 10  ? 13.860  11.354  44.602  1.00 14.53 ? 14  ASN A CA  1 
ATOM   68   C C   . ASN A 1 10  ? 13.759  9.853   44.856  1.00 14.25 ? 14  ASN A C   1 
ATOM   69   O O   . ASN A 1 10  ? 14.769  9.170   45.060  1.00 13.35 ? 14  ASN A O   1 
ATOM   70   C CB  . ASN A 1 10  ? 13.817  11.648  43.101  1.00 16.07 ? 14  ASN A CB  1 
ATOM   71   C CG  . ASN A 1 10  ? 13.566  13.122  42.806  1.00 21.53 ? 14  ASN A CG  1 
ATOM   72   O OD1 . ASN A 1 10  ? 12.614  13.713  43.318  1.00 21.89 ? 14  ASN A OD1 1 
ATOM   73   N ND2 . ASN A 1 10  ? 14.416  13.718  41.975  1.00 19.78 ? 14  ASN A ND2 1 
ATOM   74   N N   . PHE A 1 11  ? 12.527  9.351   44.854  1.00 13.39 ? 15  PHE A N   1 
ATOM   75   C CA  . PHE A 1 11  ? 12.256  7.939   45.096  1.00 12.83 ? 15  PHE A CA  1 
ATOM   76   C C   . PHE A 1 11  ? 12.043  7.173   43.790  1.00 12.97 ? 15  PHE A C   1 
ATOM   77   O O   . PHE A 1 11  ? 11.476  7.695   42.835  1.00 12.70 ? 15  PHE A O   1 
ATOM   78   C CB  . PHE A 1 11  ? 11.008  7.782   45.976  1.00 17.68 ? 15  PHE A CB  1 
ATOM   79   C CG  . PHE A 1 11  ? 11.186  8.283   47.386  1.00 20.22 ? 15  PHE A CG  1 
ATOM   80   C CD1 . PHE A 1 11  ? 11.437  9.628   47.639  1.00 21.70 ? 15  PHE A CD1 1 
ATOM   81   C CD2 . PHE A 1 11  ? 11.114  7.403   48.461  1.00 20.53 ? 15  PHE A CD2 1 
ATOM   82   C CE1 . PHE A 1 11  ? 11.617  10.091  48.945  1.00 22.71 ? 15  PHE A CE1 1 
ATOM   83   C CE2 . PHE A 1 11  ? 11.292  7.855   49.771  1.00 23.56 ? 15  PHE A CE2 1 
ATOM   84   C CZ  . PHE A 1 11  ? 11.544  9.204   50.011  1.00 21.44 ? 15  PHE A CZ  1 
ATOM   85   N N   . ILE A 1 12  ? 12.494  5.926   43.759  1.00 9.93  ? 16  ILE A N   1 
ATOM   86   C CA  . ILE A 1 12  ? 12.336  5.103   42.573  1.00 9.32  ? 16  ILE A CA  1 
ATOM   87   C C   . ILE A 1 12  ? 11.825  3.721   42.979  1.00 8.06  ? 16  ILE A C   1 
ATOM   88   O O   . ILE A 1 12  ? 12.324  3.126   43.935  1.00 7.32  ? 16  ILE A O   1 
ATOM   89   C CB  . ILE A 1 12  ? 13.683  4.965   41.821  1.00 8.03  ? 16  ILE A CB  1 
ATOM   90   C CG1 . ILE A 1 12  ? 13.484  4.175   40.529  1.00 9.07  ? 16  ILE A CG1 1 
ATOM   91   C CG2 . ILE A 1 12  ? 14.720  4.287   42.717  1.00 8.59  ? 16  ILE A CG2 1 
ATOM   92   C CD1 . ILE A 1 12  ? 14.725  4.119   39.654  1.00 11.68 ? 16  ILE A CD1 1 
ATOM   93   N N   . PRO A 1 13  ? 10.799  3.207   42.280  1.00 8.34  ? 17  PRO A N   1 
ATOM   94   C CA  . PRO A 1 13  ? 10.270  1.877   42.617  1.00 9.64  ? 17  PRO A CA  1 
ATOM   95   C C   . PRO A 1 13  ? 11.353  0.840   42.301  1.00 8.93  ? 17  PRO A C   1 
ATOM   96   O O   . PRO A 1 13  ? 11.963  0.895   41.233  1.00 9.59  ? 17  PRO A O   1 
ATOM   97   C CB  . PRO A 1 13  ? 9.058   1.738   41.695  1.00 8.83  ? 17  PRO A CB  1 
ATOM   98   C CG  . PRO A 1 13  ? 8.628   3.180   41.476  1.00 9.22  ? 17  PRO A CG  1 
ATOM   99   C CD  . PRO A 1 13  ? 9.950   3.875   41.278  1.00 8.99  ? 17  PRO A CD  1 
ATOM   100  N N   . VAL A 1 14  ? 11.575  -0.107  43.209  1.00 8.46  ? 18  VAL A N   1 
ATOM   101  C CA  . VAL A 1 14  ? 12.623  -1.110  43.014  1.00 8.53  ? 18  VAL A CA  1 
ATOM   102  C C   . VAL A 1 14  ? 12.352  -2.140  41.925  1.00 7.78  ? 18  VAL A C   1 
ATOM   103  O O   . VAL A 1 14  ? 13.269  -2.829  41.487  1.00 7.75  ? 18  VAL A O   1 
ATOM   104  C CB  . VAL A 1 14  ? 12.940  -1.857  44.330  1.00 10.33 ? 18  VAL A CB  1 
ATOM   105  C CG1 . VAL A 1 14  ? 13.364  -0.861  45.400  1.00 11.07 ? 18  VAL A CG1 1 
ATOM   106  C CG2 . VAL A 1 14  ? 11.730  -2.663  44.784  1.00 7.61  ? 18  VAL A CG2 1 
ATOM   107  N N   . LEU A 1 15  ? 11.097  -2.252  41.499  1.00 8.41  ? 19  LEU A N   1 
ATOM   108  C CA  . LEU A 1 15  ? 10.718  -3.187  40.445  1.00 7.13  ? 19  LEU A CA  1 
ATOM   109  C C   . LEU A 1 15  ? 10.078  -2.390  39.310  1.00 9.03  ? 19  LEU A C   1 
ATOM   110  O O   . LEU A 1 15  ? 9.061   -1.722  39.502  1.00 9.34  ? 19  LEU A O   1 
ATOM   111  C CB  . LEU A 1 15  ? 9.725   -4.227  40.974  1.00 8.81  ? 19  LEU A CB  1 
ATOM   112  C CG  . LEU A 1 15  ? 9.254   -5.279  39.959  1.00 12.95 ? 19  LEU A CG  1 
ATOM   113  C CD1 . LEU A 1 15  ? 10.420  -6.191  39.593  1.00 13.18 ? 19  LEU A CD1 1 
ATOM   114  C CD2 . LEU A 1 15  ? 8.108   -6.105  40.545  1.00 9.90  ? 19  LEU A CD2 1 
ATOM   115  N N   . GLY A 1 16  ? 10.685  -2.449  38.132  1.00 8.47  ? 20  GLY A N   1 
ATOM   116  C CA  . GLY A 1 16  ? 10.150  -1.712  37.000  1.00 8.84  ? 20  GLY A CA  1 
ATOM   117  C C   . GLY A 1 16  ? 9.854   -2.614  35.825  1.00 7.53  ? 20  GLY A C   1 
ATOM   118  O O   . GLY A 1 16  ? 10.442  -3.688  35.699  1.00 7.50  ? 20  GLY A O   1 
ATOM   119  N N   . PHE A 1 17  ? 8.927   -2.189  34.973  1.00 7.23  ? 21  PHE A N   1 
ATOM   120  C CA  . PHE A 1 17  ? 8.562   -2.963  33.792  1.00 6.29  ? 21  PHE A CA  1 
ATOM   121  C C   . PHE A 1 17  ? 9.241   -2.350  32.565  1.00 7.09  ? 21  PHE A C   1 
ATOM   122  O O   . PHE A 1 17  ? 9.096   -1.154  32.296  1.00 7.02  ? 21  PHE A O   1 
ATOM   123  C CB  . PHE A 1 17  ? 7.041   -2.959  33.593  1.00 8.03  ? 21  PHE A CB  1 
ATOM   124  C CG  . PHE A 1 17  ? 6.581   -3.834  32.459  1.00 9.31  ? 21  PHE A CG  1 
ATOM   125  C CD1 . PHE A 1 17  ? 6.558   -5.217  32.600  1.00 12.62 ? 21  PHE A CD1 1 
ATOM   126  C CD2 . PHE A 1 17  ? 6.219   -3.279  31.237  1.00 11.78 ? 21  PHE A CD2 1 
ATOM   127  C CE1 . PHE A 1 17  ? 6.185   -6.039  31.537  1.00 10.22 ? 21  PHE A CE1 1 
ATOM   128  C CE2 . PHE A 1 17  ? 5.846   -4.090  30.168  1.00 10.62 ? 21  PHE A CE2 1 
ATOM   129  C CZ  . PHE A 1 17  ? 5.830   -5.473  30.319  1.00 12.61 ? 21  PHE A CZ  1 
ATOM   130  N N   . GLY A 1 18  ? 9.988   -3.172  31.832  1.00 6.14  ? 22  GLY A N   1 
ATOM   131  C CA  . GLY A 1 18  ? 10.685  -2.698  30.649  1.00 8.35  ? 22  GLY A CA  1 
ATOM   132  C C   . GLY A 1 18  ? 9.792   -2.730  29.426  1.00 9.52  ? 22  GLY A C   1 
ATOM   133  O O   . GLY A 1 18  ? 9.019   -3.674  29.241  1.00 9.80  ? 22  GLY A O   1 
ATOM   134  N N   . THR A 1 19  ? 9.918   -1.721  28.570  1.00 9.01  ? 23  THR A N   1 
ATOM   135  C CA  . THR A 1 19  ? 9.067   -1.639  27.393  1.00 10.69 ? 23  THR A CA  1 
ATOM   136  C C   . THR A 1 19  ? 9.726   -1.847  26.036  1.00 12.63 ? 23  THR A C   1 
ATOM   137  O O   . THR A 1 19  ? 9.148   -1.505  25.001  1.00 12.84 ? 23  THR A O   1 
ATOM   138  C CB  . THR A 1 19  ? 8.299   -0.308  27.396  1.00 10.16 ? 23  THR A CB  1 
ATOM   139  O OG1 . THR A 1 19  ? 9.224   0.785   27.391  1.00 9.70  ? 23  THR A OG1 1 
ATOM   140  C CG2 . THR A 1 19  ? 7.429   -0.219  28.643  1.00 11.52 ? 23  THR A CG2 1 
ATOM   141  N N   . ALA A 1 20  ? 10.938  -2.391  26.029  1.00 11.23 ? 24  ALA A N   1 
ATOM   142  C CA  . ALA A 1 20  ? 11.607  -2.681  24.769  1.00 13.14 ? 24  ALA A CA  1 
ATOM   143  C C   . ALA A 1 20  ? 11.011  -4.027  24.351  1.00 14.31 ? 24  ALA A C   1 
ATOM   144  O O   . ALA A 1 20  ? 10.784  -4.897  25.195  1.00 14.42 ? 24  ALA A O   1 
ATOM   145  C CB  . ALA A 1 20  ? 13.115  -2.808  24.973  1.00 13.13 ? 24  ALA A CB  1 
ATOM   146  N N   . LEU A 1 21  ? 10.744  -4.199  23.063  1.00 14.00 ? 25  LEU A N   1 
ATOM   147  C CA  . LEU A 1 21  ? 10.164  -5.449  22.585  1.00 15.65 ? 25  LEU A CA  1 
ATOM   148  C C   . LEU A 1 21  ? 10.982  -6.040  21.454  1.00 14.39 ? 25  LEU A C   1 
ATOM   149  O O   . LEU A 1 21  ? 11.661  -5.319  20.730  1.00 14.83 ? 25  LEU A O   1 
ATOM   150  C CB  . LEU A 1 21  ? 8.735   -5.211  22.087  1.00 15.78 ? 25  LEU A CB  1 
ATOM   151  C CG  . LEU A 1 21  ? 7.764   -4.554  23.067  1.00 17.01 ? 25  LEU A CG  1 
ATOM   152  C CD1 . LEU A 1 21  ? 6.441   -4.301  22.363  1.00 19.80 ? 25  LEU A CD1 1 
ATOM   153  C CD2 . LEU A 1 21  ? 7.566   -5.446  24.281  1.00 19.62 ? 25  LEU A CD2 1 
ATOM   154  N N   . PRO A 1 22  ? 10.938  -7.370  21.293  1.00 15.92 ? 26  PRO A N   1 
ATOM   155  C CA  . PRO A 1 22  ? 11.699  -8.003  20.214  1.00 16.21 ? 26  PRO A CA  1 
ATOM   156  C C   . PRO A 1 22  ? 11.272  -7.380  18.888  1.00 18.06 ? 26  PRO A C   1 
ATOM   157  O O   . PRO A 1 22  ? 10.140  -6.916  18.756  1.00 17.04 ? 26  PRO A O   1 
ATOM   158  C CB  . PRO A 1 22  ? 11.289  -9.466  20.319  1.00 17.28 ? 26  PRO A CB  1 
ATOM   159  C CG  . PRO A 1 22  ? 11.055  -9.640  21.783  1.00 17.63 ? 26  PRO A CG  1 
ATOM   160  C CD  . PRO A 1 22  ? 10.289  -8.384  22.144  1.00 16.21 ? 26  PRO A CD  1 
ATOM   161  N N   . LEU A 1 23  ? 12.176  -7.359  17.917  1.00 19.00 ? 27  LEU A N   1 
ATOM   162  C CA  . LEU A 1 23  ? 11.873  -6.783  16.614  1.00 22.49 ? 27  LEU A CA  1 
ATOM   163  C C   . LEU A 1 23  ? 10.660  -7.456  15.977  1.00 22.72 ? 27  LEU A C   1 
ATOM   164  O O   . LEU A 1 23  ? 9.966   -6.851  15.164  1.00 23.76 ? 27  LEU A O   1 
ATOM   165  C CB  . LEU A 1 23  ? 13.082  -6.920  15.681  1.00 24.65 ? 27  LEU A CB  1 
ATOM   166  C CG  . LEU A 1 23  ? 12.915  -6.416  14.241  1.00 26.72 ? 27  LEU A CG  1 
ATOM   167  C CD1 . LEU A 1 23  ? 12.628  -4.922  14.241  1.00 27.42 ? 27  LEU A CD1 1 
ATOM   168  C CD2 . LEU A 1 23  ? 14.178  -6.714  13.449  1.00 28.49 ? 27  LEU A CD2 1 
ATOM   169  N N   . GLU A 1 24  ? 10.404  -8.704  16.358  1.00 23.46 ? 28  GLU A N   1 
ATOM   170  C CA  . GLU A 1 24  ? 9.282   -9.461  15.804  1.00 26.08 ? 28  GLU A CA  1 
ATOM   171  C C   . GLU A 1 24  ? 7.908   -8.994  16.282  1.00 25.08 ? 28  GLU A C   1 
ATOM   172  O O   . GLU A 1 24  ? 6.886   -9.439  15.758  1.00 25.68 ? 28  GLU A O   1 
ATOM   173  C CB  . GLU A 1 24  ? 9.435   -10.951 16.129  1.00 28.11 ? 28  GLU A CB  1 
ATOM   174  C CG  . GLU A 1 24  ? 10.660  -11.620 15.520  1.00 30.55 ? 28  GLU A CG  1 
ATOM   175  C CD  . GLU A 1 24  ? 11.967  -11.070 16.064  1.00 34.14 ? 28  GLU A CD  1 
ATOM   176  O OE1 . GLU A 1 24  ? 12.132  -11.042 17.304  1.00 33.21 ? 28  GLU A OE1 1 
ATOM   177  O OE2 . GLU A 1 24  ? 12.832  -10.673 15.252  1.00 34.68 ? 28  GLU A OE2 1 
ATOM   178  N N   . CYS A 1 25  ? 7.875   -8.105  17.269  1.00 22.56 ? 29  CYS A N   1 
ATOM   179  C CA  . CYS A 1 25  ? 6.605   -7.615  17.804  1.00 21.21 ? 29  CYS A CA  1 
ATOM   180  C C   . CYS A 1 25  ? 6.227   -6.236  17.287  1.00 21.12 ? 29  CYS A C   1 
ATOM   181  O O   . CYS A 1 25  ? 7.084   -5.370  17.116  1.00 19.81 ? 29  CYS A O   1 
ATOM   182  C CB  . CYS A 1 25  ? 6.657   -7.543  19.331  1.00 19.56 ? 29  CYS A CB  1 
ATOM   183  S SG  . CYS A 1 25  ? 7.115   -9.069  20.147  0.80 18.92 ? 29  CYS A SG  1 
ATOM   184  N N   . PRO A 1 26  ? 4.930   -6.015  17.025  1.00 21.67 ? 30  PRO A N   1 
ATOM   185  C CA  . PRO A 1 26  ? 4.506   -4.701  16.538  1.00 22.42 ? 30  PRO A CA  1 
ATOM   186  C C   . PRO A 1 26  ? 4.653   -3.715  17.696  1.00 22.67 ? 30  PRO A C   1 
ATOM   187  O O   . PRO A 1 26  ? 4.381   -4.059  18.847  1.00 21.81 ? 30  PRO A O   1 
ATOM   188  C CB  . PRO A 1 26  ? 3.051   -4.935  16.140  1.00 21.82 ? 30  PRO A CB  1 
ATOM   189  C CG  . PRO A 1 26  ? 2.612   -5.994  17.099  1.00 22.48 ? 30  PRO A CG  1 
ATOM   190  C CD  . PRO A 1 26  ? 3.789   -6.944  17.100  1.00 22.29 ? 30  PRO A CD  1 
ATOM   191  N N   . ALA A 1 27  ? 5.101   -2.502  17.391  1.00 23.50 ? 31  ALA A N   1 
ATOM   192  C CA  . ALA A 1 27  ? 5.309   -1.477  18.406  1.00 24.15 ? 31  ALA A CA  1 
ATOM   193  C C   . ALA A 1 27  ? 4.108   -1.283  19.329  1.00 24.37 ? 31  ALA A C   1 
ATOM   194  O O   . ALA A 1 27  ? 4.264   -1.111  20.539  1.00 24.72 ? 31  ALA A O   1 
ATOM   195  C CB  . ALA A 1 27  ? 5.668   -0.157  17.734  1.00 25.55 ? 31  ALA A CB  1 
ATOM   196  N N   . SER A 1 28  ? 2.912   -1.311  18.752  1.00 23.55 ? 32  SER A N   1 
ATOM   197  C CA  . SER A 1 28  ? 1.678   -1.121  19.508  1.00 21.49 ? 32  SER A CA  1 
ATOM   198  C C   . SER A 1 28  ? 1.523   -2.111  20.655  1.00 20.38 ? 32  SER A C   1 
ATOM   199  O O   . SER A 1 28  ? 0.763   -1.870  21.590  1.00 19.05 ? 32  SER A O   1 
ATOM   200  C CB  . SER A 1 28  ? 0.476   -1.244  18.575  1.00 22.16 ? 32  SER A CB  1 
ATOM   201  O OG  . SER A 1 28  ? 0.454   -2.522  17.971  1.00 22.92 ? 32  SER A OG  1 
ATOM   202  N N   . LYS A 1 29  ? 2.236   -3.229  20.566  1.00 18.59 ? 33  LYS A N   1 
ATOM   203  C CA  . LYS A 1 29  ? 2.193   -4.267  21.589  1.00 18.77 ? 33  LYS A CA  1 
ATOM   204  C C   . LYS A 1 29  ? 2.527   -3.675  22.960  1.00 17.29 ? 33  LYS A C   1 
ATOM   205  O O   . LYS A 1 29  ? 1.994   -4.105  23.982  1.00 16.50 ? 33  LYS A O   1 
ATOM   206  C CB  . LYS A 1 29  ? 3.200   -5.365  21.237  1.00 20.63 ? 33  LYS A CB  1 
ATOM   207  C CG  . LYS A 1 29  ? 3.218   -6.559  22.174  1.00 24.35 ? 33  LYS A CG  1 
ATOM   208  C CD  . LYS A 1 29  ? 1.978   -7.414  22.015  1.00 26.29 ? 33  LYS A CD  1 
ATOM   209  C CE  . LYS A 1 29  ? 2.152   -8.756  22.709  1.00 28.08 ? 33  LYS A CE  1 
ATOM   210  N NZ  . LYS A 1 29  ? 0.947   -9.613  22.548  1.00 29.37 ? 33  LYS A NZ  1 
ATOM   211  N N   . ALA A 1 30  ? 3.407   -2.678  22.971  1.00 15.87 ? 34  ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 3.817   -2.036  24.214  1.00 16.28 ? 34  ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 2.654   -1.376  24.947  1.00 16.88 ? 34  ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? 2.647   -1.317  26.175  1.00 16.80 ? 34  ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? 4.910   -1.005  23.937  1.00 14.85 ? 34  ALA A CB  1 
ATOM   216  N N   . LYS A 1 31  ? 1.672   -0.873  24.202  1.00 17.12 ? 35  LYS A N   1 
ATOM   217  C CA  . LYS A 1 31  ? 0.527   -0.228  24.836  1.00 16.33 ? 35  LYS A CA  1 
ATOM   218  C C   . LYS A 1 31  ? -0.230  -1.219  25.704  1.00 16.08 ? 35  LYS A C   1 
ATOM   219  O O   . LYS A 1 31  ? -0.486  -0.958  26.881  1.00 15.90 ? 35  LYS A O   1 
ATOM   220  C CB  . LYS A 1 31  ? -0.427  0.355   23.786  1.00 18.51 ? 35  LYS A CB  1 
ATOM   221  C CG  . LYS A 1 31  ? -1.657  1.029   24.393  1.00 19.63 ? 35  LYS A CG  1 
ATOM   222  C CD  . LYS A 1 31  ? -2.535  1.710   23.343  1.00 22.60 ? 35  LYS A CD  1 
ATOM   223  C CE  . LYS A 1 31  ? -3.186  0.713   22.389  1.00 23.28 ? 35  LYS A CE  1 
ATOM   224  N NZ  . LYS A 1 31  ? -2.204  -0.003  21.527  0.50 25.51 ? 35  LYS A NZ  1 
ATOM   225  N N   A GLU A 1 32  ? -0.571  -2.358  25.108  0.50 16.06 ? 36  GLU A N   1 
ATOM   226  N N   B GLU A 1 32  ? -0.594  -2.362  25.131  0.50 15.97 ? 36  GLU A N   1 
ATOM   227  C CA  A GLU A 1 32  ? -1.292  -3.430  25.786  0.50 16.17 ? 36  GLU A CA  1 
ATOM   228  C CA  B GLU A 1 32  ? -1.340  -3.362  25.886  0.50 16.02 ? 36  GLU A CA  1 
ATOM   229  C C   A GLU A 1 32  ? -0.542  -3.947  27.011  0.50 15.49 ? 36  GLU A C   1 
ATOM   230  C C   B GLU A 1 32  ? -0.535  -3.933  27.054  0.50 15.30 ? 36  GLU A C   1 
ATOM   231  O O   A GLU A 1 32  ? -1.116  -4.101  28.089  0.50 13.79 ? 36  GLU A O   1 
ATOM   232  O O   B GLU A 1 32  ? -1.073  -4.118  28.146  0.50 13.55 ? 36  GLU A O   1 
ATOM   233  C CB  A GLU A 1 32  ? -1.525  -4.590  24.810  0.50 18.36 ? 36  GLU A CB  1 
ATOM   234  C CB  B GLU A 1 32  ? -1.808  -4.490  24.962  0.50 18.01 ? 36  GLU A CB  1 
ATOM   235  C CG  A GLU A 1 32  ? -1.840  -5.926  25.478  0.50 21.65 ? 36  GLU A CG  1 
ATOM   236  C CG  B GLU A 1 32  ? -2.831  -5.423  25.602  0.50 21.08 ? 36  GLU A CG  1 
ATOM   237  C CD  A GLU A 1 32  ? -1.805  -7.095  24.506  0.50 23.16 ? 36  GLU A CD  1 
ATOM   238  C CD  B GLU A 1 32  ? -4.033  -4.682  26.174  0.50 22.46 ? 36  GLU A CD  1 
ATOM   239  O OE1 A GLU A 1 32  ? -1.869  -8.254  24.968  0.50 24.01 ? 36  GLU A OE1 1 
ATOM   240  O OE1 B GLU A 1 32  ? -4.702  -3.942  25.420  0.50 23.65 ? 36  GLU A OE1 1 
ATOM   241  O OE2 A GLU A 1 32  ? -1.716  -6.857  23.283  0.50 24.09 ? 36  GLU A OE2 1 
ATOM   242  O OE2 B GLU A 1 32  ? -4.310  -4.843  27.382  0.50 22.98 ? 36  GLU A OE2 1 
ATOM   243  N N   . LEU A 1 33  ? 0.747   -4.215  26.833  1.00 14.69 ? 37  LEU A N   1 
ATOM   244  C CA  . LEU A 1 33  ? 1.581   -4.745  27.909  1.00 13.84 ? 37  LEU A CA  1 
ATOM   245  C C   . LEU A 1 33  ? 1.728   -3.748  29.056  1.00 12.79 ? 37  LEU A C   1 
ATOM   246  O O   . LEU A 1 33  ? 1.746   -4.135  30.224  1.00 14.21 ? 37  LEU A O   1 
ATOM   247  C CB  . LEU A 1 33  ? 2.961   -5.133  27.372  1.00 12.23 ? 37  LEU A CB  1 
ATOM   248  C CG  . LEU A 1 33  ? 2.969   -6.261  26.332  1.00 13.81 ? 37  LEU A CG  1 
ATOM   249  C CD1 . LEU A 1 33  ? 4.374   -6.428  25.774  1.00 15.59 ? 37  LEU A CD1 1 
ATOM   250  C CD2 . LEU A 1 33  ? 2.482   -7.564  26.970  1.00 14.46 ? 37  LEU A CD2 1 
ATOM   251  N N   . THR A 1 34  ? 1.828   -2.464  28.730  1.00 12.66 ? 38  THR A N   1 
ATOM   252  C CA  . THR A 1 34  ? 1.965   -1.450  29.768  1.00 12.62 ? 38  THR A CA  1 
ATOM   253  C C   . THR A 1 34  ? 0.689   -1.366  30.607  1.00 14.40 ? 38  THR A C   1 
ATOM   254  O O   . THR A 1 34  ? 0.749   -1.222  31.827  1.00 12.52 ? 38  THR A O   1 
ATOM   255  C CB  . THR A 1 34  ? 2.291   -0.074  29.158  1.00 14.56 ? 38  THR A CB  1 
ATOM   256  O OG1 . THR A 1 34  ? 3.571   -0.135  28.513  1.00 9.43  ? 38  THR A OG1 1 
ATOM   257  C CG2 . THR A 1 34  ? 2.335   0.996   30.235  1.00 12.70 ? 38  THR A CG2 1 
ATOM   258  N N   . LYS A 1 35  ? -0.467  -1.471  29.960  1.00 13.83 ? 39  LYS A N   1 
ATOM   259  C CA  . LYS A 1 35  ? -1.731  -1.418  30.692  1.00 14.23 ? 39  LYS A CA  1 
ATOM   260  C C   . LYS A 1 35  ? -1.830  -2.610  31.640  1.00 12.37 ? 39  LYS A C   1 
ATOM   261  O O   . LYS A 1 35  ? -2.275  -2.477  32.777  1.00 12.75 ? 39  LYS A O   1 
ATOM   262  C CB  . LYS A 1 35  ? -2.921  -1.435  29.725  1.00 14.34 ? 39  LYS A CB  1 
ATOM   263  C CG  . LYS A 1 35  ? -3.122  -0.150  28.941  1.00 14.90 ? 39  LYS A CG  1 
ATOM   264  C CD  . LYS A 1 35  ? -4.334  -0.277  28.020  1.00 17.79 ? 39  LYS A CD  1 
ATOM   265  C CE  . LYS A 1 35  ? -4.585  0.995   27.226  1.00 18.33 ? 39  LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 35  ? -5.720  0.814   26.263  1.00 20.46 ? 39  LYS A NZ  1 
ATOM   267  N N   . ILE A 1 36  ? -1.427  -3.779  31.158  1.00 11.86 ? 40  ILE A N   1 
ATOM   268  C CA  . ILE A 1 36  ? -1.460  -4.985  31.974  1.00 11.44 ? 40  ILE A CA  1 
ATOM   269  C C   . ILE A 1 36  ? -0.536  -4.807  33.176  1.00 11.65 ? 40  ILE A C   1 
ATOM   270  O O   . ILE A 1 36  ? -0.893  -5.160  34.299  1.00 11.44 ? 40  ILE A O   1 
ATOM   271  C CB  . ILE A 1 36  ? -1.018  -6.212  31.153  1.00 11.71 ? 40  ILE A CB  1 
ATOM   272  C CG1 . ILE A 1 36  ? -2.112  -6.567  30.140  1.00 13.40 ? 40  ILE A CG1 1 
ATOM   273  C CG2 . ILE A 1 36  ? -0.734  -7.391  32.078  1.00 13.88 ? 40  ILE A CG2 1 
ATOM   274  C CD1 . ILE A 1 36  ? -1.680  -7.552  29.072  1.00 12.74 ? 40  ILE A CD1 1 
ATOM   275  N N   . ALA A 1 37  ? 0.645   -4.244  32.934  1.00 10.80 ? 41  ALA A N   1 
ATOM   276  C CA  . ALA A 1 37  ? 1.617   -4.008  34.004  1.00 10.65 ? 41  ALA A CA  1 
ATOM   277  C C   . ALA A 1 37  ? 1.029   -3.083  35.065  1.00 10.27 ? 41  ALA A C   1 
ATOM   278  O O   . ALA A 1 37  ? 1.128   -3.355  36.262  1.00 10.61 ? 41  ALA A O   1 
ATOM   279  C CB  . ALA A 1 37  ? 2.887   -3.397  33.431  1.00 9.98  ? 41  ALA A CB  1 
ATOM   280  N N   . ILE A 1 38  ? 0.422   -1.985  34.623  1.00 11.24 ? 42  ILE A N   1 
ATOM   281  C CA  . ILE A 1 38  ? -0.181  -1.037  35.551  1.00 12.38 ? 42  ILE A CA  1 
ATOM   282  C C   . ILE A 1 38  ? -1.245  -1.737  36.396  1.00 11.96 ? 42  ILE A C   1 
ATOM   283  O O   . ILE A 1 38  ? -1.291  -1.565  37.612  1.00 15.25 ? 42  ILE A O   1 
ATOM   284  C CB  . ILE A 1 38  ? -0.812  0.162   34.797  1.00 12.49 ? 42  ILE A CB  1 
ATOM   285  C CG1 . ILE A 1 38  ? 0.294   1.023   34.181  1.00 12.90 ? 42  ILE A CG1 1 
ATOM   286  C CG2 . ILE A 1 38  ? -1.659  1.000   35.755  1.00 11.16 ? 42  ILE A CG2 1 
ATOM   287  C CD1 . ILE A 1 38  ? -0.206  2.153   33.299  1.00 15.63 ? 42  ILE A CD1 1 
ATOM   288  N N   . ASP A 1 39  ? -2.095  -2.533  35.758  1.00 13.85 ? 43  ASP A N   1 
ATOM   289  C CA  . ASP A 1 39  ? -3.135  -3.251  36.494  1.00 13.84 ? 43  ASP A CA  1 
ATOM   290  C C   . ASP A 1 39  ? -2.551  -4.249  37.490  1.00 14.70 ? 43  ASP A C   1 
ATOM   291  O O   . ASP A 1 39  ? -3.171  -4.543  38.506  1.00 14.68 ? 43  ASP A O   1 
ATOM   292  C CB  . ASP A 1 39  ? -4.071  -3.994  35.535  1.00 15.97 ? 43  ASP A CB  1 
ATOM   293  C CG  . ASP A 1 39  ? -5.045  -3.068  34.830  1.00 17.90 ? 43  ASP A CG  1 
ATOM   294  O OD1 . ASP A 1 39  ? -5.093  -1.864  35.172  1.00 19.67 ? 43  ASP A OD1 1 
ATOM   295  O OD2 . ASP A 1 39  ? -5.769  -3.553  33.932  1.00 19.73 ? 43  ASP A OD2 1 
ATOM   296  N N   . ALA A 1 40  ? -1.362  -4.770  37.194  1.00 13.99 ? 44  ALA A N   1 
ATOM   297  C CA  . ALA A 1 40  ? -0.708  -5.740  38.074  1.00 14.98 ? 44  ALA A CA  1 
ATOM   298  C C   . ALA A 1 40  ? 0.023   -5.070  39.236  1.00 15.69 ? 44  ALA A C   1 
ATOM   299  O O   . ALA A 1 40  ? 0.521   -5.746  40.140  1.00 15.11 ? 44  ALA A O   1 
ATOM   300  C CB  . ALA A 1 40  ? 0.267   -6.607  37.267  1.00 13.35 ? 44  ALA A CB  1 
ATOM   301  N N   . GLY A 1 41  ? 0.099   -3.743  39.204  1.00 13.88 ? 45  GLY A N   1 
ATOM   302  C CA  . GLY A 1 41  ? 0.755   -3.022  40.283  1.00 13.82 ? 45  GLY A CA  1 
ATOM   303  C C   . GLY A 1 41  ? 2.080   -2.353  39.955  1.00 14.30 ? 45  GLY A C   1 
ATOM   304  O O   . GLY A 1 41  ? 2.713   -1.770  40.839  1.00 14.92 ? 45  GLY A O   1 
ATOM   305  N N   . PHE A 1 42  ? 2.521   -2.431  38.704  1.00 13.35 ? 46  PHE A N   1 
ATOM   306  C CA  . PHE A 1 42  ? 3.779   -1.794  38.332  1.00 14.60 ? 46  PHE A CA  1 
ATOM   307  C C   . PHE A 1 42  ? 3.617   -0.279  38.257  1.00 14.42 ? 46  PHE A C   1 
ATOM   308  O O   . PHE A 1 42  ? 2.661   0.220   37.667  1.00 15.43 ? 46  PHE A O   1 
ATOM   309  C CB  . PHE A 1 42  ? 4.285   -2.313  36.980  1.00 13.37 ? 46  PHE A CB  1 
ATOM   310  C CG  . PHE A 1 42  ? 4.901   -3.680  37.045  1.00 11.42 ? 46  PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 42  ? 4.115   -4.821  36.936  1.00 14.07 ? 46  PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 42  ? 6.277   -3.826  37.218  1.00 13.25 ? 46  PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 42  ? 4.688   -6.095  36.999  1.00 13.15 ? 46  PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 42  ? 6.861   -5.092  37.284  1.00 13.22 ? 46  PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 42  ? 6.063   -6.228  37.173  1.00 12.73 ? 46  PHE A CZ  1 
ATOM   316  N N   . HIS A 1 43  ? 4.558   0.446   38.854  1.00 15.84 ? 47  HIS A N   1 
ATOM   317  C CA  . HIS A 1 43  ? 4.527   1.907   38.847  1.00 15.02 ? 47  HIS A CA  1 
ATOM   318  C C   . HIS A 1 43  ? 5.787   2.478   38.198  1.00 14.91 ? 47  HIS A C   1 
ATOM   319  O O   . HIS A 1 43  ? 5.875   3.676   37.938  1.00 16.88 ? 47  HIS A O   1 
ATOM   320  C CB  . HIS A 1 43  ? 4.405   2.435   40.278  1.00 19.76 ? 47  HIS A CB  1 
ATOM   321  C CG  . HIS A 1 43  ? 3.085   2.142   40.921  1.00 23.65 ? 47  HIS A CG  1 
ATOM   322  N ND1 . HIS A 1 43  ? 1.925   2.799   40.571  1.00 26.25 ? 47  HIS A ND1 1 
ATOM   323  C CD2 . HIS A 1 43  ? 2.741   1.259   41.888  1.00 25.26 ? 47  HIS A CD2 1 
ATOM   324  C CE1 . HIS A 1 43  ? 0.923   2.333   41.296  1.00 26.03 ? 47  HIS A CE1 1 
ATOM   325  N NE2 . HIS A 1 43  ? 1.391   1.398   42.102  1.00 27.21 ? 47  HIS A NE2 1 
ATOM   326  N N   . HIS A 1 44  ? 6.755   1.609   37.937  1.00 10.59 ? 48  HIS A N   1 
ATOM   327  C CA  . HIS A 1 44  ? 8.019   2.002   37.328  1.00 9.62  ? 48  HIS A CA  1 
ATOM   328  C C   . HIS A 1 44  ? 8.098   1.404   35.924  1.00 8.26  ? 48  HIS A C   1 
ATOM   329  O O   . HIS A 1 44  ? 8.007   0.189   35.754  1.00 10.75 ? 48  HIS A O   1 
ATOM   330  C CB  . HIS A 1 44  ? 9.164   1.494   38.219  1.00 10.14 ? 48  HIS A CB  1 
ATOM   331  C CG  . HIS A 1 44  ? 10.536  1.650   37.634  1.00 9.09  ? 48  HIS A CG  1 
ATOM   332  N ND1 . HIS A 1 44  ? 11.670  1.272   38.319  1.00 9.66  ? 48  HIS A ND1 1 
ATOM   333  C CD2 . HIS A 1 44  ? 10.959  2.116   36.435  1.00 8.84  ? 48  HIS A CD2 1 
ATOM   334  C CE1 . HIS A 1 44  ? 12.734  1.496   37.568  1.00 9.59  ? 48  HIS A CE1 1 
ATOM   335  N NE2 . HIS A 1 44  ? 12.330  2.007   36.419  1.00 10.61 ? 48  HIS A NE2 1 
ATOM   336  N N   . PHE A 1 45  ? 8.248   2.264   34.923  1.00 7.93  ? 49  PHE A N   1 
ATOM   337  C CA  . PHE A 1 45  ? 8.344   1.819   33.536  1.00 7.51  ? 49  PHE A CA  1 
ATOM   338  C C   . PHE A 1 45  ? 9.604   2.330   32.863  1.00 7.84  ? 49  PHE A C   1 
ATOM   339  O O   . PHE A 1 45  ? 9.924   3.511   32.947  1.00 7.70  ? 49  PHE A O   1 
ATOM   340  C CB  . PHE A 1 45  ? 7.113   2.269   32.752  1.00 9.51  ? 49  PHE A CB  1 
ATOM   341  C CG  . PHE A 1 45  ? 5.855   1.597   33.199  1.00 10.08 ? 49  PHE A CG  1 
ATOM   342  C CD1 . PHE A 1 45  ? 5.156   2.064   34.309  1.00 14.26 ? 49  PHE A CD1 1 
ATOM   343  C CD2 . PHE A 1 45  ? 5.429   0.428   32.578  1.00 11.16 ? 49  PHE A CD2 1 
ATOM   344  C CE1 . PHE A 1 45  ? 4.049   1.367   34.801  1.00 14.68 ? 49  PHE A CE1 1 
ATOM   345  C CE2 . PHE A 1 45  ? 4.327   -0.277  33.061  1.00 13.24 ? 49  PHE A CE2 1 
ATOM   346  C CZ  . PHE A 1 45  ? 3.639   0.193   34.174  1.00 13.02 ? 49  PHE A CZ  1 
ATOM   347  N N   . ASP A 1 46  ? 10.311  1.431   32.183  1.00 8.53  ? 50  ASP A N   1 
ATOM   348  C CA  . ASP A 1 46  ? 11.547  1.789   31.503  1.00 9.62  ? 50  ASP A CA  1 
ATOM   349  C C   . ASP A 1 46  ? 11.413  1.782   29.981  1.00 9.40  ? 50  ASP A C   1 
ATOM   350  O O   . ASP A 1 46  ? 10.942  0.812   29.386  1.00 11.76 ? 50  ASP A O   1 
ATOM   351  C CB  . ASP A 1 46  ? 12.669  0.835   31.933  1.00 9.01  ? 50  ASP A CB  1 
ATOM   352  C CG  . ASP A 1 46  ? 14.022  1.240   31.382  1.00 11.12 ? 50  ASP A CG  1 
ATOM   353  O OD1 . ASP A 1 46  ? 14.399  0.764   30.287  1.00 9.72  ? 50  ASP A OD1 1 
ATOM   354  O OD2 . ASP A 1 46  ? 14.708  2.045   32.048  1.00 9.04  ? 50  ASP A OD2 1 
ATOM   355  N N   . SER A 1 47  ? 11.835  2.875   29.356  1.00 8.98  ? 51  SER A N   1 
ATOM   356  C CA  . SER A 1 47  ? 11.775  2.994   27.905  1.00 7.70  ? 51  SER A CA  1 
ATOM   357  C C   . SER A 1 47  ? 12.995  3.760   27.392  1.00 9.34  ? 51  SER A C   1 
ATOM   358  O O   . SER A 1 47  ? 13.926  4.044   28.148  1.00 7.39  ? 51  SER A O   1 
ATOM   359  C CB  . SER A 1 47  ? 10.488  3.711   27.487  1.00 10.24 ? 51  SER A CB  1 
ATOM   360  O OG  . SER A 1 47  ? 10.261  3.563   26.097  1.00 11.37 ? 51  SER A OG  1 
ATOM   361  N N   . ALA A 1 48  ? 12.984  4.085   26.103  1.00 9.02  ? 52  ALA A N   1 
ATOM   362  C CA  . ALA A 1 48  ? 14.076  4.813   25.476  1.00 9.05  ? 52  ALA A CA  1 
ATOM   363  C C   . ALA A 1 48  ? 13.634  5.293   24.102  1.00 11.80 ? 52  ALA A C   1 
ATOM   364  O O   . ALA A 1 48  ? 12.760  4.691   23.477  1.00 11.11 ? 52  ALA A O   1 
ATOM   365  C CB  . ALA A 1 48  ? 15.305  3.908   25.343  1.00 8.48  ? 52  ALA A CB  1 
ATOM   366  N N   . SER A 1 49  ? 14.242  6.370   23.622  1.00 13.12 ? 53  SER A N   1 
ATOM   367  C CA  . SER A 1 49  ? 13.883  6.891   22.309  1.00 16.36 ? 53  SER A CA  1 
ATOM   368  C C   . SER A 1 49  ? 14.150  5.851   21.224  1.00 16.84 ? 53  SER A C   1 
ATOM   369  O O   . SER A 1 49  ? 13.430  5.783   20.225  1.00 16.83 ? 53  SER A O   1 
ATOM   370  C CB  . SER A 1 49  ? 14.680  8.162   21.999  1.00 17.95 ? 53  SER A CB  1 
ATOM   371  O OG  . SER A 1 49  ? 16.048  7.870   21.779  1.00 21.05 ? 53  SER A OG  1 
ATOM   372  N N   . VAL A 1 50  ? 15.179  5.030   21.424  1.00 15.46 ? 54  VAL A N   1 
ATOM   373  C CA  . VAL A 1 50  ? 15.533  4.023   20.429  1.00 15.34 ? 54  VAL A CA  1 
ATOM   374  C C   . VAL A 1 50  ? 14.581  2.825   20.359  1.00 15.19 ? 54  VAL A C   1 
ATOM   375  O O   . VAL A 1 50  ? 14.575  2.095   19.365  1.00 16.53 ? 54  VAL A O   1 
ATOM   376  C CB  . VAL A 1 50  ? 16.986  3.510   20.652  1.00 14.12 ? 54  VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 50  ? 17.024  2.476   21.773  1.00 10.47 ? 54  VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 50  ? 17.539  2.938   19.355  1.00 14.86 ? 54  VAL A CG2 1 
ATOM   379  N N   . TYR A 1 51  ? 13.771  2.622   21.398  1.00 15.49 ? 55  TYR A N   1 
ATOM   380  C CA  . TYR A 1 51  ? 12.835  1.491   21.416  1.00 15.97 ? 55  TYR A CA  1 
ATOM   381  C C   . TYR A 1 51  ? 11.643  1.650   20.478  1.00 18.09 ? 55  TYR A C   1 
ATOM   382  O O   . TYR A 1 51  ? 10.983  0.663   20.139  1.00 19.64 ? 55  TYR A O   1 
ATOM   383  C CB  . TYR A 1 51  ? 12.289  1.256   22.824  1.00 13.16 ? 55  TYR A CB  1 
ATOM   384  C CG  . TYR A 1 51  ? 13.320  0.889   23.863  1.00 9.23  ? 55  TYR A CG  1 
ATOM   385  C CD1 . TYR A 1 51  ? 12.993  0.900   25.216  1.00 10.55 ? 55  TYR A CD1 1 
ATOM   386  C CD2 . TYR A 1 51  ? 14.626  0.556   23.500  1.00 9.17  ? 55  TYR A CD2 1 
ATOM   387  C CE1 . TYR A 1 51  ? 13.938  0.598   26.188  1.00 9.44  ? 55  TYR A CE1 1 
ATOM   388  C CE2 . TYR A 1 51  ? 15.581  0.252   24.465  1.00 8.15  ? 55  TYR A CE2 1 
ATOM   389  C CZ  . TYR A 1 51  ? 15.229  0.279   25.805  1.00 10.56 ? 55  TYR A CZ  1 
ATOM   390  O OH  . TYR A 1 51  ? 16.174  0.020   26.766  1.00 10.37 ? 55  TYR A OH  1 
ATOM   391  N N   . ASN A 1 52  ? 11.359  2.883   20.077  1.00 19.27 ? 56  ASN A N   1 
ATOM   392  C CA  . ASN A 1 52  ? 10.225  3.161   19.194  1.00 23.58 ? 56  ASN A CA  1 
ATOM   393  C C   . ASN A 1 52  ? 8.902   2.733   19.833  1.00 23.42 ? 56  ASN A C   1 
ATOM   394  O O   . ASN A 1 52  ? 7.949   2.371   19.137  1.00 23.56 ? 56  ASN A O   1 
ATOM   395  C CB  . ASN A 1 52  ? 10.398  2.444   17.851  1.00 25.33 ? 56  ASN A CB  1 
ATOM   396  C CG  . ASN A 1 52  ? 11.501  3.051   17.006  0.75 27.50 ? 56  ASN A CG  1 
ATOM   397  O OD1 . ASN A 1 52  ? 11.493  4.251   16.724  0.75 28.65 ? 56  ASN A OD1 1 
ATOM   398  N ND2 . ASN A 1 52  ? 12.455  2.222   16.592  0.75 28.70 ? 56  ASN A ND2 1 
ATOM   399  N N   . THR A 1 53  ? 8.845   2.781   21.159  1.00 21.92 ? 57  THR A N   1 
ATOM   400  C CA  . THR A 1 53  ? 7.637   2.391   21.874  1.00 20.69 ? 57  THR A CA  1 
ATOM   401  C C   . THR A 1 53  ? 7.131   3.469   22.829  1.00 19.50 ? 57  THR A C   1 
ATOM   402  O O   . THR A 1 53  ? 6.073   3.312   23.431  1.00 20.10 ? 57  THR A O   1 
ATOM   403  C CB  . THR A 1 53  ? 7.865   1.103   22.692  1.00 19.08 ? 57  THR A CB  1 
ATOM   404  O OG1 . THR A 1 53  ? 8.989   1.282   23.565  1.00 21.12 ? 57  THR A OG1 1 
ATOM   405  C CG2 . THR A 1 53  ? 8.115   -0.080  21.773  1.00 22.31 ? 57  THR A CG2 1 
ATOM   406  N N   . GLU A 1 54  ? 7.880   4.561   22.962  1.00 19.19 ? 58  GLU A N   1 
ATOM   407  C CA  . GLU A 1 54  ? 7.500   5.640   23.872  1.00 17.96 ? 58  GLU A CA  1 
ATOM   408  C C   . GLU A 1 54  ? 6.085   6.179   23.693  1.00 18.53 ? 58  GLU A C   1 
ATOM   409  O O   . GLU A 1 54  ? 5.356   6.345   24.670  1.00 17.89 ? 58  GLU A O   1 
ATOM   410  C CB  . GLU A 1 54  ? 8.496   6.798   23.775  1.00 18.04 ? 58  GLU A CB  1 
ATOM   411  C CG  . GLU A 1 54  ? 9.852   6.485   24.380  1.00 16.57 ? 58  GLU A CG  1 
ATOM   412  C CD  . GLU A 1 54  ? 10.645  7.736   24.696  1.00 16.66 ? 58  GLU A CD  1 
ATOM   413  O OE1 . GLU A 1 54  ? 11.037  8.444   23.752  1.00 14.60 ? 58  GLU A OE1 1 
ATOM   414  O OE2 . GLU A 1 54  ? 10.869  8.013   25.893  1.00 15.10 ? 58  GLU A OE2 1 
ATOM   415  N N   . ASP A 1 55  ? 5.694   6.465   22.457  1.00 18.60 ? 59  ASP A N   1 
ATOM   416  C CA  . ASP A 1 55  ? 4.352   6.986   22.214  1.00 18.74 ? 59  ASP A CA  1 
ATOM   417  C C   . ASP A 1 55  ? 3.275   5.986   22.647  1.00 18.01 ? 59  ASP A C   1 
ATOM   418  O O   . ASP A 1 55  ? 2.236   6.381   23.179  1.00 18.23 ? 59  ASP A O   1 
ATOM   419  C CB  . ASP A 1 55  ? 4.190   7.366   20.732  1.00 21.01 ? 59  ASP A CB  1 
ATOM   420  C CG  . ASP A 1 55  ? 4.471   6.209   19.790  1.00 22.28 ? 59  ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 55  ? 5.371   5.396   20.080  1.00 23.31 ? 59  ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 55  ? 3.798   6.123   18.742  1.00 25.88 ? 59  ASP A OD2 1 
ATOM   423  N N   . HIS A 1 56  ? 3.529   4.696   22.443  1.00 15.25 ? 60  HIS A N   1 
ATOM   424  C CA  . HIS A 1 56  ? 2.569   3.662   22.827  1.00 16.02 ? 60  HIS A CA  1 
ATOM   425  C C   . HIS A 1 56  ? 2.523   3.488   24.339  1.00 16.31 ? 60  HIS A C   1 
ATOM   426  O O   . HIS A 1 56  ? 1.459   3.263   24.917  1.00 15.18 ? 60  HIS A O   1 
ATOM   427  C CB  . HIS A 1 56  ? 2.927   2.325   22.172  1.00 17.60 ? 60  HIS A CB  1 
ATOM   428  C CG  . HIS A 1 56  ? 2.716   2.307   20.691  1.00 20.80 ? 60  HIS A CG  1 
ATOM   429  N ND1 . HIS A 1 56  ? 1.464   2.395   20.118  1.00 22.13 ? 60  HIS A ND1 1 
ATOM   430  C CD2 . HIS A 1 56  ? 3.596   2.229   19.666  1.00 20.10 ? 60  HIS A CD2 1 
ATOM   431  C CE1 . HIS A 1 56  ? 1.584   2.373   18.802  1.00 22.37 ? 60  HIS A CE1 1 
ATOM   432  N NE2 . HIS A 1 56  ? 2.867   2.273   18.502  1.00 21.31 ? 60  HIS A NE2 1 
ATOM   433  N N   . VAL A 1 57  ? 3.684   3.591   24.976  1.00 14.99 ? 61  VAL A N   1 
ATOM   434  C CA  . VAL A 1 57  ? 3.769   3.456   26.423  1.00 14.50 ? 61  VAL A CA  1 
ATOM   435  C C   . VAL A 1 57  ? 3.124   4.670   27.075  1.00 15.64 ? 61  VAL A C   1 
ATOM   436  O O   . VAL A 1 57  ? 2.422   4.551   28.083  1.00 16.72 ? 61  VAL A O   1 
ATOM   437  C CB  . VAL A 1 57  ? 5.235   3.350   26.884  1.00 12.20 ? 61  VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 57  ? 5.303   3.324   28.401  1.00 12.69 ? 61  VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 57  ? 5.864   2.089   26.303  1.00 12.59 ? 61  VAL A CG2 1 
ATOM   440  N N   . GLY A 1 58  ? 3.370   5.840   26.496  1.00 14.32 ? 62  GLY A N   1 
ATOM   441  C CA  . GLY A 1 58  ? 2.791   7.058   27.030  1.00 17.35 ? 62  GLY A CA  1 
ATOM   442  C C   . GLY A 1 58  ? 1.276   7.010   26.948  1.00 17.15 ? 62  GLY A C   1 
ATOM   443  O O   . GLY A 1 58  ? 0.579   7.459   27.858  1.00 17.61 ? 62  GLY A O   1 
ATOM   444  N N   . GLU A 1 59  ? 0.764   6.452   25.856  1.00 17.77 ? 63  GLU A N   1 
ATOM   445  C CA  . GLU A 1 59  ? -0.678  6.349   25.660  1.00 18.52 ? 63  GLU A CA  1 
ATOM   446  C C   . GLU A 1 59  ? -1.312  5.431   26.700  1.00 18.00 ? 63  GLU A C   1 
ATOM   447  O O   . GLU A 1 59  ? -2.411  5.696   27.186  1.00 17.57 ? 63  GLU A O   1 
ATOM   448  C CB  . GLU A 1 59  ? -0.981  5.833   24.253  1.00 19.61 ? 63  GLU A CB  1 
ATOM   449  C CG  . GLU A 1 59  ? -2.466  5.662   23.959  1.00 22.99 ? 63  GLU A CG  1 
ATOM   450  C CD  . GLU A 1 59  ? -2.728  5.143   22.558  0.50 24.05 ? 63  GLU A CD  1 
ATOM   451  O OE1 . GLU A 1 59  ? -3.912  4.954   22.207  0.50 25.05 ? 63  GLU A OE1 1 
ATOM   452  O OE2 . GLU A 1 59  ? -1.753  4.924   21.807  0.50 24.82 ? 63  GLU A OE2 1 
ATOM   453  N N   . ALA A 1 60  ? -0.623  4.347   27.041  1.00 17.32 ? 64  ALA A N   1 
ATOM   454  C CA  . ALA A 1 60  ? -1.139  3.415   28.035  1.00 15.51 ? 64  ALA A CA  1 
ATOM   455  C C   . ALA A 1 60  ? -1.196  4.102   29.393  1.00 14.55 ? 64  ALA A C   1 
ATOM   456  O O   . ALA A 1 60  ? -2.200  4.015   30.100  1.00 13.69 ? 64  ALA A O   1 
ATOM   457  C CB  . ALA A 1 60  ? -0.250  2.176   28.109  1.00 16.67 ? 64  ALA A CB  1 
ATOM   458  N N   . ILE A 1 61  ? -0.112  4.785   29.755  1.00 13.55 ? 65  ILE A N   1 
ATOM   459  C CA  . ILE A 1 61  ? -0.037  5.491   31.029  1.00 13.57 ? 65  ILE A CA  1 
ATOM   460  C C   . ILE A 1 61  ? -1.092  6.594   31.106  1.00 14.54 ? 65  ILE A C   1 
ATOM   461  O O   . ILE A 1 61  ? -1.823  6.689   32.091  1.00 12.98 ? 65  ILE A O   1 
ATOM   462  C CB  . ILE A 1 61  ? 1.367   6.107   31.247  1.00 14.56 ? 65  ILE A CB  1 
ATOM   463  C CG1 . ILE A 1 61  ? 2.398   4.981   31.404  1.00 14.34 ? 65  ILE A CG1 1 
ATOM   464  C CG2 . ILE A 1 61  ? 1.363   7.003   32.476  1.00 15.92 ? 65  ILE A CG2 1 
ATOM   465  C CD1 . ILE A 1 61  ? 3.829   5.460   31.551  1.00 13.46 ? 65  ILE A CD1 1 
ATOM   466  N N   . ARG A 1 62  ? -1.174  7.423   30.069  1.00 14.51 ? 66  ARG A N   1 
ATOM   467  C CA  . ARG A 1 62  ? -2.160  8.499   30.055  1.00 16.10 ? 66  ARG A CA  1 
ATOM   468  C C   . ARG A 1 62  ? -3.576  7.933   30.094  1.00 16.32 ? 66  ARG A C   1 
ATOM   469  O O   . ARG A 1 62  ? -4.472  8.524   30.697  1.00 17.04 ? 66  ARG A O   1 
ATOM   470  C CB  . ARG A 1 62  ? -1.969  9.387   28.823  1.00 14.63 ? 66  ARG A CB  1 
ATOM   471  C CG  . ARG A 1 62  ? -0.781  10.328  28.952  1.00 16.77 ? 66  ARG A CG  1 
ATOM   472  C CD  . ARG A 1 62  ? -0.666  11.304  27.789  1.00 15.33 ? 66  ARG A CD  1 
ATOM   473  N NE  . ARG A 1 62  ? -0.270  10.647  26.547  1.00 14.58 ? 66  ARG A NE  1 
ATOM   474  C CZ  . ARG A 1 62  ? -1.113  10.277  25.590  1.00 18.31 ? 66  ARG A CZ  1 
ATOM   475  N NH1 . ARG A 1 62  ? -2.416  10.499  25.720  1.00 17.46 ? 66  ARG A NH1 1 
ATOM   476  N NH2 . ARG A 1 62  ? -0.649  9.685   24.499  1.00 18.00 ? 66  ARG A NH2 1 
ATOM   477  N N   . SER A 1 63  ? -3.768  6.777   29.465  1.00 17.28 ? 67  SER A N   1 
ATOM   478  C CA  . SER A 1 63  ? -5.072  6.120   29.446  1.00 17.76 ? 67  SER A CA  1 
ATOM   479  C C   . SER A 1 63  ? -5.452  5.660   30.856  1.00 17.94 ? 67  SER A C   1 
ATOM   480  O O   . SER A 1 63  ? -6.608  5.781   31.277  1.00 15.38 ? 67  SER A O   1 
ATOM   481  C CB  . SER A 1 63  ? -5.037  4.915   28.499  1.00 18.84 ? 67  SER A CB  1 
ATOM   482  O OG  . SER A 1 63  ? -6.269  4.206   28.510  1.00 21.11 ? 67  SER A OG  1 
ATOM   483  N N   . LYS A 1 64  ? -4.472  5.136   31.586  1.00 16.26 ? 68  LYS A N   1 
ATOM   484  C CA  . LYS A 1 64  ? -4.711  4.654   32.938  1.00 15.05 ? 68  LYS A CA  1 
ATOM   485  C C   . LYS A 1 64  ? -4.845  5.787   33.941  1.00 15.12 ? 68  LYS A C   1 
ATOM   486  O O   . LYS A 1 64  ? -5.422  5.609   35.012  1.00 13.37 ? 68  LYS A O   1 
ATOM   487  C CB  . LYS A 1 64  ? -3.599  3.694   33.364  1.00 12.53 ? 68  LYS A CB  1 
ATOM   488  C CG  . LYS A 1 64  ? -3.668  2.349   32.659  1.00 13.90 ? 68  LYS A CG  1 
ATOM   489  C CD  . LYS A 1 64  ? -4.929  1.582   33.039  1.00 13.05 ? 68  LYS A CD  1 
ATOM   490  C CE  . LYS A 1 64  ? -4.993  0.235   32.333  1.00 14.72 ? 68  LYS A CE  1 
ATOM   491  N NZ  . LYS A 1 64  ? -6.156  -0.581  32.791  1.00 14.03 ? 68  LYS A NZ  1 
ATOM   492  N N   . ILE A 1 65  ? -4.305  6.951   33.597  1.00 15.72 ? 69  ILE A N   1 
ATOM   493  C CA  . ILE A 1 65  ? -4.404  8.112   34.469  1.00 16.47 ? 69  ILE A CA  1 
ATOM   494  C C   . ILE A 1 65  ? -5.785  8.706   34.241  1.00 17.52 ? 69  ILE A C   1 
ATOM   495  O O   . ILE A 1 65  ? -6.473  9.107   35.183  1.00 17.27 ? 69  ILE A O   1 
ATOM   496  C CB  . ILE A 1 65  ? -3.348  9.178   34.119  1.00 16.33 ? 69  ILE A CB  1 
ATOM   497  C CG1 . ILE A 1 65  ? -1.952  8.668   34.483  1.00 17.77 ? 69  ILE A CG1 1 
ATOM   498  C CG2 . ILE A 1 65  ? -3.659  10.480  34.861  1.00 17.62 ? 69  ILE A CG2 1 
ATOM   499  C CD1 . ILE A 1 65  ? -0.832  9.605   34.073  1.00 17.23 ? 69  ILE A CD1 1 
ATOM   500  N N   . ALA A 1 66  ? -6.181  8.738   32.974  1.00 18.11 ? 70  ALA A N   1 
ATOM   501  C CA  . ALA A 1 66  ? -7.474  9.273   32.576  1.00 19.33 ? 70  ALA A CA  1 
ATOM   502  C C   . ALA A 1 66  ? -8.655  8.526   33.193  1.00 19.07 ? 70  ALA A C   1 
ATOM   503  O O   . ALA A 1 66  ? -9.581  9.156   33.701  1.00 20.08 ? 70  ALA A O   1 
ATOM   504  C CB  . ALA A 1 66  ? -7.589  9.270   31.057  1.00 20.92 ? 70  ALA A CB  1 
ATOM   505  N N   . ASP A 1 67  ? -8.634  7.194   33.156  1.00 17.86 ? 71  ASP A N   1 
ATOM   506  C CA  . ASP A 1 67  ? -9.740  6.427   33.719  1.00 17.37 ? 71  ASP A CA  1 
ATOM   507  C C   . ASP A 1 67  ? -9.705  6.250   35.234  1.00 16.50 ? 71  ASP A C   1 
ATOM   508  O O   . ASP A 1 67  ? -10.493 5.488   35.787  1.00 16.77 ? 71  ASP A O   1 
ATOM   509  C CB  . ASP A 1 67  ? -9.870  5.053   33.044  0.80 16.53 ? 71  ASP A CB  1 
ATOM   510  C CG  . ASP A 1 67  ? -8.689  4.140   33.315  0.80 13.80 ? 71  ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 67  ? -8.034  4.280   34.368  0.80 11.65 ? 71  ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 67  ? -8.435  3.260   32.470  0.80 14.31 ? 71  ASP A OD2 1 
ATOM   513  N N   . GLY A 1 68  ? -8.789  6.951   35.895  1.00 16.49 ? 72  GLY A N   1 
ATOM   514  C CA  . GLY A 1 68  ? -8.695  6.889   37.346  1.00 16.77 ? 72  GLY A CA  1 
ATOM   515  C C   . GLY A 1 68  ? -7.915  5.763   38.008  1.00 16.48 ? 72  GLY A C   1 
ATOM   516  O O   . GLY A 1 68  ? -7.894  5.678   39.238  1.00 16.23 ? 72  GLY A O   1 
ATOM   517  N N   . THR A 1 69  ? -7.259  4.910   37.225  1.00 16.61 ? 73  THR A N   1 
ATOM   518  C CA  . THR A 1 69  ? -6.504  3.796   37.802  1.00 15.69 ? 73  THR A CA  1 
ATOM   519  C C   . THR A 1 69  ? -5.240  4.227   38.557  1.00 15.56 ? 73  THR A C   1 
ATOM   520  O O   . THR A 1 69  ? -4.946  3.700   39.633  1.00 14.57 ? 73  THR A O   1 
ATOM   521  C CB  . THR A 1 69  ? -6.102  2.765   36.715  1.00 15.85 ? 73  THR A CB  1 
ATOM   522  O OG1 . THR A 1 69  ? -7.277  2.251   36.078  1.00 15.50 ? 73  THR A OG1 1 
ATOM   523  C CG2 . THR A 1 69  ? -5.336  1.600   37.337  1.00 16.29 ? 73  THR A CG2 1 
ATOM   524  N N   . VAL A 1 70  ? -4.502  5.187   38.007  1.00 12.72 ? 74  VAL A N   1 
ATOM   525  C CA  . VAL A 1 70  ? -3.268  5.648   38.644  1.00 14.47 ? 74  VAL A CA  1 
ATOM   526  C C   . VAL A 1 70  ? -3.032  7.148   38.436  1.00 15.81 ? 74  VAL A C   1 
ATOM   527  O O   . VAL A 1 70  ? -3.625  7.757   37.545  1.00 15.97 ? 74  VAL A O   1 
ATOM   528  C CB  . VAL A 1 70  ? -2.052  4.858   38.087  1.00 14.92 ? 74  VAL A CB  1 
ATOM   529  C CG1 . VAL A 1 70  ? -1.821  5.232   36.632  1.00 14.69 ? 74  VAL A CG1 1 
ATOM   530  C CG2 . VAL A 1 70  ? -0.811  5.124   38.928  1.00 17.75 ? 74  VAL A CG2 1 
ATOM   531  N N   . ARG A 1 71  ? -2.172  7.736   39.269  1.00 16.19 ? 75  ARG A N   1 
ATOM   532  C CA  . ARG A 1 71  ? -1.837  9.160   39.187  1.00 17.33 ? 75  ARG A CA  1 
ATOM   533  C C   . ARG A 1 71  ? -0.441  9.324   38.583  1.00 17.27 ? 75  ARG A C   1 
ATOM   534  O O   . ARG A 1 71  ? 0.418   8.461   38.761  1.00 16.58 ? 75  ARG A O   1 
ATOM   535  C CB  . ARG A 1 71  ? -1.839  9.792   40.584  0.75 19.21 ? 75  ARG A CB  1 
ATOM   536  C CG  . ARG A 1 71  ? -3.180  9.785   41.312  0.75 24.76 ? 75  ARG A CG  1 
ATOM   537  C CD  . ARG A 1 71  ? -3.991  11.031  41.001  0.75 27.11 ? 75  ARG A CD  1 
ATOM   538  N NE  . ARG A 1 71  ? -4.488  11.038  39.630  0.75 32.55 ? 75  ARG A NE  1 
ATOM   539  C CZ  . ARG A 1 71  ? -5.176  12.039  39.088  0.75 33.38 ? 75  ARG A CZ  1 
ATOM   540  N NH1 . ARG A 1 71  ? -5.449  13.124  39.802  0.75 33.01 ? 75  ARG A NH1 1 
ATOM   541  N NH2 . ARG A 1 71  ? -5.589  11.952  37.831  0.75 33.24 ? 75  ARG A NH2 1 
ATOM   542  N N   . ARG A 1 72  ? -0.208  10.433  37.885  1.00 15.14 ? 76  ARG A N   1 
ATOM   543  C CA  . ARG A 1 72  ? 1.098   10.674  37.285  1.00 15.55 ? 76  ARG A CA  1 
ATOM   544  C C   . ARG A 1 72  ? 2.206   10.664  38.337  1.00 15.93 ? 76  ARG A C   1 
ATOM   545  O O   . ARG A 1 72  ? 3.267   10.087  38.112  1.00 16.82 ? 76  ARG A O   1 
ATOM   546  C CB  . ARG A 1 72  ? 1.125   12.016  36.548  1.00 14.79 ? 76  ARG A CB  1 
ATOM   547  C CG  . ARG A 1 72  ? 2.501   12.366  35.968  1.00 16.17 ? 76  ARG A CG  1 
ATOM   548  C CD  . ARG A 1 72  ? 2.879   11.454  34.797  1.00 15.87 ? 76  ARG A CD  1 
ATOM   549  N NE  . ARG A 1 72  ? 4.254   11.667  34.339  1.00 14.83 ? 76  ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 72  ? 5.324   11.067  34.859  1.00 17.04 ? 76  ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 72  ? 5.186   10.207  35.861  1.00 14.77 ? 76  ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 72  ? 6.535   11.324  34.376  1.00 15.96 ? 76  ARG A NH2 1 
ATOM   553  N N   . GLU A 1 73  ? 1.966   11.299  39.483  1.00 16.41 ? 77  GLU A N   1 
ATOM   554  C CA  . GLU A 1 73  ? 2.985   11.343  40.528  1.00 17.89 ? 77  GLU A CA  1 
ATOM   555  C C   . GLU A 1 73  ? 3.304   9.966   41.098  1.00 17.54 ? 77  GLU A C   1 
ATOM   556  O O   . GLU A 1 73  ? 4.326   9.787   41.762  1.00 18.11 ? 77  GLU A O   1 
ATOM   557  C CB  . GLU A 1 73  ? 2.576   12.291  41.667  1.00 19.04 ? 77  GLU A CB  1 
ATOM   558  C CG  . GLU A 1 73  ? 1.245   11.985  42.348  1.00 21.54 ? 77  GLU A CG  1 
ATOM   559  C CD  . GLU A 1 73  ? 0.050   12.526  41.584  0.50 20.75 ? 77  GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 73  ? -1.068  12.509  42.143  0.50 22.54 ? 77  GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 73  ? 0.224   12.967  40.429  0.50 19.65 ? 77  GLU A OE2 1 
ATOM   562  N N   . ASP A 1 74  ? 2.438   8.993   40.837  1.00 16.94 ? 78  ASP A N   1 
ATOM   563  C CA  . ASP A 1 74  ? 2.655   7.640   41.332  1.00 17.98 ? 78  ASP A CA  1 
ATOM   564  C C   . ASP A 1 74  ? 3.376   6.792   40.290  1.00 17.12 ? 78  ASP A C   1 
ATOM   565  O O   . ASP A 1 74  ? 3.760   5.655   40.555  1.00 17.17 ? 78  ASP A O   1 
ATOM   566  C CB  . ASP A 1 74  ? 1.319   7.010   41.722  1.00 20.84 ? 78  ASP A CB  1 
ATOM   567  C CG  . ASP A 1 74  ? 0.739   7.626   42.986  1.00 24.68 ? 78  ASP A CG  1 
ATOM   568  O OD1 . ASP A 1 74  ? -0.484  7.533   43.193  1.00 27.19 ? 78  ASP A OD1 1 
ATOM   569  O OD2 . ASP A 1 74  ? 1.515   8.201   43.780  1.00 28.35 ? 78  ASP A OD2 1 
ATOM   570  N N   . ILE A 1 75  ? 3.568   7.365   39.108  1.00 15.91 ? 79  ILE A N   1 
ATOM   571  C CA  . ILE A 1 75  ? 4.263   6.681   38.022  1.00 14.30 ? 79  ILE A CA  1 
ATOM   572  C C   . ILE A 1 75  ? 5.709   7.173   37.923  1.00 13.51 ? 79  ILE A C   1 
ATOM   573  O O   . ILE A 1 75  ? 5.978   8.368   38.052  1.00 12.26 ? 79  ILE A O   1 
ATOM   574  C CB  . ILE A 1 75  ? 3.582   6.952   36.657  1.00 14.98 ? 79  ILE A CB  1 
ATOM   575  C CG1 . ILE A 1 75  ? 2.199   6.298   36.613  1.00 13.47 ? 79  ILE A CG1 1 
ATOM   576  C CG2 . ILE A 1 75  ? 4.469   6.461   35.521  1.00 14.18 ? 79  ILE A CG2 1 
ATOM   577  C CD1 . ILE A 1 75  ? 2.222   4.783   36.709  1.00 17.03 ? 79  ILE A CD1 1 
ATOM   578  N N   . PHE A 1 76  ? 6.635   6.247   37.704  1.00 10.46 ? 80  PHE A N   1 
ATOM   579  C CA  . PHE A 1 76  ? 8.037   6.604   37.538  1.00 10.60 ? 80  PHE A CA  1 
ATOM   580  C C   . PHE A 1 76  ? 8.389   6.144   36.130  1.00 10.03 ? 80  PHE A C   1 
ATOM   581  O O   . PHE A 1 76  ? 8.439   4.945   35.856  1.00 11.13 ? 80  PHE A O   1 
ATOM   582  C CB  . PHE A 1 76  ? 8.912   5.894   38.577  1.00 9.87  ? 80  PHE A CB  1 
ATOM   583  C CG  . PHE A 1 76  ? 10.350  6.328   38.558  1.00 9.69  ? 80  PHE A CG  1 
ATOM   584  C CD1 . PHE A 1 76  ? 11.187  5.973   37.502  1.00 9.22  ? 80  PHE A CD1 1 
ATOM   585  C CD2 . PHE A 1 76  ? 10.865  7.110   39.588  1.00 8.97  ? 80  PHE A CD2 1 
ATOM   586  C CE1 . PHE A 1 76  ? 12.513  6.392   37.472  1.00 9.39  ? 80  PHE A CE1 1 
ATOM   587  C CE2 . PHE A 1 76  ? 12.192  7.535   39.566  1.00 10.30 ? 80  PHE A CE2 1 
ATOM   588  C CZ  . PHE A 1 76  ? 13.017  7.175   38.505  1.00 9.92  ? 80  PHE A CZ  1 
ATOM   589  N N   . TYR A 1 77  ? 8.605   7.102   35.233  1.00 9.98  ? 81  TYR A N   1 
ATOM   590  C CA  . TYR A 1 77  ? 8.922   6.791   33.844  1.00 8.76  ? 81  TYR A CA  1 
ATOM   591  C C   . TYR A 1 77  ? 10.355  7.179   33.482  1.00 9.72  ? 81  TYR A C   1 
ATOM   592  O O   . TYR A 1 77  ? 10.805  8.287   33.765  1.00 10.49 ? 81  TYR A O   1 
ATOM   593  C CB  . TYR A 1 77  ? 7.939   7.511   32.915  1.00 8.02  ? 81  TYR A CB  1 
ATOM   594  C CG  . TYR A 1 77  ? 8.220   7.313   31.447  1.00 9.04  ? 81  TYR A CG  1 
ATOM   595  C CD1 . TYR A 1 77  ? 7.685   6.229   30.749  1.00 7.25  ? 81  TYR A CD1 1 
ATOM   596  C CD2 . TYR A 1 77  ? 9.053   8.195   30.757  1.00 10.26 ? 81  TYR A CD2 1 
ATOM   597  C CE1 . TYR A 1 77  ? 7.975   6.030   29.400  1.00 9.85  ? 81  TYR A CE1 1 
ATOM   598  C CE2 . TYR A 1 77  ? 9.350   8.001   29.411  1.00 9.71  ? 81  TYR A CE2 1 
ATOM   599  C CZ  . TYR A 1 77  ? 8.810   6.920   28.740  1.00 11.22 ? 81  TYR A CZ  1 
ATOM   600  O OH  . TYR A 1 77  ? 9.115   6.723   27.414  1.00 12.36 ? 81  TYR A OH  1 
ATOM   601  N N   . THR A 1 78  ? 11.061  6.256   32.841  1.00 9.40  ? 82  THR A N   1 
ATOM   602  C CA  . THR A 1 78  ? 12.442  6.484   32.444  1.00 7.78  ? 82  THR A CA  1 
ATOM   603  C C   . THR A 1 78  ? 12.604  6.507   30.933  1.00 8.63  ? 82  THR A C   1 
ATOM   604  O O   . THR A 1 78  ? 12.016  5.688   30.226  1.00 7.24  ? 82  THR A O   1 
ATOM   605  C CB  . THR A 1 78  ? 13.369  5.350   32.973  1.00 9.64  ? 82  THR A CB  1 
ATOM   606  O OG1 . THR A 1 78  ? 13.287  5.283   34.401  1.00 7.65  ? 82  THR A OG1 1 
ATOM   607  C CG2 . THR A 1 78  ? 14.823  5.595   32.551  1.00 6.59  ? 82  THR A CG2 1 
ATOM   608  N N   . SER A 1 79  ? 13.392  7.455   30.438  1.00 9.24  ? 83  SER A N   1 
ATOM   609  C CA  . SER A 1 79  ? 13.688  7.500   29.017  1.00 10.21 ? 83  SER A CA  1 
ATOM   610  C C   . SER A 1 79  ? 15.207  7.582   28.913  1.00 9.22  ? 83  SER A C   1 
ATOM   611  O O   . SER A 1 79  ? 15.893  7.734   29.930  1.00 7.46  ? 83  SER A O   1 
ATOM   612  C CB  . SER A 1 79  ? 13.043  8.701   28.331  1.00 11.98 ? 83  SER A CB  1 
ATOM   613  O OG  . SER A 1 79  ? 13.212  8.573   26.927  1.00 12.52 ? 83  SER A OG  1 
ATOM   614  N N   . LYS A 1 80  ? 15.737  7.486   27.697  1.00 8.77  ? 84  LYS A N   1 
ATOM   615  C CA  . LYS A 1 80  ? 17.184  7.526   27.500  1.00 8.25  ? 84  LYS A CA  1 
ATOM   616  C C   . LYS A 1 80  ? 17.537  8.200   26.180  1.00 9.05  ? 84  LYS A C   1 
ATOM   617  O O   . LYS A 1 80  ? 16.874  7.979   25.172  1.00 8.02  ? 84  LYS A O   1 
ATOM   618  C CB  . LYS A 1 80  ? 17.759  6.102   27.473  1.00 10.00 ? 84  LYS A CB  1 
ATOM   619  C CG  . LYS A 1 80  ? 17.264  5.166   28.571  1.00 7.70  ? 84  LYS A CG  1 
ATOM   620  C CD  . LYS A 1 80  ? 17.966  3.805   28.450  1.00 7.05  ? 84  LYS A CD  1 
ATOM   621  C CE  . LYS A 1 80  ? 17.330  2.733   29.337  1.00 5.73  ? 84  LYS A CE  1 
ATOM   622  N NZ  . LYS A 1 80  ? 16.027  2.206   28.814  1.00 7.69  ? 84  LYS A NZ  1 
ATOM   623  N N   . VAL A 1 81  ? 18.589  9.013   26.189  1.00 8.71  ? 85  VAL A N   1 
ATOM   624  C CA  . VAL A 1 81  ? 19.027  9.679   24.972  1.00 7.67  ? 85  VAL A CA  1 
ATOM   625  C C   . VAL A 1 81  ? 19.945  8.713   24.210  1.00 8.35  ? 85  VAL A C   1 
ATOM   626  O O   . VAL A 1 81  ? 20.896  8.166   24.776  1.00 5.07  ? 85  VAL A O   1 
ATOM   627  C CB  . VAL A 1 81  ? 19.766  11.009  25.299  1.00 7.88  ? 85  VAL A CB  1 
ATOM   628  C CG1 . VAL A 1 81  ? 20.965  10.751  26.204  1.00 5.54  ? 85  VAL A CG1 1 
ATOM   629  C CG2 . VAL A 1 81  ? 20.199  11.702  24.007  1.00 7.93  ? 85  VAL A CG2 1 
ATOM   630  N N   . TRP A 1 82  ? 19.643  8.492   22.933  1.00 8.08  ? 86  TRP A N   1 
ATOM   631  C CA  . TRP A 1 82  ? 20.422  7.572   22.106  1.00 9.93  ? 86  TRP A CA  1 
ATOM   632  C C   . TRP A 1 82  ? 21.761  8.136   21.625  1.00 8.98  ? 86  TRP A C   1 
ATOM   633  O O   . TRP A 1 82  ? 21.998  9.342   21.657  1.00 8.47  ? 86  TRP A O   1 
ATOM   634  C CB  . TRP A 1 82  ? 19.583  7.115   20.904  1.00 9.04  ? 86  TRP A CB  1 
ATOM   635  C CG  . TRP A 1 82  ? 20.235  6.040   20.053  1.00 9.43  ? 86  TRP A CG  1 
ATOM   636  C CD1 . TRP A 1 82  ? 20.515  6.111   18.715  1.00 9.79  ? 86  TRP A CD1 1 
ATOM   637  C CD2 . TRP A 1 82  ? 20.676  4.745   20.485  1.00 8.64  ? 86  TRP A CD2 1 
ATOM   638  N NE1 . TRP A 1 82  ? 21.105  4.942   18.289  1.00 9.10  ? 86  TRP A NE1 1 
ATOM   639  C CE2 . TRP A 1 82  ? 21.216  4.087   19.355  1.00 9.30  ? 86  TRP A CE2 1 
ATOM   640  C CE3 . TRP A 1 82  ? 20.668  4.074   21.719  1.00 7.92  ? 86  TRP A CE3 1 
ATOM   641  C CZ2 . TRP A 1 82  ? 21.743  2.792   19.421  1.00 8.63  ? 86  TRP A CZ2 1 
ATOM   642  C CZ3 . TRP A 1 82  ? 21.193  2.782   21.784  1.00 7.47  ? 86  TRP A CZ3 1 
ATOM   643  C CH2 . TRP A 1 82  ? 21.723  2.158   20.639  1.00 9.18  ? 86  TRP A CH2 1 
ATOM   644  N N   . CYS A 1 83  ? 22.628  7.235   21.169  1.00 8.68  ? 87  CYS A N   1 
ATOM   645  C CA  . CYS A 1 83  ? 23.964  7.563   20.674  1.00 7.23  ? 87  CYS A CA  1 
ATOM   646  C C   . CYS A 1 83  ? 24.037  8.696   19.645  1.00 7.51  ? 87  CYS A C   1 
ATOM   647  O O   . CYS A 1 83  ? 25.019  9.431   19.597  1.00 6.38  ? 87  CYS A O   1 
ATOM   648  C CB  . CYS A 1 83  ? 24.599  6.309   20.060  1.00 7.97  ? 87  CYS A CB  1 
ATOM   649  S SG  . CYS A 1 83  ? 24.529  4.827   21.097  1.00 9.68  ? 87  CYS A SG  1 
ATOM   650  N N   . THR A 1 84  ? 23.008  8.831   18.817  1.00 8.67  ? 88  THR A N   1 
ATOM   651  C CA  . THR A 1 84  ? 23.005  9.857   17.778  1.00 9.26  ? 88  THR A CA  1 
ATOM   652  C C   . THR A 1 84  ? 22.716  11.270  18.271  1.00 10.36 ? 88  THR A C   1 
ATOM   653  O O   . THR A 1 84  ? 22.843  12.231  17.507  1.00 10.87 ? 88  THR A O   1 
ATOM   654  C CB  . THR A 1 84  ? 21.988  9.515   16.673  1.00 8.14  ? 88  THR A CB  1 
ATOM   655  O OG1 . THR A 1 84  ? 20.713  9.250   17.269  1.00 8.74  ? 88  THR A OG1 1 
ATOM   656  C CG2 . THR A 1 84  ? 22.446  8.288   15.883  1.00 8.93  ? 88  THR A CG2 1 
ATOM   657  N N   . SER A 1 85  ? 22.330  11.393  19.539  1.00 10.08 ? 89  SER A N   1 
ATOM   658  C CA  . SER A 1 85  ? 22.027  12.690  20.129  1.00 9.61  ? 89  SER A CA  1 
ATOM   659  C C   . SER A 1 85  ? 22.869  12.997  21.367  1.00 11.10 ? 89  SER A C   1 
ATOM   660  O O   . SER A 1 85  ? 22.415  13.704  22.268  1.00 10.87 ? 89  SER A O   1 
ATOM   661  C CB  . SER A 1 85  ? 20.542  12.779  20.493  1.00 12.16 ? 89  SER A CB  1 
ATOM   662  O OG  . SER A 1 85  ? 19.715  12.774  19.336  1.00 11.78 ? 89  SER A OG  1 
ATOM   663  N N   . LEU A 1 86  ? 24.089  12.471  21.426  1.00 9.61  ? 90  LEU A N   1 
ATOM   664  C CA  . LEU A 1 86  ? 24.936  12.749  22.578  1.00 10.52 ? 90  LEU A CA  1 
ATOM   665  C C   . LEU A 1 86  ? 25.595  14.129  22.493  1.00 12.20 ? 90  LEU A C   1 
ATOM   666  O O   . LEU A 1 86  ? 26.082  14.647  23.499  1.00 11.69 ? 90  LEU A O   1 
ATOM   667  C CB  . LEU A 1 86  ? 25.987  11.646  22.762  1.00 9.14  ? 90  LEU A CB  1 
ATOM   668  C CG  . LEU A 1 86  ? 25.380  10.260  23.035  1.00 8.03  ? 90  LEU A CG  1 
ATOM   669  C CD1 . LEU A 1 86  ? 26.462  9.305   23.526  1.00 6.94  ? 90  LEU A CD1 1 
ATOM   670  C CD2 . LEU A 1 86  ? 24.274  10.378  24.080  1.00 8.10  ? 90  LEU A CD2 1 
ATOM   671  N N   . HIS A 1 87  ? 25.619  14.721  21.298  1.00 13.63 ? 91  HIS A N   1 
ATOM   672  C CA  . HIS A 1 87  ? 26.171  16.072  21.137  1.00 15.76 ? 91  HIS A CA  1 
ATOM   673  C C   . HIS A 1 87  ? 25.444  16.916  22.182  1.00 15.30 ? 91  HIS A C   1 
ATOM   674  O O   . HIS A 1 87  ? 24.222  16.849  22.289  1.00 16.17 ? 91  HIS A O   1 
ATOM   675  C CB  . HIS A 1 87  ? 25.837  16.641  19.752  1.00 16.11 ? 91  HIS A CB  1 
ATOM   676  C CG  . HIS A 1 87  ? 26.911  16.452  18.726  1.00 20.12 ? 91  HIS A CG  1 
ATOM   677  N ND1 . HIS A 1 87  ? 27.544  15.246  18.519  1.00 20.69 ? 91  HIS A ND1 1 
ATOM   678  C CD2 . HIS A 1 87  ? 27.417  17.305  17.804  1.00 21.80 ? 91  HIS A CD2 1 
ATOM   679  C CE1 . HIS A 1 87  ? 28.392  15.363  17.513  1.00 21.71 ? 91  HIS A CE1 1 
ATOM   680  N NE2 . HIS A 1 87  ? 28.334  16.603  17.061  1.00 24.41 ? 91  HIS A NE2 1 
ATOM   681  N N   . PRO A 1 88  ? 26.177  17.725  22.961  1.00 16.84 ? 92  PRO A N   1 
ATOM   682  C CA  . PRO A 1 88  ? 25.524  18.553  23.982  1.00 17.43 ? 92  PRO A CA  1 
ATOM   683  C C   . PRO A 1 88  ? 24.322  19.340  23.466  1.00 18.63 ? 92  PRO A C   1 
ATOM   684  O O   . PRO A 1 88  ? 23.291  19.433  24.134  1.00 19.16 ? 92  PRO A O   1 
ATOM   685  C CB  . PRO A 1 88  ? 26.646  19.479  24.439  1.00 17.38 ? 92  PRO A CB  1 
ATOM   686  C CG  . PRO A 1 88  ? 27.860  18.627  24.283  1.00 18.59 ? 92  PRO A CG  1 
ATOM   687  C CD  . PRO A 1 88  ? 27.628  17.968  22.939  1.00 16.98 ? 92  PRO A CD  1 
ATOM   688  N N   . GLU A 1 89  ? 24.455  19.900  22.269  1.00 18.68 ? 93  GLU A N   1 
ATOM   689  C CA  . GLU A 1 89  ? 23.390  20.708  21.699  1.00 18.42 ? 93  GLU A CA  1 
ATOM   690  C C   . GLU A 1 89  ? 22.205  19.918  21.154  1.00 17.59 ? 93  GLU A C   1 
ATOM   691  O O   . GLU A 1 89  ? 21.237  20.512  20.679  1.00 17.27 ? 93  GLU A O   1 
ATOM   692  C CB  . GLU A 1 89  ? 23.947  21.627  20.598  1.00 19.58 ? 93  GLU A CB  1 
ATOM   693  C CG  . GLU A 1 89  ? 24.212  20.949  19.264  1.00 17.92 ? 93  GLU A CG  1 
ATOM   694  C CD  . GLU A 1 89  ? 25.500  20.151  19.228  0.75 17.95 ? 93  GLU A CD  1 
ATOM   695  O OE1 . GLU A 1 89  ? 26.174  20.026  20.272  0.75 18.91 ? 93  GLU A OE1 1 
ATOM   696  O OE2 . GLU A 1 89  ? 25.839  19.645  18.138  0.75 19.05 ? 93  GLU A OE2 1 
ATOM   697  N N   . LEU A 1 90  ? 22.269  18.590  21.231  1.00 15.28 ? 94  LEU A N   1 
ATOM   698  C CA  . LEU A 1 90  ? 21.177  17.754  20.732  1.00 13.38 ? 94  LEU A CA  1 
ATOM   699  C C   . LEU A 1 90  ? 20.454  16.980  21.837  1.00 13.94 ? 94  LEU A C   1 
ATOM   700  O O   . LEU A 1 90  ? 19.348  16.477  21.627  1.00 13.53 ? 94  LEU A O   1 
ATOM   701  C CB  . LEU A 1 90  ? 21.705  16.772  19.675  1.00 13.51 ? 94  LEU A CB  1 
ATOM   702  C CG  . LEU A 1 90  ? 22.288  17.393  18.400  1.00 12.64 ? 94  LEU A CG  1 
ATOM   703  C CD1 . LEU A 1 90  ? 22.854  16.292  17.507  1.00 14.22 ? 94  LEU A CD1 1 
ATOM   704  C CD2 . LEU A 1 90  ? 21.206  18.174  17.663  1.00 14.20 ? 94  LEU A CD2 1 
ATOM   705  N N   . VAL A 1 91  ? 21.072  16.893  23.013  1.00 13.47 ? 95  VAL A N   1 
ATOM   706  C CA  . VAL A 1 91  ? 20.473  16.171  24.139  1.00 14.05 ? 95  VAL A CA  1 
ATOM   707  C C   . VAL A 1 91  ? 19.054  16.643  24.483  1.00 15.77 ? 95  VAL A C   1 
ATOM   708  O O   . VAL A 1 91  ? 18.117  15.842  24.541  1.00 14.72 ? 95  VAL A O   1 
ATOM   709  C CB  . VAL A 1 91  ? 21.355  16.293  25.410  1.00 13.59 ? 95  VAL A CB  1 
ATOM   710  C CG1 . VAL A 1 91  ? 20.628  15.701  26.615  1.00 15.02 ? 95  VAL A CG1 1 
ATOM   711  C CG2 . VAL A 1 91  ? 22.677  15.575  25.197  1.00 10.88 ? 95  VAL A CG2 1 
ATOM   712  N N   . ARG A 1 92  ? 18.891  17.941  24.716  1.00 16.44 ? 96  ARG A N   1 
ATOM   713  C CA  . ARG A 1 92  ? 17.577  18.467  25.066  1.00 16.39 ? 96  ARG A CA  1 
ATOM   714  C C   . ARG A 1 92  ? 16.535  18.290  23.962  1.00 15.06 ? 96  ARG A C   1 
ATOM   715  O O   . ARG A 1 92  ? 15.376  17.986  24.240  1.00 15.11 ? 96  ARG A O   1 
ATOM   716  C CB  . ARG A 1 92  ? 17.680  19.944  25.451  1.00 17.59 ? 96  ARG A CB  1 
ATOM   717  C CG  . ARG A 1 92  ? 16.363  20.529  25.902  1.00 15.80 ? 96  ARG A CG  1 
ATOM   718  C CD  . ARG A 1 92  ? 16.553  21.853  26.593  1.00 18.43 ? 96  ARG A CD  1 
ATOM   719  N NE  . ARG A 1 92  ? 15.271  22.445  26.950  1.00 19.41 ? 96  ARG A NE  1 
ATOM   720  C CZ  . ARG A 1 92  ? 15.118  23.393  27.865  1.00 17.78 ? 96  ARG A CZ  1 
ATOM   721  N NH1 . ARG A 1 92  ? 16.170  23.861  28.524  1.00 17.25 ? 96  ARG A NH1 1 
ATOM   722  N NH2 . ARG A 1 92  ? 13.909  23.869  28.121  1.00 18.30 ? 96  ARG A NH2 1 
ATOM   723  N N   . ALA A 1 93  ? 16.939  18.483  22.712  1.00 15.39 ? 97  ALA A N   1 
ATOM   724  C CA  . ALA A 1 93  ? 16.014  18.329  21.597  1.00 15.08 ? 97  ALA A CA  1 
ATOM   725  C C   . ALA A 1 93  ? 15.422  16.921  21.603  1.00 15.75 ? 97  ALA A C   1 
ATOM   726  O O   . ALA A 1 93  ? 14.243  16.728  21.293  1.00 13.47 ? 97  ALA A O   1 
ATOM   727  C CB  . ALA A 1 93  ? 16.732  18.593  20.279  1.00 16.42 ? 97  ALA A CB  1 
ATOM   728  N N   . SER A 1 94  ? 16.248  15.940  21.957  1.00 14.29 ? 98  SER A N   1 
ATOM   729  C CA  . SER A 1 94  ? 15.808  14.549  22.003  1.00 14.07 ? 98  SER A CA  1 
ATOM   730  C C   . SER A 1 94  ? 14.819  14.329  23.142  1.00 12.53 ? 98  SER A C   1 
ATOM   731  O O   . SER A 1 94  ? 13.793  13.675  22.960  1.00 14.04 ? 98  SER A O   1 
ATOM   732  C CB  . SER A 1 94  ? 17.008  13.612  22.173  1.00 13.07 ? 98  SER A CB  1 
ATOM   733  O OG  . SER A 1 94  ? 16.583  12.260  22.220  1.00 14.51 ? 98  SER A OG  1 
ATOM   734  N N   . LEU A 1 95  ? 15.124  14.882  24.313  1.00 12.79 ? 99  LEU A N   1 
ATOM   735  C CA  . LEU A 1 95  ? 14.240  14.740  25.469  1.00 13.66 ? 99  LEU A CA  1 
ATOM   736  C C   . LEU A 1 95  ? 12.899  15.408  25.169  1.00 14.85 ? 99  LEU A C   1 
ATOM   737  O O   . LEU A 1 95  ? 11.833  14.861  25.468  1.00 13.06 ? 99  LEU A O   1 
ATOM   738  C CB  . LEU A 1 95  ? 14.883  15.370  26.711  1.00 14.74 ? 99  LEU A CB  1 
ATOM   739  C CG  . LEU A 1 95  ? 14.069  15.405  28.010  1.00 16.28 ? 99  LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 95  ? 13.555  14.010  28.353  1.00 16.65 ? 99  LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 95  ? 14.946  15.951  29.134  1.00 13.21 ? 99  LEU A CD2 1 
ATOM   742  N N   . GLU A 1 96  ? 12.956  16.590  24.565  1.00 14.95 ? 100 GLU A N   1 
ATOM   743  C CA  . GLU A 1 96  ? 11.739  17.311  24.220  1.00 16.54 ? 100 GLU A CA  1 
ATOM   744  C C   . GLU A 1 96  ? 10.912  16.515  23.218  1.00 14.78 ? 100 GLU A C   1 
ATOM   745  O O   . GLU A 1 96  ? 9.685   16.538  23.262  1.00 15.50 ? 100 GLU A O   1 
ATOM   746  C CB  . GLU A 1 96  ? 12.086  18.694  23.657  1.00 18.48 ? 100 GLU A CB  1 
ATOM   747  C CG  . GLU A 1 96  ? 12.822  19.568  24.664  1.00 23.33 ? 100 GLU A CG  1 
ATOM   748  C CD  . GLU A 1 96  ? 13.159  20.945  24.127  1.00 28.10 ? 100 GLU A CD  1 
ATOM   749  O OE1 . GLU A 1 96  ? 13.764  21.031  23.034  1.00 30.60 ? 100 GLU A OE1 1 
ATOM   750  O OE2 . GLU A 1 96  ? 12.829  21.942  24.805  1.00 27.99 ? 100 GLU A OE2 1 
ATOM   751  N N   . ARG A 1 97  ? 11.586  15.800  22.321  1.00 15.31 ? 101 ARG A N   1 
ATOM   752  C CA  . ARG A 1 97  ? 10.897  14.984  21.330  1.00 15.48 ? 101 ARG A CA  1 
ATOM   753  C C   . ARG A 1 97  ? 10.190  13.822  22.031  1.00 13.97 ? 101 ARG A C   1 
ATOM   754  O O   . ARG A 1 97  ? 9.050   13.484  21.707  1.00 11.75 ? 101 ARG A O   1 
ATOM   755  C CB  . ARG A 1 97  ? 11.892  14.435  20.303  1.00 18.42 ? 101 ARG A CB  1 
ATOM   756  C CG  . ARG A 1 97  ? 11.234  13.784  19.095  1.00 21.78 ? 101 ARG A CG  1 
ATOM   757  C CD  . ARG A 1 97  ? 12.272  13.287  18.102  1.00 25.71 ? 101 ARG A CD  1 
ATOM   758  N NE  . ARG A 1 97  ? 11.670  12.843  16.847  0.75 27.02 ? 101 ARG A NE  1 
ATOM   759  C CZ  . ARG A 1 97  ? 12.364  12.414  15.795  0.75 26.89 ? 101 ARG A CZ  1 
ATOM   760  N NH1 . ARG A 1 97  ? 13.688  12.367  15.846  0.75 26.46 ? 101 ARG A NH1 1 
ATOM   761  N NH2 . ARG A 1 97  ? 11.736  12.037  14.689  0.75 26.67 ? 101 ARG A NH2 1 
ATOM   762  N N   . SER A 1 98  ? 10.874  13.204  22.987  1.00 12.70 ? 102 SER A N   1 
ATOM   763  C CA  . SER A 1 98  ? 10.284  12.097  23.730  1.00 13.15 ? 102 SER A CA  1 
ATOM   764  C C   . SER A 1 98  ? 9.059   12.590  24.502  1.00 11.83 ? 102 SER A C   1 
ATOM   765  O O   . SER A 1 98  ? 8.021   11.929  24.531  1.00 13.58 ? 102 SER A O   1 
ATOM   766  C CB  . SER A 1 98  ? 11.306  11.502  24.705  1.00 13.21 ? 102 SER A CB  1 
ATOM   767  O OG  . SER A 1 98  ? 12.275  10.732  24.016  1.00 14.40 ? 102 SER A OG  1 
ATOM   768  N N   . LEU A 1 99  ? 9.178   13.756  25.128  1.00 12.33 ? 103 LEU A N   1 
ATOM   769  C CA  . LEU A 1 99  ? 8.058   14.300  25.880  1.00 13.10 ? 103 LEU A CA  1 
ATOM   770  C C   . LEU A 1 99  ? 6.872   14.536  24.946  1.00 14.02 ? 103 LEU A C   1 
ATOM   771  O O   . LEU A 1 99  ? 5.723   14.312  25.323  1.00 14.23 ? 103 LEU A O   1 
ATOM   772  C CB  . LEU A 1 99  ? 8.473   15.594  26.582  1.00 13.86 ? 103 LEU A CB  1 
ATOM   773  C CG  . LEU A 1 99  ? 9.406   15.367  27.781  1.00 14.40 ? 103 LEU A CG  1 
ATOM   774  C CD1 . LEU A 1 99  ? 9.910   16.694  28.337  1.00 13.22 ? 103 LEU A CD1 1 
ATOM   775  C CD2 . LEU A 1 99  ? 8.652   14.594  28.854  1.00 13.66 ? 103 LEU A CD2 1 
ATOM   776  N N   . GLN A 1 100 ? 7.156   14.969  23.721  1.00 15.10 ? 104 GLN A N   1 
ATOM   777  C CA  . GLN A 1 100 ? 6.105   15.214  22.733  1.00 16.00 ? 104 GLN A CA  1 
ATOM   778  C C   . GLN A 1 100 ? 5.404   13.916  22.351  1.00 17.16 ? 104 GLN A C   1 
ATOM   779  O O   . GLN A 1 100 ? 4.183   13.889  22.179  1.00 17.83 ? 104 GLN A O   1 
ATOM   780  C CB  . GLN A 1 100 ? 6.692   15.862  21.474  1.00 18.91 ? 104 GLN A CB  1 
ATOM   781  C CG  . GLN A 1 100 ? 7.122   17.311  21.654  1.00 23.15 ? 104 GLN A CG  1 
ATOM   782  C CD  . GLN A 1 100 ? 7.778   17.888  20.411  1.00 25.56 ? 104 GLN A CD  1 
ATOM   783  O OE1 . GLN A 1 100 ? 8.054   19.087  20.342  1.00 28.97 ? 104 GLN A OE1 1 
ATOM   784  N NE2 . GLN A 1 100 ? 8.038   17.036  19.424  1.00 26.29 ? 104 GLN A NE2 1 
ATOM   785  N N   . LYS A 1 101 ? 6.179   12.841  22.216  1.00 15.12 ? 105 LYS A N   1 
ATOM   786  C CA  . LYS A 1 101 ? 5.628   11.535  21.856  1.00 16.14 ? 105 LYS A CA  1 
ATOM   787  C C   . LYS A 1 101 ? 4.774   10.985  22.998  1.00 14.44 ? 105 LYS A C   1 
ATOM   788  O O   . LYS A 1 101 ? 3.758   10.332  22.773  1.00 12.06 ? 105 LYS A O   1 
ATOM   789  C CB  . LYS A 1 101 ? 6.758   10.544  21.549  1.00 16.88 ? 105 LYS A CB  1 
ATOM   790  C CG  . LYS A 1 101 ? 7.736   11.009  20.478  0.50 18.88 ? 105 LYS A CG  1 
ATOM   791  C CD  . LYS A 1 101 ? 7.055   11.187  19.131  0.50 21.71 ? 105 LYS A CD  1 
ATOM   792  C CE  . LYS A 1 101 ? 6.604   9.857   18.553  0.50 23.04 ? 105 LYS A CE  1 
ATOM   793  N NZ  . LYS A 1 101 ? 7.764   8.982   18.233  0.50 25.34 ? 105 LYS A NZ  1 
ATOM   794  N N   . LEU A 1 102 ? 5.205   11.264  24.224  1.00 14.85 ? 106 LEU A N   1 
ATOM   795  C CA  . LEU A 1 102 ? 4.523   10.807  25.433  1.00 14.76 ? 106 LEU A CA  1 
ATOM   796  C C   . LEU A 1 102 ? 3.378   11.715  25.850  1.00 15.91 ? 106 LEU A C   1 
ATOM   797  O O   . LEU A 1 102 ? 2.405   11.265  26.459  1.00 14.30 ? 106 LEU A O   1 
ATOM   798  C CB  . LEU A 1 102 ? 5.514   10.763  26.597  1.00 14.16 ? 106 LEU A CB  1 
ATOM   799  C CG  . LEU A 1 102 ? 6.652   9.748   26.560  1.00 11.62 ? 106 LEU A CG  1 
ATOM   800  C CD1 . LEU A 1 102 ? 7.808   10.233  27.427  1.00 12.21 ? 106 LEU A CD1 1 
ATOM   801  C CD2 . LEU A 1 102 ? 6.125   8.404   27.037  1.00 12.96 ? 106 LEU A CD2 1 
ATOM   802  N N   . GLN A 1 103 ? 3.522   12.995  25.525  1.00 16.52 ? 107 GLN A N   1 
ATOM   803  C CA  . GLN A 1 103 ? 2.565   14.016  25.915  1.00 18.82 ? 107 GLN A CA  1 
ATOM   804  C C   . GLN A 1 103 ? 2.640   14.113  27.438  1.00 19.05 ? 107 GLN A C   1 
ATOM   805  O O   . GLN A 1 103 ? 1.626   14.146  28.135  1.00 17.66 ? 107 GLN A O   1 
ATOM   806  C CB  . GLN A 1 103 ? 1.146   13.675  25.443  1.00 20.00 ? 107 GLN A CB  1 
ATOM   807  C CG  . GLN A 1 103 ? 1.023   13.593  23.925  1.00 22.26 ? 107 GLN A CG  1 
ATOM   808  C CD  . GLN A 1 103 ? -0.379  13.905  23.425  1.00 23.16 ? 107 GLN A CD  1 
ATOM   809  O OE1 . GLN A 1 103 ? -1.369  13.513  24.038  1.00 23.73 ? 107 GLN A OE1 1 
ATOM   810  N NE2 . GLN A 1 103 ? -0.464  14.604  22.296  1.00 23.05 ? 107 GLN A NE2 1 
ATOM   811  N N   . PHE A 1 104 ? 3.877   14.133  27.933  1.00 18.98 ? 108 PHE A N   1 
ATOM   812  C CA  . PHE A 1 104 ? 4.187   14.257  29.356  1.00 17.74 ? 108 PHE A CA  1 
ATOM   813  C C   . PHE A 1 104 ? 4.851   15.619  29.538  1.00 17.76 ? 108 PHE A C   1 
ATOM   814  O O   . PHE A 1 104 ? 5.422   16.164  28.594  1.00 16.66 ? 108 PHE A O   1 
ATOM   815  C CB  . PHE A 1 104 ? 5.207   13.194  29.805  1.00 18.08 ? 108 PHE A CB  1 
ATOM   816  C CG  . PHE A 1 104 ? 4.630   11.821  30.056  1.00 17.19 ? 108 PHE A CG  1 
ATOM   817  C CD1 . PHE A 1 104 ? 5.412   10.844  30.678  1.00 17.06 ? 108 PHE A CD1 1 
ATOM   818  C CD2 . PHE A 1 104 ? 3.339   11.490  29.666  1.00 17.27 ? 108 PHE A CD2 1 
ATOM   819  C CE1 . PHE A 1 104 ? 4.914   9.561   30.907  1.00 16.51 ? 108 PHE A CE1 1 
ATOM   820  C CE2 . PHE A 1 104 ? 2.829   10.208  29.888  1.00 17.13 ? 108 PHE A CE2 1 
ATOM   821  C CZ  . PHE A 1 104 ? 3.619   9.241   30.510  1.00 18.58 ? 108 PHE A CZ  1 
ATOM   822  N N   . ASP A 1 105 ? 4.802   16.157  30.751  1.00 17.43 ? 109 ASP A N   1 
ATOM   823  C CA  . ASP A 1 105 ? 5.440   17.437  31.027  1.00 17.59 ? 109 ASP A CA  1 
ATOM   824  C C   . ASP A 1 105 ? 6.872   17.182  31.470  1.00 17.64 ? 109 ASP A C   1 
ATOM   825  O O   . ASP A 1 105 ? 7.731   18.062  31.395  1.00 14.19 ? 109 ASP A O   1 
ATOM   826  C CB  . ASP A 1 105 ? 4.696   18.185  32.134  1.00 20.45 ? 109 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 105 ? 3.279   18.535  31.741  1.00 23.16 ? 109 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 105 ? 3.101   19.143  30.666  0.75 22.93 ? 109 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 105 ? 2.347   18.204  32.506  0.75 25.99 ? 109 ASP A OD2 1 
ATOM   830  N N   . TYR A 1 106 ? 7.119   15.958  31.928  1.00 16.92 ? 110 TYR A N   1 
ATOM   831  C CA  . TYR A 1 106 ? 8.439   15.574  32.398  1.00 16.01 ? 110 TYR A CA  1 
ATOM   832  C C   . TYR A 1 106 ? 8.548   14.057  32.454  1.00 15.36 ? 110 TYR A C   1 
ATOM   833  O O   . TYR A 1 106 ? 7.548   13.345  32.356  1.00 14.94 ? 110 TYR A O   1 
ATOM   834  C CB  . TYR A 1 106 ? 8.671   16.131  33.809  1.00 16.20 ? 110 TYR A CB  1 
ATOM   835  C CG  . TYR A 1 106 ? 7.828   15.451  34.874  1.00 15.80 ? 110 TYR A CG  1 
ATOM   836  C CD1 . TYR A 1 106 ? 8.272   14.287  35.510  1.00 17.78 ? 110 TYR A CD1 1 
ATOM   837  C CD2 . TYR A 1 106 ? 6.563   15.941  35.212  1.00 17.15 ? 110 TYR A CD2 1 
ATOM   838  C CE1 . TYR A 1 106 ? 7.478   13.626  36.452  1.00 16.18 ? 110 TYR A CE1 1 
ATOM   839  C CE2 . TYR A 1 106 ? 5.761   15.284  36.156  1.00 17.36 ? 110 TYR A CE2 1 
ATOM   840  C CZ  . TYR A 1 106 ? 6.227   14.129  36.767  1.00 16.39 ? 110 TYR A CZ  1 
ATOM   841  O OH  . TYR A 1 106 ? 5.437   13.465  37.682  1.00 18.01 ? 110 TYR A OH  1 
ATOM   842  N N   . VAL A 1 107 ? 9.776   13.577  32.590  1.00 14.76 ? 111 VAL A N   1 
ATOM   843  C CA  . VAL A 1 107 ? 10.028  12.152  32.749  1.00 13.56 ? 111 VAL A CA  1 
ATOM   844  C C   . VAL A 1 107 ? 10.693  12.109  34.114  1.00 11.45 ? 111 VAL A C   1 
ATOM   845  O O   . VAL A 1 107 ? 11.297  13.095  34.546  1.00 11.14 ? 111 VAL A O   1 
ATOM   846  C CB  . VAL A 1 107 ? 10.983  11.578  31.673  1.00 12.94 ? 111 VAL A CB  1 
ATOM   847  C CG1 . VAL A 1 107 ? 10.311  11.631  30.305  1.00 12.79 ? 111 VAL A CG1 1 
ATOM   848  C CG2 . VAL A 1 107 ? 12.306  12.338  31.668  1.00 13.70 ? 111 VAL A CG2 1 
ATOM   849  N N   . ASP A 1 108 ? 10.573  10.994  34.816  1.00 10.48 ? 112 ASP A N   1 
ATOM   850  C CA  . ASP A 1 108 ? 11.181  10.923  36.131  1.00 8.96  ? 112 ASP A CA  1 
ATOM   851  C C   . ASP A 1 108 ? 12.680  10.707  36.081  1.00 8.68  ? 112 ASP A C   1 
ATOM   852  O O   . ASP A 1 108 ? 13.406  11.147  36.975  1.00 9.85  ? 112 ASP A O   1 
ATOM   853  C CB  . ASP A 1 108 ? 10.510  9.830   36.956  1.00 9.36  ? 112 ASP A CB  1 
ATOM   854  C CG  . ASP A 1 108 ? 9.034   10.091  37.140  1.00 10.91 ? 112 ASP A CG  1 
ATOM   855  O OD1 . ASP A 1 108 ? 8.253   9.753   36.226  1.00 10.45 ? 112 ASP A OD1 1 
ATOM   856  O OD2 . ASP A 1 108 ? 8.666   10.665  38.185  1.00 11.86 ? 112 ASP A OD2 1 
ATOM   857  N N   . LEU A 1 109 ? 13.144  10.056  35.021  1.00 8.35  ? 113 LEU A N   1 
ATOM   858  C CA  . LEU A 1 109 ? 14.564  9.769   34.876  1.00 7.32  ? 113 LEU A CA  1 
ATOM   859  C C   . LEU A 1 109 ? 14.979  9.799   33.411  1.00 8.43  ? 113 LEU A C   1 
ATOM   860  O O   . LEU A 1 109 ? 14.231  9.358   32.532  1.00 8.70  ? 113 LEU A O   1 
ATOM   861  C CB  . LEU A 1 109 ? 14.863  8.393   35.492  1.00 5.69  ? 113 LEU A CB  1 
ATOM   862  C CG  . LEU A 1 109 ? 16.272  7.798   35.469  1.00 6.07  ? 113 LEU A CG  1 
ATOM   863  C CD1 . LEU A 1 109 ? 17.238  8.693   36.236  1.00 5.68  ? 113 LEU A CD1 1 
ATOM   864  C CD2 . LEU A 1 109 ? 16.234  6.401   36.097  1.00 3.56  ? 113 LEU A CD2 1 
ATOM   865  N N   . TYR A 1 110 ? 16.167  10.337  33.153  1.00 8.66  ? 114 TYR A N   1 
ATOM   866  C CA  . TYR A 1 110 ? 16.702  10.408  31.797  1.00 8.56  ? 114 TYR A CA  1 
ATOM   867  C C   . TYR A 1 110 ? 18.131  9.895   31.859  1.00 8.52  ? 114 TYR A C   1 
ATOM   868  O O   . TYR A 1 110 ? 18.930  10.358  32.682  1.00 7.06  ? 114 TYR A O   1 
ATOM   869  C CB  . TYR A 1 110 ? 16.678  11.850  31.283  1.00 10.78 ? 114 TYR A CB  1 
ATOM   870  C CG  . TYR A 1 110 ? 16.682  11.955  29.774  1.00 12.16 ? 114 TYR A CG  1 
ATOM   871  C CD1 . TYR A 1 110 ? 15.849  11.146  29.000  1.00 13.98 ? 114 TYR A CD1 1 
ATOM   872  C CD2 . TYR A 1 110 ? 17.483  12.891  29.120  1.00 12.18 ? 114 TYR A CD2 1 
ATOM   873  C CE1 . TYR A 1 110 ? 15.808  11.265  27.612  1.00 15.39 ? 114 TYR A CE1 1 
ATOM   874  C CE2 . TYR A 1 110 ? 17.449  13.021  27.729  1.00 15.33 ? 114 TYR A CE2 1 
ATOM   875  C CZ  . TYR A 1 110 ? 16.607  12.206  26.984  1.00 14.48 ? 114 TYR A CZ  1 
ATOM   876  O OH  . TYR A 1 110 ? 16.542  12.348  25.615  1.00 14.72 ? 114 TYR A OH  1 
ATOM   877  N N   . LEU A 1 111 ? 18.454  8.953   30.978  1.00 5.84  ? 115 LEU A N   1 
ATOM   878  C CA  . LEU A 1 111 ? 19.781  8.344   30.969  1.00 7.21  ? 115 LEU A CA  1 
ATOM   879  C C   . LEU A 1 111 ? 20.533  8.464   29.658  1.00 6.89  ? 115 LEU A C   1 
ATOM   880  O O   . LEU A 1 111 ? 19.932  8.571   28.592  1.00 7.65  ? 115 LEU A O   1 
ATOM   881  C CB  . LEU A 1 111 ? 19.665  6.847   31.261  1.00 5.84  ? 115 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 111 ? 18.785  6.343   32.402  1.00 7.55  ? 115 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 111 ? 18.784  4.804   32.396  1.00 6.92  ? 115 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 111 ? 19.302  6.872   33.719  1.00 4.34  ? 115 LEU A CD2 1 
ATOM   885  N N   . ILE A 1 112 ? 21.862  8.444   29.753  1.00 7.24  ? 116 ILE A N   1 
ATOM   886  C CA  . ILE A 1 112 ? 22.701  8.421   28.566  1.00 9.02  ? 116 ILE A CA  1 
ATOM   887  C C   . ILE A 1 112 ? 22.664  6.906   28.317  1.00 9.78  ? 116 ILE A C   1 
ATOM   888  O O   . ILE A 1 112 ? 23.119  6.129   29.155  1.00 7.36  ? 116 ILE A O   1 
ATOM   889  C CB  . ILE A 1 112 ? 24.143  8.877   28.872  1.00 9.22  ? 116 ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 112 ? 24.150  10.372  29.224  1.00 11.59 ? 116 ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 112 ? 25.046  8.590   27.668  1.00 9.03  ? 116 ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 112 ? 25.541  10.954  29.432  1.00 9.96  ? 116 ILE A CD1 1 
ATOM   893  N N   . HIS A 1 113 ? 22.096  6.492   27.187  1.00 9.78  ? 117 HIS A N   1 
ATOM   894  C CA  . HIS A 1 113 ? 21.932  5.072   26.870  1.00 8.53  ? 117 HIS A CA  1 
ATOM   895  C C   . HIS A 1 113 ? 23.223  4.250   26.788  1.00 8.57  ? 117 HIS A C   1 
ATOM   896  O O   . HIS A 1 113 ? 23.277  3.116   27.276  1.00 7.16  ? 117 HIS A O   1 
ATOM   897  C CB  . HIS A 1 113 ? 21.137  4.930   25.568  1.00 9.24  ? 117 HIS A CB  1 
ATOM   898  C CG  . HIS A 1 113 ? 20.360  3.653   25.470  1.00 8.00  ? 117 HIS A CG  1 
ATOM   899  N ND1 . HIS A 1 113 ? 19.117  3.582   24.877  1.00 7.89  ? 117 HIS A ND1 1 
ATOM   900  C CD2 . HIS A 1 113 ? 20.651  2.396   25.883  1.00 7.33  ? 117 HIS A CD2 1 
ATOM   901  C CE1 . HIS A 1 113 ? 18.675  2.338   24.930  1.00 7.19  ? 117 HIS A CE1 1 
ATOM   902  N NE2 . HIS A 1 113 ? 19.588  1.597   25.536  1.00 8.37  ? 117 HIS A NE2 1 
ATOM   903  N N   . TYR A 1 114 ? 24.243  4.821   26.157  1.00 7.52  ? 118 TYR A N   1 
ATOM   904  C CA  . TYR A 1 114 ? 25.551  4.184   26.004  1.00 6.88  ? 118 TYR A CA  1 
ATOM   905  C C   . TYR A 1 114 ? 26.568  5.310   25.986  1.00 7.40  ? 118 TYR A C   1 
ATOM   906  O O   . TYR A 1 114 ? 26.257  6.416   25.550  1.00 9.05  ? 118 TYR A O   1 
ATOM   907  C CB  . TYR A 1 114 ? 25.681  3.446   24.666  1.00 7.12  ? 118 TYR A CB  1 
ATOM   908  C CG  . TYR A 1 114 ? 25.133  2.040   24.620  1.00 6.93  ? 118 TYR A CG  1 
ATOM   909  C CD1 . TYR A 1 114 ? 23.964  1.757   23.922  1.00 11.30 ? 118 TYR A CD1 1 
ATOM   910  C CD2 . TYR A 1 114 ? 25.810  0.985   25.230  1.00 7.15  ? 118 TYR A CD2 1 
ATOM   911  C CE1 . TYR A 1 114 ? 23.480  0.456   23.823  1.00 10.19 ? 118 TYR A CE1 1 
ATOM   912  C CE2 . TYR A 1 114 ? 25.334  -0.327  25.137  1.00 8.86  ? 118 TYR A CE2 1 
ATOM   913  C CZ  . TYR A 1 114 ? 24.168  -0.579  24.428  1.00 10.12 ? 118 TYR A CZ  1 
ATOM   914  O OH  . TYR A 1 114 ? 23.706  -1.866  24.293  1.00 11.33 ? 118 TYR A OH  1 
ATOM   915  N N   . PRO A 1 115 ? 27.798  5.043   26.448  1.00 8.38  ? 119 PRO A N   1 
ATOM   916  C CA  . PRO A 1 115 ? 28.844  6.072   26.459  1.00 8.74  ? 119 PRO A CA  1 
ATOM   917  C C   . PRO A 1 115 ? 29.505  6.142   25.079  1.00 9.99  ? 119 PRO A C   1 
ATOM   918  O O   . PRO A 1 115 ? 30.695  6.450   24.956  1.00 10.60 ? 119 PRO A O   1 
ATOM   919  C CB  . PRO A 1 115 ? 29.800  5.565   27.532  1.00 8.48  ? 119 PRO A CB  1 
ATOM   920  C CG  . PRO A 1 115 ? 29.724  4.078   27.349  1.00 6.69  ? 119 PRO A CG  1 
ATOM   921  C CD  . PRO A 1 115 ? 28.233  3.844   27.189  1.00 7.86  ? 119 PRO A CD  1 
ATOM   922  N N   . MET A 1 116 ? 28.722  5.859   24.042  1.00 9.82  ? 120 MET A N   1 
ATOM   923  C CA  . MET A 1 116 ? 29.239  5.850   22.681  1.00 8.63  ? 120 MET A CA  1 
ATOM   924  C C   . MET A 1 116 ? 28.385  6.663   21.718  1.00 10.32 ? 120 MET A C   1 
ATOM   925  O O   . MET A 1 116 ? 27.208  6.362   21.512  1.00 11.29 ? 120 MET A O   1 
ATOM   926  C CB  . MET A 1 116 ? 29.331  4.406   22.177  1.00 9.07  ? 120 MET A CB  1 
ATOM   927  C CG  . MET A 1 116 ? 30.135  3.480   23.080  1.00 10.61 ? 120 MET A CG  1 
ATOM   928  S SD  . MET A 1 116 ? 30.152  1.796   22.454  1.00 10.57 ? 120 MET A SD  1 
ATOM   929  C CE  . MET A 1 116 ? 28.557  1.205   23.055  1.00 10.35 ? 120 MET A CE  1 
ATOM   930  N N   . ALA A 1 117 ? 28.986  7.684   21.117  1.00 8.88  ? 121 ALA A N   1 
ATOM   931  C CA  . ALA A 1 117 ? 28.269  8.530   20.167  1.00 8.73  ? 121 ALA A CA  1 
ATOM   932  C C   . ALA A 1 117 ? 28.341  7.979   18.746  1.00 8.01  ? 121 ALA A C   1 
ATOM   933  O O   . ALA A 1 117 ? 29.322  7.331   18.364  1.00 9.06  ? 121 ALA A O   1 
ATOM   934  C CB  . ALA A 1 117 ? 28.842  9.950   20.199  1.00 8.98  ? 121 ALA A CB  1 
ATOM   935  N N   . LEU A 1 118 ? 27.284  8.226   17.978  1.00 8.57  ? 122 LEU A N   1 
ATOM   936  C CA  . LEU A 1 118 ? 27.205  7.816   16.578  1.00 9.51  ? 122 LEU A CA  1 
ATOM   937  C C   . LEU A 1 118 ? 26.872  9.066   15.766  1.00 8.43  ? 122 LEU A C   1 
ATOM   938  O O   . LEU A 1 118 ? 26.391  10.054  16.313  1.00 8.22  ? 122 LEU A O   1 
ATOM   939  C CB  . LEU A 1 118 ? 26.105  6.768   16.359  1.00 7.10  ? 122 LEU A CB  1 
ATOM   940  C CG  . LEU A 1 118 ? 26.283  5.385   16.994  1.00 9.74  ? 122 LEU A CG  1 
ATOM   941  C CD1 . LEU A 1 118 ? 25.103  4.503   16.621  1.00 9.94  ? 122 LEU A CD1 1 
ATOM   942  C CD2 . LEU A 1 118 ? 27.592  4.758   16.509  1.00 7.77  ? 122 LEU A CD2 1 
ATOM   943  N N   . LYS A 1 119 ? 27.121  9.010   14.462  1.00 10.91 ? 123 LYS A N   1 
ATOM   944  C CA  . LYS A 1 119 ? 26.848  10.138  13.570  1.00 10.53 ? 123 LYS A CA  1 
ATOM   945  C C   . LYS A 1 119 ? 25.419  10.656  13.738  1.00 11.83 ? 123 LYS A C   1 
ATOM   946  O O   . LYS A 1 119 ? 24.459  9.900   13.599  1.00 11.63 ? 123 LYS A O   1 
ATOM   947  C CB  . LYS A 1 119 ? 27.062  9.710   12.120  1.00 12.34 ? 123 LYS A CB  1 
ATOM   948  C CG  . LYS A 1 119 ? 26.706  10.784  11.101  1.00 13.76 ? 123 LYS A CG  1 
ATOM   949  C CD  . LYS A 1 119 ? 26.840  10.257  9.684   1.00 16.50 ? 123 LYS A CD  1 
ATOM   950  C CE  . LYS A 1 119 ? 26.415  11.307  8.668   1.00 17.90 ? 123 LYS A CE  1 
ATOM   951  N NZ  . LYS A 1 119 ? 26.509  10.781  7.278   1.00 21.14 ? 123 LYS A NZ  1 
ATOM   952  N N   . PRO A 1 120 ? 25.264  11.959  14.028  1.00 11.35 ? 124 PRO A N   1 
ATOM   953  C CA  . PRO A 1 120 ? 23.948  12.585  14.214  1.00 11.56 ? 124 PRO A CA  1 
ATOM   954  C C   . PRO A 1 120 ? 23.059  12.386  12.987  1.00 12.82 ? 124 PRO A C   1 
ATOM   955  O O   . PRO A 1 120 ? 23.548  12.350  11.857  1.00 13.70 ? 124 PRO A O   1 
ATOM   956  C CB  . PRO A 1 120 ? 24.287  14.061  14.429  1.00 12.07 ? 124 PRO A CB  1 
ATOM   957  C CG  . PRO A 1 120 ? 25.676  14.027  14.987  1.00 12.98 ? 124 PRO A CG  1 
ATOM   958  C CD  . PRO A 1 120 ? 26.339  12.958  14.160  1.00 13.31 ? 124 PRO A CD  1 
ATOM   959  N N   . GLY A 1 121 ? 21.757  12.264  13.218  1.00 13.80 ? 125 GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 20.822  12.070  12.125  1.00 15.92 ? 125 GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 19.587  11.306  12.563  1.00 16.88 ? 125 GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 19.551  10.742  13.655  1.00 15.84 ? 125 GLY A O   1 
ATOM   963  N N   . GLU A 1 122 ? 18.571  11.281  11.706  1.00 16.99 ? 126 GLU A N   1 
ATOM   964  C CA  . GLU A 1 122 ? 17.329  10.584  12.011  1.00 16.71 ? 126 GLU A CA  1 
ATOM   965  C C   . GLU A 1 122 ? 17.556  9.085   12.204  1.00 16.03 ? 126 GLU A C   1 
ATOM   966  O O   . GLU A 1 122 ? 16.918  8.457   13.048  1.00 15.84 ? 126 GLU A O   1 
ATOM   967  C CB  . GLU A 1 122 ? 16.313  10.811  10.885  1.00 17.54 ? 126 GLU A CB  1 
ATOM   968  C CG  . GLU A 1 122 ? 14.935  10.220  11.152  0.50 17.63 ? 126 GLU A CG  1 
ATOM   969  C CD  . GLU A 1 122 ? 14.187  10.940  12.261  0.50 19.68 ? 126 GLU A CD  1 
ATOM   970  O OE1 . GLU A 1 122 ? 13.049  10.530  12.571  0.50 20.49 ? 126 GLU A OE1 1 
ATOM   971  O OE2 . GLU A 1 122 ? 14.734  11.916  12.821  0.50 19.29 ? 126 GLU A OE2 1 
ATOM   972  N N   . GLU A 1 123 ? 18.468  8.520   11.420  1.00 15.17 ? 127 GLU A N   1 
ATOM   973  C CA  . GLU A 1 123 ? 18.781  7.096   11.495  1.00 15.99 ? 127 GLU A CA  1 
ATOM   974  C C   . GLU A 1 123 ? 19.456  6.768   12.828  1.00 13.77 ? 127 GLU A C   1 
ATOM   975  O O   . GLU A 1 123 ? 20.444  7.399   13.196  1.00 12.71 ? 127 GLU A O   1 
ATOM   976  C CB  . GLU A 1 123 ? 19.702  6.710   10.332  1.00 17.03 ? 127 GLU A CB  1 
ATOM   977  C CG  . GLU A 1 123 ? 20.274  5.306   10.409  1.00 21.34 ? 127 GLU A CG  1 
ATOM   978  C CD  . GLU A 1 123 ? 19.200  4.236   10.412  1.00 24.16 ? 127 GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 123 ? 19.226  3.378   11.319  1.00 22.08 ? 127 GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 123 ? 18.336  4.251   9.506   1.00 26.72 ? 127 GLU A OE2 1 
ATOM   981  N N   . ASN A 1 124 ? 18.922  5.789   13.550  1.00 12.46 ? 128 ASN A N   1 
ATOM   982  C CA  . ASN A 1 124 ? 19.510  5.411   14.834  1.00 11.83 ? 128 ASN A CA  1 
ATOM   983  C C   . ASN A 1 124 ? 20.792  4.603   14.658  1.00 11.80 ? 128 ASN A C   1 
ATOM   984  O O   . ASN A 1 124 ? 21.681  4.643   15.510  1.00 11.45 ? 128 ASN A O   1 
ATOM   985  C CB  . ASN A 1 124 ? 18.514  4.606   15.678  1.00 13.07 ? 128 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 124 ? 17.338  5.446   16.152  1.00 13.16 ? 128 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 124 ? 17.497  6.618   16.489  1.00 16.77 ? 128 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 124 ? 16.154  4.844   16.196  1.00 13.84 ? 128 ASN A ND2 1 
ATOM   989  N N   . PHE A 1 125 ? 20.885  3.872   13.553  1.00 11.48 ? 129 PHE A N   1 
ATOM   990  C CA  . PHE A 1 125 ? 22.065  3.058   13.291  1.00 12.42 ? 129 PHE A CA  1 
ATOM   991  C C   . PHE A 1 125 ? 22.720  3.373   11.953  1.00 12.63 ? 129 PHE A C   1 
ATOM   992  O O   . PHE A 1 125 ? 22.675  2.567   11.021  1.00 10.01 ? 129 PHE A O   1 
ATOM   993  C CB  . PHE A 1 125 ? 21.701  1.573   13.362  1.00 12.76 ? 129 PHE A CB  1 
ATOM   994  C CG  . PHE A 1 125 ? 21.217  1.142   14.714  1.00 11.02 ? 129 PHE A CG  1 
ATOM   995  C CD1 . PHE A 1 125 ? 19.866  1.197   15.032  1.00 12.14 ? 129 PHE A CD1 1 
ATOM   996  C CD2 . PHE A 1 125 ? 22.122  0.720   15.688  1.00 11.04 ? 129 PHE A CD2 1 
ATOM   997  C CE1 . PHE A 1 125 ? 19.415  0.840   16.304  1.00 12.89 ? 129 PHE A CE1 1 
ATOM   998  C CE2 . PHE A 1 125 ? 21.684  0.361   16.964  1.00 11.80 ? 129 PHE A CE2 1 
ATOM   999  C CZ  . PHE A 1 125 ? 20.325  0.422   17.271  1.00 14.03 ? 129 PHE A CZ  1 
ATOM   1000 N N   . PRO A 1 126 ? 23.349  4.557   11.845  1.00 13.28 ? 130 PRO A N   1 
ATOM   1001 C CA  . PRO A 1 126 ? 24.014  4.959   10.601  1.00 14.15 ? 130 PRO A CA  1 
ATOM   1002 C C   . PRO A 1 126 ? 25.204  4.058   10.312  1.00 14.34 ? 130 PRO A C   1 
ATOM   1003 O O   . PRO A 1 126 ? 26.055  3.844   11.177  1.00 14.39 ? 130 PRO A O   1 
ATOM   1004 C CB  . PRO A 1 126 ? 24.427  6.403   10.880  1.00 15.28 ? 130 PRO A CB  1 
ATOM   1005 C CG  . PRO A 1 126 ? 24.677  6.400   12.357  1.00 13.76 ? 130 PRO A CG  1 
ATOM   1006 C CD  . PRO A 1 126 ? 23.515  5.587   12.887  1.00 12.98 ? 130 PRO A CD  1 
ATOM   1007 N N   . VAL A 1 127 ? 25.252  3.523   9.096   1.00 14.03 ? 131 VAL A N   1 
ATOM   1008 C CA  . VAL A 1 127 ? 26.333  2.635   8.694   1.00 13.97 ? 131 VAL A CA  1 
ATOM   1009 C C   . VAL A 1 127 ? 26.911  3.033   7.340   1.00 15.00 ? 131 VAL A C   1 
ATOM   1010 O O   . VAL A 1 127 ? 26.296  3.797   6.590   1.00 13.72 ? 131 VAL A O   1 
ATOM   1011 C CB  . VAL A 1 127 ? 25.847  1.171   8.597   1.00 13.85 ? 131 VAL A CB  1 
ATOM   1012 C CG1 . VAL A 1 127 ? 25.297  0.710   9.944   1.00 14.99 ? 131 VAL A CG1 1 
ATOM   1013 C CG2 . VAL A 1 127 ? 24.782  1.045   7.517   1.00 15.05 ? 131 VAL A CG2 1 
ATOM   1014 N N   . ASP A 1 128 ? 28.103  2.523   7.039   1.00 15.10 ? 132 ASP A N   1 
ATOM   1015 C CA  . ASP A 1 128 ? 28.743  2.803   5.759   1.00 17.21 ? 132 ASP A CA  1 
ATOM   1016 C C   . ASP A 1 128 ? 28.459  1.637   4.801   1.00 17.43 ? 132 ASP A C   1 
ATOM   1017 O O   . ASP A 1 128 ? 27.657  0.756   5.122   1.00 18.26 ? 132 ASP A O   1 
ATOM   1018 C CB  . ASP A 1 128 ? 30.254  3.008   5.939   1.00 16.55 ? 132 ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 128 ? 30.937  1.824   6.592   1.00 16.40 ? 132 ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 128 ? 30.369  0.714   6.584   1.00 12.97 ? 132 ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 128 ? 32.062  2.006   7.104   1.00 17.46 ? 132 ASP A OD2 1 
ATOM   1022 N N   . GLU A 1 129 ? 29.104  1.626   3.636   1.00 17.75 ? 133 GLU A N   1 
ATOM   1023 C CA  . GLU A 1 129 ? 28.872  0.563   2.657   1.00 19.91 ? 133 GLU A CA  1 
ATOM   1024 C C   . GLU A 1 129 ? 29.248  -0.814  3.173   1.00 19.68 ? 133 GLU A C   1 
ATOM   1025 O O   . GLU A 1 129 ? 28.801  -1.823  2.627   1.00 19.21 ? 133 GLU A O   1 
ATOM   1026 C CB  . GLU A 1 129 ? 29.649  0.799   1.357   1.00 23.08 ? 133 GLU A CB  1 
ATOM   1027 C CG  . GLU A 1 129 ? 30.114  2.210   1.106   1.00 27.32 ? 133 GLU A CG  1 
ATOM   1028 C CD  . GLU A 1 129 ? 31.293  2.598   1.970   1.00 26.77 ? 133 GLU A CD  1 
ATOM   1029 O OE1 . GLU A 1 129 ? 31.068  3.130   3.072   1.00 29.93 ? 133 GLU A OE1 1 
ATOM   1030 O OE2 . GLU A 1 129 ? 32.445  2.361   1.548   1.00 28.99 ? 133 GLU A OE2 1 
ATOM   1031 N N   . HIS A 1 130 ? 30.079  -0.864  4.209   1.00 18.68 ? 134 HIS A N   1 
ATOM   1032 C CA  . HIS A 1 130 ? 30.489  -2.146  4.770   1.00 18.40 ? 134 HIS A CA  1 
ATOM   1033 C C   . HIS A 1 130 ? 29.527  -2.595  5.862   1.00 17.14 ? 134 HIS A C   1 
ATOM   1034 O O   . HIS A 1 130 ? 29.708  -3.648  6.464   1.00 17.41 ? 134 HIS A O   1 
ATOM   1035 C CB  . HIS A 1 130 ? 31.908  -2.058  5.335   1.00 19.91 ? 134 HIS A CB  1 
ATOM   1036 C CG  . HIS A 1 130 ? 32.938  -1.683  4.317   1.00 22.90 ? 134 HIS A CG  1 
ATOM   1037 N ND1 . HIS A 1 130 ? 33.136  -0.384  3.902   1.00 24.68 ? 134 HIS A ND1 1 
ATOM   1038 C CD2 . HIS A 1 130 ? 33.809  -2.441  3.609   1.00 23.98 ? 134 HIS A CD2 1 
ATOM   1039 C CE1 . HIS A 1 130 ? 34.084  -0.357  2.982   1.00 26.23 ? 134 HIS A CE1 1 
ATOM   1040 N NE2 . HIS A 1 130 ? 34.509  -1.592  2.786   1.00 26.09 ? 134 HIS A NE2 1 
ATOM   1041 N N   . GLY A 1 131 ? 28.503  -1.787  6.112   1.00 17.71 ? 135 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 131 ? 27.528  -2.128  7.130   1.00 17.13 ? 135 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 131 ? 28.040  -1.878  8.535   1.00 16.21 ? 135 GLY A C   1 
ATOM   1044 O O   . GLY A 1 131 ? 27.485  -2.390  9.508   1.00 15.21 ? 135 GLY A O   1 
ATOM   1045 N N   . LYS A 1 132 ? 29.106  -1.094  8.646   1.00 15.15 ? 136 LYS A N   1 
ATOM   1046 C CA  . LYS A 1 132 ? 29.684  -0.781  9.949   1.00 14.14 ? 136 LYS A CA  1 
ATOM   1047 C C   . LYS A 1 132 ? 29.152  0.548   10.464  1.00 12.51 ? 136 LYS A C   1 
ATOM   1048 O O   . LYS A 1 132 ? 28.993  1.498   9.701   1.00 11.75 ? 136 LYS A O   1 
ATOM   1049 C CB  . LYS A 1 132 ? 31.206  -0.725  9.843   1.00 16.90 ? 136 LYS A CB  1 
ATOM   1050 C CG  . LYS A 1 132 ? 31.809  -1.983  9.239   1.00 21.45 ? 136 LYS A CG  1 
ATOM   1051 C CD  . LYS A 1 132 ? 33.279  -1.797  8.921   1.00 24.25 ? 136 LYS A CD  1 
ATOM   1052 C CE  . LYS A 1 132 ? 33.791  -2.920  8.027   1.00 27.14 ? 136 LYS A CE  1 
ATOM   1053 N NZ  . LYS A 1 132 ? 35.208  -2.705  7.619   1.00 29.47 ? 136 LYS A NZ  1 
ATOM   1054 N N   . LEU A 1 133 ? 28.878  0.609   11.763  1.00 11.70 ? 137 LEU A N   1 
ATOM   1055 C CA  . LEU A 1 133 ? 28.365  1.828   12.379  1.00 12.21 ? 137 LEU A CA  1 
ATOM   1056 C C   . LEU A 1 133 ? 29.311  3.006   12.200  1.00 12.32 ? 137 LEU A C   1 
ATOM   1057 O O   . LEU A 1 133 ? 30.533  2.856   12.280  1.00 10.99 ? 137 LEU A O   1 
ATOM   1058 C CB  . LEU A 1 133 ? 28.118  1.609   13.874  1.00 12.89 ? 137 LEU A CB  1 
ATOM   1059 C CG  . LEU A 1 133 ? 26.891  0.803   14.298  1.00 15.58 ? 137 LEU A CG  1 
ATOM   1060 C CD1 . LEU A 1 133 ? 26.937  0.586   15.798  1.00 13.69 ? 137 LEU A CD1 1 
ATOM   1061 C CD2 . LEU A 1 133 ? 25.611  1.541   13.905  1.00 15.73 ? 137 LEU A CD2 1 
ATOM   1062 N N   . ILE A 1 134 ? 28.737  4.180   11.959  1.00 11.17 ? 138 ILE A N   1 
ATOM   1063 C CA  . ILE A 1 134 ? 29.526  5.394   11.783  1.00 12.33 ? 138 ILE A CA  1 
ATOM   1064 C C   . ILE A 1 134 ? 29.683  6.065   13.142  1.00 12.11 ? 138 ILE A C   1 
ATOM   1065 O O   . ILE A 1 134 ? 28.781  6.740   13.632  1.00 12.51 ? 138 ILE A O   1 
ATOM   1066 C CB  . ILE A 1 134 ? 28.847  6.357   10.784  1.00 12.40 ? 138 ILE A CB  1 
ATOM   1067 C CG1 . ILE A 1 134 ? 28.748  5.672   9.415   1.00 13.45 ? 138 ILE A CG1 1 
ATOM   1068 C CG2 . ILE A 1 134 ? 29.654  7.657   10.674  1.00 12.29 ? 138 ILE A CG2 1 
ATOM   1069 C CD1 . ILE A 1 134 ? 27.981  6.463   8.361   1.00 14.27 ? 138 ILE A CD1 1 
ATOM   1070 N N   . PHE A 1 135 ? 30.844  5.859   13.749  1.00 12.91 ? 139 PHE A N   1 
ATOM   1071 C CA  . PHE A 1 135 ? 31.133  6.403   15.065  1.00 13.91 ? 139 PHE A CA  1 
ATOM   1072 C C   . PHE A 1 135 ? 31.400  7.897   15.052  1.00 15.85 ? 139 PHE A C   1 
ATOM   1073 O O   . PHE A 1 135 ? 31.801  8.468   14.034  1.00 16.56 ? 139 PHE A O   1 
ATOM   1074 C CB  . PHE A 1 135 ? 32.354  5.701   15.674  1.00 13.45 ? 139 PHE A CB  1 
ATOM   1075 C CG  . PHE A 1 135 ? 32.226  4.205   15.765  1.00 15.05 ? 139 PHE A CG  1 
ATOM   1076 C CD1 . PHE A 1 135 ? 31.000  3.608   16.040  1.00 14.64 ? 139 PHE A CD1 1 
ATOM   1077 C CD2 . PHE A 1 135 ? 33.348  3.391   15.617  1.00 16.47 ? 139 PHE A CD2 1 
ATOM   1078 C CE1 . PHE A 1 135 ? 30.891  2.226   16.167  1.00 15.12 ? 139 PHE A CE1 1 
ATOM   1079 C CE2 . PHE A 1 135 ? 33.250  2.009   15.742  1.00 17.27 ? 139 PHE A CE2 1 
ATOM   1080 C CZ  . PHE A 1 135 ? 32.017  1.425   16.019  1.00 17.73 ? 139 PHE A CZ  1 
ATOM   1081 N N   . ASP A 1 136 ? 31.172  8.524   16.201  1.00 16.04 ? 140 ASP A N   1 
ATOM   1082 C CA  . ASP A 1 136 ? 31.437  9.943   16.367  1.00 15.13 ? 140 ASP A CA  1 
ATOM   1083 C C   . ASP A 1 136 ? 32.119  10.082  17.722  1.00 15.06 ? 140 ASP A C   1 
ATOM   1084 O O   . ASP A 1 136 ? 32.026  9.181   18.560  1.00 14.29 ? 140 ASP A O   1 
ATOM   1085 C CB  . ASP A 1 136 ? 30.137  10.749  16.334  1.00 13.97 ? 140 ASP A CB  1 
ATOM   1086 C CG  . ASP A 1 136 ? 30.384  12.242  16.232  1.00 14.77 ? 140 ASP A CG  1 
ATOM   1087 O OD1 . ASP A 1 136 ? 31.513  12.634  15.870  1.00 15.53 ? 140 ASP A OD1 1 
ATOM   1088 O OD2 . ASP A 1 136 ? 29.448  13.020  16.501  1.00 14.20 ? 140 ASP A OD2 1 
ATOM   1089 N N   . ARG A 1 137 ? 32.830  11.187  17.919  1.00 14.44 ? 141 ARG A N   1 
ATOM   1090 C CA  . ARG A 1 137 ? 33.518  11.444  19.183  1.00 14.37 ? 141 ARG A CA  1 
ATOM   1091 C C   . ARG A 1 137 ? 32.917  12.676  19.840  1.00 14.37 ? 141 ARG A C   1 
ATOM   1092 O O   . ARG A 1 137 ? 32.786  13.726  19.209  1.00 13.82 ? 141 ARG A O   1 
ATOM   1093 C CB  . ARG A 1 137 ? 35.014  11.671  18.955  1.00 15.33 ? 141 ARG A CB  1 
ATOM   1094 C CG  . ARG A 1 137 ? 35.759  12.194  20.189  1.00 16.41 ? 141 ARG A CG  1 
ATOM   1095 C CD  . ARG A 1 137 ? 37.262  12.200  19.956  1.00 20.70 ? 141 ARG A CD  1 
ATOM   1096 N NE  . ARG A 1 137 ? 37.797  10.842  19.903  1.00 23.21 ? 141 ARG A NE  1 
ATOM   1097 C CZ  . ARG A 1 137 ? 38.003  10.081  20.976  1.00 24.61 ? 141 ARG A CZ  1 
ATOM   1098 N NH1 . ARG A 1 137 ? 37.727  10.550  22.185  1.00 23.60 ? 141 ARG A NH1 1 
ATOM   1099 N NH2 . ARG A 1 137 ? 38.467  8.847   20.840  1.00 23.56 ? 141 ARG A NH2 1 
ATOM   1100 N N   . VAL A 1 138 ? 32.548  12.541  21.108  1.00 14.88 ? 142 VAL A N   1 
ATOM   1101 C CA  . VAL A 1 138 ? 31.962  13.648  21.841  1.00 14.57 ? 142 VAL A CA  1 
ATOM   1102 C C   . VAL A 1 138 ? 32.540  13.760  23.241  1.00 15.63 ? 142 VAL A C   1 
ATOM   1103 O O   . VAL A 1 138 ? 33.072  12.795  23.792  1.00 15.53 ? 142 VAL A O   1 
ATOM   1104 C CB  . VAL A 1 138 ? 30.434  13.497  21.978  1.00 16.12 ? 142 VAL A CB  1 
ATOM   1105 C CG1 . VAL A 1 138 ? 29.785  13.436  20.602  1.00 17.88 ? 142 VAL A CG1 1 
ATOM   1106 C CG2 . VAL A 1 138 ? 30.111  12.256  22.792  1.00 16.22 ? 142 VAL A CG2 1 
ATOM   1107 N N   . ASP A 1 139 ? 32.430  14.957  23.800  1.00 15.11 ? 143 ASP A N   1 
ATOM   1108 C CA  . ASP A 1 139 ? 32.891  15.240  25.149  1.00 16.50 ? 143 ASP A CA  1 
ATOM   1109 C C   . ASP A 1 139 ? 31.745  14.787  26.052  1.00 15.14 ? 143 ASP A C   1 
ATOM   1110 O O   . ASP A 1 139 ? 30.749  15.494  26.198  1.00 15.80 ? 143 ASP A O   1 
ATOM   1111 C CB  . ASP A 1 139 ? 33.113  16.746  25.310  1.00 17.34 ? 143 ASP A CB  1 
ATOM   1112 C CG  . ASP A 1 139 ? 33.642  17.118  26.679  1.00 21.82 ? 143 ASP A CG  1 
ATOM   1113 O OD1 . ASP A 1 139 ? 33.514  16.296  27.613  1.00 19.63 ? 143 ASP A OD1 1 
ATOM   1114 O OD2 . ASP A 1 139 ? 34.175  18.241  26.822  1.00 22.51 ? 143 ASP A OD2 1 
ATOM   1115 N N   . LEU A 1 140 ? 31.872  13.608  26.646  1.00 13.67 ? 144 LEU A N   1 
ATOM   1116 C CA  . LEU A 1 140 ? 30.806  13.103  27.503  1.00 15.25 ? 144 LEU A CA  1 
ATOM   1117 C C   . LEU A 1 140 ? 30.559  13.960  28.736  1.00 15.21 ? 144 LEU A C   1 
ATOM   1118 O O   . LEU A 1 140 ? 29.477  13.910  29.319  1.00 13.22 ? 144 LEU A O   1 
ATOM   1119 C CB  . LEU A 1 140 ? 31.083  11.654  27.909  1.00 15.61 ? 144 LEU A CB  1 
ATOM   1120 C CG  . LEU A 1 140 ? 30.845  10.655  26.770  1.00 16.85 ? 144 LEU A CG  1 
ATOM   1121 C CD1 . LEU A 1 140 ? 31.133  9.244   27.253  1.00 15.67 ? 144 LEU A CD1 1 
ATOM   1122 C CD2 . LEU A 1 140 ? 29.402  10.770  26.282  1.00 16.11 ? 144 LEU A CD2 1 
ATOM   1123 N N   . CYS A 1 141 ? 31.550  14.747  29.142  1.00 16.57 ? 145 CYS A N   1 
ATOM   1124 C CA  . CYS A 1 141 ? 31.346  15.609  30.299  1.00 17.01 ? 145 CYS A CA  1 
ATOM   1125 C C   . CYS A 1 141 ? 30.440  16.743  29.860  1.00 16.67 ? 145 CYS A C   1 
ATOM   1126 O O   . CYS A 1 141 ? 29.653  17.265  30.648  1.00 17.07 ? 145 CYS A O   1 
ATOM   1127 C CB  . CYS A 1 141 ? 32.672  16.160  30.817  1.00 17.42 ? 145 CYS A CB  1 
ATOM   1128 S SG  . CYS A 1 141 ? 33.584  14.963  31.787  1.00 20.08 ? 145 CYS A SG  1 
ATOM   1129 N N   . ALA A 1 142 ? 30.554  17.111  28.588  1.00 15.25 ? 146 ALA A N   1 
ATOM   1130 C CA  . ALA A 1 142 ? 29.733  18.170  28.028  1.00 13.59 ? 146 ALA A CA  1 
ATOM   1131 C C   . ALA A 1 142 ? 28.325  17.613  27.864  1.00 12.37 ? 146 ALA A C   1 
ATOM   1132 O O   . ALA A 1 142 ? 27.338  18.323  28.053  1.00 12.27 ? 146 ALA A O   1 
ATOM   1133 C CB  . ALA A 1 142 ? 30.297  18.616  26.684  1.00 15.28 ? 146 ALA A CB  1 
ATOM   1134 N N   . THR A 1 143 ? 28.243  16.332  27.509  1.00 11.79 ? 147 THR A N   1 
ATOM   1135 C CA  . THR A 1 143 ? 26.956  15.663  27.345  1.00 12.20 ? 147 THR A CA  1 
ATOM   1136 C C   . THR A 1 143 ? 26.261  15.662  28.707  1.00 11.31 ? 147 THR A C   1 
ATOM   1137 O O   . THR A 1 143 ? 25.063  15.919  28.804  1.00 7.67  ? 147 THR A O   1 
ATOM   1138 C CB  . THR A 1 143 ? 27.135  14.189  26.881  1.00 11.21 ? 147 THR A CB  1 
ATOM   1139 O OG1 . THR A 1 143 ? 27.858  14.157  25.644  1.00 12.03 ? 147 THR A OG1 1 
ATOM   1140 C CG2 . THR A 1 143 ? 25.775  13.514  26.686  1.00 12.94 ? 147 THR A CG2 1 
ATOM   1141 N N   . TRP A 1 144 ? 27.025  15.378  29.759  1.00 12.13 ? 148 TRP A N   1 
ATOM   1142 C CA  . TRP A 1 144 ? 26.458  15.348  31.102  1.00 12.71 ? 148 TRP A CA  1 
ATOM   1143 C C   . TRP A 1 144 ? 25.956  16.726  31.509  1.00 13.17 ? 148 TRP A C   1 
ATOM   1144 O O   . TRP A 1 144 ? 24.874  16.850  32.073  1.00 12.70 ? 148 TRP A O   1 
ATOM   1145 C CB  . TRP A 1 144 ? 27.482  14.844  32.126  1.00 13.12 ? 148 TRP A CB  1 
ATOM   1146 C CG  . TRP A 1 144 ? 26.865  14.620  33.478  1.00 13.23 ? 148 TRP A CG  1 
ATOM   1147 C CD1 . TRP A 1 144 ? 27.069  15.358  34.609  1.00 13.26 ? 148 TRP A CD1 1 
ATOM   1148 C CD2 . TRP A 1 144 ? 25.891  13.621  33.821  1.00 12.62 ? 148 TRP A CD2 1 
ATOM   1149 N NE1 . TRP A 1 144 ? 26.282  14.883  35.634  1.00 13.58 ? 148 TRP A NE1 1 
ATOM   1150 C CE2 . TRP A 1 144 ? 25.549  13.818  35.177  1.00 12.34 ? 148 TRP A CE2 1 
ATOM   1151 C CE3 . TRP A 1 144 ? 25.274  12.581  33.111  1.00 13.73 ? 148 TRP A CE3 1 
ATOM   1152 C CZ2 . TRP A 1 144 ? 24.614  13.013  35.842  1.00 12.32 ? 148 TRP A CZ2 1 
ATOM   1153 C CZ3 . TRP A 1 144 ? 24.341  11.777  33.772  1.00 11.50 ? 148 TRP A CZ3 1 
ATOM   1154 C CH2 . TRP A 1 144 ? 24.022  12.002  35.124  1.00 11.11 ? 148 TRP A CH2 1 
ATOM   1155 N N   . GLU A 1 145 ? 26.733  17.765  31.216  1.00 15.45 ? 149 GLU A N   1 
ATOM   1156 C CA  . GLU A 1 145 ? 26.314  19.121  31.561  1.00 16.28 ? 149 GLU A CA  1 
ATOM   1157 C C   . GLU A 1 145 ? 24.946  19.392  30.947  1.00 14.75 ? 149 GLU A C   1 
ATOM   1158 O O   . GLU A 1 145 ? 24.087  20.010  31.574  1.00 14.89 ? 149 GLU A O   1 
ATOM   1159 C CB  . GLU A 1 145 ? 27.329  20.151  31.050  1.00 18.34 ? 149 GLU A CB  1 
ATOM   1160 C CG  . GLU A 1 145 ? 28.704  20.034  31.694  1.00 24.16 ? 149 GLU A CG  1 
ATOM   1161 C CD  . GLU A 1 145 ? 29.698  21.054  31.155  1.00 27.84 ? 149 GLU A CD  1 
ATOM   1162 O OE1 . GLU A 1 145 ? 29.903  21.093  29.923  1.00 29.35 ? 149 GLU A OE1 1 
ATOM   1163 O OE2 . GLU A 1 145 ? 30.277  21.812  31.964  1.00 29.20 ? 149 GLU A OE2 1 
ATOM   1164 N N   . ALA A 1 146 ? 24.746  18.914  29.720  1.00 13.48 ? 150 ALA A N   1 
ATOM   1165 C CA  . ALA A 1 146 ? 23.479  19.100  29.023  1.00 12.70 ? 150 ALA A CA  1 
ATOM   1166 C C   . ALA A 1 146 ? 22.355  18.351  29.732  1.00 12.45 ? 150 ALA A C   1 
ATOM   1167 O O   . ALA A 1 146 ? 21.203  18.790  29.723  1.00 11.94 ? 150 ALA A O   1 
ATOM   1168 C CB  . ALA A 1 146 ? 23.603  18.624  27.579  1.00 13.77 ? 150 ALA A CB  1 
ATOM   1169 N N   . MET A 1 147 ? 22.690  17.212  30.333  1.00 12.36 ? 151 MET A N   1 
ATOM   1170 C CA  . MET A 1 147 ? 21.708  16.421  31.067  1.00 11.60 ? 151 MET A CA  1 
ATOM   1171 C C   . MET A 1 147 ? 21.341  17.193  32.333  1.00 11.44 ? 151 MET A C   1 
ATOM   1172 O O   . MET A 1 147 ? 20.169  17.261  32.714  1.00 9.67  ? 151 MET A O   1 
ATOM   1173 C CB  . MET A 1 147 ? 22.289  15.056  31.456  1.00 10.64 ? 151 MET A CB  1 
ATOM   1174 C CG  . MET A 1 147 ? 22.631  14.134  30.282  1.00 10.23 ? 151 MET A CG  1 
ATOM   1175 S SD  . MET A 1 147 ? 21.210  13.372  29.459  1.00 10.79 ? 151 MET A SD  1 
ATOM   1176 C CE  . MET A 1 147 ? 20.842  12.025  30.606  1.00 11.78 ? 151 MET A CE  1 
ATOM   1177 N N   . GLU A 1 148 ? 22.352  17.770  32.980  1.00 10.63 ? 152 GLU A N   1 
ATOM   1178 C CA  . GLU A 1 148 ? 22.133  18.544  34.202  1.00 13.15 ? 152 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 148 ? 21.190  19.708  33.929  1.00 13.59 ? 152 GLU A C   1 
ATOM   1180 O O   . GLU A 1 148 ? 20.327  20.020  34.751  1.00 15.34 ? 152 GLU A O   1 
ATOM   1181 C CB  . GLU A 1 148 ? 23.461  19.078  34.757  1.00 11.85 ? 152 GLU A CB  1 
ATOM   1182 C CG  . GLU A 1 148 ? 24.420  18.003  35.250  1.00 12.36 ? 152 GLU A CG  1 
ATOM   1183 C CD  . GLU A 1 148 ? 25.749  18.573  35.726  1.00 15.02 ? 152 GLU A CD  1 
ATOM   1184 O OE1 . GLU A 1 148 ? 26.205  19.583  35.151  1.00 14.18 ? 152 GLU A OE1 1 
ATOM   1185 O OE2 . GLU A 1 148 ? 26.349  18.003  36.660  1.00 14.85 ? 152 GLU A OE2 1 
ATOM   1186 N N   . LYS A 1 149 ? 21.361  20.350  32.776  1.00 14.24 ? 153 LYS A N   1 
ATOM   1187 C CA  . LYS A 1 149 ? 20.512  21.476  32.404  1.00 15.50 ? 153 LYS A CA  1 
ATOM   1188 C C   . LYS A 1 149 ? 19.074  21.012  32.211  1.00 15.07 ? 153 LYS A C   1 
ATOM   1189 O O   . LYS A 1 149 ? 18.131  21.746  32.514  1.00 14.21 ? 153 LYS A O   1 
ATOM   1190 C CB  . LYS A 1 149 ? 21.028  22.138  31.120  1.00 16.06 ? 153 LYS A CB  1 
ATOM   1191 C CG  . LYS A 1 149 ? 22.369  22.840  31.290  1.00 19.62 ? 153 LYS A CG  1 
ATOM   1192 C CD  . LYS A 1 149 ? 22.768  23.581  30.025  1.00 22.34 ? 153 LYS A CD  1 
ATOM   1193 C CE  . LYS A 1 149 ? 24.130  24.237  30.178  1.00 25.58 ? 153 LYS A CE  1 
ATOM   1194 N NZ  . LYS A 1 149 ? 24.540  24.944  28.933  1.00 28.88 ? 153 LYS A NZ  1 
ATOM   1195 N N   . CYS A 1 150 ? 18.911  19.794  31.701  1.00 14.44 ? 154 CYS A N   1 
ATOM   1196 C CA  . CYS A 1 150 ? 17.582  19.224  31.494  1.00 13.59 ? 154 CYS A CA  1 
ATOM   1197 C C   . CYS A 1 150 ? 16.888  19.023  32.838  1.00 13.65 ? 154 CYS A C   1 
ATOM   1198 O O   . CYS A 1 150 ? 15.673  19.190  32.952  1.00 13.36 ? 154 CYS A O   1 
ATOM   1199 C CB  . CYS A 1 150 ? 17.684  17.887  30.754  1.00 15.30 ? 154 CYS A CB  1 
ATOM   1200 S SG  . CYS A 1 150 ? 18.018  18.043  28.981  1.00 15.27 ? 154 CYS A SG  1 
ATOM   1201 N N   . LYS A 1 151 ? 17.665  18.656  33.854  1.00 13.40 ? 155 LYS A N   1 
ATOM   1202 C CA  . LYS A 1 151 ? 17.128  18.461  35.197  1.00 14.35 ? 155 LYS A CA  1 
ATOM   1203 C C   . LYS A 1 151 ? 16.768  19.836  35.767  1.00 14.38 ? 155 LYS A C   1 
ATOM   1204 O O   . LYS A 1 151 ? 15.707  20.014  36.358  1.00 15.68 ? 155 LYS A O   1 
ATOM   1205 C CB  . LYS A 1 151 ? 18.171  17.770  36.090  1.00 14.04 ? 155 LYS A CB  1 
ATOM   1206 C CG  . LYS A 1 151 ? 17.781  17.629  37.563  1.00 13.48 ? 155 LYS A CG  1 
ATOM   1207 C CD  . LYS A 1 151 ? 18.814  16.792  38.322  1.00 13.36 ? 155 LYS A CD  1 
ATOM   1208 C CE  . LYS A 1 151 ? 18.690  16.947  39.839  1.00 13.34 ? 155 LYS A CE  1 
ATOM   1209 N NZ  . LYS A 1 151 ? 17.384  16.483  40.387  1.00 12.40 ? 155 LYS A NZ  1 
ATOM   1210 N N   . ASP A 1 152 ? 17.648  20.814  35.570  1.00 17.07 ? 156 ASP A N   1 
ATOM   1211 C CA  . ASP A 1 152 ? 17.397  22.163  36.070  1.00 15.85 ? 156 ASP A CA  1 
ATOM   1212 C C   . ASP A 1 152 ? 16.230  22.851  35.362  1.00 17.09 ? 156 ASP A C   1 
ATOM   1213 O O   . ASP A 1 152 ? 15.655  23.806  35.890  1.00 18.20 ? 156 ASP A O   1 
ATOM   1214 C CB  . ASP A 1 152 ? 18.662  23.026  35.958  1.00 16.18 ? 156 ASP A CB  1 
ATOM   1215 C CG  . ASP A 1 152 ? 19.694  22.692  37.027  1.00 17.57 ? 156 ASP A CG  1 
ATOM   1216 O OD1 . ASP A 1 152 ? 19.291  22.333  38.152  1.00 17.39 ? 156 ASP A OD1 1 
ATOM   1217 O OD2 . ASP A 1 152 ? 20.907  22.801  36.755  1.00 19.38 ? 156 ASP A OD2 1 
ATOM   1218 N N   . ALA A 1 153 ? 15.875  22.371  34.174  1.00 16.51 ? 157 ALA A N   1 
ATOM   1219 C CA  . ALA A 1 153 ? 14.761  22.947  33.422  1.00 16.31 ? 157 ALA A CA  1 
ATOM   1220 C C   . ALA A 1 153 ? 13.456  22.258  33.804  1.00 16.96 ? 157 ALA A C   1 
ATOM   1221 O O   . ALA A 1 153 ? 12.377  22.662  33.368  1.00 16.05 ? 157 ALA A O   1 
ATOM   1222 C CB  . ALA A 1 153 ? 15.002  22.807  31.926  1.00 17.18 ? 157 ALA A CB  1 
ATOM   1223 N N   . GLY A 1 154 ? 13.562  21.211  34.616  1.00 16.51 ? 158 GLY A N   1 
ATOM   1224 C CA  . GLY A 1 154 ? 12.379  20.490  35.048  1.00 16.68 ? 158 GLY A CA  1 
ATOM   1225 C C   . GLY A 1 154 ? 11.836  19.495  34.038  1.00 16.87 ? 158 GLY A C   1 
ATOM   1226 O O   . GLY A 1 154 ? 10.732  18.979  34.214  1.00 15.90 ? 158 GLY A O   1 
ATOM   1227 N N   . LEU A 1 155 ? 12.600  19.217  32.984  1.00 13.93 ? 159 LEU A N   1 
ATOM   1228 C CA  . LEU A 1 155 ? 12.155  18.277  31.960  1.00 14.01 ? 159 LEU A CA  1 
ATOM   1229 C C   . LEU A 1 155 ? 12.297  16.831  32.438  1.00 12.29 ? 159 LEU A C   1 
ATOM   1230 O O   . LEU A 1 155 ? 11.628  15.932  31.930  1.00 12.87 ? 159 LEU A O   1 
ATOM   1231 C CB  . LEU A 1 155 ? 12.942  18.493  30.664  1.00 13.75 ? 159 LEU A CB  1 
ATOM   1232 C CG  . LEU A 1 155 ? 12.783  19.902  30.077  1.00 18.56 ? 159 LEU A CG  1 
ATOM   1233 C CD1 . LEU A 1 155 ? 13.554  20.003  28.772  1.00 20.23 ? 159 LEU A CD1 1 
ATOM   1234 C CD2 . LEU A 1 155 ? 11.298  20.205  29.849  1.00 17.35 ? 159 LEU A CD2 1 
ATOM   1235 N N   . THR A 1 156 ? 13.175  16.627  33.416  1.00 13.88 ? 160 THR A N   1 
ATOM   1236 C CA  . THR A 1 156 ? 13.402  15.316  34.017  1.00 13.33 ? 160 THR A CA  1 
ATOM   1237 C C   . THR A 1 156 ? 13.739  15.551  35.489  1.00 13.48 ? 160 THR A C   1 
ATOM   1238 O O   . THR A 1 156 ? 14.474  16.482  35.818  1.00 13.30 ? 160 THR A O   1 
ATOM   1239 C CB  . THR A 1 156 ? 14.568  14.552  33.331  1.00 12.83 ? 160 THR A CB  1 
ATOM   1240 O OG1 . THR A 1 156 ? 14.732  13.272  33.957  1.00 13.27 ? 160 THR A OG1 1 
ATOM   1241 C CG2 . THR A 1 156 ? 15.872  15.331  33.441  1.00 12.85 ? 160 THR A CG2 1 
ATOM   1242 N N   . LYS A 1 157 ? 13.193  14.724  36.375  1.00 13.66 ? 161 LYS A N   1 
ATOM   1243 C CA  . LYS A 1 157 ? 13.451  14.882  37.802  1.00 13.76 ? 161 LYS A CA  1 
ATOM   1244 C C   . LYS A 1 157 ? 14.865  14.455  38.181  1.00 13.15 ? 161 LYS A C   1 
ATOM   1245 O O   . LYS A 1 157 ? 15.514  15.096  39.012  1.00 14.69 ? 161 LYS A O   1 
ATOM   1246 C CB  . LYS A 1 157 ? 12.432  14.084  38.621  1.00 14.75 ? 161 LYS A CB  1 
ATOM   1247 C CG  . LYS A 1 157 ? 10.988  14.539  38.420  1.00 16.85 ? 161 LYS A CG  1 
ATOM   1248 C CD  . LYS A 1 157 ? 10.009  13.754  39.285  1.00 19.99 ? 161 LYS A CD  1 
ATOM   1249 C CE  . LYS A 1 157 ? 10.252  13.990  40.771  1.00 24.10 ? 161 LYS A CE  1 
ATOM   1250 N NZ  . LYS A 1 157 ? 9.327   13.191  41.624  1.00 24.15 ? 161 LYS A NZ  1 
ATOM   1251 N N   . SER A 1 158 ? 15.337  13.371  37.573  1.00 10.80 ? 162 SER A N   1 
ATOM   1252 C CA  . SER A 1 158 ? 16.675  12.854  37.851  1.00 9.64  ? 162 SER A CA  1 
ATOM   1253 C C   . SER A 1 158 ? 17.402  12.474  36.566  1.00 8.33  ? 162 SER A C   1 
ATOM   1254 O O   . SER A 1 158 ? 16.788  12.323  35.511  1.00 7.99  ? 162 SER A O   1 
ATOM   1255 C CB  . SER A 1 158 ? 16.585  11.612  38.751  1.00 8.45  ? 162 SER A CB  1 
ATOM   1256 O OG  . SER A 1 158 ? 15.891  11.889  39.952  1.00 9.15  ? 162 SER A OG  1 
ATOM   1257 N N   . ILE A 1 159 ? 18.716  12.314  36.665  1.00 7.67  ? 163 ILE A N   1 
ATOM   1258 C CA  . ILE A 1 159 ? 19.519  11.924  35.514  1.00 8.04  ? 163 ILE A CA  1 
ATOM   1259 C C   . ILE A 1 159 ? 20.523  10.856  35.914  1.00 7.89  ? 163 ILE A C   1 
ATOM   1260 O O   . ILE A 1 159 ? 21.020  10.850  37.040  1.00 8.48  ? 163 ILE A O   1 
ATOM   1261 C CB  . ILE A 1 159 ? 20.277  13.131  34.911  1.00 8.48  ? 163 ILE A CB  1 
ATOM   1262 C CG1 . ILE A 1 159 ? 21.013  13.896  36.014  1.00 11.89 ? 163 ILE A CG1 1 
ATOM   1263 C CG2 . ILE A 1 159 ? 19.298  14.036  34.171  1.00 8.03  ? 163 ILE A CG2 1 
ATOM   1264 C CD1 . ILE A 1 159 ? 21.819  15.081  35.499  1.00 13.17 ? 163 ILE A CD1 1 
ATOM   1265 N N   . GLY A 1 160 ? 20.811  9.946   34.987  1.00 7.62  ? 164 GLY A N   1 
ATOM   1266 C CA  . GLY A 1 160 ? 21.758  8.883   35.262  1.00 6.87  ? 164 GLY A CA  1 
ATOM   1267 C C   . GLY A 1 160 ? 22.378  8.393   33.971  1.00 5.53  ? 164 GLY A C   1 
ATOM   1268 O O   . GLY A 1 160 ? 22.265  9.050   32.934  1.00 7.42  ? 164 GLY A O   1 
ATOM   1269 N N   . VAL A 1 161 ? 23.034  7.241   34.026  1.00 6.44  ? 165 VAL A N   1 
ATOM   1270 C CA  . VAL A 1 161 ? 23.663  6.684   32.840  1.00 7.13  ? 165 VAL A CA  1 
ATOM   1271 C C   . VAL A 1 161 ? 23.342  5.202   32.703  1.00 7.27  ? 165 VAL A C   1 
ATOM   1272 O O   . VAL A 1 161 ? 22.745  4.597   33.599  1.00 6.70  ? 165 VAL A O   1 
ATOM   1273 C CB  . VAL A 1 161 ? 25.203  6.884   32.870  1.00 7.71  ? 165 VAL A CB  1 
ATOM   1274 C CG1 . VAL A 1 161 ? 25.525  8.367   33.006  1.00 7.92  ? 165 VAL A CG1 1 
ATOM   1275 C CG2 . VAL A 1 161 ? 25.818  6.107   34.016  1.00 7.58  ? 165 VAL A CG2 1 
ATOM   1276 N N   . SER A 1 162 ? 23.730  4.634   31.565  1.00 6.85  ? 166 SER A N   1 
ATOM   1277 C CA  . SER A 1 162 ? 23.497  3.224   31.284  1.00 6.34  ? 166 SER A CA  1 
ATOM   1278 C C   . SER A 1 162 ? 24.694  2.661   30.530  1.00 6.70  ? 166 SER A C   1 
ATOM   1279 O O   . SER A 1 162 ? 25.265  3.325   29.664  1.00 5.22  ? 166 SER A O   1 
ATOM   1280 C CB  . SER A 1 162 ? 22.215  3.057   30.448  1.00 7.25  ? 166 SER A CB  1 
ATOM   1281 O OG  . SER A 1 162 ? 21.966  1.693   30.125  1.00 7.33  ? 166 SER A OG  1 
ATOM   1282 N N   . ASN A 1 163 ? 25.091  1.443   30.890  1.00 7.11  ? 167 ASN A N   1 
ATOM   1283 C CA  . ASN A 1 163 ? 26.204  0.770   30.237  1.00 7.20  ? 167 ASN A CA  1 
ATOM   1284 C C   . ASN A 1 163 ? 27.555  1.496   30.360  1.00 8.19  ? 167 ASN A C   1 
ATOM   1285 O O   . ASN A 1 163 ? 28.376  1.457   29.445  1.00 6.53  ? 167 ASN A O   1 
ATOM   1286 C CB  . ASN A 1 163 ? 25.854  0.524   28.764  1.00 6.01  ? 167 ASN A CB  1 
ATOM   1287 C CG  . ASN A 1 163 ? 24.584  -0.307  28.600  1.00 7.51  ? 167 ASN A CG  1 
ATOM   1288 O OD1 . ASN A 1 163 ? 23.603  0.125   27.972  1.00 9.55  ? 167 ASN A OD1 1 
ATOM   1289 N ND2 . ASN A 1 163 ? 24.592  -1.498  29.170  1.00 3.47  ? 167 ASN A ND2 1 
ATOM   1290 N N   . PHE A 1 164 ? 27.775  2.152   31.498  1.00 6.77  ? 168 PHE A N   1 
ATOM   1291 C CA  . PHE A 1 164 ? 29.036  2.844   31.768  1.00 7.94  ? 168 PHE A CA  1 
ATOM   1292 C C   . PHE A 1 164 ? 29.889  1.928   32.645  1.00 8.31  ? 168 PHE A C   1 
ATOM   1293 O O   . PHE A 1 164 ? 29.357  1.202   33.493  1.00 10.28 ? 168 PHE A O   1 
ATOM   1294 C CB  . PHE A 1 164 ? 28.791  4.154   32.539  1.00 9.88  ? 168 PHE A CB  1 
ATOM   1295 C CG  . PHE A 1 164 ? 28.490  5.345   31.665  1.00 10.08 ? 168 PHE A CG  1 
ATOM   1296 C CD1 . PHE A 1 164 ? 27.553  5.265   30.642  1.00 4.95  ? 168 PHE A CD1 1 
ATOM   1297 C CD2 . PHE A 1 164 ? 29.132  6.563   31.890  1.00 7.47  ? 168 PHE A CD2 1 
ATOM   1298 C CE1 . PHE A 1 164 ? 27.257  6.379   29.856  1.00 7.42  ? 168 PHE A CE1 1 
ATOM   1299 C CE2 . PHE A 1 164 ? 28.844  7.678   31.115  1.00 9.06  ? 168 PHE A CE2 1 
ATOM   1300 C CZ  . PHE A 1 164 ? 27.905  7.591   30.094  1.00 6.56  ? 168 PHE A CZ  1 
ATOM   1301 N N   . ASN A 1 165 ? 31.201  1.940   32.443  1.00 9.56  ? 169 ASN A N   1 
ATOM   1302 C CA  . ASN A 1 165 ? 32.072  1.129   33.280  1.00 9.47  ? 169 ASN A CA  1 
ATOM   1303 C C   . ASN A 1 165 ? 32.651  2.039   34.365  1.00 11.61 ? 169 ASN A C   1 
ATOM   1304 O O   . ASN A 1 165 ? 32.354  3.239   34.404  1.00 9.27  ? 169 ASN A O   1 
ATOM   1305 C CB  . ASN A 1 165 ? 33.204  0.459   32.470  1.00 8.88  ? 169 ASN A CB  1 
ATOM   1306 C CG  . ASN A 1 165 ? 34.105  1.458   31.750  1.00 9.47  ? 169 ASN A CG  1 
ATOM   1307 O OD1 . ASN A 1 165 ? 34.378  2.541   32.254  1.00 12.47 ? 169 ASN A OD1 1 
ATOM   1308 N ND2 . ASN A 1 165 ? 34.589  1.075   30.569  1.00 11.24 ? 169 ASN A ND2 1 
ATOM   1309 N N   . TYR A 1 166 ? 33.451  1.452   35.247  1.00 11.61 ? 170 TYR A N   1 
ATOM   1310 C CA  . TYR A 1 166 ? 34.087  2.159   36.356  1.00 14.16 ? 170 TYR A CA  1 
ATOM   1311 C C   . TYR A 1 166 ? 34.804  3.447   35.947  1.00 11.45 ? 170 TYR A C   1 
ATOM   1312 O O   . TYR A 1 166 ? 34.597  4.497   36.550  1.00 13.20 ? 170 TYR A O   1 
ATOM   1313 C CB  . TYR A 1 166 ? 35.087  1.219   37.047  1.00 17.53 ? 170 TYR A CB  1 
ATOM   1314 C CG  . TYR A 1 166 ? 36.095  1.930   37.916  1.00 21.29 ? 170 TYR A CG  1 
ATOM   1315 C CD1 . TYR A 1 166 ? 35.704  2.565   39.090  1.00 23.47 ? 170 TYR A CD1 1 
ATOM   1316 C CD2 . TYR A 1 166 ? 37.439  1.993   37.548  1.00 24.92 ? 170 TYR A CD2 1 
ATOM   1317 C CE1 . TYR A 1 166 ? 36.622  3.250   39.881  1.00 26.61 ? 170 TYR A CE1 1 
ATOM   1318 C CE2 . TYR A 1 166 ? 38.369  2.677   38.332  1.00 27.02 ? 170 TYR A CE2 1 
ATOM   1319 C CZ  . TYR A 1 166 ? 37.951  3.305   39.499  1.00 28.76 ? 170 TYR A CZ  1 
ATOM   1320 O OH  . TYR A 1 166 ? 38.854  3.989   40.287  1.00 29.74 ? 170 TYR A OH  1 
ATOM   1321 N N   . ARG A 1 167 ? 35.660  3.354   34.937  1.00 12.03 ? 171 ARG A N   1 
ATOM   1322 C CA  . ARG A 1 167 ? 36.420  4.509   34.465  1.00 12.11 ? 171 ARG A CA  1 
ATOM   1323 C C   . ARG A 1 167 ? 35.532  5.617   33.914  1.00 11.14 ? 171 ARG A C   1 
ATOM   1324 O O   . ARG A 1 167 ? 35.802  6.798   34.124  1.00 11.98 ? 171 ARG A O   1 
ATOM   1325 C CB  . ARG A 1 167 ? 37.433  4.068   33.404  1.00 14.38 ? 171 ARG A CB  1 
ATOM   1326 C CG  . ARG A 1 167 ? 38.513  3.141   33.952  1.00 20.43 ? 171 ARG A CG  1 
ATOM   1327 C CD  . ARG A 1 167 ? 39.308  2.469   32.834  1.00 27.36 ? 171 ARG A CD  1 
ATOM   1328 N NE  . ARG A 1 167 ? 40.218  3.384   32.153  1.00 30.33 ? 171 ARG A NE  1 
ATOM   1329 C CZ  . ARG A 1 167 ? 40.872  3.093   31.032  1.00 32.24 ? 171 ARG A CZ  1 
ATOM   1330 N NH1 . ARG A 1 167 ? 40.717  1.906   30.458  1.00 32.16 ? 171 ARG A NH1 1 
ATOM   1331 N NH2 . ARG A 1 167 ? 41.681  3.989   30.482  1.00 30.15 ? 171 ARG A NH2 1 
ATOM   1332 N N   . GLN A 1 168 ? 34.467  5.240   33.214  1.00 11.08 ? 172 GLN A N   1 
ATOM   1333 C CA  . GLN A 1 168 ? 33.555  6.229   32.647  1.00 9.22  ? 172 GLN A CA  1 
ATOM   1334 C C   . GLN A 1 168 ? 32.725  6.932   33.721  1.00 10.28 ? 172 GLN A C   1 
ATOM   1335 O O   . GLN A 1 168 ? 32.416  8.121   33.595  1.00 9.71  ? 172 GLN A O   1 
ATOM   1336 C CB  . GLN A 1 168 ? 32.679  5.557   31.587  1.00 10.02 ? 172 GLN A CB  1 
ATOM   1337 C CG  . GLN A 1 168 ? 33.542  4.970   30.464  1.00 8.14  ? 172 GLN A CG  1 
ATOM   1338 C CD  . GLN A 1 168 ? 32.768  4.111   29.486  1.00 10.08 ? 172 GLN A CD  1 
ATOM   1339 O OE1 . GLN A 1 168 ? 31.870  3.363   29.876  1.00 8.20  ? 172 GLN A OE1 1 
ATOM   1340 N NE2 . GLN A 1 168 ? 33.129  4.199   28.206  1.00 9.62  ? 172 GLN A NE2 1 
ATOM   1341 N N   . LEU A 1 169 ? 32.365  6.211   34.779  1.00 8.80  ? 173 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 169 ? 31.622  6.828   35.875  1.00 9.89  ? 173 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 169 ? 32.565  7.819   36.561  1.00 10.22 ? 173 LEU A C   1 
ATOM   1344 O O   . LEU A 1 169 ? 32.170  8.932   36.898  1.00 10.45 ? 173 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 169 ? 31.165  5.778   36.892  1.00 8.72  ? 173 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 169 ? 30.025  4.863   36.448  1.00 10.26 ? 173 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 169 ? 29.708  3.871   37.553  1.00 10.95 ? 173 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 169 ? 28.793  5.709   36.116  1.00 9.66  ? 173 LEU A CD2 1 
ATOM   1349 N N   . GLU A 1 170 ? 33.814  7.404   36.762  1.00 12.40 ? 174 GLU A N   1 
ATOM   1350 C CA  . GLU A 1 170 ? 34.813  8.270   37.395  1.00 15.05 ? 174 GLU A CA  1 
ATOM   1351 C C   . GLU A 1 170 ? 34.967  9.556   36.591  1.00 15.99 ? 174 GLU A C   1 
ATOM   1352 O O   . GLU A 1 170 ? 35.085  10.645  37.153  1.00 16.20 ? 174 GLU A O   1 
ATOM   1353 C CB  . GLU A 1 170 ? 36.165  7.554   37.475  1.00 16.19 ? 174 GLU A CB  1 
ATOM   1354 C CG  . GLU A 1 170 ? 36.263  6.510   38.578  1.00 18.64 ? 174 GLU A CG  1 
ATOM   1355 C CD  . GLU A 1 170 ? 36.244  7.128   39.964  1.00 21.30 ? 174 GLU A CD  1 
ATOM   1356 O OE1 . GLU A 1 170 ? 35.212  7.711   40.352  0.75 21.15 ? 174 GLU A OE1 1 
ATOM   1357 O OE2 . GLU A 1 170 ? 37.270  7.039   40.666  0.75 24.10 ? 174 GLU A OE2 1 
ATOM   1358 N N   . MET A 1 171 ? 34.973  9.413   35.269  1.00 16.21 ? 175 MET A N   1 
ATOM   1359 C CA  . MET A 1 171 ? 35.102  10.544  34.359  1.00 17.21 ? 175 MET A CA  1 
ATOM   1360 C C   . MET A 1 171 ? 34.077  11.617  34.692  1.00 15.96 ? 175 MET A C   1 
ATOM   1361 O O   . MET A 1 171 ? 34.372  12.811  34.649  1.00 14.21 ? 175 MET A O   1 
ATOM   1362 C CB  . MET A 1 171 ? 34.909  10.063  32.915  1.00 21.04 ? 175 MET A CB  1 
ATOM   1363 C CG  . MET A 1 171 ? 34.542  11.143  31.909  1.00 25.40 ? 175 MET A CG  1 
ATOM   1364 S SD  . MET A 1 171 ? 34.206  10.428  30.275  1.00 33.20 ? 175 MET A SD  1 
ATOM   1365 C CE  . MET A 1 171 ? 32.571  9.686   30.547  1.00 28.59 ? 175 MET A CE  1 
ATOM   1366 N N   . ILE A 1 172 ? 32.866  11.183  35.020  1.00 15.02 ? 176 ILE A N   1 
ATOM   1367 C CA  . ILE A 1 172 ? 31.793  12.104  35.359  1.00 13.21 ? 176 ILE A CA  1 
ATOM   1368 C C   . ILE A 1 172 ? 31.895  12.559  36.815  1.00 14.75 ? 176 ILE A C   1 
ATOM   1369 O O   . ILE A 1 172 ? 31.735  13.744  37.115  1.00 13.46 ? 176 ILE A O   1 
ATOM   1370 C CB  . ILE A 1 172 ? 30.408  11.446  35.139  1.00 13.70 ? 176 ILE A CB  1 
ATOM   1371 C CG1 . ILE A 1 172 ? 30.248  11.024  33.673  1.00 15.39 ? 176 ILE A CG1 1 
ATOM   1372 C CG2 . ILE A 1 172 ? 29.305  12.409  35.536  1.00 12.90 ? 176 ILE A CG2 1 
ATOM   1373 C CD1 . ILE A 1 172 ? 30.300  12.171  32.684  1.00 18.82 ? 176 ILE A CD1 1 
ATOM   1374 N N   . LEU A 1 173 ? 32.170  11.618  37.714  1.00 13.95 ? 177 LEU A N   1 
ATOM   1375 C CA  . LEU A 1 173 ? 32.275  11.922  39.141  1.00 15.32 ? 177 LEU A CA  1 
ATOM   1376 C C   . LEU A 1 173 ? 33.410  12.887  39.498  1.00 17.08 ? 177 LEU A C   1 
ATOM   1377 O O   . LEU A 1 173 ? 33.311  13.632  40.478  1.00 15.62 ? 177 LEU A O   1 
ATOM   1378 C CB  . LEU A 1 173 ? 32.444  10.625  39.940  1.00 16.04 ? 177 LEU A CB  1 
ATOM   1379 C CG  . LEU A 1 173 ? 31.279  9.633   39.858  1.00 15.01 ? 177 LEU A CG  1 
ATOM   1380 C CD1 . LEU A 1 173 ? 31.636  8.347   40.585  1.00 15.37 ? 177 LEU A CD1 1 
ATOM   1381 C CD2 . LEU A 1 173 ? 30.031  10.263  40.466  1.00 13.63 ? 177 LEU A CD2 1 
ATOM   1382 N N   . ASN A 1 174 ? 34.480  12.877  38.709  1.00 17.39 ? 178 ASN A N   1 
ATOM   1383 C CA  . ASN A 1 174 ? 35.622  13.750  38.974  1.00 19.94 ? 178 ASN A CA  1 
ATOM   1384 C C   . ASN A 1 174 ? 35.612  15.011  38.122  1.00 21.38 ? 178 ASN A C   1 
ATOM   1385 O O   . ASN A 1 174 ? 36.555  15.806  38.163  1.00 21.00 ? 178 ASN A O   1 
ATOM   1386 C CB  . ASN A 1 174 ? 36.934  13.002  38.732  1.00 20.10 ? 178 ASN A CB  1 
ATOM   1387 C CG  . ASN A 1 174 ? 37.099  11.806  39.643  1.00 20.91 ? 178 ASN A CG  1 
ATOM   1388 O OD1 . ASN A 1 174 ? 36.586  11.791  40.763  1.00 22.54 ? 178 ASN A OD1 1 
ATOM   1389 N ND2 . ASN A 1 174 ? 37.832  10.800  39.175  1.00 20.74 ? 178 ASN A ND2 1 
ATOM   1390 N N   . LYS A 1 175 ? 34.543  15.196  37.358  1.00 20.78 ? 179 LYS A N   1 
ATOM   1391 C CA  . LYS A 1 175 ? 34.426  16.352  36.485  1.00 22.17 ? 179 LYS A CA  1 
ATOM   1392 C C   . LYS A 1 175 ? 34.435  17.682  37.225  1.00 23.61 ? 179 LYS A C   1 
ATOM   1393 O O   . LYS A 1 175 ? 33.642  17.903  38.141  1.00 23.79 ? 179 LYS A O   1 
ATOM   1394 C CB  . LYS A 1 175 ? 33.142  16.263  35.656  1.00 20.24 ? 179 LYS A CB  1 
ATOM   1395 C CG  . LYS A 1 175 ? 32.895  17.472  34.764  1.00 23.79 ? 179 LYS A CG  1 
ATOM   1396 C CD  . LYS A 1 175 ? 31.531  17.396  34.096  1.00 22.23 ? 179 LYS A CD  1 
ATOM   1397 C CE  . LYS A 1 175 ? 31.241  18.646  33.291  1.00 26.56 ? 179 LYS A CE  1 
ATOM   1398 N NZ  . LYS A 1 175 ? 31.149  19.853  34.154  1.00 24.89 ? 179 LYS A NZ  1 
ATOM   1399 N N   . PRO A 1 176 ? 35.350  18.585  36.844  0.75 24.73 ? 180 PRO A N   1 
ATOM   1400 C CA  . PRO A 1 176 ? 35.380  19.881  37.522  0.75 24.45 ? 180 PRO A CA  1 
ATOM   1401 C C   . PRO A 1 176 ? 34.090  20.619  37.159  0.75 23.47 ? 180 PRO A C   1 
ATOM   1402 O O   . PRO A 1 176 ? 33.743  20.736  35.981  0.75 24.62 ? 180 PRO A O   1 
ATOM   1403 C CB  . PRO A 1 176 ? 36.619  20.547  36.931  0.75 25.84 ? 180 PRO A CB  1 
ATOM   1404 C CG  . PRO A 1 176 ? 37.518  19.380  36.649  0.75 26.46 ? 180 PRO A CG  1 
ATOM   1405 C CD  . PRO A 1 176 ? 36.557  18.395  36.022  0.75 25.00 ? 180 PRO A CD  1 
ATOM   1406 N N   . GLY A 1 177 ? 33.370  21.088  38.171  0.75 21.52 ? 181 GLY A N   1 
ATOM   1407 C CA  . GLY A 1 177 ? 32.129  21.799  37.925  1.00 21.23 ? 181 GLY A CA  1 
ATOM   1408 C C   . GLY A 1 177 ? 30.901  20.906  37.971  1.00 20.20 ? 181 GLY A C   1 
ATOM   1409 O O   . GLY A 1 177 ? 29.781  21.371  37.742  1.00 20.13 ? 181 GLY A O   1 
ATOM   1410 N N   . LEU A 1 178 ? 31.104  19.624  38.258  1.00 19.67 ? 182 LEU A N   1 
ATOM   1411 C CA  . LEU A 1 178 ? 29.991  18.677  38.335  1.00 18.24 ? 182 LEU A CA  1 
ATOM   1412 C C   . LEU A 1 178 ? 28.908  19.205  39.267  1.00 19.30 ? 182 LEU A C   1 
ATOM   1413 O O   . LEU A 1 178 ? 29.193  19.614  40.393  1.00 20.64 ? 182 LEU A O   1 
ATOM   1414 C CB  . LEU A 1 178 ? 30.477  17.323  38.855  1.00 17.83 ? 182 LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 178 ? 29.397  16.260  39.090  1.00 17.67 ? 182 LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 178 ? 28.835  15.794  37.749  1.00 16.01 ? 182 LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 178 ? 29.987  15.089  39.859  1.00 15.88 ? 182 LEU A CD2 1 
ATOM   1418 N N   . LYS A 1 179 ? 27.663  19.192  38.808  1.00 18.01 ? 183 LYS A N   1 
ATOM   1419 C CA  . LYS A 1 179 ? 26.569  19.671  39.639  1.00 17.61 ? 183 LYS A CA  1 
ATOM   1420 C C   . LYS A 1 179 ? 25.757  18.521  40.232  1.00 17.64 ? 183 LYS A C   1 
ATOM   1421 O O   . LYS A 1 179 ? 25.459  18.517  41.428  1.00 14.88 ? 183 LYS A O   1 
ATOM   1422 C CB  . LYS A 1 179 ? 25.651  20.576  38.828  1.00 18.66 ? 183 LYS A CB  1 
ATOM   1423 C CG  . LYS A 1 179 ? 24.575  21.248  39.654  1.00 20.04 ? 183 LYS A CG  1 
ATOM   1424 C CD  . LYS A 1 179 ? 23.842  22.288  38.830  1.00 20.74 ? 183 LYS A CD  1 
ATOM   1425 C CE  . LYS A 1 179 ? 22.856  23.070  39.681  1.00 20.92 ? 183 LYS A CE  1 
ATOM   1426 N NZ  . LYS A 1 179 ? 22.190  24.121  38.876  1.00 19.20 ? 183 LYS A NZ  1 
ATOM   1427 N N   . TYR A 1 180 ? 25.401  17.551  39.393  1.00 14.13 ? 184 TYR A N   1 
ATOM   1428 C CA  . TYR A 1 180 ? 24.621  16.406  39.845  1.00 15.53 ? 184 TYR A CA  1 
ATOM   1429 C C   . TYR A 1 180 ? 25.275  15.086  39.464  1.00 14.72 ? 184 TYR A C   1 
ATOM   1430 O O   . TYR A 1 180 ? 25.573  14.846  38.296  1.00 15.58 ? 184 TYR A O   1 
ATOM   1431 C CB  . TYR A 1 180 ? 23.217  16.435  39.237  1.00 15.62 ? 184 TYR A CB  1 
ATOM   1432 C CG  . TYR A 1 180 ? 22.437  17.700  39.487  1.00 16.85 ? 184 TYR A CG  1 
ATOM   1433 C CD1 . TYR A 1 180 ? 22.079  18.538  38.430  1.00 16.82 ? 184 TYR A CD1 1 
ATOM   1434 C CD2 . TYR A 1 180 ? 22.034  18.052  40.775  1.00 16.62 ? 184 TYR A CD2 1 
ATOM   1435 C CE1 . TYR A 1 180 ? 21.333  19.695  38.648  1.00 17.60 ? 184 TYR A CE1 1 
ATOM   1436 C CE2 . TYR A 1 180 ? 21.290  19.207  41.006  1.00 18.22 ? 184 TYR A CE2 1 
ATOM   1437 C CZ  . TYR A 1 180 ? 20.943  20.023  39.939  1.00 18.20 ? 184 TYR A CZ  1 
ATOM   1438 O OH  . TYR A 1 180 ? 20.207  21.163  40.158  1.00 15.42 ? 184 TYR A OH  1 
ATOM   1439 N N   . LYS A 1 181 ? 25.510  14.237  40.459  1.00 13.93 ? 185 LYS A N   1 
ATOM   1440 C CA  . LYS A 1 181 ? 26.093  12.924  40.215  1.00 13.77 ? 185 LYS A CA  1 
ATOM   1441 C C   . LYS A 1 181 ? 25.014  12.079  39.548  1.00 13.09 ? 185 LYS A C   1 
ATOM   1442 O O   . LYS A 1 181 ? 23.825  12.354  39.705  1.00 12.94 ? 185 LYS A O   1 
ATOM   1443 C CB  . LYS A 1 181 ? 26.484  12.260  41.543  1.00 14.69 ? 185 LYS A CB  1 
ATOM   1444 C CG  . LYS A 1 181 ? 27.670  12.895  42.250  1.00 18.37 ? 185 LYS A CG  1 
ATOM   1445 C CD  . LYS A 1 181 ? 27.696  12.551  43.739  1.00 22.15 ? 185 LYS A CD  1 
ATOM   1446 C CE  . LYS A 1 181 ? 27.612  11.060  43.993  1.00 22.19 ? 185 LYS A CE  1 
ATOM   1447 N NZ  . LYS A 1 181 ? 27.733  10.738  45.448  1.00 25.49 ? 185 LYS A NZ  1 
ATOM   1448 N N   . PRO A 1 182 ? 25.411  11.053  38.776  1.00 11.91 ? 186 PRO A N   1 
ATOM   1449 C CA  . PRO A 1 182 ? 24.406  10.204  38.129  1.00 11.09 ? 186 PRO A CA  1 
ATOM   1450 C C   . PRO A 1 182 ? 23.671  9.491   39.261  1.00 9.39  ? 186 PRO A C   1 
ATOM   1451 O O   . PRO A 1 182 ? 24.311  9.027   40.204  1.00 10.74 ? 186 PRO A O   1 
ATOM   1452 C CB  . PRO A 1 182 ? 25.247  9.224   37.314  1.00 12.34 ? 186 PRO A CB  1 
ATOM   1453 C CG  . PRO A 1 182 ? 26.508  9.993   37.033  1.00 14.14 ? 186 PRO A CG  1 
ATOM   1454 C CD  . PRO A 1 182 ? 26.771  10.688  38.346  1.00 12.04 ? 186 PRO A CD  1 
ATOM   1455 N N   . VAL A 1 183 ? 22.347  9.404   39.199  1.00 9.37  ? 187 VAL A N   1 
ATOM   1456 C CA  . VAL A 1 183 ? 21.633  8.719   40.273  1.00 8.65  ? 187 VAL A CA  1 
ATOM   1457 C C   . VAL A 1 183 ? 21.715  7.210   40.108  1.00 8.25  ? 187 VAL A C   1 
ATOM   1458 O O   . VAL A 1 183 ? 21.537  6.467   41.072  1.00 10.92 ? 187 VAL A O   1 
ATOM   1459 C CB  . VAL A 1 183 ? 20.128  9.115   40.347  1.00 7.53  ? 187 VAL A CB  1 
ATOM   1460 C CG1 . VAL A 1 183 ? 19.995  10.605  40.530  1.00 10.06 ? 187 VAL A CG1 1 
ATOM   1461 C CG2 . VAL A 1 183 ? 19.388  8.650   39.099  1.00 7.29  ? 187 VAL A CG2 1 
ATOM   1462 N N   . CYS A 1 184 ? 22.011  6.756   38.894  1.00 9.65  ? 188 CYS A N   1 
ATOM   1463 C CA  . CYS A 1 184 ? 22.079  5.322   38.635  1.00 9.14  ? 188 CYS A CA  1 
ATOM   1464 C C   . CYS A 1 184 ? 22.931  4.955   37.427  1.00 8.53  ? 188 CYS A C   1 
ATOM   1465 O O   . CYS A 1 184 ? 23.349  5.812   36.653  1.00 8.12  ? 188 CYS A O   1 
ATOM   1466 C CB  . CYS A 1 184 ? 20.663  4.783   38.391  1.00 8.60  ? 188 CYS A CB  1 
ATOM   1467 S SG  . CYS A 1 184 ? 19.976  5.322   36.790  1.00 9.27  ? 188 CYS A SG  1 
ATOM   1468 N N   . ASN A 1 185 ? 23.191  3.660   37.294  1.00 8.54  ? 189 ASN A N   1 
ATOM   1469 C CA  . ASN A 1 185 ? 23.915  3.110   36.160  1.00 7.16  ? 189 ASN A CA  1 
ATOM   1470 C C   . ASN A 1 185 ? 23.123  1.852   35.801  1.00 8.05  ? 189 ASN A C   1 
ATOM   1471 O O   . ASN A 1 185 ? 23.156  0.866   36.538  1.00 6.96  ? 189 ASN A O   1 
ATOM   1472 C CB  . ASN A 1 185 ? 25.357  2.749   36.536  1.00 6.96  ? 189 ASN A CB  1 
ATOM   1473 C CG  . ASN A 1 185 ? 26.176  2.299   35.338  1.00 5.86  ? 189 ASN A CG  1 
ATOM   1474 O OD1 . ASN A 1 185 ? 25.826  2.576   34.192  1.00 6.90  ? 189 ASN A OD1 1 
ATOM   1475 N ND2 . ASN A 1 185 ? 27.285  1.618   35.601  1.00 7.61  ? 189 ASN A ND2 1 
ATOM   1476 N N   . GLN A 1 186 ? 22.371  1.910   34.704  1.00 7.09  ? 190 GLN A N   1 
ATOM   1477 C CA  . GLN A 1 186 ? 21.582  0.761   34.264  1.00 5.34  ? 190 GLN A CA  1 
ATOM   1478 C C   . GLN A 1 186 ? 22.457  -0.146  33.404  1.00 4.29  ? 190 GLN A C   1 
ATOM   1479 O O   . GLN A 1 186 ? 22.903  0.234   32.320  1.00 6.42  ? 190 GLN A O   1 
ATOM   1480 C CB  . GLN A 1 186 ? 20.349  1.215   33.469  1.00 3.59  ? 190 GLN A CB  1 
ATOM   1481 C CG  . GLN A 1 186 ? 19.471  0.041   32.998  1.00 1.11  ? 190 GLN A CG  1 
ATOM   1482 C CD  . GLN A 1 186 ? 18.197  0.495   32.302  1.00 5.38  ? 190 GLN A CD  1 
ATOM   1483 O OE1 . GLN A 1 186 ? 17.816  -0.048  31.259  1.00 8.50  ? 190 GLN A OE1 1 
ATOM   1484 N NE2 . GLN A 1 186 ? 17.526  1.484   32.881  1.00 4.65  ? 190 GLN A NE2 1 
ATOM   1485 N N   . VAL A 1 187 ? 22.714  -1.345  33.911  1.00 4.08  ? 191 VAL A N   1 
ATOM   1486 C CA  . VAL A 1 187 ? 23.553  -2.312  33.226  1.00 3.79  ? 191 VAL A CA  1 
ATOM   1487 C C   . VAL A 1 187 ? 22.955  -3.715  33.301  1.00 6.46  ? 191 VAL A C   1 
ATOM   1488 O O   . VAL A 1 187 ? 21.996  -3.964  34.035  1.00 6.97  ? 191 VAL A O   1 
ATOM   1489 C CB  . VAL A 1 187 ? 24.953  -2.370  33.873  1.00 5.58  ? 191 VAL A CB  1 
ATOM   1490 C CG1 . VAL A 1 187 ? 25.679  -1.036  33.693  1.00 7.27  ? 191 VAL A CG1 1 
ATOM   1491 C CG2 . VAL A 1 187 ? 24.811  -2.698  35.357  1.00 5.62  ? 191 VAL A CG2 1 
ATOM   1492 N N   . GLU A 1 188 ? 23.547  -4.633  32.548  1.00 6.27  ? 192 GLU A N   1 
ATOM   1493 C CA  . GLU A 1 188 ? 23.096  -6.017  32.537  1.00 6.00  ? 192 GLU A CA  1 
ATOM   1494 C C   . GLU A 1 188 ? 23.559  -6.679  33.832  1.00 6.36  ? 192 GLU A C   1 
ATOM   1495 O O   . GLU A 1 188 ? 24.706  -6.505  34.246  1.00 6.40  ? 192 GLU A O   1 
ATOM   1496 C CB  . GLU A 1 188 ? 23.713  -6.751  31.343  1.00 4.40  ? 192 GLU A CB  1 
ATOM   1497 C CG  . GLU A 1 188 ? 23.212  -8.181  31.136  1.00 6.21  ? 192 GLU A CG  1 
ATOM   1498 C CD  . GLU A 1 188 ? 23.952  -8.895  30.015  1.00 7.44  ? 192 GLU A CD  1 
ATOM   1499 O OE1 . GLU A 1 188 ? 24.353  -8.218  29.040  1.00 6.67  ? 192 GLU A OE1 1 
ATOM   1500 O OE2 . GLU A 1 188 ? 24.121  -10.131 30.097  1.00 5.89  ? 192 GLU A OE2 1 
ATOM   1501 N N   . CYS A 1 189 ? 22.675  -7.429  34.479  1.00 5.88  ? 193 CYS A N   1 
ATOM   1502 C CA  . CYS A 1 189 ? 23.064  -8.114  35.707  1.00 6.53  ? 193 CYS A CA  1 
ATOM   1503 C C   . CYS A 1 189 ? 22.156  -9.300  35.980  1.00 6.81  ? 193 CYS A C   1 
ATOM   1504 O O   . CYS A 1 189 ? 20.930  -9.179  35.955  1.00 6.78  ? 193 CYS A O   1 
ATOM   1505 C CB  . CYS A 1 189 ? 23.037  -7.159  36.905  1.00 6.23  ? 193 CYS A CB  1 
ATOM   1506 S SG  . CYS A 1 189 ? 23.958  -7.788  38.348  1.00 7.82  ? 193 CYS A SG  1 
ATOM   1507 N N   . HIS A 1 190 ? 22.779  -10.448 36.230  1.00 5.42  ? 194 HIS A N   1 
ATOM   1508 C CA  . HIS A 1 190 ? 22.071  -11.696 36.511  1.00 5.19  ? 194 HIS A CA  1 
ATOM   1509 C C   . HIS A 1 190 ? 23.098  -12.646 37.129  1.00 7.14  ? 194 HIS A C   1 
ATOM   1510 O O   . HIS A 1 190 ? 24.271  -12.297 37.235  1.00 6.71  ? 194 HIS A O   1 
ATOM   1511 C CB  . HIS A 1 190 ? 21.499  -12.285 35.214  1.00 5.68  ? 194 HIS A CB  1 
ATOM   1512 C CG  . HIS A 1 190 ? 22.481  -12.322 34.087  1.00 6.95  ? 194 HIS A CG  1 
ATOM   1513 N ND1 . HIS A 1 190 ? 22.560  -11.328 33.134  1.00 9.09  ? 194 HIS A ND1 1 
ATOM   1514 C CD2 . HIS A 1 190 ? 23.460  -13.208 33.790  1.00 3.26  ? 194 HIS A CD2 1 
ATOM   1515 C CE1 . HIS A 1 190 ? 23.547  -11.599 32.299  1.00 5.55  ? 194 HIS A CE1 1 
ATOM   1516 N NE2 . HIS A 1 190 ? 24.109  -12.735 32.675  1.00 9.52  ? 194 HIS A NE2 1 
ATOM   1517 N N   . PRO A 1 191 ? 22.681  -13.859 37.538  1.00 8.89  ? 195 PRO A N   1 
ATOM   1518 C CA  . PRO A 1 191 ? 23.647  -14.782 38.143  1.00 9.77  ? 195 PRO A CA  1 
ATOM   1519 C C   . PRO A 1 191 ? 24.849  -15.185 37.290  1.00 8.90  ? 195 PRO A C   1 
ATOM   1520 O O   . PRO A 1 191 ? 25.884  -15.577 37.835  1.00 9.76  ? 195 PRO A O   1 
ATOM   1521 C CB  . PRO A 1 191 ? 22.781  -15.983 38.538  1.00 9.41  ? 195 PRO A CB  1 
ATOM   1522 C CG  . PRO A 1 191 ? 21.468  -15.356 38.838  1.00 11.31 ? 195 PRO A CG  1 
ATOM   1523 C CD  . PRO A 1 191 ? 21.312  -14.382 37.679  1.00 9.74  ? 195 PRO A CD  1 
ATOM   1524 N N   . TYR A 1 192 ? 24.725  -15.110 35.966  1.00 9.02  ? 196 TYR A N   1 
ATOM   1525 C CA  . TYR A 1 192 ? 25.847  -15.467 35.095  1.00 10.19 ? 196 TYR A CA  1 
ATOM   1526 C C   . TYR A 1 192 ? 26.804  -14.280 34.910  1.00 10.90 ? 196 TYR A C   1 
ATOM   1527 O O   . TYR A 1 192 ? 27.917  -14.438 34.405  1.00 11.59 ? 196 TYR A O   1 
ATOM   1528 C CB  . TYR A 1 192 ? 25.345  -15.941 33.725  1.00 10.01 ? 196 TYR A CB  1 
ATOM   1529 C CG  . TYR A 1 192 ? 24.724  -17.330 33.704  1.00 10.49 ? 196 TYR A CG  1 
ATOM   1530 C CD1 . TYR A 1 192 ? 24.056  -17.791 32.567  1.00 9.43  ? 196 TYR A CD1 1 
ATOM   1531 C CD2 . TYR A 1 192 ? 24.816  -18.189 34.806  1.00 7.82  ? 196 TYR A CD2 1 
ATOM   1532 C CE1 . TYR A 1 192 ? 23.495  -19.070 32.523  1.00 9.94  ? 196 TYR A CE1 1 
ATOM   1533 C CE2 . TYR A 1 192 ? 24.257  -19.474 34.771  1.00 8.97  ? 196 TYR A CE2 1 
ATOM   1534 C CZ  . TYR A 1 192 ? 23.599  -19.904 33.626  1.00 10.99 ? 196 TYR A CZ  1 
ATOM   1535 O OH  . TYR A 1 192 ? 23.043  -21.168 33.579  1.00 12.07 ? 196 TYR A OH  1 
ATOM   1536 N N   . LEU A 1 193 ? 26.348  -13.097 35.317  1.00 10.72 ? 197 LEU A N   1 
ATOM   1537 C CA  . LEU A 1 193 ? 27.123  -11.854 35.242  1.00 10.48 ? 197 LEU A CA  1 
ATOM   1538 C C   . LEU A 1 193 ? 26.647  -11.026 36.436  1.00 10.16 ? 197 LEU A C   1 
ATOM   1539 O O   . LEU A 1 193 ? 25.904  -10.057 36.268  1.00 9.57  ? 197 LEU A O   1 
ATOM   1540 C CB  . LEU A 1 193 ? 26.812  -11.106 33.934  1.00 9.39  ? 197 LEU A CB  1 
ATOM   1541 C CG  . LEU A 1 193 ? 27.613  -9.835  33.614  1.00 10.44 ? 197 LEU A CG  1 
ATOM   1542 C CD1 . LEU A 1 193 ? 28.994  -10.213 33.098  1.00 8.14  ? 197 LEU A CD1 1 
ATOM   1543 C CD2 . LEU A 1 193 ? 26.881  -9.014  32.558  1.00 8.09  ? 197 LEU A CD2 1 
ATOM   1544 N N   . ASN A 1 194 ? 27.082  -11.400 37.639  1.00 8.95  ? 198 ASN A N   1 
ATOM   1545 C CA  . ASN A 1 194 ? 26.617  -10.714 38.842  1.00 9.11  ? 198 ASN A CA  1 
ATOM   1546 C C   . ASN A 1 194 ? 27.120  -9.308  39.135  1.00 7.70  ? 198 ASN A C   1 
ATOM   1547 O O   . ASN A 1 194 ? 26.633  -8.673  40.067  1.00 7.72  ? 198 ASN A O   1 
ATOM   1548 C CB  . ASN A 1 194 ? 26.786  -11.625 40.082  1.00 8.65  ? 198 ASN A CB  1 
ATOM   1549 C CG  . ASN A 1 194 ? 28.245  -11.910 40.441  1.00 11.48 ? 198 ASN A CG  1 
ATOM   1550 O OD1 . ASN A 1 194 ? 28.540  -12.909 41.109  1.00 13.79 ? 198 ASN A OD1 1 
ATOM   1551 N ND2 . ASN A 1 194 ? 29.152  -11.040 40.023  1.00 8.41  ? 198 ASN A ND2 1 
ATOM   1552 N N   . GLN A 1 195 ? 28.065  -8.809  38.336  1.00 8.21  ? 199 GLN A N   1 
ATOM   1553 C CA  . GLN A 1 195 ? 28.586  -7.451  38.516  1.00 8.84  ? 199 GLN A CA  1 
ATOM   1554 C C   . GLN A 1 195 ? 29.018  -7.147  39.952  1.00 10.32 ? 199 GLN A C   1 
ATOM   1555 O O   . GLN A 1 195 ? 28.805  -6.036  40.441  1.00 8.57  ? 199 GLN A O   1 
ATOM   1556 C CB  . GLN A 1 195 ? 27.519  -6.417  38.119  1.00 9.52  ? 199 GLN A CB  1 
ATOM   1557 C CG  . GLN A 1 195 ? 26.981  -6.512  36.687  1.00 10.45 ? 199 GLN A CG  1 
ATOM   1558 C CD  . GLN A 1 195 ? 27.843  -5.775  35.669  1.00 12.24 ? 199 GLN A CD  1 
ATOM   1559 O OE1 . GLN A 1 195 ? 27.406  -5.516  34.542  1.00 12.09 ? 199 GLN A OE1 1 
ATOM   1560 N NE2 . GLN A 1 195 ? 29.069  -5.437  36.056  1.00 10.28 ? 199 GLN A NE2 1 
ATOM   1561 N N   . MET A 1 196 ? 29.615  -8.114  40.638  1.00 10.48 ? 200 MET A N   1 
ATOM   1562 C CA  . MET A 1 196 ? 30.031  -7.867  42.013  1.00 12.38 ? 200 MET A CA  1 
ATOM   1563 C C   . MET A 1 196 ? 30.872  -6.591  42.138  1.00 11.02 ? 200 MET A C   1 
ATOM   1564 O O   . MET A 1 196 ? 30.592  -5.736  42.973  1.00 11.18 ? 200 MET A O   1 
ATOM   1565 C CB  . MET A 1 196 ? 30.830  -9.056  42.553  1.00 14.84 ? 200 MET A CB  1 
ATOM   1566 C CG  . MET A 1 196 ? 30.940  -9.078  44.063  1.00 18.75 ? 200 MET A CG  1 
ATOM   1567 S SD  . MET A 1 196 ? 29.356  -9.457  44.850  1.00 25.87 ? 200 MET A SD  1 
ATOM   1568 C CE  . MET A 1 196 ? 29.323  -11.268 44.642  1.00 23.72 ? 200 MET A CE  1 
ATOM   1569 N N   . LYS A 1 197 ? 31.897  -6.465  41.304  1.00 11.50 ? 201 LYS A N   1 
ATOM   1570 C CA  . LYS A 1 197 ? 32.780  -5.301  41.345  1.00 11.69 ? 201 LYS A CA  1 
ATOM   1571 C C   . LYS A 1 197 ? 32.096  -3.967  41.057  1.00 11.95 ? 201 LYS A C   1 
ATOM   1572 O O   . LYS A 1 197 ? 32.208  -3.012  41.837  1.00 9.04  ? 201 LYS A O   1 
ATOM   1573 C CB  . LYS A 1 197 ? 33.944  -5.498  40.370  1.00 16.48 ? 201 LYS A CB  1 
ATOM   1574 C CG  . LYS A 1 197 ? 34.943  -6.562  40.813  1.00 20.47 ? 201 LYS A CG  1 
ATOM   1575 C CD  . LYS A 1 197 ? 36.142  -6.624  39.875  1.00 24.92 ? 201 LYS A CD  1 
ATOM   1576 C CE  . LYS A 1 197 ? 37.299  -7.408  40.490  1.00 27.70 ? 201 LYS A CE  1 
ATOM   1577 N NZ  . LYS A 1 197 ? 36.957  -8.832  40.768  1.00 32.13 ? 201 LYS A NZ  1 
ATOM   1578 N N   . LEU A 1 198 ? 31.394  -3.893  39.932  1.00 10.15 ? 202 LEU A N   1 
ATOM   1579 C CA  . LEU A 1 198 ? 30.710  -2.664  39.552  1.00 9.71  ? 202 LEU A CA  1 
ATOM   1580 C C   . LEU A 1 198 ? 29.630  -2.278  40.565  1.00 10.54 ? 202 LEU A C   1 
ATOM   1581 O O   . LEU A 1 198 ? 29.413  -1.094  40.833  1.00 11.26 ? 202 LEU A O   1 
ATOM   1582 C CB  . LEU A 1 198 ? 30.095  -2.824  38.155  1.00 9.55  ? 202 LEU A CB  1 
ATOM   1583 C CG  . LEU A 1 198 ? 29.411  -1.592  37.561  1.00 10.38 ? 202 LEU A CG  1 
ATOM   1584 C CD1 . LEU A 1 198 ? 30.370  -0.406  37.556  1.00 7.49  ? 202 LEU A CD1 1 
ATOM   1585 C CD2 . LEU A 1 198 ? 28.956  -1.923  36.143  1.00 7.82  ? 202 LEU A CD2 1 
ATOM   1586 N N   . LEU A 1 199 ? 28.945  -3.276  41.118  1.00 9.81  ? 203 LEU A N   1 
ATOM   1587 C CA  . LEU A 1 199 ? 27.904  -3.019  42.111  1.00 10.67 ? 203 LEU A CA  1 
ATOM   1588 C C   . LEU A 1 199 ? 28.516  -2.398  43.364  1.00 10.55 ? 203 LEU A C   1 
ATOM   1589 O O   . LEU A 1 199 ? 27.986  -1.428  43.913  1.00 8.97  ? 203 LEU A O   1 
ATOM   1590 C CB  . LEU A 1 199 ? 27.188  -4.321  42.489  1.00 10.37 ? 203 LEU A CB  1 
ATOM   1591 C CG  . LEU A 1 199 ? 26.145  -4.231  43.608  1.00 9.72  ? 203 LEU A CG  1 
ATOM   1592 C CD1 . LEU A 1 199 ? 25.005  -3.294  43.196  1.00 12.20 ? 203 LEU A CD1 1 
ATOM   1593 C CD2 . LEU A 1 199 ? 25.604  -5.618  43.899  1.00 13.14 ? 203 LEU A CD2 1 
ATOM   1594 N N   . ASP A 1 200 ? 29.630  -2.963  43.817  1.00 12.03 ? 204 ASP A N   1 
ATOM   1595 C CA  . ASP A 1 200 ? 30.302  -2.448  45.005  1.00 12.60 ? 204 ASP A CA  1 
ATOM   1596 C C   . ASP A 1 200 ? 30.738  -1.010  44.766  1.00 11.46 ? 204 ASP A C   1 
ATOM   1597 O O   . ASP A 1 200 ? 30.592  -0.158  45.641  1.00 11.59 ? 204 ASP A O   1 
ATOM   1598 C CB  . ASP A 1 200 ? 31.516  -3.313  45.356  1.00 14.08 ? 204 ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 200 ? 32.323  -2.746  46.513  1.00 17.49 ? 204 ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 200 ? 33.501  -2.401  46.296  1.00 20.76 ? 204 ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 200 ? 31.782  -2.644  47.636  1.00 18.72 ? 204 ASP A OD2 1 
ATOM   1602 N N   . PHE A 1 201 ? 31.260  -0.735  43.577  1.00 10.66 ? 205 PHE A N   1 
ATOM   1603 C CA  . PHE A 1 201 ? 31.691  0.621   43.260  1.00 12.28 ? 205 PHE A CA  1 
ATOM   1604 C C   . PHE A 1 201 ? 30.523  1.606   43.292  1.00 10.44 ? 205 PHE A C   1 
ATOM   1605 O O   . PHE A 1 201 ? 30.611  2.670   43.906  1.00 9.25  ? 205 PHE A O   1 
ATOM   1606 C CB  . PHE A 1 201 ? 32.343  0.677   41.880  1.00 12.55 ? 205 PHE A CB  1 
ATOM   1607 C CG  . PHE A 1 201 ? 32.713  2.066   41.455  1.00 15.55 ? 205 PHE A CG  1 
ATOM   1608 C CD1 . PHE A 1 201 ? 33.792  2.721   42.042  1.00 15.46 ? 205 PHE A CD1 1 
ATOM   1609 C CD2 . PHE A 1 201 ? 31.951  2.745   40.507  1.00 14.54 ? 205 PHE A CD2 1 
ATOM   1610 C CE1 . PHE A 1 201 ? 34.106  4.034   41.692  1.00 17.86 ? 205 PHE A CE1 1 
ATOM   1611 C CE2 . PHE A 1 201 ? 32.257  4.058   40.151  1.00 15.45 ? 205 PHE A CE2 1 
ATOM   1612 C CZ  . PHE A 1 201 ? 33.337  4.704   40.745  1.00 16.18 ? 205 PHE A CZ  1 
ATOM   1613 N N   . CYS A 1 202 ? 29.426  1.259   42.622  1.00 11.67 ? 206 CYS A N   1 
ATOM   1614 C CA  . CYS A 1 202 ? 28.268  2.144   42.593  1.00 9.41  ? 206 CYS A CA  1 
ATOM   1615 C C   . CYS A 1 202 ? 27.769  2.462   44.002  1.00 11.23 ? 206 CYS A C   1 
ATOM   1616 O O   . CYS A 1 202 ? 27.532  3.625   44.333  1.00 10.88 ? 206 CYS A O   1 
ATOM   1617 C CB  . CYS A 1 202 ? 27.148  1.529   41.736  1.00 10.23 ? 206 CYS A CB  1 
ATOM   1618 S SG  . CYS A 1 202 ? 27.535  1.473   39.948  1.00 12.65 ? 206 CYS A SG  1 
ATOM   1619 N N   . LYS A 1 203 ? 27.622  1.439   44.840  1.00 11.95 ? 207 LYS A N   1 
ATOM   1620 C CA  . LYS A 1 203 ? 27.166  1.659   46.210  1.00 13.21 ? 207 LYS A CA  1 
ATOM   1621 C C   . LYS A 1 203 ? 28.071  2.656   46.943  1.00 13.00 ? 207 LYS A C   1 
ATOM   1622 O O   . LYS A 1 203 ? 27.588  3.558   47.635  1.00 14.04 ? 207 LYS A O   1 
ATOM   1623 C CB  . LYS A 1 203 ? 27.125  0.330   46.979  1.00 13.55 ? 207 LYS A CB  1 
ATOM   1624 C CG  . LYS A 1 203 ? 26.011  -0.619  46.532  1.00 12.88 ? 207 LYS A CG  1 
ATOM   1625 C CD  . LYS A 1 203 ? 26.003  -1.910  47.346  1.00 17.08 ? 207 LYS A CD  1 
ATOM   1626 C CE  . LYS A 1 203 ? 24.772  -2.761  47.013  1.00 16.17 ? 207 LYS A CE  1 
ATOM   1627 N NZ  . LYS A 1 203 ? 24.721  -4.019  47.814  1.00 19.32 ? 207 LYS A NZ  1 
ATOM   1628 N N   . SER A 1 204 ? 29.381  2.501   46.785  1.00 13.42 ? 208 SER A N   1 
ATOM   1629 C CA  . SER A 1 204 ? 30.335  3.391   47.450  1.00 14.20 ? 208 SER A CA  1 
ATOM   1630 C C   . SER A 1 204 ? 30.185  4.845   47.006  1.00 14.97 ? 208 SER A C   1 
ATOM   1631 O O   . SER A 1 204 ? 30.629  5.760   47.706  1.00 13.11 ? 208 SER A O   1 
ATOM   1632 C CB  . SER A 1 204 ? 31.774  2.930   47.187  1.00 14.83 ? 208 SER A CB  1 
ATOM   1633 O OG  . SER A 1 204 ? 32.212  3.307   45.891  1.00 16.49 ? 208 SER A OG  1 
ATOM   1634 N N   . LYS A 1 205 ? 29.553  5.055   45.851  1.00 13.37 ? 209 LYS A N   1 
ATOM   1635 C CA  . LYS A 1 205 ? 29.354  6.398   45.303  1.00 13.18 ? 209 LYS A CA  1 
ATOM   1636 C C   . LYS A 1 205 ? 27.899  6.870   45.362  1.00 12.41 ? 209 LYS A C   1 
ATOM   1637 O O   . LYS A 1 205 ? 27.563  7.917   44.813  1.00 11.96 ? 209 LYS A O   1 
ATOM   1638 C CB  . LYS A 1 205 ? 29.828  6.446   43.841  1.00 12.40 ? 209 LYS A CB  1 
ATOM   1639 C CG  . LYS A 1 205 ? 31.274  6.004   43.610  1.00 13.42 ? 209 LYS A CG  1 
ATOM   1640 C CD  . LYS A 1 205 ? 32.261  6.925   44.301  1.00 15.17 ? 209 LYS A CD  1 
ATOM   1641 C CE  . LYS A 1 205 ? 33.689  6.447   44.089  1.00 18.79 ? 209 LYS A CE  1 
ATOM   1642 N NZ  . LYS A 1 205 ? 34.691  7.332   44.758  1.00 19.75 ? 209 LYS A NZ  1 
ATOM   1643 N N   . ASP A 1 206 ? 27.040  6.103   46.028  1.00 12.19 ? 210 ASP A N   1 
ATOM   1644 C CA  . ASP A 1 206 ? 25.620  6.445   46.131  1.00 12.47 ? 210 ASP A CA  1 
ATOM   1645 C C   . ASP A 1 206 ? 24.915  6.362   44.778  1.00 10.99 ? 210 ASP A C   1 
ATOM   1646 O O   . ASP A 1 206 ? 23.934  7.069   44.534  1.00 11.72 ? 210 ASP A O   1 
ATOM   1647 C CB  . ASP A 1 206 ? 25.421  7.852   46.704  1.00 15.31 ? 210 ASP A CB  1 
ATOM   1648 C CG  . ASP A 1 206 ? 25.986  8.000   48.100  1.00 18.66 ? 210 ASP A CG  1 
ATOM   1649 O OD1 . ASP A 1 206 ? 25.642  7.181   48.975  1.00 19.94 ? 210 ASP A OD1 1 
ATOM   1650 O OD2 . ASP A 1 206 ? 26.770  8.943   48.321  1.00 22.88 ? 210 ASP A OD2 1 
ATOM   1651 N N   . ILE A 1 207 ? 25.427  5.510   43.895  1.00 9.71  ? 211 ILE A N   1 
ATOM   1652 C CA  . ILE A 1 207 ? 24.821  5.319   42.582  1.00 8.53  ? 211 ILE A CA  1 
ATOM   1653 C C   . ILE A 1 207 ? 24.064  3.992   42.625  1.00 10.00 ? 211 ILE A C   1 
ATOM   1654 O O   . ILE A 1 207 ? 24.621  2.972   43.014  1.00 7.34  ? 211 ILE A O   1 
ATOM   1655 C CB  . ILE A 1 207 ? 25.897  5.259   41.465  1.00 10.72 ? 211 ILE A CB  1 
ATOM   1656 C CG1 . ILE A 1 207 ? 26.621  6.603   41.368  1.00 10.34 ? 211 ILE A CG1 1 
ATOM   1657 C CG2 . ILE A 1 207 ? 25.253  4.906   40.124  1.00 9.61  ? 211 ILE A CG2 1 
ATOM   1658 C CD1 . ILE A 1 207 ? 27.696  6.647   40.301  1.00 12.69 ? 211 ILE A CD1 1 
ATOM   1659 N N   . VAL A 1 208 ? 22.789  4.014   42.247  1.00 8.54  ? 212 VAL A N   1 
ATOM   1660 C CA  . VAL A 1 208 ? 21.987  2.797   42.249  1.00 9.24  ? 212 VAL A CA  1 
ATOM   1661 C C   . VAL A 1 208 ? 22.245  2.000   40.980  1.00 8.80  ? 212 VAL A C   1 
ATOM   1662 O O   . VAL A 1 208 ? 22.295  2.561   39.878  1.00 8.35  ? 212 VAL A O   1 
ATOM   1663 C CB  . VAL A 1 208 ? 20.468  3.115   42.314  1.00 9.63  ? 212 VAL A CB  1 
ATOM   1664 C CG1 . VAL A 1 208 ? 19.651  1.822   42.234  1.00 10.45 ? 212 VAL A CG1 1 
ATOM   1665 C CG2 . VAL A 1 208 ? 20.147  3.866   43.603  1.00 11.22 ? 212 VAL A CG2 1 
ATOM   1666 N N   . LEU A 1 209 ? 22.440  0.694   41.128  1.00 6.71  ? 213 LEU A N   1 
ATOM   1667 C CA  . LEU A 1 209 ? 22.634  -0.133  39.954  1.00 7.81  ? 213 LEU A CA  1 
ATOM   1668 C C   . LEU A 1 209 ? 21.236  -0.609  39.548  1.00 6.61  ? 213 LEU A C   1 
ATOM   1669 O O   . LEU A 1 209 ? 20.535  -1.237  40.344  1.00 7.95  ? 213 LEU A O   1 
ATOM   1670 C CB  . LEU A 1 209 ? 23.539  -1.333  40.268  1.00 9.56  ? 213 LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 209 ? 24.042  -2.130  39.053  1.00 7.82  ? 213 LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 209 ? 25.349  -2.823  39.411  1.00 12.09 ? 213 LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 209 ? 22.998  -3.140  38.604  1.00 10.34 ? 213 LEU A CD2 1 
ATOM   1674 N N   . VAL A 1 210 ? 20.814  -0.256  38.336  1.00 6.57  ? 214 VAL A N   1 
ATOM   1675 C CA  . VAL A 1 210 ? 19.518  -0.689  37.817  1.00 4.91  ? 214 VAL A CA  1 
ATOM   1676 C C   . VAL A 1 210 ? 19.845  -1.794  36.820  1.00 5.44  ? 214 VAL A C   1 
ATOM   1677 O O   . VAL A 1 210 ? 20.617  -1.589  35.885  1.00 4.83  ? 214 VAL A O   1 
ATOM   1678 C CB  . VAL A 1 210 ? 18.768  0.460   37.103  1.00 5.23  ? 214 VAL A CB  1 
ATOM   1679 C CG1 . VAL A 1 210 ? 17.459  -0.067  36.511  1.00 1.87  ? 214 VAL A CG1 1 
ATOM   1680 C CG2 . VAL A 1 210 ? 18.470  1.582   38.098  1.00 5.72  ? 214 VAL A CG2 1 
ATOM   1681 N N   . ALA A 1 211 ? 19.250  -2.964  37.011  1.00 6.76  ? 215 ALA A N   1 
ATOM   1682 C CA  . ALA A 1 211 ? 19.561  -4.091  36.150  1.00 7.71  ? 215 ALA A CA  1 
ATOM   1683 C C   . ALA A 1 211 ? 18.553  -4.530  35.099  1.00 7.01  ? 215 ALA A C   1 
ATOM   1684 O O   . ALA A 1 211 ? 17.348  -4.579  35.348  1.00 8.47  ? 215 ALA A O   1 
ATOM   1685 C CB  . ALA A 1 211 ? 19.916  -5.295  37.021  1.00 6.58  ? 215 ALA A CB  1 
ATOM   1686 N N   . TYR A 1 212 ? 19.071  -4.839  33.914  1.00 7.86  ? 216 TYR A N   1 
ATOM   1687 C CA  . TYR A 1 212 ? 18.255  -5.387  32.840  1.00 6.52  ? 216 TYR A CA  1 
ATOM   1688 C C   . TYR A 1 212 ? 18.886  -6.759  32.608  1.00 7.32  ? 216 TYR A C   1 
ATOM   1689 O O   . TYR A 1 212 ? 19.936  -7.058  33.182  1.00 6.78  ? 216 TYR A O   1 
ATOM   1690 C CB  . TYR A 1 212 ? 18.289  -4.520  31.566  1.00 5.15  ? 216 TYR A CB  1 
ATOM   1691 C CG  . TYR A 1 212 ? 19.630  -4.349  30.877  1.00 6.03  ? 216 TYR A CG  1 
ATOM   1692 C CD1 . TYR A 1 212 ? 20.148  -5.339  30.041  1.00 6.41  ? 216 TYR A CD1 1 
ATOM   1693 C CD2 . TYR A 1 212 ? 20.337  -3.155  30.998  1.00 2.73  ? 216 TYR A CD2 1 
ATOM   1694 C CE1 . TYR A 1 212 ? 21.333  -5.135  29.329  1.00 6.55  ? 216 TYR A CE1 1 
ATOM   1695 C CE2 . TYR A 1 212 ? 21.520  -2.938  30.301  1.00 5.42  ? 216 TYR A CE2 1 
ATOM   1696 C CZ  . TYR A 1 212 ? 22.010  -3.924  29.465  1.00 6.70  ? 216 TYR A CZ  1 
ATOM   1697 O OH  . TYR A 1 212 ? 23.150  -3.679  28.746  1.00 5.29  ? 216 TYR A OH  1 
ATOM   1698 N N   . GLY A 1 213 ? 18.248  -7.596  31.798  1.00 6.75  ? 217 GLY A N   1 
ATOM   1699 C CA  . GLY A 1 213 ? 18.780  -8.925  31.556  1.00 6.60  ? 217 GLY A CA  1 
ATOM   1700 C C   . GLY A 1 213 ? 18.679  -9.777  32.809  1.00 7.08  ? 217 GLY A C   1 
ATOM   1701 O O   . GLY A 1 213 ? 19.313  -10.828 32.911  1.00 3.77  ? 217 GLY A O   1 
ATOM   1702 N N   . VAL A 1 214 ? 17.876  -9.320  33.768  1.00 7.17  ? 218 VAL A N   1 
ATOM   1703 C CA  . VAL A 1 214 ? 17.700  -10.029 35.032  1.00 7.72  ? 218 VAL A CA  1 
ATOM   1704 C C   . VAL A 1 214 ? 17.211  -11.459 34.814  1.00 8.88  ? 218 VAL A C   1 
ATOM   1705 O O   . VAL A 1 214 ? 17.529  -12.365 35.591  1.00 9.86  ? 218 VAL A O   1 
ATOM   1706 C CB  . VAL A 1 214 ? 16.708  -9.268  35.955  1.00 8.28  ? 218 VAL A CB  1 
ATOM   1707 C CG1 . VAL A 1 214 ? 16.405  -10.088 37.213  1.00 5.46  ? 218 VAL A CG1 1 
ATOM   1708 C CG2 . VAL A 1 214 ? 17.306  -7.921  36.346  1.00 6.63  ? 218 VAL A CG2 1 
ATOM   1709 N N   . LEU A 1 215 ? 16.448  -11.659 33.746  1.00 8.55  ? 219 LEU A N   1 
ATOM   1710 C CA  . LEU A 1 215 ? 15.920  -12.977 33.434  1.00 6.72  ? 219 LEU A CA  1 
ATOM   1711 C C   . LEU A 1 215 ? 16.593  -13.571 32.199  1.00 7.87  ? 219 LEU A C   1 
ATOM   1712 O O   . LEU A 1 215 ? 16.078  -14.513 31.588  1.00 8.82  ? 219 LEU A O   1 
ATOM   1713 C CB  . LEU A 1 215 ? 14.400  -12.883 33.246  1.00 6.53  ? 219 LEU A CB  1 
ATOM   1714 C CG  . LEU A 1 215 ? 13.680  -12.264 34.457  1.00 7.46  ? 219 LEU A CG  1 
ATOM   1715 C CD1 . LEU A 1 215 ? 12.193  -12.133 34.161  1.00 9.38  ? 219 LEU A CD1 1 
ATOM   1716 C CD2 . LEU A 1 215 ? 13.898  -13.120 35.696  1.00 8.12  ? 219 LEU A CD2 1 
ATOM   1717 N N   . GLY A 1 216 ? 17.749  -13.014 31.838  1.00 6.50  ? 220 GLY A N   1 
ATOM   1718 C CA  . GLY A 1 216 ? 18.500  -13.511 30.695  1.00 6.29  ? 220 GLY A CA  1 
ATOM   1719 C C   . GLY A 1 216 ? 18.351  -12.745 29.394  1.00 6.66  ? 220 GLY A C   1 
ATOM   1720 O O   . GLY A 1 216 ? 18.946  -13.133 28.389  1.00 5.54  ? 220 GLY A O   1 
ATOM   1721 N N   . THR A 1 217 ? 17.574  -11.660 29.425  1.00 5.07  ? 221 THR A N   1 
ATOM   1722 C CA  . THR A 1 217 ? 17.296  -10.794 28.269  1.00 6.40  ? 221 THR A CA  1 
ATOM   1723 C C   . THR A 1 217 ? 16.343  -11.474 27.295  1.00 8.07  ? 221 THR A C   1 
ATOM   1724 O O   . THR A 1 217 ? 16.196  -12.694 27.318  1.00 8.48  ? 221 THR A O   1 
ATOM   1725 C CB  . THR A 1 217 ? 18.567  -10.393 27.465  1.00 5.80  ? 221 THR A CB  1 
ATOM   1726 O OG1 . THR A 1 217 ? 18.905  -11.437 26.541  1.00 7.16  ? 221 THR A OG1 1 
ATOM   1727 C CG2 . THR A 1 217 ? 19.747  -10.121 28.396  1.00 9.27  ? 221 THR A CG2 1 
ATOM   1728 N N   . GLN A 1 218 ? 15.691  -10.682 26.446  1.00 7.20  ? 222 GLN A N   1 
ATOM   1729 C CA  . GLN A 1 218 ? 14.762  -11.239 25.474  1.00 8.19  ? 222 GLN A CA  1 
ATOM   1730 C C   . GLN A 1 218 ? 15.504  -11.825 24.279  1.00 9.52  ? 222 GLN A C   1 
ATOM   1731 O O   . GLN A 1 218 ? 14.894  -12.155 23.263  1.00 8.77  ? 222 GLN A O   1 
ATOM   1732 C CB  . GLN A 1 218 ? 13.756  -10.181 25.023  1.00 8.59  ? 222 GLN A CB  1 
ATOM   1733 C CG  . GLN A 1 218 ? 12.985  -9.582  26.187  1.00 8.20  ? 222 GLN A CG  1 
ATOM   1734 C CD  . GLN A 1 218 ? 11.849  -8.683  25.748  1.00 8.85  ? 222 GLN A CD  1 
ATOM   1735 O OE1 . GLN A 1 218 ? 10.744  -9.151  25.460  1.00 11.47 ? 222 GLN A OE1 1 
ATOM   1736 N NE2 . GLN A 1 218 ? 12.114  -7.383  25.692  1.00 7.86  ? 222 GLN A NE2 1 
ATOM   1737 N N   . ARG A 1 219 ? 16.824  -11.941 24.419  1.00 8.04  ? 223 ARG A N   1 
ATOM   1738 C CA  . ARG A 1 219 ? 17.690  -12.534 23.399  1.00 10.13 ? 223 ARG A CA  1 
ATOM   1739 C C   . ARG A 1 219 ? 17.460  -11.978 21.991  1.00 11.80 ? 223 ARG A C   1 
ATOM   1740 O O   . ARG A 1 219 ? 17.309  -12.732 21.024  1.00 11.96 ? 223 ARG A O   1 
ATOM   1741 C CB  . ARG A 1 219 ? 17.495  -14.059 23.410  1.00 10.93 ? 223 ARG A CB  1 
ATOM   1742 C CG  . ARG A 1 219 ? 17.739  -14.716 24.782  1.00 10.82 ? 223 ARG A CG  1 
ATOM   1743 C CD  . ARG A 1 219 ? 17.350  -16.202 24.790  1.00 11.81 ? 223 ARG A CD  1 
ATOM   1744 N NE  . ARG A 1 219 ? 18.228  -17.020 23.953  1.00 9.45  ? 223 ARG A NE  1 
ATOM   1745 C CZ  . ARG A 1 219 ? 19.425  -17.463 24.328  1.00 10.97 ? 223 ARG A CZ  1 
ATOM   1746 N NH1 . ARG A 1 219 ? 19.897  -17.176 25.534  1.00 8.91  ? 223 ARG A NH1 1 
ATOM   1747 N NH2 . ARG A 1 219 ? 20.160  -18.188 23.492  1.00 9.07  ? 223 ARG A NH2 1 
ATOM   1748 N N   . TYR A 1 220 ? 17.462  -10.651 21.886  1.00 11.47 ? 224 TYR A N   1 
ATOM   1749 C CA  . TYR A 1 220 ? 17.236  -9.953  20.625  1.00 11.05 ? 224 TYR A CA  1 
ATOM   1750 C C   . TYR A 1 220 ? 18.157  -10.382 19.487  1.00 12.36 ? 224 TYR A C   1 
ATOM   1751 O O   . TYR A 1 220 ? 19.365  -10.496 19.668  1.00 9.83  ? 224 TYR A O   1 
ATOM   1752 C CB  . TYR A 1 220 ? 17.394  -8.445  20.830  1.00 9.92  ? 224 TYR A CB  1 
ATOM   1753 C CG  . TYR A 1 220 ? 16.731  -7.917  22.083  1.00 9.60  ? 224 TYR A CG  1 
ATOM   1754 C CD1 . TYR A 1 220 ? 17.412  -7.882  23.300  1.00 8.69  ? 224 TYR A CD1 1 
ATOM   1755 C CD2 . TYR A 1 220 ? 15.416  -7.457  22.052  1.00 7.46  ? 224 TYR A CD2 1 
ATOM   1756 C CE1 . TYR A 1 220 ? 16.796  -7.397  24.458  1.00 7.18  ? 224 TYR A CE1 1 
ATOM   1757 C CE2 . TYR A 1 220 ? 14.795  -6.977  23.198  1.00 8.69  ? 224 TYR A CE2 1 
ATOM   1758 C CZ  . TYR A 1 220 ? 15.488  -6.948  24.397  1.00 10.25 ? 224 TYR A CZ  1 
ATOM   1759 O OH  . TYR A 1 220 ? 14.857  -6.474  25.525  1.00 7.85  ? 224 TYR A OH  1 
ATOM   1760 N N   . GLY A 1 221 ? 17.576  -10.616 18.311  1.00 12.10 ? 225 GLY A N   1 
ATOM   1761 C CA  . GLY A 1 221 ? 18.382  -10.994 17.164  1.00 11.94 ? 225 GLY A CA  1 
ATOM   1762 C C   . GLY A 1 221 ? 19.309  -9.847  16.785  1.00 13.69 ? 225 GLY A C   1 
ATOM   1763 O O   . GLY A 1 221 ? 18.894  -8.685  16.775  1.00 12.07 ? 225 GLY A O   1 
ATOM   1764 N N   . GLY A 1 222 ? 20.567  -10.161 16.485  1.00 10.18 ? 226 GLY A N   1 
ATOM   1765 C CA  . GLY A 1 222 ? 21.511  -9.121  16.121  1.00 12.74 ? 226 GLY A CA  1 
ATOM   1766 C C   . GLY A 1 222 ? 22.203  -8.483  17.315  1.00 12.81 ? 226 GLY A C   1 
ATOM   1767 O O   . GLY A 1 222 ? 23.049  -7.606  17.149  1.00 14.16 ? 226 GLY A O   1 
ATOM   1768 N N   . TRP A 1 223 ? 21.845  -8.916  18.521  1.00 13.94 ? 227 TRP A N   1 
ATOM   1769 C CA  . TRP A 1 223 ? 22.455  -8.378  19.736  1.00 11.14 ? 227 TRP A CA  1 
ATOM   1770 C C   . TRP A 1 223 ? 22.868  -9.473  20.710  1.00 12.18 ? 227 TRP A C   1 
ATOM   1771 O O   . TRP A 1 223 ? 23.813  -9.298  21.477  1.00 12.97 ? 227 TRP A O   1 
ATOM   1772 C CB  . TRP A 1 223 ? 21.494  -7.420  20.454  1.00 11.74 ? 227 TRP A CB  1 
ATOM   1773 C CG  . TRP A 1 223 ? 21.178  -6.180  19.681  1.00 12.00 ? 227 TRP A CG  1 
ATOM   1774 C CD1 . TRP A 1 223 ? 20.276  -6.055  18.662  1.00 15.06 ? 227 TRP A CD1 1 
ATOM   1775 C CD2 . TRP A 1 223 ? 21.780  -4.891  19.845  1.00 12.45 ? 227 TRP A CD2 1 
ATOM   1776 N NE1 . TRP A 1 223 ? 20.278  -4.767  18.182  1.00 13.36 ? 227 TRP A NE1 1 
ATOM   1777 C CE2 . TRP A 1 223 ? 21.192  -4.031  18.890  1.00 14.91 ? 227 TRP A CE2 1 
ATOM   1778 C CE3 . TRP A 1 223 ? 22.759  -4.376  20.707  1.00 13.30 ? 227 TRP A CE3 1 
ATOM   1779 C CZ2 . TRP A 1 223 ? 21.551  -2.681  18.772  1.00 14.37 ? 227 TRP A CZ2 1 
ATOM   1780 C CZ3 . TRP A 1 223 ? 23.119  -3.033  20.590  1.00 14.39 ? 227 TRP A CZ3 1 
ATOM   1781 C CH2 . TRP A 1 223 ? 22.516  -2.203  19.629  1.00 15.65 ? 227 TRP A CH2 1 
ATOM   1782 N N   . VAL A 1 224 ? 22.158  -10.596 20.688  1.00 10.11 ? 228 VAL A N   1 
ATOM   1783 C CA  . VAL A 1 224 ? 22.468  -11.695 21.598  1.00 9.74  ? 228 VAL A CA  1 
ATOM   1784 C C   . VAL A 1 224 ? 22.850  -12.980 20.861  1.00 11.65 ? 228 VAL A C   1 
ATOM   1785 O O   . VAL A 1 224 ? 22.214  -13.346 19.873  1.00 11.49 ? 228 VAL A O   1 
ATOM   1786 C CB  . VAL A 1 224 ? 21.260  -12.006 22.516  1.00 10.48 ? 228 VAL A CB  1 
ATOM   1787 C CG1 . VAL A 1 224 ? 21.626  -13.105 23.508  1.00 8.76  ? 228 VAL A CG1 1 
ATOM   1788 C CG2 . VAL A 1 224 ? 20.822  -10.739 23.253  1.00 9.27  ? 228 VAL A CG2 1 
ATOM   1789 N N   . ASP A 1 225 ? 23.894  -13.649 21.348  1.00 10.68 ? 229 ASP A N   1 
ATOM   1790 C CA  . ASP A 1 225 ? 24.351  -14.913 20.774  1.00 12.01 ? 229 ASP A CA  1 
ATOM   1791 C C   . ASP A 1 225 ? 23.210  -15.912 20.955  1.00 11.76 ? 229 ASP A C   1 
ATOM   1792 O O   . ASP A 1 225 ? 22.916  -16.331 22.075  1.00 12.58 ? 229 ASP A O   1 
ATOM   1793 C CB  . ASP A 1 225 ? 25.593  -15.407 21.528  1.00 13.35 ? 229 ASP A CB  1 
ATOM   1794 C CG  . ASP A 1 225 ? 26.157  -16.711 20.960  1.00 15.70 ? 229 ASP A CG  1 
ATOM   1795 O OD1 . ASP A 1 225 ? 25.455  -17.397 20.190  1.00 16.42 ? 229 ASP A OD1 1 
ATOM   1796 O OD2 . ASP A 1 225 ? 27.308  -17.054 21.302  1.00 15.27 ? 229 ASP A OD2 1 
ATOM   1797 N N   . GLN A 1 226 ? 22.563  -16.290 19.860  1.00 12.49 ? 230 GLN A N   1 
ATOM   1798 C CA  . GLN A 1 226 ? 21.446  -17.225 19.938  1.00 12.51 ? 230 GLN A CA  1 
ATOM   1799 C C   . GLN A 1 226 ? 21.817  -18.604 20.478  1.00 13.61 ? 230 GLN A C   1 
ATOM   1800 O O   . GLN A 1 226 ? 20.938  -19.389 20.841  1.00 14.49 ? 230 GLN A O   1 
ATOM   1801 C CB  . GLN A 1 226 ? 20.782  -17.364 18.566  1.00 12.90 ? 230 GLN A CB  1 
ATOM   1802 C CG  . GLN A 1 226 ? 20.181  -16.064 18.047  1.00 13.19 ? 230 GLN A CG  1 
ATOM   1803 C CD  . GLN A 1 226 ? 19.123  -15.503 18.980  1.00 16.14 ? 230 GLN A CD  1 
ATOM   1804 O OE1 . GLN A 1 226 ? 18.061  -16.098 19.168  1.00 15.28 ? 230 GLN A OE1 1 
ATOM   1805 N NE2 . GLN A 1 226 ? 19.412  -14.354 19.576  1.00 13.79 ? 230 GLN A NE2 1 
ATOM   1806 N N   . ASN A 1 227 ? 23.109  -18.903 20.539  1.00 14.83 ? 231 ASN A N   1 
ATOM   1807 C CA  . ASN A 1 227 ? 23.545  -20.200 21.046  1.00 16.18 ? 231 ASN A CA  1 
ATOM   1808 C C   . ASN A 1 227 ? 23.992  -20.139 22.497  1.00 15.24 ? 231 ASN A C   1 
ATOM   1809 O O   . ASN A 1 227 ? 24.430  -21.139 23.059  1.00 16.15 ? 231 ASN A O   1 
ATOM   1810 C CB  . ASN A 1 227 ? 24.670  -20.766 20.176  1.00 18.61 ? 231 ASN A CB  1 
ATOM   1811 C CG  . ASN A 1 227 ? 24.194  -21.135 18.785  1.00 21.56 ? 231 ASN A CG  1 
ATOM   1812 O OD1 . ASN A 1 227 ? 23.192  -21.834 18.627  1.00 25.39 ? 231 ASN A OD1 1 
ATOM   1813 N ND2 . ASN A 1 227 ? 24.911  -20.669 17.768  1.00 23.30 ? 231 ASN A ND2 1 
ATOM   1814 N N   . SER A 1 228 ? 23.881  -18.965 23.105  1.00 14.10 ? 232 SER A N   1 
ATOM   1815 C CA  . SER A 1 228 ? 24.266  -18.805 24.501  1.00 13.01 ? 232 SER A CA  1 
ATOM   1816 C C   . SER A 1 228 ? 23.233  -19.523 25.365  1.00 12.90 ? 232 SER A C   1 
ATOM   1817 O O   . SER A 1 228 ? 22.092  -19.726 24.945  1.00 11.51 ? 232 SER A O   1 
ATOM   1818 C CB  . SER A 1 228 ? 24.318  -17.318 24.871  1.00 12.47 ? 232 SER A CB  1 
ATOM   1819 O OG  . SER A 1 228 ? 23.038  -16.718 24.750  1.00 10.49 ? 232 SER A OG  1 
ATOM   1820 N N   . PRO A 1 229 ? 23.621  -19.933 26.581  1.00 13.53 ? 233 PRO A N   1 
ATOM   1821 C CA  . PRO A 1 229 ? 22.674  -20.627 27.459  1.00 13.78 ? 233 PRO A CA  1 
ATOM   1822 C C   . PRO A 1 229 ? 21.505  -19.734 27.884  1.00 13.49 ? 233 PRO A C   1 
ATOM   1823 O O   . PRO A 1 229 ? 21.673  -18.533 28.078  1.00 12.51 ? 233 PRO A O   1 
ATOM   1824 C CB  . PRO A 1 229 ? 23.547  -21.049 28.639  1.00 14.50 ? 233 PRO A CB  1 
ATOM   1825 C CG  . PRO A 1 229 ? 24.593  -19.958 28.690  1.00 15.44 ? 233 PRO A CG  1 
ATOM   1826 C CD  . PRO A 1 229 ? 24.939  -19.792 27.227  1.00 15.28 ? 233 PRO A CD  1 
ATOM   1827 N N   . VAL A 1 230 ? 20.320  -20.325 28.006  1.00 12.49 ? 234 VAL A N   1 
ATOM   1828 C CA  . VAL A 1 230 ? 19.141  -19.577 28.427  1.00 11.67 ? 234 VAL A CA  1 
ATOM   1829 C C   . VAL A 1 230 ? 19.190  -19.525 29.952  1.00 10.99 ? 234 VAL A C   1 
ATOM   1830 O O   . VAL A 1 230 ? 19.145  -20.557 30.619  1.00 11.10 ? 234 VAL A O   1 
ATOM   1831 C CB  . VAL A 1 230 ? 17.843  -20.272 27.956  1.00 12.97 ? 234 VAL A CB  1 
ATOM   1832 C CG1 . VAL A 1 230 ? 16.634  -19.517 28.471  1.00 7.95  ? 234 VAL A CG1 1 
ATOM   1833 C CG2 . VAL A 1 230 ? 17.815  -20.336 26.427  1.00 12.00 ? 234 VAL A CG2 1 
ATOM   1834 N N   . LEU A 1 231 ? 19.294  -18.322 30.503  1.00 8.36  ? 235 LEU A N   1 
ATOM   1835 C CA  . LEU A 1 231 ? 19.402  -18.168 31.947  1.00 9.91  ? 235 LEU A CA  1 
ATOM   1836 C C   . LEU A 1 231 ? 18.370  -18.929 32.776  1.00 10.15 ? 235 LEU A C   1 
ATOM   1837 O O   . LEU A 1 231 ? 18.734  -19.649 33.697  1.00 11.89 ? 235 LEU A O   1 
ATOM   1838 C CB  . LEU A 1 231 ? 19.355  -16.685 32.334  1.00 8.38  ? 235 LEU A CB  1 
ATOM   1839 C CG  . LEU A 1 231 ? 19.478  -16.439 33.840  1.00 9.06  ? 235 LEU A CG  1 
ATOM   1840 C CD1 . LEU A 1 231 ? 20.879  -16.848 34.304  1.00 9.85  ? 235 LEU A CD1 1 
ATOM   1841 C CD2 . LEU A 1 231 ? 19.216  -14.975 34.160  1.00 10.95 ? 235 LEU A CD2 1 
ATOM   1842 N N   . LEU A 1 232 ? 17.089  -18.776 32.461  1.00 11.35 ? 236 LEU A N   1 
ATOM   1843 C CA  . LEU A 1 232 ? 16.056  -19.448 33.246  1.00 13.52 ? 236 LEU A CA  1 
ATOM   1844 C C   . LEU A 1 232 ? 16.076  -20.978 33.183  1.00 14.17 ? 236 LEU A C   1 
ATOM   1845 O O   . LEU A 1 232 ? 15.285  -21.643 33.860  1.00 14.39 ? 236 LEU A O   1 
ATOM   1846 C CB  . LEU A 1 232 ? 14.670  -18.909 32.873  1.00 12.55 ? 236 LEU A CB  1 
ATOM   1847 C CG  . LEU A 1 232 ? 14.459  -17.429 33.222  1.00 14.48 ? 236 LEU A CG  1 
ATOM   1848 C CD1 . LEU A 1 232 ? 13.042  -17.003 32.860  1.00 15.65 ? 236 LEU A CD1 1 
ATOM   1849 C CD2 . LEU A 1 232 ? 14.713  -17.202 34.705  1.00 14.68 ? 236 LEU A CD2 1 
ATOM   1850 N N   . ASP A 1 233 ? 16.990  -21.531 32.390  1.00 14.51 ? 237 ASP A N   1 
ATOM   1851 C CA  . ASP A 1 233 ? 17.134  -22.981 32.282  1.00 13.81 ? 237 ASP A CA  1 
ATOM   1852 C C   . ASP A 1 233 ? 18.186  -23.466 33.277  1.00 14.00 ? 237 ASP A C   1 
ATOM   1853 O O   . ASP A 1 233 ? 18.412  -24.670 33.423  1.00 11.60 ? 237 ASP A O   1 
ATOM   1854 C CB  . ASP A 1 233 ? 17.557  -23.377 30.866  1.00 14.33 ? 237 ASP A CB  1 
ATOM   1855 C CG  . ASP A 1 233 ? 16.419  -23.294 29.867  1.00 16.04 ? 237 ASP A CG  1 
ATOM   1856 O OD1 . ASP A 1 233 ? 16.678  -23.485 28.661  1.00 19.61 ? 237 ASP A OD1 1 
ATOM   1857 O OD2 . ASP A 1 233 ? 15.270  -23.043 30.282  1.00 17.70 ? 237 ASP A OD2 1 
ATOM   1858 N N   . GLU A 1 234 ? 18.830  -22.525 33.962  1.00 12.16 ? 238 GLU A N   1 
ATOM   1859 C CA  . GLU A 1 234 ? 19.862  -22.868 34.936  1.00 12.01 ? 238 GLU A CA  1 
ATOM   1860 C C   . GLU A 1 234 ? 19.308  -23.771 36.032  1.00 11.81 ? 238 GLU A C   1 
ATOM   1861 O O   . GLU A 1 234 ? 18.399  -23.381 36.758  1.00 10.40 ? 238 GLU A O   1 
ATOM   1862 C CB  . GLU A 1 234 ? 20.442  -21.599 35.566  1.00 12.66 ? 238 GLU A CB  1 
ATOM   1863 C CG  . GLU A 1 234 ? 21.235  -21.855 36.839  1.00 12.19 ? 238 GLU A CG  1 
ATOM   1864 C CD  . GLU A 1 234 ? 22.395  -22.813 36.634  1.00 15.04 ? 238 GLU A CD  1 
ATOM   1865 O OE1 . GLU A 1 234 ? 22.680  -23.600 37.564  1.00 15.53 ? 238 GLU A OE1 1 
ATOM   1866 O OE2 . GLU A 1 234 ? 23.029  -22.773 35.558  1.00 15.54 ? 238 GLU A OE2 1 
ATOM   1867 N N   . PRO A 1 235 ? 19.861  -24.992 36.169  1.00 12.86 ? 239 PRO A N   1 
ATOM   1868 C CA  . PRO A 1 235 ? 19.418  -25.958 37.182  1.00 12.51 ? 239 PRO A CA  1 
ATOM   1869 C C   . PRO A 1 235 ? 19.282  -25.395 38.594  1.00 13.18 ? 239 PRO A C   1 
ATOM   1870 O O   . PRO A 1 235 ? 18.286  -25.656 39.270  1.00 14.45 ? 239 PRO A O   1 
ATOM   1871 C CB  . PRO A 1 235 ? 20.476  -27.055 37.095  1.00 14.16 ? 239 PRO A CB  1 
ATOM   1872 C CG  . PRO A 1 235 ? 20.800  -27.065 35.637  1.00 14.40 ? 239 PRO A CG  1 
ATOM   1873 C CD  . PRO A 1 235 ? 20.926  -25.575 35.331  1.00 12.75 ? 239 PRO A CD  1 
ATOM   1874 N N   . VAL A 1 236 ? 20.278  -24.631 39.039  1.00 12.30 ? 240 VAL A N   1 
ATOM   1875 C CA  . VAL A 1 236 ? 20.243  -24.061 40.383  1.00 13.13 ? 240 VAL A CA  1 
ATOM   1876 C C   . VAL A 1 236 ? 18.986  -23.223 40.605  1.00 13.85 ? 240 VAL A C   1 
ATOM   1877 O O   . VAL A 1 236 ? 18.404  -23.252 41.691  1.00 15.61 ? 240 VAL A O   1 
ATOM   1878 C CB  . VAL A 1 236 ? 21.511  -23.223 40.665  1.00 13.84 ? 240 VAL A CB  1 
ATOM   1879 C CG1 . VAL A 1 236 ? 21.394  -22.518 42.011  1.00 16.82 ? 240 VAL A CG1 1 
ATOM   1880 C CG2 . VAL A 1 236 ? 22.737  -24.137 40.667  1.00 15.19 ? 240 VAL A CG2 1 
ATOM   1881 N N   . LEU A 1 237 ? 18.555  -22.495 39.576  1.00 12.89 ? 241 LEU A N   1 
ATOM   1882 C CA  . LEU A 1 237 ? 17.341  -21.683 39.682  1.00 11.73 ? 241 LEU A CA  1 
ATOM   1883 C C   . LEU A 1 237 ? 16.111  -22.581 39.761  1.00 13.29 ? 241 LEU A C   1 
ATOM   1884 O O   . LEU A 1 237 ? 15.139  -22.265 40.453  1.00 10.66 ? 241 LEU A O   1 
ATOM   1885 C CB  . LEU A 1 237 ? 17.210  -20.741 38.480  1.00 10.79 ? 241 LEU A CB  1 
ATOM   1886 C CG  . LEU A 1 237 ? 18.205  -19.580 38.410  1.00 8.06  ? 241 LEU A CG  1 
ATOM   1887 C CD1 . LEU A 1 237 ? 17.957  -18.787 37.137  1.00 10.19 ? 241 LEU A CD1 1 
ATOM   1888 C CD2 . LEU A 1 237 ? 18.038  -18.683 39.626  1.00 9.65  ? 241 LEU A CD2 1 
ATOM   1889 N N   . GLY A 1 238 ? 16.158  -23.705 39.050  1.00 13.73 ? 242 GLY A N   1 
ATOM   1890 C CA  . GLY A 1 238 ? 15.040  -24.635 39.066  1.00 14.90 ? 242 GLY A CA  1 
ATOM   1891 C C   . GLY A 1 238 ? 14.890  -25.302 40.422  1.00 15.23 ? 242 GLY A C   1 
ATOM   1892 O O   . GLY A 1 238 ? 13.788  -25.406 40.954  1.00 16.85 ? 242 GLY A O   1 
ATOM   1893 N N   . SER A 1 239 ? 16.003  -25.755 40.987  1.00 15.32 ? 243 SER A N   1 
ATOM   1894 C CA  . SER A 1 239 ? 15.979  -26.408 42.289  1.00 17.24 ? 243 SER A CA  1 
ATOM   1895 C C   . SER A 1 239 ? 15.522  -25.441 43.372  1.00 17.65 ? 243 SER A C   1 
ATOM   1896 O O   . SER A 1 239 ? 14.713  -25.792 44.234  1.00 15.49 ? 243 SER A O   1 
ATOM   1897 C CB  . SER A 1 239 ? 17.366  -26.944 42.635  1.00 17.83 ? 243 SER A CB  1 
ATOM   1898 O OG  . SER A 1 239 ? 17.815  -27.839 41.630  1.00 25.08 ? 243 SER A OG  1 
ATOM   1899 N N   . MET A 1 240 ? 16.039  -24.217 43.325  1.00 16.23 ? 244 MET A N   1 
ATOM   1900 C CA  . MET A 1 240 ? 15.671  -23.216 44.312  1.00 15.73 ? 244 MET A CA  1 
ATOM   1901 C C   . MET A 1 240 ? 14.191  -22.866 44.163  1.00 16.07 ? 244 MET A C   1 
ATOM   1902 O O   . MET A 1 240 ? 13.497  -22.642 45.153  1.00 16.55 ? 244 MET A O   1 
ATOM   1903 C CB  . MET A 1 240 ? 16.549  -21.972 44.142  1.00 17.12 ? 244 MET A CB  1 
ATOM   1904 C CG  . MET A 1 240 ? 16.919  -21.308 45.450  1.00 19.35 ? 244 MET A CG  1 
ATOM   1905 S SD  . MET A 1 240 ? 18.300  -20.168 45.299  1.00 17.78 ? 244 MET A SD  1 
ATOM   1906 C CE  . MET A 1 240 ? 19.696  -21.256 45.672  1.00 17.12 ? 244 MET A CE  1 
ATOM   1907 N N   . ALA A 1 241 ? 13.703  -22.832 42.927  1.00 15.67 ? 245 ALA A N   1 
ATOM   1908 C CA  . ALA A 1 241 ? 12.299  -22.523 42.686  1.00 15.52 ? 245 ALA A CA  1 
ATOM   1909 C C   . ALA A 1 241 ? 11.413  -23.541 43.405  1.00 17.48 ? 245 ALA A C   1 
ATOM   1910 O O   . ALA A 1 241 ? 10.399  -23.185 44.014  1.00 15.85 ? 245 ALA A O   1 
ATOM   1911 C CB  . ALA A 1 241 ? 12.009  -22.537 41.191  1.00 16.90 ? 245 ALA A CB  1 
ATOM   1912 N N   . LYS A 1 242 ? 11.804  -24.809 43.341  1.00 17.66 ? 246 LYS A N   1 
ATOM   1913 C CA  . LYS A 1 242 ? 11.036  -25.865 43.990  1.00 19.87 ? 246 LYS A CA  1 
ATOM   1914 C C   . LYS A 1 242 ? 11.123  -25.762 45.505  1.00 18.55 ? 246 LYS A C   1 
ATOM   1915 O O   . LYS A 1 242 ? 10.129  -25.952 46.204  1.00 19.24 ? 246 LYS A O   1 
ATOM   1916 C CB  . LYS A 1 242 ? 11.525  -27.242 43.532  1.00 21.82 ? 246 LYS A CB  1 
ATOM   1917 C CG  . LYS A 1 242 ? 11.283  -27.513 42.053  1.00 25.54 ? 246 LYS A CG  1 
ATOM   1918 C CD  . LYS A 1 242 ? 11.702  -28.923 41.664  0.75 27.70 ? 246 LYS A CD  1 
ATOM   1919 C CE  . LYS A 1 242 ? 11.448  -29.189 40.185  0.75 29.26 ? 246 LYS A CE  1 
ATOM   1920 N NZ  . LYS A 1 242 ? 12.255  -28.292 39.308  0.75 29.72 ? 246 LYS A NZ  1 
ATOM   1921 N N   . LYS A 1 243 ? 12.313  -25.458 46.010  1.00 18.25 ? 247 LYS A N   1 
ATOM   1922 C CA  . LYS A 1 243 ? 12.517  -25.328 47.448  1.00 18.38 ? 247 LYS A CA  1 
ATOM   1923 C C   . LYS A 1 243 ? 11.627  -24.238 48.044  1.00 19.03 ? 247 LYS A C   1 
ATOM   1924 O O   . LYS A 1 243 ? 11.040  -24.427 49.112  1.00 17.62 ? 247 LYS A O   1 
ATOM   1925 C CB  . LYS A 1 243 ? 13.987  -25.017 47.746  1.00 18.72 ? 247 LYS A CB  1 
ATOM   1926 C CG  . LYS A 1 243 ? 14.309  -24.810 49.226  1.00 18.84 ? 247 LYS A CG  1 
ATOM   1927 C CD  . LYS A 1 243 ? 15.800  -24.553 49.424  1.00 17.25 ? 247 LYS A CD  1 
ATOM   1928 C CE  . LYS A 1 243 ? 16.139  -24.222 50.865  1.00 18.50 ? 247 LYS A CE  1 
ATOM   1929 N NZ  . LYS A 1 243 ? 17.590  -23.926 51.031  1.00 17.24 ? 247 LYS A NZ  1 
ATOM   1930 N N   . TYR A 1 244 ? 11.521  -23.104 47.350  1.00 17.64 ? 248 TYR A N   1 
ATOM   1931 C CA  . TYR A 1 244 ? 10.709  -21.987 47.832  1.00 17.51 ? 248 TYR A CA  1 
ATOM   1932 C C   . TYR A 1 244 ? 9.273   -21.958 47.321  1.00 18.18 ? 248 TYR A C   1 
ATOM   1933 O O   . TYR A 1 244 ? 8.517   -21.040 47.642  1.00 17.44 ? 248 TYR A O   1 
ATOM   1934 C CB  . TYR A 1 244 ? 11.378  -20.650 47.488  1.00 17.36 ? 248 TYR A CB  1 
ATOM   1935 C CG  . TYR A 1 244 ? 12.647  -20.385 48.261  1.00 15.03 ? 248 TYR A CG  1 
ATOM   1936 C CD1 . TYR A 1 244 ? 13.865  -20.919 47.849  1.00 12.58 ? 248 TYR A CD1 1 
ATOM   1937 C CD2 . TYR A 1 244 ? 12.621  -19.620 49.428  1.00 13.85 ? 248 TYR A CD2 1 
ATOM   1938 C CE1 . TYR A 1 244 ? 15.030  -20.700 48.578  1.00 15.24 ? 248 TYR A CE1 1 
ATOM   1939 C CE2 . TYR A 1 244 ? 13.778  -19.397 50.165  1.00 15.41 ? 248 TYR A CE2 1 
ATOM   1940 C CZ  . TYR A 1 244 ? 14.977  -19.936 49.739  1.00 14.45 ? 248 TYR A CZ  1 
ATOM   1941 O OH  . TYR A 1 244 ? 16.120  -19.712 50.478  1.00 12.98 ? 248 TYR A OH  1 
ATOM   1942 N N   . ASN A 1 245 ? 8.886   -22.957 46.537  1.00 18.97 ? 249 ASN A N   1 
ATOM   1943 C CA  . ASN A 1 245 ? 7.528   -22.995 46.010  1.00 18.75 ? 249 ASN A CA  1 
ATOM   1944 C C   . ASN A 1 245 ? 7.260   -21.783 45.126  1.00 16.00 ? 249 ASN A C   1 
ATOM   1945 O O   . ASN A 1 245 ? 6.154   -21.254 45.117  1.00 15.25 ? 249 ASN A O   1 
ATOM   1946 C CB  . ASN A 1 245 ? 6.512   -23.013 47.157  1.00 23.17 ? 249 ASN A CB  1 
ATOM   1947 C CG  . ASN A 1 245 ? 6.035   -24.406 47.497  1.00 27.25 ? 249 ASN A CG  1 
ATOM   1948 O OD1 . ASN A 1 245 ? 5.441   -24.626 48.555  1.00 31.64 ? 249 ASN A OD1 1 
ATOM   1949 N ND2 . ASN A 1 245 ? 6.276   -25.355 46.601  1.00 27.94 ? 249 ASN A ND2 1 
ATOM   1950 N N   . ARG A 1 246 ? 8.285   -21.346 44.398  1.00 15.02 ? 250 ARG A N   1 
ATOM   1951 C CA  . ARG A 1 246 ? 8.173   -20.202 43.500  1.00 14.48 ? 250 ARG A CA  1 
ATOM   1952 C C   . ARG A 1 246 ? 8.534   -20.635 42.073  1.00 14.64 ? 250 ARG A C   1 
ATOM   1953 O O   . ARG A 1 246 ? 8.248   -21.764 41.674  1.00 13.28 ? 250 ARG A O   1 
ATOM   1954 C CB  . ARG A 1 246 ? 9.103   -19.076 43.968  1.00 15.19 ? 250 ARG A CB  1 
ATOM   1955 C CG  . ARG A 1 246 ? 8.869   -18.646 45.415  1.00 16.38 ? 250 ARG A CG  1 
ATOM   1956 C CD  . ARG A 1 246 ? 7.493   -18.004 45.618  1.00 16.56 ? 250 ARG A CD  1 
ATOM   1957 N NE  . ARG A 1 246 ? 7.170   -17.871 47.041  1.00 17.17 ? 250 ARG A NE  1 
ATOM   1958 C CZ  . ARG A 1 246 ? 6.122   -17.208 47.522  1.00 16.26 ? 250 ARG A CZ  1 
ATOM   1959 N NH1 . ARG A 1 246 ? 5.277   -16.603 46.701  1.00 17.86 ? 250 ARG A NH1 1 
ATOM   1960 N NH2 . ARG A 1 246 ? 5.919   -17.151 48.831  1.00 19.72 ? 250 ARG A NH2 1 
ATOM   1961 N N   . THR A 1 247 ? 9.153   -19.743 41.304  1.00 11.83 ? 251 THR A N   1 
ATOM   1962 C CA  . THR A 1 247 ? 9.533   -20.066 39.930  1.00 11.51 ? 251 THR A CA  1 
ATOM   1963 C C   . THR A 1 247 ? 10.955  -19.592 39.664  1.00 12.04 ? 251 THR A C   1 
ATOM   1964 O O   . THR A 1 247 ? 11.476  -18.741 40.385  1.00 10.23 ? 251 THR A O   1 
ATOM   1965 C CB  . THR A 1 247 ? 8.619   -19.378 38.902  1.00 11.73 ? 251 THR A CB  1 
ATOM   1966 O OG1 . THR A 1 247 ? 8.812   -17.962 38.974  1.00 9.86  ? 251 THR A OG1 1 
ATOM   1967 C CG2 . THR A 1 247 ? 7.159   -19.708 39.170  1.00 11.19 ? 251 THR A CG2 1 
ATOM   1968 N N   . PRO A 1 248 ? 11.603  -20.141 38.625  1.00 10.22 ? 252 PRO A N   1 
ATOM   1969 C CA  . PRO A 1 248 ? 12.973  -19.717 38.328  1.00 10.47 ? 252 PRO A CA  1 
ATOM   1970 C C   . PRO A 1 248 ? 13.093  -18.197 38.178  1.00 10.66 ? 252 PRO A C   1 
ATOM   1971 O O   . PRO A 1 248 ? 14.039  -17.593 38.682  1.00 8.95  ? 252 PRO A O   1 
ATOM   1972 C CB  . PRO A 1 248 ? 13.290  -20.476 37.043  1.00 10.29 ? 252 PRO A CB  1 
ATOM   1973 C CG  . PRO A 1 248 ? 12.568  -21.783 37.269  1.00 10.85 ? 252 PRO A CG  1 
ATOM   1974 C CD  . PRO A 1 248 ? 11.218  -21.297 37.794  1.00 11.41 ? 252 PRO A CD  1 
ATOM   1975 N N   . ALA A 1 249 ? 12.125  -17.584 37.498  1.00 10.56 ? 253 ALA A N   1 
ATOM   1976 C CA  . ALA A 1 249 ? 12.134  -16.134 37.300  1.00 11.15 ? 253 ALA A CA  1 
ATOM   1977 C C   . ALA A 1 249 ? 12.031  -15.382 38.627  1.00 10.55 ? 253 ALA A C   1 
ATOM   1978 O O   . ALA A 1 249 ? 12.732  -14.395 38.841  1.00 8.67  ? 253 ALA A O   1 
ATOM   1979 C CB  . ALA A 1 249 ? 10.985  -15.721 36.376  1.00 11.04 ? 253 ALA A CB  1 
ATOM   1980 N N   . LEU A 1 250 ? 11.157  -15.846 39.516  1.00 11.04 ? 254 LEU A N   1 
ATOM   1981 C CA  . LEU A 1 250 ? 10.989  -15.199 40.814  1.00 8.03  ? 254 LEU A CA  1 
ATOM   1982 C C   . LEU A 1 250 ? 12.272  -15.293 41.639  1.00 8.78  ? 254 LEU A C   1 
ATOM   1983 O O   . LEU A 1 250 ? 12.625  -14.360 42.361  1.00 6.22  ? 254 LEU A O   1 
ATOM   1984 C CB  . LEU A 1 250 ? 9.813   -15.825 41.578  1.00 8.14  ? 254 LEU A CB  1 
ATOM   1985 C CG  . LEU A 1 250 ? 8.425   -15.350 41.128  1.00 10.93 ? 254 LEU A CG  1 
ATOM   1986 C CD1 . LEU A 1 250 ? 7.332   -16.159 41.813  1.00 10.41 ? 254 LEU A CD1 1 
ATOM   1987 C CD2 . LEU A 1 250 ? 8.273   -13.868 41.461  1.00 10.40 ? 254 LEU A CD2 1 
ATOM   1988 N N   . ILE A 1 251 ? 12.977  -16.414 41.531  1.00 7.47  ? 255 ILE A N   1 
ATOM   1989 C CA  . ILE A 1 251 ? 14.224  -16.573 42.273  1.00 8.61  ? 255 ILE A CA  1 
ATOM   1990 C C   . ILE A 1 251 ? 15.267  -15.576 41.751  1.00 8.19  ? 255 ILE A C   1 
ATOM   1991 O O   . ILE A 1 251 ? 15.960  -14.916 42.533  1.00 6.82  ? 255 ILE A O   1 
ATOM   1992 C CB  . ILE A 1 251 ? 14.795  -18.006 42.126  1.00 8.73  ? 255 ILE A CB  1 
ATOM   1993 C CG1 . ILE A 1 251 ? 13.781  -19.039 42.637  1.00 11.12 ? 255 ILE A CG1 1 
ATOM   1994 C CG2 . ILE A 1 251 ? 16.100  -18.116 42.884  1.00 9.24  ? 255 ILE A CG2 1 
ATOM   1995 C CD1 . ILE A 1 251 ? 13.410  -18.878 44.113  1.00 12.83 ? 255 ILE A CD1 1 
ATOM   1996 N N   . ALA A 1 252 ? 15.364  -15.472 40.428  1.00 6.80  ? 256 ALA A N   1 
ATOM   1997 C CA  . ALA A 1 252 ? 16.321  -14.573 39.786  1.00 8.85  ? 256 ALA A CA  1 
ATOM   1998 C C   . ALA A 1 252 ? 16.033  -13.110 40.118  1.00 8.25  ? 256 ALA A C   1 
ATOM   1999 O O   . ALA A 1 252 ? 16.953  -12.315 40.334  1.00 6.93  ? 256 ALA A O   1 
ATOM   2000 C CB  . ALA A 1 252 ? 16.303  -14.789 38.275  1.00 7.73  ? 256 ALA A CB  1 
ATOM   2001 N N   . LEU A 1 253 ? 14.756  -12.750 40.151  1.00 6.74  ? 257 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 253 ? 14.364  -11.384 40.482  1.00 8.06  ? 257 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 253 ? 14.663  -11.065 41.948  1.00 7.15  ? 257 LEU A C   1 
ATOM   2004 O O   . LEU A 1 253 ? 15.236  -10.018 42.260  1.00 4.82  ? 257 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 253 ? 12.865  -11.181 40.227  1.00 7.56  ? 257 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 253 ? 12.351  -11.283 38.787  1.00 9.89  ? 257 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 253 ? 10.828  -11.433 38.806  1.00 9.60  ? 257 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 253 ? 12.766  -10.044 37.987  1.00 10.61 ? 257 LEU A CD2 1 
ATOM   2009 N N   . ARG A 1 254 ? 14.270  -11.966 42.848  1.00 6.24  ? 258 ARG A N   1 
ATOM   2010 C CA  . ARG A 1 254 ? 14.480  -11.752 44.279  1.00 6.85  ? 258 ARG A CA  1 
ATOM   2011 C C   . ARG A 1 254 ? 15.966  -11.672 44.627  1.00 6.35  ? 258 ARG A C   1 
ATOM   2012 O O   . ARG A 1 254 ? 16.362  -10.915 45.515  1.00 4.22  ? 258 ARG A O   1 
ATOM   2013 C CB  . ARG A 1 254 ? 13.812  -12.870 45.094  1.00 6.75  ? 258 ARG A CB  1 
ATOM   2014 C CG  . ARG A 1 254 ? 13.888  -12.655 46.598  1.00 9.17  ? 258 ARG A CG  1 
ATOM   2015 C CD  . ARG A 1 254 ? 12.964  -11.529 47.039  1.00 7.73  ? 258 ARG A CD  1 
ATOM   2016 N NE  . ARG A 1 254 ? 13.292  -11.033 48.370  1.00 8.30  ? 258 ARG A NE  1 
ATOM   2017 C CZ  . ARG A 1 254 ? 12.600  -10.090 49.000  1.00 10.51 ? 258 ARG A CZ  1 
ATOM   2018 N NH1 . ARG A 1 254 ? 11.538  -9.542  48.416  1.00 9.50  ? 258 ARG A NH1 1 
ATOM   2019 N NH2 . ARG A 1 254 ? 12.970  -9.689  50.208  1.00 7.36  ? 258 ARG A NH2 1 
ATOM   2020 N N   . TYR A 1 255 ? 16.784  -12.460 43.934  1.00 5.86  ? 259 TYR A N   1 
ATOM   2021 C CA  . TYR A 1 255 ? 18.230  -12.456 44.157  1.00 6.78  ? 259 TYR A CA  1 
ATOM   2022 C C   . TYR A 1 255 ? 18.779  -11.031 44.033  1.00 6.75  ? 259 TYR A C   1 
ATOM   2023 O O   . TYR A 1 255 ? 19.557  -10.565 44.872  1.00 5.79  ? 259 TYR A O   1 
ATOM   2024 C CB  . TYR A 1 255 ? 18.916  -13.363 43.124  1.00 8.29  ? 259 TYR A CB  1 
ATOM   2025 C CG  . TYR A 1 255 ? 20.430  -13.248 43.069  1.00 8.35  ? 259 TYR A CG  1 
ATOM   2026 C CD1 . TYR A 1 255 ? 21.222  -13.616 44.156  1.00 9.67  ? 259 TYR A CD1 1 
ATOM   2027 C CD2 . TYR A 1 255 ? 21.071  -12.782 41.916  1.00 10.02 ? 259 TYR A CD2 1 
ATOM   2028 C CE1 . TYR A 1 255 ? 22.616  -13.527 44.100  1.00 10.60 ? 259 TYR A CE1 1 
ATOM   2029 C CE2 . TYR A 1 255 ? 22.469  -12.689 41.848  1.00 11.03 ? 259 TYR A CE2 1 
ATOM   2030 C CZ  . TYR A 1 255 ? 23.233  -13.064 42.943  1.00 11.03 ? 259 TYR A CZ  1 
ATOM   2031 O OH  . TYR A 1 255 ? 24.613  -12.969 42.883  1.00 9.97  ? 259 TYR A OH  1 
ATOM   2032 N N   . GLN A 1 256 ? 18.354  -10.333 42.986  1.00 5.80  ? 260 GLN A N   1 
ATOM   2033 C CA  . GLN A 1 256 ? 18.827  -8.977  42.740  1.00 5.32  ? 260 GLN A CA  1 
ATOM   2034 C C   . GLN A 1 256 ? 18.292  -7.968  43.750  1.00 4.56  ? 260 GLN A C   1 
ATOM   2035 O O   . GLN A 1 256 ? 19.030  -7.100  44.214  1.00 6.63  ? 260 GLN A O   1 
ATOM   2036 C CB  . GLN A 1 256 ? 18.450  -8.555  41.315  1.00 4.59  ? 260 GLN A CB  1 
ATOM   2037 C CG  . GLN A 1 256 ? 19.012  -9.479  40.241  1.00 6.79  ? 260 GLN A CG  1 
ATOM   2038 C CD  . GLN A 1 256 ? 20.524  -9.394  40.110  1.00 9.05  ? 260 GLN A CD  1 
ATOM   2039 O OE1 . GLN A 1 256 ? 21.247  -9.258  41.100  1.00 9.30  ? 260 GLN A OE1 1 
ATOM   2040 N NE2 . GLN A 1 256 ? 21.010  -9.488  38.881  1.00 10.37 ? 260 GLN A NE2 1 
ATOM   2041 N N   . LEU A 1 257 ? 17.015  -8.075  44.102  1.00 5.36  ? 261 LEU A N   1 
ATOM   2042 C CA  . LEU A 1 257 ? 16.438  -7.137  45.061  1.00 6.04  ? 261 LEU A CA  1 
ATOM   2043 C C   . LEU A 1 257 ? 17.150  -7.190  46.405  1.00 8.07  ? 261 LEU A C   1 
ATOM   2044 O O   . LEU A 1 257 ? 17.340  -6.160  47.054  1.00 8.86  ? 261 LEU A O   1 
ATOM   2045 C CB  . LEU A 1 257 ? 14.948  -7.421  45.270  1.00 4.92  ? 261 LEU A CB  1 
ATOM   2046 C CG  . LEU A 1 257 ? 14.015  -7.031  44.121  1.00 6.12  ? 261 LEU A CG  1 
ATOM   2047 C CD1 . LEU A 1 257 ? 12.576  -7.379  44.484  1.00 9.61  ? 261 LEU A CD1 1 
ATOM   2048 C CD2 . LEU A 1 257 ? 14.157  -5.534  43.851  1.00 5.70  ? 261 LEU A CD2 1 
ATOM   2049 N N   . GLN A 1 258 ? 17.542  -8.387  46.825  1.00 6.98  ? 262 GLN A N   1 
ATOM   2050 C CA  . GLN A 1 258 ? 18.224  -8.540  48.105  1.00 7.38  ? 262 GLN A CA  1 
ATOM   2051 C C   . GLN A 1 258 ? 19.661  -8.026  48.100  1.00 9.35  ? 262 GLN A C   1 
ATOM   2052 O O   . GLN A 1 258 ? 20.284  -7.898  49.158  1.00 10.51 ? 262 GLN A O   1 
ATOM   2053 C CB  . GLN A 1 258 ? 18.162  -10.004 48.559  1.00 7.98  ? 262 GLN A CB  1 
ATOM   2054 C CG  . GLN A 1 258 ? 16.785  -10.375 49.102  1.00 5.92  ? 262 GLN A CG  1 
ATOM   2055 C CD  . GLN A 1 258 ? 16.712  -11.778 49.683  1.00 8.42  ? 262 GLN A CD  1 
ATOM   2056 O OE1 . GLN A 1 258 ? 17.664  -12.267 50.303  1.00 11.60 ? 262 GLN A OE1 1 
ATOM   2057 N NE2 . GLN A 1 258 ? 15.567  -12.422 49.509  1.00 6.13  ? 262 GLN A NE2 1 
ATOM   2058 N N   . ARG A 1 259 ? 20.180  -7.717  46.913  1.00 9.15  ? 263 ARG A N   1 
ATOM   2059 C CA  . ARG A 1 259 ? 21.537  -7.187  46.778  1.00 9.21  ? 263 ARG A CA  1 
ATOM   2060 C C   . ARG A 1 259 ? 21.501  -5.661  46.669  1.00 8.33  ? 263 ARG A C   1 
ATOM   2061 O O   . ARG A 1 259 ? 22.536  -5.018  46.468  1.00 6.77  ? 263 ARG A O   1 
ATOM   2062 C CB  . ARG A 1 259 ? 22.220  -7.759  45.530  1.00 10.05 ? 263 ARG A CB  1 
ATOM   2063 C CG  . ARG A 1 259 ? 22.249  -9.270  45.457  1.00 9.80  ? 263 ARG A CG  1 
ATOM   2064 C CD  . ARG A 1 259 ? 22.790  -9.720  44.107  1.00 11.13 ? 263 ARG A CD  1 
ATOM   2065 N NE  . ARG A 1 259 ? 24.233  -9.531  44.009  1.00 10.90 ? 263 ARG A NE  1 
ATOM   2066 C CZ  . ARG A 1 259 ? 24.884  -9.307  42.874  1.00 12.04 ? 263 ARG A CZ  1 
ATOM   2067 N NH1 . ARG A 1 259 ? 24.216  -9.233  41.726  1.00 7.52  ? 263 ARG A NH1 1 
ATOM   2068 N NH2 . ARG A 1 259 ? 26.206  -9.172  42.885  1.00 10.20 ? 263 ARG A NH2 1 
ATOM   2069 N N   . GLY A 1 260 ? 20.308  -5.086  46.791  1.00 7.75  ? 264 GLY A N   1 
ATOM   2070 C CA  . GLY A 1 260 ? 20.171  -3.639  46.713  1.00 8.58  ? 264 GLY A CA  1 
ATOM   2071 C C   . GLY A 1 260 ? 20.058  -3.097  45.296  1.00 9.06  ? 264 GLY A C   1 
ATOM   2072 O O   . GLY A 1 260 ? 20.231  -1.900  45.059  1.00 10.91 ? 264 GLY A O   1 
ATOM   2073 N N   . ILE A 1 261 ? 19.762  -3.981  44.352  1.00 8.39  ? 265 ILE A N   1 
ATOM   2074 C CA  . ILE A 1 261 ? 19.626  -3.606  42.951  1.00 7.40  ? 265 ILE A CA  1 
ATOM   2075 C C   . ILE A 1 261 ? 18.165  -3.329  42.597  1.00 6.92  ? 265 ILE A C   1 
ATOM   2076 O O   . ILE A 1 261 ? 17.260  -3.970  43.129  1.00 6.02  ? 265 ILE A O   1 
ATOM   2077 C CB  . ILE A 1 261 ? 20.159  -4.745  42.027  1.00 7.90  ? 265 ILE A CB  1 
ATOM   2078 C CG1 . ILE A 1 261 ? 21.675  -4.878  42.197  1.00 10.31 ? 265 ILE A CG1 1 
ATOM   2079 C CG2 . ILE A 1 261 ? 19.794  -4.476  40.567  1.00 8.86  ? 265 ILE A CG2 1 
ATOM   2080 C CD1 . ILE A 1 261 ? 22.280  -6.048  41.457  1.00 12.59 ? 265 ILE A CD1 1 
ATOM   2081 N N   . VAL A 1 262 ? 17.949  -2.347  41.724  1.00 5.60  ? 266 VAL A N   1 
ATOM   2082 C CA  . VAL A 1 262 ? 16.611  -2.007  41.233  1.00 7.41  ? 266 VAL A CA  1 
ATOM   2083 C C   . VAL A 1 262 ? 16.509  -2.891  39.995  1.00 7.31  ? 266 VAL A C   1 
ATOM   2084 O O   . VAL A 1 262 ? 17.372  -2.840  39.119  1.00 8.33  ? 266 VAL A O   1 
ATOM   2085 C CB  . VAL A 1 262 ? 16.514  -0.510  40.868  1.00 7.05  ? 266 VAL A CB  1 
ATOM   2086 C CG1 . VAL A 1 262 ? 15.267  -0.238  40.035  1.00 6.24  ? 266 VAL A CG1 1 
ATOM   2087 C CG2 . VAL A 1 262 ? 16.473  0.313   42.148  1.00 10.03 ? 266 VAL A CG2 1 
ATOM   2088 N N   A VAL A 1 263 ? 15.450  -3.693  39.925  0.50 7.13  ? 267 VAL A N   1 
ATOM   2089 N N   B VAL A 1 263 ? 15.459  -3.703  39.917  0.50 6.83  ? 267 VAL A N   1 
ATOM   2090 C CA  A VAL A 1 263 ? 15.267  -4.638  38.826  0.50 7.19  ? 267 VAL A CA  1 
ATOM   2091 C CA  B VAL A 1 263 ? 15.324  -4.619  38.793  0.50 6.54  ? 267 VAL A CA  1 
ATOM   2092 C C   A VAL A 1 263 ? 14.210  -4.309  37.777  0.50 6.96  ? 267 VAL A C   1 
ATOM   2093 C C   B VAL A 1 263 ? 14.240  -4.286  37.777  0.50 6.59  ? 267 VAL A C   1 
ATOM   2094 O O   A VAL A 1 263 ? 13.103  -3.877  38.101  0.50 6.89  ? 267 VAL A O   1 
ATOM   2095 O O   B VAL A 1 263 ? 13.149  -3.832  38.123  0.50 6.58  ? 267 VAL A O   1 
ATOM   2096 C CB  A VAL A 1 263 ? 14.963  -6.048  39.398  0.50 7.37  ? 267 VAL A CB  1 
ATOM   2097 C CB  B VAL A 1 263 ? 15.087  -6.065  39.289  0.50 6.36  ? 267 VAL A CB  1 
ATOM   2098 C CG1 A VAL A 1 263 ? 13.932  -5.940  40.507  0.50 8.02  ? 267 VAL A CG1 1 
ATOM   2099 C CG1 B VAL A 1 263 ? 16.090  -6.413  40.381  0.50 2.20  ? 267 VAL A CG1 1 
ATOM   2100 C CG2 A VAL A 1 263 ? 14.453  -6.973  38.305  0.50 6.50  ? 267 VAL A CG2 1 
ATOM   2101 C CG2 B VAL A 1 263 ? 13.673  -6.219  39.802  0.50 7.73  ? 267 VAL A CG2 1 
ATOM   2102 N N   . LEU A 1 264 ? 14.565  -4.528  36.513  1.00 6.16  ? 268 LEU A N   1 
ATOM   2103 C CA  . LEU A 1 264 ? 13.647  -4.303  35.410  1.00 6.70  ? 268 LEU A CA  1 
ATOM   2104 C C   . LEU A 1 264 ? 13.261  -5.708  34.963  1.00 9.31  ? 268 LEU A C   1 
ATOM   2105 O O   . LEU A 1 264 ? 13.955  -6.677  35.287  1.00 9.98  ? 268 LEU A O   1 
ATOM   2106 C CB  . LEU A 1 264 ? 14.345  -3.586  34.250  1.00 7.13  ? 268 LEU A CB  1 
ATOM   2107 C CG  . LEU A 1 264 ? 14.871  -2.167  34.470  1.00 7.06  ? 268 LEU A CG  1 
ATOM   2108 C CD1 . LEU A 1 264 ? 15.421  -1.626  33.149  1.00 8.69  ? 268 LEU A CD1 1 
ATOM   2109 C CD2 . LEU A 1 264 ? 13.738  -1.271  34.968  1.00 6.31  ? 268 LEU A CD2 1 
ATOM   2110 N N   . ASN A 1 265 ? 12.152  -5.831  34.243  1.00 8.19  ? 269 ASN A N   1 
ATOM   2111 C CA  . ASN A 1 265 ? 11.726  -7.130  33.734  1.00 9.29  ? 269 ASN A CA  1 
ATOM   2112 C C   . ASN A 1 265 ? 10.702  -6.906  32.638  1.00 8.60  ? 269 ASN A C   1 
ATOM   2113 O O   . ASN A 1 265 ? 9.933   -5.941  32.679  1.00 9.69  ? 269 ASN A O   1 
ATOM   2114 C CB  . ASN A 1 265 ? 11.103  -7.994  34.836  1.00 9.60  ? 269 ASN A CB  1 
ATOM   2115 C CG  . ASN A 1 265 ? 9.677   -7.587  35.167  1.00 14.83 ? 269 ASN A CG  1 
ATOM   2116 O OD1 . ASN A 1 265 ? 8.716   -8.108  34.590  1.00 14.22 ? 269 ASN A OD1 1 
ATOM   2117 N ND2 . ASN A 1 265 ? 9.533   -6.644  36.091  1.00 14.20 ? 269 ASN A ND2 1 
ATOM   2118 N N   . THR A 1 266 ? 10.726  -7.783  31.643  1.00 8.65  ? 270 THR A N   1 
ATOM   2119 C CA  . THR A 1 266 ? 9.777   -7.711  30.540  1.00 9.56  ? 270 THR A CA  1 
ATOM   2120 C C   . THR A 1 266 ? 9.262   -9.102  30.209  1.00 9.43  ? 270 THR A C   1 
ATOM   2121 O O   . THR A 1 266 ? 10.001  -10.085 30.269  1.00 7.08  ? 270 THR A O   1 
ATOM   2122 C CB  . THR A 1 266 ? 10.408  -7.132  29.257  1.00 9.23  ? 270 THR A CB  1 
ATOM   2123 O OG1 . THR A 1 266 ? 10.807  -5.776  29.486  1.00 9.25  ? 270 THR A OG1 1 
ATOM   2124 C CG2 . THR A 1 266 ? 9.402   -7.168  28.101  1.00 10.29 ? 270 THR A CG2 1 
ATOM   2125 N N   . SER A 1 267 ? 7.979   -9.171  29.875  1.00 10.39 ? 271 SER A N   1 
ATOM   2126 C CA  . SER A 1 267 ? 7.339   -10.416 29.477  1.00 11.58 ? 271 SER A CA  1 
ATOM   2127 C C   . SER A 1 267 ? 6.224   -10.018 28.532  1.00 12.87 ? 271 SER A C   1 
ATOM   2128 O O   . SER A 1 267 ? 5.614   -8.956  28.696  1.00 11.55 ? 271 SER A O   1 
ATOM   2129 C CB  . SER A 1 267 ? 6.740   -11.156 30.677  1.00 12.28 ? 271 SER A CB  1 
ATOM   2130 O OG  . SER A 1 267 ? 6.055   -12.323 30.237  1.00 11.23 ? 271 SER A OG  1 
ATOM   2131 N N   . LEU A 1 268 ? 5.969   -10.861 27.539  1.00 13.26 ? 272 LEU A N   1 
ATOM   2132 C CA  . LEU A 1 268 ? 4.919   -10.598 26.572  1.00 14.50 ? 272 LEU A CA  1 
ATOM   2133 C C   . LEU A 1 268 ? 3.653   -11.318 27.017  1.00 15.39 ? 272 LEU A C   1 
ATOM   2134 O O   . LEU A 1 268 ? 2.602   -11.172 26.399  1.00 13.71 ? 272 LEU A O   1 
ATOM   2135 C CB  . LEU A 1 268 ? 5.333   -11.110 25.189  1.00 16.98 ? 272 LEU A CB  1 
ATOM   2136 C CG  . LEU A 1 268 ? 6.649   -10.598 24.597  1.00 16.73 ? 272 LEU A CG  1 
ATOM   2137 C CD1 . LEU A 1 268 ? 6.905   -11.281 23.260  1.00 19.67 ? 272 LEU A CD1 1 
ATOM   2138 C CD2 . LEU A 1 268 ? 6.585   -9.099  24.421  1.00 19.47 ? 272 LEU A CD2 1 
ATOM   2139 N N   . LYS A 1 269 ? 3.761   -12.082 28.100  1.00 14.46 ? 273 LYS A N   1 
ATOM   2140 C CA  . LYS A 1 269 ? 2.635   -12.853 28.621  1.00 16.57 ? 273 LYS A CA  1 
ATOM   2141 C C   . LYS A 1 269 ? 2.007   -12.258 29.885  1.00 15.76 ? 273 LYS A C   1 
ATOM   2142 O O   . LYS A 1 269 ? 2.679   -12.059 30.899  1.00 15.25 ? 273 LYS A O   1 
ATOM   2143 C CB  . LYS A 1 269 ? 3.095   -14.292 28.881  1.00 18.24 ? 273 LYS A CB  1 
ATOM   2144 C CG  . LYS A 1 269 ? 3.634   -14.992 27.626  1.00 18.50 ? 273 LYS A CG  1 
ATOM   2145 C CD  . LYS A 1 269 ? 4.349   -16.288 27.970  1.00 20.86 ? 273 LYS A CD  1 
ATOM   2146 C CE  . LYS A 1 269 ? 4.773   -17.064 26.718  1.00 19.68 ? 273 LYS A CE  1 
ATOM   2147 N NZ  . LYS A 1 269 ? 5.667   -16.288 25.810  1.00 19.08 ? 273 LYS A NZ  1 
ATOM   2148 N N   . GLU A 1 270 ? 0.708   -11.986 29.814  1.00 15.55 ? 274 GLU A N   1 
ATOM   2149 C CA  . GLU A 1 270 ? -0.031  -11.410 30.936  1.00 15.37 ? 274 GLU A CA  1 
ATOM   2150 C C   . GLU A 1 270 ? 0.186   -12.148 32.259  1.00 15.23 ? 274 GLU A C   1 
ATOM   2151 O O   . GLU A 1 270 ? 0.373   -11.521 33.302  1.00 14.95 ? 274 GLU A O   1 
ATOM   2152 C CB  . GLU A 1 270 ? -1.528  -11.380 30.609  1.00 17.66 ? 274 GLU A CB  1 
ATOM   2153 C CG  . GLU A 1 270 ? -2.381  -10.728 31.680  1.00 18.19 ? 274 GLU A CG  1 
ATOM   2154 C CD  . GLU A 1 270 ? -3.871  -10.769 31.360  1.00 23.23 ? 274 GLU A CD  1 
ATOM   2155 O OE1 . GLU A 1 270 ? -4.660  -10.248 32.173  1.00 23.92 ? 274 GLU A OE1 1 
ATOM   2156 O OE2 . GLU A 1 270 ? -4.252  -11.322 30.302  1.00 23.75 ? 274 GLU A OE2 1 
ATOM   2157 N N   . GLU A 1 271 ? 0.167   -13.477 32.212  1.00 14.98 ? 275 GLU A N   1 
ATOM   2158 C CA  . GLU A 1 271 ? 0.342   -14.294 33.408  1.00 15.51 ? 275 GLU A CA  1 
ATOM   2159 C C   . GLU A 1 271 ? 1.696   -14.079 34.093  1.00 14.61 ? 275 GLU A C   1 
ATOM   2160 O O   . GLU A 1 271 ? 1.791   -14.092 35.325  1.00 12.52 ? 275 GLU A O   1 
ATOM   2161 C CB  . GLU A 1 271 ? 0.183   -15.775 33.051  1.00 18.83 ? 275 GLU A CB  1 
ATOM   2162 C CG  . GLU A 1 271 ? 0.133   -16.711 34.250  0.50 22.53 ? 275 GLU A CG  1 
ATOM   2163 C CD  . GLU A 1 271 ? -1.137  -16.555 35.069  0.50 24.88 ? 275 GLU A CD  1 
ATOM   2164 O OE1 . GLU A 1 271 ? -1.270  -17.250 36.099  0.50 26.86 ? 275 GLU A OE1 1 
ATOM   2165 O OE2 . GLU A 1 271 ? -2.006  -15.743 34.686  0.50 27.13 ? 275 GLU A OE2 1 
ATOM   2166 N N   . ARG A 1 272 ? 2.739   -13.885 33.294  1.00 12.23 ? 276 ARG A N   1 
ATOM   2167 C CA  . ARG A 1 272 ? 4.084   -13.683 33.831  1.00 12.57 ? 276 ARG A CA  1 
ATOM   2168 C C   . ARG A 1 272 ? 4.297   -12.279 34.380  1.00 11.59 ? 276 ARG A C   1 
ATOM   2169 O O   . ARG A 1 272 ? 5.039   -12.083 35.344  1.00 12.40 ? 276 ARG A O   1 
ATOM   2170 C CB  . ARG A 1 272 ? 5.121   -14.012 32.754  1.00 10.37 ? 276 ARG A CB  1 
ATOM   2171 C CG  . ARG A 1 272 ? 5.139   -15.503 32.432  1.00 13.48 ? 276 ARG A CG  1 
ATOM   2172 C CD  . ARG A 1 272 ? 6.093   -15.856 31.312  1.00 12.01 ? 276 ARG A CD  1 
ATOM   2173 N NE  . ARG A 1 272 ? 6.191   -17.305 31.149  1.00 12.08 ? 276 ARG A NE  1 
ATOM   2174 C CZ  . ARG A 1 272 ? 6.864   -17.904 30.174  1.00 13.24 ? 276 ARG A CZ  1 
ATOM   2175 N NH1 . ARG A 1 272 ? 7.505   -17.178 29.269  1.00 13.86 ? 276 ARG A NH1 1 
ATOM   2176 N NH2 . ARG A 1 272 ? 6.892   -19.229 30.100  1.00 15.30 ? 276 ARG A NH2 1 
ATOM   2177 N N   . ILE A 1 273 ? 3.639   -11.302 33.771  1.00 12.37 ? 277 ILE A N   1 
ATOM   2178 C CA  . ILE A 1 273 ? 3.745   -9.922  34.228  1.00 10.73 ? 277 ILE A CA  1 
ATOM   2179 C C   . ILE A 1 273 ? 3.157   -9.868  35.643  1.00 12.99 ? 277 ILE A C   1 
ATOM   2180 O O   . ILE A 1 273 ? 3.731   -9.256  36.552  1.00 10.63 ? 277 ILE A O   1 
ATOM   2181 C CB  . ILE A 1 273 ? 2.977   -8.981  33.267  1.00 11.81 ? 277 ILE A CB  1 
ATOM   2182 C CG1 . ILE A 1 273 ? 3.684   -8.969  31.906  1.00 11.18 ? 277 ILE A CG1 1 
ATOM   2183 C CG2 . ILE A 1 273 ? 2.882   -7.575  33.849  1.00 9.35  ? 277 ILE A CG2 1 
ATOM   2184 C CD1 . ILE A 1 273 ? 3.001   -8.102  30.853  1.00 10.40 ? 277 ILE A CD1 1 
ATOM   2185 N N   . LYS A 1 274 ? 2.020   -10.536 35.828  1.00 11.45 ? 278 LYS A N   1 
ATOM   2186 C CA  . LYS A 1 274 ? 1.363   -10.595 37.130  1.00 11.78 ? 278 LYS A CA  1 
ATOM   2187 C C   . LYS A 1 274 ? 2.212   -11.381 38.128  1.00 12.12 ? 278 LYS A C   1 
ATOM   2188 O O   . LYS A 1 274 ? 2.296   -11.023 39.305  1.00 14.66 ? 278 LYS A O   1 
ATOM   2189 C CB  . LYS A 1 274 ? 0.000   -11.286 37.013  1.00 13.09 ? 278 LYS A CB  1 
ATOM   2190 C CG  . LYS A 1 274 ? -1.056  -10.507 36.249  1.00 15.28 ? 278 LYS A CG  1 
ATOM   2191 C CD  . LYS A 1 274 ? -2.336  -11.325 36.136  1.00 19.98 ? 278 LYS A CD  1 
ATOM   2192 C CE  . LYS A 1 274 ? -3.412  -10.580 35.366  1.00 23.64 ? 278 LYS A CE  1 
ATOM   2193 N NZ  . LYS A 1 274 ? -4.621  -11.430 35.160  1.00 27.08 ? 278 LYS A NZ  1 
ATOM   2194 N N   . GLU A 1 275 ? 2.821   -12.463 37.654  1.00 9.93  ? 279 GLU A N   1 
ATOM   2195 C CA  . GLU A 1 275 ? 3.643   -13.323 38.504  1.00 11.36 ? 279 GLU A CA  1 
ATOM   2196 C C   . GLU A 1 275 ? 4.819   -12.584 39.118  1.00 10.23 ? 279 GLU A C   1 
ATOM   2197 O O   . GLU A 1 275 ? 5.063   -12.658 40.322  1.00 10.96 ? 279 GLU A O   1 
ATOM   2198 C CB  . GLU A 1 275 ? 4.182   -14.513 37.698  1.00 11.58 ? 279 GLU A CB  1 
ATOM   2199 C CG  . GLU A 1 275 ? 4.902   -15.564 38.552  1.00 14.84 ? 279 GLU A CG  1 
ATOM   2200 C CD  . GLU A 1 275 ? 5.455   -16.724 37.733  1.00 16.94 ? 279 GLU A CD  1 
ATOM   2201 O OE1 . GLU A 1 275 ? 6.668   -16.721 37.431  1.00 13.21 ? 279 GLU A OE1 1 
ATOM   2202 O OE2 . GLU A 1 275 ? 4.670   -17.637 37.387  1.00 13.15 ? 279 GLU A OE2 1 
ATOM   2203 N N   . ASN A 1 276 ? 5.543   -11.865 38.273  1.00 10.49 ? 280 ASN A N   1 
ATOM   2204 C CA  . ASN A 1 276 ? 6.726   -11.138 38.704  1.00 11.03 ? 280 ASN A CA  1 
ATOM   2205 C C   . ASN A 1 276 ? 6.512   -10.214 39.897  1.00 11.47 ? 280 ASN A C   1 
ATOM   2206 O O   . ASN A 1 276 ? 7.435   -9.991  40.683  1.00 10.11 ? 280 ASN A O   1 
ATOM   2207 C CB  . ASN A 1 276 ? 7.305   -10.389 37.504  1.00 11.70 ? 280 ASN A CB  1 
ATOM   2208 C CG  . ASN A 1 276 ? 7.789   -11.340 36.418  1.00 10.79 ? 280 ASN A CG  1 
ATOM   2209 O OD1 . ASN A 1 276 ? 8.084   -10.931 35.291  1.00 13.10 ? 280 ASN A OD1 1 
ATOM   2210 N ND2 . ASN A 1 276 ? 7.880   -12.619 36.759  1.00 5.39  ? 280 ASN A ND2 1 
ATOM   2211 N N   . MET A 1 277 ? 5.297   -9.695  40.049  1.00 10.96 ? 281 MET A N   1 
ATOM   2212 C CA  . MET A 1 277 ? 4.988   -8.811  41.167  1.00 11.50 ? 281 MET A CA  1 
ATOM   2213 C C   . MET A 1 277 ? 5.070   -9.570  42.495  1.00 12.00 ? 281 MET A C   1 
ATOM   2214 O O   . MET A 1 277 ? 5.182   -8.965  43.563  1.00 11.63 ? 281 MET A O   1 
ATOM   2215 C CB  . MET A 1 277 ? 3.586   -8.217  40.985  1.00 14.69 ? 281 MET A CB  1 
ATOM   2216 C CG  . MET A 1 277 ? 3.204   -7.156  42.005  1.00 17.69 ? 281 MET A CG  1 
ATOM   2217 S SD  . MET A 1 277 ? 4.311   -5.720  42.019  1.00 21.04 ? 281 MET A SD  1 
ATOM   2218 C CE  . MET A 1 277 ? 4.437   -5.368  40.298  1.00 10.34 ? 281 MET A CE  1 
ATOM   2219 N N   . GLN A 1 278 ? 5.027   -10.897 42.423  1.00 11.92 ? 282 GLN A N   1 
ATOM   2220 C CA  . GLN A 1 278 ? 5.085   -11.736 43.617  1.00 13.08 ? 282 GLN A CA  1 
ATOM   2221 C C   . GLN A 1 278 ? 6.478   -11.799 44.242  1.00 12.61 ? 282 GLN A C   1 
ATOM   2222 O O   . GLN A 1 278 ? 6.677   -12.440 45.273  1.00 12.34 ? 282 GLN A O   1 
ATOM   2223 C CB  . GLN A 1 278 ? 4.589   -13.150 43.280  1.00 16.70 ? 282 GLN A CB  1 
ATOM   2224 C CG  . GLN A 1 278 ? 3.135   -13.176 42.800  1.00 19.61 ? 282 GLN A CG  1 
ATOM   2225 C CD  . GLN A 1 278 ? 2.609   -14.578 42.527  1.00 24.99 ? 282 GLN A CD  1 
ATOM   2226 O OE1 . GLN A 1 278 ? 3.102   -15.286 41.649  1.00 26.21 ? 282 GLN A OE1 1 
ATOM   2227 N NE2 . GLN A 1 278 ? 1.598   -14.982 43.282  1.00 30.46 ? 282 GLN A NE2 1 
ATOM   2228 N N   . VAL A 1 279 ? 7.435   -11.110 43.629  1.00 10.45 ? 283 VAL A N   1 
ATOM   2229 C CA  . VAL A 1 279 ? 8.803   -11.095 44.127  1.00 9.28  ? 283 VAL A CA  1 
ATOM   2230 C C   . VAL A 1 279 ? 8.904   -10.490 45.531  1.00 8.59  ? 283 VAL A C   1 
ATOM   2231 O O   . VAL A 1 279 ? 9.851   -10.767 46.269  1.00 8.02  ? 283 VAL A O   1 
ATOM   2232 C CB  . VAL A 1 279 ? 9.726   -10.306 43.165  1.00 8.72  ? 283 VAL A CB  1 
ATOM   2233 C CG1 . VAL A 1 279 ? 9.350   -8.826  43.173  1.00 6.95  ? 283 VAL A CG1 1 
ATOM   2234 C CG2 . VAL A 1 279 ? 11.189  -10.508 43.556  1.00 10.15 ? 283 VAL A CG2 1 
ATOM   2235 N N   . PHE A 1 280 ? 7.925   -9.668  45.900  1.00 6.46  ? 284 PHE A N   1 
ATOM   2236 C CA  . PHE A 1 280 ? 7.916   -9.025  47.212  1.00 6.37  ? 284 PHE A CA  1 
ATOM   2237 C C   . PHE A 1 280 ? 7.366   -9.932  48.308  1.00 9.53  ? 284 PHE A C   1 
ATOM   2238 O O   . PHE A 1 280 ? 7.374   -9.575  49.488  1.00 9.51  ? 284 PHE A O   1 
ATOM   2239 C CB  . PHE A 1 280 ? 7.060   -7.759  47.160  1.00 9.10  ? 284 PHE A CB  1 
ATOM   2240 C CG  . PHE A 1 280 ? 7.623   -6.688  46.283  1.00 8.87  ? 284 PHE A CG  1 
ATOM   2241 C CD1 . PHE A 1 280 ? 8.798   -6.039  46.633  1.00 9.26  ? 284 PHE A CD1 1 
ATOM   2242 C CD2 . PHE A 1 280 ? 6.978   -6.324  45.107  1.00 10.38 ? 284 PHE A CD2 1 
ATOM   2243 C CE1 . PHE A 1 280 ? 9.322   -5.034  45.821  1.00 9.49  ? 284 PHE A CE1 1 
ATOM   2244 C CE2 . PHE A 1 280 ? 7.493   -5.325  44.291  1.00 10.19 ? 284 PHE A CE2 1 
ATOM   2245 C CZ  . PHE A 1 280 ? 8.669   -4.677  44.650  1.00 9.68  ? 284 PHE A CZ  1 
ATOM   2246 N N   . GLU A 1 281 ? 6.911   -11.115 47.922  1.00 9.87  ? 285 GLU A N   1 
ATOM   2247 C CA  . GLU A 1 281 ? 6.304   -12.019 48.886  1.00 11.70 ? 285 GLU A CA  1 
ATOM   2248 C C   . GLU A 1 281 ? 7.189   -13.006 49.641  1.00 10.92 ? 285 GLU A C   1 
ATOM   2249 O O   . GLU A 1 281 ? 6.745   -13.586 50.634  1.00 12.23 ? 285 GLU A O   1 
ATOM   2250 C CB  . GLU A 1 281 ? 5.162   -12.765 48.195  1.00 12.63 ? 285 GLU A CB  1 
ATOM   2251 C CG  . GLU A 1 281 ? 4.043   -11.833 47.730  1.00 13.94 ? 285 GLU A CG  1 
ATOM   2252 C CD  . GLU A 1 281 ? 2.975   -12.550 46.929  1.00 17.50 ? 285 GLU A CD  1 
ATOM   2253 O OE1 . GLU A 1 281 ? 2.775   -13.761 47.161  0.75 19.02 ? 285 GLU A OE1 1 
ATOM   2254 O OE2 . GLU A 1 281 ? 2.326   -11.902 46.079  0.75 16.23 ? 285 GLU A OE2 1 
ATOM   2255 N N   . PHE A 1 282 ? 8.426   -13.207 49.196  1.00 10.79 ? 286 PHE A N   1 
ATOM   2256 C CA  . PHE A 1 282 ? 9.299   -14.154 49.886  1.00 9.69  ? 286 PHE A CA  1 
ATOM   2257 C C   . PHE A 1 282 ? 10.734  -13.673 50.049  1.00 10.21 ? 286 PHE A C   1 
ATOM   2258 O O   . PHE A 1 282 ? 11.164  -12.705 49.415  1.00 10.69 ? 286 PHE A O   1 
ATOM   2259 C CB  . PHE A 1 282 ? 9.292   -15.513 49.175  1.00 7.97  ? 286 PHE A CB  1 
ATOM   2260 C CG  . PHE A 1 282 ? 9.936   -15.493 47.819  1.00 8.32  ? 286 PHE A CG  1 
ATOM   2261 C CD1 . PHE A 1 282 ? 9.288   -14.909 46.735  1.00 6.47  ? 286 PHE A CD1 1 
ATOM   2262 C CD2 . PHE A 1 282 ? 11.206  -16.035 47.631  1.00 6.45  ? 286 PHE A CD2 1 
ATOM   2263 C CE1 . PHE A 1 282 ? 9.898   -14.862 45.480  1.00 8.33  ? 286 PHE A CE1 1 
ATOM   2264 C CE2 . PHE A 1 282 ? 11.822  -15.992 46.383  1.00 7.96  ? 286 PHE A CE2 1 
ATOM   2265 C CZ  . PHE A 1 282 ? 11.166  -15.403 45.306  1.00 7.27  ? 286 PHE A CZ  1 
ATOM   2266 N N   . GLN A 1 283 ? 11.472  -14.372 50.904  1.00 11.38 ? 287 GLN A N   1 
ATOM   2267 C CA  . GLN A 1 283 ? 12.862  -14.038 51.204  1.00 10.85 ? 287 GLN A CA  1 
ATOM   2268 C C   . GLN A 1 283 ? 13.782  -15.227 50.937  1.00 10.23 ? 287 GLN A C   1 
ATOM   2269 O O   . GLN A 1 283 ? 13.479  -16.349 51.338  1.00 10.14 ? 287 GLN A O   1 
ATOM   2270 C CB  . GLN A 1 283 ? 12.975  -13.648 52.686  1.00 12.39 ? 287 GLN A CB  1 
ATOM   2271 C CG  . GLN A 1 283 ? 14.371  -13.276 53.180  1.00 12.96 ? 287 GLN A CG  1 
ATOM   2272 C CD  . GLN A 1 283 ? 14.760  -11.854 52.822  1.00 15.22 ? 287 GLN A CD  1 
ATOM   2273 O OE1 . GLN A 1 283 ? 13.915  -11.049 52.440  1.00 13.24 ? 287 GLN A OE1 1 
ATOM   2274 N NE2 . GLN A 1 283 ? 16.047  -11.534 52.957  1.00 14.62 ? 287 GLN A NE2 1 
ATOM   2275 N N   . LEU A 1 284 ? 14.898  -14.979 50.257  1.00 8.93  ? 288 LEU A N   1 
ATOM   2276 C CA  . LEU A 1 284 ? 15.882  -16.025 49.994  1.00 11.20 ? 288 LEU A CA  1 
ATOM   2277 C C   . LEU A 1 284 ? 16.826  -16.036 51.186  1.00 11.04 ? 288 LEU A C   1 
ATOM   2278 O O   . LEU A 1 284 ? 17.220  -14.976 51.679  1.00 10.76 ? 288 LEU A O   1 
ATOM   2279 C CB  . LEU A 1 284 ? 16.682  -15.716 48.728  1.00 10.46 ? 288 LEU A CB  1 
ATOM   2280 C CG  . LEU A 1 284 ? 15.963  -15.919 47.396  1.00 12.57 ? 288 LEU A CG  1 
ATOM   2281 C CD1 . LEU A 1 284 ? 16.841  -15.437 46.246  1.00 12.04 ? 288 LEU A CD1 1 
ATOM   2282 C CD2 . LEU A 1 284 ? 15.638  -17.398 47.241  1.00 12.99 ? 288 LEU A CD2 1 
ATOM   2283 N N   . SER A 1 285 ? 17.192  -17.222 51.654  1.00 10.85 ? 289 SER A N   1 
ATOM   2284 C CA  . SER A 1 285 ? 18.091  -17.317 52.794  1.00 10.90 ? 289 SER A CA  1 
ATOM   2285 C C   . SER A 1 285 ? 19.463  -16.791 52.411  1.00 12.19 ? 289 SER A C   1 
ATOM   2286 O O   . SER A 1 285 ? 19.796  -16.692 51.227  1.00 10.32 ? 289 SER A O   1 
ATOM   2287 C CB  . SER A 1 285 ? 18.219  -18.771 53.260  1.00 10.65 ? 289 SER A CB  1 
ATOM   2288 O OG  . SER A 1 285 ? 18.913  -19.547 52.295  1.00 9.38  ? 289 SER A OG  1 
ATOM   2289 N N   . SER A 1 286 ? 20.257  -16.459 53.422  1.00 13.24 ? 290 SER A N   1 
ATOM   2290 C CA  . SER A 1 286 ? 21.606  -15.951 53.213  1.00 14.47 ? 290 SER A CA  1 
ATOM   2291 C C   . SER A 1 286 ? 22.486  -17.015 52.542  1.00 14.31 ? 290 SER A C   1 
ATOM   2292 O O   . SER A 1 286 ? 23.320  -16.702 51.690  1.00 14.07 ? 290 SER A O   1 
ATOM   2293 C CB  . SER A 1 286 ? 22.212  -15.534 54.561  1.00 16.25 ? 290 SER A CB  1 
ATOM   2294 O OG  . SER A 1 286 ? 23.543  -15.068 54.411  1.00 21.82 ? 290 SER A OG  1 
ATOM   2295 N N   . GLU A 1 287 ? 22.294  -18.273 52.925  1.00 14.40 ? 291 GLU A N   1 
ATOM   2296 C CA  . GLU A 1 287 ? 23.077  -19.362 52.352  1.00 13.63 ? 291 GLU A CA  1 
ATOM   2297 C C   . GLU A 1 287 ? 22.738  -19.546 50.875  1.00 13.76 ? 291 GLU A C   1 
ATOM   2298 O O   . GLU A 1 287 ? 23.620  -19.812 50.058  1.00 12.92 ? 291 GLU A O   1 
ATOM   2299 C CB  . GLU A 1 287 ? 22.820  -20.670 53.112  1.00 15.49 ? 291 GLU A CB  1 
ATOM   2300 C CG  . GLU A 1 287 ? 23.788  -21.789 52.747  0.50 18.50 ? 291 GLU A CG  1 
ATOM   2301 C CD  . GLU A 1 287 ? 23.573  -23.052 53.564  0.50 19.21 ? 291 GLU A CD  1 
ATOM   2302 O OE1 . GLU A 1 287 ? 23.486  -22.953 54.805  0.50 20.42 ? 291 GLU A OE1 1 
ATOM   2303 O OE2 . GLU A 1 287 ? 23.502  -24.145 52.965  0.50 20.25 ? 291 GLU A OE2 1 
ATOM   2304 N N   . ASP A 1 288 ? 21.462  -19.404 50.531  1.00 10.70 ? 292 ASP A N   1 
ATOM   2305 C CA  . ASP A 1 288 ? 21.053  -19.553 49.142  1.00 10.78 ? 292 ASP A CA  1 
ATOM   2306 C C   . ASP A 1 288 ? 21.517  -18.386 48.278  1.00 10.69 ? 292 ASP A C   1 
ATOM   2307 O O   . ASP A 1 288 ? 21.699  -18.542 47.070  1.00 10.47 ? 292 ASP A O   1 
ATOM   2308 C CB  . ASP A 1 288 ? 19.533  -19.733 49.037  1.00 11.21 ? 292 ASP A CB  1 
ATOM   2309 C CG  . ASP A 1 288 ? 19.096  -21.138 49.415  1.00 14.21 ? 292 ASP A CG  1 
ATOM   2310 O OD1 . ASP A 1 288 ? 19.910  -22.065 49.225  1.00 17.33 ? 292 ASP A OD1 1 
ATOM   2311 O OD2 . ASP A 1 288 ? 17.956  -21.323 49.886  1.00 14.58 ? 292 ASP A OD2 1 
ATOM   2312 N N   . MET A 1 289 ? 21.705  -17.217 48.884  1.00 10.82 ? 293 MET A N   1 
ATOM   2313 C CA  . MET A 1 289 ? 22.188  -16.063 48.125  1.00 9.84  ? 293 MET A CA  1 
ATOM   2314 C C   . MET A 1 289 ? 23.631  -16.361 47.723  1.00 10.69 ? 293 MET A C   1 
ATOM   2315 O O   . MET A 1 289 ? 24.068  -16.044 46.615  1.00 9.59  ? 293 MET A O   1 
ATOM   2316 C CB  . MET A 1 289 ? 22.135  -14.788 48.974  1.00 10.40 ? 293 MET A CB  1 
ATOM   2317 C CG  . MET A 1 289 ? 20.727  -14.223 49.201  1.00 8.48  ? 293 MET A CG  1 
ATOM   2318 S SD  . MET A 1 289 ? 19.954  -13.527 47.714  1.00 9.04  ? 293 MET A SD  1 
ATOM   2319 C CE  . MET A 1 289 ? 20.965  -12.087 47.473  1.00 10.57 ? 293 MET A CE  1 
ATOM   2320 N N   . LYS A 1 290 ? 24.376  -16.975 48.636  1.00 11.18 ? 294 LYS A N   1 
ATOM   2321 C CA  . LYS A 1 290 ? 25.762  -17.318 48.360  1.00 12.71 ? 294 LYS A CA  1 
ATOM   2322 C C   . LYS A 1 290 ? 25.843  -18.348 47.234  1.00 12.51 ? 294 LYS A C   1 
ATOM   2323 O O   . LYS A 1 290 ? 26.752  -18.301 46.407  1.00 13.70 ? 294 LYS A O   1 
ATOM   2324 C CB  . LYS A 1 290 ? 26.441  -17.835 49.636  1.00 15.23 ? 294 LYS A CB  1 
ATOM   2325 C CG  . LYS A 1 290 ? 26.684  -16.739 50.667  1.00 18.85 ? 294 LYS A CG  1 
ATOM   2326 C CD  . LYS A 1 290 ? 27.335  -17.284 51.934  1.00 21.89 ? 294 LYS A CD  1 
ATOM   2327 C CE  . LYS A 1 290 ? 27.660  -16.161 52.910  1.00 24.91 ? 294 LYS A CE  1 
ATOM   2328 N NZ  . LYS A 1 290 ? 26.453  -15.379 53.310  1.00 26.80 ? 294 LYS A NZ  1 
ATOM   2329 N N   . VAL A 1 291 ? 24.881  -19.265 47.192  1.00 10.61 ? 295 VAL A N   1 
ATOM   2330 C CA  . VAL A 1 291 ? 24.844  -20.277 46.141  1.00 12.65 ? 295 VAL A CA  1 
ATOM   2331 C C   . VAL A 1 291 ? 24.651  -19.587 44.790  1.00 12.95 ? 295 VAL A C   1 
ATOM   2332 O O   . VAL A 1 291 ? 25.299  -19.938 43.801  1.00 12.62 ? 295 VAL A O   1 
ATOM   2333 C CB  . VAL A 1 291 ? 23.687  -21.280 46.367  1.00 14.04 ? 295 VAL A CB  1 
ATOM   2334 C CG1 . VAL A 1 291 ? 23.479  -22.145 45.127  1.00 14.21 ? 295 VAL A CG1 1 
ATOM   2335 C CG2 . VAL A 1 291 ? 24.005  -22.165 47.573  1.00 16.68 ? 295 VAL A CG2 1 
ATOM   2336 N N   . LEU A 1 292 ? 23.759  -18.601 44.753  1.00 11.60 ? 296 LEU A N   1 
ATOM   2337 C CA  . LEU A 1 292 ? 23.507  -17.871 43.518  1.00 10.72 ? 296 LEU A CA  1 
ATOM   2338 C C   . LEU A 1 292 ? 24.731  -17.036 43.129  1.00 11.41 ? 296 LEU A C   1 
ATOM   2339 O O   . LEU A 1 292 ? 25.002  -16.840 41.941  1.00 10.51 ? 296 LEU A O   1 
ATOM   2340 C CB  . LEU A 1 292 ? 22.264  -16.987 43.666  1.00 10.04 ? 296 LEU A CB  1 
ATOM   2341 C CG  . LEU A 1 292 ? 20.950  -17.761 43.843  1.00 10.08 ? 296 LEU A CG  1 
ATOM   2342 C CD1 . LEU A 1 292 ? 19.797  -16.785 44.023  1.00 12.39 ? 296 LEU A CD1 1 
ATOM   2343 C CD2 . LEU A 1 292 ? 20.706  -18.649 42.630  1.00 11.14 ? 296 LEU A CD2 1 
ATOM   2344 N N   . ASP A 1 293 ? 25.477  -16.556 44.122  1.00 12.01 ? 297 ASP A N   1 
ATOM   2345 C CA  . ASP A 1 293 ? 26.693  -15.781 43.844  1.00 13.77 ? 297 ASP A CA  1 
ATOM   2346 C C   . ASP A 1 293 ? 27.714  -16.652 43.118  1.00 13.17 ? 297 ASP A C   1 
ATOM   2347 O O   . ASP A 1 293 ? 28.590  -16.148 42.411  1.00 14.90 ? 297 ASP A O   1 
ATOM   2348 C CB  . ASP A 1 293 ? 27.362  -15.295 45.133  1.00 13.59 ? 297 ASP A CB  1 
ATOM   2349 C CG  . ASP A 1 293 ? 26.627  -14.154 45.790  1.00 16.07 ? 297 ASP A CG  1 
ATOM   2350 O OD1 . ASP A 1 293 ? 25.927  -13.397 45.082  1.00 16.78 ? 297 ASP A OD1 1 
ATOM   2351 O OD2 . ASP A 1 293 ? 26.776  -14.002 47.020  1.00 14.61 ? 297 ASP A OD2 1 
ATOM   2352 N N   . GLY A 1 294 ? 27.604  -17.962 43.314  1.00 14.30 ? 298 GLY A N   1 
ATOM   2353 C CA  . GLY A 1 294 ? 28.546  -18.887 42.706  1.00 13.23 ? 298 GLY A CA  1 
ATOM   2354 C C   . GLY A 1 294 ? 28.359  -19.191 41.232  1.00 15.73 ? 298 GLY A C   1 
ATOM   2355 O O   . GLY A 1 294 ? 29.220  -19.829 40.626  1.00 14.63 ? 298 GLY A O   1 
ATOM   2356 N N   . LEU A 1 295 ? 27.255  -18.726 40.648  1.00 13.34 ? 299 LEU A N   1 
ATOM   2357 C CA  . LEU A 1 295 ? 26.962  -18.986 39.241  1.00 12.83 ? 299 LEU A CA  1 
ATOM   2358 C C   . LEU A 1 295 ? 27.652  -18.046 38.250  1.00 12.64 ? 299 LEU A C   1 
ATOM   2359 O O   . LEU A 1 295 ? 27.615  -18.275 37.040  1.00 11.13 ? 299 LEU A O   1 
ATOM   2360 C CB  . LEU A 1 295 ? 25.444  -18.938 39.018  1.00 11.88 ? 299 LEU A CB  1 
ATOM   2361 C CG  . LEU A 1 295 ? 24.624  -19.999 39.758  1.00 13.55 ? 299 LEU A CG  1 
ATOM   2362 C CD1 . LEU A 1 295 ? 23.133  -19.719 39.592  1.00 11.57 ? 299 LEU A CD1 1 
ATOM   2363 C CD2 . LEU A 1 295 ? 24.986  -21.383 39.216  1.00 13.36 ? 299 LEU A CD2 1 
ATOM   2364 N N   . ASN A 1 296 ? 28.288  -16.998 38.756  1.00 12.30 ? 300 ASN A N   1 
ATOM   2365 C CA  . ASN A 1 296 ? 28.964  -16.040 37.888  1.00 14.71 ? 300 ASN A CA  1 
ATOM   2366 C C   . ASN A 1 296 ? 29.890  -16.738 36.890  1.00 15.83 ? 300 ASN A C   1 
ATOM   2367 O O   . ASN A 1 296 ? 30.706  -17.572 37.274  1.00 16.20 ? 300 ASN A O   1 
ATOM   2368 C CB  . ASN A 1 296 ? 29.762  -15.044 38.737  1.00 17.05 ? 300 ASN A CB  1 
ATOM   2369 C CG  . ASN A 1 296 ? 30.218  -13.836 37.940  1.00 19.34 ? 300 ASN A CG  1 
ATOM   2370 O OD1 . ASN A 1 296 ? 29.426  -13.208 37.236  1.00 18.61 ? 300 ASN A OD1 1 
ATOM   2371 N ND2 . ASN A 1 296 ? 31.497  -13.499 38.055  1.00 21.61 ? 300 ASN A ND2 1 
ATOM   2372 N N   . ARG A 1 297 ? 29.752  -16.406 35.609  1.00 15.09 ? 301 ARG A N   1 
ATOM   2373 C CA  . ARG A 1 297 ? 30.588  -17.012 34.582  1.00 17.37 ? 301 ARG A CA  1 
ATOM   2374 C C   . ARG A 1 297 ? 30.898  -16.040 33.448  1.00 18.11 ? 301 ARG A C   1 
ATOM   2375 O O   . ARG A 1 297 ? 31.231  -16.453 32.337  1.00 19.37 ? 301 ARG A O   1 
ATOM   2376 C CB  . ARG A 1 297 ? 29.921  -18.278 34.030  1.00 20.19 ? 301 ARG A CB  1 
ATOM   2377 C CG  . ARG A 1 297 ? 28.607  -18.063 33.303  1.00 21.19 ? 301 ARG A CG  1 
ATOM   2378 C CD  . ARG A 1 297 ? 27.891  -19.395 33.112  1.00 27.20 ? 301 ARG A CD  1 
ATOM   2379 N NE  . ARG A 1 297 ? 27.579  -20.004 34.405  1.00 31.22 ? 301 ARG A NE  1 
ATOM   2380 C CZ  . ARG A 1 297 ? 27.003  -21.191 34.565  1.00 33.04 ? 301 ARG A CZ  1 
ATOM   2381 N NH1 . ARG A 1 297 ? 26.665  -21.920 33.508  1.00 32.26 ? 301 ARG A NH1 1 
ATOM   2382 N NH2 . ARG A 1 297 ? 26.760  -21.646 35.789  1.00 33.29 ? 301 ARG A NH2 1 
ATOM   2383 N N   . ASN A 1 298 ? 30.797  -14.750 33.753  1.00 16.10 ? 302 ASN A N   1 
ATOM   2384 C CA  . ASN A 1 298 ? 31.060  -13.681 32.797  1.00 17.30 ? 302 ASN A CA  1 
ATOM   2385 C C   . ASN A 1 298 ? 30.319  -13.867 31.476  1.00 16.13 ? 302 ASN A C   1 
ATOM   2386 O O   . ASN A 1 298 ? 30.896  -13.738 30.395  1.00 16.72 ? 302 ASN A O   1 
ATOM   2387 C CB  . ASN A 1 298 ? 32.568  -13.553 32.544  1.00 20.70 ? 302 ASN A CB  1 
ATOM   2388 C CG  . ASN A 1 298 ? 32.927  -12.266 31.827  1.00 24.00 ? 302 ASN A CG  1 
ATOM   2389 O OD1 . ASN A 1 298 ? 32.445  -11.191 32.186  1.00 23.75 ? 302 ASN A OD1 1 
ATOM   2390 N ND2 . ASN A 1 298 ? 33.785  -12.366 30.816  1.00 25.26 ? 302 ASN A ND2 1 
ATOM   2391 N N   . MET A 1 299 ? 29.033  -14.181 31.570  1.00 13.65 ? 303 MET A N   1 
ATOM   2392 C CA  . MET A 1 299 ? 28.215  -14.358 30.382  1.00 11.86 ? 303 MET A CA  1 
ATOM   2393 C C   . MET A 1 299 ? 27.479  -13.045 30.129  1.00 11.25 ? 303 MET A C   1 
ATOM   2394 O O   . MET A 1 299 ? 26.493  -12.742 30.793  1.00 9.97  ? 303 MET A O   1 
ATOM   2395 C CB  . MET A 1 299 ? 27.205  -15.493 30.588  1.00 12.70 ? 303 MET A CB  1 
ATOM   2396 C CG  . MET A 1 299 ? 26.176  -15.649 29.460  1.00 16.43 ? 303 MET A CG  1 
ATOM   2397 S SD  . MET A 1 299 ? 26.847  -16.259 27.888  1.00 18.33 ? 303 MET A SD  1 
ATOM   2398 C CE  . MET A 1 299 ? 26.683  -14.800 26.819  1.00 17.90 ? 303 MET A CE  1 
ATOM   2399 N N   . ARG A 1 300 ? 27.972  -12.261 29.178  1.00 10.32 ? 304 ARG A N   1 
ATOM   2400 C CA  . ARG A 1 300 ? 27.339  -10.993 28.849  1.00 8.42  ? 304 ARG A CA  1 
ATOM   2401 C C   . ARG A 1 300 ? 26.447  -11.233 27.633  1.00 8.66  ? 304 ARG A C   1 
ATOM   2402 O O   . ARG A 1 300 ? 26.936  -11.411 26.518  1.00 10.01 ? 304 ARG A O   1 
ATOM   2403 C CB  . ARG A 1 300 ? 28.405  -9.932  28.539  1.00 8.97  ? 304 ARG A CB  1 
ATOM   2404 C CG  . ARG A 1 300 ? 27.866  -8.505  28.375  1.00 9.38  ? 304 ARG A CG  1 
ATOM   2405 C CD  . ARG A 1 300 ? 29.003  -7.516  28.103  1.00 8.31  ? 304 ARG A CD  1 
ATOM   2406 N NE  . ARG A 1 300 ? 29.913  -7.364  29.244  1.00 8.19  ? 304 ARG A NE  1 
ATOM   2407 C CZ  . ARG A 1 300 ? 29.631  -6.664  30.343  1.00 8.26  ? 304 ARG A CZ  1 
ATOM   2408 N NH1 . ARG A 1 300 ? 28.460  -6.048  30.462  1.00 6.91  ? 304 ARG A NH1 1 
ATOM   2409 N NH2 . ARG A 1 300 ? 30.527  -6.566  31.320  1.00 7.39  ? 304 ARG A NH2 1 
ATOM   2410 N N   . TYR A 1 301 ? 25.138  -11.255 27.852  1.00 6.43  ? 305 TYR A N   1 
ATOM   2411 C CA  . TYR A 1 301 ? 24.206  -11.483 26.757  1.00 7.00  ? 305 TYR A CA  1 
ATOM   2412 C C   . TYR A 1 301 ? 24.184  -10.349 25.741  1.00 6.06  ? 305 TYR A C   1 
ATOM   2413 O O   . TYR A 1 301 ? 24.048  -10.595 24.544  1.00 7.02  ? 305 TYR A O   1 
ATOM   2414 C CB  . TYR A 1 301 ? 22.791  -11.702 27.289  1.00 5.84  ? 305 TYR A CB  1 
ATOM   2415 C CG  . TYR A 1 301 ? 22.587  -13.019 28.005  1.00 5.87  ? 305 TYR A CG  1 
ATOM   2416 C CD1 . TYR A 1 301 ? 22.417  -13.061 29.382  1.00 5.72  ? 305 TYR A CD1 1 
ATOM   2417 C CD2 . TYR A 1 301 ? 22.570  -14.229 27.297  1.00 6.12  ? 305 TYR A CD2 1 
ATOM   2418 C CE1 . TYR A 1 301 ? 22.231  -14.272 30.053  1.00 7.38  ? 305 TYR A CE1 1 
ATOM   2419 C CE2 . TYR A 1 301 ? 22.391  -15.447 27.955  1.00 7.21  ? 305 TYR A CE2 1 
ATOM   2420 C CZ  . TYR A 1 301 ? 22.220  -15.458 29.337  1.00 9.71  ? 305 TYR A CZ  1 
ATOM   2421 O OH  . TYR A 1 301 ? 22.036  -16.644 30.004  1.00 8.90  ? 305 TYR A OH  1 
ATOM   2422 N N   . ILE A 1 302 ? 24.303  -9.109  26.211  1.00 6.95  ? 306 ILE A N   1 
ATOM   2423 C CA  . ILE A 1 302 ? 24.279  -7.963  25.306  1.00 6.56  ? 306 ILE A CA  1 
ATOM   2424 C C   . ILE A 1 302 ? 25.577  -7.167  25.367  1.00 7.92  ? 306 ILE A C   1 
ATOM   2425 O O   . ILE A 1 302 ? 25.657  -6.130  26.026  1.00 6.68  ? 306 ILE A O   1 
ATOM   2426 C CB  . ILE A 1 302 ? 23.081  -7.027  25.619  1.00 8.98  ? 306 ILE A CB  1 
ATOM   2427 C CG1 . ILE A 1 302 ? 21.778  -7.835  25.618  1.00 9.57  ? 306 ILE A CG1 1 
ATOM   2428 C CG2 . ILE A 1 302 ? 22.986  -5.928  24.564  1.00 10.16 ? 306 ILE A CG2 1 
ATOM   2429 C CD1 . ILE A 1 302 ? 20.547  -7.021  26.001  1.00 9.83  ? 306 ILE A CD1 1 
ATOM   2430 N N   . PRO A 1 303 ? 26.617  -7.645  24.665  1.00 8.49  ? 307 PRO A N   1 
ATOM   2431 C CA  . PRO A 1 303 ? 27.933  -6.999  24.624  1.00 9.37  ? 307 PRO A CA  1 
ATOM   2432 C C   . PRO A 1 303 ? 28.020  -5.790  23.698  1.00 9.90  ? 307 PRO A C   1 
ATOM   2433 O O   . PRO A 1 303 ? 29.058  -5.139  23.634  1.00 10.20 ? 307 PRO A O   1 
ATOM   2434 C CB  . PRO A 1 303 ? 28.848  -8.129  24.163  1.00 9.49  ? 307 PRO A CB  1 
ATOM   2435 C CG  . PRO A 1 303 ? 27.968  -8.871  23.206  1.00 9.85  ? 307 PRO A CG  1 
ATOM   2436 C CD  . PRO A 1 303 ? 26.648  -8.938  23.952  1.00 9.03  ? 307 PRO A CD  1 
ATOM   2437 N N   . ALA A 1 304 ? 26.931  -5.479  23.000  1.00 9.76  ? 308 ALA A N   1 
ATOM   2438 C CA  . ALA A 1 304 ? 26.921  -4.360  22.064  1.00 9.54  ? 308 ALA A CA  1 
ATOM   2439 C C   . ALA A 1 304 ? 28.060  -4.589  21.072  1.00 10.61 ? 308 ALA A C   1 
ATOM   2440 O O   . ALA A 1 304 ? 28.848  -3.686  20.783  1.00 10.23 ? 308 ALA A O   1 
ATOM   2441 C CB  . ALA A 1 304 ? 27.118  -3.044  22.808  1.00 13.40 ? 308 ALA A CB  1 
ATOM   2442 N N   . ALA A 1 305 ? 28.123  -5.811  20.550  1.00 9.37  ? 309 ALA A N   1 
ATOM   2443 C CA  . ALA A 1 305 ? 29.160  -6.220  19.612  1.00 10.07 ? 309 ALA A CA  1 
ATOM   2444 C C   . ALA A 1 305 ? 29.313  -5.343  18.373  1.00 10.28 ? 309 ALA A C   1 
ATOM   2445 O O   . ALA A 1 305 ? 30.427  -5.161  17.887  1.00 11.83 ? 309 ALA A O   1 
ATOM   2446 C CB  . ALA A 1 305 ? 28.934  -7.676  19.195  1.00 11.75 ? 309 ALA A CB  1 
ATOM   2447 N N   . ILE A 1 306 ? 28.218  -4.803  17.845  1.00 10.11 ? 310 ILE A N   1 
ATOM   2448 C CA  . ILE A 1 306 ? 28.351  -3.951  16.666  1.00 10.03 ? 310 ILE A CA  1 
ATOM   2449 C C   . ILE A 1 306 ? 29.081  -2.640  16.996  1.00 9.42  ? 310 ILE A C   1 
ATOM   2450 O O   . ILE A 1 306 ? 29.467  -1.900  16.102  1.00 10.13 ? 310 ILE A O   1 
ATOM   2451 C CB  . ILE A 1 306 ? 26.975  -3.640  16.016  1.00 12.16 ? 310 ILE A CB  1 
ATOM   2452 C CG1 . ILE A 1 306 ? 26.032  -2.985  17.029  1.00 10.22 ? 310 ILE A CG1 1 
ATOM   2453 C CG2 . ILE A 1 306 ? 26.369  -4.927  15.470  1.00 13.62 ? 310 ILE A CG2 1 
ATOM   2454 C CD1 . ILE A 1 306 ? 24.725  -2.493  16.419  1.00 14.92 ? 310 ILE A CD1 1 
ATOM   2455 N N   . PHE A 1 307 ? 29.286  -2.374  18.285  1.00 10.32 ? 311 PHE A N   1 
ATOM   2456 C CA  . PHE A 1 307 ? 29.982  -1.166  18.744  1.00 10.68 ? 311 PHE A CA  1 
ATOM   2457 C C   . PHE A 1 307 ? 31.412  -1.491  19.186  1.00 12.80 ? 311 PHE A C   1 
ATOM   2458 O O   . PHE A 1 307 ? 32.149  -0.601  19.610  1.00 13.84 ? 311 PHE A O   1 
ATOM   2459 C CB  . PHE A 1 307 ? 29.275  -0.563  19.964  1.00 9.72  ? 311 PHE A CB  1 
ATOM   2460 C CG  . PHE A 1 307 ? 28.004  0.191   19.655  1.00 9.82  ? 311 PHE A CG  1 
ATOM   2461 C CD1 . PHE A 1 307 ? 28.041  1.550   19.357  1.00 10.66 ? 311 PHE A CD1 1 
ATOM   2462 C CD2 . PHE A 1 307 ? 26.765  -0.439  19.748  1.00 10.98 ? 311 PHE A CD2 1 
ATOM   2463 C CE1 . PHE A 1 307 ? 26.859  2.276   19.165  1.00 11.19 ? 311 PHE A CE1 1 
ATOM   2464 C CE2 . PHE A 1 307 ? 25.580  0.272   19.557  1.00 10.61 ? 311 PHE A CE2 1 
ATOM   2465 C CZ  . PHE A 1 307 ? 25.628  1.637   19.266  1.00 10.76 ? 311 PHE A CZ  1 
ATOM   2466 N N   . LYS A 1 308 ? 31.798  -2.758  19.093  1.00 15.47 ? 312 LYS A N   1 
ATOM   2467 C CA  . LYS A 1 308 ? 33.113  -3.197  19.563  1.00 18.04 ? 312 LYS A CA  1 
ATOM   2468 C C   . LYS A 1 308 ? 34.352  -2.383  19.173  1.00 19.19 ? 312 LYS A C   1 
ATOM   2469 O O   . LYS A 1 308 ? 35.320  -2.330  19.935  1.00 21.91 ? 312 LYS A O   1 
ATOM   2470 C CB  . LYS A 1 308 ? 33.326  -4.671  19.201  1.00 20.85 ? 312 LYS A CB  1 
ATOM   2471 C CG  . LYS A 1 308 ? 34.462  -5.330  19.971  1.00 24.41 ? 312 LYS A CG  1 
ATOM   2472 C CD  . LYS A 1 308 ? 34.388  -6.848  19.887  1.00 27.97 ? 312 LYS A CD  1 
ATOM   2473 C CE  . LYS A 1 308 ? 33.129  -7.380  20.561  1.00 29.91 ? 312 LYS A CE  1 
ATOM   2474 N NZ  . LYS A 1 308 ? 33.079  -8.874  20.565  1.00 32.70 ? 312 LYS A NZ  1 
ATOM   2475 N N   . GLY A 1 309 ? 34.338  -1.744  18.011  1.00 17.59 ? 313 GLY A N   1 
ATOM   2476 C CA  . GLY A 1 309 ? 35.498  -0.958  17.616  1.00 17.39 ? 313 GLY A CA  1 
ATOM   2477 C C   . GLY A 1 309 ? 35.479  0.477   18.123  1.00 16.03 ? 313 GLY A C   1 
ATOM   2478 O O   . GLY A 1 309 ? 36.472  1.205   18.006  1.00 17.44 ? 313 GLY A O   1 
ATOM   2479 N N   . HIS A 1 310 ? 34.353  0.889   18.697  1.00 13.29 ? 314 HIS A N   1 
ATOM   2480 C CA  . HIS A 1 310 ? 34.207  2.249   19.203  1.00 12.14 ? 314 HIS A CA  1 
ATOM   2481 C C   . HIS A 1 310 ? 35.207  2.514   20.325  1.00 12.81 ? 314 HIS A C   1 
ATOM   2482 O O   . HIS A 1 310 ? 35.382  1.691   21.225  1.00 11.41 ? 314 HIS A O   1 
ATOM   2483 C CB  . HIS A 1 310 ? 32.777  2.472   19.712  1.00 11.21 ? 314 HIS A CB  1 
ATOM   2484 C CG  . HIS A 1 310 ? 32.424  3.913   19.921  1.00 9.50  ? 314 HIS A CG  1 
ATOM   2485 N ND1 . HIS A 1 310 ? 32.984  4.685   20.918  1.00 10.81 ? 314 HIS A ND1 1 
ATOM   2486 C CD2 . HIS A 1 310 ? 31.552  4.719   19.268  1.00 11.00 ? 314 HIS A CD2 1 
ATOM   2487 C CE1 . HIS A 1 310 ? 32.470  5.902   20.871  1.00 10.17 ? 314 HIS A CE1 1 
ATOM   2488 N NE2 . HIS A 1 310 ? 31.599  5.949   19.879  1.00 9.49  ? 314 HIS A NE2 1 
ATOM   2489 N N   . PRO A 1 311 ? 35.888  3.668   20.275  1.00 13.61 ? 315 PRO A N   1 
ATOM   2490 C CA  . PRO A 1 311 ? 36.877  4.030   21.299  1.00 14.64 ? 315 PRO A CA  1 
ATOM   2491 C C   . PRO A 1 311 ? 36.341  3.926   22.727  1.00 14.12 ? 315 PRO A C   1 
ATOM   2492 O O   . PRO A 1 311 ? 37.084  3.622   23.657  1.00 13.97 ? 315 PRO A O   1 
ATOM   2493 C CB  . PRO A 1 311 ? 37.249  5.462   20.922  1.00 15.22 ? 315 PRO A CB  1 
ATOM   2494 C CG  . PRO A 1 311 ? 37.166  5.429   19.420  1.00 16.67 ? 315 PRO A CG  1 
ATOM   2495 C CD  . PRO A 1 311 ? 35.868  4.666   19.187  1.00 12.09 ? 315 PRO A CD  1 
ATOM   2496 N N   . ASN A 1 312 ? 35.048  4.173   22.900  1.00 13.68 ? 316 ASN A N   1 
ATOM   2497 C CA  . ASN A 1 312 ? 34.453  4.111   24.227  1.00 14.11 ? 316 ASN A CA  1 
ATOM   2498 C C   . ASN A 1 312 ? 33.672  2.844   24.554  1.00 11.07 ? 316 ASN A C   1 
ATOM   2499 O O   . ASN A 1 312 ? 32.876  2.837   25.492  1.00 11.19 ? 316 ASN A O   1 
ATOM   2500 C CB  . ASN A 1 312 ? 33.563  5.331   24.463  1.00 18.24 ? 316 ASN A CB  1 
ATOM   2501 C CG  . ASN A 1 312 ? 34.353  6.537   24.923  1.00 25.76 ? 316 ASN A CG  1 
ATOM   2502 O OD1 . ASN A 1 312 ? 35.074  7.160   24.144  1.00 27.59 ? 316 ASN A OD1 1 
ATOM   2503 N ND2 . ASN A 1 312 ? 34.235  6.861   26.204  1.00 29.63 ? 316 ASN A ND2 1 
ATOM   2504 N N   . TRP A 1 313 ? 33.897  1.772   23.799  1.00 11.43 ? 317 TRP A N   1 
ATOM   2505 C CA  . TRP A 1 313 ? 33.201  0.513   24.076  1.00 10.89 ? 317 TRP A CA  1 
ATOM   2506 C C   . TRP A 1 313 ? 33.463  0.235   25.559  1.00 10.74 ? 317 TRP A C   1 
ATOM   2507 O O   . TRP A 1 313 ? 34.608  0.040   25.971  1.00 11.63 ? 317 TRP A O   1 
ATOM   2508 C CB  . TRP A 1 313 ? 33.761  -0.600  23.204  1.00 11.35 ? 317 TRP A CB  1 
ATOM   2509 C CG  . TRP A 1 313 ? 32.932  -1.835  23.247  1.00 12.09 ? 317 TRP A CG  1 
ATOM   2510 C CD1 . TRP A 1 313 ? 31.629  -1.966  22.850  1.00 10.32 ? 317 TRP A CD1 1 
ATOM   2511 C CD2 . TRP A 1 313 ? 33.350  -3.125  23.694  1.00 12.96 ? 317 TRP A CD2 1 
ATOM   2512 N NE1 . TRP A 1 313 ? 31.212  -3.267  23.018  1.00 12.49 ? 317 TRP A NE1 1 
ATOM   2513 C CE2 . TRP A 1 313 ? 32.249  -4.000  23.534  1.00 12.40 ? 317 TRP A CE2 1 
ATOM   2514 C CE3 . TRP A 1 313 ? 34.550  -3.631  24.210  1.00 13.33 ? 317 TRP A CE3 1 
ATOM   2515 C CZ2 . TRP A 1 313 ? 32.314  -5.354  23.872  1.00 14.74 ? 317 TRP A CZ2 1 
ATOM   2516 C CZ3 . TRP A 1 313 ? 34.616  -4.978  24.546  1.00 13.91 ? 317 TRP A CZ3 1 
ATOM   2517 C CH2 . TRP A 1 313 ? 33.503  -5.824  24.375  1.00 15.04 ? 317 TRP A CH2 1 
ATOM   2518 N N   . PRO A 1 314 ? 32.397  0.202   26.378  1.00 10.34 ? 318 PRO A N   1 
ATOM   2519 C CA  . PRO A 1 314 ? 32.480  -0.023  27.826  1.00 8.77  ? 318 PRO A CA  1 
ATOM   2520 C C   . PRO A 1 314 ? 32.805  -1.392  28.408  1.00 9.54  ? 318 PRO A C   1 
ATOM   2521 O O   . PRO A 1 314 ? 33.137  -1.488  29.590  1.00 9.28  ? 318 PRO A O   1 
ATOM   2522 C CB  . PRO A 1 314 ? 31.121  0.469   28.310  1.00 11.36 ? 318 PRO A CB  1 
ATOM   2523 C CG  . PRO A 1 314 ? 30.212  -0.014  27.211  1.00 10.22 ? 318 PRO A CG  1 
ATOM   2524 C CD  . PRO A 1 314 ? 30.988  0.352   25.954  1.00 10.04 ? 318 PRO A CD  1 
ATOM   2525 N N   . PHE A 1 315 ? 32.746  -2.440  27.601  1.00 9.66  ? 319 PHE A N   1 
ATOM   2526 C CA  . PHE A 1 315 ? 32.958  -3.772  28.141  1.00 10.73 ? 319 PHE A CA  1 
ATOM   2527 C C   . PHE A 1 315 ? 34.339  -4.400  28.009  1.00 13.24 ? 319 PHE A C   1 
ATOM   2528 O O   . PHE A 1 315 ? 34.488  -5.606  28.171  1.00 13.05 ? 319 PHE A O   1 
ATOM   2529 C CB  . PHE A 1 315 ? 31.880  -4.697  27.571  1.00 9.67  ? 319 PHE A CB  1 
ATOM   2530 C CG  . PHE A 1 315 ? 30.481  -4.129  27.691  1.00 9.40  ? 319 PHE A CG  1 
ATOM   2531 C CD1 . PHE A 1 315 ? 30.063  -3.531  28.882  1.00 6.84  ? 319 PHE A CD1 1 
ATOM   2532 C CD2 . PHE A 1 315 ? 29.592  -4.181  26.620  1.00 7.86  ? 319 PHE A CD2 1 
ATOM   2533 C CE1 . PHE A 1 315 ? 28.785  -2.994  29.005  1.00 7.04  ? 319 PHE A CE1 1 
ATOM   2534 C CE2 . PHE A 1 315 ? 28.314  -3.650  26.731  1.00 7.87  ? 319 PHE A CE2 1 
ATOM   2535 C CZ  . PHE A 1 315 ? 27.907  -3.052  27.929  1.00 5.72  ? 319 PHE A CZ  1 
ATOM   2536 N N   . LEU A 1 316 ? 35.349  -3.583  27.746  1.00 14.56 ? 320 LEU A N   1 
ATOM   2537 C CA  . LEU A 1 316 ? 36.706  -4.098  27.619  1.00 17.43 ? 320 LEU A CA  1 
ATOM   2538 C C   . LEU A 1 316 ? 37.334  -4.219  28.999  1.00 18.26 ? 320 LEU A C   1 
ATOM   2539 O O   . LEU A 1 316 ? 37.929  -5.243  29.328  1.00 19.30 ? 320 LEU A O   1 
ATOM   2540 C CB  . LEU A 1 316 ? 37.553  -3.171  26.744  1.00 18.43 ? 320 LEU A CB  1 
ATOM   2541 C CG  . LEU A 1 316 ? 39.016  -3.577  26.559  1.00 20.42 ? 320 LEU A CG  1 
ATOM   2542 C CD1 . LEU A 1 316 ? 39.081  -4.939  25.893  1.00 19.31 ? 320 LEU A CD1 1 
ATOM   2543 C CD2 . LEU A 1 316 ? 39.744  -2.533  25.720  1.00 22.52 ? 320 LEU A CD2 1 
ATOM   2544 N N   . ASP A 1 317 ? 37.193  -3.172  29.807  1.00 18.24 ? 321 ASP A N   1 
ATOM   2545 C CA  . ASP A 1 317 ? 37.755  -3.173  31.152  1.00 22.12 ? 321 ASP A CA  1 
ATOM   2546 C C   . ASP A 1 317 ? 37.118  -4.266  32.008  1.00 23.05 ? 321 ASP A C   1 
ATOM   2547 O O   . ASP A 1 317 ? 35.997  -4.707  31.736  1.00 21.23 ? 321 ASP A O   1 
ATOM   2548 C CB  . ASP A 1 317 ? 37.551  -1.808  31.823  1.00 23.09 ? 321 ASP A CB  1 
ATOM   2549 C CG  . ASP A 1 317 ? 38.170  -0.669  31.034  1.00 24.13 ? 321 ASP A CG  1 
ATOM   2550 O OD1 . ASP A 1 317 ? 39.079  -0.931  30.220  1.00 26.85 ? 321 ASP A OD1 1 
ATOM   2551 O OD2 . ASP A 1 317 ? 37.758  0.492   31.238  1.00 24.55 ? 321 ASP A OD2 1 
ATOM   2552 N N   . GLU A 1 318 ? 37.842  -4.702  33.038  1.00 22.45 ? 322 GLU A N   1 
ATOM   2553 C CA  . GLU A 1 318 ? 37.357  -5.743  33.943  1.00 23.55 ? 322 GLU A CA  1 
ATOM   2554 C C   . GLU A 1 318 ? 35.975  -5.376  34.485  1.00 22.52 ? 322 GLU A C   1 
ATOM   2555 O O   . GLU A 1 318 ? 35.143  -6.251  34.732  1.00 22.67 ? 322 GLU A O   1 
ATOM   2556 C CB  . GLU A 1 318 ? 38.337  -5.937  35.099  1.00 24.77 ? 322 GLU A CB  1 
ATOM   2557 C CG  . GLU A 1 318 ? 37.888  -6.980  36.103  1.00 28.11 ? 322 GLU A CG  1 
ATOM   2558 C CD  . GLU A 1 318 ? 38.904  -7.205  37.206  1.00 31.09 ? 322 GLU A CD  1 
ATOM   2559 O OE1 . GLU A 1 318 ? 39.349  -6.210  37.821  1.00 29.45 ? 322 GLU A OE1 1 
ATOM   2560 O OE2 . GLU A 1 318 ? 39.251  -8.379  37.458  1.00 32.51 ? 322 GLU A OE2 1 
ATOM   2561 N N   . TYR A 1 319 ? 35.754  -4.079  34.684  1.00 19.82 ? 323 TYR A N   1 
ATOM   2562 C CA  . TYR A 1 319 ? 34.473  -3.555  35.145  1.00 19.81 ? 323 TYR A CA  1 
ATOM   2563 C C   . TYR A 1 319 ? 34.485  -2.032  35.069  1.00 17.87 ? 323 TYR A C   1 
ATOM   2564 O O   . TYR A 1 319 ? 33.439  -1.420  35.363  1.00 12.76 ? 323 TYR A O   1 
ATOM   2565 C CB  . TYR A 1 319 ? 34.147  -4.006  36.580  1.00 21.15 ? 323 TYR A CB  1 
ATOM   2566 C CG  . TYR A 1 319 ? 34.983  -3.365  37.661  1.00 24.37 ? 323 TYR A CG  1 
ATOM   2567 C CD1 . TYR A 1 319 ? 36.288  -3.792  37.905  1.00 24.83 ? 323 TYR A CD1 1 
ATOM   2568 C CD2 . TYR A 1 319 ? 34.469  -2.329  38.443  1.00 22.84 ? 323 TYR A CD2 1 
ATOM   2569 C CE1 . TYR A 1 319 ? 37.061  -3.205  38.900  1.00 27.41 ? 323 TYR A CE1 1 
ATOM   2570 C CE2 . TYR A 1 319 ? 35.233  -1.735  39.440  1.00 26.00 ? 323 TYR A CE2 1 
ATOM   2571 C CZ  . TYR A 1 319 ? 36.530  -2.178  39.663  1.00 28.26 ? 323 TYR A CZ  1 
ATOM   2572 O OH  . TYR A 1 319 ? 37.300  -1.597  40.644  1.00 30.77 ? 323 TYR A OH  1 
ATOM   2573 O OXT . TYR A 1 319 ? 35.545  -1.473  34.700  1.00 16.36 ? 323 TYR A OXT 1 
ATOM   2574 N N   . CYS B 1 1   ? 3.491   -2.410  53.837  0.50 26.01 ? 5   CYS B N   1 
ATOM   2575 C CA  . CYS B 1 1   ? 4.199   -2.046  55.096  0.50 25.87 ? 5   CYS B CA  1 
ATOM   2576 C C   . CYS B 1 1   ? 5.698   -1.920  54.922  0.50 25.76 ? 5   CYS B C   1 
ATOM   2577 O O   . CYS B 1 1   ? 6.303   -2.639  54.125  0.50 26.42 ? 5   CYS B O   1 
ATOM   2578 C CB  . CYS B 1 1   ? 3.952   -3.096  56.187  0.50 25.65 ? 5   CYS B CB  1 
ATOM   2579 S SG  . CYS B 1 1   ? 5.259   -3.094  57.467  0.50 26.36 ? 5   CYS B SG  1 
ATOM   2580 N N   . HIS B 1 2   ? 6.293   -0.993  55.667  1.00 25.19 ? 6   HIS B N   1 
ATOM   2581 C CA  . HIS B 1 2   ? 7.741   -0.836  55.645  1.00 24.00 ? 6   HIS B CA  1 
ATOM   2582 C C   . HIS B 1 2   ? 8.150   -2.030  56.497  1.00 21.31 ? 6   HIS B C   1 
ATOM   2583 O O   . HIS B 1 2   ? 8.459   -1.898  57.679  1.00 21.12 ? 6   HIS B O   1 
ATOM   2584 C CB  . HIS B 1 2   ? 8.156   0.475   56.315  1.00 26.59 ? 6   HIS B CB  1 
ATOM   2585 C CG  . HIS B 1 2   ? 7.899   1.688   55.477  1.00 29.27 ? 6   HIS B CG  1 
ATOM   2586 N ND1 . HIS B 1 2   ? 8.533   1.908   54.273  1.00 31.06 ? 6   HIS B ND1 1 
ATOM   2587 C CD2 . HIS B 1 2   ? 7.072   2.744   55.664  1.00 31.37 ? 6   HIS B CD2 1 
ATOM   2588 C CE1 . HIS B 1 2   ? 8.109   3.047   53.754  1.00 31.33 ? 6   HIS B CE1 1 
ATOM   2589 N NE2 . HIS B 1 2   ? 7.221   3.574   54.578  1.00 31.98 ? 6   HIS B NE2 1 
ATOM   2590 N N   . CYS B 1 3   ? 8.118   -3.202  55.875  1.00 20.22 ? 7   CYS B N   1 
ATOM   2591 C CA  . CYS B 1 3   ? 8.409   -4.461  56.542  1.00 19.26 ? 7   CYS B CA  1 
ATOM   2592 C C   . CYS B 1 3   ? 9.559   -5.246  55.918  1.00 18.22 ? 7   CYS B C   1 
ATOM   2593 O O   . CYS B 1 3   ? 9.934   -5.022  54.768  1.00 17.13 ? 7   CYS B O   1 
ATOM   2594 C CB  . CYS B 1 3   ? 7.156   -5.348  56.498  1.00 22.51 ? 7   CYS B CB  1 
ATOM   2595 S SG  . CYS B 1 3   ? 5.809   -5.039  57.695  1.00 25.36 ? 7   CYS B SG  1 
ATOM   2596 N N   . VAL B 1 4   ? 10.107  -6.171  56.701  1.00 17.27 ? 8   VAL B N   1 
ATOM   2597 C CA  . VAL B 1 4   ? 11.161  -7.071  56.253  1.00 17.82 ? 8   VAL B CA  1 
ATOM   2598 C C   . VAL B 1 4   ? 10.615  -8.453  56.598  1.00 15.99 ? 8   VAL B C   1 
ATOM   2599 O O   . VAL B 1 4   ? 9.730   -8.575  57.447  1.00 15.87 ? 8   VAL B O   1 
ATOM   2600 C CB  . VAL B 1 4   ? 12.509  -6.827  56.976  1.00 19.30 ? 8   VAL B CB  1 
ATOM   2601 C CG1 . VAL B 1 4   ? 13.065  -5.466  56.574  1.00 21.76 ? 8   VAL B CG1 1 
ATOM   2602 C CG2 . VAL B 1 4   ? 12.331  -6.912  58.481  1.00 20.82 ? 8   VAL B CG2 1 
ATOM   2603 N N   . ILE B 1 5   ? 11.128  -9.487  55.944  1.00 13.72 ? 9   ILE B N   1 
ATOM   2604 C CA  . ILE B 1 5   ? 10.634  -10.843 56.168  1.00 12.45 ? 9   ILE B CA  1 
ATOM   2605 C C   . ILE B 1 5   ? 11.504  -11.678 57.109  1.00 12.26 ? 9   ILE B C   1 
ATOM   2606 O O   . ILE B 1 5   ? 12.723  -11.750 56.944  1.00 12.88 ? 9   ILE B O   1 
ATOM   2607 C CB  . ILE B 1 5   ? 10.496  -11.577 54.811  1.00 14.04 ? 9   ILE B CB  1 
ATOM   2608 C CG1 . ILE B 1 5   ? 9.732   -10.683 53.829  1.00 14.46 ? 9   ILE B CG1 1 
ATOM   2609 C CG2 . ILE B 1 5   ? 9.783   -12.915 55.001  1.00 10.38 ? 9   ILE B CG2 1 
ATOM   2610 C CD1 . ILE B 1 5   ? 9.656   -11.226 52.418  1.00 15.43 ? 9   ILE B CD1 1 
ATOM   2611 N N   . LEU B 1 6   ? 10.862  -12.309 58.093  1.00 11.24 ? 10  LEU B N   1 
ATOM   2612 C CA  . LEU B 1 6   ? 11.553  -13.147 59.074  1.00 11.95 ? 10  LEU B CA  1 
ATOM   2613 C C   . LEU B 1 6   ? 11.817  -14.532 58.484  1.00 13.97 ? 10  LEU B C   1 
ATOM   2614 O O   . LEU B 1 6   ? 11.167  -14.930 57.512  1.00 14.61 ? 10  LEU B O   1 
ATOM   2615 C CB  . LEU B 1 6   ? 10.709  -13.267 60.349  1.00 11.14 ? 10  LEU B CB  1 
ATOM   2616 C CG  . LEU B 1 6   ? 10.299  -11.925 60.980  1.00 11.43 ? 10  LEU B CG  1 
ATOM   2617 C CD1 . LEU B 1 6   ? 9.386   -12.165 62.174  1.00 12.06 ? 10  LEU B CD1 1 
ATOM   2618 C CD2 . LEU B 1 6   ? 11.540  -11.148 61.399  1.00 13.55 ? 10  LEU B CD2 1 
ATOM   2619 N N   . ASN B 1 7   ? 12.752  -15.274 59.071  1.00 13.76 ? 11  ASN B N   1 
ATOM   2620 C CA  . ASN B 1 7   ? 13.088  -16.591 58.544  1.00 13.89 ? 11  ASN B CA  1 
ATOM   2621 C C   . ASN B 1 7   ? 11.983  -17.636 58.641  1.00 15.09 ? 11  ASN B C   1 
ATOM   2622 O O   . ASN B 1 7   ? 12.146  -18.750 58.144  1.00 14.81 ? 11  ASN B O   1 
ATOM   2623 C CB  . ASN B 1 7   ? 14.377  -17.136 59.185  1.00 14.87 ? 11  ASN B CB  1 
ATOM   2624 C CG  . ASN B 1 7   ? 14.260  -17.334 60.684  1.00 15.34 ? 11  ASN B CG  1 
ATOM   2625 O OD1 . ASN B 1 7   ? 13.232  -17.785 61.188  1.00 17.66 ? 11  ASN B OD1 1 
ATOM   2626 N ND2 . ASN B 1 7   ? 15.333  -17.022 61.403  1.00 15.03 ? 11  ASN B ND2 1 
ATOM   2627 N N   . ASP B 1 8   ? 10.870  -17.292 59.284  1.00 14.15 ? 12  ASP B N   1 
ATOM   2628 C CA  . ASP B 1 8   ? 9.753   -18.226 59.382  1.00 15.06 ? 12  ASP B CA  1 
ATOM   2629 C C   . ASP B 1 8   ? 8.627   -17.776 58.451  1.00 15.46 ? 12  ASP B C   1 
ATOM   2630 O O   . ASP B 1 8   ? 7.516   -18.308 58.488  1.00 16.65 ? 12  ASP B O   1 
ATOM   2631 C CB  . ASP B 1 8   ? 9.253   -18.340 60.829  1.00 14.86 ? 12  ASP B CB  1 
ATOM   2632 C CG  . ASP B 1 8   ? 8.559   -17.085 61.318  1.00 15.28 ? 12  ASP B CG  1 
ATOM   2633 O OD1 . ASP B 1 8   ? 8.597   -16.058 60.609  1.00 15.76 ? 12  ASP B OD1 1 
ATOM   2634 O OD2 . ASP B 1 8   ? 7.977   -17.132 62.424  1.00 15.33 ? 12  ASP B OD2 1 
ATOM   2635 N N   . GLY B 1 9   ? 8.930   -16.785 57.616  1.00 16.50 ? 13  GLY B N   1 
ATOM   2636 C CA  . GLY B 1 9   ? 7.955   -16.288 56.660  1.00 16.40 ? 13  GLY B CA  1 
ATOM   2637 C C   . GLY B 1 9   ? 7.115   -15.097 57.081  1.00 18.05 ? 13  GLY B C   1 
ATOM   2638 O O   . GLY B 1 9   ? 6.526   -14.428 56.229  1.00 16.11 ? 13  GLY B O   1 
ATOM   2639 N N   . ASN B 1 10  ? 7.055   -14.818 58.379  1.00 16.84 ? 14  ASN B N   1 
ATOM   2640 C CA  . ASN B 1 10  ? 6.256   -13.702 58.869  1.00 18.39 ? 14  ASN B CA  1 
ATOM   2641 C C   . ASN B 1 10  ? 6.910   -12.348 58.614  1.00 18.32 ? 14  ASN B C   1 
ATOM   2642 O O   . ASN B 1 10  ? 8.134   -12.243 58.548  1.00 20.27 ? 14  ASN B O   1 
ATOM   2643 C CB  . ASN B 1 10  ? 5.970   -13.879 60.364  1.00 20.10 ? 14  ASN B CB  1 
ATOM   2644 C CG  . ASN B 1 10  ? 5.020   -15.033 60.639  1.00 21.78 ? 14  ASN B CG  1 
ATOM   2645 O OD1 . ASN B 1 10  ? 3.880   -15.036 60.169  1.00 23.50 ? 14  ASN B OD1 1 
ATOM   2646 N ND2 . ASN B 1 10  ? 5.485   -16.021 61.398  1.00 20.69 ? 14  ASN B ND2 1 
ATOM   2647 N N   . PHE B 1 11  ? 6.078   -11.320 58.461  1.00 16.61 ? 15  PHE B N   1 
ATOM   2648 C CA  . PHE B 1 11  ? 6.547   -9.962  58.206  1.00 16.83 ? 15  PHE B CA  1 
ATOM   2649 C C   . PHE B 1 11  ? 6.582   -9.117  59.480  1.00 14.91 ? 15  PHE B C   1 
ATOM   2650 O O   . PHE B 1 11  ? 5.704   -9.227  60.336  1.00 14.11 ? 15  PHE B O   1 
ATOM   2651 C CB  . PHE B 1 11  ? 5.644   -9.267  57.181  1.00 17.34 ? 15  PHE B CB  1 
ATOM   2652 C CG  . PHE B 1 11  ? 5.726   -9.846  55.796  1.00 19.67 ? 15  PHE B CG  1 
ATOM   2653 C CD1 . PHE B 1 11  ? 5.315   -11.153 55.543  1.00 20.57 ? 15  PHE B CD1 1 
ATOM   2654 C CD2 . PHE B 1 11  ? 6.203   -9.077  54.739  1.00 19.92 ? 15  PHE B CD2 1 
ATOM   2655 C CE1 . PHE B 1 11  ? 5.376   -11.687 54.249  1.00 21.43 ? 15  PHE B CE1 1 
ATOM   2656 C CE2 . PHE B 1 11  ? 6.268   -9.599  53.444  1.00 21.61 ? 15  PHE B CE2 1 
ATOM   2657 C CZ  . PHE B 1 11  ? 5.853   -10.907 53.200  1.00 19.35 ? 15  PHE B CZ  1 
ATOM   2658 N N   . ILE B 1 12  ? 7.597   -8.265  59.593  1.00 14.10 ? 16  ILE B N   1 
ATOM   2659 C CA  . ILE B 1 12  ? 7.737   -7.393  60.754  1.00 11.28 ? 16  ILE B CA  1 
ATOM   2660 C C   . ILE B 1 12  ? 8.037   -5.958  60.311  1.00 11.67 ? 16  ILE B C   1 
ATOM   2661 O O   . ILE B 1 12  ? 8.898   -5.732  59.463  1.00 12.07 ? 16  ILE B O   1 
ATOM   2662 C CB  . ILE B 1 12  ? 8.876   -7.889  61.682  1.00 11.40 ? 16  ILE B CB  1 
ATOM   2663 C CG1 . ILE B 1 12  ? 9.006   -6.972  62.901  1.00 7.62  ? 16  ILE B CG1 1 
ATOM   2664 C CG2 . ILE B 1 12  ? 10.191  -7.935  60.915  1.00 10.32 ? 16  ILE B CG2 1 
ATOM   2665 C CD1 . ILE B 1 12  ? 9.985   -7.491  63.958  1.00 13.30 ? 16  ILE B CD1 1 
ATOM   2666 N N   . PRO B 1 13  ? 7.307   -4.969  60.860  1.00 11.72 ? 17  PRO B N   1 
ATOM   2667 C CA  . PRO B 1 13  ? 7.549   -3.570  60.482  1.00 10.69 ? 17  PRO B CA  1 
ATOM   2668 C C   . PRO B 1 13  ? 8.943   -3.189  60.992  1.00 11.53 ? 17  PRO B C   1 
ATOM   2669 O O   . PRO B 1 13  ? 9.298   -3.534  62.122  1.00 10.23 ? 17  PRO B O   1 
ATOM   2670 C CB  . PRO B 1 13  ? 6.433   -2.814  61.203  1.00 11.73 ? 17  PRO B CB  1 
ATOM   2671 C CG  . PRO B 1 13  ? 5.348   -3.864  61.376  1.00 12.06 ? 17  PRO B CG  1 
ATOM   2672 C CD  . PRO B 1 13  ? 6.146   -5.080  61.758  1.00 11.50 ? 17  PRO B CD  1 
ATOM   2673 N N   . VAL B 1 14  ? 9.727   -2.490  60.172  1.00 10.07 ? 18  VAL B N   1 
ATOM   2674 C CA  . VAL B 1 14  ? 11.094  -2.131  60.550  1.00 11.03 ? 18  VAL B CA  1 
ATOM   2675 C C   . VAL B 1 14  ? 11.229  -1.061  61.627  1.00 11.23 ? 18  VAL B C   1 
ATOM   2676 O O   . VAL B 1 14  ? 12.308  -0.879  62.193  1.00 12.67 ? 18  VAL B O   1 
ATOM   2677 C CB  . VAL B 1 14  ? 11.921  -1.704  59.313  1.00 11.33 ? 18  VAL B CB  1 
ATOM   2678 C CG1 . VAL B 1 14  ? 11.974  -2.854  58.308  1.00 12.79 ? 18  VAL B CG1 1 
ATOM   2679 C CG2 . VAL B 1 14  ? 11.318  -0.458  58.676  1.00 8.13  ? 18  VAL B CG2 1 
ATOM   2680 N N   . LEU B 1 15  ? 10.142  -0.346  61.895  1.00 11.74 ? 19  LEU B N   1 
ATOM   2681 C CA  . LEU B 1 15  ? 10.129  0.683   62.932  1.00 12.19 ? 19  LEU B CA  1 
ATOM   2682 C C   . LEU B 1 15  ? 9.072   0.295   63.961  1.00 12.60 ? 19  LEU B C   1 
ATOM   2683 O O   . LEU B 1 15  ? 7.889   0.185   63.632  1.00 12.65 ? 19  LEU B O   1 
ATOM   2684 C CB  . LEU B 1 15  ? 9.787   2.053   62.339  1.00 12.98 ? 19  LEU B CB  1 
ATOM   2685 C CG  . LEU B 1 15  ? 9.661   3.216   63.333  1.00 14.75 ? 19  LEU B CG  1 
ATOM   2686 C CD1 . LEU B 1 15  ? 10.985  3.443   64.042  1.00 15.78 ? 19  LEU B CD1 1 
ATOM   2687 C CD2 . LEU B 1 15  ? 9.244   4.476   62.595  1.00 13.33 ? 19  LEU B CD2 1 
ATOM   2688 N N   . GLY B 1 16  ? 9.502   0.071   65.199  1.00 12.35 ? 20  GLY B N   1 
ATOM   2689 C CA  . GLY B 1 16  ? 8.573   -0.300  66.250  1.00 11.51 ? 20  GLY B CA  1 
ATOM   2690 C C   . GLY B 1 16  ? 8.601   0.681   67.406  1.00 13.30 ? 20  GLY B C   1 
ATOM   2691 O O   . GLY B 1 16  ? 9.599   1.380   67.620  1.00 12.22 ? 20  GLY B O   1 
ATOM   2692 N N   . PHE B 1 17  ? 7.498   0.745   68.146  1.00 12.74 ? 21  PHE B N   1 
ATOM   2693 C CA  . PHE B 1 17  ? 7.401   1.637   69.294  1.00 12.76 ? 21  PHE B CA  1 
ATOM   2694 C C   . PHE B 1 17  ? 7.581   0.844   70.587  1.00 13.48 ? 21  PHE B C   1 
ATOM   2695 O O   . PHE B 1 17  ? 6.860   -0.128  70.837  1.00 12.58 ? 21  PHE B O   1 
ATOM   2696 C CB  . PHE B 1 17  ? 6.042   2.342   69.319  1.00 14.63 ? 21  PHE B CB  1 
ATOM   2697 C CG  . PHE B 1 17  ? 5.931   3.388   70.390  1.00 12.86 ? 21  PHE B CG  1 
ATOM   2698 C CD1 . PHE B 1 17  ? 6.613   4.592   70.271  1.00 15.22 ? 21  PHE B CD1 1 
ATOM   2699 C CD2 . PHE B 1 17  ? 5.185   3.152   71.539  1.00 15.28 ? 21  PHE B CD2 1 
ATOM   2700 C CE1 . PHE B 1 17  ? 6.556   5.550   71.283  1.00 14.09 ? 21  PHE B CE1 1 
ATOM   2701 C CE2 . PHE B 1 17  ? 5.120   4.103   72.560  1.00 16.43 ? 21  PHE B CE2 1 
ATOM   2702 C CZ  . PHE B 1 17  ? 5.808   5.304   72.431  1.00 13.12 ? 21  PHE B CZ  1 
ATOM   2703 N N   . GLY B 1 18  ? 8.548   1.257   71.403  1.00 12.92 ? 22  GLY B N   1 
ATOM   2704 C CA  . GLY B 1 18  ? 8.802   0.573   72.659  1.00 13.65 ? 22  GLY B CA  1 
ATOM   2705 C C   . GLY B 1 18  ? 7.846   1.026   73.745  1.00 14.82 ? 22  GLY B C   1 
ATOM   2706 O O   . GLY B 1 18  ? 7.586   2.222   73.885  1.00 14.95 ? 22  GLY B O   1 
ATOM   2707 N N   . THR B 1 19  ? 7.336   0.082   74.532  1.00 14.29 ? 23  THR B N   1 
ATOM   2708 C CA  . THR B 1 19  ? 6.381   0.429   75.574  1.00 15.89 ? 23  THR B CA  1 
ATOM   2709 C C   . THR B 1 19  ? 6.922   0.375   76.995  1.00 17.10 ? 23  THR B C   1 
ATOM   2710 O O   . THR B 1 19  ? 6.153   0.414   77.955  1.00 19.02 ? 23  THR B O   1 
ATOM   2711 C CB  . THR B 1 19  ? 5.112   -0.449  75.482  1.00 15.24 ? 23  THR B CB  1 
ATOM   2712 O OG1 . THR B 1 19  ? 5.450   -1.818  75.729  1.00 16.33 ? 23  THR B OG1 1 
ATOM   2713 C CG2 . THR B 1 19  ? 4.490   -0.323  74.095  1.00 14.36 ? 23  THR B CG2 1 
ATOM   2714 N N   . ALA B 1 20  ? 8.239   0.273   77.131  1.00 17.43 ? 24  ALA B N   1 
ATOM   2715 C CA  . ALA B 1 20  ? 8.849   0.279   78.452  1.00 18.73 ? 24  ALA B CA  1 
ATOM   2716 C C   . ALA B 1 20  ? 8.886   1.757   78.834  1.00 19.78 ? 24  ALA B C   1 
ATOM   2717 O O   . ALA B 1 20  ? 9.222   2.605   78.006  1.00 19.82 ? 24  ALA B O   1 
ATOM   2718 C CB  . ALA B 1 20  ? 10.261  -0.288  78.390  1.00 18.47 ? 24  ALA B CB  1 
ATOM   2719 N N   . LEU B 1 21  ? 8.531   2.070   80.075  1.00 22.44 ? 25  LEU B N   1 
ATOM   2720 C CA  . LEU B 1 21  ? 8.520   3.457   80.523  1.00 23.46 ? 25  LEU B CA  1 
ATOM   2721 C C   . LEU B 1 21  ? 9.393   3.679   81.747  1.00 24.67 ? 25  LEU B C   1 
ATOM   2722 O O   . LEU B 1 21  ? 9.564   2.782   82.569  1.00 24.53 ? 25  LEU B O   1 
ATOM   2723 C CB  . LEU B 1 21  ? 7.086   3.895   80.839  1.00 24.55 ? 25  LEU B CB  1 
ATOM   2724 C CG  . LEU B 1 21  ? 6.090   3.878   79.676  1.00 25.76 ? 25  LEU B CG  1 
ATOM   2725 C CD1 . LEU B 1 21  ? 4.710   4.284   80.172  1.00 28.11 ? 25  LEU B CD1 1 
ATOM   2726 C CD2 . LEU B 1 21  ? 6.559   4.822   78.586  1.00 27.47 ? 25  LEU B CD2 1 
ATOM   2727 N N   . PRO B 1 22  ? 9.971   4.884   81.876  1.00 25.15 ? 26  PRO B N   1 
ATOM   2728 C CA  . PRO B 1 22  ? 10.822  5.180   83.031  1.00 26.21 ? 26  PRO B CA  1 
ATOM   2729 C C   . PRO B 1 22  ? 10.037  4.924   84.316  1.00 26.81 ? 26  PRO B C   1 
ATOM   2730 O O   . PRO B 1 22  ? 8.824   5.134   84.362  1.00 26.06 ? 26  PRO B O   1 
ATOM   2731 C CB  . PRO B 1 22  ? 11.158  6.653   82.833  1.00 26.36 ? 26  PRO B CB  1 
ATOM   2732 C CG  . PRO B 1 22  ? 11.200  6.777   81.341  1.00 26.29 ? 26  PRO B CG  1 
ATOM   2733 C CD  . PRO B 1 22  ? 9.971   6.005   80.922  1.00 25.43 ? 26  PRO B CD  1 
ATOM   2734 N N   . LEU B 1 23  ? 10.725  4.458   85.351  1.00 28.25 ? 27  LEU B N   1 
ATOM   2735 C CA  . LEU B 1 23  ? 10.081  4.169   86.626  1.00 30.33 ? 27  LEU B CA  1 
ATOM   2736 C C   . LEU B 1 23  ? 9.251   5.350   87.129  1.00 29.82 ? 27  LEU B C   1 
ATOM   2737 O O   . LEU B 1 23  ? 8.227   5.166   87.784  1.00 29.41 ? 27  LEU B O   1 
ATOM   2738 C CB  . LEU B 1 23  ? 11.138  3.798   87.670  1.00 32.17 ? 27  LEU B CB  1 
ATOM   2739 C CG  . LEU B 1 23  ? 10.622  3.314   89.028  1.00 33.73 ? 27  LEU B CG  1 
ATOM   2740 C CD1 . LEU B 1 23  ? 9.729   2.097   88.833  1.00 34.63 ? 27  LEU B CD1 1 
ATOM   2741 C CD2 . LEU B 1 23  ? 11.798  2.974   89.930  1.00 35.03 ? 27  LEU B CD2 1 
ATOM   2742 N N   . GLU B 1 24  ? 9.693   6.561   86.805  1.00 30.63 ? 28  GLU B N   1 
ATOM   2743 C CA  . GLU B 1 24  ? 9.008   7.779   87.232  1.00 31.43 ? 28  GLU B CA  1 
ATOM   2744 C C   . GLU B 1 24  ? 7.686   8.035   86.509  1.00 30.99 ? 28  GLU B C   1 
ATOM   2745 O O   . GLU B 1 24  ? 7.007   9.023   86.789  1.00 31.06 ? 28  GLU B O   1 
ATOM   2746 C CB  . GLU B 1 24  ? 9.923   8.993   87.037  1.00 32.95 ? 28  GLU B CB  1 
ATOM   2747 C CG  . GLU B 1 24  ? 11.258  8.914   87.768  1.00 35.77 ? 28  GLU B CG  1 
ATOM   2748 C CD  . GLU B 1 24  ? 12.169  7.829   87.223  1.00 36.78 ? 28  GLU B CD  1 
ATOM   2749 O OE1 . GLU B 1 24  ? 12.374  7.788   85.991  1.00 36.27 ? 28  GLU B OE1 1 
ATOM   2750 O OE2 . GLU B 1 24  ? 12.686  7.025   88.028  1.00 37.82 ? 28  GLU B OE2 1 
ATOM   2751 N N   . CYS B 1 25  ? 7.321   7.156   85.580  1.00 30.63 ? 29  CYS B N   1 
ATOM   2752 C CA  . CYS B 1 25  ? 6.075   7.320   84.835  1.00 29.37 ? 29  CYS B CA  1 
ATOM   2753 C C   . CYS B 1 25  ? 4.990   6.357   85.304  1.00 29.93 ? 29  CYS B C   1 
ATOM   2754 O O   . CYS B 1 25  ? 5.265   5.198   85.611  1.00 29.69 ? 29  CYS B O   1 
ATOM   2755 C CB  . CYS B 1 25  ? 6.307   7.092   83.337  1.00 29.68 ? 29  CYS B CB  1 
ATOM   2756 S SG  . CYS B 1 25  ? 7.386   8.279   82.518  0.80 29.61 ? 29  CYS B SG  1 
ATOM   2757 N N   . PRO B 1 26  ? 3.736   6.829   85.370  1.00 29.30 ? 30  PRO B N   1 
ATOM   2758 C CA  . PRO B 1 26  ? 2.657   5.939   85.802  1.00 30.11 ? 30  PRO B CA  1 
ATOM   2759 C C   . PRO B 1 26  ? 2.402   4.901   84.709  1.00 30.28 ? 30  PRO B C   1 
ATOM   2760 O O   . PRO B 1 26  ? 2.389   5.230   83.524  1.00 29.25 ? 30  PRO B O   1 
ATOM   2761 C CB  . PRO B 1 26  ? 1.482   6.895   85.999  1.00 28.98 ? 30  PRO B CB  1 
ATOM   2762 C CG  . PRO B 1 26  ? 1.745   7.961   84.994  1.00 30.77 ? 30  PRO B CG  1 
ATOM   2763 C CD  . PRO B 1 26  ? 3.232   8.193   85.138  1.00 29.28 ? 30  PRO B CD  1 
ATOM   2764 N N   . ALA B 1 27  ? 2.214   3.650   85.110  1.00 31.24 ? 31  ALA B N   1 
ATOM   2765 C CA  . ALA B 1 27  ? 1.976   2.569   84.161  1.00 31.71 ? 31  ALA B CA  1 
ATOM   2766 C C   . ALA B 1 27  ? 0.938   2.919   83.094  1.00 31.41 ? 31  ALA B C   1 
ATOM   2767 O O   . ALA B 1 27  ? 1.138   2.642   81.910  1.00 31.13 ? 31  ALA B O   1 
ATOM   2768 C CB  . ALA B 1 27  ? 1.549   1.313   84.909  1.00 33.46 ? 31  ALA B CB  1 
ATOM   2769 N N   . SER B 1 28  ? -0.165  3.532   83.518  1.00 30.43 ? 32  SER B N   1 
ATOM   2770 C CA  . SER B 1 28  ? -1.246  3.907   82.610  1.00 29.68 ? 32  SER B CA  1 
ATOM   2771 C C   . SER B 1 28  ? -0.788  4.801   81.462  1.00 28.93 ? 32  SER B C   1 
ATOM   2772 O O   . SER B 1 28  ? -1.477  4.928   80.451  1.00 27.71 ? 32  SER B O   1 
ATOM   2773 C CB  . SER B 1 28  ? -2.364  4.611   83.386  1.00 29.55 ? 32  SER B CB  1 
ATOM   2774 O OG  . SER B 1 28  ? -1.903  5.828   83.948  1.00 32.69 ? 32  SER B OG  1 
ATOM   2775 N N   . LYS B 1 29  ? 0.372   5.424   81.628  1.00 28.27 ? 33  LYS B N   1 
ATOM   2776 C CA  . LYS B 1 29  ? 0.927   6.303   80.606  1.00 27.05 ? 33  LYS B CA  1 
ATOM   2777 C C   . LYS B 1 29  ? 1.109   5.526   79.300  1.00 24.98 ? 33  LYS B C   1 
ATOM   2778 O O   . LYS B 1 29  ? 0.972   6.080   78.210  1.00 22.80 ? 33  LYS B O   1 
ATOM   2779 C CB  . LYS B 1 29  ? 2.277   6.846   81.079  1.00 28.64 ? 33  LYS B CB  1 
ATOM   2780 C CG  . LYS B 1 29  ? 2.915   7.880   80.172  1.00 30.79 ? 33  LYS B CG  1 
ATOM   2781 C CD  . LYS B 1 29  ? 2.271   9.239   80.332  1.00 33.00 ? 33  LYS B CD  1 
ATOM   2782 C CE  . LYS B 1 29  ? 3.067   10.298  79.590  1.00 33.87 ? 33  LYS B CE  1 
ATOM   2783 N NZ  . LYS B 1 29  ? 2.506   11.658  79.802  1.00 34.07 ? 33  LYS B NZ  1 
ATOM   2784 N N   . ALA B 1 30  ? 1.410   4.237   79.425  1.00 24.99 ? 34  ALA B N   1 
ATOM   2785 C CA  . ALA B 1 30  ? 1.617   3.379   78.263  1.00 24.55 ? 34  ALA B CA  1 
ATOM   2786 C C   . ALA B 1 30  ? 0.398   3.336   77.346  1.00 25.77 ? 34  ALA B C   1 
ATOM   2787 O O   . ALA B 1 30  ? 0.535   3.241   76.127  1.00 25.89 ? 34  ALA B O   1 
ATOM   2788 C CB  . ALA B 1 30  ? 1.977   1.966   78.716  1.00 24.52 ? 34  ALA B CB  1 
ATOM   2789 N N   . LYS B 1 31  ? -0.795  3.407   77.926  1.00 26.09 ? 35  LYS B N   1 
ATOM   2790 C CA  . LYS B 1 31  ? -2.013  3.360   77.124  1.00 26.85 ? 35  LYS B CA  1 
ATOM   2791 C C   . LYS B 1 31  ? -2.128  4.552   76.179  1.00 26.38 ? 35  LYS B C   1 
ATOM   2792 O O   . LYS B 1 31  ? -2.393  4.386   74.987  1.00 25.51 ? 35  LYS B O   1 
ATOM   2793 C CB  . LYS B 1 31  ? -3.247  3.300   78.027  1.00 27.17 ? 35  LYS B CB  1 
ATOM   2794 C CG  . LYS B 1 31  ? -4.561  3.212   77.258  1.00 27.68 ? 35  LYS B CG  1 
ATOM   2795 C CD  . LYS B 1 31  ? -5.755  3.127   78.194  1.00 26.98 ? 35  LYS B CD  1 
ATOM   2796 C CE  . LYS B 1 31  ? -7.061  3.157   77.417  0.50 28.18 ? 35  LYS B CE  1 
ATOM   2797 N NZ  . LYS B 1 31  ? -8.245  3.126   78.317  0.50 28.15 ? 35  LYS B NZ  1 
ATOM   2798 N N   . GLU B 1 32  ? -1.921  5.754   76.708  1.00 26.41 ? 36  GLU B N   1 
ATOM   2799 C CA  . GLU B 1 32  ? -2.020  6.958   75.895  1.00 26.17 ? 36  GLU B CA  1 
ATOM   2800 C C   . GLU B 1 32  ? -0.911  7.060   74.849  1.00 23.57 ? 36  GLU B C   1 
ATOM   2801 O O   . GLU B 1 32  ? -1.155  7.475   73.716  1.00 22.33 ? 36  GLU B O   1 
ATOM   2802 C CB  . GLU B 1 32  ? -2.013  8.206   76.784  1.00 29.04 ? 36  GLU B CB  1 
ATOM   2803 C CG  . GLU B 1 32  ? -2.324  9.485   76.026  1.00 33.54 ? 36  GLU B CG  1 
ATOM   2804 C CD  . GLU B 1 32  ? -3.606  9.381   75.207  1.00 37.04 ? 36  GLU B CD  1 
ATOM   2805 O OE1 . GLU B 1 32  ? -4.679  9.114   75.794  1.00 39.85 ? 36  GLU B OE1 1 
ATOM   2806 O OE2 . GLU B 1 32  ? -3.541  9.563   73.972  1.00 37.56 ? 36  GLU B OE2 1 
ATOM   2807 N N   . LEU B 1 33  ? 0.308   6.684   75.219  1.00 21.55 ? 37  LEU B N   1 
ATOM   2808 C CA  . LEU B 1 33  ? 1.416   6.746   74.271  1.00 19.63 ? 37  LEU B CA  1 
ATOM   2809 C C   . LEU B 1 33  ? 1.188   5.775   73.117  1.00 18.77 ? 37  LEU B C   1 
ATOM   2810 O O   . LEU B 1 33  ? 1.526   6.068   71.973  1.00 19.11 ? 37  LEU B O   1 
ATOM   2811 C CB  . LEU B 1 33  ? 2.742   6.432   74.973  1.00 19.39 ? 37  LEU B CB  1 
ATOM   2812 C CG  . LEU B 1 33  ? 3.252   7.515   75.931  1.00 19.10 ? 37  LEU B CG  1 
ATOM   2813 C CD1 . LEU B 1 33  ? 4.529   7.047   76.603  1.00 20.07 ? 37  LEU B CD1 1 
ATOM   2814 C CD2 . LEU B 1 33  ? 3.496   8.809   75.161  1.00 19.01 ? 37  LEU B CD2 1 
ATOM   2815 N N   . THR B 1 34  ? 0.605   4.619   73.419  1.00 19.49 ? 38  THR B N   1 
ATOM   2816 C CA  . THR B 1 34  ? 0.331   3.626   72.387  1.00 19.62 ? 38  THR B CA  1 
ATOM   2817 C C   . THR B 1 34  ? -0.714  4.154   71.407  1.00 18.97 ? 38  THR B C   1 
ATOM   2818 O O   . THR B 1 34  ? -0.589  3.961   70.197  1.00 18.31 ? 38  THR B O   1 
ATOM   2819 C CB  . THR B 1 34  ? -0.159  2.295   72.999  1.00 19.43 ? 38  THR B CB  1 
ATOM   2820 O OG1 . THR B 1 34  ? 0.869   1.746   73.836  1.00 19.04 ? 38  THR B OG1 1 
ATOM   2821 C CG2 . THR B 1 34  ? -0.494  1.293   71.900  1.00 20.19 ? 38  THR B CG2 1 
ATOM   2822 N N   . LYS B 1 35  ? -1.737  4.832   71.924  1.00 19.30 ? 39  LYS B N   1 
ATOM   2823 C CA  . LYS B 1 35  ? -2.781  5.387   71.061  1.00 19.55 ? 39  LYS B CA  1 
ATOM   2824 C C   . LYS B 1 35  ? -2.196  6.447   70.129  1.00 19.83 ? 39  LYS B C   1 
ATOM   2825 O O   . LYS B 1 35  ? -2.516  6.493   68.940  1.00 20.13 ? 39  LYS B O   1 
ATOM   2826 C CB  . LYS B 1 35  ? -3.908  6.007   71.900  1.00 19.71 ? 39  LYS B CB  1 
ATOM   2827 C CG  . LYS B 1 35  ? -4.785  5.001   72.619  1.00 21.86 ? 39  LYS B CG  1 
ATOM   2828 C CD  . LYS B 1 35  ? -5.960  5.695   73.290  1.00 24.16 ? 39  LYS B CD  1 
ATOM   2829 C CE  . LYS B 1 35  ? -6.908  4.696   73.931  1.00 24.77 ? 39  LYS B CE  1 
ATOM   2830 N NZ  . LYS B 1 35  ? -8.064  5.377   74.585  1.00 25.40 ? 39  LYS B NZ  1 
ATOM   2831 N N   . ILE B 1 36  ? -1.338  7.303   70.675  1.00 20.60 ? 40  ILE B N   1 
ATOM   2832 C CA  . ILE B 1 36  ? -0.703  8.348   69.882  1.00 19.64 ? 40  ILE B CA  1 
ATOM   2833 C C   . ILE B 1 36  ? 0.179   7.714   68.807  1.00 19.24 ? 40  ILE B C   1 
ATOM   2834 O O   . ILE B 1 36  ? 0.174   8.144   67.652  1.00 18.41 ? 40  ILE B O   1 
ATOM   2835 C CB  . ILE B 1 36  ? 0.171   9.267   70.764  1.00 21.17 ? 40  ILE B CB  1 
ATOM   2836 C CG1 . ILE B 1 36  ? -0.717  10.077  71.712  1.00 22.08 ? 40  ILE B CG1 1 
ATOM   2837 C CG2 . ILE B 1 36  ? 1.008   10.194  69.891  1.00 21.60 ? 40  ILE B CG2 1 
ATOM   2838 C CD1 . ILE B 1 36  ? 0.049   11.025  72.615  1.00 23.81 ? 40  ILE B CD1 1 
ATOM   2839 N N   . ALA B 1 37  ? 0.931   6.689   69.195  1.00 18.57 ? 41  ALA B N   1 
ATOM   2840 C CA  . ALA B 1 37  ? 1.820   5.997   68.268  1.00 18.25 ? 41  ALA B CA  1 
ATOM   2841 C C   . ALA B 1 37  ? 1.028   5.363   67.129  1.00 18.50 ? 41  ALA B C   1 
ATOM   2842 O O   . ALA B 1 37  ? 1.445   5.413   65.972  1.00 19.09 ? 41  ALA B O   1 
ATOM   2843 C CB  . ALA B 1 37  ? 2.626   4.935   69.009  1.00 16.31 ? 41  ALA B CB  1 
ATOM   2844 N N   . ILE B 1 38  ? -0.112  4.762   67.454  1.00 19.56 ? 42  ILE B N   1 
ATOM   2845 C CA  . ILE B 1 38  ? -0.946  4.154   66.425  1.00 19.60 ? 42  ILE B CA  1 
ATOM   2846 C C   . ILE B 1 38  ? -1.437  5.235   65.462  1.00 20.67 ? 42  ILE B C   1 
ATOM   2847 O O   . ILE B 1 38  ? -1.365  5.066   64.245  1.00 21.16 ? 42  ILE B O   1 
ATOM   2848 C CB  . ILE B 1 38  ? -2.150  3.404   67.043  1.00 18.96 ? 42  ILE B CB  1 
ATOM   2849 C CG1 . ILE B 1 38  ? -1.658  2.107   67.696  1.00 18.54 ? 42  ILE B CG1 1 
ATOM   2850 C CG2 . ILE B 1 38  ? -3.198  3.103   65.968  1.00 19.29 ? 42  ILE B CG2 1 
ATOM   2851 C CD1 . ILE B 1 38  ? -2.734  1.302   68.399  1.00 17.79 ? 42  ILE B CD1 1 
ATOM   2852 N N   . ASP B 1 39  ? -1.914  6.355   65.999  1.00 20.39 ? 43  ASP B N   1 
ATOM   2853 C CA  . ASP B 1 39  ? -2.391  7.433   65.145  1.00 20.84 ? 43  ASP B CA  1 
ATOM   2854 C C   . ASP B 1 39  ? -1.271  8.013   64.291  1.00 20.87 ? 43  ASP B C   1 
ATOM   2855 O O   . ASP B 1 39  ? -1.524  8.534   63.205  1.00 19.48 ? 43  ASP B O   1 
ATOM   2856 C CB  . ASP B 1 39  ? -3.040  8.549   65.972  1.00 23.95 ? 43  ASP B CB  1 
ATOM   2857 C CG  . ASP B 1 39  ? -4.382  8.139   66.555  1.00 25.31 ? 43  ASP B CG  1 
ATOM   2858 O OD1 . ASP B 1 39  ? -5.024  7.224   65.995  1.00 26.30 ? 43  ASP B OD1 1 
ATOM   2859 O OD2 . ASP B 1 39  ? -4.803  8.741   67.564  1.00 26.30 ? 43  ASP B OD2 1 
ATOM   2860 N N   . ALA B 1 40  ? -0.035  7.914   64.776  1.00 18.28 ? 44  ALA B N   1 
ATOM   2861 C CA  . ALA B 1 40  ? 1.116   8.424   64.039  1.00 18.22 ? 44  ALA B CA  1 
ATOM   2862 C C   . ALA B 1 40  ? 1.534   7.458   62.931  1.00 18.39 ? 44  ALA B C   1 
ATOM   2863 O O   . ALA B 1 40  ? 2.349   7.797   62.076  1.00 19.22 ? 44  ALA B O   1 
ATOM   2864 C CB  . ALA B 1 40  ? 2.287   8.672   64.992  1.00 18.52 ? 44  ALA B CB  1 
ATOM   2865 N N   . GLY B 1 41  ? 0.977   6.252   62.948  1.00 18.82 ? 45  GLY B N   1 
ATOM   2866 C CA  . GLY B 1 41  ? 1.312   5.287   61.917  1.00 18.72 ? 45  GLY B CA  1 
ATOM   2867 C C   . GLY B 1 41  ? 2.145   4.098   62.354  1.00 18.33 ? 45  GLY B C   1 
ATOM   2868 O O   . GLY B 1 41  ? 2.635   3.349   61.502  1.00 18.56 ? 45  GLY B O   1 
ATOM   2869 N N   . PHE B 1 42  ? 2.326   3.915   63.661  1.00 17.56 ? 46  PHE B N   1 
ATOM   2870 C CA  . PHE B 1 42  ? 3.104   2.778   64.159  1.00 17.57 ? 46  PHE B CA  1 
ATOM   2871 C C   . PHE B 1 42  ? 2.244   1.518   64.190  1.00 17.92 ? 46  PHE B C   1 
ATOM   2872 O O   . PHE B 1 42  ? 1.086   1.560   64.604  1.00 17.58 ? 46  PHE B O   1 
ATOM   2873 C CB  . PHE B 1 42  ? 3.642   3.042   65.573  1.00 15.37 ? 46  PHE B CB  1 
ATOM   2874 C CG  . PHE B 1 42  ? 4.861   3.927   65.614  1.00 15.54 ? 46  PHE B CG  1 
ATOM   2875 C CD1 . PHE B 1 42  ? 4.744   5.309   65.505  1.00 16.20 ? 46  PHE B CD1 1 
ATOM   2876 C CD2 . PHE B 1 42  ? 6.132   3.370   65.753  1.00 13.85 ? 46  PHE B CD2 1 
ATOM   2877 C CE1 . PHE B 1 42  ? 5.875   6.127   65.535  1.00 16.28 ? 46  PHE B CE1 1 
ATOM   2878 C CE2 . PHE B 1 42  ? 7.269   4.178   65.783  1.00 17.33 ? 46  PHE B CE2 1 
ATOM   2879 C CZ  . PHE B 1 42  ? 7.139   5.559   65.673  1.00 16.58 ? 46  PHE B CZ  1 
ATOM   2880 N N   . HIS B 1 43  ? 2.824   0.399   63.766  1.00 18.16 ? 47  HIS B N   1 
ATOM   2881 C CA  . HIS B 1 43  ? 2.121   -0.881  63.741  1.00 19.86 ? 47  HIS B CA  1 
ATOM   2882 C C   . HIS B 1 43  ? 2.852   -1.936  64.559  1.00 18.36 ? 47  HIS B C   1 
ATOM   2883 O O   . HIS B 1 43  ? 2.281   -2.963  64.924  1.00 21.75 ? 47  HIS B O   1 
ATOM   2884 C CB  . HIS B 1 43  ? 1.982   -1.372  62.301  1.00 24.13 ? 47  HIS B CB  1 
ATOM   2885 C CG  . HIS B 1 43  ? 1.020   -0.574  61.482  1.00 28.09 ? 47  HIS B CG  1 
ATOM   2886 N ND1 . HIS B 1 43  ? -0.341  -0.603  61.696  1.00 30.05 ? 47  HIS B ND1 1 
ATOM   2887 C CD2 . HIS B 1 43  ? 1.221   0.284   60.454  1.00 29.84 ? 47  HIS B CD2 1 
ATOM   2888 C CE1 . HIS B 1 43  ? -0.938  0.203   60.835  1.00 30.24 ? 47  HIS B CE1 1 
ATOM   2889 N NE2 . HIS B 1 43  ? -0.012  0.753   60.070  1.00 30.48 ? 47  HIS B NE2 1 
ATOM   2890 N N   . HIS B 1 44  ? 4.119   -1.669  64.841  1.00 15.09 ? 48  HIS B N   1 
ATOM   2891 C CA  . HIS B 1 44  ? 4.960   -2.578  65.602  1.00 14.07 ? 48  HIS B CA  1 
ATOM   2892 C C   . HIS B 1 44  ? 5.104   -2.044  67.026  1.00 13.68 ? 48  HIS B C   1 
ATOM   2893 O O   . HIS B 1 44  ? 5.508   -0.896  67.231  1.00 13.81 ? 48  HIS B O   1 
ATOM   2894 C CB  . HIS B 1 44  ? 6.328   -2.678  64.906  1.00 12.04 ? 48  HIS B CB  1 
ATOM   2895 C CG  . HIS B 1 44  ? 7.342   -3.508  65.634  1.00 12.02 ? 48  HIS B CG  1 
ATOM   2896 N ND1 . HIS B 1 44  ? 8.592   -3.767  65.113  1.00 12.48 ? 48  HIS B ND1 1 
ATOM   2897 C CD2 . HIS B 1 44  ? 7.307   -4.113  66.846  1.00 11.56 ? 48  HIS B CD2 1 
ATOM   2898 C CE1 . HIS B 1 44  ? 9.284   -4.494  65.972  1.00 12.41 ? 48  HIS B CE1 1 
ATOM   2899 N NE2 . HIS B 1 44  ? 8.528   -4.717  67.032  1.00 12.74 ? 48  HIS B NE2 1 
ATOM   2900 N N   . PHE B 1 45  ? 4.741   -2.867  68.003  1.00 12.74 ? 49  PHE B N   1 
ATOM   2901 C CA  . PHE B 1 45  ? 4.858   -2.477  69.400  1.00 14.01 ? 49  PHE B CA  1 
ATOM   2902 C C   . PHE B 1 45  ? 5.640   -3.518  70.180  1.00 14.73 ? 49  PHE B C   1 
ATOM   2903 O O   . PHE B 1 45  ? 5.366   -4.720  70.102  1.00 14.94 ? 49  PHE B O   1 
ATOM   2904 C CB  . PHE B 1 45  ? 3.477   -2.259  70.025  1.00 16.82 ? 49  PHE B CB  1 
ATOM   2905 C CG  . PHE B 1 45  ? 2.775   -1.045  69.497  1.00 16.66 ? 49  PHE B CG  1 
ATOM   2906 C CD1 . PHE B 1 45  ? 2.089   -1.094  68.287  1.00 16.02 ? 49  PHE B CD1 1 
ATOM   2907 C CD2 . PHE B 1 45  ? 2.874   0.173   70.163  1.00 14.03 ? 49  PHE B CD2 1 
ATOM   2908 C CE1 . PHE B 1 45  ? 1.517   0.056   67.744  1.00 16.14 ? 49  PHE B CE1 1 
ATOM   2909 C CE2 . PHE B 1 45  ? 2.306   1.325   69.630  1.00 16.26 ? 49  PHE B CE2 1 
ATOM   2910 C CZ  . PHE B 1 45  ? 1.627   1.266   68.416  1.00 15.41 ? 49  PHE B CZ  1 
ATOM   2911 N N   . ASP B 1 46  ? 6.631   -3.045  70.927  1.00 13.11 ? 50  ASP B N   1 
ATOM   2912 C CA  . ASP B 1 46  ? 7.477   -3.927  71.711  1.00 13.80 ? 50  ASP B CA  1 
ATOM   2913 C C   . ASP B 1 46  ? 7.190   -3.817  73.202  1.00 14.32 ? 50  ASP B C   1 
ATOM   2914 O O   . ASP B 1 46  ? 7.220   -2.728  73.769  1.00 14.83 ? 50  ASP B O   1 
ATOM   2915 C CB  . ASP B 1 46  ? 8.946   -3.602  71.434  1.00 13.54 ? 50  ASP B CB  1 
ATOM   2916 C CG  . ASP B 1 46  ? 9.887   -4.546  72.135  1.00 13.89 ? 50  ASP B CG  1 
ATOM   2917 O OD1 . ASP B 1 46  ? 10.324  -4.225  73.257  1.00 13.44 ? 50  ASP B OD1 1 
ATOM   2918 O OD2 . ASP B 1 46  ? 10.178  -5.619  71.566  1.00 13.87 ? 50  ASP B OD2 1 
ATOM   2919 N N   . SER B 1 47  ? 6.910   -4.955  73.829  1.00 15.13 ? 51  SER B N   1 
ATOM   2920 C CA  . SER B 1 47  ? 6.622   -4.992  75.255  1.00 15.97 ? 51  SER B CA  1 
ATOM   2921 C C   . SER B 1 47  ? 7.284   -6.205  75.899  1.00 15.06 ? 51  SER B C   1 
ATOM   2922 O O   . SER B 1 47  ? 8.050   -6.919  75.253  1.00 15.49 ? 51  SER B O   1 
ATOM   2923 C CB  . SER B 1 47  ? 5.108   -5.035  75.485  1.00 15.63 ? 51  SER B CB  1 
ATOM   2924 O OG  . SER B 1 47  ? 4.803   -4.871  76.858  1.00 18.36 ? 51  SER B OG  1 
ATOM   2925 N N   . ALA B 1 48  ? 6.987   -6.429  77.174  1.00 14.97 ? 52  ALA B N   1 
ATOM   2926 C CA  . ALA B 1 48  ? 7.549   -7.548  77.923  1.00 16.23 ? 52  ALA B CA  1 
ATOM   2927 C C   . ALA B 1 48  ? 6.755   -7.717  79.213  1.00 16.66 ? 52  ALA B C   1 
ATOM   2928 O O   . ALA B 1 48  ? 6.128   -6.773  79.685  1.00 17.14 ? 52  ALA B O   1 
ATOM   2929 C CB  . ALA B 1 48  ? 9.025   -7.278  78.246  1.00 13.12 ? 52  ALA B CB  1 
ATOM   2930 N N   . SER B 1 49  ? 6.786   -8.914  79.786  1.00 18.56 ? 53  SER B N   1 
ATOM   2931 C CA  . SER B 1 49  ? 6.048   -9.162  81.017  1.00 20.53 ? 53  SER B CA  1 
ATOM   2932 C C   . SER B 1 49  ? 6.594   -8.333  82.176  1.00 21.00 ? 53  SER B C   1 
ATOM   2933 O O   . SER B 1 49  ? 5.842   -7.892  83.042  1.00 20.94 ? 53  SER B O   1 
ATOM   2934 C CB  . SER B 1 49  ? 6.090   -10.654 81.378  1.00 21.86 ? 53  SER B CB  1 
ATOM   2935 O OG  . SER B 1 49  ? 7.418   -11.113 81.580  1.00 23.28 ? 53  SER B OG  1 
ATOM   2936 N N   . VAL B 1 50  ? 7.903   -8.105  82.178  1.00 20.78 ? 54  VAL B N   1 
ATOM   2937 C CA  . VAL B 1 50  ? 8.537   -7.345  83.250  1.00 20.91 ? 54  VAL B CA  1 
ATOM   2938 C C   . VAL B 1 50  ? 8.235   -5.841  83.234  1.00 22.31 ? 54  VAL B C   1 
ATOM   2939 O O   . VAL B 1 50  ? 8.429   -5.157  84.242  1.00 21.76 ? 54  VAL B O   1 
ATOM   2940 C CB  . VAL B 1 50  ? 10.076  -7.555  83.227  1.00 21.54 ? 54  VAL B CB  1 
ATOM   2941 C CG1 . VAL B 1 50  ? 10.690  -6.830  82.033  1.00 19.48 ? 54  VAL B CG1 1 
ATOM   2942 C CG2 . VAL B 1 50  ? 10.688  -7.080  84.533  1.00 19.35 ? 54  VAL B CG2 1 
ATOM   2943 N N   . TYR B 1 51  ? 7.751   -5.329  82.105  1.00 22.13 ? 55  TYR B N   1 
ATOM   2944 C CA  . TYR B 1 51  ? 7.448   -3.901  81.982  1.00 23.49 ? 55  TYR B CA  1 
ATOM   2945 C C   . TYR B 1 51  ? 6.215   -3.462  82.766  1.00 24.62 ? 55  TYR B C   1 
ATOM   2946 O O   . TYR B 1 51  ? 6.066   -2.280  83.080  1.00 25.24 ? 55  TYR B O   1 
ATOM   2947 C CB  . TYR B 1 51  ? 7.251   -3.515  80.507  1.00 20.98 ? 55  TYR B CB  1 
ATOM   2948 C CG  . TYR B 1 51  ? 8.469   -3.698  79.619  1.00 19.57 ? 55  TYR B CG  1 
ATOM   2949 C CD1 . TYR B 1 51  ? 8.356   -3.606  78.232  1.00 18.75 ? 55  TYR B CD1 1 
ATOM   2950 C CD2 . TYR B 1 51  ? 9.726   -3.973  80.159  1.00 17.55 ? 55  TYR B CD2 1 
ATOM   2951 C CE1 . TYR B 1 51  ? 9.460   -3.788  77.402  1.00 18.68 ? 55  TYR B CE1 1 
ATOM   2952 C CE2 . TYR B 1 51  ? 10.840  -4.155  79.339  1.00 18.76 ? 55  TYR B CE2 1 
ATOM   2953 C CZ  . TYR B 1 51  ? 10.697  -4.064  77.961  1.00 19.99 ? 55  TYR B CZ  1 
ATOM   2954 O OH  . TYR B 1 51  ? 11.781  -4.260  77.140  1.00 19.14 ? 55  TYR B OH  1 
ATOM   2955 N N   . ASN B 1 52  ? 5.333   -4.407  83.070  1.00 26.10 ? 56  ASN B N   1 
ATOM   2956 C CA  . ASN B 1 52  ? 4.103   -4.108  83.801  1.00 28.20 ? 56  ASN B CA  1 
ATOM   2957 C C   . ASN B 1 52  ? 3.258   -3.066  83.067  1.00 28.30 ? 56  ASN B C   1 
ATOM   2958 O O   . ASN B 1 52  ? 2.563   -2.264  83.694  1.00 28.90 ? 56  ASN B O   1 
ATOM   2959 C CB  . ASN B 1 52  ? 4.420   -3.602  85.213  1.00 28.21 ? 56  ASN B CB  1 
ATOM   2960 C CG  . ASN B 1 52  ? 5.160   -4.628  86.049  0.75 29.83 ? 56  ASN B CG  1 
ATOM   2961 O OD1 . ASN B 1 52  ? 4.720   -5.772  86.185  0.75 29.19 ? 56  ASN B OD1 1 
ATOM   2962 N ND2 . ASN B 1 52  ? 6.289   -4.221  86.620  0.75 30.90 ? 56  ASN B ND2 1 
ATOM   2963 N N   . THR B 1 53  ? 3.318   -3.079  81.739  1.00 26.86 ? 57  THR B N   1 
ATOM   2964 C CA  . THR B 1 53  ? 2.549   -2.132  80.938  1.00 26.59 ? 57  THR B CA  1 
ATOM   2965 C C   . THR B 1 53  ? 1.692   -2.849  79.900  1.00 26.01 ? 57  THR B C   1 
ATOM   2966 O O   . THR B 1 53  ? 0.908   -2.219  79.188  1.00 25.57 ? 57  THR B O   1 
ATOM   2967 C CB  . THR B 1 53  ? 3.477   -1.133  80.203  1.00 26.94 ? 57  THR B CB  1 
ATOM   2968 O OG1 . THR B 1 53  ? 4.359   -1.845  79.324  1.00 27.19 ? 57  THR B OG1 1 
ATOM   2969 C CG2 . THR B 1 53  ? 4.304   -0.338  81.205  1.00 28.30 ? 57  THR B CG2 1 
ATOM   2970 N N   . GLU B 1 54  ? 1.839   -4.169  79.822  1.00 25.30 ? 58  GLU B N   1 
ATOM   2971 C CA  . GLU B 1 54  ? 1.096   -4.962  78.852  1.00 25.04 ? 58  GLU B CA  1 
ATOM   2972 C C   . GLU B 1 54  ? -0.416  -4.769  78.881  1.00 25.76 ? 58  GLU B C   1 
ATOM   2973 O O   . GLU B 1 54  ? -1.042  -4.635  77.834  1.00 24.86 ? 58  GLU B O   1 
ATOM   2974 C CB  . GLU B 1 54  ? 1.419   -6.452  79.013  1.00 24.93 ? 58  GLU B CB  1 
ATOM   2975 C CG  . GLU B 1 54  ? 2.832   -6.830  78.581  1.00 23.96 ? 58  GLU B CG  1 
ATOM   2976 C CD  . GLU B 1 54  ? 3.005   -8.323  78.371  1.00 24.90 ? 58  GLU B CD  1 
ATOM   2977 O OE1 . GLU B 1 54  ? 2.873   -9.090  79.352  1.00 24.04 ? 58  GLU B OE1 1 
ATOM   2978 O OE2 . GLU B 1 54  ? 3.272   -8.730  77.219  1.00 21.35 ? 58  GLU B OE2 1 
ATOM   2979 N N   . ASP B 1 55  ? -1.011  -4.764  80.068  1.00 26.90 ? 59  ASP B N   1 
ATOM   2980 C CA  . ASP B 1 55  ? -2.457  -4.598  80.148  1.00 27.88 ? 59  ASP B CA  1 
ATOM   2981 C C   . ASP B 1 55  ? -2.888  -3.250  79.571  1.00 27.35 ? 59  ASP B C   1 
ATOM   2982 O O   . ASP B 1 55  ? -3.878  -3.170  78.843  1.00 26.76 ? 59  ASP B O   1 
ATOM   2983 C CB  . ASP B 1 55  ? -2.936  -4.768  81.597  1.00 29.54 ? 59  ASP B CB  1 
ATOM   2984 C CG  . ASP B 1 55  ? -2.342  -3.745  82.540  1.00 32.91 ? 59  ASP B CG  1 
ATOM   2985 O OD1 . ASP B 1 55  ? -1.159  -3.379  82.366  1.00 33.95 ? 59  ASP B OD1 1 
ATOM   2986 O OD2 . ASP B 1 55  ? -3.060  -3.319  83.470  1.00 34.63 ? 59  ASP B OD2 1 
ATOM   2987 N N   . HIS B 1 56  ? -2.130  -2.200  79.871  1.00 25.95 ? 60  HIS B N   1 
ATOM   2988 C CA  . HIS B 1 56  ? -2.441  -0.864  79.368  1.00 25.00 ? 60  HIS B CA  1 
ATOM   2989 C C   . HIS B 1 56  ? -2.243  -0.774  77.855  1.00 23.84 ? 60  HIS B C   1 
ATOM   2990 O O   . HIS B 1 56  ? -3.047  -0.163  77.152  1.00 22.74 ? 60  HIS B O   1 
ATOM   2991 C CB  . HIS B 1 56  ? -1.567  0.173   80.070  1.00 25.39 ? 60  HIS B CB  1 
ATOM   2992 C CG  . HIS B 1 56  ? -1.736  0.189   81.557  1.00 26.93 ? 60  HIS B CG  1 
ATOM   2993 N ND1 . HIS B 1 56  ? -2.894  0.620   82.168  1.00 26.87 ? 60  HIS B ND1 1 
ATOM   2994 C CD2 . HIS B 1 56  ? -0.913  -0.219  82.552  1.00 26.95 ? 60  HIS B CD2 1 
ATOM   2995 C CE1 . HIS B 1 56  ? -2.778  0.474   83.476  1.00 27.64 ? 60  HIS B CE1 1 
ATOM   2996 N NE2 . HIS B 1 56  ? -1.586  -0.034  83.735  1.00 28.15 ? 60  HIS B NE2 1 
ATOM   2997 N N   . VAL B 1 57  ? -1.167  -1.380  77.360  1.00 22.52 ? 61  VAL B N   1 
ATOM   2998 C CA  . VAL B 1 57  ? -0.881  -1.375  75.929  1.00 20.96 ? 61  VAL B CA  1 
ATOM   2999 C C   . VAL B 1 57  ? -1.981  -2.142  75.197  1.00 20.90 ? 61  VAL B C   1 
ATOM   3000 O O   . VAL B 1 57  ? -2.452  -1.718  74.141  1.00 19.54 ? 61  VAL B O   1 
ATOM   3001 C CB  . VAL B 1 57  ? 0.481   -2.046  75.622  1.00 20.65 ? 61  VAL B CB  1 
ATOM   3002 C CG1 . VAL B 1 57  ? 0.722   -2.073  74.117  1.00 20.90 ? 61  VAL B CG1 1 
ATOM   3003 C CG2 . VAL B 1 57  ? 1.608   -1.295  76.325  1.00 18.37 ? 61  VAL B CG2 1 
ATOM   3004 N N   . GLY B 1 58  ? -2.382  -3.275  75.767  1.00 21.42 ? 62  GLY B N   1 
ATOM   3005 C CA  . GLY B 1 58  ? -3.426  -4.081  75.162  1.00 22.92 ? 62  GLY B CA  1 
ATOM   3006 C C   . GLY B 1 58  ? -4.742  -3.331  75.079  1.00 23.23 ? 62  GLY B C   1 
ATOM   3007 O O   . GLY B 1 58  ? -5.504  -3.496  74.128  1.00 23.58 ? 62  GLY B O   1 
ATOM   3008 N N   . GLU B 1 59  ? -5.009  -2.498  76.078  1.00 24.83 ? 63  GLU B N   1 
ATOM   3009 C CA  . GLU B 1 59  ? -6.239  -1.716  76.123  1.00 24.37 ? 63  GLU B CA  1 
ATOM   3010 C C   . GLU B 1 59  ? -6.266  -0.692  74.988  1.00 24.80 ? 63  GLU B C   1 
ATOM   3011 O O   . GLU B 1 59  ? -7.293  -0.498  74.335  1.00 23.05 ? 63  GLU B O   1 
ATOM   3012 C CB  . GLU B 1 59  ? -6.352  -1.015  77.483  1.00 26.39 ? 63  GLU B CB  1 
ATOM   3013 C CG  . GLU B 1 59  ? -7.687  -0.334  77.739  1.00 27.99 ? 63  GLU B CG  1 
ATOM   3014 C CD  . GLU B 1 59  ? -7.780  0.256   79.135  0.50 28.50 ? 63  GLU B CD  1 
ATOM   3015 O OE1 . GLU B 1 59  ? -8.812  0.886   79.447  0.50 29.36 ? 63  GLU B OE1 1 
ATOM   3016 O OE2 . GLU B 1 59  ? -6.824  0.088   79.923  0.50 28.29 ? 63  GLU B OE2 1 
ATOM   3017 N N   . ALA B 1 60  ? -5.130  -0.043  74.748  1.00 24.56 ? 64  ALA B N   1 
ATOM   3018 C CA  . ALA B 1 60  ? -5.026  0.952   73.683  1.00 23.05 ? 64  ALA B CA  1 
ATOM   3019 C C   . ALA B 1 60  ? -5.207  0.298   72.315  1.00 23.19 ? 64  ALA B C   1 
ATOM   3020 O O   . ALA B 1 60  ? -5.942  0.804   71.465  1.00 23.31 ? 64  ALA B O   1 
ATOM   3021 C CB  . ALA B 1 60  ? -3.673  1.652   73.753  1.00 24.12 ? 64  ALA B CB  1 
ATOM   3022 N N   . ILE B 1 61  ? -4.535  -0.829  72.102  1.00 22.51 ? 65  ILE B N   1 
ATOM   3023 C CA  . ILE B 1 61  ? -4.638  -1.538  70.832  1.00 22.64 ? 65  ILE B CA  1 
ATOM   3024 C C   . ILE B 1 61  ? -6.063  -2.031  70.597  1.00 22.86 ? 65  ILE B C   1 
ATOM   3025 O O   . ILE B 1 61  ? -6.625  -1.824  69.524  1.00 23.59 ? 65  ILE B O   1 
ATOM   3026 C CB  . ILE B 1 61  ? -3.667  -2.743  70.779  1.00 21.88 ? 65  ILE B CB  1 
ATOM   3027 C CG1 . ILE B 1 61  ? -2.221  -2.237  70.795  1.00 21.05 ? 65  ILE B CG1 1 
ATOM   3028 C CG2 . ILE B 1 61  ? -3.928  -3.572  69.522  1.00 21.66 ? 65  ILE B CG2 1 
ATOM   3029 C CD1 . ILE B 1 61  ? -1.173  -3.332  70.751  1.00 21.05 ? 65  ILE B CD1 1 
ATOM   3030 N N   . ARG B 1 62  ? -6.649  -2.677  71.600  1.00 23.76 ? 66  ARG B N   1 
ATOM   3031 C CA  . ARG B 1 62  ? -8.014  -3.181  71.468  1.00 24.56 ? 66  ARG B CA  1 
ATOM   3032 C C   . ARG B 1 62  ? -8.994  -2.036  71.228  1.00 23.93 ? 66  ARG B C   1 
ATOM   3033 O O   . ARG B 1 62  ? -10.008 -2.207  70.551  1.00 24.34 ? 66  ARG B O   1 
ATOM   3034 C CB  . ARG B 1 62  ? -8.413  -3.977  72.717  1.00 24.60 ? 66  ARG B CB  1 
ATOM   3035 C CG  . ARG B 1 62  ? -7.718  -5.328  72.806  1.00 26.32 ? 66  ARG B CG  1 
ATOM   3036 C CD  . ARG B 1 62  ? -8.228  -6.192  73.953  1.00 27.99 ? 66  ARG B CD  1 
ATOM   3037 N NE  . ARG B 1 62  ? -7.859  -5.671  75.267  1.00 30.08 ? 66  ARG B NE  1 
ATOM   3038 C CZ  . ARG B 1 62  ? -8.682  -5.004  76.071  1.00 31.81 ? 66  ARG B CZ  1 
ATOM   3039 N NH1 . ARG B 1 62  ? -9.936  -4.772  75.702  1.00 32.32 ? 66  ARG B NH1 1 
ATOM   3040 N NH2 . ARG B 1 62  ? -8.249  -4.568  77.246  1.00 31.85 ? 66  ARG B NH2 1 
ATOM   3041 N N   . SER B 1 63  ? -8.679  -0.866  71.772  1.00 23.42 ? 67  SER B N   1 
ATOM   3042 C CA  . SER B 1 63  ? -9.525  0.308   71.604  1.00 24.28 ? 67  SER B CA  1 
ATOM   3043 C C   . SER B 1 63  ? -9.463  0.815   70.166  1.00 24.05 ? 67  SER B C   1 
ATOM   3044 O O   . SER B 1 63  ? -10.476 1.226   69.599  1.00 24.32 ? 67  SER B O   1 
ATOM   3045 C CB  . SER B 1 63  ? -9.083  1.420   72.561  1.00 25.43 ? 67  SER B CB  1 
ATOM   3046 O OG  . SER B 1 63  ? -9.765  2.635   72.290  1.00 23.46 ? 67  SER B OG  1 
ATOM   3047 N N   . LYS B 1 64  ? -8.270  0.775   69.581  1.00 23.60 ? 68  LYS B N   1 
ATOM   3048 C CA  . LYS B 1 64  ? -8.062  1.236   68.212  1.00 22.04 ? 68  LYS B CA  1 
ATOM   3049 C C   . LYS B 1 64  ? -8.623  0.277   67.174  1.00 21.79 ? 68  LYS B C   1 
ATOM   3050 O O   . LYS B 1 64  ? -8.860  0.659   66.030  1.00 22.18 ? 68  LYS B O   1 
ATOM   3051 C CB  . LYS B 1 64  ? -6.573  1.467   67.958  1.00 22.67 ? 68  LYS B CB  1 
ATOM   3052 C CG  . LYS B 1 64  ? -6.031  2.708   68.643  1.00 21.67 ? 68  LYS B CG  1 
ATOM   3053 C CD  . LYS B 1 64  ? -6.676  3.959   68.074  1.00 19.96 ? 68  LYS B CD  1 
ATOM   3054 C CE  . LYS B 1 64  ? -6.220  5.203   68.814  1.00 20.30 ? 68  LYS B CE  1 
ATOM   3055 N NZ  . LYS B 1 64  ? -6.860  6.432   68.269  1.00 16.57 ? 68  LYS B NZ  1 
ATOM   3056 N N   . ILE B 1 65  ? -8.814  -0.974  67.571  1.00 23.26 ? 69  ILE B N   1 
ATOM   3057 C CA  . ILE B 1 65  ? -9.384  -1.969  66.674  1.00 25.06 ? 69  ILE B CA  1 
ATOM   3058 C C   . ILE B 1 65  ? -10.896 -1.801  66.764  1.00 26.43 ? 69  ILE B C   1 
ATOM   3059 O O   . ILE B 1 65  ? -11.603 -1.838  65.755  1.00 26.10 ? 69  ILE B O   1 
ATOM   3060 C CB  . ILE B 1 65  ? -9.001  -3.400  67.106  1.00 24.71 ? 69  ILE B CB  1 
ATOM   3061 C CG1 . ILE B 1 65  ? -7.490  -3.596  66.951  1.00 23.27 ? 69  ILE B CG1 1 
ATOM   3062 C CG2 . ILE B 1 65  ? -9.766  -4.422  66.275  1.00 25.85 ? 69  ILE B CG2 1 
ATOM   3063 C CD1 . ILE B 1 65  ? -6.991  -4.942  67.432  1.00 25.02 ? 69  ILE B CD1 1 
ATOM   3064 N N   . ALA B 1 66  ? -11.373 -1.591  67.988  1.00 27.79 ? 70  ALA B N   1 
ATOM   3065 C CA  . ALA B 1 66  ? -12.796 -1.411  68.256  1.00 28.90 ? 70  ALA B CA  1 
ATOM   3066 C C   . ALA B 1 66  ? -13.399 -0.254  67.465  1.00 29.13 ? 70  ALA B C   1 
ATOM   3067 O O   . ALA B 1 66  ? -14.528 -0.356  66.982  1.00 30.09 ? 70  ALA B O   1 
ATOM   3068 C CB  . ALA B 1 66  ? -13.021 -1.195  69.749  1.00 29.49 ? 70  ALA B CB  1 
ATOM   3069 N N   . ASP B 1 67  ? -12.660 0.846   67.335  1.00 28.91 ? 71  ASP B N   1 
ATOM   3070 C CA  . ASP B 1 67  ? -13.172 1.987   66.583  1.00 28.38 ? 71  ASP B CA  1 
ATOM   3071 C C   . ASP B 1 67  ? -12.789 1.944   65.108  1.00 28.16 ? 71  ASP B C   1 
ATOM   3072 O O   . ASP B 1 67  ? -13.032 2.897   64.368  1.00 28.75 ? 71  ASP B O   1 
ATOM   3073 C CB  . ASP B 1 67  ? -12.717 3.317   67.202  0.80 27.40 ? 71  ASP B CB  1 
ATOM   3074 C CG  . ASP B 1 67  ? -11.211 3.448   67.292  0.80 27.90 ? 71  ASP B CG  1 
ATOM   3075 O OD1 . ASP B 1 67  ? -10.505 3.027   66.353  0.80 26.80 ? 71  ASP B OD1 1 
ATOM   3076 O OD2 . ASP B 1 67  ? -10.734 3.995   68.305  0.80 28.27 ? 71  ASP B OD2 1 
ATOM   3077 N N   . GLY B 1 68  ? -12.182 0.837   64.688  1.00 27.35 ? 72  GLY B N   1 
ATOM   3078 C CA  . GLY B 1 68  ? -11.807 0.678   63.293  1.00 26.42 ? 72  GLY B CA  1 
ATOM   3079 C C   . GLY B 1 68  ? -10.545 1.363   62.800  1.00 26.04 ? 72  GLY B C   1 
ATOM   3080 O O   . GLY B 1 68  ? -10.324 1.445   61.592  1.00 25.16 ? 72  GLY B O   1 
ATOM   3081 N N   . THR B 1 69  ? -9.711  1.856   63.708  1.00 25.26 ? 73  THR B N   1 
ATOM   3082 C CA  . THR B 1 69  ? -8.478  2.510   63.283  1.00 24.32 ? 73  THR B CA  1 
ATOM   3083 C C   . THR B 1 69  ? -7.536  1.492   62.646  1.00 22.48 ? 73  THR B C   1 
ATOM   3084 O O   . THR B 1 69  ? -6.933  1.760   61.608  1.00 20.86 ? 73  THR B O   1 
ATOM   3085 C CB  . THR B 1 69  ? -7.761  3.184   64.464  1.00 24.15 ? 73  THR B CB  1 
ATOM   3086 O OG1 . THR B 1 69  ? -8.619  4.179   65.034  1.00 24.87 ? 73  THR B OG1 1 
ATOM   3087 C CG2 . THR B 1 69  ? -6.475  3.855   63.992  1.00 24.93 ? 73  THR B CG2 1 
ATOM   3088 N N   . VAL B 1 70  ? -7.427  0.322   63.269  1.00 22.01 ? 74  VAL B N   1 
ATOM   3089 C CA  . VAL B 1 70  ? -6.561  -0.744  62.774  1.00 21.43 ? 74  VAL B CA  1 
ATOM   3090 C C   . VAL B 1 70  ? -7.165  -2.109  63.078  1.00 21.32 ? 74  VAL B C   1 
ATOM   3091 O O   . VAL B 1 70  ? -8.110  -2.220  63.858  1.00 22.45 ? 74  VAL B O   1 
ATOM   3092 C CB  . VAL B 1 70  ? -5.169  -0.696  63.442  1.00 21.51 ? 74  VAL B CB  1 
ATOM   3093 C CG1 . VAL B 1 70  ? -4.457  0.597   63.085  1.00 22.65 ? 74  VAL B CG1 1 
ATOM   3094 C CG2 . VAL B 1 70  ? -5.321  -0.821  64.950  1.00 20.12 ? 74  VAL B CG2 1 
ATOM   3095 N N   . ARG B 1 71  ? -6.607  -3.145  62.464  1.00 21.26 ? 75  ARG B N   1 
ATOM   3096 C CA  . ARG B 1 71  ? -7.069  -4.510  62.684  1.00 21.41 ? 75  ARG B CA  1 
ATOM   3097 C C   . ARG B 1 71  ? -5.962  -5.262  63.415  1.00 20.82 ? 75  ARG B C   1 
ATOM   3098 O O   . ARG B 1 71  ? -4.792  -4.901  63.310  1.00 22.25 ? 75  ARG B O   1 
ATOM   3099 C CB  . ARG B 1 71  ? -7.360  -5.196  61.349  0.75 21.45 ? 75  ARG B CB  1 
ATOM   3100 C CG  . ARG B 1 71  ? -8.432  -4.515  60.515  0.75 22.71 ? 75  ARG B CG  1 
ATOM   3101 C CD  . ARG B 1 71  ? -8.562  -5.182  59.157  0.75 24.70 ? 75  ARG B CD  1 
ATOM   3102 N NE  . ARG B 1 71  ? -7.294  -5.166  58.435  0.75 25.54 ? 75  ARG B NE  1 
ATOM   3103 C CZ  . ARG B 1 71  ? -7.096  -5.737  57.251  0.75 27.96 ? 75  ARG B CZ  1 
ATOM   3104 N NH1 . ARG B 1 71  ? -8.089  -6.377  56.647  0.75 28.63 ? 75  ARG B NH1 1 
ATOM   3105 N NH2 . ARG B 1 71  ? -5.904  -5.673  56.673  0.75 27.27 ? 75  ARG B NH2 1 
ATOM   3106 N N   . ARG B 1 72  ? -6.324  -6.303  64.158  1.00 20.70 ? 76  ARG B N   1 
ATOM   3107 C CA  . ARG B 1 72  ? -5.322  -7.079  64.880  1.00 20.05 ? 76  ARG B CA  1 
ATOM   3108 C C   . ARG B 1 72  ? -4.225  -7.587  63.943  1.00 19.46 ? 76  ARG B C   1 
ATOM   3109 O O   . ARG B 1 72  ? -3.046  -7.582  64.300  1.00 19.24 ? 76  ARG B O   1 
ATOM   3110 C CB  . ARG B 1 72  ? -5.967  -8.278  65.582  1.00 19.82 ? 76  ARG B CB  1 
ATOM   3111 C CG  . ARG B 1 72  ? -4.958  -9.177  66.294  1.00 19.87 ? 76  ARG B CG  1 
ATOM   3112 C CD  . ARG B 1 72  ? -4.357  -8.493  67.523  1.00 19.95 ? 76  ARG B CD  1 
ATOM   3113 N NE  . ARG B 1 72  ? -3.258  -9.264  68.104  1.00 19.17 ? 76  ARG B NE  1 
ATOM   3114 C CZ  . ARG B 1 72  ? -2.008  -9.247  67.650  1.00 18.87 ? 76  ARG B CZ  1 
ATOM   3115 N NH1 . ARG B 1 72  ? -1.686  -8.492  66.608  1.00 18.45 ? 76  ARG B NH1 1 
ATOM   3116 N NH2 . ARG B 1 72  ? -1.077  -9.988  68.237  1.00 17.81 ? 76  ARG B NH2 1 
ATOM   3117 N N   . GLU B 1 73  ? -4.618  -8.015  62.742  1.00 17.92 ? 77  GLU B N   1 
ATOM   3118 C CA  . GLU B 1 73  ? -3.673  -8.555  61.766  1.00 18.80 ? 77  GLU B CA  1 
ATOM   3119 C C   . GLU B 1 73  ? -2.677  -7.513  61.259  1.00 19.27 ? 77  GLU B C   1 
ATOM   3120 O O   . GLU B 1 73  ? -1.632  -7.860  60.704  1.00 18.65 ? 77  GLU B O   1 
ATOM   3121 C CB  . GLU B 1 73  ? -4.431  -9.156  60.573  1.00 19.00 ? 77  GLU B CB  1 
ATOM   3122 C CG  . GLU B 1 73  ? -4.989  -8.121  59.610  1.00 18.19 ? 77  GLU B CG  1 
ATOM   3123 C CD  . GLU B 1 73  ? -5.703  -8.742  58.426  0.50 18.36 ? 77  GLU B CD  1 
ATOM   3124 O OE1 . GLU B 1 73  ? -6.862  -9.178  58.587  0.50 17.48 ? 77  GLU B OE1 1 
ATOM   3125 O OE2 . GLU B 1 73  ? -5.098  -8.802  57.337  0.50 17.28 ? 77  GLU B OE2 1 
ATOM   3126 N N   . ASP B 1 74  ? -3.011  -6.240  61.444  1.00 19.27 ? 78  ASP B N   1 
ATOM   3127 C CA  . ASP B 1 74  ? -2.155  -5.143  61.002  1.00 19.32 ? 78  ASP B CA  1 
ATOM   3128 C C   . ASP B 1 74  ? -1.164  -4.752  62.093  1.00 19.08 ? 78  ASP B C   1 
ATOM   3129 O O   . ASP B 1 74  ? -0.212  -4.011  61.848  1.00 18.39 ? 78  ASP B O   1 
ATOM   3130 C CB  . ASP B 1 74  ? -3.013  -3.929  60.638  1.00 22.35 ? 78  ASP B CB  1 
ATOM   3131 C CG  . ASP B 1 74  ? -3.864  -4.160  59.401  1.00 23.31 ? 78  ASP B CG  1 
ATOM   3132 O OD1 . ASP B 1 74  ? -4.892  -3.467  59.250  1.00 26.38 ? 78  ASP B OD1 1 
ATOM   3133 O OD2 . ASP B 1 74  ? -3.497  -5.020  58.575  1.00 24.86 ? 78  ASP B OD2 1 
ATOM   3134 N N   . ILE B 1 75  ? -1.398  -5.250  63.298  1.00 18.77 ? 79  ILE B N   1 
ATOM   3135 C CA  . ILE B 1 75  ? -0.532  -4.947  64.429  1.00 18.38 ? 79  ILE B CA  1 
ATOM   3136 C C   . ILE B 1 75  ? 0.473   -6.060  64.696  1.00 17.66 ? 79  ILE B C   1 
ATOM   3137 O O   . ILE B 1 75  ? 0.129   -7.239  64.663  1.00 16.86 ? 79  ILE B O   1 
ATOM   3138 C CB  . ILE B 1 75  ? -1.364  -4.720  65.711  1.00 19.21 ? 79  ILE B CB  1 
ATOM   3139 C CG1 . ILE B 1 75  ? -2.167  -3.420  65.591  1.00 19.95 ? 79  ILE B CG1 1 
ATOM   3140 C CG2 . ILE B 1 75  ? -0.452  -4.699  66.934  1.00 18.77 ? 79  ILE B CG2 1 
ATOM   3141 C CD1 . ILE B 1 75  ? -1.313  -2.159  65.534  1.00 20.18 ? 79  ILE B CD1 1 
ATOM   3142 N N   . PHE B 1 76  ? 1.719   -5.673  64.948  1.00 14.90 ? 80  PHE B N   1 
ATOM   3143 C CA  . PHE B 1 76  ? 2.769   -6.632  65.263  1.00 13.46 ? 80  PHE B CA  1 
ATOM   3144 C C   . PHE B 1 76  ? 3.122   -6.342  66.718  1.00 13.24 ? 80  PHE B C   1 
ATOM   3145 O O   . PHE B 1 76  ? 3.686   -5.292  67.031  1.00 11.34 ? 80  PHE B O   1 
ATOM   3146 C CB  . PHE B 1 76  ? 3.990   -6.433  64.350  1.00 13.40 ? 80  PHE B CB  1 
ATOM   3147 C CG  . PHE B 1 76  ? 5.033   -7.521  64.477  1.00 10.56 ? 80  PHE B CG  1 
ATOM   3148 C CD1 . PHE B 1 76  ? 5.872   -7.578  65.583  1.00 13.39 ? 80  PHE B CD1 1 
ATOM   3149 C CD2 . PHE B 1 76  ? 5.161   -8.500  63.491  1.00 12.83 ? 80  PHE B CD2 1 
ATOM   3150 C CE1 . PHE B 1 76  ? 6.825   -8.592  65.713  1.00 12.93 ? 80  PHE B CE1 1 
ATOM   3151 C CE2 . PHE B 1 76  ? 6.108   -9.517  63.608  1.00 9.59  ? 80  PHE B CE2 1 
ATOM   3152 C CZ  . PHE B 1 76  ? 6.941   -9.566  64.721  1.00 13.06 ? 80  PHE B CZ  1 
ATOM   3153 N N   . TYR B 1 77  ? 2.747   -7.261  67.604  1.00 11.84 ? 81  TYR B N   1 
ATOM   3154 C CA  . TYR B 1 77  ? 2.993   -7.110  69.036  1.00 13.75 ? 81  TYR B CA  1 
ATOM   3155 C C   . TYR B 1 77  ? 4.015   -8.115  69.547  1.00 13.92 ? 81  TYR B C   1 
ATOM   3156 O O   . TYR B 1 77  ? 3.900   -9.318  69.301  1.00 15.17 ? 81  TYR B O   1 
ATOM   3157 C CB  . TYR B 1 77  ? 1.686   -7.280  69.815  1.00 13.57 ? 81  TYR B CB  1 
ATOM   3158 C CG  . TYR B 1 77  ? 1.853   -7.179  71.314  1.00 14.89 ? 81  TYR B CG  1 
ATOM   3159 C CD1 . TYR B 1 77  ? 1.768   -5.949  71.964  1.00 15.51 ? 81  TYR B CD1 1 
ATOM   3160 C CD2 . TYR B 1 77  ? 2.126   -8.313  72.082  1.00 13.44 ? 81  TYR B CD2 1 
ATOM   3161 C CE1 . TYR B 1 77  ? 1.950   -5.851  73.348  1.00 15.80 ? 81  TYR B CE1 1 
ATOM   3162 C CE2 . TYR B 1 77  ? 2.313   -8.222  73.460  1.00 15.28 ? 81  TYR B CE2 1 
ATOM   3163 C CZ  . TYR B 1 77  ? 2.223   -6.992  74.085  1.00 15.54 ? 81  TYR B CZ  1 
ATOM   3164 O OH  . TYR B 1 77  ? 2.405   -6.903  75.447  1.00 17.48 ? 81  TYR B OH  1 
ATOM   3165 N N   . THR B 1 78  ? 4.999   -7.614  70.285  1.00 14.20 ? 82  THR B N   1 
ATOM   3166 C CA  . THR B 1 78  ? 6.057   -8.450  70.835  1.00 13.07 ? 82  THR B CA  1 
ATOM   3167 C C   . THR B 1 78  ? 6.037   -8.476  72.358  1.00 14.57 ? 82  THR B C   1 
ATOM   3168 O O   . THR B 1 78  ? 5.842   -7.449  73.004  1.00 14.68 ? 82  THR B O   1 
ATOM   3169 C CB  . THR B 1 78  ? 7.451   -7.936  70.394  1.00 13.20 ? 82  THR B CB  1 
ATOM   3170 O OG1 . THR B 1 78  ? 7.538   -7.952  68.965  1.00 13.19 ? 82  THR B OG1 1 
ATOM   3171 C CG2 . THR B 1 78  ? 8.556   -8.802  70.986  1.00 13.82 ? 82  THR B CG2 1 
ATOM   3172 N N   . SER B 1 79  ? 6.233   -9.661  72.924  1.00 14.73 ? 83  SER B N   1 
ATOM   3173 C CA  . SER B 1 79  ? 6.298   -9.812  74.369  1.00 14.80 ? 83  SER B CA  1 
ATOM   3174 C C   . SER B 1 79  ? 7.569   -10.607 74.650  1.00 14.02 ? 83  SER B C   1 
ATOM   3175 O O   . SER B 1 79  ? 8.201   -11.109 73.717  1.00 12.65 ? 83  SER B O   1 
ATOM   3176 C CB  . SER B 1 79  ? 5.078   -10.558 74.899  1.00 15.93 ? 83  SER B CB  1 
ATOM   3177 O OG  . SER B 1 79  ? 5.082   -10.549 76.316  1.00 18.46 ? 83  SER B OG  1 
ATOM   3178 N N   . LYS B 1 80  ? 7.954   -10.712 75.919  1.00 12.79 ? 84  LYS B N   1 
ATOM   3179 C CA  . LYS B 1 80  ? 9.162   -11.443 76.284  1.00 13.32 ? 84  LYS B CA  1 
ATOM   3180 C C   . LYS B 1 80  ? 8.979   -12.162 77.620  1.00 13.82 ? 84  LYS B C   1 
ATOM   3181 O O   . LYS B 1 80  ? 8.388   -11.612 78.546  1.00 14.22 ? 84  LYS B O   1 
ATOM   3182 C CB  . LYS B 1 80  ? 10.356  -10.480 76.397  1.00 13.36 ? 84  LYS B CB  1 
ATOM   3183 C CG  . LYS B 1 80  ? 10.453  -9.425  75.296  1.00 12.98 ? 84  LYS B CG  1 
ATOM   3184 C CD  . LYS B 1 80  ? 11.747  -8.615  75.432  1.00 14.27 ? 84  LYS B CD  1 
ATOM   3185 C CE  . LYS B 1 80  ? 11.780  -7.418  74.485  1.00 13.24 ? 84  LYS B CE  1 
ATOM   3186 N NZ  . LYS B 1 80  ? 10.855  -6.315  74.891  1.00 12.85 ? 84  LYS B NZ  1 
ATOM   3187 N N   . VAL B 1 81  ? 9.487   -13.386 77.719  1.00 14.40 ? 85  VAL B N   1 
ATOM   3188 C CA  . VAL B 1 81  ? 9.381   -14.147 78.962  1.00 14.30 ? 85  VAL B CA  1 
ATOM   3189 C C   . VAL B 1 81  ? 10.566  -13.755 79.841  1.00 16.58 ? 85  VAL B C   1 
ATOM   3190 O O   . VAL B 1 81  ? 11.719  -13.779 79.394  1.00 15.72 ? 85  VAL B O   1 
ATOM   3191 C CB  . VAL B 1 81  ? 9.382   -15.680 78.693  1.00 15.74 ? 85  VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 81  ? 10.630  -16.089 77.924  1.00 14.25 ? 85  VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 81  ? 9.289   -16.444 80.011  1.00 13.29 ? 85  VAL B CG2 1 
ATOM   3194 N N   . TRP B 1 82  ? 10.273  -13.379 81.085  1.00 16.61 ? 86  TRP B N   1 
ATOM   3195 C CA  . TRP B 1 82  ? 11.301  -12.946 82.029  1.00 17.64 ? 86  TRP B CA  1 
ATOM   3196 C C   . TRP B 1 82  ? 12.130  -14.085 82.629  1.00 17.71 ? 86  TRP B C   1 
ATOM   3197 O O   . TRP B 1 82  ? 11.712  -15.245 82.647  1.00 18.31 ? 86  TRP B O   1 
ATOM   3198 C CB  . TRP B 1 82  ? 10.658  -12.113 83.148  1.00 17.89 ? 86  TRP B CB  1 
ATOM   3199 C CG  . TRP B 1 82  ? 11.647  -11.470 84.087  1.00 16.56 ? 86  TRP B CG  1 
ATOM   3200 C CD1 . TRP B 1 82  ? 11.728  -11.651 85.437  1.00 17.67 ? 86  TRP B CD1 1 
ATOM   3201 C CD2 . TRP B 1 82  ? 12.706  -10.567 83.739  1.00 16.21 ? 86  TRP B CD2 1 
ATOM   3202 N NE1 . TRP B 1 82  ? 12.774  -10.921 85.953  1.00 16.23 ? 86  TRP B NE1 1 
ATOM   3203 C CE2 . TRP B 1 82  ? 13.391  -10.247 84.933  1.00 16.30 ? 86  TRP B CE2 1 
ATOM   3204 C CE3 . TRP B 1 82  ? 13.145  -9.999  82.534  1.00 15.99 ? 86  TRP B CE3 1 
ATOM   3205 C CZ2 . TRP B 1 82  ? 14.493  -9.382  84.959  1.00 15.52 ? 86  TRP B CZ2 1 
ATOM   3206 C CZ3 . TRP B 1 82  ? 14.241  -9.140  82.560  1.00 16.76 ? 86  TRP B CZ3 1 
ATOM   3207 C CH2 . TRP B 1 82  ? 14.902  -8.841  83.768  1.00 17.11 ? 86  TRP B CH2 1 
ATOM   3208 N N   . CYS B 1 83  ? 13.308  -13.722 83.125  1.00 16.54 ? 87  CYS B N   1 
ATOM   3209 C CA  . CYS B 1 83  ? 14.262  -14.653 83.720  1.00 17.16 ? 87  CYS B CA  1 
ATOM   3210 C C   . CYS B 1 83  ? 13.679  -15.647 84.720  1.00 17.44 ? 87  CYS B C   1 
ATOM   3211 O O   . CYS B 1 83  ? 14.163  -16.772 84.829  1.00 19.32 ? 87  CYS B O   1 
ATOM   3212 C CB  . CYS B 1 83  ? 15.382  -13.867 84.406  1.00 17.49 ? 87  CYS B CB  1 
ATOM   3213 S SG  . CYS B 1 83  ? 16.121  -12.571 83.382  1.00 16.98 ? 87  CYS B SG  1 
ATOM   3214 N N   . THR B 1 84  ? 12.647  -15.234 85.447  1.00 17.13 ? 88  THR B N   1 
ATOM   3215 C CA  . THR B 1 84  ? 12.037  -16.096 86.452  1.00 17.82 ? 88  THR B CA  1 
ATOM   3216 C C   . THR B 1 84  ? 11.144  -17.201 85.898  1.00 18.45 ? 88  THR B C   1 
ATOM   3217 O O   . THR B 1 84  ? 10.741  -18.098 86.636  1.00 18.84 ? 88  THR B O   1 
ATOM   3218 C CB  . THR B 1 84  ? 11.224  -15.267 87.466  1.00 17.65 ? 88  THR B CB  1 
ATOM   3219 O OG1 . THR B 1 84  ? 10.224  -14.509 86.778  1.00 17.79 ? 88  THR B OG1 1 
ATOM   3220 C CG2 . THR B 1 84  ? 12.141  -14.318 88.222  1.00 17.53 ? 88  THR B CG2 1 
ATOM   3221 N N   . SER B 1 85  ? 10.840  -17.140 84.605  1.00 18.16 ? 89  SER B N   1 
ATOM   3222 C CA  . SER B 1 85  ? 9.995   -18.147 83.974  1.00 18.35 ? 89  SER B CA  1 
ATOM   3223 C C   . SER B 1 85  ? 10.691  -18.854 82.822  1.00 18.66 ? 89  SER B C   1 
ATOM   3224 O O   . SER B 1 85  ? 10.036  -19.333 81.898  1.00 19.51 ? 89  SER B O   1 
ATOM   3225 C CB  . SER B 1 85  ? 8.698   -17.511 83.465  1.00 17.63 ? 89  SER B CB  1 
ATOM   3226 O OG  . SER B 1 85  ? 7.902   -17.046 84.539  1.00 17.66 ? 89  SER B OG  1 
ATOM   3227 N N   . LEU B 1 86  ? 12.017  -18.927 82.874  1.00 18.66 ? 90  LEU B N   1 
ATOM   3228 C CA  . LEU B 1 86  ? 12.760  -19.588 81.813  1.00 20.48 ? 90  LEU B CA  1 
ATOM   3229 C C   . LEU B 1 86  ? 12.678  -21.106 81.922  1.00 22.31 ? 90  LEU B C   1 
ATOM   3230 O O   . LEU B 1 86  ? 12.882  -21.810 80.932  1.00 22.43 ? 90  LEU B O   1 
ATOM   3231 C CB  . LEU B 1 86  ? 14.218  -19.126 81.808  1.00 19.62 ? 90  LEU B CB  1 
ATOM   3232 C CG  . LEU B 1 86  ? 14.427  -17.632 81.523  1.00 19.63 ? 90  LEU B CG  1 
ATOM   3233 C CD1 . LEU B 1 86  ? 15.907  -17.360 81.304  1.00 20.13 ? 90  LEU B CD1 1 
ATOM   3234 C CD2 . LEU B 1 86  ? 13.636  -17.214 80.293  1.00 17.84 ? 90  LEU B CD2 1 
ATOM   3235 N N   . HIS B 1 87  ? 12.380  -21.616 83.117  1.00 23.24 ? 91  HIS B N   1 
ATOM   3236 C CA  . HIS B 1 87  ? 12.240  -23.061 83.288  1.00 26.02 ? 91  HIS B CA  1 
ATOM   3237 C C   . HIS B 1 87  ? 11.253  -23.524 82.219  1.00 24.28 ? 91  HIS B C   1 
ATOM   3238 O O   . HIS B 1 87  ? 10.180  -22.953 82.075  1.00 24.14 ? 91  HIS B O   1 
ATOM   3239 C CB  . HIS B 1 87  ? 11.689  -23.406 84.677  1.00 28.38 ? 91  HIS B CB  1 
ATOM   3240 C CG  . HIS B 1 87  ? 12.748  -23.639 85.710  1.00 33.73 ? 91  HIS B CG  1 
ATOM   3241 N ND1 . HIS B 1 87  ? 13.770  -24.547 85.535  1.00 35.92 ? 91  HIS B ND1 1 
ATOM   3242 C CD2 . HIS B 1 87  ? 12.927  -23.104 86.941  1.00 35.42 ? 91  HIS B CD2 1 
ATOM   3243 C CE1 . HIS B 1 87  ? 14.534  -24.560 86.614  1.00 37.00 ? 91  HIS B CE1 1 
ATOM   3244 N NE2 . HIS B 1 87  ? 14.044  -23.694 87.482  1.00 36.03 ? 91  HIS B NE2 1 
ATOM   3245 N N   . PRO B 1 88  ? 11.614  -24.565 81.455  1.00 25.15 ? 92  PRO B N   1 
ATOM   3246 C CA  . PRO B 1 88  ? 10.770  -25.109 80.387  1.00 25.29 ? 92  PRO B CA  1 
ATOM   3247 C C   . PRO B 1 88  ? 9.292   -25.213 80.741  1.00 25.98 ? 92  PRO B C   1 
ATOM   3248 O O   . PRO B 1 88  ? 8.427   -24.815 79.957  1.00 24.93 ? 92  PRO B O   1 
ATOM   3249 C CB  . PRO B 1 88  ? 11.398  -26.473 80.122  1.00 25.81 ? 92  PRO B CB  1 
ATOM   3250 C CG  . PRO B 1 88  ? 12.841  -26.213 80.367  1.00 27.73 ? 92  PRO B CG  1 
ATOM   3251 C CD  . PRO B 1 88  ? 12.818  -25.393 81.639  1.00 25.20 ? 92  PRO B CD  1 
ATOM   3252 N N   . GLU B 1 89  ? 9.007   -25.740 81.927  1.00 25.74 ? 93  GLU B N   1 
ATOM   3253 C CA  . GLU B 1 89  ? 7.629   -25.912 82.370  1.00 25.33 ? 93  GLU B CA  1 
ATOM   3254 C C   . GLU B 1 89  ? 6.922   -24.622 82.790  1.00 24.01 ? 93  GLU B C   1 
ATOM   3255 O O   . GLU B 1 89  ? 5.740   -24.650 83.125  1.00 23.31 ? 93  GLU B O   1 
ATOM   3256 C CB  . GLU B 1 89  ? 7.567   -26.927 83.524  1.00 25.93 ? 93  GLU B CB  1 
ATOM   3257 C CG  . GLU B 1 89  ? 8.271   -26.497 84.804  0.50 25.40 ? 93  GLU B CG  1 
ATOM   3258 C CD  . GLU B 1 89  ? 9.786   -26.590 84.720  0.50 25.78 ? 93  GLU B CD  1 
ATOM   3259 O OE1 . GLU B 1 89  ? 10.453  -26.269 85.725  0.50 25.60 ? 93  GLU B OE1 1 
ATOM   3260 O OE2 . GLU B 1 89  ? 10.311  -26.986 83.658  0.50 26.20 ? 93  GLU B OE2 1 
ATOM   3261 N N   . LEU B 1 90  ? 7.629   -23.495 82.763  1.00 22.54 ? 94  LEU B N   1 
ATOM   3262 C CA  . LEU B 1 90  ? 7.028   -22.223 83.166  1.00 22.40 ? 94  LEU B CA  1 
ATOM   3263 C C   . LEU B 1 90  ? 6.879   -21.214 82.033  1.00 22.05 ? 94  LEU B C   1 
ATOM   3264 O O   . LEU B 1 90  ? 6.239   -20.174 82.203  1.00 21.28 ? 94  LEU B O   1 
ATOM   3265 C CB  . LEU B 1 90  ? 7.851   -21.582 84.290  1.00 22.14 ? 94  LEU B CB  1 
ATOM   3266 C CG  . LEU B 1 90  ? 7.993   -22.361 85.600  1.00 22.53 ? 94  LEU B CG  1 
ATOM   3267 C CD1 . LEU B 1 90  ? 8.889   -21.584 86.562  1.00 21.69 ? 94  LEU B CD1 1 
ATOM   3268 C CD2 . LEU B 1 90  ? 6.621   -22.588 86.218  1.00 22.07 ? 94  LEU B CD2 1 
ATOM   3269 N N   . VAL B 1 91  ? 7.465   -21.520 80.880  1.00 22.08 ? 95  VAL B N   1 
ATOM   3270 C CA  . VAL B 1 91  ? 7.405   -20.618 79.733  1.00 21.70 ? 95  VAL B CA  1 
ATOM   3271 C C   . VAL B 1 91  ? 5.996   -20.350 79.199  1.00 21.95 ? 95  VAL B C   1 
ATOM   3272 O O   . VAL B 1 91  ? 5.579   -19.197 79.107  1.00 20.74 ? 95  VAL B O   1 
ATOM   3273 C CB  . VAL B 1 91  ? 8.278   -21.140 78.569  1.00 21.60 ? 95  VAL B CB  1 
ATOM   3274 C CG1 . VAL B 1 91  ? 8.147   -20.218 77.368  1.00 22.24 ? 95  VAL B CG1 1 
ATOM   3275 C CG2 . VAL B 1 91  ? 9.739   -21.232 79.011  1.00 19.44 ? 95  VAL B CG2 1 
ATOM   3276 N N   . ARG B 1 92  ? 5.265   -21.402 78.836  1.00 22.44 ? 96  ARG B N   1 
ATOM   3277 C CA  . ARG B 1 92  ? 3.920   -21.208 78.303  1.00 22.91 ? 96  ARG B CA  1 
ATOM   3278 C C   . ARG B 1 92  ? 2.993   -20.528 79.300  1.00 22.83 ? 96  ARG B C   1 
ATOM   3279 O O   . ARG B 1 92  ? 2.183   -19.679 78.923  1.00 24.34 ? 96  ARG B O   1 
ATOM   3280 C CB  . ARG B 1 92  ? 3.305   -22.540 77.857  1.00 24.19 ? 96  ARG B CB  1 
ATOM   3281 C CG  . ARG B 1 92  ? 1.891   -22.385 77.297  1.00 24.78 ? 96  ARG B CG  1 
ATOM   3282 C CD  . ARG B 1 92  ? 1.388   -23.662 76.640  1.00 27.64 ? 96  ARG B CD  1 
ATOM   3283 N NE  . ARG B 1 92  ? 0.043   -23.493 76.093  1.00 28.66 ? 96  ARG B NE  1 
ATOM   3284 C CZ  . ARG B 1 92  ? -0.538  -24.351 75.262  1.00 28.66 ? 96  ARG B CZ  1 
ATOM   3285 N NH1 . ARG B 1 92  ? 0.108   -25.442 74.878  1.00 29.23 ? 96  ARG B NH1 1 
ATOM   3286 N NH2 . ARG B 1 92  ? -1.766  -24.119 74.815  1.00 29.82 ? 96  ARG B NH2 1 
ATOM   3287 N N   . ALA B 1 93  ? 3.109   -20.895 80.572  1.00 22.97 ? 97  ALA B N   1 
ATOM   3288 C CA  . ALA B 1 93  ? 2.265   -20.300 81.601  1.00 22.54 ? 97  ALA B CA  1 
ATOM   3289 C C   . ALA B 1 93  ? 2.447   -18.787 81.619  1.00 22.27 ? 97  ALA B C   1 
ATOM   3290 O O   . ALA B 1 93  ? 1.496   -18.039 81.841  1.00 21.65 ? 97  ALA B O   1 
ATOM   3291 C CB  . ALA B 1 93  ? 2.608   -20.887 82.966  1.00 24.01 ? 97  ALA B CB  1 
ATOM   3292 N N   . SER B 1 94  ? 3.674   -18.338 81.379  1.00 22.16 ? 98  SER B N   1 
ATOM   3293 C CA  . SER B 1 94  ? 3.968   -16.911 81.377  1.00 19.74 ? 98  SER B CA  1 
ATOM   3294 C C   . SER B 1 94  ? 3.336   -16.214 80.177  1.00 18.93 ? 98  SER B C   1 
ATOM   3295 O O   . SER B 1 94  ? 2.816   -15.107 80.299  1.00 17.34 ? 98  SER B O   1 
ATOM   3296 C CB  . SER B 1 94  ? 5.477   -16.679 81.363  1.00 20.10 ? 98  SER B CB  1 
ATOM   3297 O OG  . SER B 1 94  ? 5.763   -15.291 81.433  1.00 21.00 ? 98  SER B OG  1 
ATOM   3298 N N   . LEU B 1 95  ? 3.391   -16.863 79.019  1.00 18.38 ? 99  LEU B N   1 
ATOM   3299 C CA  . LEU B 1 95  ? 2.816   -16.297 77.806  1.00 18.77 ? 99  LEU B CA  1 
ATOM   3300 C C   . LEU B 1 95  ? 1.299   -16.212 77.919  1.00 19.17 ? 99  LEU B C   1 
ATOM   3301 O O   . LEU B 1 95  ? 0.687   -15.231 77.493  1.00 16.00 ? 99  LEU B O   1 
ATOM   3302 C CB  . LEU B 1 95  ? 3.199   -17.148 76.593  1.00 18.99 ? 99  LEU B CB  1 
ATOM   3303 C CG  . LEU B 1 95  ? 2.571   -16.788 75.245  1.00 17.67 ? 99  LEU B CG  1 
ATOM   3304 C CD1 . LEU B 1 95  ? 2.784   -15.316 74.925  1.00 15.45 ? 99  LEU B CD1 1 
ATOM   3305 C CD2 . LEU B 1 95  ? 3.196   -17.670 74.169  1.00 18.87 ? 99  LEU B CD2 1 
ATOM   3306 N N   . GLU B 1 96  ? 0.694   -17.245 78.495  1.00 20.54 ? 100 GLU B N   1 
ATOM   3307 C CA  . GLU B 1 96  ? -0.754  -17.269 78.655  1.00 22.59 ? 100 GLU B CA  1 
ATOM   3308 C C   . GLU B 1 96  ? -1.195  -16.154 79.599  1.00 22.82 ? 100 GLU B C   1 
ATOM   3309 O O   . GLU B 1 96  ? -2.245  -15.545 79.406  1.00 22.61 ? 100 GLU B O   1 
ATOM   3310 C CB  . GLU B 1 96  ? -1.200  -18.644 79.168  1.00 24.66 ? 100 GLU B CB  1 
ATOM   3311 C CG  . GLU B 1 96  ? -0.754  -19.788 78.251  1.00 27.62 ? 100 GLU B CG  1 
ATOM   3312 C CD  . GLU B 1 96  ? -1.175  -21.166 78.738  1.00 30.06 ? 100 GLU B CD  1 
ATOM   3313 O OE1 . GLU B 1 96  ? -0.950  -21.479 79.927  1.00 31.79 ? 100 GLU B OE1 1 
ATOM   3314 O OE2 . GLU B 1 96  ? -1.717  -21.943 77.924  1.00 31.06 ? 100 GLU B OE2 1 
ATOM   3315 N N   . ARG B 1 97  ? -0.381  -15.870 80.611  1.00 23.43 ? 101 ARG B N   1 
ATOM   3316 C CA  . ARG B 1 97  ? -0.717  -14.811 81.553  1.00 23.97 ? 101 ARG B CA  1 
ATOM   3317 C C   . ARG B 1 97  ? -0.685  -13.461 80.838  1.00 23.62 ? 101 ARG B C   1 
ATOM   3318 O O   . ARG B 1 97  ? -1.543  -12.608 81.068  1.00 23.47 ? 101 ARG B O   1 
ATOM   3319 C CB  . ARG B 1 97  ? 0.261   -14.811 82.732  1.00 25.10 ? 101 ARG B CB  1 
ATOM   3320 C CG  . ARG B 1 97  ? -0.052  -13.760 83.783  1.00 27.83 ? 101 ARG B CG  1 
ATOM   3321 C CD  . ARG B 1 97  ? 0.801   -13.939 85.030  1.00 30.21 ? 101 ARG B CD  1 
ATOM   3322 N NE  . ARG B 1 97  ? 0.553   -12.883 86.010  0.75 32.40 ? 101 ARG B NE  1 
ATOM   3323 C CZ  . ARG B 1 97  ? 1.108   -12.835 87.218  0.75 32.48 ? 101 ARG B CZ  1 
ATOM   3324 N NH1 . ARG B 1 97  ? 1.948   -13.785 87.606  0.75 33.24 ? 101 ARG B NH1 1 
ATOM   3325 N NH2 . ARG B 1 97  ? 0.824   -11.833 88.039  0.75 33.96 ? 101 ARG B NH2 1 
ATOM   3326 N N   . SER B 1 98  ? 0.305   -13.264 79.971  1.00 22.56 ? 102 SER B N   1 
ATOM   3327 C CA  . SER B 1 98  ? 0.405   -12.010 79.227  1.00 22.64 ? 102 SER B CA  1 
ATOM   3328 C C   . SER B 1 98  ? -0.799  -11.867 78.302  1.00 22.17 ? 102 SER B C   1 
ATOM   3329 O O   . SER B 1 98  ? -1.396  -10.797 78.208  1.00 21.89 ? 102 SER B O   1 
ATOM   3330 C CB  . SER B 1 98  ? 1.696   -11.967 78.399  1.00 22.36 ? 102 SER B CB  1 
ATOM   3331 O OG  . SER B 1 98  ? 2.836   -11.793 79.223  1.00 24.04 ? 102 SER B OG  1 
ATOM   3332 N N   . LEU B 1 99  ? -1.149  -12.952 77.616  1.00 23.75 ? 103 LEU B N   1 
ATOM   3333 C CA  . LEU B 1 99  ? -2.285  -12.937 76.701  1.00 23.68 ? 103 LEU B CA  1 
ATOM   3334 C C   . LEU B 1 99  ? -3.550  -12.554 77.460  1.00 24.72 ? 103 LEU B C   1 
ATOM   3335 O O   . LEU B 1 99  ? -4.406  -11.841 76.939  1.00 24.78 ? 103 LEU B O   1 
ATOM   3336 C CB  . LEU B 1 99  ? -2.463  -14.311 76.047  1.00 23.29 ? 103 LEU B CB  1 
ATOM   3337 C CG  . LEU B 1 99  ? -1.329  -14.771 75.126  1.00 23.65 ? 103 LEU B CG  1 
ATOM   3338 C CD1 . LEU B 1 99  ? -1.525  -16.230 74.757  1.00 24.98 ? 103 LEU B CD1 1 
ATOM   3339 C CD2 . LEU B 1 99  ? -1.290  -13.891 73.881  1.00 24.47 ? 103 LEU B CD2 1 
ATOM   3340 N N   . GLN B 1 100 ? -3.654  -13.032 78.696  1.00 25.81 ? 104 GLN B N   1 
ATOM   3341 C CA  . GLN B 1 100 ? -4.799  -12.736 79.551  1.00 27.64 ? 104 GLN B CA  1 
ATOM   3342 C C   . GLN B 1 100 ? -4.853  -11.235 79.850  1.00 27.03 ? 104 GLN B C   1 
ATOM   3343 O O   . GLN B 1 100 ? -5.925  -10.629 79.846  1.00 26.74 ? 104 GLN B O   1 
ATOM   3344 C CB  . GLN B 1 100 ? -4.684  -13.528 80.860  1.00 29.76 ? 104 GLN B CB  1 
ATOM   3345 C CG  . GLN B 1 100 ? -5.779  -13.251 81.876  1.00 34.29 ? 104 GLN B CG  1 
ATOM   3346 C CD  . GLN B 1 100 ? -7.125  -13.821 81.472  1.00 37.80 ? 104 GLN B CD  1 
ATOM   3347 O OE1 . GLN B 1 100 ? -8.112  -13.677 82.194  1.00 40.32 ? 104 GLN B OE1 1 
ATOM   3348 N NE2 . GLN B 1 100 ? -7.171  -14.477 80.316  1.00 39.59 ? 104 GLN B NE2 1 
ATOM   3349 N N   . LYS B 1 101 ? -3.690  -10.643 80.107  1.00 26.22 ? 105 LYS B N   1 
ATOM   3350 C CA  . LYS B 1 101 ? -3.599  -9.216  80.403  1.00 25.96 ? 105 LYS B CA  1 
ATOM   3351 C C   . LYS B 1 101 ? -3.950  -8.371  79.184  1.00 25.11 ? 105 LYS B C   1 
ATOM   3352 O O   . LYS B 1 101 ? -4.607  -7.334  79.298  1.00 25.31 ? 105 LYS B O   1 
ATOM   3353 C CB  . LYS B 1 101 ? -2.181  -8.861  80.871  1.00 25.83 ? 105 LYS B CB  1 
ATOM   3354 C CG  . LYS B 1 101 ? -1.885  -9.189  82.326  0.50 25.96 ? 105 LYS B CG  1 
ATOM   3355 C CD  . LYS B 1 101 ? -2.647  -8.260  83.260  0.50 27.34 ? 105 LYS B CD  1 
ATOM   3356 C CE  . LYS B 1 101 ? -2.276  -8.498  84.718  0.50 28.25 ? 105 LYS B CE  1 
ATOM   3357 N NZ  . LYS B 1 101 ? -2.619  -9.876  85.170  0.50 28.75 ? 105 LYS B NZ  1 
ATOM   3358 N N   . LEU B 1 102 ? -3.506  -8.827  78.018  1.00 23.95 ? 106 LEU B N   1 
ATOM   3359 C CA  . LEU B 1 102 ? -3.740  -8.125  76.761  1.00 24.16 ? 106 LEU B CA  1 
ATOM   3360 C C   . LEU B 1 102 ? -5.132  -8.345  76.178  1.00 24.15 ? 106 LEU B C   1 
ATOM   3361 O O   . LEU B 1 102 ? -5.630  -7.505  75.426  1.00 23.19 ? 106 LEU B O   1 
ATOM   3362 C CB  . LEU B 1 102 ? -2.711  -8.580  75.725  1.00 24.41 ? 106 LEU B CB  1 
ATOM   3363 C CG  . LEU B 1 102 ? -1.243  -8.283  76.020  1.00 24.81 ? 106 LEU B CG  1 
ATOM   3364 C CD1 . LEU B 1 102 ? -0.354  -9.204  75.190  1.00 25.25 ? 106 LEU B CD1 1 
ATOM   3365 C CD2 . LEU B 1 102 ? -0.961  -6.816  75.722  1.00 24.90 ? 106 LEU B CD2 1 
ATOM   3366 N N   . GLN B 1 103 ? -5.749  -9.472  76.523  1.00 24.69 ? 107 GLN B N   1 
ATOM   3367 C CA  . GLN B 1 103 ? -7.063  -9.830  75.990  1.00 25.55 ? 107 GLN B CA  1 
ATOM   3368 C C   . GLN B 1 103 ? -6.829  -10.236 74.536  1.00 24.64 ? 107 GLN B C   1 
ATOM   3369 O O   . GLN B 1 103 ? -7.696  -10.072 73.677  1.00 22.66 ? 107 GLN B O   1 
ATOM   3370 C CB  . GLN B 1 103 ? -8.024  -8.640  76.046  1.00 28.69 ? 107 GLN B CB  1 
ATOM   3371 C CG  . GLN B 1 103 ? -8.297  -8.119  77.439  1.00 33.86 ? 107 GLN B CG  1 
ATOM   3372 C CD  . GLN B 1 103 ? -9.317  -8.953  78.179  1.00 37.81 ? 107 GLN B CD  1 
ATOM   3373 O OE1 . GLN B 1 103 ? -9.141  -10.160 78.360  1.00 40.12 ? 107 GLN B OE1 1 
ATOM   3374 N NE2 . GLN B 1 103 ? -10.398 -8.313  78.612  1.00 38.74 ? 107 GLN B NE2 1 
ATOM   3375 N N   . PHE B 1 104 ? -5.628  -10.748 74.275  1.00 22.49 ? 108 PHE B N   1 
ATOM   3376 C CA  . PHE B 1 104 ? -5.234  -11.202 72.946  1.00 21.82 ? 108 PHE B CA  1 
ATOM   3377 C C   . PHE B 1 104 ? -5.290  -12.721 72.889  1.00 21.36 ? 108 PHE B C   1 
ATOM   3378 O O   . PHE B 1 104 ? -5.221  -13.396 73.916  1.00 22.75 ? 108 PHE B O   1 
ATOM   3379 C CB  . PHE B 1 104 ? -3.794  -10.772 72.621  1.00 21.57 ? 108 PHE B CB  1 
ATOM   3380 C CG  . PHE B 1 104 ? -3.643  -9.322  72.230  1.00 21.72 ? 108 PHE B CG  1 
ATOM   3381 C CD1 . PHE B 1 104 ? -2.402  -8.837  71.820  1.00 21.59 ? 108 PHE B CD1 1 
ATOM   3382 C CD2 . PHE B 1 104 ? -4.724  -8.446  72.266  1.00 20.87 ? 108 PHE B CD2 1 
ATOM   3383 C CE1 . PHE B 1 104 ? -2.239  -7.503  71.450  1.00 21.60 ? 108 PHE B CE1 1 
ATOM   3384 C CE2 . PHE B 1 104 ? -4.572  -7.111  71.898  1.00 22.81 ? 108 PHE B CE2 1 
ATOM   3385 C CZ  . PHE B 1 104 ? -3.326  -6.639  71.490  1.00 23.29 ? 108 PHE B CZ  1 
ATOM   3386 N N   . ASP B 1 105 ? -5.405  -13.255 71.680  1.00 21.03 ? 109 ASP B N   1 
ATOM   3387 C CA  . ASP B 1 105 ? -5.429  -14.695 71.482  1.00 20.34 ? 109 ASP B CA  1 
ATOM   3388 C C   . ASP B 1 105 ? -4.016  -15.141 71.137  1.00 18.64 ? 109 ASP B C   1 
ATOM   3389 O O   . ASP B 1 105 ? -3.662  -16.311 71.297  1.00 18.54 ? 109 ASP B O   1 
ATOM   3390 C CB  . ASP B 1 105 ? -6.379  -15.057 70.341  1.00 21.25 ? 109 ASP B CB  1 
ATOM   3391 C CG  . ASP B 1 105 ? -7.821  -14.729 70.665  1.00 21.21 ? 109 ASP B CG  1 
ATOM   3392 O OD1 . ASP B 1 105 ? -8.484  -14.060 69.844  0.75 21.29 ? 109 ASP B OD1 1 
ATOM   3393 O OD2 . ASP B 1 105 ? -8.287  -15.146 71.746  0.75 21.68 ? 109 ASP B OD2 1 
ATOM   3394 N N   . TYR B 1 106 ? -3.202  -14.191 70.681  1.00 17.99 ? 110 TYR B N   1 
ATOM   3395 C CA  . TYR B 1 106 ? -1.830  -14.495 70.294  1.00 17.52 ? 110 TYR B CA  1 
ATOM   3396 C C   . TYR B 1 106 ? -0.972  -13.236 70.201  1.00 16.12 ? 110 TYR B C   1 
ATOM   3397 O O   . TYR B 1 106 ? -1.495  -12.132 70.042  1.00 16.96 ? 110 TYR B O   1 
ATOM   3398 C CB  . TYR B 1 106 ? -1.838  -15.179 68.924  1.00 17.59 ? 110 TYR B CB  1 
ATOM   3399 C CG  . TYR B 1 106 ? -2.076  -14.213 67.779  1.00 18.37 ? 110 TYR B CG  1 
ATOM   3400 C CD1 . TYR B 1 106 ? -1.005  -13.597 67.129  1.00 18.73 ? 110 TYR B CD1 1 
ATOM   3401 C CD2 . TYR B 1 106 ? -3.371  -13.868 67.383  1.00 18.53 ? 110 TYR B CD2 1 
ATOM   3402 C CE1 . TYR B 1 106 ? -1.213  -12.661 66.118  1.00 19.43 ? 110 TYR B CE1 1 
ATOM   3403 C CE2 . TYR B 1 106 ? -3.592  -12.931 66.373  1.00 19.04 ? 110 TYR B CE2 1 
ATOM   3404 C CZ  . TYR B 1 106 ? -2.507  -12.332 65.746  1.00 19.40 ? 110 TYR B CZ  1 
ATOM   3405 O OH  . TYR B 1 106 ? -2.709  -11.405 64.751  1.00 19.42 ? 110 TYR B OH  1 
ATOM   3406 N N   . VAL B 1 107 ? 0.345   -13.410 70.311  1.00 16.60 ? 111 VAL B N   1 
ATOM   3407 C CA  . VAL B 1 107 ? 1.282   -12.296 70.159  1.00 15.95 ? 111 VAL B CA  1 
ATOM   3408 C C   . VAL B 1 107 ? 2.031   -12.621 68.871  1.00 15.56 ? 111 VAL B C   1 
ATOM   3409 O O   . VAL B 1 107 ? 2.130   -13.785 68.489  1.00 17.40 ? 111 VAL B O   1 
ATOM   3410 C CB  . VAL B 1 107 ? 2.296   -12.186 71.335  1.00 15.86 ? 111 VAL B CB  1 
ATOM   3411 C CG1 . VAL B 1 107 ? 1.557   -11.866 72.631  1.00 15.05 ? 111 VAL B CG1 1 
ATOM   3412 C CG2 . VAL B 1 107 ? 3.106   -13.472 71.464  1.00 15.94 ? 111 VAL B CG2 1 
ATOM   3413 N N   . ASP B 1 108 ? 2.545   -11.608 68.187  1.00 15.64 ? 112 ASP B N   1 
ATOM   3414 C CA  . ASP B 1 108 ? 3.253   -11.854 66.935  1.00 15.46 ? 112 ASP B CA  1 
ATOM   3415 C C   . ASP B 1 108 ? 4.669   -12.365 67.136  1.00 15.34 ? 112 ASP B C   1 
ATOM   3416 O O   . ASP B 1 108 ? 5.210   -13.075 66.290  1.00 16.21 ? 112 ASP B O   1 
ATOM   3417 C CB  . ASP B 1 108 ? 3.286   -10.581 66.091  1.00 14.62 ? 112 ASP B CB  1 
ATOM   3418 C CG  . ASP B 1 108 ? 1.900   -10.070 65.769  1.00 16.56 ? 112 ASP B CG  1 
ATOM   3419 O OD1 . ASP B 1 108 ? 1.259   -9.478  66.660  1.00 14.97 ? 112 ASP B OD1 1 
ATOM   3420 O OD2 . ASP B 1 108 ? 1.448   -10.278 64.625  1.00 14.87 ? 112 ASP B OD2 1 
ATOM   3421 N N   . LEU B 1 109 ? 5.267   -12.007 68.264  1.00 15.43 ? 113 LEU B N   1 
ATOM   3422 C CA  . LEU B 1 109 ? 6.629   -12.422 68.550  1.00 14.38 ? 113 LEU B CA  1 
ATOM   3423 C C   . LEU B 1 109 ? 6.833   -12.565 70.052  1.00 13.79 ? 113 LEU B C   1 
ATOM   3424 O O   . LEU B 1 109 ? 6.344   -11.751 70.832  1.00 14.03 ? 113 LEU B O   1 
ATOM   3425 C CB  . LEU B 1 109 ? 7.601   -11.391 67.969  1.00 12.82 ? 113 LEU B CB  1 
ATOM   3426 C CG  . LEU B 1 109 ? 9.102   -11.567 68.199  1.00 11.67 ? 113 LEU B CG  1 
ATOM   3427 C CD1 . LEU B 1 109 ? 9.588   -12.889 67.608  1.00 12.92 ? 113 LEU B CD1 1 
ATOM   3428 C CD2 . LEU B 1 109 ? 9.827   -10.380 67.565  1.00 10.21 ? 113 LEU B CD2 1 
ATOM   3429 N N   . TYR B 1 110 ? 7.546   -13.615 70.446  1.00 14.35 ? 114 TYR B N   1 
ATOM   3430 C CA  . TYR B 1 110 ? 7.819   -13.881 71.851  1.00 15.30 ? 114 TYR B CA  1 
ATOM   3431 C C   . TYR B 1 110 ? 9.314   -14.157 71.994  1.00 14.43 ? 114 TYR B C   1 
ATOM   3432 O O   . TYR B 1 110 ? 9.854   -15.040 71.326  1.00 13.51 ? 114 TYR B O   1 
ATOM   3433 C CB  . TYR B 1 110 ? 6.998   -15.089 72.314  1.00 16.83 ? 114 TYR B CB  1 
ATOM   3434 C CG  . TYR B 1 110 ? 6.833   -15.196 73.813  1.00 18.55 ? 114 TYR B CG  1 
ATOM   3435 C CD1 . TYR B 1 110 ? 6.390   -14.108 74.563  1.00 20.53 ? 114 TYR B CD1 1 
ATOM   3436 C CD2 . TYR B 1 110 ? 7.082   -16.398 74.479  1.00 18.18 ? 114 TYR B CD2 1 
ATOM   3437 C CE1 . TYR B 1 110 ? 6.195   -14.211 75.945  1.00 20.53 ? 114 TYR B CE1 1 
ATOM   3438 C CE2 . TYR B 1 110 ? 6.892   -16.512 75.857  1.00 19.84 ? 114 TYR B CE2 1 
ATOM   3439 C CZ  . TYR B 1 110 ? 6.445   -15.414 76.582  1.00 21.00 ? 114 TYR B CZ  1 
ATOM   3440 O OH  . TYR B 1 110 ? 6.233   -15.524 77.938  1.00 22.69 ? 114 TYR B OH  1 
ATOM   3441 N N   . LEU B 1 111 ? 9.977   -13.401 72.867  1.00 13.49 ? 115 LEU B N   1 
ATOM   3442 C CA  . LEU B 1 111 ? 11.417  -13.544 73.062  1.00 13.67 ? 115 LEU B CA  1 
ATOM   3443 C C   . LEU B 1 111 ? 11.835  -13.949 74.464  1.00 14.68 ? 115 LEU B C   1 
ATOM   3444 O O   . LEU B 1 111 ? 11.117  -13.718 75.435  1.00 15.15 ? 115 LEU B O   1 
ATOM   3445 C CB  . LEU B 1 111 ? 12.128  -12.220 72.766  1.00 12.64 ? 115 LEU B CB  1 
ATOM   3446 C CG  . LEU B 1 111 ? 11.666  -11.341 71.603  1.00 10.77 ? 115 LEU B CG  1 
ATOM   3447 C CD1 . LEU B 1 111 ? 12.476  -10.047 71.599  1.00 7.87  ? 115 LEU B CD1 1 
ATOM   3448 C CD2 . LEU B 1 111 ? 11.836  -12.090 70.299  1.00 9.28  ? 115 LEU B CD2 1 
ATOM   3449 N N   . ILE B 1 112 ? 13.014  -14.555 74.547  1.00 15.43 ? 116 ILE B N   1 
ATOM   3450 C CA  . ILE B 1 112 ? 13.613  -14.908 75.825  1.00 14.67 ? 116 ILE B CA  1 
ATOM   3451 C C   . ILE B 1 112 ? 14.294  -13.566 76.119  1.00 14.40 ? 116 ILE B C   1 
ATOM   3452 O O   . ILE B 1 112 ? 15.177  -13.140 75.374  1.00 15.21 ? 116 ILE B O   1 
ATOM   3453 C CB  . ILE B 1 112 ? 14.665  -16.025 75.659  1.00 15.08 ? 116 ILE B CB  1 
ATOM   3454 C CG1 . ILE B 1 112 ? 13.966  -17.331 75.267  1.00 14.16 ? 116 ILE B CG1 1 
ATOM   3455 C CG2 . ILE B 1 112 ? 15.455  -16.199 76.954  1.00 14.29 ? 116 ILE B CG2 1 
ATOM   3456 C CD1 . ILE B 1 112 ? 14.909  -18.498 75.012  1.00 13.37 ? 116 ILE B CD1 1 
ATOM   3457 N N   . HIS B 1 113 ? 13.868  -12.890 77.181  1.00 13.30 ? 117 HIS B N   1 
ATOM   3458 C CA  . HIS B 1 113 ? 14.401  -11.564 77.502  1.00 11.61 ? 117 HIS B CA  1 
ATOM   3459 C C   . HIS B 1 113 ? 15.909  -11.497 77.727  1.00 11.46 ? 117 HIS B C   1 
ATOM   3460 O O   . HIS B 1 113 ? 16.581  -10.590 77.229  1.00 10.49 ? 117 HIS B O   1 
ATOM   3461 C CB  . HIS B 1 113 ? 13.654  -10.994 78.708  1.00 11.50 ? 117 HIS B CB  1 
ATOM   3462 C CG  . HIS B 1 113 ? 13.602  -9.497  78.730  1.00 10.96 ? 117 HIS B CG  1 
ATOM   3463 N ND1 . HIS B 1 113 ? 12.536  -8.799  79.256  1.00 11.76 ? 117 HIS B ND1 1 
ATOM   3464 C CD2 . HIS B 1 113 ? 14.484  -8.566  78.295  1.00 11.32 ? 117 HIS B CD2 1 
ATOM   3465 C CE1 . HIS B 1 113 ? 12.763  -7.502  79.142  1.00 12.42 ? 117 HIS B CE1 1 
ATOM   3466 N NE2 . HIS B 1 113 ? 13.938  -7.334  78.563  1.00 10.74 ? 117 HIS B NE2 1 
ATOM   3467 N N   . TYR B 1 114 ? 16.428  -12.450 78.488  1.00 10.73 ? 118 TYR B N   1 
ATOM   3468 C CA  . TYR B 1 114 ? 17.857  -12.547 78.777  1.00 13.43 ? 118 TYR B CA  1 
ATOM   3469 C C   . TYR B 1 114 ? 18.170  -14.031 78.869  1.00 13.12 ? 118 TYR B C   1 
ATOM   3470 O O   . TYR B 1 114 ? 17.314  -14.821 79.251  1.00 14.48 ? 118 TYR B O   1 
ATOM   3471 C CB  . TYR B 1 114 ? 18.210  -11.913 80.129  1.00 12.08 ? 118 TYR B CB  1 
ATOM   3472 C CG  . TYR B 1 114 ? 18.352  -10.411 80.156  1.00 14.47 ? 118 TYR B CG  1 
ATOM   3473 C CD1 . TYR B 1 114 ? 17.388  -9.612  80.771  1.00 13.16 ? 118 TYR B CD1 1 
ATOM   3474 C CD2 . TYR B 1 114 ? 19.482  -9.788  79.625  1.00 14.18 ? 118 TYR B CD2 1 
ATOM   3475 C CE1 . TYR B 1 114 ? 17.550  -8.230  80.863  1.00 16.19 ? 118 TYR B CE1 1 
ATOM   3476 C CE2 . TYR B 1 114 ? 19.652  -8.405  79.710  1.00 14.52 ? 118 TYR B CE2 1 
ATOM   3477 C CZ  . TYR B 1 114 ? 18.686  -7.636  80.333  1.00 14.77 ? 118 TYR B CZ  1 
ATOM   3478 O OH  . TYR B 1 114 ? 18.867  -6.279  80.453  1.00 16.49 ? 118 TYR B OH  1 
ATOM   3479 N N   . PRO B 1 115 ? 19.403  -14.430 78.525  1.00 14.48 ? 119 PRO B N   1 
ATOM   3480 C CA  . PRO B 1 115 ? 19.789  -15.844 78.591  1.00 15.16 ? 119 PRO B CA  1 
ATOM   3481 C C   . PRO B 1 115 ? 20.205  -16.220 80.017  1.00 16.29 ? 119 PRO B C   1 
ATOM   3482 O O   . PRO B 1 115 ? 21.057  -17.086 80.217  1.00 16.36 ? 119 PRO B O   1 
ATOM   3483 C CB  . PRO B 1 115 ? 20.957  -15.917 77.620  1.00 15.19 ? 119 PRO B CB  1 
ATOM   3484 C CG  . PRO B 1 115 ? 21.641  -14.590 77.848  1.00 14.45 ? 119 PRO B CG  1 
ATOM   3485 C CD  . PRO B 1 115 ? 20.470  -13.616 77.912  1.00 14.31 ? 119 PRO B CD  1 
ATOM   3486 N N   . MET B 1 116 ? 19.598  -15.564 81.001  1.00 15.92 ? 120 MET B N   1 
ATOM   3487 C CA  . MET B 1 116 ? 19.934  -15.803 82.403  1.00 16.48 ? 120 MET B CA  1 
ATOM   3488 C C   . MET B 1 116 ? 18.725  -16.061 83.287  1.00 16.31 ? 120 MET B C   1 
ATOM   3489 O O   . MET B 1 116 ? 17.939  -15.158 83.548  1.00 18.16 ? 120 MET B O   1 
ATOM   3490 C CB  . MET B 1 116 ? 20.696  -14.604 82.956  1.00 14.10 ? 120 MET B CB  1 
ATOM   3491 C CG  . MET B 1 116 ? 21.912  -14.221 82.141  1.00 16.80 ? 120 MET B CG  1 
ATOM   3492 S SD  . MET B 1 116 ? 22.734  -12.772 82.813  1.00 15.61 ? 120 MET B SD  1 
ATOM   3493 C CE  . MET B 1 116 ? 21.722  -11.463 82.124  1.00 17.51 ? 120 MET B CE  1 
ATOM   3494 N N   . ALA B 1 117 ? 18.590  -17.293 83.764  1.00 16.28 ? 121 ALA B N   1 
ATOM   3495 C CA  . ALA B 1 117 ? 17.471  -17.646 84.627  1.00 16.21 ? 121 ALA B CA  1 
ATOM   3496 C C   . ALA B 1 117 ? 17.653  -17.142 86.062  1.00 17.15 ? 121 ALA B C   1 
ATOM   3497 O O   . ALA B 1 117 ? 18.777  -17.024 86.558  1.00 16.44 ? 121 ALA B O   1 
ATOM   3498 C CB  . ALA B 1 117 ? 17.281  -19.159 84.634  1.00 16.53 ? 121 ALA B CB  1 
ATOM   3499 N N   . LEU B 1 118 ? 16.533  -16.839 86.712  1.00 17.74 ? 122 LEU B N   1 
ATOM   3500 C CA  . LEU B 1 118 ? 16.524  -16.387 88.102  1.00 18.28 ? 122 LEU B CA  1 
ATOM   3501 C C   . LEU B 1 118 ? 15.516  -17.255 88.854  1.00 18.75 ? 122 LEU B C   1 
ATOM   3502 O O   . LEU B 1 118 ? 14.615  -17.825 88.244  1.00 20.64 ? 122 LEU B O   1 
ATOM   3503 C CB  . LEU B 1 118 ? 16.105  -14.917 88.205  1.00 14.89 ? 122 LEU B CB  1 
ATOM   3504 C CG  . LEU B 1 118 ? 17.049  -13.857 87.635  1.00 13.28 ? 122 LEU B CG  1 
ATOM   3505 C CD1 . LEU B 1 118 ? 16.493  -12.474 87.945  1.00 14.73 ? 122 LEU B CD1 1 
ATOM   3506 C CD2 . LEU B 1 118 ? 18.434  -14.013 88.250  1.00 12.07 ? 122 LEU B CD2 1 
ATOM   3507 N N   . LYS B 1 119 ? 15.668  -17.351 90.172  1.00 19.64 ? 123 LYS B N   1 
ATOM   3508 C CA  . LYS B 1 119 ? 14.767  -18.158 90.993  1.00 20.10 ? 123 LYS B CA  1 
ATOM   3509 C C   . LYS B 1 119 ? 13.290  -17.904 90.687  1.00 19.31 ? 123 LYS B C   1 
ATOM   3510 O O   . LYS B 1 119 ? 12.815  -16.771 90.761  1.00 19.94 ? 123 LYS B O   1 
ATOM   3511 C CB  . LYS B 1 119 ? 15.010  -17.887 92.481  1.00 22.40 ? 123 LYS B CB  1 
ATOM   3512 C CG  . LYS B 1 119 ? 14.357  -18.927 93.381  1.00 26.23 ? 123 LYS B CG  1 
ATOM   3513 C CD  . LYS B 1 119 ? 14.442  -18.577 94.860  1.00 30.14 ? 123 LYS B CD  1 
ATOM   3514 C CE  . LYS B 1 119 ? 13.397  -17.547 95.243  1.00 32.55 ? 123 LYS B CE  1 
ATOM   3515 N NZ  . LYS B 1 119 ? 13.268  -17.422 96.725  1.00 34.42 ? 123 LYS B NZ  1 
ATOM   3516 N N   . PRO B 1 120 ? 12.542  -18.965 90.343  1.00 20.74 ? 124 PRO B N   1 
ATOM   3517 C CA  . PRO B 1 120 ? 11.114  -18.843 90.030  1.00 20.91 ? 124 PRO B CA  1 
ATOM   3518 C C   . PRO B 1 120 ? 10.339  -18.231 91.191  1.00 22.07 ? 124 PRO B C   1 
ATOM   3519 O O   . PRO B 1 120 ? 10.657  -18.478 92.355  1.00 21.98 ? 124 PRO B O   1 
ATOM   3520 C CB  . PRO B 1 120 ? 10.696  -20.285 89.764  1.00 21.34 ? 124 PRO B CB  1 
ATOM   3521 C CG  . PRO B 1 120 ? 11.931  -20.885 89.183  1.00 21.03 ? 124 PRO B CG  1 
ATOM   3522 C CD  . PRO B 1 120 ? 13.019  -20.334 90.078  1.00 20.30 ? 124 PRO B CD  1 
ATOM   3523 N N   . GLY B 1 121 ? 9.322   -17.440 90.866  1.00 22.84 ? 125 GLY B N   1 
ATOM   3524 C CA  . GLY B 1 121 ? 8.516   -16.798 91.888  1.00 24.45 ? 125 GLY B CA  1 
ATOM   3525 C C   . GLY B 1 121 ? 7.841   -15.557 91.341  1.00 26.00 ? 125 GLY B C   1 
ATOM   3526 O O   . GLY B 1 121 ? 8.176   -15.103 90.247  1.00 26.35 ? 125 GLY B O   1 
ATOM   3527 N N   . GLU B 1 122 ? 6.890   -15.006 92.092  1.00 26.79 ? 126 GLU B N   1 
ATOM   3528 C CA  . GLU B 1 122 ? 6.177   -13.809 91.656  1.00 27.98 ? 126 GLU B CA  1 
ATOM   3529 C C   . GLU B 1 122 ? 7.133   -12.625 91.513  1.00 26.93 ? 126 GLU B C   1 
ATOM   3530 O O   . GLU B 1 122 ? 6.997   -11.809 90.600  1.00 24.72 ? 126 GLU B O   1 
ATOM   3531 C CB  . GLU B 1 122 ? 5.067   -13.456 92.648  1.00 30.13 ? 126 GLU B CB  1 
ATOM   3532 C CG  . GLU B 1 122 ? 4.236   -12.248 92.234  1.00 34.39 ? 126 GLU B CG  1 
ATOM   3533 C CD  . GLU B 1 122 ? 3.286   -12.546 91.083  1.00 38.24 ? 126 GLU B CD  1 
ATOM   3534 O OE1 . GLU B 1 122 ? 3.709   -13.190 90.098  1.00 40.44 ? 126 GLU B OE1 1 
ATOM   3535 O OE2 . GLU B 1 122 ? 2.112   -12.123 91.159  1.00 39.79 ? 126 GLU B OE2 1 
ATOM   3536 N N   . GLU B 1 123 ? 8.097   -12.533 92.424  1.00 26.47 ? 127 GLU B N   1 
ATOM   3537 C CA  . GLU B 1 123 ? 9.079   -11.455 92.390  1.00 25.48 ? 127 GLU B CA  1 
ATOM   3538 C C   . GLU B 1 123 ? 9.952   -11.569 91.142  1.00 23.51 ? 127 GLU B C   1 
ATOM   3539 O O   . GLU B 1 123 ? 10.516  -12.629 90.868  1.00 21.97 ? 127 GLU B O   1 
ATOM   3540 C CB  . GLU B 1 123 ? 9.964   -11.505 93.641  1.00 27.07 ? 127 GLU B CB  1 
ATOM   3541 C CG  . GLU B 1 123 ? 11.171  -10.581 93.579  1.00 30.81 ? 127 GLU B CG  1 
ATOM   3542 C CD  . GLU B 1 123 ? 10.786  -9.126  93.376  1.00 33.18 ? 127 GLU B CD  1 
ATOM   3543 O OE1 . GLU B 1 123 ? 11.679  -8.314  93.052  1.00 34.77 ? 127 GLU B OE1 1 
ATOM   3544 O OE2 . GLU B 1 123 ? 9.594   -8.790  93.544  1.00 36.64 ? 127 GLU B OE2 1 
ATOM   3545 N N   . ASN B 1 124 ? 10.062  -10.477 90.392  1.00 21.59 ? 128 ASN B N   1 
ATOM   3546 C CA  . ASN B 1 124 ? 10.876  -10.467 89.179  1.00 20.18 ? 128 ASN B CA  1 
ATOM   3547 C C   . ASN B 1 124 ? 12.363  -10.341 89.489  1.00 19.30 ? 128 ASN B C   1 
ATOM   3548 O O   . ASN B 1 124 ? 13.206  -10.740 88.686  1.00 17.48 ? 128 ASN B O   1 
ATOM   3549 C CB  . ASN B 1 124 ? 10.465  -9.314  88.262  1.00 19.92 ? 128 ASN B CB  1 
ATOM   3550 C CG  . ASN B 1 124 ? 9.072   -9.487  87.697  1.00 20.97 ? 128 ASN B CG  1 
ATOM   3551 O OD1 . ASN B 1 124 ? 8.667   -10.594 87.343  1.00 21.11 ? 128 ASN B OD1 1 
ATOM   3552 N ND2 . ASN B 1 124 ? 8.339   -8.389  87.591  1.00 21.81 ? 128 ASN B ND2 1 
ATOM   3553 N N   . PHE B 1 125 ? 12.687  -9.779  90.649  1.00 18.32 ? 129 PHE B N   1 
ATOM   3554 C CA  . PHE B 1 125 ? 14.082  -9.608  91.031  1.00 17.16 ? 129 PHE B CA  1 
ATOM   3555 C C   . PHE B 1 125 ? 14.380  -10.163 92.416  1.00 17.11 ? 129 PHE B C   1 
ATOM   3556 O O   . PHE B 1 125 ? 14.649  -9.415  93.353  1.00 16.30 ? 129 PHE B O   1 
ATOM   3557 C CB  . PHE B 1 125 ? 14.471  -8.129  90.959  1.00 15.29 ? 129 PHE B CB  1 
ATOM   3558 C CG  . PHE B 1 125 ? 14.307  -7.535  89.593  1.00 15.37 ? 129 PHE B CG  1 
ATOM   3559 C CD1 . PHE B 1 125 ? 13.065  -7.068  89.167  1.00 15.89 ? 129 PHE B CD1 1 
ATOM   3560 C CD2 . PHE B 1 125 ? 15.380  -7.500  88.705  1.00 15.76 ? 129 PHE B CD2 1 
ATOM   3561 C CE1 . PHE B 1 125 ? 12.894  -6.578  87.876  1.00 15.10 ? 129 PHE B CE1 1 
ATOM   3562 C CE2 . PHE B 1 125 ? 15.219  -7.012  87.410  1.00 14.40 ? 129 PHE B CE2 1 
ATOM   3563 C CZ  . PHE B 1 125 ? 13.975  -6.551  86.995  1.00 14.44 ? 129 PHE B CZ  1 
ATOM   3564 N N   . PRO B 1 126 ? 14.335  -11.497 92.560  1.00 16.85 ? 130 PRO B N   1 
ATOM   3565 C CA  . PRO B 1 126 ? 14.607  -12.139 93.847  1.00 16.42 ? 130 PRO B CA  1 
ATOM   3566 C C   . PRO B 1 126 ? 16.052  -11.906 94.269  1.00 17.25 ? 130 PRO B C   1 
ATOM   3567 O O   . PRO B 1 126 ? 16.979  -12.104 93.479  1.00 16.60 ? 130 PRO B O   1 
ATOM   3568 C CB  . PRO B 1 126 ? 14.310  -13.610 93.570  1.00 15.87 ? 130 PRO B CB  1 
ATOM   3569 C CG  . PRO B 1 126 ? 14.667  -13.753 92.102  1.00 17.80 ? 130 PRO B CG  1 
ATOM   3570 C CD  . PRO B 1 126 ? 14.048  -12.499 91.517  1.00 17.44 ? 130 PRO B CD  1 
ATOM   3571 N N   . VAL B 1 127 ? 16.237  -11.472 95.512  1.00 17.31 ? 131 VAL B N   1 
ATOM   3572 C CA  . VAL B 1 127 ? 17.571  -11.210 96.042  1.00 18.61 ? 131 VAL B CA  1 
ATOM   3573 C C   . VAL B 1 127 ? 17.713  -11.782 97.441  1.00 19.17 ? 131 VAL B C   1 
ATOM   3574 O O   . VAL B 1 127 ? 16.716  -12.030 98.121  1.00 19.29 ? 131 VAL B O   1 
ATOM   3575 C CB  . VAL B 1 127 ? 17.867  -9.695  96.124  1.00 18.16 ? 131 VAL B CB  1 
ATOM   3576 C CG1 . VAL B 1 127 ? 17.923  -9.094  94.730  1.00 17.58 ? 131 VAL B CG1 1 
ATOM   3577 C CG2 . VAL B 1 127 ? 16.802  -9.005  96.968  1.00 19.70 ? 131 VAL B CG2 1 
ATOM   3578 N N   . ASP B 1 128 ? 18.959  -11.993 97.862  1.00 19.68 ? 132 ASP B N   1 
ATOM   3579 C CA  . ASP B 1 128 ? 19.241  -12.511 99.195  1.00 19.62 ? 132 ASP B CA  1 
ATOM   3580 C C   . ASP B 1 128 ? 19.464  -11.337 100.142 1.00 19.47 ? 132 ASP B C   1 
ATOM   3581 O O   . ASP B 1 128 ? 19.157  -10.196 99.798  1.00 18.61 ? 132 ASP B O   1 
ATOM   3582 C CB  . ASP B 1 128 ? 20.481  -13.416 99.180  1.00 19.65 ? 132 ASP B CB  1 
ATOM   3583 C CG  . ASP B 1 128 ? 21.723  -12.713 98.659  1.00 19.72 ? 132 ASP B CG  1 
ATOM   3584 O OD1 . ASP B 1 128 ? 21.752  -11.464 98.632  1.00 17.44 ? 132 ASP B OD1 1 
ATOM   3585 O OD2 . ASP B 1 128 ? 22.685  -13.419 98.286  1.00 19.03 ? 132 ASP B OD2 1 
ATOM   3586 N N   . GLU B 1 129 ? 20.010  -11.617 101.323 1.00 21.09 ? 133 GLU B N   1 
ATOM   3587 C CA  . GLU B 1 129 ? 20.263  -10.581 102.326 1.00 22.71 ? 133 GLU B CA  1 
ATOM   3588 C C   . GLU B 1 129 ? 21.263  -9.531  101.867 1.00 22.26 ? 133 GLU B C   1 
ATOM   3589 O O   . GLU B 1 129 ? 21.258  -8.407  102.367 1.00 22.14 ? 133 GLU B O   1 
ATOM   3590 C CB  . GLU B 1 129 ? 20.795  -11.189 103.625 1.00 25.66 ? 133 GLU B CB  1 
ATOM   3591 C CG  . GLU B 1 129 ? 20.348  -12.599 103.918 1.00 30.15 ? 133 GLU B CG  1 
ATOM   3592 C CD  . GLU B 1 129 ? 21.150  -13.638 103.164 1.00 32.29 ? 133 GLU B CD  1 
ATOM   3593 O OE1 . GLU B 1 129 ? 20.681  -14.102 102.104 1.00 34.95 ? 133 GLU B OE1 1 
ATOM   3594 O OE2 . GLU B 1 129 ? 22.257  -13.986 103.634 1.00 33.01 ? 133 GLU B OE2 1 
ATOM   3595 N N   . HIS B 1 130 ? 22.135  -9.896  100.934 1.00 21.01 ? 134 HIS B N   1 
ATOM   3596 C CA  . HIS B 1 130 ? 23.132  -8.953  100.443 1.00 19.82 ? 134 HIS B CA  1 
ATOM   3597 C C   . HIS B 1 130 ? 22.600  -8.143  99.269  1.00 19.56 ? 134 HIS B C   1 
ATOM   3598 O O   . HIS B 1 130 ? 23.317  -7.323  98.694  1.00 18.56 ? 134 HIS B O   1 
ATOM   3599 C CB  . HIS B 1 130 ? 24.412  -9.689  100.033 1.00 20.43 ? 134 HIS B CB  1 
ATOM   3600 C CG  . HIS B 1 130 ? 25.124  -10.341 101.178 1.00 22.92 ? 134 HIS B CG  1 
ATOM   3601 N ND1 . HIS B 1 130 ? 24.808  -11.603 101.633 1.00 24.88 ? 134 HIS B ND1 1 
ATOM   3602 C CD2 . HIS B 1 130 ? 26.114  -9.888  101.985 1.00 24.30 ? 134 HIS B CD2 1 
ATOM   3603 C CE1 . HIS B 1 130 ? 25.571  -11.901 102.669 1.00 23.39 ? 134 HIS B CE1 1 
ATOM   3604 N NE2 . HIS B 1 130 ? 26.372  -10.876 102.904 1.00 24.96 ? 134 HIS B NE2 1 
ATOM   3605 N N   . GLY B 1 131 ? 21.335  -8.370  98.930  1.00 19.21 ? 135 GLY B N   1 
ATOM   3606 C CA  . GLY B 1 131 ? 20.725  -7.657  97.822  1.00 19.96 ? 135 GLY B CA  1 
ATOM   3607 C C   . GLY B 1 131 ? 21.181  -8.177  96.470  1.00 20.72 ? 135 GLY B C   1 
ATOM   3608 O O   . GLY B 1 131 ? 20.998  -7.513  95.447  1.00 21.56 ? 135 GLY B O   1 
ATOM   3609 N N   . LYS B 1 132 ? 21.779  -9.366  96.459  1.00 20.20 ? 136 LYS B N   1 
ATOM   3610 C CA  . LYS B 1 132 ? 22.255  -9.971  95.219  1.00 19.68 ? 136 LYS B CA  1 
ATOM   3611 C C   . LYS B 1 132 ? 21.172  -10.856 94.611  1.00 18.27 ? 136 LYS B C   1 
ATOM   3612 O O   . LYS B 1 132 ? 20.494  -11.598 95.324  1.00 16.70 ? 136 LYS B O   1 
ATOM   3613 C CB  . LYS B 1 132 ? 23.507  -10.813 95.484  1.00 21.93 ? 136 LYS B CB  1 
ATOM   3614 C CG  . LYS B 1 132 ? 24.690  -10.032 96.048  1.00 24.89 ? 136 LYS B CG  1 
ATOM   3615 C CD  . LYS B 1 132 ? 25.233  -9.030  95.045  1.00 28.32 ? 136 LYS B CD  1 
ATOM   3616 C CE  . LYS B 1 132 ? 26.457  -8.312  95.598  1.00 32.77 ? 136 LYS B CE  1 
ATOM   3617 N NZ  . LYS B 1 132 ? 27.058  -7.377  94.603  1.00 35.33 ? 136 LYS B NZ  1 
ATOM   3618 N N   . LEU B 1 133 ? 21.006  -10.772 93.294  1.00 18.11 ? 137 LEU B N   1 
ATOM   3619 C CA  . LEU B 1 133 ? 20.011  -11.585 92.602  1.00 16.55 ? 137 LEU B CA  1 
ATOM   3620 C C   . LEU B 1 133 ? 20.274  -13.066 92.835  1.00 16.34 ? 137 LEU B C   1 
ATOM   3621 O O   . LEU B 1 133 ? 21.423  -13.501 92.881  1.00 14.95 ? 137 LEU B O   1 
ATOM   3622 C CB  . LEU B 1 133 ? 20.042  -11.305 91.097  1.00 16.34 ? 137 LEU B CB  1 
ATOM   3623 C CG  . LEU B 1 133 ? 19.459  -9.976  90.612  1.00 15.56 ? 137 LEU B CG  1 
ATOM   3624 C CD1 . LEU B 1 133 ? 19.661  -9.844  89.109  1.00 14.84 ? 137 LEU B CD1 1 
ATOM   3625 C CD2 . LEU B 1 133 ? 17.975  -9.920  90.954  1.00 15.46 ? 137 LEU B CD2 1 
ATOM   3626 N N   . ILE B 1 134 ? 19.204  -13.837 92.988  1.00 17.78 ? 138 ILE B N   1 
ATOM   3627 C CA  . ILE B 1 134 ? 19.332  -15.271 93.201  1.00 17.82 ? 138 ILE B CA  1 
ATOM   3628 C C   . ILE B 1 134 ? 19.270  -15.954 91.839  1.00 19.13 ? 138 ILE B C   1 
ATOM   3629 O O   . ILE B 1 134 ? 18.199  -16.069 91.242  1.00 18.76 ? 138 ILE B O   1 
ATOM   3630 C CB  . ILE B 1 134 ? 18.192  -15.812 94.095  1.00 17.55 ? 138 ILE B CB  1 
ATOM   3631 C CG1 . ILE B 1 134 ? 18.145  -15.025 95.407  1.00 17.82 ? 138 ILE B CG1 1 
ATOM   3632 C CG2 . ILE B 1 134 ? 18.414  -17.299 94.386  1.00 18.00 ? 138 ILE B CG2 1 
ATOM   3633 C CD1 . ILE B 1 134 ? 17.012  -15.443 96.331  1.00 20.12 ? 138 ILE B CD1 1 
ATOM   3634 N N   . PHE B 1 135 ? 20.425  -16.391 91.349  1.00 19.00 ? 139 PHE B N   1 
ATOM   3635 C CA  . PHE B 1 135 ? 20.504  -17.054 90.056  1.00 20.76 ? 139 PHE B CA  1 
ATOM   3636 C C   . PHE B 1 135 ? 19.962  -18.470 90.135  1.00 22.47 ? 139 PHE B C   1 
ATOM   3637 O O   . PHE B 1 135 ? 19.914  -19.072 91.205  1.00 22.53 ? 139 PHE B O   1 
ATOM   3638 C CB  . PHE B 1 135 ? 21.956  -17.115 89.564  1.00 21.17 ? 139 PHE B CB  1 
ATOM   3639 C CG  . PHE B 1 135 ? 22.641  -15.779 89.503  1.00 20.99 ? 139 PHE B CG  1 
ATOM   3640 C CD1 . PHE B 1 135 ? 21.952  -14.643 89.090  1.00 21.92 ? 139 PHE B CD1 1 
ATOM   3641 C CD2 . PHE B 1 135 ? 23.992  -15.665 89.820  1.00 22.68 ? 139 PHE B CD2 1 
ATOM   3642 C CE1 . PHE B 1 135 ? 22.600  -13.411 88.992  1.00 21.90 ? 139 PHE B CE1 1 
ATOM   3643 C CE2 . PHE B 1 135 ? 24.648  -14.439 89.724  1.00 21.28 ? 139 PHE B CE2 1 
ATOM   3644 C CZ  . PHE B 1 135 ? 23.951  -13.310 89.309  1.00 21.73 ? 139 PHE B CZ  1 
ATOM   3645 N N   . ASP B 1 136 ? 19.544  -18.995 88.991  1.00 23.68 ? 140 ASP B N   1 
ATOM   3646 C CA  . ASP B 1 136 ? 19.036  -20.356 88.921  1.00 24.47 ? 140 ASP B CA  1 
ATOM   3647 C C   . ASP B 1 136 ? 19.641  -20.977 87.672  1.00 25.13 ? 140 ASP B C   1 
ATOM   3648 O O   . ASP B 1 136 ? 19.983  -20.268 86.725  1.00 25.97 ? 140 ASP B O   1 
ATOM   3649 C CB  . ASP B 1 136 ? 17.506  -20.362 88.846  1.00 24.19 ? 140 ASP B CB  1 
ATOM   3650 C CG  . ASP B 1 136 ? 16.926  -21.768 88.856  1.00 26.07 ? 140 ASP B CG  1 
ATOM   3651 O OD1 . ASP B 1 136 ? 17.562  -22.673 89.436  1.00 26.26 ? 140 ASP B OD1 1 
ATOM   3652 O OD2 . ASP B 1 136 ? 15.827  -21.965 88.297  1.00 24.30 ? 140 ASP B OD2 1 
ATOM   3653 N N   . ARG B 1 137 ? 19.802  -22.293 87.674  1.00 25.53 ? 141 ARG B N   1 
ATOM   3654 C CA  . ARG B 1 137 ? 20.376  -22.957 86.517  1.00 25.57 ? 141 ARG B CA  1 
ATOM   3655 C C   . ARG B 1 137 ? 19.272  -23.527 85.646  1.00 25.31 ? 141 ARG B C   1 
ATOM   3656 O O   . ARG B 1 137 ? 18.377  -24.214 86.131  1.00 24.16 ? 141 ARG B O   1 
ATOM   3657 C CB  . ARG B 1 137 ? 21.337  -24.065 86.956  0.50 27.14 ? 141 ARG B CB  1 
ATOM   3658 C CG  . ARG B 1 137 ? 22.457  -23.577 87.872  0.50 29.18 ? 141 ARG B CG  1 
ATOM   3659 C CD  . ARG B 1 137 ? 23.126  -22.318 87.323  0.50 30.81 ? 141 ARG B CD  1 
ATOM   3660 N NE  . ARG B 1 137 ? 23.807  -22.543 86.049  0.50 31.41 ? 141 ARG B NE  1 
ATOM   3661 C CZ  . ARG B 1 137 ? 24.941  -23.225 85.914  0.50 32.21 ? 141 ARG B CZ  1 
ATOM   3662 N NH1 . ARG B 1 137 ? 25.531  -23.754 86.977  0.50 32.33 ? 141 ARG B NH1 1 
ATOM   3663 N NH2 . ARG B 1 137 ? 25.490  -23.373 84.715  0.50 32.42 ? 141 ARG B NH2 1 
ATOM   3664 N N   . VAL B 1 138 ? 19.334  -23.218 84.357  1.00 24.40 ? 142 VAL B N   1 
ATOM   3665 C CA  . VAL B 1 138 ? 18.344  -23.694 83.402  1.00 25.66 ? 142 VAL B CA  1 
ATOM   3666 C C   . VAL B 1 138 ? 19.002  -23.976 82.060  1.00 25.69 ? 142 VAL B C   1 
ATOM   3667 O O   . VAL B 1 138 ? 19.936  -23.282 81.655  1.00 26.16 ? 142 VAL B O   1 
ATOM   3668 C CB  . VAL B 1 138 ? 17.226  -22.653 83.191  1.00 24.61 ? 142 VAL B CB  1 
ATOM   3669 C CG1 . VAL B 1 138 ? 16.242  -23.145 82.143  1.00 25.65 ? 142 VAL B CG1 1 
ATOM   3670 C CG2 . VAL B 1 138 ? 16.507  -22.394 84.501  1.00 27.71 ? 142 VAL B CG2 1 
ATOM   3671 N N   . ASP B 1 139 ? 18.520  -25.009 81.381  1.00 25.63 ? 143 ASP B N   1 
ATOM   3672 C CA  . ASP B 1 139 ? 19.045  -25.371 80.073  1.00 25.58 ? 143 ASP B CA  1 
ATOM   3673 C C   . ASP B 1 139 ? 18.302  -24.517 79.048  1.00 23.66 ? 143 ASP B C   1 
ATOM   3674 O O   . ASP B 1 139 ? 17.123  -24.742 78.782  1.00 22.66 ? 143 ASP B O   1 
ATOM   3675 C CB  . ASP B 1 139 ? 18.815  -26.865 79.817  1.00 27.34 ? 143 ASP B CB  1 
ATOM   3676 C CG  . ASP B 1 139 ? 19.257  -27.300 78.432  1.00 30.70 ? 143 ASP B CG  1 
ATOM   3677 O OD1 . ASP B 1 139 ? 20.225  -26.716 77.899  1.00 30.86 ? 143 ASP B OD1 1 
ATOM   3678 O OD2 . ASP B 1 139 ? 18.643  -28.241 77.885  1.00 31.55 ? 143 ASP B OD2 1 
ATOM   3679 N N   . LEU B 1 140 ? 18.991  -23.525 78.494  1.00 22.99 ? 144 LEU B N   1 
ATOM   3680 C CA  . LEU B 1 140 ? 18.381  -22.629 77.519  1.00 22.64 ? 144 LEU B CA  1 
ATOM   3681 C C   . LEU B 1 140 ? 17.851  -23.352 76.288  1.00 23.33 ? 144 LEU B C   1 
ATOM   3682 O O   . LEU B 1 140 ? 16.899  -22.895 75.656  1.00 23.36 ? 144 LEU B O   1 
ATOM   3683 C CB  . LEU B 1 140 ? 19.374  -21.540 77.106  1.00 22.20 ? 144 LEU B CB  1 
ATOM   3684 C CG  . LEU B 1 140 ? 19.633  -20.455 78.160  1.00 21.85 ? 144 LEU B CG  1 
ATOM   3685 C CD1 . LEU B 1 140 ? 20.701  -19.502 77.658  1.00 20.53 ? 144 LEU B CD1 1 
ATOM   3686 C CD2 . LEU B 1 140 ? 18.335  -19.697 78.459  1.00 19.43 ? 144 LEU B CD2 1 
ATOM   3687 N N   . CYS B 1 141 ? 18.461  -24.480 75.942  1.00 23.29 ? 145 CYS B N   1 
ATOM   3688 C CA  . CYS B 1 141 ? 17.996  -25.239 74.789  1.00 23.95 ? 145 CYS B CA  1 
ATOM   3689 C C   . CYS B 1 141 ? 16.625  -25.824 75.099  1.00 22.20 ? 145 CYS B C   1 
ATOM   3690 O O   . CYS B 1 141 ? 15.774  -25.939 74.219  1.00 21.42 ? 145 CYS B O   1 
ATOM   3691 C CB  . CYS B 1 141 ? 18.994  -26.342 74.443  1.00 24.30 ? 145 CYS B CB  1 
ATOM   3692 S SG  . CYS B 1 141 ? 20.550  -25.677 73.808  1.00 27.00 ? 145 CYS B SG  1 
ATOM   3693 N N   . ALA B 1 142 ? 16.412  -26.180 76.363  1.00 22.61 ? 146 ALA B N   1 
ATOM   3694 C CA  . ALA B 1 142 ? 15.132  -26.729 76.792  1.00 21.55 ? 146 ALA B CA  1 
ATOM   3695 C C   . ALA B 1 142 ? 14.136  -25.580 76.820  1.00 20.53 ? 146 ALA B C   1 
ATOM   3696 O O   . ALA B 1 142 ? 12.967  -25.747 76.473  1.00 19.57 ? 146 ALA B O   1 
ATOM   3697 C CB  . ALA B 1 142 ? 15.256  -27.357 78.178  1.00 22.29 ? 146 ALA B CB  1 
ATOM   3698 N N   . THR B 1 143 ? 14.603  -24.408 77.242  1.00 20.10 ? 147 THR B N   1 
ATOM   3699 C CA  . THR B 1 143 ? 13.741  -23.234 77.285  1.00 19.73 ? 147 THR B CA  1 
ATOM   3700 C C   . THR B 1 143 ? 13.261  -22.971 75.863  1.00 19.49 ? 147 THR B C   1 
ATOM   3701 O O   . THR B 1 143 ? 12.090  -22.680 75.635  1.00 18.63 ? 147 THR B O   1 
ATOM   3702 C CB  . THR B 1 143 ? 14.497  -21.982 77.784  1.00 19.38 ? 147 THR B CB  1 
ATOM   3703 O OG1 . THR B 1 143 ? 14.881  -22.161 79.154  1.00 19.79 ? 147 THR B OG1 1 
ATOM   3704 C CG2 . THR B 1 143 ? 13.617  -20.750 77.667  1.00 18.83 ? 147 THR B CG2 1 
ATOM   3705 N N   . TRP B 1 144 ? 14.178  -23.091 74.909  1.00 19.97 ? 148 TRP B N   1 
ATOM   3706 C CA  . TRP B 1 144 ? 13.846  -22.858 73.510  1.00 20.02 ? 148 TRP B CA  1 
ATOM   3707 C C   . TRP B 1 144 ? 12.802  -23.853 73.017  1.00 20.73 ? 148 TRP B C   1 
ATOM   3708 O O   . TRP B 1 144 ? 11.867  -23.478 72.310  1.00 20.61 ? 148 TRP B O   1 
ATOM   3709 C CB  . TRP B 1 144 ? 15.105  -22.938 72.639  1.00 19.32 ? 148 TRP B CB  1 
ATOM   3710 C CG  . TRP B 1 144 ? 14.838  -22.527 71.233  1.00 17.84 ? 148 TRP B CG  1 
ATOM   3711 C CD1 . TRP B 1 144 ? 14.781  -23.337 70.135  1.00 18.08 ? 148 TRP B CD1 1 
ATOM   3712 C CD2 . TRP B 1 144 ? 14.491  -21.212 70.784  1.00 19.41 ? 148 TRP B CD2 1 
ATOM   3713 N NE1 . TRP B 1 144 ? 14.412  -22.609 69.029  1.00 19.04 ? 148 TRP B NE1 1 
ATOM   3714 C CE2 . TRP B 1 144 ? 14.227  -21.301 69.399  1.00 18.80 ? 148 TRP B CE2 1 
ATOM   3715 C CE3 . TRP B 1 144 ? 14.371  -19.967 71.421  1.00 18.05 ? 148 TRP B CE3 1 
ATOM   3716 C CZ2 . TRP B 1 144 ? 13.848  -20.190 68.635  1.00 18.63 ? 148 TRP B CZ2 1 
ATOM   3717 C CZ3 . TRP B 1 144 ? 13.994  -18.859 70.661  1.00 18.01 ? 148 TRP B CZ3 1 
ATOM   3718 C CH2 . TRP B 1 144 ? 13.737  -18.982 69.281  1.00 18.47 ? 148 TRP B CH2 1 
ATOM   3719 N N   . GLU B 1 145 ? 12.958  -25.121 73.388  1.00 21.55 ? 149 GLU B N   1 
ATOM   3720 C CA  . GLU B 1 145 ? 11.997  -26.140 72.976  1.00 22.42 ? 149 GLU B CA  1 
ATOM   3721 C C   . GLU B 1 145 ? 10.606  -25.723 73.431  1.00 21.11 ? 149 GLU B C   1 
ATOM   3722 O O   . GLU B 1 145 ? 9.620   -25.940 72.727  1.00 20.25 ? 149 GLU B O   1 
ATOM   3723 C CB  . GLU B 1 145 ? 12.349  -27.498 73.591  1.00 24.40 ? 149 GLU B CB  1 
ATOM   3724 C CG  . GLU B 1 145 ? 13.717  -28.020 73.199  1.00 29.26 ? 149 GLU B CG  1 
ATOM   3725 C CD  . GLU B 1 145 ? 14.007  -29.384 73.790  1.00 33.13 ? 149 GLU B CD  1 
ATOM   3726 O OE1 . GLU B 1 145 ? 13.986  -29.512 75.033  1.00 35.46 ? 149 GLU B OE1 1 
ATOM   3727 O OE2 . GLU B 1 145 ? 14.255  -30.329 73.011  1.00 35.27 ? 149 GLU B OE2 1 
ATOM   3728 N N   . ALA B 1 146 ? 10.536  -25.121 74.616  1.00 20.42 ? 150 ALA B N   1 
ATOM   3729 C CA  . ALA B 1 146 ? 9.269   -24.658 75.176  1.00 20.20 ? 150 ALA B CA  1 
ATOM   3730 C C   . ALA B 1 146 ? 8.722   -23.488 74.354  1.00 20.27 ? 150 ALA B C   1 
ATOM   3731 O O   . ALA B 1 146 ? 7.508   -23.328 74.212  1.00 20.13 ? 150 ALA B O   1 
ATOM   3732 C CB  . ALA B 1 146 ? 9.463   -24.240 76.638  1.00 16.92 ? 150 ALA B CB  1 
ATOM   3733 N N   . MET B 1 147 ? 9.625   -22.669 73.820  1.00 20.22 ? 151 MET B N   1 
ATOM   3734 C CA  . MET B 1 147 ? 9.235   -21.529 72.992  1.00 19.61 ? 151 MET B CA  1 
ATOM   3735 C C   . MET B 1 147 ? 8.634   -22.047 71.684  1.00 19.59 ? 151 MET B C   1 
ATOM   3736 O O   . MET B 1 147 ? 7.640   -21.511 71.188  1.00 18.76 ? 151 MET B O   1 
ATOM   3737 C CB  . MET B 1 147 ? 10.454  -20.655 72.674  1.00 18.56 ? 151 MET B CB  1 
ATOM   3738 C CG  . MET B 1 147 ? 11.085  -19.964 73.876  1.00 17.50 ? 151 MET B CG  1 
ATOM   3739 S SD  . MET B 1 147 ? 10.058  -18.658 74.583  1.00 17.14 ? 151 MET B SD  1 
ATOM   3740 C CE  . MET B 1 147 ? 10.486  -17.278 73.535  1.00 16.44 ? 151 MET B CE  1 
ATOM   3741 N N   . GLU B 1 148 ? 9.249   -23.089 71.130  1.00 19.72 ? 152 GLU B N   1 
ATOM   3742 C CA  . GLU B 1 148 ? 8.777   -23.687 69.884  1.00 20.68 ? 152 GLU B CA  1 
ATOM   3743 C C   . GLU B 1 148 ? 7.369   -24.241 70.076  1.00 21.81 ? 152 GLU B C   1 
ATOM   3744 O O   . GLU B 1 148 ? 6.508   -24.096 69.205  1.00 21.35 ? 152 GLU B O   1 
ATOM   3745 C CB  . GLU B 1 148 ? 9.725   -24.807 69.438  1.00 21.85 ? 152 GLU B CB  1 
ATOM   3746 C CG  . GLU B 1 148 ? 11.163  -24.349 69.233  1.00 21.86 ? 152 GLU B CG  1 
ATOM   3747 C CD  . GLU B 1 148 ? 12.080  -25.464 68.768  1.00 24.67 ? 152 GLU B CD  1 
ATOM   3748 O OE1 . GLU B 1 148 ? 12.098  -26.536 69.415  1.00 24.56 ? 152 GLU B OE1 1 
ATOM   3749 O OE2 . GLU B 1 148 ? 12.792  -25.266 67.759  1.00 23.32 ? 152 GLU B OE2 1 
ATOM   3750 N N   . LYS B 1 149 ? 7.135   -24.871 71.224  1.00 21.66 ? 153 LYS B N   1 
ATOM   3751 C CA  . LYS B 1 149 ? 5.822   -25.431 71.517  1.00 22.44 ? 153 LYS B CA  1 
ATOM   3752 C C   . LYS B 1 149 ? 4.786   -24.316 71.567  1.00 21.88 ? 153 LYS B C   1 
ATOM   3753 O O   . LYS B 1 149 ? 3.646   -24.501 71.140  1.00 23.17 ? 153 LYS B O   1 
ATOM   3754 C CB  . LYS B 1 149 ? 5.857   -26.196 72.843  1.00 24.24 ? 153 LYS B CB  1 
ATOM   3755 C CG  . LYS B 1 149 ? 6.747   -27.432 72.801  1.00 27.28 ? 153 LYS B CG  1 
ATOM   3756 C CD  . LYS B 1 149 ? 6.750   -28.180 74.124  1.00 29.43 ? 153 LYS B CD  1 
ATOM   3757 C CE  . LYS B 1 149 ? 7.615   -29.429 74.036  1.00 29.65 ? 153 LYS B CE  1 
ATOM   3758 N NZ  . LYS B 1 149 ? 7.700   -30.149 75.337  1.00 32.44 ? 153 LYS B NZ  1 
ATOM   3759 N N   . CYS B 1 150 ? 5.182   -23.153 72.080  1.00 21.46 ? 154 CYS B N   1 
ATOM   3760 C CA  . CYS B 1 150 ? 4.266   -22.018 72.152  1.00 21.92 ? 154 CYS B CA  1 
ATOM   3761 C C   . CYS B 1 150 ? 3.886   -21.585 70.741  1.00 20.62 ? 154 CYS B C   1 
ATOM   3762 O O   . CYS B 1 150 ? 2.748   -21.186 70.487  1.00 20.37 ? 154 CYS B O   1 
ATOM   3763 C CB  . CYS B 1 150 ? 4.907   -20.847 72.901  1.00 21.33 ? 154 CYS B CB  1 
ATOM   3764 S SG  . CYS B 1 150 ? 5.087   -21.105 74.686  1.00 22.14 ? 154 CYS B SG  1 
ATOM   3765 N N   . LYS B 1 151 ? 4.845   -21.665 69.825  1.00 19.87 ? 155 LYS B N   1 
ATOM   3766 C CA  . LYS B 1 151 ? 4.596   -21.300 68.436  1.00 20.29 ? 155 LYS B CA  1 
ATOM   3767 C C   . LYS B 1 151 ? 3.656   -22.329 67.806  1.00 21.34 ? 155 LYS B C   1 
ATOM   3768 O O   . LYS B 1 151 ? 2.687   -21.967 67.135  1.00 20.67 ? 155 LYS B O   1 
ATOM   3769 C CB  . LYS B 1 151 ? 5.916   -21.238 67.657  1.00 20.13 ? 155 LYS B CB  1 
ATOM   3770 C CG  . LYS B 1 151 ? 5.766   -20.970 66.161  1.00 21.03 ? 155 LYS B CG  1 
ATOM   3771 C CD  . LYS B 1 151 ? 7.134   -20.753 65.510  1.00 20.22 ? 155 LYS B CD  1 
ATOM   3772 C CE  . LYS B 1 151 ? 7.069   -20.841 63.988  1.00 18.51 ? 155 LYS B CE  1 
ATOM   3773 N NZ  . LYS B 1 151 ? 6.147   -19.840 63.386  1.00 18.67 ? 155 LYS B NZ  1 
ATOM   3774 N N   . ASP B 1 152 ? 3.934   -23.610 68.026  1.00 21.52 ? 156 ASP B N   1 
ATOM   3775 C CA  . ASP B 1 152 ? 3.083   -24.658 67.472  1.00 23.37 ? 156 ASP B CA  1 
ATOM   3776 C C   . ASP B 1 152 ? 1.693   -24.619 68.083  1.00 23.57 ? 156 ASP B C   1 
ATOM   3777 O O   . ASP B 1 152 ? 0.719   -25.039 67.456  1.00 24.13 ? 156 ASP B O   1 
ATOM   3778 C CB  . ASP B 1 152 ? 3.693   -26.041 67.695  1.00 23.18 ? 156 ASP B CB  1 
ATOM   3779 C CG  . ASP B 1 152 ? 4.817   -26.339 66.733  1.00 24.03 ? 156 ASP B CG  1 
ATOM   3780 O OD1 . ASP B 1 152 ? 4.726   -25.897 65.568  1.00 25.28 ? 156 ASP B OD1 1 
ATOM   3781 O OD2 . ASP B 1 152 ? 5.779   -27.023 67.132  1.00 25.17 ? 156 ASP B OD2 1 
ATOM   3782 N N   . ALA B 1 153 ? 1.602   -24.113 69.307  1.00 23.92 ? 157 ALA B N   1 
ATOM   3783 C CA  . ALA B 1 153 ? 0.319   -24.020 69.991  1.00 23.67 ? 157 ALA B CA  1 
ATOM   3784 C C   . ALA B 1 153 ? -0.470  -22.818 69.482  1.00 22.99 ? 157 ALA B C   1 
ATOM   3785 O O   . ALA B 1 153 ? -1.641  -22.649 69.817  1.00 23.09 ? 157 ALA B O   1 
ATOM   3786 C CB  . ALA B 1 153 ? 0.535   -23.910 71.497  1.00 24.46 ? 157 ALA B CB  1 
ATOM   3787 N N   . GLY B 1 154 ? 0.177   -21.982 68.677  1.00 21.45 ? 158 GLY B N   1 
ATOM   3788 C CA  . GLY B 1 154 ? -0.496  -20.816 68.132  1.00 20.84 ? 158 GLY B CA  1 
ATOM   3789 C C   . GLY B 1 154 ? -0.573  -19.626 69.072  1.00 20.13 ? 158 GLY B C   1 
ATOM   3790 O O   . GLY B 1 154 ? -1.240  -18.636 68.769  1.00 19.44 ? 158 GLY B O   1 
ATOM   3791 N N   . LEU B 1 155 ? 0.110   -19.712 70.209  1.00 19.06 ? 159 LEU B N   1 
ATOM   3792 C CA  . LEU B 1 155 ? 0.105   -18.621 71.178  1.00 18.88 ? 159 LEU B CA  1 
ATOM   3793 C C   . LEU B 1 155 ? 0.982   -17.466 70.696  1.00 17.75 ? 159 LEU B C   1 
ATOM   3794 O O   . LEU B 1 155 ? 0.799   -16.321 71.110  1.00 17.36 ? 159 LEU B O   1 
ATOM   3795 C CB  . LEU B 1 155 ? 0.589   -19.123 72.543  1.00 20.94 ? 159 LEU B CB  1 
ATOM   3796 C CG  . LEU B 1 155 ? -0.316  -20.158 73.218  1.00 21.30 ? 159 LEU B CG  1 
ATOM   3797 C CD1 . LEU B 1 155 ? 0.262   -20.559 74.567  1.00 24.01 ? 159 LEU B CD1 1 
ATOM   3798 C CD2 . LEU B 1 155 ? -1.710  -19.574 73.393  1.00 22.61 ? 159 LEU B CD2 1 
ATOM   3799 N N   . THR B 1 156 ? 1.934   -17.778 69.824  1.00 16.02 ? 160 THR B N   1 
ATOM   3800 C CA  . THR B 1 156 ? 2.824   -16.771 69.253  1.00 16.68 ? 160 THR B CA  1 
ATOM   3801 C C   . THR B 1 156 ? 3.136   -17.176 67.815  1.00 16.70 ? 160 THR B C   1 
ATOM   3802 O O   . THR B 1 156 ? 3.335   -18.357 67.531  1.00 17.09 ? 160 THR B O   1 
ATOM   3803 C CB  . THR B 1 156 ? 4.147   -16.654 70.046  1.00 15.53 ? 160 THR B CB  1 
ATOM   3804 O OG1 . THR B 1 156 ? 4.975   -15.647 69.447  1.00 17.12 ? 160 THR B OG1 1 
ATOM   3805 C CG2 . THR B 1 156 ? 4.892   -17.986 70.055  1.00 19.12 ? 160 THR B CG2 1 
ATOM   3806 N N   . LYS B 1 157 ? 3.174   -16.206 66.906  1.00 16.09 ? 161 LYS B N   1 
ATOM   3807 C CA  . LYS B 1 157 ? 3.459   -16.510 65.507  1.00 16.32 ? 161 LYS B CA  1 
ATOM   3808 C C   . LYS B 1 157 ? 4.937   -16.784 65.273  1.00 15.51 ? 161 LYS B C   1 
ATOM   3809 O O   . LYS B 1 157 ? 5.294   -17.707 64.542  1.00 16.63 ? 161 LYS B O   1 
ATOM   3810 C CB  . LYS B 1 157 ? 2.991   -15.366 64.605  1.00 17.35 ? 161 LYS B CB  1 
ATOM   3811 C CG  . LYS B 1 157 ? 1.478   -15.159 64.607  1.00 18.07 ? 161 LYS B CG  1 
ATOM   3812 C CD  . LYS B 1 157 ? 1.061   -14.036 63.665  1.00 20.93 ? 161 LYS B CD  1 
ATOM   3813 C CE  . LYS B 1 157 ? 1.354   -14.380 62.205  1.00 22.45 ? 161 LYS B CE  1 
ATOM   3814 N NZ  . LYS B 1 157 ? 1.025   -13.249 61.287  1.00 22.01 ? 161 LYS B NZ  1 
ATOM   3815 N N   . SER B 1 158 ? 5.795   -15.983 65.898  1.00 14.95 ? 162 SER B N   1 
ATOM   3816 C CA  . SER B 1 158 ? 7.237   -16.146 65.758  1.00 14.34 ? 162 SER B CA  1 
ATOM   3817 C C   . SER B 1 158 ? 7.921   -16.129 67.122  1.00 14.14 ? 162 SER B C   1 
ATOM   3818 O O   . SER B 1 158 ? 7.365   -15.630 68.100  1.00 14.63 ? 162 SER B O   1 
ATOM   3819 C CB  . SER B 1 158 ? 7.817   -15.027 64.888  1.00 12.66 ? 162 SER B CB  1 
ATOM   3820 O OG  . SER B 1 158 ? 7.219   -15.015 63.602  1.00 15.11 ? 162 SER B OG  1 
ATOM   3821 N N   . ILE B 1 159 ? 9.129   -16.678 67.180  1.00 14.75 ? 163 ILE B N   1 
ATOM   3822 C CA  . ILE B 1 159 ? 9.891   -16.714 68.422  1.00 14.52 ? 163 ILE B CA  1 
ATOM   3823 C C   . ILE B 1 159 ? 11.318  -16.256 68.173  1.00 14.86 ? 163 ILE B C   1 
ATOM   3824 O O   . ILE B 1 159 ? 11.888  -16.499 67.103  1.00 15.30 ? 163 ILE B O   1 
ATOM   3825 C CB  . ILE B 1 159 ? 9.913   -18.132 69.041  1.00 15.38 ? 163 ILE B CB  1 
ATOM   3826 C CG1 . ILE B 1 159 ? 10.377  -19.159 68.002  1.00 13.30 ? 163 ILE B CG1 1 
ATOM   3827 C CG2 . ILE B 1 159 ? 8.533   -18.486 69.572  1.00 15.01 ? 163 ILE B CG2 1 
ATOM   3828 C CD1 . ILE B 1 159 ? 10.302  -20.589 68.487  1.00 15.30 ? 163 ILE B CD1 1 
ATOM   3829 N N   . GLY B 1 160 ? 11.885  -15.578 69.163  1.00 14.51 ? 164 GLY B N   1 
ATOM   3830 C CA  . GLY B 1 160 ? 13.243  -15.085 69.046  1.00 13.65 ? 164 GLY B CA  1 
ATOM   3831 C C   . GLY B 1 160 ? 13.888  -14.957 70.410  1.00 13.72 ? 164 GLY B C   1 
ATOM   3832 O O   . GLY B 1 160 ? 13.399  -15.513 71.393  1.00 15.58 ? 164 GLY B O   1 
ATOM   3833 N N   . VAL B 1 161 ? 14.993  -14.227 70.469  1.00 12.46 ? 165 VAL B N   1 
ATOM   3834 C CA  . VAL B 1 161 ? 15.707  -14.026 71.718  1.00 12.41 ? 165 VAL B CA  1 
ATOM   3835 C C   . VAL B 1 161 ? 16.094  -12.562 71.857  1.00 12.88 ? 165 VAL B C   1 
ATOM   3836 O O   . VAL B 1 161 ? 15.951  -11.775 70.917  1.00 11.21 ? 165 VAL B O   1 
ATOM   3837 C CB  . VAL B 1 161 ? 16.996  -14.891 71.781  1.00 13.09 ? 165 VAL B CB  1 
ATOM   3838 C CG1 . VAL B 1 161 ? 16.635  -16.369 71.723  1.00 12.07 ? 165 VAL B CG1 1 
ATOM   3839 C CG2 . VAL B 1 161 ? 17.928  -14.527 70.635  1.00 12.34 ? 165 VAL B CG2 1 
ATOM   3840 N N   . SER B 1 162 ? 16.585  -12.205 73.038  1.00 11.92 ? 166 SER B N   1 
ATOM   3841 C CA  . SER B 1 162 ? 17.009  -10.846 73.311  1.00 11.76 ? 166 SER B CA  1 
ATOM   3842 C C   . SER B 1 162 ? 18.240  -10.894 74.207  1.00 12.52 ? 166 SER B C   1 
ATOM   3843 O O   . SER B 1 162 ? 18.333  -11.733 75.100  1.00 11.11 ? 166 SER B O   1 
ATOM   3844 C CB  . SER B 1 162 ? 15.885  -10.071 74.010  1.00 11.42 ? 166 SER B CB  1 
ATOM   3845 O OG  . SER B 1 162 ? 16.261  -8.725  74.258  1.00 10.04 ? 166 SER B OG  1 
ATOM   3846 N N   . ASN B 1 163 ? 19.191  -10.004 73.949  1.00 13.49 ? 167 ASN B N   1 
ATOM   3847 C CA  . ASN B 1 163 ? 20.410  -9.928  74.748  1.00 12.75 ? 167 ASN B CA  1 
ATOM   3848 C C   . ASN B 1 163 ? 21.294  -11.183 74.719  1.00 12.70 ? 167 ASN B C   1 
ATOM   3849 O O   . ASN B 1 163 ? 21.961  -11.507 75.706  1.00 11.85 ? 167 ASN B O   1 
ATOM   3850 C CB  . ASN B 1 163 ? 20.037  -9.568  76.191  1.00 12.66 ? 167 ASN B CB  1 
ATOM   3851 C CG  . ASN B 1 163 ? 19.328  -8.227  76.287  1.00 11.34 ? 167 ASN B CG  1 
ATOM   3852 O OD1 . ASN B 1 163 ? 18.292  -8.097  76.948  1.00 15.47 ? 167 ASN B OD1 1 
ATOM   3853 N ND2 . ASN B 1 163 ? 19.884  -7.219  75.626  1.00 7.89  ? 167 ASN B ND2 1 
ATOM   3854 N N   . PHE B 1 164 ? 21.299  -11.877 73.585  1.00 12.53 ? 168 PHE B N   1 
ATOM   3855 C CA  . PHE B 1 164 ? 22.121  -13.077 73.393  1.00 13.63 ? 168 PHE B CA  1 
ATOM   3856 C C   . PHE B 1 164 ? 23.397  -12.700 72.630  1.00 13.26 ? 168 PHE B C   1 
ATOM   3857 O O   . PHE B 1 164 ? 23.347  -11.867 71.729  1.00 14.30 ? 168 PHE B O   1 
ATOM   3858 C CB  . PHE B 1 164 ? 21.364  -14.112 72.551  1.00 13.39 ? 168 PHE B CB  1 
ATOM   3859 C CG  . PHE B 1 164 ? 20.491  -15.048 73.345  1.00 13.79 ? 168 PHE B CG  1 
ATOM   3860 C CD1 . PHE B 1 164 ? 19.549  -14.563 74.245  1.00 13.91 ? 168 PHE B CD1 1 
ATOM   3861 C CD2 . PHE B 1 164 ? 20.583  -16.424 73.149  1.00 15.39 ? 168 PHE B CD2 1 
ATOM   3862 C CE1 . PHE B 1 164 ? 18.709  -15.439 74.936  1.00 15.87 ? 168 PHE B CE1 1 
ATOM   3863 C CE2 . PHE B 1 164 ? 19.752  -17.304 73.831  1.00 15.06 ? 168 PHE B CE2 1 
ATOM   3864 C CZ  . PHE B 1 164 ? 18.813  -16.812 74.726  1.00 15.43 ? 168 PHE B CZ  1 
ATOM   3865 N N   . ASN B 1 165 ? 24.543  -13.281 72.989  1.00 14.18 ? 169 ASN B N   1 
ATOM   3866 C CA  . ASN B 1 165 ? 25.756  -12.996 72.230  1.00 13.72 ? 169 ASN B CA  1 
ATOM   3867 C C   . ASN B 1 165 ? 25.795  -14.078 71.147  1.00 14.88 ? 169 ASN B C   1 
ATOM   3868 O O   . ASN B 1 165 ? 25.062  -15.064 71.240  1.00 14.24 ? 169 ASN B O   1 
ATOM   3869 C CB  . ASN B 1 165 ? 27.021  -13.029 73.108  1.00 13.89 ? 169 ASN B CB  1 
ATOM   3870 C CG  . ASN B 1 165 ? 27.212  -14.346 73.835  1.00 14.61 ? 169 ASN B CG  1 
ATOM   3871 O OD1 . ASN B 1 165 ? 27.079  -15.421 73.249  1.00 17.02 ? 169 ASN B OD1 1 
ATOM   3872 N ND2 . ASN B 1 165 ? 27.551  -14.266 75.120  1.00 12.69 ? 169 ASN B ND2 1 
ATOM   3873 N N   . TYR B 1 166 ? 26.621  -13.909 70.121  1.00 14.87 ? 170 TYR B N   1 
ATOM   3874 C CA  . TYR B 1 166 ? 26.652  -14.900 69.045  1.00 15.29 ? 170 TYR B CA  1 
ATOM   3875 C C   . TYR B 1 166 ? 26.975  -16.322 69.494  1.00 15.83 ? 170 TYR B C   1 
ATOM   3876 O O   . TYR B 1 166 ? 26.527  -17.285 68.868  1.00 15.78 ? 170 TYR B O   1 
ATOM   3877 C CB  . TYR B 1 166 ? 27.601  -14.456 67.922  1.00 15.60 ? 170 TYR B CB  1 
ATOM   3878 C CG  . TYR B 1 166 ? 29.047  -14.285 68.320  1.00 16.77 ? 170 TYR B CG  1 
ATOM   3879 C CD1 . TYR B 1 166 ? 29.876  -15.390 68.507  1.00 17.16 ? 170 TYR B CD1 1 
ATOM   3880 C CD2 . TYR B 1 166 ? 29.589  -13.012 68.500  1.00 18.20 ? 170 TYR B CD2 1 
ATOM   3881 C CE1 . TYR B 1 166 ? 31.215  -15.231 68.865  1.00 19.17 ? 170 TYR B CE1 1 
ATOM   3882 C CE2 . TYR B 1 166 ? 30.921  -12.839 68.857  1.00 19.31 ? 170 TYR B CE2 1 
ATOM   3883 C CZ  . TYR B 1 166 ? 31.729  -13.951 69.039  1.00 18.60 ? 170 TYR B CZ  1 
ATOM   3884 O OH  . TYR B 1 166 ? 33.042  -13.780 69.414  1.00 18.49 ? 170 TYR B OH  1 
ATOM   3885 N N   . ARG B 1 167 ? 27.738  -16.465 70.575  1.00 15.54 ? 171 ARG B N   1 
ATOM   3886 C CA  . ARG B 1 167 ? 28.064  -17.797 71.073  1.00 16.06 ? 171 ARG B CA  1 
ATOM   3887 C C   . ARG B 1 167 ? 26.798  -18.490 71.561  1.00 15.83 ? 171 ARG B C   1 
ATOM   3888 O O   . ARG B 1 167 ? 26.604  -19.682 71.342  1.00 16.30 ? 171 ARG B O   1 
ATOM   3889 C CB  . ARG B 1 167 ? 29.073  -17.722 72.221  1.00 18.99 ? 171 ARG B CB  1 
ATOM   3890 C CG  . ARG B 1 167 ? 30.512  -17.495 71.789  1.00 22.80 ? 171 ARG B CG  1 
ATOM   3891 C CD  . ARG B 1 167 ? 31.441  -17.561 72.999  1.00 27.36 ? 171 ARG B CD  1 
ATOM   3892 N NE  . ARG B 1 167 ? 32.855  -17.474 72.637  1.00 31.78 ? 171 ARG B NE  1 
ATOM   3893 C CZ  . ARG B 1 167 ? 33.429  -16.399 72.106  1.00 34.20 ? 171 ARG B CZ  1 
ATOM   3894 N NH1 . ARG B 1 167 ? 32.711  -15.309 71.871  1.00 35.62 ? 171 ARG B NH1 1 
ATOM   3895 N NH2 . ARG B 1 167 ? 34.724  -16.412 71.812  1.00 35.37 ? 171 ARG B NH2 1 
ATOM   3896 N N   . GLN B 1 168 ? 25.933  -17.732 72.225  1.00 14.97 ? 172 GLN B N   1 
ATOM   3897 C CA  . GLN B 1 168 ? 24.685  -18.278 72.736  1.00 13.87 ? 172 GLN B CA  1 
ATOM   3898 C C   . GLN B 1 168 ? 23.716  -18.570 71.589  1.00 13.65 ? 172 GLN B C   1 
ATOM   3899 O O   . GLN B 1 168 ? 22.932  -19.520 71.653  1.00 13.30 ? 172 GLN B O   1 
ATOM   3900 C CB  . GLN B 1 168 ? 24.080  -17.302 73.748  1.00 13.69 ? 172 GLN B CB  1 
ATOM   3901 C CG  . GLN B 1 168 ? 25.031  -17.048 74.923  1.00 16.25 ? 172 GLN B CG  1 
ATOM   3902 C CD  . GLN B 1 168 ? 24.585  -15.924 75.835  1.00 18.94 ? 172 GLN B CD  1 
ATOM   3903 O OE1 . GLN B 1 168 ? 24.159  -14.865 75.373  1.00 18.72 ? 172 GLN B OE1 1 
ATOM   3904 N NE2 . GLN B 1 168 ? 24.703  -16.140 77.142  1.00 18.15 ? 172 GLN B NE2 1 
ATOM   3905 N N   . LEU B 1 169 ? 23.776  -17.761 70.536  1.00 12.88 ? 173 LEU B N   1 
ATOM   3906 C CA  . LEU B 1 169 ? 22.912  -17.981 69.382  1.00 14.73 ? 173 LEU B CA  1 
ATOM   3907 C C   . LEU B 1 169 ? 23.315  -19.292 68.700  1.00 15.69 ? 173 LEU B C   1 
ATOM   3908 O O   . LEU B 1 169 ? 22.463  -20.096 68.324  1.00 17.27 ? 173 LEU B O   1 
ATOM   3909 C CB  . LEU B 1 169 ? 23.036  -16.823 68.386  1.00 15.33 ? 173 LEU B CB  1 
ATOM   3910 C CG  . LEU B 1 169 ? 22.453  -15.463 68.782  1.00 17.22 ? 173 LEU B CG  1 
ATOM   3911 C CD1 . LEU B 1 169 ? 22.816  -14.430 67.725  1.00 15.50 ? 173 LEU B CD1 1 
ATOM   3912 C CD2 . LEU B 1 169 ? 20.939  -15.569 68.926  1.00 16.54 ? 173 LEU B CD2 1 
ATOM   3913 N N   . GLU B 1 170 ? 24.618  -19.508 68.552  1.00 16.58 ? 174 GLU B N   1 
ATOM   3914 C CA  . GLU B 1 170 ? 25.111  -20.723 67.911  1.00 18.34 ? 174 GLU B CA  1 
ATOM   3915 C C   . GLU B 1 170 ? 24.666  -21.967 68.668  1.00 19.11 ? 174 GLU B C   1 
ATOM   3916 O O   . GLU B 1 170 ? 24.335  -22.983 68.059  1.00 18.41 ? 174 GLU B O   1 
ATOM   3917 C CB  . GLU B 1 170 ? 26.636  -20.687 67.808  1.00 21.09 ? 174 GLU B CB  1 
ATOM   3918 C CG  . GLU B 1 170 ? 27.144  -19.505 67.007  1.00 24.25 ? 174 GLU B CG  1 
ATOM   3919 C CD  . GLU B 1 170 ? 28.641  -19.521 66.810  1.00 27.15 ? 174 GLU B CD  1 
ATOM   3920 O OE1 . GLU B 1 170 ? 29.385  -19.558 67.815  1.00 27.83 ? 174 GLU B OE1 1 
ATOM   3921 O OE2 . GLU B 1 170 ? 29.075  -19.494 65.640  1.00 30.33 ? 174 GLU B OE2 1 
ATOM   3922 N N   . MET B 1 171 ? 24.652  -21.886 69.996  1.00 19.40 ? 175 MET B N   1 
ATOM   3923 C CA  . MET B 1 171 ? 24.227  -23.015 70.812  1.00 19.97 ? 175 MET B CA  1 
ATOM   3924 C C   . MET B 1 171 ? 22.821  -23.437 70.394  1.00 19.55 ? 175 MET B C   1 
ATOM   3925 O O   . MET B 1 171 ? 22.544  -24.624 70.200  1.00 19.38 ? 175 MET B O   1 
ATOM   3926 C CB  . MET B 1 171 ? 24.228  -22.631 72.294  1.00 21.82 ? 175 MET B CB  1 
ATOM   3927 C CG  . MET B 1 171 ? 23.781  -23.758 73.214  1.00 25.44 ? 175 MET B CG  1 
ATOM   3928 S SD  . MET B 1 171 ? 23.768  -23.272 74.954  1.00 29.29 ? 175 MET B SD  1 
ATOM   3929 C CE  . MET B 1 171 ? 22.159  -22.518 75.068  1.00 28.08 ? 175 MET B CE  1 
ATOM   3930 N N   . ILE B 1 172 ? 21.939  -22.453 70.249  1.00 18.91 ? 176 ILE B N   1 
ATOM   3931 C CA  . ILE B 1 172 ? 20.559  -22.703 69.848  1.00 19.55 ? 176 ILE B CA  1 
ATOM   3932 C C   . ILE B 1 172 ? 20.478  -23.193 68.403  1.00 19.15 ? 176 ILE B C   1 
ATOM   3933 O O   . ILE B 1 172 ? 19.792  -24.173 68.108  1.00 19.34 ? 176 ILE B O   1 
ATOM   3934 C CB  . ILE B 1 172 ? 19.703  -21.425 69.980  1.00 20.26 ? 176 ILE B CB  1 
ATOM   3935 C CG1 . ILE B 1 172 ? 19.749  -20.918 71.421  1.00 21.73 ? 176 ILE B CG1 1 
ATOM   3936 C CG2 . ILE B 1 172 ? 18.266  -21.708 69.565  1.00 20.21 ? 176 ILE B CG2 1 
ATOM   3937 C CD1 . ILE B 1 172 ? 19.246  -21.918 72.444  1.00 23.02 ? 176 ILE B CD1 1 
ATOM   3938 N N   . LEU B 1 173 ? 21.180  -22.506 67.507  1.00 18.86 ? 177 LEU B N   1 
ATOM   3939 C CA  . LEU B 1 173 ? 21.180  -22.863 66.089  1.00 19.09 ? 177 LEU B CA  1 
ATOM   3940 C C   . LEU B 1 173 ? 21.708  -24.273 65.824  1.00 20.40 ? 177 LEU B C   1 
ATOM   3941 O O   . LEU B 1 173 ? 21.284  -24.923 64.873  1.00 19.56 ? 177 LEU B O   1 
ATOM   3942 C CB  . LEU B 1 173 ? 22.009  -21.849 65.290  1.00 17.59 ? 177 LEU B CB  1 
ATOM   3943 C CG  . LEU B 1 173 ? 21.467  -20.417 65.199  1.00 16.24 ? 177 LEU B CG  1 
ATOM   3944 C CD1 . LEU B 1 173 ? 22.536  -19.494 64.620  1.00 17.08 ? 177 LEU B CD1 1 
ATOM   3945 C CD2 . LEU B 1 173 ? 20.214  -20.392 64.335  1.00 14.75 ? 177 LEU B CD2 1 
ATOM   3946 N N   . ASN B 1 174 ? 22.625  -24.745 66.665  1.00 22.34 ? 178 ASN B N   1 
ATOM   3947 C CA  . ASN B 1 174 ? 23.206  -26.079 66.500  1.00 24.80 ? 178 ASN B CA  1 
ATOM   3948 C C   . ASN B 1 174 ? 22.515  -27.146 67.343  1.00 26.42 ? 178 ASN B C   1 
ATOM   3949 O O   . ASN B 1 174 ? 22.932  -28.304 67.361  1.00 25.84 ? 178 ASN B O   1 
ATOM   3950 C CB  . ASN B 1 174 ? 24.692  -26.054 66.852  1.00 26.75 ? 178 ASN B CB  1 
ATOM   3951 C CG  . ASN B 1 174 ? 25.479  -25.135 65.956  1.00 27.29 ? 178 ASN B CG  1 
ATOM   3952 O OD1 . ASN B 1 174 ? 25.345  -25.183 64.733  1.00 28.04 ? 178 ASN B OD1 1 
ATOM   3953 N ND2 . ASN B 1 174 ? 26.311  -24.290 66.554  1.00 30.98 ? 178 ASN B ND2 1 
ATOM   3954 N N   . LYS B 1 175 ? 21.458  -26.747 68.037  1.00 26.34 ? 179 LYS B N   1 
ATOM   3955 C CA  . LYS B 1 175 ? 20.705  -27.654 68.891  1.00 27.31 ? 179 LYS B CA  1 
ATOM   3956 C C   . LYS B 1 175 ? 20.160  -28.878 68.152  1.00 27.44 ? 179 LYS B C   1 
ATOM   3957 O O   . LYS B 1 175 ? 19.565  -28.759 67.081  1.00 28.13 ? 179 LYS B O   1 
ATOM   3958 C CB  . LYS B 1 175 ? 19.543  -26.899 69.536  1.00 28.04 ? 179 LYS B CB  1 
ATOM   3959 C CG  . LYS B 1 175 ? 18.571  -27.790 70.272  1.00 31.04 ? 179 LYS B CG  1 
ATOM   3960 C CD  . LYS B 1 175 ? 17.342  -27.025 70.712  1.00 29.38 ? 179 LYS B CD  1 
ATOM   3961 C CE  . LYS B 1 175 ? 16.370  -27.954 71.400  1.00 29.73 ? 179 LYS B CE  1 
ATOM   3962 N NZ  . LYS B 1 175 ? 15.957  -29.071 70.510  1.00 29.89 ? 179 LYS B NZ  1 
ATOM   3963 N N   . PRO B 1 176 ? 20.360  -30.077 68.720  0.75 26.67 ? 180 PRO B N   1 
ATOM   3964 C CA  . PRO B 1 176 ? 19.863  -31.298 68.081  0.75 25.44 ? 180 PRO B CA  1 
ATOM   3965 C C   . PRO B 1 176 ? 18.338  -31.255 67.994  0.75 25.04 ? 180 PRO B C   1 
ATOM   3966 O O   . PRO B 1 176 ? 17.665  -30.911 68.966  0.75 25.27 ? 180 PRO B O   1 
ATOM   3967 C CB  . PRO B 1 176 ? 20.350  -32.401 69.020  0.75 25.90 ? 180 PRO B CB  1 
ATOM   3968 C CG  . PRO B 1 176 ? 21.614  -31.826 69.588  0.75 25.59 ? 180 PRO B CG  1 
ATOM   3969 C CD  . PRO B 1 176 ? 21.210  -30.400 69.880  0.75 25.92 ? 180 PRO B CD  1 
ATOM   3970 N N   . GLY B 1 177 ? 17.798  -31.589 66.828  0.75 24.61 ? 181 GLY B N   1 
ATOM   3971 C CA  . GLY B 1 177 ? 16.356  -31.588 66.661  1.00 26.20 ? 181 GLY B CA  1 
ATOM   3972 C C   . GLY B 1 177 ? 15.716  -30.211 66.625  1.00 26.66 ? 181 GLY B C   1 
ATOM   3973 O O   . GLY B 1 177 ? 14.506  -30.081 66.828  1.00 27.26 ? 181 GLY B O   1 
ATOM   3974 N N   . LEU B 1 178 ? 16.516  -29.179 66.370  1.00 25.65 ? 182 LEU B N   1 
ATOM   3975 C CA  . LEU B 1 178 ? 15.994  -27.816 66.302  1.00 24.82 ? 182 LEU B CA  1 
ATOM   3976 C C   . LEU B 1 178 ? 14.820  -27.761 65.333  1.00 23.46 ? 182 LEU B C   1 
ATOM   3977 O O   . LEU B 1 178 ? 14.891  -28.312 64.238  1.00 23.71 ? 182 LEU B O   1 
ATOM   3978 C CB  . LEU B 1 178 ? 17.083  -26.853 65.825  1.00 25.29 ? 182 LEU B CB  1 
ATOM   3979 C CG  . LEU B 1 178 ? 16.644  -25.396 65.666  1.00 26.81 ? 182 LEU B CG  1 
ATOM   3980 C CD1 . LEU B 1 178 ? 16.231  -24.838 67.025  1.00 27.90 ? 182 LEU B CD1 1 
ATOM   3981 C CD2 . LEU B 1 178 ? 17.782  -24.580 65.071  1.00 26.36 ? 182 LEU B CD2 1 
ATOM   3982 N N   . LYS B 1 179 ? 13.741  -27.092 65.730  1.00 22.57 ? 183 LYS B N   1 
ATOM   3983 C CA  . LYS B 1 179 ? 12.570  -26.988 64.866  1.00 22.09 ? 183 LYS B CA  1 
ATOM   3984 C C   . LYS B 1 179 ? 12.408  -25.601 64.249  1.00 21.72 ? 183 LYS B C   1 
ATOM   3985 O O   . LYS B 1 179 ? 12.102  -25.475 63.064  1.00 21.17 ? 183 LYS B O   1 
ATOM   3986 C CB  . LYS B 1 179 ? 11.303  -27.358 65.640  1.00 23.59 ? 183 LYS B CB  1 
ATOM   3987 C CG  . LYS B 1 179 ? 10.056  -27.415 64.770  1.00 24.64 ? 183 LYS B CG  1 
ATOM   3988 C CD  . LYS B 1 179 ? 8.888   -28.044 65.507  1.00 26.16 ? 183 LYS B CD  1 
ATOM   3989 C CE  . LYS B 1 179 ? 7.682   -28.202 64.590  1.00 26.50 ? 183 LYS B CE  1 
ATOM   3990 N NZ  . LYS B 1 179 ? 6.573   -28.947 65.258  1.00 26.59 ? 183 LYS B NZ  1 
ATOM   3991 N N   . TYR B 1 180 ? 12.614  -24.562 65.052  1.00 19.38 ? 184 TYR B N   1 
ATOM   3992 C CA  . TYR B 1 180 ? 12.484  -23.193 64.565  1.00 18.58 ? 184 TYR B CA  1 
ATOM   3993 C C   . TYR B 1 180 ? 13.670  -22.357 65.025  1.00 18.34 ? 184 TYR B C   1 
ATOM   3994 O O   . TYR B 1 180 ? 13.995  -22.335 66.212  1.00 19.38 ? 184 TYR B O   1 
ATOM   3995 C CB  . TYR B 1 180 ? 11.200  -22.551 65.097  1.00 17.04 ? 184 TYR B CB  1 
ATOM   3996 C CG  . TYR B 1 180 ? 9.928   -23.283 64.738  1.00 18.06 ? 184 TYR B CG  1 
ATOM   3997 C CD1 . TYR B 1 180 ? 9.063   -23.739 65.731  1.00 17.92 ? 184 TYR B CD1 1 
ATOM   3998 C CD2 . TYR B 1 180 ? 9.579   -23.505 63.407  1.00 18.24 ? 184 TYR B CD2 1 
ATOM   3999 C CE1 . TYR B 1 180 ? 7.874   -24.403 65.404  1.00 21.06 ? 184 TYR B CE1 1 
ATOM   4000 C CE2 . TYR B 1 180 ? 8.399   -24.163 63.069  1.00 19.80 ? 184 TYR B CE2 1 
ATOM   4001 C CZ  . TYR B 1 180 ? 7.551   -24.609 64.069  1.00 22.14 ? 184 TYR B CZ  1 
ATOM   4002 O OH  . TYR B 1 180 ? 6.385   -25.265 63.734  1.00 23.08 ? 184 TYR B OH  1 
ATOM   4003 N N   . LYS B 1 181 ? 14.314  -21.676 64.085  1.00 17.10 ? 185 LYS B N   1 
ATOM   4004 C CA  . LYS B 1 181 ? 15.447  -20.817 64.407  1.00 17.61 ? 185 LYS B CA  1 
ATOM   4005 C C   . LYS B 1 181 ? 14.901  -19.523 64.992  1.00 15.53 ? 185 LYS B C   1 
ATOM   4006 O O   . LYS B 1 181 ? 13.770  -19.139 64.705  1.00 16.36 ? 185 LYS B O   1 
ATOM   4007 C CB  . LYS B 1 181 ? 16.242  -20.485 63.142  1.00 17.34 ? 185 LYS B CB  1 
ATOM   4008 C CG  . LYS B 1 181 ? 16.942  -21.669 62.501  1.00 19.97 ? 185 LYS B CG  1 
ATOM   4009 C CD  . LYS B 1 181 ? 17.386  -21.351 61.074  1.00 23.85 ? 185 LYS B CD  1 
ATOM   4010 C CE  . LYS B 1 181 ? 18.306  -20.144 61.015  1.00 24.32 ? 185 LYS B CE  1 
ATOM   4011 N NZ  . LYS B 1 181 ? 18.755  -19.856 59.620  1.00 23.96 ? 185 LYS B NZ  1 
ATOM   4012 N N   . PRO B 1 182 ? 15.688  -18.839 65.833  1.00 14.85 ? 186 PRO B N   1 
ATOM   4013 C CA  . PRO B 1 182 ? 15.188  -17.585 66.396  1.00 13.71 ? 186 PRO B CA  1 
ATOM   4014 C C   . PRO B 1 182 ? 15.025  -16.639 65.207  1.00 13.38 ? 186 PRO B C   1 
ATOM   4015 O O   . PRO B 1 182 ? 15.880  -16.618 64.325  1.00 12.11 ? 186 PRO B O   1 
ATOM   4016 C CB  . PRO B 1 182 ? 16.327  -17.140 67.314  1.00 14.32 ? 186 PRO B CB  1 
ATOM   4017 C CG  . PRO B 1 182 ? 17.006  -18.428 67.681  1.00 15.05 ? 186 PRO B CG  1 
ATOM   4018 C CD  . PRO B 1 182 ? 17.015  -19.170 66.379  1.00 15.12 ? 186 PRO B CD  1 
ATOM   4019 N N   . VAL B 1 183 ? 13.942  -15.870 65.158  1.00 12.52 ? 187 VAL B N   1 
ATOM   4020 C CA  . VAL B 1 183 ? 13.768  -14.954 64.037  1.00 12.12 ? 187 VAL B CA  1 
ATOM   4021 C C   . VAL B 1 183 ? 14.530  -13.654 64.248  1.00 12.39 ? 187 VAL B C   1 
ATOM   4022 O O   . VAL B 1 183 ? 14.784  -12.919 63.295  1.00 10.92 ? 187 VAL B O   1 
ATOM   4023 C CB  . VAL B 1 183 ? 12.283  -14.611 63.789  1.00 13.37 ? 187 VAL B CB  1 
ATOM   4024 C CG1 . VAL B 1 183 ? 11.496  -15.888 63.512  1.00 11.96 ? 187 VAL B CG1 1 
ATOM   4025 C CG2 . VAL B 1 183 ? 11.706  -13.851 64.981  1.00 13.06 ? 187 VAL B CG2 1 
ATOM   4026 N N   . CYS B 1 184 ? 14.906  -13.382 65.495  1.00 11.30 ? 188 CYS B N   1 
ATOM   4027 C CA  . CYS B 1 184 ? 15.619  -12.150 65.813  1.00 9.86  ? 188 CYS B CA  1 
ATOM   4028 C C   . CYS B 1 184 ? 16.402  -12.242 67.109  1.00 10.35 ? 188 CYS B C   1 
ATOM   4029 O O   . CYS B 1 184 ? 16.276  -13.201 67.868  1.00 8.60  ? 188 CYS B O   1 
ATOM   4030 C CB  . CYS B 1 184 ? 14.627  -10.996 65.961  1.00 11.00 ? 188 CYS B CB  1 
ATOM   4031 S SG  . CYS B 1 184 ? 13.589  -11.152 67.456  1.00 11.88 ? 188 CYS B SG  1 
ATOM   4032 N N   . ASN B 1 185 ? 17.220  -11.222 67.335  1.00 8.94  ? 189 ASN B N   1 
ATOM   4033 C CA  . ASN B 1 185 ? 17.998  -11.083 68.556  1.00 9.45  ? 189 ASN B CA  1 
ATOM   4034 C C   . ASN B 1 185 ? 17.910  -9.594  68.849  1.00 10.03 ? 189 ASN B C   1 
ATOM   4035 O O   . ASN B 1 185 ? 18.561  -8.786  68.184  1.00 11.36 ? 189 ASN B O   1 
ATOM   4036 C CB  . ASN B 1 185 ? 19.460  -11.495 68.355  1.00 11.35 ? 189 ASN B CB  1 
ATOM   4037 C CG  . ASN B 1 185 ? 20.270  -11.394 69.643  1.00 13.56 ? 189 ASN B CG  1 
ATOM   4038 O OD1 . ASN B 1 185 ? 19.709  -11.444 70.739  1.00 10.96 ? 189 ASN B OD1 1 
ATOM   4039 N ND2 . ASN B 1 185 ? 21.586  -11.262 69.517  1.00 12.25 ? 189 ASN B ND2 1 
ATOM   4040 N N   . GLN B 1 186 ? 17.068  -9.228  69.810  1.00 9.68  ? 190 GLN B N   1 
ATOM   4041 C CA  . GLN B 1 186 ? 16.902  -7.826  70.171  1.00 9.16  ? 190 GLN B CA  1 
ATOM   4042 C C   . GLN B 1 186 ? 17.995  -7.424  71.149  1.00 10.28 ? 190 GLN B C   1 
ATOM   4043 O O   . GLN B 1 186 ? 18.060  -7.934  72.268  1.00 10.79 ? 190 GLN B O   1 
ATOM   4044 C CB  . GLN B 1 186 ? 15.524  -7.593  70.789  1.00 10.73 ? 190 GLN B CB  1 
ATOM   4045 C CG  . GLN B 1 186 ? 15.313  -6.166  71.280  1.00 8.39  ? 190 GLN B CG  1 
ATOM   4046 C CD  . GLN B 1 186 ? 13.930  -5.938  71.853  1.00 11.59 ? 190 GLN B CD  1 
ATOM   4047 O OE1 . GLN B 1 186 ? 13.769  -5.218  72.836  1.00 9.80  ? 190 GLN B OE1 1 
ATOM   4048 N NE2 . GLN B 1 186 ? 12.923  -6.536  71.230  1.00 12.30 ? 190 GLN B NE2 1 
ATOM   4049 N N   . VAL B 1 187 ? 18.859  -6.513  70.710  1.00 9.82  ? 191 VAL B N   1 
ATOM   4050 C CA  . VAL B 1 187 ? 19.971  -6.047  71.529  1.00 9.63  ? 191 VAL B CA  1 
ATOM   4051 C C   . VAL B 1 187 ? 20.158  -4.542  71.430  1.00 9.07  ? 191 VAL B C   1 
ATOM   4052 O O   . VAL B 1 187 ? 19.549  -3.881  70.587  1.00 6.80  ? 191 VAL B O   1 
ATOM   4053 C CB  . VAL B 1 187 ? 21.293  -6.722  71.109  1.00 10.05 ? 191 VAL B CB  1 
ATOM   4054 C CG1 . VAL B 1 187 ? 21.213  -8.219  71.346  1.00 9.45  ? 191 VAL B CG1 1 
ATOM   4055 C CG2 . VAL B 1 187 ? 21.580  -6.436  69.644  1.00 10.17 ? 191 VAL B CG2 1 
ATOM   4056 N N   . GLU B 1 188 ? 21.008  -4.007  72.300  1.00 8.35  ? 192 GLU B N   1 
ATOM   4057 C CA  . GLU B 1 188 ? 21.299  -2.577  72.317  1.00 8.29  ? 192 GLU B CA  1 
ATOM   4058 C C   . GLU B 1 188 ? 22.178  -2.243  71.117  1.00 9.16  ? 192 GLU B C   1 
ATOM   4059 O O   . GLU B 1 188 ? 23.170  -2.926  70.870  1.00 10.77 ? 192 GLU B O   1 
ATOM   4060 C CB  . GLU B 1 188 ? 22.046  -2.209  73.605  1.00 9.17  ? 192 GLU B CB  1 
ATOM   4061 C CG  . GLU B 1 188 ? 22.314  -0.719  73.776  1.00 11.99 ? 192 GLU B CG  1 
ATOM   4062 C CD  . GLU B 1 188 ? 23.161  -0.418  75.003  1.00 13.36 ? 192 GLU B CD  1 
ATOM   4063 O OE1 . GLU B 1 188 ? 22.961  -1.086  76.039  1.00 12.42 ? 192 GLU B OE1 1 
ATOM   4064 O OE2 . GLU B 1 188 ? 24.017  0.490   74.940  1.00 12.79 ? 192 GLU B OE2 1 
ATOM   4065 N N   . CYS B 1 189 ? 21.824  -1.201  70.370  1.00 7.67  ? 193 CYS B N   1 
ATOM   4066 C CA  . CYS B 1 189 ? 22.633  -0.822  69.217  1.00 9.94  ? 193 CYS B CA  1 
ATOM   4067 C C   . CYS B 1 189 ? 22.449  0.643   68.858  1.00 11.26 ? 193 CYS B C   1 
ATOM   4068 O O   . CYS B 1 189 ? 21.324  1.120   68.700  1.00 10.89 ? 193 CYS B O   1 
ATOM   4069 C CB  . CYS B 1 189 ? 22.295  -1.707  68.013  1.00 10.69 ? 193 CYS B CB  1 
ATOM   4070 S SG  . CYS B 1 189 ? 23.551  -1.656  66.711  1.00 12.24 ? 193 CYS B SG  1 
ATOM   4071 N N   . HIS B 1 190 ? 23.575  1.344   68.734  1.00 11.72 ? 194 HIS B N   1 
ATOM   4072 C CA  . HIS B 1 190 ? 23.610  2.770   68.415  1.00 11.32 ? 194 HIS B CA  1 
ATOM   4073 C C   . HIS B 1 190 ? 25.030  3.125   67.951  1.00 10.27 ? 194 HIS B C   1 
ATOM   4074 O O   . HIS B 1 190 ? 25.926  2.288   67.997  1.00 10.27 ? 194 HIS B O   1 
ATOM   4075 C CB  . HIS B 1 190 ? 23.250  3.588   69.656  1.00 12.06 ? 194 HIS B CB  1 
ATOM   4076 C CG  . HIS B 1 190 ? 24.027  3.197   70.873  1.00 10.54 ? 194 HIS B CG  1 
ATOM   4077 N ND1 . HIS B 1 190 ? 23.522  2.359   71.844  1.00 11.88 ? 194 HIS B ND1 1 
ATOM   4078 C CD2 . HIS B 1 190 ? 25.297  3.479   71.245  1.00 9.83  ? 194 HIS B CD2 1 
ATOM   4079 C CE1 . HIS B 1 190 ? 24.448  2.139   72.760  1.00 9.19  ? 194 HIS B CE1 1 
ATOM   4080 N NE2 . HIS B 1 190 ? 25.536  2.806   72.420  1.00 13.38 ? 194 HIS B NE2 1 
ATOM   4081 N N   . PRO B 1 191 ? 25.254  4.371   67.500  1.00 12.42 ? 195 PRO B N   1 
ATOM   4082 C CA  . PRO B 1 191 ? 26.593  4.756   67.041  1.00 13.01 ? 195 PRO B CA  1 
ATOM   4083 C C   . PRO B 1 191 ? 27.750  4.528   68.018  1.00 11.92 ? 195 PRO B C   1 
ATOM   4084 O O   . PRO B 1 191 ? 28.891  4.359   67.591  1.00 13.81 ? 195 PRO B O   1 
ATOM   4085 C CB  . PRO B 1 191 ? 26.415  6.228   66.673  1.00 13.07 ? 195 PRO B CB  1 
ATOM   4086 C CG  . PRO B 1 191 ? 25.006  6.257   66.161  1.00 13.36 ? 195 PRO B CG  1 
ATOM   4087 C CD  . PRO B 1 191 ? 24.274  5.430   67.193  1.00 13.03 ? 195 PRO B CD  1 
ATOM   4088 N N   . TYR B 1 192 ? 27.471  4.528   69.318  1.00 12.11 ? 196 TYR B N   1 
ATOM   4089 C CA  . TYR B 1 192 ? 28.534  4.308   70.305  1.00 13.22 ? 196 TYR B CA  1 
ATOM   4090 C C   . TYR B 1 192 ? 28.808  2.819   70.524  1.00 12.77 ? 196 TYR B C   1 
ATOM   4091 O O   . TYR B 1 192 ? 29.817  2.442   71.122  1.00 14.00 ? 196 TYR B O   1 
ATOM   4092 C CB  . TYR B 1 192 ? 28.166  4.961   71.641  1.00 14.21 ? 196 TYR B CB  1 
ATOM   4093 C CG  . TYR B 1 192 ? 28.312  6.467   71.677  1.00 16.23 ? 196 TYR B CG  1 
ATOM   4094 C CD1 . TYR B 1 192 ? 27.819  7.203   72.754  1.00 17.98 ? 196 TYR B CD1 1 
ATOM   4095 C CD2 . TYR B 1 192 ? 28.957  7.157   70.649  1.00 16.20 ? 196 TYR B CD2 1 
ATOM   4096 C CE1 . TYR B 1 192 ? 27.962  8.582   72.809  1.00 18.13 ? 196 TYR B CE1 1 
ATOM   4097 C CE2 . TYR B 1 192 ? 29.108  8.541   70.694  1.00 18.76 ? 196 TYR B CE2 1 
ATOM   4098 C CZ  . TYR B 1 192 ? 28.607  9.245   71.777  1.00 18.30 ? 196 TYR B CZ  1 
ATOM   4099 O OH  . TYR B 1 192 ? 28.744  10.610  71.833  1.00 18.20 ? 196 TYR B OH  1 
ATOM   4100 N N   . LEU B 1 193 ? 27.900  1.981   70.039  1.00 12.49 ? 197 LEU B N   1 
ATOM   4101 C CA  . LEU B 1 193 ? 28.011  0.529   70.164  1.00 11.54 ? 197 LEU B CA  1 
ATOM   4102 C C   . LEU B 1 193 ? 27.278  -0.026  68.948  1.00 13.79 ? 197 LEU B C   1 
ATOM   4103 O O   . LEU B 1 193 ? 26.158  -0.536  69.074  1.00 13.80 ? 197 LEU B O   1 
ATOM   4104 C CB  . LEU B 1 193 ? 27.311  0.067   71.444  1.00 10.28 ? 197 LEU B CB  1 
ATOM   4105 C CG  . LEU B 1 193 ? 27.405  -1.412  71.823  1.00 10.20 ? 197 LEU B CG  1 
ATOM   4106 C CD1 . LEU B 1 193 ? 28.717  -1.655  72.564  1.00 12.80 ? 197 LEU B CD1 1 
ATOM   4107 C CD2 . LEU B 1 193 ? 26.217  -1.794  72.710  1.00 11.24 ? 197 LEU B CD2 1 
ATOM   4108 N N   . ASN B 1 194 ? 27.911  0.059   67.777  1.00 13.65 ? 198 ASN B N   1 
ATOM   4109 C CA  . ASN B 1 194 ? 27.258  -0.374  66.548  1.00 12.91 ? 198 ASN B CA  1 
ATOM   4110 C C   . ASN B 1 194 ? 27.112  -1.866  66.258  1.00 12.38 ? 198 ASN B C   1 
ATOM   4111 O O   . ASN B 1 194 ? 26.585  -2.241  65.215  1.00 11.65 ? 198 ASN B O   1 
ATOM   4112 C CB  . ASN B 1 194 ? 27.858  0.380   65.338  1.00 12.64 ? 198 ASN B CB  1 
ATOM   4113 C CG  . ASN B 1 194 ? 29.277  -0.058  64.976  1.00 13.90 ? 198 ASN B CG  1 
ATOM   4114 O OD1 . ASN B 1 194 ? 30.021  0.707   64.349  1.00 17.92 ? 198 ASN B OD1 1 
ATOM   4115 N ND2 . ASN B 1 194 ? 29.646  -1.280  65.333  1.00 10.97 ? 198 ASN B ND2 1 
ATOM   4116 N N   . GLN B 1 195 ? 27.558  -2.715  67.181  1.00 13.09 ? 199 GLN B N   1 
ATOM   4117 C CA  . GLN B 1 195 ? 27.414  -4.168  67.034  1.00 14.06 ? 199 GLN B CA  1 
ATOM   4118 C C   . GLN B 1 195 ? 27.715  -4.734  65.638  1.00 14.83 ? 199 GLN B C   1 
ATOM   4119 O O   . GLN B 1 195 ? 27.081  -5.705  65.222  1.00 14.74 ? 199 GLN B O   1 
ATOM   4120 C CB  . GLN B 1 195 ? 25.979  -4.578  67.402  1.00 12.85 ? 199 GLN B CB  1 
ATOM   4121 C CG  . GLN B 1 195 ? 25.476  -4.115  68.772  1.00 12.57 ? 199 GLN B CG  1 
ATOM   4122 C CD  . GLN B 1 195 ? 25.725  -5.135  69.873  1.00 12.10 ? 199 GLN B CD  1 
ATOM   4123 O OE1 . GLN B 1 195 ? 25.081  -5.099  70.923  1.00 11.64 ? 199 GLN B OE1 1 
ATOM   4124 N NE2 . GLN B 1 195 ? 26.665  -6.042  69.642  1.00 8.42  ? 199 GLN B NE2 1 
ATOM   4125 N N   . MET B 1 196 ? 28.672  -4.154  64.922  1.00 14.68 ? 200 MET B N   1 
ATOM   4126 C CA  . MET B 1 196 ? 28.995  -4.624  63.574  1.00 16.19 ? 200 MET B CA  1 
ATOM   4127 C C   . MET B 1 196 ? 29.203  -6.139  63.475  1.00 16.10 ? 200 MET B C   1 
ATOM   4128 O O   . MET B 1 196 ? 28.715  -6.782  62.545  1.00 14.61 ? 200 MET B O   1 
ATOM   4129 C CB  . MET B 1 196 ? 30.248  -3.913  63.057  1.00 20.14 ? 200 MET B CB  1 
ATOM   4130 C CG  . MET B 1 196 ? 30.400  -3.957  61.540  1.00 24.27 ? 200 MET B CG  1 
ATOM   4131 S SD  . MET B 1 196 ? 29.151  -2.947  60.689  1.00 30.73 ? 200 MET B SD  1 
ATOM   4132 C CE  . MET B 1 196 ? 30.019  -1.377  60.537  1.00 29.00 ? 200 MET B CE  1 
ATOM   4133 N N   . LYS B 1 197 ? 29.929  -6.697  64.439  1.00 14.95 ? 201 LYS B N   1 
ATOM   4134 C CA  . LYS B 1 197 ? 30.228  -8.125  64.473  1.00 14.28 ? 201 LYS B CA  1 
ATOM   4135 C C   . LYS B 1 197 ? 28.983  -8.983  64.660  1.00 14.16 ? 201 LYS B C   1 
ATOM   4136 O O   . LYS B 1 197 ? 28.749  -9.928  63.904  1.00 12.33 ? 201 LYS B O   1 
ATOM   4137 C CB  . LYS B 1 197 ? 31.219  -8.407  65.604  1.00 17.17 ? 201 LYS B CB  1 
ATOM   4138 C CG  . LYS B 1 197 ? 31.805  -9.807  65.625  1.00 19.26 ? 201 LYS B CG  1 
ATOM   4139 C CD  . LYS B 1 197 ? 32.919  -9.860  66.676  1.00 21.57 ? 201 LYS B CD  1 
ATOM   4140 C CE  . LYS B 1 197 ? 33.748  -11.123 66.584  1.00 21.56 ? 201 LYS B CE  1 
ATOM   4141 N NZ  . LYS B 1 197 ? 34.976  -11.006 67.420  1.00 18.99 ? 201 LYS B NZ  1 
ATOM   4142 N N   . LEU B 1 198 ? 28.188  -8.655  65.672  1.00 12.38 ? 202 LEU B N   1 
ATOM   4143 C CA  . LEU B 1 198 ? 26.968  -9.403  65.951  1.00 12.58 ? 202 LEU B CA  1 
ATOM   4144 C C   . LEU B 1 198 ? 25.957  -9.230  64.818  1.00 12.07 ? 202 LEU B C   1 
ATOM   4145 O O   . LEU B 1 198 ? 25.220  -10.161 64.492  1.00 12.13 ? 202 LEU B O   1 
ATOM   4146 C CB  . LEU B 1 198 ? 26.361  -8.932  67.274  1.00 12.07 ? 202 LEU B CB  1 
ATOM   4147 C CG  . LEU B 1 198 ? 25.057  -9.578  67.754  1.00 12.35 ? 202 LEU B CG  1 
ATOM   4148 C CD1 . LEU B 1 198 ? 25.217  -11.096 67.877  1.00 9.77  ? 202 LEU B CD1 1 
ATOM   4149 C CD2 . LEU B 1 198 ? 24.684  -8.957  69.098  1.00 11.77 ? 202 LEU B CD2 1 
ATOM   4150 N N   . LEU B 1 199 ? 25.920  -8.040  64.224  1.00 11.36 ? 203 LEU B N   1 
ATOM   4151 C CA  . LEU B 1 199 ? 24.998  -7.774  63.120  1.00 12.69 ? 203 LEU B CA  1 
ATOM   4152 C C   . LEU B 1 199 ? 25.334  -8.672  61.932  1.00 13.04 ? 203 LEU B C   1 
ATOM   4153 O O   . LEU B 1 199 ? 24.450  -9.310  61.349  1.00 12.60 ? 203 LEU B O   1 
ATOM   4154 C CB  . LEU B 1 199 ? 25.076  -6.303  62.689  1.00 12.42 ? 203 LEU B CB  1 
ATOM   4155 C CG  . LEU B 1 199 ? 24.264  -5.890  61.452  1.00 14.25 ? 203 LEU B CG  1 
ATOM   4156 C CD1 . LEU B 1 199 ? 22.791  -6.225  61.648  1.00 13.70 ? 203 LEU B CD1 1 
ATOM   4157 C CD2 . LEU B 1 199 ? 24.434  -4.394  61.200  1.00 14.92 ? 203 LEU B CD2 1 
ATOM   4158 N N   . ASP B 1 200 ? 26.611  -8.721  61.569  1.00 12.91 ? 204 ASP B N   1 
ATOM   4159 C CA  . ASP B 1 200 ? 27.025  -9.556  60.449  1.00 13.82 ? 204 ASP B CA  1 
ATOM   4160 C C   . ASP B 1 200 ? 26.733  -11.024 60.730  1.00 12.40 ? 204 ASP B C   1 
ATOM   4161 O O   . ASP B 1 200 ? 26.376  -11.773 59.821  1.00 13.47 ? 204 ASP B O   1 
ATOM   4162 C CB  . ASP B 1 200 ? 28.511  -9.358  60.138  1.00 16.47 ? 204 ASP B CB  1 
ATOM   4163 C CG  . ASP B 1 200 ? 28.796  -8.005  59.502  1.00 20.80 ? 204 ASP B CG  1 
ATOM   4164 O OD1 . ASP B 1 200 ? 27.918  -7.492  58.770  1.00 22.17 ? 204 ASP B OD1 1 
ATOM   4165 O OD2 . ASP B 1 200 ? 29.898  -7.461  59.717  1.00 21.79 ? 204 ASP B OD2 1 
ATOM   4166 N N   . PHE B 1 201 ? 26.886  -11.438 61.987  1.00 11.63 ? 205 PHE B N   1 
ATOM   4167 C CA  . PHE B 1 201 ? 26.596  -12.823 62.358  1.00 11.11 ? 205 PHE B CA  1 
ATOM   4168 C C   . PHE B 1 201 ? 25.112  -13.116 62.141  1.00 11.12 ? 205 PHE B C   1 
ATOM   4169 O O   . PHE B 1 201 ? 24.746  -14.085 61.471  1.00 10.30 ? 205 PHE B O   1 
ATOM   4170 C CB  . PHE B 1 201 ? 26.937  -13.083 63.829  1.00 13.11 ? 205 PHE B CB  1 
ATOM   4171 C CG  . PHE B 1 201 ? 26.563  -14.462 64.294  1.00 14.77 ? 205 PHE B CG  1 
ATOM   4172 C CD1 . PHE B 1 201 ? 27.344  -15.563 63.950  1.00 12.63 ? 205 PHE B CD1 1 
ATOM   4173 C CD2 . PHE B 1 201 ? 25.392  -14.671 65.016  1.00 14.75 ? 205 PHE B CD2 1 
ATOM   4174 C CE1 . PHE B 1 201 ? 26.961  -16.854 64.314  1.00 14.71 ? 205 PHE B CE1 1 
ATOM   4175 C CE2 . PHE B 1 201 ? 24.999  -15.956 65.386  1.00 13.12 ? 205 PHE B CE2 1 
ATOM   4176 C CZ  . PHE B 1 201 ? 25.785  -17.051 65.031  1.00 15.50 ? 205 PHE B CZ  1 
ATOM   4177 N N   . CYS B 1 202 ? 24.256  -12.277 62.714  1.00 10.87 ? 206 CYS B N   1 
ATOM   4178 C CA  . CYS B 1 202 ? 22.816  -12.465 62.576  1.00 12.68 ? 206 CYS B CA  1 
ATOM   4179 C C   . CYS B 1 202 ? 22.388  -12.516 61.110  1.00 13.32 ? 206 CYS B C   1 
ATOM   4180 O O   . CYS B 1 202 ? 21.590  -13.367 60.721  1.00 17.43 ? 206 CYS B O   1 
ATOM   4181 C CB  . CYS B 1 202 ? 22.063  -11.352 63.303  1.00 10.69 ? 206 CYS B CB  1 
ATOM   4182 S SG  . CYS B 1 202 ? 22.266  -11.393 65.098  1.00 14.64 ? 206 CYS B SG  1 
ATOM   4183 N N   . LYS B 1 203 ? 22.919  -11.614 60.296  1.00 13.88 ? 207 LYS B N   1 
ATOM   4184 C CA  . LYS B 1 203 ? 22.569  -11.604 58.881  1.00 13.88 ? 207 LYS B CA  1 
ATOM   4185 C C   . LYS B 1 203 ? 22.939  -12.934 58.217  1.00 14.14 ? 207 LYS B C   1 
ATOM   4186 O O   . LYS B 1 203 ? 22.161  -13.488 57.436  1.00 12.21 ? 207 LYS B O   1 
ATOM   4187 C CB  . LYS B 1 203 ? 23.276  -10.444 58.171  1.00 15.99 ? 207 LYS B CB  1 
ATOM   4188 C CG  . LYS B 1 203 ? 22.718  -9.064  58.519  1.00 17.24 ? 207 LYS B CG  1 
ATOM   4189 C CD  . LYS B 1 203 ? 23.413  -7.967  57.722  1.00 16.73 ? 207 LYS B CD  1 
ATOM   4190 C CE  . LYS B 1 203 ? 22.722  -6.622  57.896  1.00 17.77 ? 207 LYS B CE  1 
ATOM   4191 N NZ  . LYS B 1 203 ? 23.433  -5.539  57.154  1.00 19.55 ? 207 LYS B NZ  1 
ATOM   4192 N N   . SER B 1 204 ? 24.119  -13.457 58.544  1.00 13.41 ? 208 SER B N   1 
ATOM   4193 C CA  . SER B 1 204 ? 24.572  -14.718 57.964  1.00 13.55 ? 208 SER B CA  1 
ATOM   4194 C C   . SER B 1 204 ? 23.681  -15.894 58.351  1.00 15.57 ? 208 SER B C   1 
ATOM   4195 O O   . SER B 1 204 ? 23.658  -16.916 57.660  1.00 15.73 ? 208 SER B O   1 
ATOM   4196 C CB  . SER B 1 204 ? 26.015  -15.021 58.389  1.00 13.96 ? 208 SER B CB  1 
ATOM   4197 O OG  . SER B 1 204 ? 26.071  -15.486 59.730  1.00 12.89 ? 208 SER B OG  1 
ATOM   4198 N N   . LYS B 1 205 ? 22.940  -15.752 59.446  1.00 14.45 ? 209 LYS B N   1 
ATOM   4199 C CA  . LYS B 1 205 ? 22.066  -16.827 59.908  1.00 14.15 ? 209 LYS B CA  1 
ATOM   4200 C C   . LYS B 1 205 ? 20.589  -16.523 59.677  1.00 13.95 ? 209 LYS B C   1 
ATOM   4201 O O   . LYS B 1 205 ? 19.719  -17.238 60.171  1.00 13.25 ? 209 LYS B O   1 
ATOM   4202 C CB  . LYS B 1 205 ? 22.298  -17.087 61.399  1.00 14.48 ? 209 LYS B CB  1 
ATOM   4203 C CG  . LYS B 1 205 ? 23.742  -17.395 61.771  1.00 16.59 ? 209 LYS B CG  1 
ATOM   4204 C CD  . LYS B 1 205 ? 24.243  -18.642 61.061  1.00 17.73 ? 209 LYS B CD  1 
ATOM   4205 C CE  . LYS B 1 205 ? 25.647  -19.014 61.512  1.00 20.67 ? 209 LYS B CE  1 
ATOM   4206 N NZ  . LYS B 1 205 ? 26.178  -20.173 60.744  1.00 20.62 ? 209 LYS B NZ  1 
ATOM   4207 N N   . ASP B 1 206 ? 20.309  -15.461 58.932  1.00 13.42 ? 210 ASP B N   1 
ATOM   4208 C CA  . ASP B 1 206 ? 18.933  -15.065 58.651  1.00 14.00 ? 210 ASP B CA  1 
ATOM   4209 C C   . ASP B 1 206 ? 18.210  -14.652 59.932  1.00 13.43 ? 210 ASP B C   1 
ATOM   4210 O O   . ASP B 1 206 ? 17.005  -14.861 60.081  1.00 13.54 ? 210 ASP B O   1 
ATOM   4211 C CB  . ASP B 1 206 ? 18.166  -16.202 57.969  1.00 16.40 ? 210 ASP B CB  1 
ATOM   4212 C CG  . ASP B 1 206 ? 18.812  -16.650 56.666  1.00 16.57 ? 210 ASP B CG  1 
ATOM   4213 O OD1 . ASP B 1 206 ? 19.081  -15.796 55.799  1.00 14.23 ? 210 ASP B OD1 1 
ATOM   4214 O OD2 . ASP B 1 206 ? 19.040  -17.867 56.510  1.00 19.05 ? 210 ASP B OD2 1 
ATOM   4215 N N   . ILE B 1 207 ? 18.959  -14.071 60.862  1.00 12.04 ? 211 ILE B N   1 
ATOM   4216 C CA  . ILE B 1 207 ? 18.391  -13.593 62.116  1.00 10.90 ? 211 ILE B CA  1 
ATOM   4217 C C   . ILE B 1 207 ? 18.365  -12.072 62.037  1.00 10.54 ? 211 ILE B C   1 
ATOM   4218 O O   . ILE B 1 207 ? 19.363  -11.450 61.687  1.00 10.09 ? 211 ILE B O   1 
ATOM   4219 C CB  . ILE B 1 207 ? 19.248  -14.018 63.331  1.00 11.86 ? 211 ILE B CB  1 
ATOM   4220 C CG1 . ILE B 1 207 ? 19.234  -15.542 63.465  1.00 13.28 ? 211 ILE B CG1 1 
ATOM   4221 C CG2 . ILE B 1 207 ? 18.722  -13.353 64.602  1.00 10.40 ? 211 ILE B CG2 1 
ATOM   4222 C CD1 . ILE B 1 207 ? 20.038  -16.067 64.633  1.00 14.20 ? 211 ILE B CD1 1 
ATOM   4223 N N   . VAL B 1 208 ? 17.217  -11.478 62.343  1.00 10.56 ? 212 VAL B N   1 
ATOM   4224 C CA  . VAL B 1 208 ? 17.092  -10.030 62.300  1.00 11.69 ? 212 VAL B CA  1 
ATOM   4225 C C   . VAL B 1 208 ? 17.558  -9.408  63.609  1.00 11.84 ? 212 VAL B C   1 
ATOM   4226 O O   . VAL B 1 208 ? 17.168  -9.852  64.690  1.00 10.26 ? 212 VAL B O   1 
ATOM   4227 C CB  . VAL B 1 208 ? 15.631  -9.603  62.051  1.00 11.46 ? 212 VAL B CB  1 
ATOM   4228 C CG1 . VAL B 1 208 ? 15.496  -8.087  62.187  1.00 14.37 ? 212 VAL B CG1 1 
ATOM   4229 C CG2 . VAL B 1 208 ? 15.190  -10.052 60.664  1.00 13.04 ? 212 VAL B CG2 1 
ATOM   4230 N N   . LEU B 1 209 ? 18.408  -8.391  63.516  1.00 11.69 ? 213 LEU B N   1 
ATOM   4231 C CA  . LEU B 1 209 ? 18.860  -7.713  64.723  1.00 11.86 ? 213 LEU B CA  1 
ATOM   4232 C C   . LEU B 1 209 ? 17.875  -6.579  64.979  1.00 11.87 ? 213 LEU B C   1 
ATOM   4233 O O   . LEU B 1 209 ? 17.704  -5.693  64.146  1.00 11.16 ? 213 LEU B O   1 
ATOM   4234 C CB  . LEU B 1 209 ? 20.277  -7.153  64.552  1.00 12.33 ? 213 LEU B CB  1 
ATOM   4235 C CG  . LEU B 1 209 ? 20.920  -6.591  65.829  1.00 11.24 ? 213 LEU B CG  1 
ATOM   4236 C CD1 . LEU B 1 209 ? 22.431  -6.627  65.705  1.00 13.30 ? 213 LEU B CD1 1 
ATOM   4237 C CD2 . LEU B 1 209 ? 20.427  -5.172  66.088  1.00 10.68 ? 213 LEU B CD2 1 
ATOM   4238 N N   . VAL B 1 210 ? 17.201  -6.640  66.120  1.00 11.24 ? 214 VAL B N   1 
ATOM   4239 C CA  . VAL B 1 210 ? 16.240  -5.614  66.506  1.00 11.39 ? 214 VAL B CA  1 
ATOM   4240 C C   . VAL B 1 210 ? 16.958  -4.791  67.558  1.00 10.27 ? 214 VAL B C   1 
ATOM   4241 O O   . VAL B 1 210 ? 17.388  -5.324  68.577  1.00 10.49 ? 214 VAL B O   1 
ATOM   4242 C CB  . VAL B 1 210 ? 14.968  -6.236  67.114  1.00 10.24 ? 214 VAL B CB  1 
ATOM   4243 C CG1 . VAL B 1 210 ? 14.041  -5.143  67.616  1.00 10.94 ? 214 VAL B CG1 1 
ATOM   4244 C CG2 . VAL B 1 210 ? 14.256  -7.086  66.063  1.00 11.50 ? 214 VAL B CG2 1 
ATOM   4245 N N   . ALA B 1 211 ? 17.084  -3.494  67.310  1.00 9.63  ? 215 ALA B N   1 
ATOM   4246 C CA  . ALA B 1 211 ? 17.801  -2.624  68.229  1.00 10.87 ? 215 ALA B CA  1 
ATOM   4247 C C   . ALA B 1 211 ? 16.981  -1.752  69.159  1.00 10.96 ? 215 ALA B C   1 
ATOM   4248 O O   . ALA B 1 211 ? 15.941  -1.202  68.785  1.00 8.82  ? 215 ALA B O   1 
ATOM   4249 C CB  . ALA B 1 211 ? 18.760  -1.737  67.439  1.00 11.37 ? 215 ALA B CB  1 
ATOM   4250 N N   . TYR B 1 212 ? 17.464  -1.651  70.392  1.00 11.07 ? 216 TYR B N   1 
ATOM   4251 C CA  . TYR B 1 212 ? 16.873  -0.772  71.384  1.00 10.51 ? 216 TYR B CA  1 
ATOM   4252 C C   . TYR B 1 212 ? 18.059  0.117   71.745  1.00 11.98 ? 216 TYR B C   1 
ATOM   4253 O O   . TYR B 1 212 ? 19.187  -0.161  71.323  1.00 9.63  ? 216 TYR B O   1 
ATOM   4254 C CB  . TYR B 1 212 ? 16.330  -1.549  72.595  1.00 11.31 ? 216 TYR B CB  1 
ATOM   4255 C CG  . TYR B 1 212 ? 17.327  -2.303  73.450  1.00 11.12 ? 216 TYR B CG  1 
ATOM   4256 C CD1 . TYR B 1 212 ? 18.089  -1.649  74.425  1.00 11.73 ? 216 TYR B CD1 1 
ATOM   4257 C CD2 . TYR B 1 212 ? 17.444  -3.685  73.347  1.00 10.39 ? 216 TYR B CD2 1 
ATOM   4258 C CE1 . TYR B 1 212 ? 18.930  -2.364  75.284  1.00 10.46 ? 216 TYR B CE1 1 
ATOM   4259 C CE2 . TYR B 1 212 ? 18.283  -4.408  74.198  1.00 10.94 ? 216 TYR B CE2 1 
ATOM   4260 C CZ  . TYR B 1 212 ? 19.017  -3.743  75.164  1.00 9.74  ? 216 TYR B CZ  1 
ATOM   4261 O OH  . TYR B 1 212 ? 19.811  -4.466  76.022  1.00 12.34 ? 216 TYR B OH  1 
ATOM   4262 N N   . GLY B 1 213 ? 17.815  1.194   72.483  1.00 10.86 ? 217 GLY B N   1 
ATOM   4263 C CA  . GLY B 1 213 ? 18.900  2.097   72.827  1.00 11.66 ? 217 GLY B CA  1 
ATOM   4264 C C   . GLY B 1 213 ? 19.356  2.848   71.587  1.00 11.59 ? 217 GLY B C   1 
ATOM   4265 O O   . GLY B 1 213 ? 20.414  3.477   71.576  1.00 12.44 ? 217 GLY B O   1 
ATOM   4266 N N   . VAL B 1 214 ? 18.547  2.785   70.533  1.00 10.82 ? 218 VAL B N   1 
ATOM   4267 C CA  . VAL B 1 214 ? 18.866  3.451   69.272  1.00 10.95 ? 218 VAL B CA  1 
ATOM   4268 C C   . VAL B 1 214 ? 19.083  4.954   69.468  1.00 12.51 ? 218 VAL B C   1 
ATOM   4269 O O   . VAL B 1 214 ? 19.814  5.590   68.705  1.00 12.76 ? 218 VAL B O   1 
ATOM   4270 C CB  . VAL B 1 214 ? 17.745  3.210   68.224  1.00 11.12 ? 218 VAL B CB  1 
ATOM   4271 C CG1 . VAL B 1 214 ? 18.037  3.982   66.938  1.00 12.22 ? 218 VAL B CG1 1 
ATOM   4272 C CG2 . VAL B 1 214 ? 17.642  1.720   67.918  1.00 10.52 ? 218 VAL B CG2 1 
ATOM   4273 N N   . LEU B 1 215 ? 18.452  5.515   70.495  1.00 12.47 ? 219 LEU B N   1 
ATOM   4274 C CA  . LEU B 1 215 ? 18.593  6.935   70.794  1.00 13.22 ? 219 LEU B CA  1 
ATOM   4275 C C   . LEU B 1 215 ? 19.319  7.165   72.128  1.00 14.09 ? 219 LEU B C   1 
ATOM   4276 O O   . LEU B 1 215 ? 19.228  8.241   72.726  1.00 11.92 ? 219 LEU B O   1 
ATOM   4277 C CB  . LEU B 1 215 ? 17.210  7.595   70.806  1.00 15.05 ? 219 LEU B CB  1 
ATOM   4278 C CG  . LEU B 1 215 ? 16.471  7.430   69.471  1.00 16.44 ? 219 LEU B CG  1 
ATOM   4279 C CD1 . LEU B 1 215 ? 15.077  8.018   69.572  1.00 16.87 ? 219 LEU B CD1 1 
ATOM   4280 C CD2 . LEU B 1 215 ? 17.259  8.110   68.350  1.00 16.28 ? 219 LEU B CD2 1 
ATOM   4281 N N   . GLY B 1 216 ? 20.039  6.143   72.587  1.00 14.49 ? 220 GLY B N   1 
ATOM   4282 C CA  . GLY B 1 216 ? 20.793  6.250   73.828  1.00 13.78 ? 220 GLY B CA  1 
ATOM   4283 C C   . GLY B 1 216 ? 20.131  5.690   75.075  1.00 14.69 ? 220 GLY B C   1 
ATOM   4284 O O   . GLY B 1 216 ? 20.716  5.749   76.158  1.00 13.13 ? 220 GLY B O   1 
ATOM   4285 N N   . THR B 1 217 ? 18.926  5.141   74.910  1.00 12.96 ? 221 THR B N   1 
ATOM   4286 C CA  . THR B 1 217 ? 18.111  4.564   75.989  1.00 14.26 ? 221 THR B CA  1 
ATOM   4287 C C   . THR B 1 217 ? 17.468  5.660   76.823  1.00 14.23 ? 221 THR B C   1 
ATOM   4288 O O   . THR B 1 217 ? 17.900  6.817   76.790  1.00 13.80 ? 221 THR B O   1 
ATOM   4289 C CB  . THR B 1 217 ? 18.915  3.647   76.961  1.00 14.61 ? 221 THR B CB  1 
ATOM   4290 O OG1 . THR B 1 217 ? 19.711  4.449   77.844  1.00 14.75 ? 221 THR B OG1 1 
ATOM   4291 C CG2 . THR B 1 217 ? 19.799  2.686   76.192  1.00 16.30 ? 221 THR B CG2 1 
ATOM   4292 N N   . GLN B 1 218 ? 16.422  5.303   77.558  1.00 14.10 ? 222 GLN B N   1 
ATOM   4293 C CA  . GLN B 1 218 ? 15.739  6.273   78.401  1.00 14.86 ? 222 GLN B CA  1 
ATOM   4294 C C   . GLN B 1 218 ? 16.545  6.490   79.683  1.00 14.75 ? 222 GLN B C   1 
ATOM   4295 O O   . GLN B 1 218 ? 16.109  7.195   80.588  1.00 14.43 ? 222 GLN B O   1 
ATOM   4296 C CB  . GLN B 1 218 ? 14.325  5.791   78.723  1.00 14.48 ? 222 GLN B CB  1 
ATOM   4297 C CG  . GLN B 1 218 ? 13.516  5.465   77.472  1.00 15.37 ? 222 GLN B CG  1 
ATOM   4298 C CD  . GLN B 1 218 ? 12.043  5.284   77.750  1.00 14.29 ? 222 GLN B CD  1 
ATOM   4299 O OE1 . GLN B 1 218 ? 11.307  6.257   77.911  1.00 16.12 ? 222 GLN B OE1 1 
ATOM   4300 N NE2 . GLN B 1 218 ? 11.603  4.034   77.815  1.00 14.92 ? 222 GLN B NE2 1 
ATOM   4301 N N   . ARG B 1 219 ? 17.722  5.870   79.737  1.00 15.26 ? 223 ARG B N   1 
ATOM   4302 C CA  . ARG B 1 219 ? 18.645  5.979   80.866  1.00 16.10 ? 223 ARG B CA  1 
ATOM   4303 C C   . ARG B 1 219 ? 18.012  5.667   82.221  1.00 16.64 ? 223 ARG B C   1 
ATOM   4304 O O   . ARG B 1 219 ? 18.127  6.450   83.168  1.00 16.28 ? 223 ARG B O   1 
ATOM   4305 C CB  . ARG B 1 219 ? 19.262  7.385   80.879  1.00 18.13 ? 223 ARG B CB  1 
ATOM   4306 C CG  . ARG B 1 219 ? 19.958  7.757   79.566  1.00 17.40 ? 223 ARG B CG  1 
ATOM   4307 C CD  . ARG B 1 219 ? 20.305  9.237   79.503  1.00 18.54 ? 223 ARG B CD  1 
ATOM   4308 N NE  . ARG B 1 219 ? 21.310  9.625   80.489  1.00 18.55 ? 223 ARG B NE  1 
ATOM   4309 C CZ  . ARG B 1 219 ? 22.619  9.454   80.337  1.00 19.83 ? 223 ARG B CZ  1 
ATOM   4310 N NH1 . ARG B 1 219 ? 23.099  8.899   79.229  1.00 18.48 ? 223 ARG B NH1 1 
ATOM   4311 N NH2 . ARG B 1 219 ? 23.450  9.844   81.296  1.00 20.21 ? 223 ARG B NH2 1 
ATOM   4312 N N   . TYR B 1 220 ? 17.368  4.505   82.310  1.00 16.87 ? 224 TYR B N   1 
ATOM   4313 C CA  . TYR B 1 220 ? 16.696  4.064   83.533  1.00 17.34 ? 224 TYR B CA  1 
ATOM   4314 C C   . TYR B 1 220 ? 17.605  4.028   84.758  1.00 18.35 ? 224 TYR B C   1 
ATOM   4315 O O   . TYR B 1 220 ? 18.738  3.548   84.695  1.00 16.21 ? 224 TYR B O   1 
ATOM   4316 C CB  . TYR B 1 220 ? 16.097  2.668   83.337  1.00 17.08 ? 224 TYR B CB  1 
ATOM   4317 C CG  . TYR B 1 220 ? 15.433  2.464   81.993  1.00 18.09 ? 224 TYR B CG  1 
ATOM   4318 C CD1 . TYR B 1 220 ? 16.187  2.136   80.863  1.00 16.68 ? 224 TYR B CD1 1 
ATOM   4319 C CD2 . TYR B 1 220 ? 14.055  2.625   81.843  1.00 15.93 ? 224 TYR B CD2 1 
ATOM   4320 C CE1 . TYR B 1 220 ? 15.585  1.973   79.617  1.00 16.79 ? 224 TYR B CE1 1 
ATOM   4321 C CE2 . TYR B 1 220 ? 13.441  2.466   80.599  1.00 17.52 ? 224 TYR B CE2 1 
ATOM   4322 C CZ  . TYR B 1 220 ? 14.212  2.141   79.493  1.00 15.77 ? 224 TYR B CZ  1 
ATOM   4323 O OH  . TYR B 1 220 ? 13.612  1.997   78.262  1.00 15.30 ? 224 TYR B OH  1 
ATOM   4324 N N   . GLY B 1 221 ? 17.089  4.524   85.879  1.00 19.83 ? 225 GLY B N   1 
ATOM   4325 C CA  . GLY B 1 221 ? 17.861  4.520   87.109  1.00 19.65 ? 225 GLY B CA  1 
ATOM   4326 C C   . GLY B 1 221 ? 18.024  3.098   87.610  1.00 19.62 ? 225 GLY B C   1 
ATOM   4327 O O   . GLY B 1 221 ? 17.067  2.319   87.608  1.00 20.88 ? 225 GLY B O   1 
ATOM   4328 N N   . GLY B 1 222 ? 19.237  2.754   88.032  1.00 18.83 ? 226 GLY B N   1 
ATOM   4329 C CA  . GLY B 1 222 ? 19.497  1.413   88.522  1.00 19.58 ? 226 GLY B CA  1 
ATOM   4330 C C   . GLY B 1 222 ? 19.948  0.479   87.415  1.00 19.74 ? 226 GLY B C   1 
ATOM   4331 O O   . GLY B 1 222 ? 20.311  -0.671  87.670  1.00 21.59 ? 226 GLY B O   1 
ATOM   4332 N N   . TRP B 1 223 ? 19.932  0.972   86.180  1.00 19.18 ? 227 TRP B N   1 
ATOM   4333 C CA  . TRP B 1 223 ? 20.333  0.164   85.032  1.00 17.60 ? 227 TRP B CA  1 
ATOM   4334 C C   . TRP B 1 223 ? 21.369  0.839   84.150  1.00 16.60 ? 227 TRP B C   1 
ATOM   4335 O O   . TRP B 1 223 ? 22.203  0.168   83.539  1.00 17.26 ? 227 TRP B O   1 
ATOM   4336 C CB  . TRP B 1 223 ? 19.110  -0.198  84.185  1.00 16.70 ? 227 TRP B CB  1 
ATOM   4337 C CG  . TRP B 1 223 ? 18.207  -1.178  84.854  1.00 16.65 ? 227 TRP B CG  1 
ATOM   4338 C CD1 . TRP B 1 223 ? 17.247  -0.909  85.784  1.00 16.79 ? 227 TRP B CD1 1 
ATOM   4339 C CD2 . TRP B 1 223 ? 18.228  -2.601  84.696  1.00 16.13 ? 227 TRP B CD2 1 
ATOM   4340 N NE1 . TRP B 1 223 ? 16.668  -2.079  86.220  1.00 18.16 ? 227 TRP B NE1 1 
ATOM   4341 C CE2 . TRP B 1 223 ? 17.253  -3.132  85.568  1.00 16.63 ? 227 TRP B CE2 1 
ATOM   4342 C CE3 . TRP B 1 223 ? 18.979  -3.478  83.904  1.00 16.40 ? 227 TRP B CE3 1 
ATOM   4343 C CZ2 . TRP B 1 223 ? 17.007  -4.505  85.671  1.00 15.91 ? 227 TRP B CZ2 1 
ATOM   4344 C CZ3 . TRP B 1 223 ? 18.736  -4.844  84.007  1.00 15.71 ? 227 TRP B CZ3 1 
ATOM   4345 C CH2 . TRP B 1 223 ? 17.757  -5.343  84.885  1.00 16.21 ? 227 TRP B CH2 1 
ATOM   4346 N N   . VAL B 1 224 ? 21.313  2.165   84.084  1.00 16.09 ? 228 VAL B N   1 
ATOM   4347 C CA  . VAL B 1 224 ? 22.244  2.930   83.265  1.00 15.71 ? 228 VAL B CA  1 
ATOM   4348 C C   . VAL B 1 224 ? 23.081  3.922   84.075  1.00 17.61 ? 228 VAL B C   1 
ATOM   4349 O O   . VAL B 1 224 ? 22.572  4.596   84.972  1.00 15.76 ? 228 VAL B O   1 
ATOM   4350 C CB  . VAL B 1 224 ? 21.493  3.719   82.175  1.00 15.56 ? 228 VAL B CB  1 
ATOM   4351 C CG1 . VAL B 1 224 ? 22.481  4.525   81.331  1.00 14.85 ? 228 VAL B CG1 1 
ATOM   4352 C CG2 . VAL B 1 224 ? 20.694  2.762   81.301  1.00 14.26 ? 228 VAL B CG2 1 
ATOM   4353 N N   . ASP B 1 225 ? 24.367  4.005   83.744  1.00 18.77 ? 229 ASP B N   1 
ATOM   4354 C CA  . ASP B 1 225 ? 25.277  4.930   84.412  1.00 19.74 ? 229 ASP B CA  1 
ATOM   4355 C C   . ASP B 1 225 ? 24.772  6.329   84.104  1.00 19.28 ? 229 ASP B C   1 
ATOM   4356 O O   . ASP B 1 225 ? 24.817  6.772   82.958  1.00 19.28 ? 229 ASP B O   1 
ATOM   4357 C CB  . ASP B 1 225 ? 26.695  4.768   83.859  1.00 20.12 ? 229 ASP B CB  1 
ATOM   4358 C CG  . ASP B 1 225 ? 27.711  5.631   84.584  1.00 21.45 ? 229 ASP B CG  1 
ATOM   4359 O OD1 . ASP B 1 225 ? 27.316  6.650   85.190  1.00 20.81 ? 229 ASP B OD1 1 
ATOM   4360 O OD2 . ASP B 1 225 ? 28.910  5.293   84.532  1.00 21.40 ? 229 ASP B OD2 1 
ATOM   4361 N N   . GLN B 1 226 ? 24.290  7.027   85.125  1.00 20.05 ? 230 GLN B N   1 
ATOM   4362 C CA  . GLN B 1 226 ? 23.757  8.368   84.931  1.00 20.53 ? 230 GLN B CA  1 
ATOM   4363 C C   . GLN B 1 226 ? 24.808  9.375   84.472  1.00 21.89 ? 230 GLN B C   1 
ATOM   4364 O O   . GLN B 1 226 ? 24.468  10.455  83.990  1.00 21.09 ? 230 GLN B O   1 
ATOM   4365 C CB  . GLN B 1 226 ? 23.089  8.854   86.219  1.00 21.45 ? 230 GLN B CB  1 
ATOM   4366 C CG  . GLN B 1 226 ? 21.897  8.009   86.640  1.00 20.08 ? 230 GLN B CG  1 
ATOM   4367 C CD  . GLN B 1 226 ? 20.808  7.983   85.588  1.00 19.45 ? 230 GLN B CD  1 
ATOM   4368 O OE1 . GLN B 1 226 ? 20.214  9.012   85.269  1.00 19.33 ? 230 GLN B OE1 1 
ATOM   4369 N NE2 . GLN B 1 226 ? 20.543  6.803   85.037  1.00 19.49 ? 230 GLN B NE2 1 
ATOM   4370 N N   . ASN B 1 227 ? 26.081  9.017   84.618  1.00 22.69 ? 231 ASN B N   1 
ATOM   4371 C CA  . ASN B 1 227 ? 27.165  9.902   84.207  1.00 23.97 ? 231 ASN B CA  1 
ATOM   4372 C C   . ASN B 1 227 ? 27.660  9.598   82.800  1.00 23.37 ? 231 ASN B C   1 
ATOM   4373 O O   . ASN B 1 227 ? 28.557  10.271  82.294  1.00 24.27 ? 231 ASN B O   1 
ATOM   4374 C CB  . ASN B 1 227 ? 28.333  9.812   85.192  1.00 26.54 ? 231 ASN B CB  1 
ATOM   4375 C CG  . ASN B 1 227 ? 27.969  10.337  86.564  1.00 29.15 ? 231 ASN B CG  1 
ATOM   4376 O OD1 . ASN B 1 227 ? 27.440  11.441  86.696  1.00 29.65 ? 231 ASN B OD1 1 
ATOM   4377 N ND2 . ASN B 1 227 ? 28.250  9.550   87.595  1.00 30.72 ? 231 ASN B ND2 1 
ATOM   4378 N N   . SER B 1 228 ? 27.082  8.580   82.170  1.00 20.80 ? 232 SER B N   1 
ATOM   4379 C CA  . SER B 1 228 ? 27.470  8.224   80.812  1.00 19.40 ? 232 SER B CA  1 
ATOM   4380 C C   . SER B 1 228 ? 27.029  9.355   79.889  1.00 19.00 ? 232 SER B C   1 
ATOM   4381 O O   . SER B 1 228 ? 26.047  10.044  80.164  1.00 18.91 ? 232 SER B O   1 
ATOM   4382 C CB  . SER B 1 228 ? 26.786  6.923   80.386  1.00 17.90 ? 232 SER B CB  1 
ATOM   4383 O OG  . SER B 1 228 ? 25.379  7.091   80.353  1.00 15.23 ? 232 SER B OG  1 
ATOM   4384 N N   . PRO B 1 229 ? 27.750  9.564   78.779  1.00 19.19 ? 233 PRO B N   1 
ATOM   4385 C CA  . PRO B 1 229 ? 27.369  10.637  77.856  1.00 19.43 ? 233 PRO B CA  1 
ATOM   4386 C C   . PRO B 1 229 ? 25.989  10.390  77.255  1.00 18.19 ? 233 PRO B C   1 
ATOM   4387 O O   . PRO B 1 229 ? 25.580  9.244   77.078  1.00 18.79 ? 233 PRO B O   1 
ATOM   4388 C CB  . PRO B 1 229 ? 28.473  10.592  76.803  1.00 18.67 ? 233 PRO B CB  1 
ATOM   4389 C CG  . PRO B 1 229 ? 28.837  9.135   76.773  1.00 20.74 ? 233 PRO B CG  1 
ATOM   4390 C CD  . PRO B 1 229 ? 28.885  8.789   78.246  1.00 18.83 ? 233 PRO B CD  1 
ATOM   4391 N N   . VAL B 1 230 ? 25.272  11.468  76.955  1.00 16.45 ? 234 VAL B N   1 
ATOM   4392 C CA  . VAL B 1 230 ? 23.946  11.361  76.355  1.00 17.03 ? 234 VAL B CA  1 
ATOM   4393 C C   . VAL B 1 230 ? 24.161  11.252  74.849  1.00 16.93 ? 234 VAL B C   1 
ATOM   4394 O O   . VAL B 1 230 ? 24.698  12.163  74.225  1.00 17.13 ? 234 VAL B O   1 
ATOM   4395 C CB  . VAL B 1 230 ? 23.091  12.602  76.676  1.00 17.97 ? 234 VAL B CB  1 
ATOM   4396 C CG1 . VAL B 1 230 ? 21.704  12.457  76.064  1.00 18.78 ? 234 VAL B CG1 1 
ATOM   4397 C CG2 . VAL B 1 230 ? 22.989  12.777  78.190  1.00 19.19 ? 234 VAL B CG2 1 
ATOM   4398 N N   . LEU B 1 231 ? 23.749  10.130  74.268  1.00 16.22 ? 235 LEU B N   1 
ATOM   4399 C CA  . LEU B 1 231 ? 23.949  9.897   72.842  1.00 16.07 ? 235 LEU B CA  1 
ATOM   4400 C C   . LEU B 1 231 ? 23.568  11.039  71.906  1.00 14.58 ? 235 LEU B C   1 
ATOM   4401 O O   . LEU B 1 231 ? 24.387  11.476  71.101  1.00 15.11 ? 235 LEU B O   1 
ATOM   4402 C CB  . LEU B 1 231 ? 23.214  8.626   72.403  1.00 14.68 ? 235 LEU B CB  1 
ATOM   4403 C CG  . LEU B 1 231 ? 23.318  8.281   70.914  1.00 17.01 ? 235 LEU B CG  1 
ATOM   4404 C CD1 . LEU B 1 231 ? 24.769  7.957   70.553  1.00 17.13 ? 235 LEU B CD1 1 
ATOM   4405 C CD2 . LEU B 1 231 ? 22.414  7.097   70.604  1.00 14.89 ? 235 LEU B CD2 1 
ATOM   4406 N N   . LEU B 1 232 ? 22.334  11.520  72.002  1.00 15.28 ? 236 LEU B N   1 
ATOM   4407 C CA  . LEU B 1 232 ? 21.880  12.585  71.112  1.00 15.31 ? 236 LEU B CA  1 
ATOM   4408 C C   . LEU B 1 232 ? 22.612  13.917  71.260  1.00 17.07 ? 236 LEU B C   1 
ATOM   4409 O O   . LEU B 1 232 ? 22.372  14.845  70.487  1.00 16.65 ? 236 LEU B O   1 
ATOM   4410 C CB  . LEU B 1 232 ? 20.366  12.793  71.255  1.00 13.91 ? 236 LEU B CB  1 
ATOM   4411 C CG  . LEU B 1 232 ? 19.505  11.606  70.803  1.00 14.57 ? 236 LEU B CG  1 
ATOM   4412 C CD1 . LEU B 1 232 ? 18.026  11.973  70.899  1.00 13.20 ? 236 LEU B CD1 1 
ATOM   4413 C CD2 . LEU B 1 232 ? 19.864  11.218  69.374  1.00 14.41 ? 236 LEU B CD2 1 
ATOM   4414 N N   . ASP B 1 233 ? 23.505  14.012  72.242  1.00 16.90 ? 237 ASP B N   1 
ATOM   4415 C CA  . ASP B 1 233 ? 24.273  15.238  72.441  1.00 18.25 ? 237 ASP B CA  1 
ATOM   4416 C C   . ASP B 1 233 ? 25.603  15.146  71.700  1.00 17.90 ? 237 ASP B C   1 
ATOM   4417 O O   . ASP B 1 233 ? 26.419  16.070  71.751  1.00 18.59 ? 237 ASP B O   1 
ATOM   4418 C CB  . ASP B 1 233 ? 24.524  15.484  73.933  1.00 20.11 ? 237 ASP B CB  1 
ATOM   4419 C CG  . ASP B 1 233 ? 23.277  15.952  74.662  1.00 20.99 ? 237 ASP B CG  1 
ATOM   4420 O OD1 . ASP B 1 233 ? 23.291  15.983  75.909  1.00 22.30 ? 237 ASP B OD1 1 
ATOM   4421 O OD2 . ASP B 1 233 ? 22.284  16.297  73.987  1.00 23.78 ? 237 ASP B OD2 1 
ATOM   4422 N N   . GLU B 1 234 ? 25.821  14.022  71.020  1.00 16.34 ? 238 GLU B N   1 
ATOM   4423 C CA  . GLU B 1 234 ? 27.048  13.814  70.255  1.00 15.67 ? 238 GLU B CA  1 
ATOM   4424 C C   . GLU B 1 234 ? 27.148  14.881  69.169  1.00 16.39 ? 238 GLU B C   1 
ATOM   4425 O O   . GLU B 1 234 ? 26.236  15.039  68.357  1.00 17.06 ? 238 GLU B O   1 
ATOM   4426 C CB  . GLU B 1 234 ? 27.050  12.417  69.619  1.00 14.56 ? 238 GLU B CB  1 
ATOM   4427 C CG  . GLU B 1 234 ? 28.108  12.221  68.535  1.00 15.67 ? 238 GLU B CG  1 
ATOM   4428 C CD  . GLU B 1 234 ? 29.515  12.503  69.026  1.00 15.61 ? 238 GLU B CD  1 
ATOM   4429 O OE1 . GLU B 1 234 ? 30.271  13.181  68.304  1.00 17.50 ? 238 GLU B OE1 1 
ATOM   4430 O OE2 . GLU B 1 234 ? 29.869  12.040  70.129  1.00 17.27 ? 238 GLU B OE2 1 
ATOM   4431 N N   . PRO B 1 235 ? 28.257  15.639  69.152  1.00 17.25 ? 239 PRO B N   1 
ATOM   4432 C CA  . PRO B 1 235 ? 28.488  16.702  68.169  1.00 17.52 ? 239 PRO B CA  1 
ATOM   4433 C C   . PRO B 1 235 ? 28.322  16.248  66.721  1.00 17.44 ? 239 PRO B C   1 
ATOM   4434 O O   . PRO B 1 235 ? 27.726  16.954  65.907  1.00 19.59 ? 239 PRO B O   1 
ATOM   4435 C CB  . PRO B 1 235 ? 29.920  17.140  68.474  1.00 18.09 ? 239 PRO B CB  1 
ATOM   4436 C CG  . PRO B 1 235 ? 30.012  16.937  69.950  1.00 18.71 ? 239 PRO B CG  1 
ATOM   4437 C CD  . PRO B 1 235 ? 29.361  15.586  70.129  1.00 16.36 ? 239 PRO B CD  1 
ATOM   4438 N N   . VAL B 1 236 ? 28.854  15.070  66.404  1.00 17.01 ? 240 VAL B N   1 
ATOM   4439 C CA  . VAL B 1 236 ? 28.774  14.537  65.049  1.00 16.18 ? 240 VAL B CA  1 
ATOM   4440 C C   . VAL B 1 236 ? 27.334  14.360  64.577  1.00 14.66 ? 240 VAL B C   1 
ATOM   4441 O O   . VAL B 1 236 ? 27.035  14.587  63.408  1.00 13.49 ? 240 VAL B O   1 
ATOM   4442 C CB  . VAL B 1 236 ? 29.521  13.192  64.934  1.00 16.25 ? 240 VAL B CB  1 
ATOM   4443 C CG1 . VAL B 1 236 ? 29.321  12.600  63.541  1.00 17.92 ? 240 VAL B CG1 1 
ATOM   4444 C CG2 . VAL B 1 236 ? 31.007  13.402  65.208  1.00 17.15 ? 240 VAL B CG2 1 
ATOM   4445 N N   . LEU B 1 237 ? 26.446  13.948  65.479  1.00 14.95 ? 241 LEU B N   1 
ATOM   4446 C CA  . LEU B 1 237 ? 25.042  13.780  65.118  1.00 15.51 ? 241 LEU B CA  1 
ATOM   4447 C C   . LEU B 1 237 ? 24.425  15.154  64.909  1.00 16.27 ? 241 LEU B C   1 
ATOM   4448 O O   . LEU B 1 237 ? 23.619  15.352  63.998  1.00 18.16 ? 241 LEU B O   1 
ATOM   4449 C CB  . LEU B 1 237 ? 24.273  13.027  66.213  1.00 15.65 ? 241 LEU B CB  1 
ATOM   4450 C CG  . LEU B 1 237 ? 24.648  11.556  66.424  1.00 16.22 ? 241 LEU B CG  1 
ATOM   4451 C CD1 . LEU B 1 237 ? 23.822  10.967  67.563  1.00 15.55 ? 241 LEU B CD1 1 
ATOM   4452 C CD2 . LEU B 1 237 ? 24.420  10.780  65.130  1.00 17.69 ? 241 LEU B CD2 1 
ATOM   4453 N N   . GLY B 1 238 ? 24.817  16.108  65.751  1.00 16.70 ? 242 GLY B N   1 
ATOM   4454 C CA  . GLY B 1 238 ? 24.289  17.455  65.632  1.00 16.99 ? 242 GLY B CA  1 
ATOM   4455 C C   . GLY B 1 238 ? 24.654  18.072  64.298  1.00 17.32 ? 242 GLY B C   1 
ATOM   4456 O O   . GLY B 1 238 ? 23.815  18.668  63.619  1.00 18.97 ? 242 GLY B O   1 
ATOM   4457 N N   . SER B 1 239 ? 25.918  17.920  63.920  1.00 18.68 ? 243 SER B N   1 
ATOM   4458 C CA  . SER B 1 239 ? 26.414  18.457  62.661  1.00 18.40 ? 243 SER B CA  1 
ATOM   4459 C C   . SER B 1 239 ? 25.730  17.803  61.463  1.00 17.82 ? 243 SER B C   1 
ATOM   4460 O O   . SER B 1 239 ? 25.295  18.486  60.536  1.00 16.67 ? 243 SER B O   1 
ATOM   4461 C CB  . SER B 1 239 ? 27.926  18.246  62.567  1.00 20.09 ? 243 SER B CB  1 
ATOM   4462 O OG  . SER B 1 239 ? 28.590  18.930  63.613  1.00 24.29 ? 243 SER B OG  1 
ATOM   4463 N N   . MET B 1 240 ? 25.629  16.478  61.484  1.00 18.23 ? 244 MET B N   1 
ATOM   4464 C CA  . MET B 1 240 ? 25.002  15.769  60.377  1.00 16.53 ? 244 MET B CA  1 
ATOM   4465 C C   . MET B 1 240 ? 23.527  16.140  60.269  1.00 16.56 ? 244 MET B C   1 
ATOM   4466 O O   . MET B 1 240 ? 22.983  16.252  59.167  1.00 16.23 ? 244 MET B O   1 
ATOM   4467 C CB  . MET B 1 240 ? 25.164  14.256  60.558  1.00 18.50 ? 244 MET B CB  1 
ATOM   4468 C CG  . MET B 1 240 ? 25.158  13.485  59.247  1.00 18.05 ? 244 MET B CG  1 
ATOM   4469 S SD  . MET B 1 240 ? 25.617  11.749  59.421  1.00 17.53 ? 244 MET B SD  1 
ATOM   4470 C CE  . MET B 1 240 ? 27.421  11.858  59.415  1.00 13.94 ? 244 MET B CE  1 
ATOM   4471 N N   . ALA B 1 241 ? 22.883  16.344  61.414  1.00 16.27 ? 245 ALA B N   1 
ATOM   4472 C CA  . ALA B 1 241 ? 21.472  16.708  61.429  1.00 16.87 ? 245 ALA B CA  1 
ATOM   4473 C C   . ALA B 1 241 ? 21.271  18.014  60.666  1.00 17.11 ? 245 ALA B C   1 
ATOM   4474 O O   . ALA B 1 241 ? 20.332  18.150  59.877  1.00 16.90 ? 245 ALA B O   1 
ATOM   4475 C CB  . ALA B 1 241 ? 20.983  16.850  62.867  1.00 15.97 ? 245 ALA B CB  1 
ATOM   4476 N N   . LYS B 1 242 ? 22.162  18.973  60.901  1.00 18.87 ? 246 LYS B N   1 
ATOM   4477 C CA  . LYS B 1 242 ? 22.083  20.259  60.221  1.00 19.10 ? 246 LYS B CA  1 
ATOM   4478 C C   . LYS B 1 242 ? 22.354  20.072  58.733  1.00 18.68 ? 246 LYS B C   1 
ATOM   4479 O O   . LYS B 1 242 ? 21.675  20.658  57.891  1.00 18.83 ? 246 LYS B O   1 
ATOM   4480 C CB  . LYS B 1 242 ? 23.093  21.248  60.821  1.00 21.35 ? 246 LYS B CB  1 
ATOM   4481 C CG  . LYS B 1 242 ? 22.715  21.754  62.211  1.00 22.03 ? 246 LYS B CG  1 
ATOM   4482 C CD  . LYS B 1 242 ? 23.767  22.697  62.778  0.75 23.49 ? 246 LYS B CD  1 
ATOM   4483 C CE  . LYS B 1 242 ? 23.361  23.216  64.154  0.75 23.11 ? 246 LYS B CE  1 
ATOM   4484 N NZ  . LYS B 1 242 ? 24.391  24.126  64.733  0.75 24.15 ? 246 LYS B NZ  1 
ATOM   4485 N N   . LYS B 1 243 ? 23.343  19.247  58.408  1.00 18.60 ? 247 LYS B N   1 
ATOM   4486 C CA  . LYS B 1 243 ? 23.678  19.003  57.012  1.00 18.74 ? 247 LYS B CA  1 
ATOM   4487 C C   . LYS B 1 243 ? 22.468  18.491  56.232  1.00 18.98 ? 247 LYS B C   1 
ATOM   4488 O O   . LYS B 1 243 ? 22.189  18.966  55.131  1.00 18.28 ? 247 LYS B O   1 
ATOM   4489 C CB  . LYS B 1 243 ? 24.827  17.997  56.905  1.00 18.07 ? 247 LYS B CB  1 
ATOM   4490 C CG  . LYS B 1 243 ? 25.155  17.585  55.474  1.00 20.02 ? 247 LYS B CG  1 
ATOM   4491 C CD  . LYS B 1 243 ? 26.276  16.560  55.432  1.00 21.74 ? 247 LYS B CD  1 
ATOM   4492 C CE  . LYS B 1 243 ? 26.605  16.152  54.002  1.00 22.31 ? 247 LYS B CE  1 
ATOM   4493 N NZ  . LYS B 1 243 ? 27.759  15.205  53.945  1.00 21.55 ? 247 LYS B NZ  1 
ATOM   4494 N N   . TYR B 1 244 ? 21.741  17.536  56.807  1.00 18.04 ? 248 TYR B N   1 
ATOM   4495 C CA  . TYR B 1 244 ? 20.567  16.971  56.137  1.00 17.83 ? 248 TYR B CA  1 
ATOM   4496 C C   . TYR B 1 244 ? 19.254  17.671  56.458  1.00 18.72 ? 248 TYR B C   1 
ATOM   4497 O O   . TYR B 1 244 ? 18.207  17.300  55.926  1.00 18.09 ? 248 TYR B O   1 
ATOM   4498 C CB  . TYR B 1 244 ? 20.420  15.485  56.472  1.00 15.89 ? 248 TYR B CB  1 
ATOM   4499 C CG  . TYR B 1 244 ? 21.487  14.607  55.863  1.00 15.51 ? 248 TYR B CG  1 
ATOM   4500 C CD1 . TYR B 1 244 ? 22.769  14.540  56.415  1.00 14.37 ? 248 TYR B CD1 1 
ATOM   4501 C CD2 . TYR B 1 244 ? 21.219  13.856  54.724  1.00 13.64 ? 248 TYR B CD2 1 
ATOM   4502 C CE1 . TYR B 1 244 ? 23.757  13.741  55.837  1.00 13.52 ? 248 TYR B CE1 1 
ATOM   4503 C CE2 . TYR B 1 244 ? 22.193  13.062  54.142  1.00 14.55 ? 248 TYR B CE2 1 
ATOM   4504 C CZ  . TYR B 1 244 ? 23.458  13.007  54.698  1.00 14.43 ? 248 TYR B CZ  1 
ATOM   4505 O OH  . TYR B 1 244 ? 24.415  12.224  54.100  1.00 13.21 ? 248 TYR B OH  1 
ATOM   4506 N N   . ASN B 1 245 ? 19.307  18.677  57.322  1.00 20.12 ? 249 ASN B N   1 
ATOM   4507 C CA  . ASN B 1 245 ? 18.108  19.412  57.716  1.00 20.26 ? 249 ASN B CA  1 
ATOM   4508 C C   . ASN B 1 245 ? 17.104  18.479  58.400  1.00 19.57 ? 249 ASN B C   1 
ATOM   4509 O O   . ASN B 1 245 ? 15.905  18.509  58.117  1.00 18.10 ? 249 ASN B O   1 
ATOM   4510 C CB  . ASN B 1 245 ? 17.455  20.072  56.499  1.00 24.85 ? 249 ASN B CB  1 
ATOM   4511 C CG  . ASN B 1 245 ? 16.453  21.142  56.887  1.00 29.48 ? 249 ASN B CG  1 
ATOM   4512 O OD1 . ASN B 1 245 ? 15.681  21.620  56.054  1.00 32.31 ? 249 ASN B OD1 1 
ATOM   4513 N ND2 . ASN B 1 245 ? 16.466  21.533  58.160  1.00 31.63 ? 249 ASN B ND2 1 
ATOM   4514 N N   . ARG B 1 246 ? 17.611  17.638  59.294  1.00 16.97 ? 250 ARG B N   1 
ATOM   4515 C CA  . ARG B 1 246 ? 16.779  16.711  60.050  1.00 16.75 ? 250 ARG B CA  1 
ATOM   4516 C C   . ARG B 1 246 ? 17.149  16.923  61.519  1.00 17.21 ? 250 ARG B C   1 
ATOM   4517 O O   . ARG B 1 246 ? 17.651  17.985  61.872  1.00 19.11 ? 250 ARG B O   1 
ATOM   4518 C CB  . ARG B 1 246 ? 17.059  15.270  59.606  1.00 15.28 ? 250 ARG B CB  1 
ATOM   4519 C CG  . ARG B 1 246 ? 16.729  15.009  58.125  1.00 14.53 ? 250 ARG B CG  1 
ATOM   4520 C CD  . ARG B 1 246 ? 15.228  15.091  57.863  1.00 16.67 ? 250 ARG B CD  1 
ATOM   4521 N NE  . ARG B 1 246 ? 14.906  14.940  56.444  1.00 19.41 ? 250 ARG B NE  1 
ATOM   4522 C CZ  . ARG B 1 246 ? 13.674  14.813  55.961  1.00 19.18 ? 250 ARG B CZ  1 
ATOM   4523 N NH1 . ARG B 1 246 ? 12.630  14.818  56.778  1.00 19.21 ? 250 ARG B NH1 1 
ATOM   4524 N NH2 . ARG B 1 246 ? 13.487  14.664  54.657  1.00 19.24 ? 250 ARG B NH2 1 
ATOM   4525 N N   . THR B 1 247 ? 16.901  15.938  62.374  1.00 17.22 ? 251 THR B N   1 
ATOM   4526 C CA  . THR B 1 247 ? 17.233  16.076  63.794  1.00 16.80 ? 251 THR B CA  1 
ATOM   4527 C C   . THR B 1 247 ? 18.245  15.015  64.191  1.00 16.07 ? 251 THR B C   1 
ATOM   4528 O O   . THR B 1 247 ? 18.413  14.019  63.489  1.00 14.52 ? 251 THR B O   1 
ATOM   4529 C CB  . THR B 1 247 ? 15.993  15.903  64.691  1.00 17.45 ? 251 THR B CB  1 
ATOM   4530 O OG1 . THR B 1 247 ? 15.468  14.581  64.525  1.00 16.26 ? 251 THR B OG1 1 
ATOM   4531 C CG2 . THR B 1 247 ? 14.919  16.925  64.328  1.00 17.00 ? 251 THR B CG2 1 
ATOM   4532 N N   . PRO B 1 248 ? 18.950  15.218  65.316  1.00 16.48 ? 252 PRO B N   1 
ATOM   4533 C CA  . PRO B 1 248 ? 19.926  14.200  65.712  1.00 14.16 ? 252 PRO B CA  1 
ATOM   4534 C C   . PRO B 1 248 ? 19.261  12.830  65.829  1.00 14.06 ? 252 PRO B C   1 
ATOM   4535 O O   . PRO B 1 248 ? 19.831  11.815  65.424  1.00 13.09 ? 252 PRO B O   1 
ATOM   4536 C CB  . PRO B 1 248 ? 20.442  14.727  67.050  1.00 13.94 ? 252 PRO B CB  1 
ATOM   4537 C CG  . PRO B 1 248 ? 20.415  16.224  66.829  1.00 14.35 ? 252 PRO B CG  1 
ATOM   4538 C CD  . PRO B 1 248 ? 19.051  16.412  66.180  1.00 14.06 ? 252 PRO B CD  1 
ATOM   4539 N N   . ALA B 1 249 ? 18.047  12.809  66.370  1.00 14.06 ? 253 ALA B N   1 
ATOM   4540 C CA  . ALA B 1 249 ? 17.314  11.558  66.530  1.00 15.34 ? 253 ALA B CA  1 
ATOM   4541 C C   . ALA B 1 249 ? 17.077  10.888  65.178  1.00 14.91 ? 253 ALA B C   1 
ATOM   4542 O O   . ALA B 1 249 ? 17.310  9.690   65.026  1.00 14.85 ? 253 ALA B O   1 
ATOM   4543 C CB  . ALA B 1 249 ? 15.985  11.816  67.225  1.00 16.49 ? 253 ALA B CB  1 
ATOM   4544 N N   . LEU B 1 250 ? 16.618  11.661  64.196  1.00 15.02 ? 254 LEU B N   1 
ATOM   4545 C CA  . LEU B 1 250 ? 16.361  11.107  62.866  1.00 15.61 ? 254 LEU B CA  1 
ATOM   4546 C C   . LEU B 1 250 ? 17.629  10.540  62.229  1.00 14.06 ? 254 LEU B C   1 
ATOM   4547 O O   . LEU B 1 250 ? 17.574  9.536   61.516  1.00 14.01 ? 254 LEU B O   1 
ATOM   4548 C CB  . LEU B 1 250 ? 15.731  12.165  61.951  1.00 13.93 ? 254 LEU B CB  1 
ATOM   4549 C CG  . LEU B 1 250 ? 14.237  12.419  62.201  1.00 15.50 ? 254 LEU B CG  1 
ATOM   4550 C CD1 . LEU B 1 250 ? 13.742  13.570  61.342  1.00 17.13 ? 254 LEU B CD1 1 
ATOM   4551 C CD2 . LEU B 1 250 ? 13.447  11.150  61.892  1.00 16.56 ? 254 LEU B CD2 1 
ATOM   4552 N N   . ILE B 1 251 ? 18.769  11.177  62.489  1.00 14.04 ? 255 ILE B N   1 
ATOM   4553 C CA  . ILE B 1 251 ? 20.044  10.706  61.952  1.00 12.59 ? 255 ILE B CA  1 
ATOM   4554 C C   . ILE B 1 251 ? 20.372  9.339   62.567  1.00 12.17 ? 255 ILE B C   1 
ATOM   4555 O O   . ILE B 1 251 ? 20.774  8.410   61.864  1.00 11.89 ? 255 ILE B O   1 
ATOM   4556 C CB  . ILE B 1 251 ? 21.197  11.703  62.276  1.00 13.00 ? 255 ILE B CB  1 
ATOM   4557 C CG1 . ILE B 1 251 ? 20.966  13.038  61.555  1.00 12.97 ? 255 ILE B CG1 1 
ATOM   4558 C CG2 . ILE B 1 251 ? 22.549  11.099  61.892  1.00 13.22 ? 255 ILE B CG2 1 
ATOM   4559 C CD1 . ILE B 1 251 ? 20.994  12.959  60.034  1.00 15.00 ? 255 ILE B CD1 1 
ATOM   4560 N N   . ALA B 1 252 ? 20.189  9.218   63.880  1.00 12.61 ? 256 ALA B N   1 
ATOM   4561 C CA  . ALA B 1 252 ? 20.467  7.965   64.587  1.00 12.61 ? 256 ALA B CA  1 
ATOM   4562 C C   . ALA B 1 252 ? 19.540  6.833   64.147  1.00 12.69 ? 256 ALA B C   1 
ATOM   4563 O O   . ALA B 1 252 ? 19.958  5.673   64.059  1.00 10.28 ? 256 ALA B O   1 
ATOM   4564 C CB  . ALA B 1 252 ? 20.347  8.175   66.097  1.00 13.03 ? 256 ALA B CB  1 
ATOM   4565 N N   . LEU B 1 253 ? 18.280  7.169   63.886  1.00 11.82 ? 257 LEU B N   1 
ATOM   4566 C CA  . LEU B 1 253 ? 17.304  6.170   63.448  1.00 12.24 ? 257 LEU B CA  1 
ATOM   4567 C C   . LEU B 1 253 ? 17.621  5.683   62.036  1.00 12.10 ? 257 LEU B C   1 
ATOM   4568 O O   . LEU B 1 253 ? 17.665  4.475   61.780  1.00 11.28 ? 257 LEU B O   1 
ATOM   4569 C CB  . LEU B 1 253 ? 15.886  6.759   63.479  1.00 11.96 ? 257 LEU B CB  1 
ATOM   4570 C CG  . LEU B 1 253 ? 15.278  7.036   64.863  1.00 13.27 ? 257 LEU B CG  1 
ATOM   4571 C CD1 . LEU B 1 253 ? 14.035  7.892   64.720  1.00 12.08 ? 257 LEU B CD1 1 
ATOM   4572 C CD2 . LEU B 1 253 ? 14.937  5.724   65.554  1.00 14.97 ? 257 LEU B CD2 1 
ATOM   4573 N N   . ARG B 1 254 ? 17.849  6.629   61.127  1.00 11.60 ? 258 ARG B N   1 
ATOM   4574 C CA  . ARG B 1 254 ? 18.147  6.314   59.731  1.00 10.27 ? 258 ARG B CA  1 
ATOM   4575 C C   . ARG B 1 254 ? 19.428  5.494   59.607  1.00 10.64 ? 258 ARG B C   1 
ATOM   4576 O O   . ARG B 1 254 ? 19.534  4.604   58.760  1.00 8.61  ? 258 ARG B O   1 
ATOM   4577 C CB  . ARG B 1 254 ? 18.285  7.604   58.912  1.00 9.31  ? 258 ARG B CB  1 
ATOM   4578 C CG  . ARG B 1 254 ? 18.363  7.364   57.401  1.00 11.68 ? 258 ARG B CG  1 
ATOM   4579 C CD  . ARG B 1 254 ? 17.058  6.760   56.866  1.00 10.34 ? 258 ARG B CD  1 
ATOM   4580 N NE  . ARG B 1 254 ? 17.238  6.148   55.548  1.00 11.92 ? 258 ARG B NE  1 
ATOM   4581 C CZ  . ARG B 1 254 ? 16.250  5.654   54.804  1.00 12.69 ? 258 ARG B CZ  1 
ATOM   4582 N NH1 . ARG B 1 254 ? 14.997  5.698   55.238  1.00 10.26 ? 258 ARG B NH1 1 
ATOM   4583 N NH2 . ARG B 1 254 ? 16.518  5.110   53.625  1.00 12.81 ? 258 ARG B NH2 1 
ATOM   4584 N N   . TYR B 1 255 ? 20.407  5.806   60.447  1.00 9.17  ? 259 TYR B N   1 
ATOM   4585 C CA  . TYR B 1 255 ? 21.667  5.085   60.433  1.00 9.27  ? 259 TYR B CA  1 
ATOM   4586 C C   . TYR B 1 255 ? 21.418  3.579   60.529  1.00 9.76  ? 259 TYR B C   1 
ATOM   4587 O O   . TYR B 1 255 ? 21.943  2.795   59.736  1.00 11.87 ? 259 TYR B O   1 
ATOM   4588 C CB  . TYR B 1 255 ? 22.534  5.539   61.614  1.00 10.39 ? 259 TYR B CB  1 
ATOM   4589 C CG  . TYR B 1 255 ? 23.778  4.705   61.826  1.00 9.82  ? 259 TYR B CG  1 
ATOM   4590 C CD1 . TYR B 1 255 ? 24.788  4.667   60.863  1.00 11.71 ? 259 TYR B CD1 1 
ATOM   4591 C CD2 . TYR B 1 255 ? 23.958  3.971   63.000  1.00 9.03  ? 259 TYR B CD2 1 
ATOM   4592 C CE1 . TYR B 1 255 ? 25.949  3.924   61.067  1.00 10.22 ? 259 TYR B CE1 1 
ATOM   4593 C CE2 . TYR B 1 255 ? 25.112  3.223   63.210  1.00 10.52 ? 259 TYR B CE2 1 
ATOM   4594 C CZ  . TYR B 1 255 ? 26.104  3.206   62.242  1.00 12.07 ? 259 TYR B CZ  1 
ATOM   4595 O OH  . TYR B 1 255 ? 27.256  2.481   62.451  1.00 12.91 ? 259 TYR B OH  1 
ATOM   4596 N N   . GLN B 1 256 ? 20.603  3.183   61.501  1.00 11.07 ? 260 GLN B N   1 
ATOM   4597 C CA  . GLN B 1 256 ? 20.304  1.774   61.724  1.00 11.14 ? 260 GLN B CA  1 
ATOM   4598 C C   . GLN B 1 256 ? 19.440  1.151   60.624  1.00 10.50 ? 260 GLN B C   1 
ATOM   4599 O O   . GLN B 1 256 ? 19.700  0.033   60.189  1.00 9.92  ? 260 GLN B O   1 
ATOM   4600 C CB  . GLN B 1 256 ? 19.629  1.611   63.083  1.00 10.68 ? 260 GLN B CB  1 
ATOM   4601 C CG  . GLN B 1 256 ? 20.443  2.190   64.244  1.00 11.12 ? 260 GLN B CG  1 
ATOM   4602 C CD  . GLN B 1 256 ? 21.621  1.315   64.646  1.00 14.02 ? 260 GLN B CD  1 
ATOM   4603 O OE1 . GLN B 1 256 ? 22.412  0.886   63.807  1.00 13.73 ? 260 GLN B OE1 1 
ATOM   4604 N NE2 . GLN B 1 256 ? 21.745  1.056   65.943  1.00 17.67 ? 260 GLN B NE2 1 
ATOM   4605 N N   . LEU B 1 257 ? 18.418  1.864   60.169  1.00 9.73  ? 261 LEU B N   1 
ATOM   4606 C CA  . LEU B 1 257 ? 17.569  1.320   59.109  1.00 10.63 ? 261 LEU B CA  1 
ATOM   4607 C C   . LEU B 1 257 ? 18.384  0.989   57.862  1.00 11.77 ? 261 LEU B C   1 
ATOM   4608 O O   . LEU B 1 257 ? 18.122  -0.004  57.179  1.00 10.18 ? 261 LEU B O   1 
ATOM   4609 C CB  . LEU B 1 257 ? 16.463  2.310   58.737  1.00 11.59 ? 261 LEU B CB  1 
ATOM   4610 C CG  . LEU B 1 257 ? 15.277  2.442   59.691  1.00 12.70 ? 261 LEU B CG  1 
ATOM   4611 C CD1 . LEU B 1 257 ? 14.266  3.422   59.101  1.00 12.76 ? 261 LEU B CD1 1 
ATOM   4612 C CD2 . LEU B 1 257 ? 14.632  1.081   59.908  1.00 14.23 ? 261 LEU B CD2 1 
ATOM   4613 N N   . GLN B 1 258 ? 19.377  1.822   57.563  1.00 10.56 ? 262 GLN B N   1 
ATOM   4614 C CA  . GLN B 1 258 ? 20.206  1.595   56.387  1.00 9.77  ? 262 GLN B CA  1 
ATOM   4615 C C   . GLN B 1 258 ? 21.201  0.459   56.551  1.00 10.56 ? 262 GLN B C   1 
ATOM   4616 O O   . GLN B 1 258 ? 21.858  0.066   55.588  1.00 12.14 ? 262 GLN B O   1 
ATOM   4617 C CB  . GLN B 1 258 ? 20.930  2.882   55.988  1.00 10.50 ? 262 GLN B CB  1 
ATOM   4618 C CG  . GLN B 1 258 ? 20.019  3.851   55.255  1.00 10.06 ? 262 GLN B CG  1 
ATOM   4619 C CD  . GLN B 1 258 ? 20.726  5.096   54.767  1.00 11.80 ? 262 GLN B CD  1 
ATOM   4620 O OE1 . GLN B 1 258 ? 21.870  5.042   54.312  1.00 14.88 ? 262 GLN B OE1 1 
ATOM   4621 N NE2 . GLN B 1 258 ? 20.037  6.224   54.836  1.00 9.68  ? 262 GLN B NE2 1 
ATOM   4622 N N   . ARG B 1 259 ? 21.306  -0.071  57.766  1.00 9.84  ? 263 ARG B N   1 
ATOM   4623 C CA  . ARG B 1 259 ? 22.211  -1.183  58.036  1.00 10.13 ? 263 ARG B CA  1 
ATOM   4624 C C   . ARG B 1 259 ? 21.425  -2.496  58.086  1.00 11.02 ? 263 ARG B C   1 
ATOM   4625 O O   . ARG B 1 259 ? 21.975  -3.549  58.415  1.00 11.33 ? 263 ARG B O   1 
ATOM   4626 C CB  . ARG B 1 259 ? 22.942  -0.962  59.364  1.00 11.49 ? 263 ARG B CB  1 
ATOM   4627 C CG  . ARG B 1 259 ? 23.769  0.324   59.419  1.00 9.84  ? 263 ARG B CG  1 
ATOM   4628 C CD  . ARG B 1 259 ? 24.319  0.545   60.825  1.00 12.50 ? 263 ARG B CD  1 
ATOM   4629 N NE  . ARG B 1 259 ? 25.399  -0.383  61.147  1.00 13.13 ? 263 ARG B NE  1 
ATOM   4630 C CZ  . ARG B 1 259 ? 25.628  -0.876  62.360  1.00 13.55 ? 263 ARG B CZ  1 
ATOM   4631 N NH1 . ARG B 1 259 ? 24.845  -0.537  63.379  1.00 11.71 ? 263 ARG B NH1 1 
ATOM   4632 N NH2 . ARG B 1 259 ? 26.647  -1.698  62.559  1.00 13.90 ? 263 ARG B NH2 1 
ATOM   4633 N N   . GLY B 1 260 ? 20.136  -2.425  57.758  1.00 11.72 ? 264 GLY B N   1 
ATOM   4634 C CA  . GLY B 1 260 ? 19.295  -3.614  57.769  1.00 12.16 ? 264 GLY B CA  1 
ATOM   4635 C C   . GLY B 1 260 ? 18.759  -3.971  59.145  1.00 12.15 ? 264 GLY B C   1 
ATOM   4636 O O   . GLY B 1 260 ? 18.291  -5.088  59.375  1.00 10.65 ? 264 GLY B O   1 
ATOM   4637 N N   . ILE B 1 261 ? 18.820  -3.017  60.066  1.00 11.44 ? 265 ILE B N   1 
ATOM   4638 C CA  . ILE B 1 261 ? 18.343  -3.241  61.424  1.00 11.76 ? 265 ILE B CA  1 
ATOM   4639 C C   . ILE B 1 261 ? 16.896  -2.783  61.619  1.00 10.28 ? 265 ILE B C   1 
ATOM   4640 O O   . ILE B 1 261 ? 16.470  -1.779  61.044  1.00 11.48 ? 265 ILE B O   1 
ATOM   4641 C CB  . ILE B 1 261 ? 19.239  -2.495  62.443  1.00 11.45 ? 265 ILE B CB  1 
ATOM   4642 C CG1 . ILE B 1 261 ? 20.652  -3.084  62.417  1.00 13.09 ? 265 ILE B CG1 1 
ATOM   4643 C CG2 . ILE B 1 261 ? 18.641  -2.579  63.841  1.00 12.07 ? 265 ILE B CG2 1 
ATOM   4644 C CD1 . ILE B 1 261 ? 21.639  -2.372  63.330  1.00 12.72 ? 265 ILE B CD1 1 
ATOM   4645 N N   . VAL B 1 262 ? 16.146  -3.539  62.415  1.00 8.40  ? 266 VAL B N   1 
ATOM   4646 C CA  . VAL B 1 262 ? 14.765  -3.195  62.744  1.00 10.64 ? 266 VAL B CA  1 
ATOM   4647 C C   . VAL B 1 262 ? 14.913  -2.332  63.992  1.00 11.86 ? 266 VAL B C   1 
ATOM   4648 O O   . VAL B 1 262 ? 15.493  -2.773  64.985  1.00 10.19 ? 266 VAL B O   1 
ATOM   4649 C CB  . VAL B 1 262 ? 13.926  -4.450  63.076  1.00 11.90 ? 266 VAL B CB  1 
ATOM   4650 C CG1 . VAL B 1 262 ? 12.636  -4.051  63.768  1.00 10.44 ? 266 VAL B CG1 1 
ATOM   4651 C CG2 . VAL B 1 262 ? 13.606  -5.212  61.790  1.00 11.41 ? 266 VAL B CG2 1 
ATOM   4652 N N   . VAL B 1 263 ? 14.391  -1.111  63.946  1.00 12.93 ? 267 VAL B N   1 
ATOM   4653 C CA  . VAL B 1 263 ? 14.543  -0.198  65.070  1.00 13.06 ? 267 VAL B CA  1 
ATOM   4654 C C   . VAL B 1 263 ? 13.348  0.042   65.979  1.00 13.62 ? 267 VAL B C   1 
ATOM   4655 O O   . VAL B 1 263 ? 12.203  0.135   65.532  1.00 12.51 ? 267 VAL B O   1 
ATOM   4656 C CB  . VAL B 1 263 ? 15.035  1.184   64.585  1.00 14.47 ? 267 VAL B CB  1 
ATOM   4657 C CG1 . VAL B 1 263 ? 16.371  1.038   63.876  1.00 15.10 ? 267 VAL B CG1 1 
ATOM   4658 C CG2 . VAL B 1 263 ? 14.011  1.804   63.658  1.00 16.58 ? 267 VAL B CG2 1 
ATOM   4659 N N   . LEU B 1 264 ? 13.641  0.142   67.270  1.00 13.59 ? 268 LEU B N   1 
ATOM   4660 C CA  . LEU B 1 264 ? 12.628  0.431   68.272  1.00 12.97 ? 268 LEU B CA  1 
ATOM   4661 C C   . LEU B 1 264 ? 12.911  1.854   68.730  1.00 13.90 ? 268 LEU B C   1 
ATOM   4662 O O   . LEU B 1 264 ? 14.028  2.352   68.578  1.00 12.53 ? 268 LEU B O   1 
ATOM   4663 C CB  . LEU B 1 264 ? 12.753  -0.510  69.470  1.00 12.83 ? 268 LEU B CB  1 
ATOM   4664 C CG  . LEU B 1 264 ? 12.627  -2.012  69.222  1.00 11.73 ? 268 LEU B CG  1 
ATOM   4665 C CD1 . LEU B 1 264 ? 12.624  -2.730  70.562  1.00 12.95 ? 268 LEU B CD1 1 
ATOM   4666 C CD2 . LEU B 1 264 ? 11.332  -2.306  68.449  1.00 8.76  ? 268 LEU B CD2 1 
ATOM   4667 N N   . ASN B 1 265 ? 11.903  2.516   69.278  1.00 12.32 ? 269 ASN B N   1 
ATOM   4668 C CA  . ASN B 1 265 ? 12.089  3.872   69.768  1.00 13.97 ? 269 ASN B CA  1 
ATOM   4669 C C   . ASN B 1 265 ? 10.972  4.186   70.738  1.00 14.43 ? 269 ASN B C   1 
ATOM   4670 O O   . ASN B 1 265 ? 9.870   3.636   70.638  1.00 14.95 ? 269 ASN B O   1 
ATOM   4671 C CB  . ASN B 1 265 ? 12.078  4.877   68.606  1.00 16.54 ? 269 ASN B CB  1 
ATOM   4672 C CG  . ASN B 1 265 ? 10.678  5.205   68.129  1.00 18.75 ? 269 ASN B CG  1 
ATOM   4673 O OD1 . ASN B 1 265 ? 10.051  6.150   68.611  1.00 21.30 ? 269 ASN B OD1 1 
ATOM   4674 N ND2 . ASN B 1 265 ? 10.173  4.417   67.186  1.00 19.57 ? 269 ASN B ND2 1 
ATOM   4675 N N   . THR B 1 266 ? 11.266  5.047   71.700  1.00 15.22 ? 270 THR B N   1 
ATOM   4676 C CA  . THR B 1 266 ? 10.266  5.451   72.670  1.00 16.19 ? 270 THR B CA  1 
ATOM   4677 C C   . THR B 1 266 ? 10.453  6.921   72.979  1.00 17.89 ? 270 THR B C   1 
ATOM   4678 O O   . THR B 1 266 ? 11.579  7.417   73.064  1.00 15.43 ? 270 THR B O   1 
ATOM   4679 C CB  . THR B 1 266 ? 10.375  4.664   73.994  1.00 16.47 ? 270 THR B CB  1 
ATOM   4680 O OG1 . THR B 1 266 ? 10.088  3.281   73.760  1.00 16.36 ? 270 THR B OG1 1 
ATOM   4681 C CG2 . THR B 1 266 ? 9.381   5.208   75.021  1.00 16.02 ? 270 THR B CG2 1 
ATOM   4682 N N   . SER B 1 267 ? 9.332   7.613   73.118  1.00 17.23 ? 271 SER B N   1 
ATOM   4683 C CA  . SER B 1 267 ? 9.323   9.024   73.457  1.00 17.94 ? 271 SER B CA  1 
ATOM   4684 C C   . SER B 1 267 ? 8.043   9.272   74.236  1.00 19.07 ? 271 SER B C   1 
ATOM   4685 O O   . SER B 1 267 ? 7.003   8.679   73.938  1.00 18.42 ? 271 SER B O   1 
ATOM   4686 C CB  . SER B 1 267 ? 9.335   9.898   72.204  1.00 17.23 ? 271 SER B CB  1 
ATOM   4687 O OG  . SER B 1 267 ? 9.266   11.267  72.564  1.00 16.51 ? 271 SER B OG  1 
ATOM   4688 N N   . LEU B 1 268 ? 8.125   10.138  75.238  1.00 20.24 ? 272 LEU B N   1 
ATOM   4689 C CA  . LEU B 1 268 ? 6.964   10.466  76.052  1.00 21.26 ? 272 LEU B CA  1 
ATOM   4690 C C   . LEU B 1 268 ? 6.278   11.686  75.458  1.00 22.25 ? 272 LEU B C   1 
ATOM   4691 O O   . LEU B 1 268 ? 5.222   12.110  75.931  1.00 22.31 ? 272 LEU B O   1 
ATOM   4692 C CB  . LEU B 1 268 ? 7.398   10.770  77.486  1.00 22.57 ? 272 LEU B CB  1 
ATOM   4693 C CG  . LEU B 1 268 ? 8.216   9.683   78.186  1.00 22.12 ? 272 LEU B CG  1 
ATOM   4694 C CD1 . LEU B 1 268 ? 8.643   10.175  79.561  1.00 23.04 ? 272 LEU B CD1 1 
ATOM   4695 C CD2 . LEU B 1 268 ? 7.395   8.410   78.297  1.00 23.94 ? 272 LEU B CD2 1 
ATOM   4696 N N   . LYS B 1 269 ? 6.885   12.241  74.413  1.00 20.87 ? 273 LYS B N   1 
ATOM   4697 C CA  . LYS B 1 269 ? 6.357   13.427  73.756  1.00 22.15 ? 273 LYS B CA  1 
ATOM   4698 C C   . LYS B 1 269 ? 5.677   13.113  72.426  1.00 21.42 ? 273 LYS B C   1 
ATOM   4699 O O   . LYS B 1 269 ? 6.265   12.496  71.537  1.00 20.73 ? 273 LYS B O   1 
ATOM   4700 C CB  . LYS B 1 269 ? 7.490   14.437  73.558  1.00 22.48 ? 273 LYS B CB  1 
ATOM   4701 C CG  . LYS B 1 269 ? 8.136   14.864  74.874  1.00 25.25 ? 273 LYS B CG  1 
ATOM   4702 C CD  . LYS B 1 269 ? 9.395   15.690  74.657  1.00 26.56 ? 273 LYS B CD  1 
ATOM   4703 C CE  . LYS B 1 269 ? 9.968   16.193  75.980  1.00 25.47 ? 273 LYS B CE  1 
ATOM   4704 N NZ  . LYS B 1 269 ? 10.242  15.094  76.949  1.00 25.06 ? 273 LYS B NZ  1 
ATOM   4705 N N   . GLU B 1 270 ? 4.425   13.540  72.303  1.00 20.87 ? 274 GLU B N   1 
ATOM   4706 C CA  . GLU B 1 270 ? 3.644   13.304  71.096  1.00 20.78 ? 274 GLU B CA  1 
ATOM   4707 C C   . GLU B 1 270 ? 4.337   13.831  69.843  1.00 20.91 ? 274 GLU B C   1 
ATOM   4708 O O   . GLU B 1 270 ? 4.349   13.170  68.804  1.00 19.64 ? 274 GLU B O   1 
ATOM   4709 C CB  . GLU B 1 270 ? 2.265   13.961  71.233  1.00 22.32 ? 274 GLU B CB  1 
ATOM   4710 C CG  . GLU B 1 270 ? 1.367   13.802  70.017  1.00 25.11 ? 274 GLU B CG  1 
ATOM   4711 C CD  . GLU B 1 270 ? 0.010   14.462  70.202  1.00 27.86 ? 274 GLU B CD  1 
ATOM   4712 O OE1 . GLU B 1 270 ? -0.802  14.428  69.254  1.00 28.87 ? 274 GLU B OE1 1 
ATOM   4713 O OE2 . GLU B 1 270 ? -0.248  15.013  71.297  1.00 30.00 ? 274 GLU B OE2 1 
ATOM   4714 N N   . GLU B 1 271 ? 4.919   15.021  69.944  1.00 19.41 ? 275 GLU B N   1 
ATOM   4715 C CA  . GLU B 1 271 ? 5.586   15.633  68.805  1.00 20.33 ? 275 GLU B CA  1 
ATOM   4716 C C   . GLU B 1 271 ? 6.753   14.801  68.281  1.00 19.29 ? 275 GLU B C   1 
ATOM   4717 O O   . GLU B 1 271 ? 7.004   14.766  67.079  1.00 18.51 ? 275 GLU B O   1 
ATOM   4718 C CB  . GLU B 1 271 ? 6.081   17.033  69.175  1.00 22.33 ? 275 GLU B CB  1 
ATOM   4719 C CG  . GLU B 1 271 ? 6.550   17.861  67.988  0.50 25.92 ? 275 GLU B CG  1 
ATOM   4720 C CD  . GLU B 1 271 ? 5.423   18.213  67.031  0.50 28.81 ? 275 GLU B CD  1 
ATOM   4721 O OE1 . GLU B 1 271 ? 5.692   18.907  66.027  0.50 30.38 ? 275 GLU B OE1 1 
ATOM   4722 O OE2 . GLU B 1 271 ? 4.269   17.799  67.279  0.50 31.04 ? 275 GLU B OE2 1 
ATOM   4723 N N   . ARG B 1 272 ? 7.464   14.132  69.182  1.00 19.38 ? 276 ARG B N   1 
ATOM   4724 C CA  . ARG B 1 272 ? 8.608   13.312  68.787  1.00 18.23 ? 276 ARG B CA  1 
ATOM   4725 C C   . ARG B 1 272 ? 8.200   11.960  68.214  1.00 18.54 ? 276 ARG B C   1 
ATOM   4726 O O   . ARG B 1 272 ? 8.915   11.391  67.379  1.00 16.18 ? 276 ARG B O   1 
ATOM   4727 C CB  . ARG B 1 272 ? 9.548   13.134  69.977  1.00 19.00 ? 276 ARG B CB  1 
ATOM   4728 C CG  . ARG B 1 272 ? 10.233  14.443  70.365  1.00 18.18 ? 276 ARG B CG  1 
ATOM   4729 C CD  . ARG B 1 272 ? 11.050  14.309  71.633  1.00 20.91 ? 276 ARG B CD  1 
ATOM   4730 N NE  . ARG B 1 272 ? 11.894  15.481  71.847  1.00 18.56 ? 276 ARG B NE  1 
ATOM   4731 C CZ  . ARG B 1 272 ? 12.657  15.660  72.919  1.00 19.87 ? 276 ARG B CZ  1 
ATOM   4732 N NH1 . ARG B 1 272 ? 12.679  14.743  73.877  1.00 19.31 ? 276 ARG B NH1 1 
ATOM   4733 N NH2 . ARG B 1 272 ? 13.401  16.749  73.030  1.00 18.81 ? 276 ARG B NH2 1 
ATOM   4734 N N   . ILE B 1 273 ? 7.055   11.448  68.661  1.00 16.42 ? 277 ILE B N   1 
ATOM   4735 C CA  . ILE B 1 273 ? 6.543   10.176  68.161  1.00 16.37 ? 277 ILE B CA  1 
ATOM   4736 C C   . ILE B 1 273 ? 6.271   10.361  66.672  1.00 17.66 ? 277 ILE B C   1 
ATOM   4737 O O   . ILE B 1 273 ? 6.654   9.529   65.842  1.00 13.31 ? 277 ILE B O   1 
ATOM   4738 C CB  . ILE B 1 273 ? 5.215   9.784   68.849  1.00 16.95 ? 277 ILE B CB  1 
ATOM   4739 C CG1 . ILE B 1 273 ? 5.421   9.656   70.359  1.00 18.12 ? 277 ILE B CG1 1 
ATOM   4740 C CG2 . ILE B 1 273 ? 4.679   8.486   68.255  1.00 14.29 ? 277 ILE B CG2 1 
ATOM   4741 C CD1 . ILE B 1 273 ? 6.516   8.709   70.744  1.00 22.58 ? 277 ILE B CD1 1 
ATOM   4742 N N   . LYS B 1 274 ? 5.603   11.466  66.347  1.00 17.69 ? 278 LYS B N   1 
ATOM   4743 C CA  . LYS B 1 274 ? 5.271   11.790  64.966  1.00 18.98 ? 278 LYS B CA  1 
ATOM   4744 C C   . LYS B 1 274 ? 6.536   12.024  64.149  1.00 18.76 ? 278 LYS B C   1 
ATOM   4745 O O   . LYS B 1 274 ? 6.648   11.555  63.018  1.00 18.39 ? 278 LYS B O   1 
ATOM   4746 C CB  . LYS B 1 274 ? 4.395   13.045  64.908  1.00 19.59 ? 278 LYS B CB  1 
ATOM   4747 C CG  . LYS B 1 274 ? 3.044   12.919  65.591  1.00 21.01 ? 278 LYS B CG  1 
ATOM   4748 C CD  . LYS B 1 274 ? 2.309   14.258  65.554  1.00 23.66 ? 278 LYS B CD  1 
ATOM   4749 C CE  . LYS B 1 274 ? 0.989   14.208  66.309  1.00 24.63 ? 278 LYS B CE  1 
ATOM   4750 N NZ  . LYS B 1 274 ? 0.311   15.540  66.342  1.00 24.79 ? 278 LYS B NZ  1 
ATOM   4751 N N   . GLU B 1 275 ? 7.484   12.752  64.732  1.00 18.60 ? 279 GLU B N   1 
ATOM   4752 C CA  . GLU B 1 275 ? 8.744   13.067  64.062  1.00 19.48 ? 279 GLU B CA  1 
ATOM   4753 C C   . GLU B 1 275 ? 9.525   11.826  63.643  1.00 18.37 ? 279 GLU B C   1 
ATOM   4754 O O   . GLU B 1 275 ? 10.003  11.739  62.517  1.00 19.34 ? 279 GLU B O   1 
ATOM   4755 C CB  . GLU B 1 275 ? 9.634   13.923  64.972  1.00 19.05 ? 279 GLU B CB  1 
ATOM   4756 C CG  . GLU B 1 275 ? 10.938  14.350  64.311  1.00 21.15 ? 279 GLU B CG  1 
ATOM   4757 C CD  . GLU B 1 275 ? 11.853  15.116  65.242  1.00 22.17 ? 279 GLU B CD  1 
ATOM   4758 O OE1 . GLU B 1 275 ? 12.669  14.482  65.938  1.00 21.34 ? 279 GLU B OE1 1 
ATOM   4759 O OE2 . GLU B 1 275 ? 11.751  16.357  65.285  1.00 24.08 ? 279 GLU B OE2 1 
ATOM   4760 N N   . ASN B 1 276 ? 9.657   10.872  64.556  1.00 18.96 ? 280 ASN B N   1 
ATOM   4761 C CA  . ASN B 1 276 ? 10.399  9.648   64.282  1.00 17.36 ? 280 ASN B CA  1 
ATOM   4762 C C   . ASN B 1 276 ? 9.908   8.899   63.036  1.00 18.76 ? 280 ASN B C   1 
ATOM   4763 O O   . ASN B 1 276 ? 10.677  8.180   62.398  1.00 18.08 ? 280 ASN B O   1 
ATOM   4764 C CB  . ASN B 1 276 ? 10.354  8.743   65.514  1.00 17.05 ? 280 ASN B CB  1 
ATOM   4765 C CG  . ASN B 1 276 ? 11.069  9.359   66.711  1.00 15.82 ? 280 ASN B CG  1 
ATOM   4766 O OD1 . ASN B 1 276 ? 10.974  8.862   67.834  1.00 19.05 ? 280 ASN B OD1 1 
ATOM   4767 N ND2 . ASN B 1 276 ? 11.793  10.445  66.471  1.00 14.74 ? 280 ASN B ND2 1 
ATOM   4768 N N   . MET B 1 277 ? 8.635   9.071   62.690  1.00 17.93 ? 281 MET B N   1 
ATOM   4769 C CA  . MET B 1 277 ? 8.079   8.422   61.504  1.00 18.92 ? 281 MET B CA  1 
ATOM   4770 C C   . MET B 1 277 ? 8.689   9.006   60.233  1.00 17.87 ? 281 MET B C   1 
ATOM   4771 O O   . MET B 1 277 ? 8.620   8.399   59.164  1.00 16.74 ? 281 MET B O   1 
ATOM   4772 C CB  . MET B 1 277 ? 6.558   8.599   61.451  1.00 21.19 ? 281 MET B CB  1 
ATOM   4773 C CG  . MET B 1 277 ? 5.756   7.398   61.923  1.00 25.22 ? 281 MET B CG  1 
ATOM   4774 S SD  . MET B 1 277 ? 5.982   5.914   60.899  1.00 27.58 ? 281 MET B SD  1 
ATOM   4775 C CE  . MET B 1 277 ? 5.953   4.660   62.154  1.00 27.74 ? 281 MET B CE  1 
ATOM   4776 N N   . GLN B 1 278 ? 9.293   10.185  60.355  1.00 17.09 ? 282 GLN B N   1 
ATOM   4777 C CA  . GLN B 1 278 ? 9.905   10.848  59.208  1.00 17.53 ? 282 GLN B CA  1 
ATOM   4778 C C   . GLN B 1 278 ? 11.230  10.202  58.801  1.00 15.83 ? 282 GLN B C   1 
ATOM   4779 O O   . GLN B 1 278 ? 11.880  10.649  57.858  1.00 16.31 ? 282 GLN B O   1 
ATOM   4780 C CB  . GLN B 1 278 ? 10.120  12.337  59.517  1.00 18.81 ? 282 GLN B CB  1 
ATOM   4781 C CG  . GLN B 1 278 ? 8.860   13.033  60.023  1.00 25.76 ? 282 GLN B CG  1 
ATOM   4782 C CD  . GLN B 1 278 ? 9.014   14.538  60.166  1.00 28.95 ? 282 GLN B CD  1 
ATOM   4783 O OE1 . GLN B 1 278 ? 9.984   15.027  60.746  1.00 29.41 ? 282 GLN B OE1 1 
ATOM   4784 N NE2 . GLN B 1 278 ? 8.042   15.281  59.647  1.00 30.72 ? 282 GLN B NE2 1 
ATOM   4785 N N   . VAL B 1 279 ? 11.625  9.144   59.504  1.00 15.22 ? 283 VAL B N   1 
ATOM   4786 C CA  . VAL B 1 279 ? 12.880  8.464   59.195  1.00 14.34 ? 283 VAL B CA  1 
ATOM   4787 C C   . VAL B 1 279 ? 12.865  7.874   57.781  1.00 14.86 ? 283 VAL B C   1 
ATOM   4788 O O   . VAL B 1 279 ? 13.916  7.667   57.169  1.00 12.91 ? 283 VAL B O   1 
ATOM   4789 C CB  . VAL B 1 279 ? 13.171  7.337   60.218  1.00 14.48 ? 283 VAL B CB  1 
ATOM   4790 C CG1 . VAL B 1 279 ? 12.140  6.229   60.088  1.00 15.71 ? 283 VAL B CG1 1 
ATOM   4791 C CG2 . VAL B 1 279 ? 14.580  6.796   60.014  1.00 15.26 ? 283 VAL B CG2 1 
ATOM   4792 N N   . PHE B 1 280 ? 11.669  7.622   57.257  1.00 13.93 ? 284 PHE B N   1 
ATOM   4793 C CA  . PHE B 1 280 ? 11.528  7.051   55.920  1.00 15.10 ? 284 PHE B CA  1 
ATOM   4794 C C   . PHE B 1 280 ? 11.599  8.089   54.795  1.00 14.52 ? 284 PHE B C   1 
ATOM   4795 O O   . PHE B 1 280 ? 11.500  7.727   53.625  1.00 14.27 ? 284 PHE B O   1 
ATOM   4796 C CB  . PHE B 1 280 ? 10.189  6.306   55.805  1.00 14.82 ? 284 PHE B CB  1 
ATOM   4797 C CG  . PHE B 1 280 ? 10.044  5.153   56.762  1.00 15.03 ? 284 PHE B CG  1 
ATOM   4798 C CD1 . PHE B 1 280 ? 10.857  4.032   56.649  1.00 13.84 ? 284 PHE B CD1 1 
ATOM   4799 C CD2 . PHE B 1 280 ? 9.090   5.191   57.774  1.00 14.19 ? 284 PHE B CD2 1 
ATOM   4800 C CE1 . PHE B 1 280 ? 10.723  2.956   57.533  1.00 14.80 ? 284 PHE B CE1 1 
ATOM   4801 C CE2 . PHE B 1 280 ? 8.947   4.123   58.664  1.00 13.80 ? 284 PHE B CE2 1 
ATOM   4802 C CZ  . PHE B 1 280 ? 9.766   3.003   58.541  1.00 13.61 ? 284 PHE B CZ  1 
ATOM   4803 N N   . GLU B 1 281 ? 11.795  9.362   55.133  1.00 14.57 ? 285 GLU B N   1 
ATOM   4804 C CA  . GLU B 1 281 ? 11.811  10.411  54.112  1.00 14.29 ? 285 GLU B CA  1 
ATOM   4805 C C   . GLU B 1 281 ? 13.153  10.778  53.493  1.00 13.95 ? 285 GLU B C   1 
ATOM   4806 O O   . GLU B 1 281 ? 13.187  11.447  52.458  1.00 14.25 ? 285 GLU B O   1 
ATOM   4807 C CB  . GLU B 1 281 ? 11.185  11.701  54.659  1.00 16.96 ? 285 GLU B CB  1 
ATOM   4808 C CG  . GLU B 1 281 ? 9.882   11.526  55.403  1.00 17.14 ? 285 GLU B CG  1 
ATOM   4809 C CD  . GLU B 1 281 ? 9.272   12.860  55.805  1.00 18.71 ? 285 GLU B CD  1 
ATOM   4810 O OE1 . GLU B 1 281 ? 10.039  13.814  56.054  0.75 17.15 ? 285 GLU B OE1 1 
ATOM   4811 O OE2 . GLU B 1 281 ? 8.029   12.949  55.881  0.75 19.22 ? 285 GLU B OE2 1 
ATOM   4812 N N   . PHE B 1 282 ? 14.256  10.363  54.108  1.00 12.83 ? 286 PHE B N   1 
ATOM   4813 C CA  . PHE B 1 282 ? 15.563  10.717  53.568  1.00 12.72 ? 286 PHE B CA  1 
ATOM   4814 C C   . PHE B 1 282 ? 16.590  9.592   53.603  1.00 12.78 ? 286 PHE B C   1 
ATOM   4815 O O   . PHE B 1 282 ? 16.392  8.563   54.251  1.00 11.46 ? 286 PHE B O   1 
ATOM   4816 C CB  . PHE B 1 282 ? 16.125  11.933  54.307  1.00 13.75 ? 286 PHE B CB  1 
ATOM   4817 C CG  . PHE B 1 282 ? 16.543  11.641  55.723  1.00 13.22 ? 286 PHE B CG  1 
ATOM   4818 C CD1 . PHE B 1 282 ? 15.594  11.385  56.706  1.00 14.16 ? 286 PHE B CD1 1 
ATOM   4819 C CD2 . PHE B 1 282 ? 17.891  11.606  56.067  1.00 15.35 ? 286 PHE B CD2 1 
ATOM   4820 C CE1 . PHE B 1 282 ? 15.981  11.096  58.017  1.00 14.36 ? 286 PHE B CE1 1 
ATOM   4821 C CE2 . PHE B 1 282 ? 18.288  11.318  57.375  1.00 14.50 ? 286 PHE B CE2 1 
ATOM   4822 C CZ  . PHE B 1 282 ? 17.327  11.063  58.350  1.00 13.44 ? 286 PHE B CZ  1 
ATOM   4823 N N   . GLN B 1 283 ? 17.707  9.828   52.921  1.00 12.19 ? 287 GLN B N   1 
ATOM   4824 C CA  . GLN B 1 283 ? 18.787  8.855   52.802  1.00 12.51 ? 287 GLN B CA  1 
ATOM   4825 C C   . GLN B 1 283 ? 20.141  9.436   53.216  1.00 12.57 ? 287 GLN B C   1 
ATOM   4826 O O   . GLN B 1 283 ? 20.500  10.540  52.810  1.00 13.26 ? 287 GLN B O   1 
ATOM   4827 C CB  . GLN B 1 283 ? 18.863  8.390   51.343  1.00 12.04 ? 287 GLN B CB  1 
ATOM   4828 C CG  . GLN B 1 283 ? 19.932  7.353   51.027  1.00 13.23 ? 287 GLN B CG  1 
ATOM   4829 C CD  . GLN B 1 283 ? 19.524  5.958   51.440  1.00 12.51 ? 287 GLN B CD  1 
ATOM   4830 O OE1 . GLN B 1 283 ? 18.342  5.683   51.647  1.00 12.96 ? 287 GLN B OE1 1 
ATOM   4831 N NE2 . GLN B 1 283 ? 20.498  5.061   51.545  1.00 12.44 ? 287 GLN B NE2 1 
ATOM   4832 N N   . LEU B 1 284 ? 20.888  8.691   54.021  1.00 11.71 ? 288 LEU B N   1 
ATOM   4833 C CA  . LEU B 1 284 ? 22.215  9.131   54.446  1.00 13.30 ? 288 LEU B CA  1 
ATOM   4834 C C   . LEU B 1 284 ? 23.218  8.627   53.420  1.00 13.32 ? 288 LEU B C   1 
ATOM   4835 O O   . LEU B 1 284 ? 23.197  7.455   53.052  1.00 13.08 ? 288 LEU B O   1 
ATOM   4836 C CB  . LEU B 1 284 ? 22.569  8.554   55.820  1.00 12.54 ? 288 LEU B CB  1 
ATOM   4837 C CG  . LEU B 1 284 ? 21.774  9.067   57.018  1.00 13.52 ? 288 LEU B CG  1 
ATOM   4838 C CD1 . LEU B 1 284 ? 22.165  8.272   58.262  1.00 13.55 ? 288 LEU B CD1 1 
ATOM   4839 C CD2 . LEU B 1 284 ? 22.038  10.558  57.212  1.00 11.96 ? 288 LEU B CD2 1 
ATOM   4840 N N   . SER B 1 285 ? 24.098  9.509   52.962  1.00 13.73 ? 289 SER B N   1 
ATOM   4841 C CA  . SER B 1 285 ? 25.098  9.125   51.973  1.00 12.57 ? 289 SER B CA  1 
ATOM   4842 C C   . SER B 1 285 ? 25.986  8.022   52.523  1.00 13.54 ? 289 SER B C   1 
ATOM   4843 O O   . SER B 1 285 ? 26.137  7.876   53.741  1.00 13.49 ? 289 SER B O   1 
ATOM   4844 C CB  . SER B 1 285 ? 25.966  10.327  51.596  1.00 13.13 ? 289 SER B CB  1 
ATOM   4845 O OG  . SER B 1 285 ? 26.861  10.643  52.647  1.00 9.42  ? 289 SER B OG  1 
ATOM   4846 N N   . SER B 1 286 ? 26.573  7.244   51.618  1.00 12.76 ? 290 SER B N   1 
ATOM   4847 C CA  . SER B 1 286 ? 27.461  6.156   51.999  1.00 14.28 ? 290 SER B CA  1 
ATOM   4848 C C   . SER B 1 286 ? 28.643  6.694   52.805  1.00 15.23 ? 290 SER B C   1 
ATOM   4849 O O   . SER B 1 286 ? 29.110  6.052   53.745  1.00 14.68 ? 290 SER B O   1 
ATOM   4850 C CB  . SER B 1 286 ? 27.966  5.441   50.743  1.00 14.83 ? 290 SER B CB  1 
ATOM   4851 O OG  . SER B 1 286 ? 28.920  4.443   51.060  1.00 18.53 ? 290 SER B OG  1 
ATOM   4852 N N   . GLU B 1 287 ? 29.117  7.881   52.439  1.00 15.73 ? 291 GLU B N   1 
ATOM   4853 C CA  . GLU B 1 287 ? 30.252  8.489   53.128  1.00 16.57 ? 291 GLU B CA  1 
ATOM   4854 C C   . GLU B 1 287 ? 29.905  8.899   54.557  1.00 15.50 ? 291 GLU B C   1 
ATOM   4855 O O   . GLU B 1 287 ? 30.723  8.749   55.463  1.00 15.62 ? 291 GLU B O   1 
ATOM   4856 C CB  . GLU B 1 287 ? 30.757  9.707   52.347  1.00 18.97 ? 291 GLU B CB  1 
ATOM   4857 C CG  . GLU B 1 287 ? 32.250  9.947   52.486  0.50 22.26 ? 291 GLU B CG  1 
ATOM   4858 C CD  . GLU B 1 287 ? 33.078  8.814   51.897  0.50 24.95 ? 291 GLU B CD  1 
ATOM   4859 O OE1 . GLU B 1 287 ? 32.947  7.665   52.368  0.50 26.06 ? 291 GLU B OE1 1 
ATOM   4860 O OE2 . GLU B 1 287 ? 33.861  9.072   50.959  0.50 27.60 ? 291 GLU B OE2 1 
ATOM   4861 N N   . ASP B 1 288 ? 28.699  9.421   54.764  1.00 14.59 ? 292 ASP B N   1 
ATOM   4862 C CA  . ASP B 1 288 ? 28.296  9.826   56.103  1.00 12.86 ? 292 ASP B CA  1 
ATOM   4863 C C   . ASP B 1 288 ? 28.000  8.613   56.977  1.00 13.26 ? 292 ASP B C   1 
ATOM   4864 O O   . ASP B 1 288 ? 28.121  8.681   58.199  1.00 13.05 ? 292 ASP B O   1 
ATOM   4865 C CB  . ASP B 1 288 ? 27.090  10.774  56.054  1.00 13.88 ? 292 ASP B CB  1 
ATOM   4866 C CG  . ASP B 1 288 ? 27.474  12.182  55.619  1.00 14.35 ? 292 ASP B CG  1 
ATOM   4867 O OD1 . ASP B 1 288 ? 28.603  12.617  55.937  1.00 15.06 ? 292 ASP B OD1 1 
ATOM   4868 O OD2 . ASP B 1 288 ? 26.649  12.863  54.973  1.00 14.42 ? 292 ASP B OD2 1 
ATOM   4869 N N   . MET B 1 289 ? 27.616  7.500   56.357  1.00 12.60 ? 293 MET B N   1 
ATOM   4870 C CA  . MET B 1 289 ? 27.367  6.280   57.114  1.00 12.80 ? 293 MET B CA  1 
ATOM   4871 C C   . MET B 1 289 ? 28.713  5.845   57.703  1.00 14.49 ? 293 MET B C   1 
ATOM   4872 O O   . MET B 1 289 ? 28.780  5.358   58.832  1.00 12.12 ? 293 MET B O   1 
ATOM   4873 C CB  . MET B 1 289 ? 26.803  5.183   56.205  1.00 14.35 ? 293 MET B CB  1 
ATOM   4874 C CG  . MET B 1 289 ? 25.327  5.372   55.820  1.00 12.94 ? 293 MET B CG  1 
ATOM   4875 S SD  . MET B 1 289 ? 24.170  5.156   57.206  1.00 13.88 ? 293 MET B SD  1 
ATOM   4876 C CE  . MET B 1 289 ? 24.251  3.365   57.424  1.00 14.11 ? 293 MET B CE  1 
ATOM   4877 N N   . LYS B 1 290 ? 29.784  6.027   56.933  1.00 15.08 ? 294 LYS B N   1 
ATOM   4878 C CA  . LYS B 1 290 ? 31.122  5.672   57.402  1.00 18.05 ? 294 LYS B CA  1 
ATOM   4879 C C   . LYS B 1 290 ? 31.516  6.580   58.562  1.00 18.08 ? 294 LYS B C   1 
ATOM   4880 O O   . LYS B 1 290 ? 32.175  6.142   59.507  1.00 19.02 ? 294 LYS B O   1 
ATOM   4881 C CB  . LYS B 1 290 ? 32.148  5.804   56.271  1.00 19.64 ? 294 LYS B CB  1 
ATOM   4882 C CG  . LYS B 1 290 ? 31.951  4.813   55.128  1.00 24.63 ? 294 LYS B CG  1 
ATOM   4883 C CD  . LYS B 1 290 ? 32.949  5.066   54.006  1.00 28.05 ? 294 LYS B CD  1 
ATOM   4884 C CE  . LYS B 1 290 ? 32.743  4.102   52.850  1.00 31.17 ? 294 LYS B CE  1 
ATOM   4885 N NZ  . LYS B 1 290 ? 33.758  4.301   51.776  1.00 31.98 ? 294 LYS B NZ  1 
ATOM   4886 N N   . VAL B 1 291 ? 31.115  7.848   58.491  1.00 18.79 ? 295 VAL B N   1 
ATOM   4887 C CA  . VAL B 1 291 ? 31.422  8.789   59.563  1.00 18.05 ? 295 VAL B CA  1 
ATOM   4888 C C   . VAL B 1 291 ? 30.758  8.286   60.844  1.00 18.45 ? 295 VAL B C   1 
ATOM   4889 O O   . VAL B 1 291 ? 31.384  8.237   61.911  1.00 17.87 ? 295 VAL B O   1 
ATOM   4890 C CB  . VAL B 1 291 ? 30.889  10.209  59.252  1.00 20.72 ? 295 VAL B CB  1 
ATOM   4891 C CG1 . VAL B 1 291 ? 31.072  11.116  60.470  1.00 19.46 ? 295 VAL B CG1 1 
ATOM   4892 C CG2 . VAL B 1 291 ? 31.625  10.794  58.047  1.00 20.74 ? 295 VAL B CG2 1 
ATOM   4893 N N   . LEU B 1 292 ? 29.488  7.905   60.735  1.00 16.14 ? 296 LEU B N   1 
ATOM   4894 C CA  . LEU B 1 292 ? 28.761  7.405   61.891  1.00 13.50 ? 296 LEU B CA  1 
ATOM   4895 C C   . LEU B 1 292 ? 29.389  6.115   62.404  1.00 13.15 ? 296 LEU B C   1 
ATOM   4896 O O   . LEU B 1 292 ? 29.405  5.878   63.606  1.00 12.63 ? 296 LEU B O   1 
ATOM   4897 C CB  . LEU B 1 292 ? 27.278  7.190   61.549  1.00 13.97 ? 296 LEU B CB  1 
ATOM   4898 C CG  . LEU B 1 292 ? 26.526  8.488   61.223  1.00 13.58 ? 296 LEU B CG  1 
ATOM   4899 C CD1 . LEU B 1 292 ? 25.064  8.180   60.887  1.00 14.60 ? 296 LEU B CD1 1 
ATOM   4900 C CD2 . LEU B 1 292 ? 26.603  9.444   62.414  1.00 15.01 ? 296 LEU B CD2 1 
ATOM   4901 N N   . ASP B 1 293 ? 29.908  5.283   61.499  1.00 13.16 ? 297 ASP B N   1 
ATOM   4902 C CA  . ASP B 1 293 ? 30.562  4.038   61.911  1.00 14.57 ? 297 ASP B CA  1 
ATOM   4903 C C   . ASP B 1 293 ? 31.766  4.359   62.792  1.00 15.26 ? 297 ASP B C   1 
ATOM   4904 O O   . ASP B 1 293 ? 32.167  3.558   63.641  1.00 15.71 ? 297 ASP B O   1 
ATOM   4905 C CB  . ASP B 1 293 ? 31.067  3.239   60.703  1.00 14.71 ? 297 ASP B CB  1 
ATOM   4906 C CG  . ASP B 1 293 ? 29.952  2.562   59.933  1.00 16.03 ? 297 ASP B CG  1 
ATOM   4907 O OD1 . ASP B 1 293 ? 28.872  2.328   60.512  1.00 14.79 ? 297 ASP B OD1 1 
ATOM   4908 O OD2 . ASP B 1 293 ? 30.174  2.243   58.746  1.00 15.91 ? 297 ASP B OD2 1 
ATOM   4909 N N   . GLY B 1 294 ? 32.344  5.534   62.570  1.00 15.54 ? 298 GLY B N   1 
ATOM   4910 C CA  . GLY B 1 294 ? 33.508  5.949   63.331  1.00 16.63 ? 298 GLY B CA  1 
ATOM   4911 C C   . GLY B 1 294 ? 33.252  6.374   64.766  1.00 16.16 ? 298 GLY B C   1 
ATOM   4912 O O   . GLY B 1 294 ? 34.198  6.602   65.521  1.00 16.30 ? 298 GLY B O   1 
ATOM   4913 N N   . LEU B 1 295 ? 31.986  6.480   65.157  1.00 15.30 ? 299 LEU B N   1 
ATOM   4914 C CA  . LEU B 1 295 ? 31.657  6.891   66.522  1.00 15.39 ? 299 LEU B CA  1 
ATOM   4915 C C   . LEU B 1 295 ? 31.688  5.718   67.496  1.00 15.11 ? 299 LEU B C   1 
ATOM   4916 O O   . LEU B 1 295 ? 31.553  5.904   68.707  1.00 15.43 ? 299 LEU B O   1 
ATOM   4917 C CB  . LEU B 1 295 ? 30.272  7.545   66.559  1.00 16.04 ? 299 LEU B CB  1 
ATOM   4918 C CG  . LEU B 1 295 ? 30.084  8.833   65.754  1.00 15.97 ? 299 LEU B CG  1 
ATOM   4919 C CD1 . LEU B 1 295 ? 28.626  9.259   65.814  1.00 15.43 ? 299 LEU B CD1 1 
ATOM   4920 C CD2 . LEU B 1 295 ? 30.990  9.924   66.308  1.00 18.06 ? 299 LEU B CD2 1 
ATOM   4921 N N   . ASN B 1 296 ? 31.871  4.513   66.965  1.00 15.34 ? 300 ASN B N   1 
ATOM   4922 C CA  . ASN B 1 296 ? 31.906  3.306   67.785  1.00 15.00 ? 300 ASN B CA  1 
ATOM   4923 C C   . ASN B 1 296 ? 32.940  3.423   68.908  1.00 16.53 ? 300 ASN B C   1 
ATOM   4924 O O   . ASN B 1 296 ? 34.110  3.707   68.658  1.00 16.11 ? 300 ASN B O   1 
ATOM   4925 C CB  . ASN B 1 296 ? 32.214  2.095   66.906  1.00 13.97 ? 300 ASN B CB  1 
ATOM   4926 C CG  . ASN B 1 296 ? 31.862  0.788   67.579  1.00 15.45 ? 300 ASN B CG  1 
ATOM   4927 O OD1 . ASN B 1 296 ? 30.754  0.619   68.085  1.00 15.19 ? 300 ASN B OD1 1 
ATOM   4928 N ND2 . ASN B 1 296 ? 32.801  -0.149  67.583  1.00 17.34 ? 300 ASN B ND2 1 
ATOM   4929 N N   . ARG B 1 297 ? 32.506  3.201   70.145  1.00 17.62 ? 301 ARG B N   1 
ATOM   4930 C CA  . ARG B 1 297 ? 33.415  3.315   71.285  1.00 18.90 ? 301 ARG B CA  1 
ATOM   4931 C C   . ARG B 1 297 ? 33.098  2.352   72.425  1.00 18.17 ? 301 ARG B C   1 
ATOM   4932 O O   . ARG B 1 297 ? 33.514  2.566   73.566  1.00 17.32 ? 301 ARG B O   1 
ATOM   4933 C CB  . ARG B 1 297 ? 33.400  4.757   71.807  1.00 20.80 ? 301 ARG B CB  1 
ATOM   4934 C CG  . ARG B 1 297 ? 32.027  5.254   72.240  1.00 21.55 ? 301 ARG B CG  1 
ATOM   4935 C CD  . ARG B 1 297 ? 32.046  6.756   72.496  1.00 23.61 ? 301 ARG B CD  1 
ATOM   4936 N NE  . ARG B 1 297 ? 32.381  7.494   71.279  1.00 25.08 ? 301 ARG B NE  1 
ATOM   4937 C CZ  . ARG B 1 297 ? 32.445  8.819   71.194  1.00 27.08 ? 301 ARG B CZ  1 
ATOM   4938 N NH1 . ARG B 1 297 ? 32.199  9.573   72.260  1.00 25.71 ? 301 ARG B NH1 1 
ATOM   4939 N NH2 . ARG B 1 297 ? 32.747  9.391   70.035  1.00 26.50 ? 301 ARG B NH2 1 
ATOM   4940 N N   . ASN B 1 298 ? 32.365  1.293   72.108  1.00 17.53 ? 302 ASN B N   1 
ATOM   4941 C CA  . ASN B 1 298 ? 31.986  0.284   73.087  1.00 17.26 ? 302 ASN B CA  1 
ATOM   4942 C C   . ASN B 1 298 ? 31.350  0.869   74.346  1.00 17.55 ? 302 ASN B C   1 
ATOM   4943 O O   . ASN B 1 298 ? 31.743  0.543   75.469  1.00 17.19 ? 302 ASN B O   1 
ATOM   4944 C CB  . ASN B 1 298 ? 33.199  -0.577  73.460  1.00 20.57 ? 302 ASN B CB  1 
ATOM   4945 C CG  . ASN B 1 298 ? 32.819  -1.781  74.300  1.00 23.12 ? 302 ASN B CG  1 
ATOM   4946 O OD1 . ASN B 1 298 ? 31.769  -2.389  74.087  1.00 24.62 ? 302 ASN B OD1 1 
ATOM   4947 N ND2 . ASN B 1 298 ? 33.676  -2.141  75.251  1.00 25.21 ? 302 ASN B ND2 1 
ATOM   4948 N N   . MET B 1 299 ? 30.372  1.744   74.146  1.00 15.78 ? 303 MET B N   1 
ATOM   4949 C CA  . MET B 1 299 ? 29.641  2.359   75.247  1.00 15.94 ? 303 MET B CA  1 
ATOM   4950 C C   . MET B 1 299 ? 28.331  1.589   75.359  1.00 15.54 ? 303 MET B C   1 
ATOM   4951 O O   . MET B 1 299 ? 27.435  1.759   74.534  1.00 13.83 ? 303 MET B O   1 
ATOM   4952 C CB  . MET B 1 299 ? 29.352  3.831   74.941  1.00 17.35 ? 303 MET B CB  1 
ATOM   4953 C CG  . MET B 1 299 ? 28.408  4.519   75.925  1.00 20.08 ? 303 MET B CG  1 
ATOM   4954 S SD  . MET B 1 299 ? 29.089  4.696   77.593  1.00 23.35 ? 303 MET B SD  1 
ATOM   4955 C CE  . MET B 1 299 ? 28.151  3.457   78.504  1.00 25.30 ? 303 MET B CE  1 
ATOM   4956 N N   . ARG B 1 300 ? 28.232  0.729   76.368  1.00 15.10 ? 304 ARG B N   1 
ATOM   4957 C CA  . ARG B 1 300 ? 27.028  -0.069  76.581  1.00 15.21 ? 304 ARG B CA  1 
ATOM   4958 C C   . ARG B 1 300 ? 26.214  0.540   77.722  1.00 15.26 ? 304 ARG B C   1 
ATOM   4959 O O   . ARG B 1 300 ? 26.573  0.405   78.896  1.00 15.88 ? 304 ARG B O   1 
ATOM   4960 C CB  . ARG B 1 300 ? 27.406  -1.514  76.921  1.00 14.30 ? 304 ARG B CB  1 
ATOM   4961 C CG  . ARG B 1 300 ? 26.221  -2.469  77.027  1.00 13.49 ? 304 ARG B CG  1 
ATOM   4962 C CD  . ARG B 1 300 ? 26.675  -3.866  77.450  1.00 14.48 ? 304 ARG B CD  1 
ATOM   4963 N NE  . ARG B 1 300 ? 27.548  -4.501  76.461  1.00 14.83 ? 304 ARG B NE  1 
ATOM   4964 C CZ  . ARG B 1 300 ? 27.123  -5.088  75.346  1.00 17.02 ? 304 ARG B CZ  1 
ATOM   4965 N NH1 . ARG B 1 300 ? 25.827  -5.131  75.061  1.00 14.83 ? 304 ARG B NH1 1 
ATOM   4966 N NH2 . ARG B 1 300 ? 27.997  -5.637  74.512  1.00 19.40 ? 304 ARG B NH2 1 
ATOM   4967 N N   . TYR B 1 301 ? 25.122  1.210   77.372  1.00 13.32 ? 305 TYR B N   1 
ATOM   4968 C CA  . TYR B 1 301 ? 24.266  1.852   78.363  1.00 12.54 ? 305 TYR B CA  1 
ATOM   4969 C C   . TYR B 1 301 ? 23.575  0.900   79.334  1.00 12.22 ? 305 TYR B C   1 
ATOM   4970 O O   . TYR B 1 301 ? 23.405  1.228   80.508  1.00 13.91 ? 305 TYR B O   1 
ATOM   4971 C CB  . TYR B 1 301 ? 23.204  2.709   77.674  1.00 13.46 ? 305 TYR B CB  1 
ATOM   4972 C CG  . TYR B 1 301 ? 23.752  3.941   76.986  1.00 13.28 ? 305 TYR B CG  1 
ATOM   4973 C CD1 . TYR B 1 301 ? 23.772  4.037   75.592  1.00 14.82 ? 305 TYR B CD1 1 
ATOM   4974 C CD2 . TYR B 1 301 ? 24.244  5.017   77.729  1.00 12.95 ? 305 TYR B CD2 1 
ATOM   4975 C CE1 . TYR B 1 301 ? 24.265  5.178   74.954  1.00 11.81 ? 305 TYR B CE1 1 
ATOM   4976 C CE2 . TYR B 1 301 ? 24.739  6.157   77.103  1.00 11.65 ? 305 TYR B CE2 1 
ATOM   4977 C CZ  . TYR B 1 301 ? 24.746  6.231   75.716  1.00 12.60 ? 305 TYR B CZ  1 
ATOM   4978 O OH  . TYR B 1 301 ? 25.225  7.358   75.097  1.00 10.87 ? 305 TYR B OH  1 
ATOM   4979 N N   . ILE B 1 302 ? 23.164  -0.269  78.854  1.00 11.02 ? 306 ILE B N   1 
ATOM   4980 C CA  . ILE B 1 302 ? 22.487  -1.230  79.720  1.00 11.25 ? 306 ILE B CA  1 
ATOM   4981 C C   . ILE B 1 302 ? 23.264  -2.539  79.784  1.00 12.89 ? 306 ILE B C   1 
ATOM   4982 O O   . ILE B 1 302 ? 22.974  -3.489  79.054  1.00 13.49 ? 306 ILE B O   1 
ATOM   4983 C CB  . ILE B 1 302 ? 21.051  -1.523  79.223  1.00 11.70 ? 306 ILE B CB  1 
ATOM   4984 C CG1 . ILE B 1 302 ? 20.281  -0.214  79.069  1.00 13.51 ? 306 ILE B CG1 1 
ATOM   4985 C CG2 . ILE B 1 302 ? 20.338  -2.442  80.205  1.00 13.33 ? 306 ILE B CG2 1 
ATOM   4986 C CD1 . ILE B 1 302 ? 18.840  -0.387  78.644  1.00 11.70 ? 306 ILE B CD1 1 
ATOM   4987 N N   . PRO B 1 303 ? 24.271  -2.607  80.666  1.00 13.09 ? 307 PRO B N   1 
ATOM   4988 C CA  . PRO B 1 303 ? 25.080  -3.819  80.801  1.00 12.29 ? 307 PRO B CA  1 
ATOM   4989 C C   . PRO B 1 303 ? 24.466  -4.912  81.679  1.00 12.92 ? 307 PRO B C   1 
ATOM   4990 O O   . PRO B 1 303 ? 25.077  -5.961  81.873  1.00 12.44 ? 307 PRO B O   1 
ATOM   4991 C CB  . PRO B 1 303 ? 26.386  -3.281  81.379  1.00 11.87 ? 307 PRO B CB  1 
ATOM   4992 C CG  . PRO B 1 303 ? 25.898  -2.212  82.299  1.00 13.49 ? 307 PRO B CG  1 
ATOM   4993 C CD  . PRO B 1 303 ? 24.858  -1.498  81.442  1.00 14.10 ? 307 PRO B CD  1 
ATOM   4994 N N   . ALA B 1 304 ? 23.258  -4.679  82.190  1.00 12.91 ? 308 ALA B N   1 
ATOM   4995 C CA  . ALA B 1 304 ? 22.606  -5.652  83.070  1.00 13.60 ? 308 ALA B CA  1 
ATOM   4996 C C   . ALA B 1 304 ? 23.609  -5.998  84.167  1.00 13.19 ? 308 ALA B C   1 
ATOM   4997 O O   . ALA B 1 304 ? 23.806  -7.166  84.506  1.00 10.79 ? 308 ALA B O   1 
ATOM   4998 C CB  . ALA B 1 304 ? 22.226  -6.908  82.293  1.00 13.32 ? 308 ALA B CB  1 
ATOM   4999 N N   . ALA B 1 305 ? 24.243  -4.963  84.706  1.00 12.55 ? 309 ALA B N   1 
ATOM   5000 C CA  . ALA B 1 305 ? 25.260  -5.122  85.739  1.00 13.97 ? 309 ALA B CA  1 
ATOM   5001 C C   . ALA B 1 305 ? 24.852  -5.945  86.959  1.00 13.45 ? 309 ALA B C   1 
ATOM   5002 O O   . ALA B 1 305 ? 25.688  -6.626  87.549  1.00 14.86 ? 309 ALA B O   1 
ATOM   5003 C CB  . ALA B 1 305 ? 25.766  -3.744  86.180  1.00 15.45 ? 309 ALA B CB  1 
ATOM   5004 N N   . ILE B 1 306 ? 23.587  -5.888  87.361  1.00 15.25 ? 310 ILE B N   1 
ATOM   5005 C CA  . ILE B 1 306 ? 23.177  -6.669  88.527  1.00 14.56 ? 310 ILE B CA  1 
ATOM   5006 C C   . ILE B 1 306 ? 23.216  -8.163  88.226  1.00 16.85 ? 310 ILE B C   1 
ATOM   5007 O O   . ILE B 1 306 ? 23.064  -8.990  89.127  1.00 16.02 ? 310 ILE B O   1 
ATOM   5008 C CB  . ILE B 1 306 ? 21.759  -6.291  89.017  1.00 15.61 ? 310 ILE B CB  1 
ATOM   5009 C CG1 . ILE B 1 306 ? 20.746  -6.447  87.879  1.00 14.94 ? 310 ILE B CG1 1 
ATOM   5010 C CG2 . ILE B 1 306 ? 21.762  -4.871  89.560  1.00 13.59 ? 310 ILE B CG2 1 
ATOM   5011 C CD1 . ILE B 1 306 ? 19.298  -6.241  88.308  1.00 15.91 ? 310 ILE B CD1 1 
ATOM   5012 N N   . PHE B 1 307 ? 23.433  -8.503  86.958  1.00 16.46 ? 311 PHE B N   1 
ATOM   5013 C CA  . PHE B 1 307 ? 23.495  -9.898  86.532  1.00 17.14 ? 311 PHE B CA  1 
ATOM   5014 C C   . PHE B 1 307 ? 24.926  -10.418 86.416  1.00 19.57 ? 311 PHE B C   1 
ATOM   5015 O O   . PHE B 1 307 ? 25.139  -11.597 86.131  1.00 19.77 ? 311 PHE B O   1 
ATOM   5016 C CB  . PHE B 1 307 ? 22.791  -10.071 85.185  1.00 15.54 ? 311 PHE B CB  1 
ATOM   5017 C CG  . PHE B 1 307 ? 21.295  -10.123 85.277  1.00 13.18 ? 311 PHE B CG  1 
ATOM   5018 C CD1 . PHE B 1 307 ? 20.640  -11.330 85.515  1.00 13.53 ? 311 PHE B CD1 1 
ATOM   5019 C CD2 . PHE B 1 307 ? 20.534  -8.972  85.094  1.00 13.78 ? 311 PHE B CD2 1 
ATOM   5020 C CE1 . PHE B 1 307 ? 19.246  -11.388 85.563  1.00 12.98 ? 311 PHE B CE1 1 
ATOM   5021 C CE2 . PHE B 1 307 ? 19.141  -9.018  85.140  1.00 11.88 ? 311 PHE B CE2 1 
ATOM   5022 C CZ  . PHE B 1 307 ? 18.497  -10.228 85.374  1.00 13.17 ? 311 PHE B CZ  1 
ATOM   5023 N N   . LYS B 1 308 ? 25.907  -9.546  86.619  1.00 21.49 ? 312 LYS B N   1 
ATOM   5024 C CA  . LYS B 1 308 ? 27.293  -9.980  86.533  1.00 24.83 ? 312 LYS B CA  1 
ATOM   5025 C C   . LYS B 1 308 ? 27.528  -11.092 87.544  1.00 25.01 ? 312 LYS B C   1 
ATOM   5026 O O   . LYS B 1 308 ? 26.982  -11.077 88.650  1.00 25.41 ? 312 LYS B O   1 
ATOM   5027 C CB  . LYS B 1 308 ? 28.251  -8.815  86.794  1.00 26.41 ? 312 LYS B CB  1 
ATOM   5028 C CG  . LYS B 1 308 ? 28.283  -7.790  85.671  1.00 30.18 ? 312 LYS B CG  1 
ATOM   5029 C CD  . LYS B 1 308 ? 29.348  -6.731  85.919  1.00 32.70 ? 312 LYS B CD  1 
ATOM   5030 C CE  . LYS B 1 308 ? 29.350  -5.680  84.821  1.00 34.30 ? 312 LYS B CE  1 
ATOM   5031 N NZ  . LYS B 1 308 ? 30.424  -4.668  85.036  1.00 36.41 ? 312 LYS B NZ  1 
ATOM   5032 N N   . GLY B 1 309 ? 28.344  -12.062 87.156  1.00 25.18 ? 313 GLY B N   1 
ATOM   5033 C CA  . GLY B 1 309 ? 28.613  -13.181 88.034  1.00 24.85 ? 313 GLY B CA  1 
ATOM   5034 C C   . GLY B 1 309 ? 27.790  -14.356 87.555  1.00 24.63 ? 313 GLY B C   1 
ATOM   5035 O O   . GLY B 1 309 ? 28.160  -15.510 87.763  1.00 25.39 ? 313 GLY B O   1 
ATOM   5036 N N   . HIS B 1 310 ? 26.664  -14.064 86.909  1.00 22.73 ? 314 HIS B N   1 
ATOM   5037 C CA  . HIS B 1 310 ? 25.812  -15.126 86.393  1.00 20.74 ? 314 HIS B CA  1 
ATOM   5038 C C   . HIS B 1 310 ? 26.592  -15.851 85.302  1.00 20.54 ? 314 HIS B C   1 
ATOM   5039 O O   . HIS B 1 310 ? 27.186  -15.217 84.430  1.00 19.10 ? 314 HIS B O   1 
ATOM   5040 C CB  . HIS B 1 310 ? 24.519  -14.551 85.813  1.00 20.08 ? 314 HIS B CB  1 
ATOM   5041 C CG  . HIS B 1 310 ? 23.524  -15.598 85.418  1.00 17.92 ? 314 HIS B CG  1 
ATOM   5042 N ND1 . HIS B 1 310 ? 23.786  -16.546 84.452  1.00 16.82 ? 314 HIS B ND1 1 
ATOM   5043 C CD2 . HIS B 1 310 ? 22.271  -15.851 85.864  1.00 16.17 ? 314 HIS B CD2 1 
ATOM   5044 C CE1 . HIS B 1 310 ? 22.737  -17.339 84.321  1.00 17.95 ? 314 HIS B CE1 1 
ATOM   5045 N NE2 . HIS B 1 310 ? 21.804  -16.938 85.167  1.00 18.10 ? 314 HIS B NE2 1 
ATOM   5046 N N   . PRO B 1 311 ? 26.605  -17.192 85.340  1.00 20.50 ? 315 PRO B N   1 
ATOM   5047 C CA  . PRO B 1 311 ? 27.327  -17.986 84.345  1.00 21.80 ? 315 PRO B CA  1 
ATOM   5048 C C   . PRO B 1 311 ? 27.050  -17.580 82.896  1.00 21.32 ? 315 PRO B C   1 
ATOM   5049 O O   . PRO B 1 311 ? 27.939  -17.657 82.047  1.00 21.68 ? 315 PRO B O   1 
ATOM   5050 C CB  . PRO B 1 311 ? 26.860  -19.410 84.639  1.00 22.20 ? 315 PRO B CB  1 
ATOM   5051 C CG  . PRO B 1 311 ? 26.625  -19.384 86.109  1.00 24.12 ? 315 PRO B CG  1 
ATOM   5052 C CD  . PRO B 1 311 ? 25.905  -18.069 86.296  1.00 22.37 ? 315 PRO B CD  1 
ATOM   5053 N N   . ASN B 1 312 ? 25.826  -17.142 82.614  1.00 19.11 ? 316 ASN B N   1 
ATOM   5054 C CA  . ASN B 1 312 ? 25.465  -16.761 81.249  1.00 18.75 ? 316 ASN B CA  1 
ATOM   5055 C C   . ASN B 1 312 ? 25.455  -15.259 80.925  1.00 18.81 ? 316 ASN B C   1 
ATOM   5056 O O   . ASN B 1 312 ? 24.852  -14.860 79.926  1.00 17.69 ? 316 ASN B O   1 
ATOM   5057 C CB  . ASN B 1 312 ? 24.095  -17.351 80.876  1.00 19.53 ? 316 ASN B CB  1 
ATOM   5058 C CG  . ASN B 1 312 ? 24.049  -18.868 80.993  1.00 22.67 ? 316 ASN B CG  1 
ATOM   5059 O OD1 . ASN B 1 312 ? 25.034  -19.559 80.728  1.00 24.70 ? 316 ASN B OD1 1 
ATOM   5060 N ND2 . ASN B 1 312 ? 22.889  -19.393 81.370  1.00 23.67 ? 316 ASN B ND2 1 
ATOM   5061 N N   . TRP B 1 313 ? 26.099  -14.424 81.744  1.00 16.72 ? 317 TRP B N   1 
ATOM   5062 C CA  . TRP B 1 313 ? 26.126  -12.983 81.453  1.00 16.81 ? 317 TRP B CA  1 
ATOM   5063 C C   . TRP B 1 313 ? 26.615  -12.869 80.008  1.00 16.84 ? 317 TRP B C   1 
ATOM   5064 O O   . TRP B 1 313 ? 27.741  -13.250 79.691  1.00 15.98 ? 317 TRP B O   1 
ATOM   5065 C CB  . TRP B 1 313 ? 27.079  -12.248 82.401  1.00 15.47 ? 317 TRP B CB  1 
ATOM   5066 C CG  . TRP B 1 313 ? 26.928  -10.749 82.366  1.00 15.28 ? 317 TRP B CG  1 
ATOM   5067 C CD1 . TRP B 1 313 ? 25.832  -10.027 82.745  1.00 14.78 ? 317 TRP B CD1 1 
ATOM   5068 C CD2 . TRP B 1 313 ? 27.911  -9.793  81.948  1.00 15.55 ? 317 TRP B CD2 1 
ATOM   5069 N NE1 . TRP B 1 313 ? 26.072  -8.681  82.593  1.00 14.42 ? 317 TRP B NE1 1 
ATOM   5070 C CE2 . TRP B 1 313 ? 27.340  -8.509  82.106  1.00 15.68 ? 317 TRP B CE2 1 
ATOM   5071 C CE3 . TRP B 1 313 ? 29.220  -9.895  81.458  1.00 16.20 ? 317 TRP B CE3 1 
ATOM   5072 C CZ2 . TRP B 1 313 ? 28.032  -7.337  81.792  1.00 16.11 ? 317 TRP B CZ2 1 
ATOM   5073 C CZ3 . TRP B 1 313 ? 29.909  -8.727  81.147  1.00 16.31 ? 317 TRP B CZ3 1 
ATOM   5074 C CH2 . TRP B 1 313 ? 29.313  -7.465  81.315  1.00 16.94 ? 317 TRP B CH2 1 
ATOM   5075 N N   . PRO B 1 314 ? 25.771  -12.330 79.115  1.00 17.28 ? 318 PRO B N   1 
ATOM   5076 C CA  . PRO B 1 314 ? 26.068  -12.167 77.689  1.00 16.32 ? 318 PRO B CA  1 
ATOM   5077 C C   . PRO B 1 314 ? 26.991  -11.066 77.191  1.00 16.59 ? 318 PRO B C   1 
ATOM   5078 O O   . PRO B 1 314 ? 27.359  -11.081 76.015  1.00 17.12 ? 318 PRO B O   1 
ATOM   5079 C CB  . PRO B 1 314 ? 24.680  -12.016 77.081  1.00 15.36 ? 318 PRO B CB  1 
ATOM   5080 C CG  . PRO B 1 314 ? 23.991  -11.163 78.114  1.00 15.65 ? 318 PRO B CG  1 
ATOM   5081 C CD  . PRO B 1 314 ? 24.421  -11.813 79.429  1.00 16.65 ? 318 PRO B CD  1 
ATOM   5082 N N   . PHE B 1 315 ? 27.395  -10.136 78.050  1.00 16.85 ? 319 PHE B N   1 
ATOM   5083 C CA  . PHE B 1 315 ? 28.195  -9.017  77.561  1.00 17.33 ? 319 PHE B CA  1 
ATOM   5084 C C   . PHE B 1 315 ? 29.709  -8.971  77.704  1.00 18.73 ? 319 PHE B C   1 
ATOM   5085 O O   . PHE B 1 315 ? 30.288  -7.885  77.712  1.00 19.48 ? 319 PHE B O   1 
ATOM   5086 C CB  . PHE B 1 315 ? 27.604  -7.712  78.102  1.00 16.06 ? 319 PHE B CB  1 
ATOM   5087 C CG  . PHE B 1 315 ? 26.131  -7.571  77.847  1.00 13.87 ? 319 PHE B CG  1 
ATOM   5088 C CD1 . PHE B 1 315 ? 25.597  -7.882  76.598  1.00 15.46 ? 319 PHE B CD1 1 
ATOM   5089 C CD2 . PHE B 1 315 ? 25.275  -7.147  78.856  1.00 14.23 ? 319 PHE B CD2 1 
ATOM   5090 C CE1 . PHE B 1 315 ? 24.232  -7.776  76.361  1.00 14.77 ? 319 PHE B CE1 1 
ATOM   5091 C CE2 . PHE B 1 315 ? 23.908  -7.035  78.632  1.00 14.71 ? 319 PHE B CE2 1 
ATOM   5092 C CZ  . PHE B 1 315 ? 23.383  -7.351  77.382  1.00 15.80 ? 319 PHE B CZ  1 
ATOM   5093 N N   . LEU B 1 316 ? 30.362  -10.121 77.796  1.00 19.71 ? 320 LEU B N   1 
ATOM   5094 C CA  . LEU B 1 316 ? 31.815  -10.111 77.893  1.00 21.80 ? 320 LEU B CA  1 
ATOM   5095 C C   . LEU B 1 316 ? 32.361  -9.502  76.607  1.00 22.53 ? 320 LEU B C   1 
ATOM   5096 O O   . LEU B 1 316 ? 31.798  -9.705  75.530  1.00 21.41 ? 320 LEU B O   1 
ATOM   5097 C CB  . LEU B 1 316 ? 32.356  -11.530 78.072  1.00 23.72 ? 320 LEU B CB  1 
ATOM   5098 C CG  . LEU B 1 316 ? 32.031  -12.191 79.413  1.00 24.60 ? 320 LEU B CG  1 
ATOM   5099 C CD1 . LEU B 1 316 ? 32.650  -13.577 79.469  1.00 24.99 ? 320 LEU B CD1 1 
ATOM   5100 C CD2 . LEU B 1 316 ? 32.560  -11.322 80.547  1.00 27.15 ? 320 LEU B CD2 1 
ATOM   5101 N N   . ASP B 1 317 ? 33.445  -8.741  76.717  1.00 22.86 ? 321 ASP B N   1 
ATOM   5102 C CA  . ASP B 1 317 ? 34.041  -8.118  75.545  1.00 23.03 ? 321 ASP B CA  1 
ATOM   5103 C C   . ASP B 1 317 ? 34.711  -9.155  74.649  1.00 22.16 ? 321 ASP B C   1 
ATOM   5104 O O   . ASP B 1 317 ? 35.052  -10.249 75.097  1.00 21.00 ? 321 ASP B O   1 
ATOM   5105 C CB  . ASP B 1 317 ? 35.073  -7.066  75.960  1.00 26.22 ? 321 ASP B CB  1 
ATOM   5106 C CG  . ASP B 1 317 ? 34.447  -5.888  76.683  1.00 29.19 ? 321 ASP B CG  1 
ATOM   5107 O OD1 . ASP B 1 317 ? 33.463  -5.319  76.161  1.00 30.26 ? 321 ASP B OD1 1 
ATOM   5108 O OD2 . ASP B 1 317 ? 34.947  -5.529  77.770  1.00 33.46 ? 321 ASP B OD2 1 
ATOM   5109 N N   . GLU B 1 318 ? 34.891  -8.799  73.382  1.00 21.11 ? 322 GLU B N   1 
ATOM   5110 C CA  . GLU B 1 318 ? 35.527  -9.682  72.411  1.00 21.24 ? 322 GLU B CA  1 
ATOM   5111 C C   . GLU B 1 318 ? 37.027  -9.682  72.662  1.00 21.89 ? 322 GLU B C   1 
ATOM   5112 O O   . GLU B 1 318 ? 37.559  -8.755  73.278  1.00 20.52 ? 322 GLU B O   1 
ATOM   5113 C CB  . GLU B 1 318 ? 35.261  -9.183  70.987  1.00 22.44 ? 322 GLU B CB  1 
ATOM   5114 C CG  . GLU B 1 318 ? 33.791  -8.988  70.660  1.00 22.52 ? 322 GLU B CG  1 
ATOM   5115 C CD  . GLU B 1 318 ? 33.022  -10.290 70.628  1.00 22.94 ? 322 GLU B CD  1 
ATOM   5116 O OE1 . GLU B 1 318 ? 31.789  -10.252 70.819  1.00 24.39 ? 322 GLU B OE1 1 
ATOM   5117 O OE2 . GLU B 1 318 ? 33.646  -11.349 70.397  1.00 23.46 ? 322 GLU B OE2 1 
ATOM   5118 N N   . TYR B 1 319 ? 37.706  -10.722 72.192  1.00 22.60 ? 323 TYR B N   1 
ATOM   5119 C CA  . TYR B 1 319 ? 39.152  -10.814 72.344  1.00 24.70 ? 323 TYR B CA  1 
ATOM   5120 C C   . TYR B 1 319 ? 39.775  -9.806  71.387  1.00 25.52 ? 323 TYR B C   1 
ATOM   5121 O O   . TYR B 1 319 ? 40.791  -9.180  71.752  1.00 27.26 ? 323 TYR B O   1 
ATOM   5122 C CB  . TYR B 1 319 ? 39.650  -12.222 72.006  1.00 24.68 ? 323 TYR B CB  1 
ATOM   5123 C CG  . TYR B 1 319 ? 39.166  -13.298 72.954  1.00 24.63 ? 323 TYR B CG  1 
ATOM   5124 C CD1 . TYR B 1 319 ? 39.423  -13.216 74.322  1.00 26.43 ? 323 TYR B CD1 1 
ATOM   5125 C CD2 . TYR B 1 319 ? 38.449  -14.397 72.484  1.00 25.30 ? 323 TYR B CD2 1 
ATOM   5126 C CE1 . TYR B 1 319 ? 38.978  -14.201 75.198  1.00 26.72 ? 323 TYR B CE1 1 
ATOM   5127 C CE2 . TYR B 1 319 ? 37.998  -15.390 73.353  1.00 25.66 ? 323 TYR B CE2 1 
ATOM   5128 C CZ  . TYR B 1 319 ? 38.266  -15.283 74.709  1.00 27.41 ? 323 TYR B CZ  1 
ATOM   5129 O OH  . TYR B 1 319 ? 37.819  -16.252 75.577  1.00 28.70 ? 323 TYR B OH  1 
ATOM   5130 O OXT . TYR B 1 319 ? 39.234  -9.666  70.271  1.00 27.00 ? 323 TYR B OXT 1 
HETATM 5131 P PA  . NAP C 2 .   ? 14.474  -9.744  30.817  1.00 4.82  ? 1   NAP A PA  1 
HETATM 5132 O O1A . NAP C 2 .   ? 15.781  -10.349 31.228  1.00 5.03  ? 1   NAP A O1A 1 
HETATM 5133 O O2A . NAP C 2 .   ? 13.766  -8.807  31.724  1.00 5.49  ? 1   NAP A O2A 1 
HETATM 5134 O O5B . NAP C 2 .   ? 13.492  -10.938 30.415  1.00 5.42  ? 1   NAP A O5B 1 
HETATM 5135 C C5B . NAP C 2 .   ? 13.995  -12.013 29.589  1.00 8.13  ? 1   NAP A C5B 1 
HETATM 5136 C C4B . NAP C 2 .   ? 12.869  -12.994 29.325  1.00 8.99  ? 1   NAP A C4B 1 
HETATM 5137 O O4B . NAP C 2 .   ? 12.224  -13.362 30.555  1.00 7.67  ? 1   NAP A O4B 1 
HETATM 5138 C C3B . NAP C 2 .   ? 11.722  -12.516 28.424  1.00 10.51 ? 1   NAP A C3B 1 
HETATM 5139 O O3B . NAP C 2 .   ? 12.036  -12.854 27.080  1.00 11.87 ? 1   NAP A O3B 1 
HETATM 5140 C C2B . NAP C 2 .   ? 10.489  -13.229 29.031  1.00 9.90  ? 1   NAP A C2B 1 
HETATM 5141 O O2B . NAP C 2 .   ? 9.864   -14.123 28.123  1.00 10.35 ? 1   NAP A O2B 1 
HETATM 5142 C C1B . NAP C 2 .   ? 11.007  -13.991 30.227  1.00 9.77  ? 1   NAP A C1B 1 
HETATM 5143 N N9A . NAP C 2 .   ? 10.171  -13.933 31.440  1.00 10.26 ? 1   NAP A N9A 1 
HETATM 5144 C C8A . NAP C 2 .   ? 9.718   -12.792 32.102  1.00 10.44 ? 1   NAP A C8A 1 
HETATM 5145 N N7A . NAP C 2 .   ? 8.987   -13.056 33.170  1.00 9.17  ? 1   NAP A N7A 1 
HETATM 5146 C C5A . NAP C 2 .   ? 8.960   -14.418 33.208  1.00 11.08 ? 1   NAP A C5A 1 
HETATM 5147 C C6A . NAP C 2 .   ? 8.306   -15.433 34.162  1.00 9.89  ? 1   NAP A C6A 1 
HETATM 5148 N N6A . NAP C 2 .   ? 7.588   -15.045 35.218  1.00 11.53 ? 1   NAP A N6A 1 
HETATM 5149 N N1A . NAP C 2 .   ? 8.498   -16.774 33.877  1.00 11.30 ? 1   NAP A N1A 1 
HETATM 5150 C C2A . NAP C 2 .   ? 9.245   -17.170 32.782  1.00 10.76 ? 1   NAP A C2A 1 
HETATM 5151 N N3A . NAP C 2 .   ? 9.871   -16.342 31.870  1.00 11.62 ? 1   NAP A N3A 1 
HETATM 5152 C C4A . NAP C 2 .   ? 9.686   -14.984 32.144  1.00 11.02 ? 1   NAP A C4A 1 
HETATM 5153 O O3  . NAP C 2 .   ? 14.730  -9.053  29.395  1.00 4.86  ? 1   NAP A O3  1 
HETATM 5154 P PN  . NAP C 2 .   ? 15.472  -7.776  28.843  1.00 4.78  ? 1   NAP A PN  1 
HETATM 5155 O O1N . NAP C 2 .   ? 15.853  -8.010  27.442  1.00 6.02  ? 1   NAP A O1N 1 
HETATM 5156 O O2N . NAP C 2 .   ? 16.597  -7.525  29.801  1.00 5.68  ? 1   NAP A O2N 1 
HETATM 5157 O O5D . NAP C 2 .   ? 14.419  -6.590  28.921  1.00 6.10  ? 1   NAP A O5D 1 
HETATM 5158 C C5D . NAP C 2 .   ? 13.973  -5.968  30.131  1.00 4.60  ? 1   NAP A C5D 1 
HETATM 5159 C C4D . NAP C 2 .   ? 14.017  -4.474  29.995  1.00 6.60  ? 1   NAP A C4D 1 
HETATM 5160 O O4D . NAP C 2 .   ? 15.373  -4.012  30.238  1.00 6.63  ? 1   NAP A O4D 1 
HETATM 5161 C C3D . NAP C 2 .   ? 13.689  -3.881  28.612  1.00 6.25  ? 1   NAP A C3D 1 
HETATM 5162 O O3D . NAP C 2 .   ? 12.318  -3.877  28.261  1.00 8.04  ? 1   NAP A O3D 1 
HETATM 5163 C C2D . NAP C 2 .   ? 14.354  -2.521  28.691  1.00 5.09  ? 1   NAP A C2D 1 
HETATM 5164 O O2D . NAP C 2 .   ? 13.437  -1.621  29.292  1.00 5.57  ? 1   NAP A O2D 1 
HETATM 5165 C C1D . NAP C 2 .   ? 15.624  -2.828  29.509  1.00 7.24  ? 1   NAP A C1D 1 
HETATM 5166 N N1N . NAP C 2 .   ? 16.863  -3.040  28.682  1.00 8.99  ? 1   NAP A N1N 1 
HETATM 5167 C C2N . NAP C 2 .   ? 17.810  -2.012  28.742  1.00 8.08  ? 1   NAP A C2N 1 
HETATM 5168 C C3N . NAP C 2 .   ? 19.009  -2.098  28.007  1.00 7.99  ? 1   NAP A C3N 1 
HETATM 5169 C C7N . NAP C 2 .   ? 20.048  -1.003  28.049  1.00 6.65  ? 1   NAP A C7N 1 
HETATM 5170 O O7N . NAP C 2 .   ? 21.076  -1.114  27.380  1.00 5.97  ? 1   NAP A O7N 1 
HETATM 5171 N N7N . NAP C 2 .   ? 19.814  0.070   28.828  1.00 7.65  ? 1   NAP A N7N 1 
HETATM 5172 C C4N . NAP C 2 .   ? 19.242  -3.283  27.185  1.00 9.89  ? 1   NAP A C4N 1 
HETATM 5173 C C5N . NAP C 2 .   ? 18.278  -4.329  27.127  1.00 9.82  ? 1   NAP A C5N 1 
HETATM 5174 C C6N . NAP C 2 .   ? 17.093  -4.213  27.869  1.00 9.45  ? 1   NAP A C6N 1 
HETATM 5175 P P2B . NAP C 2 .   ? 8.297   -14.033 27.746  1.00 10.21 ? 1   NAP A P2B 1 
HETATM 5176 O O1X . NAP C 2 .   ? 8.055   -12.660 27.169  1.00 10.65 ? 1   NAP A O1X 1 
HETATM 5177 O O2X . NAP C 2 .   ? 8.153   -15.194 26.784  1.00 11.91 ? 1   NAP A O2X 1 
HETATM 5178 O O3X . NAP C 2 .   ? 7.548   -14.254 29.029  1.00 9.73  ? 1   NAP A O3X 1 
HETATM 5179 C C1  . FFA D 3 .   ? 14.242  -3.664  19.852  0.80 32.28 ? 3   FFA A C1  1 
HETATM 5180 C C2  . FFA D 3 .   ? 13.238  -3.698  18.670  0.80 34.36 ? 3   FFA A C2  1 
HETATM 5181 C C3  . FFA D 3 .   ? 13.539  -2.698  17.555  0.80 34.48 ? 3   FFA A C3  1 
HETATM 5182 C C4  . FFA D 3 .   ? 14.918  -2.145  17.447  0.80 33.83 ? 3   FFA A C4  1 
HETATM 5183 C C5  . FFA D 3 .   ? 15.920  -2.470  18.309  1.00 31.90 ? 3   FFA A C5  1 
HETATM 5184 C C6  . FFA D 3 .   ? 15.773  -3.439  19.525  1.00 31.16 ? 3   FFA A C6  1 
HETATM 5185 C C7  . FFA D 3 .   ? 16.448  -2.794  20.816  1.00 28.94 ? 3   FFA A C7  1 
HETATM 5186 C C8  . FFA D 3 .   ? 17.921  -2.306  20.544  1.00 27.19 ? 3   FFA A C8  1 
HETATM 5187 C C9  . FFA D 3 .   ? 17.940  -1.291  19.366  1.00 28.90 ? 3   FFA A C9  1 
HETATM 5188 C C10 . FFA D 3 .   ? 17.307  -1.858  18.080  1.00 31.07 ? 3   FFA A C10 1 
HETATM 5189 C C11 . FFA D 3 .   ? 16.404  -3.757  22.077  1.00 28.27 ? 3   FFA A C11 1 
HETATM 5190 C C12 . FFA D 3 .   ? 17.062  -3.056  23.306  1.00 26.43 ? 3   FFA A C12 1 
HETATM 5191 C C14 . FFA D 3 .   ? 18.551  -1.698  21.837  1.00 27.65 ? 3   FFA A C14 1 
HETATM 5192 C C13 . FFA D 3 .   ? 18.557  -2.692  23.022  1.00 26.66 ? 3   FFA A C13 1 
HETATM 5193 C C15 . FFA D 3 .   ? 19.999  -1.170  21.836  1.00 25.22 ? 3   FFA A C15 1 
HETATM 5194 C C16 . FFA D 3 .   ? 20.263  -0.956  23.347  1.00 25.66 ? 3   FFA A C16 1 
HETATM 5195 C C17 . FFA D 3 .   ? 19.307  -1.902  24.118  1.00 25.99 ? 3   FFA A C17 1 
HETATM 5196 C C18 . FFA D 3 .   ? 19.380  -4.014  22.822  1.00 27.42 ? 3   FFA A C18 1 
HETATM 5197 C C19 . FFA D 3 .   ? 16.406  -4.800  19.114  1.00 31.86 ? 3   FFA A C19 1 
HETATM 5198 O O3  . FFA D 3 .   ? 12.669  -2.372  16.758  0.80 36.90 ? 3   FFA A O3  1 
HETATM 5199 O O17 . FFA D 3 .   ? 18.419  -1.107  24.926  1.00 24.45 ? 3   FFA A O17 1 
HETATM 5200 C C1  . BME E 4 .   ? 5.951   -12.663 18.905  1.00 43.84 ? 324 BME A C1  1 
HETATM 5201 C C2  . BME E 4 .   ? 5.129   -11.497 18.388  1.00 42.85 ? 324 BME A C2  1 
HETATM 5202 O O1  . BME E 4 .   ? 6.349   -13.486 17.804  1.00 43.74 ? 324 BME A O1  1 
HETATM 5203 S S2  . BME E 4 .   ? 4.621   -10.448 19.774  1.00 43.68 ? 324 BME A S2  1 
HETATM 5204 C C1  . BME F 4 .   ? 35.026  13.524  27.859  0.25 11.38 ? 325 BME A C1  1 
HETATM 5205 C C2  . BME F 4 .   ? 35.989  13.300  29.011  0.25 11.61 ? 325 BME A C2  1 
HETATM 5206 O O1  . BME F 4 .   ? 34.690  12.270  27.260  0.25 10.59 ? 325 BME A O1  1 
HETATM 5207 S S2  . BME F 4 .   ? 36.407  14.895  29.767  0.25 14.52 ? 325 BME A S2  1 
HETATM 5208 C C1  . EDO G 5 .   ? 9.475   -19.128 27.041  1.00 23.66 ? 326 EDO A C1  1 
HETATM 5209 O O1  . EDO G 5 .   ? 8.074   -18.847 26.968  1.00 25.06 ? 326 EDO A O1  1 
HETATM 5210 C C2  . EDO G 5 .   ? 10.260  -18.035 26.303  1.00 23.24 ? 326 EDO A C2  1 
HETATM 5211 O O2  . EDO G 5 .   ? 10.327  -17.040 27.000  1.00 18.21 ? 326 EDO A O2  1 
HETATM 5212 C C1  . EDO H 5 .   ? 24.208  14.766  43.982  1.00 30.50 ? 327 EDO A C1  1 
HETATM 5213 O O1  . EDO H 5 .   ? 25.451  14.909  43.297  1.00 29.22 ? 327 EDO A O1  1 
HETATM 5214 C C2  . EDO H 5 .   ? 23.193  15.742  43.388  1.00 32.32 ? 327 EDO A C2  1 
HETATM 5215 O O2  . EDO H 5 .   ? 22.193  15.139  43.064  1.00 30.99 ? 327 EDO A O2  1 
HETATM 5216 P PA  . NAP I 2 .   ? 15.418  4.947   73.082  1.00 12.17 ? 2   NAP B PA  1 
HETATM 5217 O O1A . NAP I 2 .   ? 16.889  4.845   72.842  1.00 12.25 ? 2   NAP B O1A 1 
HETATM 5218 O O2A . NAP I 2 .   ? 14.463  4.443   72.070  1.00 11.06 ? 2   NAP B O2A 1 
HETATM 5219 O O5B . NAP I 2 .   ? 15.086  6.475   73.433  1.00 13.54 ? 2   NAP B O5B 1 
HETATM 5220 C C5B . NAP I 2 .   ? 15.981  7.231   74.286  1.00 13.57 ? 2   NAP B C5B 1 
HETATM 5221 C C4B . NAP I 2 .   ? 15.438  8.643   74.449  1.00 13.39 ? 2   NAP B C4B 1 
HETATM 5222 O O4B . NAP I 2 .   ? 15.237  9.263   73.160  1.00 15.11 ? 2   NAP B O4B 1 
HETATM 5223 C C3B . NAP I 2 .   ? 14.079  8.795   75.166  1.00 16.48 ? 2   NAP B C3B 1 
HETATM 5224 O O3B . NAP I 2 .   ? 14.300  8.996   76.554  1.00 15.02 ? 2   NAP B O3B 1 
HETATM 5225 C C2B . NAP I 2 .   ? 13.416  9.977   74.429  1.00 15.16 ? 2   NAP B C2B 1 
HETATM 5226 O O2B . NAP I 2 .   ? 13.142  11.082  75.280  1.00 15.43 ? 2   NAP B O2B 1 
HETATM 5227 C C1B . NAP I 2 .   ? 14.385  10.383  73.344  1.00 14.35 ? 2   NAP B C1B 1 
HETATM 5228 N N9A . NAP I 2 .   ? 13.779  10.671  72.032  1.00 14.45 ? 2   NAP B N9A 1 
HETATM 5229 C C8A . NAP I 2 .   ? 12.917  9.858   71.306  1.00 14.53 ? 2   NAP B C8A 1 
HETATM 5230 N N7A . NAP I 2 .   ? 12.541  10.388  70.158  1.00 15.03 ? 2   NAP B N7A 1 
HETATM 5231 C C5A . NAP I 2 .   ? 13.175  11.589  70.132  1.00 13.65 ? 2   NAP B C5A 1 
HETATM 5232 C C6A . NAP I 2 .   ? 13.206  12.742  69.108  1.00 14.02 ? 2   NAP B C6A 1 
HETATM 5233 N N6A . NAP I 2 .   ? 12.517  12.683  67.962  1.00 15.11 ? 2   NAP B N6A 1 
HETATM 5234 N N1A . NAP I 2 .   ? 13.984  13.844  69.426  1.00 17.13 ? 2   NAP B N1A 1 
HETATM 5235 C C2A . NAP I 2 .   ? 14.696  13.894  70.611  1.00 14.56 ? 2   NAP B C2A 1 
HETATM 5236 N N3A . NAP I 2 .   ? 14.735  12.914  71.591  1.00 14.39 ? 2   NAP B N3A 1 
HETATM 5237 C C4A . NAP I 2 .   ? 13.949  11.793  71.282  1.00 14.74 ? 2   NAP B C4A 1 
HETATM 5238 O O3  . NAP I 2 .   ? 15.143  4.229   74.488  1.00 12.41 ? 2   NAP B O3  1 
HETATM 5239 P PN  . NAP I 2 .   ? 15.118  2.765   75.071  1.00 11.66 ? 2   NAP B PN  1 
HETATM 5240 O O1N . NAP I 2 .   ? 15.478  2.826   76.502  1.00 13.03 ? 2   NAP B O1N 1 
HETATM 5241 O O2N . NAP I 2 .   ? 16.033  1.957   74.201  1.00 12.67 ? 2   NAP B O2N 1 
HETATM 5242 O O5D . NAP I 2 .   ? 13.626  2.243   74.916  1.00 13.87 ? 2   NAP B O5D 1 
HETATM 5243 C C5D . NAP I 2 .   ? 13.000  1.921   73.667  1.00 12.83 ? 2   NAP B C5D 1 
HETATM 5244 C C4D . NAP I 2 .   ? 12.334  0.576   73.741  1.00 11.69 ? 2   NAP B C4D 1 
HETATM 5245 O O4D . NAP I 2 .   ? 13.338  -0.482  73.629  1.00 11.84 ? 2   NAP B O4D 1 
HETATM 5246 C C3D . NAP I 2 .   ? 11.594  0.215   75.046  1.00 11.25 ? 2   NAP B C3D 1 
HETATM 5247 O O3D . NAP I 2 .   ? 10.349  0.869   75.249  1.00 12.61 ? 2   NAP B O3D 1 
HETATM 5248 C C2D . NAP I 2 .   ? 11.544  -1.301  74.954  1.00 10.08 ? 2   NAP B C2D 1 
HETATM 5249 O O2D . NAP I 2 .   ? 10.403  -1.667  74.194  1.00 10.93 ? 2   NAP B O2D 1 
HETATM 5250 C C1D . NAP I 2 .   ? 12.901  -1.634  74.311  1.00 11.36 ? 2   NAP B C1D 1 
HETATM 5251 N N1N . NAP I 2 .   ? 13.972  -2.040  75.291  1.00 12.81 ? 2   NAP B N1N 1 
HETATM 5252 C C2N . NAP I 2 .   ? 14.323  -3.396  75.279  1.00 11.59 ? 2   NAP B C2N 1 
HETATM 5253 C C3N . NAP I 2 .   ? 15.317  -3.888  76.160  1.00 12.01 ? 2   NAP B C3N 1 
HETATM 5254 C C7N . NAP I 2 .   ? 15.725  -5.345  76.178  1.00 11.24 ? 2   NAP B C7N 1 
HETATM 5255 O O7N . NAP I 2 .   ? 16.596  -5.729  76.971  1.00 10.95 ? 2   NAP B O7N 1 
HETATM 5256 N N7N . NAP I 2 .   ? 15.120  -6.186  75.317  1.00 10.62 ? 2   NAP B N7N 1 
HETATM 5257 C C4N . NAP I 2 .   ? 15.960  -2.952  77.072  1.00 12.80 ? 2   NAP B C4N 1 
HETATM 5258 C C5N . NAP I 2 .   ? 15.599  -1.573  77.078  1.00 14.31 ? 2   NAP B C5N 1 
HETATM 5259 C C6N . NAP I 2 .   ? 14.613  -1.118  76.195  1.00 13.77 ? 2   NAP B C6N 1 
HETATM 5260 P P2B . NAP I 2 .   ? 11.681  11.705  75.486  1.00 18.50 ? 2   NAP B P2B 1 
HETATM 5261 O O1X . NAP I 2 .   ? 10.789  10.600  76.014  1.00 16.18 ? 2   NAP B O1X 1 
HETATM 5262 O O2X . NAP I 2 .   ? 11.962  12.843  76.445  1.00 20.03 ? 2   NAP B O2X 1 
HETATM 5263 O O3X . NAP I 2 .   ? 11.253  12.190  74.128  1.00 17.46 ? 2   NAP B O3X 1 
HETATM 5264 C C1  . FFA J 3 .   ? 11.163  0.126   83.732  0.80 38.81 ? 4   FFA B C1  1 
HETATM 5265 C C2  . FFA J 3 .   ? 10.170  0.738   84.753  0.80 39.85 ? 4   FFA B C2  1 
HETATM 5266 C C3  . FFA J 3 .   ? 9.739   -0.220  85.862  0.80 40.30 ? 4   FFA B C3  1 
HETATM 5267 C C4  . FFA J 3 .   ? 10.600  -1.401  86.156  0.80 39.61 ? 4   FFA B C4  1 
HETATM 5268 C C5  . FFA J 3 .   ? 11.740  -1.681  85.468  1.00 38.36 ? 4   FFA B C5  1 
HETATM 5269 C C6  . FFA J 3 .   ? 12.296  -0.831  84.281  1.00 37.37 ? 4   FFA B C6  1 
HETATM 5270 C C7  . FFA J 3 .   ? 12.731  -1.787  83.087  1.00 35.79 ? 4   FFA B C7  1 
HETATM 5271 C C8  . FFA J 3 .   ? 13.687  -2.946  83.562  1.00 34.54 ? 4   FFA B C8  1 
HETATM 5272 C C9  . FFA J 3 .   ? 13.001  -3.777  84.686  1.00 35.22 ? 4   FFA B C9  1 
HETATM 5273 C C10 . FFA J 3 .   ? 12.559  -2.911  85.881  1.00 37.26 ? 4   FFA B C10 1 
HETATM 5274 C C11 . FFA J 3 .   ? 13.378  -0.991  81.877  1.00 34.99 ? 4   FFA B C11 1 
HETATM 5275 C C12 . FFA J 3 .   ? 13.760  -1.982  80.738  1.00 34.39 ? 4   FFA B C12 1 
HETATM 5276 C C14 . FFA J 3 .   ? 14.105  -3.847  82.358  1.00 34.70 ? 4   FFA B C14 1 
HETATM 5277 C C13 . FFA J 3 .   ? 14.798  -3.047  81.228  1.00 34.75 ? 4   FFA B C13 1 
HETATM 5278 C C15 . FFA J 3 .   ? 15.062  -5.035  82.560  1.00 34.48 ? 4   FFA B C15 1 
HETATM 5279 C C16 . FFA J 3 .   ? 15.423  -5.413  81.099  1.00 34.27 ? 4   FFA B C16 1 
HETATM 5280 C C17 . FFA J 3 .   ? 15.188  -4.155  80.225  1.00 34.40 ? 4   FFA B C17 1 
HETATM 5281 C C18 . FFA J 3 .   ? 16.142  -2.326  81.604  1.00 34.71 ? 4   FFA B C18 1 
HETATM 5282 C C19 . FFA J 3 .   ? 13.470  0.036   84.829  1.00 38.27 ? 4   FFA B C19 1 
HETATM 5283 O O3  . FFA J 3 .   ? 8.718   -0.014  86.506  0.80 42.12 ? 4   FFA B O3  1 
HETATM 5284 O O17 . FFA J 3 .   ? 14.131  -4.436  79.287  1.00 32.21 ? 4   FFA B O17 1 
HETATM 5285 C C1  . BME K 4 .   ? 7.340   11.610  84.218  1.00 50.04 ? 324 BME B C1  1 
HETATM 5286 C C2  . BME K 4 .   ? 6.530   11.946  82.982  1.00 50.22 ? 324 BME B C2  1 
HETATM 5287 O O1  . BME K 4 .   ? 8.208   12.704  84.530  1.00 51.53 ? 324 BME B O1  1 
HETATM 5288 S S2  . BME K 4 .   ? 5.432   10.559  82.590  1.00 49.09 ? 324 BME B S2  1 
HETATM 5289 C C1  . BME L 4 .   ? 22.899  -28.514 75.980  1.00 54.48 ? 325 BME B C1  1 
HETATM 5290 C C2  . BME L 4 .   ? 23.402  -27.647 74.841  1.00 53.86 ? 325 BME B C2  1 
HETATM 5291 O O1  . BME L 4 .   ? 23.604  -28.187 77.178  1.00 53.59 ? 325 BME B O1  1 
HETATM 5292 S S2  . BME L 4 .   ? 22.501  -28.069 73.322  1.00 55.95 ? 325 BME B S2  1 
HETATM 5293 C C1  . EDO M 5 .   ? 12.103  -21.837 60.313  1.00 32.05 ? 326 EDO B C1  1 
HETATM 5294 O O1  . EDO M 5 .   ? 11.258  -21.238 61.298  1.00 30.21 ? 326 EDO B O1  1 
HETATM 5295 C C2  . EDO M 5 .   ? 13.570  -21.571 60.661  1.00 31.05 ? 326 EDO B C2  1 
HETATM 5296 O O2  . EDO M 5 .   ? 14.023  -22.520 61.268  1.00 29.74 ? 326 EDO B O2  1 
HETATM 5297 O O   . HOH N 6 .   ? 14.551  2.826   34.693  1.00 4.94  ? 328 HOH A O   1 
HETATM 5298 O O   . HOH N 6 .   ? 25.649  -3.644  30.611  1.00 5.20  ? 329 HOH A O   1 
HETATM 5299 O O   . HOH N 6 .   ? 15.652  -7.373  33.225  1.00 6.11  ? 330 HOH A O   1 
HETATM 5300 O O   . HOH N 6 .   ? 17.310  3.110   35.238  1.00 5.77  ? 331 HOH A O   1 
HETATM 5301 O O   . HOH N 6 .   ? 26.413  -15.140 40.426  1.00 7.19  ? 332 HOH A O   1 
HETATM 5302 O O   . HOH N 6 .   ? 10.283  -19.056 35.595  1.00 9.83  ? 333 HOH A O   1 
HETATM 5303 O O   . HOH N 6 .   ? 29.459  -1.434  32.305  1.00 5.77  ? 334 HOH A O   1 
HETATM 5304 O O   . HOH N 6 .   ? 17.726  5.616   23.266  1.00 10.10 ? 335 HOH A O   1 
HETATM 5305 O O   . HOH N 6 .   ? 31.772  -2.579  33.413  1.00 8.16  ? 336 HOH A O   1 
HETATM 5306 O O   . HOH N 6 .   ? 25.330  -12.657 23.386  1.00 14.40 ? 337 HOH A O   1 
HETATM 5307 O O   . HOH N 6 .   ? 18.911  -12.205 38.030  1.00 7.05  ? 338 HOH A O   1 
HETATM 5308 O O   . HOH N 6 .   ? 21.422  7.312   43.624  1.00 10.18 ? 339 HOH A O   1 
HETATM 5309 O O   . HOH N 6 .   ? 19.036  -16.106 28.302  1.00 7.57  ? 340 HOH A O   1 
HETATM 5310 O O   . HOH N 6 .   ? 25.247  -7.073  21.331  1.00 8.16  ? 341 HOH A O   1 
HETATM 5311 O O   . HOH N 6 .   ? 22.449  9.082   12.066  1.00 10.92 ? 342 HOH A O   1 
HETATM 5312 O O   . HOH N 6 .   ? 31.230  -5.856  37.638  1.00 10.34 ? 343 HOH A O   1 
HETATM 5313 O O   . HOH N 6 .   ? 27.939  -3.730  32.182  1.00 5.73  ? 344 HOH A O   1 
HETATM 5314 O O   . HOH N 6 .   ? 6.240   11.156  38.815  1.00 13.52 ? 345 HOH A O   1 
HETATM 5315 O O   . HOH N 6 .   ? 26.007  -5.937  28.982  1.00 9.54  ? 346 HOH A O   1 
HETATM 5316 O O   . HOH N 6 .   ? 30.698  -4.983  33.966  1.00 12.06 ? 347 HOH A O   1 
HETATM 5317 O O   . HOH N 6 .   ? 17.726  9.946   21.377  1.00 9.40  ? 348 HOH A O   1 
HETATM 5318 O O   . HOH N 6 .   ? 19.612  13.591  39.404  1.00 10.70 ? 349 HOH A O   1 
HETATM 5319 O O   . HOH N 6 .   ? 20.172  -11.358 51.372  1.00 8.80  ? 350 HOH A O   1 
HETATM 5320 O O   . HOH N 6 .   ? 27.206  12.089  17.875  1.00 12.95 ? 351 HOH A O   1 
HETATM 5321 O O   . HOH N 6 .   ? 12.325  -15.317 26.427  1.00 9.71  ? 352 HOH A O   1 
HETATM 5322 O O   . HOH N 6 .   ? 15.924  -16.933 30.408  1.00 8.49  ? 353 HOH A O   1 
HETATM 5323 O O   . HOH N 6 .   ? 10.103  -11.848 25.528  1.00 9.14  ? 354 HOH A O   1 
HETATM 5324 O O   . HOH N 6 .   ? 36.048  -0.670  28.296  1.00 10.89 ? 355 HOH A O   1 
HETATM 5325 O O   . HOH N 6 .   ? 16.441  -15.372 28.117  1.00 9.82  ? 356 HOH A O   1 
HETATM 5326 O O   . HOH N 6 .   ? 13.194  10.878  39.774  1.00 11.89 ? 357 HOH A O   1 
HETATM 5327 O O   . HOH N 6 .   ? 29.969  -9.900  36.472  1.00 9.87  ? 358 HOH A O   1 
HETATM 5328 O O   . HOH N 6 .   ? 24.974  13.462  18.752  1.00 7.71  ? 359 HOH A O   1 
HETATM 5329 O O   . HOH N 6 .   ? 6.609   -0.862  40.128  1.00 16.89 ? 360 HOH A O   1 
HETATM 5330 O O   . HOH N 6 .   ? 1.928   8.999   24.245  1.00 15.03 ? 361 HOH A O   1 
HETATM 5331 O O   . HOH N 6 .   ? 22.262  -0.460  43.755  1.00 12.20 ? 362 HOH A O   1 
HETATM 5332 O O   . HOH N 6 .   ? 19.376  11.627  48.819  1.00 13.02 ? 363 HOH A O   1 
HETATM 5333 O O   . HOH N 6 .   ? 10.947  -17.766 29.915  1.00 13.20 ? 364 HOH A O   1 
HETATM 5334 O O   . HOH N 6 .   ? 29.116  -11.941 25.241  1.00 15.44 ? 365 HOH A O   1 
HETATM 5335 O O   . HOH N 6 .   ? 16.605  -3.701  46.029  1.00 13.55 ? 366 HOH A O   1 
HETATM 5336 O O   . HOH N 6 .   ? 18.756  9.137   15.644  1.00 15.27 ? 367 HOH A O   1 
HETATM 5337 O O   . HOH N 6 .   ? 33.866  -3.135  31.465  1.00 12.28 ? 368 HOH A O   1 
HETATM 5338 O O   . HOH N 6 .   ? 20.934  20.096  24.925  1.00 19.05 ? 369 HOH A O   1 
HETATM 5339 O O   . HOH N 6 .   ? 30.363  15.514  43.620  1.00 31.41 ? 370 HOH A O   1 
HETATM 5340 O O   . HOH N 6 .   ? -1.790  6.219   41.716  1.00 19.32 ? 371 HOH A O   1 
HETATM 5341 O O   . HOH N 6 .   ? 18.738  10.468  18.910  1.00 13.92 ? 372 HOH A O   1 
HETATM 5342 O O   . HOH N 6 .   ? 21.142  -22.122 31.573  1.00 10.89 ? 373 HOH A O   1 
HETATM 5343 O O   . HOH N 6 .   ? 20.661  13.064  15.839  1.00 15.17 ? 374 HOH A O   1 
HETATM 5344 O O   . HOH N 6 .   ? 14.518  -10.980 18.426  1.00 20.43 ? 375 HOH A O   1 
HETATM 5345 O O   . HOH N 6 .   ? 8.478   -1.433  43.106  1.00 12.36 ? 376 HOH A O   1 
HETATM 5346 O O   . HOH N 6 .   ? -0.155  0.224   38.920  1.00 20.21 ? 377 HOH A O   1 
HETATM 5347 O O   . HOH N 6 .   ? 22.020  -12.579 17.175  1.00 18.51 ? 378 HOH A O   1 
HETATM 5348 O O   . HOH N 6 .   ? 21.952  13.399  41.219  1.00 13.40 ? 379 HOH A O   1 
HETATM 5349 O O   . HOH N 6 .   ? 15.070  10.858  24.082  1.00 16.70 ? 380 HOH A O   1 
HETATM 5350 O O   . HOH N 6 .   ? 10.070  -16.031 52.711  1.00 17.22 ? 381 HOH A O   1 
HETATM 5351 O O   . HOH N 6 .   ? -6.792  2.326   30.525  1.00 14.00 ? 382 HOH A O   1 
HETATM 5352 O O   . HOH N 6 .   ? 29.297  -1.793  13.223  1.00 19.00 ? 383 HOH A O   1 
HETATM 5353 O O   . HOH N 6 .   ? 25.295  -13.017 48.949  1.00 23.20 ? 384 HOH A O   1 
HETATM 5354 O O   . HOH N 6 .   ? 13.263  11.129  20.973  1.00 24.99 ? 385 HOH A O   1 
HETATM 5355 O O   . HOH N 6 .   ? 30.112  -13.128 27.234  1.00 12.50 ? 386 HOH A O   1 
HETATM 5356 O O   . HOH N 6 .   ? -8.404  10.904  36.007  1.00 14.59 ? 387 HOH A O   1 
HETATM 5357 O O   . HOH N 6 .   ? 32.834  -8.410  39.259  1.00 15.37 ? 388 HOH A O   1 
HETATM 5358 O O   . HOH N 6 .   ? 24.726  -3.493  26.133  1.00 17.04 ? 389 HOH A O   1 
HETATM 5359 O O   . HOH N 6 .   ? 19.823  -23.212 27.571  1.00 19.40 ? 390 HOH A O   1 
HETATM 5360 O O   . HOH N 6 .   ? 20.360  20.813  27.771  1.00 20.09 ? 391 HOH A O   1 
HETATM 5361 O O   . HOH N 6 .   ? 21.156  7.251   47.359  1.00 20.53 ? 392 HOH A O   1 
HETATM 5362 O O   . HOH N 6 .   ? 18.441  15.282  19.185  1.00 16.67 ? 393 HOH A O   1 
HETATM 5363 O O   . HOH N 6 .   ? 22.957  4.060   7.249   1.00 23.22 ? 394 HOH A O   1 
HETATM 5364 O O   . HOH N 6 .   ? 30.422  -17.475 29.597  1.00 26.48 ? 395 HOH A O   1 
HETATM 5365 O O   . HOH N 6 .   ? 19.681  -8.722  51.669  1.00 18.86 ? 396 HOH A O   1 
HETATM 5366 O O   . HOH N 6 .   ? 9.529   -7.716  50.125  1.00 16.54 ? 397 HOH A O   1 
HETATM 5367 O O   . HOH N 6 .   ? 7.657   20.075  29.440  1.00 24.01 ? 398 HOH A O   1 
HETATM 5368 O O   . HOH N 6 .   ? 15.245  11.878  19.220  1.00 24.32 ? 399 HOH A O   1 
HETATM 5369 O O   . HOH N 6 .   ? 13.263  -21.068 29.652  1.00 22.49 ? 400 HOH A O   1 
HETATM 5370 O O   . HOH N 6 .   ? 18.800  20.401  21.995  1.00 25.61 ? 401 HOH A O   1 
HETATM 5371 O O   . HOH N 6 .   ? 16.315  4.593   12.735  1.00 17.82 ? 402 HOH A O   1 
HETATM 5372 O O   . HOH N 6 .   ? 32.037  -9.209  28.939  1.00 20.43 ? 403 HOH A O   1 
HETATM 5373 O O   . HOH N 6 .   ? 13.560  -5.439  50.044  1.00 39.05 ? 404 HOH A O   1 
HETATM 5374 O O   . HOH N 6 .   ? 7.573   -18.722 35.559  1.00 19.64 ? 405 HOH A O   1 
HETATM 5375 O O   . HOH N 6 .   ? -2.401  12.404  37.661  1.00 20.15 ? 406 HOH A O   1 
HETATM 5376 O O   . HOH N 6 .   ? 8.725   -15.168 24.115  1.00 22.05 ? 407 HOH A O   1 
HETATM 5377 O O   . HOH N 6 .   ? 15.668  -23.513 35.826  1.00 19.21 ? 408 HOH A O   1 
HETATM 5378 O O   . HOH N 6 .   ? 25.251  22.223  35.055  1.00 22.48 ? 409 HOH A O   1 
HETATM 5379 O O   . HOH N 6 .   ? 5.168   17.744  26.175  1.00 26.19 ? 410 HOH A O   1 
HETATM 5380 O O   . HOH N 6 .   ? 12.732  -22.538 33.821  1.00 26.29 ? 411 HOH A O   1 
HETATM 5381 O O   . HOH N 6 .   ? 28.771  9.123   49.951  1.00 21.50 ? 412 HOH A O   1 
HETATM 5382 O O   . HOH N 6 .   ? -2.466  14.397  26.221  1.00 25.28 ? 413 HOH A O   1 
HETATM 5383 O O   . HOH N 6 .   ? 31.298  17.330  22.381  1.00 21.46 ? 414 HOH A O   1 
HETATM 5384 O O   . HOH N 6 .   ? 35.479  9.616   42.020  1.00 26.30 ? 415 HOH A O   1 
HETATM 5385 O O   . HOH N 6 .   ? 20.652  -27.727 40.766  1.00 20.20 ? 416 HOH A O   1 
HETATM 5386 O O   . HOH N 6 .   ? 33.439  10.137  22.539  1.00 14.85 ? 417 HOH A O   1 
HETATM 5387 O O   . HOH N 6 .   ? 4.545   -14.589 51.965  1.00 15.14 ? 418 HOH A O   1 
HETATM 5388 O O   . HOH N 6 .   ? 26.881  -3.341  1.454   1.00 18.75 ? 419 HOH A O   1 
HETATM 5389 O O   . HOH N 6 .   ? 31.409  -10.531 38.890  1.00 19.46 ? 420 HOH A O   1 
HETATM 5390 O O   . HOH N 6 .   ? 12.664  18.351  19.846  1.00 24.21 ? 421 HOH A O   1 
HETATM 5391 O O   . HOH N 6 .   ? 16.031  7.811   18.653  1.00 36.33 ? 422 HOH A O   1 
HETATM 5392 O O   . HOH N 6 .   ? 37.721  13.006  42.805  1.00 24.42 ? 423 HOH A O   1 
HETATM 5393 O O   . HOH N 6 .   ? 14.501  -16.865 27.020  1.00 11.65 ? 424 HOH A O   1 
HETATM 5394 O O   . HOH N 6 .   ? 13.619  -18.135 29.401  1.00 9.95  ? 425 HOH A O   1 
HETATM 5395 O O   . HOH N 6 .   ? 10.169  -13.022 23.318  1.00 13.75 ? 426 HOH A O   1 
HETATM 5396 O O   . HOH N 6 .   ? 2.418   15.529  21.406  1.00 16.54 ? 427 HOH A O   1 
HETATM 5397 O O   . HOH N 6 .   ? 14.681  -8.174  18.625  1.00 17.99 ? 428 HOH A O   1 
HETATM 5398 O O   . HOH N 6 .   ? 18.031  12.190  16.125  1.00 22.79 ? 429 HOH A O   1 
HETATM 5399 O O   . HOH N 6 .   ? 22.656  9.419   9.244   1.00 28.21 ? 430 HOH A O   1 
HETATM 5400 O O   . HOH N 6 .   ? 31.360  8.408   22.519  1.00 24.70 ? 431 HOH A O   1 
HETATM 5401 O O   . HOH N 6 .   ? 11.836  13.195  48.632  1.00 46.64 ? 432 HOH A O   1 
HETATM 5402 O O   . HOH N 6 .   ? 10.799  -3.281  49.307  1.00 40.30 ? 433 HOH A O   1 
HETATM 5403 O O   . HOH N 6 .   ? 15.785  14.530  18.527  1.00 26.39 ? 434 HOH A O   1 
HETATM 5404 O O   . HOH N 6 .   ? -2.551  -7.089  35.266  1.00 17.60 ? 435 HOH A O   1 
HETATM 5405 O O   . HOH N 6 .   ? 10.868  8.066   21.083  1.00 23.12 ? 436 HOH A O   1 
HETATM 5406 O O   . HOH N 6 .   ? -6.257  8.864   37.906  1.00 17.26 ? 437 HOH A O   1 
HETATM 5407 O O   . HOH N 6 .   ? 13.661  16.587  41.707  1.00 26.96 ? 438 HOH A O   1 
HETATM 5408 O O   . HOH N 6 .   ? 13.900  18.516  37.715  1.00 21.82 ? 439 HOH A O   1 
HETATM 5409 O O   . HOH N 6 .   ? 11.316  -2.052  21.189  1.00 19.69 ? 440 HOH A O   1 
HETATM 5410 O O   . HOH N 6 .   ? 25.902  -21.263 50.677  1.00 17.81 ? 441 HOH A O   1 
HETATM 5411 O O   . HOH N 6 .   ? 27.222  -21.530 31.035  1.00 25.30 ? 442 HOH A O   1 
HETATM 5412 O O   . HOH N 6 .   ? 34.198  0.517   7.531   1.00 26.83 ? 443 HOH A O   1 
HETATM 5413 O O   . HOH N 6 .   ? 19.656  9.756   9.041   1.00 24.37 ? 444 HOH A O   1 
HETATM 5414 O O   . HOH N 6 .   ? 5.951   -1.065  42.850  1.00 31.65 ? 445 HOH A O   1 
HETATM 5415 O O   . HOH N 6 .   ? 2.720   16.055  34.443  1.00 22.86 ? 446 HOH A O   1 
HETATM 5416 O O   . HOH N 6 .   ? 30.696  -16.045 27.299  1.00 20.10 ? 447 HOH A O   1 
HETATM 5417 O O   . HOH N 6 .   ? 31.046  -16.555 41.621  1.00 24.21 ? 448 HOH A O   1 
HETATM 5418 O O   . HOH N 6 .   ? 10.297  11.386  44.509  1.00 25.69 ? 449 HOH A O   1 
HETATM 5419 O O   . HOH N 6 .   ? 23.103  -6.495  14.701  1.00 23.72 ? 450 HOH A O   1 
HETATM 5420 O O   . HOH N 6 .   ? 0.679   16.789  30.715  1.00 43.87 ? 451 HOH A O   1 
HETATM 5421 O O   . HOH N 6 .   ? 3.814   14.216  32.871  1.00 22.00 ? 452 HOH A O   1 
HETATM 5422 O O   . HOH N 6 .   ? 36.641  14.168  34.739  1.00 19.53 ? 453 HOH A O   1 
HETATM 5423 O O   . HOH N 6 .   ? 1.873   -17.747 41.123  1.00 38.56 ? 454 HOH A O   1 
HETATM 5424 O O   . HOH N 6 .   ? 25.539  -11.064 46.180  1.00 24.32 ? 455 HOH A O   1 
HETATM 5425 O O   . HOH N 6 .   ? 36.729  0.712   33.624  1.00 21.81 ? 456 HOH A O   1 
HETATM 5426 O O   . HOH N 6 .   ? 17.940  -26.351 28.131  1.00 29.25 ? 457 HOH A O   1 
HETATM 5427 O O   . HOH N 6 .   ? 5.240   -18.977 33.538  1.00 29.23 ? 458 HOH A O   1 
HETATM 5428 O O   . HOH N 6 .   ? 28.608  20.169  35.539  1.00 21.46 ? 459 HOH A O   1 
HETATM 5429 O O   . HOH N 6 .   ? -2.570  0.304   40.173  1.00 42.88 ? 460 HOH A O   1 
HETATM 5430 O O   . HOH N 6 .   ? 28.812  19.594  19.617  1.00 19.65 ? 461 HOH A O   1 
HETATM 5431 O O   . HOH N 6 .   ? 37.002  0.446   24.934  1.00 22.62 ? 462 HOH A O   1 
HETATM 5432 O O   . HOH N 6 .   ? 26.035  -22.493 42.941  1.00 22.83 ? 463 HOH A O   1 
HETATM 5433 O O   . HOH N 6 .   ? 34.213  10.151  44.053  1.00 26.11 ? 464 HOH A O   1 
HETATM 5434 O O   . HOH N 6 .   ? 30.949  8.477   48.052  1.00 24.22 ? 465 HOH A O   1 
HETATM 5435 O O   . HOH N 6 .   ? -8.611  0.437   33.316  1.00 21.05 ? 466 HOH A O   1 
HETATM 5436 O O   . HOH N 6 .   ? 34.572  6.048   47.452  1.00 27.22 ? 467 HOH A O   1 
HETATM 5437 O O   . HOH N 6 .   ? 31.400  19.659  23.541  1.00 28.66 ? 468 HOH A O   1 
HETATM 5438 O O   . HOH N 6 .   ? 22.921  23.053  35.052  1.00 28.59 ? 469 HOH A O   1 
HETATM 5439 O O   . HOH N 6 .   ? 17.367  -17.572 21.399  1.00 21.98 ? 470 HOH A O   1 
HETATM 5440 O O   . HOH N 6 .   ? -0.233  -4.935  18.568  1.00 34.88 ? 471 HOH A O   1 
HETATM 5441 O O   . HOH N 6 .   ? 29.422  10.686  7.291   1.00 33.90 ? 472 HOH A O   1 
HETATM 5442 O O   . HOH N 6 .   ? 7.654   -26.845 44.972  1.00 40.48 ? 473 HOH A O   1 
HETATM 5443 O O   . HOH N 6 .   ? 29.126  -19.720 53.187  1.00 35.20 ? 474 HOH A O   1 
HETATM 5444 O O   . HOH N 6 .   ? 34.422  -2.606  43.432  1.00 21.62 ? 475 HOH A O   1 
HETATM 5445 O O   . HOH N 6 .   ? -4.353  -7.853  33.381  1.00 34.65 ? 476 HOH A O   1 
HETATM 5446 O O   . HOH N 6 .   ? 25.573  11.182  47.535  1.00 25.02 ? 477 HOH A O   1 
HETATM 5447 O O   . HOH N 6 .   ? -0.956  14.981  28.189  1.00 22.83 ? 478 HOH A O   1 
HETATM 5448 O O   . HOH N 6 .   ? 24.399  19.828  15.818  1.00 25.27 ? 479 HOH A O   1 
HETATM 5449 O O   . HOH N 6 .   ? -0.454  -15.181 30.001  1.00 23.00 ? 480 HOH A O   1 
HETATM 5450 O O   . HOH N 6 .   ? 4.505   -16.523 43.899  1.00 23.09 ? 481 HOH A O   1 
HETATM 5451 O O   . HOH N 6 .   ? 8.515   -18.916 49.470  1.00 27.91 ? 482 HOH A O   1 
HETATM 5452 O O   . HOH N 6 .   ? 26.565  -20.554 53.168  1.00 25.64 ? 483 HOH A O   1 
HETATM 5453 O O   . HOH N 6 .   ? 33.023  13.796  13.917  1.00 26.34 ? 484 HOH A O   1 
HETATM 5454 O O   . HOH N 6 .   ? 34.120  16.239  41.073  1.00 24.50 ? 485 HOH A O   1 
HETATM 5455 O O   . HOH N 6 .   ? 13.649  -17.641 53.841  1.00 27.19 ? 486 HOH A O   1 
HETATM 5456 O O   . HOH N 6 .   ? 29.160  -18.798 46.363  1.00 24.04 ? 487 HOH A O   1 
HETATM 5457 O O   . HOH N 6 .   ? 12.701  -28.683 36.656  1.00 41.22 ? 488 HOH A O   1 
HETATM 5458 O O   . HOH N 6 .   ? 10.031  -18.563 51.447  1.00 28.50 ? 489 HOH A O   1 
HETATM 5459 O O   . HOH N 6 .   ? 14.276  -12.630 20.397  1.00 21.30 ? 490 HOH A O   1 
HETATM 5460 O O   . HOH N 6 .   ? 7.527   8.387   40.760  1.00 30.28 ? 491 HOH A O   1 
HETATM 5461 O O   . HOH N 6 .   ? -8.014  0.714   29.131  1.00 29.33 ? 492 HOH A O   1 
HETATM 5462 O O   . HOH N 6 .   ? 19.756  22.629  23.495  1.00 33.72 ? 493 HOH A O   1 
HETATM 5463 O O   . HOH N 6 .   ? 13.233  -24.160 31.705  1.00 36.00 ? 494 HOH A O   1 
HETATM 5464 O O   . HOH N 6 .   ? 25.303  -17.223 55.080  1.00 29.62 ? 495 HOH A O   1 
HETATM 5465 O O   . HOH N 6 .   ? 16.551  10.163  17.553  1.00 25.65 ? 496 HOH A O   1 
HETATM 5466 O O   . HOH N 6 .   ? 15.205  18.267  40.192  1.00 30.24 ? 497 HOH A O   1 
HETATM 5467 O O   . HOH N 6 .   ? 19.873  -24.487 48.166  1.00 26.13 ? 498 HOH A O   1 
HETATM 5468 O O   . HOH N 6 .   ? -0.825  -12.751 27.574  1.00 28.40 ? 499 HOH A O   1 
HETATM 5469 O O   . HOH N 6 .   ? 29.788  17.151  20.019  1.00 38.72 ? 500 HOH A O   1 
HETATM 5470 O O   . HOH N 6 .   ? -3.685  -7.876  37.600  1.00 24.11 ? 501 HOH A O   1 
HETATM 5471 O O   . HOH N 6 .   ? 14.578  -18.627 25.087  1.00 33.54 ? 502 HOH A O   1 
HETATM 5472 O O   . HOH N 6 .   ? 29.083  -5.519  8.469   1.00 29.71 ? 503 HOH A O   1 
HETATM 5473 O O   . HOH N 6 .   ? 39.463  0.079   34.515  1.00 26.71 ? 504 HOH A O   1 
HETATM 5474 O O   . HOH N 6 .   ? 28.133  -12.972 23.155  1.00 21.57 ? 505 HOH A O   1 
HETATM 5475 O O   . HOH N 6 .   ? 15.326  -14.984 19.858  1.00 28.89 ? 506 HOH A O   1 
HETATM 5476 O O   . HOH N 6 .   ? 10.573  10.859  40.749  1.00 35.09 ? 507 HOH A O   1 
HETATM 5477 O O   . HOH N 6 .   ? 20.159  15.371  14.834  1.00 25.82 ? 508 HOH A O   1 
HETATM 5478 O O   . HOH N 6 .   ? 14.862  -16.027 55.459  1.00 32.64 ? 509 HOH A O   1 
HETATM 5479 O O   . HOH N 6 .   ? 39.199  15.835  37.107  1.00 36.56 ? 510 HOH A O   1 
HETATM 5480 O O   . HOH N 6 .   ? 21.162  16.197  46.811  1.00 35.99 ? 511 HOH A O   1 
HETATM 5481 O O   . HOH N 6 .   ? 38.339  7.482   34.354  1.00 22.18 ? 512 HOH A O   1 
HETATM 5482 O O   . HOH N 6 .   ? 20.605  -22.089 23.963  1.00 23.75 ? 513 HOH A O   1 
HETATM 5483 O O   . HOH N 6 .   ? 10.880  -20.709 33.510  1.00 27.80 ? 514 HOH A O   1 
HETATM 5484 O O   . HOH N 6 .   ? 18.940  -22.100 53.196  1.00 26.50 ? 515 HOH A O   1 
HETATM 5485 O O   . HOH N 6 .   ? 16.426  25.215  38.170  1.00 32.51 ? 516 HOH A O   1 
HETATM 5486 O O   . HOH N 6 .   ? 14.845  -28.299 45.366  1.00 18.24 ? 517 HOH A O   1 
HETATM 5487 O O   . HOH N 6 .   ? 24.826  8.724   7.387   1.00 30.41 ? 518 HOH A O   1 
HETATM 5488 O O   . HOH N 6 .   ? 23.784  1.849   45.427  1.00 39.28 ? 519 HOH A O   1 
HETATM 5489 O O   . HOH N 6 .   ? 20.405  17.089  43.996  1.00 31.51 ? 520 HOH A O   1 
HETATM 5490 O O   . HOH N 6 .   ? 4.982   -18.913 42.404  1.00 25.03 ? 521 HOH A O   1 
HETATM 5491 O O   . HOH N 6 .   ? 29.149  -6.500  45.375  1.00 20.97 ? 522 HOH A O   1 
HETATM 5492 O O   . HOH N 6 .   ? 18.511  24.502  32.650  1.00 22.79 ? 523 HOH A O   1 
HETATM 5493 O O   . HOH N 6 .   ? 23.637  -15.802 17.148  1.00 16.46 ? 524 HOH A O   1 
HETATM 5494 O O   . HOH N 6 .   ? 40.397  -3.725  33.415  1.00 35.84 ? 525 HOH A O   1 
HETATM 5495 O O   . HOH N 6 .   ? 1.249   13.987  31.640  1.00 30.86 ? 526 HOH A O   1 
HETATM 5496 O O   . HOH N 6 .   ? 5.668   3.329   17.543  1.00 30.33 ? 527 HOH A O   1 
HETATM 5497 O O   . HOH N 6 .   ? 3.873   -2.599  43.982  1.00 34.96 ? 528 HOH A O   1 
HETATM 5498 O O   . HOH N 6 .   ? 7.533   6.722   42.669  1.00 36.72 ? 529 HOH A O   1 
HETATM 5499 O O   . HOH N 6 .   ? 27.008  21.022  27.684  1.00 27.03 ? 530 HOH A O   1 
HETATM 5500 O O   . HOH N 6 .   ? 26.646  -18.555 18.110  1.00 33.66 ? 531 HOH A O   1 
HETATM 5501 O O   . HOH N 6 .   ? 0.196   -15.172 37.496  1.00 32.26 ? 532 HOH A O   1 
HETATM 5502 O O   . HOH N 6 .   ? 8.932   -12.818 20.959  1.00 26.44 ? 533 HOH A O   1 
HETATM 5503 O O   . HOH N 6 .   ? 33.801  21.121  40.557  1.00 25.96 ? 534 HOH A O   1 
HETATM 5504 O O   . HOH N 6 .   ? 21.839  17.302  13.694  1.00 26.64 ? 535 HOH A O   1 
HETATM 5505 O O   . HOH N 6 .   ? 39.723  6.218   36.112  1.00 35.58 ? 536 HOH A O   1 
HETATM 5506 O O   . HOH N 6 .   ? 9.352   -3.615  18.292  1.00 39.01 ? 537 HOH A O   1 
HETATM 5507 O O   . HOH N 6 .   ? 18.126  -21.714 22.942  1.00 28.74 ? 538 HOH A O   1 
HETATM 5508 O O   . HOH N 6 .   ? 11.504  -25.810 39.104  1.00 33.12 ? 539 HOH A O   1 
HETATM 5509 O O   . HOH N 6 .   ? 10.643  -20.278 30.681  1.00 26.90 ? 540 HOH A O   1 
HETATM 5510 O O   . HOH N 6 .   ? 16.240  26.231  31.237  1.00 37.14 ? 541 HOH A O   1 
HETATM 5511 O O   . HOH N 6 .   ? 31.891  -7.326  34.648  1.00 33.97 ? 542 HOH A O   1 
HETATM 5512 O O   . HOH N 6 .   ? -6.401  -1.975  37.584  1.00 22.88 ? 543 HOH A O   1 
HETATM 5513 O O   . HOH N 6 .   ? 22.556  -12.151 51.992  1.00 36.28 ? 544 HOH A O   1 
HETATM 5514 O O   . HOH N 6 .   ? -4.238  6.362   42.923  1.00 31.14 ? 545 HOH A O   1 
HETATM 5515 O O   . HOH N 6 .   ? 6.585   -18.272 23.682  1.00 35.26 ? 546 HOH A O   1 
HETATM 5516 O O   . HOH N 6 .   ? 18.413  16.734  16.927  1.00 27.98 ? 547 HOH A O   1 
HETATM 5517 O O   . HOH N 6 .   ? 22.930  12.535  9.075   1.00 28.45 ? 548 HOH A O   1 
HETATM 5518 O O   . HOH N 6 .   ? 33.615  -6.970  30.885  1.00 28.54 ? 549 HOH A O   1 
HETATM 5519 O O   . HOH N 6 .   ? 22.249  -5.924  50.144  1.00 31.81 ? 550 HOH A O   1 
HETATM 5520 O O   . HOH N 6 .   ? 12.715  -14.362 23.492  1.00 32.50 ? 551 HOH A O   1 
HETATM 5521 O O   . HOH N 6 .   ? 27.974  16.507  43.463  1.00 36.85 ? 552 HOH A O   1 
HETATM 5522 O O   . HOH N 6 .   ? 17.874  -1.078  46.391  1.00 37.39 ? 553 HOH A O   1 
HETATM 5523 O O   . HOH N 6 .   ? 8.206   18.675  24.920  1.00 32.43 ? 554 HOH A O   1 
HETATM 5524 O O   . HOH N 6 .   ? 32.171  -6.898  16.590  1.00 33.97 ? 555 HOH A O   1 
HETATM 5525 O O   . HOH N 6 .   ? 19.477  -21.674 55.687  1.00 35.13 ? 556 HOH A O   1 
HETATM 5526 O O   . HOH N 6 .   ? 14.919  9.972   15.128  1.00 39.77 ? 557 HOH A O   1 
HETATM 5527 O O   . HOH N 6 .   ? -6.385  -2.220  30.768  1.00 32.65 ? 558 HOH A O   1 
HETATM 5528 O O   . HOH N 6 .   ? 10.975  -12.873 19.220  1.00 32.51 ? 559 HOH A O   1 
HETATM 5529 O O   . HOH N 6 .   ? 30.205  10.186  45.946  1.00 42.76 ? 560 HOH A O   1 
HETATM 5530 O O   . HOH N 6 .   ? 17.079  17.131  43.349  1.00 32.93 ? 561 HOH A O   1 
HETATM 5531 O O   . HOH N 6 .   ? 27.837  -5.084  47.014  1.00 31.39 ? 562 HOH A O   1 
HETATM 5532 O O   . HOH N 6 .   ? 24.101  25.357  34.405  1.00 24.37 ? 563 HOH A O   1 
HETATM 5533 O O   . HOH N 6 .   ? -0.352  12.963  33.310  1.00 32.82 ? 564 HOH A O   1 
HETATM 5534 O O   . HOH N 6 .   ? 29.452  -3.577  48.607  1.00 25.98 ? 565 HOH A O   1 
HETATM 5535 O O   . HOH N 6 .   ? 17.722  -4.817  50.472  1.00 38.08 ? 566 HOH A O   1 
HETATM 5536 O O   . HOH N 6 .   ? 18.861  -4.204  15.439  1.00 35.22 ? 567 HOH A O   1 
HETATM 5537 O O   . HOH N 6 .   ? 17.318  -27.685 46.929  1.00 33.58 ? 568 HOH A O   1 
HETATM 5538 O O   . HOH N 6 .   ? 37.032  6.333   43.184  1.00 24.26 ? 569 HOH A O   1 
HETATM 5539 O O   . HOH N 6 .   ? 26.996  10.137  4.569   1.00 31.00 ? 570 HOH A O   1 
HETATM 5540 O O   . HOH N 6 .   ? 15.085  -23.187 26.584  1.00 34.16 ? 571 HOH A O   1 
HETATM 5541 O O   . HOH N 6 .   ? 21.192  1.402   9.268   1.00 32.29 ? 572 HOH A O   1 
HETATM 5542 O O   . HOH N 6 .   ? 35.480  -14.516 30.732  1.00 39.08 ? 573 HOH A O   1 
HETATM 5543 O O   . HOH N 6 .   ? 28.584  20.405  16.751  1.00 32.97 ? 574 HOH A O   1 
HETATM 5544 O O   . HOH N 6 .   ? 18.603  14.872  12.824  1.00 28.27 ? 575 HOH A O   1 
HETATM 5545 O O   . HOH N 6 .   ? 31.754  11.026  43.849  1.00 28.96 ? 576 HOH A O   1 
HETATM 5546 O O   . HOH N 6 .   ? 33.314  20.223  25.131  1.00 28.36 ? 577 HOH A O   1 
HETATM 5547 O O   . HOH N 6 .   ? 34.638  -7.857  16.702  1.00 28.29 ? 578 HOH A O   1 
HETATM 5548 O O   . HOH N 6 .   ? 19.214  -26.187 50.278  1.00 34.77 ? 579 HOH A O   1 
HETATM 5549 O O   . HOH N 6 .   ? -8.676  3.182   41.252  1.00 33.94 ? 580 HOH A O   1 
HETATM 5550 O O   . HOH N 6 .   ? 19.944  4.328   47.575  1.00 31.20 ? 581 HOH A O   1 
HETATM 5551 O O   . HOH N 6 .   ? 37.118  2.652   29.563  1.00 29.66 ? 582 HOH A O   1 
HETATM 5552 O O   . HOH N 6 .   ? 38.021  5.150   29.967  1.00 37.51 ? 583 HOH A O   1 
HETATM 5553 O O   . HOH N 6 .   ? 15.100  -26.129 35.744  1.00 41.31 ? 584 HOH A O   1 
HETATM 5554 O O   . HOH N 6 .   ? 16.708  -8.633  52.286  1.00 39.36 ? 585 HOH A O   1 
HETATM 5555 O O   . HOH N 6 .   ? 16.301  13.579  14.689  1.00 41.86 ? 586 HOH A O   1 
HETATM 5556 O O   . HOH N 6 .   ? -8.431  -3.120  33.731  1.00 30.29 ? 587 HOH A O   1 
HETATM 5557 O O   . HOH N 6 .   ? -3.342  -13.807 33.796  1.00 33.55 ? 588 HOH A O   1 
HETATM 5558 O O   . HOH N 6 .   ? 24.448  -25.483 37.234  1.00 33.42 ? 589 HOH A O   1 
HETATM 5559 O O   . HOH N 6 .   ? 11.603  -7.674  52.165  1.00 22.54 ? 590 HOH A O   1 
HETATM 5560 O O   . HOH N 6 .   ? 13.122  -8.869  53.935  1.00 21.44 ? 591 HOH A O   1 
HETATM 5561 O O   . HOH N 6 .   ? 15.515  -7.956  54.541  1.00 21.09 ? 592 HOH A O   1 
HETATM 5562 O O   . HOH N 6 .   ? 28.638  -5.470  11.584  1.00 35.96 ? 593 HOH A O   1 
HETATM 5563 O O   . HOH N 6 .   ? 18.054  -25.096 46.129  1.00 21.42 ? 594 HOH A O   1 
HETATM 5564 O O   . HOH N 6 .   ? -4.330  12.149  27.372  1.00 29.13 ? 595 HOH A O   1 
HETATM 5565 O O   . HOH N 6 .   ? 35.932  7.957   16.754  1.00 36.87 ? 596 HOH A O   1 
HETATM 5566 O O   . HOH N 6 .   ? 15.378  -21.585 53.226  1.00 29.28 ? 597 HOH A O   1 
HETATM 5567 O O   . HOH N 6 .   ? 0.781   -9.464  43.281  1.00 28.39 ? 598 HOH A O   1 
HETATM 5568 O O   . HOH N 6 .   ? 27.311  -3.260  12.082  1.00 33.40 ? 599 HOH A O   1 
HETATM 5569 O O   . HOH N 6 .   ? 31.160  -6.222  14.041  1.00 30.35 ? 600 HOH A O   1 
HETATM 5570 O O   . HOH N 6 .   ? 31.626  13.262  42.581  1.00 17.93 ? 601 HOH A O   1 
HETATM 5571 O O   . HOH N 6 .   ? 36.934  8.502   45.408  1.00 28.34 ? 602 HOH A O   1 
HETATM 5572 O O   . HOH O 6 .   ? 15.629  2.144   70.833  1.00 8.37  ? 327 HOH B O   1 
HETATM 5573 O O   . HOH O 6 .   ? 16.901  14.983  67.959  1.00 13.40 ? 328 HOH B O   1 
HETATM 5574 O O   . HOH O 6 .   ? 22.053  -5.735  74.393  1.00 12.28 ? 329 HOH B O   1 
HETATM 5575 O O   . HOH O 6 .   ? 17.423  12.001  50.991  1.00 11.50 ? 330 HOH B O   1 
HETATM 5576 O O   . HOH O 6 .   ? 11.904  8.960   77.742  1.00 15.42 ? 331 HOH B O   1 
HETATM 5577 O O   . HOH O 6 .   ? 22.387  -2.403  83.733  1.00 13.70 ? 332 HOH B O   1 
HETATM 5578 O O   . HOH O 6 .   ? 28.924  -6.909  68.000  1.00 9.25  ? 333 HOH B O   1 
HETATM 5579 O O   . HOH O 6 .   ? 21.311  4.612   66.559  1.00 13.50 ? 334 HOH B O   1 
HETATM 5580 O O   . HOH O 6 .   ? 22.064  8.320   76.407  1.00 13.07 ? 335 HOH B O   1 
HETATM 5581 O O   . HOH O 6 .   ? 9.861   -6.296  68.926  1.00 12.47 ? 336 HOH B O   1 
HETATM 5582 O O   . HOH O 6 .   ? 12.111  -7.876  68.688  1.00 8.94  ? 337 HOH B O   1 
HETATM 5583 O O   . HOH O 6 .   ? 21.596  11.220  50.400  1.00 15.53 ? 338 HOH B O   1 
HETATM 5584 O O   . HOH O 6 .   ? 14.653  -13.833 60.675  1.00 11.04 ? 339 HOH B O   1 
HETATM 5585 O O   . HOH O 6 .   ? 11.117  -16.512 55.152  1.00 13.36 ? 340 HOH B O   1 
HETATM 5586 O O   . HOH O 6 .   ? 23.257  -3.860  76.205  1.00 8.76  ? 341 HOH B O   1 
HETATM 5587 O O   . HOH O 6 .   ? 19.070  -7.432  60.873  1.00 13.79 ? 342 HOH B O   1 
HETATM 5588 O O   . HOH O 6 .   ? 24.399  -6.853  73.178  1.00 16.03 ? 343 HOH B O   1 
HETATM 5589 O O   . HOH O 6 .   ? 9.522   -18.212 64.559  1.00 12.50 ? 344 HOH B O   1 
HETATM 5590 O O   . HOH O 6 .   ? 12.710  4.800   53.359  1.00 19.37 ? 345 HOH B O   1 
HETATM 5591 O O   . HOH O 6 .   ? -0.051  10.787  66.996  1.00 18.21 ? 346 HOH B O   1 
HETATM 5592 O O   . HOH O 6 .   ? 27.923  -11.303 70.547  1.00 14.35 ? 347 HOH B O   1 
HETATM 5593 O O   . HOH O 6 .   ? -0.751  -9.821  63.639  1.00 13.55 ? 348 HOH B O   1 
HETATM 5594 O O   . HOH O 6 .   ? 31.335  -2.723  66.709  1.00 21.84 ? 349 HOH B O   1 
HETATM 5595 O O   . HOH O 6 .   ? 27.744  -7.015  71.862  1.00 15.43 ? 350 HOH B O   1 
HETATM 5596 O O   . HOH O 6 .   ? 27.379  12.358  73.536  1.00 19.37 ? 351 HOH B O   1 
HETATM 5597 O O   . HOH O 6 .   ? 23.784  3.007   53.365  1.00 18.37 ? 352 HOH B O   1 
HETATM 5598 O O   . HOH O 6 .   ? 29.773  -2.656  69.182  1.00 16.42 ? 353 HOH B O   1 
HETATM 5599 O O   . HOH O 6 .   ? 8.466   -13.263 88.250  1.00 23.97 ? 354 HOH B O   1 
HETATM 5600 O O   . HOH O 6 .   ? 29.353  3.581   65.119  1.00 15.66 ? 355 HOH B O   1 
HETATM 5601 O O   . HOH O 6 .   ? 21.799  4.101   87.626  1.00 20.99 ? 356 HOH B O   1 
HETATM 5602 O O   . HOH O 6 .   ? 30.096  16.378  55.143  1.00 19.98 ? 357 HOH B O   1 
HETATM 5603 O O   . HOH O 6 .   ? 29.312  -10.465 74.257  1.00 19.31 ? 358 HOH B O   1 
HETATM 5604 O O   . HOH O 6 .   ? 28.962  3.311   53.949  1.00 17.33 ? 359 HOH B O   1 
HETATM 5605 O O   . HOH O 6 .   ? 3.348   -11.891 58.866  1.00 20.84 ? 360 HOH B O   1 
HETATM 5606 O O   . HOH O 6 .   ? 20.143  -6.258  103.596 1.00 12.98 ? 361 HOH B O   1 
HETATM 5607 O O   . HOH O 6 .   ? 24.668  -9.490  73.180  1.00 14.93 ? 362 HOH B O   1 
HETATM 5608 O O   . HOH O 6 .   ? 5.413   -13.059 63.494  1.00 19.06 ? 363 HOH B O   1 
HETATM 5609 O O   . HOH O 6 .   ? 7.861   0.162   59.797  1.00 14.33 ? 364 HOH B O   1 
HETATM 5610 O O   . HOH O 6 .   ? 30.341  -11.750 62.434  1.00 20.24 ? 365 HOH B O   1 
HETATM 5611 O O   . HOH O 6 .   ? 11.973  -19.259 62.996  1.00 20.50 ? 366 HOH B O   1 
HETATM 5612 O O   . HOH O 6 .   ? 28.695  -0.347  80.385  1.00 19.20 ? 367 HOH B O   1 
HETATM 5613 O O   . HOH O 6 .   ? 30.425  0.484   78.393  1.00 15.04 ? 368 HOH B O   1 
HETATM 5614 O O   . HOH O 6 .   ? 14.681  3.842   51.707  1.00 23.05 ? 369 HOH B O   1 
HETATM 5615 O O   . HOH O 6 .   ? 15.507  11.126  77.418  1.00 23.51 ? 370 HOH B O   1 
HETATM 5616 O O   . HOH O 6 .   ? 12.661  -9.076  98.335  1.00 39.42 ? 371 HOH B O   1 
HETATM 5617 O O   . HOH O 6 .   ? 25.502  2.287   81.949  1.00 16.66 ? 372 HOH B O   1 
HETATM 5618 O O   . HOH O 6 .   ? 14.806  12.317  50.185  1.00 18.37 ? 373 HOH B O   1 
HETATM 5619 O O   . HOH O 6 .   ? 10.036  -9.925  80.389  1.00 17.68 ? 374 HOH B O   1 
HETATM 5620 O O   . HOH O 6 .   ? 23.363  13.526  82.293  1.00 33.61 ? 375 HOH B O   1 
HETATM 5621 O O   . HOH O 6 .   ? 8.581   -28.015 76.978  1.00 31.85 ? 376 HOH B O   1 
HETATM 5622 O O   . HOH O 6 .   ? 5.511   0.566   62.631  1.00 17.57 ? 377 HOH B O   1 
HETATM 5623 O O   . HOH O 6 .   ? 6.374   16.314  64.976  1.00 26.98 ? 378 HOH B O   1 
HETATM 5624 O O   . HOH O 6 .   ? 13.290  17.302  60.770  1.00 31.82 ? 379 HOH B O   1 
HETATM 5625 O O   . HOH O 6 .   ? -7.570  -8.885  62.270  1.00 21.40 ? 380 HOH B O   1 
HETATM 5626 O O   . HOH O 6 .   ? 14.770  13.786  76.346  1.00 29.28 ? 381 HOH B O   1 
HETATM 5627 O O   . HOH O 6 .   ? 29.565  -12.838 77.442  1.00 19.31 ? 382 HOH B O   1 
HETATM 5628 O O   . HOH O 6 .   ? 5.119   -13.280 79.124  1.00 20.30 ? 383 HOH B O   1 
HETATM 5629 O O   . HOH O 6 .   ? 22.247  1.023   52.743  1.00 22.66 ? 384 HOH B O   1 
HETATM 5630 O O   . HOH O 6 .   ? -9.273  -7.167  64.201  1.00 24.26 ? 385 HOH B O   1 
HETATM 5631 O O   . HOH O 6 .   ? 20.405  -23.820 62.627  1.00 19.95 ? 386 HOH B O   1 
HETATM 5632 O O   . HOH O 6 .   ? 8.317   -14.479 84.946  1.00 18.86 ? 387 HOH B O   1 
HETATM 5633 O O   . HOH O 6 .   ? 14.551  -13.811 57.105  1.00 25.80 ? 388 HOH B O   1 
HETATM 5634 O O   . HOH O 6 .   ? 16.231  13.478  74.033  1.00 19.67 ? 389 HOH B O   1 
HETATM 5635 O O   . HOH O 6 .   ? 27.875  19.956  66.248  1.00 21.29 ? 390 HOH B O   1 
HETATM 5636 O O   . HOH O 6 .   ? 16.897  4.075   50.113  1.00 18.67 ? 391 HOH B O   1 
HETATM 5637 O O   . HOH O 6 .   ? 8.082   -8.119  90.758  1.00 27.57 ? 392 HOH B O   1 
HETATM 5638 O O   . HOH O 6 .   ? 29.107  -2.727  83.978  1.00 26.00 ? 393 HOH B O   1 
HETATM 5639 O O   . HOH O 6 .   ? 8.017   0.044   82.177  1.00 20.51 ? 394 HOH B O   1 
HETATM 5640 O O   . HOH O 6 .   ? 29.091  15.100  61.098  1.00 21.98 ? 395 HOH B O   1 
HETATM 5641 O O   . HOH O 6 .   ? 26.175  12.775  81.066  1.00 27.08 ? 396 HOH B O   1 
HETATM 5642 O O   . HOH O 6 .   ? 24.797  6.117   88.020  1.00 24.83 ? 397 HOH B O   1 
HETATM 5643 O O   . HOH O 6 .   ? 31.442  -0.784  70.307  1.00 25.81 ? 398 HOH B O   1 
HETATM 5644 O O   . HOH O 6 .   ? 20.059  10.453  73.750  1.00 15.12 ? 399 HOH B O   1 
HETATM 5645 O O   . HOH O 6 .   ? 32.252  8.919   74.864  1.00 21.67 ? 400 HOH B O   1 
HETATM 5646 O O   . HOH O 6 .   ? 18.926  -8.550  58.179  1.00 30.45 ? 401 HOH B O   1 
HETATM 5647 O O   . HOH O 6 .   ? 27.332  -9.649  72.711  1.00 18.47 ? 402 HOH B O   1 
HETATM 5648 O O   . HOH O 6 .   ? 22.779  -8.926  92.035  1.00 15.33 ? 403 HOH B O   1 
HETATM 5649 O O   . HOH O 6 .   ? 18.522  12.697  74.581  1.00 16.83 ? 404 HOH B O   1 
HETATM 5650 O O   . HOH O 6 .   ? 19.330  9.007   76.024  1.00 25.56 ? 405 HOH B O   1 
HETATM 5651 O O   . HOH O 6 .   ? 7.854   -13.929 82.296  1.00 18.57 ? 406 HOH B O   1 
HETATM 5652 O O   . HOH O 6 .   ? 29.019  1.972   56.458  1.00 20.90 ? 407 HOH B O   1 
HETATM 5653 O O   . HOH O 6 .   ? 14.563  -20.123 86.776  1.00 19.90 ? 408 HOH B O   1 
HETATM 5654 O O   . HOH O 6 .   ? 27.993  16.134  59.090  1.00 23.93 ? 409 HOH B O   1 
HETATM 5655 O O   . HOH O 6 .   ? 20.711  -5.286  78.546  1.00 19.62 ? 410 HOH B O   1 
HETATM 5656 O O   . HOH O 6 .   ? 25.392  -12.956 97.963  1.00 27.98 ? 411 HOH B O   1 
HETATM 5657 O O   . HOH O 6 .   ? 17.066  15.492  54.350  1.00 18.47 ? 412 HOH B O   1 
HETATM 5658 O O   . HOH O 6 .   ? 12.453  10.177  80.049  1.00 18.96 ? 413 HOH B O   1 
HETATM 5659 O O   . HOH O 6 .   ? 27.599  0.082   59.227  1.00 25.45 ? 414 HOH B O   1 
HETATM 5660 O O   . HOH O 6 .   ? 14.144  -28.343 68.741  1.00 27.23 ? 415 HOH B O   1 
HETATM 5661 O O   . HOH O 6 .   ? -5.496  -5.130  77.627  1.00 24.61 ? 416 HOH B O   1 
HETATM 5662 O O   . HOH O 6 .   ? 15.264  -10.285 57.038  1.00 34.47 ? 417 HOH B O   1 
HETATM 5663 O O   . HOH O 6 .   ? 29.847  -9.715  69.149  1.00 18.45 ? 418 HOH B O   1 
HETATM 5664 O O   . HOH O 6 .   ? 2.971   -11.711 62.550  1.00 25.87 ? 419 HOH B O   1 
HETATM 5665 O O   . HOH O 6 .   ? 2.055   -19.966 65.611  1.00 22.03 ? 420 HOH B O   1 
HETATM 5666 O O   . HOH O 6 .   ? 37.907  -7.127  69.204  1.00 28.20 ? 421 HOH B O   1 
HETATM 5667 O O   . HOH O 6 .   ? 14.174  16.002  67.808  1.00 23.89 ? 422 HOH B O   1 
HETATM 5668 O O   . HOH O 6 .   ? 4.807   -18.010 57.428  1.00 35.93 ? 423 HOH B O   1 
HETATM 5669 O O   . HOH O 6 .   ? 12.128  -20.286 85.547  1.00 20.51 ? 424 HOH B O   1 
HETATM 5670 O O   . HOH O 6 .   ? 14.383  16.296  76.362  1.00 31.88 ? 425 HOH B O   1 
HETATM 5671 O O   . HOH O 6 .   ? 29.317  3.911   82.055  1.00 39.98 ? 426 HOH B O   1 
HETATM 5672 O O   . HOH O 6 .   ? 30.488  -12.078 72.328  1.00 26.41 ? 427 HOH B O   1 
HETATM 5673 O O   . HOH O 6 .   ? 20.730  10.361  83.113  1.00 32.48 ? 428 HOH B O   1 
HETATM 5674 O O   . HOH O 6 .   ? 27.962  1.336   82.507  1.00 30.91 ? 429 HOH B O   1 
HETATM 5675 O O   . HOH O 6 .   ? 11.094  -15.073 92.197  1.00 20.55 ? 430 HOH B O   1 
HETATM 5676 O O   . HOH O 6 .   ? 13.349  3.803   85.323  1.00 27.70 ? 431 HOH B O   1 
HETATM 5677 O O   . HOH O 6 .   ? 11.096  -20.781 93.412  1.00 31.84 ? 432 HOH B O   1 
HETATM 5678 O O   . HOH O 6 .   ? 29.572  14.762  57.274  1.00 19.58 ? 433 HOH B O   1 
HETATM 5679 O O   . HOH O 6 .   ? 22.664  -16.843 92.882  1.00 24.72 ? 434 HOH B O   1 
HETATM 5680 O O   . HOH O 6 .   ? 31.434  -1.712  77.434  1.00 23.43 ? 435 HOH B O   1 
HETATM 5681 O O   . HOH O 6 .   ? 30.875  17.360  65.058  1.00 27.11 ? 436 HOH B O   1 
HETATM 5682 O O   . HOH O 6 .   ? 33.349  9.740   62.980  1.00 28.72 ? 437 HOH B O   1 
HETATM 5683 O O   . HOH O 6 .   ? 6.603   -12.670 85.767  1.00 31.14 ? 438 HOH B O   1 
HETATM 5684 O O   . HOH O 6 .   ? -5.102  -11.160 69.356  1.00 23.02 ? 439 HOH B O   1 
HETATM 5685 O O   . HOH O 6 .   ? -4.867  -17.785 73.543  1.00 23.23 ? 440 HOH B O   1 
HETATM 5686 O O   . HOH O 6 .   ? 20.706  -20.358 84.123  1.00 31.15 ? 441 HOH B O   1 
HETATM 5687 O O   . HOH O 6 .   ? 39.044  -8.485  75.498  1.00 25.32 ? 442 HOH B O   1 
HETATM 5688 O O   . HOH O 6 .   ? 24.116  -26.652 70.636  1.00 27.95 ? 443 HOH B O   1 
HETATM 5689 O O   . HOH O 6 .   ? 36.517  -10.894 77.437  1.00 31.65 ? 444 HOH B O   1 
HETATM 5690 O O   . HOH O 6 .   ? 18.584  2.121   49.497  1.00 24.85 ? 445 HOH B O   1 
HETATM 5691 O O   . HOH O 6 .   ? 29.585  -2.708  81.049  1.00 27.79 ? 446 HOH B O   1 
HETATM 5692 O O   . HOH O 6 .   ? 20.889  -27.719 64.877  1.00 26.94 ? 447 HOH B O   1 
HETATM 5693 O O   . HOH O 6 .   ? 12.648  -27.486 84.567  1.00 44.12 ? 448 HOH B O   1 
HETATM 5694 O O   . HOH O 6 .   ? 26.873  20.666  59.753  1.00 22.52 ? 449 HOH B O   1 
HETATM 5695 O O   . HOH O 6 .   ? 22.900  -19.556 57.347  1.00 26.95 ? 450 HOH B O   1 
HETATM 5696 O O   . HOH O 6 .   ? 5.715   -18.747 84.387  1.00 29.08 ? 451 HOH B O   1 
HETATM 5697 O O   . HOH O 6 .   ? 8.522   -17.989 88.111  1.00 30.87 ? 452 HOH B O   1 
HETATM 5698 O O   . HOH O 6 .   ? 34.511  -8.719  79.103  1.00 29.93 ? 453 HOH B O   1 
HETATM 5699 O O   . HOH O 6 .   ? 6.584   -15.527 87.616  1.00 29.96 ? 454 HOH B O   1 
HETATM 5700 O O   . HOH O 6 .   ? 34.188  -13.805 73.749  1.00 35.65 ? 455 HOH B O   1 
HETATM 5701 O O   . HOH O 6 .   ? 20.659  17.124  70.106  1.00 34.33 ? 456 HOH B O   1 
HETATM 5702 O O   . HOH O 6 .   ? 11.619  -1.513  54.910  1.00 32.78 ? 457 HOH B O   1 
HETATM 5703 O O   . HOH O 6 .   ? 18.411  14.366  52.281  1.00 25.49 ? 458 HOH B O   1 
HETATM 5704 O O   . HOH O 6 .   ? 3.666   -20.404 63.496  1.00 29.94 ? 459 HOH B O   1 
HETATM 5705 O O   . HOH O 6 .   ? -3.740  10.585  69.024  1.00 36.63 ? 460 HOH B O   1 
HETATM 5706 O O   . HOH O 6 .   ? 11.839  12.550  79.132  1.00 23.83 ? 461 HOH B O   1 
HETATM 5707 O O   . HOH O 6 .   ? 18.058  16.242  70.280  1.00 33.20 ? 462 HOH B O   1 
HETATM 5708 O O   . HOH O 6 .   ? 14.448  6.180   85.498  1.00 34.19 ? 463 HOH B O   1 
HETATM 5709 O O   . HOH O 6 .   ? 31.124  -14.844 75.858  1.00 35.06 ? 464 HOH B O   1 
HETATM 5710 O O   . HOH O 6 .   ? 33.533  12.874  62.277  1.00 19.42 ? 465 HOH B O   1 
HETATM 5711 O O   . HOH O 6 .   ? 21.132  -19.042 55.448  1.00 21.39 ? 466 HOH B O   1 
HETATM 5712 O O   . HOH O 6 .   ? -7.499  -9.792  69.981  1.00 24.18 ? 467 HOH B O   1 
HETATM 5713 O O   . HOH O 6 .   ? -3.851  -18.475 75.978  1.00 25.10 ? 468 HOH B O   1 
HETATM 5714 O O   . HOH O 6 .   ? 25.432  21.985  57.985  1.00 24.93 ? 469 HOH B O   1 
HETATM 5715 O O   . HOH O 6 .   ? 13.677  -10.974 96.977  1.00 31.29 ? 470 HOH B O   1 
HETATM 5716 O O   . HOH O 6 .   ? 11.141  12.821  51.268  1.00 22.47 ? 471 HOH B O   1 
HETATM 5717 O O   . HOH O 6 .   ? 34.596  -5.885  72.583  1.00 30.86 ? 472 HOH B O   1 
HETATM 5718 O O   . HOH O 6 .   ? -9.451  6.479   67.171  1.00 29.99 ? 473 HOH B O   1 
HETATM 5719 O O   . HOH O 6 .   ? 3.083   -23.467 63.646  1.00 32.48 ? 474 HOH B O   1 
HETATM 5720 O O   . HOH O 6 .   ? 28.666  -16.550 76.742  1.00 24.64 ? 475 HOH B O   1 
HETATM 5721 O O   . HOH O 6 .   ? 15.115  18.540  67.726  1.00 32.53 ? 476 HOH B O   1 
HETATM 5722 O O   . HOH O 6 .   ? 21.399  19.739  65.447  1.00 34.33 ? 477 HOH B O   1 
HETATM 5723 O O   . HOH O 6 .   ? 29.730  -14.655 72.030  1.00 24.39 ? 478 HOH B O   1 
HETATM 5724 O O   . HOH O 6 .   ? 19.527  -7.051  56.229  1.00 35.98 ? 479 HOH B O   1 
HETATM 5725 O O   . HOH O 6 .   ? -0.102  -10.370 60.601  1.00 37.04 ? 480 HOH B O   1 
HETATM 5726 O O   . HOH O 6 .   ? 30.524  13.766  76.761  1.00 23.76 ? 481 HOH B O   1 
HETATM 5727 O O   . HOH O 6 .   ? 16.533  -1.160  53.881  1.00 37.43 ? 482 HOH B O   1 
HETATM 5728 O O   . HOH O 6 .   ? 32.054  -5.217  66.383  1.00 24.17 ? 483 HOH B O   1 
HETATM 5729 O O   . HOH O 6 .   ? -1.843  12.284  68.111  1.00 36.52 ? 484 HOH B O   1 
HETATM 5730 O O   . HOH O 6 .   ? 33.533  9.167   55.237  1.00 26.38 ? 485 HOH B O   1 
HETATM 5731 O O   . HOH O 6 .   ? 13.725  -7.453  94.676  1.00 33.34 ? 486 HOH B O   1 
HETATM 5732 O O   . HOH O 6 .   ? 1.316   -0.828  53.626  1.00 48.51 ? 487 HOH B O   1 
HETATM 5733 O O   . HOH O 6 .   ? 21.841  -21.989 61.355  1.00 22.48 ? 488 HOH B O   1 
HETATM 5734 O O   . HOH O 6 .   ? 34.353  0.960   76.796  1.00 36.50 ? 489 HOH B O   1 
HETATM 5735 O O   . HOH O 6 .   ? 34.834  8.027   67.938  1.00 28.01 ? 490 HOH B O   1 
HETATM 5736 O O   . HOH O 6 .   ? 8.882   -21.998 60.048  1.00 40.73 ? 491 HOH B O   1 
HETATM 5737 O O   . HOH O 6 .   ? 11.248  -15.373 94.786  1.00 31.46 ? 492 HOH B O   1 
HETATM 5738 O O   . HOH O 6 .   ? 30.666  13.062  54.169  1.00 26.20 ? 493 HOH B O   1 
HETATM 5739 O O   . HOH O 6 .   ? 22.721  9.426   49.011  1.00 34.40 ? 494 HOH B O   1 
HETATM 5740 O O   . HOH O 6 .   ? 30.039  -21.663 69.155  1.00 28.46 ? 495 HOH B O   1 
HETATM 5741 O O   . HOH O 6 .   ? 31.877  14.893  61.308  1.00 31.52 ? 496 HOH B O   1 
HETATM 5742 O O   . HOH O 6 .   ? 22.622  -3.135  54.950  1.00 35.44 ? 497 HOH B O   1 
HETATM 5743 O O   . HOH O 6 .   ? 3.258   -18.054 61.647  1.00 22.75 ? 498 HOH B O   1 
HETATM 5744 O O   . HOH O 6 .   ? 43.080  -9.920  72.848  1.00 29.32 ? 499 HOH B O   1 
HETATM 5745 O O   . HOH O 6 .   ? 16.154  -2.017  58.185  1.00 16.40 ? 500 HOH B O   1 
HETATM 5746 O O   . HOH O 6 .   ? 32.794  0.391   63.282  1.00 41.23 ? 501 HOH B O   1 
HETATM 5747 O O   . HOH O 6 .   ? 3.001   -12.432 81.973  1.00 32.16 ? 502 HOH B O   1 
HETATM 5748 O O   . HOH O 6 .   ? 28.451  18.980  58.509  1.00 29.99 ? 503 HOH B O   1 
HETATM 5749 O O   . HOH O 6 .   ? -1.158  2.744   62.857  1.00 35.40 ? 504 HOH B O   1 
HETATM 5750 O O   . HOH O 6 .   ? -12.707 1.829   70.776  1.00 32.80 ? 505 HOH B O   1 
HETATM 5751 O O   . HOH O 6 .   ? 4.397   -23.351 81.482  1.00 31.14 ? 506 HOH B O   1 
HETATM 5752 O O   . HOH O 6 .   ? 23.279  21.126  53.848  1.00 41.66 ? 507 HOH B O   1 
HETATM 5753 O O   . HOH O 6 .   ? 26.222  -18.682 77.973  1.00 34.19 ? 508 HOH B O   1 
HETATM 5754 O O   . HOH O 6 .   ? 4.481   -14.082 84.380  1.00 37.53 ? 509 HOH B O   1 
HETATM 5755 O O   . HOH O 6 .   ? 4.869   0.601   59.402  1.00 37.52 ? 510 HOH B O   1 
HETATM 5756 O O   . HOH O 6 .   ? 28.973  6.777   87.313  1.00 34.90 ? 511 HOH B O   1 
HETATM 5757 O O   . HOH O 6 .   ? 11.805  18.195  67.179  1.00 38.64 ? 512 HOH B O   1 
HETATM 5758 O O   . HOH O 6 .   ? 26.847  -11.408 57.194  1.00 21.00 ? 513 HOH B O   1 
HETATM 5759 O O   . HOH O 6 .   ? 26.298  21.151  55.771  1.00 36.84 ? 514 HOH B O   1 
HETATM 5760 O O   . HOH O 6 .   ? 6.666   2.588   84.778  1.00 37.25 ? 515 HOH B O   1 
HETATM 5761 O O   . HOH O 6 .   ? 6.015   -24.844 76.118  1.00 36.70 ? 516 HOH B O   1 
HETATM 5762 O O   . HOH O 6 .   ? 21.856  -23.341 78.552  1.00 34.47 ? 517 HOH B O   1 
HETATM 5763 O O   . HOH O 6 .   ? 14.327  2.439   87.366  1.00 37.40 ? 518 HOH B O   1 
HETATM 5764 O O   . HOH O 6 .   ? 19.370  1.819   52.366  1.00 33.90 ? 519 HOH B O   1 
HETATM 5765 O O   . HOH O 6 .   ? 21.962  -28.257 80.176  1.00 33.06 ? 520 HOH B O   1 
HETATM 5766 O O   . HOH O 6 .   ? 27.739  22.025  62.432  1.00 22.17 ? 521 HOH B O   1 
HETATM 5767 O O   . HOH O 6 .   ? 31.592  13.065  72.398  1.00 33.18 ? 522 HOH B O   1 
HETATM 5768 O O   . HOH O 6 .   ? 31.580  5.344   50.370  1.00 27.81 ? 523 HOH B O   1 
HETATM 5769 O O   . HOH O 6 .   ? -9.164  4.379   70.277  1.00 26.57 ? 524 HOH B O   1 
HETATM 5770 O O   . HOH O 6 .   ? -10.927 -2.981  63.419  1.00 36.71 ? 525 HOH B O   1 
HETATM 5771 O O   . HOH O 6 .   ? 5.983   -24.231 78.954  1.00 26.59 ? 526 HOH B O   1 
HETATM 5772 O O   . HOH O 6 .   ? 18.362  11.195  77.158  1.00 16.04 ? 527 HOH B O   1 
HETATM 5773 O O   . HOH O 6 .   ? 26.494  13.878  77.497  1.00 19.14 ? 528 HOH B O   1 
HETATM 5774 O O   . HOH O 6 .   ? 28.254  14.191  75.311  1.00 27.57 ? 529 HOH B O   1 
HETATM 5775 O O   . HOH O 6 .   ? 11.981  15.563  59.318  1.00 26.29 ? 530 HOH B O   1 
HETATM 5776 O O   . HOH O 6 .   ? 31.976  2.647   78.396  1.00 36.45 ? 531 HOH B O   1 
HETATM 5777 O O   . HOH O 6 .   ? 37.325  -10.895 68.819  1.00 17.25 ? 532 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   5   5   CYS CYS A . n 
A 1 2   HIS 2   6   6   HIS HIS A . n 
A 1 3   CYS 3   7   7   CYS CYS A . n 
A 1 4   VAL 4   8   8   VAL VAL A . n 
A 1 5   ILE 5   9   9   ILE ILE A . n 
A 1 6   LEU 6   10  10  LEU LEU A . n 
A 1 7   ASN 7   11  11  ASN ASN A . n 
A 1 8   ASP 8   12  12  ASP ASP A . n 
A 1 9   GLY 9   13  13  GLY GLY A . n 
A 1 10  ASN 10  14  14  ASN ASN A . n 
A 1 11  PHE 11  15  15  PHE PHE A . n 
A 1 12  ILE 12  16  16  ILE ILE A . n 
A 1 13  PRO 13  17  17  PRO PRO A . n 
A 1 14  VAL 14  18  18  VAL VAL A . n 
A 1 15  LEU 15  19  19  LEU LEU A . n 
A 1 16  GLY 16  20  20  GLY GLY A . n 
A 1 17  PHE 17  21  21  PHE PHE A . n 
A 1 18  GLY 18  22  22  GLY GLY A . n 
A 1 19  THR 19  23  23  THR THR A . n 
A 1 20  ALA 20  24  24  ALA ALA A . n 
A 1 21  LEU 21  25  25  LEU LEU A . n 
A 1 22  PRO 22  26  26  PRO PRO A . n 
A 1 23  LEU 23  27  27  LEU LEU A . n 
A 1 24  GLU 24  28  28  GLU GLU A . n 
A 1 25  CYS 25  29  29  CYS CYS A . n 
A 1 26  PRO 26  30  30  PRO PRO A . n 
A 1 27  ALA 27  31  31  ALA ALA A . n 
A 1 28  SER 28  32  32  SER SER A . n 
A 1 29  LYS 29  33  33  LYS LYS A . n 
A 1 30  ALA 30  34  34  ALA ALA A . n 
A 1 31  LYS 31  35  35  LYS LYS A . n 
A 1 32  GLU 32  36  36  GLU GLU A . n 
A 1 33  LEU 33  37  37  LEU LEU A . n 
A 1 34  THR 34  38  38  THR THR A . n 
A 1 35  LYS 35  39  39  LYS LYS A . n 
A 1 36  ILE 36  40  40  ILE ILE A . n 
A 1 37  ALA 37  41  41  ALA ALA A . n 
A 1 38  ILE 38  42  42  ILE ILE A . n 
A 1 39  ASP 39  43  43  ASP ASP A . n 
A 1 40  ALA 40  44  44  ALA ALA A . n 
A 1 41  GLY 41  45  45  GLY GLY A . n 
A 1 42  PHE 42  46  46  PHE PHE A . n 
A 1 43  HIS 43  47  47  HIS HIS A . n 
A 1 44  HIS 44  48  48  HIS HIS A . n 
A 1 45  PHE 45  49  49  PHE PHE A . n 
A 1 46  ASP 46  50  50  ASP ASP A . n 
A 1 47  SER 47  51  51  SER SER A . n 
A 1 48  ALA 48  52  52  ALA ALA A . n 
A 1 49  SER 49  53  53  SER SER A . n 
A 1 50  VAL 50  54  54  VAL VAL A . n 
A 1 51  TYR 51  55  55  TYR TYR A . n 
A 1 52  ASN 52  56  56  ASN ASN A . n 
A 1 53  THR 53  57  57  THR THR A . n 
A 1 54  GLU 54  58  58  GLU GLU A . n 
A 1 55  ASP 55  59  59  ASP ASP A . n 
A 1 56  HIS 56  60  60  HIS HIS A . n 
A 1 57  VAL 57  61  61  VAL VAL A . n 
A 1 58  GLY 58  62  62  GLY GLY A . n 
A 1 59  GLU 59  63  63  GLU GLU A . n 
A 1 60  ALA 60  64  64  ALA ALA A . n 
A 1 61  ILE 61  65  65  ILE ILE A . n 
A 1 62  ARG 62  66  66  ARG ARG A . n 
A 1 63  SER 63  67  67  SER SER A . n 
A 1 64  LYS 64  68  68  LYS LYS A . n 
A 1 65  ILE 65  69  69  ILE ILE A . n 
A 1 66  ALA 66  70  70  ALA ALA A . n 
A 1 67  ASP 67  71  71  ASP ASP A . n 
A 1 68  GLY 68  72  72  GLY GLY A . n 
A 1 69  THR 69  73  73  THR THR A . n 
A 1 70  VAL 70  74  74  VAL VAL A . n 
A 1 71  ARG 71  75  75  ARG ARG A . n 
A 1 72  ARG 72  76  76  ARG ARG A . n 
A 1 73  GLU 73  77  77  GLU GLU A . n 
A 1 74  ASP 74  78  78  ASP ASP A . n 
A 1 75  ILE 75  79  79  ILE ILE A . n 
A 1 76  PHE 76  80  80  PHE PHE A . n 
A 1 77  TYR 77  81  81  TYR TYR A . n 
A 1 78  THR 78  82  82  THR THR A . n 
A 1 79  SER 79  83  83  SER SER A . n 
A 1 80  LYS 80  84  84  LYS LYS A . n 
A 1 81  VAL 81  85  85  VAL VAL A . n 
A 1 82  TRP 82  86  86  TRP TRP A . n 
A 1 83  CYS 83  87  87  CYS CYS A . n 
A 1 84  THR 84  88  88  THR THR A . n 
A 1 85  SER 85  89  89  SER SER A . n 
A 1 86  LEU 86  90  90  LEU LEU A . n 
A 1 87  HIS 87  91  91  HIS HIS A . n 
A 1 88  PRO 88  92  92  PRO PRO A . n 
A 1 89  GLU 89  93  93  GLU GLU A . n 
A 1 90  LEU 90  94  94  LEU LEU A . n 
A 1 91  VAL 91  95  95  VAL VAL A . n 
A 1 92  ARG 92  96  96  ARG ARG A . n 
A 1 93  ALA 93  97  97  ALA ALA A . n 
A 1 94  SER 94  98  98  SER SER A . n 
A 1 95  LEU 95  99  99  LEU LEU A . n 
A 1 96  GLU 96  100 100 GLU GLU A . n 
A 1 97  ARG 97  101 101 ARG ARG A . n 
A 1 98  SER 98  102 102 SER SER A . n 
A 1 99  LEU 99  103 103 LEU LEU A . n 
A 1 100 GLN 100 104 104 GLN GLN A . n 
A 1 101 LYS 101 105 105 LYS LYS A . n 
A 1 102 LEU 102 106 106 LEU LEU A . n 
A 1 103 GLN 103 107 107 GLN GLN A . n 
A 1 104 PHE 104 108 108 PHE PHE A . n 
A 1 105 ASP 105 109 109 ASP ASP A . n 
A 1 106 TYR 106 110 110 TYR TYR A . n 
A 1 107 VAL 107 111 111 VAL VAL A . n 
A 1 108 ASP 108 112 112 ASP ASP A . n 
A 1 109 LEU 109 113 113 LEU LEU A . n 
A 1 110 TYR 110 114 114 TYR TYR A . n 
A 1 111 LEU 111 115 115 LEU LEU A . n 
A 1 112 ILE 112 116 116 ILE ILE A . n 
A 1 113 HIS 113 117 117 HIS HIS A . n 
A 1 114 TYR 114 118 118 TYR TYR A . n 
A 1 115 PRO 115 119 119 PRO PRO A . n 
A 1 116 MET 116 120 120 MET MET A . n 
A 1 117 ALA 117 121 121 ALA ALA A . n 
A 1 118 LEU 118 122 122 LEU LEU A . n 
A 1 119 LYS 119 123 123 LYS LYS A . n 
A 1 120 PRO 120 124 124 PRO PRO A . n 
A 1 121 GLY 121 125 125 GLY GLY A . n 
A 1 122 GLU 122 126 126 GLU GLU A . n 
A 1 123 GLU 123 127 127 GLU GLU A . n 
A 1 124 ASN 124 128 128 ASN ASN A . n 
A 1 125 PHE 125 129 129 PHE PHE A . n 
A 1 126 PRO 126 130 130 PRO PRO A . n 
A 1 127 VAL 127 131 131 VAL VAL A . n 
A 1 128 ASP 128 132 132 ASP ASP A . n 
A 1 129 GLU 129 133 133 GLU GLU A . n 
A 1 130 HIS 130 134 134 HIS HIS A . n 
A 1 131 GLY 131 135 135 GLY GLY A . n 
A 1 132 LYS 132 136 136 LYS LYS A . n 
A 1 133 LEU 133 137 137 LEU LEU A . n 
A 1 134 ILE 134 138 138 ILE ILE A . n 
A 1 135 PHE 135 139 139 PHE PHE A . n 
A 1 136 ASP 136 140 140 ASP ASP A . n 
A 1 137 ARG 137 141 141 ARG ARG A . n 
A 1 138 VAL 138 142 142 VAL VAL A . n 
A 1 139 ASP 139 143 143 ASP ASP A . n 
A 1 140 LEU 140 144 144 LEU LEU A . n 
A 1 141 CYS 141 145 145 CYS CYS A . n 
A 1 142 ALA 142 146 146 ALA ALA A . n 
A 1 143 THR 143 147 147 THR THR A . n 
A 1 144 TRP 144 148 148 TRP TRP A . n 
A 1 145 GLU 145 149 149 GLU GLU A . n 
A 1 146 ALA 146 150 150 ALA ALA A . n 
A 1 147 MET 147 151 151 MET MET A . n 
A 1 148 GLU 148 152 152 GLU GLU A . n 
A 1 149 LYS 149 153 153 LYS LYS A . n 
A 1 150 CYS 150 154 154 CYS CYS A . n 
A 1 151 LYS 151 155 155 LYS LYS A . n 
A 1 152 ASP 152 156 156 ASP ASP A . n 
A 1 153 ALA 153 157 157 ALA ALA A . n 
A 1 154 GLY 154 158 158 GLY GLY A . n 
A 1 155 LEU 155 159 159 LEU LEU A . n 
A 1 156 THR 156 160 160 THR THR A . n 
A 1 157 LYS 157 161 161 LYS LYS A . n 
A 1 158 SER 158 162 162 SER SER A . n 
A 1 159 ILE 159 163 163 ILE ILE A . n 
A 1 160 GLY 160 164 164 GLY GLY A . n 
A 1 161 VAL 161 165 165 VAL VAL A . n 
A 1 162 SER 162 166 166 SER SER A . n 
A 1 163 ASN 163 167 167 ASN ASN A . n 
A 1 164 PHE 164 168 168 PHE PHE A . n 
A 1 165 ASN 165 169 169 ASN ASN A . n 
A 1 166 TYR 166 170 170 TYR TYR A . n 
A 1 167 ARG 167 171 171 ARG ARG A . n 
A 1 168 GLN 168 172 172 GLN GLN A . n 
A 1 169 LEU 169 173 173 LEU LEU A . n 
A 1 170 GLU 170 174 174 GLU GLU A . n 
A 1 171 MET 171 175 175 MET MET A . n 
A 1 172 ILE 172 176 176 ILE ILE A . n 
A 1 173 LEU 173 177 177 LEU LEU A . n 
A 1 174 ASN 174 178 178 ASN ASN A . n 
A 1 175 LYS 175 179 179 LYS LYS A . n 
A 1 176 PRO 176 180 180 PRO PRO A . n 
A 1 177 GLY 177 181 181 GLY GLY A . n 
A 1 178 LEU 178 182 182 LEU LEU A . n 
A 1 179 LYS 179 183 183 LYS LYS A . n 
A 1 180 TYR 180 184 184 TYR TYR A . n 
A 1 181 LYS 181 185 185 LYS LYS A . n 
A 1 182 PRO 182 186 186 PRO PRO A . n 
A 1 183 VAL 183 187 187 VAL VAL A . n 
A 1 184 CYS 184 188 188 CYS CYS A . n 
A 1 185 ASN 185 189 189 ASN ASN A . n 
A 1 186 GLN 186 190 190 GLN GLN A . n 
A 1 187 VAL 187 191 191 VAL VAL A . n 
A 1 188 GLU 188 192 192 GLU GLU A . n 
A 1 189 CYS 189 193 193 CYS CYS A . n 
A 1 190 HIS 190 194 194 HIS HIS A . n 
A 1 191 PRO 191 195 195 PRO PRO A . n 
A 1 192 TYR 192 196 196 TYR TYR A . n 
A 1 193 LEU 193 197 197 LEU LEU A . n 
A 1 194 ASN 194 198 198 ASN ASN A . n 
A 1 195 GLN 195 199 199 GLN GLN A . n 
A 1 196 MET 196 200 200 MET MET A . n 
A 1 197 LYS 197 201 201 LYS LYS A . n 
A 1 198 LEU 198 202 202 LEU LEU A . n 
A 1 199 LEU 199 203 203 LEU LEU A . n 
A 1 200 ASP 200 204 204 ASP ASP A . n 
A 1 201 PHE 201 205 205 PHE PHE A . n 
A 1 202 CYS 202 206 206 CYS CYS A . n 
A 1 203 LYS 203 207 207 LYS LYS A . n 
A 1 204 SER 204 208 208 SER SER A . n 
A 1 205 LYS 205 209 209 LYS LYS A . n 
A 1 206 ASP 206 210 210 ASP ASP A . n 
A 1 207 ILE 207 211 211 ILE ILE A . n 
A 1 208 VAL 208 212 212 VAL VAL A . n 
A 1 209 LEU 209 213 213 LEU LEU A . n 
A 1 210 VAL 210 214 214 VAL VAL A . n 
A 1 211 ALA 211 215 215 ALA ALA A . n 
A 1 212 TYR 212 216 216 TYR TYR A . n 
A 1 213 GLY 213 217 217 GLY GLY A . n 
A 1 214 VAL 214 218 218 VAL VAL A . n 
A 1 215 LEU 215 219 219 LEU LEU A . n 
A 1 216 GLY 216 220 220 GLY GLY A . n 
A 1 217 THR 217 221 221 THR THR A . n 
A 1 218 GLN 218 222 222 GLN GLN A . n 
A 1 219 ARG 219 223 223 ARG ARG A . n 
A 1 220 TYR 220 224 224 TYR TYR A . n 
A 1 221 GLY 221 225 225 GLY GLY A . n 
A 1 222 GLY 222 226 226 GLY GLY A . n 
A 1 223 TRP 223 227 227 TRP TRP A . n 
A 1 224 VAL 224 228 228 VAL VAL A . n 
A 1 225 ASP 225 229 229 ASP ASP A . n 
A 1 226 GLN 226 230 230 GLN GLN A . n 
A 1 227 ASN 227 231 231 ASN ASN A . n 
A 1 228 SER 228 232 232 SER SER A . n 
A 1 229 PRO 229 233 233 PRO PRO A . n 
A 1 230 VAL 230 234 234 VAL VAL A . n 
A 1 231 LEU 231 235 235 LEU LEU A . n 
A 1 232 LEU 232 236 236 LEU LEU A . n 
A 1 233 ASP 233 237 237 ASP ASP A . n 
A 1 234 GLU 234 238 238 GLU GLU A . n 
A 1 235 PRO 235 239 239 PRO PRO A . n 
A 1 236 VAL 236 240 240 VAL VAL A . n 
A 1 237 LEU 237 241 241 LEU LEU A . n 
A 1 238 GLY 238 242 242 GLY GLY A . n 
A 1 239 SER 239 243 243 SER SER A . n 
A 1 240 MET 240 244 244 MET MET A . n 
A 1 241 ALA 241 245 245 ALA ALA A . n 
A 1 242 LYS 242 246 246 LYS LYS A . n 
A 1 243 LYS 243 247 247 LYS LYS A . n 
A 1 244 TYR 244 248 248 TYR TYR A . n 
A 1 245 ASN 245 249 249 ASN ASN A . n 
A 1 246 ARG 246 250 250 ARG ARG A . n 
A 1 247 THR 247 251 251 THR THR A . n 
A 1 248 PRO 248 252 252 PRO PRO A . n 
A 1 249 ALA 249 253 253 ALA ALA A . n 
A 1 250 LEU 250 254 254 LEU LEU A . n 
A 1 251 ILE 251 255 255 ILE ILE A . n 
A 1 252 ALA 252 256 256 ALA ALA A . n 
A 1 253 LEU 253 257 257 LEU LEU A . n 
A 1 254 ARG 254 258 258 ARG ARG A . n 
A 1 255 TYR 255 259 259 TYR TYR A . n 
A 1 256 GLN 256 260 260 GLN GLN A . n 
A 1 257 LEU 257 261 261 LEU LEU A . n 
A 1 258 GLN 258 262 262 GLN GLN A . n 
A 1 259 ARG 259 263 263 ARG ARG A . n 
A 1 260 GLY 260 264 264 GLY GLY A . n 
A 1 261 ILE 261 265 265 ILE ILE A . n 
A 1 262 VAL 262 266 266 VAL VAL A . n 
A 1 263 VAL 263 267 267 VAL VAL A . n 
A 1 264 LEU 264 268 268 LEU LEU A . n 
A 1 265 ASN 265 269 269 ASN ASN A . n 
A 1 266 THR 266 270 270 THR THR A . n 
A 1 267 SER 267 271 271 SER SER A . n 
A 1 268 LEU 268 272 272 LEU LEU A . n 
A 1 269 LYS 269 273 273 LYS LYS A . n 
A 1 270 GLU 270 274 274 GLU GLU A . n 
A 1 271 GLU 271 275 275 GLU GLU A . n 
A 1 272 ARG 272 276 276 ARG ARG A . n 
A 1 273 ILE 273 277 277 ILE ILE A . n 
A 1 274 LYS 274 278 278 LYS LYS A . n 
A 1 275 GLU 275 279 279 GLU GLU A . n 
A 1 276 ASN 276 280 280 ASN ASN A . n 
A 1 277 MET 277 281 281 MET MET A . n 
A 1 278 GLN 278 282 282 GLN GLN A . n 
A 1 279 VAL 279 283 283 VAL VAL A . n 
A 1 280 PHE 280 284 284 PHE PHE A . n 
A 1 281 GLU 281 285 285 GLU GLU A . n 
A 1 282 PHE 282 286 286 PHE PHE A . n 
A 1 283 GLN 283 287 287 GLN GLN A . n 
A 1 284 LEU 284 288 288 LEU LEU A . n 
A 1 285 SER 285 289 289 SER SER A . n 
A 1 286 SER 286 290 290 SER SER A . n 
A 1 287 GLU 287 291 291 GLU GLU A . n 
A 1 288 ASP 288 292 292 ASP ASP A . n 
A 1 289 MET 289 293 293 MET MET A . n 
A 1 290 LYS 290 294 294 LYS LYS A . n 
A 1 291 VAL 291 295 295 VAL VAL A . n 
A 1 292 LEU 292 296 296 LEU LEU A . n 
A 1 293 ASP 293 297 297 ASP ASP A . n 
A 1 294 GLY 294 298 298 GLY GLY A . n 
A 1 295 LEU 295 299 299 LEU LEU A . n 
A 1 296 ASN 296 300 300 ASN ASN A . n 
A 1 297 ARG 297 301 301 ARG ARG A . n 
A 1 298 ASN 298 302 302 ASN ASN A . n 
A 1 299 MET 299 303 303 MET MET A . n 
A 1 300 ARG 300 304 304 ARG ARG A . n 
A 1 301 TYR 301 305 305 TYR TYR A . n 
A 1 302 ILE 302 306 306 ILE ILE A . n 
A 1 303 PRO 303 307 307 PRO PRO A . n 
A 1 304 ALA 304 308 308 ALA ALA A . n 
A 1 305 ALA 305 309 309 ALA ALA A . n 
A 1 306 ILE 306 310 310 ILE ILE A . n 
A 1 307 PHE 307 311 311 PHE PHE A . n 
A 1 308 LYS 308 312 312 LYS LYS A . n 
A 1 309 GLY 309 313 313 GLY GLY A . n 
A 1 310 HIS 310 314 314 HIS HIS A . n 
A 1 311 PRO 311 315 315 PRO PRO A . n 
A 1 312 ASN 312 316 316 ASN ASN A . n 
A 1 313 TRP 313 317 317 TRP TRP A . n 
A 1 314 PRO 314 318 318 PRO PRO A . n 
A 1 315 PHE 315 319 319 PHE PHE A . n 
A 1 316 LEU 316 320 320 LEU LEU A . n 
A 1 317 ASP 317 321 321 ASP ASP A . n 
A 1 318 GLU 318 322 322 GLU GLU A . n 
A 1 319 TYR 319 323 323 TYR TYR A . n 
B 1 1   CYS 1   5   5   CYS CYS B . n 
B 1 2   HIS 2   6   6   HIS HIS B . n 
B 1 3   CYS 3   7   7   CYS CYS B . n 
B 1 4   VAL 4   8   8   VAL VAL B . n 
B 1 5   ILE 5   9   9   ILE ILE B . n 
B 1 6   LEU 6   10  10  LEU LEU B . n 
B 1 7   ASN 7   11  11  ASN ASN B . n 
B 1 8   ASP 8   12  12  ASP ASP B . n 
B 1 9   GLY 9   13  13  GLY GLY B . n 
B 1 10  ASN 10  14  14  ASN ASN B . n 
B 1 11  PHE 11  15  15  PHE PHE B . n 
B 1 12  ILE 12  16  16  ILE ILE B . n 
B 1 13  PRO 13  17  17  PRO PRO B . n 
B 1 14  VAL 14  18  18  VAL VAL B . n 
B 1 15  LEU 15  19  19  LEU LEU B . n 
B 1 16  GLY 16  20  20  GLY GLY B . n 
B 1 17  PHE 17  21  21  PHE PHE B . n 
B 1 18  GLY 18  22  22  GLY GLY B . n 
B 1 19  THR 19  23  23  THR THR B . n 
B 1 20  ALA 20  24  24  ALA ALA B . n 
B 1 21  LEU 21  25  25  LEU LEU B . n 
B 1 22  PRO 22  26  26  PRO PRO B . n 
B 1 23  LEU 23  27  27  LEU LEU B . n 
B 1 24  GLU 24  28  28  GLU GLU B . n 
B 1 25  CYS 25  29  29  CYS CYS B . n 
B 1 26  PRO 26  30  30  PRO PRO B . n 
B 1 27  ALA 27  31  31  ALA ALA B . n 
B 1 28  SER 28  32  32  SER SER B . n 
B 1 29  LYS 29  33  33  LYS LYS B . n 
B 1 30  ALA 30  34  34  ALA ALA B . n 
B 1 31  LYS 31  35  35  LYS LYS B . n 
B 1 32  GLU 32  36  36  GLU GLU B . n 
B 1 33  LEU 33  37  37  LEU LEU B . n 
B 1 34  THR 34  38  38  THR THR B . n 
B 1 35  LYS 35  39  39  LYS LYS B . n 
B 1 36  ILE 36  40  40  ILE ILE B . n 
B 1 37  ALA 37  41  41  ALA ALA B . n 
B 1 38  ILE 38  42  42  ILE ILE B . n 
B 1 39  ASP 39  43  43  ASP ASP B . n 
B 1 40  ALA 40  44  44  ALA ALA B . n 
B 1 41  GLY 41  45  45  GLY GLY B . n 
B 1 42  PHE 42  46  46  PHE PHE B . n 
B 1 43  HIS 43  47  47  HIS HIS B . n 
B 1 44  HIS 44  48  48  HIS HIS B . n 
B 1 45  PHE 45  49  49  PHE PHE B . n 
B 1 46  ASP 46  50  50  ASP ASP B . n 
B 1 47  SER 47  51  51  SER SER B . n 
B 1 48  ALA 48  52  52  ALA ALA B . n 
B 1 49  SER 49  53  53  SER SER B . n 
B 1 50  VAL 50  54  54  VAL VAL B . n 
B 1 51  TYR 51  55  55  TYR TYR B . n 
B 1 52  ASN 52  56  56  ASN ASN B . n 
B 1 53  THR 53  57  57  THR THR B . n 
B 1 54  GLU 54  58  58  GLU GLU B . n 
B 1 55  ASP 55  59  59  ASP ASP B . n 
B 1 56  HIS 56  60  60  HIS HIS B . n 
B 1 57  VAL 57  61  61  VAL VAL B . n 
B 1 58  GLY 58  62  62  GLY GLY B . n 
B 1 59  GLU 59  63  63  GLU GLU B . n 
B 1 60  ALA 60  64  64  ALA ALA B . n 
B 1 61  ILE 61  65  65  ILE ILE B . n 
B 1 62  ARG 62  66  66  ARG ARG B . n 
B 1 63  SER 63  67  67  SER SER B . n 
B 1 64  LYS 64  68  68  LYS LYS B . n 
B 1 65  ILE 65  69  69  ILE ILE B . n 
B 1 66  ALA 66  70  70  ALA ALA B . n 
B 1 67  ASP 67  71  71  ASP ASP B . n 
B 1 68  GLY 68  72  72  GLY GLY B . n 
B 1 69  THR 69  73  73  THR THR B . n 
B 1 70  VAL 70  74  74  VAL VAL B . n 
B 1 71  ARG 71  75  75  ARG ARG B . n 
B 1 72  ARG 72  76  76  ARG ARG B . n 
B 1 73  GLU 73  77  77  GLU GLU B . n 
B 1 74  ASP 74  78  78  ASP ASP B . n 
B 1 75  ILE 75  79  79  ILE ILE B . n 
B 1 76  PHE 76  80  80  PHE PHE B . n 
B 1 77  TYR 77  81  81  TYR TYR B . n 
B 1 78  THR 78  82  82  THR THR B . n 
B 1 79  SER 79  83  83  SER SER B . n 
B 1 80  LYS 80  84  84  LYS LYS B . n 
B 1 81  VAL 81  85  85  VAL VAL B . n 
B 1 82  TRP 82  86  86  TRP TRP B . n 
B 1 83  CYS 83  87  87  CYS CYS B . n 
B 1 84  THR 84  88  88  THR THR B . n 
B 1 85  SER 85  89  89  SER SER B . n 
B 1 86  LEU 86  90  90  LEU LEU B . n 
B 1 87  HIS 87  91  91  HIS HIS B . n 
B 1 88  PRO 88  92  92  PRO PRO B . n 
B 1 89  GLU 89  93  93  GLU GLU B . n 
B 1 90  LEU 90  94  94  LEU LEU B . n 
B 1 91  VAL 91  95  95  VAL VAL B . n 
B 1 92  ARG 92  96  96  ARG ARG B . n 
B 1 93  ALA 93  97  97  ALA ALA B . n 
B 1 94  SER 94  98  98  SER SER B . n 
B 1 95  LEU 95  99  99  LEU LEU B . n 
B 1 96  GLU 96  100 100 GLU GLU B . n 
B 1 97  ARG 97  101 101 ARG ARG B . n 
B 1 98  SER 98  102 102 SER SER B . n 
B 1 99  LEU 99  103 103 LEU LEU B . n 
B 1 100 GLN 100 104 104 GLN GLN B . n 
B 1 101 LYS 101 105 105 LYS LYS B . n 
B 1 102 LEU 102 106 106 LEU LEU B . n 
B 1 103 GLN 103 107 107 GLN GLN B . n 
B 1 104 PHE 104 108 108 PHE PHE B . n 
B 1 105 ASP 105 109 109 ASP ASP B . n 
B 1 106 TYR 106 110 110 TYR TYR B . n 
B 1 107 VAL 107 111 111 VAL VAL B . n 
B 1 108 ASP 108 112 112 ASP ASP B . n 
B 1 109 LEU 109 113 113 LEU LEU B . n 
B 1 110 TYR 110 114 114 TYR TYR B . n 
B 1 111 LEU 111 115 115 LEU LEU B . n 
B 1 112 ILE 112 116 116 ILE ILE B . n 
B 1 113 HIS 113 117 117 HIS HIS B . n 
B 1 114 TYR 114 118 118 TYR TYR B . n 
B 1 115 PRO 115 119 119 PRO PRO B . n 
B 1 116 MET 116 120 120 MET MET B . n 
B 1 117 ALA 117 121 121 ALA ALA B . n 
B 1 118 LEU 118 122 122 LEU LEU B . n 
B 1 119 LYS 119 123 123 LYS LYS B . n 
B 1 120 PRO 120 124 124 PRO PRO B . n 
B 1 121 GLY 121 125 125 GLY GLY B . n 
B 1 122 GLU 122 126 126 GLU GLU B . n 
B 1 123 GLU 123 127 127 GLU GLU B . n 
B 1 124 ASN 124 128 128 ASN ASN B . n 
B 1 125 PHE 125 129 129 PHE PHE B . n 
B 1 126 PRO 126 130 130 PRO PRO B . n 
B 1 127 VAL 127 131 131 VAL VAL B . n 
B 1 128 ASP 128 132 132 ASP ASP B . n 
B 1 129 GLU 129 133 133 GLU GLU B . n 
B 1 130 HIS 130 134 134 HIS HIS B . n 
B 1 131 GLY 131 135 135 GLY GLY B . n 
B 1 132 LYS 132 136 136 LYS LYS B . n 
B 1 133 LEU 133 137 137 LEU LEU B . n 
B 1 134 ILE 134 138 138 ILE ILE B . n 
B 1 135 PHE 135 139 139 PHE PHE B . n 
B 1 136 ASP 136 140 140 ASP ASP B . n 
B 1 137 ARG 137 141 141 ARG ARG B . n 
B 1 138 VAL 138 142 142 VAL VAL B . n 
B 1 139 ASP 139 143 143 ASP ASP B . n 
B 1 140 LEU 140 144 144 LEU LEU B . n 
B 1 141 CYS 141 145 145 CYS CYS B . n 
B 1 142 ALA 142 146 146 ALA ALA B . n 
B 1 143 THR 143 147 147 THR THR B . n 
B 1 144 TRP 144 148 148 TRP TRP B . n 
B 1 145 GLU 145 149 149 GLU GLU B . n 
B 1 146 ALA 146 150 150 ALA ALA B . n 
B 1 147 MET 147 151 151 MET MET B . n 
B 1 148 GLU 148 152 152 GLU GLU B . n 
B 1 149 LYS 149 153 153 LYS LYS B . n 
B 1 150 CYS 150 154 154 CYS CYS B . n 
B 1 151 LYS 151 155 155 LYS LYS B . n 
B 1 152 ASP 152 156 156 ASP ASP B . n 
B 1 153 ALA 153 157 157 ALA ALA B . n 
B 1 154 GLY 154 158 158 GLY GLY B . n 
B 1 155 LEU 155 159 159 LEU LEU B . n 
B 1 156 THR 156 160 160 THR THR B . n 
B 1 157 LYS 157 161 161 LYS LYS B . n 
B 1 158 SER 158 162 162 SER SER B . n 
B 1 159 ILE 159 163 163 ILE ILE B . n 
B 1 160 GLY 160 164 164 GLY GLY B . n 
B 1 161 VAL 161 165 165 VAL VAL B . n 
B 1 162 SER 162 166 166 SER SER B . n 
B 1 163 ASN 163 167 167 ASN ASN B . n 
B 1 164 PHE 164 168 168 PHE PHE B . n 
B 1 165 ASN 165 169 169 ASN ASN B . n 
B 1 166 TYR 166 170 170 TYR TYR B . n 
B 1 167 ARG 167 171 171 ARG ARG B . n 
B 1 168 GLN 168 172 172 GLN GLN B . n 
B 1 169 LEU 169 173 173 LEU LEU B . n 
B 1 170 GLU 170 174 174 GLU GLU B . n 
B 1 171 MET 171 175 175 MET MET B . n 
B 1 172 ILE 172 176 176 ILE ILE B . n 
B 1 173 LEU 173 177 177 LEU LEU B . n 
B 1 174 ASN 174 178 178 ASN ASN B . n 
B 1 175 LYS 175 179 179 LYS LYS B . n 
B 1 176 PRO 176 180 180 PRO PRO B . n 
B 1 177 GLY 177 181 181 GLY GLY B . n 
B 1 178 LEU 178 182 182 LEU LEU B . n 
B 1 179 LYS 179 183 183 LYS LYS B . n 
B 1 180 TYR 180 184 184 TYR TYR B . n 
B 1 181 LYS 181 185 185 LYS LYS B . n 
B 1 182 PRO 182 186 186 PRO PRO B . n 
B 1 183 VAL 183 187 187 VAL VAL B . n 
B 1 184 CYS 184 188 188 CYS CYS B . n 
B 1 185 ASN 185 189 189 ASN ASN B . n 
B 1 186 GLN 186 190 190 GLN GLN B . n 
B 1 187 VAL 187 191 191 VAL VAL B . n 
B 1 188 GLU 188 192 192 GLU GLU B . n 
B 1 189 CYS 189 193 193 CYS CYS B . n 
B 1 190 HIS 190 194 194 HIS HIS B . n 
B 1 191 PRO 191 195 195 PRO PRO B . n 
B 1 192 TYR 192 196 196 TYR TYR B . n 
B 1 193 LEU 193 197 197 LEU LEU B . n 
B 1 194 ASN 194 198 198 ASN ASN B . n 
B 1 195 GLN 195 199 199 GLN GLN B . n 
B 1 196 MET 196 200 200 MET MET B . n 
B 1 197 LYS 197 201 201 LYS LYS B . n 
B 1 198 LEU 198 202 202 LEU LEU B . n 
B 1 199 LEU 199 203 203 LEU LEU B . n 
B 1 200 ASP 200 204 204 ASP ASP B . n 
B 1 201 PHE 201 205 205 PHE PHE B . n 
B 1 202 CYS 202 206 206 CYS CYS B . n 
B 1 203 LYS 203 207 207 LYS LYS B . n 
B 1 204 SER 204 208 208 SER SER B . n 
B 1 205 LYS 205 209 209 LYS LYS B . n 
B 1 206 ASP 206 210 210 ASP ASP B . n 
B 1 207 ILE 207 211 211 ILE ILE B . n 
B 1 208 VAL 208 212 212 VAL VAL B . n 
B 1 209 LEU 209 213 213 LEU LEU B . n 
B 1 210 VAL 210 214 214 VAL VAL B . n 
B 1 211 ALA 211 215 215 ALA ALA B . n 
B 1 212 TYR 212 216 216 TYR TYR B . n 
B 1 213 GLY 213 217 217 GLY GLY B . n 
B 1 214 VAL 214 218 218 VAL VAL B . n 
B 1 215 LEU 215 219 219 LEU LEU B . n 
B 1 216 GLY 216 220 220 GLY GLY B . n 
B 1 217 THR 217 221 221 THR THR B . n 
B 1 218 GLN 218 222 222 GLN GLN B . n 
B 1 219 ARG 219 223 223 ARG ARG B . n 
B 1 220 TYR 220 224 224 TYR TYR B . n 
B 1 221 GLY 221 225 225 GLY GLY B . n 
B 1 222 GLY 222 226 226 GLY GLY B . n 
B 1 223 TRP 223 227 227 TRP TRP B . n 
B 1 224 VAL 224 228 228 VAL VAL B . n 
B 1 225 ASP 225 229 229 ASP ASP B . n 
B 1 226 GLN 226 230 230 GLN GLN B . n 
B 1 227 ASN 227 231 231 ASN ASN B . n 
B 1 228 SER 228 232 232 SER SER B . n 
B 1 229 PRO 229 233 233 PRO PRO B . n 
B 1 230 VAL 230 234 234 VAL VAL B . n 
B 1 231 LEU 231 235 235 LEU LEU B . n 
B 1 232 LEU 232 236 236 LEU LEU B . n 
B 1 233 ASP 233 237 237 ASP ASP B . n 
B 1 234 GLU 234 238 238 GLU GLU B . n 
B 1 235 PRO 235 239 239 PRO PRO B . n 
B 1 236 VAL 236 240 240 VAL VAL B . n 
B 1 237 LEU 237 241 241 LEU LEU B . n 
B 1 238 GLY 238 242 242 GLY GLY B . n 
B 1 239 SER 239 243 243 SER SER B . n 
B 1 240 MET 240 244 244 MET MET B . n 
B 1 241 ALA 241 245 245 ALA ALA B . n 
B 1 242 LYS 242 246 246 LYS LYS B . n 
B 1 243 LYS 243 247 247 LYS LYS B . n 
B 1 244 TYR 244 248 248 TYR TYR B . n 
B 1 245 ASN 245 249 249 ASN ASN B . n 
B 1 246 ARG 246 250 250 ARG ARG B . n 
B 1 247 THR 247 251 251 THR THR B . n 
B 1 248 PRO 248 252 252 PRO PRO B . n 
B 1 249 ALA 249 253 253 ALA ALA B . n 
B 1 250 LEU 250 254 254 LEU LEU B . n 
B 1 251 ILE 251 255 255 ILE ILE B . n 
B 1 252 ALA 252 256 256 ALA ALA B . n 
B 1 253 LEU 253 257 257 LEU LEU B . n 
B 1 254 ARG 254 258 258 ARG ARG B . n 
B 1 255 TYR 255 259 259 TYR TYR B . n 
B 1 256 GLN 256 260 260 GLN GLN B . n 
B 1 257 LEU 257 261 261 LEU LEU B . n 
B 1 258 GLN 258 262 262 GLN GLN B . n 
B 1 259 ARG 259 263 263 ARG ARG B . n 
B 1 260 GLY 260 264 264 GLY GLY B . n 
B 1 261 ILE 261 265 265 ILE ILE B . n 
B 1 262 VAL 262 266 266 VAL VAL B . n 
B 1 263 VAL 263 267 267 VAL VAL B . n 
B 1 264 LEU 264 268 268 LEU LEU B . n 
B 1 265 ASN 265 269 269 ASN ASN B . n 
B 1 266 THR 266 270 270 THR THR B . n 
B 1 267 SER 267 271 271 SER SER B . n 
B 1 268 LEU 268 272 272 LEU LEU B . n 
B 1 269 LYS 269 273 273 LYS LYS B . n 
B 1 270 GLU 270 274 274 GLU GLU B . n 
B 1 271 GLU 271 275 275 GLU GLU B . n 
B 1 272 ARG 272 276 276 ARG ARG B . n 
B 1 273 ILE 273 277 277 ILE ILE B . n 
B 1 274 LYS 274 278 278 LYS LYS B . n 
B 1 275 GLU 275 279 279 GLU GLU B . n 
B 1 276 ASN 276 280 280 ASN ASN B . n 
B 1 277 MET 277 281 281 MET MET B . n 
B 1 278 GLN 278 282 282 GLN GLN B . n 
B 1 279 VAL 279 283 283 VAL VAL B . n 
B 1 280 PHE 280 284 284 PHE PHE B . n 
B 1 281 GLU 281 285 285 GLU GLU B . n 
B 1 282 PHE 282 286 286 PHE PHE B . n 
B 1 283 GLN 283 287 287 GLN GLN B . n 
B 1 284 LEU 284 288 288 LEU LEU B . n 
B 1 285 SER 285 289 289 SER SER B . n 
B 1 286 SER 286 290 290 SER SER B . n 
B 1 287 GLU 287 291 291 GLU GLU B . n 
B 1 288 ASP 288 292 292 ASP ASP B . n 
B 1 289 MET 289 293 293 MET MET B . n 
B 1 290 LYS 290 294 294 LYS LYS B . n 
B 1 291 VAL 291 295 295 VAL VAL B . n 
B 1 292 LEU 292 296 296 LEU LEU B . n 
B 1 293 ASP 293 297 297 ASP ASP B . n 
B 1 294 GLY 294 298 298 GLY GLY B . n 
B 1 295 LEU 295 299 299 LEU LEU B . n 
B 1 296 ASN 296 300 300 ASN ASN B . n 
B 1 297 ARG 297 301 301 ARG ARG B . n 
B 1 298 ASN 298 302 302 ASN ASN B . n 
B 1 299 MET 299 303 303 MET MET B . n 
B 1 300 ARG 300 304 304 ARG ARG B . n 
B 1 301 TYR 301 305 305 TYR TYR B . n 
B 1 302 ILE 302 306 306 ILE ILE B . n 
B 1 303 PRO 303 307 307 PRO PRO B . n 
B 1 304 ALA 304 308 308 ALA ALA B . n 
B 1 305 ALA 305 309 309 ALA ALA B . n 
B 1 306 ILE 306 310 310 ILE ILE B . n 
B 1 307 PHE 307 311 311 PHE PHE B . n 
B 1 308 LYS 308 312 312 LYS LYS B . n 
B 1 309 GLY 309 313 313 GLY GLY B . n 
B 1 310 HIS 310 314 314 HIS HIS B . n 
B 1 311 PRO 311 315 315 PRO PRO B . n 
B 1 312 ASN 312 316 316 ASN ASN B . n 
B 1 313 TRP 313 317 317 TRP TRP B . n 
B 1 314 PRO 314 318 318 PRO PRO B . n 
B 1 315 PHE 315 319 319 PHE PHE B . n 
B 1 316 LEU 316 320 320 LEU LEU B . n 
B 1 317 ASP 317 321 321 ASP ASP B . n 
B 1 318 GLU 318 322 322 GLU GLU B . n 
B 1 319 TYR 319 323 323 TYR TYR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAP 1   1   1   NAP NAP A . 
D 3 FFA 1   3   3   FFA FFA A . 
E 4 BME 1   324 5   BME BME A . 
F 4 BME 1   325 6   BME BME A . 
G 5 EDO 1   326 9   EDO EDO A . 
H 5 EDO 1   327 11  EDO EDO A . 
I 2 NAP 1   2   2   NAP NAP B . 
J 3 FFA 1   4   4   FFA FFA B . 
K 4 BME 1   324 7   BME BME B . 
L 4 BME 1   325 8   BME BME B . 
M 5 EDO 1   326 10  EDO EDO B . 
N 6 HOH 1   328 12  HOH HOH A . 
N 6 HOH 2   329 13  HOH HOH A . 
N 6 HOH 3   330 14  HOH HOH A . 
N 6 HOH 4   331 16  HOH HOH A . 
N 6 HOH 5   332 17  HOH HOH A . 
N 6 HOH 6   333 18  HOH HOH A . 
N 6 HOH 7   334 19  HOH HOH A . 
N 6 HOH 8   335 20  HOH HOH A . 
N 6 HOH 9   336 21  HOH HOH A . 
N 6 HOH 10  337 22  HOH HOH A . 
N 6 HOH 11  338 23  HOH HOH A . 
N 6 HOH 12  339 24  HOH HOH A . 
N 6 HOH 13  340 25  HOH HOH A . 
N 6 HOH 14  341 27  HOH HOH A . 
N 6 HOH 15  342 32  HOH HOH A . 
N 6 HOH 16  343 33  HOH HOH A . 
N 6 HOH 17  344 34  HOH HOH A . 
N 6 HOH 18  345 35  HOH HOH A . 
N 6 HOH 19  346 36  HOH HOH A . 
N 6 HOH 20  347 37  HOH HOH A . 
N 6 HOH 21  348 39  HOH HOH A . 
N 6 HOH 22  349 41  HOH HOH A . 
N 6 HOH 23  350 42  HOH HOH A . 
N 6 HOH 24  351 44  HOH HOH A . 
N 6 HOH 25  352 46  HOH HOH A . 
N 6 HOH 26  353 47  HOH HOH A . 
N 6 HOH 27  354 48  HOH HOH A . 
N 6 HOH 28  355 49  HOH HOH A . 
N 6 HOH 29  356 51  HOH HOH A . 
N 6 HOH 30  357 53  HOH HOH A . 
N 6 HOH 31  358 55  HOH HOH A . 
N 6 HOH 32  359 56  HOH HOH A . 
N 6 HOH 33  360 57  HOH HOH A . 
N 6 HOH 34  361 59  HOH HOH A . 
N 6 HOH 35  362 60  HOH HOH A . 
N 6 HOH 36  363 62  HOH HOH A . 
N 6 HOH 37  364 64  HOH HOH A . 
N 6 HOH 38  365 65  HOH HOH A . 
N 6 HOH 39  366 67  HOH HOH A . 
N 6 HOH 40  367 68  HOH HOH A . 
N 6 HOH 41  368 69  HOH HOH A . 
N 6 HOH 42  369 71  HOH HOH A . 
N 6 HOH 43  370 72  HOH HOH A . 
N 6 HOH 44  371 73  HOH HOH A . 
N 6 HOH 45  372 77  HOH HOH A . 
N 6 HOH 46  373 79  HOH HOH A . 
N 6 HOH 47  374 82  HOH HOH A . 
N 6 HOH 48  375 83  HOH HOH A . 
N 6 HOH 49  376 84  HOH HOH A . 
N 6 HOH 50  377 85  HOH HOH A . 
N 6 HOH 51  378 86  HOH HOH A . 
N 6 HOH 52  379 88  HOH HOH A . 
N 6 HOH 53  380 89  HOH HOH A . 
N 6 HOH 54  381 92  HOH HOH A . 
N 6 HOH 55  382 94  HOH HOH A . 
N 6 HOH 56  383 97  HOH HOH A . 
N 6 HOH 57  384 99  HOH HOH A . 
N 6 HOH 58  385 103 HOH HOH A . 
N 6 HOH 59  386 105 HOH HOH A . 
N 6 HOH 60  387 106 HOH HOH A . 
N 6 HOH 61  388 107 HOH HOH A . 
N 6 HOH 62  389 108 HOH HOH A . 
N 6 HOH 63  390 109 HOH HOH A . 
N 6 HOH 64  391 111 HOH HOH A . 
N 6 HOH 65  392 114 HOH HOH A . 
N 6 HOH 66  393 118 HOH HOH A . 
N 6 HOH 67  394 119 HOH HOH A . 
N 6 HOH 68  395 122 HOH HOH A . 
N 6 HOH 69  396 126 HOH HOH A . 
N 6 HOH 70  397 127 HOH HOH A . 
N 6 HOH 71  398 129 HOH HOH A . 
N 6 HOH 72  399 130 HOH HOH A . 
N 6 HOH 73  400 132 HOH HOH A . 
N 6 HOH 74  401 133 HOH HOH A . 
N 6 HOH 75  402 135 HOH HOH A . 
N 6 HOH 76  403 137 HOH HOH A . 
N 6 HOH 77  404 140 HOH HOH A . 
N 6 HOH 78  405 142 HOH HOH A . 
N 6 HOH 79  406 143 HOH HOH A . 
N 6 HOH 80  407 144 HOH HOH A . 
N 6 HOH 81  408 145 HOH HOH A . 
N 6 HOH 82  409 146 HOH HOH A . 
N 6 HOH 83  410 148 HOH HOH A . 
N 6 HOH 84  411 149 HOH HOH A . 
N 6 HOH 85  412 152 HOH HOH A . 
N 6 HOH 86  413 157 HOH HOH A . 
N 6 HOH 87  414 160 HOH HOH A . 
N 6 HOH 88  415 161 HOH HOH A . 
N 6 HOH 89  416 164 HOH HOH A . 
N 6 HOH 90  417 165 HOH HOH A . 
N 6 HOH 91  418 168 HOH HOH A . 
N 6 HOH 92  419 173 HOH HOH A . 
N 6 HOH 93  420 175 HOH HOH A . 
N 6 HOH 94  421 178 HOH HOH A . 
N 6 HOH 95  422 179 HOH HOH A . 
N 6 HOH 96  423 182 HOH HOH A . 
N 6 HOH 97  424 183 HOH HOH A . 
N 6 HOH 98  425 184 HOH HOH A . 
N 6 HOH 99  426 185 HOH HOH A . 
N 6 HOH 100 427 190 HOH HOH A . 
N 6 HOH 101 428 191 HOH HOH A . 
N 6 HOH 102 429 195 HOH HOH A . 
N 6 HOH 103 430 197 HOH HOH A . 
N 6 HOH 104 431 199 HOH HOH A . 
N 6 HOH 105 432 200 HOH HOH A . 
N 6 HOH 106 433 201 HOH HOH A . 
N 6 HOH 107 434 202 HOH HOH A . 
N 6 HOH 108 435 204 HOH HOH A . 
N 6 HOH 109 436 207 HOH HOH A . 
N 6 HOH 110 437 212 HOH HOH A . 
N 6 HOH 111 438 215 HOH HOH A . 
N 6 HOH 112 439 216 HOH HOH A . 
N 6 HOH 113 440 219 HOH HOH A . 
N 6 HOH 114 441 221 HOH HOH A . 
N 6 HOH 115 442 223 HOH HOH A . 
N 6 HOH 116 443 225 HOH HOH A . 
N 6 HOH 117 444 226 HOH HOH A . 
N 6 HOH 118 445 227 HOH HOH A . 
N 6 HOH 119 446 230 HOH HOH A . 
N 6 HOH 120 447 232 HOH HOH A . 
N 6 HOH 121 448 235 HOH HOH A . 
N 6 HOH 122 449 236 HOH HOH A . 
N 6 HOH 123 450 237 HOH HOH A . 
N 6 HOH 124 451 239 HOH HOH A . 
N 6 HOH 125 452 240 HOH HOH A . 
N 6 HOH 126 453 242 HOH HOH A . 
N 6 HOH 127 454 244 HOH HOH A . 
N 6 HOH 128 455 245 HOH HOH A . 
N 6 HOH 129 456 248 HOH HOH A . 
N 6 HOH 130 457 249 HOH HOH A . 
N 6 HOH 131 458 250 HOH HOH A . 
N 6 HOH 132 459 251 HOH HOH A . 
N 6 HOH 133 460 253 HOH HOH A . 
N 6 HOH 134 461 254 HOH HOH A . 
N 6 HOH 135 462 259 HOH HOH A . 
N 6 HOH 136 463 260 HOH HOH A . 
N 6 HOH 137 464 263 HOH HOH A . 
N 6 HOH 138 465 264 HOH HOH A . 
N 6 HOH 139 466 265 HOH HOH A . 
N 6 HOH 140 467 266 HOH HOH A . 
N 6 HOH 141 468 267 HOH HOH A . 
N 6 HOH 142 469 269 HOH HOH A . 
N 6 HOH 143 470 270 HOH HOH A . 
N 6 HOH 144 471 272 HOH HOH A . 
N 6 HOH 145 472 273 HOH HOH A . 
N 6 HOH 146 473 275 HOH HOH A . 
N 6 HOH 147 474 276 HOH HOH A . 
N 6 HOH 148 475 278 HOH HOH A . 
N 6 HOH 149 476 280 HOH HOH A . 
N 6 HOH 150 477 281 HOH HOH A . 
N 6 HOH 151 478 283 HOH HOH A . 
N 6 HOH 152 479 286 HOH HOH A . 
N 6 HOH 153 480 288 HOH HOH A . 
N 6 HOH 154 481 289 HOH HOH A . 
N 6 HOH 155 482 290 HOH HOH A . 
N 6 HOH 156 483 291 HOH HOH A . 
N 6 HOH 157 484 292 HOH HOH A . 
N 6 HOH 158 485 293 HOH HOH A . 
N 6 HOH 159 486 295 HOH HOH A . 
N 6 HOH 160 487 296 HOH HOH A . 
N 6 HOH 161 488 298 HOH HOH A . 
N 6 HOH 162 489 299 HOH HOH A . 
N 6 HOH 163 490 304 HOH HOH A . 
N 6 HOH 164 491 305 HOH HOH A . 
N 6 HOH 165 492 306 HOH HOH A . 
N 6 HOH 166 493 307 HOH HOH A . 
N 6 HOH 167 494 309 HOH HOH A . 
N 6 HOH 168 495 312 HOH HOH A . 
N 6 HOH 169 496 313 HOH HOH A . 
N 6 HOH 170 497 314 HOH HOH A . 
N 6 HOH 171 498 315 HOH HOH A . 
N 6 HOH 172 499 316 HOH HOH A . 
N 6 HOH 173 500 319 HOH HOH A . 
N 6 HOH 174 501 323 HOH HOH A . 
N 6 HOH 175 502 325 HOH HOH A . 
N 6 HOH 176 503 327 HOH HOH A . 
N 6 HOH 177 504 328 HOH HOH A . 
N 6 HOH 178 505 329 HOH HOH A . 
N 6 HOH 179 506 334 HOH HOH A . 
N 6 HOH 180 507 336 HOH HOH A . 
N 6 HOH 181 508 337 HOH HOH A . 
N 6 HOH 182 509 338 HOH HOH A . 
N 6 HOH 183 510 339 HOH HOH A . 
N 6 HOH 184 511 340 HOH HOH A . 
N 6 HOH 185 512 341 HOH HOH A . 
N 6 HOH 186 513 344 HOH HOH A . 
N 6 HOH 187 514 347 HOH HOH A . 
N 6 HOH 188 515 348 HOH HOH A . 
N 6 HOH 189 516 349 HOH HOH A . 
N 6 HOH 190 517 353 HOH HOH A . 
N 6 HOH 191 518 354 HOH HOH A . 
N 6 HOH 192 519 355 HOH HOH A . 
N 6 HOH 193 520 356 HOH HOH A . 
N 6 HOH 194 521 358 HOH HOH A . 
N 6 HOH 195 522 361 HOH HOH A . 
N 6 HOH 196 523 363 HOH HOH A . 
N 6 HOH 197 524 365 HOH HOH A . 
N 6 HOH 198 525 366 HOH HOH A . 
N 6 HOH 199 526 367 HOH HOH A . 
N 6 HOH 200 527 368 HOH HOH A . 
N 6 HOH 201 528 369 HOH HOH A . 
N 6 HOH 202 529 370 HOH HOH A . 
N 6 HOH 203 530 371 HOH HOH A . 
N 6 HOH 204 531 372 HOH HOH A . 
N 6 HOH 205 532 373 HOH HOH A . 
N 6 HOH 206 533 374 HOH HOH A . 
N 6 HOH 207 534 375 HOH HOH A . 
N 6 HOH 208 535 376 HOH HOH A . 
N 6 HOH 209 536 377 HOH HOH A . 
N 6 HOH 210 537 378 HOH HOH A . 
N 6 HOH 211 538 380 HOH HOH A . 
N 6 HOH 212 539 381 HOH HOH A . 
N 6 HOH 213 540 382 HOH HOH A . 
N 6 HOH 214 541 383 HOH HOH A . 
N 6 HOH 215 542 385 HOH HOH A . 
N 6 HOH 216 543 386 HOH HOH A . 
N 6 HOH 217 544 387 HOH HOH A . 
N 6 HOH 218 545 388 HOH HOH A . 
N 6 HOH 219 546 389 HOH HOH A . 
N 6 HOH 220 547 391 HOH HOH A . 
N 6 HOH 221 548 392 HOH HOH A . 
N 6 HOH 222 549 395 HOH HOH A . 
N 6 HOH 223 550 396 HOH HOH A . 
N 6 HOH 224 551 399 HOH HOH A . 
N 6 HOH 225 552 401 HOH HOH A . 
N 6 HOH 226 553 402 HOH HOH A . 
N 6 HOH 227 554 403 HOH HOH A . 
N 6 HOH 228 555 405 HOH HOH A . 
N 6 HOH 229 556 406 HOH HOH A . 
N 6 HOH 230 557 407 HOH HOH A . 
N 6 HOH 231 558 409 HOH HOH A . 
N 6 HOH 232 559 410 HOH HOH A . 
N 6 HOH 233 560 413 HOH HOH A . 
N 6 HOH 234 561 414 HOH HOH A . 
N 6 HOH 235 562 415 HOH HOH A . 
N 6 HOH 236 563 416 HOH HOH A . 
N 6 HOH 237 564 418 HOH HOH A . 
N 6 HOH 238 565 420 HOH HOH A . 
N 6 HOH 239 566 426 HOH HOH A . 
N 6 HOH 240 567 427 HOH HOH A . 
N 6 HOH 241 568 431 HOH HOH A . 
N 6 HOH 242 569 432 HOH HOH A . 
N 6 HOH 243 570 433 HOH HOH A . 
N 6 HOH 244 571 434 HOH HOH A . 
N 6 HOH 245 572 435 HOH HOH A . 
N 6 HOH 246 573 437 HOH HOH A . 
N 6 HOH 247 574 438 HOH HOH A . 
N 6 HOH 248 575 439 HOH HOH A . 
N 6 HOH 249 576 440 HOH HOH A . 
N 6 HOH 250 577 441 HOH HOH A . 
N 6 HOH 251 578 444 HOH HOH A . 
N 6 HOH 252 579 446 HOH HOH A . 
N 6 HOH 253 580 452 HOH HOH A . 
N 6 HOH 254 581 453 HOH HOH A . 
N 6 HOH 255 582 455 HOH HOH A . 
N 6 HOH 256 583 456 HOH HOH A . 
N 6 HOH 257 584 457 HOH HOH A . 
N 6 HOH 258 585 458 HOH HOH A . 
N 6 HOH 259 586 459 HOH HOH A . 
N 6 HOH 260 587 460 HOH HOH A . 
N 6 HOH 261 588 462 HOH HOH A . 
N 6 HOH 262 589 463 HOH HOH A . 
N 6 HOH 263 590 465 HOH HOH A . 
N 6 HOH 264 591 466 HOH HOH A . 
N 6 HOH 265 592 468 HOH HOH A . 
N 6 HOH 266 593 469 HOH HOH A . 
N 6 HOH 267 594 471 HOH HOH A . 
N 6 HOH 268 595 472 HOH HOH A . 
N 6 HOH 269 596 473 HOH HOH A . 
N 6 HOH 270 597 475 HOH HOH A . 
N 6 HOH 271 598 477 HOH HOH A . 
N 6 HOH 272 599 479 HOH HOH A . 
N 6 HOH 273 600 480 HOH HOH A . 
N 6 HOH 274 601 481 HOH HOH A . 
N 6 HOH 275 602 483 HOH HOH A . 
O 6 HOH 1   327 15  HOH HOH B . 
O 6 HOH 2   328 26  HOH HOH B . 
O 6 HOH 3   329 28  HOH HOH B . 
O 6 HOH 4   330 29  HOH HOH B . 
O 6 HOH 5   331 30  HOH HOH B . 
O 6 HOH 6   332 31  HOH HOH B . 
O 6 HOH 7   333 38  HOH HOH B . 
O 6 HOH 8   334 40  HOH HOH B . 
O 6 HOH 9   335 43  HOH HOH B . 
O 6 HOH 10  336 45  HOH HOH B . 
O 6 HOH 11  337 50  HOH HOH B . 
O 6 HOH 12  338 52  HOH HOH B . 
O 6 HOH 13  339 54  HOH HOH B . 
O 6 HOH 14  340 58  HOH HOH B . 
O 6 HOH 15  341 61  HOH HOH B . 
O 6 HOH 16  342 63  HOH HOH B . 
O 6 HOH 17  343 66  HOH HOH B . 
O 6 HOH 18  344 70  HOH HOH B . 
O 6 HOH 19  345 74  HOH HOH B . 
O 6 HOH 20  346 75  HOH HOH B . 
O 6 HOH 21  347 76  HOH HOH B . 
O 6 HOH 22  348 78  HOH HOH B . 
O 6 HOH 23  349 80  HOH HOH B . 
O 6 HOH 24  350 81  HOH HOH B . 
O 6 HOH 25  351 87  HOH HOH B . 
O 6 HOH 26  352 90  HOH HOH B . 
O 6 HOH 27  353 91  HOH HOH B . 
O 6 HOH 28  354 93  HOH HOH B . 
O 6 HOH 29  355 95  HOH HOH B . 
O 6 HOH 30  356 96  HOH HOH B . 
O 6 HOH 31  357 98  HOH HOH B . 
O 6 HOH 32  358 100 HOH HOH B . 
O 6 HOH 33  359 101 HOH HOH B . 
O 6 HOH 34  360 102 HOH HOH B . 
O 6 HOH 35  361 104 HOH HOH B . 
O 6 HOH 36  362 110 HOH HOH B . 
O 6 HOH 37  363 112 HOH HOH B . 
O 6 HOH 38  364 113 HOH HOH B . 
O 6 HOH 39  365 115 HOH HOH B . 
O 6 HOH 40  366 116 HOH HOH B . 
O 6 HOH 41  367 117 HOH HOH B . 
O 6 HOH 42  368 120 HOH HOH B . 
O 6 HOH 43  369 121 HOH HOH B . 
O 6 HOH 44  370 123 HOH HOH B . 
O 6 HOH 45  371 124 HOH HOH B . 
O 6 HOH 46  372 125 HOH HOH B . 
O 6 HOH 47  373 128 HOH HOH B . 
O 6 HOH 48  374 131 HOH HOH B . 
O 6 HOH 49  375 134 HOH HOH B . 
O 6 HOH 50  376 136 HOH HOH B . 
O 6 HOH 51  377 138 HOH HOH B . 
O 6 HOH 52  378 139 HOH HOH B . 
O 6 HOH 53  379 141 HOH HOH B . 
O 6 HOH 54  380 147 HOH HOH B . 
O 6 HOH 55  381 150 HOH HOH B . 
O 6 HOH 56  382 151 HOH HOH B . 
O 6 HOH 57  383 153 HOH HOH B . 
O 6 HOH 58  384 154 HOH HOH B . 
O 6 HOH 59  385 155 HOH HOH B . 
O 6 HOH 60  386 156 HOH HOH B . 
O 6 HOH 61  387 158 HOH HOH B . 
O 6 HOH 62  388 159 HOH HOH B . 
O 6 HOH 63  389 162 HOH HOH B . 
O 6 HOH 64  390 163 HOH HOH B . 
O 6 HOH 65  391 166 HOH HOH B . 
O 6 HOH 66  392 167 HOH HOH B . 
O 6 HOH 67  393 169 HOH HOH B . 
O 6 HOH 68  394 170 HOH HOH B . 
O 6 HOH 69  395 171 HOH HOH B . 
O 6 HOH 70  396 172 HOH HOH B . 
O 6 HOH 71  397 174 HOH HOH B . 
O 6 HOH 72  398 176 HOH HOH B . 
O 6 HOH 73  399 177 HOH HOH B . 
O 6 HOH 74  400 180 HOH HOH B . 
O 6 HOH 75  401 181 HOH HOH B . 
O 6 HOH 76  402 186 HOH HOH B . 
O 6 HOH 77  403 187 HOH HOH B . 
O 6 HOH 78  404 188 HOH HOH B . 
O 6 HOH 79  405 189 HOH HOH B . 
O 6 HOH 80  406 192 HOH HOH B . 
O 6 HOH 81  407 193 HOH HOH B . 
O 6 HOH 82  408 194 HOH HOH B . 
O 6 HOH 83  409 196 HOH HOH B . 
O 6 HOH 84  410 198 HOH HOH B . 
O 6 HOH 85  411 203 HOH HOH B . 
O 6 HOH 86  412 205 HOH HOH B . 
O 6 HOH 87  413 206 HOH HOH B . 
O 6 HOH 88  414 208 HOH HOH B . 
O 6 HOH 89  415 209 HOH HOH B . 
O 6 HOH 90  416 210 HOH HOH B . 
O 6 HOH 91  417 211 HOH HOH B . 
O 6 HOH 92  418 213 HOH HOH B . 
O 6 HOH 93  419 214 HOH HOH B . 
O 6 HOH 94  420 217 HOH HOH B . 
O 6 HOH 95  421 218 HOH HOH B . 
O 6 HOH 96  422 220 HOH HOH B . 
O 6 HOH 97  423 222 HOH HOH B . 
O 6 HOH 98  424 224 HOH HOH B . 
O 6 HOH 99  425 228 HOH HOH B . 
O 6 HOH 100 426 229 HOH HOH B . 
O 6 HOH 101 427 231 HOH HOH B . 
O 6 HOH 102 428 233 HOH HOH B . 
O 6 HOH 103 429 234 HOH HOH B . 
O 6 HOH 104 430 238 HOH HOH B . 
O 6 HOH 105 431 241 HOH HOH B . 
O 6 HOH 106 432 243 HOH HOH B . 
O 6 HOH 107 433 246 HOH HOH B . 
O 6 HOH 108 434 247 HOH HOH B . 
O 6 HOH 109 435 252 HOH HOH B . 
O 6 HOH 110 436 255 HOH HOH B . 
O 6 HOH 111 437 256 HOH HOH B . 
O 6 HOH 112 438 257 HOH HOH B . 
O 6 HOH 113 439 258 HOH HOH B . 
O 6 HOH 114 440 261 HOH HOH B . 
O 6 HOH 115 441 262 HOH HOH B . 
O 6 HOH 116 442 268 HOH HOH B . 
O 6 HOH 117 443 271 HOH HOH B . 
O 6 HOH 118 444 274 HOH HOH B . 
O 6 HOH 119 445 277 HOH HOH B . 
O 6 HOH 120 446 279 HOH HOH B . 
O 6 HOH 121 447 282 HOH HOH B . 
O 6 HOH 122 448 284 HOH HOH B . 
O 6 HOH 123 449 285 HOH HOH B . 
O 6 HOH 124 450 287 HOH HOH B . 
O 6 HOH 125 451 294 HOH HOH B . 
O 6 HOH 126 452 297 HOH HOH B . 
O 6 HOH 127 453 300 HOH HOH B . 
O 6 HOH 128 454 301 HOH HOH B . 
O 6 HOH 129 455 302 HOH HOH B . 
O 6 HOH 130 456 303 HOH HOH B . 
O 6 HOH 131 457 308 HOH HOH B . 
O 6 HOH 132 458 310 HOH HOH B . 
O 6 HOH 133 459 311 HOH HOH B . 
O 6 HOH 134 460 317 HOH HOH B . 
O 6 HOH 135 461 318 HOH HOH B . 
O 6 HOH 136 462 320 HOH HOH B . 
O 6 HOH 137 463 321 HOH HOH B . 
O 6 HOH 138 464 322 HOH HOH B . 
O 6 HOH 139 465 324 HOH HOH B . 
O 6 HOH 140 466 326 HOH HOH B . 
O 6 HOH 141 467 330 HOH HOH B . 
O 6 HOH 142 468 331 HOH HOH B . 
O 6 HOH 143 469 332 HOH HOH B . 
O 6 HOH 144 470 333 HOH HOH B . 
O 6 HOH 145 471 335 HOH HOH B . 
O 6 HOH 146 472 342 HOH HOH B . 
O 6 HOH 147 473 343 HOH HOH B . 
O 6 HOH 148 474 345 HOH HOH B . 
O 6 HOH 149 475 346 HOH HOH B . 
O 6 HOH 150 476 350 HOH HOH B . 
O 6 HOH 151 477 351 HOH HOH B . 
O 6 HOH 152 478 352 HOH HOH B . 
O 6 HOH 153 479 357 HOH HOH B . 
O 6 HOH 154 480 359 HOH HOH B . 
O 6 HOH 155 481 360 HOH HOH B . 
O 6 HOH 156 482 362 HOH HOH B . 
O 6 HOH 157 483 364 HOH HOH B . 
O 6 HOH 158 484 379 HOH HOH B . 
O 6 HOH 159 485 384 HOH HOH B . 
O 6 HOH 160 486 390 HOH HOH B . 
O 6 HOH 161 487 393 HOH HOH B . 
O 6 HOH 162 488 394 HOH HOH B . 
O 6 HOH 163 489 397 HOH HOH B . 
O 6 HOH 164 490 398 HOH HOH B . 
O 6 HOH 165 491 400 HOH HOH B . 
O 6 HOH 166 492 404 HOH HOH B . 
O 6 HOH 167 493 408 HOH HOH B . 
O 6 HOH 168 494 411 HOH HOH B . 
O 6 HOH 169 495 412 HOH HOH B . 
O 6 HOH 170 496 417 HOH HOH B . 
O 6 HOH 171 497 419 HOH HOH B . 
O 6 HOH 172 498 421 HOH HOH B . 
O 6 HOH 173 499 422 HOH HOH B . 
O 6 HOH 174 500 423 HOH HOH B . 
O 6 HOH 175 501 424 HOH HOH B . 
O 6 HOH 176 502 425 HOH HOH B . 
O 6 HOH 177 503 428 HOH HOH B . 
O 6 HOH 178 504 429 HOH HOH B . 
O 6 HOH 179 505 430 HOH HOH B . 
O 6 HOH 180 506 436 HOH HOH B . 
O 6 HOH 181 507 442 HOH HOH B . 
O 6 HOH 182 508 443 HOH HOH B . 
O 6 HOH 183 509 445 HOH HOH B . 
O 6 HOH 184 510 447 HOH HOH B . 
O 6 HOH 185 511 448 HOH HOH B . 
O 6 HOH 186 512 449 HOH HOH B . 
O 6 HOH 187 513 450 HOH HOH B . 
O 6 HOH 188 514 451 HOH HOH B . 
O 6 HOH 189 515 454 HOH HOH B . 
O 6 HOH 190 516 461 HOH HOH B . 
O 6 HOH 191 517 464 HOH HOH B . 
O 6 HOH 192 518 467 HOH HOH B . 
O 6 HOH 193 519 470 HOH HOH B . 
O 6 HOH 194 520 474 HOH HOH B . 
O 6 HOH 195 521 476 HOH HOH B . 
O 6 HOH 196 522 478 HOH HOH B . 
O 6 HOH 197 523 482 HOH HOH B . 
O 6 HOH 198 524 484 HOH HOH B . 
O 6 HOH 199 525 485 HOH HOH B . 
O 6 HOH 200 526 486 HOH HOH B . 
O 6 HOH 201 527 487 HOH HOH B . 
O 6 HOH 202 528 488 HOH HOH B . 
O 6 HOH 203 529 489 HOH HOH B . 
O 6 HOH 204 530 490 HOH HOH B . 
O 6 HOH 205 531 491 HOH HOH B . 
O 6 HOH 206 532 492 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-05-16 
5 'Structure model' 1 4 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Source and taxonomy'       
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' chem_comp          
2 5 'Structure model' entity             
3 5 'Structure model' entity_src_gen     
4 5 'Structure model' struct_ref         
5 5 'Structure model' struct_ref_seq     
6 5 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_entity.pdbx_ec'                                
2  5 'Structure model' '_entity_src_gen.gene_src_common_name'           
3  5 'Structure model' '_entity_src_gen.pdbx_beg_seq_num'               
4  5 'Structure model' '_entity_src_gen.pdbx_end_seq_num'               
5  5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
6  5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
7  5 'Structure model' '_entity_src_gen.pdbx_seq_type'                  
8  5 'Structure model' '_struct_ref.db_code'                            
9  5 'Structure model' '_struct_ref.pdbx_db_accession'                  
10 5 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'           
11 5 'Structure model' '_struct_ref_seq.pdbx_db_accession'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
XSCALE       .     ?                package 'Wolfgang Kabsch' ?                        'data processing' 
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/xscale_program.html ?          ? 1 
CNS          1.1   ?                package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                                      Fortran_77 ? 2 
PDB_EXTRACT  2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                                   C++        ? 3 
CrystalClear .     ?                ?       ?                 ?                        'data collection' ? ?          ? 4 
XDS          .     ?                ?       ?                 ?                        'data reduction'  ? ?          ? 5 
XSCALE       .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 6 
MOLREP       .     ?                ?       ?                 ?                        phasing           ? ?          ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 119 ? ? -83.19  31.71   
2 1 THR A 221 ? ? 73.51   159.80  
3 1 ARG A 250 ? ? -121.73 -145.81 
4 1 ARG A 301 ? ? -146.21 22.57   
5 1 PRO B 119 ? ? -83.05  31.26   
6 1 LEU B 197 ? ? -151.17 75.40   
7 1 THR B 221 ? ? 76.06   160.84  
8 1 ARG B 250 ? ? -128.44 -157.55 
9 1 ARG B 301 ? ? -147.33 20.37   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE'              NAP 
3 '(10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE' FFA 
4 BETA-MERCAPTOETHANOL                                            BME 
5 1,2-ETHANEDIOL                                                  EDO 
6 water                                                           HOH 
#