data_2ISZ
# 
_entry.id   2ISZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ISZ         
NDB   PD0884       
RCSB  RCSB039977   
WWPDB D_1000039977 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FX7 'Crystal structure of the cobalt-activated full-length IdeR'                    unspecified 
PDB 1U8R 'Crystal structure of a full-length IdeR-DNA complex'                           unspecified 
PDB 2ISY 'Crystal structure of the nickel-activated two-domain iron-dependent regulator' unspecified 
PDB 2IT0 'Crystal structure of a two-domain IdeR-DNA complex crystal form II'            unspecified 
# 
_pdbx_database_status.entry_id                        2ISZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wisedchaisri, G.' 1 
'Chou, C.J.'       2 
'Wu, M.'           3 
'Roach, C.'        4 
'Rice, A.E.'       5 
'Holmes, R.K.'     6 
'Beeson, C.'       7 
'Hol, W.G.'        8 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                436 
_citation.page_last                 447 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17209554 
_citation.pdbx_database_id_DOI      10.1021/bi0609826 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wisedchaisri, G.' 1 
primary 'Chou, C.J.'       2 
primary 'Wu, M.'           3 
primary 'Roach, C.'        4 
primary 'Rice, A.E.'       5 
primary 'Holmes, R.K.'     6 
primary 'Beeson, C.'       7 
primary 'Hol, W.G.'        8 
# 
_cell.length_a           53.832 
_cell.length_b           69.739 
_cell.length_c           76.461 
_cell.angle_alpha        106.570 
_cell.angle_beta         104.850 
_cell.angle_gamma        99.660 
_cell.entry_id           2ISZ 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         2ISZ 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'mbtA/mbtB operator strand 1'   10112.492 1   ? ? ? ? 
2 polymer     syn 'mbtA/mbtB operator strand 2'   10188.573 1   ? ? ? ? 
3 polymer     man 'Iron-dependent repressor ideR' 17855.262 4   ? ? ? ? 
4 non-polymer syn 'NICKEL (II) ION'               58.693    12  ? ? ? ? 
5 non-polymer syn 'SODIUM ION'                    22.990    3   ? ? ? ? 
6 water       nat water                           18.015    142 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DA)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DC)(DT)(DG)(DC)(DC)
(DC)(DT)(DA)(DA)(DT)(DT)(DT)(DT)(DA)(DG)(DT)(DG)(DG)
;
CCCTGTTAGCACAGGCTGCCCTAATTTTAGTGG E       ? 
2 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DT)(DA)(DA)(DA)(DA)(DT)(DT)(DA)(DG)(DG)(DG)(DC)(DA)(DG)(DC)(DC)(DT)
(DG)(DT)(DG)(DC)(DT)(DA)(DA)(DC)(DA)(DG)(DG)(DG)(DC)
;
CACTAAAATTAGGGCAGCCTGTGCTAACAGGGC F       ? 
3 'polypeptide(L)'        no no 
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYFQGGGHHHHHH
;
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYFQGGGHHHHHH
;
A,B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DC  n 
1 3   DC  n 
1 4   DT  n 
1 5   DG  n 
1 6   DT  n 
1 7   DT  n 
1 8   DA  n 
1 9   DG  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DA  n 
1 14  DG  n 
1 15  DG  n 
1 16  DC  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DC  n 
1 22  DT  n 
1 23  DA  n 
1 24  DA  n 
1 25  DT  n 
1 26  DT  n 
1 27  DT  n 
1 28  DT  n 
1 29  DA  n 
1 30  DG  n 
1 31  DT  n 
1 32  DG  n 
1 33  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DA  n 
2 17  DG  n 
2 18  DC  n 
2 19  DC  n 
2 20  DT  n 
2 21  DG  n 
2 22  DT  n 
2 23  DG  n 
2 24  DC  n 
2 25  DT  n 
2 26  DA  n 
2 27  DA  n 
2 28  DC  n 
2 29  DA  n 
2 30  DG  n 
2 31  DG  n 
2 32  DG  n 
2 33  DC  n 
3 1   MET n 
3 2   ASN n 
3 3   GLU n 
3 4   LEU n 
3 5   VAL n 
3 6   ASP n 
3 7   THR n 
3 8   THR n 
3 9   GLU n 
3 10  MET n 
3 11  TYR n 
3 12  LEU n 
3 13  ARG n 
3 14  THR n 
3 15  ILE n 
3 16  TYR n 
3 17  ASP n 
3 18  LEU n 
3 19  GLU n 
3 20  GLU n 
3 21  GLU n 
3 22  GLY n 
3 23  VAL n 
3 24  THR n 
3 25  PRO n 
3 26  LEU n 
3 27  ARG n 
3 28  ALA n 
3 29  ARG n 
3 30  ILE n 
3 31  ALA n 
3 32  GLU n 
3 33  ARG n 
3 34  LEU n 
3 35  ASP n 
3 36  GLN n 
3 37  SER n 
3 38  GLY n 
3 39  PRO n 
3 40  THR n 
3 41  VAL n 
3 42  SER n 
3 43  GLN n 
3 44  THR n 
3 45  VAL n 
3 46  SER n 
3 47  ARG n 
3 48  MET n 
3 49  GLU n 
3 50  ARG n 
3 51  ASP n 
3 52  GLY n 
3 53  LEU n 
3 54  LEU n 
3 55  ARG n 
3 56  VAL n 
3 57  ALA n 
3 58  GLY n 
3 59  ASP n 
3 60  ARG n 
3 61  HIS n 
3 62  LEU n 
3 63  GLU n 
3 64  LEU n 
3 65  THR n 
3 66  GLU n 
3 67  LYS n 
3 68  GLY n 
3 69  ARG n 
3 70  ALA n 
3 71  LEU n 
3 72  ALA n 
3 73  ILE n 
3 74  ALA n 
3 75  VAL n 
3 76  MET n 
3 77  ARG n 
3 78  LYS n 
3 79  HIS n 
3 80  ARG n 
3 81  LEU n 
3 82  ALA n 
3 83  GLU n 
3 84  ARG n 
3 85  LEU n 
3 86  LEU n 
3 87  VAL n 
3 88  ASP n 
3 89  VAL n 
3 90  ILE n 
3 91  GLY n 
3 92  LEU n 
3 93  PRO n 
3 94  TRP n 
3 95  GLU n 
3 96  GLU n 
3 97  VAL n 
3 98  HIS n 
3 99  ALA n 
3 100 GLU n 
3 101 ALA n 
3 102 CYS n 
3 103 ARG n 
3 104 TRP n 
3 105 GLU n 
3 106 HIS n 
3 107 VAL n 
3 108 MET n 
3 109 SER n 
3 110 GLU n 
3 111 ASP n 
3 112 VAL n 
3 113 GLU n 
3 114 ARG n 
3 115 ARG n 
3 116 LEU n 
3 117 VAL n 
3 118 LYS n 
3 119 VAL n 
3 120 LEU n 
3 121 ASN n 
3 122 ASN n 
3 123 PRO n 
3 124 THR n 
3 125 THR n 
3 126 SER n 
3 127 PRO n 
3 128 PHE n 
3 129 GLY n 
3 130 ASN n 
3 131 PRO n 
3 132 ILE n 
3 133 PRO n 
3 134 GLY n 
3 135 LEU n 
3 136 VAL n 
3 137 GLU n 
3 138 LEU n 
3 139 GLY n 
3 140 VAL n 
3 141 ALA n 
3 142 SER n 
3 143 GLU n 
3 144 ASN n 
3 145 LEU n 
3 146 TYR n 
3 147 PHE n 
3 148 GLN n 
3 149 GLY n 
3 150 GLY n 
3 151 GLY n 
3 152 HIS n 
3 153 HIS n 
3 154 HIS n 
3 155 HIS n 
3 156 HIS n 
3 157 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Mycobacterium 
_entity_src_gen.pdbx_gene_src_gene                 IdeR,dtxR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1773 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAER36 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP IDER_MYCTU P0A672 1 
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
;
? 
2 1 PDB 2ISZ       2ISZ   ? ? ? 
3 2 PDB 2ISZ       2ISZ   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ISZ A 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
2 1 2ISZ B 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
3 1 2ISZ C 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
4 1 2ISZ D 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
5 2 2ISZ E 1 ? 33  ? 2ISZ   1 ? 33  ? 1 33  
6 3 2ISZ F 1 ? 33  ? 2ISZ   1 ? 33  ? 1 33  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ISZ ALA A 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 1  
1 2ISZ SER A 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 2  
1 2ISZ GLU A 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 3  
1 2ISZ ASN A 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 4  
1 2ISZ LEU A 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 5  
1 2ISZ TYR A 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 6  
1 2ISZ PHE A 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 7  
1 2ISZ GLN A 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 8  
1 2ISZ GLY A 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 9  
1 2ISZ GLY A 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 10 
1 2ISZ GLY A 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 11 
1 2ISZ HIS A 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 12 
1 2ISZ HIS A 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 13 
1 2ISZ HIS A 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 14 
1 2ISZ HIS A 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 15 
1 2ISZ HIS A 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 16 
1 2ISZ HIS A 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 17 
2 2ISZ ALA B 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 18 
2 2ISZ SER B 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 19 
2 2ISZ GLU B 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 20 
2 2ISZ ASN B 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 21 
2 2ISZ LEU B 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 22 
2 2ISZ TYR B 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 23 
2 2ISZ PHE B 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 24 
2 2ISZ GLN B 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 25 
2 2ISZ GLY B 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 26 
2 2ISZ GLY B 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 27 
2 2ISZ GLY B 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 28 
2 2ISZ HIS B 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 29 
2 2ISZ HIS B 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 30 
2 2ISZ HIS B 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 31 
2 2ISZ HIS B 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 32 
2 2ISZ HIS B 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 33 
2 2ISZ HIS B 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 34 
3 2ISZ ALA C 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 35 
3 2ISZ SER C 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 36 
3 2ISZ GLU C 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 37 
3 2ISZ ASN C 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 38 
3 2ISZ LEU C 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 39 
3 2ISZ TYR C 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 40 
3 2ISZ PHE C 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 41 
3 2ISZ GLN C 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 42 
3 2ISZ GLY C 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 43 
3 2ISZ GLY C 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 44 
3 2ISZ GLY C 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 45 
3 2ISZ HIS C 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 46 
3 2ISZ HIS C 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 47 
3 2ISZ HIS C 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 48 
3 2ISZ HIS C 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 49 
3 2ISZ HIS C 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 50 
3 2ISZ HIS C 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 51 
4 2ISZ ALA D 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 52 
4 2ISZ SER D 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 53 
4 2ISZ GLU D 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 54 
4 2ISZ ASN D 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 55 
4 2ISZ LEU D 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 56 
4 2ISZ TYR D 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 57 
4 2ISZ PHE D 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 58 
4 2ISZ GLN D 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 59 
4 2ISZ GLY D 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 60 
4 2ISZ GLY D 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 61 
4 2ISZ GLY D 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 62 
4 2ISZ HIS D 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 63 
4 2ISZ HIS D 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 64 
4 2ISZ HIS D 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 65 
4 2ISZ HIS D 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 66 
4 2ISZ HIS D 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 67 
4 2ISZ HIS D 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
NI  non-polymer         . 'NICKEL (II) ION'                    ? 'Ni 2'            58.693  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2ISZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'28% PEG 3350, 0.2 M ammonium acetate, 0.1 M Bis-Tris pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 3350'         ? ? ? 
1 2 1 'ammonium acetate' ? ? ? 
1 3 1 Bis-Tris           ? ? ? 
1 4 2 'PEG 3350'         ? ? ? 
1 5 2 'ammonium acetate' ? ? ? 
1 6 2 Bis-Tris           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0781 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0781 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
# 
_reflns.entry_id                     2ISZ 
_reflns.d_resolution_high            2.400 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   34892 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_netI_over_sigmaI        8.900 
_reflns.pdbx_chi_squared             1.047 
_reflns.percent_possible_obs         90.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.40 2.49  ? ? ? 0.296 ? ? 1.001 ? ? 2361 60.70 ? 1  
2.49 2.59  ? ? ? 0.286 ? ? 1.018 ? ? 2852 74.70 ? 2  
2.59 2.70  ? ? ? 0.254 ? ? 1.059 ? ? 3365 86.80 ? 3  
2.70 2.85  ? ? ? 0.211 ? ? 1.065 ? ? 3670 95.40 ? 4  
2.85 3.02  ? ? ? 0.169 ? ? 1.076 ? ? 3809 97.80 ? 5  
3.02 3.26  ? ? ? 0.122 ? ? 1.039 ? ? 3745 97.50 ? 6  
3.26 3.58  ? ? ? 0.086 ? ? 1.055 ? ? 3757 97.40 ? 7  
3.58 4.10  ? ? ? 0.061 ? ? 1.050 ? ? 3767 97.50 ? 8  
4.10 5.17  ? ? ? 0.05  ? ? 1.040 ? ? 3749 97.70 ? 9  
5.17 50.00 ? ? ? 0.043 ? ? 1.035 ? ? 3817 98.50 ? 10 
# 
_refine.entry_id                                 2ISZ 
_refine.ls_d_res_high                            2.403 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    90.040 
_refine.ls_number_reflns_obs                     34889 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1754 
_refine.B_iso_mean                               40.298 
_refine.aniso_B[1][1]                            0.750 
_refine.aniso_B[2][2]                            -0.850 
_refine.aniso_B[3][3]                            -0.290 
_refine.aniso_B[1][2]                            0.550 
_refine.aniso_B[1][3]                            0.480 
_refine.aniso_B[2][3]                            -1.450 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.pdbx_overall_ESU_R                       0.402 
_refine.pdbx_overall_ESU_R_Free                  0.257 
_refine.overall_SU_ML                            0.183 
_refine.overall_SU_B                             7.812 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1U8R 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4440 
_refine_hist.pdbx_number_atoms_nucleic_acid   1347 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             142 
_refine_hist.number_atoms_total               5944 
_refine_hist.d_res_high                       2.403 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         6048 0.007  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      8432 1.134  2.265  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   556  4.650  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   215  34.951 22.791 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   824  16.900 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   60   19.238 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           974  0.066  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     4051 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2729 0.222  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          4019 0.315  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    486  0.216  0.500  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      9    0.320  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   43   0.201  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 11   0.208  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2792 1.072  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4524 1.872  4.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              3572 1.236  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3908 1.648  4.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.403 
_refine_ls_shell.d_res_low                        2.465 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               54.130 
_refine_ls_shell.number_reflns_R_work             1488 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.R_factor_R_free                  0.38 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1553 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ISZ 
_struct.title                     'Crystal structure of a two-domain IdeR-DNA complex crystal form I' 
_struct.pdbx_descriptor           'Iron-dependent repressor ideR/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ISZ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'DNA-binding protein, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 5 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological double-dimer two-domain IdeR-DNA complex' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 6   ? GLY C 22  ? ASP A 6   GLY A 22  1 ? 17 
HELX_P HELX_P2  2  LEU C 26  ? ASP C 35  ? LEU A 26  ASP A 35  1 ? 10 
HELX_P HELX_P3  3  SER C 37  ? ASP C 51  ? SER A 37  ASP A 51  1 ? 15 
HELX_P HELX_P4  4  THR C 65  ? VAL C 89  ? THR A 65  VAL A 89  1 ? 25 
HELX_P HELX_P5  5  PRO C 93  ? GLU C 105 ? PRO A 93  GLU A 105 1 ? 13 
HELX_P HELX_P6  6  SER C 109 ? LEU C 120 ? SER A 109 LEU A 120 1 ? 12 
HELX_P HELX_P7  7  GLY C 134 ? GLY C 139 ? GLY A 134 GLY A 139 1 ? 6  
HELX_P HELX_P8  8  ASP D 6   ? GLY D 22  ? ASP B 6   GLY B 22  1 ? 17 
HELX_P HELX_P9  9  LEU D 26  ? ASP D 35  ? LEU B 26  ASP B 35  1 ? 10 
HELX_P HELX_P10 10 SER D 37  ? ASP D 51  ? SER B 37  ASP B 51  1 ? 15 
HELX_P HELX_P11 11 THR D 65  ? VAL D 89  ? THR B 65  VAL B 89  1 ? 25 
HELX_P HELX_P12 12 PRO D 93  ? GLU D 105 ? PRO B 93  GLU B 105 1 ? 13 
HELX_P HELX_P13 13 SER D 109 ? LEU D 120 ? SER B 109 LEU B 120 1 ? 12 
HELX_P HELX_P14 14 ASP E 6   ? GLY E 22  ? ASP C 6   GLY C 22  1 ? 17 
HELX_P HELX_P15 15 LEU E 26  ? ASP E 35  ? LEU C 26  ASP C 35  1 ? 10 
HELX_P HELX_P16 16 SER E 37  ? ASP E 51  ? SER C 37  ASP C 51  1 ? 15 
HELX_P HELX_P17 17 THR E 65  ? VAL E 89  ? THR C 65  VAL C 89  1 ? 25 
HELX_P HELX_P18 18 PRO E 93  ? GLU E 95  ? PRO C 93  GLU C 95  5 ? 3  
HELX_P HELX_P19 19 GLU E 96  ? GLU E 105 ? GLU C 96  GLU C 105 1 ? 10 
HELX_P HELX_P20 20 SER E 109 ? LEU E 120 ? SER C 109 LEU C 120 1 ? 12 
HELX_P HELX_P21 21 GLY E 134 ? VAL E 140 ? GLY C 134 VAL C 140 1 ? 7  
HELX_P HELX_P22 22 ASP F 6   ? GLY F 22  ? ASP D 6   GLY D 22  1 ? 17 
HELX_P HELX_P23 23 LEU F 26  ? ASP F 35  ? LEU D 26  ASP D 35  1 ? 10 
HELX_P HELX_P24 24 SER F 37  ? ASP F 51  ? SER D 37  ASP D 51  1 ? 15 
HELX_P HELX_P25 25 THR F 65  ? VAL F 89  ? THR D 65  VAL D 89  1 ? 25 
HELX_P HELX_P26 26 PRO F 93  ? GLU F 95  ? PRO D 93  GLU D 95  5 ? 3  
HELX_P HELX_P27 27 GLU F 96  ? GLU F 105 ? GLU D 96  GLU D 105 1 ? 10 
HELX_P HELX_P28 28 SER F 109 ? LEU F 120 ? SER D 109 LEU D 120 1 ? 12 
HELX_P HELX_P29 29 GLY F 134 ? GLY F 139 ? GLY D 134 GLY D 139 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G NI .  NI  ? ? ? 1_555 C  GLU 83  OE2 ? ? A NI 1001 A GLU 83   1_555 ? ? ? ? ? ? ?            1.965 ? 
metalc2  metalc ? ? G NI .  NI  ? ? ? 1_555 X  HOH .   O   ? ? A NI 1001 A HOH 2030 1_555 ? ? ? ? ? ? ?            2.597 ? 
metalc3  metalc ? ? G NI .  NI  ? ? ? 1_555 C  HIS 79  NE2 ? ? A NI 1001 A HIS 79   1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc4  metalc ? ? G NI .  NI  ? ? ? 1_555 C  HIS 98  ND1 ? ? A NI 1001 A HIS 98   1_555 ? ? ? ? ? ? ?            2.045 ? 
metalc5  metalc ? ? H NI .  NI  ? ? ? 1_555 C  MET 10  SD  ? ? A NI 1002 A MET 10   1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc6  metalc ? ? H NI .  NI  ? ? ? 1_555 C  GLU 105 OE2 ? ? A NI 1002 A GLU 105  1_555 ? ? ? ? ? ? ?            1.949 ? 
metalc7  metalc ? ? H NI .  NI  ? ? ? 1_555 C  HIS 106 NE2 ? ? A NI 1002 A HIS 106  1_555 ? ? ? ? ? ? ?            2.029 ? 
metalc8  metalc ? ? H NI .  NI  ? ? ? 1_555 X  HOH .   O   ? ? A NI 1002 A HOH 2013 1_555 ? ? ? ? ? ? ?            1.991 ? 
metalc9  metalc ? ? H NI .  NI  ? ? ? 1_555 C  CYS 102 O   ? ? A NI 1002 A CYS 102  1_555 ? ? ? ? ? ? ?            1.969 ? 
metalc10 metalc ? ? I NI .  NI  ? ? ? 1_555 C  HIS 61  ND1 ? ? A NI 1003 A HIS 61   1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc11 metalc ? ? J NA .  NA  ? ? ? 1_555 X  HOH .   O   ? ? A NA 2001 A HOH 2029 1_555 ? ? ? ? ? ? ?            2.003 ? 
metalc12 metalc ? ? J NA .  NA  ? ? ? 1_555 W  HOH .   O   ? ? A NA 2001 F HOH 51   1_555 ? ? ? ? ? ? ?            1.859 ? 
metalc13 metalc ? ? J NA .  NA  ? ? ? 1_555 W  HOH .   O   ? ? A NA 2001 F HOH 50   1_555 ? ? ? ? ? ? ?            2.103 ? 
metalc14 metalc ? ? J NA .  NA  ? ? ? 1_555 X  HOH .   O   ? ? A NA 2001 A HOH 2028 1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc15 metalc ? ? K NI .  NI  ? ? ? 1_555 D  GLU 83  OE2 ? ? B NI 1001 B GLU 83   1_555 ? ? ? ? ? ? ?            1.964 ? 
metalc16 metalc ? ? K NI .  NI  ? ? ? 1_555 Y  HOH .   O   ? ? B NI 1001 B HOH 1028 1_555 ? ? ? ? ? ? ?            2.614 ? 
metalc17 metalc ? ? K NI .  NI  ? ? ? 1_555 D  HIS 98  ND1 ? ? B NI 1001 B HIS 98   1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc18 metalc ? ? K NI .  NI  ? ? ? 1_555 D  HIS 79  NE2 ? ? B NI 1001 B HIS 79   1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc19 metalc ? ? L NI .  NI  ? ? ? 1_555 D  MET 10  SD  ? ? B NI 1002 B MET 10   1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc20 metalc ? ? L NI .  NI  ? ? ? 1_555 D  GLU 105 OE2 ? ? B NI 1002 B GLU 105  1_555 ? ? ? ? ? ? ?            1.946 ? 
metalc21 metalc ? ? L NI .  NI  ? ? ? 1_555 D  CYS 102 O   ? ? B NI 1002 B CYS 102  1_555 ? ? ? ? ? ? ?            1.955 ? 
metalc22 metalc ? ? L NI .  NI  ? ? ? 1_555 D  HIS 106 NE2 ? ? B NI 1002 B HIS 106  1_555 ? ? ? ? ? ? ?            2.042 ? 
metalc23 metalc ? ? L NI .  NI  ? ? ? 1_555 D  CYS 102 SG  ? ? B NI 1002 B CYS 102  1_555 ? ? ? ? ? ? ?            2.615 ? 
metalc24 metalc ? ? M NI .  NI  ? ? ? 1_555 Y  HOH .   O   ? ? B NI 1003 B HOH 1030 1_555 ? ? ? ? ? ? ?            1.826 ? 
metalc25 metalc ? ? M NI .  NI  ? ? ? 1_555 Y  HOH .   O   ? ? B NI 1003 B HOH 1019 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc26 metalc ? ? M NI .  NI  ? ? ? 1_555 Y  HOH .   O   ? ? B NI 1003 B HOH 1009 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc27 metalc ? ? M NI .  NI  ? ? ? 1_555 D  HIS 61  ND1 ? ? B NI 1003 B HIS 61   1_555 ? ? ? ? ? ? ?            2.026 ? 
metalc28 metalc ? ? N NI .  NI  ? ? ? 1_555 E  GLU 83  OE2 ? ? C NI 1001 C GLU 83   1_555 ? ? ? ? ? ? ?            1.960 ? 
metalc29 metalc ? ? N NI .  NI  ? ? ? 1_555 E  HIS 98  ND1 ? ? C NI 1001 C HIS 98   1_555 ? ? ? ? ? ? ?            2.038 ? 
metalc30 metalc ? ? N NI .  NI  ? ? ? 1_555 E  HIS 79  NE2 ? ? C NI 1001 C HIS 79   1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc31 metalc ? ? O NI .  NI  ? ? ? 1_555 E  HIS 106 NE2 ? ? C NI 1002 C HIS 106  1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc32 metalc ? ? O NI .  NI  ? ? ? 1_555 E  GLU 105 OE2 ? ? C NI 1002 C GLU 105  1_555 ? ? ? ? ? ? ?            1.957 ? 
metalc33 metalc ? ? O NI .  NI  ? ? ? 1_555 E  CYS 102 O   ? ? C NI 1002 C CYS 102  1_555 ? ? ? ? ? ? ?            1.955 ? 
metalc34 metalc ? ? O NI .  NI  ? ? ? 1_555 Z  HOH .   O   ? ? C NI 1002 C HOH 2020 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc35 metalc ? ? O NI .  NI  ? ? ? 1_555 E  MET 10  SD  ? ? C NI 1002 C MET 10   1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc36 metalc ? ? P NI .  NI  ? ? ? 1_555 Z  HOH .   O   ? ? C NI 1003 C HOH 2024 1_555 ? ? ? ? ? ? ?            2.442 ? 
metalc37 metalc ? ? P NI .  NI  ? ? ? 1_555 Z  HOH .   O   ? ? C NI 1003 C HOH 2023 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc38 metalc ? ? P NI .  NI  ? ? ? 1_555 E  HIS 61  ND1 ? ? C NI 1003 C HIS 61   1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc39 metalc ? ? Q NA .  NA  ? ? ? 1_555 V  HOH .   O   ? ? C NA 2001 E HOH 55   1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc40 metalc ? ? Q NA .  NA  ? ? ? 1_555 Z  HOH .   O   ? ? C NA 2001 C HOH 2018 1_555 ? ? ? ? ? ? ?            2.542 ? 
metalc41 metalc ? ? Q NA .  NA  ? ? ? 1_555 V  HOH .   O   ? ? C NA 2001 E HOH 58   1_555 ? ? ? ? ? ? ?            2.486 ? 
metalc42 metalc ? ? R NI .  NI  ? ? ? 1_555 F  HIS 79  NE2 ? ? D NI 1001 D HIS 79   1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc43 metalc ? ? R NI .  NI  ? ? ? 1_555 F  GLU 83  OE2 ? ? D NI 1001 D GLU 83   1_555 ? ? ? ? ? ? ?            1.957 ? 
metalc44 metalc ? ? R NI .  NI  ? ? ? 1_555 AA HOH .   O   ? ? D NI 1001 D HOH 2017 1_555 ? ? ? ? ? ? ?            2.624 ? 
metalc45 metalc ? ? R NI .  NI  ? ? ? 1_555 F  HIS 98  ND1 ? ? D NI 1001 D HIS 98   1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc46 metalc ? ? S NI .  NI  ? ? ? 1_555 F  GLU 105 OE2 ? ? D NI 1002 D GLU 105  1_555 ? ? ? ? ? ? ?            1.945 ? 
metalc47 metalc ? ? S NI .  NI  ? ? ? 1_555 F  CYS 102 O   ? ? D NI 1002 D CYS 102  1_555 ? ? ? ? ? ? ?            1.951 ? 
metalc48 metalc ? ? S NI .  NI  ? ? ? 1_555 F  MET 10  SD  ? ? D NI 1002 D MET 10   1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc49 metalc ? ? S NI .  NI  ? ? ? 1_555 F  HIS 106 NE2 ? ? D NI 1002 D HIS 106  1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc50 metalc ? ? S NI .  NI  ? ? ? 1_555 AA HOH .   O   ? ? D NI 1002 D HOH 2006 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc51 metalc ? ? T NI .  NI  ? ? ? 1_555 AA HOH .   O   ? ? D NI 1003 D HOH 2019 1_555 ? ? ? ? ? ? ?            2.666 ? 
metalc52 metalc ? ? T NI .  NI  ? ? ? 1_555 AA HOH .   O   ? ? D NI 1003 D HOH 2018 1_555 ? ? ? ? ? ? ?            2.738 ? 
metalc53 metalc ? ? T NI .  NI  ? ? ? 1_555 F  HIS 61  ND1 ? ? D NI 1003 D HIS 61   1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc54 metalc ? ? U NA .  NA  ? ? ? 1_555 AA HOH .   O   ? ? D NA 2001 D HOH 2014 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc55 metalc ? ? U NA .  NA  ? ? ? 1_555 AA HOH .   O   ? ? D NA 2001 D HOH 2015 1_555 ? ? ? ? ? ? ?            1.937 ? 
metalc56 metalc ? ? U NA .  NA  ? ? ? 1_555 W  HOH .   O   ? ? D NA 2001 F HOH 49   1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc57 metalc ? ? B DC 19 OP1 ? ? ? 1_555 J  NA  .   NA  ? ? F DC 19   A NA  2001 1_555 ? ? ? ? ? ? ?            2.862 ? 
hydrog1  hydrog ? ? A DC 1  N3  ? ? ? 1_555 B  DG  32  N1  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC 1  N4  ? ? ? 1_555 B  DG  32  O6  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 1  O2  ? ? ? 1_555 B  DG  32  N2  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N3  ? ? ? 1_555 B  DG  31  N1  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  N4  ? ? ? 1_555 B  DG  31  O6  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2  O2  ? ? ? 1_555 B  DG  31  N2  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 3  N3  ? ? ? 1_555 B  DG  30  N1  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 3  N4  ? ? ? 1_555 B  DG  30  O6  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC 3  O2  ? ? ? 1_555 B  DG  30  N2  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT 4  N3  ? ? ? 1_555 B  DA  29  N1  ? ? E DT 4    F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT 4  O4  ? ? ? 1_555 B  DA  29  N6  ? ? E DT 4    F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 5  N1  ? ? ? 1_555 B  DC  28  N3  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 5  N2  ? ? ? 1_555 B  DC  28  O2  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 5  O6  ? ? ? 1_555 B  DC  28  N4  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT 6  N3  ? ? ? 1_555 B  DA  27  N1  ? ? E DT 6    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 6  O4  ? ? ? 1_555 B  DA  27  N6  ? ? E DT 6    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 7  N3  ? ? ? 1_555 B  DA  26  N1  ? ? E DT 7    F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DT 7  O4  ? ? ? 1_555 B  DA  26  N6  ? ? E DT 7    F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 8  N1  ? ? ? 1_555 B  DT  25  N3  ? ? E DA 8    F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 8  N6  ? ? ? 1_555 B  DT  25  O4  ? ? E DA 8    F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 9  N1  ? ? ? 1_555 B  DC  24  N3  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 9  N2  ? ? ? 1_555 B  DC  24  O2  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 9  O6  ? ? ? 1_555 B  DC  24  N4  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC 10 N3  ? ? ? 1_555 B  DG  23  N1  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC 10 N4  ? ? ? 1_555 B  DG  23  O6  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC 10 O2  ? ? ? 1_555 B  DG  23  N2  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA 11 N1  ? ? ? 1_555 B  DT  22  N3  ? ? E DA 11   F DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 11 N6  ? ? ? 1_555 B  DT  22  O4  ? ? E DA 11   F DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 12 N3  ? ? ? 1_555 B  DG  21  N1  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 12 N4  ? ? ? 1_555 B  DG  21  O6  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 12 O2  ? ? ? 1_555 B  DG  21  N2  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA 13 N1  ? ? ? 1_555 B  DT  20  N3  ? ? E DA 13   F DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 13 N6  ? ? ? 1_555 B  DT  20  O4  ? ? E DA 13   F DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG 14 N1  ? ? ? 1_555 B  DC  19  N3  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DG 14 N2  ? ? ? 1_555 B  DC  19  O2  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG 14 O6  ? ? ? 1_555 B  DC  19  N4  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG 15 N1  ? ? ? 1_555 B  DC  18  N3  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG 15 N2  ? ? ? 1_555 B  DC  18  O2  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DG 15 O6  ? ? ? 1_555 B  DC  18  N4  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DC 16 N3  ? ? ? 1_555 B  DG  17  N1  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DC 16 N4  ? ? ? 1_555 B  DG  17  O6  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DC 16 O2  ? ? ? 1_555 B  DG  17  N2  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DT 17 N3  ? ? ? 1_555 B  DA  16  N1  ? ? E DT 17   F DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DT 17 O4  ? ? ? 1_555 B  DA  16  N6  ? ? E DT 17   F DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A DG 18 N1  ? ? ? 1_555 B  DC  15  N3  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A DG 18 N2  ? ? ? 1_555 B  DC  15  O2  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A DG 18 O6  ? ? ? 1_555 B  DC  15  N4  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? A DC 19 N3  ? ? ? 1_555 B  DG  14  N1  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? A DC 19 N4  ? ? ? 1_555 B  DG  14  O6  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? A DC 19 O2  ? ? ? 1_555 B  DG  14  N2  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? A DC 20 N3  ? ? ? 1_555 B  DG  13  N1  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? A DC 20 N4  ? ? ? 1_555 B  DG  13  O6  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? A DC 20 O2  ? ? ? 1_555 B  DG  13  N2  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? A DC 21 N3  ? ? ? 1_555 B  DG  12  N1  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? A DC 21 N4  ? ? ? 1_555 B  DG  12  O6  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? A DC 21 O2  ? ? ? 1_555 B  DG  12  N2  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? A DT 22 N3  ? ? ? 1_555 B  DA  11  N1  ? ? E DT 22   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? A DT 22 O4  ? ? ? 1_555 B  DA  11  N6  ? ? E DT 22   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? A DA 23 N1  ? ? ? 1_555 B  DT  10  N3  ? ? E DA 23   F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? A DA 23 N6  ? ? ? 1_555 B  DT  10  O4  ? ? E DA 23   F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? A DA 24 N1  ? ? ? 1_555 B  DT  9   N3  ? ? E DA 24   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? A DA 24 N6  ? ? ? 1_555 B  DT  9   O4  ? ? E DA 24   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? A DT 25 N3  ? ? ? 1_555 B  DA  8   N1  ? ? E DT 25   F DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? A DT 25 O4  ? ? ? 1_555 B  DA  8   N6  ? ? E DT 25   F DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? A DT 26 N3  ? ? ? 1_555 B  DA  7   N1  ? ? E DT 26   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? A DT 26 O4  ? ? ? 1_555 B  DA  7   N6  ? ? E DT 26   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? A DT 27 N3  ? ? ? 1_555 B  DA  6   N1  ? ? E DT 27   F DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? A DT 27 O4  ? ? ? 1_555 B  DA  6   N6  ? ? E DT 27   F DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? A DT 28 N3  ? ? ? 1_555 B  DA  5   N1  ? ? E DT 28   F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? A DT 28 O4  ? ? ? 1_555 B  DA  5   N6  ? ? E DT 28   F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? A DA 29 N1  ? ? ? 1_555 B  DT  4   N3  ? ? E DA 29   F DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? A DA 29 N6  ? ? ? 1_555 B  DT  4   O4  ? ? E DA 29   F DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? A DG 30 N1  ? ? ? 1_555 B  DC  3   N3  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? A DG 30 N2  ? ? ? 1_555 B  DC  3   O2  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? A DG 30 O6  ? ? ? 1_555 B  DC  3   N4  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? A DT 31 N3  ? ? ? 1_555 B  DA  2   N1  ? ? E DT 31   F DA  2    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog77 hydrog ? ? A DG 32 N1  ? ? ? 1_555 B  DC  1   N3  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? A DG 32 N2  ? ? ? 1_555 B  DC  1   O2  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ? ? A DG 32 O6  ? ? ? 1_555 B  DC  1   N4  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 54 ? VAL C 56 ? LEU A 54 VAL A 56 
A 2 LEU C 62 ? LEU C 64 ? LEU A 62 LEU A 64 
B 1 LEU D 54 ? VAL D 56 ? LEU B 54 VAL B 56 
B 2 LEU D 62 ? LEU D 64 ? LEU B 62 LEU B 64 
C 1 LEU E 54 ? VAL E 56 ? LEU C 54 VAL C 56 
C 2 LEU E 62 ? LEU E 64 ? LEU C 62 LEU C 64 
D 1 LEU F 54 ? VAL F 56 ? LEU D 54 VAL D 56 
D 2 LEU F 62 ? LEU F 64 ? LEU D 62 LEU D 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 55 ? N ARG A 55 O GLU C 63 ? O GLU A 63 
B 1 2 N ARG D 55 ? N ARG B 55 O GLU D 63 ? O GLU B 63 
C 1 2 N ARG E 55 ? N ARG C 55 O GLU E 63 ? O GLU C 63 
D 1 2 N ARG F 55 ? N ARG D 55 O GLU F 63 ? O GLU D 63 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 1001' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI A 1002' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NI A 1003' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 1001' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI B 1002' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 1003' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI C 1001' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI C 1002' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI C 1003' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI D 1001' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI D 1002' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NI D 1003' 
BC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 2001' 
BC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA C 2001' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA D 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS C  79  ? HIS A 79   . ? 1_555 ? 
2  AC1 4 GLU C  83  ? GLU A 83   . ? 1_555 ? 
3  AC1 4 HIS C  98  ? HIS A 98   . ? 1_555 ? 
4  AC1 4 HOH X  .   ? HOH A 2030 . ? 1_555 ? 
5  AC2 5 MET C  10  ? MET A 10   . ? 1_555 ? 
6  AC2 5 CYS C  102 ? CYS A 102  . ? 1_555 ? 
7  AC2 5 GLU C  105 ? GLU A 105  . ? 1_555 ? 
8  AC2 5 HIS C  106 ? HIS A 106  . ? 1_555 ? 
9  AC2 5 HOH X  .   ? HOH A 2013 . ? 1_555 ? 
10 AC3 1 HIS C  61  ? HIS A 61   . ? 1_555 ? 
11 AC4 4 HIS D  79  ? HIS B 79   . ? 1_555 ? 
12 AC4 4 GLU D  83  ? GLU B 83   . ? 1_555 ? 
13 AC4 4 HIS D  98  ? HIS B 98   . ? 1_555 ? 
14 AC4 4 HOH Y  .   ? HOH B 1028 . ? 1_555 ? 
15 AC5 5 MET D  10  ? MET B 10   . ? 1_555 ? 
16 AC5 5 CYS D  102 ? CYS B 102  . ? 1_555 ? 
17 AC5 5 GLU D  105 ? GLU B 105  . ? 1_555 ? 
18 AC5 5 HIS D  106 ? HIS B 106  . ? 1_555 ? 
19 AC5 5 HOH Y  .   ? HOH B 1026 . ? 1_555 ? 
20 AC6 4 HIS D  61  ? HIS B 61   . ? 1_555 ? 
21 AC6 4 HOH Y  .   ? HOH B 1009 . ? 1_555 ? 
22 AC6 4 HOH Y  .   ? HOH B 1019 . ? 1_555 ? 
23 AC6 4 HOH Y  .   ? HOH B 1030 . ? 1_555 ? 
24 AC7 4 HIS E  79  ? HIS C 79   . ? 1_555 ? 
25 AC7 4 GLU E  83  ? GLU C 83   . ? 1_555 ? 
26 AC7 4 HIS E  98  ? HIS C 98   . ? 1_555 ? 
27 AC7 4 HOH Z  .   ? HOH C 2021 . ? 1_555 ? 
28 AC8 5 MET E  10  ? MET C 10   . ? 1_555 ? 
29 AC8 5 CYS E  102 ? CYS C 102  . ? 1_555 ? 
30 AC8 5 GLU E  105 ? GLU C 105  . ? 1_555 ? 
31 AC8 5 HIS E  106 ? HIS C 106  . ? 1_555 ? 
32 AC8 5 HOH Z  .   ? HOH C 2020 . ? 1_555 ? 
33 AC9 4 HIS E  61  ? HIS C 61   . ? 1_555 ? 
34 AC9 4 HOH Z  .   ? HOH C 2022 . ? 1_555 ? 
35 AC9 4 HOH Z  .   ? HOH C 2023 . ? 1_555 ? 
36 AC9 4 HOH Z  .   ? HOH C 2024 . ? 1_555 ? 
37 BC1 4 HIS F  79  ? HIS D 79   . ? 1_555 ? 
38 BC1 4 GLU F  83  ? GLU D 83   . ? 1_555 ? 
39 BC1 4 HIS F  98  ? HIS D 98   . ? 1_555 ? 
40 BC1 4 HOH AA .   ? HOH D 2017 . ? 1_555 ? 
41 BC2 5 MET F  10  ? MET D 10   . ? 1_555 ? 
42 BC2 5 CYS F  102 ? CYS D 102  . ? 1_555 ? 
43 BC2 5 GLU F  105 ? GLU D 105  . ? 1_555 ? 
44 BC2 5 HIS F  106 ? HIS D 106  . ? 1_555 ? 
45 BC2 5 HOH AA .   ? HOH D 2006 . ? 1_555 ? 
46 BC3 3 HIS F  61  ? HIS D 61   . ? 1_555 ? 
47 BC3 3 HOH AA .   ? HOH D 2018 . ? 1_555 ? 
48 BC3 3 HOH AA .   ? HOH D 2019 . ? 1_555 ? 
49 BC4 5 HOH X  .   ? HOH A 2028 . ? 1_555 ? 
50 BC4 5 HOH X  .   ? HOH A 2029 . ? 1_555 ? 
51 BC4 5 DC  B  19  ? DC  F 19   . ? 1_555 ? 
52 BC4 5 HOH W  .   ? HOH F 50   . ? 1_555 ? 
53 BC4 5 HOH W  .   ? HOH F 51   . ? 1_555 ? 
54 BC5 4 HOH Z  .   ? HOH C 2018 . ? 1_555 ? 
55 BC5 4 DC  A  16  ? DC  E 16   . ? 1_555 ? 
56 BC5 4 HOH V  .   ? HOH E 55   . ? 1_555 ? 
57 BC5 4 HOH V  .   ? HOH E 58   . ? 1_555 ? 
58 BC6 4 HOH AA .   ? HOH D 2014 . ? 1_555 ? 
59 BC6 4 HOH AA .   ? HOH D 2015 . ? 1_555 ? 
60 BC6 4 DC  B  24  ? DC  F 24   . ? 1_555 ? 
61 BC6 4 HOH W  .   ? HOH F 49   . ? 1_555 ? 
# 
_atom_sites.entry_id                    2ISZ 
_atom_sites.fract_transf_matrix[1][1]   0.018576 
_atom_sites.fract_transf_matrix[1][2]   0.003162 
_atom_sites.fract_transf_matrix[1][3]   0.006406 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014545 
_atom_sites.fract_transf_matrix[2][3]   0.005336 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014412 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A  1 1   ? -34.893 -5.032  26.531  1.00 76.37  ? 1    DC  E "O5'" 1 
ATOM   2    C  "C5'" . DC  A  1 1   ? -34.934 -3.876  27.357  1.00 76.41  ? 1    DC  E "C5'" 1 
ATOM   3    C  "C4'" . DC  A  1 1   ? -34.244 -4.163  28.676  1.00 76.44  ? 1    DC  E "C4'" 1 
ATOM   4    O  "O4'" . DC  A  1 1   ? -34.410 -5.556  29.023  1.00 76.21  ? 1    DC  E "O4'" 1 
ATOM   5    C  "C3'" . DC  A  1 1   ? -32.730 -4.055  28.671  1.00 76.75  ? 1    DC  E "C3'" 1 
ATOM   6    O  "O3'" . DC  A  1 1   ? -32.308 -2.704  28.712  1.00 77.85  ? 1    DC  E "O3'" 1 
ATOM   7    C  "C2'" . DC  A  1 1   ? -32.387 -4.774  29.968  1.00 76.09  ? 1    DC  E "C2'" 1 
ATOM   8    C  "C1'" . DC  A  1 1   ? -33.476 -5.842  30.046  1.00 75.09  ? 1    DC  E "C1'" 1 
ATOM   9    N  N1    . DC  A  1 1   ? -32.961 -7.237  29.906  1.00 74.27  ? 1    DC  E N1    1 
ATOM   10   C  C2    . DC  A  1 1   ? -32.238 -7.782  30.970  1.00 73.88  ? 1    DC  E C2    1 
ATOM   11   O  O2    . DC  A  1 1   ? -32.052 -7.088  31.976  1.00 73.90  ? 1    DC  E O2    1 
ATOM   12   N  N3    . DC  A  1 1   ? -31.765 -9.048  30.876  1.00 73.38  ? 1    DC  E N3    1 
ATOM   13   C  C4    . DC  A  1 1   ? -31.992 -9.757  29.774  1.00 73.45  ? 1    DC  E C4    1 
ATOM   14   N  N4    . DC  A  1 1   ? -31.503 -11.000 29.732  1.00 73.75  ? 1    DC  E N4    1 
ATOM   15   C  C5    . DC  A  1 1   ? -32.728 -9.220  28.674  1.00 73.49  ? 1    DC  E C5    1 
ATOM   16   C  C6    . DC  A  1 1   ? -33.191 -7.968  28.778  1.00 73.65  ? 1    DC  E C6    1 
ATOM   17   P  P     . DC  A  1 2   ? -31.041 -2.263  27.836  1.00 78.43  ? 2    DC  E P     1 
ATOM   18   O  OP1   . DC  A  1 2   ? -30.951 -0.781  27.871  1.00 78.42  ? 2    DC  E OP1   1 
ATOM   19   O  OP2   . DC  A  1 2   ? -31.148 -2.972  26.538  1.00 78.13  ? 2    DC  E OP2   1 
ATOM   20   O  "O5'" . DC  A  1 2   ? -29.800 -2.858  28.657  1.00 78.02  ? 2    DC  E "O5'" 1 
ATOM   21   C  "C5'" . DC  A  1 2   ? -29.077 -2.002  29.532  1.00 77.63  ? 2    DC  E "C5'" 1 
ATOM   22   C  "C4'" . DC  A  1 2   ? -28.959 -2.623  30.909  1.00 77.57  ? 2    DC  E "C4'" 1 
ATOM   23   O  "O4'" . DC  A  1 2   ? -29.717 -3.854  30.960  1.00 77.36  ? 2    DC  E "O4'" 1 
ATOM   24   C  "C3'" . DC  A  1 2   ? -27.544 -3.024  31.289  1.00 77.47  ? 2    DC  E "C3'" 1 
ATOM   25   O  "O3'" . DC  A  1 2   ? -26.891 -1.916  31.893  1.00 77.28  ? 2    DC  E "O3'" 1 
ATOM   26   C  "C2'" . DC  A  1 2   ? -27.758 -4.163  32.278  1.00 77.41  ? 2    DC  E "C2'" 1 
ATOM   27   C  "C1'" . DC  A  1 2   ? -29.040 -4.809  31.759  1.00 77.35  ? 2    DC  E "C1'" 1 
ATOM   28   N  N1    . DC  A  1 2   ? -28.854 -6.062  30.946  1.00 77.13  ? 2    DC  E N1    1 
ATOM   29   C  C2    . DC  A  1 2   ? -28.161 -7.165  31.470  1.00 76.92  ? 2    DC  E C2    1 
ATOM   30   O  O2    . DC  A  1 2   ? -27.676 -7.114  32.606  1.00 76.98  ? 2    DC  E O2    1 
ATOM   31   N  N3    . DC  A  1 2   ? -28.033 -8.278  30.710  1.00 76.96  ? 2    DC  E N3    1 
ATOM   32   C  C4    . DC  A  1 2   ? -28.559 -8.320  29.484  1.00 77.07  ? 2    DC  E C4    1 
ATOM   33   N  N4    . DC  A  1 2   ? -28.398 -9.445  28.778  1.00 77.21  ? 2    DC  E N4    1 
ATOM   34   C  C5    . DC  A  1 2   ? -29.269 -7.213  28.931  1.00 76.89  ? 2    DC  E C5    1 
ATOM   35   C  C6    . DC  A  1 2   ? -29.391 -6.120  29.691  1.00 76.95  ? 2    DC  E C6    1 
ATOM   36   P  P     . DC  A  1 3   ? -25.603 -1.291  31.172  1.00 77.15  ? 3    DC  E P     1 
ATOM   37   O  OP1   . DC  A  1 3   ? -25.505 0.136   31.556  1.00 77.08  ? 3    DC  E OP1   1 
ATOM   38   O  OP2   . DC  A  1 3   ? -25.666 -1.675  29.738  1.00 77.12  ? 3    DC  E OP2   1 
ATOM   39   O  "O5'" . DC  A  1 3   ? -24.400 -2.089  31.863  1.00 75.42  ? 3    DC  E "O5'" 1 
ATOM   40   C  "C5'" . DC  A  1 3   ? -24.539 -2.559  33.200  1.00 73.01  ? 3    DC  E "C5'" 1 
ATOM   41   C  "C4'" . DC  A  1 3   ? -23.810 -3.877  33.358  1.00 70.98  ? 3    DC  E "C4'" 1 
ATOM   42   O  "O4'" . DC  A  1 3   ? -24.609 -4.938  32.799  1.00 70.69  ? 3    DC  E "O4'" 1 
ATOM   43   C  "C3'" . DC  A  1 3   ? -22.504 -3.953  32.583  1.00 69.62  ? 3    DC  E "C3'" 1 
ATOM   44   O  "O3'" . DC  A  1 3   ? -21.443 -3.495  33.404  1.00 67.03  ? 3    DC  E "O3'" 1 
ATOM   45   C  "C2'" . DC  A  1 3   ? -22.342 -5.436  32.250  1.00 69.82  ? 3    DC  E "C2'" 1 
ATOM   46   C  "C1'" . DC  A  1 3   ? -23.744 -5.999  32.441  1.00 70.00  ? 3    DC  E "C1'" 1 
ATOM   47   N  N1    . DC  A  1 3   ? -24.271 -6.676  31.225  1.00 69.77  ? 3    DC  E N1    1 
ATOM   48   C  C2    . DC  A  1 3   ? -23.898 -8.004  30.998  1.00 69.59  ? 3    DC  E C2    1 
ATOM   49   O  O2    . DC  A  1 3   ? -23.139 -8.555  31.809  1.00 69.04  ? 3    DC  E O2    1 
ATOM   50   N  N3    . DC  A  1 3   ? -24.381 -8.641  29.898  1.00 69.56  ? 3    DC  E N3    1 
ATOM   51   C  C4    . DC  A  1 3   ? -25.196 -7.998  29.057  1.00 69.51  ? 3    DC  E C4    1 
ATOM   52   N  N4    . DC  A  1 3   ? -25.640 -8.670  27.989  1.00 69.39  ? 3    DC  E N4    1 
ATOM   53   C  C5    . DC  A  1 3   ? -25.585 -6.638  29.273  1.00 69.55  ? 3    DC  E C5    1 
ATOM   54   C  C6    . DC  A  1 3   ? -25.107 -6.022  30.362  1.00 69.64  ? 3    DC  E C6    1 
ATOM   55   P  P     . DT  A  1 4   ? -20.162 -2.838  32.719  1.00 64.12  ? 4    DT  E P     1 
ATOM   56   O  OP1   . DT  A  1 4   ? -19.321 -2.280  33.796  1.00 64.02  ? 4    DT  E OP1   1 
ATOM   57   O  OP2   . DT  A  1 4   ? -20.650 -2.000  31.595  1.00 63.66  ? 4    DT  E OP2   1 
ATOM   58   O  "O5'" . DT  A  1 4   ? -19.384 -4.096  32.122  1.00 62.35  ? 4    DT  E "O5'" 1 
ATOM   59   C  "C5'" . DT  A  1 4   ? -18.745 -5.005  32.999  1.00 59.87  ? 4    DT  E "C5'" 1 
ATOM   60   C  "C4'" . DT  A  1 4   ? -18.108 -6.105  32.178  1.00 57.91  ? 4    DT  E "C4'" 1 
ATOM   61   O  "O4'" . DT  A  1 4   ? -19.149 -6.843  31.487  1.00 57.64  ? 4    DT  E "O4'" 1 
ATOM   62   C  "C3'" . DT  A  1 4   ? -17.155 -5.593  31.104  1.00 56.64  ? 4    DT  E "C3'" 1 
ATOM   63   O  "O3'" . DT  A  1 4   ? -15.930 -6.297  31.187  1.00 54.97  ? 4    DT  E "O3'" 1 
ATOM   64   C  "C2'" . DT  A  1 4   ? -17.882 -5.870  29.792  1.00 56.49  ? 4    DT  E "C2'" 1 
ATOM   65   C  "C1'" . DT  A  1 4   ? -18.741 -7.073  30.155  1.00 56.46  ? 4    DT  E "C1'" 1 
ATOM   66   N  N1    . DT  A  1 4   ? -19.930 -7.242  29.254  1.00 55.98  ? 4    DT  E N1    1 
ATOM   67   C  C2    . DT  A  1 4   ? -20.179 -8.486  28.715  1.00 55.44  ? 4    DT  E C2    1 
ATOM   68   O  O2    . DT  A  1 4   ? -19.490 -9.464  28.937  1.00 55.24  ? 4    DT  E O2    1 
ATOM   69   N  N3    . DT  A  1 4   ? -21.277 -8.545  27.898  1.00 55.17  ? 4    DT  E N3    1 
ATOM   70   C  C4    . DT  A  1 4   ? -22.127 -7.508  27.569  1.00 55.16  ? 4    DT  E C4    1 
ATOM   71   O  O4    . DT  A  1 4   ? -23.084 -7.659  26.817  1.00 55.45  ? 4    DT  E O4    1 
ATOM   72   C  C5    . DT  A  1 4   ? -21.814 -6.233  28.159  1.00 55.19  ? 4    DT  E C5    1 
ATOM   73   C  C7    . DT  A  1 4   ? -22.566 -5.014  27.707  1.00 55.14  ? 4    DT  E C7    1 
ATOM   74   C  C6    . DT  A  1 4   ? -20.745 -6.159  28.966  1.00 55.33  ? 4    DT  E C6    1 
ATOM   75   P  P     . DG  A  1 5   ? -14.650 -5.804  30.365  1.00 53.99  ? 5    DG  E P     1 
ATOM   76   O  OP1   . DG  A  1 5   ? -13.439 -6.242  31.096  1.00 53.78  ? 5    DG  E OP1   1 
ATOM   77   O  OP2   . DG  A  1 5   ? -14.826 -4.385  29.995  1.00 53.69  ? 5    DG  E OP2   1 
ATOM   78   O  "O5'" . DG  A  1 5   ? -14.777 -6.710  29.054  1.00 54.07  ? 5    DG  E "O5'" 1 
ATOM   79   C  "C5'" . DG  A  1 5   ? -14.711 -8.130  29.261  1.00 52.45  ? 5    DG  E "C5'" 1 
ATOM   80   C  "C4'" . DG  A  1 5   ? -15.116 -8.949  28.048  1.00 50.40  ? 5    DG  E "C4'" 1 
ATOM   81   O  "O4'" . DG  A  1 5   ? -16.518 -8.742  27.750  1.00 49.06  ? 5    DG  E "O4'" 1 
ATOM   82   C  "C3'" . DG  A  1 5   ? -14.348 -8.645  26.761  1.00 49.78  ? 5    DG  E "C3'" 1 
ATOM   83   O  "O3'" . DG  A  1 5   ? -13.400 -9.704  26.502  1.00 49.63  ? 5    DG  E "O3'" 1 
ATOM   84   C  "C2'" . DG  A  1 5   ? -15.449 -8.564  25.705  1.00 48.59  ? 5    DG  E "C2'" 1 
ATOM   85   C  "C1'" . DG  A  1 5   ? -16.680 -9.127  26.411  1.00 46.91  ? 5    DG  E "C1'" 1 
ATOM   86   N  N9    . DG  A  1 5   ? -17.915 -8.567  25.871  1.00 46.34  ? 5    DG  E N9    1 
ATOM   87   C  C8    . DG  A  1 5   ? -18.326 -7.255  25.904  1.00 45.79  ? 5    DG  E C8    1 
ATOM   88   N  N7    . DG  A  1 5   ? -19.473 -7.065  25.315  1.00 45.86  ? 5    DG  E N7    1 
ATOM   89   C  C5    . DG  A  1 5   ? -19.845 -8.326  24.861  1.00 45.41  ? 5    DG  E C5    1 
ATOM   90   C  C6    . DG  A  1 5   ? -20.992 -8.747  24.150  1.00 45.61  ? 5    DG  E C6    1 
ATOM   91   O  O6    . DG  A  1 5   ? -21.950 -8.069  23.762  1.00 45.31  ? 5    DG  E O6    1 
ATOM   92   N  N1    . DG  A  1 5   ? -20.965 -10.114 23.892  1.00 45.88  ? 5    DG  E N1    1 
ATOM   93   C  C2    . DG  A  1 5   ? -19.955 -10.970 24.269  1.00 45.77  ? 5    DG  E C2    1 
ATOM   94   N  N2    . DG  A  1 5   ? -20.093 -12.260 23.934  1.00 45.88  ? 5    DG  E N2    1 
ATOM   95   N  N3    . DG  A  1 5   ? -18.877 -10.589 24.936  1.00 45.75  ? 5    DG  E N3    1 
ATOM   96   C  C4    . DG  A  1 5   ? -18.893 -9.259  25.194  1.00 45.72  ? 5    DG  E C4    1 
ATOM   97   P  P     . DT  A  1 6   ? -12.509 -9.766  25.165  1.00 49.39  ? 6    DT  E P     1 
ATOM   98   O  OP1   . DT  A  1 6   ? -11.093 -9.885  25.568  1.00 48.82  ? 6    DT  E OP1   1 
ATOM   99   O  OP2   . DT  A  1 6   ? -12.924 -8.670  24.253  1.00 48.75  ? 6    DT  E OP2   1 
ATOM   100  O  "O5'" . DT  A  1 6   ? -12.918 -11.177 24.527  1.00 49.25  ? 6    DT  E "O5'" 1 
ATOM   101  C  "C5'" . DT  A  1 6   ? -14.023 -11.920 25.013  1.00 49.41  ? 6    DT  E "C5'" 1 
ATOM   102  C  "C4'" . DT  A  1 6   ? -14.584 -12.818 23.929  1.00 49.59  ? 6    DT  E "C4'" 1 
ATOM   103  O  "O4'" . DT  A  1 6   ? -15.915 -12.362 23.580  1.00 49.16  ? 6    DT  E "O4'" 1 
ATOM   104  C  "C3'" . DT  A  1 6   ? -13.774 -12.842 22.633  1.00 49.99  ? 6    DT  E "C3'" 1 
ATOM   105  O  "O3'" . DT  A  1 6   ? -13.772 -14.150 22.087  1.00 51.26  ? 6    DT  E "O3'" 1 
ATOM   106  C  "C2'" . DT  A  1 6   ? -14.544 -11.881 21.737  1.00 48.96  ? 6    DT  E "C2'" 1 
ATOM   107  C  "C1'" . DT  A  1 6   ? -15.981 -12.120 22.194  1.00 48.00  ? 6    DT  E "C1'" 1 
ATOM   108  N  N1    . DT  A  1 6   ? -16.841 -10.942 21.947  1.00 47.09  ? 6    DT  E N1    1 
ATOM   109  C  C2    . DT  A  1 6   ? -18.028 -11.107 21.277  1.00 46.81  ? 6    DT  E C2    1 
ATOM   110  O  O2    . DT  A  1 6   ? -18.424 -12.186 20.883  1.00 46.62  ? 6    DT  E O2    1 
ATOM   111  N  N3    . DT  A  1 6   ? -18.740 -9.949  21.089  1.00 46.85  ? 6    DT  E N3    1 
ATOM   112  C  C4    . DT  A  1 6   ? -18.385 -8.672  21.491  1.00 45.56  ? 6    DT  E C4    1 
ATOM   113  O  O4    . DT  A  1 6   ? -19.098 -7.703  21.269  1.00 45.62  ? 6    DT  E O4    1 
ATOM   114  C  C5    . DT  A  1 6   ? -17.126 -8.573  22.182  1.00 45.92  ? 6    DT  E C5    1 
ATOM   115  C  C7    . DT  A  1 6   ? -16.634 -7.249  22.690  1.00 46.04  ? 6    DT  E C7    1 
ATOM   116  C  C6    . DT  A  1 6   ? -16.424 -9.697  22.370  1.00 46.40  ? 6    DT  E C6    1 
ATOM   117  P  P     . DT  A  1 7   ? -12.642 -14.624 21.051  1.00 52.92  ? 7    DT  E P     1 
ATOM   118  O  OP1   . DT  A  1 7   ? -12.149 -15.935 21.544  1.00 53.09  ? 7    DT  E OP1   1 
ATOM   119  O  OP2   . DT  A  1 7   ? -11.699 -13.500 20.815  1.00 52.53  ? 7    DT  E OP2   1 
ATOM   120  O  "O5'" . DT  A  1 7   ? -13.470 -14.909 19.717  1.00 52.03  ? 7    DT  E "O5'" 1 
ATOM   121  C  "C5'" . DT  A  1 7   ? -14.739 -15.537 19.830  1.00 52.27  ? 7    DT  E "C5'" 1 
ATOM   122  C  "C4'" . DT  A  1 7   ? -15.402 -15.572 18.471  1.00 52.24  ? 7    DT  E "C4'" 1 
ATOM   123  O  "O4'" . DT  A  1 7   ? -16.378 -14.502 18.380  1.00 51.76  ? 7    DT  E "O4'" 1 
ATOM   124  C  "C3'" . DT  A  1 7   ? -14.440 -15.404 17.294  1.00 52.21  ? 7    DT  E "C3'" 1 
ATOM   125  O  "O3'" . DT  A  1 7   ? -14.827 -16.365 16.296  1.00 52.69  ? 7    DT  E "O3'" 1 
ATOM   126  C  "C2'" . DT  A  1 7   ? -14.647 -13.942 16.885  1.00 51.60  ? 7    DT  E "C2'" 1 
ATOM   127  C  "C1'" . DT  A  1 7   ? -16.119 -13.718 17.233  1.00 50.94  ? 7    DT  E "C1'" 1 
ATOM   128  N  N1    . DT  A  1 7   ? -16.470 -12.311 17.559  1.00 49.99  ? 7    DT  E N1    1 
ATOM   129  C  C2    . DT  A  1 7   ? -17.698 -11.808 17.184  1.00 49.87  ? 7    DT  E C2    1 
ATOM   130  O  O2    . DT  A  1 7   ? -18.535 -12.450 16.589  1.00 50.56  ? 7    DT  E O2    1 
ATOM   131  N  N3    . DT  A  1 7   ? -17.925 -10.505 17.535  1.00 49.92  ? 7    DT  E N3    1 
ATOM   132  C  C4    . DT  A  1 7   ? -17.056 -9.675  18.218  1.00 49.66  ? 7    DT  E C4    1 
ATOM   133  O  O4    . DT  A  1 7   ? -17.353 -8.517  18.484  1.00 50.05  ? 7    DT  E O4    1 
ATOM   134  C  C5    . DT  A  1 7   ? -15.783 -10.259 18.582  1.00 49.37  ? 7    DT  E C5    1 
ATOM   135  C  C7    . DT  A  1 7   ? -14.691 -9.405  19.158  1.00 48.89  ? 7    DT  E C7    1 
ATOM   136  C  C6    . DT  A  1 7   ? -15.558 -11.535 18.241  1.00 49.58  ? 7    DT  E C6    1 
ATOM   137  P  P     . DA  A  1 8   ? -14.265 -16.419 14.787  1.00 52.58  ? 8    DA  E P     1 
ATOM   138  O  OP1   . DA  A  1 8   ? -14.427 -17.818 14.330  1.00 52.10  ? 8    DA  E OP1   1 
ATOM   139  O  OP2   . DA  A  1 8   ? -12.928 -15.764 14.745  1.00 51.65  ? 8    DA  E OP2   1 
ATOM   140  O  "O5'" . DA  A  1 8   ? -15.342 -15.532 13.977  1.00 49.18  ? 8    DA  E "O5'" 1 
ATOM   141  C  "C5'" . DA  A  1 8   ? -16.698 -15.962 13.852  1.00 45.77  ? 8    DA  E "C5'" 1 
ATOM   142  C  "C4'" . DA  A  1 8   ? -17.475 -15.114 12.857  1.00 43.37  ? 8    DA  E "C4'" 1 
ATOM   143  O  "O4'" . DA  A  1 8   ? -17.812 -13.833 13.456  1.00 43.00  ? 8    DA  E "O4'" 1 
ATOM   144  C  "C3'" . DA  A  1 8   ? -16.719 -14.801 11.564  1.00 42.05  ? 8    DA  E "C3'" 1 
ATOM   145  O  "O3'" . DA  A  1 8   ? -17.599 -14.933 10.456  1.00 40.00  ? 8    DA  E "O3'" 1 
ATOM   146  C  "C2'" . DA  A  1 8   ? -16.245 -13.361 11.758  1.00 41.19  ? 8    DA  E "C2'" 1 
ATOM   147  C  "C1'" . DA  A  1 8   ? -17.379 -12.781 12.605  1.00 41.16  ? 8    DA  E "C1'" 1 
ATOM   148  N  N9    . DA  A  1 8   ? -16.983 -11.612 13.395  1.00 40.43  ? 8    DA  E N9    1 
ATOM   149  C  C8    . DA  A  1 8   ? -15.848 -11.450 14.142  1.00 39.85  ? 8    DA  E C8    1 
ATOM   150  N  N7    . DA  A  1 8   ? -15.760 -10.282 14.735  1.00 39.81  ? 8    DA  E N7    1 
ATOM   151  C  C5    . DA  A  1 8   ? -16.919 -9.622  14.345  1.00 40.35  ? 8    DA  E C5    1 
ATOM   152  C  C6    . DA  A  1 8   ? -17.441 -8.338  14.626  1.00 40.26  ? 8    DA  E C6    1 
ATOM   153  N  N6    . DA  A  1 8   ? -16.837 -7.441  15.409  1.00 40.09  ? 8    DA  E N6    1 
ATOM   154  N  N1    . DA  A  1 8   ? -18.625 -8.000  14.076  1.00 40.56  ? 8    DA  E N1    1 
ATOM   155  C  C2    . DA  A  1 8   ? -19.240 -8.889  13.294  1.00 40.73  ? 8    DA  E C2    1 
ATOM   156  N  N3    . DA  A  1 8   ? -18.853 -10.124 12.958  1.00 40.93  ? 8    DA  E N3    1 
ATOM   157  C  C4    . DA  A  1 8   ? -17.676 -10.432 13.518  1.00 40.37  ? 8    DA  E C4    1 
ATOM   158  P  P     . DG  A  1 9   ? -17.056 -14.926 8.950   1.00 39.42  ? 9    DG  E P     1 
ATOM   159  O  OP1   . DG  A  1 9   ? -17.915 -15.872 8.190   1.00 38.69  ? 9    DG  E OP1   1 
ATOM   160  O  OP2   . DG  A  1 9   ? -15.587 -15.071 8.939   1.00 38.33  ? 9    DG  E OP2   1 
ATOM   161  O  "O5'" . DG  A  1 9   ? -17.404 -13.441 8.467   1.00 38.34  ? 9    DG  E "O5'" 1 
ATOM   162  C  "C5'" . DG  A  1 9   ? -18.766 -12.988 8.414   1.00 36.05  ? 9    DG  E "C5'" 1 
ATOM   163  C  "C4'" . DG  A  1 9   ? -18.779 -11.517 8.049   1.00 34.64  ? 9    DG  E "C4'" 1 
ATOM   164  O  "O4'" . DG  A  1 9   ? -18.388 -10.716 9.200   1.00 33.98  ? 9    DG  E "O4'" 1 
ATOM   165  C  "C3'" . DG  A  1 9   ? -17.783 -11.165 6.949   1.00 33.97  ? 9    DG  E "C3'" 1 
ATOM   166  O  "O3'" . DG  A  1 9   ? -18.367 -10.265 6.031   1.00 33.87  ? 9    DG  E "O3'" 1 
ATOM   167  C  "C2'" . DG  A  1 9   ? -16.664 -10.482 7.720   1.00 33.68  ? 9    DG  E "C2'" 1 
ATOM   168  C  "C1'" . DG  A  1 9   ? -17.503 -9.727  8.739   1.00 33.51  ? 9    DG  E "C1'" 1 
ATOM   169  N  N9    . DG  A  1 9   ? -16.691 -9.137  9.796   1.00 33.51  ? 9    DG  E N9    1 
ATOM   170  C  C8    . DG  A  1 9   ? -15.496 -9.617  10.282  1.00 33.57  ? 9    DG  E C8    1 
ATOM   171  N  N7    . DG  A  1 9   ? -14.967 -8.867  11.210  1.00 33.54  ? 9    DG  E N7    1 
ATOM   172  C  C5    . DG  A  1 9   ? -15.868 -7.812  11.342  1.00 33.90  ? 9    DG  E C5    1 
ATOM   173  C  C6    . DG  A  1 9   ? -15.833 -6.687  12.200  1.00 33.44  ? 9    DG  E C6    1 
ATOM   174  O  O6    . DG  A  1 9   ? -14.966 -6.387  13.028  1.00 32.96  ? 9    DG  E O6    1 
ATOM   175  N  N1    . DG  A  1 9   ? -16.941 -5.862  12.018  1.00 34.23  ? 9    DG  E N1    1 
ATOM   176  C  C2    . DG  A  1 9   ? -17.961 -6.097  11.118  1.00 34.63  ? 9    DG  E C2    1 
ATOM   177  N  N2    . DG  A  1 9   ? -18.955 -5.198  11.072  1.00 33.26  ? 9    DG  E N2    1 
ATOM   178  N  N3    . DG  A  1 9   ? -18.001 -7.155  10.312  1.00 34.74  ? 9    DG  E N3    1 
ATOM   179  C  C4    . DG  A  1 9   ? -16.929 -7.965  10.476  1.00 33.58  ? 9    DG  E C4    1 
ATOM   180  P  P     . DC  A  1 10  ? -17.905 -10.312 4.514   1.00 33.25  ? 10   DC  E P     1 
ATOM   181  O  OP1   . DC  A  1 10  ? -19.015 -10.965 3.803   1.00 35.82  ? 10   DC  E OP1   1 
ATOM   182  O  OP2   . DC  A  1 10  ? -16.537 -10.854 4.478   1.00 34.03  ? 10   DC  E OP2   1 
ATOM   183  O  "O5'" . DC  A  1 10  ? -17.841 -8.820  3.961   1.00 33.77  ? 10   DC  E "O5'" 1 
ATOM   184  C  "C5'" . DC  A  1 10  ? -16.916 -7.911  4.533   1.00 32.88  ? 10   DC  E "C5'" 1 
ATOM   185  C  "C4'" . DC  A  1 10  ? -17.680 -6.766  5.172   1.00 32.36  ? 10   DC  E "C4'" 1 
ATOM   186  O  "O4'" . DC  A  1 10  ? -17.704 -6.878  6.629   1.00 31.82  ? 10   DC  E "O4'" 1 
ATOM   187  C  "C3'" . DC  A  1 10  ? -17.094 -5.405  4.868   1.00 31.11  ? 10   DC  E "C3'" 1 
ATOM   188  O  "O3'" . DC  A  1 10  ? -17.644 -4.975  3.651   1.00 31.43  ? 10   DC  E "O3'" 1 
ATOM   189  C  "C2'" . DC  A  1 10  ? -17.612 -4.601  6.052   1.00 30.64  ? 10   DC  E "C2'" 1 
ATOM   190  C  "C1'" . DC  A  1 10  ? -17.532 -5.598  7.202   1.00 29.34  ? 10   DC  E "C1'" 1 
ATOM   191  N  N1    . DC  A  1 10  ? -16.254 -5.607  7.974   1.00 29.66  ? 10   DC  E N1    1 
ATOM   192  C  C2    . DC  A  1 10  ? -15.979 -4.567  8.880   1.00 30.16  ? 10   DC  E C2    1 
ATOM   193  O  O2    . DC  A  1 10  ? -16.789 -3.639  9.017   1.00 31.90  ? 10   DC  E O2    1 
ATOM   194  N  N3    . DC  A  1 10  ? -14.819 -4.594  9.587   1.00 29.03  ? 10   DC  E N3    1 
ATOM   195  C  C4    . DC  A  1 10  ? -13.964 -5.603  9.426   1.00 27.84  ? 10   DC  E C4    1 
ATOM   196  N  N4    . DC  A  1 10  ? -12.847 -5.562  10.150  1.00 27.20  ? 10   DC  E N4    1 
ATOM   197  C  C5    . DC  A  1 10  ? -14.219 -6.676  8.517   1.00 27.67  ? 10   DC  E C5    1 
ATOM   198  C  C6    . DC  A  1 10  ? -15.364 -6.640  7.818   1.00 28.50  ? 10   DC  E C6    1 
ATOM   199  P  P     . DA  A  1 11  ? -17.031 -3.716  2.884   1.00 32.52  ? 11   DA  E P     1 
ATOM   200  O  OP1   . DA  A  1 11  ? -17.859 -3.449  1.691   1.00 32.75  ? 11   DA  E OP1   1 
ATOM   201  O  OP2   . DA  A  1 11  ? -15.561 -3.898  2.743   1.00 32.10  ? 11   DA  E OP2   1 
ATOM   202  O  "O5'" . DA  A  1 11  ? -17.228 -2.527  3.938   1.00 34.60  ? 11   DA  E "O5'" 1 
ATOM   203  C  "C5'" . DA  A  1 11  ? -18.416 -1.757  4.042   1.00 34.91  ? 11   DA  E "C5'" 1 
ATOM   204  C  "C4'" . DA  A  1 11  ? -18.044 -0.517  4.823   1.00 35.15  ? 11   DA  E "C4'" 1 
ATOM   205  O  "O4'" . DA  A  1 11  ? -17.467 -0.947  6.075   1.00 34.34  ? 11   DA  E "O4'" 1 
ATOM   206  C  "C3'" . DA  A  1 11  ? -16.962 0.300   4.142   1.00 35.78  ? 11   DA  E "C3'" 1 
ATOM   207  O  "O3'" . DA  A  1 11  ? -17.543 1.360   3.389   1.00 37.04  ? 11   DA  E "O3'" 1 
ATOM   208  C  "C2'" . DA  A  1 11  ? -16.121 0.852   5.286   1.00 34.95  ? 11   DA  E "C2'" 1 
ATOM   209  C  "C1'" . DA  A  1 11  ? -16.375 -0.119  6.433   1.00 34.74  ? 11   DA  E "C1'" 1 
ATOM   210  N  N9    . DA  A  1 11  ? -15.235 -0.968  6.799   1.00 34.60  ? 11   DA  E N9    1 
ATOM   211  C  C8    . DA  A  1 11  ? -14.957 -2.237  6.356   1.00 35.26  ? 11   DA  E C8    1 
ATOM   212  N  N7    . DA  A  1 11  ? -13.865 -2.761  6.872   1.00 35.05  ? 11   DA  E N7    1 
ATOM   213  C  C5    . DA  A  1 11  ? -13.396 -1.765  7.721   1.00 35.11  ? 11   DA  E C5    1 
ATOM   214  C  C6    . DA  A  1 11  ? -12.276 -1.683  8.578   1.00 34.52  ? 11   DA  E C6    1 
ATOM   215  N  N6    . DA  A  1 11  ? -11.377 -2.653  8.724   1.00 34.39  ? 11   DA  E N6    1 
ATOM   216  N  N1    . DA  A  1 11  ? -12.103 -0.546  9.280   1.00 34.75  ? 11   DA  E N1    1 
ATOM   217  C  C2    . DA  A  1 11  ? -12.994 0.445   9.139   1.00 34.70  ? 11   DA  E C2    1 
ATOM   218  N  N3    . DA  A  1 11  ? -14.083 0.482   8.378   1.00 34.48  ? 11   DA  E N3    1 
ATOM   219  C  C4    . DA  A  1 11  ? -14.229 -0.657  7.683   1.00 34.48  ? 11   DA  E C4    1 
ATOM   220  P  P     . DC  A  1 12  ? -16.632 1.996   2.234   1.00 37.47  ? 12   DC  E P     1 
ATOM   221  O  OP1   . DC  A  1 12  ? -17.500 2.768   1.323   1.00 36.97  ? 12   DC  E OP1   1 
ATOM   222  O  OP2   . DC  A  1 12  ? -15.752 0.926   1.711   1.00 37.06  ? 12   DC  E OP2   1 
ATOM   223  O  "O5'" . DC  A  1 12  ? -15.704 3.006   3.056   1.00 36.77  ? 12   DC  E "O5'" 1 
ATOM   224  C  "C5'" . DC  A  1 12  ? -16.240 3.941   3.986   1.00 34.61  ? 12   DC  E "C5'" 1 
ATOM   225  C  "C4'" . DC  A  1 12  ? -15.085 4.671   4.634   1.00 33.02  ? 12   DC  E "C4'" 1 
ATOM   226  O  "O4'" . DC  A  1 12  ? -14.323 3.704   5.399   1.00 33.55  ? 12   DC  E "O4'" 1 
ATOM   227  C  "C3'" . DC  A  1 12  ? -14.103 5.276   3.636   1.00 32.73  ? 12   DC  E "C3'" 1 
ATOM   228  O  "O3'" . DC  A  1 12  ? -13.860 6.615   4.012   1.00 31.60  ? 12   DC  E "O3'" 1 
ATOM   229  C  "C2'" . DC  A  1 12  ? -12.838 4.405   3.720   1.00 31.89  ? 12   DC  E "C2'" 1 
ATOM   230  C  "C1'" . DC  A  1 12  ? -12.939 3.863   5.144   1.00 32.58  ? 12   DC  E "C1'" 1 
ATOM   231  N  N1    . DC  A  1 12  ? -12.275 2.546   5.358   1.00 31.38  ? 12   DC  E N1    1 
ATOM   232  C  C2    . DC  A  1 12  ? -11.217 2.413   6.273   1.00 31.76  ? 12   DC  E C2    1 
ATOM   233  O  O2    . DC  A  1 12  ? -10.820 3.384   6.919   1.00 32.95  ? 12   DC  E O2    1 
ATOM   234  N  N3    . DC  A  1 12  ? -10.637 1.213   6.449   1.00 31.76  ? 12   DC  E N3    1 
ATOM   235  C  C4    . DC  A  1 12  ? -11.071 0.170   5.748   1.00 31.75  ? 12   DC  E C4    1 
ATOM   236  N  N4    . DC  A  1 12  ? -10.468 -1.003  5.951   1.00 32.08  ? 12   DC  E N4    1 
ATOM   237  C  C5    . DC  A  1 12  ? -12.147 0.281   4.819   1.00 31.64  ? 12   DC  E C5    1 
ATOM   238  C  C6    . DC  A  1 12  ? -12.717 1.476   4.657   1.00 30.82  ? 12   DC  E C6    1 
ATOM   239  P  P     . DA  A  1 13  ? -12.804 7.493   3.185   1.00 31.77  ? 13   DA  E P     1 
ATOM   240  O  OP1   . DA  A  1 13  ? -13.189 8.918   3.323   1.00 32.25  ? 13   DA  E OP1   1 
ATOM   241  O  OP2   . DA  A  1 13  ? -12.669 6.909   1.836   1.00 30.93  ? 13   DA  E OP2   1 
ATOM   242  O  "O5'" . DA  A  1 13  ? -11.456 7.314   4.027   1.00 30.79  ? 13   DA  E "O5'" 1 
ATOM   243  C  "C5'" . DA  A  1 13  ? -11.461 7.689   5.399   1.00 29.18  ? 13   DA  E "C5'" 1 
ATOM   244  C  "C4'" . DA  A  1 13  ? -10.051 7.785   5.946   1.00 28.26  ? 13   DA  E "C4'" 1 
ATOM   245  O  "O4'" . DA  A  1 13  ? -9.512  6.454   6.131   1.00 29.23  ? 13   DA  E "O4'" 1 
ATOM   246  C  "C3'" . DA  A  1 13  ? -9.050  8.517   5.062   1.00 28.21  ? 13   DA  E "C3'" 1 
ATOM   247  O  "O3'" . DA  A  1 13  ? -8.243  9.265   5.938   1.00 28.00  ? 13   DA  E "O3'" 1 
ATOM   248  C  "C2'" . DA  A  1 13  ? -8.281  7.392   4.357   1.00 27.75  ? 13   DA  E "C2'" 1 
ATOM   249  C  "C1'" . DA  A  1 13  ? -8.278  6.311   5.440   1.00 28.19  ? 13   DA  E "C1'" 1 
ATOM   250  N  N9    . DA  A  1 13  ? -8.267  4.912   5.017   1.00 28.17  ? 13   DA  E N9    1 
ATOM   251  C  C8    . DA  A  1 13  ? -9.064  4.345   4.058   1.00 28.18  ? 13   DA  E C8    1 
ATOM   252  N  N7    . DA  A  1 13  ? -8.865  3.054   3.903   1.00 27.92  ? 13   DA  E N7    1 
ATOM   253  C  C5    . DA  A  1 13  ? -7.880  2.748   4.833   1.00 27.37  ? 13   DA  E C5    1 
ATOM   254  C  C6    . DA  A  1 13  ? -7.234  1.540   5.161   1.00 27.27  ? 13   DA  E C6    1 
ATOM   255  N  N6    . DA  A  1 13  ? -7.514  0.383   4.555   1.00 26.61  ? 13   DA  E N6    1 
ATOM   256  N  N1    . DA  A  1 13  ? -6.291  1.572   6.132   1.00 27.50  ? 13   DA  E N1    1 
ATOM   257  C  C2    . DA  A  1 13  ? -6.026  2.742   6.727   1.00 27.60  ? 13   DA  E C2    1 
ATOM   258  N  N3    . DA  A  1 13  ? -6.575  3.942   6.499   1.00 28.13  ? 13   DA  E N3    1 
ATOM   259  C  C4    . DA  A  1 13  ? -7.503  3.880   5.532   1.00 27.64  ? 13   DA  E C4    1 
ATOM   260  P  P     . DG  A  1 14  ? -7.156  10.323  5.433   1.00 28.66  ? 14   DG  E P     1 
ATOM   261  O  OP1   . DG  A  1 14  ? -6.854  11.168  6.609   1.00 30.06  ? 14   DG  E OP1   1 
ATOM   262  O  OP2   . DG  A  1 14  ? -7.596  10.922  4.162   1.00 29.36  ? 14   DG  E OP2   1 
ATOM   263  O  "O5'" . DG  A  1 14  ? -5.851  9.443   5.201   1.00 30.37  ? 14   DG  E "O5'" 1 
ATOM   264  C  "C5'" . DG  A  1 14  ? -5.262  8.834   6.357   1.00 28.98  ? 14   DG  E "C5'" 1 
ATOM   265  C  "C4'" . DG  A  1 14  ? -4.146  7.910   5.938   1.00 28.90  ? 14   DG  E "C4'" 1 
ATOM   266  O  "O4'" . DG  A  1 14  ? -4.721  6.695   5.405   1.00 29.44  ? 14   DG  E "O4'" 1 
ATOM   267  C  "C3'" . DG  A  1 14  ? -3.242  8.455   4.832   1.00 30.10  ? 14   DG  E "C3'" 1 
ATOM   268  O  "O3'" . DG  A  1 14  ? -1.909  8.134   5.161   1.00 30.92  ? 14   DG  E "O3'" 1 
ATOM   269  C  "C2'" . DG  A  1 14  ? -3.682  7.681   3.596   1.00 29.26  ? 14   DG  E "C2'" 1 
ATOM   270  C  "C1'" . DG  A  1 14  ? -3.913  6.352   4.298   1.00 28.97  ? 14   DG  E "C1'" 1 
ATOM   271  N  N9    . DG  A  1 14  ? -4.530  5.290   3.513   1.00 28.63  ? 14   DG  E N9    1 
ATOM   272  C  C8    . DG  A  1 14  ? -5.506  5.381   2.547   1.00 28.83  ? 14   DG  E C8    1 
ATOM   273  N  N7    . DG  A  1 14  ? -5.834  4.214   2.045   1.00 29.56  ? 14   DG  E N7    1 
ATOM   274  C  C5    . DG  A  1 14  ? -5.021  3.303   2.722   1.00 28.67  ? 14   DG  E C5    1 
ATOM   275  C  C6    . DG  A  1 14  ? -4.909  1.897   2.612   1.00 28.85  ? 14   DG  E C6    1 
ATOM   276  O  O6    . DG  A  1 14  ? -5.538  1.142   1.858   1.00 28.72  ? 14   DG  E O6    1 
ATOM   277  N  N1    . DG  A  1 14  ? -3.955  1.372   3.490   1.00 28.36  ? 14   DG  E N1    1 
ATOM   278  C  C2    . DG  A  1 14  ? -3.205  2.120   4.363   1.00 27.47  ? 14   DG  E C2    1 
ATOM   279  N  N2    . DG  A  1 14  ? -2.326  1.477   5.132   1.00 28.12  ? 14   DG  E N2    1 
ATOM   280  N  N3    . DG  A  1 14  ? -3.302  3.432   4.475   1.00 28.97  ? 14   DG  E N3    1 
ATOM   281  C  C4    . DG  A  1 14  ? -4.220  3.955   3.625   1.00 28.70  ? 14   DG  E C4    1 
ATOM   282  P  P     . DG  A  1 15  ? -0.798  9.276   5.344   1.00 32.37  ? 15   DG  E P     1 
ATOM   283  O  OP1   . DG  A  1 15  ? -0.709  9.605   6.774   1.00 32.43  ? 15   DG  E OP1   1 
ATOM   284  O  OP2   . DG  A  1 15  ? -1.032  10.346  4.348   1.00 31.16  ? 15   DG  E OP2   1 
ATOM   285  O  "O5'" . DG  A  1 15  ? 0.544   8.460   4.980   1.00 32.46  ? 15   DG  E "O5'" 1 
ATOM   286  C  "C5'" . DG  A  1 15  ? 0.646   7.725   3.758   1.00 30.82  ? 15   DG  E "C5'" 1 
ATOM   287  C  "C4'" . DG  A  1 15  ? 1.105   6.290   3.972   1.00 28.87  ? 15   DG  E "C4'" 1 
ATOM   288  O  "O4'" . DG  A  1 15  ? -0.041  5.411   4.044   1.00 28.67  ? 15   DG  E "O4'" 1 
ATOM   289  C  "C3'" . DG  A  1 15  ? 1.897   5.701   2.819   1.00 28.41  ? 15   DG  E "C3'" 1 
ATOM   290  O  "O3'" . DG  A  1 15  ? 3.234   6.080   2.936   1.00 29.38  ? 15   DG  E "O3'" 1 
ATOM   291  C  "C2'" . DG  A  1 15  ? 1.761   4.220   3.113   1.00 28.48  ? 15   DG  E "C2'" 1 
ATOM   292  C  "C1'" . DG  A  1 15  ? 0.315   4.124   3.575   1.00 27.46  ? 15   DG  E "C1'" 1 
ATOM   293  N  N9    . DG  A  1 15  ? -0.609  3.715   2.518   1.00 27.60  ? 15   DG  E N9    1 
ATOM   294  C  C8    . DG  A  1 15  ? -1.539  4.503   1.874   1.00 27.17  ? 15   DG  E C8    1 
ATOM   295  N  N7    . DG  A  1 15  ? -2.229  3.852   0.973   1.00 27.48  ? 15   DG  E N7    1 
ATOM   296  C  C5    . DG  A  1 15  ? -1.721  2.552   1.008   1.00 27.07  ? 15   DG  E C5    1 
ATOM   297  C  C6    . DG  A  1 15  ? -2.062  1.400   0.257   1.00 26.92  ? 15   DG  E C6    1 
ATOM   298  O  O6    . DG  A  1 15  ? -2.922  1.273   -0.619  1.00 27.10  ? 15   DG  E O6    1 
ATOM   299  N  N1    . DG  A  1 15  ? -1.293  0.289   0.604   1.00 26.65  ? 15   DG  E N1    1 
ATOM   300  C  C2    . DG  A  1 15  ? -0.316  0.290   1.561   1.00 26.20  ? 15   DG  E C2    1 
ATOM   301  N  N2    . DG  A  1 15  ? 0.310   -0.869  1.757   1.00 27.00  ? 15   DG  E N2    1 
ATOM   302  N  N3    . DG  A  1 15  ? 0.017   1.351   2.279   1.00 27.24  ? 15   DG  E N3    1 
ATOM   303  C  C4    . DG  A  1 15  ? -0.719  2.451   1.953   1.00 27.43  ? 15   DG  E C4    1 
ATOM   304  P  P     . DC  A  1 16  ? 4.166   6.262   1.654   1.00 30.75  ? 16   DC  E P     1 
ATOM   305  O  OP1   . DC  A  1 16  ? 5.422   6.883   2.112   1.00 30.02  ? 16   DC  E OP1   1 
ATOM   306  O  OP2   . DC  A  1 16  ? 3.361   6.877   0.580   1.00 31.58  ? 16   DC  E OP2   1 
ATOM   307  O  "O5'" . DC  A  1 16  ? 4.494   4.756   1.204   1.00 30.54  ? 16   DC  E "O5'" 1 
ATOM   308  C  "C5'" . DC  A  1 16  ? 5.155   3.832   2.083   1.00 27.58  ? 16   DC  E "C5'" 1 
ATOM   309  C  "C4'" . DC  A  1 16  ? 5.020   2.417   1.556   1.00 26.56  ? 16   DC  E "C4'" 1 
ATOM   310  O  "O4'" . DC  A  1 16  ? 3.617   2.040   1.472   1.00 25.66  ? 16   DC  E "O4'" 1 
ATOM   311  C  "C3'" . DC  A  1 16  ? 5.573   2.184   0.149   1.00 26.04  ? 16   DC  E "C3'" 1 
ATOM   312  O  "O3'" . DC  A  1 16  ? 6.971   1.952   0.196   1.00 26.68  ? 16   DC  E "O3'" 1 
ATOM   313  C  "C2'" . DC  A  1 16  ? 4.823   0.925   -0.269  1.00 25.75  ? 16   DC  E "C2'" 1 
ATOM   314  C  "C1'" . DC  A  1 16  ? 3.470   1.077   0.428   1.00 25.43  ? 16   DC  E "C1'" 1 
ATOM   315  N  N1    . DC  A  1 16  ? 2.365   1.509   -0.458  1.00 24.92  ? 16   DC  E N1    1 
ATOM   316  C  C2    . DC  A  1 16  ? 1.734   0.590   -1.306  1.00 25.23  ? 16   DC  E C2    1 
ATOM   317  O  O2    . DC  A  1 16  ? 2.112   -0.585  -1.329  1.00 24.96  ? 16   DC  E O2    1 
ATOM   318  N  N3    . DC  A  1 16  ? 0.713   1.011   -2.090  1.00 24.30  ? 16   DC  E N3    1 
ATOM   319  C  C4    . DC  A  1 16  ? 0.321   2.285   -2.038  1.00 25.24  ? 16   DC  E C4    1 
ATOM   320  N  N4    . DC  A  1 16  ? -0.689  2.650   -2.830  1.00 25.39  ? 16   DC  E N4    1 
ATOM   321  C  C5    . DC  A  1 16  ? 0.949   3.246   -1.191  1.00 25.35  ? 16   DC  E C5    1 
ATOM   322  C  C6    . DC  A  1 16  ? 1.952   2.811   -0.420  1.00 25.72  ? 16   DC  E C6    1 
ATOM   323  P  P     . DT  A  1 17  ? 7.947   2.188   -1.062  1.00 28.11  ? 17   DT  E P     1 
ATOM   324  O  OP1   . DT  A  1 17  ? 9.339   2.117   -0.572  1.00 27.20  ? 17   DT  E OP1   1 
ATOM   325  O  OP2   . DT  A  1 17  ? 7.511   3.360   -1.859  1.00 27.74  ? 17   DT  E OP2   1 
ATOM   326  O  "O5'" . DT  A  1 17  ? 7.662   0.858   -1.898  1.00 28.92  ? 17   DT  E "O5'" 1 
ATOM   327  C  "C5'" . DT  A  1 17  ? 7.904   -0.426  -1.300  1.00 28.24  ? 17   DT  E "C5'" 1 
ATOM   328  C  "C4'" . DT  A  1 17  ? 7.612   -1.512  -2.319  1.00 27.71  ? 17   DT  E "C4'" 1 
ATOM   329  O  "O4'" . DT  A  1 17  ? 6.214   -1.415  -2.697  1.00 27.85  ? 17   DT  E "O4'" 1 
ATOM   330  C  "C3'" . DT  A  1 17  ? 8.421   -1.381  -3.610  1.00 27.82  ? 17   DT  E "C3'" 1 
ATOM   331  O  "O3'" . DT  A  1 17  ? 8.879   -2.680  -4.018  1.00 27.77  ? 17   DT  E "O3'" 1 
ATOM   332  C  "C2'" . DT  A  1 17  ? 7.434   -0.740  -4.593  1.00 27.13  ? 17   DT  E "C2'" 1 
ATOM   333  C  "C1'" . DT  A  1 17  ? 6.097   -1.281  -4.103  1.00 27.78  ? 17   DT  E "C1'" 1 
ATOM   334  N  N1    . DT  A  1 17  ? 4.944   -0.389  -4.419  1.00 27.71  ? 17   DT  E N1    1 
ATOM   335  C  C2    . DT  A  1 17  ? 3.867   -0.862  -5.148  1.00 28.29  ? 17   DT  E C2    1 
ATOM   336  O  O2    . DT  A  1 17  ? 3.773   -2.008  -5.567  1.00 28.37  ? 17   DT  E O2    1 
ATOM   337  N  N3    . DT  A  1 17  ? 2.878   0.067   -5.369  1.00 28.31  ? 17   DT  E N3    1 
ATOM   338  C  C4    . DT  A  1 17  ? 2.868   1.390   -4.948  1.00 28.76  ? 17   DT  E C4    1 
ATOM   339  O  O4    . DT  A  1 17  ? 1.948   2.164   -5.190  1.00 28.69  ? 17   DT  E O4    1 
ATOM   340  C  C5    . DT  A  1 17  ? 4.021   1.811   -4.204  1.00 27.49  ? 17   DT  E C5    1 
ATOM   341  C  C7    . DT  A  1 17  ? 4.221   3.260   -3.922  1.00 28.19  ? 17   DT  E C7    1 
ATOM   342  C  C6    . DT  A  1 17  ? 4.988   0.917   -3.979  1.00 28.35  ? 17   DT  E C6    1 
ATOM   343  P  P     . DG  A  1 18  ? 9.792   -2.978  -5.319  1.00 27.38  ? 18   DG  E P     1 
ATOM   344  O  OP1   . DG  A  1 18  ? 10.533  -4.228  -5.017  1.00 28.19  ? 18   DG  E OP1   1 
ATOM   345  O  OP2   . DG  A  1 18  ? 10.534  -1.768  -5.749  1.00 25.10  ? 18   DG  E OP2   1 
ATOM   346  O  "O5'" . DG  A  1 18  ? 8.677   -3.368  -6.390  1.00 25.48  ? 18   DG  E "O5'" 1 
ATOM   347  C  "C5'" . DG  A  1 18  ? 7.896   -4.534  -6.208  1.00 24.57  ? 18   DG  E "C5'" 1 
ATOM   348  C  "C4'" . DG  A  1 18  ? 7.088   -4.790  -7.467  1.00 24.16  ? 18   DG  E "C4'" 1 
ATOM   349  O  "O4'" . DG  A  1 18  ? 6.032   -3.797  -7.594  1.00 23.26  ? 18   DG  E "O4'" 1 
ATOM   350  C  "C3'" . DG  A  1 18  ? 7.880   -4.709  -8.762  1.00 24.38  ? 18   DG  E "C3'" 1 
ATOM   351  O  "O3'" . DG  A  1 18  ? 7.423   -5.795  -9.561  1.00 25.92  ? 18   DG  E "O3'" 1 
ATOM   352  C  "C2'" . DG  A  1 18  ? 7.460   -3.355  -9.355  1.00 24.00  ? 18   DG  E "C2'" 1 
ATOM   353  C  "C1'" . DG  A  1 18  ? 6.010   -3.228  -8.880  1.00 22.59  ? 18   DG  E "C1'" 1 
ATOM   354  N  N9    . DG  A  1 18  ? 5.479   -1.867  -8.720  1.00 22.94  ? 18   DG  E N9    1 
ATOM   355  C  C8    . DG  A  1 18  ? 6.094   -0.851  -8.032  1.00 22.96  ? 18   DG  E C8    1 
ATOM   356  N  N7    . DG  A  1 18  ? 5.418   0.263   -8.012  1.00 22.48  ? 18   DG  E N7    1 
ATOM   357  C  C5    . DG  A  1 18  ? 4.273   -0.020  -8.739  1.00 23.14  ? 18   DG  E C5    1 
ATOM   358  C  C6    . DG  A  1 18  ? 3.164   0.821   -9.051  1.00 23.03  ? 18   DG  E C6    1 
ATOM   359  O  O6    . DG  A  1 18  ? 3.001   2.004   -8.731  1.00 22.86  ? 18   DG  E O6    1 
ATOM   360  N  N1    . DG  A  1 18  ? 2.189   0.167   -9.800  1.00 21.82  ? 18   DG  E N1    1 
ATOM   361  C  C2    . DG  A  1 18  ? 2.281   -1.146  -10.196 1.00 22.65  ? 18   DG  E C2    1 
ATOM   362  N  N2    . DG  A  1 18  ? 1.252   -1.622  -10.916 1.00 21.66  ? 18   DG  E N2    1 
ATOM   363  N  N3    . DG  A  1 18  ? 3.317   -1.940  -9.901  1.00 23.36  ? 18   DG  E N3    1 
ATOM   364  C  C4    . DG  A  1 18  ? 4.286   -1.325  -9.176  1.00 22.48  ? 18   DG  E C4    1 
ATOM   365  P  P     . DC  A  1 19  ? 8.164   -6.222  -10.915 1.00 25.86  ? 19   DC  E P     1 
ATOM   366  O  OP1   . DC  A  1 19  ? 7.737   -7.616  -11.133 1.00 25.05  ? 19   DC  E OP1   1 
ATOM   367  O  OP2   . DC  A  1 19  ? 9.591   -5.839  -10.875 1.00 25.04  ? 19   DC  E OP2   1 
ATOM   368  O  "O5'" . DC  A  1 19  ? 7.489   -5.279  -12.014 1.00 25.69  ? 19   DC  E "O5'" 1 
ATOM   369  C  "C5'" . DC  A  1 19  ? 6.143   -5.591  -12.371 1.00 26.08  ? 19   DC  E "C5'" 1 
ATOM   370  C  "C4'" . DC  A  1 19  ? 5.631   -4.600  -13.386 1.00 25.10  ? 19   DC  E "C4'" 1 
ATOM   371  O  "O4'" . DC  A  1 19  ? 5.328   -3.370  -12.696 1.00 25.29  ? 19   DC  E "O4'" 1 
ATOM   372  C  "C3'" . DC  A  1 19  ? 6.639   -4.190  -14.447 1.00 26.35  ? 19   DC  E "C3'" 1 
ATOM   373  O  "O3'" . DC  A  1 19  ? 5.890   -3.957  -15.593 1.00 28.03  ? 19   DC  E "O3'" 1 
ATOM   374  C  "C2'" . DC  A  1 19  ? 7.157   -2.843  -13.963 1.00 25.50  ? 19   DC  E "C2'" 1 
ATOM   375  C  "C1'" . DC  A  1 19  ? 5.816   -2.316  -13.495 1.00 24.41  ? 19   DC  E "C1'" 1 
ATOM   376  N  N1    . DC  A  1 19  ? 5.864   -1.056  -12.711 1.00 24.75  ? 19   DC  E N1    1 
ATOM   377  C  C2    . DC  A  1 19  ? 4.741   -0.202  -12.724 1.00 23.76  ? 19   DC  E C2    1 
ATOM   378  O  O2    . DC  A  1 19  ? 3.741   -0.534  -13.374 1.00 22.96  ? 19   DC  E O2    1 
ATOM   379  N  N3    . DC  A  1 19  ? 4.783   0.956   -12.021 1.00 23.34  ? 19   DC  E N3    1 
ATOM   380  C  C4    . DC  A  1 19  ? 5.880   1.273   -11.323 1.00 23.93  ? 19   DC  E C4    1 
ATOM   381  N  N4    . DC  A  1 19  ? 5.884   2.420   -10.624 1.00 22.33  ? 19   DC  E N4    1 
ATOM   382  C  C5    . DC  A  1 19  ? 7.024   0.415   -11.303 1.00 23.61  ? 19   DC  E C5    1 
ATOM   383  C  C6    . DC  A  1 19  ? 6.980   -0.731  -11.999 1.00 23.82  ? 19   DC  E C6    1 
ATOM   384  P  P     . DC  A  1 20  ? 6.005   -4.826  -16.928 1.00 28.25  ? 20   DC  E P     1 
ATOM   385  O  OP1   . DC  A  1 20  ? 4.873   -5.765  -16.918 1.00 26.80  ? 20   DC  E OP1   1 
ATOM   386  O  OP2   . DC  A  1 20  ? 7.390   -5.349  -17.059 1.00 27.12  ? 20   DC  E OP2   1 
ATOM   387  O  "O5'" . DC  A  1 20  ? 5.824   -3.616  -17.998 1.00 28.34  ? 20   DC  E "O5'" 1 
ATOM   388  C  "C5'" . DC  A  1 20  ? 4.558   -3.285  -18.553 1.00 30.54  ? 20   DC  E "C5'" 1 
ATOM   389  C  "C4'" . DC  A  1 20  ? 4.141   -1.802  -18.536 1.00 30.92  ? 20   DC  E "C4'" 1 
ATOM   390  O  "O4'" . DC  A  1 20  ? 4.166   -1.257  -17.192 1.00 30.76  ? 20   DC  E "O4'" 1 
ATOM   391  C  "C3'" . DC  A  1 20  ? 4.916   -0.716  -19.294 1.00 30.45  ? 20   DC  E "C3'" 1 
ATOM   392  O  "O3'" . DC  A  1 20  ? 4.838   -0.766  -20.715 1.00 29.45  ? 20   DC  E "O3'" 1 
ATOM   393  C  "C2'" . DC  A  1 20  ? 4.086   0.463   -18.814 1.00 30.37  ? 20   DC  E "C2'" 1 
ATOM   394  C  "C1'" . DC  A  1 20  ? 3.872   0.121   -17.340 1.00 30.86  ? 20   DC  E "C1'" 1 
ATOM   395  N  N1    . DC  A  1 20  ? 4.712   0.956   -16.424 1.00 30.79  ? 20   DC  E N1    1 
ATOM   396  C  C2    . DC  A  1 20  ? 4.275   2.253   -16.132 1.00 31.35  ? 20   DC  E C2    1 
ATOM   397  O  O2    . DC  A  1 20  ? 3.214   2.655   -16.641 1.00 31.46  ? 20   DC  E O2    1 
ATOM   398  N  N3    . DC  A  1 20  ? 5.023   3.029   -15.304 1.00 31.01  ? 20   DC  E N3    1 
ATOM   399  C  C4    . DC  A  1 20  ? 6.153   2.552   -14.783 1.00 30.30  ? 20   DC  E C4    1 
ATOM   400  N  N4    . DC  A  1 20  ? 6.853   3.354   -13.969 1.00 30.60  ? 20   DC  E N4    1 
ATOM   401  C  C5    . DC  A  1 20  ? 6.613   1.236   -15.077 1.00 29.60  ? 20   DC  E C5    1 
ATOM   402  C  C6    . DC  A  1 20  ? 5.873   0.480   -15.895 1.00 29.77  ? 20   DC  E C6    1 
ATOM   403  P  P     . DC  A  1 21  ? 5.724   0.223   -21.639 1.00 30.78  ? 21   DC  E P     1 
ATOM   404  O  OP1   . DC  A  1 21  ? 5.838   -0.392  -22.984 1.00 30.13  ? 21   DC  E OP1   1 
ATOM   405  O  OP2   . DC  A  1 21  ? 6.960   0.584   -20.924 1.00 28.80  ? 21   DC  E OP2   1 
ATOM   406  O  "O5'" . DC  A  1 21  ? 4.855   1.567   -21.803 1.00 31.00  ? 21   DC  E "O5'" 1 
ATOM   407  C  "C5'" . DC  A  1 21  ? 3.436   1.620   -21.874 1.00 30.72  ? 21   DC  E "C5'" 1 
ATOM   408  C  "C4'" . DC  A  1 21  ? 2.978   3.067   -21.724 1.00 31.31  ? 21   DC  E "C4'" 1 
ATOM   409  O  "O4'" . DC  A  1 21  ? 3.095   3.455   -20.335 1.00 29.97  ? 21   DC  E "O4'" 1 
ATOM   410  C  "C3'" . DC  A  1 21  ? 3.823   4.092   -22.469 1.00 31.75  ? 21   DC  E "C3'" 1 
ATOM   411  O  "O3'" . DC  A  1 21  ? 3.343   4.266   -23.779 1.00 35.48  ? 21   DC  E "O3'" 1 
ATOM   412  C  "C2'" . DC  A  1 21  ? 3.641   5.368   -21.653 1.00 29.88  ? 21   DC  E "C2'" 1 
ATOM   413  C  "C1'" . DC  A  1 21  ? 3.469   4.824   -20.241 1.00 28.27  ? 21   DC  E "C1'" 1 
ATOM   414  N  N1    . DC  A  1 21  ? 4.657   4.964   -19.328 1.00 28.04  ? 21   DC  E N1    1 
ATOM   415  C  C2    . DC  A  1 21  ? 4.821   6.171   -18.645 1.00 27.54  ? 21   DC  E C2    1 
ATOM   416  O  O2    . DC  A  1 21  ? 3.998   7.074   -18.842 1.00 29.66  ? 21   DC  E O2    1 
ATOM   417  N  N3    . DC  A  1 21  ? 5.866   6.330   -17.796 1.00 25.85  ? 21   DC  E N3    1 
ATOM   418  C  C4    . DC  A  1 21  ? 6.726   5.338   -17.608 1.00 25.18  ? 21   DC  E C4    1 
ATOM   419  N  N4    . DC  A  1 21  ? 7.728   5.577   -16.759 1.00 24.00  ? 21   DC  E N4    1 
ATOM   420  C  C5    . DC  A  1 21  ? 6.587   4.083   -18.289 1.00 26.02  ? 21   DC  E C5    1 
ATOM   421  C  C6    . DC  A  1 21  ? 5.549   3.937   -19.131 1.00 27.04  ? 21   DC  E C6    1 
ATOM   422  P  P     . DT  A  1 22  ? 4.242   4.987   -24.905 1.00 38.09  ? 22   DT  E P     1 
ATOM   423  O  OP1   . DT  A  1 22  ? 3.582   4.662   -26.188 1.00 38.76  ? 22   DT  E OP1   1 
ATOM   424  O  OP2   . DT  A  1 22  ? 5.658   4.661   -24.674 1.00 38.86  ? 22   DT  E OP2   1 
ATOM   425  O  "O5'" . DT  A  1 22  ? 4.076   6.555   -24.648 1.00 39.94  ? 22   DT  E "O5'" 1 
ATOM   426  C  "C5'" . DT  A  1 22  ? 2.767   7.136   -24.569 1.00 41.41  ? 22   DT  E "C5'" 1 
ATOM   427  C  "C4'" . DT  A  1 22  ? 2.877   8.632   -24.348 1.00 42.24  ? 22   DT  E "C4'" 1 
ATOM   428  O  "O4'" . DT  A  1 22  ? 3.425   8.926   -23.037 1.00 41.57  ? 22   DT  E "O4'" 1 
ATOM   429  C  "C3'" . DT  A  1 22  ? 3.774   9.345   -25.351 1.00 43.37  ? 22   DT  E "C3'" 1 
ATOM   430  O  "O3'" . DT  A  1 22  ? 3.185   10.587  -25.615 1.00 47.27  ? 22   DT  E "O3'" 1 
ATOM   431  C  "C2'" . DT  A  1 22  ? 5.074   9.555   -24.597 1.00 42.32  ? 22   DT  E "C2'" 1 
ATOM   432  C  "C1'" . DT  A  1 22  ? 4.592   9.717   -23.160 1.00 41.27  ? 22   DT  E "C1'" 1 
ATOM   433  N  N1    . DT  A  1 22  ? 5.595   9.199   -22.198 1.00 41.17  ? 22   DT  E N1    1 
ATOM   434  C  C2    . DT  A  1 22  ? 6.050   9.997   -21.176 1.00 41.15  ? 22   DT  E C2    1 
ATOM   435  O  O2    . DT  A  1 22  ? 5.672   11.140  -21.009 1.00 41.37  ? 22   DT  E O2    1 
ATOM   436  N  N3    . DT  A  1 22  ? 6.977   9.398   -20.355 1.00 40.64  ? 22   DT  E N3    1 
ATOM   437  C  C4    . DT  A  1 22  ? 7.475   8.110   -20.460 1.00 39.48  ? 22   DT  E C4    1 
ATOM   438  O  O4    . DT  A  1 22  ? 8.303   7.677   -19.670 1.00 39.90  ? 22   DT  E O4    1 
ATOM   439  C  C5    . DT  A  1 22  ? 6.950   7.332   -21.553 1.00 38.78  ? 22   DT  E C5    1 
ATOM   440  C  C7    . DT  A  1 22  ? 7.290   5.883   -21.721 1.00 37.74  ? 22   DT  E C7    1 
ATOM   441  C  C6    . DT  A  1 22  ? 6.055   7.909   -22.355 1.00 39.55  ? 22   DT  E C6    1 
ATOM   442  P  P     . DA  A  1 23  ? 3.661   11.495  -26.842 1.00 49.30  ? 23   DA  E P     1 
ATOM   443  O  OP1   . DA  A  1 23  ? 2.387   12.011  -27.394 1.00 49.66  ? 23   DA  E OP1   1 
ATOM   444  O  OP2   . DA  A  1 23  ? 4.619   10.724  -27.678 1.00 49.16  ? 23   DA  E OP2   1 
ATOM   445  O  "O5'" . DA  A  1 23  ? 4.439   12.712  -26.154 1.00 47.86  ? 23   DA  E "O5'" 1 
ATOM   446  C  "C5'" . DA  A  1 23  ? 4.123   13.069  -24.820 1.00 47.10  ? 23   DA  E "C5'" 1 
ATOM   447  C  "C4'" . DA  A  1 23  ? 4.904   14.300  -24.424 1.00 46.68  ? 23   DA  E "C4'" 1 
ATOM   448  O  "O4'" . DA  A  1 23  ? 5.902   13.951  -23.432 1.00 46.11  ? 23   DA  E "O4'" 1 
ATOM   449  C  "C3'" . DA  A  1 23  ? 5.657   14.956  -25.574 1.00 46.94  ? 23   DA  E "C3'" 1 
ATOM   450  O  "O3'" . DA  A  1 23  ? 5.638   16.380  -25.360 1.00 48.28  ? 23   DA  E "O3'" 1 
ATOM   451  C  "C2'" . DA  A  1 23  ? 7.043   14.308  -25.488 1.00 45.68  ? 23   DA  E "C2'" 1 
ATOM   452  C  "C1'" . DA  A  1 23  ? 7.206   14.036  -23.988 1.00 44.21  ? 23   DA  E "C1'" 1 
ATOM   453  N  N9    . DA  A  1 23  ? 7.930   12.802  -23.647 1.00 43.61  ? 23   DA  E N9    1 
ATOM   454  C  C8    . DA  A  1 23  ? 7.961   11.626  -24.348 1.00 42.46  ? 23   DA  E C8    1 
ATOM   455  N  N7    . DA  A  1 23  ? 8.700   10.702  -23.782 1.00 42.07  ? 23   DA  E N7    1 
ATOM   456  C  C5    . DA  A  1 23  ? 9.193   11.308  -22.633 1.00 41.93  ? 23   DA  E C5    1 
ATOM   457  C  C6    . DA  A  1 23  ? 10.037  10.865  -21.592 1.00 42.06  ? 23   DA  E C6    1 
ATOM   458  N  N6    . DA  A  1 23  ? 10.573  9.646   -21.531 1.00 42.60  ? 23   DA  E N6    1 
ATOM   459  N  N1    . DA  A  1 23  ? 10.332  11.730  -20.601 1.00 42.39  ? 23   DA  E N1    1 
ATOM   460  C  C2    . DA  A  1 23  ? 9.803   12.957  -20.647 1.00 42.00  ? 23   DA  E C2    1 
ATOM   461  N  N3    . DA  A  1 23  ? 8.993   13.478  -21.565 1.00 42.06  ? 23   DA  E N3    1 
ATOM   462  C  C4    . DA  A  1 23  ? 8.724   12.599  -22.537 1.00 42.26  ? 23   DA  E C4    1 
ATOM   463  P  P     . DA  A  1 24  ? 6.621   17.380  -26.141 1.00 49.41  ? 24   DA  E P     1 
ATOM   464  O  OP1   . DA  A  1 24  ? 6.113   18.759  -25.949 1.00 49.40  ? 24   DA  E OP1   1 
ATOM   465  O  OP2   . DA  A  1 24  ? 6.851   16.834  -27.503 1.00 47.73  ? 24   DA  E OP2   1 
ATOM   466  O  "O5'" . DA  A  1 24  ? 7.971   17.278  -25.287 1.00 48.87  ? 24   DA  E "O5'" 1 
ATOM   467  C  "C5'" . DA  A  1 24  ? 8.006   17.725  -23.938 1.00 48.17  ? 24   DA  E "C5'" 1 
ATOM   468  C  "C4'" . DA  A  1 24  ? 9.453   17.743  -23.481 1.00 47.73  ? 24   DA  E "C4'" 1 
ATOM   469  O  "O4'" . DA  A  1 24  ? 9.882   16.374  -23.224 1.00 46.67  ? 24   DA  E "O4'" 1 
ATOM   470  C  "C3'" . DA  A  1 24  ? 10.450  18.288  -24.506 1.00 47.70  ? 24   DA  E "C3'" 1 
ATOM   471  O  "O3'" . DA  A  1 24  ? 11.511  18.935  -23.815 1.00 49.32  ? 24   DA  E "O3'" 1 
ATOM   472  C  "C2'" . DA  A  1 24  ? 10.978  17.010  -25.155 1.00 46.25  ? 24   DA  E "C2'" 1 
ATOM   473  C  "C1'" . DA  A  1 24  ? 11.128  16.183  -23.881 1.00 43.96  ? 24   DA  E "C1'" 1 
ATOM   474  N  N9    . DA  A  1 24  ? 11.402  14.756  -24.072 1.00 43.07  ? 24   DA  E N9    1 
ATOM   475  C  C8    . DA  A  1 24  ? 10.945  13.969  -25.094 1.00 42.64  ? 24   DA  E C8    1 
ATOM   476  N  N7    . DA  A  1 24  ? 11.342  12.723  -25.013 1.00 42.29  ? 24   DA  E N7    1 
ATOM   477  C  C5    . DA  A  1 24  ? 12.112  12.690  -23.859 1.00 41.94  ? 24   DA  E C5    1 
ATOM   478  C  C6    . DA  A  1 24  ? 12.818  11.646  -23.228 1.00 41.37  ? 24   DA  E C6    1 
ATOM   479  N  N6    . DA  A  1 24  ? 12.844  10.403  -23.709 1.00 41.26  ? 24   DA  E N6    1 
ATOM   480  N  N1    . DA  A  1 24  ? 13.488  11.932  -22.096 1.00 40.75  ? 24   DA  E N1    1 
ATOM   481  C  C2    . DA  A  1 24  ? 13.447  13.185  -21.631 1.00 40.92  ? 24   DA  E C2    1 
ATOM   482  N  N3    . DA  A  1 24  ? 12.814  14.250  -22.135 1.00 41.68  ? 24   DA  E N3    1 
ATOM   483  C  C4    . DA  A  1 24  ? 12.159  13.933  -23.265 1.00 41.84  ? 24   DA  E C4    1 
ATOM   484  P  P     . DT  A  1 25  ? 12.114  20.342  -24.285 1.00 50.31  ? 25   DT  E P     1 
ATOM   485  O  OP1   . DT  A  1 25  ? 12.176  21.159  -23.051 1.00 49.82  ? 25   DT  E OP1   1 
ATOM   486  O  OP2   . DT  A  1 25  ? 11.388  20.802  -25.500 1.00 49.47  ? 25   DT  E OP2   1 
ATOM   487  O  "O5'" . DT  A  1 25  ? 13.613  20.014  -24.724 1.00 49.77  ? 25   DT  E "O5'" 1 
ATOM   488  C  "C5'" . DT  A  1 25  ? 14.121  18.706  -24.588 1.00 48.84  ? 25   DT  E "C5'" 1 
ATOM   489  C  "C4'" . DT  A  1 25  ? 14.741  18.486  -23.226 1.00 47.91  ? 25   DT  E "C4'" 1 
ATOM   490  O  "O4'" . DT  A  1 25  ? 14.499  17.102  -22.879 1.00 47.22  ? 25   DT  E "O4'" 1 
ATOM   491  C  "C3'" . DT  A  1 25  ? 16.253  18.672  -23.240 1.00 48.03  ? 25   DT  E "C3'" 1 
ATOM   492  O  "O3'" . DT  A  1 25  ? 16.790  19.202  -22.034 1.00 48.80  ? 25   DT  E "O3'" 1 
ATOM   493  C  "C2'" . DT  A  1 25  ? 16.788  17.266  -23.496 1.00 47.15  ? 25   DT  E "C2'" 1 
ATOM   494  C  "C1'" . DT  A  1 25  ? 15.688  16.347  -22.987 1.00 45.51  ? 25   DT  E "C1'" 1 
ATOM   495  N  N1    . DT  A  1 25  ? 15.488  15.179  -23.891 1.00 44.39  ? 25   DT  E N1    1 
ATOM   496  C  C2    . DT  A  1 25  ? 15.989  13.964  -23.479 1.00 43.93  ? 25   DT  E C2    1 
ATOM   497  O  O2    . DT  A  1 25  ? 16.556  13.822  -22.415 1.00 44.42  ? 25   DT  E O2    1 
ATOM   498  N  N3    . DT  A  1 25  ? 15.793  12.921  -24.345 1.00 43.03  ? 25   DT  E N3    1 
ATOM   499  C  C4    . DT  A  1 25  ? 15.157  12.970  -25.571 1.00 43.41  ? 25   DT  E C4    1 
ATOM   500  O  O4    . DT  A  1 25  ? 15.031  11.968  -26.273 1.00 43.65  ? 25   DT  E O4    1 
ATOM   501  C  C5    . DT  A  1 25  ? 14.659  14.279  -25.958 1.00 43.67  ? 25   DT  E C5    1 
ATOM   502  C  C7    . DT  A  1 25  ? 13.859  14.440  -27.218 1.00 42.05  ? 25   DT  E C7    1 
ATOM   503  C  C6    . DT  A  1 25  ? 14.852  15.310  -25.110 1.00 43.98  ? 25   DT  E C6    1 
ATOM   504  P  P     . DT  A  1 26  ? 18.299  19.748  -22.126 1.00 50.54  ? 26   DT  E P     1 
ATOM   505  O  OP1   . DT  A  1 26  ? 18.523  20.767  -21.075 1.00 49.41  ? 26   DT  E OP1   1 
ATOM   506  O  OP2   . DT  A  1 26  ? 18.568  20.052  -23.553 1.00 49.51  ? 26   DT  E OP2   1 
ATOM   507  O  "O5'" . DT  A  1 26  ? 19.160  18.455  -21.728 1.00 50.21  ? 26   DT  E "O5'" 1 
ATOM   508  C  "C5'" . DT  A  1 26  ? 18.821  17.729  -20.549 1.00 48.93  ? 26   DT  E "C5'" 1 
ATOM   509  C  "C4'" . DT  A  1 26  ? 19.721  16.518  -20.432 1.00 48.20  ? 26   DT  E "C4'" 1 
ATOM   510  O  "O4'" . DT  A  1 26  ? 19.305  15.461  -21.335 1.00 47.22  ? 26   DT  E "O4'" 1 
ATOM   511  C  "C3'" . DT  A  1 26  ? 21.177  16.816  -20.748 1.00 48.43  ? 26   DT  E "C3'" 1 
ATOM   512  O  "O3'" . DT  A  1 26  ? 21.914  16.282  -19.656 1.00 49.77  ? 26   DT  E "O3'" 1 
ATOM   513  C  "C2'" . DT  A  1 26  ? 21.430  16.117  -22.087 1.00 47.25  ? 26   DT  E "C2'" 1 
ATOM   514  C  "C1'" . DT  A  1 26  ? 20.417  14.979  -22.058 1.00 46.45  ? 26   DT  E "C1'" 1 
ATOM   515  N  N1    . DT  A  1 26  ? 19.905  14.499  -23.389 1.00 45.89  ? 26   DT  E N1    1 
ATOM   516  C  C2    . DT  A  1 26  ? 19.955  13.151  -23.656 1.00 45.29  ? 26   DT  E C2    1 
ATOM   517  O  O2    . DT  A  1 26  ? 20.411  12.341  -22.867 1.00 45.23  ? 26   DT  E O2    1 
ATOM   518  N  N3    . DT  A  1 26  ? 19.450  12.794  -24.884 1.00 45.10  ? 26   DT  E N3    1 
ATOM   519  C  C4    . DT  A  1 26  ? 18.912  13.628  -25.854 1.00 44.67  ? 26   DT  E C4    1 
ATOM   520  O  O4    . DT  A  1 26  ? 18.486  13.215  -26.934 1.00 45.06  ? 26   DT  E O4    1 
ATOM   521  C  C5    . DT  A  1 26  ? 18.883  15.021  -25.509 1.00 44.09  ? 26   DT  E C5    1 
ATOM   522  C  C7    . DT  A  1 26  ? 18.306  16.010  -26.476 1.00 43.58  ? 26   DT  E C7    1 
ATOM   523  C  C6    . DT  A  1 26  ? 19.371  15.383  -24.312 1.00 45.07  ? 26   DT  E C6    1 
ATOM   524  P  P     . DT  A  1 27  ? 23.495  16.439  -19.523 1.00 50.68  ? 27   DT  E P     1 
ATOM   525  O  OP1   . DT  A  1 27  ? 23.843  16.518  -18.084 1.00 49.84  ? 27   DT  E OP1   1 
ATOM   526  O  OP2   . DT  A  1 27  ? 23.981  17.457  -20.484 1.00 49.85  ? 27   DT  E OP2   1 
ATOM   527  O  "O5'" . DT  A  1 27  ? 23.914  15.005  -20.073 1.00 50.95  ? 27   DT  E "O5'" 1 
ATOM   528  C  "C5'" . DT  A  1 27  ? 23.693  13.859  -19.264 1.00 50.58  ? 27   DT  E "C5'" 1 
ATOM   529  C  "C4'" . DT  A  1 27  ? 24.145  12.618  -20.010 1.00 50.04  ? 27   DT  E "C4'" 1 
ATOM   530  O  "O4'" . DT  A  1 27  ? 23.530  12.612  -21.313 1.00 48.97  ? 27   DT  E "O4'" 1 
ATOM   531  C  "C3'" . DT  A  1 27  ? 25.649  12.508  -20.258 1.00 50.56  ? 27   DT  E "C3'" 1 
ATOM   532  O  "O3'" . DT  A  1 27  ? 26.080  11.234  -19.757 1.00 53.03  ? 27   DT  E "O3'" 1 
ATOM   533  C  "C2'" . DT  A  1 27  ? 25.808  12.652  -21.775 1.00 48.97  ? 27   DT  E "C2'" 1 
ATOM   534  C  "C1'" . DT  A  1 27  ? 24.464  12.123  -22.251 1.00 47.84  ? 27   DT  E "C1'" 1 
ATOM   535  N  N1    . DT  A  1 27  ? 23.923  12.552  -23.567 1.00 46.33  ? 27   DT  E N1    1 
ATOM   536  C  C2    . DT  A  1 27  ? 23.617  11.585  -24.495 1.00 46.05  ? 27   DT  E C2    1 
ATOM   537  O  O2    . DT  A  1 27  ? 23.809  10.400  -24.308 1.00 46.46  ? 27   DT  E O2    1 
ATOM   538  N  N3    . DT  A  1 27  ? 23.083  12.054  -25.668 1.00 46.17  ? 27   DT  E N3    1 
ATOM   539  C  C4    . DT  A  1 27  ? 22.823  13.373  -25.989 1.00 46.03  ? 27   DT  E C4    1 
ATOM   540  O  O4    . DT  A  1 27  ? 22.345  13.695  -27.069 1.00 46.77  ? 27   DT  E O4    1 
ATOM   541  C  C5    . DT  A  1 27  ? 23.156  14.337  -24.972 1.00 45.83  ? 27   DT  E C5    1 
ATOM   542  C  C7    . DT  A  1 27  ? 23.169  15.796  -25.317 1.00 45.60  ? 27   DT  E C7    1 
ATOM   543  C  C6    . DT  A  1 27  ? 23.673  13.884  -23.817 1.00 46.08  ? 27   DT  E C6    1 
ATOM   544  P  P     . DT  A  1 28  ? 27.632  10.854  -19.595 1.00 54.36  ? 28   DT  E P     1 
ATOM   545  O  OP1   . DT  A  1 28  ? 27.761  9.930   -18.446 1.00 53.41  ? 28   DT  E OP1   1 
ATOM   546  O  OP2   . DT  A  1 28  ? 28.445  12.091  -19.687 1.00 53.45  ? 28   DT  E OP2   1 
ATOM   547  O  "O5'" . DT  A  1 28  ? 27.852  10.003  -20.921 1.00 53.61  ? 28   DT  E "O5'" 1 
ATOM   548  C  "C5'" . DT  A  1 28  ? 26.873  9.038   -21.243 1.00 53.58  ? 28   DT  E "C5'" 1 
ATOM   549  C  "C4'" . DT  A  1 28  ? 27.289  8.308   -22.496 1.00 53.64  ? 28   DT  E "C4'" 1 
ATOM   550  O  "O4'" . DT  A  1 28  ? 26.675  8.951   -23.631 1.00 53.41  ? 28   DT  E "O4'" 1 
ATOM   551  C  "C3'" . DT  A  1 28  ? 28.787  8.309   -22.763 1.00 54.40  ? 28   DT  E "C3'" 1 
ATOM   552  O  "O3'" . DT  A  1 28  ? 29.113  6.965   -23.070 1.00 55.86  ? 28   DT  E "O3'" 1 
ATOM   553  C  "C2'" . DT  A  1 28  ? 28.956  9.282   -23.935 1.00 53.67  ? 28   DT  E "C2'" 1 
ATOM   554  C  "C1'" . DT  A  1 28  ? 27.621  9.140   -24.658 1.00 52.73  ? 28   DT  E "C1'" 1 
ATOM   555  N  N1    . DT  A  1 28  ? 27.140  10.323  -25.421 1.00 51.65  ? 28   DT  E N1    1 
ATOM   556  C  C2    . DT  A  1 28  ? 26.465  10.124  -26.608 1.00 51.51  ? 28   DT  E C2    1 
ATOM   557  O  O2    . DT  A  1 28  ? 26.258  9.019   -27.084 1.00 52.04  ? 28   DT  E O2    1 
ATOM   558  N  N3    . DT  A  1 28  ? 26.042  11.272  -27.233 1.00 51.17  ? 28   DT  E N3    1 
ATOM   559  C  C4    . DT  A  1 28  ? 26.224  12.571  -26.788 1.00 51.35  ? 28   DT  E C4    1 
ATOM   560  O  O4    . DT  A  1 28  ? 25.812  13.542  -27.413 1.00 51.47  ? 28   DT  E O4    1 
ATOM   561  C  C5    . DT  A  1 28  ? 26.931  12.706  -25.535 1.00 51.51  ? 28   DT  E C5    1 
ATOM   562  C  C7    . DT  A  1 28  ? 27.193  14.066  -24.963 1.00 51.31  ? 28   DT  E C7    1 
ATOM   563  C  C6    . DT  A  1 28  ? 27.347  11.590  -24.915 1.00 51.75  ? 28   DT  E C6    1 
ATOM   564  P  P     . DA  A  1 29  ? 30.602  6.378   -23.161 1.00 57.33  ? 29   DA  E P     1 
ATOM   565  O  OP1   . DA  A  1 29  ? 30.654  5.180   -22.282 1.00 56.03  ? 29   DA  E OP1   1 
ATOM   566  O  OP2   . DA  A  1 29  ? 31.592  7.475   -23.014 1.00 56.71  ? 29   DA  E OP2   1 
ATOM   567  O  "O5'" . DA  A  1 29  ? 30.597  5.902   -24.690 1.00 57.22  ? 29   DA  E "O5'" 1 
ATOM   568  C  "C5'" . DA  A  1 29  ? 29.335  5.549   -25.242 1.00 59.28  ? 29   DA  E "C5'" 1 
ATOM   569  C  "C4'" . DA  A  1 29  ? 29.444  4.988   -26.645 1.00 60.68  ? 29   DA  E "C4'" 1 
ATOM   570  O  "O4'" . DA  A  1 29  ? 28.953  5.931   -27.638 1.00 59.90  ? 29   DA  E "O4'" 1 
ATOM   571  C  "C3'" . DA  A  1 29  ? 30.860  4.655   -27.075 1.00 62.21  ? 29   DA  E "C3'" 1 
ATOM   572  O  "O3'" . DA  A  1 29  ? 30.750  3.585   -28.018 1.00 64.91  ? 29   DA  E "O3'" 1 
ATOM   573  C  "C2'" . DA  A  1 29  ? 31.329  5.983   -27.672 1.00 61.14  ? 29   DA  E "C2'" 1 
ATOM   574  C  "C1'" . DA  A  1 29  ? 30.050  6.527   -28.315 1.00 60.07  ? 29   DA  E "C1'" 1 
ATOM   575  N  N9    . DA  A  1 29  ? 29.906  7.982   -28.229 1.00 59.70  ? 29   DA  E N9    1 
ATOM   576  C  C8    . DA  A  1 29  ? 30.381  8.808   -27.244 1.00 59.38  ? 29   DA  E C8    1 
ATOM   577  N  N7    . DA  A  1 29  ? 30.094  10.076  -27.430 1.00 59.25  ? 29   DA  E N7    1 
ATOM   578  C  C5    . DA  A  1 29  ? 29.377  10.081  -28.615 1.00 58.95  ? 29   DA  E C5    1 
ATOM   579  C  C6    . DA  A  1 29  ? 28.782  11.116  -29.355 1.00 59.06  ? 29   DA  E C6    1 
ATOM   580  N  N6    . DA  A  1 29  ? 28.824  12.394  -28.981 1.00 59.18  ? 29   DA  E N6    1 
ATOM   581  N  N1    . DA  A  1 29  ? 28.144  10.788  -30.498 1.00 59.47  ? 29   DA  E N1    1 
ATOM   582  C  C2    . DA  A  1 29  ? 28.104  9.501   -30.870 1.00 59.37  ? 29   DA  E C2    1 
ATOM   583  N  N3    . DA  A  1 29  ? 28.621  8.437   -30.253 1.00 59.45  ? 29   DA  E N3    1 
ATOM   584  C  C4    . DA  A  1 29  ? 29.252  8.801   -29.123 1.00 59.20  ? 29   DA  E C4    1 
ATOM   585  P  P     . DG  A  1 30  ? 31.992  3.035   -28.862 1.00 66.48  ? 30   DG  E P     1 
ATOM   586  O  OP1   . DG  A  1 30  ? 31.694  1.610   -29.128 1.00 66.40  ? 30   DG  E OP1   1 
ATOM   587  O  OP2   . DG  A  1 30  ? 33.243  3.431   -28.171 1.00 66.48  ? 30   DG  E OP2   1 
ATOM   588  O  "O5'" . DG  A  1 30  ? 31.879  3.846   -30.243 1.00 67.06  ? 30   DG  E "O5'" 1 
ATOM   589  C  "C5'" . DG  A  1 30  ? 30.773  3.564   -31.105 1.00 68.45  ? 30   DG  E "C5'" 1 
ATOM   590  C  "C4'" . DG  A  1 30  ? 30.762  4.467   -32.324 1.00 69.41  ? 30   DG  E "C4'" 1 
ATOM   591  O  "O4'" . DG  A  1 30  ? 30.532  5.844   -31.915 1.00 69.14  ? 30   DG  E "O4'" 1 
ATOM   592  C  "C3'" . DG  A  1 30  ? 32.065  4.451   -33.122 1.00 70.45  ? 30   DG  E "C3'" 1 
ATOM   593  O  "O3'" . DG  A  1 30  ? 31.787  4.216   -34.515 1.00 72.48  ? 30   DG  E "O3'" 1 
ATOM   594  C  "C2'" . DG  A  1 30  ? 32.666  5.828   -32.832 1.00 69.51  ? 30   DG  E "C2'" 1 
ATOM   595  C  "C1'" . DG  A  1 30  ? 31.413  6.675   -32.641 1.00 67.95  ? 30   DG  E "C1'" 1 
ATOM   596  N  N9    . DG  A  1 30  ? 31.661  7.937   -31.941 1.00 67.53  ? 30   DG  E N9    1 
ATOM   597  C  C8    . DG  A  1 30  ? 32.371  8.132   -30.776 1.00 67.18  ? 30   DG  E C8    1 
ATOM   598  N  N7    . DG  A  1 30  ? 32.430  9.385   -30.407 1.00 66.90  ? 30   DG  E N7    1 
ATOM   599  C  C5    . DG  A  1 30  ? 31.714  10.065  -31.390 1.00 66.83  ? 30   DG  E C5    1 
ATOM   600  C  C6    . DG  A  1 30  ? 31.431  11.448  -31.531 1.00 67.03  ? 30   DG  E C6    1 
ATOM   601  O  O6    . DG  A  1 30  ? 31.768  12.377  -30.783 1.00 67.14  ? 30   DG  E O6    1 
ATOM   602  N  N1    . DG  A  1 30  ? 30.676  11.718  -32.673 1.00 66.93  ? 30   DG  E N1    1 
ATOM   603  C  C2    . DG  A  1 30  ? 30.246  10.763  -33.568 1.00 67.25  ? 30   DG  E C2    1 
ATOM   604  N  N2    . DG  A  1 30  ? 29.529  11.206  -34.612 1.00 67.23  ? 30   DG  E N2    1 
ATOM   605  N  N3    . DG  A  1 30  ? 30.503  9.462   -33.449 1.00 66.99  ? 30   DG  E N3    1 
ATOM   606  C  C4    . DG  A  1 30  ? 31.238  9.187   -32.342 1.00 67.04  ? 30   DG  E C4    1 
ATOM   607  P  P     . DT  A  1 31  ? 32.782  4.651   -35.708 1.00 74.70  ? 31   DT  E P     1 
ATOM   608  O  OP1   . DT  A  1 31  ? 32.534  3.717   -36.834 1.00 74.04  ? 31   DT  E OP1   1 
ATOM   609  O  OP2   . DT  A  1 31  ? 34.154  4.845   -35.173 1.00 73.95  ? 31   DT  E OP2   1 
ATOM   610  O  "O5'" . DT  A  1 31  ? 32.229  6.096   -36.119 1.00 75.17  ? 31   DT  E "O5'" 1 
ATOM   611  C  "C5'" . DT  A  1 31  ? 30.952  6.238   -36.736 1.00 76.47  ? 31   DT  E "C5'" 1 
ATOM   612  C  "C4'" . DT  A  1 31  ? 30.988  7.432   -37.668 1.00 77.29  ? 31   DT  E "C4'" 1 
ATOM   613  O  "O4'" . DT  A  1 31  ? 31.108  8.647   -36.880 1.00 76.68  ? 31   DT  E "O4'" 1 
ATOM   614  C  "C3'" . DT  A  1 31  ? 32.175  7.396   -38.625 1.00 78.18  ? 31   DT  E "C3'" 1 
ATOM   615  O  "O3'" . DT  A  1 31  ? 31.778  7.803   -39.941 1.00 79.92  ? 31   DT  E "O3'" 1 
ATOM   616  C  "C2'" . DT  A  1 31  ? 33.181  8.348   -37.977 1.00 77.47  ? 31   DT  E "C2'" 1 
ATOM   617  C  "C1'" . DT  A  1 31  ? 32.294  9.337   -37.224 1.00 76.34  ? 31   DT  E "C1'" 1 
ATOM   618  N  N1    . DT  A  1 31  ? 32.963  9.881   -35.993 1.00 75.73  ? 31   DT  E N1    1 
ATOM   619  C  C2    . DT  A  1 31  ? 32.805  11.211  -35.661 1.00 74.90  ? 31   DT  E C2    1 
ATOM   620  O  O2    . DT  A  1 31  ? 32.129  11.990  -36.310 1.00 74.64  ? 31   DT  E O2    1 
ATOM   621  N  N3    . DT  A  1 31  ? 33.468  11.597  -34.524 1.00 74.55  ? 31   DT  E N3    1 
ATOM   622  C  C4    . DT  A  1 31  ? 34.261  10.811  -33.705 1.00 74.89  ? 31   DT  E C4    1 
ATOM   623  O  O4    . DT  A  1 31  ? 34.813  11.257  -32.701 1.00 74.82  ? 31   DT  E O4    1 
ATOM   624  C  C5    . DT  A  1 31  ? 34.388  9.431   -34.112 1.00 75.18  ? 31   DT  E C5    1 
ATOM   625  C  C7    . DT  A  1 31  ? 35.245  8.483   -33.326 1.00 74.90  ? 31   DT  E C7    1 
ATOM   626  C  C6    . DT  A  1 31  ? 33.743  9.041   -35.220 1.00 75.46  ? 31   DT  E C6    1 
ATOM   627  P  P     . DG  A  1 32  ? 32.837  8.444   -40.963 1.00 81.34  ? 32   DG  E P     1 
ATOM   628  O  OP1   . DG  A  1 32  ? 32.290  8.330   -42.337 1.00 80.85  ? 32   DG  E OP1   1 
ATOM   629  O  OP2   . DG  A  1 32  ? 34.178  7.894   -40.646 1.00 81.14  ? 32   DG  E OP2   1 
ATOM   630  O  "O5'" . DG  A  1 32  ? 32.819  9.988   -40.538 1.00 81.44  ? 32   DG  E "O5'" 1 
ATOM   631  C  "C5'" . DG  A  1 32  ? 31.657  10.788  -40.774 1.00 81.50  ? 32   DG  E "C5'" 1 
ATOM   632  C  "C4'" . DG  A  1 32  ? 32.049  12.225  -41.068 1.00 81.08  ? 32   DG  E "C4'" 1 
ATOM   633  O  "O4'" . DG  A  1 32  ? 32.668  12.819  -39.894 1.00 80.63  ? 32   DG  E "O4'" 1 
ATOM   634  C  "C3'" . DG  A  1 32  ? 33.063  12.382  -42.192 1.00 81.12  ? 32   DG  E "C3'" 1 
ATOM   635  O  "O3'" . DG  A  1 32  ? 32.784  13.594  -42.891 1.00 81.93  ? 32   DG  E "O3'" 1 
ATOM   636  C  "C2'" . DG  A  1 32  ? 34.399  12.408  -41.445 1.00 80.47  ? 32   DG  E "C2'" 1 
ATOM   637  C  "C1'" . DG  A  1 32  ? 34.028  13.124  -40.149 1.00 79.35  ? 32   DG  E "C1'" 1 
ATOM   638  N  N9    . DG  A  1 32  ? 34.825  12.719  -38.996 1.00 78.80  ? 32   DG  E N9    1 
ATOM   639  C  C8    . DG  A  1 32  ? 35.434  11.503  -38.789 1.00 78.60  ? 32   DG  E C8    1 
ATOM   640  N  N7    . DG  A  1 32  ? 36.081  11.430  -37.659 1.00 78.31  ? 32   DG  E N7    1 
ATOM   641  C  C5    . DG  A  1 32  ? 35.887  12.678  -37.079 1.00 78.28  ? 32   DG  E C5    1 
ATOM   642  C  C6    . DG  A  1 32  ? 36.351  13.187  -35.842 1.00 78.57  ? 32   DG  E C6    1 
ATOM   643  O  O6    . DG  A  1 32  ? 37.049  12.613  -34.995 1.00 78.80  ? 32   DG  E O6    1 
ATOM   644  N  N1    . DG  A  1 32  ? 35.931  14.500  -35.627 1.00 78.60  ? 32   DG  E N1    1 
ATOM   645  C  C2    . DG  A  1 32  ? 35.157  15.227  -36.504 1.00 78.62  ? 32   DG  E C2    1 
ATOM   646  N  N2    . DG  A  1 32  ? 34.857  16.476  -36.122 1.00 78.69  ? 32   DG  E N2    1 
ATOM   647  N  N3    . DG  A  1 32  ? 34.709  14.761  -37.668 1.00 78.37  ? 32   DG  E N3    1 
ATOM   648  C  C4    . DG  A  1 32  ? 35.114  13.483  -37.888 1.00 78.42  ? 32   DG  E C4    1 
ATOM   649  P  P     . DG  A  1 33  ? 33.940  14.406  -43.654 1.00 82.51  ? 33   DG  E P     1 
ATOM   650  O  OP1   . DG  A  1 33  ? 33.286  15.175  -44.739 1.00 82.51  ? 33   DG  E OP1   1 
ATOM   651  O  OP2   . DG  A  1 33  ? 35.049  13.472  -43.971 1.00 82.54  ? 33   DG  E OP2   1 
ATOM   652  O  "O5'" . DG  A  1 33  ? 34.463  15.430  -42.536 1.00 81.64  ? 33   DG  E "O5'" 1 
ATOM   653  C  "C5'" . DG  A  1 33  ? 33.565  16.381  -41.951 1.00 80.39  ? 33   DG  E "C5'" 1 
ATOM   654  C  "C4'" . DG  A  1 33  ? 34.315  17.627  -41.512 1.00 79.12  ? 33   DG  E "C4'" 1 
ATOM   655  O  "O4'" . DG  A  1 33  ? 35.052  17.343  -40.294 1.00 78.30  ? 33   DG  E "O4'" 1 
ATOM   656  C  "C3'" . DG  A  1 33  ? 35.333  18.134  -42.532 1.00 78.67  ? 33   DG  E "C3'" 1 
ATOM   657  O  "O3'" . DG  A  1 33  ? 35.300  19.561  -42.592 1.00 78.83  ? 33   DG  E "O3'" 1 
ATOM   658  C  "C2'" . DG  A  1 33  ? 36.669  17.598  -42.015 1.00 77.92  ? 33   DG  E "C2'" 1 
ATOM   659  C  "C1'" . DG  A  1 33  ? 36.442  17.497  -40.507 1.00 76.38  ? 33   DG  E "C1'" 1 
ATOM   660  N  N9    . DG  A  1 33  ? 37.126  16.369  -39.881 1.00 75.66  ? 33   DG  E N9    1 
ATOM   661  C  C8    . DG  A  1 33  ? 37.291  15.103  -40.390 1.00 75.33  ? 33   DG  E C8    1 
ATOM   662  N  N7    . DG  A  1 33  ? 37.955  14.310  -39.594 1.00 75.14  ? 33   DG  E N7    1 
ATOM   663  C  C5    . DG  A  1 33  ? 38.252  15.098  -38.486 1.00 75.14  ? 33   DG  E C5    1 
ATOM   664  C  C6    . DG  A  1 33  ? 38.954  14.787  -37.292 1.00 75.29  ? 33   DG  E C6    1 
ATOM   665  O  O6    . DG  A  1 33  ? 39.477  13.716  -36.955 1.00 75.21  ? 33   DG  E O6    1 
ATOM   666  N  N1    . DG  A  1 33  ? 39.024  15.882  -36.433 1.00 75.34  ? 33   DG  E N1    1 
ATOM   667  C  C2    . DG  A  1 33  ? 38.484  17.121  -36.694 1.00 75.28  ? 33   DG  E C2    1 
ATOM   668  N  N2    . DG  A  1 33  ? 38.655  18.055  -35.746 1.00 75.49  ? 33   DG  E N2    1 
ATOM   669  N  N3    . DG  A  1 33  ? 37.825  17.427  -37.806 1.00 75.15  ? 33   DG  E N3    1 
ATOM   670  C  C4    . DG  A  1 33  ? 37.746  16.370  -38.652 1.00 75.26  ? 33   DG  E C4    1 
ATOM   671  O  "O5'" . DC  B  2 1   ? 38.092  19.550  -28.243 1.00 85.40  ? 1    DC  F "O5'" 1 
ATOM   672  C  "C5'" . DC  B  2 1   ? 38.363  20.826  -28.820 1.00 85.34  ? 1    DC  F "C5'" 1 
ATOM   673  C  "C4'" . DC  B  2 1   ? 37.625  20.998  -30.138 1.00 85.24  ? 1    DC  F "C4'" 1 
ATOM   674  O  "O4'" . DC  B  2 1   ? 37.975  19.914  -31.042 1.00 84.95  ? 1    DC  F "O4'" 1 
ATOM   675  C  "C3'" . DC  B  2 1   ? 36.102  20.999  -30.021 1.00 85.19  ? 1    DC  F "C3'" 1 
ATOM   676  O  "O3'" . DC  B  2 1   ? 35.531  22.019  -30.855 1.00 84.99  ? 1    DC  F "O3'" 1 
ATOM   677  C  "C2'" . DC  B  2 1   ? 35.731  19.585  -30.467 1.00 85.13  ? 1    DC  F "C2'" 1 
ATOM   678  C  "C1'" . DC  B  2 1   ? 36.802  19.277  -31.507 1.00 84.72  ? 1    DC  F "C1'" 1 
ATOM   679  N  N1    . DC  B  2 1   ? 37.067  17.811  -31.664 1.00 84.40  ? 1    DC  F N1    1 
ATOM   680  C  C2    . DC  B  2 1   ? 36.688  17.138  -32.836 1.00 84.09  ? 1    DC  F C2    1 
ATOM   681  O  O2    . DC  B  2 1   ? 36.131  17.764  -33.749 1.00 83.66  ? 1    DC  F O2    1 
ATOM   682  N  N3    . DC  B  2 1   ? 36.946  15.807  -32.932 1.00 84.13  ? 1    DC  F N3    1 
ATOM   683  C  C4    . DC  B  2 1   ? 37.551  15.161  -31.924 1.00 84.13  ? 1    DC  F C4    1 
ATOM   684  N  N4    . DC  B  2 1   ? 37.791  13.852  -32.057 1.00 83.96  ? 1    DC  F N4    1 
ATOM   685  C  C5    . DC  B  2 1   ? 37.941  15.829  -30.727 1.00 84.02  ? 1    DC  F C5    1 
ATOM   686  C  C6    . DC  B  2 1   ? 37.679  17.137  -30.644 1.00 84.33  ? 1    DC  F C6    1 
ATOM   687  P  P     . DA  B  2 2   ? 33.978  22.007  -31.265 1.00 84.76  ? 2    DA  F P     1 
ATOM   688  O  OP1   . DA  B  2 2   ? 33.589  23.379  -31.667 1.00 84.75  ? 2    DA  F OP1   1 
ATOM   689  O  OP2   . DA  B  2 2   ? 33.226  21.314  -30.191 1.00 84.63  ? 2    DA  F OP2   1 
ATOM   690  O  "O5'" . DA  B  2 2   ? 33.966  21.079  -32.573 1.00 84.36  ? 2    DA  F "O5'" 1 
ATOM   691  C  "C5'" . DA  B  2 2   ? 33.813  21.646  -33.876 1.00 83.49  ? 2    DA  F "C5'" 1 
ATOM   692  C  "C4'" . DA  B  2 2   ? 32.646  21.036  -34.646 1.00 82.51  ? 2    DA  F "C4'" 1 
ATOM   693  O  "O4'" . DA  B  2 2   ? 32.766  19.586  -34.704 1.00 82.36  ? 2    DA  F "O4'" 1 
ATOM   694  C  "C3'" . DA  B  2 2   ? 31.263  21.325  -34.075 1.00 81.88  ? 2    DA  F "C3'" 1 
ATOM   695  O  "O3'" . DA  B  2 2   ? 30.337  21.536  -35.138 1.00 81.32  ? 2    DA  F "O3'" 1 
ATOM   696  C  "C2'" . DA  B  2 2   ? 30.936  20.068  -33.263 1.00 81.72  ? 2    DA  F "C2'" 1 
ATOM   697  C  "C1'" . DA  B  2 2   ? 31.746  18.962  -33.939 1.00 81.06  ? 2    DA  F "C1'" 1 
ATOM   698  N  N9    . DA  B  2 2   ? 32.393  18.060  -32.989 1.00 80.39  ? 2    DA  F N9    1 
ATOM   699  C  C8    . DA  B  2 2   ? 32.814  18.364  -31.724 1.00 80.25  ? 2    DA  F C8    1 
ATOM   700  N  N7    . DA  B  2 2   ? 33.374  17.361  -31.088 1.00 80.10  ? 2    DA  F N7    1 
ATOM   701  C  C5    . DA  B  2 2   ? 33.316  16.326  -32.001 1.00 80.12  ? 2    DA  F C5    1 
ATOM   702  C  C6    . DA  B  2 2   ? 33.746  14.987  -31.933 1.00 80.23  ? 2    DA  F C6    1 
ATOM   703  N  N6    . DA  B  2 2   ? 34.339  14.462  -30.855 1.00 80.09  ? 2    DA  F N6    1 
ATOM   704  N  N1    . DA  B  2 2   ? 33.538  14.215  -33.021 1.00 80.21  ? 2    DA  F N1    1 
ATOM   705  C  C2    . DA  B  2 2   ? 32.939  14.753  -34.093 1.00 79.85  ? 2    DA  F C2    1 
ATOM   706  N  N3    . DA  B  2 2   ? 32.493  15.996  -34.274 1.00 79.78  ? 2    DA  F N3    1 
ATOM   707  C  C4    . DA  B  2 2   ? 32.715  16.738  -33.179 1.00 80.06  ? 2    DA  F C4    1 
ATOM   708  P  P     . DC  B  2 3   ? 28.760  21.578  -34.837 1.00 81.36  ? 3    DC  F P     1 
ATOM   709  O  OP1   . DC  B  2 3   ? 28.152  22.668  -35.639 1.00 80.91  ? 3    DC  F OP1   1 
ATOM   710  O  OP2   . DC  B  2 3   ? 28.584  21.558  -33.364 1.00 80.72  ? 3    DC  F OP2   1 
ATOM   711  O  "O5'" . DC  B  2 3   ? 28.255  20.180  -35.438 1.00 80.46  ? 3    DC  F "O5'" 1 
ATOM   712  C  "C5'" . DC  B  2 3   ? 28.070  20.024  -36.854 1.00 78.79  ? 3    DC  F "C5'" 1 
ATOM   713  C  "C4'" . DC  B  2 3   ? 27.582  18.621  -37.171 1.00 77.35  ? 3    DC  F "C4'" 1 
ATOM   714  O  "O4'" . DC  B  2 3   ? 28.439  17.670  -36.485 1.00 76.54  ? 3    DC  F "O4'" 1 
ATOM   715  C  "C3'" . DC  B  2 3   ? 26.152  18.320  -36.719 1.00 76.91  ? 3    DC  F "C3'" 1 
ATOM   716  O  "O3'" . DC  B  2 3   ? 25.424  17.651  -37.763 1.00 76.66  ? 3    DC  F "O3'" 1 
ATOM   717  C  "C2'" . DC  B  2 3   ? 26.354  17.455  -35.473 1.00 76.08  ? 3    DC  F "C2'" 1 
ATOM   718  C  "C1'" . DC  B  2 3   ? 27.650  16.724  -35.797 1.00 74.92  ? 3    DC  F "C1'" 1 
ATOM   719  N  N1    . DC  B  2 3   ? 28.398  16.241  -34.591 1.00 74.03  ? 3    DC  F N1    1 
ATOM   720  C  C2    . DC  B  2 3   ? 28.942  14.949  -34.572 1.00 73.37  ? 3    DC  F C2    1 
ATOM   721  O  O2    . DC  B  2 3   ? 28.802  14.213  -35.559 1.00 72.92  ? 3    DC  F O2    1 
ATOM   722  N  N3    . DC  B  2 3   ? 29.610  14.532  -33.465 1.00 73.02  ? 3    DC  F N3    1 
ATOM   723  C  C4    . DC  B  2 3   ? 29.745  15.345  -32.417 1.00 72.73  ? 3    DC  F C4    1 
ATOM   724  N  N4    . DC  B  2 3   ? 30.413  14.892  -31.353 1.00 72.69  ? 3    DC  F N4    1 
ATOM   725  C  C5    . DC  B  2 3   ? 29.200  16.661  -32.416 1.00 73.10  ? 3    DC  F C5    1 
ATOM   726  C  C6    . DC  B  2 3   ? 28.540  17.062  -33.511 1.00 73.59  ? 3    DC  F C6    1 
ATOM   727  P  P     . DT  B  2 4   ? 23.970  17.001  -37.520 1.00 76.95  ? 4    DT  F P     1 
ATOM   728  O  OP1   . DT  B  2 4   ? 22.954  17.794  -38.254 1.00 76.84  ? 4    DT  F OP1   1 
ATOM   729  O  OP2   . DT  B  2 4   ? 23.800  16.738  -36.069 1.00 76.91  ? 4    DT  F OP2   1 
ATOM   730  O  "O5'" . DT  B  2 4   ? 24.111  15.584  -38.248 1.00 75.39  ? 4    DT  F "O5'" 1 
ATOM   731  C  "C5'" . DT  B  2 4   ? 25.340  14.863  -38.172 1.00 72.89  ? 4    DT  F "C5'" 1 
ATOM   732  C  "C4'" . DT  B  2 4   ? 25.140  13.463  -37.614 1.00 70.67  ? 4    DT  F "C4'" 1 
ATOM   733  O  "O4'" . DT  B  2 4   ? 25.906  13.322  -36.389 1.00 69.80  ? 4    DT  F "O4'" 1 
ATOM   734  C  "C3'" . DT  B  2 4   ? 23.706  13.063  -37.261 1.00 69.28  ? 4    DT  F "C3'" 1 
ATOM   735  O  "O3'" . DT  B  2 4   ? 23.495  11.723  -37.699 1.00 68.03  ? 4    DT  F "O3'" 1 
ATOM   736  C  "C2'" . DT  B  2 4   ? 23.685  13.179  -35.736 1.00 68.72  ? 4    DT  F "C2'" 1 
ATOM   737  C  "C1'" . DT  B  2 4   ? 25.097  12.701  -35.416 1.00 67.99  ? 4    DT  F "C1'" 1 
ATOM   738  N  N1    . DT  B  2 4   ? 25.628  13.090  -34.080 1.00 67.24  ? 4    DT  F N1    1 
ATOM   739  C  C2    . DT  B  2 4   ? 26.387  12.176  -33.385 1.00 66.51  ? 4    DT  F C2    1 
ATOM   740  O  O2    . DT  B  2 4   ? 26.639  11.064  -33.810 1.00 66.26  ? 4    DT  F O2    1 
ATOM   741  N  N3    . DT  B  2 4   ? 26.839  12.613  -32.167 1.00 66.20  ? 4    DT  F N3    1 
ATOM   742  C  C4    . DT  B  2 4   ? 26.618  13.850  -31.592 1.00 66.19  ? 4    DT  F C4    1 
ATOM   743  O  O4    . DT  B  2 4   ? 27.073  14.140  -30.488 1.00 66.21  ? 4    DT  F O4    1 
ATOM   744  C  C5    . DT  B  2 4   ? 25.815  14.761  -32.376 1.00 66.23  ? 4    DT  F C5    1 
ATOM   745  C  C7    . DT  B  2 4   ? 25.448  16.112  -31.838 1.00 66.48  ? 4    DT  F C7    1 
ATOM   746  C  C6    . DT  B  2 4   ? 25.366  14.345  -33.567 1.00 66.55  ? 4    DT  F C6    1 
ATOM   747  P  P     . DA  B  2 5   ? 22.036  11.167  -38.068 1.00 67.12  ? 5    DA  F P     1 
ATOM   748  O  OP1   . DA  B  2 5   ? 21.973  10.976  -39.537 1.00 66.97  ? 5    DA  F OP1   1 
ATOM   749  O  OP2   . DA  B  2 5   ? 21.022  11.995  -37.373 1.00 66.81  ? 5    DA  F OP2   1 
ATOM   750  O  "O5'" . DA  B  2 5   ? 22.032  9.725   -37.378 1.00 64.80  ? 5    DA  F "O5'" 1 
ATOM   751  C  "C5'" . DA  B  2 5   ? 23.205  8.931   -37.345 1.00 61.01  ? 5    DA  F "C5'" 1 
ATOM   752  C  "C4'" . DA  B  2 5   ? 23.094  7.922   -36.217 1.00 58.31  ? 5    DA  F "C4'" 1 
ATOM   753  O  "O4'" . DA  B  2 5   ? 23.625  8.497   -34.999 1.00 57.73  ? 5    DA  F "O4'" 1 
ATOM   754  C  "C3'" . DA  B  2 5   ? 21.673  7.474   -35.895 1.00 57.09  ? 5    DA  F "C3'" 1 
ATOM   755  O  "O3'" . DA  B  2 5   ? 21.693  6.050   -35.788 1.00 55.97  ? 5    DA  F "O3'" 1 
ATOM   756  C  "C2'" . DA  B  2 5   ? 21.314  8.188   -34.590 1.00 56.05  ? 5    DA  F "C2'" 1 
ATOM   757  C  "C1'" . DA  B  2 5   ? 22.680  8.431   -33.951 1.00 55.07  ? 5    DA  F "C1'" 1 
ATOM   758  N  N9    . DA  B  2 5   ? 22.787  9.670   -33.176 1.00 53.75  ? 5    DA  F N9    1 
ATOM   759  C  C8    . DA  B  2 5   ? 22.118  10.840  -33.386 1.00 53.17  ? 5    DA  F C8    1 
ATOM   760  N  N7    . DA  B  2 5   ? 22.423  11.784  -32.526 1.00 53.07  ? 5    DA  F N7    1 
ATOM   761  C  C5    . DA  B  2 5   ? 23.351  11.188  -31.688 1.00 53.05  ? 5    DA  F C5    1 
ATOM   762  C  C6    . DA  B  2 5   ? 24.062  11.656  -30.562 1.00 53.36  ? 5    DA  F C6    1 
ATOM   763  N  N6    . DA  B  2 5   ? 23.935  12.890  -30.073 1.00 53.48  ? 5    DA  F N6    1 
ATOM   764  N  N1    . DA  B  2 5   ? 24.911  10.804  -29.952 1.00 53.31  ? 5    DA  F N1    1 
ATOM   765  C  C2    . DA  B  2 5   ? 25.034  9.565   -30.444 1.00 52.58  ? 5    DA  F C2    1 
ATOM   766  N  N3    . DA  B  2 5   ? 24.425  9.011   -31.491 1.00 52.65  ? 5    DA  F N3    1 
ATOM   767  C  C4    . DA  B  2 5   ? 23.587  9.884   -32.076 1.00 53.02  ? 5    DA  F C4    1 
ATOM   768  P  P     . DA  B  2 6   ? 20.452  5.213   -35.215 1.00 54.78  ? 6    DA  F P     1 
ATOM   769  O  OP1   . DA  B  2 6   ? 20.371  3.938   -35.967 1.00 53.99  ? 6    DA  F OP1   1 
ATOM   770  O  OP2   . DA  B  2 6   ? 19.273  6.114   -35.102 1.00 54.10  ? 6    DA  F OP2   1 
ATOM   771  O  "O5'" . DA  B  2 6   ? 20.998  4.878   -33.748 1.00 52.07  ? 6    DA  F "O5'" 1 
ATOM   772  C  "C5'" . DA  B  2 6   ? 22.320  4.360   -33.617 1.00 47.55  ? 6    DA  F "C5'" 1 
ATOM   773  C  "C4'" . DA  B  2 6   ? 22.684  4.250   -32.155 1.00 43.80  ? 6    DA  F "C4'" 1 
ATOM   774  O  "O4'" . DA  B  2 6   ? 22.770  5.566   -31.568 1.00 43.02  ? 6    DA  F "O4'" 1 
ATOM   775  C  "C3'" . DA  B  2 6   ? 21.654  3.515   -31.316 1.00 43.03  ? 6    DA  F "C3'" 1 
ATOM   776  O  "O3'" . DA  B  2 6   ? 22.387  2.717   -30.414 1.00 41.29  ? 6    DA  F "O3'" 1 
ATOM   777  C  "C2'" . DA  B  2 6   ? 20.861  4.622   -30.614 1.00 41.75  ? 6    DA  F "C2'" 1 
ATOM   778  C  "C1'" . DA  B  2 6   ? 21.978  5.632   -30.393 1.00 41.59  ? 6    DA  F "C1'" 1 
ATOM   779  N  N9    . DA  B  2 6   ? 21.552  7.025   -30.249 1.00 41.30  ? 6    DA  F N9    1 
ATOM   780  C  C8    . DA  B  2 6   ? 20.667  7.691   -31.052 1.00 40.23  ? 6    DA  F C8    1 
ATOM   781  N  N7    . DA  B  2 6   ? 20.482  8.936   -30.698 1.00 40.25  ? 6    DA  F N7    1 
ATOM   782  C  C5    . DA  B  2 6   ? 21.301  9.104   -29.595 1.00 39.84  ? 6    DA  F C5    1 
ATOM   783  C  C6    . DA  B  2 6   ? 21.555  10.209  -28.769 1.00 40.00  ? 6    DA  F C6    1 
ATOM   784  N  N6    . DA  B  2 6   ? 20.976  11.395  -28.940 1.00 40.70  ? 6    DA  F N6    1 
ATOM   785  N  N1    . DA  B  2 6   ? 22.423  10.052  -27.752 1.00 40.74  ? 6    DA  F N1    1 
ATOM   786  C  C2    . DA  B  2 6   ? 22.999  8.854   -27.589 1.00 40.11  ? 6    DA  F C2    1 
ATOM   787  N  N3    . DA  B  2 6   ? 22.838  7.742   -28.305 1.00 39.91  ? 6    DA  F N3    1 
ATOM   788  C  C4    . DA  B  2 6   ? 21.971  7.937   -29.304 1.00 40.12  ? 6    DA  F C4    1 
ATOM   789  P  P     . DA  B  2 7   ? 21.627  1.679   -29.482 1.00 39.92  ? 7    DA  F P     1 
ATOM   790  O  OP1   . DA  B  2 7   ? 22.516  0.496   -29.347 1.00 41.93  ? 7    DA  F OP1   1 
ATOM   791  O  OP2   . DA  B  2 7   ? 20.253  1.531   -30.005 1.00 39.65  ? 7    DA  F OP2   1 
ATOM   792  O  "O5'" . DA  B  2 7   ? 21.627  2.436   -28.073 1.00 38.39  ? 7    DA  F "O5'" 1 
ATOM   793  C  "C5'" . DA  B  2 7   ? 22.842  3.058   -27.645 1.00 37.31  ? 7    DA  F "C5'" 1 
ATOM   794  C  "C4'" . DA  B  2 7   ? 22.716  3.743   -26.295 1.00 36.38  ? 7    DA  F "C4'" 1 
ATOM   795  O  "O4'" . DA  B  2 7   ? 22.255  5.101   -26.484 1.00 36.17  ? 7    DA  F "O4'" 1 
ATOM   796  C  "C3'" . DA  B  2 7   ? 21.733  3.090   -25.326 1.00 36.31  ? 7    DA  F "C3'" 1 
ATOM   797  O  "O3'" . DA  B  2 7   ? 22.397  2.905   -24.092 1.00 35.55  ? 7    DA  F "O3'" 1 
ATOM   798  C  "C2'" . DA  B  2 7   ? 20.563  4.071   -25.229 1.00 35.46  ? 7    DA  F "C2'" 1 
ATOM   799  C  "C1'" . DA  B  2 7   ? 21.235  5.399   -25.545 1.00 36.06  ? 7    DA  F "C1'" 1 
ATOM   800  N  N9    . DA  B  2 7   ? 20.361  6.399   -26.155 1.00 36.15  ? 7    DA  F N9    1 
ATOM   801  C  C8    . DA  B  2 7   ? 19.475  6.199   -27.181 1.00 35.80  ? 7    DA  F C8    1 
ATOM   802  N  N7    . DA  B  2 7   ? 18.830  7.289   -27.537 1.00 35.84  ? 7    DA  F N7    1 
ATOM   803  C  C5    . DA  B  2 7   ? 19.326  8.268   -26.692 1.00 35.55  ? 7    DA  F C5    1 
ATOM   804  C  C6    . DA  B  2 7   ? 19.046  9.643   -26.566 1.00 35.60  ? 7    DA  F C6    1 
ATOM   805  N  N6    . DA  B  2 7   ? 18.155  10.290  -27.324 1.00 35.88  ? 7    DA  F N6    1 
ATOM   806  N  N1    . DA  B  2 7   ? 19.721  10.336  -25.626 1.00 36.17  ? 7    DA  F N1    1 
ATOM   807  C  C2    . DA  B  2 7   ? 20.617  9.690   -24.863 1.00 36.95  ? 7    DA  F C2    1 
ATOM   808  N  N3    . DA  B  2 7   ? 20.959  8.401   -24.890 1.00 36.90  ? 7    DA  F N3    1 
ATOM   809  C  C4    . DA  B  2 7   ? 20.273  7.738   -25.836 1.00 35.74  ? 7    DA  F C4    1 
ATOM   810  P  P     . DA  B  2 8   ? 21.702  2.090   -22.911 1.00 34.48  ? 8    DA  F P     1 
ATOM   811  O  OP1   . DA  B  2 8   ? 22.778  1.427   -22.140 1.00 37.05  ? 8    DA  F OP1   1 
ATOM   812  O  OP2   . DA  B  2 8   ? 20.584  1.301   -23.462 1.00 33.98  ? 8    DA  F OP2   1 
ATOM   813  O  "O5'" . DA  B  2 8   ? 21.185  3.270   -21.967 1.00 35.99  ? 8    DA  F "O5'" 1 
ATOM   814  C  "C5'" . DA  B  2 8   ? 22.135  4.244   -21.490 1.00 36.12  ? 8    DA  F "C5'" 1 
ATOM   815  C  "C4'" . DA  B  2 8   ? 21.455  5.463   -20.880 1.00 35.67  ? 8    DA  F "C4'" 1 
ATOM   816  O  "O4'" . DA  B  2 8   ? 20.729  6.216   -21.885 1.00 35.00  ? 8    DA  F "O4'" 1 
ATOM   817  C  "C3'" . DA  B  2 8   ? 20.431  5.139   -19.800 1.00 35.79  ? 8    DA  F "C3'" 1 
ATOM   818  O  "O3'" . DA  B  2 8   ? 20.908  5.700   -18.584 1.00 36.89  ? 8    DA  F "O3'" 1 
ATOM   819  C  "C2'" . DA  B  2 8   ? 19.124  5.780   -20.276 1.00 34.74  ? 8    DA  F "C2'" 1 
ATOM   820  C  "C1'" . DA  B  2 8   ? 19.601  6.810   -21.284 1.00 32.71  ? 8    DA  F "C1'" 1 
ATOM   821  N  N9    . DA  B  2 8   ? 18.634  7.131   -22.336 1.00 32.36  ? 8    DA  F N9    1 
ATOM   822  C  C8    . DA  B  2 8   ? 17.999  6.265   -23.182 1.00 30.79  ? 8    DA  F C8    1 
ATOM   823  N  N7    . DA  B  2 8   ? 17.189  6.852   -24.028 1.00 30.63  ? 8    DA  F N7    1 
ATOM   824  C  C5    . DA  B  2 8   ? 17.297  8.198   -23.715 1.00 31.28  ? 8    DA  F C5    1 
ATOM   825  C  C6    . DA  B  2 8   ? 16.686  9.356   -24.240 1.00 31.20  ? 8    DA  F C6    1 
ATOM   826  N  N6    . DA  B  2 8   ? 15.812  9.334   -25.243 1.00 31.49  ? 8    DA  F N6    1 
ATOM   827  N  N1    . DA  B  2 8   ? 17.004  10.546  -23.703 1.00 31.84  ? 8    DA  F N1    1 
ATOM   828  C  C2    . DA  B  2 8   ? 17.877  10.582  -22.691 1.00 32.79  ? 8    DA  F C2    1 
ATOM   829  N  N3    . DA  B  2 8   ? 18.513  9.561   -22.107 1.00 33.23  ? 8    DA  F N3    1 
ATOM   830  C  C4    . DA  B  2 8   ? 18.181  8.386   -22.677 1.00 31.86  ? 8    DA  F C4    1 
ATOM   831  P  P     . DT  B  2 9   ? 20.032  5.752   -17.241 1.00 37.60  ? 9    DT  F P     1 
ATOM   832  O  OP1   . DT  B  2 9   ? 21.020  5.721   -16.139 1.00 37.35  ? 9    DT  F OP1   1 
ATOM   833  O  OP2   . DT  B  2 9   ? 18.925  4.769   -17.298 1.00 35.17  ? 9    DT  F OP2   1 
ATOM   834  O  "O5'" . DT  B  2 9   ? 19.416  7.237   -17.313 1.00 36.62  ? 9    DT  F "O5'" 1 
ATOM   835  C  "C5'" . DT  B  2 9   ? 20.219  8.302   -17.806 1.00 36.11  ? 9    DT  F "C5'" 1 
ATOM   836  C  "C4'" . DT  B  2 9   ? 19.577  9.655   -17.556 1.00 36.03  ? 9    DT  F "C4'" 1 
ATOM   837  O  "O4'" . DT  B  2 9   ? 18.726  10.043  -18.670 1.00 34.65  ? 9    DT  F "O4'" 1 
ATOM   838  C  "C3'" . DT  B  2 9   ? 18.717  9.753   -16.299 1.00 36.04  ? 9    DT  F "C3'" 1 
ATOM   839  O  "O3'" . DT  B  2 9   ? 18.976  11.036  -15.763 1.00 37.16  ? 9    DT  F "O3'" 1 
ATOM   840  C  "C2'" . DT  B  2 9   ? 17.299  9.595   -16.844 1.00 35.26  ? 9    DT  F "C2'" 1 
ATOM   841  C  "C1'" . DT  B  2 9   ? 17.405  10.254  -18.219 1.00 33.21  ? 9    DT  F "C1'" 1 
ATOM   842  N  N1    . DT  B  2 9   ? 16.469  9.731   -19.258 1.00 32.56  ? 9    DT  F N1    1 
ATOM   843  C  C2    . DT  B  2 9   ? 15.702  10.642  -19.961 1.00 32.57  ? 9    DT  F C2    1 
ATOM   844  O  O2    . DT  B  2 9   ? 15.770  11.845  -19.762 1.00 32.38  ? 9    DT  F O2    1 
ATOM   845  N  N3    . DT  B  2 9   ? 14.860  10.096  -20.907 1.00 30.90  ? 9    DT  F N3    1 
ATOM   846  C  C4    . DT  B  2 9   ? 14.725  8.752   -21.208 1.00 30.54  ? 9    DT  F C4    1 
ATOM   847  O  O4    . DT  B  2 9   ? 13.958  8.347   -22.071 1.00 30.11  ? 9    DT  F O4    1 
ATOM   848  C  C5    . DT  B  2 9   ? 15.546  7.852   -20.429 1.00 30.50  ? 9    DT  F C5    1 
ATOM   849  C  C7    . DT  B  2 9   ? 15.324  6.377   -20.537 1.00 29.54  ? 9    DT  F C7    1 
ATOM   850  C  C6    . DT  B  2 9   ? 16.372  8.374   -19.506 1.00 31.41  ? 9    DT  F C6    1 
ATOM   851  P  P     . DT  B  2 10  ? 18.493  11.581  -14.333 1.00 39.23  ? 10   DT  F P     1 
ATOM   852  O  OP1   . DT  B  2 10  ? 19.594  12.440  -13.824 1.00 37.49  ? 10   DT  F OP1   1 
ATOM   853  O  OP2   . DT  B  2 10  ? 17.935  10.477  -13.511 1.00 38.33  ? 10   DT  F OP2   1 
ATOM   854  O  "O5'" . DT  B  2 10  ? 17.286  12.525  -14.789 1.00 38.62  ? 10   DT  F "O5'" 1 
ATOM   855  C  "C5'" . DT  B  2 10  ? 17.517  13.568  -15.726 1.00 38.36  ? 10   DT  F "C5'" 1 
ATOM   856  C  "C4'" . DT  B  2 10  ? 16.212  14.306  -15.948 1.00 38.85  ? 10   DT  F "C4'" 1 
ATOM   857  O  "O4'" . DT  B  2 10  ? 15.390  13.606  -16.923 1.00 37.57  ? 10   DT  F "O4'" 1 
ATOM   858  C  "C3'" . DT  B  2 10  ? 15.372  14.412  -14.678 1.00 39.64  ? 10   DT  F "C3'" 1 
ATOM   859  O  "O3'" . DT  B  2 10  ? 14.924  15.773  -14.559 1.00 41.50  ? 10   DT  F "O3'" 1 
ATOM   860  C  "C2'" . DT  B  2 10  ? 14.259  13.374  -14.896 1.00 38.31  ? 10   DT  F "C2'" 1 
ATOM   861  C  "C1'" . DT  B  2 10  ? 14.078  13.460  -16.411 1.00 37.22  ? 10   DT  F "C1'" 1 
ATOM   862  N  N1    . DT  B  2 10  ? 13.478  12.268  -17.101 1.00 36.39  ? 10   DT  F N1    1 
ATOM   863  C  C2    . DT  B  2 10  ? 12.582  12.475  -18.132 1.00 35.80  ? 10   DT  F C2    1 
ATOM   864  O  O2    . DT  B  2 10  ? 12.228  13.573  -18.503 1.00 36.19  ? 10   DT  F O2    1 
ATOM   865  N  N3    . DT  B  2 10  ? 12.106  11.340  -18.725 1.00 35.64  ? 10   DT  F N3    1 
ATOM   866  C  C4    . DT  B  2 10  ? 12.438  10.043  -18.395 1.00 34.89  ? 10   DT  F C4    1 
ATOM   867  O  O4    . DT  B  2 10  ? 11.945  9.099   -18.990 1.00 35.45  ? 10   DT  F O4    1 
ATOM   868  C  C5    . DT  B  2 10  ? 13.380  9.884   -17.312 1.00 34.55  ? 10   DT  F C5    1 
ATOM   869  C  C7    . DT  B  2 10  ? 13.703  8.520   -16.772 1.00 32.83  ? 10   DT  F C7    1 
ATOM   870  C  C6    . DT  B  2 10  ? 13.853  10.992  -16.728 1.00 35.02  ? 10   DT  F C6    1 
ATOM   871  P  P     . DA  B  2 11  ? 14.225  16.357  -13.233 1.00 41.45  ? 11   DA  F P     1 
ATOM   872  O  OP1   . DA  B  2 11  ? 14.701  17.754  -13.090 1.00 42.48  ? 11   DA  F OP1   1 
ATOM   873  O  OP2   . DA  B  2 11  ? 14.360  15.402  -12.116 1.00 41.83  ? 11   DA  F OP2   1 
ATOM   874  O  "O5'" . DA  B  2 11  ? 12.686  16.396  -13.670 1.00 40.65  ? 11   DA  F "O5'" 1 
ATOM   875  C  "C5'" . DA  B  2 11  ? 12.306  16.857  -14.956 1.00 38.49  ? 11   DA  F "C5'" 1 
ATOM   876  C  "C4'" . DA  B  2 11  ? 10.810  16.655  -15.095 1.00 37.79  ? 11   DA  F "C4'" 1 
ATOM   877  O  "O4'" . DA  B  2 11  ? 10.526  15.465  -15.883 1.00 37.72  ? 11   DA  F "O4'" 1 
ATOM   878  C  "C3'" . DA  B  2 11  ? 10.075  16.470  -13.765 1.00 37.55  ? 11   DA  F "C3'" 1 
ATOM   879  O  "O3'" . DA  B  2 11  ? 8.996   17.420  -13.688 1.00 36.71  ? 11   DA  F "O3'" 1 
ATOM   880  C  "C2'" . DA  B  2 11  ? 9.583   15.018  -13.795 1.00 36.96  ? 11   DA  F "C2'" 1 
ATOM   881  C  "C1'" . DA  B  2 11  ? 9.455   14.749  -15.294 1.00 35.70  ? 11   DA  F "C1'" 1 
ATOM   882  N  N9    . DA  B  2 11  ? 9.599   13.339  -15.647 1.00 35.40  ? 11   DA  F N9    1 
ATOM   883  C  C8    . DA  B  2 11  ? 10.430  12.415  -15.052 1.00 34.69  ? 11   DA  F C8    1 
ATOM   884  N  N7    . DA  B  2 11  ? 10.343  11.218  -15.588 1.00 34.69  ? 11   DA  F N7    1 
ATOM   885  C  C5    . DA  B  2 11  ? 9.399   11.365  -16.601 1.00 34.51  ? 11   DA  F C5    1 
ATOM   886  C  C6    . DA  B  2 11  ? 8.852   10.469  -17.544 1.00 34.54  ? 11   DA  F C6    1 
ATOM   887  N  N6    . DA  B  2 11  ? 9.195   9.182   -17.635 1.00 34.64  ? 11   DA  F N6    1 
ATOM   888  N  N1    . DA  B  2 11  ? 7.925   10.940  -18.403 1.00 34.76  ? 11   DA  F N1    1 
ATOM   889  C  C2    . DA  B  2 11  ? 7.575   12.230  -18.327 1.00 34.76  ? 11   DA  F C2    1 
ATOM   890  N  N3    . DA  B  2 11  ? 8.018   13.165  -17.487 1.00 35.16  ? 11   DA  F N3    1 
ATOM   891  C  C4    . DA  B  2 11  ? 8.933   12.666  -16.644 1.00 34.61  ? 11   DA  F C4    1 
ATOM   892  P  P     . DG  B  2 12  ? 7.858   17.386  -12.551 1.00 36.02  ? 12   DG  F P     1 
ATOM   893  O  OP1   . DG  B  2 12  ? 7.277   18.756  -12.588 1.00 36.28  ? 12   DG  F OP1   1 
ATOM   894  O  OP2   . DG  B  2 12  ? 8.396   16.826  -11.288 1.00 34.29  ? 12   DG  F OP2   1 
ATOM   895  O  "O5'" . DG  B  2 12  ? 6.771   16.355  -13.135 1.00 34.08  ? 12   DG  F "O5'" 1 
ATOM   896  C  "C5'" . DG  B  2 12  ? 5.775   16.747  -14.099 1.00 32.63  ? 12   DG  F "C5'" 1 
ATOM   897  C  "C4'" . DG  B  2 12  ? 4.750   15.630  -14.262 1.00 31.71  ? 12   DG  F "C4'" 1 
ATOM   898  O  "O4'" . DG  B  2 12  ? 5.394   14.445  -14.818 1.00 31.02  ? 12   DG  F "O4'" 1 
ATOM   899  C  "C3'" . DG  B  2 12  ? 4.102   15.190  -12.943 1.00 31.54  ? 12   DG  F "C3'" 1 
ATOM   900  O  "O3'" . DG  B  2 12  ? 2.697   15.122  -13.085 1.00 31.65  ? 12   DG  F "O3'" 1 
ATOM   901  C  "C2'" . DG  B  2 12  ? 4.678   13.805  -12.699 1.00 30.77  ? 12   DG  F "C2'" 1 
ATOM   902  C  "C1'" . DG  B  2 12  ? 4.904   13.322  -14.133 1.00 29.57  ? 12   DG  F "C1'" 1 
ATOM   903  N  N9    . DG  B  2 12  ? 5.795   12.159  -14.160 1.00 29.59  ? 12   DG  F N9    1 
ATOM   904  C  C8    . DG  B  2 12  ? 6.816   11.896  -13.263 1.00 28.86  ? 12   DG  F C8    1 
ATOM   905  N  N7    . DG  B  2 12  ? 7.422   10.761  -13.480 1.00 28.49  ? 12   DG  F N7    1 
ATOM   906  C  C5    . DG  B  2 12  ? 6.760   10.221  -14.583 1.00 29.03  ? 12   DG  F C5    1 
ATOM   907  C  C6    . DG  B  2 12  ? 6.982   9.003   -15.274 1.00 29.11  ? 12   DG  F C6    1 
ATOM   908  O  O6    . DG  B  2 12  ? 7.828   8.124   -15.052 1.00 29.52  ? 12   DG  F O6    1 
ATOM   909  N  N1    . DG  B  2 12  ? 6.094   8.838   -16.333 1.00 29.15  ? 12   DG  F N1    1 
ATOM   910  C  C2    . DG  B  2 12  ? 5.116   9.733   -16.681 1.00 28.71  ? 12   DG  F C2    1 
ATOM   911  N  N2    . DG  B  2 12  ? 4.363   9.381   -17.723 1.00 28.66  ? 12   DG  F N2    1 
ATOM   912  N  N3    . DG  B  2 12  ? 4.890   10.879  -16.050 1.00 29.09  ? 12   DG  F N3    1 
ATOM   913  C  C4    . DG  B  2 12  ? 5.748   11.063  -15.010 1.00 29.45  ? 12   DG  F C4    1 
ATOM   914  P  P     . DG  B  2 13  ? 1.744   14.727  -11.867 1.00 31.74  ? 13   DG  F P     1 
ATOM   915  O  OP1   . DG  B  2 13  ? 0.359   14.906  -12.351 1.00 32.13  ? 13   DG  F OP1   1 
ATOM   916  O  OP2   . DG  B  2 13  ? 2.227   15.370  -10.624 1.00 30.42  ? 13   DG  F OP2   1 
ATOM   917  O  "O5'" . DG  B  2 13  ? 1.971   13.161  -11.693 1.00 31.65  ? 13   DG  F "O5'" 1 
ATOM   918  C  "C5'" . DG  B  2 13  ? 0.861   12.291  -11.804 1.00 31.00  ? 13   DG  F "C5'" 1 
ATOM   919  C  "C4'" . DG  B  2 13  ? 0.737   11.746  -13.208 1.00 30.39  ? 13   DG  F "C4'" 1 
ATOM   920  O  "O4'" . DG  B  2 13  ? 2.042   11.499  -13.783 1.00 30.50  ? 13   DG  F "O4'" 1 
ATOM   921  C  "C3'" . DG  B  2 13  ? 0.053   10.401  -13.256 1.00 30.44  ? 13   DG  F "C3'" 1 
ATOM   922  O  "O3'" . DG  B  2 13  ? -1.302  10.656  -13.361 1.00 30.56  ? 13   DG  F "O3'" 1 
ATOM   923  C  "C2'" . DG  B  2 13  ? 0.594   9.816   -14.559 1.00 29.79  ? 13   DG  F "C2'" 1 
ATOM   924  C  "C1'" . DG  B  2 13  ? 2.031   10.303  -14.540 1.00 28.61  ? 13   DG  F "C1'" 1 
ATOM   925  N  N9    . DG  B  2 13  ? 2.996   9.378   -13.933 1.00 28.13  ? 13   DG  F N9    1 
ATOM   926  C  C8    . DG  B  2 13  ? 3.826   9.654   -12.875 1.00 26.73  ? 13   DG  F C8    1 
ATOM   927  N  N7    . DG  B  2 13  ? 4.590   8.660   -12.544 1.00 26.48  ? 13   DG  F N7    1 
ATOM   928  C  C5    . DG  B  2 13  ? 4.253   7.658   -13.450 1.00 28.10  ? 13   DG  F C5    1 
ATOM   929  C  C6    . DG  B  2 13  ? 4.765   6.341   -13.589 1.00 27.87  ? 13   DG  F C6    1 
ATOM   930  O  O6    . DG  B  2 13  ? 5.639   5.798   -12.906 1.00 28.85  ? 13   DG  F O6    1 
ATOM   931  N  N1    . DG  B  2 13  ? 4.162   5.640   -14.632 1.00 27.82  ? 13   DG  F N1    1 
ATOM   932  C  C2    . DG  B  2 13  ? 3.177   6.155   -15.452 1.00 27.40  ? 13   DG  F C2    1 
ATOM   933  N  N2    . DG  B  2 13  ? 2.704   5.347   -16.407 1.00 27.16  ? 13   DG  F N2    1 
ATOM   934  N  N3    . DG  B  2 13  ? 2.699   7.389   -15.342 1.00 27.82  ? 13   DG  F N3    1 
ATOM   935  C  C4    . DG  B  2 13  ? 3.276   8.084   -14.320 1.00 27.61  ? 13   DG  F C4    1 
ATOM   936  P  P     . DG  B  2 14  ? -2.380  9.828   -12.538 1.00 31.59  ? 14   DG  F P     1 
ATOM   937  O  OP1   . DG  B  2 14  ? -3.651  10.594  -12.634 1.00 32.53  ? 14   DG  F OP1   1 
ATOM   938  O  OP2   . DG  B  2 14  ? -1.804  9.490   -11.226 1.00 30.31  ? 14   DG  F OP2   1 
ATOM   939  O  "O5'" . DG  B  2 14  ? -2.571  8.501   -13.410 1.00 32.12  ? 14   DG  F "O5'" 1 
ATOM   940  C  "C5'" . DG  B  2 14  ? -2.647  8.522   -14.842 1.00 30.98  ? 14   DG  F "C5'" 1 
ATOM   941  C  "C4'" . DG  B  2 14  ? -2.622  7.078   -15.314 1.00 31.28  ? 14   DG  F "C4'" 1 
ATOM   942  O  "O4'" . DG  B  2 14  ? -1.244  6.621   -15.406 1.00 29.58  ? 14   DG  F "O4'" 1 
ATOM   943  C  "C3'" . DG  B  2 14  ? -3.287  6.136   -14.320 1.00 32.12  ? 14   DG  F "C3'" 1 
ATOM   944  O  "O3'" . DG  B  2 14  ? -4.623  5.910   -14.680 1.00 35.08  ? 14   DG  F "O3'" 1 
ATOM   945  C  "C2'" . DG  B  2 14  ? -2.497  4.837   -14.452 1.00 31.21  ? 14   DG  F "C2'" 1 
ATOM   946  C  "C1'" . DG  B  2 14  ? -1.131  5.287   -14.947 1.00 28.49  ? 14   DG  F "C1'" 1 
ATOM   947  N  N9    . DG  B  2 14  ? -0.076  5.254   -13.945 1.00 28.75  ? 14   DG  F N9    1 
ATOM   948  C  C8    . DG  B  2 14  ? 0.287   6.272   -13.089 1.00 28.26  ? 14   DG  F C8    1 
ATOM   949  N  N7    . DG  B  2 14  ? 1.282   5.959   -12.312 1.00 27.77  ? 14   DG  F N7    1 
ATOM   950  C  C5    . DG  B  2 14  ? 1.605   4.649   -12.672 1.00 28.27  ? 14   DG  F C5    1 
ATOM   951  C  C6    . DG  B  2 14  ? 2.609   3.773   -12.177 1.00 27.51  ? 14   DG  F C6    1 
ATOM   952  O  O6    . DG  B  2 14  ? 3.450   3.968   -11.297 1.00 28.09  ? 14   DG  F O6    1 
ATOM   953  N  N1    . DG  B  2 14  ? 2.586   2.544   -12.803 1.00 27.51  ? 14   DG  F N1    1 
ATOM   954  C  C2    . DG  B  2 14  ? 1.713   2.189   -13.791 1.00 28.36  ? 14   DG  F C2    1 
ATOM   955  N  N2    . DG  B  2 14  ? 1.873   0.948   -14.262 1.00 27.88  ? 14   DG  F N2    1 
ATOM   956  N  N3    . DG  B  2 14  ? 0.769   2.988   -14.283 1.00 28.32  ? 14   DG  F N3    1 
ATOM   957  C  C4    . DG  B  2 14  ? 0.773   4.200   -13.674 1.00 28.24  ? 14   DG  F C4    1 
ATOM   958  P  P     . DC  B  2 15  ? -5.612  5.207   -13.627 1.00 37.00  ? 15   DC  F P     1 
ATOM   959  O  OP1   . DC  B  2 15  ? -6.951  5.190   -14.259 1.00 37.31  ? 15   DC  F OP1   1 
ATOM   960  O  OP2   . DC  B  2 15  ? -5.383  5.809   -12.302 1.00 35.86  ? 15   DC  F OP2   1 
ATOM   961  O  "O5'" . DC  B  2 15  ? -5.128  3.690   -13.569 1.00 35.53  ? 15   DC  F "O5'" 1 
ATOM   962  C  "C5'" . DC  B  2 15  ? -5.250  2.872   -14.726 1.00 33.24  ? 15   DC  F "C5'" 1 
ATOM   963  C  "C4'" . DC  B  2 15  ? -4.731  1.495   -14.370 1.00 31.77  ? 15   DC  F "C4'" 1 
ATOM   964  O  "O4'" . DC  B  2 15  ? -3.321  1.561   -13.970 1.00 30.22  ? 15   DC  F "O4'" 1 
ATOM   965  C  "C3'" . DC  B  2 15  ? -5.517  0.871   -13.217 1.00 30.53  ? 15   DC  F "C3'" 1 
ATOM   966  O  "O3'" . DC  B  2 15  ? -5.696  -0.500  -13.535 1.00 30.64  ? 15   DC  F "O3'" 1 
ATOM   967  C  "C2'" . DC  B  2 15  ? -4.598  1.118   -12.025 1.00 29.59  ? 15   DC  F "C2'" 1 
ATOM   968  C  "C1'" . DC  B  2 15  ? -3.203  1.049   -12.663 1.00 28.08  ? 15   DC  F "C1'" 1 
ATOM   969  N  N1    . DC  B  2 15  ? -2.176  1.770   -11.857 1.00 27.67  ? 15   DC  F N1    1 
ATOM   970  C  C2    . DC  B  2 15  ? -1.075  1.034   -11.383 1.00 26.53  ? 15   DC  F C2    1 
ATOM   971  O  O2    . DC  B  2 15  ? -0.979  -0.158  -11.671 1.00 26.69  ? 15   DC  F O2    1 
ATOM   972  N  N3    . DC  B  2 15  ? -0.135  1.632   -10.617 1.00 25.18  ? 15   DC  F N3    1 
ATOM   973  C  C4    . DC  B  2 15  ? -0.252  2.912   -10.295 1.00 25.08  ? 15   DC  F C4    1 
ATOM   974  N  N4    . DC  B  2 15  ? 0.733   3.426   -9.543  1.00 24.17  ? 15   DC  F N4    1 
ATOM   975  C  C5    . DC  B  2 15  ? -1.370  3.695   -10.764 1.00 25.57  ? 15   DC  F C5    1 
ATOM   976  C  C6    . DC  B  2 15  ? -2.310  3.092   -11.524 1.00 26.14  ? 15   DC  F C6    1 
ATOM   977  P  P     . DA  B  2 16  ? -6.553  -1.506  -12.644 1.00 31.59  ? 16   DA  F P     1 
ATOM   978  O  OP1   . DA  B  2 16  ? -7.358  -2.350  -13.554 1.00 31.11  ? 16   DA  F OP1   1 
ATOM   979  O  OP2   . DA  B  2 16  ? -7.210  -0.728  -11.581 1.00 32.69  ? 16   DA  F OP2   1 
ATOM   980  O  "O5'" . DA  B  2 16  ? -5.449  -2.444  -11.953 1.00 31.09  ? 16   DA  F "O5'" 1 
ATOM   981  C  "C5'" . DA  B  2 16  ? -4.462  -3.142  -12.724 1.00 30.45  ? 16   DA  F "C5'" 1 
ATOM   982  C  "C4'" . DA  B  2 16  ? -3.641  -4.078  -11.847 1.00 29.40  ? 16   DA  F "C4'" 1 
ATOM   983  O  "O4'" . DA  B  2 16  ? -2.635  -3.334  -11.110 1.00 29.19  ? 16   DA  F "O4'" 1 
ATOM   984  C  "C3'" . DA  B  2 16  ? -4.429  -4.813  -10.781 1.00 29.04  ? 16   DA  F "C3'" 1 
ATOM   985  O  "O3'" . DA  B  2 16  ? -3.834  -6.075  -10.643 1.00 30.01  ? 16   DA  F "O3'" 1 
ATOM   986  C  "C2'" . DA  B  2 16  ? -4.214  -3.936  -9.547  1.00 28.69  ? 16   DA  F "C2'" 1 
ATOM   987  C  "C1'" . DA  B  2 16  ? -2.764  -3.515  -9.724  1.00 27.98  ? 16   DA  F "C1'" 1 
ATOM   988  N  N9    . DA  B  2 16  ? -2.380  -2.236  -9.140  1.00 28.53  ? 16   DA  F N9    1 
ATOM   989  C  C8    . DA  B  2 16  ? -3.053  -1.052  -9.242  1.00 28.46  ? 16   DA  F C8    1 
ATOM   990  N  N7    . DA  B  2 16  ? -2.468  -0.051  -8.628  1.00 28.43  ? 16   DA  F N7    1 
ATOM   991  C  C5    . DA  B  2 16  ? -1.320  -0.609  -8.095  1.00 27.65  ? 16   DA  F C5    1 
ATOM   992  C  C6    . DA  B  2 16  ? -0.272  -0.072  -7.328  1.00 28.24  ? 16   DA  F C6    1 
ATOM   993  N  N6    . DA  B  2 16  ? -0.210  1.211   -6.953  1.00 27.44  ? 16   DA  F N6    1 
ATOM   994  N  N1    . DA  B  2 16  ? 0.720   -0.912  -6.950  1.00 28.67  ? 16   DA  F N1    1 
ATOM   995  C  C2    . DA  B  2 16  ? 0.653   -2.193  -7.315  1.00 28.25  ? 16   DA  F C2    1 
ATOM   996  N  N3    . DA  B  2 16  ? -0.287  -2.807  -8.029  1.00 28.69  ? 16   DA  F N3    1 
ATOM   997  C  C4    . DA  B  2 16  ? -1.251  -1.954  -8.396  1.00 28.22  ? 16   DA  F C4    1 
ATOM   998  P  P     . DG  B  2 17  ? -4.556  -7.276  -9.876  1.00 29.95  ? 17   DG  F P     1 
ATOM   999  O  OP1   . DG  B  2 17  ? -4.118  -8.526  -10.522 1.00 33.02  ? 17   DG  F OP1   1 
ATOM   1000 O  OP2   . DG  B  2 17  ? -5.998  -7.004  -9.756  1.00 31.43  ? 17   DG  F OP2   1 
ATOM   1001 O  "O5'" . DG  B  2 17  ? -3.813  -7.167  -8.479  1.00 31.36  ? 17   DG  F "O5'" 1 
ATOM   1002 C  "C5'" . DG  B  2 17  ? -2.393  -7.051  -8.511  1.00 30.28  ? 17   DG  F "C5'" 1 
ATOM   1003 C  "C4'" . DG  B  2 17  ? -1.871  -6.828  -7.110  1.00 29.39  ? 17   DG  F "C4'" 1 
ATOM   1004 O  "O4'" . DG  B  2 17  ? -1.745  -5.395  -6.895  1.00 29.73  ? 17   DG  F "O4'" 1 
ATOM   1005 C  "C3'" . DG  B  2 17  ? -2.798  -7.340  -6.012  1.00 29.44  ? 17   DG  F "C3'" 1 
ATOM   1006 O  "O3'" . DG  B  2 17  ? -2.022  -7.832  -4.941  1.00 30.47  ? 17   DG  F "O3'" 1 
ATOM   1007 C  "C2'" . DG  B  2 17  ? -3.502  -6.066  -5.564  1.00 28.63  ? 17   DG  F "C2'" 1 
ATOM   1008 C  "C1'" . DG  B  2 17  ? -2.291  -5.140  -5.619  1.00 28.44  ? 17   DG  F "C1'" 1 
ATOM   1009 N  N9    . DG  B  2 17  ? -2.557  -3.716  -5.415  1.00 28.20  ? 17   DG  F N9    1 
ATOM   1010 C  C8    . DG  B  2 17  ? -3.660  -2.985  -5.800  1.00 26.91  ? 17   DG  F C8    1 
ATOM   1011 N  N7    . DG  B  2 17  ? -3.582  -1.728  -5.452  1.00 27.01  ? 17   DG  F N7    1 
ATOM   1012 C  C5    . DG  B  2 17  ? -2.362  -1.606  -4.799  1.00 26.98  ? 17   DG  F C5    1 
ATOM   1013 C  C6    . DG  B  2 17  ? -1.730  -0.491  -4.200  1.00 27.45  ? 17   DG  F C6    1 
ATOM   1014 O  O6    . DG  B  2 17  ? -2.118  0.677   -4.103  1.00 27.60  ? 17   DG  F O6    1 
ATOM   1015 N  N1    . DG  B  2 17  ? -0.496  -0.825  -3.649  1.00 28.02  ? 17   DG  F N1    1 
ATOM   1016 C  C2    . DG  B  2 17  ? 0.068   -2.076  -3.673  1.00 27.47  ? 17   DG  F C2    1 
ATOM   1017 N  N2    . DG  B  2 17  ? 1.270   -2.187  -3.083  1.00 27.20  ? 17   DG  F N2    1 
ATOM   1018 N  N3    . DG  B  2 17  ? -0.508  -3.133  -4.233  1.00 27.21  ? 17   DG  F N3    1 
ATOM   1019 C  C4    . DG  B  2 17  ? -1.716  -2.828  -4.771  1.00 28.21  ? 17   DG  F C4    1 
ATOM   1020 P  P     . DC  B  2 18  ? -1.915  -9.390  -4.589  1.00 30.07  ? 18   DC  F P     1 
ATOM   1021 O  OP1   . DC  B  2 18  ? -0.869  -9.919  -5.479  1.00 30.88  ? 18   DC  F OP1   1 
ATOM   1022 O  OP2   . DC  B  2 18  ? -3.251  -10.016 -4.592  1.00 30.06  ? 18   DC  F OP2   1 
ATOM   1023 O  "O5'" . DC  B  2 18  ? -1.333  -9.345  -3.098  1.00 29.19  ? 18   DC  F "O5'" 1 
ATOM   1024 C  "C5'" . DC  B  2 18  ? -1.932  -8.574  -2.054  1.00 27.59  ? 18   DC  F "C5'" 1 
ATOM   1025 C  "C4'" . DC  B  2 18  ? -0.895  -7.798  -1.260  1.00 26.86  ? 18   DC  F "C4'" 1 
ATOM   1026 O  "O4'" . DC  B  2 18  ? -0.680  -6.533  -1.918  1.00 27.41  ? 18   DC  F "O4'" 1 
ATOM   1027 C  "C3'" . DC  B  2 18  ? -1.287  -7.402  0.158   1.00 27.92  ? 18   DC  F "C3'" 1 
ATOM   1028 O  "O3'" . DC  B  2 18  ? -1.004  -8.450  1.098   1.00 28.18  ? 18   DC  F "O3'" 1 
ATOM   1029 C  "C2'" . DC  B  2 18  ? -0.384  -6.196  0.401   1.00 27.72  ? 18   DC  F "C2'" 1 
ATOM   1030 C  "C1'" . DC  B  2 18  ? -0.330  -5.540  -0.976  1.00 28.39  ? 18   DC  F "C1'" 1 
ATOM   1031 N  N1    . DC  B  2 18  ? -1.259  -4.386  -1.136  1.00 28.85  ? 18   DC  F N1    1 
ATOM   1032 C  C2    . DC  B  2 18  ? -0.963  -3.145  -0.561  1.00 28.70  ? 18   DC  F C2    1 
ATOM   1033 O  O2    . DC  B  2 18  ? 0.079   -2.999  0.090   1.00 28.17  ? 18   DC  F O2    1 
ATOM   1034 N  N3    . DC  B  2 18  ? -1.836  -2.121  -0.737  1.00 29.46  ? 18   DC  F N3    1 
ATOM   1035 C  C4    . DC  B  2 18  ? -2.958  -2.292  -1.444  1.00 30.04  ? 18   DC  F C4    1 
ATOM   1036 N  N4    . DC  B  2 18  ? -3.787  -1.247  -1.589  1.00 29.25  ? 18   DC  F N4    1 
ATOM   1037 C  C5    . DC  B  2 18  ? -3.276  -3.547  -2.033  1.00 29.94  ? 18   DC  F C5    1 
ATOM   1038 C  C6    . DC  B  2 18  ? -2.409  -4.554  -1.853  1.00 30.15  ? 18   DC  F C6    1 
ATOM   1039 P  P     . DC  B  2 19  ? -1.863  -8.622  2.443   1.00 28.02  ? 19   DC  F P     1 
ATOM   1040 O  OP1   . DC  B  2 19  ? -1.319  -9.783  3.194   1.00 28.30  ? 19   DC  F OP1   1 
ATOM   1041 O  OP2   . DC  B  2 19  ? -3.284  -8.583  2.095   1.00 28.01  ? 19   DC  F OP2   1 
ATOM   1042 O  "O5'" . DC  B  2 19  ? -1.456  -7.315  3.265   1.00 27.91  ? 19   DC  F "O5'" 1 
ATOM   1043 C  "C5'" . DC  B  2 19  ? -0.063  -7.121  3.525   1.00 28.49  ? 19   DC  F "C5'" 1 
ATOM   1044 C  "C4'" . DC  B  2 19  ? 0.203   -5.822  4.252   1.00 27.82  ? 19   DC  F "C4'" 1 
ATOM   1045 O  "O4'" . DC  B  2 19  ? -0.053  -4.720  3.354   1.00 28.34  ? 19   DC  F "O4'" 1 
ATOM   1046 C  "C3'" . DC  B  2 19  ? -0.704  -5.588  5.453   1.00 27.93  ? 19   DC  F "C3'" 1 
ATOM   1047 O  "O3'" . DC  B  2 19  ? -0.109  -6.207  6.594   1.00 27.14  ? 19   DC  F "O3'" 1 
ATOM   1048 C  "C2'" . DC  B  2 19  ? -0.704  -4.063  5.541   1.00 27.11  ? 19   DC  F "C2'" 1 
ATOM   1049 C  "C1'" . DC  B  2 19  ? -0.565  -3.623  4.089   1.00 27.68  ? 19   DC  F "C1'" 1 
ATOM   1050 N  N1    . DC  B  2 19  ? -1.835  -3.161  3.426   1.00 28.58  ? 19   DC  F N1    1 
ATOM   1051 C  C2    . DC  B  2 19  ? -2.253  -1.843  3.620   1.00 28.51  ? 19   DC  F C2    1 
ATOM   1052 O  O2    . DC  B  2 19  ? -1.568  -1.117  4.344   1.00 29.24  ? 19   DC  F O2    1 
ATOM   1053 N  N3    . DC  B  2 19  ? -3.385  -1.401  3.018   1.00 28.54  ? 19   DC  F N3    1 
ATOM   1054 C  C4    . DC  B  2 19  ? -4.097  -2.230  2.253   1.00 28.14  ? 19   DC  F C4    1 
ATOM   1055 N  N4    . DC  B  2 19  ? -5.214  -1.750  1.679   1.00 27.67  ? 19   DC  F N4    1 
ATOM   1056 C  C5    . DC  B  2 19  ? -3.685  -3.583  2.045   1.00 27.91  ? 19   DC  F C5    1 
ATOM   1057 C  C6    . DC  B  2 19  ? -2.566  -4.004  2.639   1.00 27.61  ? 19   DC  F C6    1 
ATOM   1058 P  P     . DT  B  2 20  ? -0.915  -6.403  7.958   1.00 28.46  ? 20   DT  F P     1 
ATOM   1059 O  OP1   . DT  B  2 20  ? -0.090  -7.200  8.878   1.00 28.76  ? 20   DT  F OP1   1 
ATOM   1060 O  OP2   . DT  B  2 20  ? -2.286  -6.856  7.636   1.00 29.34  ? 20   DT  F OP2   1 
ATOM   1061 O  "O5'" . DT  B  2 20  ? -0.963  -4.925  8.563   1.00 27.67  ? 20   DT  F "O5'" 1 
ATOM   1062 C  "C5'" . DT  B  2 20  ? 0.240   -4.212  8.848   1.00 26.13  ? 20   DT  F "C5'" 1 
ATOM   1063 C  "C4'" . DT  B  2 20  ? -0.118  -2.900  9.516   1.00 25.18  ? 20   DT  F "C4'" 1 
ATOM   1064 O  "O4'" . DT  B  2 20  ? -0.913  -2.072  8.610   1.00 25.25  ? 20   DT  F "O4'" 1 
ATOM   1065 C  "C3'" . DT  B  2 20  ? -0.943  -3.066  10.788  1.00 24.46  ? 20   DT  F "C3'" 1 
ATOM   1066 O  "O3'" . DT  B  2 20  ? -0.389  -2.207  11.802  1.00 25.38  ? 20   DT  F "O3'" 1 
ATOM   1067 C  "C2'" . DT  B  2 20  ? -2.359  -2.681  10.343  1.00 24.38  ? 20   DT  F "C2'" 1 
ATOM   1068 C  "C1'" . DT  B  2 20  ? -2.115  -1.655  9.238   1.00 22.64  ? 20   DT  F "C1'" 1 
ATOM   1069 N  N1    . DT  B  2 20  ? -3.180  -1.658  8.188   1.00 22.38  ? 20   DT  F N1    1 
ATOM   1070 C  C2    . DT  B  2 20  ? -3.840  -0.486  7.805   1.00 20.89  ? 20   DT  F C2    1 
ATOM   1071 O  O2    . DT  B  2 20  ? -3.617  0.604   8.292   1.00 20.76  ? 20   DT  F O2    1 
ATOM   1072 N  N3    . DT  B  2 20  ? -4.781  -0.637  6.815   1.00 19.16  ? 20   DT  F N3    1 
ATOM   1073 C  C4    . DT  B  2 20  ? -5.120  -1.833  6.193   1.00 20.15  ? 20   DT  F C4    1 
ATOM   1074 O  O4    . DT  B  2 20  ? -5.981  -1.904  5.321   1.00 20.88  ? 20   DT  F O4    1 
ATOM   1075 C  C5    . DT  B  2 20  ? -4.397  -3.011  6.630   1.00 18.31  ? 20   DT  F C5    1 
ATOM   1076 C  C7    . DT  B  2 20  ? -4.753  -4.352  6.090   1.00 17.86  ? 20   DT  F C7    1 
ATOM   1077 C  C6    . DT  B  2 20  ? -3.475  -2.870  7.584   1.00 20.00  ? 20   DT  F C6    1 
ATOM   1078 P  P     . DG  B  2 21  ? -1.105  -1.920  13.216  1.00 25.65  ? 21   DG  F P     1 
ATOM   1079 O  OP1   . DG  B  2 21  ? -0.074  -1.377  14.127  1.00 24.63  ? 21   DG  F OP1   1 
ATOM   1080 O  OP2   . DG  B  2 21  ? -1.938  -3.079  13.584  1.00 25.40  ? 21   DG  F OP2   1 
ATOM   1081 O  "O5'" . DG  B  2 21  ? -2.116  -0.710  12.848  1.00 26.37  ? 21   DG  F "O5'" 1 
ATOM   1082 C  "C5'" . DG  B  2 21  ? -1.644  0.628   12.725  1.00 25.72  ? 21   DG  F "C5'" 1 
ATOM   1083 C  "C4'" . DG  B  2 21  ? -2.796  1.619   12.717  1.00 26.87  ? 21   DG  F "C4'" 1 
ATOM   1084 O  "O4'" . DG  B  2 21  ? -3.611  1.408   11.536  1.00 26.73  ? 21   DG  F "O4'" 1 
ATOM   1085 C  "C3'" . DG  B  2 21  ? -3.744  1.535   13.913  1.00 28.58  ? 21   DG  F "C3'" 1 
ATOM   1086 O  "O3'" . DG  B  2 21  ? -4.097  2.864   14.291  1.00 31.66  ? 21   DG  F "O3'" 1 
ATOM   1087 C  "C2'" . DG  B  2 21  ? -4.951  0.790   13.346  1.00 28.35  ? 21   DG  F "C2'" 1 
ATOM   1088 C  "C1'" . DG  B  2 21  ? -4.976  1.311   11.906  1.00 26.96  ? 21   DG  F "C1'" 1 
ATOM   1089 N  N9    . DG  B  2 21  ? -5.697  0.410   11.013  1.00 26.14  ? 21   DG  F N9    1 
ATOM   1090 C  C8    . DG  B  2 21  ? -5.510  -0.948  10.939  1.00 26.57  ? 21   DG  F C8    1 
ATOM   1091 N  N7    . DG  B  2 21  ? -6.280  -1.540  10.073  1.00 26.31  ? 21   DG  F N7    1 
ATOM   1092 C  C5    . DG  B  2 21  ? -7.051  -0.520  9.541   1.00 26.05  ? 21   DG  F C5    1 
ATOM   1093 C  C6    . DG  B  2 21  ? -8.063  -0.578  8.549   1.00 26.53  ? 21   DG  F C6    1 
ATOM   1094 O  O6    . DG  B  2 21  ? -8.517  -1.561  7.923   1.00 26.51  ? 21   DG  F O6    1 
ATOM   1095 N  N1    . DG  B  2 21  ? -8.571  0.685   8.293   1.00 26.51  ? 21   DG  F N1    1 
ATOM   1096 C  C2    . DG  B  2 21  ? -8.177  1.834   8.919   1.00 26.45  ? 21   DG  F C2    1 
ATOM   1097 N  N2    . DG  B  2 21  ? -8.820  2.930   8.519   1.00 26.40  ? 21   DG  F N2    1 
ATOM   1098 N  N3    . DG  B  2 21  ? -7.233  1.906   9.848   1.00 26.44  ? 21   DG  F N3    1 
ATOM   1099 C  C4    . DG  B  2 21  ? -6.708  0.689   10.113  1.00 26.10  ? 21   DG  F C4    1 
ATOM   1100 P  P     . DT  B  2 22  ? -4.605  3.333   15.748  1.00 31.73  ? 22   DT  F P     1 
ATOM   1101 O  OP1   . DT  B  2 22  ? -3.991  4.652   15.977  1.00 32.06  ? 22   DT  F OP1   1 
ATOM   1102 O  OP2   . DT  B  2 22  ? -4.463  2.243   16.740  1.00 32.66  ? 22   DT  F OP2   1 
ATOM   1103 O  "O5'" . DT  B  2 22  ? -6.156  3.549   15.480  1.00 32.62  ? 22   DT  F "O5'" 1 
ATOM   1104 C  "C5'" . DT  B  2 22  ? -6.523  4.380   14.400  1.00 33.05  ? 22   DT  F "C5'" 1 
ATOM   1105 C  "C4'" . DT  B  2 22  ? -7.979  4.140   14.091  1.00 33.28  ? 22   DT  F "C4'" 1 
ATOM   1106 O  "O4'" . DT  B  2 22  ? -8.134  2.986   13.230  1.00 33.32  ? 22   DT  F "O4'" 1 
ATOM   1107 C  "C3'" . DT  B  2 22  ? -8.855  3.860   15.309  1.00 34.43  ? 22   DT  F "C3'" 1 
ATOM   1108 O  "O3'" . DT  B  2 22  ? -9.953  4.789   15.197  1.00 36.02  ? 22   DT  F "O3'" 1 
ATOM   1109 C  "C2'" . DT  B  2 22  ? -9.276  2.393   15.142  1.00 33.79  ? 22   DT  F "C2'" 1 
ATOM   1110 C  "C1'" . DT  B  2 22  ? -9.332  2.351   13.613  1.00 33.49  ? 22   DT  F "C1'" 1 
ATOM   1111 N  N1    . DT  B  2 22  ? -9.395  1.021   12.931  1.00 33.13  ? 22   DT  F N1    1 
ATOM   1112 C  C2    . DT  B  2 22  ? -10.185 0.898   11.798  1.00 33.13  ? 22   DT  F C2    1 
ATOM   1113 O  O2    . DT  B  2 22  ? -10.840 1.808   11.322  1.00 33.44  ? 22   DT  F O2    1 
ATOM   1114 N  N3    . DT  B  2 22  ? -10.185 -0.345  11.228  1.00 32.86  ? 22   DT  F N3    1 
ATOM   1115 C  C4    . DT  B  2 22  ? -9.492  -1.455  11.671  1.00 32.83  ? 22   DT  F C4    1 
ATOM   1116 O  O4    . DT  B  2 22  ? -9.565  -2.528  11.083  1.00 33.10  ? 22   DT  F O4    1 
ATOM   1117 C  C5    . DT  B  2 22  ? -8.684  -1.263  12.855  1.00 32.74  ? 22   DT  F C5    1 
ATOM   1118 C  C7    . DT  B  2 22  ? -7.757  -2.348  13.320  1.00 31.99  ? 22   DT  F C7    1 
ATOM   1119 C  C6    . DT  B  2 22  ? -8.671  -0.046  13.423  1.00 32.55  ? 22   DT  F C6    1 
ATOM   1120 P  P     . DG  B  2 23  ? -10.760 5.360   16.449  1.00 35.16  ? 23   DG  F P     1 
ATOM   1121 O  OP1   . DG  B  2 23  ? -11.143 6.724   16.063  1.00 36.91  ? 23   DG  F OP1   1 
ATOM   1122 O  OP2   . DG  B  2 23  ? -9.994  5.115   17.690  1.00 35.30  ? 23   DG  F OP2   1 
ATOM   1123 O  "O5'" . DG  B  2 23  ? -12.036 4.392   16.464  1.00 34.52  ? 23   DG  F "O5'" 1 
ATOM   1124 C  "C5'" . DG  B  2 23  ? -13.322 4.873   16.138  1.00 32.38  ? 23   DG  F "C5'" 1 
ATOM   1125 C  "C4'" . DG  B  2 23  ? -14.065 4.105   15.045  1.00 31.51  ? 23   DG  F "C4'" 1 
ATOM   1126 O  "O4'" . DG  B  2 23  ? -13.233 3.295   14.175  1.00 29.90  ? 23   DG  F "O4'" 1 
ATOM   1127 C  "C3'" . DG  B  2 23  ? -15.115 3.091   15.460  1.00 30.42  ? 23   DG  F "C3'" 1 
ATOM   1128 O  "O3'" . DG  B  2 23  ? -16.215 3.733   16.033  1.00 30.70  ? 23   DG  F "O3'" 1 
ATOM   1129 C  "C2'" . DG  B  2 23  ? -15.487 2.576   14.077  1.00 29.77  ? 23   DG  F "C2'" 1 
ATOM   1130 C  "C1'" . DG  B  2 23  ? -14.113 2.474   13.419  1.00 28.34  ? 23   DG  F "C1'" 1 
ATOM   1131 N  N9    . DG  B  2 23  ? -13.563 1.119   13.391  1.00 28.27  ? 23   DG  F N9    1 
ATOM   1132 C  C8    . DG  B  2 23  ? -12.497 0.658   14.132  1.00 27.99  ? 23   DG  F C8    1 
ATOM   1133 N  N7    . DG  B  2 23  ? -12.217 -0.594  13.907  1.00 28.50  ? 23   DG  F N7    1 
ATOM   1134 C  C5    . DG  B  2 23  ? -13.152 -0.989  12.946  1.00 28.08  ? 23   DG  F C5    1 
ATOM   1135 C  C6    . DG  B  2 23  ? -13.335 -2.240  12.306  1.00 27.62  ? 23   DG  F C6    1 
ATOM   1136 O  O6    . DG  B  2 23  ? -12.685 -3.288  12.460  1.00 27.41  ? 23   DG  F O6    1 
ATOM   1137 N  N1    . DG  B  2 23  ? -14.399 -2.212  11.413  1.00 27.31  ? 23   DG  F N1    1 
ATOM   1138 C  C2    . DG  B  2 23  ? -15.184 -1.114  11.162  1.00 27.88  ? 23   DG  F C2    1 
ATOM   1139 N  N2    . DG  B  2 23  ? -16.168 -1.268  10.270  1.00 27.64  ? 23   DG  F N2    1 
ATOM   1140 N  N3    . DG  B  2 23  ? -15.016 0.067   11.740  1.00 29.42  ? 23   DG  F N3    1 
ATOM   1141 C  C4    . DG  B  2 23  ? -13.985 0.056   12.623  1.00 28.03  ? 23   DG  F C4    1 
ATOM   1142 P  P     . DC  B  2 24  ? -17.164 2.952   17.041  1.00 31.12  ? 24   DC  F P     1 
ATOM   1143 O  OP1   . DC  B  2 24  ? -17.928 3.973   17.780  1.00 32.05  ? 24   DC  F OP1   1 
ATOM   1144 O  OP2   . DC  B  2 24  ? -16.373 1.950   17.794  1.00 29.36  ? 24   DC  F OP2   1 
ATOM   1145 O  "O5'" . DC  B  2 24  ? -18.177 2.199   16.065  1.00 32.63  ? 24   DC  F "O5'" 1 
ATOM   1146 C  "C5'" . DC  B  2 24  ? -18.824 2.885   15.010  1.00 34.50  ? 24   DC  F "C5'" 1 
ATOM   1147 C  "C4'" . DC  B  2 24  ? -19.438 1.886   14.032  1.00 35.76  ? 24   DC  F "C4'" 1 
ATOM   1148 O  "O4'" . DC  B  2 24  ? -18.410 1.188   13.263  1.00 35.16  ? 24   DC  F "O4'" 1 
ATOM   1149 C  "C3'" . DC  B  2 24  ? -20.295 0.797   14.667  1.00 35.92  ? 24   DC  F "C3'" 1 
ATOM   1150 O  "O3'" . DC  B  2 24  ? -21.617 1.309   14.835  1.00 38.08  ? 24   DC  F "O3'" 1 
ATOM   1151 C  "C2'" . DC  B  2 24  ? -20.243 -0.280  13.589  1.00 34.94  ? 24   DC  F "C2'" 1 
ATOM   1152 C  "C1'" . DC  B  2 24  ? -18.839 -0.133  13.001  1.00 34.77  ? 24   DC  F "C1'" 1 
ATOM   1153 N  N1    . DC  B  2 24  ? -17.823 -1.129  13.533  1.00 34.29  ? 24   DC  F N1    1 
ATOM   1154 C  C2    . DC  B  2 24  ? -17.805 -2.425  12.999  1.00 33.88  ? 24   DC  F C2    1 
ATOM   1155 O  O2    . DC  B  2 24  ? -18.623 -2.715  12.112  1.00 33.65  ? 24   DC  F O2    1 
ATOM   1156 N  N3    . DC  B  2 24  ? -16.897 -3.325  13.467  1.00 34.01  ? 24   DC  F N3    1 
ATOM   1157 C  C4    . DC  B  2 24  ? -16.030 -2.973  14.423  1.00 33.61  ? 24   DC  F C4    1 
ATOM   1158 N  N4    . DC  B  2 24  ? -15.156 -3.893  14.852  1.00 32.91  ? 24   DC  F N4    1 
ATOM   1159 C  C5    . DC  B  2 24  ? -16.035 -1.655  14.978  1.00 33.94  ? 24   DC  F C5    1 
ATOM   1160 C  C6    . DC  B  2 24  ? -16.937 -0.775  14.511  1.00 33.83  ? 24   DC  F C6    1 
ATOM   1161 P  P     . DT  B  2 25  ? -22.761 0.599   15.724  1.00 40.53  ? 25   DT  F P     1 
ATOM   1162 O  OP1   . DT  B  2 25  ? -23.894 1.547   15.726  1.00 40.50  ? 25   DT  F OP1   1 
ATOM   1163 O  OP2   . DT  B  2 25  ? -22.186 0.087   16.989  1.00 39.38  ? 25   DT  F OP2   1 
ATOM   1164 O  "O5'" . DT  B  2 25  ? -23.240 -0.665  14.881  1.00 41.58  ? 25   DT  F "O5'" 1 
ATOM   1165 C  "C5'" . DT  B  2 25  ? -23.909 -0.507  13.643  1.00 43.33  ? 25   DT  F "C5'" 1 
ATOM   1166 C  "C4'" . DT  B  2 25  ? -24.309 -1.879  13.146  1.00 43.77  ? 25   DT  F "C4'" 1 
ATOM   1167 O  "O4'" . DT  B  2 25  ? -23.127 -2.710  12.998  1.00 43.13  ? 25   DT  F "O4'" 1 
ATOM   1168 C  "C3'" . DT  B  2 25  ? -25.235 -2.614  14.097  1.00 45.06  ? 25   DT  F "C3'" 1 
ATOM   1169 O  "O3'" . DT  B  2 25  ? -26.213 -3.277  13.320  1.00 49.01  ? 25   DT  F "O3'" 1 
ATOM   1170 C  "C2'" . DT  B  2 25  ? -24.322 -3.605  14.819  1.00 44.28  ? 25   DT  F "C2'" 1 
ATOM   1171 C  "C1'" . DT  B  2 25  ? -23.246 -3.884  13.775  1.00 42.44  ? 25   DT  F "C1'" 1 
ATOM   1172 N  N1    . DT  B  2 25  ? -21.916 -4.189  14.366  1.00 41.49  ? 25   DT  F N1    1 
ATOM   1173 C  C2    . DT  B  2 25  ? -21.353 -5.414  14.110  1.00 40.78  ? 25   DT  F C2    1 
ATOM   1174 O  O2    . DT  B  2 25  ? -21.901 -6.255  13.426  1.00 40.39  ? 25   DT  F O2    1 
ATOM   1175 N  N3    . DT  B  2 25  ? -20.127 -5.623  14.695  1.00 40.73  ? 25   DT  F N3    1 
ATOM   1176 C  C4    . DT  B  2 25  ? -19.422 -4.738  15.490  1.00 40.19  ? 25   DT  F C4    1 
ATOM   1177 O  O4    . DT  B  2 25  ? -18.328 -5.029  15.954  1.00 40.26  ? 25   DT  F O4    1 
ATOM   1178 C  C5    . DT  B  2 25  ? -20.070 -3.466  15.726  1.00 40.12  ? 25   DT  F C5    1 
ATOM   1179 C  C7    . DT  B  2 25  ? -19.515 -2.510  16.736  1.00 38.88  ? 25   DT  F C7    1 
ATOM   1180 C  C6    . DT  B  2 25  ? -21.269 -3.256  15.160  1.00 40.86  ? 25   DT  F C6    1 
ATOM   1181 P  P     . DA  B  2 26  ? -27.390 -4.121  14.014  1.00 51.54  ? 26   DA  F P     1 
ATOM   1182 O  OP1   . DA  B  2 26  ? -28.530 -4.007  13.070  1.00 51.26  ? 26   DA  F OP1   1 
ATOM   1183 O  OP2   . DA  B  2 26  ? -27.529 -3.722  15.435  1.00 50.58  ? 26   DA  F OP2   1 
ATOM   1184 O  "O5'" . DA  B  2 26  ? -26.833 -5.621  13.980  1.00 51.80  ? 26   DA  F "O5'" 1 
ATOM   1185 C  "C5'" . DA  B  2 26  ? -26.642 -6.265  12.730  1.00 52.58  ? 26   DA  F "C5'" 1 
ATOM   1186 C  "C4'" . DA  B  2 26  ? -26.243 -7.698  12.995  1.00 53.14  ? 26   DA  F "C4'" 1 
ATOM   1187 O  "O4'" . DA  B  2 26  ? -24.911 -7.719  13.562  1.00 52.39  ? 26   DA  F "O4'" 1 
ATOM   1188 C  "C3'" . DA  B  2 26  ? -27.145 -8.414  13.990  1.00 54.15  ? 26   DA  F "C3'" 1 
ATOM   1189 O  "O3'" . DA  B  2 26  ? -27.557 -9.649  13.387  1.00 57.17  ? 26   DA  F "O3'" 1 
ATOM   1190 C  "C2'" . DA  B  2 26  ? -26.273 -8.580  15.244  1.00 52.89  ? 26   DA  F "C2'" 1 
ATOM   1191 C  "C1'" . DA  B  2 26  ? -24.860 -8.587  14.670  1.00 50.30  ? 26   DA  F "C1'" 1 
ATOM   1192 N  N9    . DA  B  2 26  ? -23.804 -8.062  15.531  1.00 49.39  ? 26   DA  F N9    1 
ATOM   1193 C  C8    . DA  B  2 26  ? -23.801 -6.874  16.199  1.00 48.56  ? 26   DA  F C8    1 
ATOM   1194 N  N7    . DA  B  2 26  ? -22.705 -6.661  16.886  1.00 48.42  ? 26   DA  F N7    1 
ATOM   1195 C  C5    . DA  B  2 26  ? -21.926 -7.780  16.648  1.00 48.56  ? 26   DA  F C5    1 
ATOM   1196 C  C6    . DA  B  2 26  ? -20.638 -8.167  17.086  1.00 48.65  ? 26   DA  F C6    1 
ATOM   1197 N  N6    . DA  B  2 26  ? -19.872 -7.435  17.898  1.00 48.54  ? 26   DA  F N6    1 
ATOM   1198 N  N1    . DA  B  2 26  ? -20.159 -9.352  16.662  1.00 48.76  ? 26   DA  F N1    1 
ATOM   1199 C  C2    . DA  B  2 26  ? -20.923 -10.095 15.853  1.00 48.74  ? 26   DA  F C2    1 
ATOM   1200 N  N3    . DA  B  2 26  ? -22.138 -9.836  15.368  1.00 48.51  ? 26   DA  F N3    1 
ATOM   1201 C  C4    . DA  B  2 26  ? -22.590 -8.652  15.808  1.00 48.96  ? 26   DA  F C4    1 
ATOM   1202 P  P     . DA  B  2 27  ? -28.722 -10.565 14.009  1.00 59.95  ? 27   DA  F P     1 
ATOM   1203 O  OP1   . DA  B  2 27  ? -29.388 -11.261 12.881  1.00 59.35  ? 27   DA  F OP1   1 
ATOM   1204 O  OP2   . DA  B  2 27  ? -29.524 -9.742  14.956  1.00 59.24  ? 27   DA  F OP2   1 
ATOM   1205 O  "O5'" . DA  B  2 27  ? -27.881 -11.666 14.820  1.00 59.30  ? 27   DA  F "O5'" 1 
ATOM   1206 C  "C5'" . DA  B  2 27  ? -26.703 -12.216 14.235  1.00 60.15  ? 27   DA  F "C5'" 1 
ATOM   1207 C  "C4'" . DA  B  2 27  ? -25.957 -13.066 15.243  1.00 60.76  ? 27   DA  F "C4'" 1 
ATOM   1208 O  "O4'" . DA  B  2 27  ? -24.907 -12.297 15.886  1.00 60.51  ? 27   DA  F "O4'" 1 
ATOM   1209 C  "C3'" . DA  B  2 27  ? -26.848 -13.600 16.354  1.00 61.68  ? 27   DA  F "C3'" 1 
ATOM   1210 O  "O3'" . DA  B  2 27  ? -26.650 -14.998 16.408  1.00 63.97  ? 27   DA  F "O3'" 1 
ATOM   1211 C  "C2'" . DA  B  2 27  ? -26.369 -12.879 17.615  1.00 61.22  ? 27   DA  F "C2'" 1 
ATOM   1212 C  "C1'" . DA  B  2 27  ? -24.919 -12.543 17.277  1.00 59.63  ? 27   DA  F "C1'" 1 
ATOM   1213 N  N9    . DA  B  2 27  ? -24.398 -11.375 17.995  1.00 59.15  ? 27   DA  F N9    1 
ATOM   1214 C  C8    . DA  B  2 27  ? -25.047 -10.199 18.254  1.00 58.81  ? 27   DA  F C8    1 
ATOM   1215 N  N7    . DA  B  2 27  ? -24.324 -9.329  18.923  1.00 58.73  ? 27   DA  F N7    1 
ATOM   1216 C  C5    . DA  B  2 27  ? -23.115 -9.974  19.117  1.00 58.48  ? 27   DA  F C5    1 
ATOM   1217 C  C6    . DA  B  2 27  ? -21.921 -9.586  19.763  1.00 58.59  ? 27   DA  F C6    1 
ATOM   1218 N  N6    . DA  B  2 27  ? -21.758 -8.396  20.352  1.00 58.42  ? 27   DA  F N6    1 
ATOM   1219 N  N1    . DA  B  2 27  ? -20.898 -10.470 19.781  1.00 58.22  ? 27   DA  F N1    1 
ATOM   1220 C  C2    . DA  B  2 27  ? -21.068 -11.659 19.191  1.00 58.73  ? 27   DA  F C2    1 
ATOM   1221 N  N3    . DA  B  2 27  ? -22.141 -12.138 18.554  1.00 58.97  ? 27   DA  F N3    1 
ATOM   1222 C  C4    . DA  B  2 27  ? -23.142 -11.237 18.553  1.00 58.90  ? 27   DA  F C4    1 
ATOM   1223 P  P     . DC  B  2 28  ? -27.416 -15.930 17.461  1.00 65.85  ? 28   DC  F P     1 
ATOM   1224 O  OP1   . DC  B  2 28  ? -27.447 -17.296 16.879  1.00 66.10  ? 28   DC  F OP1   1 
ATOM   1225 O  OP2   . DC  B  2 28  ? -28.673 -15.261 17.882  1.00 65.19  ? 28   DC  F OP2   1 
ATOM   1226 O  "O5'" . DC  B  2 28  ? -26.375 -15.963 18.676  1.00 65.99  ? 28   DC  F "O5'" 1 
ATOM   1227 C  "C5'" . DC  B  2 28  ? -25.035 -16.360 18.383  1.00 66.56  ? 28   DC  F "C5'" 1 
ATOM   1228 C  "C4'" . DC  B  2 28  ? -24.155 -16.194 19.604  1.00 66.80  ? 28   DC  F "C4'" 1 
ATOM   1229 O  "O4'" . DC  B  2 28  ? -23.912 -14.783 19.838  1.00 65.97  ? 28   DC  F "O4'" 1 
ATOM   1230 C  "C3'" . DC  B  2 28  ? -24.766 -16.746 20.890  1.00 67.43  ? 28   DC  F "C3'" 1 
ATOM   1231 O  "O3'" . DC  B  2 28  ? -23.849 -17.658 21.488  1.00 69.37  ? 28   DC  F "O3'" 1 
ATOM   1232 C  "C2'" . DC  B  2 28  ? -24.981 -15.503 21.756  1.00 66.42  ? 28   DC  F "C2'" 1 
ATOM   1233 C  "C1'" . DC  B  2 28  ? -23.873 -14.593 21.236  1.00 64.88  ? 28   DC  F "C1'" 1 
ATOM   1234 N  N1    . DC  B  2 28  ? -24.037 -13.140 21.573  1.00 63.55  ? 28   DC  F N1    1 
ATOM   1235 C  C2    . DC  B  2 28  ? -22.950 -12.426 22.098  1.00 62.43  ? 28   DC  F C2    1 
ATOM   1236 O  O2    . DC  B  2 28  ? -21.874 -13.005 22.271  1.00 61.91  ? 28   DC  F O2    1 
ATOM   1237 N  N3    . DC  B  2 28  ? -23.107 -11.114 22.404  1.00 62.19  ? 28   DC  F N3    1 
ATOM   1238 C  C4    . DC  B  2 28  ? -24.285 -10.521 22.202  1.00 62.60  ? 28   DC  F C4    1 
ATOM   1239 N  N4    . DC  B  2 28  ? -24.395 -9.227  22.516  1.00 62.72  ? 28   DC  F N4    1 
ATOM   1240 C  C5    . DC  B  2 28  ? -25.403 -11.230 21.665  1.00 62.82  ? 28   DC  F C5    1 
ATOM   1241 C  C6    . DC  B  2 28  ? -25.238 -12.524 21.370  1.00 62.88  ? 28   DC  F C6    1 
ATOM   1242 P  P     . DA  B  2 29  ? -24.355 -18.835 22.456  1.00 70.96  ? 29   DA  F P     1 
ATOM   1243 O  OP1   . DA  B  2 29  ? -24.512 -20.048 21.619  1.00 70.47  ? 29   DA  F OP1   1 
ATOM   1244 O  OP2   . DA  B  2 29  ? -25.504 -18.338 23.251  1.00 70.08  ? 29   DA  F OP2   1 
ATOM   1245 O  "O5'" . DA  B  2 29  ? -23.109 -19.058 23.446  1.00 71.54  ? 29   DA  F "O5'" 1 
ATOM   1246 C  "C5'" . DA  B  2 29  ? -21.972 -18.185 23.446  1.00 72.81  ? 29   DA  F "C5'" 1 
ATOM   1247 C  "C4'" . DA  B  2 29  ? -21.556 -17.795 24.858  1.00 73.78  ? 29   DA  F "C4'" 1 
ATOM   1248 O  "O4'" . DA  B  2 29  ? -21.633 -16.355 25.013  1.00 73.00  ? 29   DA  F "O4'" 1 
ATOM   1249 C  "C3'" . DA  B  2 29  ? -22.422 -18.359 25.981  1.00 75.29  ? 29   DA  F "C3'" 1 
ATOM   1250 O  "O3'" . DA  B  2 29  ? -21.623 -18.559 27.138  1.00 78.58  ? 29   DA  F "O3'" 1 
ATOM   1251 C  "C2'" . DA  B  2 29  ? -23.438 -17.247 26.211  1.00 73.83  ? 29   DA  F "C2'" 1 
ATOM   1252 C  "C1'" . DA  B  2 29  ? -22.507 -16.050 26.083  1.00 72.18  ? 29   DA  F "C1'" 1 
ATOM   1253 N  N9    . DA  B  2 29  ? -23.192 -14.790 25.813  1.00 71.63  ? 29   DA  F N9    1 
ATOM   1254 C  C8    . DA  B  2 29  ? -24.352 -14.602 25.112  1.00 71.32  ? 29   DA  F C8    1 
ATOM   1255 N  N7    . DA  B  2 29  ? -24.729 -13.346 25.042  1.00 71.02  ? 29   DA  F N7    1 
ATOM   1256 C  C5    . DA  B  2 29  ? -23.745 -12.666 25.749  1.00 71.12  ? 29   DA  F C5    1 
ATOM   1257 C  C6    . DA  B  2 29  ? -23.555 -11.303 26.047  1.00 71.03  ? 29   DA  F C6    1 
ATOM   1258 N  N6    . DA  B  2 29  ? -24.392 -10.343 25.648  1.00 71.14  ? 29   DA  F N6    1 
ATOM   1259 N  N1    . DA  B  2 29  ? -22.468 -10.965 26.774  1.00 71.23  ? 29   DA  F N1    1 
ATOM   1260 C  C2    . DA  B  2 29  ? -21.626 -11.925 27.179  1.00 70.75  ? 29   DA  F C2    1 
ATOM   1261 N  N3    . DA  B  2 29  ? -21.698 -13.235 26.960  1.00 70.82  ? 29   DA  F N3    1 
ATOM   1262 C  C4    . DA  B  2 29  ? -22.790 -13.542 26.234  1.00 71.25  ? 29   DA  F C4    1 
ATOM   1263 P  P     . DG  B  2 30  ? -21.819 -19.869 28.044  1.00 81.39  ? 30   DG  F P     1 
ATOM   1264 O  OP1   . DG  B  2 30  ? -20.794 -20.844 27.595  1.00 81.06  ? 30   DG  F OP1   1 
ATOM   1265 O  OP2   . DG  B  2 30  ? -23.263 -20.225 28.065  1.00 80.71  ? 30   DG  F OP2   1 
ATOM   1266 O  "O5'" . DG  B  2 30  ? -21.431 -19.378 29.520  1.00 82.71  ? 30   DG  F "O5'" 1 
ATOM   1267 C  "C5'" . DG  B  2 30  ? -20.478 -18.338 29.743  1.00 84.93  ? 30   DG  F "C5'" 1 
ATOM   1268 C  "C4'" . DG  B  2 30  ? -20.990 -17.446 30.855  1.00 86.56  ? 30   DG  F "C4'" 1 
ATOM   1269 O  "O4'" . DG  B  2 30  ? -21.598 -16.273 30.261  1.00 86.42  ? 30   DG  F "O4'" 1 
ATOM   1270 C  "C3'" . DG  B  2 30  ? -22.063 -18.118 31.716  1.00 87.97  ? 30   DG  F "C3'" 1 
ATOM   1271 O  "O3'" . DG  B  2 30  ? -21.630 -18.226 33.083  1.00 90.82  ? 30   DG  F "O3'" 1 
ATOM   1272 C  "C2'" . DG  B  2 30  ? -23.300 -17.234 31.561  1.00 87.32  ? 30   DG  F "C2'" 1 
ATOM   1273 C  "C1'" . DG  B  2 30  ? -22.732 -15.929 31.025  1.00 86.20  ? 30   DG  F "C1'" 1 
ATOM   1274 N  N9    . DG  B  2 30  ? -23.696 -15.203 30.205  1.00 86.00  ? 30   DG  F N9    1 
ATOM   1275 C  C8    . DG  B  2 30  ? -24.691 -15.719 29.409  1.00 85.69  ? 30   DG  F C8    1 
ATOM   1276 N  N7    . DG  B  2 30  ? -25.399 -14.804 28.807  1.00 85.59  ? 30   DG  F N7    1 
ATOM   1277 C  C5    . DG  B  2 30  ? -24.841 -13.603 29.234  1.00 85.61  ? 30   DG  F C5    1 
ATOM   1278 C  C6    . DG  B  2 30  ? -25.185 -12.263 28.924  1.00 85.67  ? 30   DG  F C6    1 
ATOM   1279 O  O6    . DG  B  2 30  ? -26.086 -11.847 28.179  1.00 85.76  ? 30   DG  F O6    1 
ATOM   1280 N  N1    . DG  B  2 30  ? -24.356 -11.358 29.582  1.00 85.60  ? 30   DG  F N1    1 
ATOM   1281 C  C2    . DG  B  2 30  ? -23.327 -11.704 30.430  1.00 85.65  ? 30   DG  F C2    1 
ATOM   1282 N  N2    . DG  B  2 30  ? -22.630 -10.700 30.976  1.00 85.80  ? 30   DG  F N2    1 
ATOM   1283 N  N3    . DG  B  2 30  ? -22.995 -12.950 30.729  1.00 85.69  ? 30   DG  F N3    1 
ATOM   1284 C  C4    . DG  B  2 30  ? -23.794 -13.839 30.097  1.00 85.81  ? 30   DG  F C4    1 
ATOM   1285 P  P     . DG  B  2 31  ? -22.634 -18.599 34.287  1.00 92.96  ? 31   DG  F P     1 
ATOM   1286 O  OP1   . DG  B  2 31  ? -21.840 -19.251 35.356  1.00 92.49  ? 31   DG  F OP1   1 
ATOM   1287 O  OP2   . DG  B  2 31  ? -23.831 -19.282 33.741  1.00 92.60  ? 31   DG  F OP2   1 
ATOM   1288 O  "O5'" . DG  B  2 31  ? -23.087 -17.150 34.799  1.00 94.09  ? 31   DG  F "O5'" 1 
ATOM   1289 C  "C5'" . DG  B  2 31  ? -22.117 -16.164 35.175  1.00 95.45  ? 31   DG  F "C5'" 1 
ATOM   1290 C  "C4'" . DG  B  2 31  ? -22.817 -14.953 35.768  1.00 96.28  ? 31   DG  F "C4'" 1 
ATOM   1291 O  "O4'" . DG  B  2 31  ? -23.318 -14.109 34.691  1.00 96.05  ? 31   DG  F "O4'" 1 
ATOM   1292 C  "C3'" . DG  B  2 31  ? -24.021 -15.311 36.647  1.00 97.01  ? 31   DG  F "C3'" 1 
ATOM   1293 O  "O3'" . DG  B  2 31  ? -24.069 -14.497 37.828  1.00 98.71  ? 31   DG  F "O3'" 1 
ATOM   1294 C  "C2'" . DG  B  2 31  ? -25.193 -15.032 35.714  1.00 96.60  ? 31   DG  F "C2'" 1 
ATOM   1295 C  "C1'" . DG  B  2 31  ? -24.660 -13.799 35.000  1.00 95.70  ? 31   DG  F "C1'" 1 
ATOM   1296 N  N9    . DG  B  2 31  ? -25.463 -13.454 33.832  1.00 95.48  ? 31   DG  F N9    1 
ATOM   1297 C  C8    . DG  B  2 31  ? -26.085 -14.322 32.969  1.00 95.36  ? 31   DG  F C8    1 
ATOM   1298 N  N7    . DG  B  2 31  ? -26.758 -13.716 32.031  1.00 95.41  ? 31   DG  F N7    1 
ATOM   1299 C  C5    . DG  B  2 31  ? -26.578 -12.363 32.297  1.00 95.21  ? 31   DG  F C5    1 
ATOM   1300 C  C6    . DG  B  2 31  ? -27.069 -11.224 31.616  1.00 95.11  ? 31   DG  F C6    1 
ATOM   1301 O  O6    . DG  B  2 31  ? -27.785 -11.187 30.608  1.00 95.09  ? 31   DG  F O6    1 
ATOM   1302 N  N1    . DG  B  2 31  ? -26.652 -10.040 32.221  1.00 95.13  ? 31   DG  F N1    1 
ATOM   1303 C  C2    . DG  B  2 31  ? -25.856 -9.968  33.340  1.00 95.02  ? 31   DG  F C2    1 
ATOM   1304 N  N2    . DG  B  2 31  ? -25.555 -8.740  33.782  1.00 95.28  ? 31   DG  F N2    1 
ATOM   1305 N  N3    . DG  B  2 31  ? -25.386 -11.027 33.986  1.00 95.08  ? 31   DG  F N3    1 
ATOM   1306 C  C4    . DG  B  2 31  ? -25.787 -12.186 33.409  1.00 95.27  ? 31   DG  F C4    1 
ATOM   1307 P  P     . DG  B  2 32  ? -25.437 -14.202 38.624  1.00 99.76  ? 32   DG  F P     1 
ATOM   1308 O  OP1   . DG  B  2 32  ? -25.071 -13.802 40.002  1.00 99.59  ? 32   DG  F OP1   1 
ATOM   1309 O  OP2   . DG  B  2 32  ? -26.379 -15.326 38.405  1.00 99.69  ? 32   DG  F OP2   1 
ATOM   1310 O  "O5'" . DG  B  2 32  ? -26.022 -12.918 37.875  1.00 100.01 ? 32   DG  F "O5'" 1 
ATOM   1311 C  "C5'" . DG  B  2 32  ? -25.209 -11.762 37.725  1.00 100.97 ? 32   DG  F "C5'" 1 
ATOM   1312 C  "C4'" . DG  B  2 32  ? -25.958 -10.534 38.202  1.00 101.50 ? 32   DG  F "C4'" 1 
ATOM   1313 O  "O4'" . DG  B  2 32  ? -26.720 -9.974  37.104  1.00 101.44 ? 32   DG  F "O4'" 1 
ATOM   1314 C  "C3'" . DG  B  2 32  ? -26.959 -10.809 39.315  1.00 101.93 ? 32   DG  F "C3'" 1 
ATOM   1315 O  "O3'" . DG  B  2 32  ? -27.035 -9.692  40.187  1.00 102.78 ? 32   DG  F "O3'" 1 
ATOM   1316 C  "C2'" . DG  B  2 32  ? -28.274 -11.034 38.574  1.00 101.72 ? 32   DG  F "C2'" 1 
ATOM   1317 C  "C1'" . DG  B  2 32  ? -28.093 -10.256 37.275  1.00 101.16 ? 32   DG  F "C1'" 1 
ATOM   1318 N  N9    . DG  B  2 32  ? -28.577 -11.009 36.125  1.00 101.03 ? 32   DG  F N9    1 
ATOM   1319 C  C8    . DG  B  2 32  ? -28.547 -12.370 35.933  1.00 100.96 ? 32   DG  F C8    1 
ATOM   1320 N  N7    . DG  B  2 32  ? -29.073 -12.744 34.799  1.00 100.95 ? 32   DG  F N7    1 
ATOM   1321 C  C5    . DG  B  2 32  ? -29.479 -11.555 34.207  1.00 100.79 ? 32   DG  F C5    1 
ATOM   1322 C  C6    . DG  B  2 32  ? -30.114 -11.323 32.967  1.00 100.87 ? 32   DG  F C6    1 
ATOM   1323 O  O6    . DG  B  2 32  ? -30.456 -12.154 32.114  1.00 100.91 ? 32   DG  F O6    1 
ATOM   1324 N  N1    . DG  B  2 32  ? -30.343 -9.963  32.762  1.00 100.90 ? 32   DG  F N1    1 
ATOM   1325 C  C2    . DG  B  2 32  ? -30.002 -8.962  33.645  1.00 100.73 ? 32   DG  F C2    1 
ATOM   1326 N  N2    . DG  B  2 32  ? -30.300 -7.708  33.286  1.00 100.91 ? 32   DG  F N2    1 
ATOM   1327 N  N3    . DG  B  2 32  ? -29.406 -9.166  34.807  1.00 100.70 ? 32   DG  F N3    1 
ATOM   1328 C  C4    . DG  B  2 32  ? -29.179 -10.481 35.014  1.00 100.84 ? 32   DG  F C4    1 
ATOM   1329 P  P     . DC  B  2 33  ? -28.058 -9.697  41.419  1.00 103.32 ? 33   DC  F P     1 
ATOM   1330 O  OP1   . DC  B  2 33  ? -27.445 -8.894  42.505  1.00 103.01 ? 33   DC  F OP1   1 
ATOM   1331 O  OP2   . DC  B  2 33  ? -28.496 -11.094 41.666  1.00 103.18 ? 33   DC  F OP2   1 
ATOM   1332 O  "O5'" . DC  B  2 33  ? -29.301 -8.892  40.818  1.00 103.00 ? 33   DC  F "O5'" 1 
ATOM   1333 C  "C5'" . DC  B  2 33  ? -29.051 -7.685  40.117  1.00 102.96 ? 33   DC  F "C5'" 1 
ATOM   1334 C  "C4'" . DC  B  2 33  ? -30.360 -7.007  39.784  1.00 102.73 ? 33   DC  F "C4'" 1 
ATOM   1335 O  "O4'" . DC  B  2 33  ? -30.550 -7.019  38.348  1.00 102.60 ? 33   DC  F "O4'" 1 
ATOM   1336 C  "C3'" . DC  B  2 33  ? -31.588 -7.716  40.331  1.00 102.66 ? 33   DC  F "C3'" 1 
ATOM   1337 O  "O3'" . DC  B  2 33  ? -31.805 -7.383  41.697  1.00 102.57 ? 33   DC  F "O3'" 1 
ATOM   1338 C  "C2'" . DC  B  2 33  ? -32.656 -7.130  39.417  1.00 102.68 ? 33   DC  F "C2'" 1 
ATOM   1339 C  "C1'" . DC  B  2 33  ? -31.933 -7.148  38.071  1.00 102.37 ? 33   DC  F "C1'" 1 
ATOM   1340 N  N1    . DC  B  2 33  ? -32.178 -8.398  37.278  1.00 102.05 ? 33   DC  F N1    1 
ATOM   1341 C  C2    . DC  B  2 33  ? -32.915 -8.304  36.092  1.00 101.83 ? 33   DC  F C2    1 
ATOM   1342 O  O2    . DC  B  2 33  ? -33.337 -7.195  35.732  1.00 101.59 ? 33   DC  F O2    1 
ATOM   1343 N  N3    . DC  B  2 33  ? -33.142 -9.433  35.372  1.00 101.67 ? 33   DC  F N3    1 
ATOM   1344 C  C4    . DC  B  2 33  ? -32.669 -10.608 35.797  1.00 101.58 ? 33   DC  F C4    1 
ATOM   1345 N  N4    . DC  B  2 33  ? -32.923 -11.686 35.048  1.00 101.68 ? 33   DC  F N4    1 
ATOM   1346 C  C5    . DC  B  2 33  ? -31.918 -10.725 37.005  1.00 101.61 ? 33   DC  F C5    1 
ATOM   1347 C  C6    . DC  B  2 33  ? -31.699 -9.607  37.706  1.00 101.75 ? 33   DC  F C6    1 
ATOM   1348 N  N     . MET C  3 1   ? 6.492   -11.161 -10.496 1.00 62.04  ? 1    MET A N     1 
ATOM   1349 C  CA    . MET C  3 1   ? 5.348   -12.121 -10.476 1.00 61.95  ? 1    MET A CA    1 
ATOM   1350 C  C     . MET C  3 1   ? 4.689   -12.224 -9.103  1.00 61.76  ? 1    MET A C     1 
ATOM   1351 O  O     . MET C  3 1   ? 5.356   -12.378 -8.077  1.00 61.89  ? 1    MET A O     1 
ATOM   1352 C  CB    . MET C  3 1   ? 5.789   -13.518 -10.928 1.00 62.16  ? 1    MET A CB    1 
ATOM   1353 C  CG    . MET C  3 1   ? 4.641   -14.527 -11.064 1.00 62.13  ? 1    MET A CG    1 
ATOM   1354 S  SD    . MET C  3 1   ? 5.195   -16.237 -11.282 1.00 61.80  ? 1    MET A SD    1 
ATOM   1355 C  CE    . MET C  3 1   ? 5.631   -16.690 -9.598  1.00 61.66  ? 1    MET A CE    1 
ATOM   1356 N  N     . ASN C  3 2   ? 3.366   -12.128 -9.113  1.00 60.95  ? 2    ASN A N     1 
ATOM   1357 C  CA    . ASN C  3 2   ? 2.529   -12.436 -7.968  1.00 59.40  ? 2    ASN A CA    1 
ATOM   1358 C  C     . ASN C  3 2   ? 2.828   -13.852 -7.453  1.00 58.07  ? 2    ASN A C     1 
ATOM   1359 O  O     . ASN C  3 2   ? 3.192   -14.734 -8.235  1.00 58.16  ? 2    ASN A O     1 
ATOM   1360 C  CB    . ASN C  3 2   ? 1.077   -12.365 -8.437  1.00 59.94  ? 2    ASN A CB    1 
ATOM   1361 C  CG    . ASN C  3 2   ? 0.106   -12.103 -7.321  1.00 60.26  ? 2    ASN A CG    1 
ATOM   1362 O  OD1   . ASN C  3 2   ? 0.356   -12.435 -6.158  1.00 60.86  ? 2    ASN A OD1   1 
ATOM   1363 N  ND2   . ASN C  3 2   ? -1.028  -11.508 -7.671  1.00 60.01  ? 2    ASN A ND2   1 
ATOM   1364 N  N     . GLU C  3 3   ? 2.680   -14.075 -6.148  1.00 55.40  ? 3    GLU A N     1 
ATOM   1365 C  CA    . GLU C  3 3   ? 2.717   -15.437 -5.623  1.00 52.51  ? 3    GLU A CA    1 
ATOM   1366 C  C     . GLU C  3 3   ? 1.483   -16.199 -6.089  1.00 48.84  ? 3    GLU A C     1 
ATOM   1367 O  O     . GLU C  3 3   ? 1.490   -17.430 -6.177  1.00 47.64  ? 3    GLU A O     1 
ATOM   1368 C  CB    . GLU C  3 3   ? 2.798   -15.453 -4.096  1.00 54.83  ? 3    GLU A CB    1 
ATOM   1369 C  CG    . GLU C  3 3   ? 2.412   -16.801 -3.499  1.00 57.50  ? 3    GLU A CG    1 
ATOM   1370 C  CD    . GLU C  3 3   ? 3.279   -17.210 -2.319  1.00 59.47  ? 3    GLU A CD    1 
ATOM   1371 O  OE1   . GLU C  3 3   ? 3.554   -16.349 -1.452  1.00 60.46  ? 3    GLU A OE1   1 
ATOM   1372 O  OE2   . GLU C  3 3   ? 3.679   -18.399 -2.256  1.00 59.80  ? 3    GLU A OE2   1 
ATOM   1373 N  N     . LEU C  3 4   ? 0.426   -15.450 -6.393  1.00 44.74  ? 4    LEU A N     1 
ATOM   1374 C  CA    . LEU C  3 4   ? -0.815  -16.020 -6.920  1.00 41.01  ? 4    LEU A CA    1 
ATOM   1375 C  C     . LEU C  3 4   ? -0.768  -16.178 -8.436  1.00 37.93  ? 4    LEU A C     1 
ATOM   1376 O  O     . LEU C  3 4   ? -1.720  -16.664 -9.040  1.00 37.39  ? 4    LEU A O     1 
ATOM   1377 C  CB    . LEU C  3 4   ? -2.015  -15.151 -6.527  1.00 39.92  ? 4    LEU A CB    1 
ATOM   1378 C  CG    . LEU C  3 4   ? -2.336  -15.057 -5.029  1.00 40.16  ? 4    LEU A CG    1 
ATOM   1379 C  CD1   . LEU C  3 4   ? -3.595  -14.211 -4.801  1.00 39.57  ? 4    LEU A CD1   1 
ATOM   1380 C  CD2   . LEU C  3 4   ? -2.474  -16.445 -4.388  1.00 37.90  ? 4    LEU A CD2   1 
ATOM   1381 N  N     . VAL C  3 5   ? 0.353   -15.773 -9.029  1.00 35.04  ? 5    VAL A N     1 
ATOM   1382 C  CA    . VAL C  3 5   ? 0.533   -15.724 -10.486 1.00 33.44  ? 5    VAL A CA    1 
ATOM   1383 C  C     . VAL C  3 5   ? -0.518  -14.831 -11.168 1.00 32.59  ? 5    VAL A C     1 
ATOM   1384 O  O     . VAL C  3 5   ? -0.166  -13.834 -11.796 1.00 32.28  ? 5    VAL A O     1 
ATOM   1385 C  CB    . VAL C  3 5   ? 0.626   -17.129 -11.137 1.00 32.73  ? 5    VAL A CB    1 
ATOM   1386 C  CG1   . VAL C  3 5   ? 1.228   -17.028 -12.532 1.00 30.88  ? 5    VAL A CG1   1 
ATOM   1387 C  CG2   . VAL C  3 5   ? 1.476   -18.049 -10.276 1.00 31.90  ? 5    VAL A CG2   1 
ATOM   1388 N  N     . ASP C  3 6   ? -1.795  -15.187 -11.041 1.00 31.15  ? 6    ASP A N     1 
ATOM   1389 C  CA    . ASP C  3 6   ? -2.877  -14.286 -11.441 1.00 30.87  ? 6    ASP A CA    1 
ATOM   1390 C  C     . ASP C  3 6   ? -3.921  -14.138 -10.342 1.00 28.70  ? 6    ASP A C     1 
ATOM   1391 O  O     . ASP C  3 6   ? -4.763  -15.007 -10.155 1.00 27.38  ? 6    ASP A O     1 
ATOM   1392 C  CB    . ASP C  3 6   ? -3.555  -14.730 -12.738 1.00 32.37  ? 6    ASP A CB    1 
ATOM   1393 C  CG    . ASP C  3 6   ? -4.592  -13.720 -13.228 1.00 33.25  ? 6    ASP A CG    1 
ATOM   1394 O  OD1   . ASP C  3 6   ? -5.774  -13.832 -12.850 1.00 34.12  ? 6    ASP A OD1   1 
ATOM   1395 O  OD2   . ASP C  3 6   ? -4.224  -12.790 -13.969 1.00 34.65  ? 6    ASP A OD2   1 
ATOM   1396 N  N     . THR C  3 7   ? -3.857  -13.015 -9.634  1.00 27.42  ? 7    THR A N     1 
ATOM   1397 C  CA    . THR C  3 7   ? -4.800  -12.685 -8.559  1.00 25.93  ? 7    THR A CA    1 
ATOM   1398 C  C     . THR C  3 7   ? -6.274  -12.873 -8.901  1.00 24.66  ? 7    THR A C     1 
ATOM   1399 O  O     . THR C  3 7   ? -7.002  -13.534 -8.162  1.00 23.82  ? 7    THR A O     1 
ATOM   1400 C  CB    . THR C  3 7   ? -4.605  -11.233 -8.142  1.00 25.67  ? 7    THR A CB    1 
ATOM   1401 O  OG1   . THR C  3 7   ? -3.325  -11.106 -7.525  1.00 26.24  ? 7    THR A OG1   1 
ATOM   1402 C  CG2   . THR C  3 7   ? -5.707  -10.774 -7.181  1.00 24.96  ? 7    THR A CG2   1 
ATOM   1403 N  N     . THR C  3 8   ? -6.708  -12.258 -10.001 1.00 24.09  ? 8    THR A N     1 
ATOM   1404 C  CA    . THR C  3 8   ? -8.101  -12.310 -10.440 1.00 24.66  ? 8    THR A CA    1 
ATOM   1405 C  C     . THR C  3 8   ? -8.566  -13.747 -10.597 1.00 25.44  ? 8    THR A C     1 
ATOM   1406 O  O     . THR C  3 8   ? -9.597  -14.140 -10.056 1.00 27.00  ? 8    THR A O     1 
ATOM   1407 C  CB    . THR C  3 8   ? -8.296  -11.580 -11.797 1.00 25.21  ? 8    THR A CB    1 
ATOM   1408 O  OG1   . THR C  3 8   ? -7.959  -10.202 -11.658 1.00 23.63  ? 8    THR A OG1   1 
ATOM   1409 C  CG2   . THR C  3 8   ? -9.737  -11.676 -12.271 1.00 25.94  ? 8    THR A CG2   1 
ATOM   1410 N  N     . GLU C  3 9   ? -7.805  -14.526 -11.358 1.00 25.81  ? 9    GLU A N     1 
ATOM   1411 C  CA    . GLU C  3 9   ? -8.117  -15.931 -11.566 1.00 26.53  ? 9    GLU A CA    1 
ATOM   1412 C  C     . GLU C  3 9   ? -8.109  -16.727 -10.261 1.00 26.09  ? 9    GLU A C     1 
ATOM   1413 O  O     . GLU C  3 9   ? -8.846  -17.699 -10.109 1.00 26.14  ? 9    GLU A O     1 
ATOM   1414 C  CB    . GLU C  3 9   ? -7.127  -16.552 -12.548 1.00 27.48  ? 9    GLU A CB    1 
ATOM   1415 C  CG    . GLU C  3 9   ? -7.315  -16.155 -14.006 1.00 28.40  ? 9    GLU A CG    1 
ATOM   1416 C  CD    . GLU C  3 9   ? -6.266  -16.806 -14.908 1.00 29.76  ? 9    GLU A CD    1 
ATOM   1417 O  OE1   . GLU C  3 9   ? -5.549  -17.716 -14.416 1.00 29.43  ? 9    GLU A OE1   1 
ATOM   1418 O  OE2   . GLU C  3 9   ? -6.156  -16.409 -16.091 1.00 28.03  ? 9    GLU A OE2   1 
ATOM   1419 N  N     . MET C  3 10  ? -7.272  -16.328 -9.317  1.00 26.29  ? 10   MET A N     1 
ATOM   1420 C  CA    . MET C  3 10  ? -7.249  -17.024 -8.046  1.00 29.02  ? 10   MET A CA    1 
ATOM   1421 C  C     . MET C  3 10  ? -8.487  -16.711 -7.212  1.00 29.26  ? 10   MET A C     1 
ATOM   1422 O  O     . MET C  3 10  ? -8.974  -17.557 -6.459  1.00 30.24  ? 10   MET A O     1 
ATOM   1423 C  CB    . MET C  3 10  ? -5.953  -16.752 -7.283  1.00 28.82  ? 10   MET A CB    1 
ATOM   1424 C  CG    . MET C  3 10  ? -4.795  -17.641 -7.738  1.00 29.80  ? 10   MET A CG    1 
ATOM   1425 S  SD    . MET C  3 10  ? -5.187  -19.414 -7.785  1.00 29.45  ? 10   MET A SD    1 
ATOM   1426 C  CE    . MET C  3 10  ? -5.620  -19.700 -6.075  1.00 30.97  ? 10   MET A CE    1 
ATOM   1427 N  N     . TYR C  3 11  ? -9.004  -15.496 -7.361  1.00 30.09  ? 11   TYR A N     1 
ATOM   1428 C  CA    . TYR C  3 11  ? -10.257 -15.120 -6.694  1.00 29.95  ? 11   TYR A CA    1 
ATOM   1429 C  C     . TYR C  3 11  ? -11.447 -15.896 -7.271  1.00 29.40  ? 11   TYR A C     1 
ATOM   1430 O  O     . TYR C  3 11  ? -12.259 -16.454 -6.532  1.00 30.03  ? 11   TYR A O     1 
ATOM   1431 C  CB    . TYR C  3 11  ? -10.482 -13.609 -6.778  1.00 28.60  ? 11   TYR A CB    1 
ATOM   1432 C  CG    . TYR C  3 11  ? -9.788  -12.810 -5.685  1.00 29.06  ? 11   TYR A CG    1 
ATOM   1433 C  CD1   . TYR C  3 11  ? -8.443  -13.032 -5.369  1.00 28.24  ? 11   TYR A CD1   1 
ATOM   1434 C  CD2   . TYR C  3 11  ? -10.473 -11.816 -4.975  1.00 28.33  ? 11   TYR A CD2   1 
ATOM   1435 C  CE1   . TYR C  3 11  ? -7.806  -12.298 -4.377  1.00 26.76  ? 11   TYR A CE1   1 
ATOM   1436 C  CE2   . TYR C  3 11  ? -9.840  -11.076 -3.980  1.00 27.61  ? 11   TYR A CE2   1 
ATOM   1437 C  CZ    . TYR C  3 11  ? -8.511  -11.320 -3.690  1.00 27.74  ? 11   TYR A CZ    1 
ATOM   1438 O  OH    . TYR C  3 11  ? -7.883  -10.585 -2.713  1.00 27.52  ? 11   TYR A OH    1 
ATOM   1439 N  N     . LEU C  3 12  ? -11.526 -15.957 -8.594  1.00 28.90  ? 12   LEU A N     1 
ATOM   1440 C  CA    . LEU C  3 12  ? -12.567 -16.730 -9.270  1.00 29.26  ? 12   LEU A CA    1 
ATOM   1441 C  C     . LEU C  3 12  ? -12.548 -18.211 -8.902  1.00 30.94  ? 12   LEU A C     1 
ATOM   1442 O  O     . LEU C  3 12  ? -13.585 -18.789 -8.552  1.00 31.41  ? 12   LEU A O     1 
ATOM   1443 C  CB    . LEU C  3 12  ? -12.416 -16.579 -10.777 1.00 29.37  ? 12   LEU A CB    1 
ATOM   1444 C  CG    . LEU C  3 12  ? -12.440 -15.136 -11.280 1.00 28.27  ? 12   LEU A CG    1 
ATOM   1445 C  CD1   . LEU C  3 12  ? -12.046 -15.093 -12.740 1.00 27.16  ? 12   LEU A CD1   1 
ATOM   1446 C  CD2   . LEU C  3 12  ? -13.827 -14.536 -11.058 1.00 27.44  ? 12   LEU A CD2   1 
ATOM   1447 N  N     . ARG C  3 13  ? -11.369 -18.826 -8.982  1.00 31.22  ? 13   ARG A N     1 
ATOM   1448 C  CA    . ARG C  3 13  ? -11.215 -20.240 -8.626  1.00 31.31  ? 13   ARG A CA    1 
ATOM   1449 C  C     . ARG C  3 13  ? -11.628 -20.506 -7.177  1.00 30.75  ? 13   ARG A C     1 
ATOM   1450 O  O     . ARG C  3 13  ? -12.281 -21.512 -6.880  1.00 29.24  ? 13   ARG A O     1 
ATOM   1451 C  CB    . ARG C  3 13  ? -9.768  -20.679 -8.835  1.00 32.87  ? 13   ARG A CB    1 
ATOM   1452 C  CG    . ARG C  3 13  ? -9.620  -21.844 -9.785  1.00 35.56  ? 13   ARG A CG    1 
ATOM   1453 C  CD    . ARG C  3 13  ? -9.629  -23.174 -9.073  1.00 35.36  ? 13   ARG A CD    1 
ATOM   1454 N  NE    . ARG C  3 13  ? -8.316  -23.512 -8.540  1.00 36.47  ? 13   ARG A NE    1 
ATOM   1455 C  CZ    . ARG C  3 13  ? -7.987  -23.414 -7.260  1.00 37.15  ? 13   ARG A CZ    1 
ATOM   1456 N  NH1   . ARG C  3 13  ? -8.876  -22.980 -6.386  1.00 37.82  ? 13   ARG A NH1   1 
ATOM   1457 N  NH2   . ARG C  3 13  ? -6.772  -23.745 -6.856  1.00 37.47  ? 13   ARG A NH2   1 
ATOM   1458 N  N     . THR C  3 14  ? -11.243 -19.602 -6.278  1.00 29.86  ? 14   THR A N     1 
ATOM   1459 C  CA    . THR C  3 14  ? -11.538 -19.771 -4.859  1.00 30.35  ? 14   THR A CA    1 
ATOM   1460 C  C     . THR C  3 14  ? -13.036 -19.727 -4.595  1.00 30.58  ? 14   THR A C     1 
ATOM   1461 O  O     . THR C  3 14  ? -13.562 -20.540 -3.844  1.00 31.85  ? 14   THR A O     1 
ATOM   1462 C  CB    . THR C  3 14  ? -10.833 -18.713 -4.003  1.00 29.80  ? 14   THR A CB    1 
ATOM   1463 O  OG1   . THR C  3 14  ? -9.455  -18.629 -4.390  1.00 29.11  ? 14   THR A OG1   1 
ATOM   1464 C  CG2   . THR C  3 14  ? -10.942 -19.068 -2.533  1.00 27.92  ? 14   THR A CG2   1 
ATOM   1465 N  N     . ILE C  3 15  ? -13.721 -18.782 -5.229  1.00 32.09  ? 15   ILE A N     1 
ATOM   1466 C  CA    . ILE C  3 15  ? -15.172 -18.706 -5.152  1.00 33.43  ? 15   ILE A CA    1 
ATOM   1467 C  C     . ILE C  3 15  ? -15.781 -19.996 -5.678  1.00 34.06  ? 15   ILE A C     1 
ATOM   1468 O  O     . ILE C  3 15  ? -16.733 -20.522 -5.111  1.00 33.99  ? 15   ILE A O     1 
ATOM   1469 C  CB    . ILE C  3 15  ? -15.719 -17.492 -5.950  1.00 34.22  ? 15   ILE A CB    1 
ATOM   1470 C  CG1   . ILE C  3 15  ? -15.431 -16.188 -5.193  1.00 34.34  ? 15   ILE A CG1   1 
ATOM   1471 C  CG2   . ILE C  3 15  ? -17.212 -17.648 -6.227  1.00 33.16  ? 15   ILE A CG2   1 
ATOM   1472 C  CD1   . ILE C  3 15  ? -15.539 -14.935 -6.046  1.00 34.79  ? 15   ILE A CD1   1 
ATOM   1473 N  N     . TYR C  3 16  ? -15.213 -20.503 -6.767  1.00 36.03  ? 16   TYR A N     1 
ATOM   1474 C  CA    . TYR C  3 16  ? -15.675 -21.736 -7.378  1.00 36.75  ? 16   TYR A CA    1 
ATOM   1475 C  C     . TYR C  3 16  ? -15.458 -22.946 -6.463  1.00 36.52  ? 16   TYR A C     1 
ATOM   1476 O  O     . TYR C  3 16  ? -16.343 -23.784 -6.348  1.00 36.87  ? 16   TYR A O     1 
ATOM   1477 C  CB    . TYR C  3 16  ? -14.992 -21.939 -8.734  1.00 40.56  ? 16   TYR A CB    1 
ATOM   1478 C  CG    . TYR C  3 16  ? -15.611 -23.034 -9.566  1.00 41.60  ? 16   TYR A CG    1 
ATOM   1479 C  CD1   . TYR C  3 16  ? -15.276 -24.365 -9.353  1.00 42.23  ? 16   TYR A CD1   1 
ATOM   1480 C  CD2   . TYR C  3 16  ? -16.545 -22.741 -10.549 1.00 42.04  ? 16   TYR A CD2   1 
ATOM   1481 C  CE1   . TYR C  3 16  ? -15.851 -25.375 -10.101 1.00 42.80  ? 16   TYR A CE1   1 
ATOM   1482 C  CE2   . TYR C  3 16  ? -17.121 -23.743 -11.307 1.00 42.40  ? 16   TYR A CE2   1 
ATOM   1483 C  CZ    . TYR C  3 16  ? -16.769 -25.056 -11.075 1.00 42.65  ? 16   TYR A CZ    1 
ATOM   1484 O  OH    . TYR C  3 16  ? -17.333 -26.062 -11.817 1.00 43.34  ? 16   TYR A OH    1 
ATOM   1485 N  N     . ASP C  3 17  ? -14.292 -23.042 -5.820  1.00 36.38  ? 17   ASP A N     1 
ATOM   1486 C  CA    . ASP C  3 17  ? -14.047 -24.104 -4.832  1.00 36.29  ? 17   ASP A CA    1 
ATOM   1487 C  C     . ASP C  3 17  ? -15.130 -24.053 -3.784  1.00 35.74  ? 17   ASP A C     1 
ATOM   1488 O  O     . ASP C  3 17  ? -15.690 -25.074 -3.405  1.00 34.63  ? 17   ASP A O     1 
ATOM   1489 C  CB    . ASP C  3 17  ? -12.726 -23.907 -4.080  1.00 37.17  ? 17   ASP A CB    1 
ATOM   1490 C  CG    . ASP C  3 17  ? -11.515 -24.049 -4.956  1.00 38.01  ? 17   ASP A CG    1 
ATOM   1491 O  OD1   . ASP C  3 17  ? -11.606 -24.734 -5.999  1.00 37.67  ? 17   ASP A OD1   1 
ATOM   1492 O  OD2   . ASP C  3 17  ? -10.465 -23.470 -4.578  1.00 37.88  ? 17   ASP A OD2   1 
ATOM   1493 N  N     . LEU C  3 18  ? -15.394 -22.848 -3.290  1.00 35.87  ? 18   LEU A N     1 
ATOM   1494 C  CA    . LEU C  3 18  ? -16.378 -22.670 -2.239  1.00 35.95  ? 18   LEU A CA    1 
ATOM   1495 C  C     . LEU C  3 18  ? -17.719 -23.217 -2.670  1.00 36.35  ? 18   LEU A C     1 
ATOM   1496 O  O     . LEU C  3 18  ? -18.396 -23.878 -1.892  1.00 36.96  ? 18   LEU A O     1 
ATOM   1497 C  CB    . LEU C  3 18  ? -16.489 -21.199 -1.846  1.00 34.15  ? 18   LEU A CB    1 
ATOM   1498 C  CG    . LEU C  3 18  ? -15.214 -20.659 -1.195  1.00 33.46  ? 18   LEU A CG    1 
ATOM   1499 C  CD1   . LEU C  3 18  ? -15.254 -19.140 -1.103  1.00 32.26  ? 18   LEU A CD1   1 
ATOM   1500 C  CD2   . LEU C  3 18  ? -14.987 -21.309 0.179   1.00 31.78  ? 18   LEU A CD2   1 
ATOM   1501 N  N     . GLU C  3 19  ? -18.089 -22.958 -3.920  1.00 38.17  ? 19   GLU A N     1 
ATOM   1502 C  CA    . GLU C  3 19  ? -19.357 -23.437 -4.458  1.00 39.83  ? 19   GLU A CA    1 
ATOM   1503 C  C     . GLU C  3 19  ? -19.374 -24.949 -4.555  1.00 40.05  ? 19   GLU A C     1 
ATOM   1504 O  O     . GLU C  3 19  ? -20.407 -25.581 -4.317  1.00 39.78  ? 19   GLU A O     1 
ATOM   1505 C  CB    . GLU C  3 19  ? -19.629 -22.822 -5.827  1.00 41.06  ? 19   GLU A CB    1 
ATOM   1506 C  CG    . GLU C  3 19  ? -19.992 -21.349 -5.763  1.00 42.68  ? 19   GLU A CG    1 
ATOM   1507 C  CD    . GLU C  3 19  ? -20.362 -20.780 -7.116  1.00 43.97  ? 19   GLU A CD    1 
ATOM   1508 O  OE1   . GLU C  3 19  ? -20.582 -21.573 -8.059  1.00 44.63  ? 19   GLU A OE1   1 
ATOM   1509 O  OE2   . GLU C  3 19  ? -20.435 -19.536 -7.236  1.00 44.77  ? 19   GLU A OE2   1 
ATOM   1510 N  N     . GLU C  3 20  ? -18.220 -25.517 -4.903  1.00 40.59  ? 20   GLU A N     1 
ATOM   1511 C  CA    . GLU C  3 20  ? -18.034 -26.967 -4.955  1.00 41.16  ? 20   GLU A CA    1 
ATOM   1512 C  C     . GLU C  3 20  ? -18.169 -27.609 -3.577  1.00 40.89  ? 20   GLU A C     1 
ATOM   1513 O  O     . GLU C  3 20  ? -18.711 -28.704 -3.442  1.00 40.15  ? 20   GLU A O     1 
ATOM   1514 C  CB    . GLU C  3 20  ? -16.660 -27.310 -5.528  1.00 41.87  ? 20   GLU A CB    1 
ATOM   1515 C  CG    . GLU C  3 20  ? -16.644 -27.730 -6.981  1.00 43.45  ? 20   GLU A CG    1 
ATOM   1516 C  CD    . GLU C  3 20  ? -15.412 -28.558 -7.310  1.00 45.32  ? 20   GLU A CD    1 
ATOM   1517 O  OE1   . GLU C  3 20  ? -14.322 -28.235 -6.781  1.00 46.20  ? 20   GLU A OE1   1 
ATOM   1518 O  OE2   . GLU C  3 20  ? -15.531 -29.539 -8.081  1.00 46.47  ? 20   GLU A OE2   1 
ATOM   1519 N  N     . GLU C  3 21  ? -17.665 -26.922 -2.558  1.00 40.74  ? 21   GLU A N     1 
ATOM   1520 C  CA    . GLU C  3 21  ? -17.668 -27.453 -1.206  1.00 41.59  ? 21   GLU A CA    1 
ATOM   1521 C  C     . GLU C  3 21  ? -18.977 -27.167 -0.492  1.00 41.93  ? 21   GLU A C     1 
ATOM   1522 O  O     . GLU C  3 21  ? -19.213 -27.658 0.616   1.00 42.10  ? 21   GLU A O     1 
ATOM   1523 C  CB    . GLU C  3 21  ? -16.513 -26.865 -0.410  1.00 42.38  ? 21   GLU A CB    1 
ATOM   1524 C  CG    . GLU C  3 21  ? -15.171 -27.109 -1.043  1.00 43.58  ? 21   GLU A CG    1 
ATOM   1525 C  CD    . GLU C  3 21  ? -14.107 -26.241 -0.434  1.00 44.71  ? 21   GLU A CD    1 
ATOM   1526 O  OE1   . GLU C  3 21  ? -14.331 -25.761 0.698   1.00 45.06  ? 21   GLU A OE1   1 
ATOM   1527 O  OE2   . GLU C  3 21  ? -13.058 -26.035 -1.088  1.00 45.63  ? 21   GLU A OE2   1 
ATOM   1528 N  N     . GLY C  3 22  ? -19.824 -26.366 -1.126  1.00 41.52  ? 22   GLY A N     1 
ATOM   1529 C  CA    . GLY C  3 22  ? -21.112 -26.030 -0.557  1.00 40.60  ? 22   GLY A CA    1 
ATOM   1530 C  C     . GLY C  3 22  ? -20.992 -25.076 0.609   1.00 40.30  ? 22   GLY A C     1 
ATOM   1531 O  O     . GLY C  3 22  ? -21.788 -25.133 1.537   1.00 40.52  ? 22   GLY A O     1 
ATOM   1532 N  N     . VAL C  3 23  ? -19.989 -24.206 0.579   1.00 40.02  ? 23   VAL A N     1 
ATOM   1533 C  CA    . VAL C  3 23  ? -19.937 -23.110 1.545   1.00 40.46  ? 23   VAL A CA    1 
ATOM   1534 C  C     . VAL C  3 23  ? -20.244 -21.769 0.877   1.00 40.55  ? 23   VAL A C     1 
ATOM   1535 O  O     . VAL C  3 23  ? -20.054 -21.601 -0.329  1.00 41.50  ? 23   VAL A O     1 
ATOM   1536 C  CB    . VAL C  3 23  ? -18.631 -23.099 2.415   1.00 40.47  ? 23   VAL A CB    1 
ATOM   1537 C  CG1   . VAL C  3 23  ? -17.712 -24.264 2.075   1.00 39.91  ? 23   VAL A CG1   1 
ATOM   1538 C  CG2   . VAL C  3 23  ? -17.916 -21.770 2.347   1.00 40.05  ? 23   VAL A CG2   1 
ATOM   1539 N  N     . THR C  3 24  ? -20.769 -20.832 1.661   1.00 39.57  ? 24   THR A N     1 
ATOM   1540 C  CA    . THR C  3 24  ? -21.178 -19.535 1.134   1.00 37.93  ? 24   THR A CA    1 
ATOM   1541 C  C     . THR C  3 24  ? -19.968 -18.667 0.804   1.00 35.94  ? 24   THR A C     1 
ATOM   1542 O  O     . THR C  3 24  ? -19.156 -18.371 1.684   1.00 34.96  ? 24   THR A O     1 
ATOM   1543 C  CB    . THR C  3 24  ? -22.052 -18.792 2.152   1.00 38.57  ? 24   THR A CB    1 
ATOM   1544 O  OG1   . THR C  3 24  ? -22.938 -19.729 2.776   1.00 39.41  ? 24   THR A OG1   1 
ATOM   1545 C  CG2   . THR C  3 24  ? -22.860 -17.683 1.472   1.00 38.49  ? 24   THR A CG2   1 
ATOM   1546 N  N     . PRO C  3 25  ? -19.843 -18.256 -0.470  1.00 34.30  ? 25   PRO A N     1 
ATOM   1547 C  CA    . PRO C  3 25  ? -18.732 -17.402 -0.875  1.00 32.85  ? 25   PRO A CA    1 
ATOM   1548 C  C     . PRO C  3 25  ? -18.815 -16.014 -0.255  1.00 32.00  ? 25   PRO A C     1 
ATOM   1549 O  O     . PRO C  3 25  ? -19.692 -15.223 -0.616  1.00 32.58  ? 25   PRO A O     1 
ATOM   1550 C  CB    . PRO C  3 25  ? -18.875 -17.334 -2.403  1.00 32.65  ? 25   PRO A CB    1 
ATOM   1551 C  CG    . PRO C  3 25  ? -19.774 -18.474 -2.767  1.00 32.85  ? 25   PRO A CG    1 
ATOM   1552 C  CD    . PRO C  3 25  ? -20.711 -18.593 -1.609  1.00 33.67  ? 25   PRO A CD    1 
ATOM   1553 N  N     . LEU C  3 26  ? -17.916 -15.741 0.687   1.00 31.18  ? 26   LEU A N     1 
ATOM   1554 C  CA    . LEU C  3 26  ? -17.780 -14.422 1.308   1.00 30.80  ? 26   LEU A CA    1 
ATOM   1555 C  C     . LEU C  3 26  ? -16.352 -13.930 1.152   1.00 30.84  ? 26   LEU A C     1 
ATOM   1556 O  O     . LEU C  3 26  ? -15.416 -14.736 1.132   1.00 31.26  ? 26   LEU A O     1 
ATOM   1557 C  CB    . LEU C  3 26  ? -18.098 -14.494 2.801   1.00 31.21  ? 26   LEU A CB    1 
ATOM   1558 C  CG    . LEU C  3 26  ? -19.528 -14.805 3.222   1.00 32.53  ? 26   LEU A CG    1 
ATOM   1559 C  CD1   . LEU C  3 26  ? -19.630 -14.781 4.742   1.00 32.40  ? 26   LEU A CD1   1 
ATOM   1560 C  CD2   . LEU C  3 26  ? -20.507 -13.816 2.581   1.00 31.54  ? 26   LEU A CD2   1 
ATOM   1561 N  N     . ARG C  3 27  ? -16.166 -12.616 1.062   1.00 30.43  ? 27   ARG A N     1 
ATOM   1562 C  CA    . ARG C  3 27  ? -14.808 -12.067 1.041   1.00 30.51  ? 27   ARG A CA    1 
ATOM   1563 C  C     . ARG C  3 27  ? -13.965 -12.641 2.193   1.00 30.46  ? 27   ARG A C     1 
ATOM   1564 O  O     . ARG C  3 27  ? -12.778 -12.918 2.028   1.00 30.52  ? 27   ARG A O     1 
ATOM   1565 C  CB    . ARG C  3 27  ? -14.828 -10.537 1.071   1.00 29.88  ? 27   ARG A CB    1 
ATOM   1566 C  CG    . ARG C  3 27  ? -15.247 -9.926  -0.264  1.00 31.04  ? 27   ARG A CG    1 
ATOM   1567 C  CD    . ARG C  3 27  ? -15.691 -8.483  -0.133  1.00 29.64  ? 27   ARG A CD    1 
ATOM   1568 N  NE    . ARG C  3 27  ? -16.896 -8.379  0.676   1.00 30.71  ? 27   ARG A NE    1 
ATOM   1569 C  CZ    . ARG C  3 27  ? -17.730 -7.342  0.660   1.00 29.83  ? 27   ARG A CZ    1 
ATOM   1570 N  NH1   . ARG C  3 27  ? -17.503 -6.310  -0.137  1.00 29.17  ? 27   ARG A NH1   1 
ATOM   1571 N  NH2   . ARG C  3 27  ? -18.793 -7.342  1.445   1.00 30.20  ? 27   ARG A NH2   1 
ATOM   1572 N  N     . ALA C  3 28  ? -14.593 -12.843 3.345   1.00 29.21  ? 28   ALA A N     1 
ATOM   1573 C  CA    . ALA C  3 28  ? -13.896 -13.395 4.504   1.00 30.36  ? 28   ALA A CA    1 
ATOM   1574 C  C     . ALA C  3 28  ? -13.289 -14.781 4.216   1.00 30.41  ? 28   ALA A C     1 
ATOM   1575 O  O     . ALA C  3 28  ? -12.272 -15.143 4.798   1.00 30.87  ? 28   ALA A O     1 
ATOM   1576 C  CB    . ALA C  3 28  ? -14.824 -13.439 5.725   1.00 26.35  ? 28   ALA A CB    1 
ATOM   1577 N  N     . ARG C  3 29  ? -13.916 -15.541 3.315   1.00 30.94  ? 29   ARG A N     1 
ATOM   1578 C  CA    . ARG C  3 29  ? -13.434 -16.873 2.940   1.00 29.82  ? 29   ARG A CA    1 
ATOM   1579 C  C     . ARG C  3 29  ? -12.196 -16.763 2.049   1.00 30.45  ? 29   ARG A C     1 
ATOM   1580 O  O     . ARG C  3 29  ? -11.226 -17.518 2.211   1.00 30.82  ? 29   ARG A O     1 
ATOM   1581 C  CB    . ARG C  3 29  ? -14.520 -17.667 2.204   1.00 29.86  ? 29   ARG A CB    1 
ATOM   1582 C  CG    . ARG C  3 29  ? -15.787 -17.995 3.007   1.00 29.28  ? 29   ARG A CG    1 
ATOM   1583 C  CD    . ARG C  3 29  ? -15.515 -19.063 4.075   1.00 29.36  ? 29   ARG A CD    1 
ATOM   1584 N  NE    . ARG C  3 29  ? -14.734 -18.501 5.170   1.00 29.35  ? 29   ARG A NE    1 
ATOM   1585 C  CZ    . ARG C  3 29  ? -15.266 -17.753 6.132   1.00 29.58  ? 29   ARG A CZ    1 
ATOM   1586 N  NH1   . ARG C  3 29  ? -14.510 -17.241 7.093   1.00 28.04  ? 29   ARG A NH1   1 
ATOM   1587 N  NH2   . ARG C  3 29  ? -16.566 -17.498 6.114   1.00 30.73  ? 29   ARG A NH2   1 
ATOM   1588 N  N     . ILE C  3 30  ? -12.229 -15.817 1.114   1.00 29.17  ? 30   ILE A N     1 
ATOM   1589 C  CA    . ILE C  3 30  ? -11.093 -15.571 0.240   1.00 28.81  ? 30   ILE A CA    1 
ATOM   1590 C  C     . ILE C  3 30  ? -9.862  -15.099 1.003   1.00 30.61  ? 30   ILE A C     1 
ATOM   1591 O  O     . ILE C  3 30  ? -8.744  -15.464 0.660   1.00 32.32  ? 30   ILE A O     1 
ATOM   1592 C  CB    . ILE C  3 30  ? -11.418 -14.526 -0.834  1.00 27.76  ? 30   ILE A CB    1 
ATOM   1593 C  CG1   . ILE C  3 30  ? -12.575 -15.008 -1.707  1.00 26.43  ? 30   ILE A CG1   1 
ATOM   1594 C  CG2   . ILE C  3 30  ? -10.176 -14.236 -1.679  1.00 26.14  ? 30   ILE A CG2   1 
ATOM   1595 C  CD1   . ILE C  3 30  ? -13.058 -13.974 -2.681  1.00 26.64  ? 30   ILE A CD1   1 
ATOM   1596 N  N     . ALA C  3 31  ? -10.059 -14.287 2.034   1.00 31.54  ? 31   ALA A N     1 
ATOM   1597 C  CA    . ALA C  3 31  ? -8.931  -13.791 2.823   1.00 33.05  ? 31   ALA A CA    1 
ATOM   1598 C  C     . ALA C  3 31  ? -8.277  -14.928 3.634   1.00 33.67  ? 31   ALA A C     1 
ATOM   1599 O  O     . ALA C  3 31  ? -7.064  -14.935 3.848   1.00 32.32  ? 31   ALA A O     1 
ATOM   1600 C  CB    . ALA C  3 31  ? -9.384  -12.647 3.741   1.00 30.52  ? 31   ALA A CB    1 
ATOM   1601 N  N     . GLU C  3 32  ? -9.106  -15.867 4.092   1.00 34.85  ? 32   GLU A N     1 
ATOM   1602 C  CA    . GLU C  3 32  ? -8.654  -17.055 4.816   1.00 36.25  ? 32   GLU A CA    1 
ATOM   1603 C  C     . GLU C  3 32  ? -7.817  -17.983 3.954   1.00 35.46  ? 32   GLU A C     1 
ATOM   1604 O  O     . GLU C  3 32  ? -6.741  -18.426 4.361   1.00 35.42  ? 32   GLU A O     1 
ATOM   1605 C  CB    . GLU C  3 32  ? -9.861  -17.865 5.263   1.00 38.16  ? 32   GLU A CB    1 
ATOM   1606 C  CG    . GLU C  3 32  ? -10.276 -17.663 6.683   1.00 40.51  ? 32   GLU A CG    1 
ATOM   1607 C  CD    . GLU C  3 32  ? -11.602 -18.324 6.969   1.00 41.54  ? 32   GLU A CD    1 
ATOM   1608 O  OE1   . GLU C  3 32  ? -12.019 -19.220 6.196   1.00 42.29  ? 32   GLU A OE1   1 
ATOM   1609 O  OE2   . GLU C  3 32  ? -12.234 -17.933 7.963   1.00 42.50  ? 32   GLU A OE2   1 
ATOM   1610 N  N     . ARG C  3 33  ? -8.342  -18.289 2.770   1.00 34.04  ? 33   ARG A N     1 
ATOM   1611 C  CA    . ARG C  3 33  ? -7.744  -19.278 1.876   1.00 33.08  ? 33   ARG A CA    1 
ATOM   1612 C  C     . ARG C  3 33  ? -6.518  -18.778 1.115   1.00 32.66  ? 33   ARG A C     1 
ATOM   1613 O  O     . ARG C  3 33  ? -5.671  -19.580 0.712   1.00 31.92  ? 33   ARG A O     1 
ATOM   1614 C  CB    . ARG C  3 33  ? -8.786  -19.803 0.892   1.00 33.09  ? 33   ARG A CB    1 
ATOM   1615 C  CG    . ARG C  3 33  ? -9.968  -20.430 1.578   1.00 34.04  ? 33   ARG A CG    1 
ATOM   1616 C  CD    . ARG C  3 33  ? -10.533 -21.562 0.773   1.00 35.50  ? 33   ARG A CD    1 
ATOM   1617 N  NE    . ARG C  3 33  ? -11.560 -22.278 1.520   1.00 36.94  ? 33   ARG A NE    1 
ATOM   1618 C  CZ    . ARG C  3 33  ? -12.240 -23.316 1.045   1.00 37.02  ? 33   ARG A CZ    1 
ATOM   1619 N  NH1   . ARG C  3 33  ? -12.003 -23.759 -0.184  1.00 36.48  ? 33   ARG A NH1   1 
ATOM   1620 N  NH2   . ARG C  3 33  ? -13.153 -23.908 1.800   1.00 37.05  ? 33   ARG A NH2   1 
ATOM   1621 N  N     . LEU C  3 34  ? -6.426  -17.463 0.924   1.00 31.33  ? 34   LEU A N     1 
ATOM   1622 C  CA    . LEU C  3 34  ? -5.315  -16.866 0.181   1.00 30.79  ? 34   LEU A CA    1 
ATOM   1623 C  C     . LEU C  3 34  ? -4.381  -16.089 1.095   1.00 30.83  ? 34   LEU A C     1 
ATOM   1624 O  O     . LEU C  3 34  ? -3.398  -15.507 0.631   1.00 30.24  ? 34   LEU A O     1 
ATOM   1625 C  CB    . LEU C  3 34  ? -5.829  -15.948 -0.935  1.00 29.97  ? 34   LEU A CB    1 
ATOM   1626 C  CG    . LEU C  3 34  ? -6.784  -16.571 -1.964  1.00 31.33  ? 34   LEU A CG    1 
ATOM   1627 C  CD1   . LEU C  3 34  ? -7.109  -15.577 -3.085  1.00 29.30  ? 34   LEU A CD1   1 
ATOM   1628 C  CD2   . LEU C  3 34  ? -6.209  -17.880 -2.539  1.00 30.10  ? 34   LEU A CD2   1 
ATOM   1629 N  N     . ASP C  3 35  ? -4.704  -16.068 2.386   1.00 31.56  ? 35   ASP A N     1 
ATOM   1630 C  CA    . ASP C  3 35  ? -3.880  -15.389 3.387   1.00 32.29  ? 35   ASP A CA    1 
ATOM   1631 C  C     . ASP C  3 35  ? -3.670  -13.917 3.021   1.00 31.31  ? 35   ASP A C     1 
ATOM   1632 O  O     . ASP C  3 35  ? -2.543  -13.440 2.896   1.00 30.19  ? 35   ASP A O     1 
ATOM   1633 C  CB    . ASP C  3 35  ? -2.543  -16.125 3.552   1.00 34.35  ? 35   ASP A CB    1 
ATOM   1634 C  CG    . ASP C  3 35  ? -1.799  -15.735 4.822   1.00 36.87  ? 35   ASP A CG    1 
ATOM   1635 O  OD1   . ASP C  3 35  ? -2.428  -15.228 5.780   1.00 37.51  ? 35   ASP A OD1   1 
ATOM   1636 O  OD2   . ASP C  3 35  ? -0.567  -15.951 4.861   1.00 39.18  ? 35   ASP A OD2   1 
ATOM   1637 N  N     . GLN C  3 36  ? -4.777  -13.204 2.837   1.00 31.39  ? 36   GLN A N     1 
ATOM   1638 C  CA    . GLN C  3 36  ? -4.736  -11.774 2.542   1.00 30.23  ? 36   GLN A CA    1 
ATOM   1639 C  C     . GLN C  3 36  ? -5.574  -11.001 3.565   1.00 30.14  ? 36   GLN A C     1 
ATOM   1640 O  O     . GLN C  3 36  ? -6.462  -11.558 4.203   1.00 32.00  ? 36   GLN A O     1 
ATOM   1641 C  CB    . GLN C  3 36  ? -5.222  -11.515 1.112   1.00 30.43  ? 36   GLN A CB    1 
ATOM   1642 C  CG    . GLN C  3 36  ? -4.362  -12.174 0.021   1.00 30.35  ? 36   GLN A CG    1 
ATOM   1643 C  CD    . GLN C  3 36  ? -4.600  -11.584 -1.357  1.00 31.10  ? 36   GLN A CD    1 
ATOM   1644 O  OE1   . GLN C  3 36  ? -5.735  -11.340 -1.750  1.00 32.17  ? 36   GLN A OE1   1 
ATOM   1645 N  NE2   . GLN C  3 36  ? -3.525  -11.349 -2.097  1.00 32.22  ? 36   GLN A NE2   1 
ATOM   1646 N  N     . SER C  3 37  ? -5.280  -9.723  3.746   1.00 30.82  ? 37   SER A N     1 
ATOM   1647 C  CA    . SER C  3 37  ? -6.052  -8.894  4.665   1.00 29.92  ? 37   SER A CA    1 
ATOM   1648 C  C     . SER C  3 37  ? -7.394  -8.548  4.028   1.00 30.19  ? 37   SER A C     1 
ATOM   1649 O  O     . SER C  3 37  ? -7.498  -8.460  2.802   1.00 28.76  ? 37   SER A O     1 
ATOM   1650 C  CB    . SER C  3 37  ? -5.312  -7.598  4.928   1.00 30.04  ? 37   SER A CB    1 
ATOM   1651 O  OG    . SER C  3 37  ? -5.470  -6.742  3.806   1.00 30.45  ? 37   SER A OG    1 
ATOM   1652 N  N     . GLY C  3 38  ? -8.406  -8.330  4.867   1.00 28.94  ? 38   GLY A N     1 
ATOM   1653 C  CA    . GLY C  3 38  ? -9.723  -7.908  4.402   1.00 28.08  ? 38   GLY A CA    1 
ATOM   1654 C  C     . GLY C  3 38  ? -9.695  -6.681  3.501   1.00 26.69  ? 38   GLY A C     1 
ATOM   1655 O  O     . GLY C  3 38  ? -10.286 -6.672  2.424   1.00 28.44  ? 38   GLY A O     1 
ATOM   1656 N  N     . PRO C  3 39  ? -9.030  -5.615  3.935   1.00 25.87  ? 39   PRO A N     1 
ATOM   1657 C  CA    . PRO C  3 39  ? -9.003  -4.500  3.003   1.00 26.63  ? 39   PRO A CA    1 
ATOM   1658 C  C     . PRO C  3 39  ? -8.476  -4.882  1.611   1.00 28.11  ? 39   PRO A C     1 
ATOM   1659 O  O     . PRO C  3 39  ? -8.916  -4.308  0.610   1.00 30.03  ? 39   PRO A O     1 
ATOM   1660 C  CB    . PRO C  3 39  ? -8.087  -3.489  3.701   1.00 26.55  ? 39   PRO A CB    1 
ATOM   1661 C  CG    . PRO C  3 39  ? -8.243  -3.823  5.168   1.00 25.66  ? 39   PRO A CG    1 
ATOM   1662 C  CD    . PRO C  3 39  ? -8.347  -5.307  5.204   1.00 24.59  ? 39   PRO A CD    1 
ATOM   1663 N  N     . THR C  3 40  ? -7.558  -5.843  1.539   1.00 28.29  ? 40   THR A N     1 
ATOM   1664 C  CA    . THR C  3 40  ? -7.004  -6.256  0.246   1.00 27.87  ? 40   THR A CA    1 
ATOM   1665 C  C     . THR C  3 40  ? -8.053  -6.950  -0.618  1.00 27.63  ? 40   THR A C     1 
ATOM   1666 O  O     . THR C  3 40  ? -8.264  -6.572  -1.770  1.00 27.42  ? 40   THR A O     1 
ATOM   1667 C  CB    . THR C  3 40  ? -5.726  -7.140  0.401   1.00 28.45  ? 40   THR A CB    1 
ATOM   1668 O  OG1   . THR C  3 40  ? -4.660  -6.346  0.934   1.00 29.03  ? 40   THR A OG1   1 
ATOM   1669 C  CG2   . THR C  3 40  ? -5.284  -7.684  -0.923  1.00 27.64  ? 40   THR A CG2   1 
ATOM   1670 N  N     . VAL C  3 41  ? -8.735  -7.948  -0.065  1.00 28.25  ? 41   VAL A N     1 
ATOM   1671 C  CA    . VAL C  3 41  ? -9.714  -8.670  -0.861  1.00 28.91  ? 41   VAL A CA    1 
ATOM   1672 C  C     . VAL C  3 41  ? -10.963 -7.840  -1.175  1.00 29.49  ? 41   VAL A C     1 
ATOM   1673 O  O     . VAL C  3 41  ? -11.584 -8.047  -2.212  1.00 30.58  ? 41   VAL A O     1 
ATOM   1674 C  CB    . VAL C  3 41  ? -10.048 -10.079 -0.297  1.00 29.32  ? 41   VAL A CB    1 
ATOM   1675 C  CG1   . VAL C  3 41  ? -9.008  -10.503 0.740   1.00 29.26  ? 41   VAL A CG1   1 
ATOM   1676 C  CG2   . VAL C  3 41  ? -11.446 -10.142 0.247   1.00 29.80  ? 41   VAL A CG2   1 
ATOM   1677 N  N     . SER C  3 42  ? -11.311 -6.898  -0.300  1.00 29.24  ? 42   SER A N     1 
ATOM   1678 C  CA    . SER C  3 42  ? -12.394 -5.950  -0.567  1.00 28.92  ? 42   SER A CA    1 
ATOM   1679 C  C     . SER C  3 42  ? -12.110 -5.069  -1.770  1.00 27.53  ? 42   SER A C     1 
ATOM   1680 O  O     . SER C  3 42  ? -12.959 -4.887  -2.628  1.00 26.81  ? 42   SER A O     1 
ATOM   1681 C  CB    . SER C  3 42  ? -12.630 -5.039  0.639   1.00 29.37  ? 42   SER A CB    1 
ATOM   1682 O  OG    . SER C  3 42  ? -13.639 -5.571  1.468   1.00 33.18  ? 42   SER A OG    1 
ATOM   1683 N  N     . GLN C  3 43  ? -10.915 -4.501  -1.815  1.00 27.17  ? 43   GLN A N     1 
ATOM   1684 C  CA    . GLN C  3 43  ? -10.553 -3.633  -2.911  1.00 28.09  ? 43   GLN A CA    1 
ATOM   1685 C  C     . GLN C  3 43  ? -10.453 -4.405  -4.225  1.00 28.44  ? 43   GLN A C     1 
ATOM   1686 O  O     . GLN C  3 43  ? -10.931 -3.937  -5.265  1.00 28.44  ? 43   GLN A O     1 
ATOM   1687 C  CB    . GLN C  3 43  ? -9.242  -2.928  -2.605  1.00 29.24  ? 43   GLN A CB    1 
ATOM   1688 C  CG    . GLN C  3 43  ? -8.712  -2.091  -3.734  1.00 31.01  ? 43   GLN A CG    1 
ATOM   1689 C  CD    . GLN C  3 43  ? -7.426  -1.396  -3.356  1.00 32.77  ? 43   GLN A CD    1 
ATOM   1690 O  OE1   . GLN C  3 43  ? -6.573  -1.967  -2.672  1.00 34.25  ? 43   GLN A OE1   1 
ATOM   1691 N  NE2   . GLN C  3 43  ? -7.279  -0.155  -3.790  1.00 34.11  ? 43   GLN A NE2   1 
ATOM   1692 N  N     . THR C  3 44  ? -9.840  -5.589  -4.176  1.00 27.22  ? 44   THR A N     1 
ATOM   1693 C  CA    . THR C  3 44  ? -9.675  -6.407  -5.374  1.00 26.47  ? 44   THR A CA    1 
ATOM   1694 C  C     . THR C  3 44  ? -11.017 -6.906  -5.900  1.00 26.55  ? 44   THR A C     1 
ATOM   1695 O  O     . THR C  3 44  ? -11.262 -6.881  -7.095  1.00 26.32  ? 44   THR A O     1 
ATOM   1696 C  CB    . THR C  3 44  ? -8.714  -7.600  -5.143  1.00 26.76  ? 44   THR A CB    1 
ATOM   1697 O  OG1   . THR C  3 44  ? -7.371  -7.109  -5.038  1.00 26.46  ? 44   THR A OG1   1 
ATOM   1698 C  CG2   . THR C  3 44  ? -8.784  -8.568  -6.313  1.00 25.80  ? 44   THR A CG2   1 
ATOM   1699 N  N     . VAL C  3 45  ? -11.888 -7.354  -5.002  1.00 27.03  ? 45   VAL A N     1 
ATOM   1700 C  CA    . VAL C  3 45  ? -13.223 -7.772  -5.403  1.00 27.55  ? 45   VAL A CA    1 
ATOM   1701 C  C     . VAL C  3 45  ? -14.013 -6.623  -6.046  1.00 28.77  ? 45   VAL A C     1 
ATOM   1702 O  O     . VAL C  3 45  ? -14.856 -6.858  -6.915  1.00 29.09  ? 45   VAL A O     1 
ATOM   1703 C  CB    . VAL C  3 45  ? -14.014 -8.365  -4.230  1.00 26.27  ? 45   VAL A CB    1 
ATOM   1704 C  CG1   . VAL C  3 45  ? -15.485 -8.452  -4.581  1.00 25.02  ? 45   VAL A CG1   1 
ATOM   1705 C  CG2   . VAL C  3 45  ? -13.452 -9.742  -3.850  1.00 25.14  ? 45   VAL A CG2   1 
ATOM   1706 N  N     . SER C  3 46  ? -13.727 -5.392  -5.622  1.00 29.29  ? 46   SER A N     1 
ATOM   1707 C  CA    . SER C  3 46  ? -14.330 -4.205  -6.232  1.00 30.32  ? 46   SER A CA    1 
ATOM   1708 C  C     . SER C  3 46  ? -13.857 -4.000  -7.659  1.00 31.25  ? 46   SER A C     1 
ATOM   1709 O  O     . SER C  3 46  ? -14.658 -3.654  -8.526  1.00 32.71  ? 46   SER A O     1 
ATOM   1710 C  CB    . SER C  3 46  ? -14.020 -2.946  -5.425  1.00 28.75  ? 46   SER A CB    1 
ATOM   1711 O  OG    . SER C  3 46  ? -14.625 -3.039  -4.158  1.00 29.73  ? 46   SER A OG    1 
ATOM   1712 N  N     . ARG C  3 47  ? -12.559 -4.188  -7.890  1.00 31.14  ? 47   ARG A N     1 
ATOM   1713 C  CA    . ARG C  3 47  ? -12.002 -4.104  -9.234  1.00 32.65  ? 47   ARG A CA    1 
ATOM   1714 C  C     . ARG C  3 47  ? -12.646 -5.138  -10.151 1.00 32.20  ? 47   ARG A C     1 
ATOM   1715 O  O     . ARG C  3 47  ? -12.902 -4.873  -11.325 1.00 32.13  ? 47   ARG A O     1 
ATOM   1716 C  CB    . ARG C  3 47  ? -10.496 -4.329  -9.206  1.00 33.76  ? 47   ARG A CB    1 
ATOM   1717 C  CG    . ARG C  3 47  ? -9.689  -3.063  -9.202  1.00 36.61  ? 47   ARG A CG    1 
ATOM   1718 C  CD    . ARG C  3 47  ? -8.273  -3.353  -9.656  1.00 39.23  ? 47   ARG A CD    1 
ATOM   1719 N  NE    . ARG C  3 47  ? -7.753  -4.562  -9.016  1.00 41.00  ? 47   ARG A NE    1 
ATOM   1720 C  CZ    . ARG C  3 47  ? -7.168  -4.575  -7.822  1.00 41.48  ? 47   ARG A CZ    1 
ATOM   1721 N  NH1   . ARG C  3 47  ? -7.031  -3.437  -7.147  1.00 41.41  ? 47   ARG A NH1   1 
ATOM   1722 N  NH2   . ARG C  3 47  ? -6.724  -5.718  -7.306  1.00 41.22  ? 47   ARG A NH2   1 
ATOM   1723 N  N     . MET C  3 48  ? -12.907 -6.317  -9.599  1.00 31.45  ? 48   MET A N     1 
ATOM   1724 C  CA    . MET C  3 48  ? -13.551 -7.388  -10.342 1.00 31.29  ? 48   MET A CA    1 
ATOM   1725 C  C     . MET C  3 48  ? -15.031 -7.118  -10.598 1.00 31.41  ? 48   MET A C     1 
ATOM   1726 O  O     . MET C  3 48  ? -15.583 -7.611  -11.572 1.00 32.07  ? 48   MET A O     1 
ATOM   1727 C  CB    . MET C  3 48  ? -13.347 -8.728  -9.632  1.00 29.85  ? 48   MET A CB    1 
ATOM   1728 C  CG    . MET C  3 48  ? -11.891 -9.130  -9.571  1.00 28.92  ? 48   MET A CG    1 
ATOM   1729 S  SD    . MET C  3 48  ? -11.520 -10.542 -8.516  1.00 30.52  ? 48   MET A SD    1 
ATOM   1730 C  CE    . MET C  3 48  ? -12.419 -11.859 -9.322  1.00 28.18  ? 48   MET A CE    1 
ATOM   1731 N  N     . GLU C  3 49  ? -15.676 -6.355  -9.723  1.00 32.93  ? 49   GLU A N     1 
ATOM   1732 C  CA    . GLU C  3 49  ? -17.041 -5.901  -9.990  1.00 34.27  ? 49   GLU A CA    1 
ATOM   1733 C  C     . GLU C  3 49  ? -17.002 -4.894  -11.130 1.00 33.67  ? 49   GLU A C     1 
ATOM   1734 O  O     . GLU C  3 49  ? -17.752 -4.996  -12.106 1.00 32.74  ? 49   GLU A O     1 
ATOM   1735 C  CB    . GLU C  3 49  ? -17.690 -5.279  -8.748  1.00 35.46  ? 49   GLU A CB    1 
ATOM   1736 C  CG    . GLU C  3 49  ? -18.866 -6.082  -8.204  1.00 37.55  ? 49   GLU A CG    1 
ATOM   1737 C  CD    . GLU C  3 49  ? -19.641 -5.364  -7.104  1.00 38.74  ? 49   GLU A CD    1 
ATOM   1738 O  OE1   . GLU C  3 49  ? -20.876 -5.571  -7.007  1.00 38.79  ? 49   GLU A OE1   1 
ATOM   1739 O  OE2   . GLU C  3 49  ? -19.018 -4.601  -6.332  1.00 39.46  ? 49   GLU A OE2   1 
ATOM   1740 N  N     . ARG C  3 50  ? -16.085 -3.945  -11.004 1.00 33.27  ? 50   ARG A N     1 
ATOM   1741 C  CA    . ARG C  3 50  ? -15.857 -2.939  -12.025 1.00 32.96  ? 50   ARG A CA    1 
ATOM   1742 C  C     . ARG C  3 50  ? -15.670 -3.564  -13.411 1.00 33.15  ? 50   ARG A C     1 
ATOM   1743 O  O     . ARG C  3 50  ? -16.199 -3.062  -14.402 1.00 33.27  ? 50   ARG A O     1 
ATOM   1744 C  CB    . ARG C  3 50  ? -14.636 -2.107  -11.650 1.00 32.04  ? 50   ARG A CB    1 
ATOM   1745 C  CG    . ARG C  3 50  ? -14.450 -0.866  -12.482 1.00 32.22  ? 50   ARG A CG    1 
ATOM   1746 C  CD    . ARG C  3 50  ? -13.026 -0.380  -12.369 1.00 32.80  ? 50   ARG A CD    1 
ATOM   1747 N  NE    . ARG C  3 50  ? -12.111 -1.301  -13.038 1.00 34.02  ? 50   ARG A NE    1 
ATOM   1748 C  CZ    . ARG C  3 50  ? -10.808 -1.379  -12.796 1.00 34.47  ? 50   ARG A CZ    1 
ATOM   1749 N  NH1   . ARG C  3 50  ? -10.247 -0.597  -11.883 1.00 34.97  ? 50   ARG A NH1   1 
ATOM   1750 N  NH2   . ARG C  3 50  ? -10.064 -2.248  -13.467 1.00 34.92  ? 50   ARG A NH2   1 
ATOM   1751 N  N     . ASP C  3 51  ? -14.913 -4.655  -13.477 1.00 33.15  ? 51   ASP A N     1 
ATOM   1752 C  CA    . ASP C  3 51  ? -14.608 -5.298  -14.750 1.00 33.20  ? 51   ASP A CA    1 
ATOM   1753 C  C     . ASP C  3 51  ? -15.636 -6.390  -15.086 1.00 32.04  ? 51   ASP A C     1 
ATOM   1754 O  O     . ASP C  3 51  ? -15.490 -7.127  -16.060 1.00 31.42  ? 51   ASP A O     1 
ATOM   1755 C  CB    . ASP C  3 51  ? -13.176 -5.845  -14.738 1.00 35.13  ? 51   ASP A CB    1 
ATOM   1756 C  CG    . ASP C  3 51  ? -12.126 -4.742  -14.586 1.00 37.47  ? 51   ASP A CG    1 
ATOM   1757 O  OD1   . ASP C  3 51  ? -12.378 -3.593  -15.023 1.00 37.85  ? 51   ASP A OD1   1 
ATOM   1758 O  OD2   . ASP C  3 51  ? -11.040 -5.021  -14.026 1.00 37.97  ? 51   ASP A OD2   1 
ATOM   1759 N  N     . GLY C  3 52  ? -16.682 -6.476  -14.272 1.00 31.83  ? 52   GLY A N     1 
ATOM   1760 C  CA    . GLY C  3 52  ? -17.805 -7.371  -14.540 1.00 30.41  ? 52   GLY A CA    1 
ATOM   1761 C  C     . GLY C  3 52  ? -17.494 -8.851  -14.443 1.00 29.87  ? 52   GLY A C     1 
ATOM   1762 O  O     . GLY C  3 52  ? -17.951 -9.641  -15.270 1.00 28.95  ? 52   GLY A O     1 
ATOM   1763 N  N     . LEU C  3 53  ? -16.719 -9.240  -13.436 1.00 28.68  ? 53   LEU A N     1 
ATOM   1764 C  CA    . LEU C  3 53  ? -16.385 -10.654 -13.263 1.00 28.19  ? 53   LEU A CA    1 
ATOM   1765 C  C     . LEU C  3 53  ? -17.188 -11.248 -12.123 1.00 28.03  ? 53   LEU A C     1 
ATOM   1766 O  O     . LEU C  3 53  ? -17.466 -12.446 -12.102 1.00 27.37  ? 53   LEU A O     1 
ATOM   1767 C  CB    . LEU C  3 53  ? -14.893 -10.828 -12.998 1.00 28.00  ? 53   LEU A CB    1 
ATOM   1768 C  CG    . LEU C  3 53  ? -13.991 -10.489 -14.175 1.00 28.54  ? 53   LEU A CG    1 
ATOM   1769 C  CD1   . LEU C  3 53  ? -12.592 -10.128 -13.713 1.00 26.98  ? 53   LEU A CD1   1 
ATOM   1770 C  CD2   . LEU C  3 53  ? -13.968 -11.669 -15.109 1.00 29.09  ? 53   LEU A CD2   1 
ATOM   1771 N  N     . LEU C  3 54  ? -17.532 -10.400 -11.160 1.00 29.00  ? 54   LEU A N     1 
ATOM   1772 C  CA    . LEU C  3 54  ? -18.415 -10.792 -10.066 1.00 31.75  ? 54   LEU A CA    1 
ATOM   1773 C  C     . LEU C  3 54  ? -19.298 -9.644  -9.599  1.00 31.90  ? 54   LEU A C     1 
ATOM   1774 O  O     . LEU C  3 54  ? -19.180 -8.517  -10.076 1.00 31.07  ? 54   LEU A O     1 
ATOM   1775 C  CB    . LEU C  3 54  ? -17.628 -11.386 -8.883  1.00 32.20  ? 54   LEU A CB    1 
ATOM   1776 C  CG    . LEU C  3 54  ? -16.430 -10.637 -8.312  1.00 32.46  ? 54   LEU A CG    1 
ATOM   1777 C  CD1   . LEU C  3 54  ? -16.872 -9.321  -7.703  1.00 33.64  ? 54   LEU A CD1   1 
ATOM   1778 C  CD2   . LEU C  3 54  ? -15.723 -11.491 -7.275  1.00 31.96  ? 54   LEU A CD2   1 
ATOM   1779 N  N     . ARG C  3 55  ? -20.206 -9.950  -8.682  1.00 33.92  ? 55   ARG A N     1 
ATOM   1780 C  CA    . ARG C  3 55  ? -20.925 -8.910  -7.970  1.00 35.70  ? 55   ARG A CA    1 
ATOM   1781 C  C     . ARG C  3 55  ? -21.129 -9.283  -6.510  1.00 34.90  ? 55   ARG A C     1 
ATOM   1782 O  O     . ARG C  3 55  ? -21.257 -10.454 -6.164  1.00 33.81  ? 55   ARG A O     1 
ATOM   1783 C  CB    . ARG C  3 55  ? -22.252 -8.558  -8.660  1.00 38.59  ? 55   ARG A CB    1 
ATOM   1784 C  CG    . ARG C  3 55  ? -23.447 -9.369  -8.207  1.00 41.42  ? 55   ARG A CG    1 
ATOM   1785 C  CD    . ARG C  3 55  ? -24.762 -8.718  -8.645  1.00 42.71  ? 55   ARG A CD    1 
ATOM   1786 N  NE    . ARG C  3 55  ? -25.906 -9.206  -7.869  1.00 43.92  ? 55   ARG A NE    1 
ATOM   1787 C  CZ    . ARG C  3 55  ? -26.611 -8.458  -7.024  1.00 43.84  ? 55   ARG A CZ    1 
ATOM   1788 N  NH1   . ARG C  3 55  ? -27.633 -8.982  -6.366  1.00 43.41  ? 55   ARG A NH1   1 
ATOM   1789 N  NH2   . ARG C  3 55  ? -26.299 -7.181  -6.849  1.00 44.55  ? 55   ARG A NH2   1 
ATOM   1790 N  N     . VAL C  3 56  ? -21.108 -8.268  -5.654  1.00 35.18  ? 56   VAL A N     1 
ATOM   1791 C  CA    . VAL C  3 56  ? -21.451 -8.423  -4.251  1.00 33.71  ? 56   VAL A CA    1 
ATOM   1792 C  C     . VAL C  3 56  ? -22.975 -8.344  -4.125  1.00 33.93  ? 56   VAL A C     1 
ATOM   1793 O  O     . VAL C  3 56  ? -23.572 -7.350  -4.525  1.00 35.41  ? 56   VAL A O     1 
ATOM   1794 C  CB    . VAL C  3 56  ? -20.789 -7.301  -3.426  1.00 33.27  ? 56   VAL A CB    1 
ATOM   1795 C  CG1   . VAL C  3 56  ? -21.025 -7.491  -1.938  1.00 31.72  ? 56   VAL A CG1   1 
ATOM   1796 C  CG2   . VAL C  3 56  ? -19.307 -7.257  -3.721  1.00 33.74  ? 56   VAL A CG2   1 
ATOM   1797 N  N     . ALA C  3 57  ? -23.610 -9.386  -3.597  1.00 33.29  ? 57   ALA A N     1 
ATOM   1798 C  CA    . ALA C  3 57  ? -25.054 -9.342  -3.367  1.00 32.95  ? 57   ALA A CA    1 
ATOM   1799 C  C     . ALA C  3 57  ? -25.414 -8.429  -2.198  1.00 34.25  ? 57   ALA A C     1 
ATOM   1800 O  O     . ALA C  3 57  ? -24.543 -7.992  -1.441  1.00 34.30  ? 57   ALA A O     1 
ATOM   1801 C  CB    . ALA C  3 57  ? -25.611 -10.731 -3.134  1.00 32.44  ? 57   ALA A CB    1 
ATOM   1802 N  N     . GLY C  3 58  ? -26.706 -8.144  -2.060  1.00 35.56  ? 58   GLY A N     1 
ATOM   1803 C  CA    . GLY C  3 58  ? -27.213 -7.357  -0.942  1.00 35.80  ? 58   GLY A CA    1 
ATOM   1804 C  C     . GLY C  3 58  ? -26.827 -7.955  0.399   1.00 36.51  ? 58   GLY A C     1 
ATOM   1805 O  O     . GLY C  3 58  ? -26.542 -7.225  1.347   1.00 37.01  ? 58   GLY A O     1 
ATOM   1806 N  N     . ASP C  3 59  ? -26.807 -9.282  0.487   1.00 36.16  ? 59   ASP A N     1 
ATOM   1807 C  CA    . ASP C  3 59  ? -26.391 -9.945  1.719   1.00 36.77  ? 59   ASP A CA    1 
ATOM   1808 C  C     . ASP C  3 59  ? -24.888 -10.242 1.781   1.00 37.35  ? 59   ASP A C     1 
ATOM   1809 O  O     . ASP C  3 59  ? -24.432 -10.951 2.685   1.00 38.61  ? 59   ASP A O     1 
ATOM   1810 C  CB    . ASP C  3 59  ? -27.230 -11.208 2.005   1.00 36.94  ? 59   ASP A CB    1 
ATOM   1811 C  CG    . ASP C  3 59  ? -27.199 -12.222 0.868   1.00 37.31  ? 59   ASP A CG    1 
ATOM   1812 O  OD1   . ASP C  3 59  ? -26.445 -12.027 -0.115  1.00 38.01  ? 59   ASP A OD1   1 
ATOM   1813 O  OD2   . ASP C  3 59  ? -27.935 -13.231 0.967   1.00 36.48  ? 59   ASP A OD2   1 
ATOM   1814 N  N     . ARG C  3 60  ? -24.135 -9.696  0.824   1.00 36.69  ? 60   ARG A N     1 
ATOM   1815 C  CA    . ARG C  3 60  ? -22.656 -9.750  0.817   1.00 36.08  ? 60   ARG A CA    1 
ATOM   1816 C  C     . ARG C  3 60  ? -22.059 -11.063 0.275   1.00 35.05  ? 60   ARG A C     1 
ATOM   1817 O  O     . ARG C  3 60  ? -20.840 -11.254 0.274   1.00 34.42  ? 60   ARG A O     1 
ATOM   1818 C  CB    . ARG C  3 60  ? -22.067 -9.357  2.188   1.00 37.10  ? 60   ARG A CB    1 
ATOM   1819 C  CG    . ARG C  3 60  ? -22.505 -7.947  2.629   1.00 39.46  ? 60   ARG A CG    1 
ATOM   1820 C  CD    . ARG C  3 60  ? -21.667 -7.327  3.756   1.00 40.20  ? 60   ARG A CD    1 
ATOM   1821 N  NE    . ARG C  3 60  ? -21.656 -8.143  4.971   1.00 41.17  ? 60   ARG A NE    1 
ATOM   1822 C  CZ    . ARG C  3 60  ? -21.492 -7.661  6.205   1.00 41.06  ? 60   ARG A CZ    1 
ATOM   1823 N  NH1   . ARG C  3 60  ? -21.484 -8.495  7.238   1.00 40.03  ? 60   ARG A NH1   1 
ATOM   1824 N  NH2   . ARG C  3 60  ? -21.349 -6.352  6.410   1.00 39.69  ? 60   ARG A NH2   1 
ATOM   1825 N  N     . HIS C  3 61  ? -22.929 -11.952 -0.192  1.00 33.39  ? 61   HIS A N     1 
ATOM   1826 C  CA    . HIS C  3 61  ? -22.516 -13.139 -0.913  1.00 32.27  ? 61   HIS A CA    1 
ATOM   1827 C  C     . HIS C  3 61  ? -21.877 -12.708 -2.223  1.00 32.44  ? 61   HIS A C     1 
ATOM   1828 O  O     . HIS C  3 61  ? -22.369 -11.797 -2.895  1.00 30.28  ? 61   HIS A O     1 
ATOM   1829 C  CB    . HIS C  3 61  ? -23.727 -14.016 -1.191  1.00 33.22  ? 61   HIS A CB    1 
ATOM   1830 C  CG    . HIS C  3 61  ? -24.388 -14.535 0.048   1.00 35.43  ? 61   HIS A CG    1 
ATOM   1831 N  ND1   . HIS C  3 61  ? -25.393 -15.480 0.017   1.00 37.88  ? 61   HIS A ND1   1 
ATOM   1832 C  CD2   . HIS C  3 61  ? -24.177 -14.251 1.357   1.00 34.70  ? 61   HIS A CD2   1 
ATOM   1833 C  CE1   . HIS C  3 61  ? -25.773 -15.751 1.255   1.00 35.82  ? 61   HIS A CE1   1 
ATOM   1834 N  NE2   . HIS C  3 61  ? -25.055 -15.015 2.085   1.00 34.43  ? 61   HIS A NE2   1 
ATOM   1835 N  N     . LEU C  3 62  ? -20.760 -13.342 -2.566  1.00 31.85  ? 62   LEU A N     1 
ATOM   1836 C  CA    . LEU C  3 62  ? -20.114 -13.080 -3.842  1.00 31.50  ? 62   LEU A CA    1 
ATOM   1837 C  C     . LEU C  3 62  ? -20.730 -13.971 -4.908  1.00 31.09  ? 62   LEU A C     1 
ATOM   1838 O  O     . LEU C  3 62  ? -20.833 -15.187 -4.739  1.00 30.44  ? 62   LEU A O     1 
ATOM   1839 C  CB    . LEU C  3 62  ? -18.607 -13.327 -3.761  1.00 31.70  ? 62   LEU A CB    1 
ATOM   1840 C  CG    . LEU C  3 62  ? -17.824 -12.495 -2.740  1.00 32.03  ? 62   LEU A CG    1 
ATOM   1841 C  CD1   . LEU C  3 62  ? -16.343 -12.692 -2.953  1.00 31.08  ? 62   LEU A CD1   1 
ATOM   1842 C  CD2   . LEU C  3 62  ? -18.194 -11.008 -2.812  1.00 32.08  ? 62   LEU A CD2   1 
ATOM   1843 N  N     . GLU C  3 63  ? -21.164 -13.362 -6.002  1.00 30.20  ? 63   GLU A N     1 
ATOM   1844 C  CA    . GLU C  3 63  ? -21.648 -14.154 -7.117  1.00 30.36  ? 63   GLU A CA    1 
ATOM   1845 C  C     . GLU C  3 63  ? -20.834 -13.952 -8.396  1.00 29.16  ? 63   GLU A C     1 
ATOM   1846 O  O     . GLU C  3 63  ? -20.429 -12.838 -8.724  1.00 28.98  ? 63   GLU A O     1 
ATOM   1847 C  CB    . GLU C  3 63  ? -23.146 -13.943 -7.342  1.00 31.49  ? 63   GLU A CB    1 
ATOM   1848 C  CG    . GLU C  3 63  ? -23.635 -12.524 -7.237  1.00 32.50  ? 63   GLU A CG    1 
ATOM   1849 C  CD    . GLU C  3 63  ? -25.132 -12.439 -7.461  1.00 33.43  ? 63   GLU A CD    1 
ATOM   1850 O  OE1   . GLU C  3 63  ? -25.879 -12.974 -6.611  1.00 31.50  ? 63   GLU A OE1   1 
ATOM   1851 O  OE2   . GLU C  3 63  ? -25.554 -11.859 -8.498  1.00 33.86  ? 63   GLU A OE2   1 
ATOM   1852 N  N     . LEU C  3 64  ? -20.560 -15.040 -9.100  1.00 28.79  ? 64   LEU A N     1 
ATOM   1853 C  CA    . LEU C  3 64  ? -19.853 -14.927 -10.371 1.00 29.64  ? 64   LEU A CA    1 
ATOM   1854 C  C     . LEU C  3 64  ? -20.848 -14.477 -11.435 1.00 30.72  ? 64   LEU A C     1 
ATOM   1855 O  O     . LEU C  3 64  ? -21.964 -14.989 -11.483 1.00 31.08  ? 64   LEU A O     1 
ATOM   1856 C  CB    . LEU C  3 64  ? -19.216 -16.260 -10.764 1.00 27.07  ? 64   LEU A CB    1 
ATOM   1857 C  CG    . LEU C  3 64  ? -18.145 -16.841 -9.829  1.00 27.68  ? 64   LEU A CG    1 
ATOM   1858 C  CD1   . LEU C  3 64  ? -17.810 -18.280 -10.194 1.00 26.36  ? 64   LEU A CD1   1 
ATOM   1859 C  CD2   . LEU C  3 64  ? -16.879 -15.992 -9.843  1.00 28.02  ? 64   LEU A CD2   1 
ATOM   1860 N  N     . THR C  3 65  ? -20.463 -13.507 -12.262 1.00 30.96  ? 65   THR A N     1 
ATOM   1861 C  CA    . THR C  3 65  ? -21.268 -13.161 -13.420 1.00 32.53  ? 65   THR A CA    1 
ATOM   1862 C  C     . THR C  3 65  ? -21.203 -14.315 -14.418 1.00 35.22  ? 65   THR A C     1 
ATOM   1863 O  O     . THR C  3 65  ? -20.790 -15.428 -14.070 1.00 36.97  ? 65   THR A O     1 
ATOM   1864 C  CB    . THR C  3 65  ? -20.793 -11.852 -14.104 1.00 32.22  ? 65   THR A CB    1 
ATOM   1865 O  OG1   . THR C  3 65  ? -19.464 -12.017 -14.617 1.00 31.83  ? 65   THR A OG1   1 
ATOM   1866 C  CG2   . THR C  3 65  ? -20.825 -10.669 -13.130 1.00 30.83  ? 65   THR A CG2   1 
ATOM   1867 N  N     . GLU C  3 66  ? -21.619 -14.072 -15.655 1.00 36.08  ? 66   GLU A N     1 
ATOM   1868 C  CA    . GLU C  3 66  ? -21.445 -15.075 -16.695 1.00 37.13  ? 66   GLU A CA    1 
ATOM   1869 C  C     . GLU C  3 66  ? -19.990 -15.096 -17.159 1.00 36.90  ? 66   GLU A C     1 
ATOM   1870 O  O     . GLU C  3 66  ? -19.420 -16.163 -17.364 1.00 35.90  ? 66   GLU A O     1 
ATOM   1871 C  CB    . GLU C  3 66  ? -22.385 -14.822 -17.871 1.00 38.10  ? 66   GLU A CB    1 
ATOM   1872 C  CG    . GLU C  3 66  ? -23.825 -15.209 -17.586 1.00 40.20  ? 66   GLU A CG    1 
ATOM   1873 C  CD    . GLU C  3 66  ? -23.952 -16.631 -17.072 1.00 41.87  ? 66   GLU A CD    1 
ATOM   1874 O  OE1   . GLU C  3 66  ? -23.681 -16.870 -15.872 1.00 43.65  ? 66   GLU A OE1   1 
ATOM   1875 O  OE2   . GLU C  3 66  ? -24.330 -17.515 -17.871 1.00 42.50  ? 66   GLU A OE2   1 
ATOM   1876 N  N     . LYS C  3 67  ? -19.399 -13.912 -17.315 1.00 36.60  ? 67   LYS A N     1 
ATOM   1877 C  CA    . LYS C  3 67  ? -17.999 -13.795 -17.703 1.00 36.29  ? 67   LYS A CA    1 
ATOM   1878 C  C     . LYS C  3 67  ? -17.072 -14.394 -16.638 1.00 36.24  ? 67   LYS A C     1 
ATOM   1879 O  O     . LYS C  3 67  ? -16.086 -15.054 -16.962 1.00 37.16  ? 67   LYS A O     1 
ATOM   1880 C  CB    . LYS C  3 67  ? -17.628 -12.338 -17.980 1.00 36.36  ? 67   LYS A CB    1 
ATOM   1881 C  CG    . LYS C  3 67  ? -16.143 -12.144 -18.213 1.00 38.13  ? 67   LYS A CG    1 
ATOM   1882 C  CD    . LYS C  3 67  ? -15.862 -11.132 -19.314 1.00 39.28  ? 67   LYS A CD    1 
ATOM   1883 C  CE    . LYS C  3 67  ? -15.442 -9.774  -18.777 1.00 39.73  ? 67   LYS A CE    1 
ATOM   1884 N  NZ    . LYS C  3 67  ? -16.482 -9.111  -17.945 1.00 40.45  ? 67   LYS A NZ    1 
ATOM   1885 N  N     . GLY C  3 68  ? -17.413 -14.179 -15.371 1.00 34.78  ? 68   GLY A N     1 
ATOM   1886 C  CA    . GLY C  3 68  ? -16.625 -14.679 -14.256 1.00 31.38  ? 68   GLY A CA    1 
ATOM   1887 C  C     . GLY C  3 68  ? -16.771 -16.166 -14.048 1.00 30.69  ? 68   GLY A C     1 
ATOM   1888 O  O     . GLY C  3 68  ? -15.823 -16.848 -13.646 1.00 30.39  ? 68   GLY A O     1 
ATOM   1889 N  N     . ARG C  3 69  ? -17.957 -16.689 -14.311 1.00 29.54  ? 69   ARG A N     1 
ATOM   1890 C  CA    . ARG C  3 69  ? -18.137 -18.127 -14.193 1.00 29.91  ? 69   ARG A CA    1 
ATOM   1891 C  C     . ARG C  3 69  ? -17.416 -18.859 -15.336 1.00 29.73  ? 69   ARG A C     1 
ATOM   1892 O  O     . ARG C  3 69  ? -16.803 -19.897 -15.124 1.00 29.86  ? 69   ARG A O     1 
ATOM   1893 C  CB    . ARG C  3 69  ? -19.618 -18.490 -14.119 1.00 29.73  ? 69   ARG A CB    1 
ATOM   1894 C  CG    . ARG C  3 69  ? -19.896 -19.979 -13.967 1.00 30.10  ? 69   ARG A CG    1 
ATOM   1895 C  CD    . ARG C  3 69  ? -21.372 -20.236 -13.650 1.00 31.12  ? 69   ARG A CD    1 
ATOM   1896 N  NE    . ARG C  3 69  ? -21.792 -19.677 -12.358 1.00 31.81  ? 69   ARG A NE    1 
ATOM   1897 C  CZ    . ARG C  3 69  ? -21.465 -20.201 -11.176 1.00 32.07  ? 69   ARG A CZ    1 
ATOM   1898 N  NH1   . ARG C  3 69  ? -20.700 -21.281 -11.130 1.00 31.37  ? 69   ARG A NH1   1 
ATOM   1899 N  NH2   . ARG C  3 69  ? -21.884 -19.643 -10.042 1.00 31.07  ? 69   ARG A NH2   1 
ATOM   1900 N  N     . ALA C  3 70  ? -17.465 -18.302 -16.538 1.00 29.14  ? 70   ALA A N     1 
ATOM   1901 C  CA    . ALA C  3 70  ? -16.804 -18.921 -17.685 1.00 29.53  ? 70   ALA A CA    1 
ATOM   1902 C  C     . ALA C  3 70  ? -15.286 -18.989 -17.493 1.00 29.95  ? 70   ALA A C     1 
ATOM   1903 O  O     . ALA C  3 70  ? -14.642 -19.957 -17.905 1.00 30.55  ? 70   ALA A O     1 
ATOM   1904 C  CB    . ALA C  3 70  ? -17.148 -18.167 -18.971 1.00 28.56  ? 70   ALA A CB    1 
ATOM   1905 N  N     . LEU C  3 71  ? -14.730 -17.961 -16.858 1.00 30.56  ? 71   LEU A N     1 
ATOM   1906 C  CA    . LEU C  3 71  ? -13.303 -17.871 -16.603 1.00 30.51  ? 71   LEU A CA    1 
ATOM   1907 C  C     . LEU C  3 71  ? -12.889 -18.810 -15.471 1.00 31.14  ? 71   LEU A C     1 
ATOM   1908 O  O     . LEU C  3 71  ? -11.881 -19.511 -15.579 1.00 32.25  ? 71   LEU A O     1 
ATOM   1909 C  CB    . LEU C  3 71  ? -12.920 -16.433 -16.246 1.00 30.78  ? 71   LEU A CB    1 
ATOM   1910 C  CG    . LEU C  3 71  ? -11.526 -15.930 -16.665 1.00 31.88  ? 71   LEU A CG    1 
ATOM   1911 C  CD1   . LEU C  3 71  ? -11.045 -14.784 -15.769 1.00 31.36  ? 71   LEU A CD1   1 
ATOM   1912 C  CD2   . LEU C  3 71  ? -10.493 -17.044 -16.680 1.00 31.34  ? 71   LEU A CD2   1 
ATOM   1913 N  N     . ALA C  3 72  ? -13.663 -18.803 -14.387 1.00 30.59  ? 72   ALA A N     1 
ATOM   1914 C  CA    . ALA C  3 72  ? -13.422 -19.664 -13.226 1.00 29.66  ? 72   ALA A CA    1 
ATOM   1915 C  C     . ALA C  3 72  ? -13.379 -21.122 -13.643 1.00 29.50  ? 72   ALA A C     1 
ATOM   1916 O  O     . ALA C  3 72  ? -12.487 -21.869 -13.254 1.00 29.09  ? 72   ALA A O     1 
ATOM   1917 C  CB    . ALA C  3 72  ? -14.520 -19.457 -12.165 1.00 27.78  ? 72   ALA A CB    1 
ATOM   1918 N  N     . ILE C  3 73  ? -14.376 -21.519 -14.428 1.00 30.48  ? 73   ILE A N     1 
ATOM   1919 C  CA    . ILE C  3 73  ? -14.474 -22.869 -14.959 1.00 28.92  ? 73   ILE A CA    1 
ATOM   1920 C  C     . ILE C  3 73  ? -13.247 -23.196 -15.809 1.00 28.80  ? 73   ILE A C     1 
ATOM   1921 O  O     . ILE C  3 73  ? -12.664 -24.272 -15.680 1.00 26.70  ? 73   ILE A O     1 
ATOM   1922 C  CB    . ILE C  3 73  ? -15.753 -23.013 -15.788 1.00 29.30  ? 73   ILE A CB    1 
ATOM   1923 C  CG1   . ILE C  3 73  ? -16.954 -23.197 -14.858 1.00 30.17  ? 73   ILE A CG1   1 
ATOM   1924 C  CG2   . ILE C  3 73  ? -15.637 -24.158 -16.817 1.00 29.40  ? 73   ILE A CG2   1 
ATOM   1925 C  CD1   . ILE C  3 73  ? -18.310 -23.129 -15.580 1.00 29.61  ? 73   ILE A CD1   1 
ATOM   1926 N  N     . ALA C  3 74  ? -12.850 -22.254 -16.663 1.00 27.82  ? 74   ALA A N     1 
ATOM   1927 C  CA    . ALA C  3 74  ? -11.675 -22.446 -17.494 1.00 28.69  ? 74   ALA A CA    1 
ATOM   1928 C  C     . ALA C  3 74  ? -10.432 -22.729 -16.635 1.00 29.14  ? 74   ALA A C     1 
ATOM   1929 O  O     . ALA C  3 74  ? -9.636  -23.608 -16.962 1.00 28.58  ? 74   ALA A O     1 
ATOM   1930 C  CB    . ALA C  3 74  ? -11.453 -21.247 -18.410 1.00 27.09  ? 74   ALA A CB    1 
ATOM   1931 N  N     . VAL C  3 75  ? -10.285 -22.001 -15.530 1.00 29.51  ? 75   VAL A N     1 
ATOM   1932 C  CA    . VAL C  3 75  ? -9.117  -22.156 -14.658 1.00 28.69  ? 75   VAL A CA    1 
ATOM   1933 C  C     . VAL C  3 75  ? -9.155  -23.488 -13.912 1.00 29.08  ? 75   VAL A C     1 
ATOM   1934 O  O     . VAL C  3 75  ? -8.144  -24.168 -13.803 1.00 28.53  ? 75   VAL A O     1 
ATOM   1935 C  CB    . VAL C  3 75  ? -8.958  -20.959 -13.663 1.00 28.11  ? 75   VAL A CB    1 
ATOM   1936 C  CG1   . VAL C  3 75  ? -7.820  -21.214 -12.660 1.00 27.34  ? 75   VAL A CG1   1 
ATOM   1937 C  CG2   . VAL C  3 75  ? -8.714  -19.664 -14.421 1.00 25.76  ? 75   VAL A CG2   1 
ATOM   1938 N  N     . MET C  3 76  ? -10.327 -23.865 -13.418 1.00 30.24  ? 76   MET A N     1 
ATOM   1939 C  CA    . MET C  3 76  ? -10.495 -25.143 -12.746 1.00 31.58  ? 76   MET A CA    1 
ATOM   1940 C  C     . MET C  3 76  ? -10.191 -26.309 -13.701 1.00 31.86  ? 76   MET A C     1 
ATOM   1941 O  O     . MET C  3 76  ? -9.643  -27.342 -13.301 1.00 31.57  ? 76   MET A O     1 
ATOM   1942 C  CB    . MET C  3 76  ? -11.912 -25.257 -12.192 1.00 33.97  ? 76   MET A CB    1 
ATOM   1943 C  CG    . MET C  3 76  ? -12.166 -26.546 -11.423 1.00 38.24  ? 76   MET A CG    1 
ATOM   1944 S  SD    . MET C  3 76  ? -11.023 -26.753 -10.035 1.00 42.27  ? 76   MET A SD    1 
ATOM   1945 C  CE    . MET C  3 76  ? -11.893 -25.821 -8.769  1.00 40.78  ? 76   MET A CE    1 
ATOM   1946 N  N     . ARG C  3 77  ? -10.560 -26.129 -14.964 1.00 30.60  ? 77   ARG A N     1 
ATOM   1947 C  CA    . ARG C  3 77  ? -10.327 -27.119 -16.004 1.00 29.18  ? 77   ARG A CA    1 
ATOM   1948 C  C     . ARG C  3 77  ? -8.824  -27.320 -16.236 1.00 29.52  ? 77   ARG A C     1 
ATOM   1949 O  O     . ARG C  3 77  ? -8.329  -28.459 -16.190 1.00 28.83  ? 77   ARG A O     1 
ATOM   1950 C  CB    . ARG C  3 77  ? -11.009 -26.673 -17.296 1.00 28.43  ? 77   ARG A CB    1 
ATOM   1951 C  CG    . ARG C  3 77  ? -11.121 -27.743 -18.348 1.00 29.01  ? 77   ARG A CG    1 
ATOM   1952 C  CD    . ARG C  3 77  ? -11.880 -27.204 -19.541 1.00 29.56  ? 77   ARG A CD    1 
ATOM   1953 N  NE    . ARG C  3 77  ? -11.170 -26.091 -20.162 1.00 30.13  ? 77   ARG A NE    1 
ATOM   1954 C  CZ    . ARG C  3 77  ? -11.762 -25.034 -20.710 1.00 30.31  ? 77   ARG A CZ    1 
ATOM   1955 N  NH1   . ARG C  3 77  ? -13.087 -24.937 -20.696 1.00 30.20  ? 77   ARG A NH1   1 
ATOM   1956 N  NH2   . ARG C  3 77  ? -11.028 -24.069 -21.257 1.00 28.91  ? 77   ARG A NH2   1 
ATOM   1957 N  N     . LYS C  3 78  ? -8.104  -26.221 -16.472 1.00 27.82  ? 78   LYS A N     1 
ATOM   1958 C  CA    . LYS C  3 78  ? -6.643  -26.267 -16.599 1.00 28.14  ? 78   LYS A CA    1 
ATOM   1959 C  C     . LYS C  3 78  ? -5.979  -26.841 -15.341 1.00 29.67  ? 78   LYS A C     1 
ATOM   1960 O  O     . LYS C  3 78  ? -5.001  -27.571 -15.438 1.00 30.14  ? 78   LYS A O     1 
ATOM   1961 C  CB    . LYS C  3 78  ? -6.077  -24.873 -16.860 1.00 27.28  ? 78   LYS A CB    1 
ATOM   1962 C  CG    . LYS C  3 78  ? -6.756  -24.109 -17.967 1.00 26.92  ? 78   LYS A CG    1 
ATOM   1963 C  CD    . LYS C  3 78  ? -6.203  -22.697 -18.058 1.00 27.04  ? 78   LYS A CD    1 
ATOM   1964 C  CE    . LYS C  3 78  ? -7.020  -21.851 -19.028 1.00 26.65  ? 78   LYS A CE    1 
ATOM   1965 N  NZ    . LYS C  3 78  ? -7.066  -22.516 -20.364 1.00 27.67  ? 78   LYS A NZ    1 
ATOM   1966 N  N     . HIS C  3 79  ? -6.508  -26.494 -14.165 1.00 30.86  ? 79   HIS A N     1 
ATOM   1967 C  CA    . HIS C  3 79  ? -5.944  -26.951 -12.904 1.00 30.75  ? 79   HIS A CA    1 
ATOM   1968 C  C     . HIS C  3 79  ? -5.949  -28.470 -12.853 1.00 30.28  ? 79   HIS A C     1 
ATOM   1969 O  O     . HIS C  3 79  ? -4.923  -29.088 -12.599 1.00 29.61  ? 79   HIS A O     1 
ATOM   1970 C  CB    . HIS C  3 79  ? -6.689  -26.358 -11.691 1.00 31.73  ? 79   HIS A CB    1 
ATOM   1971 C  CG    . HIS C  3 79  ? -6.103  -26.758 -10.364 1.00 33.65  ? 79   HIS A CG    1 
ATOM   1972 N  ND1   . HIS C  3 79  ? -5.079  -26.062 -9.757  1.00 33.39  ? 79   HIS A ND1   1 
ATOM   1973 C  CD2   . HIS C  3 79  ? -6.392  -27.792 -9.537  1.00 34.16  ? 79   HIS A CD2   1 
ATOM   1974 C  CE1   . HIS C  3 79  ? -4.760  -26.652 -8.619  1.00 34.14  ? 79   HIS A CE1   1 
ATOM   1975 N  NE2   . HIS C  3 79  ? -5.545  -27.703 -8.459  1.00 37.01  ? 79   HIS A NE2   1 
ATOM   1976 N  N     . ARG C  3 80  ? -7.105  -29.067 -13.120 1.00 30.97  ? 80   ARG A N     1 
ATOM   1977 C  CA    . ARG C  3 80  ? -7.255  -30.510 -13.004 1.00 30.46  ? 80   ARG A CA    1 
ATOM   1978 C  C     . ARG C  3 80  ? -6.618  -31.266 -14.168 1.00 30.38  ? 80   ARG A C     1 
ATOM   1979 O  O     . ARG C  3 80  ? -6.171  -32.396 -13.997 1.00 30.86  ? 80   ARG A O     1 
ATOM   1980 C  CB    . ARG C  3 80  ? -8.725  -30.892 -12.793 1.00 30.33  ? 80   ARG A CB    1 
ATOM   1981 C  CG    . ARG C  3 80  ? -9.280  -30.265 -11.533 1.00 30.77  ? 80   ARG A CG    1 
ATOM   1982 C  CD    . ARG C  3 80  ? -10.667 -30.733 -11.113 1.00 31.81  ? 80   ARG A CD    1 
ATOM   1983 N  NE    . ARG C  3 80  ? -10.944 -30.161 -9.792  1.00 34.17  ? 80   ARG A NE    1 
ATOM   1984 C  CZ    . ARG C  3 80  ? -12.145 -29.928 -9.269  1.00 34.15  ? 80   ARG A CZ    1 
ATOM   1985 N  NH1   . ARG C  3 80  ? -13.256 -30.218 -9.942  1.00 34.40  ? 80   ARG A NH1   1 
ATOM   1986 N  NH2   . ARG C  3 80  ? -12.226 -29.390 -8.056  1.00 34.26  ? 80   ARG A NH2   1 
ATOM   1987 N  N     . LEU C  3 81  ? -6.569  -30.643 -15.340 1.00 29.89  ? 81   LEU A N     1 
ATOM   1988 C  CA    . LEU C  3 81  ? -5.818  -31.204 -16.460 1.00 30.63  ? 81   LEU A CA    1 
ATOM   1989 C  C     . LEU C  3 81  ? -4.320  -31.179 -16.160 1.00 31.07  ? 81   LEU A C     1 
ATOM   1990 O  O     . LEU C  3 81  ? -3.600  -32.110 -16.513 1.00 31.02  ? 81   LEU A O     1 
ATOM   1991 C  CB    . LEU C  3 81  ? -6.108  -30.450 -17.766 1.00 29.93  ? 81   LEU A CB    1 
ATOM   1992 C  CG    . LEU C  3 81  ? -7.412  -30.812 -18.480 1.00 30.40  ? 81   LEU A CG    1 
ATOM   1993 C  CD1   . LEU C  3 81  ? -7.684  -29.887 -19.641 1.00 29.36  ? 81   LEU A CD1   1 
ATOM   1994 C  CD2   . LEU C  3 81  ? -7.359  -32.253 -18.948 1.00 30.76  ? 81   LEU A CD2   1 
ATOM   1995 N  N     . ALA C  3 82  ? -3.863  -30.110 -15.512 1.00 31.44  ? 82   ALA A N     1 
ATOM   1996 C  CA    . ALA C  3 82  ? -2.467  -29.979 -15.125 1.00 31.39  ? 82   ALA A CA    1 
ATOM   1997 C  C     . ALA C  3 82  ? -2.148  -31.039 -14.091 1.00 33.24  ? 82   ALA A C     1 
ATOM   1998 O  O     . ALA C  3 82  ? -1.088  -31.669 -14.146 1.00 32.99  ? 82   ALA A O     1 
ATOM   1999 C  CB    . ALA C  3 82  ? -2.195  -28.609 -14.558 1.00 30.07  ? 82   ALA A CB    1 
ATOM   2000 N  N     . GLU C  3 83  ? -3.065  -31.221 -13.143 1.00 33.77  ? 83   GLU A N     1 
ATOM   2001 C  CA    . GLU C  3 83  ? -2.893  -32.218 -12.103 1.00 34.63  ? 83   GLU A CA    1 
ATOM   2002 C  C     . GLU C  3 83  ? -2.685  -33.592 -12.748 1.00 35.25  ? 83   GLU A C     1 
ATOM   2003 O  O     . GLU C  3 83  ? -1.743  -34.305 -12.398 1.00 36.43  ? 83   GLU A O     1 
ATOM   2004 C  CB    . GLU C  3 83  ? -4.070  -32.201 -11.108 1.00 35.94  ? 83   GLU A CB    1 
ATOM   2005 C  CG    . GLU C  3 83  ? -4.005  -31.057 -10.068 1.00 38.12  ? 83   GLU A CG    1 
ATOM   2006 C  CD    . GLU C  3 83  ? -5.209  -30.993 -9.110  1.00 39.01  ? 83   GLU A CD    1 
ATOM   2007 O  OE1   . GLU C  3 83  ? -6.260  -31.592 -9.406  1.00 39.12  ? 83   GLU A OE1   1 
ATOM   2008 O  OE2   . GLU C  3 83  ? -5.112  -30.317 -8.055  1.00 43.36  ? 83   GLU A OE2   1 
ATOM   2009 N  N     . ARG C  3 84  ? -3.534  -33.943 -13.712 1.00 34.37  ? 84   ARG A N     1 
ATOM   2010 C  CA    . ARG C  3 84  ? -3.396  -35.203 -14.447 1.00 34.73  ? 84   ARG A CA    1 
ATOM   2011 C  C     . ARG C  3 84  ? -2.078  -35.359 -15.207 1.00 34.07  ? 84   ARG A C     1 
ATOM   2012 O  O     . ARG C  3 84  ? -1.429  -36.394 -15.121 1.00 33.70  ? 84   ARG A O     1 
ATOM   2013 C  CB    . ARG C  3 84  ? -4.546  -35.402 -15.428 1.00 35.55  ? 84   ARG A CB    1 
ATOM   2014 C  CG    . ARG C  3 84  ? -5.774  -36.014 -14.810 1.00 37.18  ? 84   ARG A CG    1 
ATOM   2015 C  CD    . ARG C  3 84  ? -6.120  -37.317 -15.484 1.00 37.61  ? 84   ARG A CD    1 
ATOM   2016 N  NE    . ARG C  3 84  ? -5.689  -38.445 -14.669 1.00 38.74  ? 84   ARG A NE    1 
ATOM   2017 C  CZ    . ARG C  3 84  ? -6.498  -39.151 -13.886 1.00 38.42  ? 84   ARG A CZ    1 
ATOM   2018 N  NH1   . ARG C  3 84  ? -7.785  -38.843 -13.816 1.00 37.26  ? 84   ARG A NH1   1 
ATOM   2019 N  NH2   . ARG C  3 84  ? -6.016  -40.163 -13.172 1.00 38.87  ? 84   ARG A NH2   1 
ATOM   2020 N  N     . LEU C  3 85  ? -1.702  -34.346 -15.978 1.00 33.34  ? 85   LEU A N     1 
ATOM   2021 C  CA    . LEU C  3 85  ? -0.421  -34.369 -16.651 1.00 32.08  ? 85   LEU A CA    1 
ATOM   2022 C  C     . LEU C  3 85  ? 0.670   -34.668 -15.630 1.00 31.95  ? 85   LEU A C     1 
ATOM   2023 O  O     . LEU C  3 85  ? 1.497   -35.554 -15.820 1.00 32.79  ? 85   LEU A O     1 
ATOM   2024 C  CB    . LEU C  3 85  ? -0.145  -33.027 -17.309 1.00 31.60  ? 85   LEU A CB    1 
ATOM   2025 C  CG    . LEU C  3 85  ? 1.250   -32.905 -17.926 1.00 32.00  ? 85   LEU A CG    1 
ATOM   2026 C  CD1   . LEU C  3 85  ? 1.427   -33.920 -19.056 1.00 30.82  ? 85   LEU A CD1   1 
ATOM   2027 C  CD2   . LEU C  3 85  ? 1.509   -31.493 -18.413 1.00 31.27  ? 85   LEU A CD2   1 
ATOM   2028 N  N     . LEU C  3 86  ? 0.644   -33.931 -14.532 1.00 31.50  ? 86   LEU A N     1 
ATOM   2029 C  CA    . LEU C  3 86  ? 1.689   -34.008 -13.525 1.00 30.70  ? 86   LEU A CA    1 
ATOM   2030 C  C     . LEU C  3 86  ? 1.815   -35.369 -12.852 1.00 30.57  ? 86   LEU A C     1 
ATOM   2031 O  O     . LEU C  3 86  ? 2.903   -35.758 -12.449 1.00 28.85  ? 86   LEU A O     1 
ATOM   2032 C  CB    . LEU C  3 86  ? 1.480   -32.921 -12.472 1.00 28.69  ? 86   LEU A CB    1 
ATOM   2033 C  CG    . LEU C  3 86  ? 1.882   -31.530 -12.930 1.00 28.39  ? 86   LEU A CG    1 
ATOM   2034 C  CD1   . LEU C  3 86  ? 1.398   -30.492 -11.931 1.00 29.36  ? 86   LEU A CD1   1 
ATOM   2035 C  CD2   . LEU C  3 86  ? 3.386   -31.454 -13.120 1.00 29.01  ? 86   LEU A CD2   1 
ATOM   2036 N  N     . VAL C  3 87  ? 0.697   -36.070 -12.719 1.00 31.96  ? 87   VAL A N     1 
ATOM   2037 C  CA    . VAL C  3 87  ? 0.665   -37.349 -12.031 1.00 34.17  ? 87   VAL A CA    1 
ATOM   2038 C  C     . VAL C  3 87  ? 0.839   -38.512 -13.006 1.00 35.69  ? 87   VAL A C     1 
ATOM   2039 O  O     . VAL C  3 87  ? 1.734   -39.334 -12.849 1.00 36.61  ? 87   VAL A O     1 
ATOM   2040 C  CB    . VAL C  3 87  ? -0.660  -37.529 -11.265 1.00 34.83  ? 87   VAL A CB    1 
ATOM   2041 C  CG1   . VAL C  3 87  ? -0.793  -38.959 -10.734 1.00 34.55  ? 87   VAL A CG1   1 
ATOM   2042 C  CG2   . VAL C  3 87  ? -0.756  -36.518 -10.133 1.00 34.62  ? 87   VAL A CG2   1 
ATOM   2043 N  N     . ASP C  3 88  ? -0.032  -38.584 -14.005 1.00 36.50  ? 88   ASP A N     1 
ATOM   2044 C  CA    . ASP C  3 88  ? 0.033   -39.650 -14.988 1.00 37.13  ? 88   ASP A CA    1 
ATOM   2045 C  C     . ASP C  3 88  ? 1.339   -39.627 -15.776 1.00 36.95  ? 88   ASP A C     1 
ATOM   2046 O  O     . ASP C  3 88  ? 2.000   -40.652 -15.937 1.00 37.38  ? 88   ASP A O     1 
ATOM   2047 C  CB    . ASP C  3 88  ? -1.130  -39.530 -15.962 1.00 38.98  ? 88   ASP A CB    1 
ATOM   2048 C  CG    . ASP C  3 88  ? -2.437  -40.033 -15.383 1.00 41.01  ? 88   ASP A CG    1 
ATOM   2049 O  OD1   . ASP C  3 88  ? -2.499  -40.304 -14.159 1.00 40.91  ? 88   ASP A OD1   1 
ATOM   2050 O  OD2   . ASP C  3 88  ? -3.402  -40.160 -16.174 1.00 42.19  ? 88   ASP A OD2   1 
ATOM   2051 N  N     . VAL C  3 89  ? 1.710   -38.456 -16.281 1.00 35.59  ? 89   VAL A N     1 
ATOM   2052 C  CA    . VAL C  3 89  ? 2.861   -38.378 -17.163 1.00 33.11  ? 89   VAL A CA    1 
ATOM   2053 C  C     . VAL C  3 89  ? 4.170   -38.047 -16.453 1.00 32.79  ? 89   VAL A C     1 
ATOM   2054 O  O     . VAL C  3 89  ? 5.138   -38.794 -16.561 1.00 33.82  ? 89   VAL A O     1 
ATOM   2055 C  CB    . VAL C  3 89  ? 2.624   -37.409 -18.306 1.00 32.94  ? 89   VAL A CB    1 
ATOM   2056 C  CG1   . VAL C  3 89  ? 3.882   -37.285 -19.145 1.00 32.65  ? 89   VAL A CG1   1 
ATOM   2057 C  CG2   . VAL C  3 89  ? 1.446   -37.890 -19.153 1.00 32.63  ? 89   VAL A CG2   1 
ATOM   2058 N  N     . ILE C  3 90  ? 4.208   -36.935 -15.728 1.00 31.57  ? 90   ILE A N     1 
ATOM   2059 C  CA    . ILE C  3 90  ? 5.460   -36.475 -15.132 1.00 30.02  ? 90   ILE A CA    1 
ATOM   2060 C  C     . ILE C  3 90  ? 5.858   -37.278 -13.883 1.00 30.15  ? 90   ILE A C     1 
ATOM   2061 O  O     . ILE C  3 90  ? 7.045   -37.437 -13.589 1.00 30.67  ? 90   ILE A O     1 
ATOM   2062 C  CB    . ILE C  3 90  ? 5.410   -34.949 -14.872 1.00 29.64  ? 90   ILE A CB    1 
ATOM   2063 C  CG1   . ILE C  3 90  ? 5.563   -34.192 -16.200 1.00 29.90  ? 90   ILE A CG1   1 
ATOM   2064 C  CG2   . ILE C  3 90  ? 6.500   -34.518 -13.914 1.00 29.30  ? 90   ILE A CG2   1 
ATOM   2065 C  CD1   . ILE C  3 90  ? 4.604   -33.040 -16.405 1.00 28.58  ? 90   ILE A CD1   1 
ATOM   2066 N  N     . GLY C  3 91  ? 4.862   -37.819 -13.182 1.00 29.98  ? 91   GLY A N     1 
ATOM   2067 C  CA    . GLY C  3 91  ? 5.073   -38.477 -11.896 1.00 30.18  ? 91   GLY A CA    1 
ATOM   2068 C  C     . GLY C  3 91  ? 5.475   -37.570 -10.730 1.00 31.27  ? 91   GLY A C     1 
ATOM   2069 O  O     . GLY C  3 91  ? 6.117   -38.027 -9.789  1.00 29.80  ? 91   GLY A O     1 
ATOM   2070 N  N     . LEU C  3 92  ? 5.122   -36.285 -10.770 1.00 32.30  ? 92   LEU A N     1 
ATOM   2071 C  CA    . LEU C  3 92  ? 5.400   -35.419 -9.608  1.00 32.91  ? 92   LEU A CA    1 
ATOM   2072 C  C     . LEU C  3 92  ? 4.661   -35.997 -8.405  1.00 33.18  ? 92   LEU A C     1 
ATOM   2073 O  O     . LEU C  3 92  ? 3.507   -36.406 -8.538  1.00 32.87  ? 92   LEU A O     1 
ATOM   2074 C  CB    . LEU C  3 92  ? 4.972   -33.974 -9.860  1.00 32.32  ? 92   LEU A CB    1 
ATOM   2075 C  CG    . LEU C  3 92  ? 5.348   -32.937 -8.790  1.00 32.29  ? 92   LEU A CG    1 
ATOM   2076 C  CD1   . LEU C  3 92  ? 6.835   -32.606 -8.841  1.00 31.66  ? 92   LEU A CD1   1 
ATOM   2077 C  CD2   . LEU C  3 92  ? 4.516   -31.661 -8.930  1.00 30.83  ? 92   LEU A CD2   1 
ATOM   2078 N  N     . PRO C  3 93  ? 5.326   -36.054 -7.233  1.00 34.11  ? 93   PRO A N     1 
ATOM   2079 C  CA    . PRO C  3 93  ? 4.701   -36.667 -6.046  1.00 33.43  ? 93   PRO A CA    1 
ATOM   2080 C  C     . PRO C  3 93  ? 3.351   -36.024 -5.749  1.00 32.19  ? 93   PRO A C     1 
ATOM   2081 O  O     . PRO C  3 93  ? 3.182   -34.832 -5.981  1.00 33.08  ? 93   PRO A O     1 
ATOM   2082 C  CB    . PRO C  3 93  ? 5.681   -36.343 -4.915  1.00 34.01  ? 93   PRO A CB    1 
ATOM   2083 C  CG    . PRO C  3 93  ? 6.988   -36.081 -5.590  1.00 34.84  ? 93   PRO A CG    1 
ATOM   2084 C  CD    . PRO C  3 93  ? 6.678   -35.534 -6.955  1.00 33.57  ? 93   PRO A CD    1 
ATOM   2085 N  N     . TRP C  3 94  ? 2.411   -36.814 -5.243  1.00 31.30  ? 94   TRP A N     1 
ATOM   2086 C  CA    . TRP C  3 94  ? 1.059   -36.349 -4.928  1.00 31.38  ? 94   TRP A CA    1 
ATOM   2087 C  C     . TRP C  3 94  ? 0.986   -35.058 -4.099  1.00 31.69  ? 94   TRP A C     1 
ATOM   2088 O  O     . TRP C  3 94  ? 0.286   -34.114 -4.470  1.00 31.32  ? 94   TRP A O     1 
ATOM   2089 C  CB    . TRP C  3 94  ? 0.274   -37.453 -4.214  1.00 31.99  ? 94   TRP A CB    1 
ATOM   2090 C  CG    . TRP C  3 94  ? -0.050  -38.633 -5.086  1.00 32.20  ? 94   TRP A CG    1 
ATOM   2091 C  CD1   . TRP C  3 94  ? 0.685   -39.772 -5.231  1.00 32.26  ? 94   TRP A CD1   1 
ATOM   2092 C  CD2   . TRP C  3 94  ? -1.203  -38.789 -5.927  1.00 32.60  ? 94   TRP A CD2   1 
ATOM   2093 N  NE1   . TRP C  3 94  ? 0.065   -40.628 -6.109  1.00 32.67  ? 94   TRP A NE1   1 
ATOM   2094 C  CE2   . TRP C  3 94  ? -1.096  -40.050 -6.552  1.00 32.45  ? 94   TRP A CE2   1 
ATOM   2095 C  CE3   . TRP C  3 94  ? -2.320  -37.987 -6.205  1.00 31.97  ? 94   TRP A CE3   1 
ATOM   2096 C  CZ2   . TRP C  3 94  ? -2.059  -40.533 -7.440  1.00 32.40  ? 94   TRP A CZ2   1 
ATOM   2097 C  CZ3   . TRP C  3 94  ? -3.278  -38.466 -7.089  1.00 32.56  ? 94   TRP A CZ3   1 
ATOM   2098 C  CH2   . TRP C  3 94  ? -3.138  -39.730 -7.699  1.00 32.37  ? 94   TRP A CH2   1 
ATOM   2099 N  N     . GLU C  3 95  ? 1.701   -34.994 -2.985  1.00 31.33  ? 95   GLU A N     1 
ATOM   2100 C  CA    . GLU C  3 95  ? 1.537   -33.831 -2.114  1.00 33.22  ? 95   GLU A CA    1 
ATOM   2101 C  C     . GLU C  3 95  ? 2.081   -32.529 -2.712  1.00 33.61  ? 95   GLU A C     1 
ATOM   2102 O  O     . GLU C  3 95  ? 2.067   -31.504 -2.039  1.00 32.65  ? 95   GLU A O     1 
ATOM   2103 C  CB    . GLU C  3 95  ? 2.134   -34.073 -0.720  1.00 32.85  ? 95   GLU A CB    1 
ATOM   2104 C  CG    . GLU C  3 95  ? 3.651   -33.926 -0.659  1.00 32.33  ? 95   GLU A CG    1 
ATOM   2105 C  CD    . GLU C  3 95  ? 4.366   -35.133 -1.224  1.00 32.81  ? 95   GLU A CD    1 
ATOM   2106 O  OE1   . GLU C  3 95  ? 5.609   -35.127 -1.252  1.00 33.62  ? 95   GLU A OE1   1 
ATOM   2107 O  OE2   . GLU C  3 95  ? 3.684   -36.094 -1.635  1.00 31.84  ? 95   GLU A OE2   1 
ATOM   2108 N  N     . GLU C  3 96  ? 2.537   -32.566 -3.966  1.00 34.65  ? 96   GLU A N     1 
ATOM   2109 C  CA    . GLU C  3 96  ? 3.101   -31.376 -4.628  1.00 35.48  ? 96   GLU A CA    1 
ATOM   2110 C  C     . GLU C  3 96  ? 2.278   -30.960 -5.842  1.00 35.22  ? 96   GLU A C     1 
ATOM   2111 O  O     . GLU C  3 96  ? 2.463   -29.868 -6.381  1.00 32.98  ? 96   GLU A O     1 
ATOM   2112 C  CB    . GLU C  3 96  ? 4.543   -31.628 -5.090  1.00 37.36  ? 96   GLU A CB    1 
ATOM   2113 C  CG    . GLU C  3 96  ? 5.528   -31.988 -3.998  1.00 40.72  ? 96   GLU A CG    1 
ATOM   2114 C  CD    . GLU C  3 96  ? 5.993   -30.782 -3.186  1.00 43.28  ? 96   GLU A CD    1 
ATOM   2115 O  OE1   . GLU C  3 96  ? 7.118   -30.842 -2.636  1.00 45.08  ? 96   GLU A OE1   1 
ATOM   2116 O  OE2   . GLU C  3 96  ? 5.245   -29.781 -3.089  1.00 43.82  ? 96   GLU A OE2   1 
ATOM   2117 N  N     . VAL C  3 97  ? 1.382   -31.842 -6.278  1.00 35.25  ? 97   VAL A N     1 
ATOM   2118 C  CA    . VAL C  3 97  ? 0.691   -31.643 -7.544  1.00 35.77  ? 97   VAL A CA    1 
ATOM   2119 C  C     . VAL C  3 97  ? -0.253  -30.440 -7.511  1.00 36.05  ? 97   VAL A C     1 
ATOM   2120 O  O     . VAL C  3 97  ? -0.216  -29.599 -8.415  1.00 35.14  ? 97   VAL A O     1 
ATOM   2121 C  CB    . VAL C  3 97  ? -0.020  -32.936 -8.047  1.00 36.54  ? 97   VAL A CB    1 
ATOM   2122 C  CG1   . VAL C  3 97  ? 0.906   -34.126 -7.898  1.00 35.96  ? 97   VAL A CG1   1 
ATOM   2123 C  CG2   . VAL C  3 97  ? -1.314  -33.188 -7.297  1.00 37.66  ? 97   VAL A CG2   1 
ATOM   2124 N  N     . HIS C  3 98  ? -1.071  -30.334 -6.461  1.00 35.23  ? 98   HIS A N     1 
ATOM   2125 C  CA    . HIS C  3 98  ? -1.987  -29.202 -6.363  1.00 34.57  ? 98   HIS A CA    1 
ATOM   2126 C  C     . HIS C  3 98  ? -1.231  -27.874 -6.360  1.00 32.97  ? 98   HIS A C     1 
ATOM   2127 O  O     . HIS C  3 98  ? -1.582  -26.939 -7.083  1.00 32.93  ? 98   HIS A O     1 
ATOM   2128 C  CB    . HIS C  3 98  ? -2.873  -29.290 -5.125  1.00 35.73  ? 98   HIS A CB    1 
ATOM   2129 C  CG    . HIS C  3 98  ? -3.715  -28.070 -4.918  1.00 36.88  ? 98   HIS A CG    1 
ATOM   2130 N  ND1   . HIS C  3 98  ? -4.874  -27.835 -5.630  1.00 39.46  ? 98   HIS A ND1   1 
ATOM   2131 C  CD2   . HIS C  3 98  ? -3.549  -27.003 -4.100  1.00 36.18  ? 98   HIS A CD2   1 
ATOM   2132 C  CE1   . HIS C  3 98  ? -5.388  -26.679 -5.249  1.00 37.23  ? 98   HIS A CE1   1 
ATOM   2133 N  NE2   . HIS C  3 98  ? -4.604  -26.157 -4.322  1.00 36.80  ? 98   HIS A NE2   1 
ATOM   2134 N  N     . ALA C  3 99  ? -0.197  -27.796 -5.537  1.00 30.92  ? 99   ALA A N     1 
ATOM   2135 C  CA    . ALA C  3 99  ? 0.593   -26.584 -5.449  1.00 30.67  ? 99   ALA A CA    1 
ATOM   2136 C  C     . ALA C  3 99  ? 1.161   -26.201 -6.810  1.00 31.12  ? 99   ALA A C     1 
ATOM   2137 O  O     . ALA C  3 99  ? 1.095   -25.039 -7.205  1.00 32.63  ? 99   ALA A O     1 
ATOM   2138 C  CB    . ALA C  3 99  ? 1.706   -26.748 -4.429  1.00 30.26  ? 99   ALA A CB    1 
ATOM   2139 N  N     . GLU C  3 100 ? 1.725   -27.174 -7.523  1.00 30.62  ? 100  GLU A N     1 
ATOM   2140 C  CA    . GLU C  3 100 ? 2.310   -26.910 -8.837  1.00 29.76  ? 100  GLU A CA    1 
ATOM   2141 C  C     . GLU C  3 100 ? 1.222   -26.493 -9.821  1.00 27.27  ? 100  GLU A C     1 
ATOM   2142 O  O     . GLU C  3 100 ? 1.376   -25.533 -10.566 1.00 26.23  ? 100  GLU A O     1 
ATOM   2143 C  CB    . GLU C  3 100 ? 3.058   -28.152 -9.370  1.00 30.06  ? 100  GLU A CB    1 
ATOM   2144 C  CG    . GLU C  3 100 ? 3.688   -27.974 -10.771 1.00 30.23  ? 100  GLU A CG    1 
ATOM   2145 C  CD    . GLU C  3 100 ? 5.140   -27.525 -10.730 1.00 31.87  ? 100  GLU A CD    1 
ATOM   2146 O  OE1   . GLU C  3 100 ? 5.879   -27.977 -9.826  1.00 33.32  ? 100  GLU A OE1   1 
ATOM   2147 O  OE2   . GLU C  3 100 ? 5.560   -26.740 -11.609 1.00 31.70  ? 100  GLU A OE2   1 
ATOM   2148 N  N     . ALA C  3 101 ? 0.135   -27.251 -9.824  1.00 26.26  ? 101  ALA A N     1 
ATOM   2149 C  CA    . ALA C  3 101 ? -0.989  -27.013 -10.708 1.00 25.12  ? 101  ALA A CA    1 
ATOM   2150 C  C     . ALA C  3 101 ? -1.627  -25.631 -10.482 1.00 26.36  ? 101  ALA A C     1 
ATOM   2151 O  O     . ALA C  3 101 ? -2.123  -25.003 -11.417 1.00 24.17  ? 101  ALA A O     1 
ATOM   2152 C  CB    . ALA C  3 101 ? -2.017  -28.119 -10.533 1.00 23.74  ? 101  ALA A CB    1 
ATOM   2153 N  N     . CYS C  3 102 ? -1.593  -25.167 -9.234  1.00 28.31  ? 102  CYS A N     1 
ATOM   2154 C  CA    . CYS C  3 102 ? -2.120  -23.858 -8.853  1.00 28.99  ? 102  CYS A CA    1 
ATOM   2155 C  C     . CYS C  3 102 ? -1.401  -22.687 -9.551  1.00 28.65  ? 102  CYS A C     1 
ATOM   2156 O  O     . CYS C  3 102 ? -1.975  -21.580 -9.731  1.00 30.77  ? 102  CYS A O     1 
ATOM   2157 C  CB    . CYS C  3 102 ? -2.034  -23.713 -7.333  1.00 30.44  ? 102  CYS A CB    1 
ATOM   2158 S  SG    . CYS C  3 102 ? -2.920  -22.312 -6.647  1.00 31.79  ? 102  CYS A SG    1 
ATOM   2159 N  N     . ARG C  3 103 ? -0.152  -22.928 -9.932  1.00 26.22  ? 103  ARG A N     1 
ATOM   2160 C  CA    . ARG C  3 103 ? 0.595   -21.998 -10.769 1.00 26.71  ? 103  ARG A CA    1 
ATOM   2161 C  C     . ARG C  3 103 ? 0.284   -22.248 -12.250 1.00 27.15  ? 103  ARG A C     1 
ATOM   2162 O  O     . ARG C  3 103 ? 0.012   -21.310 -13.011 1.00 26.68  ? 103  ARG A O     1 
ATOM   2163 C  CB    . ARG C  3 103 ? 2.103   -22.120 -10.517 1.00 26.44  ? 103  ARG A CB    1 
ATOM   2164 C  CG    . ARG C  3 103 ? 2.555   -21.711 -9.123  1.00 25.34  ? 103  ARG A CG    1 
ATOM   2165 C  CD    . ARG C  3 103 ? 4.066   -21.512 -9.044  1.00 26.90  ? 103  ARG A CD    1 
ATOM   2166 N  NE    . ARG C  3 103 ? 4.832   -22.685 -9.472  1.00 28.59  ? 103  ARG A NE    1 
ATOM   2167 C  CZ    . ARG C  3 103 ? 5.081   -23.750 -8.709  1.00 28.44  ? 103  ARG A CZ    1 
ATOM   2168 N  NH1   . ARG C  3 103 ? 5.787   -24.762 -9.192  1.00 28.52  ? 103  ARG A NH1   1 
ATOM   2169 N  NH2   . ARG C  3 103 ? 4.621   -23.808 -7.468  1.00 27.86  ? 103  ARG A NH2   1 
ATOM   2170 N  N     . TRP C  3 104 ? 0.285   -23.519 -12.645 1.00 27.51  ? 104  TRP A N     1 
ATOM   2171 C  CA    . TRP C  3 104 ? 0.094   -23.894 -14.054 1.00 28.50  ? 104  TRP A CA    1 
ATOM   2172 C  C     . TRP C  3 104 ? -1.251  -23.433 -14.627 1.00 27.13  ? 104  TRP A C     1 
ATOM   2173 O  O     . TRP C  3 104 ? -1.334  -23.049 -15.787 1.00 25.97  ? 104  TRP A O     1 
ATOM   2174 C  CB    . TRP C  3 104 ? 0.275   -25.405 -14.241 1.00 30.52  ? 104  TRP A CB    1 
ATOM   2175 C  CG    . TRP C  3 104 ? 1.720   -25.839 -14.170 1.00 32.41  ? 104  TRP A CG    1 
ATOM   2176 C  CD1   . TRP C  3 104 ? 2.690   -25.357 -13.322 1.00 31.67  ? 104  TRP A CD1   1 
ATOM   2177 C  CD2   . TRP C  3 104 ? 2.359   -26.846 -14.970 1.00 32.46  ? 104  TRP A CD2   1 
ATOM   2178 N  NE1   . TRP C  3 104 ? 3.881   -25.990 -13.561 1.00 31.50  ? 104  TRP A NE1   1 
ATOM   2179 C  CE2   . TRP C  3 104 ? 3.706   -26.913 -14.560 1.00 32.22  ? 104  TRP A CE2   1 
ATOM   2180 C  CE3   . TRP C  3 104 ? 1.921   -27.696 -15.992 1.00 32.96  ? 104  TRP A CE3   1 
ATOM   2181 C  CZ2   . TRP C  3 104 ? 4.619   -27.803 -15.134 1.00 32.18  ? 104  TRP A CZ2   1 
ATOM   2182 C  CZ3   . TRP C  3 104 ? 2.832   -28.579 -16.564 1.00 31.89  ? 104  TRP A CZ3   1 
ATOM   2183 C  CH2   . TRP C  3 104 ? 4.161   -28.623 -16.134 1.00 31.76  ? 104  TRP A CH2   1 
ATOM   2184 N  N     . GLU C  3 105 ? -2.291  -23.467 -13.805 1.00 24.70  ? 105  GLU A N     1 
ATOM   2185 C  CA    . GLU C  3 105 ? -3.632  -23.078 -14.229 1.00 25.20  ? 105  GLU A CA    1 
ATOM   2186 C  C     . GLU C  3 105 ? -3.727  -21.682 -14.864 1.00 25.53  ? 105  GLU A C     1 
ATOM   2187 O  O     . GLU C  3 105 ? -4.676  -21.394 -15.580 1.00 26.78  ? 105  GLU A O     1 
ATOM   2188 C  CB    . GLU C  3 105 ? -4.588  -23.160 -13.040 1.00 24.06  ? 105  GLU A CB    1 
ATOM   2189 C  CG    . GLU C  3 105 ? -4.096  -22.402 -11.826 1.00 23.99  ? 105  GLU A CG    1 
ATOM   2190 C  CD    . GLU C  3 105 ? -5.033  -22.504 -10.636 1.00 24.53  ? 105  GLU A CD    1 
ATOM   2191 O  OE1   . GLU C  3 105 ? -5.988  -23.302 -10.699 1.00 23.93  ? 105  GLU A OE1   1 
ATOM   2192 O  OE2   . GLU C  3 105 ? -4.810  -21.779 -9.635  1.00 26.38  ? 105  GLU A OE2   1 
ATOM   2193 N  N     . HIS C  3 106 ? -2.750  -20.821 -14.598 1.00 25.94  ? 106  HIS A N     1 
ATOM   2194 C  CA    . HIS C  3 106 ? -2.819  -19.429 -15.017 1.00 26.40  ? 106  HIS A CA    1 
ATOM   2195 C  C     . HIS C  3 106 ? -2.049  -19.146 -16.304 1.00 27.58  ? 106  HIS A C     1 
ATOM   2196 O  O     . HIS C  3 106 ? -2.012  -18.012 -16.764 1.00 29.11  ? 106  HIS A O     1 
ATOM   2197 C  CB    . HIS C  3 106 ? -2.362  -18.492 -13.876 1.00 25.81  ? 106  HIS A CB    1 
ATOM   2198 C  CG    . HIS C  3 106 ? -2.961  -18.833 -12.545 1.00 24.83  ? 106  HIS A CG    1 
ATOM   2199 N  ND1   . HIS C  3 106 ? -4.301  -18.669 -12.270 1.00 25.66  ? 106  HIS A ND1   1 
ATOM   2200 C  CD2   . HIS C  3 106 ? -2.409  -19.359 -11.425 1.00 25.95  ? 106  HIS A CD2   1 
ATOM   2201 C  CE1   . HIS C  3 106 ? -4.549  -19.075 -11.035 1.00 25.63  ? 106  HIS A CE1   1 
ATOM   2202 N  NE2   . HIS C  3 106 ? -3.418  -19.504 -10.501 1.00 26.36  ? 106  HIS A NE2   1 
ATOM   2203 N  N     . VAL C  3 107 ? -1.449  -20.177 -16.894 1.00 28.34  ? 107  VAL A N     1 
ATOM   2204 C  CA    . VAL C  3 107 ? -0.583  -19.991 -18.061 1.00 27.45  ? 107  VAL A CA    1 
ATOM   2205 C  C     . VAL C  3 107 ? -0.858  -20.949 -19.220 1.00 27.45  ? 107  VAL A C     1 
ATOM   2206 O  O     . VAL C  3 107 ? -0.440  -20.695 -20.342 1.00 26.43  ? 107  VAL A O     1 
ATOM   2207 C  CB    . VAL C  3 107 ? 0.925   -20.078 -17.696 1.00 28.07  ? 107  VAL A CB    1 
ATOM   2208 C  CG1   . VAL C  3 107 ? 1.324   -18.936 -16.771 1.00 26.76  ? 107  VAL A CG1   1 
ATOM   2209 C  CG2   . VAL C  3 107 ? 1.288   -21.468 -17.091 1.00 26.70  ? 107  VAL A CG2   1 
ATOM   2210 N  N     . MET C  3 108 ? -1.549  -22.047 -18.953 1.00 28.27  ? 108  MET A N     1 
ATOM   2211 C  CA    . MET C  3 108 ? -1.827  -23.017 -20.000 1.00 31.11  ? 108  MET A CA    1 
ATOM   2212 C  C     . MET C  3 108 ? -2.866  -22.483 -20.971 1.00 32.55  ? 108  MET A C     1 
ATOM   2213 O  O     . MET C  3 108 ? -3.920  -21.980 -20.550 1.00 31.93  ? 108  MET A O     1 
ATOM   2214 C  CB    . MET C  3 108 ? -2.333  -24.311 -19.399 1.00 33.33  ? 108  MET A CB    1 
ATOM   2215 C  CG    . MET C  3 108 ? -1.419  -24.902 -18.360 1.00 37.10  ? 108  MET A CG    1 
ATOM   2216 S  SD    . MET C  3 108 ? -2.276  -26.255 -17.545 1.00 42.82  ? 108  MET A SD    1 
ATOM   2217 C  CE    . MET C  3 108 ? -3.186  -26.952 -18.948 1.00 37.78  ? 108  MET A CE    1 
ATOM   2218 N  N     . SER C  3 109 ? -2.581  -22.596 -22.267 1.00 32.60  ? 109  SER A N     1 
ATOM   2219 C  CA    . SER C  3 109 ? -3.543  -22.159 -23.271 1.00 32.66  ? 109  SER A CA    1 
ATOM   2220 C  C     . SER C  3 109 ? -4.619  -23.217 -23.409 1.00 33.17  ? 109  SER A C     1 
ATOM   2221 O  O     . SER C  3 109 ? -4.462  -24.327 -22.916 1.00 32.16  ? 109  SER A O     1 
ATOM   2222 C  CB    . SER C  3 109 ? -2.868  -21.862 -24.616 1.00 32.05  ? 109  SER A CB    1 
ATOM   2223 O  OG    . SER C  3 109 ? -2.195  -22.996 -25.136 1.00 32.17  ? 109  SER A OG    1 
ATOM   2224 N  N     . GLU C  3 110 ? -5.730  -22.854 -24.039 1.00 35.68  ? 110  GLU A N     1 
ATOM   2225 C  CA    . GLU C  3 110 ? -6.759  -23.815 -24.388 1.00 37.83  ? 110  GLU A CA    1 
ATOM   2226 C  C     . GLU C  3 110 ? -6.254  -24.689 -25.531 1.00 38.14  ? 110  GLU A C     1 
ATOM   2227 O  O     . GLU C  3 110 ? -6.682  -25.832 -25.666 1.00 38.09  ? 110  GLU A O     1 
ATOM   2228 C  CB    . GLU C  3 110 ? -8.058  -23.112 -24.801 1.00 40.66  ? 110  GLU A CB    1 
ATOM   2229 C  CG    . GLU C  3 110 ? -8.727  -22.323 -23.683 1.00 44.69  ? 110  GLU A CG    1 
ATOM   2230 C  CD    . GLU C  3 110 ? -10.213 -22.084 -23.920 1.00 46.86  ? 110  GLU A CD    1 
ATOM   2231 O  OE1   . GLU C  3 110 ? -10.636 -22.063 -25.101 1.00 47.46  ? 110  GLU A OE1   1 
ATOM   2232 O  OE2   . GLU C  3 110 ? -10.956 -21.912 -22.916 1.00 47.79  ? 110  GLU A OE2   1 
ATOM   2233 N  N     . ASP C  3 111 ? -5.360  -24.145 -26.359 1.00 38.05  ? 111  ASP A N     1 
ATOM   2234 C  CA    . ASP C  3 111 ? -4.705  -24.936 -27.397 1.00 39.40  ? 111  ASP A CA    1 
ATOM   2235 C  C     . ASP C  3 111 ? -4.098  -26.176 -26.757 1.00 38.83  ? 111  ASP A C     1 
ATOM   2236 O  O     . ASP C  3 111 ? -4.374  -27.296 -27.175 1.00 39.34  ? 111  ASP A O     1 
ATOM   2237 C  CB    . ASP C  3 111 ? -3.604  -24.136 -28.102 1.00 41.96  ? 111  ASP A CB    1 
ATOM   2238 C  CG    . ASP C  3 111 ? -4.156  -23.059 -29.023 1.00 45.04  ? 111  ASP A CG    1 
ATOM   2239 O  OD1   . ASP C  3 111 ? -4.770  -23.416 -30.051 1.00 46.25  ? 111  ASP A OD1   1 
ATOM   2240 O  OD2   . ASP C  3 111 ? -3.976  -21.851 -28.721 1.00 46.42  ? 111  ASP A OD2   1 
ATOM   2241 N  N     . VAL C  3 112 ? -3.276  -25.959 -25.733 1.00 37.30  ? 112  VAL A N     1 
ATOM   2242 C  CA    . VAL C  3 112 ? -2.626  -27.036 -25.003 1.00 36.80  ? 112  VAL A CA    1 
ATOM   2243 C  C     . VAL C  3 112 ? -3.626  -27.917 -24.273 1.00 37.55  ? 112  VAL A C     1 
ATOM   2244 O  O     . VAL C  3 112 ? -3.414  -29.124 -24.148 1.00 37.39  ? 112  VAL A O     1 
ATOM   2245 C  CB    . VAL C  3 112 ? -1.586  -26.484 -23.992 1.00 36.22  ? 112  VAL A CB    1 
ATOM   2246 C  CG1   . VAL C  3 112 ? -1.593  -27.281 -22.699 1.00 35.86  ? 112  VAL A CG1   1 
ATOM   2247 C  CG2   . VAL C  3 112 ? -0.205  -26.492 -24.609 1.00 35.96  ? 112  VAL A CG2   1 
ATOM   2248 N  N     . GLU C  3 113 ? -4.708  -27.309 -23.785 1.00 37.81  ? 113  GLU A N     1 
ATOM   2249 C  CA    . GLU C  3 113 ? -5.706  -28.033 -23.004 1.00 38.05  ? 113  GLU A CA    1 
ATOM   2250 C  C     . GLU C  3 113 ? -6.323  -29.130 -23.847 1.00 37.45  ? 113  GLU A C     1 
ATOM   2251 O  O     . GLU C  3 113 ? -6.513  -30.252 -23.384 1.00 37.48  ? 113  GLU A O     1 
ATOM   2252 C  CB    . GLU C  3 113 ? -6.820  -27.096 -22.540 1.00 38.91  ? 113  GLU A CB    1 
ATOM   2253 C  CG    . GLU C  3 113 ? -6.578  -26.360 -21.238 1.00 39.25  ? 113  GLU A CG    1 
ATOM   2254 C  CD    . GLU C  3 113 ? -7.856  -25.737 -20.720 1.00 40.24  ? 113  GLU A CD    1 
ATOM   2255 O  OE1   . GLU C  3 113 ? -8.654  -26.454 -20.075 1.00 39.49  ? 113  GLU A OE1   1 
ATOM   2256 O  OE2   . GLU C  3 113 ? -8.070  -24.531 -20.975 1.00 41.46  ? 113  GLU A OE2   1 
ATOM   2257 N  N     . ARG C  3 114 ? -6.642  -28.781 -25.087 1.00 36.86  ? 114  ARG A N     1 
ATOM   2258 C  CA    . ARG C  3 114 ? -7.257  -29.698 -26.033 1.00 37.61  ? 114  ARG A CA    1 
ATOM   2259 C  C     . ARG C  3 114 ? -6.307  -30.821 -26.434 1.00 38.27  ? 114  ARG A C     1 
ATOM   2260 O  O     . ARG C  3 114 ? -6.720  -31.974 -26.559 1.00 39.24  ? 114  ARG A O     1 
ATOM   2261 C  CB    . ARG C  3 114 ? -7.746  -28.935 -27.258 1.00 37.45  ? 114  ARG A CB    1 
ATOM   2262 C  CG    . ARG C  3 114 ? -8.848  -27.962 -26.915 1.00 38.01  ? 114  ARG A CG    1 
ATOM   2263 C  CD    . ARG C  3 114 ? -9.470  -27.360 -28.134 1.00 38.84  ? 114  ARG A CD    1 
ATOM   2264 N  NE    . ARG C  3 114 ? -8.685  -26.257 -28.662 1.00 39.73  ? 114  ARG A NE    1 
ATOM   2265 C  CZ    . ARG C  3 114 ? -8.951  -24.981 -28.409 1.00 41.15  ? 114  ARG A CZ    1 
ATOM   2266 N  NH1   . ARG C  3 114 ? -9.983  -24.655 -27.628 1.00 39.60  ? 114  ARG A NH1   1 
ATOM   2267 N  NH2   . ARG C  3 114 ? -8.185  -24.031 -28.936 1.00 41.61  ? 114  ARG A NH2   1 
ATOM   2268 N  N     . ARG C  3 115 ? -5.034  -30.490 -26.614 1.00 37.54  ? 115  ARG A N     1 
ATOM   2269 C  CA    . ARG C  3 115 ? -4.029  -31.515 -26.834 1.00 38.02  ? 115  ARG A CA    1 
ATOM   2270 C  C     . ARG C  3 115 ? -3.965  -32.484 -25.647 1.00 38.66  ? 115  ARG A C     1 
ATOM   2271 O  O     . ARG C  3 115 ? -3.896  -33.698 -25.842 1.00 39.59  ? 115  ARG A O     1 
ATOM   2272 C  CB    . ARG C  3 115 ? -2.660  -30.886 -27.118 1.00 38.38  ? 115  ARG A CB    1 
ATOM   2273 C  CG    . ARG C  3 115 ? -2.571  -30.120 -28.451 1.00 38.15  ? 115  ARG A CG    1 
ATOM   2274 C  CD    . ARG C  3 115 ? -2.706  -31.061 -29.631 1.00 38.05  ? 115  ARG A CD    1 
ATOM   2275 N  NE    . ARG C  3 115 ? -1.893  -32.256 -29.414 1.00 39.70  ? 115  ARG A NE    1 
ATOM   2276 C  CZ    . ARG C  3 115 ? -2.106  -33.436 -29.989 1.00 39.32  ? 115  ARG A CZ    1 
ATOM   2277 N  NH1   . ARG C  3 115 ? -3.115  -33.597 -30.840 1.00 39.18  ? 115  ARG A NH1   1 
ATOM   2278 N  NH2   . ARG C  3 115 ? -1.310  -34.458 -29.705 1.00 38.40  ? 115  ARG A NH2   1 
ATOM   2279 N  N     . LEU C  3 116 ? -4.019  -31.951 -24.423 1.00 38.27  ? 116  LEU A N     1 
ATOM   2280 C  CA    . LEU C  3 116 ? -3.955  -32.779 -23.210 1.00 37.63  ? 116  LEU A CA    1 
ATOM   2281 C  C     . LEU C  3 116 ? -5.132  -33.728 -23.061 1.00 37.91  ? 116  LEU A C     1 
ATOM   2282 O  O     . LEU C  3 116 ? -4.989  -34.825 -22.531 1.00 37.14  ? 116  LEU A O     1 
ATOM   2283 C  CB    . LEU C  3 116 ? -3.869  -31.915 -21.952 1.00 36.71  ? 116  LEU A CB    1 
ATOM   2284 C  CG    . LEU C  3 116 ? -2.533  -31.285 -21.582 1.00 36.00  ? 116  LEU A CG    1 
ATOM   2285 C  CD1   . LEU C  3 116 ? -2.695  -30.496 -20.277 1.00 34.92  ? 116  LEU A CD1   1 
ATOM   2286 C  CD2   . LEU C  3 116 ? -1.439  -32.340 -21.466 1.00 35.19  ? 116  LEU A CD2   1 
ATOM   2287 N  N     . VAL C  3 117 ? -6.304  -33.292 -23.507 1.00 39.79  ? 117  VAL A N     1 
ATOM   2288 C  CA    . VAL C  3 117 ? -7.491  -34.136 -23.453 1.00 41.39  ? 117  VAL A CA    1 
ATOM   2289 C  C     . VAL C  3 117 ? -7.266  -35.374 -24.318 1.00 42.90  ? 117  VAL A C     1 
ATOM   2290 O  O     . VAL C  3 117 ? -7.630  -36.488 -23.934 1.00 43.59  ? 117  VAL A O     1 
ATOM   2291 C  CB    . VAL C  3 117 ? -8.753  -33.372 -23.921 1.00 41.12  ? 117  VAL A CB    1 
ATOM   2292 C  CG1   . VAL C  3 117 ? -9.823  -34.337 -24.376 1.00 40.90  ? 117  VAL A CG1   1 
ATOM   2293 C  CG2   . VAL C  3 117 ? -9.279  -32.499 -22.802 1.00 40.44  ? 117  VAL A CG2   1 
ATOM   2294 N  N     . LYS C  3 118 ? -6.643  -35.168 -25.477 1.00 43.85  ? 118  LYS A N     1 
ATOM   2295 C  CA    . LYS C  3 118 ? -6.325  -36.263 -26.379 1.00 45.03  ? 118  LYS A CA    1 
ATOM   2296 C  C     . LYS C  3 118 ? -5.205  -37.132 -25.804 1.00 44.61  ? 118  LYS A C     1 
ATOM   2297 O  O     . LYS C  3 118 ? -5.351  -38.346 -25.689 1.00 43.58  ? 118  LYS A O     1 
ATOM   2298 C  CB    . LYS C  3 118 ? -5.952  -35.729 -27.767 1.00 46.03  ? 118  LYS A CB    1 
ATOM   2299 C  CG    . LYS C  3 118 ? -7.145  -35.185 -28.564 1.00 48.45  ? 118  LYS A CG    1 
ATOM   2300 C  CD    . LYS C  3 118 ? -8.009  -36.324 -29.120 1.00 49.94  ? 118  LYS A CD    1 
ATOM   2301 C  CE    . LYS C  3 118 ? -9.470  -35.907 -29.315 1.00 50.56  ? 118  LYS A CE    1 
ATOM   2302 N  NZ    . LYS C  3 118 ? -10.222 -35.753 -28.022 1.00 50.84  ? 118  LYS A NZ    1 
ATOM   2303 N  N     . VAL C  3 119 ? -4.104  -36.497 -25.418 1.00 44.47  ? 119  VAL A N     1 
ATOM   2304 C  CA    . VAL C  3 119 ? -2.919  -37.208 -24.956 1.00 44.80  ? 119  VAL A CA    1 
ATOM   2305 C  C     . VAL C  3 119 ? -3.186  -38.051 -23.714 1.00 44.92  ? 119  VAL A C     1 
ATOM   2306 O  O     . VAL C  3 119 ? -2.679  -39.163 -23.600 1.00 45.12  ? 119  VAL A O     1 
ATOM   2307 C  CB    . VAL C  3 119 ? -1.745  -36.235 -24.683 1.00 45.37  ? 119  VAL A CB    1 
ATOM   2308 C  CG1   . VAL C  3 119 ? -0.481  -37.006 -24.353 1.00 45.74  ? 119  VAL A CG1   1 
ATOM   2309 C  CG2   . VAL C  3 119 ? -1.505  -35.343 -25.886 1.00 45.26  ? 119  VAL A CG2   1 
ATOM   2310 N  N     . LEU C  3 120 ? -3.985  -37.525 -22.789 1.00 45.50  ? 120  LEU A N     1 
ATOM   2311 C  CA    . LEU C  3 120 ? -4.277  -38.223 -21.535 1.00 45.69  ? 120  LEU A CA    1 
ATOM   2312 C  C     . LEU C  3 120 ? -5.492  -39.137 -21.649 1.00 46.60  ? 120  LEU A C     1 
ATOM   2313 O  O     . LEU C  3 120 ? -6.043  -39.576 -20.640 1.00 47.44  ? 120  LEU A O     1 
ATOM   2314 C  CB    . LEU C  3 120 ? -4.477  -37.225 -20.388 1.00 44.50  ? 120  LEU A CB    1 
ATOM   2315 C  CG    . LEU C  3 120 ? -3.326  -36.248 -20.138 1.00 44.37  ? 120  LEU A CG    1 
ATOM   2316 C  CD1   . LEU C  3 120 ? -3.772  -35.088 -19.262 1.00 44.43  ? 120  LEU A CD1   1 
ATOM   2317 C  CD2   . LEU C  3 120 ? -2.123  -36.949 -19.533 1.00 44.50  ? 120  LEU A CD2   1 
ATOM   2318 N  N     . ASN C  3 121 ? -5.909  -39.403 -22.881 1.00 48.33  ? 121  ASN A N     1 
ATOM   2319 C  CA    . ASN C  3 121 ? -6.997  -40.343 -23.172 1.00 49.89  ? 121  ASN A CA    1 
ATOM   2320 C  C     . ASN C  3 121 ? -8.370  -39.952 -22.623 1.00 50.21  ? 121  ASN A C     1 
ATOM   2321 O  O     . ASN C  3 121 ? -9.083  -40.779 -22.043 1.00 49.34  ? 121  ASN A O     1 
ATOM   2322 C  CB    . ASN C  3 121 ? -6.617  -41.766 -22.751 1.00 51.59  ? 121  ASN A CB    1 
ATOM   2323 C  CG    . ASN C  3 121 ? -5.542  -42.364 -23.645 1.00 53.34  ? 121  ASN A CG    1 
ATOM   2324 O  OD1   . ASN C  3 121 ? -4.571  -42.953 -23.163 1.00 54.31  ? 121  ASN A OD1   1 
ATOM   2325 N  ND2   . ASN C  3 121 ? -5.705  -42.200 -24.957 1.00 53.77  ? 121  ASN A ND2   1 
ATOM   2326 N  N     . ASN C  3 122 ? -8.732  -38.687 -22.830 1.00 50.41  ? 122  ASN A N     1 
ATOM   2327 C  CA    . ASN C  3 122 ? -10.054 -38.178 -22.472 1.00 49.86  ? 122  ASN A CA    1 
ATOM   2328 C  C     . ASN C  3 122 ? -10.379 -38.325 -20.983 1.00 48.75  ? 122  ASN A C     1 
ATOM   2329 O  O     . ASN C  3 122 ? -11.313 -39.042 -20.611 1.00 49.16  ? 122  ASN A O     1 
ATOM   2330 C  CB    . ASN C  3 122 ? -11.134 -38.841 -23.336 1.00 50.38  ? 122  ASN A CB    1 
ATOM   2331 C  CG    . ASN C  3 122 ? -10.887 -38.652 -24.827 1.00 51.70  ? 122  ASN A CG    1 
ATOM   2332 O  OD1   . ASN C  3 122 ? -10.287 -37.661 -25.254 1.00 52.30  ? 122  ASN A OD1   1 
ATOM   2333 N  ND2   . ASN C  3 122 ? -11.346 -39.606 -25.626 1.00 51.77  ? 122  ASN A ND2   1 
ATOM   2334 N  N     . PRO C  3 123 ? -9.620  -37.625 -20.127 1.00 47.09  ? 123  PRO A N     1 
ATOM   2335 C  CA    . PRO C  3 123 ? -9.810  -37.705 -18.681 1.00 46.80  ? 123  PRO A CA    1 
ATOM   2336 C  C     . PRO C  3 123 ? -10.974 -36.835 -18.203 1.00 46.26  ? 123  PRO A C     1 
ATOM   2337 O  O     . PRO C  3 123 ? -11.005 -35.633 -18.472 1.00 47.02  ? 123  PRO A O     1 
ATOM   2338 C  CB    . PRO C  3 123 ? -8.495  -37.167 -18.136 1.00 46.63  ? 123  PRO A CB    1 
ATOM   2339 C  CG    . PRO C  3 123 ? -8.061  -36.173 -19.168 1.00 46.57  ? 123  PRO A CG    1 
ATOM   2340 C  CD    . PRO C  3 123 ? -8.544  -36.691 -20.495 1.00 46.70  ? 123  PRO A CD    1 
ATOM   2341 N  N     . THR C  3 124 ? -11.922 -37.442 -17.498 1.00 44.89  ? 124  THR A N     1 
ATOM   2342 C  CA    . THR C  3 124 ? -13.074 -36.711 -16.989 1.00 43.59  ? 124  THR A CA    1 
ATOM   2343 C  C     . THR C  3 124 ? -12.868 -36.265 -15.544 1.00 42.52  ? 124  THR A C     1 
ATOM   2344 O  O     . THR C  3 124 ? -13.729 -35.597 -14.968 1.00 42.71  ? 124  THR A O     1 
ATOM   2345 C  CB    . THR C  3 124 ? -14.348 -37.567 -17.047 1.00 44.10  ? 124  THR A CB    1 
ATOM   2346 O  OG1   . THR C  3 124 ? -14.161 -38.748 -16.258 1.00 44.79  ? 124  THR A OG1   1 
ATOM   2347 C  CG2   . THR C  3 124 ? -14.665 -37.965 -18.487 1.00 44.47  ? 124  THR A CG2   1 
ATOM   2348 N  N     . THR C  3 125 ? -11.733 -36.640 -14.957 1.00 40.44  ? 125  THR A N     1 
ATOM   2349 C  CA    . THR C  3 125 ? -11.470 -36.346 -13.551 1.00 38.71  ? 125  THR A CA    1 
ATOM   2350 C  C     . THR C  3 125 ? -10.016 -35.970 -13.323 1.00 38.02  ? 125  THR A C     1 
ATOM   2351 O  O     . THR C  3 125 ? -9.152  -36.277 -14.147 1.00 38.17  ? 125  THR A O     1 
ATOM   2352 C  CB    . THR C  3 125 ? -11.767 -37.555 -12.657 1.00 38.46  ? 125  THR A CB    1 
ATOM   2353 O  OG1   . THR C  3 125 ? -10.839 -38.604 -12.957 1.00 38.70  ? 125  THR A OG1   1 
ATOM   2354 C  CG2   . THR C  3 125 ? -13.191 -38.061 -12.869 1.00 38.25  ? 125  THR A CG2   1 
ATOM   2355 N  N     . SER C  3 126 ? -9.744  -35.306 -12.203 1.00 35.81  ? 126  SER A N     1 
ATOM   2356 C  CA    . SER C  3 126 ? -8.371  -35.094 -11.786 1.00 34.95  ? 126  SER A CA    1 
ATOM   2357 C  C     . SER C  3 126 ? -7.856  -36.382 -11.128 1.00 35.35  ? 126  SER A C     1 
ATOM   2358 O  O     . SER C  3 126 ? -8.645  -37.295 -10.838 1.00 34.39  ? 126  SER A O     1 
ATOM   2359 C  CB    . SER C  3 126 ? -8.258  -33.894 -10.839 1.00 34.40  ? 126  SER A CB    1 
ATOM   2360 O  OG    . SER C  3 126 ? -8.546  -34.248 -9.496  1.00 33.41  ? 126  SER A OG    1 
ATOM   2361 N  N     . PRO C  3 127 ? -6.532  -36.471 -10.901 1.00 34.73  ? 127  PRO A N     1 
ATOM   2362 C  CA    . PRO C  3 127 ? -5.971  -37.674 -10.297 1.00 34.83  ? 127  PRO A CA    1 
ATOM   2363 C  C     . PRO C  3 127 ? -6.517  -37.930 -8.894  1.00 33.90  ? 127  PRO A C     1 
ATOM   2364 O  O     . PRO C  3 127 ? -6.347  -39.026 -8.363  1.00 34.55  ? 127  PRO A O     1 
ATOM   2365 C  CB    . PRO C  3 127 ? -4.463  -37.382 -10.254 1.00 35.35  ? 127  PRO A CB    1 
ATOM   2366 C  CG    . PRO C  3 127 ? -4.358  -35.894 -10.324 1.00 35.76  ? 127  PRO A CG    1 
ATOM   2367 C  CD    . PRO C  3 127 ? -5.495  -35.470 -11.199 1.00 35.39  ? 127  PRO A CD    1 
ATOM   2368 N  N     . PHE C  3 128 ? -7.173  -36.928 -8.311  1.00 32.49  ? 128  PHE A N     1 
ATOM   2369 C  CA    . PHE C  3 128 ? -7.806  -37.056 -6.991  1.00 30.77  ? 128  PHE A CA    1 
ATOM   2370 C  C     . PHE C  3 128 ? -9.271  -37.534 -7.062  1.00 31.91  ? 128  PHE A C     1 
ATOM   2371 O  O     . PHE C  3 128 ? -9.888  -37.822 -6.037  1.00 32.75  ? 128  PHE A O     1 
ATOM   2372 C  CB    . PHE C  3 128 ? -7.755  -35.722 -6.241  1.00 27.84  ? 128  PHE A CB    1 
ATOM   2373 C  CG    . PHE C  3 128 ? -6.364  -35.232 -5.944  1.00 26.50  ? 128  PHE A CG    1 
ATOM   2374 C  CD1   . PHE C  3 128 ? -5.764  -34.281 -6.751  1.00 25.02  ? 128  PHE A CD1   1 
ATOM   2375 C  CD2   . PHE C  3 128 ? -5.663  -35.712 -4.842  1.00 26.27  ? 128  PHE A CD2   1 
ATOM   2376 C  CE1   . PHE C  3 128 ? -4.488  -33.819 -6.478  1.00 25.01  ? 128  PHE A CE1   1 
ATOM   2377 C  CE2   . PHE C  3 128 ? -4.392  -35.262 -4.557  1.00 25.35  ? 128  PHE A CE2   1 
ATOM   2378 C  CZ    . PHE C  3 128 ? -3.797  -34.307 -5.378  1.00 26.26  ? 128  PHE A CZ    1 
ATOM   2379 N  N     . GLY C  3 129 ? -9.840  -37.588 -8.260  1.00 32.37  ? 129  GLY A N     1 
ATOM   2380 C  CA    . GLY C  3 129 ? -11.233 -37.986 -8.409  1.00 32.86  ? 129  GLY A CA    1 
ATOM   2381 C  C     . GLY C  3 129 ? -12.207 -36.848 -8.688  1.00 33.33  ? 129  GLY A C     1 
ATOM   2382 O  O     . GLY C  3 129 ? -13.332 -37.078 -9.099  1.00 32.62  ? 129  GLY A O     1 
ATOM   2383 N  N     . ASN C  3 130 ? -11.792 -35.613 -8.466  1.00 35.24  ? 130  ASN A N     1 
ATOM   2384 C  CA    . ASN C  3 130 ? -12.695 -34.493 -8.723  1.00 37.42  ? 130  ASN A CA    1 
ATOM   2385 C  C     . ASN C  3 130 ? -12.984 -34.356 -10.208 1.00 37.58  ? 130  ASN A C     1 
ATOM   2386 O  O     . ASN C  3 130 ? -12.065 -34.390 -11.016 1.00 37.89  ? 130  ASN A O     1 
ATOM   2387 C  CB    . ASN C  3 130 ? -12.106 -33.196 -8.194  1.00 37.91  ? 130  ASN A CB    1 
ATOM   2388 C  CG    . ASN C  3 130 ? -11.721 -33.293 -6.746  1.00 38.28  ? 130  ASN A CG    1 
ATOM   2389 O  OD1   . ASN C  3 130 ? -10.535 -33.261 -6.405  1.00 39.70  ? 130  ASN A OD1   1 
ATOM   2390 N  ND2   . ASN C  3 130 ? -12.715 -33.423 -5.879  1.00 37.43  ? 130  ASN A ND2   1 
ATOM   2391 N  N     . PRO C  3 131 ? -14.269 -34.214 -10.571 1.00 38.47  ? 131  PRO A N     1 
ATOM   2392 C  CA    . PRO C  3 131 ? -14.650 -34.072 -11.979 1.00 38.00  ? 131  PRO A CA    1 
ATOM   2393 C  C     . PRO C  3 131 ? -14.030 -32.825 -12.607 1.00 36.73  ? 131  PRO A C     1 
ATOM   2394 O  O     . PRO C  3 131 ? -13.829 -31.830 -11.920 1.00 35.96  ? 131  PRO A O     1 
ATOM   2395 C  CB    . PRO C  3 131 ? -16.177 -33.943 -11.919 1.00 38.54  ? 131  PRO A CB    1 
ATOM   2396 C  CG    . PRO C  3 131 ? -16.563 -34.557 -10.602 1.00 39.13  ? 131  PRO A CG    1 
ATOM   2397 C  CD    . PRO C  3 131 ? -15.442 -34.188 -9.678  1.00 38.37  ? 131  PRO A CD    1 
ATOM   2398 N  N     . ILE C  3 132 ? -13.705 -32.902 -13.896 1.00 36.03  ? 132  ILE A N     1 
ATOM   2399 C  CA    . ILE C  3 132 ? -13.163 -31.764 -14.636 1.00 35.53  ? 132  ILE A CA    1 
ATOM   2400 C  C     . ILE C  3 132 ? -14.288 -31.023 -15.346 1.00 35.81  ? 132  ILE A C     1 
ATOM   2401 O  O     . ILE C  3 132 ? -14.977 -31.595 -16.195 1.00 36.94  ? 132  ILE A O     1 
ATOM   2402 C  CB    . ILE C  3 132 ? -12.139 -32.202 -15.695 1.00 34.23  ? 132  ILE A CB    1 
ATOM   2403 C  CG1   . ILE C  3 132 ? -11.049 -33.065 -15.062 1.00 34.08  ? 132  ILE A CG1   1 
ATOM   2404 C  CG2   . ILE C  3 132 ? -11.536 -30.993 -16.369 1.00 34.19  ? 132  ILE A CG2   1 
ATOM   2405 C  CD1   . ILE C  3 132 ? -10.019 -33.544 -16.034 1.00 32.92  ? 132  ILE A CD1   1 
ATOM   2406 N  N     . PRO C  3 133 ? -14.483 -29.745 -15.000 1.00 35.67  ? 133  PRO A N     1 
ATOM   2407 C  CA    . PRO C  3 133 ? -15.559 -28.963 -15.598 1.00 35.53  ? 133  PRO A CA    1 
ATOM   2408 C  C     . PRO C  3 133 ? -15.193 -28.432 -16.978 1.00 36.40  ? 133  PRO A C     1 
ATOM   2409 O  O     . PRO C  3 133 ? -14.013 -28.353 -17.321 1.00 36.28  ? 133  PRO A O     1 
ATOM   2410 C  CB    . PRO C  3 133 ? -15.701 -27.794 -14.625 1.00 35.38  ? 133  PRO A CB    1 
ATOM   2411 C  CG    . PRO C  3 133 ? -14.319 -27.594 -14.097 1.00 35.25  ? 133  PRO A CG    1 
ATOM   2412 C  CD    . PRO C  3 133 ? -13.712 -28.969 -14.011 1.00 35.09  ? 133  PRO A CD    1 
ATOM   2413 N  N     . GLY C  3 134 ? -16.206 -28.072 -17.762 1.00 36.69  ? 134  GLY A N     1 
ATOM   2414 C  CA    . GLY C  3 134 ? -16.002 -27.287 -18.976 1.00 36.44  ? 134  GLY A CA    1 
ATOM   2415 C  C     . GLY C  3 134 ? -15.353 -27.990 -20.150 1.00 36.64  ? 134  GLY A C     1 
ATOM   2416 O  O     . GLY C  3 134 ? -14.716 -27.349 -20.990 1.00 36.59  ? 134  GLY A O     1 
ATOM   2417 N  N     . LEU C  3 135 ? -15.521 -29.304 -20.218 1.00 37.36  ? 135  LEU A N     1 
ATOM   2418 C  CA    . LEU C  3 135 ? -14.970 -30.090 -21.313 1.00 38.37  ? 135  LEU A CA    1 
ATOM   2419 C  C     . LEU C  3 135 ? -15.785 -29.853 -22.575 1.00 40.16  ? 135  LEU A C     1 
ATOM   2420 O  O     . LEU C  3 135 ? -15.244 -29.779 -23.676 1.00 40.02  ? 135  LEU A O     1 
ATOM   2421 C  CB    . LEU C  3 135 ? -14.941 -31.572 -20.945 1.00 37.41  ? 135  LEU A CB    1 
ATOM   2422 C  CG    . LEU C  3 135 ? -13.873 -31.909 -19.898 1.00 37.43  ? 135  LEU A CG    1 
ATOM   2423 C  CD1   . LEU C  3 135 ? -13.899 -33.378 -19.520 1.00 37.26  ? 135  LEU A CD1   1 
ATOM   2424 C  CD2   . LEU C  3 135 ? -12.488 -31.509 -20.387 1.00 37.12  ? 135  LEU A CD2   1 
ATOM   2425 N  N     . VAL C  3 136 ? -17.093 -29.710 -22.398 1.00 42.66  ? 136  VAL A N     1 
ATOM   2426 C  CA    . VAL C  3 136 ? -17.964 -29.314 -23.488 1.00 44.82  ? 136  VAL A CA    1 
ATOM   2427 C  C     . VAL C  3 136 ? -17.520 -27.954 -24.027 1.00 45.93  ? 136  VAL A C     1 
ATOM   2428 O  O     . VAL C  3 136 ? -17.266 -27.814 -25.223 1.00 46.53  ? 136  VAL A O     1 
ATOM   2429 C  CB    . VAL C  3 136 ? -19.439 -29.273 -23.038 1.00 45.28  ? 136  VAL A CB    1 
ATOM   2430 C  CG1   . VAL C  3 136 ? -20.295 -28.479 -24.026 1.00 45.70  ? 136  VAL A CG1   1 
ATOM   2431 C  CG2   . VAL C  3 136 ? -19.974 -30.689 -22.867 1.00 45.48  ? 136  VAL A CG2   1 
ATOM   2432 N  N     . GLU C  3 137 ? -17.405 -26.964 -23.141 1.00 46.93  ? 137  GLU A N     1 
ATOM   2433 C  CA    . GLU C  3 137 ? -16.982 -25.619 -23.542 1.00 48.01  ? 137  GLU A CA    1 
ATOM   2434 C  C     . GLU C  3 137 ? -15.563 -25.589 -24.103 1.00 47.60  ? 137  GLU A C     1 
ATOM   2435 O  O     . GLU C  3 137 ? -15.242 -24.727 -24.912 1.00 47.39  ? 137  GLU A O     1 
ATOM   2436 C  CB    . GLU C  3 137 ? -17.110 -24.617 -22.391 1.00 49.46  ? 137  GLU A CB    1 
ATOM   2437 C  CG    . GLU C  3 137 ? -18.531 -24.385 -21.902 1.00 51.60  ? 137  GLU A CG    1 
ATOM   2438 C  CD    . GLU C  3 137 ? -18.910 -25.290 -20.737 1.00 52.89  ? 137  GLU A CD    1 
ATOM   2439 O  OE1   . GLU C  3 137 ? -18.525 -26.481 -20.740 1.00 53.07  ? 137  GLU A OE1   1 
ATOM   2440 O  OE2   . GLU C  3 137 ? -19.599 -24.805 -19.815 1.00 53.65  ? 137  GLU A OE2   1 
ATOM   2441 N  N     . LEU C  3 138 ? -14.713 -26.516 -23.663 1.00 48.01  ? 138  LEU A N     1 
ATOM   2442 C  CA    . LEU C  3 138 ? -13.393 -26.681 -24.274 1.00 47.68  ? 138  LEU A CA    1 
ATOM   2443 C  C     . LEU C  3 138 ? -13.646 -27.076 -25.712 1.00 48.85  ? 138  LEU A C     1 
ATOM   2444 O  O     . LEU C  3 138 ? -13.037 -26.534 -26.635 1.00 48.50  ? 138  LEU A O     1 
ATOM   2445 C  CB    . LEU C  3 138 ? -12.605 -27.797 -23.588 1.00 45.88  ? 138  LEU A CB    1 
ATOM   2446 C  CG    . LEU C  3 138 ? -11.117 -27.616 -23.254 1.00 44.41  ? 138  LEU A CG    1 
ATOM   2447 C  CD1   . LEU C  3 138 ? -10.449 -28.968 -23.038 1.00 42.56  ? 138  LEU A CD1   1 
ATOM   2448 C  CD2   . LEU C  3 138 ? -10.366 -26.805 -24.293 1.00 43.61  ? 138  LEU A CD2   1 
ATOM   2449 N  N     . GLY C  3 139 ? -14.568 -28.023 -25.882 1.00 50.82  ? 139  GLY A N     1 
ATOM   2450 C  CA    . GLY C  3 139 ? -14.961 -28.534 -27.196 1.00 53.10  ? 139  GLY A CA    1 
ATOM   2451 C  C     . GLY C  3 139 ? -14.613 -29.999 -27.399 1.00 53.86  ? 139  GLY A C     1 
ATOM   2452 O  O     . GLY C  3 139 ? -13.973 -30.356 -28.389 1.00 55.09  ? 139  GLY A O     1 
ATOM   2453 N  N     . VAL C  3 140 ? -15.046 -30.852 -26.472 1.00 54.21  ? 140  VAL A N     1 
ATOM   2454 C  CA    . VAL C  3 140 ? -14.680 -32.270 -26.498 1.00 54.11  ? 140  VAL A CA    1 
ATOM   2455 C  C     . VAL C  3 140 ? -15.865 -33.227 -26.297 1.00 54.03  ? 140  VAL A C     1 
ATOM   2456 O  O     . VAL C  3 140 ? -16.712 -33.031 -25.420 1.00 53.09  ? 140  VAL A O     1 
ATOM   2457 C  CB    . VAL C  3 140 ? -13.591 -32.565 -25.455 1.00 54.69  ? 140  VAL A CB    1 
ATOM   2458 C  CG1   . VAL C  3 140 ? -13.483 -34.072 -25.190 1.00 55.49  ? 140  VAL A CG1   1 
ATOM   2459 C  CG2   . VAL C  3 140 ? -12.257 -31.966 -25.904 1.00 55.01  ? 140  VAL A CG2   1 
ATOM   2460 N  N     . MET D  3 1   ? -3.035  -10.572 -14.961 1.00 61.33  ? 1    MET B N     1 
ATOM   2461 C  CA    . MET D  3 1   ? -1.583  -10.829 -14.703 1.00 60.83  ? 1    MET B CA    1 
ATOM   2462 C  C     . MET D  3 1   ? -0.662  -10.231 -15.778 1.00 59.89  ? 1    MET B C     1 
ATOM   2463 O  O     . MET D  3 1   ? -1.048  -10.063 -16.939 1.00 59.72  ? 1    MET B O     1 
ATOM   2464 C  CB    . MET D  3 1   ? -1.308  -12.333 -14.576 1.00 60.93  ? 1    MET B CB    1 
ATOM   2465 C  CG    . MET D  3 1   ? -1.489  -13.112 -15.880 1.00 61.10  ? 1    MET B CG    1 
ATOM   2466 S  SD    . MET D  3 1   ? -0.310  -14.466 -16.062 1.00 61.56  ? 1    MET B SD    1 
ATOM   2467 C  CE    . MET D  3 1   ? -0.926  -15.635 -14.865 1.00 61.34  ? 1    MET B CE    1 
ATOM   2468 N  N     . ASN D  3 2   ? 0.559   -9.916  -15.361 1.00 58.45  ? 2    ASN B N     1 
ATOM   2469 C  CA    . ASN D  3 2   ? 1.630   -9.502  -16.255 1.00 56.96  ? 2    ASN B CA    1 
ATOM   2470 C  C     . ASN D  3 2   ? 1.660   -10.317 -17.556 1.00 54.74  ? 2    ASN B C     1 
ATOM   2471 O  O     . ASN D  3 2   ? 1.635   -11.547 -17.528 1.00 54.35  ? 2    ASN B O     1 
ATOM   2472 C  CB    . ASN D  3 2   ? 2.965   -9.667  -15.517 1.00 58.12  ? 2    ASN B CB    1 
ATOM   2473 C  CG    . ASN D  3 2   ? 4.021   -8.682  -15.975 1.00 58.94  ? 2    ASN B CG    1 
ATOM   2474 O  OD1   . ASN D  3 2   ? 3.917   -8.091  -17.056 1.00 60.05  ? 2    ASN B OD1   1 
ATOM   2475 N  ND2   . ASN D  3 2   ? 5.053   -8.504  -15.154 1.00 57.98  ? 2    ASN B ND2   1 
ATOM   2476 N  N     . GLU D  3 3   ? 1.707   -9.623  -18.690 1.00 52.27  ? 3    GLU B N     1 
ATOM   2477 C  CA    . GLU D  3 3   ? 1.910   -10.261 -19.994 1.00 49.12  ? 3    GLU B CA    1 
ATOM   2478 C  C     . GLU D  3 3   ? 3.170   -11.138 -19.969 1.00 45.32  ? 3    GLU B C     1 
ATOM   2479 O  O     . GLU D  3 3   ? 3.169   -12.255 -20.487 1.00 43.37  ? 3    GLU B O     1 
ATOM   2480 C  CB    . GLU D  3 3   ? 2.041   -9.186  -21.078 1.00 51.29  ? 3    GLU B CB    1 
ATOM   2481 C  CG    . GLU D  3 3   ? 2.397   -9.698  -22.473 1.00 53.93  ? 3    GLU B CG    1 
ATOM   2482 C  CD    . GLU D  3 3   ? 1.166   -9.950  -23.338 1.00 56.15  ? 3    GLU B CD    1 
ATOM   2483 O  OE1   . GLU D  3 3   ? 0.174   -10.528 -22.823 1.00 57.05  ? 3    GLU B OE1   1 
ATOM   2484 O  OE2   . GLU D  3 3   ? 1.192   -9.567  -24.532 1.00 56.08  ? 3    GLU B OE2   1 
ATOM   2485 N  N     . LEU D  3 4   ? 4.230   -10.614 -19.347 1.00 40.55  ? 4    LEU B N     1 
ATOM   2486 C  CA    . LEU D  3 4   ? 5.506   -11.302 -19.197 1.00 35.83  ? 4    LEU B CA    1 
ATOM   2487 C  C     . LEU D  3 4   ? 5.459   -12.432 -18.177 1.00 34.79  ? 4    LEU B C     1 
ATOM   2488 O  O     . LEU D  3 4   ? 6.342   -13.284 -18.170 1.00 36.37  ? 4    LEU B O     1 
ATOM   2489 C  CB    . LEU D  3 4   ? 6.594   -10.309 -18.789 1.00 33.78  ? 4    LEU B CB    1 
ATOM   2490 C  CG    . LEU D  3 4   ? 7.002   -9.231  -19.801 1.00 33.41  ? 4    LEU B CG    1 
ATOM   2491 C  CD1   . LEU D  3 4   ? 8.004   -8.254  -19.186 1.00 32.40  ? 4    LEU B CD1   1 
ATOM   2492 C  CD2   . LEU D  3 4   ? 7.564   -9.840  -21.088 1.00 32.47  ? 4    LEU B CD2   1 
ATOM   2493 N  N     . VAL D  3 5   ? 4.429   -12.428 -17.330 1.00 33.47  ? 5    VAL B N     1 
ATOM   2494 C  CA    . VAL D  3 5   ? 4.254   -13.372 -16.210 1.00 31.82  ? 5    VAL B CA    1 
ATOM   2495 C  C     . VAL D  3 5   ? 5.231   -13.080 -15.075 1.00 31.55  ? 5    VAL B C     1 
ATOM   2496 O  O     . VAL D  3 5   ? 4.830   -12.852 -13.943 1.00 31.21  ? 5    VAL B O     1 
ATOM   2497 C  CB    . VAL D  3 5   ? 4.356   -14.855 -16.626 1.00 31.78  ? 5    VAL B CB    1 
ATOM   2498 C  CG1   . VAL D  3 5   ? 3.972   -15.749 -15.464 1.00 31.48  ? 5    VAL B CG1   1 
ATOM   2499 C  CG2   . VAL D  3 5   ? 3.470   -15.146 -17.832 1.00 31.58  ? 5    VAL B CG2   1 
ATOM   2500 N  N     . ASP D  3 6   ? 6.519   -13.074 -15.383 1.00 31.82  ? 6    ASP B N     1 
ATOM   2501 C  CA    . ASP D  3 6   ? 7.520   -12.663 -14.415 1.00 32.28  ? 6    ASP B CA    1 
ATOM   2502 C  C     . ASP D  3 6   ? 8.501   -11.715 -15.090 1.00 30.35  ? 6    ASP B C     1 
ATOM   2503 O  O     . ASP D  3 6   ? 9.275   -12.136 -15.936 1.00 31.35  ? 6    ASP B O     1 
ATOM   2504 C  CB    . ASP D  3 6   ? 8.248   -13.881 -13.838 1.00 33.28  ? 6    ASP B CB    1 
ATOM   2505 C  CG    . ASP D  3 6   ? 9.014   -13.550 -12.576 1.00 34.88  ? 6    ASP B CG    1 
ATOM   2506 O  OD1   . ASP D  3 6   ? 8.874   -14.296 -11.588 1.00 37.19  ? 6    ASP B OD1   1 
ATOM   2507 O  OD2   . ASP D  3 6   ? 9.741   -12.534 -12.560 1.00 35.58  ? 6    ASP B OD2   1 
ATOM   2508 N  N     . THR D  3 7   ? 8.456   -10.440 -14.720 1.00 29.30  ? 7    THR B N     1 
ATOM   2509 C  CA    . THR D  3 7   ? 9.248   -9.406  -15.400 1.00 28.95  ? 7    THR B CA    1 
ATOM   2510 C  C     . THR D  3 7   ? 10.738  -9.603  -15.158 1.00 28.68  ? 7    THR B C     1 
ATOM   2511 O  O     . THR D  3 7   ? 11.554  -9.527  -16.083 1.00 28.62  ? 7    THR B O     1 
ATOM   2512 C  CB    . THR D  3 7   ? 8.821   -7.979  -14.954 1.00 28.56  ? 7    THR B CB    1 
ATOM   2513 O  OG1   . THR D  3 7   ? 7.518   -7.687  -15.475 1.00 29.08  ? 7    THR B OG1   1 
ATOM   2514 C  CG2   . THR D  3 7   ? 9.807   -6.916  -15.435 1.00 25.84  ? 7    THR B CG2   1 
ATOM   2515 N  N     . THR D  3 8   ? 11.080  -9.868  -13.908 1.00 28.72  ? 8    THR B N     1 
ATOM   2516 C  CA    . THR D  3 8   ? 12.465  -10.071 -13.522 1.00 29.74  ? 8    THR B CA    1 
ATOM   2517 C  C     . THR D  3 8   ? 13.097  -11.226 -14.287 1.00 29.04  ? 8    THR B C     1 
ATOM   2518 O  O     . THR D  3 8   ? 14.168  -11.075 -14.881 1.00 29.42  ? 8    THR B O     1 
ATOM   2519 C  CB    . THR D  3 8   ? 12.574  -10.287 -12.011 1.00 30.13  ? 8    THR B CB    1 
ATOM   2520 O  OG1   . THR D  3 8   ? 12.246  -9.058  -11.354 1.00 30.58  ? 8    THR B OG1   1 
ATOM   2521 C  CG2   . THR D  3 8   ? 13.981  -10.700 -11.616 1.00 30.45  ? 8    THR B CG2   1 
ATOM   2522 N  N     . GLU D  3 9   ? 12.418  -12.366 -14.300 1.00 28.11  ? 9    GLU B N     1 
ATOM   2523 C  CA    . GLU D  3 9   ? 12.903  -13.520 -15.042 1.00 28.10  ? 9    GLU B CA    1 
ATOM   2524 C  C     . GLU D  3 9   ? 13.026  -13.255 -16.534 1.00 27.89  ? 9    GLU B C     1 
ATOM   2525 O  O     . GLU D  3 9   ? 14.028  -13.614 -17.149 1.00 26.91  ? 9    GLU B O     1 
ATOM   2526 C  CB    . GLU D  3 9   ? 12.047  -14.760 -14.768 1.00 27.51  ? 9    GLU B CB    1 
ATOM   2527 C  CG    . GLU D  3 9   ? 12.433  -15.446 -13.468 1.00 27.13  ? 9    GLU B CG    1 
ATOM   2528 C  CD    . GLU D  3 9   ? 11.459  -16.514 -13.051 1.00 28.27  ? 9    GLU B CD    1 
ATOM   2529 O  OE1   . GLU D  3 9   ? 10.601  -16.902 -13.874 1.00 28.31  ? 9    GLU B OE1   1 
ATOM   2530 O  OE2   . GLU D  3 9   ? 11.551  -16.972 -11.892 1.00 29.67  ? 9    GLU B OE2   1 
ATOM   2531 N  N     . MET D  3 10  ? 12.017  -12.624 -17.121 1.00 28.77  ? 10   MET B N     1 
ATOM   2532 C  CA    . MET D  3 10  ? 12.061  -12.351 -18.557 1.00 28.60  ? 10   MET B CA    1 
ATOM   2533 C  C     . MET D  3 10  ? 13.211  -11.411 -18.902 1.00 28.27  ? 10   MET B C     1 
ATOM   2534 O  O     . MET D  3 10  ? 13.755  -11.454 -20.004 1.00 29.83  ? 10   MET B O     1 
ATOM   2535 C  CB    . MET D  3 10  ? 10.725  -11.800 -19.047 1.00 28.86  ? 10   MET B CB    1 
ATOM   2536 C  CG    . MET D  3 10  ? 9.685   -12.888 -19.255 1.00 29.20  ? 10   MET B CG    1 
ATOM   2537 S  SD    . MET D  3 10  ? 10.233  -14.158 -20.434 1.00 28.11  ? 10   MET B SD    1 
ATOM   2538 C  CE    . MET D  3 10  ? 10.578  -13.119 -21.853 1.00 26.53  ? 10   MET B CE    1 
ATOM   2539 N  N     . TYR D  3 11  ? 13.588  -10.576 -17.940 1.00 27.48  ? 11   TYR B N     1 
ATOM   2540 C  CA    . TYR D  3 11  ? 14.704  -9.659  -18.111 1.00 26.66  ? 11   TYR B CA    1 
ATOM   2541 C  C     . TYR D  3 11  ? 16.030  -10.412 -18.067 1.00 27.59  ? 11   TYR B C     1 
ATOM   2542 O  O     . TYR D  3 11  ? 16.908  -10.159 -18.885 1.00 27.41  ? 11   TYR B O     1 
ATOM   2543 C  CB    . TYR D  3 11  ? 14.658  -8.555  -17.055 1.00 24.91  ? 11   TYR B CB    1 
ATOM   2544 C  CG    . TYR D  3 11  ? 13.933  -7.306  -17.516 1.00 25.07  ? 11   TYR B CG    1 
ATOM   2545 C  CD1   . TYR D  3 11  ? 12.621  -7.360  -17.994 1.00 24.14  ? 11   TYR B CD1   1 
ATOM   2546 C  CD2   . TYR D  3 11  ? 14.558  -6.071  -17.469 1.00 23.69  ? 11   TYR B CD2   1 
ATOM   2547 C  CE1   . TYR D  3 11  ? 11.963  -6.221  -18.416 1.00 23.42  ? 11   TYR B CE1   1 
ATOM   2548 C  CE2   . TYR D  3 11  ? 13.906  -4.931  -17.888 1.00 24.21  ? 11   TYR B CE2   1 
ATOM   2549 C  CZ    . TYR D  3 11  ? 12.616  -5.005  -18.364 1.00 24.60  ? 11   TYR B CZ    1 
ATOM   2550 O  OH    . TYR D  3 11  ? 11.994  -3.839  -18.786 1.00 25.11  ? 11   TYR B OH    1 
ATOM   2551 N  N     . LEU D  3 12  ? 16.166  -11.333 -17.112 1.00 27.99  ? 12   LEU B N     1 
ATOM   2552 C  CA    . LEU D  3 12  ? 17.370  -12.144 -16.996 1.00 27.77  ? 12   LEU B CA    1 
ATOM   2553 C  C     . LEU D  3 12  ? 17.528  -13.022 -18.223 1.00 28.82  ? 12   LEU B C     1 
ATOM   2554 O  O     . LEU D  3 12  ? 18.582  -13.032 -18.854 1.00 27.64  ? 12   LEU B O     1 
ATOM   2555 C  CB    . LEU D  3 12  ? 17.324  -13.016 -15.739 1.00 27.84  ? 12   LEU B CB    1 
ATOM   2556 C  CG    . LEU D  3 12  ? 17.411  -12.263 -14.412 1.00 27.78  ? 12   LEU B CG    1 
ATOM   2557 C  CD1   . LEU D  3 12  ? 16.915  -13.129 -13.287 1.00 26.86  ? 12   LEU B CD1   1 
ATOM   2558 C  CD2   . LEU D  3 12  ? 18.829  -11.767 -14.150 1.00 26.43  ? 12   LEU B CD2   1 
ATOM   2559 N  N     . ARG D  3 13  ? 16.476  -13.760 -18.566 1.00 30.05  ? 13   ARG B N     1 
ATOM   2560 C  CA    . ARG D  3 13  ? 16.560  -14.629 -19.721 1.00 32.39  ? 13   ARG B CA    1 
ATOM   2561 C  C     . ARG D  3 13  ? 16.801  -13.848 -21.008 1.00 33.21  ? 13   ARG B C     1 
ATOM   2562 O  O     . ARG D  3 13  ? 17.482  -14.340 -21.897 1.00 34.80  ? 13   ARG B O     1 
ATOM   2563 C  CB    . ARG D  3 13  ? 15.335  -15.537 -19.869 1.00 33.40  ? 13   ARG B CB    1 
ATOM   2564 C  CG    . ARG D  3 13  ? 15.660  -16.822 -20.646 1.00 34.58  ? 13   ARG B CG    1 
ATOM   2565 C  CD    . ARG D  3 13  ? 14.476  -17.375 -21.416 1.00 35.13  ? 13   ARG B CD    1 
ATOM   2566 N  NE    . ARG D  3 13  ? 14.134  -16.506 -22.534 1.00 35.97  ? 13   ARG B NE    1 
ATOM   2567 C  CZ    . ARG D  3 13  ? 12.944  -16.473 -23.119 1.00 35.59  ? 13   ARG B CZ    1 
ATOM   2568 N  NH1   . ARG D  3 13  ? 12.729  -15.644 -24.124 1.00 35.59  ? 13   ARG B NH1   1 
ATOM   2569 N  NH2   . ARG D  3 13  ? 11.967  -17.263 -22.694 1.00 36.68  ? 13   ARG B NH2   1 
ATOM   2570 N  N     . THR D  3 14  ? 16.239  -12.647 -21.121 1.00 32.94  ? 14   THR B N     1 
ATOM   2571 C  CA    . THR D  3 14  ? 16.450  -11.862 -22.331 1.00 32.86  ? 14   THR B CA    1 
ATOM   2572 C  C     . THR D  3 14  ? 17.924  -11.504 -22.456 1.00 34.18  ? 14   THR B C     1 
ATOM   2573 O  O     . THR D  3 14  ? 18.466  -11.471 -23.549 1.00 33.83  ? 14   THR B O     1 
ATOM   2574 C  CB    . THR D  3 14  ? 15.573  -10.594 -22.378 1.00 32.13  ? 14   THR B CB    1 
ATOM   2575 O  OG1   . THR D  3 14  ? 14.202  -10.973 -22.563 1.00 31.28  ? 14   THR B OG1   1 
ATOM   2576 C  CG2   . THR D  3 14  ? 15.991  -9.696  -23.533 1.00 30.14  ? 14   THR B CG2   1 
ATOM   2577 N  N     . ILE D  3 15  ? 18.564  -11.244 -21.319 1.00 35.85  ? 15   ILE B N     1 
ATOM   2578 C  CA    . ILE D  3 15  ? 19.997  -10.977 -21.271 1.00 36.68  ? 15   ILE B CA    1 
ATOM   2579 C  C     . ILE D  3 15  ? 20.792  -12.229 -21.658 1.00 37.70  ? 15   ILE B C     1 
ATOM   2580 O  O     . ILE D  3 15  ? 21.845  -12.133 -22.286 1.00 37.60  ? 15   ILE B O     1 
ATOM   2581 C  CB    . ILE D  3 15  ? 20.432  -10.469 -19.872 1.00 36.12  ? 15   ILE B CB    1 
ATOM   2582 C  CG1   . ILE D  3 15  ? 19.791  -9.109  -19.595 1.00 35.49  ? 15   ILE B CG1   1 
ATOM   2583 C  CG2   . ILE D  3 15  ? 21.957  -10.379 -19.769 1.00 35.45  ? 15   ILE B CG2   1 
ATOM   2584 C  CD1   . ILE D  3 15  ? 20.129  -8.530  -18.257 1.00 35.57  ? 15   ILE B CD1   1 
ATOM   2585 N  N     . TYR D  3 16  ? 20.260  -13.393 -21.294 1.00 38.27  ? 16   TYR B N     1 
ATOM   2586 C  CA    . TYR D  3 16  ? 20.831  -14.674 -21.682 1.00 39.36  ? 16   TYR B CA    1 
ATOM   2587 C  C     . TYR D  3 16  ? 20.746  -14.862 -23.196 1.00 39.14  ? 16   TYR B C     1 
ATOM   2588 O  O     . TYR D  3 16  ? 21.719  -15.251 -23.832 1.00 39.04  ? 16   TYR B O     1 
ATOM   2589 C  CB    . TYR D  3 16  ? 20.117  -15.824 -20.956 1.00 40.51  ? 16   TYR B CB    1 
ATOM   2590 C  CG    . TYR D  3 16  ? 20.793  -17.171 -21.135 1.00 41.63  ? 16   TYR B CG    1 
ATOM   2591 C  CD1   . TYR D  3 16  ? 20.514  -17.973 -22.243 1.00 41.68  ? 16   TYR B CD1   1 
ATOM   2592 C  CD2   . TYR D  3 16  ? 21.718  -17.637 -20.202 1.00 41.96  ? 16   TYR B CD2   1 
ATOM   2593 C  CE1   . TYR D  3 16  ? 21.132  -19.196 -22.414 1.00 41.67  ? 16   TYR B CE1   1 
ATOM   2594 C  CE2   . TYR D  3 16  ? 22.347  -18.862 -20.367 1.00 42.13  ? 16   TYR B CE2   1 
ATOM   2595 C  CZ    . TYR D  3 16  ? 22.049  -19.635 -21.473 1.00 42.25  ? 16   TYR B CZ    1 
ATOM   2596 O  OH    . TYR D  3 16  ? 22.666  -20.855 -21.639 1.00 42.50  ? 16   TYR B OH    1 
ATOM   2597 N  N     . ASP D  3 17  ? 19.567  -14.592 -23.752 1.00 39.87  ? 17   ASP B N     1 
ATOM   2598 C  CA    . ASP D  3 17  ? 19.336  -14.585 -25.195 1.00 39.81  ? 17   ASP B CA    1 
ATOM   2599 C  C     . ASP D  3 17  ? 20.355  -13.751 -25.963 1.00 38.38  ? 17   ASP B C     1 
ATOM   2600 O  O     . ASP D  3 17  ? 20.898  -14.197 -26.974 1.00 38.43  ? 17   ASP B O     1 
ATOM   2601 C  CB    . ASP D  3 17  ? 17.941  -14.039 -25.506 1.00 42.04  ? 17   ASP B CB    1 
ATOM   2602 C  CG    . ASP D  3 17  ? 16.847  -15.066 -25.299 1.00 44.38  ? 17   ASP B CG    1 
ATOM   2603 O  OD1   . ASP D  3 17  ? 17.154  -16.275 -25.338 1.00 44.93  ? 17   ASP B OD1   1 
ATOM   2604 O  OD2   . ASP D  3 17  ? 15.671  -14.661 -25.114 1.00 45.51  ? 17   ASP B OD2   1 
ATOM   2605 N  N     . LEU D  3 18  ? 20.603  -12.534 -25.503 1.00 36.18  ? 18   LEU B N     1 
ATOM   2606 C  CA    . LEU D  3 18  ? 21.505  -11.640 -26.229 1.00 36.65  ? 18   LEU B CA    1 
ATOM   2607 C  C     . LEU D  3 18  ? 22.944  -12.140 -26.162 1.00 37.21  ? 18   LEU B C     1 
ATOM   2608 O  O     . LEU D  3 18  ? 23.710  -12.013 -27.116 1.00 37.63  ? 18   LEU B O     1 
ATOM   2609 C  CB    . LEU D  3 18  ? 21.389  -10.208 -25.703 1.00 34.36  ? 18   LEU B CB    1 
ATOM   2610 C  CG    . LEU D  3 18  ? 19.985  -9.620  -25.896 1.00 33.91  ? 18   LEU B CG    1 
ATOM   2611 C  CD1   . LEU D  3 18  ? 19.717  -8.448  -24.957 1.00 33.73  ? 18   LEU B CD1   1 
ATOM   2612 C  CD2   . LEU D  3 18  ? 19.735  -9.238  -27.357 1.00 32.65  ? 18   LEU B CD2   1 
ATOM   2613 N  N     . GLU D  3 19  ? 23.299  -12.722 -25.027 1.00 38.42  ? 19   GLU B N     1 
ATOM   2614 C  CA    . GLU D  3 19  ? 24.622  -13.281 -24.858 1.00 39.60  ? 19   GLU B CA    1 
ATOM   2615 C  C     . GLU D  3 19  ? 24.782  -14.509 -25.736 1.00 39.60  ? 19   GLU B C     1 
ATOM   2616 O  O     . GLU D  3 19  ? 25.832  -14.714 -26.333 1.00 39.70  ? 19   GLU B O     1 
ATOM   2617 C  CB    . GLU D  3 19  ? 24.881  -13.597 -23.390 1.00 39.25  ? 19   GLU B CB    1 
ATOM   2618 C  CG    . GLU D  3 19  ? 24.964  -12.337 -22.561 1.00 41.23  ? 19   GLU B CG    1 
ATOM   2619 C  CD    . GLU D  3 19  ? 25.354  -12.582 -21.129 1.00 42.20  ? 19   GLU B CD    1 
ATOM   2620 O  OE1   . GLU D  3 19  ? 26.357  -11.989 -20.690 1.00 43.46  ? 19   GLU B OE1   1 
ATOM   2621 O  OE2   . GLU D  3 19  ? 24.662  -13.359 -20.438 1.00 43.84  ? 19   GLU B OE2   1 
ATOM   2622 N  N     . GLU D  3 20  ? 23.725  -15.304 -25.837 1.00 39.81  ? 20   GLU B N     1 
ATOM   2623 C  CA    . GLU D  3 20  ? 23.763  -16.508 -26.654 1.00 40.38  ? 20   GLU B CA    1 
ATOM   2624 C  C     . GLU D  3 20  ? 23.921  -16.177 -28.137 1.00 40.50  ? 20   GLU B C     1 
ATOM   2625 O  O     . GLU D  3 20  ? 24.621  -16.883 -28.864 1.00 40.89  ? 20   GLU B O     1 
ATOM   2626 C  CB    . GLU D  3 20  ? 22.512  -17.354 -26.425 1.00 40.47  ? 20   GLU B CB    1 
ATOM   2627 C  CG    . GLU D  3 20  ? 22.637  -18.740 -27.001 1.00 41.60  ? 20   GLU B CG    1 
ATOM   2628 C  CD    . GLU D  3 20  ? 21.492  -19.642 -26.629 1.00 41.95  ? 20   GLU B CD    1 
ATOM   2629 O  OE1   . GLU D  3 20  ? 20.381  -19.443 -27.170 1.00 41.77  ? 20   GLU B OE1   1 
ATOM   2630 O  OE2   . GLU D  3 20  ? 21.715  -20.565 -25.812 1.00 42.53  ? 20   GLU B OE2   1 
ATOM   2631 N  N     . GLU D  3 21  ? 23.282  -15.092 -28.568 1.00 40.38  ? 21   GLU B N     1 
ATOM   2632 C  CA    . GLU D  3 21  ? 23.334  -14.642 -29.951 1.00 40.77  ? 21   GLU B CA    1 
ATOM   2633 C  C     . GLU D  3 21  ? 24.601  -13.850 -30.269 1.00 40.41  ? 21   GLU B C     1 
ATOM   2634 O  O     . GLU D  3 21  ? 24.928  -13.625 -31.436 1.00 40.09  ? 21   GLU B O     1 
ATOM   2635 C  CB    . GLU D  3 21  ? 22.115  -13.781 -30.258 1.00 42.66  ? 21   GLU B CB    1 
ATOM   2636 C  CG    . GLU D  3 21  ? 20.806  -14.464 -29.953 1.00 45.45  ? 21   GLU B CG    1 
ATOM   2637 C  CD    . GLU D  3 21  ? 19.608  -13.632 -30.356 1.00 46.71  ? 21   GLU B CD    1 
ATOM   2638 O  OE1   . GLU D  3 21  ? 19.804  -12.446 -30.704 1.00 47.12  ? 21   GLU B OE1   1 
ATOM   2639 O  OE2   . GLU D  3 21  ? 18.476  -14.172 -30.331 1.00 47.70  ? 21   GLU B OE2   1 
ATOM   2640 N  N     . GLY D  3 22  ? 25.299  -13.408 -29.231 1.00 40.31  ? 22   GLY B N     1 
ATOM   2641 C  CA    . GLY D  3 22  ? 26.508  -12.620 -29.409 1.00 39.99  ? 22   GLY B CA    1 
ATOM   2642 C  C     . GLY D  3 22  ? 26.294  -11.116 -29.525 1.00 40.62  ? 22   GLY B C     1 
ATOM   2643 O  O     . GLY D  3 22  ? 27.166  -10.403 -30.027 1.00 39.98  ? 22   GLY B O     1 
ATOM   2644 N  N     . VAL D  3 23  ? 25.147  -10.615 -29.064 1.00 39.67  ? 23   VAL B N     1 
ATOM   2645 C  CA    . VAL D  3 23  ? 24.933  -9.167  -29.095 1.00 38.47  ? 23   VAL B CA    1 
ATOM   2646 C  C     . VAL D  3 23  ? 25.082  -8.559  -27.701 1.00 37.59  ? 23   VAL B C     1 
ATOM   2647 O  O     . VAL D  3 23  ? 24.638  -9.128  -26.706 1.00 36.48  ? 23   VAL B O     1 
ATOM   2648 C  CB    . VAL D  3 23  ? 23.597  -8.753  -29.784 1.00 38.32  ? 23   VAL B CB    1 
ATOM   2649 C  CG1   . VAL D  3 23  ? 23.035  -9.908  -30.600 1.00 39.06  ? 23   VAL B CG1   1 
ATOM   2650 C  CG2   . VAL D  3 23  ? 22.577  -8.277  -28.779 1.00 37.84  ? 23   VAL B CG2   1 
ATOM   2651 N  N     . THR D  3 24  ? 25.747  -7.411  -27.652 1.00 37.45  ? 24   THR B N     1 
ATOM   2652 C  CA    . THR D  3 24  ? 26.008  -6.692  -26.415 1.00 37.96  ? 24   THR B CA    1 
ATOM   2653 C  C     . THR D  3 24  ? 24.715  -6.393  -25.643 1.00 38.15  ? 24   THR B C     1 
ATOM   2654 O  O     . THR D  3 24  ? 23.826  -5.691  -26.138 1.00 38.09  ? 24   THR B O     1 
ATOM   2655 C  CB    . THR D  3 24  ? 26.780  -5.389  -26.714 1.00 37.94  ? 24   THR B CB    1 
ATOM   2656 O  OG1   . THR D  3 24  ? 28.073  -5.721  -27.225 1.00 38.93  ? 24   THR B OG1   1 
ATOM   2657 C  CG2   . THR D  3 24  ? 26.946  -4.552  -25.467 1.00 38.17  ? 24   THR B CG2   1 
ATOM   2658 N  N     . PRO D  3 25  ? 24.596  -6.953  -24.433 1.00 38.27  ? 25   PRO B N     1 
ATOM   2659 C  CA    . PRO D  3 25  ? 23.388  -6.781  -23.616 1.00 37.64  ? 25   PRO B CA    1 
ATOM   2660 C  C     . PRO D  3 25  ? 23.226  -5.355  -23.085 1.00 36.46  ? 25   PRO B C     1 
ATOM   2661 O  O     . PRO D  3 25  ? 23.784  -5.017  -22.048 1.00 37.48  ? 25   PRO B O     1 
ATOM   2662 C  CB    . PRO D  3 25  ? 23.598  -7.768  -22.457 1.00 37.48  ? 25   PRO B CB    1 
ATOM   2663 C  CG    . PRO D  3 25  ? 24.722  -8.671  -22.905 1.00 37.90  ? 25   PRO B CG    1 
ATOM   2664 C  CD    . PRO D  3 25  ? 25.586  -7.818  -23.774 1.00 37.39  ? 25   PRO B CD    1 
ATOM   2665 N  N     . LEU D  3 26  ? 22.469  -4.538  -23.812 1.00 35.20  ? 26   LEU B N     1 
ATOM   2666 C  CA    . LEU D  3 26  ? 22.162  -3.164  -23.420 1.00 33.21  ? 26   LEU B CA    1 
ATOM   2667 C  C     . LEU D  3 26  ? 20.679  -3.053  -23.082 1.00 32.76  ? 26   LEU B C     1 
ATOM   2668 O  O     . LEU D  3 26  ? 19.862  -3.839  -23.579 1.00 32.55  ? 26   LEU B O     1 
ATOM   2669 C  CB    . LEU D  3 26  ? 22.479  -2.191  -24.556 1.00 32.26  ? 26   LEU B CB    1 
ATOM   2670 C  CG    . LEU D  3 26  ? 23.935  -1.867  -24.893 1.00 32.87  ? 26   LEU B CG    1 
ATOM   2671 C  CD1   . LEU D  3 26  ? 24.007  -0.601  -25.758 1.00 31.54  ? 26   LEU B CD1   1 
ATOM   2672 C  CD2   . LEU D  3 26  ? 24.790  -1.707  -23.622 1.00 32.16  ? 26   LEU B CD2   1 
ATOM   2673 N  N     . ARG D  3 27  ? 20.335  -2.079  -22.241 1.00 31.03  ? 27   ARG B N     1 
ATOM   2674 C  CA    . ARG D  3 27  ? 18.938  -1.799  -21.920 1.00 30.78  ? 27   ARG B CA    1 
ATOM   2675 C  C     . ARG D  3 27  ? 18.132  -1.565  -23.194 1.00 30.33  ? 27   ARG B C     1 
ATOM   2676 O  O     . ARG D  3 27  ? 16.978  -1.986  -23.291 1.00 29.71  ? 27   ARG B O     1 
ATOM   2677 C  CB    . ARG D  3 27  ? 18.825  -0.588  -20.992 1.00 31.55  ? 27   ARG B CB    1 
ATOM   2678 C  CG    . ARG D  3 27  ? 19.075  -0.908  -19.524 1.00 32.34  ? 27   ARG B CG    1 
ATOM   2679 C  CD    . ARG D  3 27  ? 19.532  0.320   -18.745 1.00 32.91  ? 27   ARG B CD    1 
ATOM   2680 N  NE    . ARG D  3 27  ? 20.884  0.721   -19.111 1.00 33.69  ? 27   ARG B NE    1 
ATOM   2681 C  CZ    . ARG D  3 27  ? 21.598  1.638   -18.464 1.00 34.48  ? 27   ARG B CZ    1 
ATOM   2682 N  NH1   . ARG D  3 27  ? 21.091  2.254   -17.406 1.00 34.01  ? 27   ARG B NH1   1 
ATOM   2683 N  NH2   . ARG D  3 27  ? 22.823  1.943   -18.877 1.00 34.84  ? 27   ARG B NH2   1 
ATOM   2684 N  N     . ALA D  3 28  ? 18.756  -0.923  -24.182 1.00 29.53  ? 28   ALA B N     1 
ATOM   2685 C  CA    . ALA D  3 28  ? 18.080  -0.626  -25.443 1.00 28.71  ? 28   ALA B CA    1 
ATOM   2686 C  C     . ALA D  3 28  ? 17.662  -1.900  -26.183 1.00 28.78  ? 28   ALA B C     1 
ATOM   2687 O  O     . ALA D  3 28  ? 16.699  -1.877  -26.961 1.00 27.50  ? 28   ALA B O     1 
ATOM   2688 C  CB    . ALA D  3 28  ? 18.946  0.251   -26.319 1.00 27.55  ? 28   ALA B CB    1 
ATOM   2689 N  N     . ARG D  3 29  ? 18.383  -2.998  -25.930 1.00 28.04  ? 29   ARG B N     1 
ATOM   2690 C  CA    . ARG D  3 29  ? 18.078  -4.307  -26.527 1.00 27.94  ? 29   ARG B CA    1 
ATOM   2691 C  C     . ARG D  3 29  ? 16.861  -4.908  -25.876 1.00 27.75  ? 29   ARG B C     1 
ATOM   2692 O  O     . ARG D  3 29  ? 16.026  -5.514  -26.543 1.00 28.74  ? 29   ARG B O     1 
ATOM   2693 C  CB    . ARG D  3 29  ? 19.219  -5.315  -26.326 1.00 27.90  ? 29   ARG B CB    1 
ATOM   2694 C  CG    . ARG D  3 29  ? 20.578  -4.888  -26.792 1.00 27.75  ? 29   ARG B CG    1 
ATOM   2695 C  CD    . ARG D  3 29  ? 20.665  -4.785  -28.297 1.00 29.73  ? 29   ARG B CD    1 
ATOM   2696 N  NE    . ARG D  3 29  ? 21.199  -3.466  -28.604 1.00 32.05  ? 29   ARG B NE    1 
ATOM   2697 C  CZ    . ARG D  3 29  ? 20.489  -2.492  -29.148 1.00 32.02  ? 29   ARG B CZ    1 
ATOM   2698 N  NH1   . ARG D  3 29  ? 19.237  -2.720  -29.514 1.00 32.27  ? 29   ARG B NH1   1 
ATOM   2699 N  NH2   . ARG D  3 29  ? 21.042  -1.308  -29.349 1.00 32.93  ? 29   ARG B NH2   1 
ATOM   2700 N  N     . ILE D  3 30  ? 16.780  -4.778  -24.555 1.00 28.57  ? 30   ILE B N     1 
ATOM   2701 C  CA    . ILE D  3 30  ? 15.634  -5.312  -23.833 1.00 27.29  ? 30   ILE B CA    1 
ATOM   2702 C  C     . ILE D  3 30  ? 14.382  -4.574  -24.267 1.00 26.78  ? 30   ILE B C     1 
ATOM   2703 O  O     . ILE D  3 30  ? 13.336  -5.182  -24.440 1.00 27.92  ? 30   ILE B O     1 
ATOM   2704 C  CB    . ILE D  3 30  ? 15.795  -5.203  -22.315 1.00 27.24  ? 30   ILE B CB    1 
ATOM   2705 C  CG1   . ILE D  3 30  ? 17.058  -5.935  -21.853 1.00 26.45  ? 30   ILE B CG1   1 
ATOM   2706 C  CG2   . ILE D  3 30  ? 14.567  -5.785  -21.619 1.00 28.01  ? 30   ILE B CG2   1 
ATOM   2707 C  CD1   . ILE D  3 30  ? 17.279  -5.888  -20.357 1.00 24.10  ? 30   ILE B CD1   1 
ATOM   2708 N  N     . ALA D  3 31  ? 14.503  -3.265  -24.469 1.00 26.70  ? 31   ALA B N     1 
ATOM   2709 C  CA    . ALA D  3 31  ? 13.381  -2.442  -24.922 1.00 27.60  ? 31   ALA B CA    1 
ATOM   2710 C  C     . ALA D  3 31  ? 12.829  -2.938  -26.251 1.00 28.92  ? 31   ALA B C     1 
ATOM   2711 O  O     . ALA D  3 31  ? 11.619  -3.059  -26.424 1.00 28.41  ? 31   ALA B O     1 
ATOM   2712 C  CB    . ALA D  3 31  ? 13.802  -0.979  -25.028 1.00 27.33  ? 31   ALA B CB    1 
ATOM   2713 N  N     . GLU D  3 32  ? 13.727  -3.242  -27.186 1.00 31.04  ? 32   GLU B N     1 
ATOM   2714 C  CA    . GLU D  3 32  ? 13.331  -3.801  -28.471 1.00 32.07  ? 32   GLU B CA    1 
ATOM   2715 C  C     . GLU D  3 32  ? 12.728  -5.178  -28.311 1.00 32.06  ? 32   GLU B C     1 
ATOM   2716 O  O     . GLU D  3 32  ? 11.604  -5.420  -28.733 1.00 32.42  ? 32   GLU B O     1 
ATOM   2717 C  CB    . GLU D  3 32  ? 14.528  -3.883  -29.407 1.00 33.34  ? 32   GLU B CB    1 
ATOM   2718 C  CG    . GLU D  3 32  ? 15.148  -2.540  -29.717 1.00 35.14  ? 32   GLU B CG    1 
ATOM   2719 C  CD    . GLU D  3 32  ? 16.472  -2.687  -30.415 1.00 36.60  ? 32   GLU B CD    1 
ATOM   2720 O  OE1   . GLU D  3 32  ? 16.812  -3.836  -30.783 1.00 37.18  ? 32   GLU B OE1   1 
ATOM   2721 O  OE2   . GLU D  3 32  ? 17.175  -1.666  -30.578 1.00 37.27  ? 32   GLU B OE2   1 
ATOM   2722 N  N     . ARG D  3 33  ? 13.487  -6.079  -27.698 1.00 33.16  ? 33   ARG B N     1 
ATOM   2723 C  CA    . ARG D  3 33  ? 13.057  -7.460  -27.529 1.00 33.96  ? 33   ARG B CA    1 
ATOM   2724 C  C     . ARG D  3 33  ? 11.728  -7.622  -26.791 1.00 34.12  ? 33   ARG B C     1 
ATOM   2725 O  O     . ARG D  3 33  ? 10.865  -8.375  -27.231 1.00 33.89  ? 33   ARG B O     1 
ATOM   2726 C  CB    . ARG D  3 33  ? 14.143  -8.260  -26.820 1.00 35.59  ? 33   ARG B CB    1 
ATOM   2727 C  CG    . ARG D  3 33  ? 15.352  -8.510  -27.680 1.00 36.96  ? 33   ARG B CG    1 
ATOM   2728 C  CD    . ARG D  3 33  ? 14.986  -9.380  -28.873 1.00 38.54  ? 33   ARG B CD    1 
ATOM   2729 N  NE    . ARG D  3 33  ? 16.117  -9.504  -29.776 1.00 39.92  ? 33   ARG B NE    1 
ATOM   2730 C  CZ    . ARG D  3 33  ? 17.088  -10.398 -29.640 1.00 40.53  ? 33   ARG B CZ    1 
ATOM   2731 N  NH1   . ARG D  3 33  ? 17.059  -11.275 -28.640 1.00 40.89  ? 33   ARG B NH1   1 
ATOM   2732 N  NH2   . ARG D  3 33  ? 18.085  -10.416 -30.513 1.00 40.68  ? 33   ARG B NH2   1 
ATOM   2733 N  N     . LEU D  3 34  ? 11.564  -6.928  -25.667 1.00 33.35  ? 34   LEU B N     1 
ATOM   2734 C  CA    . LEU D  3 34  ? 10.359  -7.093  -24.860 1.00 32.78  ? 34   LEU B CA    1 
ATOM   2735 C  C     . LEU D  3 34  ? 9.302   -6.044  -25.210 1.00 33.95  ? 34   LEU B C     1 
ATOM   2736 O  O     . LEU D  3 34  ? 8.214   -6.023  -24.617 1.00 33.07  ? 34   LEU B O     1 
ATOM   2737 C  CB    . LEU D  3 34  ? 10.701  -7.074  -23.364 1.00 32.21  ? 34   LEU B CB    1 
ATOM   2738 C  CG    . LEU D  3 34  ? 11.582  -8.247  -22.903 1.00 31.85  ? 34   LEU B CG    1 
ATOM   2739 C  CD1   . LEU D  3 34  ? 11.907  -8.171  -21.419 1.00 31.46  ? 34   LEU B CD1   1 
ATOM   2740 C  CD2   . LEU D  3 34  ? 10.916  -9.572  -23.233 1.00 30.69  ? 34   LEU B CD2   1 
ATOM   2741 N  N     . ASP D  3 35  ? 9.628   -5.194  -26.186 1.00 33.20  ? 35   ASP B N     1 
ATOM   2742 C  CA    . ASP D  3 35  ? 8.755   -4.102  -26.614 1.00 33.43  ? 35   ASP B CA    1 
ATOM   2743 C  C     . ASP D  3 35  ? 8.283   -3.234  -25.452 1.00 32.22  ? 35   ASP B C     1 
ATOM   2744 O  O     . ASP D  3 35  ? 7.094   -3.163  -25.169 1.00 33.37  ? 35   ASP B O     1 
ATOM   2745 C  CB    . ASP D  3 35  ? 7.540   -4.624  -27.380 1.00 34.78  ? 35   ASP B CB    1 
ATOM   2746 C  CG    . ASP D  3 35  ? 6.827   -3.520  -28.151 1.00 37.10  ? 35   ASP B CG    1 
ATOM   2747 O  OD1   . ASP D  3 35  ? 5.611   -3.654  -28.402 1.00 38.62  ? 35   ASP B OD1   1 
ATOM   2748 O  OD2   . ASP D  3 35  ? 7.481   -2.510  -28.505 1.00 38.31  ? 35   ASP B OD2   1 
ATOM   2749 N  N     . GLN D  3 36  ? 9.222   -2.585  -24.781 1.00 30.57  ? 36   GLN B N     1 
ATOM   2750 C  CA    . GLN D  3 36  ? 8.915   -1.693  -23.680 1.00 29.04  ? 36   GLN B CA    1 
ATOM   2751 C  C     . GLN D  3 36  ? 9.694   -0.411  -23.897 1.00 29.55  ? 36   GLN B C     1 
ATOM   2752 O  O     . GLN D  3 36  ? 10.578  -0.349  -24.750 1.00 30.39  ? 36   GLN B O     1 
ATOM   2753 C  CB    . GLN D  3 36  ? 9.276   -2.328  -22.337 1.00 27.60  ? 36   GLN B CB    1 
ATOM   2754 C  CG    . GLN D  3 36  ? 8.269   -3.373  -21.874 1.00 26.48  ? 36   GLN B CG    1 
ATOM   2755 C  CD    . GLN D  3 36  ? 8.704   -4.074  -20.607 1.00 26.45  ? 36   GLN B CD    1 
ATOM   2756 O  OE1   . GLN D  3 36  ? 9.809   -3.845  -20.105 1.00 27.73  ? 36   GLN B OE1   1 
ATOM   2757 N  NE2   . GLN D  3 36  ? 7.839   -4.928  -20.075 1.00 23.43  ? 36   GLN B NE2   1 
ATOM   2758 N  N     . SER D  3 37  ? 9.359   0.620   -23.145 1.00 27.92  ? 37   SER B N     1 
ATOM   2759 C  CA    . SER D  3 37  ? 9.989   1.899   -23.350 1.00 27.57  ? 37   SER B CA    1 
ATOM   2760 C  C     . SER D  3 37  ? 11.322  1.912   -22.621 1.00 27.26  ? 37   SER B C     1 
ATOM   2761 O  O     . SER D  3 37  ? 11.532  1.124   -21.690 1.00 26.29  ? 37   SER B O     1 
ATOM   2762 C  CB    . SER D  3 37  ? 9.077   3.022   -22.836 1.00 28.11  ? 37   SER B CB    1 
ATOM   2763 O  OG    . SER D  3 37  ? 8.724   2.813   -21.476 1.00 27.24  ? 37   SER B OG    1 
ATOM   2764 N  N     . GLY D  3 38  ? 12.213  2.801   -23.048 1.00 25.38  ? 38   GLY B N     1 
ATOM   2765 C  CA    . GLY D  3 38  ? 13.465  3.039   -22.338 1.00 27.94  ? 38   GLY B CA    1 
ATOM   2766 C  C     . GLY D  3 38  ? 13.296  3.347   -20.852 1.00 29.02  ? 38   GLY B C     1 
ATOM   2767 O  O     . GLY D  3 38  ? 13.920  2.701   -20.011 1.00 29.80  ? 38   GLY B O     1 
ATOM   2768 N  N     . PRO D  3 39  ? 12.469  4.357   -20.516 1.00 29.60  ? 39   PRO B N     1 
ATOM   2769 C  CA    . PRO D  3 39  ? 12.257  4.657   -19.098 1.00 29.49  ? 39   PRO B CA    1 
ATOM   2770 C  C     . PRO D  3 39  ? 11.819  3.434   -18.300 1.00 29.63  ? 39   PRO B C     1 
ATOM   2771 O  O     . PRO D  3 39  ? 12.279  3.235   -17.175 1.00 31.87  ? 39   PRO B O     1 
ATOM   2772 C  CB    . PRO D  3 39  ? 11.151  5.734   -19.117 1.00 29.48  ? 39   PRO B CB    1 
ATOM   2773 C  CG    . PRO D  3 39  ? 11.261  6.367   -20.489 1.00 28.93  ? 39   PRO B CG    1 
ATOM   2774 C  CD    . PRO D  3 39  ? 11.730  5.281   -21.408 1.00 28.99  ? 39   PRO B CD    1 
ATOM   2775 N  N     . THR D  3 40  ? 10.952  2.608   -18.865 1.00 29.20  ? 40   THR B N     1 
ATOM   2776 C  CA    . THR D  3 40  ? 10.523  1.414   -18.148 1.00 29.07  ? 40   THR B CA    1 
ATOM   2777 C  C     . THR D  3 40  ? 11.668  0.448   -17.922 1.00 29.23  ? 40   THR B C     1 
ATOM   2778 O  O     . THR D  3 40  ? 11.801  -0.126  -16.834 1.00 31.04  ? 40   THR B O     1 
ATOM   2779 C  CB    . THR D  3 40  ? 9.429   0.659   -18.887 1.00 28.22  ? 40   THR B CB    1 
ATOM   2780 O  OG1   . THR D  3 40  ? 8.304   1.517   -19.050 1.00 28.09  ? 40   THR B OG1   1 
ATOM   2781 C  CG2   . THR D  3 40  ? 9.010   -0.557  -18.085 1.00 28.43  ? 40   THR B CG2   1 
ATOM   2782 N  N     . VAL D  3 41  ? 12.488  0.264   -18.953 1.00 28.91  ? 41   VAL B N     1 
ATOM   2783 C  CA    . VAL D  3 41  ? 13.550  -0.733  -18.907 1.00 28.38  ? 41   VAL B CA    1 
ATOM   2784 C  C     . VAL D  3 41  ? 14.633  -0.315  -17.926 1.00 28.70  ? 41   VAL B C     1 
ATOM   2785 O  O     . VAL D  3 41  ? 15.105  -1.132  -17.135 1.00 29.67  ? 41   VAL B O     1 
ATOM   2786 C  CB    . VAL D  3 41  ? 14.145  -1.044  -20.303 1.00 27.73  ? 41   VAL B CB    1 
ATOM   2787 C  CG1   . VAL D  3 41  ? 15.404  -1.913  -20.158 1.00 28.13  ? 41   VAL B CG1   1 
ATOM   2788 C  CG2   . VAL D  3 41  ? 13.110  -1.747  -21.187 1.00 26.10  ? 41   VAL B CG2   1 
ATOM   2789 N  N     . SER D  3 42  ? 15.010  0.958   -17.944 1.00 28.25  ? 42   SER B N     1 
ATOM   2790 C  CA    . SER D  3 42  ? 16.001  1.414   -16.978 1.00 28.73  ? 42   SER B CA    1 
ATOM   2791 C  C     . SER D  3 42  ? 15.475  1.311   -15.554 1.00 28.60  ? 42   SER B C     1 
ATOM   2792 O  O     . SER D  3 42  ? 16.225  0.987   -14.637 1.00 29.42  ? 42   SER B O     1 
ATOM   2793 C  CB    . SER D  3 42  ? 16.471  2.831   -17.274 1.00 27.31  ? 42   SER B CB    1 
ATOM   2794 O  OG    . SER D  3 42  ? 17.198  2.851   -18.492 1.00 28.27  ? 42   SER B OG    1 
ATOM   2795 N  N     . GLN D  3 43  ? 14.183  1.557   -15.375 1.00 27.61  ? 43   GLN B N     1 
ATOM   2796 C  CA    . GLN D  3 43  ? 13.615  1.528   -14.044 1.00 27.63  ? 43   GLN B CA    1 
ATOM   2797 C  C     . GLN D  3 43  ? 13.670  0.119   -13.480 1.00 26.64  ? 43   GLN B C     1 
ATOM   2798 O  O     . GLN D  3 43  ? 14.086  -0.077  -12.340 1.00 25.04  ? 43   GLN B O     1 
ATOM   2799 C  CB    . GLN D  3 43  ? 12.177  2.070   -14.025 1.00 29.28  ? 43   GLN B CB    1 
ATOM   2800 C  CG    . GLN D  3 43  ? 11.620  2.231   -12.610 1.00 31.13  ? 43   GLN B CG    1 
ATOM   2801 C  CD    . GLN D  3 43  ? 10.238  2.872   -12.560 1.00 31.82  ? 43   GLN B CD    1 
ATOM   2802 O  OE1   . GLN D  3 43  ? 9.320   2.494   -13.295 1.00 31.56  ? 43   GLN B OE1   1 
ATOM   2803 N  NE2   . GLN D  3 43  ? 10.084  3.839   -11.667 1.00 32.21  ? 43   GLN B NE2   1 
ATOM   2804 N  N     . THR D  3 44  ? 13.255  -0.856  -14.287 1.00 26.45  ? 44   THR B N     1 
ATOM   2805 C  CA    . THR D  3 44  ? 13.234  -2.246  -13.856 1.00 25.60  ? 44   THR B CA    1 
ATOM   2806 C  C     . THR D  3 44  ? 14.649  -2.745  -13.616 1.00 26.96  ? 44   THR B C     1 
ATOM   2807 O  O     . THR D  3 44  ? 14.933  -3.395  -12.608 1.00 28.07  ? 44   THR B O     1 
ATOM   2808 C  CB    . THR D  3 44  ? 12.533  -3.144  -14.877 1.00 25.86  ? 44   THR B CB    1 
ATOM   2809 O  OG1   . THR D  3 44  ? 11.125  -2.855  -14.882 1.00 24.52  ? 44   THR B OG1   1 
ATOM   2810 C  CG2   . THR D  3 44  ? 12.750  -4.609  -14.527 1.00 24.81  ? 44   THR B CG2   1 
ATOM   2811 N  N     . VAL D  3 45  ? 15.543  -2.406  -14.535 1.00 27.81  ? 45   VAL B N     1 
ATOM   2812 C  CA    . VAL D  3 45  ? 16.947  -2.770  -14.413 1.00 27.54  ? 45   VAL B CA    1 
ATOM   2813 C  C     . VAL D  3 45  ? 17.561  -2.222  -13.134 1.00 27.69  ? 45   VAL B C     1 
ATOM   2814 O  O     . VAL D  3 45  ? 18.378  -2.890  -12.504 1.00 29.02  ? 45   VAL B O     1 
ATOM   2815 C  CB    . VAL D  3 45  ? 17.734  -2.331  -15.660 1.00 26.98  ? 45   VAL B CB    1 
ATOM   2816 C  CG1   . VAL D  3 45  ? 19.224  -2.227  -15.367 1.00 26.50  ? 45   VAL B CG1   1 
ATOM   2817 C  CG2   . VAL D  3 45  ? 17.452  -3.291  -16.802 1.00 25.45  ? 45   VAL B CG2   1 
ATOM   2818 N  N     . SER D  3 46  ? 17.152  -1.020  -12.740 1.00 29.16  ? 46   SER B N     1 
ATOM   2819 C  CA    . SER D  3 46  ? 17.561  -0.431  -11.453 1.00 30.34  ? 46   SER B CA    1 
ATOM   2820 C  C     . SER D  3 46  ? 17.110  -1.280  -10.278 1.00 29.83  ? 46   SER B C     1 
ATOM   2821 O  O     . SER D  3 46  ? 17.871  -1.507  -9.344  1.00 31.89  ? 46   SER B O     1 
ATOM   2822 C  CB    . SER D  3 46  ? 16.969  0.975   -11.272 1.00 32.25  ? 46   SER B CB    1 
ATOM   2823 O  OG    . SER D  3 46  ? 17.608  1.914   -12.110 1.00 35.29  ? 46   SER B OG    1 
ATOM   2824 N  N     . ARG D  3 47  ? 15.862  -1.730  -10.302 1.00 28.87  ? 47   ARG B N     1 
ATOM   2825 C  CA    . ARG D  3 47  ? 15.388  -2.585  -9.229  1.00 29.68  ? 47   ARG B CA    1 
ATOM   2826 C  C     . ARG D  3 47  ? 16.229  -3.849  -9.136  1.00 29.53  ? 47   ARG B C     1 
ATOM   2827 O  O     . ARG D  3 47  ? 16.586  -4.285  -8.043  1.00 28.99  ? 47   ARG B O     1 
ATOM   2828 C  CB    . ARG D  3 47  ? 13.925  -2.955  -9.425  1.00 29.28  ? 47   ARG B CB    1 
ATOM   2829 C  CG    . ARG D  3 47  ? 12.971  -1.911  -8.935  1.00 30.68  ? 47   ARG B CG    1 
ATOM   2830 C  CD    . ARG D  3 47  ? 11.578  -2.492  -8.804  1.00 30.32  ? 47   ARG B CD    1 
ATOM   2831 N  NE    . ARG D  3 47  ? 11.135  -3.156  -10.026 1.00 29.71  ? 47   ARG B NE    1 
ATOM   2832 C  CZ    . ARG D  3 47  ? 10.621  -2.532  -11.087 1.00 29.31  ? 47   ARG B CZ    1 
ATOM   2833 N  NH1   . ARG D  3 47  ? 10.502  -1.214  -11.102 1.00 27.89  ? 47   ARG B NH1   1 
ATOM   2834 N  NH2   . ARG D  3 47  ? 10.236  -3.236  -12.147 1.00 29.45  ? 47   ARG B NH2   1 
ATOM   2835 N  N     . MET D  3 48  ? 16.526  -4.431  -10.295 1.00 30.18  ? 48   MET B N     1 
ATOM   2836 C  CA    . MET D  3 48  ? 17.250  -5.689  -10.379 1.00 30.64  ? 48   MET B CA    1 
ATOM   2837 C  C     . MET D  3 48  ? 18.693  -5.533  -9.940  1.00 31.73  ? 48   MET B C     1 
ATOM   2838 O  O     . MET D  3 48  ? 19.262  -6.452  -9.360  1.00 32.07  ? 48   MET B O     1 
ATOM   2839 C  CB    . MET D  3 48  ? 17.197  -6.231  -11.803 1.00 30.77  ? 48   MET B CB    1 
ATOM   2840 C  CG    . MET D  3 48  ? 15.813  -6.643  -12.252 1.00 31.09  ? 48   MET B CG    1 
ATOM   2841 S  SD    . MET D  3 48  ? 15.755  -7.086  -14.001 1.00 32.72  ? 48   MET B SD    1 
ATOM   2842 C  CE    . MET D  3 48  ? 16.791  -8.551  -13.981 1.00 32.14  ? 48   MET B CE    1 
ATOM   2843 N  N     . GLU D  3 49  ? 19.288  -4.380  -10.240 1.00 33.75  ? 49   GLU B N     1 
ATOM   2844 C  CA    . GLU D  3 49  ? 20.621  -4.054  -9.748  1.00 35.62  ? 49   GLU B CA    1 
ATOM   2845 C  C     . GLU D  3 49  ? 20.572  -3.901  -8.229  1.00 36.35  ? 49   GLU B C     1 
ATOM   2846 O  O     . GLU D  3 49  ? 21.428  -4.427  -7.516  1.00 37.40  ? 49   GLU B O     1 
ATOM   2847 C  CB    . GLU D  3 49  ? 21.157  -2.778  -10.412 1.00 37.33  ? 49   GLU B CB    1 
ATOM   2848 C  CG    . GLU D  3 49  ? 22.446  -2.253  -9.783  1.00 40.77  ? 49   GLU B CG    1 
ATOM   2849 C  CD    . GLU D  3 49  ? 23.337  -1.469  -10.755 1.00 42.89  ? 49   GLU B CD    1 
ATOM   2850 O  OE1   . GLU D  3 49  ? 24.584  -1.604  -10.671 1.00 43.72  ? 49   GLU B OE1   1 
ATOM   2851 O  OE2   . GLU D  3 49  ? 22.804  -0.719  -11.604 1.00 44.32  ? 49   GLU B OE2   1 
ATOM   2852 N  N     . ARG D  3 50  ? 19.550  -3.198  -7.741  1.00 36.57  ? 50   ARG B N     1 
ATOM   2853 C  CA    . ARG D  3 50  ? 19.320  -3.034  -6.305  1.00 36.30  ? 50   ARG B CA    1 
ATOM   2854 C  C     . ARG D  3 50  ? 19.189  -4.375  -5.606  1.00 35.79  ? 50   ARG B C     1 
ATOM   2855 O  O     . ARG D  3 50  ? 19.644  -4.534  -4.473  1.00 35.80  ? 50   ARG B O     1 
ATOM   2856 C  CB    . ARG D  3 50  ? 18.055  -2.208  -6.052  1.00 37.53  ? 50   ARG B CB    1 
ATOM   2857 C  CG    . ARG D  3 50  ? 17.765  -1.916  -4.573  1.00 38.00  ? 50   ARG B CG    1 
ATOM   2858 C  CD    . ARG D  3 50  ? 16.303  -1.533  -4.354  1.00 37.95  ? 50   ARG B CD    1 
ATOM   2859 N  NE    . ARG D  3 50  ? 15.417  -2.683  -4.527  1.00 39.59  ? 50   ARG B NE    1 
ATOM   2860 C  CZ    . ARG D  3 50  ? 14.128  -2.609  -4.857  1.00 39.70  ? 50   ARG B CZ    1 
ATOM   2861 N  NH1   . ARG D  3 50  ? 13.549  -1.436  -5.070  1.00 39.66  ? 50   ARG B NH1   1 
ATOM   2862 N  NH2   . ARG D  3 50  ? 13.417  -3.719  -4.990  1.00 40.00  ? 50   ARG B NH2   1 
ATOM   2863 N  N     . ASP D  3 51  ? 18.570  -5.337  -6.290  1.00 35.07  ? 51   ASP B N     1 
ATOM   2864 C  CA    . ASP D  3 51  ? 18.268  -6.645  -5.704  1.00 34.70  ? 51   ASP B CA    1 
ATOM   2865 C  C     . ASP D  3 51  ? 19.397  -7.677  -5.870  1.00 33.58  ? 51   ASP B C     1 
ATOM   2866 O  O     . ASP D  3 51  ? 19.234  -8.845  -5.512  1.00 32.58  ? 51   ASP B O     1 
ATOM   2867 C  CB    . ASP D  3 51  ? 16.971  -7.200  -6.293  1.00 35.37  ? 51   ASP B CB    1 
ATOM   2868 C  CG    . ASP D  3 51  ? 15.738  -6.474  -5.786  1.00 37.39  ? 51   ASP B CG    1 
ATOM   2869 O  OD1   . ASP D  3 51  ? 15.761  -5.955  -4.644  1.00 37.28  ? 51   ASP B OD1   1 
ATOM   2870 O  OD2   . ASP D  3 51  ? 14.730  -6.435  -6.532  1.00 38.62  ? 51   ASP B OD2   1 
ATOM   2871 N  N     . GLY D  3 52  ? 20.525  -7.244  -6.425  1.00 31.74  ? 52   GLY B N     1 
ATOM   2872 C  CA    . GLY D  3 52  ? 21.688  -8.102  -6.584  1.00 31.20  ? 52   GLY B CA    1 
ATOM   2873 C  C     . GLY D  3 52  ? 21.661  -9.031  -7.788  1.00 31.09  ? 52   GLY B C     1 
ATOM   2874 O  O     . GLY D  3 52  ? 22.395  -10.019 -7.831  1.00 30.24  ? 52   GLY B O     1 
ATOM   2875 N  N     . LEU D  3 53  ? 20.823  -8.720  -8.773  1.00 30.03  ? 53   LEU B N     1 
ATOM   2876 C  CA    . LEU D  3 53  ? 20.644  -9.623  -9.901  1.00 29.12  ? 53   LEU B CA    1 
ATOM   2877 C  C     . LEU D  3 53  ? 21.519  -9.286  -11.106 1.00 29.18  ? 53   LEU B C     1 
ATOM   2878 O  O     . LEU D  3 53  ? 21.775  -10.135 -11.945 1.00 30.91  ? 53   LEU B O     1 
ATOM   2879 C  CB    . LEU D  3 53  ? 19.173  -9.690  -10.308 1.00 28.25  ? 53   LEU B CB    1 
ATOM   2880 C  CG    . LEU D  3 53  ? 18.249  -10.411 -9.330  1.00 27.72  ? 53   LEU B CG    1 
ATOM   2881 C  CD1   . LEU D  3 53  ? 16.806  -10.233 -9.747  1.00 27.34  ? 53   LEU B CD1   1 
ATOM   2882 C  CD2   . LEU D  3 53  ? 18.602  -11.886 -9.232  1.00 28.02  ? 53   LEU B CD2   1 
ATOM   2883 N  N     . LEU D  3 54  ? 21.971  -8.047  -11.195 1.00 30.52  ? 54   LEU B N     1 
ATOM   2884 C  CA    . LEU D  3 54  ? 22.827  -7.635  -12.292 1.00 32.12  ? 54   LEU B CA    1 
ATOM   2885 C  C     . LEU D  3 54  ? 23.552  -6.367  -11.914 1.00 32.59  ? 54   LEU B C     1 
ATOM   2886 O  O     . LEU D  3 54  ? 23.334  -5.828  -10.831 1.00 33.26  ? 54   LEU B O     1 
ATOM   2887 C  CB    . LEU D  3 54  ? 22.026  -7.447  -13.596 1.00 32.06  ? 54   LEU B CB    1 
ATOM   2888 C  CG    . LEU D  3 54  ? 20.720  -6.640  -13.603 1.00 32.24  ? 54   LEU B CG    1 
ATOM   2889 C  CD1   . LEU D  3 54  ? 20.996  -5.157  -13.436 1.00 32.07  ? 54   LEU B CD1   1 
ATOM   2890 C  CD2   . LEU D  3 54  ? 19.928  -6.882  -14.883 1.00 30.82  ? 54   LEU B CD2   1 
ATOM   2891 N  N     . ARG D  3 55  ? 24.437  -5.920  -12.799 1.00 35.20  ? 55   ARG B N     1 
ATOM   2892 C  CA    . ARG D  3 55  ? 25.141  -4.646  -12.667 1.00 37.73  ? 55   ARG B CA    1 
ATOM   2893 C  C     . ARG D  3 55  ? 25.049  -3.909  -13.989 1.00 38.19  ? 55   ARG B C     1 
ATOM   2894 O  O     . ARG D  3 55  ? 25.091  -4.527  -15.052 1.00 37.95  ? 55   ARG B O     1 
ATOM   2895 C  CB    . ARG D  3 55  ? 26.619  -4.874  -12.363 1.00 40.21  ? 55   ARG B CB    1 
ATOM   2896 C  CG    . ARG D  3 55  ? 26.953  -5.154  -10.915 1.00 44.37  ? 55   ARG B CG    1 
ATOM   2897 C  CD    . ARG D  3 55  ? 28.079  -6.185  -10.827 1.00 48.43  ? 55   ARG B CD    1 
ATOM   2898 N  NE    . ARG D  3 55  ? 29.355  -5.714  -11.379 1.00 51.76  ? 55   ARG B NE    1 
ATOM   2899 C  CZ    . ARG D  3 55  ? 30.375  -6.511  -11.705 1.00 52.97  ? 55   ARG B CZ    1 
ATOM   2900 N  NH1   . ARG D  3 55  ? 30.272  -7.827  -11.556 1.00 53.67  ? 55   ARG B NH1   1 
ATOM   2901 N  NH2   . ARG D  3 55  ? 31.500  -5.995  -12.189 1.00 53.75  ? 55   ARG B NH2   1 
ATOM   2902 N  N     . VAL D  3 56  ? 24.917  -2.592  -13.938 1.00 38.93  ? 56   VAL B N     1 
ATOM   2903 C  CA    . VAL D  3 56  ? 25.141  -1.810  -15.145 1.00 40.14  ? 56   VAL B CA    1 
ATOM   2904 C  C     . VAL D  3 56  ? 26.616  -1.424  -15.146 1.00 41.32  ? 56   VAL B C     1 
ATOM   2905 O  O     . VAL D  3 56  ? 27.048  -0.580  -14.361 1.00 41.32  ? 56   VAL B O     1 
ATOM   2906 C  CB    . VAL D  3 56  ? 24.262  -0.549  -15.221 1.00 39.44  ? 56   VAL B CB    1 
ATOM   2907 C  CG1   . VAL D  3 56  ? 24.567  0.217   -16.495 1.00 39.08  ? 56   VAL B CG1   1 
ATOM   2908 C  CG2   . VAL D  3 56  ? 22.786  -0.917  -15.154 1.00 38.86  ? 56   VAL B CG2   1 
ATOM   2909 N  N     . ALA D  3 57  ? 27.386  -2.071  -16.015 1.00 42.90  ? 57   ALA B N     1 
ATOM   2910 C  CA    . ALA D  3 57  ? 28.831  -1.906  -16.035 1.00 44.26  ? 57   ALA B CA    1 
ATOM   2911 C  C     . ALA D  3 57  ? 29.221  -0.506  -16.471 1.00 44.90  ? 57   ALA B C     1 
ATOM   2912 O  O     . ALA D  3 57  ? 28.403  0.231   -17.024 1.00 45.43  ? 57   ALA B O     1 
ATOM   2913 C  CB    . ALA D  3 57  ? 29.472  -2.944  -16.943 1.00 43.87  ? 57   ALA B CB    1 
ATOM   2914 N  N     . GLY D  3 58  ? 30.479  -0.155  -16.217 1.00 46.29  ? 58   GLY B N     1 
ATOM   2915 C  CA    . GLY D  3 58  ? 31.013  1.160   -16.553 1.00 47.42  ? 58   GLY B CA    1 
ATOM   2916 C  C     . GLY D  3 58  ? 30.756  1.560   -17.989 1.00 48.51  ? 58   GLY B C     1 
ATOM   2917 O  O     . GLY D  3 58  ? 30.440  2.716   -18.266 1.00 48.79  ? 58   GLY B O     1 
ATOM   2918 N  N     . ASP D  3 59  ? 30.884  0.605   -18.908 1.00 49.50  ? 59   ASP B N     1 
ATOM   2919 C  CA    . ASP D  3 59  ? 30.610  0.870   -20.320 1.00 49.79  ? 59   ASP B CA    1 
ATOM   2920 C  C     . ASP D  3 59  ? 29.180  0.507   -20.722 1.00 49.26  ? 59   ASP B C     1 
ATOM   2921 O  O     . ASP D  3 59  ? 28.893  0.300   -21.904 1.00 49.80  ? 59   ASP B O     1 
ATOM   2922 C  CB    . ASP D  3 59  ? 31.626  0.171   -21.228 1.00 50.72  ? 59   ASP B CB    1 
ATOM   2923 C  CG    . ASP D  3 59  ? 31.627  -1.337  -21.060 1.00 51.57  ? 59   ASP B CG    1 
ATOM   2924 O  OD1   . ASP D  3 59  ? 32.276  -2.009  -21.892 1.00 51.49  ? 59   ASP B OD1   1 
ATOM   2925 O  OD2   . ASP D  3 59  ? 30.984  -1.846  -20.107 1.00 51.64  ? 59   ASP B OD2   1 
ATOM   2926 N  N     . ARG D  3 60  ? 28.294  0.420   -19.733 1.00 47.81  ? 60   ARG B N     1 
ATOM   2927 C  CA    . ARG D  3 60  ? 26.851  0.332   -19.982 1.00 46.79  ? 60   ARG B CA    1 
ATOM   2928 C  C     . ARG D  3 60  ? 26.289  -1.072  -20.201 1.00 44.91  ? 60   ARG B C     1 
ATOM   2929 O  O     . ARG D  3 60  ? 25.070  -1.250  -20.182 1.00 43.19  ? 60   ARG B O     1 
ATOM   2930 C  CB    . ARG D  3 60  ? 26.437  1.242   -21.146 1.00 47.91  ? 60   ARG B CB    1 
ATOM   2931 C  CG    . ARG D  3 60  ? 26.572  2.725   -20.850 1.00 50.16  ? 60   ARG B CG    1 
ATOM   2932 C  CD    . ARG D  3 60  ? 25.891  3.587   -21.905 1.00 51.19  ? 60   ARG B CD    1 
ATOM   2933 N  NE    . ARG D  3 60  ? 26.356  3.276   -23.251 1.00 52.51  ? 60   ARG B NE    1 
ATOM   2934 C  CZ    . ARG D  3 60  ? 26.170  4.062   -24.309 1.00 53.35  ? 60   ARG B CZ    1 
ATOM   2935 N  NH1   . ARG D  3 60  ? 26.627  3.685   -25.497 1.00 53.69  ? 60   ARG B NH1   1 
ATOM   2936 N  NH2   . ARG D  3 60  ? 25.528  5.222   -24.181 1.00 52.83  ? 60   ARG B NH2   1 
ATOM   2937 N  N     . HIS D  3 61  ? 27.161  -2.057  -20.420 1.00 43.99  ? 61   HIS B N     1 
ATOM   2938 C  CA    . HIS D  3 61  ? 26.712  -3.437  -20.608 1.00 42.90  ? 61   HIS B CA    1 
ATOM   2939 C  C     . HIS D  3 61  ? 26.060  -3.931  -19.326 1.00 42.15  ? 61   HIS B C     1 
ATOM   2940 O  O     . HIS D  3 61  ? 26.372  -3.450  -18.237 1.00 41.65  ? 61   HIS B O     1 
ATOM   2941 C  CB    . HIS D  3 61  ? 27.863  -4.384  -20.985 1.00 43.89  ? 61   HIS B CB    1 
ATOM   2942 C  CG    . HIS D  3 61  ? 28.688  -3.924  -22.150 1.00 44.69  ? 61   HIS B CG    1 
ATOM   2943 N  ND1   . HIS D  3 61  ? 30.000  -4.313  -22.328 1.00 46.01  ? 61   HIS B ND1   1 
ATOM   2944 C  CD2   . HIS D  3 61  ? 28.399  -3.094  -23.180 1.00 44.20  ? 61   HIS B CD2   1 
ATOM   2945 C  CE1   . HIS D  3 61  ? 30.477  -3.752  -23.425 1.00 44.93  ? 61   HIS B CE1   1 
ATOM   2946 N  NE2   . HIS D  3 61  ? 29.526  -3.007  -23.959 1.00 44.65  ? 61   HIS B NE2   1 
ATOM   2947 N  N     . LEU D  3 62  ? 25.153  -4.890  -19.461 1.00 40.71  ? 62   LEU B N     1 
ATOM   2948 C  CA    . LEU D  3 62  ? 24.485  -5.477  -18.317 1.00 41.09  ? 62   LEU B CA    1 
ATOM   2949 C  C     . LEU D  3 62  ? 25.087  -6.848  -17.986 1.00 41.64  ? 62   LEU B C     1 
ATOM   2950 O  O     . LEU D  3 62  ? 24.800  -7.845  -18.652 1.00 42.03  ? 62   LEU B O     1 
ATOM   2951 C  CB    . LEU D  3 62  ? 22.983  -5.601  -18.591 1.00 40.11  ? 62   LEU B CB    1 
ATOM   2952 C  CG    . LEU D  3 62  ? 22.252  -4.380  -19.163 1.00 39.95  ? 62   LEU B CG    1 
ATOM   2953 C  CD1   . LEU D  3 62  ? 20.783  -4.691  -19.338 1.00 39.09  ? 62   LEU B CD1   1 
ATOM   2954 C  CD2   . LEU D  3 62  ? 22.434  -3.143  -18.289 1.00 39.59  ? 62   LEU B CD2   1 
ATOM   2955 N  N     . GLU D  3 63  ? 25.935  -6.893  -16.967 1.00 41.84  ? 63   GLU B N     1 
ATOM   2956 C  CA    . GLU D  3 63  ? 26.546  -8.148  -16.562 1.00 42.17  ? 63   GLU B CA    1 
ATOM   2957 C  C     . GLU D  3 63  ? 25.681  -8.768  -15.484 1.00 39.87  ? 63   GLU B C     1 
ATOM   2958 O  O     . GLU D  3 63  ? 25.395  -8.128  -14.485 1.00 39.67  ? 63   GLU B O     1 
ATOM   2959 C  CB    . GLU D  3 63  ? 27.983  -7.917  -16.061 1.00 45.56  ? 63   GLU B CB    1 
ATOM   2960 C  CG    . GLU D  3 63  ? 28.692  -9.135  -15.409 1.00 49.82  ? 63   GLU B CG    1 
ATOM   2961 C  CD    . GLU D  3 63  ? 29.230  -10.187 -16.409 1.00 52.53  ? 63   GLU B CD    1 
ATOM   2962 O  OE1   . GLU D  3 63  ? 28.555  -10.460 -17.435 1.00 53.59  ? 63   GLU B OE1   1 
ATOM   2963 O  OE2   . GLU D  3 63  ? 30.322  -10.766 -16.147 1.00 52.46  ? 63   GLU B OE2   1 
ATOM   2964 N  N     . LEU D  3 64  ? 25.232  -9.999  -15.703 1.00 37.33  ? 64   LEU B N     1 
ATOM   2965 C  CA    . LEU D  3 64  ? 24.522  -10.736 -14.664 1.00 35.71  ? 64   LEU B CA    1 
ATOM   2966 C  C     . LEU D  3 64  ? 25.469  -11.066 -13.514 1.00 35.13  ? 64   LEU B C     1 
ATOM   2967 O  O     . LEU D  3 64  ? 26.619  -11.446 -13.739 1.00 36.52  ? 64   LEU B O     1 
ATOM   2968 C  CB    . LEU D  3 64  ? 23.943  -12.038 -15.220 1.00 34.35  ? 64   LEU B CB    1 
ATOM   2969 C  CG    . LEU D  3 64  ? 22.970  -11.904 -16.381 1.00 33.81  ? 64   LEU B CG    1 
ATOM   2970 C  CD1   . LEU D  3 64  ? 22.471  -13.259 -16.794 1.00 32.79  ? 64   LEU B CD1   1 
ATOM   2971 C  CD2   . LEU D  3 64  ? 21.820  -10.987 -15.990 1.00 33.12  ? 64   LEU B CD2   1 
ATOM   2972 N  N     . THR D  3 65  ? 24.990  -10.919 -12.285 1.00 33.25  ? 65   THR B N     1 
ATOM   2973 C  CA    . THR D  3 65  ? 25.741  -11.381 -11.137 1.00 31.45  ? 65   THR B CA    1 
ATOM   2974 C  C     . THR D  3 65  ? 25.634  -12.901 -11.096 1.00 32.21  ? 65   THR B C     1 
ATOM   2975 O  O     . THR D  3 65  ? 25.026  -13.502 -11.972 1.00 33.85  ? 65   THR B O     1 
ATOM   2976 C  CB    . THR D  3 65  ? 25.196  -10.788 -9.825  1.00 30.47  ? 65   THR B CB    1 
ATOM   2977 O  OG1   . THR D  3 65  ? 23.867  -11.282 -9.587  1.00 29.34  ? 65   THR B OG1   1 
ATOM   2978 C  CG2   . THR D  3 65  ? 25.182  -9.275  -9.900  1.00 29.99  ? 65   THR B CG2   1 
ATOM   2979 N  N     . GLU D  3 66  ? 26.219  -13.517 -10.079 1.00 32.07  ? 66   GLU B N     1 
ATOM   2980 C  CA    . GLU D  3 66  ? 26.132  -14.952 -9.908  1.00 32.76  ? 66   GLU B CA    1 
ATOM   2981 C  C     . GLU D  3 66  ? 24.695  -15.369 -9.598  1.00 32.78  ? 66   GLU B C     1 
ATOM   2982 O  O     . GLU D  3 66  ? 24.218  -16.391 -10.089 1.00 33.75  ? 66   GLU B O     1 
ATOM   2983 C  CB    . GLU D  3 66  ? 27.084  -15.397 -8.794  1.00 33.42  ? 66   GLU B CB    1 
ATOM   2984 C  CG    . GLU D  3 66  ? 27.141  -16.887 -8.530  1.00 35.11  ? 66   GLU B CG    1 
ATOM   2985 C  CD    . GLU D  3 66  ? 28.480  -17.309 -7.907  1.00 36.78  ? 66   GLU B CD    1 
ATOM   2986 O  OE1   . GLU D  3 66  ? 28.473  -18.118 -6.953  1.00 36.31  ? 66   GLU B OE1   1 
ATOM   2987 O  OE2   . GLU D  3 66  ? 29.539  -16.820 -8.373  1.00 37.03  ? 66   GLU B OE2   1 
ATOM   2988 N  N     . LYS D  3 67  ? 23.997  -14.596 -8.778  1.00 33.21  ? 67   LYS B N     1 
ATOM   2989 C  CA    . LYS D  3 67  ? 22.601  -14.924 -8.503  1.00 33.00  ? 67   LYS B CA    1 
ATOM   2990 C  C     . LYS D  3 67  ? 21.766  -14.727 -9.765  1.00 31.77  ? 67   LYS B C     1 
ATOM   2991 O  O     . LYS D  3 67  ? 20.977  -15.588 -10.125 1.00 32.30  ? 67   LYS B O     1 
ATOM   2992 C  CB    . LYS D  3 67  ? 22.036  -14.091 -7.355  1.00 33.34  ? 67   LYS B CB    1 
ATOM   2993 C  CG    . LYS D  3 67  ? 20.803  -14.716 -6.731  1.00 34.78  ? 67   LYS B CG    1 
ATOM   2994 C  CD    . LYS D  3 67  ? 19.848  -13.675 -6.175  1.00 36.92  ? 67   LYS B CD    1 
ATOM   2995 C  CE    . LYS D  3 67  ? 20.457  -12.876 -5.037  1.00 38.33  ? 67   LYS B CE    1 
ATOM   2996 N  NZ    . LYS D  3 67  ? 19.635  -11.652 -4.729  1.00 39.03  ? 67   LYS B NZ    1 
ATOM   2997 N  N     . GLY D  3 68  ? 21.954  -13.591 -10.430 1.00 31.60  ? 68   GLY B N     1 
ATOM   2998 C  CA    . GLY D  3 68  ? 21.274  -13.306 -11.685 1.00 30.59  ? 68   GLY B CA    1 
ATOM   2999 C  C     . GLY D  3 68  ? 21.485  -14.383 -12.733 1.00 30.17  ? 68   GLY B C     1 
ATOM   3000 O  O     . GLY D  3 68  ? 20.532  -14.809 -13.386 1.00 30.29  ? 68   GLY B O     1 
ATOM   3001 N  N     . ARG D  3 69  ? 22.731  -14.830 -12.894 1.00 29.91  ? 69   ARG B N     1 
ATOM   3002 C  CA    . ARG D  3 69  ? 23.061  -15.869 -13.880 1.00 29.00  ? 69   ARG B CA    1 
ATOM   3003 C  C     . ARG D  3 69  ? 22.419  -17.223 -13.561 1.00 28.33  ? 69   ARG B C     1 
ATOM   3004 O  O     . ARG D  3 69  ? 21.844  -17.860 -14.435 1.00 28.10  ? 69   ARG B O     1 
ATOM   3005 C  CB    . ARG D  3 69  ? 24.577  -16.018 -14.056 1.00 29.58  ? 69   ARG B CB    1 
ATOM   3006 C  CG    . ARG D  3 69  ? 24.969  -16.985 -15.193 1.00 30.00  ? 69   ARG B CG    1 
ATOM   3007 C  CD    . ARG D  3 69  ? 26.399  -16.776 -15.696 1.00 29.70  ? 69   ARG B CD    1 
ATOM   3008 N  NE    . ARG D  3 69  ? 26.571  -15.479 -16.343 1.00 30.38  ? 69   ARG B NE    1 
ATOM   3009 C  CZ    . ARG D  3 69  ? 26.156  -15.194 -17.578 1.00 31.10  ? 69   ARG B CZ    1 
ATOM   3010 N  NH1   . ARG D  3 69  ? 25.533  -16.119 -18.294 1.00 31.01  ? 69   ARG B NH1   1 
ATOM   3011 N  NH2   . ARG D  3 69  ? 26.356  -13.985 -18.101 1.00 29.59  ? 69   ARG B NH2   1 
ATOM   3012 N  N     . ALA D  3 70  ? 22.506  -17.668 -12.316 1.00 27.32  ? 70   ALA B N     1 
ATOM   3013 C  CA    . ALA D  3 70  ? 21.829  -18.910 -11.947 1.00 28.37  ? 70   ALA B CA    1 
ATOM   3014 C  C     . ALA D  3 70  ? 20.336  -18.884 -12.323 1.00 27.80  ? 70   ALA B C     1 
ATOM   3015 O  O     . ALA D  3 70  ? 19.829  -19.806 -12.957 1.00 27.25  ? 70   ALA B O     1 
ATOM   3016 C  CB    . ALA D  3 70  ? 22.012  -19.203 -10.468 1.00 28.25  ? 70   ALA B CB    1 
ATOM   3017 N  N     . LEU D  3 71  ? 19.639  -17.818 -11.943 1.00 28.75  ? 71   LEU B N     1 
ATOM   3018 C  CA    . LEU D  3 71  ? 18.223  -17.681 -12.293 1.00 29.36  ? 71   LEU B CA    1 
ATOM   3019 C  C     . LEU D  3 71  ? 18.020  -17.670 -13.822 1.00 28.23  ? 71   LEU B C     1 
ATOM   3020 O  O     . LEU D  3 71  ? 17.182  -18.399 -14.343 1.00 26.76  ? 71   LEU B O     1 
ATOM   3021 C  CB    . LEU D  3 71  ? 17.630  -16.418 -11.666 1.00 30.67  ? 71   LEU B CB    1 
ATOM   3022 C  CG    . LEU D  3 71  ? 16.242  -16.462 -11.004 1.00 31.94  ? 71   LEU B CG    1 
ATOM   3023 C  CD1   . LEU D  3 71  ? 15.608  -15.079 -11.048 1.00 29.92  ? 71   LEU B CD1   1 
ATOM   3024 C  CD2   . LEU D  3 71  ? 15.287  -17.506 -11.607 1.00 32.18  ? 71   LEU B CD2   1 
ATOM   3025 N  N     . ALA D  3 72  ? 18.798  -16.861 -14.539 1.00 27.41  ? 72   ALA B N     1 
ATOM   3026 C  CA    . ALA D  3 72  ? 18.698  -16.815 -16.006 1.00 28.61  ? 72   ALA B CA    1 
ATOM   3027 C  C     . ALA D  3 72  ? 18.841  -18.197 -16.654 1.00 29.44  ? 72   ALA B C     1 
ATOM   3028 O  O     . ALA D  3 72  ? 18.124  -18.536 -17.595 1.00 31.45  ? 72   ALA B O     1 
ATOM   3029 C  CB    . ALA D  3 72  ? 19.715  -15.835 -16.590 1.00 26.87  ? 72   ALA B CB    1 
ATOM   3030 N  N     . ILE D  3 73  ? 19.776  -18.993 -16.145 1.00 30.19  ? 73   ILE B N     1 
ATOM   3031 C  CA    . ILE D  3 73  ? 20.000  -20.335 -16.655 1.00 29.27  ? 73   ILE B CA    1 
ATOM   3032 C  C     . ILE D  3 73  ? 18.844  -21.247 -16.287 1.00 29.41  ? 73   ILE B C     1 
ATOM   3033 O  O     . ILE D  3 73  ? 18.375  -22.035 -17.121 1.00 30.71  ? 73   ILE B O     1 
ATOM   3034 C  CB    . ILE D  3 73  ? 21.318  -20.918 -16.119 1.00 29.13  ? 73   ILE B CB    1 
ATOM   3035 C  CG1   . ILE D  3 73  ? 22.493  -20.319 -16.889 1.00 28.89  ? 73   ILE B CG1   1 
ATOM   3036 C  CG2   . ILE D  3 73  ? 21.317  -22.443 -16.215 1.00 27.99  ? 73   ILE B CG2   1 
ATOM   3037 C  CD1   . ILE D  3 73  ? 23.776  -20.321 -16.106 1.00 31.02  ? 73   ILE B CD1   1 
ATOM   3038 N  N     . ALA D  3 74  ? 18.394  -21.149 -15.040 1.00 28.02  ? 74   ALA B N     1 
ATOM   3039 C  CA    . ALA D  3 74  ? 17.252  -21.934 -14.584 1.00 28.34  ? 74   ALA B CA    1 
ATOM   3040 C  C     . ALA D  3 74  ? 16.016  -21.658 -15.434 1.00 28.24  ? 74   ALA B C     1 
ATOM   3041 O  O     . ALA D  3 74  ? 15.266  -22.576 -15.747 1.00 29.34  ? 74   ALA B O     1 
ATOM   3042 C  CB    . ALA D  3 74  ? 16.964  -21.671 -13.106 1.00 28.17  ? 74   ALA B CB    1 
ATOM   3043 N  N     . VAL D  3 75  ? 15.806  -20.402 -15.824 1.00 28.17  ? 75   VAL B N     1 
ATOM   3044 C  CA    . VAL D  3 75  ? 14.621  -20.067 -16.622 1.00 29.10  ? 75   VAL B CA    1 
ATOM   3045 C  C     . VAL D  3 75  ? 14.752  -20.517 -18.083 1.00 29.33  ? 75   VAL B C     1 
ATOM   3046 O  O     . VAL D  3 75  ? 13.789  -21.031 -18.673 1.00 27.86  ? 75   VAL B O     1 
ATOM   3047 C  CB    . VAL D  3 75  ? 14.252  -18.563 -16.549 1.00 29.27  ? 75   VAL B CB    1 
ATOM   3048 C  CG1   . VAL D  3 75  ? 13.066  -18.266 -17.463 1.00 28.98  ? 75   VAL B CG1   1 
ATOM   3049 C  CG2   . VAL D  3 75  ? 13.920  -18.175 -15.125 1.00 28.81  ? 75   VAL B CG2   1 
ATOM   3050 N  N     . MET D  3 76  ? 15.935  -20.325 -18.665 1.00 29.43  ? 76   MET B N     1 
ATOM   3051 C  CA    . MET D  3 76  ? 16.160  -20.785 -20.033 1.00 30.77  ? 76   MET B CA    1 
ATOM   3052 C  C     . MET D  3 76  ? 16.009  -22.296 -20.111 1.00 29.99  ? 76   MET B C     1 
ATOM   3053 O  O     . MET D  3 76  ? 15.428  -22.821 -21.057 1.00 30.24  ? 76   MET B O     1 
ATOM   3054 C  CB    . MET D  3 76  ? 17.521  -20.337 -20.568 1.00 32.27  ? 76   MET B CB    1 
ATOM   3055 C  CG    . MET D  3 76  ? 17.794  -20.791 -22.000 1.00 35.35  ? 76   MET B CG    1 
ATOM   3056 S  SD    . MET D  3 76  ? 16.594  -20.183 -23.226 1.00 39.79  ? 76   MET B SD    1 
ATOM   3057 C  CE    . MET D  3 76  ? 17.233  -18.528 -23.469 1.00 37.88  ? 76   MET B CE    1 
ATOM   3058 N  N     . ARG D  3 77  ? 16.508  -22.986 -19.092 1.00 29.53  ? 77   ARG B N     1 
ATOM   3059 C  CA    . ARG D  3 77  ? 16.403  -24.437 -19.007 1.00 28.39  ? 77   ARG B CA    1 
ATOM   3060 C  C     . ARG D  3 77  ? 14.942  -24.899 -18.983 1.00 27.61  ? 77   ARG B C     1 
ATOM   3061 O  O     . ARG D  3 77  ? 14.539  -25.740 -19.784 1.00 29.39  ? 77   ARG B O     1 
ATOM   3062 C  CB    . ARG D  3 77  ? 17.162  -24.934 -17.764 1.00 29.81  ? 77   ARG B CB    1 
ATOM   3063 C  CG    . ARG D  3 77  ? 17.062  -26.421 -17.508 1.00 30.02  ? 77   ARG B CG    1 
ATOM   3064 C  CD    . ARG D  3 77  ? 17.843  -26.837 -16.268 1.00 31.80  ? 77   ARG B CD    1 
ATOM   3065 N  NE    . ARG D  3 77  ? 17.187  -26.443 -15.017 1.00 33.12  ? 77   ARG B NE    1 
ATOM   3066 C  CZ    . ARG D  3 77  ? 17.797  -25.821 -14.009 1.00 33.93  ? 77   ARG B CZ    1 
ATOM   3067 N  NH1   . ARG D  3 77  ? 19.092  -25.528 -14.080 1.00 33.81  ? 77   ARG B NH1   1 
ATOM   3068 N  NH2   . ARG D  3 77  ? 17.114  -25.499 -12.918 1.00 34.67  ? 77   ARG B NH2   1 
ATOM   3069 N  N     . LYS D  3 78  ? 14.141  -24.359 -18.069 1.00 26.45  ? 78   LYS B N     1 
ATOM   3070 C  CA    . LYS D  3 78  ? 12.715  -24.705 -18.019 1.00 25.41  ? 78   LYS B CA    1 
ATOM   3071 C  C     . LYS D  3 78  ? 12.028  -24.445 -19.352 1.00 25.05  ? 78   LYS B C     1 
ATOM   3072 O  O     . LYS D  3 78  ? 11.152  -25.204 -19.765 1.00 23.52  ? 78   LYS B O     1 
ATOM   3073 C  CB    . LYS D  3 78  ? 11.981  -23.912 -16.927 1.00 25.56  ? 78   LYS B CB    1 
ATOM   3074 C  CG    . LYS D  3 78  ? 12.609  -23.976 -15.549 1.00 24.33  ? 78   LYS B CG    1 
ATOM   3075 C  CD    . LYS D  3 78  ? 11.784  -23.218 -14.541 1.00 24.42  ? 78   LYS B CD    1 
ATOM   3076 C  CE    . LYS D  3 78  ? 12.614  -22.819 -13.333 1.00 23.95  ? 78   LYS B CE    1 
ATOM   3077 N  NZ    . LYS D  3 78  ? 12.656  -23.906 -12.310 1.00 25.21  ? 78   LYS B NZ    1 
ATOM   3078 N  N     . HIS D  3 79  ? 12.418  -23.358 -20.009 1.00 26.44  ? 79   HIS B N     1 
ATOM   3079 C  CA    . HIS D  3 79  ? 11.825  -22.956 -21.286 1.00 28.80  ? 79   HIS B CA    1 
ATOM   3080 C  C     . HIS D  3 79  ? 12.032  -24.037 -22.348 1.00 28.56  ? 79   HIS B C     1 
ATOM   3081 O  O     . HIS D  3 79  ? 11.076  -24.471 -23.004 1.00 28.24  ? 79   HIS B O     1 
ATOM   3082 C  CB    . HIS D  3 79  ? 12.423  -21.617 -21.734 1.00 32.05  ? 79   HIS B CB    1 
ATOM   3083 C  CG    . HIS D  3 79  ? 12.003  -21.179 -23.103 1.00 35.46  ? 79   HIS B CG    1 
ATOM   3084 N  ND1   . HIS D  3 79  ? 10.930  -20.341 -23.320 1.00 37.16  ? 79   HIS B ND1   1 
ATOM   3085 C  CD2   . HIS D  3 79  ? 12.525  -21.443 -24.322 1.00 36.89  ? 79   HIS B CD2   1 
ATOM   3086 C  CE1   . HIS D  3 79  ? 10.799  -20.122 -24.615 1.00 37.59  ? 79   HIS B CE1   1 
ATOM   3087 N  NE2   . HIS D  3 79  ? 11.755  -20.778 -25.246 1.00 40.40  ? 79   HIS B NE2   1 
ATOM   3088 N  N     . ARG D  3 80  ? 13.274  -24.495 -22.491 1.00 27.02  ? 80   ARG B N     1 
ATOM   3089 C  CA    . ARG D  3 80  ? 13.598  -25.473 -23.520 1.00 26.40  ? 80   ARG B CA    1 
ATOM   3090 C  C     . ARG D  3 80  ? 13.106  -26.876 -23.182 1.00 27.51  ? 80   ARG B C     1 
ATOM   3091 O  O     . ARG D  3 80  ? 12.735  -27.632 -24.081 1.00 27.84  ? 80   ARG B O     1 
ATOM   3092 C  CB    . ARG D  3 80  ? 15.084  -25.410 -23.869 1.00 25.86  ? 80   ARG B CB    1 
ATOM   3093 C  CG    . ARG D  3 80  ? 15.442  -24.036 -24.427 1.00 24.86  ? 80   ARG B CG    1 
ATOM   3094 C  CD    . ARG D  3 80  ? 16.891  -23.856 -24.831 1.00 25.79  ? 80   ARG B CD    1 
ATOM   3095 N  NE    . ARG D  3 80  ? 17.005  -22.673 -25.681 1.00 26.88  ? 80   ARG B NE    1 
ATOM   3096 C  CZ    . ARG D  3 80  ? 18.098  -21.928 -25.829 1.00 28.21  ? 80   ARG B CZ    1 
ATOM   3097 N  NH1   . ARG D  3 80  ? 19.230  -22.227 -25.194 1.00 27.39  ? 80   ARG B NH1   1 
ATOM   3098 N  NH2   . ARG D  3 80  ? 18.056  -20.869 -26.628 1.00 28.57  ? 80   ARG B NH2   1 
ATOM   3099 N  N     . LEU D  3 81  ? 13.063  -27.216 -21.896 1.00 27.15  ? 81   LEU B N     1 
ATOM   3100 C  CA    . LEU D  3 81  ? 12.419  -28.458 -21.478 1.00 28.85  ? 81   LEU B CA    1 
ATOM   3101 C  C     . LEU D  3 81  ? 10.913  -28.405 -21.704 1.00 30.02  ? 81   LEU B C     1 
ATOM   3102 O  O     . LEU D  3 81  ? 10.294  -29.403 -22.074 1.00 30.55  ? 81   LEU B O     1 
ATOM   3103 C  CB    . LEU D  3 81  ? 12.706  -28.757 -20.005 1.00 29.93  ? 81   LEU B CB    1 
ATOM   3104 C  CG    . LEU D  3 81  ? 14.086  -29.344 -19.695 1.00 30.88  ? 81   LEU B CG    1 
ATOM   3105 C  CD1   . LEU D  3 81  ? 14.325  -29.375 -18.198 1.00 30.49  ? 81   LEU B CD1   1 
ATOM   3106 C  CD2   . LEU D  3 81  ? 14.212  -30.737 -20.313 1.00 30.17  ? 81   LEU B CD2   1 
ATOM   3107 N  N     . ALA D  3 82  ? 10.321  -27.237 -21.469 1.00 30.59  ? 82   ALA B N     1 
ATOM   3108 C  CA    . ALA D  3 82  ? 8.909   -27.028 -21.779 1.00 30.94  ? 82   ALA B CA    1 
ATOM   3109 C  C     . ALA D  3 82  ? 8.685   -27.175 -23.277 1.00 30.23  ? 82   ALA B C     1 
ATOM   3110 O  O     . ALA D  3 82  ? 7.723   -27.803 -23.706 1.00 30.82  ? 82   ALA B O     1 
ATOM   3111 C  CB    . ALA D  3 82  ? 8.433   -25.647 -21.294 1.00 30.24  ? 82   ALA B CB    1 
ATOM   3112 N  N     . GLU D  3 83  ? 9.582   -26.602 -24.071 1.00 30.66  ? 83   GLU B N     1 
ATOM   3113 C  CA    . GLU D  3 83  ? 9.488   -26.716 -25.523 1.00 31.24  ? 83   GLU B CA    1 
ATOM   3114 C  C     . GLU D  3 83  ? 9.534   -28.181 -25.966 1.00 33.02  ? 83   GLU B C     1 
ATOM   3115 O  O     . GLU D  3 83  ? 8.661   -28.640 -26.723 1.00 32.86  ? 83   GLU B O     1 
ATOM   3116 C  CB    . GLU D  3 83  ? 10.561  -25.867 -26.205 1.00 30.72  ? 83   GLU B CB    1 
ATOM   3117 C  CG    . GLU D  3 83  ? 10.128  -24.419 -26.395 1.00 32.35  ? 83   GLU B CG    1 
ATOM   3118 C  CD    . GLU D  3 83  ? 11.250  -23.515 -26.870 1.00 33.84  ? 83   GLU B CD    1 
ATOM   3119 O  OE1   . GLU D  3 83  ? 12.404  -23.990 -26.872 1.00 34.07  ? 83   GLU B OE1   1 
ATOM   3120 O  OE2   . GLU D  3 83  ? 10.983  -22.333 -27.234 1.00 37.64  ? 83   GLU B OE2   1 
ATOM   3121 N  N     . ARG D  3 84  ? 10.527  -28.919 -25.463 1.00 33.08  ? 84   ARG B N     1 
ATOM   3122 C  CA    . ARG D  3 84  ? 10.613  -30.351 -25.710 1.00 33.73  ? 84   ARG B CA    1 
ATOM   3123 C  C     . ARG D  3 84  ? 9.330   -31.064 -25.316 1.00 33.66  ? 84   ARG B C     1 
ATOM   3124 O  O     . ARG D  3 84  ? 8.757   -31.790 -26.124 1.00 34.61  ? 84   ARG B O     1 
ATOM   3125 C  CB    . ARG D  3 84  ? 11.803  -30.965 -24.965 1.00 36.04  ? 84   ARG B CB    1 
ATOM   3126 C  CG    . ARG D  3 84  ? 13.129  -30.869 -25.701 1.00 37.32  ? 84   ARG B CG    1 
ATOM   3127 C  CD    . ARG D  3 84  ? 13.503  -32.191 -26.366 1.00 38.56  ? 84   ARG B CD    1 
ATOM   3128 N  NE    . ARG D  3 84  ? 12.871  -32.404 -27.663 1.00 39.15  ? 84   ARG B NE    1 
ATOM   3129 C  CZ    . ARG D  3 84  ? 13.471  -32.194 -28.835 1.00 40.33  ? 84   ARG B CZ    1 
ATOM   3130 N  NH1   . ARG D  3 84  ? 14.726  -31.748 -28.882 1.00 40.74  ? 84   ARG B NH1   1 
ATOM   3131 N  NH2   . ARG D  3 84  ? 12.814  -32.428 -29.966 1.00 39.37  ? 84   ARG B NH2   1 
ATOM   3132 N  N     . LEU D  3 85  ? 8.881   -30.867 -24.076 1.00 33.09  ? 85   LEU B N     1 
ATOM   3133 C  CA    . LEU D  3 85  ? 7.638   -31.492 -23.596 1.00 32.53  ? 85   LEU B CA    1 
ATOM   3134 C  C     . LEU D  3 85  ? 6.438   -31.215 -24.501 1.00 31.48  ? 85   LEU B C     1 
ATOM   3135 O  O     . LEU D  3 85  ? 5.642   -32.100 -24.769 1.00 30.42  ? 85   LEU B O     1 
ATOM   3136 C  CB    . LEU D  3 85  ? 7.313   -31.028 -22.172 1.00 33.33  ? 85   LEU B CB    1 
ATOM   3137 C  CG    . LEU D  3 85  ? 5.995   -31.537 -21.567 1.00 34.09  ? 85   LEU B CG    1 
ATOM   3138 C  CD1   . LEU D  3 85  ? 6.084   -33.022 -21.238 1.00 34.20  ? 85   LEU B CD1   1 
ATOM   3139 C  CD2   . LEU D  3 85  ? 5.596   -30.748 -20.325 1.00 33.70  ? 85   LEU B CD2   1 
ATOM   3140 N  N     . LEU D  3 86  ? 6.307   -29.972 -24.952 1.00 32.17  ? 86   LEU B N     1 
ATOM   3141 C  CA    . LEU D  3 86  ? 5.165   -29.555 -25.779 1.00 32.79  ? 86   LEU B CA    1 
ATOM   3142 C  C     . LEU D  3 86  ? 5.171   -30.194 -27.172 1.00 34.33  ? 86   LEU B C     1 
ATOM   3143 O  O     . LEU D  3 86  ? 4.127   -30.599 -27.690 1.00 35.23  ? 86   LEU B O     1 
ATOM   3144 C  CB    . LEU D  3 86  ? 5.119   -28.026 -25.889 1.00 30.87  ? 86   LEU B CB    1 
ATOM   3145 C  CG    . LEU D  3 86  ? 4.700   -27.284 -24.610 1.00 29.72  ? 86   LEU B CG    1 
ATOM   3146 C  CD1   . LEU D  3 86  ? 5.205   -25.862 -24.603 1.00 26.70  ? 86   LEU B CD1   1 
ATOM   3147 C  CD2   . LEU D  3 86  ? 3.188   -27.334 -24.422 1.00 29.33  ? 86   LEU B CD2   1 
ATOM   3148 N  N     . VAL D  3 87  ? 6.353   -30.289 -27.770 1.00 35.36  ? 87   VAL B N     1 
ATOM   3149 C  CA    . VAL D  3 87  ? 6.487   -30.907 -29.079 1.00 36.43  ? 87   VAL B CA    1 
ATOM   3150 C  C     . VAL D  3 87  ? 6.410   -32.435 -29.013 1.00 37.49  ? 87   VAL B C     1 
ATOM   3151 O  O     . VAL D  3 87  ? 5.603   -33.054 -29.708 1.00 37.96  ? 87   VAL B O     1 
ATOM   3152 C  CB    . VAL D  3 87  ? 7.799   -30.492 -29.753 1.00 35.69  ? 87   VAL B CB    1 
ATOM   3153 C  CG1   . VAL D  3 87  ? 8.048   -31.334 -30.997 1.00 35.87  ? 87   VAL B CG1   1 
ATOM   3154 C  CG2   . VAL D  3 87  ? 7.761   -29.019 -30.108 1.00 35.42  ? 87   VAL B CG2   1 
ATOM   3155 N  N     . ASP D  3 88  ? 7.252   -33.030 -28.171 1.00 39.09  ? 88   ASP B N     1 
ATOM   3156 C  CA    . ASP D  3 88  ? 7.446   -34.476 -28.142 1.00 39.35  ? 88   ASP B CA    1 
ATOM   3157 C  C     . ASP D  3 88  ? 6.281   -35.223 -27.529 1.00 39.30  ? 88   ASP B C     1 
ATOM   3158 O  O     . ASP D  3 88  ? 5.911   -36.283 -28.016 1.00 39.66  ? 88   ASP B O     1 
ATOM   3159 C  CB    . ASP D  3 88  ? 8.714   -34.832 -27.364 1.00 42.12  ? 88   ASP B CB    1 
ATOM   3160 C  CG    . ASP D  3 88  ? 9.979   -34.313 -28.026 1.00 44.40  ? 88   ASP B CG    1 
ATOM   3161 O  OD1   . ASP D  3 88  ? 9.946   -33.991 -29.235 1.00 45.37  ? 88   ASP B OD1   1 
ATOM   3162 O  OD2   . ASP D  3 88  ? 11.017  -34.233 -27.328 1.00 46.32  ? 88   ASP B OD2   1 
ATOM   3163 N  N     . VAL D  3 89  ? 5.717   -34.683 -26.448 1.00 39.25  ? 89   VAL B N     1 
ATOM   3164 C  CA    . VAL D  3 89  ? 4.678   -35.386 -25.694 1.00 38.50  ? 89   VAL B CA    1 
ATOM   3165 C  C     . VAL D  3 89  ? 3.283   -34.818 -25.933 1.00 38.62  ? 89   VAL B C     1 
ATOM   3166 O  O     . VAL D  3 89  ? 2.355   -35.553 -26.259 1.00 39.47  ? 89   VAL B O     1 
ATOM   3167 C  CB    . VAL D  3 89  ? 4.978   -35.404 -24.174 1.00 38.63  ? 89   VAL B CB    1 
ATOM   3168 C  CG1   . VAL D  3 89  ? 3.942   -36.220 -23.441 1.00 38.49  ? 89   VAL B CG1   1 
ATOM   3169 C  CG2   . VAL D  3 89  ? 6.366   -35.972 -23.905 1.00 38.82  ? 89   VAL B CG2   1 
ATOM   3170 N  N     . ILE D  3 90  ? 3.133   -33.510 -25.778 1.00 38.75  ? 90   ILE B N     1 
ATOM   3171 C  CA    . ILE D  3 90  ? 1.822   -32.875 -25.932 1.00 38.44  ? 90   ILE B CA    1 
ATOM   3172 C  C     . ILE D  3 90  ? 1.386   -32.737 -27.394 1.00 39.35  ? 90   ILE B C     1 
ATOM   3173 O  O     . ILE D  3 90  ? 0.203   -32.871 -27.706 1.00 38.35  ? 90   ILE B O     1 
ATOM   3174 C  CB    . ILE D  3 90  ? 1.759   -31.527 -25.175 1.00 37.37  ? 90   ILE B CB    1 
ATOM   3175 C  CG1   . ILE D  3 90  ? 1.676   -31.807 -23.667 1.00 36.39  ? 90   ILE B CG1   1 
ATOM   3176 C  CG2   . ILE D  3 90  ? 0.566   -30.681 -25.643 1.00 35.80  ? 90   ILE B CG2   1 
ATOM   3177 C  CD1   . ILE D  3 90  ? 2.181   -30.706 -22.784 1.00 34.18  ? 90   ILE B CD1   1 
ATOM   3178 N  N     . GLY D  3 91  ? 2.344   -32.496 -28.284 1.00 40.73  ? 91   GLY B N     1 
ATOM   3179 C  CA    . GLY D  3 91  ? 2.056   -32.387 -29.709 1.00 42.05  ? 91   GLY B CA    1 
ATOM   3180 C  C     . GLY D  3 91  ? 1.476   -31.039 -30.098 1.00 44.12  ? 91   GLY B C     1 
ATOM   3181 O  O     . GLY D  3 91  ? 0.634   -30.948 -30.988 1.00 44.37  ? 91   GLY B O     1 
ATOM   3182 N  N     . LEU D  3 92  ? 1.917   -29.982 -29.428 1.00 45.58  ? 92   LEU B N     1 
ATOM   3183 C  CA    . LEU D  3 92  ? 1.481   -28.645 -29.797 1.00 47.11  ? 92   LEU B CA    1 
ATOM   3184 C  C     . LEU D  3 92  ? 2.184   -28.255 -31.096 1.00 47.56  ? 92   LEU B C     1 
ATOM   3185 O  O     . LEU D  3 92  ? 3.365   -28.545 -31.265 1.00 46.87  ? 92   LEU B O     1 
ATOM   3186 C  CB    . LEU D  3 92  ? 1.790   -27.644 -28.670 1.00 46.87  ? 92   LEU B CB    1 
ATOM   3187 C  CG    . LEU D  3 92  ? 1.153   -26.247 -28.720 1.00 46.93  ? 92   LEU B CG    1 
ATOM   3188 C  CD1   . LEU D  3 92  ? -0.370  -26.310 -28.614 1.00 46.87  ? 92   LEU B CD1   1 
ATOM   3189 C  CD2   . LEU D  3 92  ? 1.720   -25.343 -27.629 1.00 46.71  ? 92   LEU B CD2   1 
ATOM   3190 N  N     . PRO D  3 93  ? 1.447   -27.637 -32.037 1.00 48.90  ? 93   PRO B N     1 
ATOM   3191 C  CA    . PRO D  3 93  ? 2.043   -27.122 -33.275 1.00 49.28  ? 93   PRO B CA    1 
ATOM   3192 C  C     . PRO D  3 93  ? 3.309   -26.299 -33.018 1.00 50.24  ? 93   PRO B C     1 
ATOM   3193 O  O     . PRO D  3 93  ? 3.338   -25.510 -32.079 1.00 51.05  ? 93   PRO B O     1 
ATOM   3194 C  CB    . PRO D  3 93  ? 0.938   -26.226 -33.840 1.00 48.78  ? 93   PRO B CB    1 
ATOM   3195 C  CG    . PRO D  3 93  ? -0.325  -26.841 -33.348 1.00 48.20  ? 93   PRO B CG    1 
ATOM   3196 C  CD    . PRO D  3 93  ? -0.012  -27.424 -31.994 1.00 48.50  ? 93   PRO B CD    1 
ATOM   3197 N  N     . TRP D  3 94  ? 4.334   -26.488 -33.851 1.00 51.92  ? 94   TRP B N     1 
ATOM   3198 C  CA    . TRP D  3 94  ? 5.612   -25.766 -33.745 1.00 53.17  ? 94   TRP B CA    1 
ATOM   3199 C  C     . TRP D  3 94  ? 5.432   -24.267 -33.596 1.00 52.79  ? 94   TRP B C     1 
ATOM   3200 O  O     . TRP D  3 94  ? 6.064   -23.637 -32.752 1.00 51.86  ? 94   TRP B O     1 
ATOM   3201 C  CB    . TRP D  3 94  ? 6.478   -26.002 -34.994 1.00 56.46  ? 94   TRP B CB    1 
ATOM   3202 C  CG    . TRP D  3 94  ? 6.814   -27.427 -35.252 1.00 57.63  ? 94   TRP B CG    1 
ATOM   3203 C  CD1   . TRP D  3 94  ? 6.109   -28.314 -36.026 1.00 58.33  ? 94   TRP B CD1   1 
ATOM   3204 C  CD2   . TRP D  3 94  ? 7.943   -28.146 -34.742 1.00 58.24  ? 94   TRP B CD2   1 
ATOM   3205 N  NE1   . TRP D  3 94  ? 6.730   -29.546 -36.020 1.00 59.09  ? 94   TRP B NE1   1 
ATOM   3206 C  CE2   . TRP D  3 94  ? 7.858   -29.470 -35.243 1.00 58.72  ? 94   TRP B CE2   1 
ATOM   3207 C  CE3   . TRP D  3 94  ? 9.017   -27.804 -33.912 1.00 57.79  ? 94   TRP B CE3   1 
ATOM   3208 C  CZ2   . TRP D  3 94  ? 8.808   -30.448 -34.937 1.00 58.20  ? 94   TRP B CZ2   1 
ATOM   3209 C  CZ3   . TRP D  3 94  ? 9.958   -28.772 -33.612 1.00 57.82  ? 94   TRP B CZ3   1 
ATOM   3210 C  CH2   . TRP D  3 94  ? 9.847   -30.082 -34.120 1.00 58.11  ? 94   TRP B CH2   1 
ATOM   3211 N  N     . GLU D  3 95  ? 4.583   -23.702 -34.449 1.00 53.08  ? 95   GLU B N     1 
ATOM   3212 C  CA    . GLU D  3 95  ? 4.390   -22.265 -34.524 1.00 53.75  ? 95   GLU B CA    1 
ATOM   3213 C  C     . GLU D  3 95  ? 4.226   -21.686 -33.131 1.00 52.91  ? 95   GLU B C     1 
ATOM   3214 O  O     . GLU D  3 95  ? 4.714   -20.590 -32.845 1.00 52.77  ? 95   GLU B O     1 
ATOM   3215 C  CB    . GLU D  3 95  ? 3.141   -21.933 -35.348 1.00 56.32  ? 95   GLU B CB    1 
ATOM   3216 C  CG    . GLU D  3 95  ? 2.723   -23.005 -36.356 1.00 59.26  ? 95   GLU B CG    1 
ATOM   3217 C  CD    . GLU D  3 95  ? 3.702   -23.148 -37.513 1.00 61.02  ? 95   GLU B CD    1 
ATOM   3218 O  OE1   . GLU D  3 95  ? 3.864   -22.172 -38.291 1.00 61.70  ? 95   GLU B OE1   1 
ATOM   3219 O  OE2   . GLU D  3 95  ? 4.301   -24.242 -37.647 1.00 61.53  ? 95   GLU B OE2   1 
ATOM   3220 N  N     . GLU D  3 96  ? 3.556   -22.448 -32.267 1.00 51.41  ? 96   GLU B N     1 
ATOM   3221 C  CA    . GLU D  3 96  ? 3.056   -21.949 -30.988 1.00 50.13  ? 96   GLU B CA    1 
ATOM   3222 C  C     . GLU D  3 96  ? 3.840   -22.311 -29.727 1.00 48.55  ? 96   GLU B C     1 
ATOM   3223 O  O     . GLU D  3 96  ? 3.682   -21.644 -28.708 1.00 47.38  ? 96   GLU B O     1 
ATOM   3224 C  CB    . GLU D  3 96  ? 1.623   -22.421 -30.797 1.00 51.82  ? 96   GLU B CB    1 
ATOM   3225 C  CG    . GLU D  3 96  ? 0.704   -22.042 -31.929 1.00 53.59  ? 96   GLU B CG    1 
ATOM   3226 C  CD    . GLU D  3 96  ? -0.624  -22.736 -31.820 1.00 54.23  ? 96   GLU B CD    1 
ATOM   3227 O  OE1   . GLU D  3 96  ? -1.031  -23.036 -30.677 1.00 54.72  ? 96   GLU B OE1   1 
ATOM   3228 O  OE2   . GLU D  3 96  ? -1.256  -22.982 -32.871 1.00 55.59  ? 96   GLU B OE2   1 
ATOM   3229 N  N     . VAL D  3 97  ? 4.666   -23.355 -29.773 1.00 46.22  ? 97   VAL B N     1 
ATOM   3230 C  CA    . VAL D  3 97  ? 5.269   -23.863 -28.537 1.00 44.46  ? 97   VAL B CA    1 
ATOM   3231 C  C     . VAL D  3 97  ? 6.213   -22.891 -27.836 1.00 43.63  ? 97   VAL B C     1 
ATOM   3232 O  O     . VAL D  3 97  ? 6.342   -22.936 -26.618 1.00 44.26  ? 97   VAL B O     1 
ATOM   3233 C  CB    . VAL D  3 97  ? 5.962   -25.252 -28.695 1.00 44.74  ? 97   VAL B CB    1 
ATOM   3234 C  CG1   . VAL D  3 97  ? 5.056   -26.239 -29.436 1.00 43.24  ? 97   VAL B CG1   1 
ATOM   3235 C  CG2   . VAL D  3 97  ? 7.324   -25.118 -29.359 1.00 44.17  ? 97   VAL B CG2   1 
ATOM   3236 N  N     . HIS D  3 98  ? 6.861   -22.003 -28.584 1.00 42.03  ? 98   HIS B N     1 
ATOM   3237 C  CA    . HIS D  3 98  ? 7.719   -21.013 -27.947 1.00 40.78  ? 98   HIS B CA    1 
ATOM   3238 C  C     . HIS D  3 98  ? 6.892   -20.025 -27.125 1.00 39.30  ? 98   HIS B C     1 
ATOM   3239 O  O     . HIS D  3 98  ? 7.258   -19.682 -26.000 1.00 37.89  ? 98   HIS B O     1 
ATOM   3240 C  CB    . HIS D  3 98  ? 8.577   -20.257 -28.961 1.00 42.16  ? 98   HIS B CB    1 
ATOM   3241 C  CG    . HIS D  3 98  ? 9.313   -19.096 -28.365 1.00 43.76  ? 98   HIS B CG    1 
ATOM   3242 N  ND1   . HIS D  3 98  ? 10.560  -19.218 -27.783 1.00 45.28  ? 98   HIS B ND1   1 
ATOM   3243 C  CD2   . HIS D  3 98  ? 8.958   -17.795 -28.231 1.00 44.03  ? 98   HIS B CD2   1 
ATOM   3244 C  CE1   . HIS D  3 98  ? 10.945  -18.035 -27.336 1.00 44.83  ? 98   HIS B CE1   1 
ATOM   3245 N  NE2   . HIS D  3 98  ? 9.990   -17.157 -27.590 1.00 44.33  ? 98   HIS B NE2   1 
ATOM   3246 N  N     . ALA D  3 99  ? 5.782   -19.571 -27.702 1.00 37.73  ? 99   ALA B N     1 
ATOM   3247 C  CA    . ALA D  3 99  ? 4.864   -18.667 -27.016 1.00 35.62  ? 99   ALA B CA    1 
ATOM   3248 C  C     . ALA D  3 99  ? 4.398   -19.307 -25.721 1.00 33.41  ? 99   ALA B C     1 
ATOM   3249 O  O     . ALA D  3 99  ? 4.423   -18.682 -24.668 1.00 34.16  ? 99   ALA B O     1 
ATOM   3250 C  CB    . ALA D  3 99  ? 3.669   -18.338 -27.905 1.00 34.96  ? 99   ALA B CB    1 
ATOM   3251 N  N     . GLU D  3 100 ? 3.982   -20.559 -25.812 1.00 32.01  ? 100  GLU B N     1 
ATOM   3252 C  CA    . GLU D  3 100 ? 3.552   -21.312 -24.653 1.00 32.34  ? 100  GLU B CA    1 
ATOM   3253 C  C     . GLU D  3 100 ? 4.677   -21.452 -23.633 1.00 31.47  ? 100  GLU B C     1 
ATOM   3254 O  O     . GLU D  3 100 ? 4.516   -21.087 -22.476 1.00 31.64  ? 100  GLU B O     1 
ATOM   3255 C  CB    . GLU D  3 100 ? 3.051   -22.692 -25.068 1.00 32.82  ? 100  GLU B CB    1 
ATOM   3256 C  CG    . GLU D  3 100 ? 2.365   -23.452 -23.942 1.00 35.54  ? 100  GLU B CG    1 
ATOM   3257 C  CD    . GLU D  3 100 ? 0.910   -23.064 -23.796 1.00 37.25  ? 100  GLU B CD    1 
ATOM   3258 O  OE1   . GLU D  3 100 ? 0.412   -22.342 -24.684 1.00 38.83  ? 100  GLU B OE1   1 
ATOM   3259 O  OE2   . GLU D  3 100 ? 0.263   -23.475 -22.807 1.00 38.08  ? 100  GLU B OE2   1 
ATOM   3260 N  N     . ALA D  3 101 ? 5.818   -21.965 -24.072 1.00 30.96  ? 101  ALA B N     1 
ATOM   3261 C  CA    . ALA D  3 101 ? 6.943   -22.204 -23.179 1.00 31.55  ? 101  ALA B CA    1 
ATOM   3262 C  C     . ALA D  3 101 ? 7.445   -20.914 -22.524 1.00 31.58  ? 101  ALA B C     1 
ATOM   3263 O  O     . ALA D  3 101 ? 8.099   -20.953 -21.482 1.00 31.98  ? 101  ALA B O     1 
ATOM   3264 C  CB    . ALA D  3 101 ? 8.077   -22.906 -23.927 1.00 31.28  ? 101  ALA B CB    1 
ATOM   3265 N  N     . CYS D  3 102 ? 7.125   -19.774 -23.128 1.00 31.11  ? 102  CYS B N     1 
ATOM   3266 C  CA    . CYS D  3 102 ? 7.552   -18.484 -22.597 1.00 30.48  ? 102  CYS B CA    1 
ATOM   3267 C  C     . CYS D  3 102 ? 6.791   -18.101 -21.327 1.00 29.78  ? 102  CYS B C     1 
ATOM   3268 O  O     . CYS D  3 102 ? 7.209   -17.192 -20.589 1.00 29.41  ? 102  CYS B O     1 
ATOM   3269 C  CB    . CYS D  3 102 ? 7.400   -17.393 -23.646 1.00 30.85  ? 102  CYS B CB    1 
ATOM   3270 S  SG    . CYS D  3 102 ? 8.083   -15.828 -23.119 1.00 34.40  ? 102  CYS B SG    1 
ATOM   3271 N  N     . ARG D  3 103 ? 5.683   -18.802 -21.089 1.00 27.50  ? 103  ARG B N     1 
ATOM   3272 C  CA    . ARG D  3 103 ? 4.883   -18.640 -19.884 1.00 26.70  ? 103  ARG B CA    1 
ATOM   3273 C  C     . ARG D  3 103 ? 5.195   -19.743 -18.867 1.00 27.16  ? 103  ARG B C     1 
ATOM   3274 O  O     . ARG D  3 103 ? 5.338   -19.472 -17.675 1.00 27.37  ? 103  ARG B O     1 
ATOM   3275 C  CB    . ARG D  3 103 ? 3.388   -18.663 -20.228 1.00 25.71  ? 103  ARG B CB    1 
ATOM   3276 C  CG    . ARG D  3 103 ? 2.948   -17.515 -21.122 1.00 25.63  ? 103  ARG B CG    1 
ATOM   3277 C  CD    . ARG D  3 103 ? 1.427   -17.368 -21.178 1.00 25.72  ? 103  ARG B CD    1 
ATOM   3278 N  NE    . ARG D  3 103 ? 0.730   -18.574 -21.633 1.00 25.29  ? 103  ARG B NE    1 
ATOM   3279 C  CZ    . ARG D  3 103 ? 0.468   -18.861 -22.909 1.00 25.09  ? 103  ARG B CZ    1 
ATOM   3280 N  NH1   . ARG D  3 103 ? -0.182  -19.974 -23.226 1.00 25.41  ? 103  ARG B NH1   1 
ATOM   3281 N  NH2   . ARG D  3 103 ? 0.862   -18.046 -23.874 1.00 25.02  ? 103  ARG B NH2   1 
ATOM   3282 N  N     . TRP D  3 104 ? 5.294   -20.984 -19.335 1.00 27.28  ? 104  TRP B N     1 
ATOM   3283 C  CA    . TRP D  3 104 ? 5.598   -22.125 -18.450 1.00 27.62  ? 104  TRP B CA    1 
ATOM   3284 C  C     . TRP D  3 104 ? 6.931   -21.977 -17.720 1.00 26.58  ? 104  TRP B C     1 
ATOM   3285 O  O     . TRP D  3 104 ? 7.037   -22.340 -16.558 1.00 26.99  ? 104  TRP B O     1 
ATOM   3286 C  CB    . TRP D  3 104 ? 5.563   -23.452 -19.217 1.00 28.42  ? 104  TRP B CB    1 
ATOM   3287 C  CG    . TRP D  3 104 ? 4.209   -23.838 -19.729 1.00 28.58  ? 104  TRP B CG    1 
ATOM   3288 C  CD1   . TRP D  3 104 ? 3.211   -22.992 -20.155 1.00 28.74  ? 104  TRP B CD1   1 
ATOM   3289 C  CD2   . TRP D  3 104 ? 3.710   -25.172 -19.915 1.00 28.84  ? 104  TRP B CD2   1 
ATOM   3290 N  NE1   . TRP D  3 104 ? 2.114   -23.724 -20.566 1.00 29.12  ? 104  TRP B NE1   1 
ATOM   3291 C  CE2   . TRP D  3 104 ? 2.396   -25.061 -20.432 1.00 29.08  ? 104  TRP B CE2   1 
ATOM   3292 C  CE3   . TRP D  3 104 ? 4.240   -26.449 -19.680 1.00 29.75  ? 104  TRP B CE3   1 
ATOM   3293 C  CZ2   . TRP D  3 104 ? 1.609   -26.180 -20.723 1.00 29.70  ? 104  TRP B CZ2   1 
ATOM   3294 C  CZ3   . TRP D  3 104 ? 3.457   -27.568 -19.970 1.00 29.43  ? 104  TRP B CZ3   1 
ATOM   3295 C  CH2   . TRP D  3 104 ? 2.156   -27.425 -20.488 1.00 29.95  ? 104  TRP B CH2   1 
ATOM   3296 N  N     . GLU D  3 105 ? 7.930   -21.414 -18.393 1.00 26.52  ? 105  GLU B N     1 
ATOM   3297 C  CA    . GLU D  3 105 ? 9.264   -21.248 -17.815 1.00 27.24  ? 105  GLU B CA    1 
ATOM   3298 C  C     . GLU D  3 105 ? 9.211   -20.525 -16.474 1.00 27.18  ? 105  GLU B C     1 
ATOM   3299 O  O     . GLU D  3 105 ? 10.140  -20.614 -15.671 1.00 25.84  ? 105  GLU B O     1 
ATOM   3300 C  CB    . GLU D  3 105 ? 10.155  -20.453 -18.774 1.00 28.08  ? 105  GLU B CB    1 
ATOM   3301 C  CG    . GLU D  3 105 ? 9.498   -19.156 -19.206 1.00 30.28  ? 105  GLU B CG    1 
ATOM   3302 C  CD    . GLU D  3 105 ? 10.406  -18.247 -20.000 1.00 31.63  ? 105  GLU B CD    1 
ATOM   3303 O  OE1   . GLU D  3 105 ? 11.547  -18.640 -20.305 1.00 32.57  ? 105  GLU B OE1   1 
ATOM   3304 O  OE2   . GLU D  3 105 ? 9.961   -17.126 -20.330 1.00 33.31  ? 105  GLU B OE2   1 
ATOM   3305 N  N     . HIS D  3 106 ? 8.118   -19.800 -16.243 1.00 27.45  ? 106  HIS B N     1 
ATOM   3306 C  CA    . HIS D  3 106 ? 8.008   -18.929 -15.079 1.00 26.26  ? 106  HIS B CA    1 
ATOM   3307 C  C     . HIS D  3 106 ? 7.298   -19.609 -13.910 1.00 25.65  ? 106  HIS B C     1 
ATOM   3308 O  O     . HIS D  3 106 ? 7.303   -19.095 -12.801 1.00 24.43  ? 106  HIS B O     1 
ATOM   3309 C  CB    . HIS D  3 106 ? 7.302   -17.621 -15.457 1.00 25.94  ? 106  HIS B CB    1 
ATOM   3310 C  CG    . HIS D  3 106 ? 7.937   -16.898 -16.605 1.00 24.55  ? 106  HIS B CG    1 
ATOM   3311 N  ND1   . HIS D  3 106 ? 9.165   -16.283 -16.509 1.00 24.63  ? 106  HIS B ND1   1 
ATOM   3312 C  CD2   . HIS D  3 106 ? 7.503   -16.673 -17.869 1.00 25.46  ? 106  HIS B CD2   1 
ATOM   3313 C  CE1   . HIS D  3 106 ? 9.472   -15.728 -17.670 1.00 26.32  ? 106  HIS B CE1   1 
ATOM   3314 N  NE2   . HIS D  3 106 ? 8.478   -15.947 -18.516 1.00 27.15  ? 106  HIS B NE2   1 
ATOM   3315 N  N     . VAL D  3 107 ? 6.701   -20.771 -14.158 1.00 25.52  ? 107  VAL B N     1 
ATOM   3316 C  CA    . VAL D  3 107 ? 5.948   -21.476 -13.115 1.00 25.69  ? 107  VAL B CA    1 
ATOM   3317 C  C     . VAL D  3 107 ? 6.478   -22.897 -12.797 1.00 26.46  ? 107  VAL B C     1 
ATOM   3318 O  O     . VAL D  3 107 ? 6.096   -23.491 -11.792 1.00 26.90  ? 107  VAL B O     1 
ATOM   3319 C  CB    . VAL D  3 107 ? 4.443   -21.585 -13.478 1.00 24.22  ? 107  VAL B CB    1 
ATOM   3320 C  CG1   . VAL D  3 107 ? 3.757   -20.234 -13.399 1.00 25.48  ? 107  VAL B CG1   1 
ATOM   3321 C  CG2   . VAL D  3 107 ? 4.269   -22.188 -14.849 1.00 22.79  ? 107  VAL B CG2   1 
ATOM   3322 N  N     . MET D  3 108 ? 7.329   -23.442 -13.658 1.00 27.17  ? 108  MET B N     1 
ATOM   3323 C  CA    . MET D  3 108 ? 7.825   -24.816 -13.492 1.00 30.23  ? 108  MET B CA    1 
ATOM   3324 C  C     . MET D  3 108 ? 8.834   -24.939 -12.360 1.00 28.05  ? 108  MET B C     1 
ATOM   3325 O  O     . MET D  3 108 ? 9.837   -24.237 -12.334 1.00 26.30  ? 108  MET B O     1 
ATOM   3326 C  CB    . MET D  3 108 ? 8.489   -25.319 -14.778 1.00 32.87  ? 108  MET B CB    1 
ATOM   3327 C  CG    . MET D  3 108 ? 7.561   -25.498 -15.973 1.00 36.44  ? 108  MET B CG    1 
ATOM   3328 S  SD    . MET D  3 108 ? 8.495   -26.160 -17.383 1.00 42.45  ? 108  MET B SD    1 
ATOM   3329 C  CE    . MET D  3 108 ? 9.655   -27.259 -16.549 1.00 37.48  ? 108  MET B CE    1 
ATOM   3330 N  N     . SER D  3 109 ? 8.573   -25.840 -11.430 1.00 27.46  ? 109  SER B N     1 
ATOM   3331 C  CA    . SER D  3 109 ? 9.523   -26.083 -10.356 1.00 28.20  ? 109  SER B CA    1 
ATOM   3332 C  C     . SER D  3 109 ? 10.659  -26.957 -10.870 1.00 28.98  ? 109  SER B C     1 
ATOM   3333 O  O     . SER D  3 109 ? 10.473  -27.737 -11.797 1.00 29.20  ? 109  SER B O     1 
ATOM   3334 C  CB    . SER D  3 109 ? 8.826   -26.759 -9.178  1.00 26.67  ? 109  SER B CB    1 
ATOM   3335 O  OG    . SER D  3 109 ? 8.495   -28.095 -9.496  1.00 25.68  ? 109  SER B OG    1 
ATOM   3336 N  N     . GLU D  3 110 ? 11.836  -26.830 -10.273 1.00 31.53  ? 110  GLU B N     1 
ATOM   3337 C  CA    . GLU D  3 110 ? 12.953  -27.715 -10.615 1.00 34.17  ? 110  GLU B CA    1 
ATOM   3338 C  C     . GLU D  3 110 ? 12.568  -29.173 -10.420 1.00 34.05  ? 110  GLU B C     1 
ATOM   3339 O  O     . GLU D  3 110 ? 13.043  -30.051 -11.136 1.00 35.20  ? 110  GLU B O     1 
ATOM   3340 C  CB    . GLU D  3 110 ? 14.197  -27.386 -9.785  1.00 36.16  ? 110  GLU B CB    1 
ATOM   3341 C  CG    . GLU D  3 110 ? 14.791  -26.031 -10.115 1.00 40.06  ? 110  GLU B CG    1 
ATOM   3342 C  CD    . GLU D  3 110 ? 16.217  -25.868 -9.634  1.00 42.07  ? 110  GLU B CD    1 
ATOM   3343 O  OE1   . GLU D  3 110 ? 16.705  -26.753 -8.887  1.00 43.09  ? 110  GLU B OE1   1 
ATOM   3344 O  OE2   . GLU D  3 110 ? 16.846  -24.846 -10.007 1.00 42.70  ? 110  GLU B OE2   1 
ATOM   3345 N  N     . ASP D  3 111 ? 11.703  -29.417 -9.446  1.00 33.87  ? 111  ASP B N     1 
ATOM   3346 C  CA    . ASP D  3 111 ? 11.196  -30.747 -9.160  1.00 34.54  ? 111  ASP B CA    1 
ATOM   3347 C  C     . ASP D  3 111 ? 10.553  -31.356 -10.411 1.00 34.37  ? 111  ASP B C     1 
ATOM   3348 O  O     . ASP D  3 111 ? 10.699  -32.542 -10.678 1.00 35.95  ? 111  ASP B O     1 
ATOM   3349 C  CB    . ASP D  3 111 ? 10.179  -30.645 -8.026  1.00 37.53  ? 111  ASP B CB    1 
ATOM   3350 C  CG    . ASP D  3 111 ? 9.988   -31.948 -7.272  1.00 40.17  ? 111  ASP B CG    1 
ATOM   3351 O  OD1   . ASP D  3 111 ? 10.309  -33.026 -7.815  1.00 41.56  ? 111  ASP B OD1   1 
ATOM   3352 O  OD2   . ASP D  3 111 ? 9.497   -31.891 -6.121  1.00 42.14  ? 111  ASP B OD2   1 
ATOM   3353 N  N     . VAL D  3 112 ? 9.842   -30.539 -11.183 1.00 33.20  ? 112  VAL B N     1 
ATOM   3354 C  CA    . VAL D  3 112 ? 9.239   -30.990 -12.429 1.00 30.64  ? 112  VAL B CA    1 
ATOM   3355 C  C     . VAL D  3 112 ? 10.283  -31.106 -13.547 1.00 30.31  ? 112  VAL B C     1 
ATOM   3356 O  O     . VAL D  3 112 ? 10.229  -32.030 -14.348 1.00 30.16  ? 112  VAL B O     1 
ATOM   3357 C  CB    . VAL D  3 112 ? 8.071   -30.058 -12.871 1.00 29.98  ? 112  VAL B CB    1 
ATOM   3358 C  CG1   . VAL D  3 112 ? 7.705   -30.287 -14.335 1.00 27.65  ? 112  VAL B CG1   1 
ATOM   3359 C  CG2   . VAL D  3 112 ? 6.866   -30.292 -11.994 1.00 29.86  ? 112  VAL B CG2   1 
ATOM   3360 N  N     . GLU D  3 113 ? 11.217  -30.162 -13.606 1.00 30.36  ? 113  GLU B N     1 
ATOM   3361 C  CA    . GLU D  3 113 ? 12.288  -30.199 -14.592 1.00 32.01  ? 113  GLU B CA    1 
ATOM   3362 C  C     . GLU D  3 113 ? 13.071  -31.510 -14.520 1.00 33.17  ? 113  GLU B C     1 
ATOM   3363 O  O     . GLU D  3 113 ? 13.326  -32.146 -15.546 1.00 33.71  ? 113  GLU B O     1 
ATOM   3364 C  CB    . GLU D  3 113 ? 13.276  -29.064 -14.359 1.00 32.48  ? 113  GLU B CB    1 
ATOM   3365 C  CG    . GLU D  3 113 ? 12.762  -27.678 -14.539 1.00 31.65  ? 113  GLU B CG    1 
ATOM   3366 C  CD    . GLU D  3 113 ? 13.893  -26.676 -14.497 1.00 32.95  ? 113  GLU B CD    1 
ATOM   3367 O  OE1   . GLU D  3 113 ? 14.621  -26.588 -15.507 1.00 33.76  ? 113  GLU B OE1   1 
ATOM   3368 O  OE2   . GLU D  3 113 ? 14.065  -25.983 -13.461 1.00 32.59  ? 113  GLU B OE2   1 
ATOM   3369 N  N     . ARG D  3 114 ? 13.467  -31.897 -13.309 1.00 33.54  ? 114  ARG B N     1 
ATOM   3370 C  CA    . ARG D  3 114 ? 14.184  -33.145 -13.100 1.00 34.30  ? 114  ARG B CA    1 
ATOM   3371 C  C     . ARG D  3 114 ? 13.396  -34.335 -13.624 1.00 35.47  ? 114  ARG B C     1 
ATOM   3372 O  O     . ARG D  3 114 ? 13.957  -35.197 -14.306 1.00 36.12  ? 114  ARG B O     1 
ATOM   3373 C  CB    . ARG D  3 114 ? 14.548  -33.340 -11.628 1.00 34.90  ? 114  ARG B CB    1 
ATOM   3374 C  CG    . ARG D  3 114 ? 15.847  -32.653 -11.231 1.00 36.31  ? 114  ARG B CG    1 
ATOM   3375 C  CD    . ARG D  3 114 ? 16.280  -33.006 -9.809  1.00 37.91  ? 114  ARG B CD    1 
ATOM   3376 N  NE    . ARG D  3 114 ? 15.532  -32.266 -8.796  1.00 39.13  ? 114  ARG B NE    1 
ATOM   3377 C  CZ    . ARG D  3 114 ? 15.892  -31.075 -8.321  1.00 40.03  ? 114  ARG B CZ    1 
ATOM   3378 N  NH1   . ARG D  3 114 ? 16.992  -30.474 -8.762  1.00 38.75  ? 114  ARG B NH1   1 
ATOM   3379 N  NH2   . ARG D  3 114 ? 15.139  -30.476 -7.406  1.00 40.98  ? 114  ARG B NH2   1 
ATOM   3380 N  N     . ARG D  3 115 ? 12.098  -34.383 -13.328 1.00 35.54  ? 115  ARG B N     1 
ATOM   3381 C  CA    . ARG D  3 115 ? 11.256  -35.468 -13.839 1.00 36.15  ? 115  ARG B CA    1 
ATOM   3382 C  C     . ARG D  3 115 ? 11.005  -35.405 -15.352 1.00 36.34  ? 115  ARG B C     1 
ATOM   3383 O  O     . ARG D  3 115 ? 10.646  -36.410 -15.962 1.00 36.09  ? 115  ARG B O     1 
ATOM   3384 C  CB    . ARG D  3 115 ? 9.930   -35.527 -13.083 1.00 37.34  ? 115  ARG B CB    1 
ATOM   3385 C  CG    . ARG D  3 115 ? 10.037  -36.254 -11.765 1.00 37.91  ? 115  ARG B CG    1 
ATOM   3386 C  CD    . ARG D  3 115 ? 8.845   -36.012 -10.855 1.00 37.52  ? 115  ARG B CD    1 
ATOM   3387 N  NE    . ARG D  3 115 ? 9.056   -36.670 -9.567  1.00 38.57  ? 115  ARG B NE    1 
ATOM   3388 C  CZ    . ARG D  3 115 ? 9.796   -36.157 -8.594  1.00 38.46  ? 115  ARG B CZ    1 
ATOM   3389 N  NH1   . ARG D  3 115 ? 10.379  -34.981 -8.773  1.00 39.26  ? 115  ARG B NH1   1 
ATOM   3390 N  NH2   . ARG D  3 115 ? 9.952   -36.804 -7.447  1.00 38.07  ? 115  ARG B NH2   1 
ATOM   3391 N  N     . LEU D  3 116 ? 11.189  -34.225 -15.943 1.00 35.97  ? 116  LEU B N     1 
ATOM   3392 C  CA    . LEU D  3 116 ? 11.032  -34.031 -17.384 1.00 35.84  ? 116  LEU B CA    1 
ATOM   3393 C  C     . LEU D  3 116 ? 12.210  -34.596 -18.157 1.00 36.01  ? 116  LEU B C     1 
ATOM   3394 O  O     . LEU D  3 116 ? 12.044  -35.187 -19.221 1.00 36.35  ? 116  LEU B O     1 
ATOM   3395 C  CB    . LEU D  3 116 ? 10.903  -32.545 -17.721 1.00 34.78  ? 116  LEU B CB    1 
ATOM   3396 C  CG    . LEU D  3 116 ? 9.542   -31.882 -17.583 1.00 33.99  ? 116  LEU B CG    1 
ATOM   3397 C  CD1   . LEU D  3 116 ? 9.539   -30.616 -18.399 1.00 33.78  ? 116  LEU B CD1   1 
ATOM   3398 C  CD2   . LEU D  3 116 ? 8.454   -32.816 -18.049 1.00 34.56  ? 116  LEU B CD2   1 
ATOM   3399 N  N     . VAL D  3 117 ? 13.403  -34.384 -17.618 1.00 37.65  ? 117  VAL B N     1 
ATOM   3400 C  CA    . VAL D  3 117 ? 14.632  -34.890 -18.207 1.00 38.35  ? 117  VAL B CA    1 
ATOM   3401 C  C     . VAL D  3 117 ? 14.524  -36.389 -18.449 1.00 38.84  ? 117  VAL B C     1 
ATOM   3402 O  O     . VAL D  3 117 ? 14.881  -36.881 -19.523 1.00 39.11  ? 117  VAL B O     1 
ATOM   3403 C  CB    . VAL D  3 117 ? 15.847  -34.567 -17.313 1.00 38.72  ? 117  VAL B CB    1 
ATOM   3404 C  CG1   . VAL D  3 117 ? 17.058  -35.378 -17.732 1.00 38.85  ? 117  VAL B CG1   1 
ATOM   3405 C  CG2   . VAL D  3 117 ? 16.157  -33.075 -17.365 1.00 38.10  ? 117  VAL B CG2   1 
ATOM   3406 N  N     . LYS D  3 118 ? 14.008  -37.108 -17.455 1.00 39.18  ? 118  LYS B N     1 
ATOM   3407 C  CA    . LYS D  3 118 ? 13.782  -38.537 -17.593 1.00 38.62  ? 118  LYS B CA    1 
ATOM   3408 C  C     . LYS D  3 118 ? 12.670  -38.811 -18.596 1.00 37.56  ? 118  LYS B C     1 
ATOM   3409 O  O     . LYS D  3 118 ? 12.835  -39.608 -19.518 1.00 37.00  ? 118  LYS B O     1 
ATOM   3410 C  CB    . LYS D  3 118 ? 13.454  -39.164 -16.238 1.00 40.56  ? 118  LYS B CB    1 
ATOM   3411 C  CG    . LYS D  3 118 ? 14.644  -39.200 -15.294 1.00 42.88  ? 118  LYS B CG    1 
ATOM   3412 C  CD    . LYS D  3 118 ? 14.314  -39.921 -13.997 1.00 44.45  ? 118  LYS B CD    1 
ATOM   3413 C  CE    . LYS D  3 118 ? 15.510  -39.891 -13.042 1.00 45.46  ? 118  LYS B CE    1 
ATOM   3414 N  NZ    . LYS D  3 118 ? 15.096  -40.156 -11.630 1.00 46.26  ? 118  LYS B NZ    1 
ATOM   3415 N  N     . VAL D  3 119 ? 11.537  -38.143 -18.421 1.00 36.83  ? 119  VAL B N     1 
ATOM   3416 C  CA    . VAL D  3 119 ? 10.405  -38.326 -19.330 1.00 36.25  ? 119  VAL B CA    1 
ATOM   3417 C  C     . VAL D  3 119 ? 10.802  -38.093 -20.794 1.00 35.28  ? 119  VAL B C     1 
ATOM   3418 O  O     . VAL D  3 119 ? 10.286  -38.746 -21.690 1.00 33.71  ? 119  VAL B O     1 
ATOM   3419 C  CB    . VAL D  3 119 ? 9.222   -37.405 -18.966 1.00 35.95  ? 119  VAL B CB    1 
ATOM   3420 C  CG1   . VAL D  3 119 ? 8.178   -37.419 -20.074 1.00 36.69  ? 119  VAL B CG1   1 
ATOM   3421 C  CG2   . VAL D  3 119 ? 8.602   -37.823 -17.643 1.00 35.77  ? 119  VAL B CG2   1 
ATOM   3422 N  N     . LEU D  3 120 ? 11.728  -37.170 -21.029 1.00 35.29  ? 120  LEU B N     1 
ATOM   3423 C  CA    . LEU D  3 120 ? 12.132  -36.835 -22.395 1.00 36.39  ? 120  LEU B CA    1 
ATOM   3424 C  C     . LEU D  3 120 ? 13.402  -37.558 -22.861 1.00 37.36  ? 120  LEU B C     1 
ATOM   3425 O  O     . LEU D  3 120 ? 13.980  -37.195 -23.892 1.00 37.91  ? 120  LEU B O     1 
ATOM   3426 C  CB    . LEU D  3 120 ? 12.274  -35.321 -22.553 1.00 35.22  ? 120  LEU B CB    1 
ATOM   3427 C  CG    . LEU D  3 120 ? 11.052  -34.523 -22.083 1.00 35.46  ? 120  LEU B CG    1 
ATOM   3428 C  CD1   . LEU D  3 120 ? 11.361  -33.031 -22.019 1.00 35.36  ? 120  LEU B CD1   1 
ATOM   3429 C  CD2   . LEU D  3 120 ? 9.820   -34.798 -22.938 1.00 34.17  ? 120  LEU B CD2   1 
ATOM   3430 N  N     . ASN D  3 121 ? 13.814  -38.585 -22.113 1.00 37.99  ? 121  ASN B N     1 
ATOM   3431 C  CA    . ASN D  3 121 ? 14.976  -39.409 -22.464 1.00 38.93  ? 121  ASN B CA    1 
ATOM   3432 C  C     . ASN D  3 121 ? 16.262  -38.598 -22.555 1.00 39.13  ? 121  ASN B C     1 
ATOM   3433 O  O     . ASN D  3 121 ? 16.963  -38.636 -23.567 1.00 38.70  ? 121  ASN B O     1 
ATOM   3434 C  CB    . ASN D  3 121 ? 14.753  -40.162 -23.775 1.00 40.57  ? 121  ASN B CB    1 
ATOM   3435 C  CG    . ASN D  3 121 ? 13.478  -40.991 -23.769 1.00 43.23  ? 121  ASN B CG    1 
ATOM   3436 O  OD1   . ASN D  3 121 ? 12.656  -40.895 -24.693 1.00 44.45  ? 121  ASN B OD1   1 
ATOM   3437 N  ND2   . ASN D  3 121 ? 13.302  -41.808 -22.729 1.00 41.99  ? 121  ASN B ND2   1 
ATOM   3438 N  N     . ASN D  3 122 ? 16.558  -37.866 -21.486 1.00 38.86  ? 122  ASN B N     1 
ATOM   3439 C  CA    . ASN D  3 122 ? 17.774  -37.068 -21.397 1.00 38.20  ? 122  ASN B CA    1 
ATOM   3440 C  C     . ASN D  3 122 ? 18.017  -36.202 -22.622 1.00 37.50  ? 122  ASN B C     1 
ATOM   3441 O  O     . ASN D  3 122 ? 19.012  -36.384 -23.333 1.00 36.98  ? 122  ASN B O     1 
ATOM   3442 C  CB    . ASN D  3 122 ? 18.982  -37.960 -21.116 1.00 38.74  ? 122  ASN B CB    1 
ATOM   3443 C  CG    . ASN D  3 122 ? 18.910  -38.605 -19.755 1.00 39.79  ? 122  ASN B CG    1 
ATOM   3444 O  OD1   . ASN D  3 122 ? 19.718  -38.309 -18.871 1.00 40.77  ? 122  ASN B OD1   1 
ATOM   3445 N  ND2   . ASN D  3 122 ? 17.921  -39.467 -19.562 1.00 38.92  ? 122  ASN B ND2   1 
ATOM   3446 N  N     . PRO D  3 123 ? 17.115  -35.236 -22.858 1.00 36.80  ? 123  PRO B N     1 
ATOM   3447 C  CA    . PRO D  3 123 ? 17.248  -34.335 -23.985 1.00 36.29  ? 123  PRO B CA    1 
ATOM   3448 C  C     . PRO D  3 123 ? 18.437  -33.413 -23.750 1.00 36.09  ? 123  PRO B C     1 
ATOM   3449 O  O     . PRO D  3 123 ? 18.786  -33.143 -22.595 1.00 36.06  ? 123  PRO B O     1 
ATOM   3450 C  CB    . PRO D  3 123 ? 15.946  -33.534 -23.936 1.00 36.93  ? 123  PRO B CB    1 
ATOM   3451 C  CG    . PRO D  3 123 ? 15.554  -33.555 -22.502 1.00 36.93  ? 123  PRO B CG    1 
ATOM   3452 C  CD    . PRO D  3 123 ? 15.933  -34.920 -22.035 1.00 36.92  ? 123  PRO B CD    1 
ATOM   3453 N  N     . THR D  3 124 ? 19.060  -32.943 -24.825 1.00 34.98  ? 124  THR B N     1 
ATOM   3454 C  CA    . THR D  3 124 ? 20.168  -32.010 -24.689 1.00 35.09  ? 124  THR B CA    1 
ATOM   3455 C  C     . THR D  3 124 ? 19.910  -30.749 -25.479 1.00 34.92  ? 124  THR B C     1 
ATOM   3456 O  O     . THR D  3 124 ? 20.744  -29.842 -25.495 1.00 36.95  ? 124  THR B O     1 
ATOM   3457 C  CB    . THR D  3 124 ? 21.494  -32.599 -25.210 1.00 35.63  ? 124  THR B CB    1 
ATOM   3458 O  OG1   . THR D  3 124 ? 21.407  -32.766 -26.635 1.00 35.74  ? 124  THR B OG1   1 
ATOM   3459 C  CG2   . THR D  3 124 ? 21.825  -33.936 -24.519 1.00 34.10  ? 124  THR B CG2   1 
ATOM   3460 N  N     . THR D  3 125 ? 18.771  -30.696 -26.154 1.00 34.23  ? 125  THR B N     1 
ATOM   3461 C  CA    . THR D  3 125 ? 18.463  -29.578 -27.030 1.00 35.25  ? 125  THR B CA    1 
ATOM   3462 C  C     . THR D  3 125 ? 16.971  -29.273 -27.028 1.00 35.86  ? 125  THR B C     1 
ATOM   3463 O  O     . THR D  3 125 ? 16.156  -30.140 -26.721 1.00 36.33  ? 125  THR B O     1 
ATOM   3464 C  CB    . THR D  3 125 ? 18.882  -29.872 -28.499 1.00 35.28  ? 125  THR B CB    1 
ATOM   3465 O  OG1   . THR D  3 125 ? 18.253  -31.075 -28.943 1.00 35.82  ? 125  THR B OG1   1 
ATOM   3466 C  CG2   . THR D  3 125 ? 20.400  -30.015 -28.641 1.00 35.50  ? 125  THR B CG2   1 
ATOM   3467 N  N     . SER D  3 126 ? 16.623  -28.037 -27.376 1.00 36.37  ? 126  SER B N     1 
ATOM   3468 C  CA    . SER D  3 126 ? 15.242  -27.688 -27.674 1.00 37.77  ? 126  SER B CA    1 
ATOM   3469 C  C     . SER D  3 126 ? 14.874  -28.208 -29.067 1.00 38.81  ? 126  SER B C     1 
ATOM   3470 O  O     . SER D  3 126 ? 15.752  -28.435 -29.903 1.00 37.79  ? 126  SER B O     1 
ATOM   3471 C  CB    . SER D  3 126 ? 15.050  -26.170 -27.629 1.00 38.12  ? 126  SER B CB    1 
ATOM   3472 O  OG    . SER D  3 126 ? 15.640  -25.547 -28.756 1.00 39.13  ? 126  SER B OG    1 
ATOM   3473 N  N     . PRO D  3 127 ? 13.568  -28.386 -29.330 1.00 39.76  ? 127  PRO B N     1 
ATOM   3474 C  CA    . PRO D  3 127 ? 13.146  -28.876 -30.645 1.00 39.41  ? 127  PRO B CA    1 
ATOM   3475 C  C     . PRO D  3 127 ? 13.602  -27.966 -31.797 1.00 39.96  ? 127  PRO B C     1 
ATOM   3476 O  O     . PRO D  3 127 ? 13.600  -28.391 -32.952 1.00 39.79  ? 127  PRO B O     1 
ATOM   3477 C  CB    . PRO D  3 127 ? 11.614  -28.912 -30.539 1.00 38.34  ? 127  PRO B CB    1 
ATOM   3478 C  CG    . PRO D  3 127 ? 11.274  -28.071 -29.368 1.00 38.29  ? 127  PRO B CG    1 
ATOM   3479 C  CD    . PRO D  3 127 ? 12.424  -28.147 -28.432 1.00 39.08  ? 127  PRO B CD    1 
ATOM   3480 N  N     . PHE D  3 128 ? 14.000  -26.737 -31.476 1.00 39.45  ? 128  PHE B N     1 
ATOM   3481 C  CA    . PHE D  3 128 ? 14.504  -25.801 -32.472 1.00 39.41  ? 128  PHE B CA    1 
ATOM   3482 C  C     . PHE D  3 128 ? 16.035  -25.866 -32.619 1.00 39.16  ? 128  PHE B C     1 
ATOM   3483 O  O     . PHE D  3 128 ? 16.617  -25.088 -33.378 1.00 39.17  ? 128  PHE B O     1 
ATOM   3484 C  CB    . PHE D  3 128 ? 14.051  -24.374 -32.139 1.00 40.82  ? 128  PHE B CB    1 
ATOM   3485 C  CG    . PHE D  3 128 ? 12.574  -24.263 -31.836 1.00 43.46  ? 128  PHE B CG    1 
ATOM   3486 C  CD1   . PHE D  3 128 ? 12.129  -24.040 -30.542 1.00 43.88  ? 128  PHE B CD1   1 
ATOM   3487 C  CD2   . PHE D  3 128 ? 11.628  -24.413 -32.847 1.00 44.68  ? 128  PHE B CD2   1 
ATOM   3488 C  CE1   . PHE D  3 128 ? 10.777  -23.958 -30.260 1.00 44.64  ? 128  PHE B CE1   1 
ATOM   3489 C  CE2   . PHE D  3 128 ? 10.269  -24.333 -32.571 1.00 44.91  ? 128  PHE B CE2   1 
ATOM   3490 C  CZ    . PHE D  3 128 ? 9.845   -24.104 -31.277 1.00 45.59  ? 128  PHE B CZ    1 
ATOM   3491 N  N     . GLY D  3 129 ? 16.682  -26.776 -31.889 1.00 37.51  ? 129  GLY B N     1 
ATOM   3492 C  CA    . GLY D  3 129 ? 18.122  -27.003 -32.033 1.00 36.17  ? 129  GLY B CA    1 
ATOM   3493 C  C     . GLY D  3 129 ? 19.032  -26.450 -30.943 1.00 36.13  ? 129  GLY B C     1 
ATOM   3494 O  O     . GLY D  3 129 ? 20.118  -26.990 -30.702 1.00 36.32  ? 129  GLY B O     1 
ATOM   3495 N  N     . ASN D  3 130 ? 18.606  -25.370 -30.286 1.00 35.90  ? 130  ASN B N     1 
ATOM   3496 C  CA    . ASN D  3 130 ? 19.424  -24.732 -29.247 1.00 34.87  ? 130  ASN B CA    1 
ATOM   3497 C  C     . ASN D  3 130 ? 19.685  -25.664 -28.064 1.00 34.02  ? 130  ASN B C     1 
ATOM   3498 O  O     . ASN D  3 130 ? 18.831  -26.493 -27.721 1.00 33.73  ? 130  ASN B O     1 
ATOM   3499 C  CB    . ASN D  3 130 ? 18.792  -23.428 -28.753 1.00 34.93  ? 130  ASN B CB    1 
ATOM   3500 C  CG    . ASN D  3 130 ? 18.120  -22.635 -29.866 1.00 34.66  ? 130  ASN B CG    1 
ATOM   3501 O  OD1   . ASN D  3 130 ? 17.161  -23.100 -30.474 1.00 33.74  ? 130  ASN B OD1   1 
ATOM   3502 N  ND2   . ASN D  3 130 ? 18.609  -21.423 -30.115 1.00 33.19  ? 130  ASN B ND2   1 
ATOM   3503 N  N     . PRO D  3 131 ? 20.874  -25.542 -27.448 1.00 32.60  ? 131  PRO B N     1 
ATOM   3504 C  CA    . PRO D  3 131 ? 21.245  -26.424 -26.346 1.00 33.33  ? 131  PRO B CA    1 
ATOM   3505 C  C     . PRO D  3 131 ? 20.481  -26.075 -25.072 1.00 33.45  ? 131  PRO B C     1 
ATOM   3506 O  O     . PRO D  3 131 ? 20.073  -24.921 -24.893 1.00 33.28  ? 131  PRO B O     1 
ATOM   3507 C  CB    . PRO D  3 131 ? 22.743  -26.155 -26.172 1.00 32.54  ? 131  PRO B CB    1 
ATOM   3508 C  CG    . PRO D  3 131 ? 22.929  -24.765 -26.669 1.00 33.35  ? 131  PRO B CG    1 
ATOM   3509 C  CD    . PRO D  3 131 ? 21.935  -24.571 -27.766 1.00 32.32  ? 131  PRO B CD    1 
ATOM   3510 N  N     . ILE D  3 132 ? 20.274  -27.070 -24.211 1.00 32.40  ? 132  ILE B N     1 
ATOM   3511 C  CA    . ILE D  3 132 ? 19.586  -26.864 -22.940 1.00 32.48  ? 132  ILE B CA    1 
ATOM   3512 C  C     . ILE D  3 132 ? 20.607  -26.628 -21.837 1.00 33.16  ? 132  ILE B C     1 
ATOM   3513 O  O     . ILE D  3 132 ? 21.377  -27.520 -21.495 1.00 33.67  ? 132  ILE B O     1 
ATOM   3514 C  CB    . ILE D  3 132 ? 18.686  -28.070 -22.569 1.00 31.86  ? 132  ILE B CB    1 
ATOM   3515 C  CG1   . ILE D  3 132 ? 17.567  -28.233 -23.597 1.00 30.65  ? 132  ILE B CG1   1 
ATOM   3516 C  CG2   . ILE D  3 132 ? 18.093  -27.900 -21.176 1.00 31.38  ? 132  ILE B CG2   1 
ATOM   3517 C  CD1   . ILE D  3 132 ? 16.820  -29.531 -23.477 1.00 30.14  ? 132  ILE B CD1   1 
ATOM   3518 N  N     . PRO D  3 133 ? 20.616  -25.413 -21.272 1.00 34.00  ? 133  PRO B N     1 
ATOM   3519 C  CA    . PRO D  3 133 ? 21.624  -25.044 -20.277 1.00 33.06  ? 133  PRO B CA    1 
ATOM   3520 C  C     . PRO D  3 133 ? 21.294  -25.531 -18.875 1.00 32.36  ? 133  PRO B C     1 
ATOM   3521 O  O     . PRO D  3 133 ? 20.158  -25.890 -18.597 1.00 32.17  ? 133  PRO B O     1 
ATOM   3522 C  CB    . PRO D  3 133 ? 21.598  -23.517 -20.316 1.00 32.92  ? 133  PRO B CB    1 
ATOM   3523 C  CG    . PRO D  3 133 ? 20.197  -23.183 -20.683 1.00 33.37  ? 133  PRO B CG    1 
ATOM   3524 C  CD    . PRO D  3 133 ? 19.676  -24.312 -21.550 1.00 33.10  ? 133  PRO B CD    1 
ATOM   3525 N  N     . GLY D  3 134 ? 22.302  -25.546 -18.009 1.00 33.04  ? 134  GLY B N     1 
ATOM   3526 C  CA    . GLY D  3 134 ? 22.132  -25.856 -16.591 1.00 33.48  ? 134  GLY B CA    1 
ATOM   3527 C  C     . GLY D  3 134 ? 21.590  -27.229 -16.250 1.00 34.05  ? 134  GLY B C     1 
ATOM   3528 O  O     . GLY D  3 134 ? 20.911  -27.393 -15.236 1.00 33.63  ? 134  GLY B O     1 
ATOM   3529 N  N     . LEU D  3 135 ? 21.885  -28.220 -17.085 1.00 35.65  ? 135  LEU B N     1 
ATOM   3530 C  CA    . LEU D  3 135 ? 21.447  -29.587 -16.816 1.00 37.21  ? 135  LEU B CA    1 
ATOM   3531 C  C     . LEU D  3 135 ? 22.292  -30.196 -15.700 1.00 38.31  ? 135  LEU B C     1 
ATOM   3532 O  O     . LEU D  3 135 ? 21.838  -31.071 -14.960 1.00 38.06  ? 135  LEU B O     1 
ATOM   3533 C  CB    . LEU D  3 135 ? 21.526  -30.436 -18.083 1.00 37.89  ? 135  LEU B CB    1 
ATOM   3534 C  CG    . LEU D  3 135 ? 20.497  -30.120 -19.174 1.00 38.56  ? 135  LEU B CG    1 
ATOM   3535 C  CD1   . LEU D  3 135 ? 20.875  -30.764 -20.504 1.00 38.93  ? 135  LEU B CD1   1 
ATOM   3536 C  CD2   . LEU D  3 135 ? 19.101  -30.550 -18.747 1.00 38.14  ? 135  LEU B CD2   1 
ATOM   3537 N  N     . VAL D  3 136 ? 23.522  -29.707 -15.579 1.00 40.38  ? 136  VAL B N     1 
ATOM   3538 C  CA    . VAL D  3 136 ? 24.431  -30.149 -14.530 1.00 42.90  ? 136  VAL B CA    1 
ATOM   3539 C  C     . VAL D  3 136 ? 23.948  -29.688 -13.156 1.00 44.64  ? 136  VAL B C     1 
ATOM   3540 O  O     . VAL D  3 136 ? 23.731  -30.505 -12.257 1.00 45.35  ? 136  VAL B O     1 
ATOM   3541 C  CB    . VAL D  3 136 ? 25.881  -29.661 -14.792 1.00 42.89  ? 136  VAL B CB    1 
ATOM   3542 C  CG1   . VAL D  3 136 ? 26.712  -29.709 -13.521 1.00 43.14  ? 136  VAL B CG1   1 
ATOM   3543 C  CG2   . VAL D  3 136 ? 26.534  -30.490 -15.891 1.00 42.90  ? 136  VAL B CG2   1 
ATOM   3544 N  N     . GLU D  3 137 ? 23.763  -28.383 -12.994 1.00 46.27  ? 137  GLU B N     1 
ATOM   3545 C  CA    . GLU D  3 137 ? 23.358  -27.852 -11.699 1.00 48.08  ? 137  GLU B CA    1 
ATOM   3546 C  C     . GLU D  3 137 ? 21.923  -28.224 -11.335 1.00 48.37  ? 137  GLU B C     1 
ATOM   3547 O  O     . GLU D  3 137 ? 21.521  -28.093 -10.183 1.00 49.43  ? 137  GLU B O     1 
ATOM   3548 C  CB    . GLU D  3 137 ? 23.594  -26.339 -11.606 1.00 49.01  ? 137  GLU B CB    1 
ATOM   3549 C  CG    . GLU D  3 137 ? 23.313  -25.556 -12.883 1.00 50.46  ? 137  GLU B CG    1 
ATOM   3550 C  CD    . GLU D  3 137 ? 24.431  -25.657 -13.911 1.00 50.36  ? 137  GLU B CD    1 
ATOM   3551 O  OE1   . GLU D  3 137 ? 24.479  -26.664 -14.648 1.00 50.64  ? 137  GLU B OE1   1 
ATOM   3552 O  OE2   . GLU D  3 137 ? 25.248  -24.717 -13.998 1.00 50.33  ? 137  GLU B OE2   1 
ATOM   3553 N  N     . LEU D  3 138 ? 21.165  -28.713 -12.310 1.00 48.63  ? 138  LEU B N     1 
ATOM   3554 C  CA    . LEU D  3 138 ? 19.840  -29.265 -12.049 1.00 49.36  ? 138  LEU B CA    1 
ATOM   3555 C  C     . LEU D  3 138 ? 19.979  -30.600 -11.316 1.00 51.70  ? 138  LEU B C     1 
ATOM   3556 O  O     . LEU D  3 138 ? 19.014  -31.114 -10.743 1.00 52.74  ? 138  LEU B O     1 
ATOM   3557 C  CB    . LEU D  3 138 ? 19.092  -29.487 -13.365 1.00 47.34  ? 138  LEU B CB    1 
ATOM   3558 C  CG    . LEU D  3 138 ? 17.567  -29.379 -13.467 1.00 45.63  ? 138  LEU B CG    1 
ATOM   3559 C  CD1   . LEU D  3 138 ? 17.061  -30.426 -14.437 1.00 44.14  ? 138  LEU B CD1   1 
ATOM   3560 C  CD2   . LEU D  3 138 ? 16.855  -29.502 -12.135 1.00 44.50  ? 138  LEU B CD2   1 
ATOM   3561 N  N     . GLY D  3 139 ? 21.179  -31.171 -11.357 1.00 53.88  ? 139  GLY B N     1 
ATOM   3562 C  CA    . GLY D  3 139 ? 21.467  -32.407 -10.629 1.00 55.91  ? 139  GLY B CA    1 
ATOM   3563 C  C     . GLY D  3 139 ? 21.317  -33.676 -11.447 1.00 57.17  ? 139  GLY B C     1 
ATOM   3564 O  O     . GLY D  3 139 ? 20.815  -34.685 -10.948 1.00 58.34  ? 139  GLY B O     1 
ATOM   3565 N  N     . VAL D  3 140 ? 21.738  -33.629 -12.711 1.00 57.91  ? 140  VAL B N     1 
ATOM   3566 C  CA    . VAL D  3 140 ? 21.760  -34.820 -13.563 1.00 57.70  ? 140  VAL B CA    1 
ATOM   3567 C  C     . VAL D  3 140 ? 22.950  -34.777 -14.526 1.00 57.28  ? 140  VAL B C     1 
ATOM   3568 O  O     . VAL D  3 140 ? 22.875  -35.280 -15.649 1.00 55.93  ? 140  VAL B O     1 
ATOM   3569 C  CB    . VAL D  3 140 ? 20.467  -34.986 -14.386 1.00 58.53  ? 140  VAL B CB    1 
ATOM   3570 C  CG1   . VAL D  3 140 ? 20.210  -36.474 -14.657 1.00 59.13  ? 140  VAL B CG1   1 
ATOM   3571 C  CG2   . VAL D  3 140 ? 19.266  -34.342 -13.685 1.00 58.40  ? 140  VAL B CG2   1 
ATOM   3572 N  N     . MET E  3 1   ? -2.118  8.336   15.827  1.00 67.26  ? 1    MET C N     1 
ATOM   3573 C  CA    . MET E  3 1   ? -1.998  9.677   15.190  1.00 66.30  ? 1    MET C CA    1 
ATOM   3574 C  C     . MET E  3 1   ? -1.188  9.629   13.901  1.00 65.39  ? 1    MET C C     1 
ATOM   3575 O  O     . MET E  3 1   ? -0.231  8.861   13.764  1.00 65.10  ? 1    MET C O     1 
ATOM   3576 C  CB    . MET E  3 1   ? -1.349  10.674  16.153  1.00 67.66  ? 1    MET C CB    1 
ATOM   3577 C  CG    . MET E  3 1   ? -1.620  12.143  15.828  1.00 67.93  ? 1    MET C CG    1 
ATOM   3578 S  SD    . MET E  3 1   ? -0.382  13.244  16.543  1.00 69.08  ? 1    MET C SD    1 
ATOM   3579 C  CE    . MET E  3 1   ? 0.212   12.251  17.920  1.00 68.90  ? 1    MET C CE    1 
ATOM   3580 N  N     . ASN E  3 2   ? -1.586  10.471  12.960  1.00 63.94  ? 2    ASN C N     1 
ATOM   3581 C  CA    . ASN E  3 2   ? -0.864  10.653  11.717  1.00 61.85  ? 2    ASN C CA    1 
ATOM   3582 C  C     . ASN E  3 2   ? 0.421   11.437  11.993  1.00 60.04  ? 2    ASN C C     1 
ATOM   3583 O  O     . ASN E  3 2   ? 0.455   12.271  12.900  1.00 59.82  ? 2    ASN C O     1 
ATOM   3584 C  CB    . ASN E  3 2   ? -1.758  11.438  10.757  1.00 61.63  ? 2    ASN C CB    1 
ATOM   3585 C  CG    . ASN E  3 2   ? -1.452  11.159  9.313   1.00 61.51  ? 2    ASN C CG    1 
ATOM   3586 O  OD1   . ASN E  3 2   ? -0.310  11.282  8.873   1.00 62.03  ? 2    ASN C OD1   1 
ATOM   3587 N  ND2   . ASN E  3 2   ? -2.481  10.794  8.554   1.00 61.08  ? 2    ASN C ND2   1 
ATOM   3588 N  N     . GLU E  3 3   ? 1.480   11.157  11.239  1.00 57.33  ? 3    GLU C N     1 
ATOM   3589 C  CA    . GLU E  3 3   ? 2.680   11.988  11.296  1.00 54.76  ? 3    GLU C CA    1 
ATOM   3590 C  C     . GLU E  3 3   ? 2.333   13.395  10.799  1.00 51.31  ? 3    GLU C C     1 
ATOM   3591 O  O     . GLU E  3 3   ? 2.866   14.393  11.288  1.00 50.52  ? 3    GLU C O     1 
ATOM   3592 C  CB    . GLU E  3 3   ? 3.799   11.384  10.452  1.00 56.87  ? 3    GLU C CB    1 
ATOM   3593 C  CG    . GLU E  3 3   ? 5.018   12.291  10.279  1.00 59.33  ? 3    GLU C CG    1 
ATOM   3594 C  CD    . GLU E  3 3   ? 6.009   12.187  11.431  1.00 60.88  ? 3    GLU C CD    1 
ATOM   3595 O  OE1   . GLU E  3 3   ? 7.067   12.857  11.369  1.00 61.05  ? 3    GLU C OE1   1 
ATOM   3596 O  OE2   . GLU E  3 3   ? 5.736   11.432  12.393  1.00 61.77  ? 3    GLU C OE2   1 
ATOM   3597 N  N     . LEU E  3 4   ? 1.426   13.460  9.828   1.00 47.04  ? 4    LEU C N     1 
ATOM   3598 C  CA    . LEU E  3 4   ? 0.901   14.734  9.327   1.00 43.29  ? 4    LEU C CA    1 
ATOM   3599 C  C     . LEU E  3 4   ? -0.170  15.328  10.247  1.00 40.46  ? 4    LEU C C     1 
ATOM   3600 O  O     . LEU E  3 4   ? -0.506  16.503  10.121  1.00 39.88  ? 4    LEU C O     1 
ATOM   3601 C  CB    . LEU E  3 4   ? 0.321   14.558  7.920   1.00 42.09  ? 4    LEU C CB    1 
ATOM   3602 C  CG    . LEU E  3 4   ? 1.322   14.262  6.801   1.00 41.77  ? 4    LEU C CG    1 
ATOM   3603 C  CD1   . LEU E  3 4   ? 0.611   13.862  5.521   1.00 40.16  ? 4    LEU C CD1   1 
ATOM   3604 C  CD2   . LEU E  3 4   ? 2.242   15.462  6.563   1.00 41.68  ? 4    LEU C CD2   1 
ATOM   3605 N  N     . VAL E  3 5   ? -0.682  14.512  11.170  1.00 37.23  ? 5    VAL C N     1 
ATOM   3606 C  CA    . VAL E  3 5   ? -1.807  14.870  12.048  1.00 35.65  ? 5    VAL C CA    1 
ATOM   3607 C  C     . VAL E  3 5   ? -3.101  14.921  11.254  1.00 34.63  ? 5    VAL C C     1 
ATOM   3608 O  O     . VAL E  3 5   ? -4.065  14.251  11.587  1.00 34.14  ? 5    VAL C O     1 
ATOM   3609 C  CB    . VAL E  3 5   ? -1.608  16.216  12.795  1.00 36.13  ? 5    VAL C CB    1 
ATOM   3610 C  CG1   . VAL E  3 5   ? -2.724  16.421  13.812  1.00 34.76  ? 5    VAL C CG1   1 
ATOM   3611 C  CG2   . VAL E  3 5   ? -0.245  16.262  13.482  1.00 36.21  ? 5    VAL C CG2   1 
ATOM   3612 N  N     . ASP E  3 6   ? -3.116  15.717  10.193  1.00 34.45  ? 6    ASP C N     1 
ATOM   3613 C  CA    . ASP E  3 6   ? -4.241  15.721  9.281   1.00 34.92  ? 6    ASP C CA    1 
ATOM   3614 C  C     . ASP E  3 6   ? -3.775  15.753  7.822   1.00 34.14  ? 6    ASP C C     1 
ATOM   3615 O  O     . ASP E  3 6   ? -3.329  16.792  7.315   1.00 34.00  ? 6    ASP C O     1 
ATOM   3616 C  CB    . ASP E  3 6   ? -5.190  16.880  9.579   1.00 36.06  ? 6    ASP C CB    1 
ATOM   3617 C  CG    . ASP E  3 6   ? -6.505  16.740  8.859   1.00 37.71  ? 6    ASP C CG    1 
ATOM   3618 O  OD1   . ASP E  3 6   ? -7.342  15.914  9.279   1.00 39.35  ? 6    ASP C OD1   1 
ATOM   3619 O  OD2   . ASP E  3 6   ? -6.703  17.449  7.857   1.00 39.39  ? 6    ASP C OD2   1 
ATOM   3620 N  N     . THR E  3 7   ? -3.893  14.606  7.157   1.00 32.27  ? 7    THR C N     1 
ATOM   3621 C  CA    . THR E  3 7   ? -3.448  14.451  5.776   1.00 30.25  ? 7    THR C CA    1 
ATOM   3622 C  C     . THR E  3 7   ? -4.097  15.457  4.824   1.00 29.53  ? 7    THR C C     1 
ATOM   3623 O  O     . THR E  3 7   ? -3.393  16.204  4.140   1.00 28.34  ? 7    THR C O     1 
ATOM   3624 C  CB    . THR E  3 7   ? -3.695  13.022  5.283   1.00 30.18  ? 7    THR C CB    1 
ATOM   3625 O  OG1   . THR E  3 7   ? -2.881  12.125  6.043   1.00 30.56  ? 7    THR C OG1   1 
ATOM   3626 C  CG2   . THR E  3 7   ? -3.353  12.883  3.806   1.00 30.05  ? 7    THR C CG2   1 
ATOM   3627 N  N     . THR E  3 8   ? -5.429  15.474  4.780   1.00 28.44  ? 8    THR C N     1 
ATOM   3628 C  CA    . THR E  3 8   ? -6.156  16.392  3.901   1.00 28.81  ? 8    THR C CA    1 
ATOM   3629 C  C     . THR E  3 8   ? -5.664  17.826  4.086   1.00 29.50  ? 8    THR C C     1 
ATOM   3630 O  O     . THR E  3 8   ? -5.309  18.506  3.125   1.00 30.09  ? 8    THR C O     1 
ATOM   3631 C  CB    . THR E  3 8   ? -7.673  16.355  4.177   1.00 29.37  ? 8    THR C CB    1 
ATOM   3632 O  OG1   . THR E  3 8   ? -8.141  15.005  4.191   1.00 29.15  ? 8    THR C OG1   1 
ATOM   3633 C  CG2   . THR E  3 8   ? -8.427  17.118  3.122   1.00 29.49  ? 8    THR C CG2   1 
ATOM   3634 N  N     . GLU E  3 9   ? -5.626  18.273  5.337   1.00 30.15  ? 9    GLU C N     1 
ATOM   3635 C  CA    . GLU E  3 9   ? -5.233  19.634  5.662   1.00 31.25  ? 9    GLU C CA    1 
ATOM   3636 C  C     . GLU E  3 9   ? -3.810  19.961  5.247   1.00 31.54  ? 9    GLU C C     1 
ATOM   3637 O  O     . GLU E  3 9   ? -3.552  21.025  4.693   1.00 32.10  ? 9    GLU C O     1 
ATOM   3638 C  CB    . GLU E  3 9   ? -5.424  19.904  7.156   1.00 32.19  ? 9    GLU C CB    1 
ATOM   3639 C  CG    . GLU E  3 9   ? -6.863  20.196  7.538   1.00 32.80  ? 9    GLU C CG    1 
ATOM   3640 C  CD    . GLU E  3 9   ? -7.026  20.523  9.011   1.00 34.38  ? 9    GLU C CD    1 
ATOM   3641 O  OE1   . GLU E  3 9   ? -6.004  20.757  9.700   1.00 34.46  ? 9    GLU C OE1   1 
ATOM   3642 O  OE2   . GLU E  3 9   ? -8.185  20.539  9.480   1.00 35.42  ? 9    GLU C OE2   1 
ATOM   3643 N  N     . MET E  3 10  ? -2.882  19.059  5.542   1.00 31.88  ? 10   MET C N     1 
ATOM   3644 C  CA    . MET E  3 10  ? -1.509  19.211  5.074   1.00 32.27  ? 10   MET C CA    1 
ATOM   3645 C  C     . MET E  3 10  ? -1.424  19.327  3.546   1.00 31.84  ? 10   MET C C     1 
ATOM   3646 O  O     . MET E  3 10  ? -0.618  20.096  3.018   1.00 30.94  ? 10   MET C O     1 
ATOM   3647 C  CB    . MET E  3 10  ? -0.632  18.058  5.575   1.00 32.79  ? 10   MET C CB    1 
ATOM   3648 C  CG    . MET E  3 10  ? -0.241  18.206  7.027   1.00 32.94  ? 10   MET C CG    1 
ATOM   3649 S  SD    . MET E  3 10  ? 0.346   19.872  7.370   1.00 35.54  ? 10   MET C SD    1 
ATOM   3650 C  CE    . MET E  3 10  ? 1.887   19.921  6.452   1.00 33.59  ? 10   MET C CE    1 
ATOM   3651 N  N     . TYR E  3 11  ? -2.254  18.558  2.843   1.00 31.71  ? 11   TYR C N     1 
ATOM   3652 C  CA    . TYR E  3 11  ? -2.308  18.625  1.384   1.00 31.25  ? 11   TYR C CA    1 
ATOM   3653 C  C     . TYR E  3 11  ? -2.794  20.006  0.941   1.00 31.79  ? 11   TYR C C     1 
ATOM   3654 O  O     . TYR E  3 11  ? -2.180  20.642  0.091   1.00 32.05  ? 11   TYR C O     1 
ATOM   3655 C  CB    . TYR E  3 11  ? -3.218  17.531  0.826   1.00 30.23  ? 11   TYR C CB    1 
ATOM   3656 C  CG    . TYR E  3 11  ? -2.525  16.205  0.577   1.00 30.77  ? 11   TYR C CG    1 
ATOM   3657 C  CD1   . TYR E  3 11  ? -1.740  15.602  1.564   1.00 30.68  ? 11   TYR C CD1   1 
ATOM   3658 C  CD2   . TYR E  3 11  ? -2.670  15.543  -0.640  1.00 30.14  ? 11   TYR C CD2   1 
ATOM   3659 C  CE1   . TYR E  3 11  ? -1.109  14.381  1.340   1.00 29.82  ? 11   TYR C CE1   1 
ATOM   3660 C  CE2   . TYR E  3 11  ? -2.044  14.322  -0.874  1.00 30.15  ? 11   TYR C CE2   1 
ATOM   3661 C  CZ    . TYR E  3 11  ? -1.264  13.746  0.118   1.00 30.13  ? 11   TYR C CZ    1 
ATOM   3662 O  OH    . TYR E  3 11  ? -0.639  12.541  -0.118  1.00 28.80  ? 11   TYR C OH    1 
ATOM   3663 N  N     . LEU E  3 12  ? -3.893  20.465  1.536   1.00 32.11  ? 12   LEU C N     1 
ATOM   3664 C  CA    . LEU E  3 12  ? -4.409  21.809  1.291   1.00 31.78  ? 12   LEU C CA    1 
ATOM   3665 C  C     . LEU E  3 12  ? -3.351  22.878  1.551   1.00 33.11  ? 12   LEU C C     1 
ATOM   3666 O  O     . LEU E  3 12  ? -3.097  23.726  0.698   1.00 33.33  ? 12   LEU C O     1 
ATOM   3667 C  CB    . LEU E  3 12  ? -5.628  22.074  2.170   1.00 30.62  ? 12   LEU C CB    1 
ATOM   3668 C  CG    . LEU E  3 12  ? -6.879  21.288  1.793   1.00 30.21  ? 12   LEU C CG    1 
ATOM   3669 C  CD1   . LEU E  3 12  ? -7.955  21.492  2.826   1.00 29.74  ? 12   LEU C CD1   1 
ATOM   3670 C  CD2   . LEU E  3 12  ? -7.382  21.687  0.409   1.00 30.37  ? 12   LEU C CD2   1 
ATOM   3671 N  N     . ARG E  3 13  ? -2.729  22.827  2.724   1.00 35.05  ? 13   ARG C N     1 
ATOM   3672 C  CA    . ARG E  3 13  ? -1.744  23.833  3.114   1.00 37.01  ? 13   ARG C CA    1 
ATOM   3673 C  C     . ARG E  3 13  ? -0.495  23.762  2.234   1.00 36.66  ? 13   ARG C C     1 
ATOM   3674 O  O     . ARG E  3 13  ? 0.160   24.774  1.981   1.00 37.41  ? 13   ARG C O     1 
ATOM   3675 C  CB    . ARG E  3 13  ? -1.389  23.684  4.601   1.00 39.28  ? 13   ARG C CB    1 
ATOM   3676 C  CG    . ARG E  3 13  ? -0.985  24.988  5.290   1.00 41.33  ? 13   ARG C CG    1 
ATOM   3677 C  CD    . ARG E  3 13  ? 0.520   25.172  5.326   1.00 42.75  ? 13   ARG C CD    1 
ATOM   3678 N  NE    . ARG E  3 13  ? 1.123   24.318  6.339   1.00 45.09  ? 13   ARG C NE    1 
ATOM   3679 C  CZ    . ARG E  3 13  ? 2.429   24.211  6.548   1.00 45.98  ? 13   ARG C CZ    1 
ATOM   3680 N  NH1   . ARG E  3 13  ? 3.274   24.908  5.800   1.00 47.26  ? 13   ARG C NH1   1 
ATOM   3681 N  NH2   . ARG E  3 13  ? 2.890   23.405  7.500   1.00 46.49  ? 13   ARG C NH2   1 
ATOM   3682 N  N     . THR E  3 14  ? -0.169  22.565  1.759   1.00 36.70  ? 14   THR C N     1 
ATOM   3683 C  CA    . THR E  3 14  ? 0.951   22.408  0.838   1.00 35.58  ? 14   THR C CA    1 
ATOM   3684 C  C     . THR E  3 14  ? 0.624   23.060  -0.486  1.00 35.31  ? 14   THR C C     1 
ATOM   3685 O  O     . THR E  3 14  ? 1.456   23.762  -1.061  1.00 35.35  ? 14   THR C O     1 
ATOM   3686 C  CB    . THR E  3 14  ? 1.316   20.936  0.597   1.00 35.16  ? 14   THR C CB    1 
ATOM   3687 O  OG1   . THR E  3 14  ? 1.683   20.337  1.842   1.00 34.39  ? 14   THR C OG1   1 
ATOM   3688 C  CG2   . THR E  3 14  ? 2.491   20.829  -0.383  1.00 33.23  ? 14   THR C CG2   1 
ATOM   3689 N  N     . ILE E  3 15  ? -0.591  22.831  -0.968  1.00 35.69  ? 15   ILE C N     1 
ATOM   3690 C  CA    . ILE E  3 15  ? -1.036  23.510  -2.179  1.00 36.72  ? 15   ILE C CA    1 
ATOM   3691 C  C     . ILE E  3 15  ? -0.950  25.024  -1.969  1.00 37.40  ? 15   ILE C C     1 
ATOM   3692 O  O     . ILE E  3 15  ? -0.346  25.733  -2.775  1.00 37.22  ? 15   ILE C O     1 
ATOM   3693 C  CB    . ILE E  3 15  ? -2.450  23.073  -2.619  1.00 36.20  ? 15   ILE C CB    1 
ATOM   3694 C  CG1   . ILE E  3 15  ? -2.457  21.576  -2.958  1.00 35.11  ? 15   ILE C CG1   1 
ATOM   3695 C  CG2   . ILE E  3 15  ? -2.917  23.907  -3.824  1.00 35.73  ? 15   ILE C CG2   1 
ATOM   3696 C  CD1   . ILE E  3 15  ? -3.839  20.989  -3.207  1.00 34.39  ? 15   ILE C CD1   1 
ATOM   3697 N  N     . TYR E  3 16  ? -1.523  25.503  -0.866  1.00 38.10  ? 16   TYR C N     1 
ATOM   3698 C  CA    . TYR E  3 16  ? -1.422  26.912  -0.504  1.00 38.83  ? 16   TYR C CA    1 
ATOM   3699 C  C     . TYR E  3 16  ? 0.021   27.440  -0.581  1.00 39.61  ? 16   TYR C C     1 
ATOM   3700 O  O     . TYR E  3 16  ? 0.275   28.450  -1.237  1.00 39.54  ? 16   TYR C O     1 
ATOM   3701 C  CB    . TYR E  3 16  ? -2.021  27.175  0.887   1.00 38.89  ? 16   TYR C CB    1 
ATOM   3702 C  CG    . TYR E  3 16  ? -2.151  28.652  1.199   1.00 38.43  ? 16   TYR C CG    1 
ATOM   3703 C  CD1   . TYR E  3 16  ? -1.059  29.379  1.644   1.00 38.16  ? 16   TYR C CD1   1 
ATOM   3704 C  CD2   . TYR E  3 16  ? -3.366  29.325  1.023   1.00 38.78  ? 16   TYR C CD2   1 
ATOM   3705 C  CE1   . TYR E  3 16  ? -1.159  30.725  1.917   1.00 39.21  ? 16   TYR C CE1   1 
ATOM   3706 C  CE2   . TYR E  3 16  ? -3.480  30.679  1.296   1.00 39.16  ? 16   TYR C CE2   1 
ATOM   3707 C  CZ    . TYR E  3 16  ? -2.366  31.373  1.741   1.00 39.45  ? 16   TYR C CZ    1 
ATOM   3708 O  OH    . TYR E  3 16  ? -2.439  32.713  2.014   1.00 39.89  ? 16   TYR C OH    1 
ATOM   3709 N  N     . ASP E  3 17  ? 0.954   26.771  0.097   1.00 40.63  ? 17   ASP C N     1 
ATOM   3710 C  CA    . ASP E  3 17  ? 2.367   27.172  0.072   1.00 41.82  ? 17   ASP C CA    1 
ATOM   3711 C  C     . ASP E  3 17  ? 2.907   27.310  -1.349  1.00 42.26  ? 17   ASP C C     1 
ATOM   3712 O  O     . ASP E  3 17  ? 3.630   28.260  -1.660  1.00 42.25  ? 17   ASP C O     1 
ATOM   3713 C  CB    . ASP E  3 17  ? 3.238   26.150  0.804   1.00 43.35  ? 17   ASP C CB    1 
ATOM   3714 C  CG    . ASP E  3 17  ? 3.110   26.229  2.314   1.00 44.93  ? 17   ASP C CG    1 
ATOM   3715 O  OD1   . ASP E  3 17  ? 3.111   27.352  2.869   1.00 45.69  ? 17   ASP C OD1   1 
ATOM   3716 O  OD2   . ASP E  3 17  ? 3.038   25.156  2.950   1.00 45.52  ? 17   ASP C OD2   1 
ATOM   3717 N  N     . LEU E  3 18  ? 2.579   26.340  -2.197  1.00 42.13  ? 18   LEU C N     1 
ATOM   3718 C  CA    . LEU E  3 18  ? 3.113   26.289  -3.547  1.00 42.55  ? 18   LEU C CA    1 
ATOM   3719 C  C     . LEU E  3 18  ? 2.607   27.460  -4.358  1.00 43.43  ? 18   LEU C C     1 
ATOM   3720 O  O     . LEU E  3 18  ? 3.386   28.168  -4.999  1.00 42.91  ? 18   LEU C O     1 
ATOM   3721 C  CB    . LEU E  3 18  ? 2.734   24.968  -4.213  1.00 42.68  ? 18   LEU C CB    1 
ATOM   3722 C  CG    . LEU E  3 18  ? 3.484   23.751  -3.652  1.00 41.95  ? 18   LEU C CG    1 
ATOM   3723 C  CD1   . LEU E  3 18  ? 2.771   22.462  -4.008  1.00 41.30  ? 18   LEU C CD1   1 
ATOM   3724 C  CD2   . LEU E  3 18  ? 4.936   23.737  -4.126  1.00 41.02  ? 18   LEU C CD2   1 
ATOM   3725 N  N     . GLU E  3 19  ? 1.295   27.660  -4.313  1.00 44.88  ? 19   GLU C N     1 
ATOM   3726 C  CA    . GLU E  3 19  ? 0.657   28.807  -4.925  1.00 46.53  ? 19   GLU C CA    1 
ATOM   3727 C  C     . GLU E  3 19  ? 1.348   30.092  -4.464  1.00 47.58  ? 19   GLU C C     1 
ATOM   3728 O  O     . GLU E  3 19  ? 1.692   30.952  -5.273  1.00 47.72  ? 19   GLU C O     1 
ATOM   3729 C  CB    . GLU E  3 19  ? -0.807  28.849  -4.510  1.00 48.20  ? 19   GLU C CB    1 
ATOM   3730 C  CG    . GLU E  3 19  ? -1.746  29.254  -5.612  1.00 50.71  ? 19   GLU C CG    1 
ATOM   3731 C  CD    . GLU E  3 19  ? -2.323  28.058  -6.332  1.00 51.67  ? 19   GLU C CD    1 
ATOM   3732 O  OE1   . GLU E  3 19  ? -2.887  27.180  -5.647  1.00 52.69  ? 19   GLU C OE1   1 
ATOM   3733 O  OE2   . GLU E  3 19  ? -2.224  27.999  -7.577  1.00 52.69  ? 19   GLU C OE2   1 
ATOM   3734 N  N     . GLU E  3 20  ? 1.553   30.199  -3.153  1.00 48.01  ? 20   GLU C N     1 
ATOM   3735 C  CA    . GLU E  3 20  ? 2.200   31.350  -2.532  1.00 48.27  ? 20   GLU C CA    1 
ATOM   3736 C  C     . GLU E  3 20  ? 3.642   31.580  -3.017  1.00 48.19  ? 20   GLU C C     1 
ATOM   3737 O  O     . GLU E  3 20  ? 4.086   32.719  -3.135  1.00 48.97  ? 20   GLU C O     1 
ATOM   3738 C  CB    . GLU E  3 20  ? 2.131   31.212  -1.001  1.00 48.59  ? 20   GLU C CB    1 
ATOM   3739 C  CG    . GLU E  3 20  ? 2.793   32.321  -0.209  1.00 49.18  ? 20   GLU C CG    1 
ATOM   3740 C  CD    . GLU E  3 20  ? 2.366   32.338  1.259   1.00 50.37  ? 20   GLU C CD    1 
ATOM   3741 O  OE1   . GLU E  3 20  ? 3.111   31.808  2.116   1.00 50.19  ? 20   GLU C OE1   1 
ATOM   3742 O  OE2   . GLU E  3 20  ? 1.283   32.883  1.557   1.00 50.35  ? 20   GLU C OE2   1 
ATOM   3743 N  N     . GLU E  3 21  ? 4.371   30.507  -3.300  1.00 48.14  ? 21   GLU C N     1 
ATOM   3744 C  CA    . GLU E  3 21  ? 5.721   30.631  -3.857  1.00 48.05  ? 21   GLU C CA    1 
ATOM   3745 C  C     . GLU E  3 21  ? 5.663   30.852  -5.364  1.00 47.87  ? 21   GLU C C     1 
ATOM   3746 O  O     . GLU E  3 21  ? 6.670   31.154  -5.996  1.00 47.79  ? 21   GLU C O     1 
ATOM   3747 C  CB    . GLU E  3 21  ? 6.551   29.379  -3.568  1.00 48.03  ? 21   GLU C CB    1 
ATOM   3748 C  CG    . GLU E  3 21  ? 6.674   29.015  -2.099  1.00 48.17  ? 21   GLU C CG    1 
ATOM   3749 C  CD    . GLU E  3 21  ? 7.253   27.625  -1.899  1.00 48.44  ? 21   GLU C CD    1 
ATOM   3750 O  OE1   . GLU E  3 21  ? 8.082   27.201  -2.738  1.00 48.28  ? 21   GLU C OE1   1 
ATOM   3751 O  OE2   . GLU E  3 21  ? 6.878   26.956  -0.909  1.00 47.80  ? 21   GLU C OE2   1 
ATOM   3752 N  N     . GLY E  3 22  ? 4.478   30.691  -5.940  1.00 48.19  ? 22   GLY C N     1 
ATOM   3753 C  CA    . GLY E  3 22  ? 4.313   30.801  -7.384  1.00 47.55  ? 22   GLY C CA    1 
ATOM   3754 C  C     . GLY E  3 22  ? 4.792   29.585  -8.163  1.00 47.31  ? 22   GLY C C     1 
ATOM   3755 O  O     . GLY E  3 22  ? 5.198   29.709  -9.315  1.00 47.34  ? 22   GLY C O     1 
ATOM   3756 N  N     . VAL E  3 23  ? 4.756   28.406  -7.546  1.00 46.60  ? 23   VAL C N     1 
ATOM   3757 C  CA    . VAL E  3 23  ? 5.022   27.173  -8.294  1.00 45.97  ? 23   VAL C CA    1 
ATOM   3758 C  C     . VAL E  3 23  ? 3.724   26.411  -8.589  1.00 45.41  ? 23   VAL C C     1 
ATOM   3759 O  O     . VAL E  3 23  ? 2.847   26.300  -7.728  1.00 45.64  ? 23   VAL C O     1 
ATOM   3760 C  CB    . VAL E  3 23  ? 6.111   26.268  -7.626  1.00 45.68  ? 23   VAL C CB    1 
ATOM   3761 C  CG1   . VAL E  3 23  ? 6.314   26.623  -6.175  1.00 45.98  ? 23   VAL C CG1   1 
ATOM   3762 C  CG2   . VAL E  3 23  ? 5.779   24.794  -7.800  1.00 45.32  ? 23   VAL C CG2   1 
ATOM   3763 N  N     . THR E  3 24  ? 3.593   25.918  -9.817  1.00 43.28  ? 24   THR C N     1 
ATOM   3764 C  CA    . THR E  3 24  ? 2.400   25.186  -10.216 1.00 42.99  ? 24   THR C CA    1 
ATOM   3765 C  C     . THR E  3 24  ? 2.129   24.007  -9.277  1.00 42.13  ? 24   THR C C     1 
ATOM   3766 O  O     . THR E  3 24  ? 2.985   23.137  -9.087  1.00 41.47  ? 24   THR C O     1 
ATOM   3767 C  CB    . THR E  3 24  ? 2.494   24.674  -11.676 1.00 43.52  ? 24   THR C CB    1 
ATOM   3768 O  OG1   . THR E  3 24  ? 2.518   25.784  -12.581 1.00 44.84  ? 24   THR C OG1   1 
ATOM   3769 C  CG2   . THR E  3 24  ? 1.300   23.812  -12.014 1.00 43.82  ? 24   THR C CG2   1 
ATOM   3770 N  N     . PRO E  3 25  ? 0.932   23.987  -8.671  1.00 40.69  ? 25   PRO C N     1 
ATOM   3771 C  CA    . PRO E  3 25  ? 0.525   22.861  -7.840  1.00 38.64  ? 25   PRO C CA    1 
ATOM   3772 C  C     . PRO E  3 25  ? 0.286   21.587  -8.656  1.00 36.43  ? 25   PRO C C     1 
ATOM   3773 O  O     . PRO E  3 25  ? -0.697  21.486  -9.400  1.00 35.74  ? 25   PRO C O     1 
ATOM   3774 C  CB    . PRO E  3 25  ? -0.770  23.355  -7.182  1.00 38.98  ? 25   PRO C CB    1 
ATOM   3775 C  CG    . PRO E  3 25  ? -1.295  24.386  -8.112  1.00 39.84  ? 25   PRO C CG    1 
ATOM   3776 C  CD    . PRO E  3 25  ? -0.093  25.044  -8.721  1.00 39.87  ? 25   PRO C CD    1 
ATOM   3777 N  N     . LEU E  3 26  ? 1.206   20.635  -8.508  1.00 33.82  ? 26   LEU C N     1 
ATOM   3778 C  CA    . LEU E  3 26  ? 1.092   19.305  -9.095  1.00 31.31  ? 26   LEU C CA    1 
ATOM   3779 C  C     . LEU E  3 26  ? 1.175   18.287  -7.982  1.00 30.50  ? 26   LEU C C     1 
ATOM   3780 O  O     . LEU E  3 26  ? 1.760   18.552  -6.935  1.00 30.27  ? 26   LEU C O     1 
ATOM   3781 C  CB    . LEU E  3 26  ? 2.249   19.034  -10.058 1.00 30.36  ? 26   LEU C CB    1 
ATOM   3782 C  CG    . LEU E  3 26  ? 2.440   19.930  -11.280 1.00 30.32  ? 26   LEU C CG    1 
ATOM   3783 C  CD1   . LEU E  3 26  ? 3.628   19.424  -12.092 1.00 30.10  ? 26   LEU C CD1   1 
ATOM   3784 C  CD2   . LEU E  3 26  ? 1.184   19.992  -12.132 1.00 28.87  ? 26   LEU C CD2   1 
ATOM   3785 N  N     . ARG E  3 27  ? 0.613   17.113  -8.208  1.00 29.46  ? 27   ARG C N     1 
ATOM   3786 C  CA    . ARG E  3 27  ? 0.813   16.022  -7.269  1.00 30.07  ? 27   ARG C CA    1 
ATOM   3787 C  C     . ARG E  3 27  ? 2.292   15.727  -6.999  1.00 29.84  ? 27   ARG C C     1 
ATOM   3788 O  O     . ARG E  3 27  ? 2.647   15.341  -5.886  1.00 29.99  ? 27   ARG C O     1 
ATOM   3789 C  CB    . ARG E  3 27  ? 0.044   14.776  -7.713  1.00 30.12  ? 27   ARG C CB    1 
ATOM   3790 C  CG    . ARG E  3 27  ? -1.453  14.910  -7.433  1.00 29.79  ? 27   ARG C CG    1 
ATOM   3791 C  CD    . ARG E  3 27  ? -2.273  13.982  -8.281  1.00 30.68  ? 27   ARG C CD    1 
ATOM   3792 N  NE    . ARG E  3 27  ? -2.059  14.232  -9.697  1.00 31.26  ? 27   ARG C NE    1 
ATOM   3793 C  CZ    . ARG E  3 27  ? -2.704  13.602  -10.671 1.00 31.49  ? 27   ARG C CZ    1 
ATOM   3794 N  NH1   . ARG E  3 27  ? -3.625  12.683  -10.386 1.00 30.11  ? 27   ARG C NH1   1 
ATOM   3795 N  NH2   . ARG E  3 27  ? -2.430  13.901  -11.932 1.00 31.56  ? 27   ARG C NH2   1 
ATOM   3796 N  N     . ALA E  3 28  ? 3.152   15.951  -7.995  1.00 29.73  ? 28   ALA C N     1 
ATOM   3797 C  CA    . ALA E  3 28  ? 4.595   15.710  -7.839  1.00 29.95  ? 28   ALA C CA    1 
ATOM   3798 C  C     . ALA E  3 28  ? 5.225   16.579  -6.756  1.00 30.11  ? 28   ALA C C     1 
ATOM   3799 O  O     . ALA E  3 28  ? 6.152   16.148  -6.070  1.00 28.82  ? 28   ALA C O     1 
ATOM   3800 C  CB    . ALA E  3 28  ? 5.324   15.923  -9.150  1.00 28.71  ? 28   ALA C CB    1 
ATOM   3801 N  N     . ARG E  3 29  ? 4.730   17.810  -6.630  1.00 31.40  ? 29   ARG C N     1 
ATOM   3802 C  CA    . ARG E  3 29  ? 5.260   18.783  -5.666  1.00 31.54  ? 29   ARG C CA    1 
ATOM   3803 C  C     . ARG E  3 29  ? 4.911   18.371  -4.242  1.00 31.41  ? 29   ARG C C     1 
ATOM   3804 O  O     . ARG E  3 29  ? 5.718   18.534  -3.320  1.00 33.29  ? 29   ARG C O     1 
ATOM   3805 C  CB    . ARG E  3 29  ? 4.715   20.186  -5.953  1.00 31.28  ? 29   ARG C CB    1 
ATOM   3806 C  CG    . ARG E  3 29  ? 5.042   20.736  -7.341  1.00 31.56  ? 29   ARG C CG    1 
ATOM   3807 C  CD    . ARG E  3 29  ? 6.529   21.095  -7.493  1.00 32.10  ? 29   ARG C CD    1 
ATOM   3808 N  NE    . ARG E  3 29  ? 7.362   19.912  -7.720  1.00 32.88  ? 29   ARG C NE    1 
ATOM   3809 C  CZ    . ARG E  3 29  ? 7.473   19.288  -8.892  1.00 32.49  ? 29   ARG C CZ    1 
ATOM   3810 N  NH1   . ARG E  3 29  ? 8.245   18.217  -9.002  1.00 32.59  ? 29   ARG C NH1   1 
ATOM   3811 N  NH2   . ARG E  3 29  ? 6.811   19.725  -9.953  1.00 31.08  ? 29   ARG C NH2   1 
ATOM   3812 N  N     . ILE E  3 30  ? 3.708   17.826  -4.080  1.00 30.03  ? 30   ILE C N     1 
ATOM   3813 C  CA    . ILE E  3 30  ? 3.242   17.314  -2.801  1.00 29.21  ? 30   ILE C CA    1 
ATOM   3814 C  C     . ILE E  3 30  ? 4.019   16.065  -2.384  1.00 30.74  ? 30   ILE C C     1 
ATOM   3815 O  O     . ILE E  3 30  ? 4.367   15.896  -1.209  1.00 31.77  ? 30   ILE C O     1 
ATOM   3816 C  CB    . ILE E  3 30  ? 1.749   16.940  -2.883  1.00 27.96  ? 30   ILE C CB    1 
ATOM   3817 C  CG1   . ILE E  3 30  ? 0.906   18.134  -3.377  1.00 27.14  ? 30   ILE C CG1   1 
ATOM   3818 C  CG2   . ILE E  3 30  ? 1.255   16.388  -1.547  1.00 25.74  ? 30   ILE C CG2   1 
ATOM   3819 C  CD1   . ILE E  3 30  ? -0.598  17.870  -3.353  1.00 24.76  ? 30   ILE C CD1   1 
ATOM   3820 N  N     . ALA E  3 31  ? 4.263   15.181  -3.349  1.00 31.75  ? 31   ALA C N     1 
ATOM   3821 C  CA    . ALA E  3 31  ? 5.035   13.966  -3.113  1.00 32.10  ? 31   ALA C CA    1 
ATOM   3822 C  C     . ALA E  3 31  ? 6.420   14.317  -2.578  1.00 33.44  ? 31   ALA C C     1 
ATOM   3823 O  O     . ALA E  3 31  ? 6.871   13.731  -1.596  1.00 33.52  ? 31   ALA C O     1 
ATOM   3824 C  CB    . ALA E  3 31  ? 5.135   13.144  -4.387  1.00 30.33  ? 31   ALA C CB    1 
ATOM   3825 N  N     . GLU E  3 32  ? 7.074   15.292  -3.213  1.00 35.06  ? 32   GLU C N     1 
ATOM   3826 C  CA    . GLU E  3 32  ? 8.377   15.780  -2.767  1.00 37.64  ? 32   GLU C CA    1 
ATOM   3827 C  C     . GLU E  3 32  ? 8.312   16.361  -1.377  1.00 37.95  ? 32   GLU C C     1 
ATOM   3828 O  O     . GLU E  3 32  ? 9.124   16.032  -0.516  1.00 37.97  ? 32   GLU C O     1 
ATOM   3829 C  CB    . GLU E  3 32  ? 8.862   16.920  -3.653  1.00 39.14  ? 32   GLU C CB    1 
ATOM   3830 C  CG    . GLU E  3 32  ? 9.214   16.565  -5.059  1.00 40.84  ? 32   GLU C CG    1 
ATOM   3831 C  CD    . GLU E  3 32  ? 9.408   17.813  -5.883  1.00 41.83  ? 32   GLU C CD    1 
ATOM   3832 O  OE1   . GLU E  3 32  ? 9.537   18.903  -5.277  1.00 41.78  ? 32   GLU C OE1   1 
ATOM   3833 O  OE2   . GLU E  3 32  ? 9.421   17.709  -7.125  1.00 42.31  ? 32   GLU C OE2   1 
ATOM   3834 N  N     . ARG E  3 33  ? 7.358   17.269  -1.187  1.00 38.18  ? 33   ARG C N     1 
ATOM   3835 C  CA    . ARG E  3 33  ? 7.278   18.077  0.024   1.00 38.62  ? 33   ARG C CA    1 
ATOM   3836 C  C     . ARG E  3 33  ? 6.881   17.321  1.278   1.00 37.55  ? 33   ARG C C     1 
ATOM   3837 O  O     . ARG E  3 33  ? 7.345   17.659  2.368   1.00 37.63  ? 33   ARG C O     1 
ATOM   3838 C  CB    . ARG E  3 33  ? 6.342   19.275  -0.183  1.00 40.70  ? 33   ARG C CB    1 
ATOM   3839 C  CG    . ARG E  3 33  ? 7.081   20.582  -0.408  1.00 42.90  ? 33   ARG C CG    1 
ATOM   3840 C  CD    . ARG E  3 33  ? 6.356   21.452  -1.403  1.00 45.34  ? 33   ARG C CD    1 
ATOM   3841 N  NE    . ARG E  3 33  ? 7.253   22.432  -2.009  1.00 47.35  ? 33   ARG C NE    1 
ATOM   3842 C  CZ    . ARG E  3 33  ? 7.325   23.709  -1.643  1.00 48.52  ? 33   ARG C CZ    1 
ATOM   3843 N  NH1   . ARG E  3 33  ? 6.543   24.175  -0.672  1.00 48.09  ? 33   ARG C NH1   1 
ATOM   3844 N  NH2   . ARG E  3 33  ? 8.175   24.523  -2.259  1.00 48.74  ? 33   ARG C NH2   1 
ATOM   3845 N  N     . LEU E  3 34  ? 6.034   16.304  1.135   1.00 35.63  ? 34   LEU C N     1 
ATOM   3846 C  CA    . LEU E  3 34  ? 5.601   15.529  2.295   1.00 35.20  ? 34   LEU C CA    1 
ATOM   3847 C  C     . LEU E  3 34  ? 6.296   14.170  2.375   1.00 35.84  ? 34   LEU C C     1 
ATOM   3848 O  O     . LEU E  3 34  ? 6.037   13.385  3.298   1.00 35.47  ? 34   LEU C O     1 
ATOM   3849 C  CB    . LEU E  3 34  ? 4.072   15.377  2.323   1.00 34.50  ? 34   LEU C CB    1 
ATOM   3850 C  CG    . LEU E  3 34  ? 3.259   16.675  2.185   1.00 34.33  ? 34   LEU C CG    1 
ATOM   3851 C  CD1   . LEU E  3 34  ? 1.774   16.400  2.212   1.00 33.07  ? 34   LEU C CD1   1 
ATOM   3852 C  CD2   . LEU E  3 34  ? 3.646   17.692  3.269   1.00 33.96  ? 34   LEU C CD2   1 
ATOM   3853 N  N     . ASP E  3 35  ? 7.181   13.910  1.408   1.00 35.85  ? 35   ASP C N     1 
ATOM   3854 C  CA    . ASP E  3 35  ? 7.932   12.652  1.319   1.00 35.88  ? 35   ASP C CA    1 
ATOM   3855 C  C     . ASP E  3 35  ? 7.008   11.437  1.280   1.00 34.39  ? 35   ASP C C     1 
ATOM   3856 O  O     . ASP E  3 35  ? 7.149   10.510  2.075   1.00 33.36  ? 35   ASP C O     1 
ATOM   3857 C  CB    . ASP E  3 35  ? 8.952   12.518  2.465   1.00 38.08  ? 35   ASP C CB    1 
ATOM   3858 C  CG    . ASP E  3 35  ? 9.918   11.351  2.258   1.00 40.52  ? 35   ASP C CG    1 
ATOM   3859 O  OD1   . ASP E  3 35  ? 10.175  10.994  1.085   1.00 42.67  ? 35   ASP C OD1   1 
ATOM   3860 O  OD2   . ASP E  3 35  ? 10.419  10.785  3.258   1.00 40.69  ? 35   ASP C OD2   1 
ATOM   3861 N  N     . GLN E  3 36  ? 6.059   11.446  0.352   1.00 32.92  ? 36   GLN C N     1 
ATOM   3862 C  CA    . GLN E  3 36  ? 5.157   10.314  0.185   1.00 31.62  ? 36   GLN C CA    1 
ATOM   3863 C  C     . GLN E  3 36  ? 5.301   9.749   -1.226  1.00 30.83  ? 36   GLN C C     1 
ATOM   3864 O  O     . GLN E  3 36  ? 5.852   10.410  -2.102  1.00 30.84  ? 36   GLN C O     1 
ATOM   3865 C  CB    . GLN E  3 36  ? 3.712   10.725  0.489   1.00 32.66  ? 36   GLN C CB    1 
ATOM   3866 C  CG    . GLN E  3 36  ? 3.515   11.264  1.916   1.00 32.89  ? 36   GLN C CG    1 
ATOM   3867 C  CD    . GLN E  3 36  ? 2.054   11.398  2.310   1.00 33.42  ? 36   GLN C CD    1 
ATOM   3868 O  OE1   . GLN E  3 36  ? 1.205   11.738  1.491   1.00 33.74  ? 36   GLN C OE1   1 
ATOM   3869 N  NE2   . GLN E  3 36  ? 1.756   11.118  3.570   1.00 33.41  ? 36   GLN C NE2   1 
ATOM   3870 N  N     . SER E  3 37  ? 4.837   8.518   -1.438  1.00 29.58  ? 37   SER C N     1 
ATOM   3871 C  CA    . SER E  3 37  ? 4.918   7.892   -2.751  1.00 27.99  ? 37   SER C CA    1 
ATOM   3872 C  C     . SER E  3 37  ? 3.932   8.541   -3.715  1.00 28.51  ? 37   SER C C     1 
ATOM   3873 O  O     . SER E  3 37  ? 2.969   9.191   -3.294  1.00 28.72  ? 37   SER C O     1 
ATOM   3874 C  CB    . SER E  3 37  ? 4.628   6.404   -2.642  1.00 28.22  ? 37   SER C CB    1 
ATOM   3875 O  OG    . SER E  3 37  ? 3.252   6.182   -2.379  1.00 28.43  ? 37   SER C OG    1 
ATOM   3876 N  N     . GLY E  3 38  ? 4.169   8.361   -5.009  1.00 28.03  ? 38   GLY C N     1 
ATOM   3877 C  CA    . GLY E  3 38  ? 3.324   8.966   -6.032  1.00 26.92  ? 38   GLY C CA    1 
ATOM   3878 C  C     . GLY E  3 38  ? 1.901   8.459   -5.967  1.00 27.09  ? 38   GLY C C     1 
ATOM   3879 O  O     . GLY E  3 38  ? 0.970   9.240   -6.016  1.00 27.32  ? 38   GLY C O     1 
ATOM   3880 N  N     . PRO E  3 39  ? 1.717   7.133   -5.880  1.00 28.93  ? 39   PRO C N     1 
ATOM   3881 C  CA    . PRO E  3 39  ? 0.350   6.583   -5.799  1.00 29.30  ? 39   PRO C CA    1 
ATOM   3882 C  C     . PRO E  3 39  ? -0.398  7.007   -4.533  1.00 30.52  ? 39   PRO C C     1 
ATOM   3883 O  O     . PRO E  3 39  ? -1.632  7.105   -4.533  1.00 32.16  ? 39   PRO C O     1 
ATOM   3884 C  CB    . PRO E  3 39  ? 0.577   5.064   -5.810  1.00 28.38  ? 39   PRO C CB    1 
ATOM   3885 C  CG    . PRO E  3 39  ? 1.966   4.893   -6.377  1.00 28.13  ? 39   PRO C CG    1 
ATOM   3886 C  CD    . PRO E  3 39  ? 2.742   6.075   -5.911  1.00 26.77  ? 39   PRO C CD    1 
ATOM   3887 N  N     . THR E  3 40  ? 0.340   7.265   -3.463  1.00 30.25  ? 40   THR C N     1 
ATOM   3888 C  CA    . THR E  3 40  ? -0.288  7.697   -2.235  1.00 31.19  ? 40   THR C CA    1 
ATOM   3889 C  C     . THR E  3 40  ? -0.926  9.062   -2.429  1.00 30.08  ? 40   THR C C     1 
ATOM   3890 O  O     . THR E  3 40  ? -2.083  9.249   -2.081  1.00 30.30  ? 40   THR C O     1 
ATOM   3891 C  CB    . THR E  3 40  ? 0.694   7.703   -1.054  1.00 32.30  ? 40   THR C CB    1 
ATOM   3892 O  OG1   . THR E  3 40  ? 1.284   6.401   -0.938  1.00 34.53  ? 40   THR C OG1   1 
ATOM   3893 C  CG2   . THR E  3 40  ? -0.028  8.016   0.233   1.00 31.94  ? 40   THR C CG2   1 
ATOM   3894 N  N     . VAL E  3 41  ? -0.198  10.007  -3.009  1.00 29.81  ? 41   VAL C N     1 
ATOM   3895 C  CA    . VAL E  3 41  ? -0.761  11.335  -3.178  1.00 30.57  ? 41   VAL C CA    1 
ATOM   3896 C  C     . VAL E  3 41  ? -1.917  11.358  -4.187  1.00 30.89  ? 41   VAL C C     1 
ATOM   3897 O  O     . VAL E  3 41  ? -2.956  11.958  -3.913  1.00 30.00  ? 41   VAL C O     1 
ATOM   3898 C  CB    . VAL E  3 41  ? 0.312   12.460  -3.415  1.00 30.98  ? 41   VAL C CB    1 
ATOM   3899 C  CG1   . VAL E  3 41  ? 1.663   12.053  -2.848  1.00 29.73  ? 41   VAL C CG1   1 
ATOM   3900 C  CG2   . VAL E  3 41  ? 0.421   12.852  -4.864  1.00 31.50  ? 41   VAL C CG2   1 
ATOM   3901 N  N     . SER E  3 42  ? -1.751  10.669  -5.318  1.00 31.40  ? 42   SER C N     1 
ATOM   3902 C  CA    . SER E  3 42  ? -2.806  10.573  -6.337  1.00 31.95  ? 42   SER C CA    1 
ATOM   3903 C  C     . SER E  3 42  ? -4.080  9.966   -5.781  1.00 31.89  ? 42   SER C C     1 
ATOM   3904 O  O     . SER E  3 42  ? -5.179  10.371  -6.170  1.00 32.51  ? 42   SER C O     1 
ATOM   3905 C  CB    . SER E  3 42  ? -2.345  9.761   -7.557  1.00 31.73  ? 42   SER C CB    1 
ATOM   3906 O  OG    . SER E  3 42  ? -1.384  10.493  -8.302  1.00 33.12  ? 42   SER C OG    1 
ATOM   3907 N  N     . GLN E  3 43  ? -3.938  8.983   -4.894  1.00 31.71  ? 43   GLN C N     1 
ATOM   3908 C  CA    . GLN E  3 43  ? -5.105  8.414   -4.221  1.00 32.56  ? 43   GLN C CA    1 
ATOM   3909 C  C     . GLN E  3 43  ? -5.746  9.383   -3.228  1.00 29.96  ? 43   GLN C C     1 
ATOM   3910 O  O     . GLN E  3 43  ? -6.967  9.514   -3.195  1.00 29.00  ? 43   GLN C O     1 
ATOM   3911 C  CB    . GLN E  3 43  ? -4.775  7.094   -3.518  1.00 34.33  ? 43   GLN C CB    1 
ATOM   3912 C  CG    . GLN E  3 43  ? -5.248  5.879   -4.279  1.00 38.73  ? 43   GLN C CG    1 
ATOM   3913 C  CD    . GLN E  3 43  ? -6.705  5.986   -4.730  1.00 41.45  ? 43   GLN C CD    1 
ATOM   3914 O  OE1   . GLN E  3 43  ? -7.058  5.570   -5.837  1.00 42.21  ? 43   GLN C OE1   1 
ATOM   3915 N  NE2   . GLN E  3 43  ? -7.558  6.542   -3.868  1.00 43.61  ? 43   GLN C NE2   1 
ATOM   3916 N  N     . THR E  3 44  ? -4.926  10.045  -2.416  1.00 28.60  ? 44   THR C N     1 
ATOM   3917 C  CA    . THR E  3 44  ? -5.443  11.010  -1.452  1.00 28.50  ? 44   THR C CA    1 
ATOM   3918 C  C     . THR E  3 44  ? -6.108  12.164  -2.199  1.00 28.18  ? 44   THR C C     1 
ATOM   3919 O  O     . THR E  3 44  ? -7.221  12.570  -1.874  1.00 26.91  ? 44   THR C O     1 
ATOM   3920 C  CB    . THR E  3 44  ? -4.342  11.555  -0.521  1.00 29.08  ? 44   THR C CB    1 
ATOM   3921 O  OG1   . THR E  3 44  ? -3.804  10.484  0.278   1.00 30.13  ? 44   THR C OG1   1 
ATOM   3922 C  CG2   . THR E  3 44  ? -4.914  12.639  0.396   1.00 28.45  ? 44   THR C CG2   1 
ATOM   3923 N  N     . VAL E  3 45  ? -5.431  12.663  -3.226  1.00 28.33  ? 45   VAL C N     1 
ATOM   3924 C  CA    . VAL E  3 45  ? -5.986  13.719  -4.048  1.00 29.24  ? 45   VAL C CA    1 
ATOM   3925 C  C     . VAL E  3 45  ? -7.344  13.308  -4.622  1.00 31.07  ? 45   VAL C C     1 
ATOM   3926 O  O     . VAL E  3 45  ? -8.251  14.136  -4.740  1.00 31.68  ? 45   VAL C O     1 
ATOM   3927 C  CB    . VAL E  3 45  ? -5.016  14.141  -5.160  1.00 27.89  ? 45   VAL C CB    1 
ATOM   3928 C  CG1   . VAL E  3 45  ? -5.749  14.946  -6.206  1.00 27.49  ? 45   VAL C CG1   1 
ATOM   3929 C  CG2   . VAL E  3 45  ? -3.855  14.947  -4.567  1.00 26.50  ? 45   VAL C CG2   1 
ATOM   3930 N  N     . SER E  3 46  ? -7.494  12.021  -4.934  1.00 31.97  ? 46   SER C N     1 
ATOM   3931 C  CA    . SER E  3 46  ? -8.754  11.504  -5.468  1.00 33.34  ? 46   SER C CA    1 
ATOM   3932 C  C     . SER E  3 46  ? -9.880  11.610  -4.472  1.00 33.27  ? 46   SER C C     1 
ATOM   3933 O  O     . SER E  3 46  ? -11.004 11.936  -4.848  1.00 35.24  ? 46   SER C O     1 
ATOM   3934 C  CB    . SER E  3 46  ? -8.628  10.044  -5.903  1.00 33.36  ? 46   SER C CB    1 
ATOM   3935 O  OG    . SER E  3 46  ? -7.758  9.937   -7.001  1.00 35.31  ? 46   SER C OG    1 
ATOM   3936 N  N     . ARG E  3 47  ? -9.584  11.296  -3.215  1.00 32.77  ? 47   ARG C N     1 
ATOM   3937 C  CA    . ARG E  3 47  ? -10.576 11.389  -2.152  1.00 32.82  ? 47   ARG C CA    1 
ATOM   3938 C  C     . ARG E  3 47  ? -10.994 12.845  -1.971  1.00 32.74  ? 47   ARG C C     1 
ATOM   3939 O  O     . ARG E  3 47  ? -12.178 13.145  -1.834  1.00 33.01  ? 47   ARG C O     1 
ATOM   3940 C  CB    . ARG E  3 47  ? -10.039 10.806  -0.838  1.00 32.69  ? 47   ARG C CB    1 
ATOM   3941 C  CG    . ARG E  3 47  ? -9.917  9.278   -0.828  1.00 32.95  ? 47   ARG C CG    1 
ATOM   3942 C  CD    . ARG E  3 47  ? -9.755  8.729   0.598   1.00 33.92  ? 47   ARG C CD    1 
ATOM   3943 N  NE    . ARG E  3 47  ? -8.583  9.301   1.261   1.00 34.56  ? 47   ARG C NE    1 
ATOM   3944 C  CZ    . ARG E  3 47  ? -7.345  8.824   1.151   1.00 34.54  ? 47   ARG C CZ    1 
ATOM   3945 N  NH1   . ARG E  3 47  ? -7.108  7.743   0.416   1.00 34.08  ? 47   ARG C NH1   1 
ATOM   3946 N  NH2   . ARG E  3 47  ? -6.340  9.429   1.778   1.00 34.40  ? 47   ARG C NH2   1 
ATOM   3947 N  N     . MET E  3 48  ? -10.014 13.743  -1.993  1.00 32.92  ? 48   MET C N     1 
ATOM   3948 C  CA    . MET E  3 48  ? -10.265 15.178  -1.869  1.00 33.51  ? 48   MET C CA    1 
ATOM   3949 C  C     . MET E  3 48  ? -11.127 15.741  -3.001  1.00 34.40  ? 48   MET C C     1 
ATOM   3950 O  O     . MET E  3 48  ? -11.846 16.713  -2.808  1.00 33.82  ? 48   MET C O     1 
ATOM   3951 C  CB    . MET E  3 48  ? -8.946  15.945  -1.788  1.00 32.67  ? 48   MET C CB    1 
ATOM   3952 C  CG    . MET E  3 48  ? -8.131  15.620  -0.545  1.00 32.21  ? 48   MET C CG    1 
ATOM   3953 S  SD    . MET E  3 48  ? -6.470  16.319  -0.607  1.00 32.40  ? 48   MET C SD    1 
ATOM   3954 C  CE    . MET E  3 48  ? -6.807  18.063  -0.374  1.00 31.56  ? 48   MET C CE    1 
ATOM   3955 N  N     . GLU E  3 49  ? -11.041 15.127  -4.178  1.00 36.63  ? 49   GLU C N     1 
ATOM   3956 C  CA    . GLU E  3 49  ? -11.838 15.527  -5.333  1.00 38.15  ? 49   GLU C CA    1 
ATOM   3957 C  C     . GLU E  3 49  ? -13.224 14.923  -5.197  1.00 38.34  ? 49   GLU C C     1 
ATOM   3958 O  O     . GLU E  3 49  ? -14.227 15.555  -5.504  1.00 38.66  ? 49   GLU C O     1 
ATOM   3959 C  CB    . GLU E  3 49  ? -11.161 15.060  -6.626  1.00 40.17  ? 49   GLU C CB    1 
ATOM   3960 C  CG    . GLU E  3 49  ? -11.796 15.569  -7.919  1.00 41.95  ? 49   GLU C CG    1 
ATOM   3961 C  CD    . GLU E  3 49  ? -10.845 15.479  -9.110  1.00 42.86  ? 49   GLU C CD    1 
ATOM   3962 O  OE1   . GLU E  3 49  ? -11.184 15.996  -10.200 1.00 42.75  ? 49   GLU C OE1   1 
ATOM   3963 O  OE2   . GLU E  3 49  ? -9.748  14.902  -8.948  1.00 43.35  ? 49   GLU C OE2   1 
ATOM   3964 N  N     . ARG E  3 50  ? -13.276 13.692  -4.709  1.00 39.71  ? 50   ARG C N     1 
ATOM   3965 C  CA    . ARG E  3 50  ? -14.544 13.056  -4.384  1.00 39.71  ? 50   ARG C CA    1 
ATOM   3966 C  C     . ARG E  3 50  ? -15.319 13.960  -3.427  1.00 40.02  ? 50   ARG C C     1 
ATOM   3967 O  O     . ARG E  3 50  ? -16.540 14.094  -3.532  1.00 40.06  ? 50   ARG C O     1 
ATOM   3968 C  CB    . ARG E  3 50  ? -14.292 11.692  -3.735  1.00 38.87  ? 50   ARG C CB    1 
ATOM   3969 C  CG    . ARG E  3 50  ? -15.530 10.823  -3.534  1.00 39.37  ? 50   ARG C CG    1 
ATOM   3970 C  CD    . ARG E  3 50  ? -15.230 9.668   -2.577  1.00 39.77  ? 50   ARG C CD    1 
ATOM   3971 N  NE    . ARG E  3 50  ? -14.857 10.158  -1.249  1.00 40.26  ? 50   ARG C NE    1 
ATOM   3972 C  CZ    . ARG E  3 50  ? -14.193 9.453   -0.335  1.00 40.02  ? 50   ARG C CZ    1 
ATOM   3973 N  NH1   . ARG E  3 50  ? -13.812 8.208   -0.588  1.00 40.53  ? 50   ARG C NH1   1 
ATOM   3974 N  NH2   . ARG E  3 50  ? -13.907 9.996   0.839   1.00 39.12  ? 50   ARG C NH2   1 
ATOM   3975 N  N     . ASP E  3 51  ? -14.595 14.595  -2.507  1.00 39.72  ? 51   ASP C N     1 
ATOM   3976 C  CA    . ASP E  3 51  ? -15.218 15.290  -1.383  1.00 39.61  ? 51   ASP C CA    1 
ATOM   3977 C  C     . ASP E  3 51  ? -15.407 16.783  -1.608  1.00 39.15  ? 51   ASP C C     1 
ATOM   3978 O  O     . ASP E  3 51  ? -15.698 17.511  -0.665  1.00 40.60  ? 51   ASP C O     1 
ATOM   3979 C  CB    . ASP E  3 51  ? -14.410 15.063  -0.100  1.00 39.74  ? 51   ASP C CB    1 
ATOM   3980 C  CG    . ASP E  3 51  ? -14.685 13.707  0.541   1.00 40.73  ? 51   ASP C CG    1 
ATOM   3981 O  OD1   . ASP E  3 51  ? -15.550 12.942  0.045   1.00 40.26  ? 51   ASP C OD1   1 
ATOM   3982 O  OD2   . ASP E  3 51  ? -14.023 13.412  1.558   1.00 40.91  ? 51   ASP C OD2   1 
ATOM   3983 N  N     . GLY E  3 52  ? -15.222 17.238  -2.843  1.00 37.85  ? 52   GLY C N     1 
ATOM   3984 C  CA    . GLY E  3 52  ? -15.499 18.624  -3.207  1.00 35.34  ? 52   GLY C CA    1 
ATOM   3985 C  C     . GLY E  3 52  ? -14.417 19.635  -2.868  1.00 34.61  ? 52   GLY C C     1 
ATOM   3986 O  O     . GLY E  3 52  ? -14.667 20.838  -2.898  1.00 34.35  ? 52   GLY C O     1 
ATOM   3987 N  N     . LEU E  3 53  ? -13.209 19.154  -2.575  1.00 33.22  ? 53   LEU C N     1 
ATOM   3988 C  CA    . LEU E  3 53  ? -12.108 20.017  -2.122  1.00 30.72  ? 53   LEU C CA    1 
ATOM   3989 C  C     . LEU E  3 53  ? -11.205 20.546  -3.233  1.00 29.06  ? 53   LEU C C     1 
ATOM   3990 O  O     . LEU E  3 53  ? -10.521 21.562  -3.069  1.00 26.85  ? 53   LEU C O     1 
ATOM   3991 C  CB    . LEU E  3 53  ? -11.263 19.278  -1.085  1.00 30.89  ? 53   LEU C CB    1 
ATOM   3992 C  CG    . LEU E  3 53  ? -11.971 19.016  0.238   1.00 31.58  ? 53   LEU C CG    1 
ATOM   3993 C  CD1   . LEU E  3 53  ? -11.025 18.332  1.206   1.00 31.08  ? 53   LEU C CD1   1 
ATOM   3994 C  CD2   . LEU E  3 53  ? -12.472 20.335  0.807   1.00 31.80  ? 53   LEU C CD2   1 
ATOM   3995 N  N     . LEU E  3 54  ? -11.184 19.840  -4.355  1.00 29.29  ? 54   LEU C N     1 
ATOM   3996 C  CA    . LEU E  3 54  ? -10.336 20.219  -5.478  1.00 29.75  ? 54   LEU C CA    1 
ATOM   3997 C  C     . LEU E  3 54  ? -10.711 19.419  -6.703  1.00 31.26  ? 54   LEU C C     1 
ATOM   3998 O  O     . LEU E  3 54  ? -11.607 18.580  -6.666  1.00 32.12  ? 54   LEU C O     1 
ATOM   3999 C  CB    . LEU E  3 54  ? -8.851  20.006  -5.154  1.00 29.01  ? 54   LEU C CB    1 
ATOM   4000 C  CG    . LEU E  3 54  ? -8.345  18.628  -4.690  1.00 28.09  ? 54   LEU C CG    1 
ATOM   4001 C  CD1   . LEU E  3 54  ? -8.404  17.560  -5.795  1.00 27.09  ? 54   LEU C CD1   1 
ATOM   4002 C  CD2   . LEU E  3 54  ? -6.925  18.758  -4.167  1.00 27.57  ? 54   LEU C CD2   1 
ATOM   4003 N  N     . ARG E  3 55  ? -10.029 19.700  -7.801  1.00 34.65  ? 55   ARG C N     1 
ATOM   4004 C  CA    . ARG E  3 55  ? -10.134 18.860  -8.982  1.00 36.92  ? 55   ARG C CA    1 
ATOM   4005 C  C     . ARG E  3 55  ? -8.807  18.832  -9.716  1.00 35.63  ? 55   ARG C C     1 
ATOM   4006 O  O     . ARG E  3 55  ? -8.009  19.768  -9.636  1.00 34.23  ? 55   ARG C O     1 
ATOM   4007 C  CB    . ARG E  3 55  ? -11.272 19.317  -9.906  1.00 40.49  ? 55   ARG C CB    1 
ATOM   4008 C  CG    . ARG E  3 55  ? -11.080 20.684  -10.521 1.00 45.01  ? 55   ARG C CG    1 
ATOM   4009 C  CD    . ARG E  3 55  ? -12.413 21.260  -11.004 1.00 48.59  ? 55   ARG C CD    1 
ATOM   4010 N  NE    . ARG E  3 55  ? -12.403 22.727  -11.005 1.00 51.18  ? 55   ARG C NE    1 
ATOM   4011 C  CZ    . ARG E  3 55  ? -12.478 23.481  -9.907  1.00 52.23  ? 55   ARG C CZ    1 
ATOM   4012 N  NH1   . ARG E  3 55  ? -12.555 22.910  -8.707  1.00 51.56  ? 55   ARG C NH1   1 
ATOM   4013 N  NH2   . ARG E  3 55  ? -12.464 24.810  -10.009 1.00 52.85  ? 55   ARG C NH2   1 
ATOM   4014 N  N     . VAL E  3 56  ? -8.566  17.735  -10.415 1.00 35.72  ? 56   VAL C N     1 
ATOM   4015 C  CA    . VAL E  3 56  ? -7.384  17.634  -11.239 1.00 35.19  ? 56   VAL C CA    1 
ATOM   4016 C  C     . VAL E  3 56  ? -7.734  18.108  -12.642 1.00 34.44  ? 56   VAL C C     1 
ATOM   4017 O  O     . VAL E  3 56  ? -8.568  17.505  -13.314 1.00 34.28  ? 56   VAL C O     1 
ATOM   4018 C  CB    . VAL E  3 56  ? -6.842  16.196  -11.265 1.00 34.88  ? 56   VAL C CB    1 
ATOM   4019 C  CG1   . VAL E  3 56  ? -5.476  16.167  -11.931 1.00 35.22  ? 56   VAL C CG1   1 
ATOM   4020 C  CG2   . VAL E  3 56  ? -6.754  15.656  -9.848  1.00 35.69  ? 56   VAL C CG2   1 
ATOM   4021 N  N     . ALA E  3 57  ? -7.117  19.205  -13.063 1.00 34.31  ? 57   ALA C N     1 
ATOM   4022 C  CA    . ALA E  3 57  ? -7.309  19.719  -14.415 1.00 37.03  ? 57   ALA C CA    1 
ATOM   4023 C  C     . ALA E  3 57  ? -6.861  18.695  -15.455 1.00 38.43  ? 57   ALA C C     1 
ATOM   4024 O  O     . ALA E  3 57  ? -6.159  17.729  -15.127 1.00 39.50  ? 57   ALA C O     1 
ATOM   4025 C  CB    . ALA E  3 57  ? -6.544  21.025  -14.605 1.00 36.36  ? 57   ALA C CB    1 
ATOM   4026 N  N     . GLY E  3 58  ? -7.268  18.911  -16.704 1.00 38.91  ? 58   GLY C N     1 
ATOM   4027 C  CA    . GLY E  3 58  ? -6.836  18.068  -17.821 1.00 39.81  ? 58   GLY C CA    1 
ATOM   4028 C  C     . GLY E  3 58  ? -5.328  18.104  -18.020 1.00 39.84  ? 58   GLY C C     1 
ATOM   4029 O  O     . GLY E  3 58  ? -4.721  17.107  -18.387 1.00 40.57  ? 58   GLY C O     1 
ATOM   4030 N  N     . ASP E  3 59  ? -4.715  19.255  -17.773 1.00 39.92  ? 59   ASP C N     1 
ATOM   4031 C  CA    . ASP E  3 59  ? -3.264  19.341  -17.803 1.00 40.35  ? 59   ASP C CA    1 
ATOM   4032 C  C     . ASP E  3 59  ? -2.640  19.054  -16.423 1.00 40.22  ? 59   ASP C C     1 
ATOM   4033 O  O     . ASP E  3 59  ? -1.472  19.361  -16.180 1.00 39.63  ? 59   ASP C O     1 
ATOM   4034 C  CB    . ASP E  3 59  ? -2.819  20.699  -18.347 1.00 40.45  ? 59   ASP C CB    1 
ATOM   4035 C  CG    . ASP E  3 59  ? -3.166  21.830  -17.425 1.00 41.49  ? 59   ASP C CG    1 
ATOM   4036 O  OD1   . ASP E  3 59  ? -4.060  21.642  -16.573 1.00 41.67  ? 59   ASP C OD1   1 
ATOM   4037 O  OD2   . ASP E  3 59  ? -2.533  22.902  -17.544 1.00 42.15  ? 59   ASP C OD2   1 
ATOM   4038 N  N     . ARG E  3 60  ? -3.446  18.480  -15.531 1.00 40.93  ? 60   ARG C N     1 
ATOM   4039 C  CA    . ARG E  3 60  ? -2.991  17.920  -14.245 1.00 42.31  ? 60   ARG C CA    1 
ATOM   4040 C  C     . ARG E  3 60  ? -2.693  18.915  -13.118 1.00 43.01  ? 60   ARG C C     1 
ATOM   4041 O  O     . ARG E  3 60  ? -2.157  18.542  -12.063 1.00 41.70  ? 60   ARG C O     1 
ATOM   4042 C  CB    . ARG E  3 60  ? -1.836  16.919  -14.445 1.00 42.68  ? 60   ARG C CB    1 
ATOM   4043 C  CG    . ARG E  3 60  ? -2.232  15.766  -15.358 1.00 43.44  ? 60   ARG C CG    1 
ATOM   4044 C  CD    . ARG E  3 60  ? -1.361  14.541  -15.204 1.00 44.33  ? 60   ARG C CD    1 
ATOM   4045 N  NE    . ARG E  3 60  ? -0.041  14.680  -15.821 1.00 45.57  ? 60   ARG C NE    1 
ATOM   4046 C  CZ    . ARG E  3 60  ? 0.582   13.696  -16.469 1.00 45.53  ? 60   ARG C CZ    1 
ATOM   4047 N  NH1   . ARG E  3 60  ? 1.783   13.892  -16.991 1.00 44.72  ? 60   ARG C NH1   1 
ATOM   4048 N  NH2   . ARG E  3 60  ? -0.008  12.514  -16.607 1.00 46.33  ? 60   ARG C NH2   1 
ATOM   4049 N  N     . HIS E  3 61  ? -3.050  20.180  -13.344 1.00 42.93  ? 61   HIS C N     1 
ATOM   4050 C  CA    . HIS E  3 61  ? -3.005  21.185  -12.292 1.00 42.66  ? 61   HIS C CA    1 
ATOM   4051 C  C     . HIS E  3 61  ? -4.041  20.861  -11.221 1.00 40.39  ? 61   HIS C C     1 
ATOM   4052 O  O     . HIS E  3 61  ? -5.149  20.428  -11.528 1.00 39.09  ? 61   HIS C O     1 
ATOM   4053 C  CB    . HIS E  3 61  ? -3.261  22.582  -12.853 1.00 45.30  ? 61   HIS C CB    1 
ATOM   4054 C  CG    . HIS E  3 61  ? -2.181  23.074  -13.759 1.00 47.91  ? 61   HIS C CG    1 
ATOM   4055 N  ND1   . HIS E  3 61  ? -2.329  24.189  -14.556 1.00 50.26  ? 61   HIS C ND1   1 
ATOM   4056 C  CD2   . HIS E  3 61  ? -0.937  22.598  -14.004 1.00 49.36  ? 61   HIS C CD2   1 
ATOM   4057 C  CE1   . HIS E  3 61  ? -1.218  24.384  -15.246 1.00 50.58  ? 61   HIS C CE1   1 
ATOM   4058 N  NE2   . HIS E  3 61  ? -0.358  23.431  -14.932 1.00 50.12  ? 61   HIS C NE2   1 
ATOM   4059 N  N     . LEU E  3 62  ? -3.665  21.054  -9.963  1.00 38.62  ? 62   LEU C N     1 
ATOM   4060 C  CA    . LEU E  3 62  ? -4.589  20.861  -8.854  1.00 37.81  ? 62   LEU C CA    1 
ATOM   4061 C  C     . LEU E  3 62  ? -5.313  22.178  -8.578  1.00 36.66  ? 62   LEU C C     1 
ATOM   4062 O  O     . LEU E  3 62  ? -4.685  23.158  -8.183  1.00 37.13  ? 62   LEU C O     1 
ATOM   4063 C  CB    . LEU E  3 62  ? -3.834  20.405  -7.606  1.00 37.50  ? 62   LEU C CB    1 
ATOM   4064 C  CG    . LEU E  3 62  ? -3.032  19.109  -7.724  1.00 37.25  ? 62   LEU C CG    1 
ATOM   4065 C  CD1   . LEU E  3 62  ? -2.288  18.864  -6.423  1.00 37.43  ? 62   LEU C CD1   1 
ATOM   4066 C  CD2   . LEU E  3 62  ? -3.933  17.936  -8.063  1.00 36.67  ? 62   LEU C CD2   1 
ATOM   4067 N  N     . GLU E  3 63  ? -6.621  22.198  -8.818  1.00 35.22  ? 63   GLU C N     1 
ATOM   4068 C  CA    . GLU E  3 63  ? -7.434  23.402  -8.627  1.00 34.48  ? 63   GLU C CA    1 
ATOM   4069 C  C     . GLU E  3 63  ? -8.307  23.311  -7.379  1.00 31.26  ? 63   GLU C C     1 
ATOM   4070 O  O     . GLU E  3 63  ? -9.220  22.492  -7.295  1.00 29.64  ? 63   GLU C O     1 
ATOM   4071 C  CB    . GLU E  3 63  ? -8.341  23.639  -9.831  1.00 37.27  ? 63   GLU C CB    1 
ATOM   4072 C  CG    . GLU E  3 63  ? -7.639  23.971  -11.125 1.00 41.62  ? 63   GLU C CG    1 
ATOM   4073 C  CD    . GLU E  3 63  ? -8.637  24.195  -12.250 1.00 44.50  ? 63   GLU C CD    1 
ATOM   4074 O  OE1   . GLU E  3 63  ? -8.634  23.402  -13.218 1.00 45.86  ? 63   GLU C OE1   1 
ATOM   4075 O  OE2   . GLU E  3 63  ? -9.456  25.144  -12.149 1.00 46.28  ? 63   GLU C OE2   1 
ATOM   4076 N  N     . LEU E  3 64  ? -8.023  24.166  -6.411  1.00 30.18  ? 64   LEU C N     1 
ATOM   4077 C  CA    . LEU E  3 64  ? -8.836  24.240  -5.208  1.00 29.20  ? 64   LEU C CA    1 
ATOM   4078 C  C     . LEU E  3 64  ? -10.233 24.768  -5.532  1.00 29.53  ? 64   LEU C C     1 
ATOM   4079 O  O     . LEU E  3 64  ? -10.395 25.736  -6.284  1.00 29.56  ? 64   LEU C O     1 
ATOM   4080 C  CB    . LEU E  3 64  ? -8.138  25.094  -4.140  1.00 27.89  ? 64   LEU C CB    1 
ATOM   4081 C  CG    . LEU E  3 64  ? -6.853  24.468  -3.561  1.00 27.57  ? 64   LEU C CG    1 
ATOM   4082 C  CD1   . LEU E  3 64  ? -6.204  25.333  -2.491  1.00 27.58  ? 64   LEU C CD1   1 
ATOM   4083 C  CD2   . LEU E  3 64  ? -7.134  23.082  -3.001  1.00 26.46  ? 64   LEU C CD2   1 
ATOM   4084 N  N     . THR E  3 65  ? -11.239 24.090  -4.992  1.00 29.27  ? 65   THR C N     1 
ATOM   4085 C  CA    . THR E  3 65  ? -12.606 24.534  -5.090  1.00 29.96  ? 65   THR C CA    1 
ATOM   4086 C  C     . THR E  3 65  ? -12.755 25.661  -4.093  1.00 32.01  ? 65   THR C C     1 
ATOM   4087 O  O     . THR E  3 65  ? -11.864 25.884  -3.283  1.00 31.78  ? 65   THR C O     1 
ATOM   4088 C  CB    . THR E  3 65  ? -13.563 23.424  -4.696  1.00 29.02  ? 65   THR C CB    1 
ATOM   4089 O  OG1   . THR E  3 65  ? -13.230 22.972  -3.377  1.00 27.95  ? 65   THR C OG1   1 
ATOM   4090 C  CG2   . THR E  3 65  ? -13.459 22.266  -5.664  1.00 28.55  ? 65   THR C CG2   1 
ATOM   4091 N  N     . GLU E  3 66  ? -13.873 26.378  -4.142  1.00 34.75  ? 66   GLU C N     1 
ATOM   4092 C  CA    . GLU E  3 66  ? -14.065 27.490  -3.213  1.00 36.62  ? 66   GLU C CA    1 
ATOM   4093 C  C     . GLU E  3 66  ? -13.981 26.989  -1.769  1.00 36.38  ? 66   GLU C C     1 
ATOM   4094 O  O     . GLU E  3 66  ? -13.345 27.610  -0.916  1.00 36.50  ? 66   GLU C O     1 
ATOM   4095 C  CB    . GLU E  3 66  ? -15.391 28.207  -3.463  1.00 37.21  ? 66   GLU C CB    1 
ATOM   4096 C  CG    . GLU E  3 66  ? -15.346 29.650  -3.008  1.00 39.17  ? 66   GLU C CG    1 
ATOM   4097 C  CD    . GLU E  3 66  ? -16.709 30.281  -2.880  1.00 39.87  ? 66   GLU C CD    1 
ATOM   4098 O  OE1   . GLU E  3 66  ? -17.577 30.003  -3.733  1.00 40.46  ? 66   GLU C OE1   1 
ATOM   4099 O  OE2   . GLU E  3 66  ? -16.904 31.063  -1.924  1.00 41.49  ? 66   GLU C OE2   1 
ATOM   4100 N  N     . LYS E  3 67  ? -14.618 25.855  -1.513  1.00 36.27  ? 67   LYS C N     1 
ATOM   4101 C  CA    . LYS E  3 67  ? -14.562 25.225  -0.207  1.00 36.92  ? 67   LYS C CA    1 
ATOM   4102 C  C     . LYS E  3 67  ? -13.136 24.792  0.136   1.00 36.89  ? 67   LYS C C     1 
ATOM   4103 O  O     . LYS E  3 67  ? -12.684 24.962  1.269   1.00 37.95  ? 67   LYS C O     1 
ATOM   4104 C  CB    . LYS E  3 67  ? -15.516 24.036  -0.174  1.00 38.41  ? 67   LYS C CB    1 
ATOM   4105 C  CG    . LYS E  3 67  ? -15.298 23.044  0.955   1.00 40.05  ? 67   LYS C CG    1 
ATOM   4106 C  CD    . LYS E  3 67  ? -16.300 21.902  0.794   1.00 41.67  ? 67   LYS C CD    1 
ATOM   4107 C  CE    . LYS E  3 67  ? -16.042 20.746  1.753   1.00 42.79  ? 67   LYS C CE    1 
ATOM   4108 N  NZ    . LYS E  3 67  ? -16.949 19.597  1.441   1.00 42.75  ? 67   LYS C NZ    1 
ATOM   4109 N  N     . GLY E  3 68  ? -12.418 24.259  -0.848  1.00 34.97  ? 68   GLY C N     1 
ATOM   4110 C  CA    . GLY E  3 68  ? -11.050 23.810  -0.622  1.00 32.13  ? 68   GLY C CA    1 
ATOM   4111 C  C     . GLY E  3 68  ? -10.098 24.922  -0.230  1.00 30.62  ? 68   GLY C C     1 
ATOM   4112 O  O     . GLY E  3 68  ? -9.254  24.749  0.661   1.00 29.89  ? 68   GLY C O     1 
ATOM   4113 N  N     . ARG E  3 69  ? -10.220 26.065  -0.898  1.00 28.76  ? 69   ARG C N     1 
ATOM   4114 C  CA    . ARG E  3 69  ? -9.359  27.205  -0.596  1.00 28.33  ? 69   ARG C CA    1 
ATOM   4115 C  C     . ARG E  3 69  ? -9.692  27.876  0.741   1.00 28.79  ? 69   ARG C C     1 
ATOM   4116 O  O     . ARG E  3 69  ? -8.811  28.443  1.395   1.00 26.68  ? 69   ARG C O     1 
ATOM   4117 C  CB    . ARG E  3 69  ? -9.392  28.231  -1.719  1.00 28.36  ? 69   ARG C CB    1 
ATOM   4118 C  CG    . ARG E  3 69  ? -8.760  29.527  -1.313  1.00 29.66  ? 69   ARG C CG    1 
ATOM   4119 C  CD    . ARG E  3 69  ? -7.752  30.008  -2.298  1.00 30.63  ? 69   ARG C CD    1 
ATOM   4120 N  NE    . ARG E  3 69  ? -6.504  29.261  -2.212  1.00 32.76  ? 69   ARG C NE    1 
ATOM   4121 C  CZ    . ARG E  3 69  ? -5.305  29.802  -1.999  1.00 33.23  ? 69   ARG C CZ    1 
ATOM   4122 N  NH1   . ARG E  3 69  ? -5.173  31.107  -1.819  1.00 33.30  ? 69   ARG C NH1   1 
ATOM   4123 N  NH2   . ARG E  3 69  ? -4.231  29.031  -1.970  1.00 34.02  ? 69   ARG C NH2   1 
ATOM   4124 N  N     . ALA E  3 70  ? -10.964 27.806  1.136   1.00 29.18  ? 70   ALA C N     1 
ATOM   4125 C  CA    . ALA E  3 70  ? -11.404 28.331  2.419   1.00 30.28  ? 70   ALA C CA    1 
ATOM   4126 C  C     . ALA E  3 70  ? -10.773 27.520  3.546   1.00 31.38  ? 70   ALA C C     1 
ATOM   4127 O  O     . ALA E  3 70  ? -10.245 28.087  4.503   1.00 32.23  ? 70   ALA C O     1 
ATOM   4128 C  CB    . ALA E  3 70  ? -12.929 28.320  2.514   1.00 29.24  ? 70   ALA C CB    1 
ATOM   4129 N  N     . LEU E  3 71  ? -10.797 26.197  3.424   1.00 32.84  ? 71   LEU C N     1 
ATOM   4130 C  CA    . LEU E  3 71  ? -10.111 25.363  4.405   1.00 34.26  ? 71   LEU C CA    1 
ATOM   4131 C  C     . LEU E  3 71  ? -8.606  25.626  4.363   1.00 34.21  ? 71   LEU C C     1 
ATOM   4132 O  O     . LEU E  3 71  ? -7.973  25.742  5.409   1.00 34.88  ? 71   LEU C O     1 
ATOM   4133 C  CB    . LEU E  3 71  ? -10.415 23.873  4.203   1.00 35.09  ? 71   LEU C CB    1 
ATOM   4134 C  CG    . LEU E  3 71  ? -10.540 23.005  5.472   1.00 37.22  ? 71   LEU C CG    1 
ATOM   4135 C  CD1   . LEU E  3 71  ? -10.331 21.505  5.187   1.00 36.17  ? 71   LEU C CD1   1 
ATOM   4136 C  CD2   . LEU E  3 71  ? -9.612  23.453  6.617   1.00 36.83  ? 71   LEU C CD2   1 
ATOM   4137 N  N     . ALA E  3 72  ? -8.037  25.746  3.161   1.00 33.90  ? 72   ALA C N     1 
ATOM   4138 C  CA    . ALA E  3 72  ? -6.594  25.969  3.023   1.00 34.07  ? 72   ALA C CA    1 
ATOM   4139 C  C     . ALA E  3 72  ? -6.158  27.236  3.749   1.00 35.02  ? 72   ALA C C     1 
ATOM   4140 O  O     . ALA E  3 72  ? -5.210  27.214  4.542   1.00 36.54  ? 72   ALA C O     1 
ATOM   4141 C  CB    . ALA E  3 72  ? -6.178  26.022  1.546   1.00 33.49  ? 72   ALA C CB    1 
ATOM   4142 N  N     . ILE E  3 73  ? -6.854  28.338  3.468   1.00 34.61  ? 73   ILE C N     1 
ATOM   4143 C  CA    . ILE E  3 73  ? -6.632  29.614  4.144   1.00 34.53  ? 73   ILE C CA    1 
ATOM   4144 C  C     . ILE E  3 73  ? -6.766  29.498  5.665   1.00 34.42  ? 73   ILE C C     1 
ATOM   4145 O  O     . ILE E  3 73  ? -5.981  30.080  6.414   1.00 33.72  ? 73   ILE C O     1 
ATOM   4146 C  CB    . ILE E  3 73  ? -7.650  30.678  3.649   1.00 34.79  ? 73   ILE C CB    1 
ATOM   4147 C  CG1   . ILE E  3 73  ? -7.261  31.194  2.255   1.00 34.52  ? 73   ILE C CG1   1 
ATOM   4148 C  CG2   . ILE E  3 73  ? -7.761  31.823  4.651   1.00 33.46  ? 73   ILE C CG2   1 
ATOM   4149 C  CD1   . ILE E  3 73  ? -8.431  31.779  1.473   1.00 35.18  ? 73   ILE C CD1   1 
ATOM   4150 N  N     . ALA E  3 74  ? -7.774  28.749  6.104   1.00 34.81  ? 74   ALA C N     1 
ATOM   4151 C  CA    . ALA E  3 74  ? -8.088  28.593  7.521   1.00 35.23  ? 74   ALA C CA    1 
ATOM   4152 C  C     . ALA E  3 74  ? -6.978  27.890  8.276   1.00 36.31  ? 74   ALA C C     1 
ATOM   4153 O  O     . ALA E  3 74  ? -6.781  28.139  9.465   1.00 37.38  ? 74   ALA C O     1 
ATOM   4154 C  CB    . ALA E  3 74  ? -9.397  27.839  7.696   1.00 35.02  ? 74   ALA C CB    1 
ATOM   4155 N  N     . VAL E  3 75  ? -6.253  27.012  7.584   1.00 36.63  ? 75   VAL C N     1 
ATOM   4156 C  CA    . VAL E  3 75  ? -5.186  26.238  8.207   1.00 35.54  ? 75   VAL C CA    1 
ATOM   4157 C  C     . VAL E  3 75  ? -3.928  27.073  8.336   1.00 36.11  ? 75   VAL C C     1 
ATOM   4158 O  O     . VAL E  3 75  ? -3.242  27.025  9.366   1.00 36.60  ? 75   VAL C O     1 
ATOM   4159 C  CB    . VAL E  3 75  ? -4.889  24.944  7.418   1.00 35.66  ? 75   VAL C CB    1 
ATOM   4160 C  CG1   . VAL E  3 75  ? -3.652  24.255  7.955   1.00 36.00  ? 75   VAL C CG1   1 
ATOM   4161 C  CG2   . VAL E  3 75  ? -6.075  24.010  7.485   1.00 35.60  ? 75   VAL C CG2   1 
ATOM   4162 N  N     . MET E  3 76  ? -3.621  27.843  7.294   1.00 35.55  ? 76   MET C N     1 
ATOM   4163 C  CA    . MET E  3 76  ? -2.466  28.741  7.331   1.00 35.48  ? 76   MET C CA    1 
ATOM   4164 C  C     . MET E  3 76  ? -2.646  29.854  8.386   1.00 35.23  ? 76   MET C C     1 
ATOM   4165 O  O     . MET E  3 76  ? -1.686  30.288  9.029   1.00 34.14  ? 76   MET C O     1 
ATOM   4166 C  CB    . MET E  3 76  ? -2.214  29.331  5.939   1.00 36.60  ? 76   MET C CB    1 
ATOM   4167 C  CG    . MET E  3 76  ? -1.061  30.308  5.874   1.00 38.43  ? 76   MET C CG    1 
ATOM   4168 S  SD    . MET E  3 76  ? 0.574   29.541  5.977   1.00 41.26  ? 76   MET C SD    1 
ATOM   4169 C  CE    . MET E  3 76  ? 0.671   28.756  4.370   1.00 40.09  ? 76   MET C CE    1 
ATOM   4170 N  N     . ARG E  3 77  ? -3.885  30.306  8.561   1.00 34.58  ? 77   ARG C N     1 
ATOM   4171 C  CA    . ARG E  3 77  ? -4.198  31.291  9.594   1.00 34.28  ? 77   ARG C CA    1 
ATOM   4172 C  C     . ARG E  3 77  ? -3.814  30.714  10.957  1.00 34.12  ? 77   ARG C C     1 
ATOM   4173 O  O     . ARG E  3 77  ? -3.128  31.366  11.754  1.00 34.01  ? 77   ARG C O     1 
ATOM   4174 C  CB    . ARG E  3 77  ? -5.686  31.634  9.554   1.00 33.29  ? 77   ARG C CB    1 
ATOM   4175 C  CG    . ARG E  3 77  ? -6.093  32.878  10.325  1.00 33.41  ? 77   ARG C CG    1 
ATOM   4176 C  CD    . ARG E  3 77  ? -7.582  33.139  10.124  1.00 32.89  ? 77   ARG C CD    1 
ATOM   4177 N  NE    . ARG E  3 77  ? -8.396  32.013  10.580  1.00 32.29  ? 77   ARG C NE    1 
ATOM   4178 C  CZ    . ARG E  3 77  ? -9.523  31.606  9.998   1.00 32.28  ? 77   ARG C CZ    1 
ATOM   4179 N  NH1   . ARG E  3 77  ? -9.989  32.226  8.922   1.00 30.85  ? 77   ARG C NH1   1 
ATOM   4180 N  NH2   . ARG E  3 77  ? -10.187 30.569  10.498  1.00 32.60  ? 77   ARG C NH2   1 
ATOM   4181 N  N     . LYS E  3 78  ? -4.243  29.482  11.211  1.00 32.96  ? 78   LYS C N     1 
ATOM   4182 C  CA    . LYS E  3 78  ? -3.889  28.795  12.445  1.00 33.19  ? 78   LYS C CA    1 
ATOM   4183 C  C     . LYS E  3 78  ? -2.376  28.608  12.540  1.00 34.46  ? 78   LYS C C     1 
ATOM   4184 O  O     . LYS E  3 78  ? -1.783  28.860  13.591  1.00 34.03  ? 78   LYS C O     1 
ATOM   4185 C  CB    . LYS E  3 78  ? -4.604  27.451  12.537  1.00 32.88  ? 78   LYS C CB    1 
ATOM   4186 C  CG    . LYS E  3 78  ? -6.113  27.557  12.654  1.00 31.60  ? 78   LYS C CG    1 
ATOM   4187 C  CD    . LYS E  3 78  ? -6.769  26.257  12.252  1.00 33.11  ? 78   LYS C CD    1 
ATOM   4188 C  CE    . LYS E  3 78  ? -8.257  26.439  11.960  1.00 33.64  ? 78   LYS C CE    1 
ATOM   4189 N  NZ    . LYS E  3 78  ? -9.059  26.652  13.198  1.00 34.17  ? 78   LYS C NZ    1 
ATOM   4190 N  N     . HIS E  3 79  ? -1.752  28.193  11.436  1.00 35.23  ? 79   HIS C N     1 
ATOM   4191 C  CA    . HIS E  3 79  ? -0.302  28.021  11.403  1.00 35.73  ? 79   HIS C CA    1 
ATOM   4192 C  C     . HIS E  3 79  ? 0.410   29.297  11.860  1.00 35.50  ? 79   HIS C C     1 
ATOM   4193 O  O     . HIS E  3 79  ? 1.274   29.258  12.745  1.00 35.37  ? 79   HIS C O     1 
ATOM   4194 C  CB    . HIS E  3 79  ? 0.181   27.616  9.993   1.00 36.62  ? 79   HIS C CB    1 
ATOM   4195 C  CG    . HIS E  3 79  ? 1.665   27.414  9.892   1.00 37.43  ? 79   HIS C CG    1 
ATOM   4196 N  ND1   . HIS E  3 79  ? 2.279   26.227  10.232  1.00 37.68  ? 79   HIS C ND1   1 
ATOM   4197 C  CD2   . HIS E  3 79  ? 2.656   28.248  9.491   1.00 38.32  ? 79   HIS C CD2   1 
ATOM   4198 C  CE1   . HIS E  3 79  ? 3.584   26.342  10.056  1.00 38.41  ? 79   HIS C CE1   1 
ATOM   4199 N  NE2   . HIS E  3 79  ? 3.841   27.557  9.602   1.00 42.42  ? 79   HIS C NE2   1 
ATOM   4200 N  N     . ARG E  3 80  ? 0.045   30.425  11.257  1.00 35.15  ? 80   ARG C N     1 
ATOM   4201 C  CA    . ARG E  3 80  ? 0.779   31.667  11.478  1.00 35.64  ? 80   ARG C CA    1 
ATOM   4202 C  C     . ARG E  3 80  ? 0.462   32.353  12.800  1.00 35.68  ? 80   ARG C C     1 
ATOM   4203 O  O     . ARG E  3 80  ? 1.316   33.026  13.374  1.00 35.38  ? 80   ARG C O     1 
ATOM   4204 C  CB    . ARG E  3 80  ? 0.613   32.619  10.290  1.00 36.77  ? 80   ARG C CB    1 
ATOM   4205 C  CG    . ARG E  3 80  ? 1.697   32.417  9.252   1.00 37.50  ? 80   ARG C CG    1 
ATOM   4206 C  CD    . ARG E  3 80  ? 1.310   32.900  7.885   1.00 37.45  ? 80   ARG C CD    1 
ATOM   4207 N  NE    . ARG E  3 80  ? 2.259   32.368  6.918   1.00 38.99  ? 80   ARG C NE    1 
ATOM   4208 C  CZ    . ARG E  3 80  ? 2.141   32.455  5.596   1.00 39.44  ? 80   ARG C CZ    1 
ATOM   4209 N  NH1   . ARG E  3 80  ? 1.097   33.064  5.045   1.00 39.54  ? 80   ARG C NH1   1 
ATOM   4210 N  NH2   . ARG E  3 80  ? 3.077   31.921  4.825   1.00 40.28  ? 80   ARG C NH2   1 
ATOM   4211 N  N     . LEU E  3 81  ? -0.759  32.176  13.288  1.00 36.26  ? 81   LEU C N     1 
ATOM   4212 C  CA    . LEU E  3 81  ? -1.097  32.636  14.626  1.00 37.41  ? 81   LEU C CA    1 
ATOM   4213 C  C     . LEU E  3 81  ? -0.326  31.809  15.653  1.00 38.87  ? 81   LEU C C     1 
ATOM   4214 O  O     . LEU E  3 81  ? 0.193   32.348  16.636  1.00 39.68  ? 81   LEU C O     1 
ATOM   4215 C  CB    . LEU E  3 81  ? -2.606  32.540  14.875  1.00 37.53  ? 81   LEU C CB    1 
ATOM   4216 C  CG    . LEU E  3 81  ? -3.504  33.647  14.308  1.00 36.74  ? 81   LEU C CG    1 
ATOM   4217 C  CD1   . LEU E  3 81  ? -4.967  33.290  14.505  1.00 36.63  ? 81   LEU C CD1   1 
ATOM   4218 C  CD2   . LEU E  3 81  ? -3.192  34.982  14.968  1.00 36.55  ? 81   LEU C CD2   1 
ATOM   4219 N  N     . ALA E  3 82  ? -0.245  30.503  15.416  1.00 39.53  ? 82   ALA C N     1 
ATOM   4220 C  CA    . ALA E  3 82  ? 0.521   29.615  16.280  1.00 40.72  ? 82   ALA C CA    1 
ATOM   4221 C  C     . ALA E  3 82  ? 1.993   30.018  16.341  1.00 42.13  ? 82   ALA C C     1 
ATOM   4222 O  O     . ALA E  3 82  ? 2.637   29.868  17.375  1.00 41.58  ? 82   ALA C O     1 
ATOM   4223 C  CB    . ALA E  3 82  ? 0.391   28.184  15.815  1.00 40.11  ? 82   ALA C CB    1 
ATOM   4224 N  N     . GLU E  3 83  ? 2.525   30.529  15.233  1.00 44.04  ? 83   GLU C N     1 
ATOM   4225 C  CA    . GLU E  3 83  ? 3.923   30.960  15.198  1.00 45.77  ? 83   GLU C CA    1 
ATOM   4226 C  C     . GLU E  3 83  ? 4.122   32.224  16.034  1.00 45.70  ? 83   GLU C C     1 
ATOM   4227 O  O     . GLU E  3 83  ? 5.132   32.376  16.720  1.00 45.34  ? 83   GLU C O     1 
ATOM   4228 C  CB    . GLU E  3 83  ? 4.397   31.184  13.757  1.00 46.27  ? 83   GLU C CB    1 
ATOM   4229 C  CG    . GLU E  3 83  ? 4.542   29.912  12.943  1.00 48.62  ? 83   GLU C CG    1 
ATOM   4230 C  CD    . GLU E  3 83  ? 5.032   30.169  11.521  1.00 50.25  ? 83   GLU C CD    1 
ATOM   4231 O  OE1   . GLU E  3 83  ? 4.787   31.286  11.009  1.00 50.20  ? 83   GLU C OE1   1 
ATOM   4232 O  OE2   . GLU E  3 83  ? 5.651   29.252  10.913  1.00 52.69  ? 83   GLU C OE2   1 
ATOM   4233 N  N     . ARG E  3 84  ? 3.152   33.129  15.970  1.00 46.95  ? 84   ARG C N     1 
ATOM   4234 C  CA    . ARG E  3 84  ? 3.186   34.351  16.767  1.00 47.45  ? 84   ARG C CA    1 
ATOM   4235 C  C     . ARG E  3 84  ? 3.139   34.035  18.260  1.00 46.81  ? 84   ARG C C     1 
ATOM   4236 O  O     . ARG E  3 84  ? 3.973   34.516  19.024  1.00 46.21  ? 84   ARG C O     1 
ATOM   4237 C  CB    . ARG E  3 84  ? 2.042   35.288  16.372  1.00 48.52  ? 84   ARG C CB    1 
ATOM   4238 C  CG    . ARG E  3 84  ? 2.376   36.242  15.231  1.00 49.73  ? 84   ARG C CG    1 
ATOM   4239 C  CD    . ARG E  3 84  ? 2.910   37.565  15.754  1.00 50.67  ? 84   ARG C CD    1 
ATOM   4240 N  NE    . ARG E  3 84  ? 4.336   37.523  16.066  1.00 51.58  ? 84   ARG C NE    1 
ATOM   4241 C  CZ    . ARG E  3 84  ? 5.260   38.252  15.439  1.00 52.35  ? 84   ARG C CZ    1 
ATOM   4242 N  NH1   . ARG E  3 84  ? 4.909   39.085  14.464  1.00 52.63  ? 84   ARG C NH1   1 
ATOM   4243 N  NH2   . ARG E  3 84  ? 6.535   38.156  15.791  1.00 52.42  ? 84   ARG C NH2   1 
ATOM   4244 N  N     . LEU E  3 85  ? 2.176   33.211  18.661  1.00 46.35  ? 85   LEU C N     1 
ATOM   4245 C  CA    . LEU E  3 85  ? 2.069   32.768  20.045  1.00 46.75  ? 85   LEU C CA    1 
ATOM   4246 C  C     . LEU E  3 85  ? 3.363   32.129  20.556  1.00 47.06  ? 85   LEU C C     1 
ATOM   4247 O  O     . LEU E  3 85  ? 3.841   32.460  21.645  1.00 48.21  ? 85   LEU C O     1 
ATOM   4248 C  CB    . LEU E  3 85  ? 0.910   31.781  20.198  1.00 47.09  ? 85   LEU C CB    1 
ATOM   4249 C  CG    . LEU E  3 85  ? 0.755   31.134  21.579  1.00 47.57  ? 85   LEU C CG    1 
ATOM   4250 C  CD1   . LEU E  3 85  ? 0.563   32.202  22.652  1.00 47.11  ? 85   LEU C CD1   1 
ATOM   4251 C  CD2   . LEU E  3 85  ? -0.400  30.129  21.596  1.00 47.19  ? 85   LEU C CD2   1 
ATOM   4252 N  N     . LEU E  3 86  ? 3.925   31.220  19.765  1.00 46.23  ? 86   LEU C N     1 
ATOM   4253 C  CA    . LEU E  3 86  ? 5.101   30.452  20.169  1.00 46.18  ? 86   LEU C CA    1 
ATOM   4254 C  C     . LEU E  3 86  ? 6.363   31.302  20.291  1.00 47.09  ? 86   LEU C C     1 
ATOM   4255 O  O     . LEU E  3 86  ? 7.293   30.946  21.012  1.00 46.70  ? 86   LEU C O     1 
ATOM   4256 C  CB    . LEU E  3 86  ? 5.347   29.305  19.180  1.00 45.52  ? 86   LEU C CB    1 
ATOM   4257 C  CG    . LEU E  3 86  ? 4.391   28.109  19.208  1.00 44.41  ? 86   LEU C CG    1 
ATOM   4258 C  CD1   . LEU E  3 86  ? 4.460   27.310  17.913  1.00 43.22  ? 86   LEU C CD1   1 
ATOM   4259 C  CD2   . LEU E  3 86  ? 4.687   27.221  20.405  1.00 44.35  ? 86   LEU C CD2   1 
ATOM   4260 N  N     . VAL E  3 87  ? 6.403   32.419  19.575  1.00 48.57  ? 87   VAL C N     1 
ATOM   4261 C  CA    . VAL E  3 87  ? 7.575   33.281  19.605  1.00 50.42  ? 87   VAL C CA    1 
ATOM   4262 C  C     . VAL E  3 87  ? 7.360   34.465  20.542  1.00 51.57  ? 87   VAL C C     1 
ATOM   4263 O  O     . VAL E  3 87  ? 8.173   34.714  21.431  1.00 52.75  ? 87   VAL C O     1 
ATOM   4264 C  CB    . VAL E  3 87  ? 7.981   33.754  18.184  1.00 50.77  ? 87   VAL C CB    1 
ATOM   4265 C  CG1   . VAL E  3 87  ? 9.064   34.824  18.252  1.00 50.60  ? 87   VAL C CG1   1 
ATOM   4266 C  CG2   . VAL E  3 87  ? 8.467   32.576  17.363  1.00 50.58  ? 87   VAL C CG2   1 
ATOM   4267 N  N     . ASP E  3 88  ? 6.254   35.177  20.361  1.00 52.39  ? 88   ASP C N     1 
ATOM   4268 C  CA    . ASP E  3 88  ? 5.956   36.346  21.187  1.00 53.10  ? 88   ASP C CA    1 
ATOM   4269 C  C     . ASP E  3 88  ? 5.712   36.017  22.662  1.00 52.40  ? 88   ASP C C     1 
ATOM   4270 O  O     . ASP E  3 88  ? 6.091   36.784  23.547  1.00 52.74  ? 88   ASP C O     1 
ATOM   4271 C  CB    . ASP E  3 88  ? 4.755   37.114  20.626  1.00 54.58  ? 88   ASP C CB    1 
ATOM   4272 C  CG    . ASP E  3 88  ? 5.084   37.868  19.347  1.00 56.55  ? 88   ASP C CG    1 
ATOM   4273 O  OD1   . ASP E  3 88  ? 4.167   38.516  18.789  1.00 57.60  ? 88   ASP C OD1   1 
ATOM   4274 O  OD2   . ASP E  3 88  ? 6.255   37.821  18.902  1.00 57.53  ? 88   ASP C OD2   1 
ATOM   4275 N  N     . VAL E  3 89  ? 5.077   34.884  22.929  1.00 51.46  ? 89   VAL C N     1 
ATOM   4276 C  CA    . VAL E  3 89  ? 4.694   34.559  24.301  1.00 50.47  ? 89   VAL C CA    1 
ATOM   4277 C  C     . VAL E  3 89  ? 5.476   33.391  24.901  1.00 49.61  ? 89   VAL C C     1 
ATOM   4278 O  O     . VAL E  3 89  ? 6.081   33.521  25.965  1.00 49.61  ? 89   VAL C O     1 
ATOM   4279 C  CB    . VAL E  3 89  ? 3.179   34.282  24.410  1.00 50.58  ? 89   VAL C CB    1 
ATOM   4280 C  CG1   . VAL E  3 89  ? 2.820   33.791  25.814  1.00 50.32  ? 89   VAL C CG1   1 
ATOM   4281 C  CG2   . VAL E  3 89  ? 2.384   35.530  24.035  1.00 50.23  ? 89   VAL C CG2   1 
ATOM   4282 N  N     . ILE E  3 90  ? 5.464   32.254  24.216  1.00 48.15  ? 90   ILE C N     1 
ATOM   4283 C  CA    . ILE E  3 90  ? 6.042   31.028  24.766  1.00 46.97  ? 90   ILE C CA    1 
ATOM   4284 C  C     . ILE E  3 90  ? 7.577   31.034  24.717  1.00 46.27  ? 90   ILE C C     1 
ATOM   4285 O  O     . ILE E  3 90  ? 8.240   30.502  25.609  1.00 44.89  ? 90   ILE C O     1 
ATOM   4286 C  CB    . ILE E  3 90  ? 5.435   29.773  24.077  1.00 46.44  ? 90   ILE C CB    1 
ATOM   4287 C  CG1   . ILE E  3 90  ? 3.925   29.724  24.340  1.00 45.41  ? 90   ILE C CG1   1 
ATOM   4288 C  CG2   . ILE E  3 90  ? 6.104   28.502  24.568  1.00 46.40  ? 90   ILE C CG2   1 
ATOM   4289 C  CD1   . ILE E  3 90  ? 3.159   28.735  23.486  1.00 44.19  ? 90   ILE C CD1   1 
ATOM   4290 N  N     . GLY E  3 91  ? 8.131   31.657  23.682  1.00 46.16  ? 91   GLY C N     1 
ATOM   4291 C  CA    . GLY E  3 91  ? 9.576   31.838  23.582  1.00 47.11  ? 91   GLY C CA    1 
ATOM   4292 C  C     . GLY E  3 91  ? 10.334  30.634  23.062  1.00 48.16  ? 91   GLY C C     1 
ATOM   4293 O  O     . GLY E  3 91  ? 11.494  30.421  23.409  1.00 48.11  ? 91   GLY C O     1 
ATOM   4294 N  N     . LEU E  3 92  ? 9.681   29.837  22.226  1.00 49.07  ? 92   LEU C N     1 
ATOM   4295 C  CA    . LEU E  3 92  ? 10.349  28.709  21.605  1.00 49.75  ? 92   LEU C CA    1 
ATOM   4296 C  C     . LEU E  3 92  ? 11.421  29.267  20.671  1.00 51.04  ? 92   LEU C C     1 
ATOM   4297 O  O     . LEU E  3 92  ? 11.178  30.257  19.979  1.00 51.39  ? 92   LEU C O     1 
ATOM   4298 C  CB    . LEU E  3 92  ? 9.334   27.867  20.833  1.00 48.74  ? 92   LEU C CB    1 
ATOM   4299 C  CG    . LEU E  3 92  ? 9.732   26.481  20.313  1.00 48.56  ? 92   LEU C CG    1 
ATOM   4300 C  CD1   . LEU E  3 92  ? 9.965   25.491  21.450  1.00 47.51  ? 92   LEU C CD1   1 
ATOM   4301 C  CD2   . LEU E  3 92  ? 8.664   25.964  19.358  1.00 47.53  ? 92   LEU C CD2   1 
ATOM   4302 N  N     . PRO E  3 93  ? 12.622  28.658  20.670  1.00 52.21  ? 93   PRO C N     1 
ATOM   4303 C  CA    . PRO E  3 93  ? 13.662  29.077  19.733  1.00 53.18  ? 93   PRO C CA    1 
ATOM   4304 C  C     . PRO E  3 93  ? 13.130  29.173  18.304  1.00 54.05  ? 93   PRO C C     1 
ATOM   4305 O  O     . PRO E  3 93  ? 12.295  28.367  17.895  1.00 53.80  ? 93   PRO C O     1 
ATOM   4306 C  CB    . PRO E  3 93  ? 14.706  27.961  19.842  1.00 52.62  ? 93   PRO C CB    1 
ATOM   4307 C  CG    . PRO E  3 93  ? 14.539  27.429  21.211  1.00 52.37  ? 93   PRO C CG    1 
ATOM   4308 C  CD    . PRO E  3 93  ? 13.075  27.560  21.544  1.00 52.69  ? 93   PRO C CD    1 
ATOM   4309 N  N     . TRP E  3 94  ? 13.628  30.158  17.563  1.00 55.93  ? 94   TRP C N     1 
ATOM   4310 C  CA    . TRP E  3 94  ? 13.165  30.457  16.211  1.00 57.02  ? 94   TRP C CA    1 
ATOM   4311 C  C     . TRP E  3 94  ? 13.239  29.247  15.262  1.00 57.91  ? 94   TRP C C     1 
ATOM   4312 O  O     . TRP E  3 94  ? 12.440  29.135  14.327  1.00 57.93  ? 94   TRP C O     1 
ATOM   4313 C  CB    . TRP E  3 94  ? 13.976  31.634  15.647  1.00 57.30  ? 94   TRP C CB    1 
ATOM   4314 C  CG    . TRP E  3 94  ? 13.156  32.632  14.879  1.00 57.53  ? 94   TRP C CG    1 
ATOM   4315 N  N     . GLU E  3 95  ? 14.186  28.344  15.517  1.00 58.93  ? 95   GLU C N     1 
ATOM   4316 C  CA    . GLU E  3 95  ? 14.433  27.198  14.636  1.00 59.94  ? 95   GLU C CA    1 
ATOM   4317 C  C     . GLU E  3 95  ? 13.353  26.114  14.705  1.00 59.23  ? 95   GLU C C     1 
ATOM   4318 O  O     . GLU E  3 95  ? 13.232  25.302  13.783  1.00 59.79  ? 95   GLU C O     1 
ATOM   4319 C  CB    . GLU E  3 95  ? 15.812  26.568  14.912  1.00 61.06  ? 95   GLU C CB    1 
ATOM   4320 C  CG    . GLU E  3 95  ? 15.879  25.726  16.193  1.00 63.18  ? 95   GLU C CG    1 
ATOM   4321 C  CD    . GLU E  3 95  ? 16.890  24.575  16.118  1.00 64.55  ? 95   GLU C CD    1 
ATOM   4322 O  OE1   . GLU E  3 95  ? 16.482  23.404  16.313  1.00 64.60  ? 95   GLU C OE1   1 
ATOM   4323 O  OE2   . GLU E  3 95  ? 18.089  24.835  15.864  1.00 65.16  ? 95   GLU C OE2   1 
ATOM   4324 N  N     . GLU E  3 96  ? 12.570  26.102  15.783  1.00 57.76  ? 96   GLU C N     1 
ATOM   4325 C  CA    . GLU E  3 96  ? 11.660  24.983  16.055  1.00 56.13  ? 96   GLU C CA    1 
ATOM   4326 C  C     . GLU E  3 96  ? 10.186  25.334  16.003  1.00 53.89  ? 96   GLU C C     1 
ATOM   4327 O  O     . GLU E  3 96  ? 9.348   24.500  16.337  1.00 53.39  ? 96   GLU C O     1 
ATOM   4328 C  CB    . GLU E  3 96  ? 11.958  24.388  17.430  1.00 57.48  ? 96   GLU C CB    1 
ATOM   4329 C  CG    . GLU E  3 96  ? 13.204  23.540  17.485  1.00 60.21  ? 96   GLU C CG    1 
ATOM   4330 C  CD    . GLU E  3 96  ? 14.016  23.822  18.726  1.00 61.62  ? 96   GLU C CD    1 
ATOM   4331 O  OE1   . GLU E  3 96  ? 13.771  24.882  19.343  1.00 62.45  ? 96   GLU C OE1   1 
ATOM   4332 O  OE2   . GLU E  3 96  ? 14.896  23.000  19.079  1.00 62.37  ? 96   GLU C OE2   1 
ATOM   4333 N  N     . VAL E  3 97  ? 9.861   26.557  15.597  1.00 51.82  ? 97   VAL C N     1 
ATOM   4334 C  CA    . VAL E  3 97  ? 8.475   27.017  15.674  1.00 50.11  ? 97   VAL C CA    1 
ATOM   4335 C  C     . VAL E  3 97  ? 7.590   26.487  14.544  1.00 48.80  ? 97   VAL C C     1 
ATOM   4336 O  O     . VAL E  3 97  ? 6.474   26.030  14.789  1.00 47.93  ? 97   VAL C O     1 
ATOM   4337 C  CB    . VAL E  3 97  ? 8.378   28.553  15.787  1.00 50.57  ? 97   VAL C CB    1 
ATOM   4338 C  CG1   . VAL E  3 97  ? 9.455   29.070  16.723  1.00 50.32  ? 97   VAL C CG1   1 
ATOM   4339 C  CG2   . VAL E  3 97  ? 8.489   29.215  14.423  1.00 51.37  ? 97   VAL C CG2   1 
ATOM   4340 N  N     . HIS E  3 98  ? 8.092   26.531  13.313  1.00 47.38  ? 98   HIS C N     1 
ATOM   4341 C  CA    . HIS E  3 98  ? 7.328   26.035  12.183  1.00 45.36  ? 98   HIS C CA    1 
ATOM   4342 C  C     . HIS E  3 98  ? 6.967   24.565  12.379  1.00 43.60  ? 98   HIS C C     1 
ATOM   4343 O  O     . HIS E  3 98  ? 5.831   24.153  12.123  1.00 42.71  ? 98   HIS C O     1 
ATOM   4344 C  CB    . HIS E  3 98  ? 8.094   26.214  10.876  1.00 46.69  ? 98   HIS C CB    1 
ATOM   4345 C  CG    . HIS E  3 98  ? 7.424   25.563  9.710   1.00 47.81  ? 98   HIS C CG    1 
ATOM   4346 N  ND1   . HIS E  3 98  ? 6.473   26.207  8.946   1.00 49.79  ? 98   HIS C ND1   1 
ATOM   4347 C  CD2   . HIS E  3 98  ? 7.533   24.310  9.204   1.00 47.59  ? 98   HIS C CD2   1 
ATOM   4348 C  CE1   . HIS E  3 98  ? 6.038   25.382  8.009   1.00 48.68  ? 98   HIS C CE1   1 
ATOM   4349 N  NE2   . HIS E  3 98  ? 6.665   24.226  8.145   1.00 48.13  ? 98   HIS C NE2   1 
ATOM   4350 N  N     . ALA E  3 99  ? 7.948   23.781  12.818  1.00 41.45  ? 99   ALA C N     1 
ATOM   4351 C  CA    . ALA E  3 99  ? 7.734   22.379  13.151  1.00 39.65  ? 99   ALA C CA    1 
ATOM   4352 C  C     . ALA E  3 99  ? 6.575   22.209  14.133  1.00 38.90  ? 99   ALA C C     1 
ATOM   4353 O  O     . ALA E  3 99  ? 5.696   21.375  13.924  1.00 39.64  ? 99   ALA C O     1 
ATOM   4354 C  CB    . ALA E  3 99  ? 9.003   21.771  13.718  1.00 39.80  ? 99   ALA C CB    1 
ATOM   4355 N  N     . GLU E  3 100 ? 6.573   23.004  15.200  1.00 37.62  ? 100  GLU C N     1 
ATOM   4356 C  CA    . GLU E  3 100 ? 5.502   22.943  16.198  1.00 36.58  ? 100  GLU C CA    1 
ATOM   4357 C  C     . GLU E  3 100 ? 4.166   23.451  15.629  1.00 35.03  ? 100  GLU C C     1 
ATOM   4358 O  O     . GLU E  3 100 ? 3.127   22.815  15.799  1.00 34.21  ? 100  GLU C O     1 
ATOM   4359 C  CB    . GLU E  3 100 ? 5.890   23.736  17.455  1.00 36.15  ? 100  GLU C CB    1 
ATOM   4360 C  CG    . GLU E  3 100 ? 4.923   23.581  18.626  1.00 36.39  ? 100  GLU C CG    1 
ATOM   4361 C  CD    . GLU E  3 100 ? 5.252   22.394  19.504  1.00 37.12  ? 100  GLU C CD    1 
ATOM   4362 O  OE1   . GLU E  3 100 ? 6.433   22.016  19.549  1.00 38.25  ? 100  GLU C OE1   1 
ATOM   4363 O  OE2   . GLU E  3 100 ? 4.343   21.838  20.156  1.00 37.16  ? 100  GLU C OE2   1 
ATOM   4364 N  N     . ALA E  3 101 ? 4.207   24.600  14.960  1.00 33.75  ? 101  ALA C N     1 
ATOM   4365 C  CA    . ALA E  3 101 ? 3.018   25.206  14.364  1.00 33.55  ? 101  ALA C CA    1 
ATOM   4366 C  C     . ALA E  3 101 ? 2.388   24.295  13.323  1.00 34.04  ? 101  ALA C C     1 
ATOM   4367 O  O     . ALA E  3 101 ? 1.182   24.338  13.105  1.00 34.34  ? 101  ALA C O     1 
ATOM   4368 C  CB    . ALA E  3 101 ? 3.372   26.528  13.738  1.00 33.64  ? 101  ALA C CB    1 
ATOM   4369 N  N     . CYS E  3 102 ? 3.220   23.468  12.692  1.00 35.04  ? 102  CYS C N     1 
ATOM   4370 C  CA    . CYS E  3 102 ? 2.785   22.509  11.681  1.00 35.46  ? 102  CYS C CA    1 
ATOM   4371 C  C     . CYS E  3 102 ? 1.848   21.423  12.231  1.00 34.91  ? 102  CYS C C     1 
ATOM   4372 O  O     . CYS E  3 102 ? 1.008   20.880  11.503  1.00 35.72  ? 102  CYS C O     1 
ATOM   4373 C  CB    . CYS E  3 102 ? 4.010   21.874  11.014  1.00 36.43  ? 102  CYS C CB    1 
ATOM   4374 S  SG    . CYS E  3 102 ? 3.639   20.845  9.573   1.00 39.41  ? 102  CYS C SG    1 
ATOM   4375 N  N     . ARG E  3 103 ? 2.010   21.091  13.506  1.00 34.40  ? 103  ARG C N     1 
ATOM   4376 C  CA    . ARG E  3 103 ? 1.126   20.144  14.159  1.00 34.09  ? 103  ARG C CA    1 
ATOM   4377 C  C     . ARG E  3 103 ? -0.043  20.879  14.788  1.00 34.48  ? 103  ARG C C     1 
ATOM   4378 O  O     . ARG E  3 103 ? -1.159  20.367  14.838  1.00 33.93  ? 103  ARG C O     1 
ATOM   4379 C  CB    . ARG E  3 103 ? 1.872   19.358  15.232  1.00 33.87  ? 103  ARG C CB    1 
ATOM   4380 C  CG    . ARG E  3 103 ? 2.881   18.371  14.689  1.00 35.03  ? 103  ARG C CG    1 
ATOM   4381 C  CD    . ARG E  3 103 ? 3.346   17.391  15.763  1.00 35.62  ? 103  ARG C CD    1 
ATOM   4382 N  NE    . ARG E  3 103 ? 3.722   18.081  16.995  1.00 36.38  ? 103  ARG C NE    1 
ATOM   4383 C  CZ    . ARG E  3 103 ? 4.882   18.702  17.188  1.00 36.98  ? 103  ARG C CZ    1 
ATOM   4384 N  NH1   . ARG E  3 103 ? 5.122   19.310  18.350  1.00 36.60  ? 103  ARG C NH1   1 
ATOM   4385 N  NH2   . ARG E  3 103 ? 5.799   18.724  16.224  1.00 36.14  ? 103  ARG C NH2   1 
ATOM   4386 N  N     . TRP E  3 104 ? 0.221   22.088  15.266  1.00 35.24  ? 104  TRP C N     1 
ATOM   4387 C  CA    . TRP E  3 104 ? -0.786  22.890  15.964  1.00 36.47  ? 104  TRP C CA    1 
ATOM   4388 C  C     . TRP E  3 104 ? -1.919  23.363  15.050  1.00 36.35  ? 104  TRP C C     1 
ATOM   4389 O  O     . TRP E  3 104 ? -3.091  23.333  15.433  1.00 36.14  ? 104  TRP C O     1 
ATOM   4390 C  CB    . TRP E  3 104 ? -0.112  24.091  16.616  1.00 38.14  ? 104  TRP C CB    1 
ATOM   4391 C  CG    . TRP E  3 104 ? 0.598   23.753  17.888  1.00 39.07  ? 104  TRP C CG    1 
ATOM   4392 C  CD1   . TRP E  3 104 ? 1.287   22.602  18.172  1.00 39.06  ? 104  TRP C CD1   1 
ATOM   4393 C  CD2   . TRP E  3 104 ? 0.699   24.579  19.050  1.00 39.65  ? 104  TRP C CD2   1 
ATOM   4394 N  NE1   . TRP E  3 104 ? 1.801   22.660  19.444  1.00 39.17  ? 104  TRP C NE1   1 
ATOM   4395 C  CE2   . TRP E  3 104 ? 1.460   23.863  20.005  1.00 39.49  ? 104  TRP C CE2   1 
ATOM   4396 C  CE3   . TRP E  3 104 ? 0.222   25.857  19.379  1.00 39.88  ? 104  TRP C CE3   1 
ATOM   4397 C  CZ2   . TRP E  3 104 ? 1.753   24.382  21.269  1.00 39.18  ? 104  TRP C CZ2   1 
ATOM   4398 C  CZ3   . TRP E  3 104 ? 0.511   26.372  20.642  1.00 39.35  ? 104  TRP C CZ3   1 
ATOM   4399 C  CH2   . TRP E  3 104 ? 1.270   25.632  21.570  1.00 39.32  ? 104  TRP C CH2   1 
ATOM   4400 N  N     . GLU E  3 105 ? -1.555  23.797  13.846  1.00 35.54  ? 105  GLU C N     1 
ATOM   4401 C  CA    . GLU E  3 105 ? -2.507  24.271  12.847  1.00 35.92  ? 105  GLU C CA    1 
ATOM   4402 C  C     . GLU E  3 105 ? -3.699  23.320  12.709  1.00 36.49  ? 105  GLU C C     1 
ATOM   4403 O  O     . GLU E  3 105 ? -4.782  23.723  12.268  1.00 37.55  ? 105  GLU C O     1 
ATOM   4404 C  CB    . GLU E  3 105 ? -1.802  24.430  11.490  1.00 35.96  ? 105  GLU C CB    1 
ATOM   4405 C  CG    . GLU E  3 105 ? -1.162  23.140  10.988  1.00 36.51  ? 105  GLU C CG    1 
ATOM   4406 C  CD    . GLU E  3 105 ? -0.341  23.298  9.714   1.00 37.69  ? 105  GLU C CD    1 
ATOM   4407 O  OE1   . GLU E  3 105 ? -0.124  24.447  9.286   1.00 37.36  ? 105  GLU C OE1   1 
ATOM   4408 O  OE2   . GLU E  3 105 ? 0.099   22.255  9.150   1.00 38.55  ? 105  GLU C OE2   1 
ATOM   4409 N  N     . HIS E  3 106 ? -3.504  22.061  13.101  1.00 34.99  ? 106  HIS C N     1 
ATOM   4410 C  CA    . HIS E  3 106 ? -4.508  21.033  12.851  1.00 33.92  ? 106  HIS C CA    1 
ATOM   4411 C  C     . HIS E  3 106 ? -5.484  20.818  14.002  1.00 33.38  ? 106  HIS C C     1 
ATOM   4412 O  O     . HIS E  3 106 ? -6.527  20.189  13.817  1.00 32.38  ? 106  HIS C O     1 
ATOM   4413 C  CB    . HIS E  3 106 ? -3.839  19.710  12.435  1.00 34.13  ? 106  HIS C CB    1 
ATOM   4414 C  CG    . HIS E  3 106 ? -2.858  19.864  11.313  1.00 33.52  ? 106  HIS C CG    1 
ATOM   4415 N  ND1   . HIS E  3 106 ? -3.230  20.283  10.054  1.00 33.83  ? 106  HIS C ND1   1 
ATOM   4416 C  CD2   . HIS E  3 106 ? -1.518  19.681  11.268  1.00 33.81  ? 106  HIS C CD2   1 
ATOM   4417 C  CE1   . HIS E  3 106 ? -2.161  20.345  9.280   1.00 34.24  ? 106  HIS C CE1   1 
ATOM   4418 N  NE2   . HIS E  3 106 ? -1.108  19.986  9.992   1.00 34.09  ? 106  HIS C NE2   1 
ATOM   4419 N  N     . VAL E  3 107 ? -5.160  21.350  15.181  1.00 34.00  ? 107  VAL C N     1 
ATOM   4420 C  CA    . VAL E  3 107 ? -5.996  21.133  16.372  1.00 33.34  ? 107  VAL C CA    1 
ATOM   4421 C  C     . VAL E  3 107 ? -6.596  22.411  16.957  1.00 34.03  ? 107  VAL C C     1 
ATOM   4422 O  O     . VAL E  3 107 ? -7.486  22.348  17.802  1.00 34.51  ? 107  VAL C O     1 
ATOM   4423 C  CB    . VAL E  3 107 ? -5.225  20.371  17.482  1.00 31.99  ? 107  VAL C CB    1 
ATOM   4424 C  CG1   . VAL E  3 107 ? -5.028  18.920  17.093  1.00 30.90  ? 107  VAL C CG1   1 
ATOM   4425 C  CG2   . VAL E  3 107 ? -3.888  21.039  17.762  1.00 31.89  ? 107  VAL C CG2   1 
ATOM   4426 N  N     . MET E  3 108 ? -6.096  23.562  16.518  1.00 34.93  ? 108  MET C N     1 
ATOM   4427 C  CA    . MET E  3 108 ? -6.583  24.856  16.996  1.00 36.37  ? 108  MET C CA    1 
ATOM   4428 C  C     . MET E  3 108 ? -8.009  25.127  16.544  1.00 36.21  ? 108  MET C C     1 
ATOM   4429 O  O     . MET E  3 108 ? -8.319  24.979  15.365  1.00 36.03  ? 108  MET C O     1 
ATOM   4430 C  CB    . MET E  3 108 ? -5.702  25.994  16.477  1.00 38.28  ? 108  MET C CB    1 
ATOM   4431 C  CG    . MET E  3 108 ? -4.453  26.258  17.285  1.00 41.25  ? 108  MET C CG    1 
ATOM   4432 S  SD    . MET E  3 108 ? -3.651  27.784  16.732  1.00 45.90  ? 108  MET C SD    1 
ATOM   4433 C  CE    . MET E  3 108 ? -5.045  28.904  16.661  1.00 41.51  ? 108  MET C CE    1 
ATOM   4434 N  N     . SER E  3 109 ? -8.863  25.544  17.480  1.00 35.55  ? 109  SER C N     1 
ATOM   4435 C  CA    . SER E  3 109 ? -10.223 25.955  17.150  1.00 35.37  ? 109  SER C CA    1 
ATOM   4436 C  C     . SER E  3 109 ? -10.240 27.430  16.759  1.00 35.97  ? 109  SER C C     1 
ATOM   4437 O  O     . SER E  3 109 ? -9.277  28.153  17.014  1.00 35.71  ? 109  SER C O     1 
ATOM   4438 C  CB    . SER E  3 109 ? -11.160 25.711  18.334  1.00 34.36  ? 109  SER C CB    1 
ATOM   4439 O  OG    . SER E  3 109 ? -10.973 26.695  19.339  1.00 32.50  ? 109  SER C OG    1 
ATOM   4440 N  N     . GLU E  3 110 ? -11.334 27.870  16.143  1.00 37.86  ? 110  GLU C N     1 
ATOM   4441 C  CA    . GLU E  3 110 ? -11.505 29.286  15.767  1.00 40.00  ? 110  GLU C CA    1 
ATOM   4442 C  C     . GLU E  3 110 ? -11.658 30.156  17.006  1.00 39.85  ? 110  GLU C C     1 
ATOM   4443 O  O     . GLU E  3 110 ? -11.172 31.291  17.050  1.00 39.75  ? 110  GLU C O     1 
ATOM   4444 C  CB    . GLU E  3 110 ? -12.719 29.473  14.847  1.00 41.40  ? 110  GLU C CB    1 
ATOM   4445 C  CG    . GLU E  3 110 ? -12.613 28.741  13.514  1.00 45.00  ? 110  GLU C CG    1 
ATOM   4446 C  CD    . GLU E  3 110 ? -13.800 28.997  12.584  1.00 47.28  ? 110  GLU C CD    1 
ATOM   4447 O  OE1   . GLU E  3 110 ? -14.932 29.203  13.089  1.00 48.15  ? 110  GLU C OE1   1 
ATOM   4448 O  OE2   . GLU E  3 110 ? -13.597 28.981  11.345  1.00 47.96  ? 110  GLU C OE2   1 
ATOM   4449 N  N     . ASP E  3 111 ? -12.341 29.618  18.012  1.00 39.68  ? 111  ASP C N     1 
ATOM   4450 C  CA    . ASP E  3 111 ? -12.467 30.293  19.299  1.00 40.47  ? 111  ASP C CA    1 
ATOM   4451 C  C     . ASP E  3 111 ? -11.088 30.667  19.839  1.00 40.60  ? 111  ASP C C     1 
ATOM   4452 O  O     . ASP E  3 111 ? -10.846 31.826  20.181  1.00 40.70  ? 111  ASP C O     1 
ATOM   4453 C  CB    . ASP E  3 111 ? -13.207 29.417  20.308  1.00 40.63  ? 111  ASP C CB    1 
ATOM   4454 C  CG    . ASP E  3 111 ? -14.459 28.790  19.728  1.00 42.33  ? 111  ASP C CG    1 
ATOM   4455 O  OD1   . ASP E  3 111 ? -15.539 28.969  20.333  1.00 41.63  ? 111  ASP C OD1   1 
ATOM   4456 O  OD2   . ASP E  3 111 ? -14.364 28.108  18.672  1.00 43.79  ? 111  ASP C OD2   1 
ATOM   4457 N  N     . VAL E  3 112 ? -10.180 29.693  19.908  1.00 40.28  ? 112  VAL C N     1 
ATOM   4458 C  CA    . VAL E  3 112 ? -8.812  29.998  20.318  1.00 40.02  ? 112  VAL C CA    1 
ATOM   4459 C  C     . VAL E  3 112 ? -8.204  31.055  19.411  1.00 39.59  ? 112  VAL C C     1 
ATOM   4460 O  O     . VAL E  3 112 ? -7.691  32.055  19.902  1.00 39.81  ? 112  VAL C O     1 
ATOM   4461 C  CB    . VAL E  3 112 ? -7.893  28.758  20.351  1.00 39.70  ? 112  VAL C CB    1 
ATOM   4462 C  CG1   . VAL E  3 112 ? -6.442  29.193  20.486  1.00 38.13  ? 112  VAL C CG1   1 
ATOM   4463 C  CG2   . VAL E  3 112 ? -8.282  27.845  21.499  1.00 38.80  ? 112  VAL C CG2   1 
ATOM   4464 N  N     . GLU E  3 113 ? -8.273  30.835  18.096  1.00 39.63  ? 113  GLU C N     1 
ATOM   4465 C  CA    . GLU E  3 113 ? -7.749  31.798  17.112  1.00 39.87  ? 113  GLU C CA    1 
ATOM   4466 C  C     . GLU E  3 113 ? -8.189  33.226  17.393  1.00 38.95  ? 113  GLU C C     1 
ATOM   4467 O  O     . GLU E  3 113 ? -7.376  34.142  17.362  1.00 38.84  ? 113  GLU C O     1 
ATOM   4468 C  CB    . GLU E  3 113 ? -8.204  31.455  15.693  1.00 40.39  ? 113  GLU C CB    1 
ATOM   4469 C  CG    . GLU E  3 113 ? -7.611  30.221  15.094  1.00 41.18  ? 113  GLU C CG    1 
ATOM   4470 C  CD    . GLU E  3 113 ? -7.766  30.203  13.592  1.00 42.67  ? 113  GLU C CD    1 
ATOM   4471 O  OE1   . GLU E  3 113 ? -7.032  30.959  12.919  1.00 42.86  ? 113  GLU C OE1   1 
ATOM   4472 O  OE2   . GLU E  3 113 ? -8.621  29.440  13.083  1.00 43.56  ? 113  GLU C OE2   1 
ATOM   4473 N  N     . ARG E  3 114 ? -9.484  33.407  17.634  1.00 39.17  ? 114  ARG C N     1 
ATOM   4474 C  CA    . ARG E  3 114 ? -10.042 34.730  17.917  1.00 40.31  ? 114  ARG C CA    1 
ATOM   4475 C  C     . ARG E  3 114 ? -9.500  35.329  19.206  1.00 40.57  ? 114  ARG C C     1 
ATOM   4476 O  O     . ARG E  3 114 ? -9.282  36.536  19.287  1.00 41.25  ? 114  ARG C O     1 
ATOM   4477 C  CB    . ARG E  3 114 ? -11.572 34.689  17.950  1.00 40.26  ? 114  ARG C CB    1 
ATOM   4478 C  CG    . ARG E  3 114 ? -12.186 34.526  16.574  1.00 40.63  ? 114  ARG C CG    1 
ATOM   4479 C  CD    . ARG E  3 114 ? -13.669 34.779  16.589  1.00 41.15  ? 114  ARG C CD    1 
ATOM   4480 N  NE    . ARG E  3 114 ? -14.407 33.584  16.966  1.00 41.89  ? 114  ARG C NE    1 
ATOM   4481 C  CZ    . ARG E  3 114 ? -14.828 32.669  16.097  1.00 41.75  ? 114  ARG C CZ    1 
ATOM   4482 N  NH1   . ARG E  3 114 ? -14.579 32.821  14.802  1.00 40.98  ? 114  ARG C NH1   1 
ATOM   4483 N  NH2   . ARG E  3 114 ? -15.495 31.602  16.523  1.00 40.96  ? 114  ARG C NH2   1 
ATOM   4484 N  N     . ARG E  3 115 ? -9.272  34.483  20.206  1.00 40.96  ? 115  ARG C N     1 
ATOM   4485 C  CA    . ARG E  3 115 ? -8.700  34.935  21.464  1.00 41.25  ? 115  ARG C CA    1 
ATOM   4486 C  C     . ARG E  3 115 ? -7.248  35.326  21.277  1.00 41.75  ? 115  ARG C C     1 
ATOM   4487 O  O     . ARG E  3 115 ? -6.708  36.111  22.049  1.00 43.38  ? 115  ARG C O     1 
ATOM   4488 C  CB    . ARG E  3 115 ? -8.802  33.850  22.541  1.00 41.75  ? 115  ARG C CB    1 
ATOM   4489 C  CG    . ARG E  3 115 ? -10.204 33.624  23.099  1.00 41.85  ? 115  ARG C CG    1 
ATOM   4490 C  CD    . ARG E  3 115 ? -10.702 34.847  23.853  1.00 42.67  ? 115  ARG C CD    1 
ATOM   4491 N  NE    . ARG E  3 115 ? -9.735  35.348  24.834  1.00 42.58  ? 115  ARG C NE    1 
ATOM   4492 C  CZ    . ARG E  3 115 ? -9.702  36.608  25.267  1.00 43.23  ? 115  ARG C CZ    1 
ATOM   4493 N  NH1   . ARG E  3 115 ? -10.572 37.499  24.792  1.00 42.92  ? 115  ARG C NH1   1 
ATOM   4494 N  NH2   . ARG E  3 115 ? -8.799  36.987  26.161  1.00 42.19  ? 115  ARG C NH2   1 
ATOM   4495 N  N     . LEU E  3 116 ? -6.607  34.771  20.260  1.00 42.77  ? 116  LEU C N     1 
ATOM   4496 C  CA    . LEU E  3 116 ? -5.190  35.047  20.027  1.00 43.24  ? 116  LEU C CA    1 
ATOM   4497 C  C     . LEU E  3 116 ? -4.992  36.365  19.293  1.00 43.14  ? 116  LEU C C     1 
ATOM   4498 O  O     . LEU E  3 116 ? -3.982  37.028  19.474  1.00 42.28  ? 116  LEU C O     1 
ATOM   4499 C  CB    . LEU E  3 116 ? -4.523  33.893  19.267  1.00 43.76  ? 116  LEU C CB    1 
ATOM   4500 C  CG    . LEU E  3 116 ? -4.151  32.631  20.061  1.00 44.06  ? 116  LEU C CG    1 
ATOM   4501 C  CD1   . LEU E  3 116 ? -3.816  31.476  19.121  1.00 43.11  ? 116  LEU C CD1   1 
ATOM   4502 C  CD2   . LEU E  3 116 ? -2.984  32.904  21.004  1.00 44.02  ? 116  LEU C CD2   1 
ATOM   4503 N  N     . VAL E  3 117 ? -5.958  36.737  18.459  1.00 44.65  ? 117  VAL C N     1 
ATOM   4504 C  CA    . VAL E  3 117 ? -5.927  38.038  17.798  1.00 46.49  ? 117  VAL C CA    1 
ATOM   4505 C  C     . VAL E  3 117 ? -5.979  39.139  18.864  1.00 48.12  ? 117  VAL C C     1 
ATOM   4506 O  O     . VAL E  3 117 ? -5.278  40.152  18.775  1.00 48.70  ? 117  VAL C O     1 
ATOM   4507 C  CB    . VAL E  3 117 ? -7.107  38.207  16.811  1.00 46.25  ? 117  VAL C CB    1 
ATOM   4508 C  CG1   . VAL E  3 117 ? -6.988  39.522  16.054  1.00 46.13  ? 117  VAL C CG1   1 
ATOM   4509 C  CG2   . VAL E  3 117 ? -7.168  37.040  15.838  1.00 45.22  ? 117  VAL C CG2   1 
ATOM   4510 N  N     . LYS E  3 118 ? -6.809  38.922  19.882  1.00 49.45  ? 118  LYS C N     1 
ATOM   4511 C  CA    . LYS E  3 118 ? -6.894  39.837  21.013  1.00 50.49  ? 118  LYS C CA    1 
ATOM   4512 C  C     . LYS E  3 118 ? -5.581  39.851  21.789  1.00 50.75  ? 118  LYS C C     1 
ATOM   4513 O  O     . LYS E  3 118 ? -4.902  40.874  21.863  1.00 50.29  ? 118  LYS C O     1 
ATOM   4514 C  CB    . LYS E  3 118 ? -8.042  39.434  21.935  1.00 51.59  ? 118  LYS C CB    1 
ATOM   4515 C  CG    . LYS E  3 118 ? -9.400  39.250  21.241  1.00 53.16  ? 118  LYS C CG    1 
ATOM   4516 C  CD    . LYS E  3 118 ? -9.925  40.533  20.596  1.00 54.45  ? 118  LYS C CD    1 
ATOM   4517 C  CE    . LYS E  3 118 ? -9.744  40.527  19.066  1.00 55.79  ? 118  LYS C CE    1 
ATOM   4518 N  NZ    . LYS E  3 118 ? -10.360 41.713  18.381  1.00 55.29  ? 118  LYS C NZ    1 
ATOM   4519 N  N     . VAL E  3 119 ? -5.223  38.693  22.338  1.00 51.34  ? 119  VAL C N     1 
ATOM   4520 C  CA    . VAL E  3 119 ? -4.031  38.525  23.171  1.00 51.89  ? 119  VAL C CA    1 
ATOM   4521 C  C     . VAL E  3 119 ? -2.727  38.974  22.504  1.00 53.10  ? 119  VAL C C     1 
ATOM   4522 O  O     . VAL E  3 119 ? -1.834  39.506  23.167  1.00 53.26  ? 119  VAL C O     1 
ATOM   4523 C  CB    . VAL E  3 119 ? -3.889  37.054  23.636  1.00 51.48  ? 119  VAL C CB    1 
ATOM   4524 C  CG1   . VAL E  3 119 ? -2.513  36.799  24.218  1.00 51.13  ? 119  VAL C CG1   1 
ATOM   4525 C  CG2   . VAL E  3 119 ? -4.987  36.696  24.638  1.00 51.23  ? 119  VAL C CG2   1 
ATOM   4526 N  N     . LEU E  3 120 ? -2.614  38.770  21.196  1.00 54.66  ? 120  LEU C N     1 
ATOM   4527 C  CA    . LEU E  3 120 ? -1.384  39.125  20.483  1.00 55.78  ? 120  LEU C CA    1 
ATOM   4528 C  C     . LEU E  3 120 ? -1.410  40.544  19.901  1.00 56.63  ? 120  LEU C C     1 
ATOM   4529 O  O     . LEU E  3 120 ? -0.481  40.951  19.197  1.00 56.19  ? 120  LEU C O     1 
ATOM   4530 C  CB    . LEU E  3 120 ? -1.068  38.086  19.404  1.00 55.60  ? 120  LEU C CB    1 
ATOM   4531 C  CG    . LEU E  3 120 ? -0.779  36.679  19.948  1.00 55.28  ? 120  LEU C CG    1 
ATOM   4532 C  CD1   . LEU E  3 120 ? -0.783  35.645  18.833  1.00 54.95  ? 120  LEU C CD1   1 
ATOM   4533 C  CD2   . LEU E  3 120 ? 0.539   36.646  20.719  1.00 55.08  ? 120  LEU C CD2   1 
ATOM   4534 N  N     . ASN E  3 121 ? -2.471  41.286  20.219  1.00 57.82  ? 121  ASN C N     1 
ATOM   4535 C  CA    . ASN E  3 121 ? -2.637  42.679  19.787  1.00 59.28  ? 121  ASN C CA    1 
ATOM   4536 C  C     . ASN E  3 121 ? -2.822  42.809  18.283  1.00 59.50  ? 121  ASN C C     1 
ATOM   4537 O  O     . ASN E  3 121 ? -1.917  43.272  17.577  1.00 59.30  ? 121  ASN C O     1 
ATOM   4538 C  CB    . ASN E  3 121 ? -1.467  43.559  20.254  1.00 60.38  ? 121  ASN C CB    1 
ATOM   4539 C  CG    . ASN E  3 121 ? -1.422  43.726  21.767  1.00 61.59  ? 121  ASN C CG    1 
ATOM   4540 O  OD1   . ASN E  3 121 ? -2.460  43.770  22.440  1.00 61.20  ? 121  ASN C OD1   1 
ATOM   4541 N  ND2   . ASN E  3 121 ? -0.209  43.822  22.310  1.00 62.19  ? 121  ASN C ND2   1 
ATOM   4542 N  N     . ASN E  3 122 ? -4.004  42.409  17.813  1.00 59.53  ? 122  ASN C N     1 
ATOM   4543 C  CA    . ASN E  3 122 ? -4.320  42.356  16.382  1.00 59.84  ? 122  ASN C CA    1 
ATOM   4544 C  C     . ASN E  3 122 ? -3.097  42.147  15.487  1.00 59.64  ? 122  ASN C C     1 
ATOM   4545 O  O     . ASN E  3 122 ? -2.654  43.077  14.811  1.00 60.12  ? 122  ASN C O     1 
ATOM   4546 C  CB    . ASN E  3 122 ? -5.117  43.592  15.944  1.00 60.25  ? 122  ASN C CB    1 
ATOM   4547 C  CG    . ASN E  3 122 ? -6.548  43.581  16.470  1.00 60.60  ? 122  ASN C CG    1 
ATOM   4548 O  OD1   . ASN E  3 122 ? -7.486  43.234  15.748  1.00 60.98  ? 122  ASN C OD1   1 
ATOM   4549 N  ND2   . ASN E  3 122 ? -6.718  43.942  17.736  1.00 60.16  ? 122  ASN C ND2   1 
ATOM   4550 N  N     . PRO E  3 123 ? -2.541  40.922  15.490  1.00 59.12  ? 123  PRO C N     1 
ATOM   4551 C  CA    . PRO E  3 123 ? -1.375  40.640  14.663  1.00 58.75  ? 123  PRO C CA    1 
ATOM   4552 C  C     . PRO E  3 123 ? -1.795  40.476  13.212  1.00 58.84  ? 123  PRO C C     1 
ATOM   4553 O  O     . PRO E  3 123 ? -2.935  40.080  12.943  1.00 58.72  ? 123  PRO C O     1 
ATOM   4554 C  CB    . PRO E  3 123 ? -0.855  39.318  15.227  1.00 58.41  ? 123  PRO C CB    1 
ATOM   4555 C  CG    . PRO E  3 123 ? -2.056  38.656  15.805  1.00 58.55  ? 123  PRO C CG    1 
ATOM   4556 C  CD    . PRO E  3 123 ? -2.981  39.745  16.263  1.00 58.93  ? 123  PRO C CD    1 
ATOM   4557 N  N     . THR E  3 124 ? -0.889  40.796  12.289  1.00 58.22  ? 124  THR C N     1 
ATOM   4558 C  CA    . THR E  3 124 ? -1.194  40.709  10.862  1.00 57.75  ? 124  THR C CA    1 
ATOM   4559 C  C     . THR E  3 124 ? -0.126  39.942  10.074  1.00 57.12  ? 124  THR C C     1 
ATOM   4560 O  O     . THR E  3 124 ? -0.302  39.667  8.890   1.00 56.67  ? 124  THR C O     1 
ATOM   4561 C  CB    . THR E  3 124 ? -1.434  42.111  10.225  1.00 58.08  ? 124  THR C CB    1 
ATOM   4562 O  OG1   . THR E  3 124 ? -0.290  42.952  10.433  1.00 58.12  ? 124  THR C OG1   1 
ATOM   4563 C  CG2   . THR E  3 124 ? -2.670  42.776  10.820  1.00 57.76  ? 124  THR C CG2   1 
ATOM   4564 N  N     . THR E  3 125 ? 0.977   39.601  10.733  1.00 57.15  ? 125  THR C N     1 
ATOM   4565 C  CA    . THR E  3 125 ? 2.049   38.849  10.085  1.00 56.65  ? 125  THR C CA    1 
ATOM   4566 C  C     . THR E  3 125 ? 2.559   37.703  10.951  1.00 57.10  ? 125  THR C C     1 
ATOM   4567 O  O     . THR E  3 125 ? 2.377   37.691  12.171  1.00 57.25  ? 125  THR C O     1 
ATOM   4568 C  CB    . THR E  3 125 ? 3.264   39.744  9.706   1.00 56.07  ? 125  THR C CB    1 
ATOM   4569 O  OG1   . THR E  3 125 ? 3.878   40.255  10.893  1.00 55.75  ? 125  THR C OG1   1 
ATOM   4570 C  CG2   . THR E  3 125 ? 2.846   40.902  8.816   1.00 55.99  ? 125  THR C CG2   1 
ATOM   4571 N  N     . SER E  3 126 ? 3.189   36.737  10.290  1.00 56.99  ? 126  SER C N     1 
ATOM   4572 C  CA    . SER E  3 126 ? 3.972   35.703  10.944  1.00 56.86  ? 126  SER C CA    1 
ATOM   4573 C  C     . SER E  3 126 ? 5.205   36.387  11.536  1.00 57.15  ? 126  SER C C     1 
ATOM   4574 O  O     . SER E  3 126 ? 5.531   37.504  11.141  1.00 57.59  ? 126  SER C O     1 
ATOM   4575 C  CB    . SER E  3 126 ? 4.372   34.651  9.896   1.00 56.29  ? 126  SER C CB    1 
ATOM   4576 O  OG    . SER E  3 126 ? 5.555   33.952  10.241  1.00 55.30  ? 126  SER C OG    1 
ATOM   4577 N  N     . PRO E  3 127 ? 5.875   35.745  12.512  1.00 57.12  ? 127  PRO C N     1 
ATOM   4578 C  CA    . PRO E  3 127 ? 7.177   36.245  12.961  1.00 57.13  ? 127  PRO C CA    1 
ATOM   4579 C  C     . PRO E  3 127 ? 8.170   36.395  11.805  1.00 57.52  ? 127  PRO C C     1 
ATOM   4580 O  O     . PRO E  3 127 ? 9.125   37.166  11.899  1.00 57.55  ? 127  PRO C O     1 
ATOM   4581 C  CB    . PRO E  3 127 ? 7.661   35.146  13.912  1.00 56.88  ? 127  PRO C CB    1 
ATOM   4582 C  CG    . PRO E  3 127 ? 6.422   34.511  14.412  1.00 56.70  ? 127  PRO C CG    1 
ATOM   4583 C  CD    . PRO E  3 127 ? 5.445   34.561  13.275  1.00 56.74  ? 127  PRO C CD    1 
ATOM   4584 N  N     . PHE E  3 128 ? 7.937   35.659  10.724  1.00 57.82  ? 128  PHE C N     1 
ATOM   4585 C  CA    . PHE E  3 128 ? 8.864   35.626  9.601   1.00 58.04  ? 128  PHE C CA    1 
ATOM   4586 C  C     . PHE E  3 128 ? 8.505   36.649  8.523   1.00 57.41  ? 128  PHE C C     1 
ATOM   4587 O  O     . PHE E  3 128 ? 9.147   36.708  7.474   1.00 57.74  ? 128  PHE C O     1 
ATOM   4588 C  CB    . PHE E  3 128 ? 8.934   34.211  9.017   1.00 59.06  ? 128  PHE C CB    1 
ATOM   4589 C  CG    . PHE E  3 128 ? 9.373   33.166  10.015  1.00 60.36  ? 128  PHE C CG    1 
ATOM   4590 C  CD1   . PHE E  3 128 ? 8.435   32.404  10.704  1.00 60.43  ? 128  PHE C CD1   1 
ATOM   4591 C  CD2   . PHE E  3 128 ? 10.724  32.955  10.273  1.00 60.61  ? 128  PHE C CD2   1 
ATOM   4592 C  CE1   . PHE E  3 128 ? 8.835   31.450  11.628  1.00 60.69  ? 128  PHE C CE1   1 
ATOM   4593 C  CE2   . PHE E  3 128 ? 11.133  32.000  11.195  1.00 60.89  ? 128  PHE C CE2   1 
ATOM   4594 C  CZ    . PHE E  3 128 ? 10.188  31.247  11.874  1.00 60.97  ? 128  PHE C CZ    1 
ATOM   4595 N  N     . GLY E  3 129 ? 7.481   37.452  8.789   1.00 56.40  ? 129  GLY C N     1 
ATOM   4596 C  CA    . GLY E  3 129 ? 7.086   38.519  7.877   1.00 54.90  ? 129  GLY C CA    1 
ATOM   4597 C  C     . GLY E  3 129 ? 5.867   38.221  7.025   1.00 53.96  ? 129  GLY C C     1 
ATOM   4598 O  O     . GLY E  3 129 ? 5.219   39.135  6.529   1.00 54.23  ? 129  GLY C O     1 
ATOM   4599 N  N     . ASN E  3 130 ? 5.546   36.946  6.846   1.00 53.51  ? 130  ASN C N     1 
ATOM   4600 C  CA    . ASN E  3 130 ? 4.429   36.573  5.981   1.00 52.69  ? 130  ASN C CA    1 
ATOM   4601 C  C     . ASN E  3 130 ? 3.083   36.931  6.592   1.00 51.75  ? 130  ASN C C     1 
ATOM   4602 O  O     . ASN E  3 130 ? 2.863   36.712  7.781   1.00 52.16  ? 130  ASN C O     1 
ATOM   4603 C  CB    . ASN E  3 130 ? 4.482   35.086  5.661   1.00 53.10  ? 130  ASN C CB    1 
ATOM   4604 C  CG    . ASN E  3 130 ? 5.871   34.628  5.295   1.00 54.13  ? 130  ASN C CG    1 
ATOM   4605 O  OD1   . ASN E  3 130 ? 6.631   34.178  6.156   1.00 54.71  ? 130  ASN C OD1   1 
ATOM   4606 N  ND2   . ASN E  3 130 ? 6.224   34.757  4.018   1.00 53.70  ? 130  ASN C ND2   1 
ATOM   4607 N  N     . PRO E  3 131 ? 2.170   37.480  5.775   1.00 50.90  ? 131  PRO C N     1 
ATOM   4608 C  CA    . PRO E  3 131 ? 0.860   37.892  6.280   1.00 49.82  ? 131  PRO C CA    1 
ATOM   4609 C  C     . PRO E  3 131 ? 0.016   36.714  6.759   1.00 48.67  ? 131  PRO C C     1 
ATOM   4610 O  O     . PRO E  3 131 ? 0.114   35.614  6.211   1.00 48.05  ? 131  PRO C O     1 
ATOM   4611 C  CB    . PRO E  3 131 ? 0.203   38.555  5.062   1.00 50.10  ? 131  PRO C CB    1 
ATOM   4612 C  CG    . PRO E  3 131 ? 0.907   37.967  3.881   1.00 50.61  ? 131  PRO C CG    1 
ATOM   4613 C  CD    . PRO E  3 131 ? 2.320   37.739  4.331   1.00 50.60  ? 131  PRO C CD    1 
ATOM   4614 N  N     . ILE E  3 132 ? -0.793  36.954  7.790   1.00 47.49  ? 132  ILE C N     1 
ATOM   4615 C  CA    . ILE E  3 132 ? -1.740  35.966  8.290   1.00 45.60  ? 132  ILE C CA    1 
ATOM   4616 C  C     . ILE E  3 132 ? -3.033  36.131  7.514   1.00 44.73  ? 132  ILE C C     1 
ATOM   4617 O  O     . ILE E  3 132 ? -3.714  37.141  7.667   1.00 45.75  ? 132  ILE C O     1 
ATOM   4618 C  CB    . ILE E  3 132 ? -2.049  36.167  9.792   1.00 44.91  ? 132  ILE C CB    1 
ATOM   4619 C  CG1   . ILE E  3 132 ? -0.762  36.182  10.622  1.00 44.70  ? 132  ILE C CG1   1 
ATOM   4620 C  CG2   . ILE E  3 132 ? -3.002  35.085  10.291  1.00 44.00  ? 132  ILE C CG2   1 
ATOM   4621 C  CD1   . ILE E  3 132 ? -0.969  36.567  12.083  1.00 44.14  ? 132  ILE C CD1   1 
ATOM   4622 N  N     . PRO E  3 133 ? -3.381  35.140  6.676   1.00 43.81  ? 133  PRO C N     1 
ATOM   4623 C  CA    . PRO E  3 133 ? -4.586  35.259  5.870   1.00 42.08  ? 133  PRO C CA    1 
ATOM   4624 C  C     . PRO E  3 133 ? -5.819  34.868  6.674   1.00 41.57  ? 133  PRO C C     1 
ATOM   4625 O  O     . PRO E  3 133 ? -5.699  34.278  7.754   1.00 40.64  ? 133  PRO C O     1 
ATOM   4626 C  CB    . PRO E  3 133 ? -4.353  34.228  4.764   1.00 41.95  ? 133  PRO C CB    1 
ATOM   4627 C  CG    . PRO E  3 133 ? -3.565  33.156  5.436   1.00 41.83  ? 133  PRO C CG    1 
ATOM   4628 C  CD    . PRO E  3 133 ? -2.687  33.856  6.447   1.00 42.87  ? 133  PRO C CD    1 
ATOM   4629 N  N     . GLY E  3 134 ? -6.993  35.199  6.146   1.00 40.66  ? 134  GLY C N     1 
ATOM   4630 C  CA    . GLY E  3 134 ? -8.252  34.714  6.687   1.00 40.46  ? 134  GLY C CA    1 
ATOM   4631 C  C     . GLY E  3 134 ? -8.772  35.426  7.918   1.00 41.52  ? 134  GLY C C     1 
ATOM   4632 O  O     . GLY E  3 134 ? -9.754  34.979  8.510   1.00 42.21  ? 134  GLY C O     1 
ATOM   4633 N  N     . LEU E  3 135 ? -8.135  36.531  8.305   1.00 41.46  ? 135  LEU C N     1 
ATOM   4634 C  CA    . LEU E  3 135 ? -8.556  37.277  9.500   1.00 42.24  ? 135  LEU C CA    1 
ATOM   4635 C  C     . LEU E  3 135 ? -9.960  37.874  9.352   1.00 43.73  ? 135  LEU C C     1 
ATOM   4636 O  O     . LEU E  3 135 ? -10.809 37.712  10.238  1.00 44.60  ? 135  LEU C O     1 
ATOM   4637 C  CB    . LEU E  3 135 ? -7.537  38.359  9.866   1.00 40.84  ? 135  LEU C CB    1 
ATOM   4638 C  CG    . LEU E  3 135 ? -6.119  37.843  10.160  1.00 40.52  ? 135  LEU C CG    1 
ATOM   4639 C  CD1   . LEU E  3 135 ? -5.098  38.980  10.246  1.00 39.50  ? 135  LEU C CD1   1 
ATOM   4640 C  CD2   . LEU E  3 135 ? -6.088  36.984  11.421  1.00 39.38  ? 135  LEU C CD2   1 
ATOM   4641 N  N     . VAL E  3 136 ? -10.212 38.546  8.233   1.00 44.52  ? 136  VAL C N     1 
ATOM   4642 C  CA    . VAL E  3 136 ? -11.539 39.098  7.972   1.00 45.90  ? 136  VAL C CA    1 
ATOM   4643 C  C     . VAL E  3 136 ? -12.605 38.021  8.092   1.00 47.44  ? 136  VAL C C     1 
ATOM   4644 O  O     . VAL E  3 136 ? -13.567 38.162  8.858   1.00 47.83  ? 136  VAL C O     1 
ATOM   4645 C  CB    . VAL E  3 136 ? -11.631 39.758  6.585   1.00 46.07  ? 136  VAL C CB    1 
ATOM   4646 C  CG1   . VAL E  3 136 ? -13.075 40.151  6.270   1.00 45.25  ? 136  VAL C CG1   1 
ATOM   4647 C  CG2   . VAL E  3 136 ? -10.696 40.967  6.511   1.00 45.95  ? 136  VAL C CG2   1 
ATOM   4648 N  N     . GLU E  3 137 ? -12.435 36.933  7.351   1.00 49.34  ? 137  GLU C N     1 
ATOM   4649 C  CA    . GLU E  3 137 ? -13.415 35.851  7.411   1.00 51.77  ? 137  GLU C CA    1 
ATOM   4650 C  C     . GLU E  3 137 ? -13.387 35.083  8.753   1.00 52.71  ? 137  GLU C C     1 
ATOM   4651 O  O     . GLU E  3 137 ? -14.254 34.250  9.011   1.00 52.72  ? 137  GLU C O     1 
ATOM   4652 C  CB    . GLU E  3 137 ? -13.322 34.924  6.183   1.00 52.21  ? 137  GLU C CB    1 
ATOM   4653 C  CG    . GLU E  3 137 ? -11.914 34.585  5.692   1.00 54.24  ? 137  GLU C CG    1 
ATOM   4654 C  CD    . GLU E  3 137 ? -11.256 35.695  4.871   1.00 55.32  ? 137  GLU C CD    1 
ATOM   4655 O  OE1   . GLU E  3 137 ? -10.696 36.638  5.473   1.00 56.19  ? 137  GLU C OE1   1 
ATOM   4656 O  OE2   . GLU E  3 137 ? -11.265 35.613  3.623   1.00 56.15  ? 137  GLU C OE2   1 
ATOM   4657 N  N     . LEU E  3 138 ? -12.413 35.394  9.611   1.00 53.71  ? 138  LEU C N     1 
ATOM   4658 C  CA    . LEU E  3 138 ? -12.330 34.798  10.948  1.00 54.58  ? 138  LEU C CA    1 
ATOM   4659 C  C     . LEU E  3 138 ? -13.478 35.316  11.799  1.00 56.28  ? 138  LEU C C     1 
ATOM   4660 O  O     . LEU E  3 138 ? -14.194 34.548  12.442  1.00 56.34  ? 138  LEU C O     1 
ATOM   4661 C  CB    . LEU E  3 138 ? -11.001 35.158  11.630  1.00 53.04  ? 138  LEU C CB    1 
ATOM   4662 C  CG    . LEU E  3 138 ? -10.309 34.152  12.572  1.00 52.13  ? 138  LEU C CG    1 
ATOM   4663 C  CD1   . LEU E  3 138 ? -9.265  34.839  13.447  1.00 50.42  ? 138  LEU C CD1   1 
ATOM   4664 C  CD2   . LEU E  3 138 ? -11.283 33.356  13.423  1.00 50.65  ? 138  LEU C CD2   1 
ATOM   4665 N  N     . GLY E  3 139 ? -13.647 36.633  11.784  1.00 58.56  ? 139  GLY C N     1 
ATOM   4666 C  CA    . GLY E  3 139 ? -14.644 37.310  12.604  1.00 61.01  ? 139  GLY C CA    1 
ATOM   4667 C  C     . GLY E  3 139 ? -14.038 38.597  13.130  1.00 63.13  ? 139  GLY C C     1 
ATOM   4668 O  O     . GLY E  3 139 ? -14.421 39.088  14.199  1.00 63.16  ? 139  GLY C O     1 
ATOM   4669 N  N     . VAL E  3 140 ? -13.081 39.131  12.366  1.00 64.40  ? 140  VAL C N     1 
ATOM   4670 C  CA    . VAL E  3 140 ? -12.361 40.357  12.717  1.00 65.67  ? 140  VAL C CA    1 
ATOM   4671 C  C     . VAL E  3 140 ? -12.827 41.538  11.860  1.00 66.32  ? 140  VAL C C     1 
ATOM   4672 O  O     . VAL E  3 140 ? -12.535 41.612  10.662  1.00 66.26  ? 140  VAL C O     1 
ATOM   4673 C  CB    . VAL E  3 140 ? -10.827 40.185  12.551  1.00 66.26  ? 140  VAL C CB    1 
ATOM   4674 C  CG1   . VAL E  3 140 ? -10.093 41.479  12.906  1.00 66.38  ? 140  VAL C CG1   1 
ATOM   4675 C  CG2   . VAL E  3 140 ? -10.313 39.009  13.391  1.00 66.16  ? 140  VAL C CG2   1 
ATOM   4676 N  N     . MET F  3 1   ? -8.741  13.830  9.980   1.00 63.94  ? 1    MET D N     1 
ATOM   4677 C  CA    . MET F  3 1   ? -7.976  13.089  11.024  1.00 63.17  ? 1    MET D CA    1 
ATOM   4678 C  C     . MET F  3 1   ? -8.906  12.396  12.013  1.00 62.31  ? 1    MET D C     1 
ATOM   4679 O  O     . MET F  3 1   ? -10.089 12.721  12.107  1.00 62.00  ? 1    MET D O     1 
ATOM   4680 C  CB    . MET F  3 1   ? -7.056  14.040  11.791  1.00 63.78  ? 1    MET D CB    1 
ATOM   4681 C  CG    . MET F  3 1   ? -7.804  15.126  12.549  1.00 64.53  ? 1    MET D CG    1 
ATOM   4682 S  SD    . MET F  3 1   ? -6.814  15.953  13.805  1.00 64.73  ? 1    MET D SD    1 
ATOM   4683 C  CE    . MET F  3 1   ? -8.007  17.144  14.424  1.00 64.92  ? 1    MET D CE    1 
ATOM   4684 N  N     . ASN F  3 2   ? -8.351  11.436  12.746  1.00 61.43  ? 2    ASN D N     1 
ATOM   4685 C  CA    . ASN F  3 2   ? -9.042  10.790  13.851  1.00 59.80  ? 2    ASN D CA    1 
ATOM   4686 C  C     . ASN F  3 2   ? -9.697  11.847  14.737  1.00 58.41  ? 2    ASN D C     1 
ATOM   4687 O  O     . ASN F  3 2   ? -9.147  12.940  14.924  1.00 58.74  ? 2    ASN D O     1 
ATOM   4688 C  CB    . ASN F  3 2   ? -8.032  9.979   14.667  1.00 60.34  ? 2    ASN D CB    1 
ATOM   4689 C  CG    . ASN F  3 2   ? -8.686  8.912   15.516  1.00 60.84  ? 2    ASN D CG    1 
ATOM   4690 O  OD1   . ASN F  3 2   ? -9.771  9.112   16.057  1.00 61.45  ? 2    ASN D OD1   1 
ATOM   4691 N  ND2   . ASN F  3 2   ? -8.022  7.767   15.641  1.00 61.06  ? 2    ASN D ND2   1 
ATOM   4692 N  N     . GLU F  3 3   ? -10.870 11.527  15.278  1.00 55.88  ? 3    GLU D N     1 
ATOM   4693 C  CA    . GLU F  3 3   ? -11.529 12.421  16.225  1.00 53.18  ? 3    GLU D CA    1 
ATOM   4694 C  C     . GLU F  3 3   ? -10.749 12.508  17.544  1.00 49.57  ? 3    GLU D C     1 
ATOM   4695 O  O     . GLU F  3 3   ? -10.589 13.590  18.107  1.00 48.78  ? 3    GLU D O     1 
ATOM   4696 C  CB    . GLU F  3 3   ? -12.976 11.992  16.468  1.00 55.09  ? 3    GLU D CB    1 
ATOM   4697 C  CG    . GLU F  3 3   ? -13.696 12.846  17.498  1.00 57.39  ? 3    GLU D CG    1 
ATOM   4698 C  CD    . GLU F  3 3   ? -15.198 12.925  17.260  1.00 59.30  ? 3    GLU D CD    1 
ATOM   4699 O  OE1   . GLU F  3 3   ? -15.685 12.366  16.244  1.00 59.58  ? 3    GLU D OE1   1 
ATOM   4700 O  OE2   . GLU F  3 3   ? -15.890 13.556  18.093  1.00 59.87  ? 3    GLU D OE2   1 
ATOM   4701 N  N     . LEU F  3 4   ? -10.255 11.367  18.019  1.00 45.11  ? 4    LEU D N     1 
ATOM   4702 C  CA    . LEU F  3 4   ? -9.375  11.321  19.186  1.00 41.55  ? 4    LEU D CA    1 
ATOM   4703 C  C     . LEU F  3 4   ? -7.995  11.915  18.899  1.00 39.82  ? 4    LEU D C     1 
ATOM   4704 O  O     . LEU F  3 4   ? -7.253  12.226  19.818  1.00 39.66  ? 4    LEU D O     1 
ATOM   4705 C  CB    . LEU F  3 4   ? -9.218  9.882   19.692  1.00 39.80  ? 4    LEU D CB    1 
ATOM   4706 C  CG    . LEU F  3 4   ? -10.458 9.122   20.176  1.00 39.01  ? 4    LEU D CG    1 
ATOM   4707 C  CD1   . LEU F  3 4   ? -10.088 7.715   20.634  1.00 37.83  ? 4    LEU D CD1   1 
ATOM   4708 C  CD2   . LEU F  3 4   ? -11.155 9.872   21.298  1.00 38.35  ? 4    LEU D CD2   1 
ATOM   4709 N  N     . VAL F  3 5   ? -7.669  12.076  17.619  1.00 39.46  ? 5    VAL D N     1 
ATOM   4710 C  CA    . VAL F  3 5   ? -6.356  12.566  17.160  1.00 37.86  ? 5    VAL D CA    1 
ATOM   4711 C  C     . VAL F  3 5   ? -5.276  11.485  17.293  1.00 38.33  ? 5    VAL D C     1 
ATOM   4712 O  O     . VAL F  3 5   ? -4.659  11.082  16.299  1.00 38.46  ? 5    VAL D O     1 
ATOM   4713 C  CB    . VAL F  3 5   ? -5.907  13.854  17.871  1.00 36.67  ? 5    VAL D CB    1 
ATOM   4714 C  CG1   . VAL F  3 5   ? -4.694  14.446  17.167  1.00 35.14  ? 5    VAL D CG1   1 
ATOM   4715 C  CG2   . VAL F  3 5   ? -7.039  14.864  17.897  1.00 37.00  ? 5    VAL D CG2   1 
ATOM   4716 N  N     . ASP F  3 6   ? -5.051  11.029  18.522  1.00 37.30  ? 6    ASP D N     1 
ATOM   4717 C  CA    . ASP F  3 6   ? -4.222  9.862   18.770  1.00 36.50  ? 6    ASP D CA    1 
ATOM   4718 C  C     . ASP F  3 6   ? -4.996  8.914   19.673  1.00 35.64  ? 6    ASP D C     1 
ATOM   4719 O  O     . ASP F  3 6   ? -5.213  9.187   20.850  1.00 35.41  ? 6    ASP D O     1 
ATOM   4720 C  CB    . ASP F  3 6   ? -2.890  10.258  19.407  1.00 37.45  ? 6    ASP D CB    1 
ATOM   4721 C  CG    . ASP F  3 6   ? -1.926  9.085   19.539  1.00 37.97  ? 6    ASP D CG    1 
ATOM   4722 O  OD1   . ASP F  3 6   ? -0.753  9.277   19.183  1.00 39.02  ? 6    ASP D OD1   1 
ATOM   4723 O  OD2   . ASP F  3 6   ? -2.323  7.985   19.997  1.00 36.73  ? 6    ASP D OD2   1 
ATOM   4724 N  N     . THR F  3 7   ? -5.424  7.803   19.092  1.00 35.24  ? 7    THR D N     1 
ATOM   4725 C  CA    . THR F  3 7   ? -6.205  6.796   19.786  1.00 34.57  ? 7    THR D CA    1 
ATOM   4726 C  C     . THR F  3 7   ? -5.420  6.169   20.940  1.00 34.73  ? 7    THR D C     1 
ATOM   4727 O  O     . THR F  3 7   ? -5.932  6.043   22.051  1.00 34.75  ? 7    THR D O     1 
ATOM   4728 C  CB    . THR F  3 7   ? -6.673  5.704   18.788  1.00 34.41  ? 7    THR D CB    1 
ATOM   4729 O  OG1   . THR F  3 7   ? -7.700  6.244   17.945  1.00 34.69  ? 7    THR D OG1   1 
ATOM   4730 C  CG2   . THR F  3 7   ? -7.212  4.482   19.516  1.00 33.45  ? 7    THR D CG2   1 
ATOM   4731 N  N     . THR F  3 8   ? -4.175  5.789   20.679  1.00 33.40  ? 8    THR D N     1 
ATOM   4732 C  CA    . THR F  3 8   ? -3.369  5.126   21.685  1.00 33.46  ? 8    THR D CA    1 
ATOM   4733 C  C     . THR F  3 8   ? -3.194  6.027   22.911  1.00 33.90  ? 8    THR D C     1 
ATOM   4734 O  O     . THR F  3 8   ? -3.385  5.587   24.054  1.00 34.37  ? 8    THR D O     1 
ATOM   4735 C  CB    . THR F  3 8   ? -2.002  4.683   21.104  1.00 34.05  ? 8    THR D CB    1 
ATOM   4736 O  OG1   . THR F  3 8   ? -2.216  3.717   20.063  1.00 34.43  ? 8    THR D OG1   1 
ATOM   4737 C  CG2   . THR F  3 8   ? -1.110  4.074   22.171  1.00 33.18  ? 8    THR D CG2   1 
ATOM   4738 N  N     . GLU F  3 9   ? -2.856  7.290   22.675  1.00 32.84  ? 9    GLU D N     1 
ATOM   4739 C  CA    . GLU F  3 9   ? -2.639  8.229   23.770  1.00 32.29  ? 9    GLU D CA    1 
ATOM   4740 C  C     . GLU F  3 9   ? -3.921  8.465   24.562  1.00 32.88  ? 9    GLU D C     1 
ATOM   4741 O  O     . GLU F  3 9   ? -3.882  8.560   25.792  1.00 32.73  ? 9    GLU D O     1 
ATOM   4742 C  CB    . GLU F  3 9   ? -2.063  9.552   23.263  1.00 31.91  ? 9    GLU D CB    1 
ATOM   4743 C  CG    . GLU F  3 9   ? -0.610  9.456   22.835  1.00 31.95  ? 9    GLU D CG    1 
ATOM   4744 C  CD    . GLU F  3 9   ? 0.000   10.804  22.476  1.00 33.45  ? 9    GLU D CD    1 
ATOM   4745 O  OE1   . GLU F  3 9   ? -0.747  11.787  22.263  1.00 33.24  ? 9    GLU D OE1   1 
ATOM   4746 O  OE2   . GLU F  3 9   ? 1.246   10.881  22.405  1.00 34.25  ? 9    GLU D OE2   1 
ATOM   4747 N  N     . MET F  3 10  ? -5.055  8.538   23.863  1.00 31.71  ? 10   MET D N     1 
ATOM   4748 C  CA    . MET F  3 10  ? -6.333  8.729   24.529  1.00 31.22  ? 10   MET D CA    1 
ATOM   4749 C  C     . MET F  3 10  ? -6.735  7.495   25.332  1.00 30.58  ? 10   MET D C     1 
ATOM   4750 O  O     . MET F  3 10  ? -7.426  7.607   26.346  1.00 31.35  ? 10   MET D O     1 
ATOM   4751 C  CB    . MET F  3 10  ? -7.436  9.119   23.537  1.00 31.77  ? 10   MET D CB    1 
ATOM   4752 C  CG    . MET F  3 10  ? -7.405  10.577  23.120  1.00 33.26  ? 10   MET D CG    1 
ATOM   4753 S  SD    . MET F  3 10  ? -7.397  11.707  24.534  1.00 36.35  ? 10   MET D SD    1 
ATOM   4754 C  CE    . MET F  3 10  ? -8.940  11.219  25.320  1.00 34.46  ? 10   MET D CE    1 
ATOM   4755 N  N     . TYR F  3 11  ? -6.306  6.321   24.884  1.00 29.82  ? 11   TYR D N     1 
ATOM   4756 C  CA    . TYR F  3 11  ? -6.532  5.086   25.649  1.00 29.49  ? 11   TYR D CA    1 
ATOM   4757 C  C     . TYR F  3 11  ? -5.661  5.068   26.900  1.00 29.73  ? 11   TYR D C     1 
ATOM   4758 O  O     . TYR F  3 11  ? -6.157  4.834   27.998  1.00 30.56  ? 11   TYR D O     1 
ATOM   4759 C  CB    . TYR F  3 11  ? -6.274  3.846   24.791  1.00 27.99  ? 11   TYR D CB    1 
ATOM   4760 C  CG    . TYR F  3 11  ? -7.495  3.362   24.043  1.00 27.61  ? 11   TYR D CG    1 
ATOM   4761 C  CD1   . TYR F  3 11  ? -8.223  4.227   23.209  1.00 26.86  ? 11   TYR D CD1   1 
ATOM   4762 C  CD2   . TYR F  3 11  ? -7.929  2.043   24.167  1.00 26.94  ? 11   TYR D CD2   1 
ATOM   4763 C  CE1   . TYR F  3 11  ? -9.352  3.787   22.526  1.00 26.39  ? 11   TYR D CE1   1 
ATOM   4764 C  CE2   . TYR F  3 11  ? -9.054  1.592   23.488  1.00 27.27  ? 11   TYR D CE2   1 
ATOM   4765 C  CZ    . TYR F  3 11  ? -9.759  2.470   22.667  1.00 27.26  ? 11   TYR D CZ    1 
ATOM   4766 O  OH    . TYR F  3 11  ? -10.870 2.019   21.989  1.00 27.91  ? 11   TYR D OH    1 
ATOM   4767 N  N     . LEU F  3 12  ? -4.372  5.341   26.730  1.00 29.82  ? 12   LEU D N     1 
ATOM   4768 C  CA    . LEU F  3 12  ? -3.461  5.509   27.863  1.00 31.90  ? 12   LEU D CA    1 
ATOM   4769 C  C     . LEU F  3 12  ? -3.941  6.572   28.869  1.00 33.21  ? 12   LEU D C     1 
ATOM   4770 O  O     . LEU F  3 12  ? -4.030  6.303   30.071  1.00 33.76  ? 12   LEU D O     1 
ATOM   4771 C  CB    . LEU F  3 12  ? -2.044  5.851   27.374  1.00 30.86  ? 12   LEU D CB    1 
ATOM   4772 C  CG    . LEU F  3 12  ? -1.323  4.729   26.626  1.00 32.35  ? 12   LEU D CG    1 
ATOM   4773 C  CD1   . LEU F  3 12  ? 0.003   5.218   26.051  1.00 32.00  ? 12   LEU D CD1   1 
ATOM   4774 C  CD2   . LEU F  3 12  ? -1.116  3.496   27.518  1.00 31.27  ? 12   LEU D CD2   1 
ATOM   4775 N  N     . ARG F  3 13  ? -4.242  7.776   28.385  1.00 34.20  ? 13   ARG D N     1 
ATOM   4776 C  CA    . ARG F  3 13  ? -4.652  8.844   29.284  1.00 36.11  ? 13   ARG D CA    1 
ATOM   4777 C  C     . ARG F  3 13  ? -5.968  8.531   29.985  1.00 35.93  ? 13   ARG D C     1 
ATOM   4778 O  O     . ARG F  3 13  ? -6.156  8.884   31.149  1.00 37.27  ? 13   ARG D O     1 
ATOM   4779 C  CB    . ARG F  3 13  ? -4.751  10.185  28.564  1.00 37.56  ? 13   ARG D CB    1 
ATOM   4780 C  CG    . ARG F  3 13  ? -4.532  11.372  29.498  1.00 39.10  ? 13   ARG D CG    1 
ATOM   4781 C  CD    . ARG F  3 13  ? -5.313  12.583  29.035  1.00 40.02  ? 13   ARG D CD    1 
ATOM   4782 N  NE    . ARG F  3 13  ? -6.728  12.443  29.343  1.00 41.16  ? 13   ARG D NE    1 
ATOM   4783 C  CZ    . ARG F  3 13  ? -7.706  13.009  28.648  1.00 41.63  ? 13   ARG D CZ    1 
ATOM   4784 N  NH1   . ARG F  3 13  ? -8.962  12.816  29.017  1.00 42.03  ? 13   ARG D NH1   1 
ATOM   4785 N  NH2   . ARG F  3 13  ? -7.434  13.757  27.586  1.00 41.46  ? 13   ARG D NH2   1 
ATOM   4786 N  N     . THR F  3 14  ? -6.872  7.861   29.281  1.00 35.64  ? 14   THR D N     1 
ATOM   4787 C  CA    . THR F  3 14  ? -8.143  7.461   29.878  1.00 35.21  ? 14   THR D CA    1 
ATOM   4788 C  C     . THR F  3 14  ? -7.946  6.447   31.000  1.00 34.94  ? 14   THR D C     1 
ATOM   4789 O  O     . THR F  3 14  ? -8.578  6.573   32.041  1.00 35.87  ? 14   THR D O     1 
ATOM   4790 C  CB    . THR F  3 14  ? -9.128  6.917   28.829  1.00 34.42  ? 14   THR D CB    1 
ATOM   4791 O  OG1   . THR F  3 14  ? -9.503  7.984   27.953  1.00 34.87  ? 14   THR D OG1   1 
ATOM   4792 C  CG2   . THR F  3 14  ? -10.370 6.361   29.496  1.00 32.65  ? 14   THR D CG2   1 
ATOM   4793 N  N     . ILE F  3 15  ? -7.074  5.456   30.791  1.00 34.63  ? 15   ILE D N     1 
ATOM   4794 C  CA    . ILE F  3 15  ? -6.743  4.482   31.839  1.00 34.33  ? 15   ILE D CA    1 
ATOM   4795 C  C     . ILE F  3 15  ? -6.202  5.222   33.062  1.00 35.79  ? 15   ILE D C     1 
ATOM   4796 O  O     . ILE F  3 15  ? -6.661  5.001   34.188  1.00 34.82  ? 15   ILE D O     1 
ATOM   4797 C  CB    . ILE F  3 15  ? -5.698  3.426   31.365  1.00 34.20  ? 15   ILE D CB    1 
ATOM   4798 C  CG1   . ILE F  3 15  ? -6.304  2.495   30.306  1.00 33.77  ? 15   ILE D CG1   1 
ATOM   4799 C  CG2   . ILE F  3 15  ? -5.168  2.604   32.543  1.00 32.18  ? 15   ILE D CG2   1 
ATOM   4800 C  CD1   . ILE F  3 15  ? -5.280  1.754   29.458  1.00 31.15  ? 15   ILE D CD1   1 
ATOM   4801 N  N     . TYR F  3 16  ? -5.233  6.106   32.821  1.00 36.43  ? 16   TYR D N     1 
ATOM   4802 C  CA    . TYR F  3 16  ? -4.655  6.957   33.858  1.00 36.94  ? 16   TYR D CA    1 
ATOM   4803 C  C     . TYR F  3 16  ? -5.722  7.716   34.660  1.00 37.14  ? 16   TYR D C     1 
ATOM   4804 O  O     . TYR F  3 16  ? -5.697  7.693   35.891  1.00 36.77  ? 16   TYR D O     1 
ATOM   4805 C  CB    . TYR F  3 16  ? -3.667  7.938   33.227  1.00 38.25  ? 16   TYR D CB    1 
ATOM   4806 C  CG    . TYR F  3 16  ? -2.785  8.671   34.209  1.00 38.83  ? 16   TYR D CG    1 
ATOM   4807 C  CD1   . TYR F  3 16  ? -3.065  9.980   34.575  1.00 39.54  ? 16   TYR D CD1   1 
ATOM   4808 C  CD2   . TYR F  3 16  ? -1.664  8.058   34.766  1.00 40.24  ? 16   TYR D CD2   1 
ATOM   4809 C  CE1   . TYR F  3 16  ? -2.259  10.666  35.467  1.00 39.53  ? 16   TYR D CE1   1 
ATOM   4810 C  CE2   . TYR F  3 16  ? -0.847  8.736   35.667  1.00 40.09  ? 16   TYR D CE2   1 
ATOM   4811 C  CZ    . TYR F  3 16  ? -1.153  10.042  36.006  1.00 39.74  ? 16   TYR D CZ    1 
ATOM   4812 O  OH    . TYR F  3 16  ? -0.357  10.729  36.892  1.00 40.24  ? 16   TYR D OH    1 
ATOM   4813 N  N     . ASP F  3 17  ? -6.646  8.381   33.959  1.00 37.18  ? 17   ASP D N     1 
ATOM   4814 C  CA    . ASP F  3 17  ? -7.784  9.072   34.589  1.00 36.84  ? 17   ASP D CA    1 
ATOM   4815 C  C     . ASP F  3 17  ? -8.521  8.198   35.582  1.00 36.29  ? 17   ASP D C     1 
ATOM   4816 O  O     . ASP F  3 17  ? -8.714  8.573   36.734  1.00 35.17  ? 17   ASP D O     1 
ATOM   4817 C  CB    . ASP F  3 17  ? -8.805  9.502   33.541  1.00 37.44  ? 17   ASP D CB    1 
ATOM   4818 C  CG    . ASP F  3 17  ? -8.441  10.787  32.883  1.00 38.12  ? 17   ASP D CG    1 
ATOM   4819 O  OD1   . ASP F  3 17  ? -7.825  11.633  33.563  1.00 38.92  ? 17   ASP D OD1   1 
ATOM   4820 O  OD2   . ASP F  3 17  ? -8.781  10.953  31.691  1.00 38.80  ? 17   ASP D OD2   1 
ATOM   4821 N  N     . LEU F  3 18  ? -8.963  7.041   35.108  1.00 35.69  ? 18   LEU D N     1 
ATOM   4822 C  CA    . LEU F  3 18  ? -9.679  6.106   35.953  1.00 36.52  ? 18   LEU D CA    1 
ATOM   4823 C  C     . LEU F  3 18  ? -8.879  5.748   37.197  1.00 36.71  ? 18   LEU D C     1 
ATOM   4824 O  O     . LEU F  3 18  ? -9.445  5.596   38.275  1.00 37.60  ? 18   LEU D O     1 
ATOM   4825 C  CB    . LEU F  3 18  ? -10.034 4.848   35.163  1.00 35.98  ? 18   LEU D CB    1 
ATOM   4826 C  CG    . LEU F  3 18  ? -10.986 5.129   34.004  1.00 35.42  ? 18   LEU D CG    1 
ATOM   4827 C  CD1   . LEU F  3 18  ? -10.964 3.990   32.991  1.00 35.22  ? 18   LEU D CD1   1 
ATOM   4828 C  CD2   . LEU F  3 18  ? -12.395 5.385   34.535  1.00 34.15  ? 18   LEU D CD2   1 
ATOM   4829 N  N     . GLU F  3 19  ? -7.564  5.622   37.050  1.00 37.41  ? 19   GLU D N     1 
ATOM   4830 C  CA    . GLU F  3 19  ? -6.702  5.308   38.188  1.00 38.59  ? 19   GLU D CA    1 
ATOM   4831 C  C     . GLU F  3 19  ? -6.647  6.458   39.197  1.00 37.86  ? 19   GLU D C     1 
ATOM   4832 O  O     . GLU F  3 19  ? -6.649  6.228   40.400  1.00 36.80  ? 19   GLU D O     1 
ATOM   4833 C  CB    . GLU F  3 19  ? -5.290  4.918   37.726  1.00 40.29  ? 19   GLU D CB    1 
ATOM   4834 C  CG    . GLU F  3 19  ? -5.150  3.466   37.259  1.00 42.09  ? 19   GLU D CG    1 
ATOM   4835 C  CD    . GLU F  3 19  ? -3.718  3.103   36.849  1.00 43.83  ? 19   GLU D CD    1 
ATOM   4836 O  OE1   . GLU F  3 19  ? -3.542  2.127   36.084  1.00 45.08  ? 19   GLU D OE1   1 
ATOM   4837 O  OE2   . GLU F  3 19  ? -2.766  3.787   37.290  1.00 44.83  ? 19   GLU D OE2   1 
ATOM   4838 N  N     . GLU F  3 20  ? -6.588  7.689   38.701  1.00 38.13  ? 20   GLU D N     1 
ATOM   4839 C  CA    . GLU F  3 20  ? -6.694  8.863   39.560  1.00 39.06  ? 20   GLU D CA    1 
ATOM   4840 C  C     . GLU F  3 20  ? -8.026  8.858   40.309  1.00 38.96  ? 20   GLU D C     1 
ATOM   4841 O  O     . GLU F  3 20  ? -8.077  9.143   41.508  1.00 38.11  ? 20   GLU D O     1 
ATOM   4842 C  CB    . GLU F  3 20  ? -6.559  10.154  38.746  1.00 40.06  ? 20   GLU D CB    1 
ATOM   4843 C  CG    . GLU F  3 20  ? -5.119  10.551  38.424  1.00 41.92  ? 20   GLU D CG    1 
ATOM   4844 C  CD    . GLU F  3 20  ? -5.011  11.974  37.878  1.00 43.58  ? 20   GLU D CD    1 
ATOM   4845 O  OE1   . GLU F  3 20  ? -5.945  12.417  37.167  1.00 44.56  ? 20   GLU D OE1   1 
ATOM   4846 O  OE2   . GLU F  3 20  ? -3.996  12.653  38.156  1.00 43.92  ? 20   GLU D OE2   1 
ATOM   4847 N  N     . GLU F  3 21  ? -9.096  8.513   39.598  1.00 38.66  ? 21   GLU D N     1 
ATOM   4848 C  CA    . GLU F  3 21  ? -10.436 8.512   40.172  1.00 38.90  ? 21   GLU D CA    1 
ATOM   4849 C  C     . GLU F  3 21  ? -10.699 7.317   41.062  1.00 38.64  ? 21   GLU D C     1 
ATOM   4850 O  O     . GLU F  3 21  ? -11.690 7.292   41.792  1.00 39.51  ? 21   GLU D O     1 
ATOM   4851 C  CB    . GLU F  3 21  ? -11.487 8.559   39.074  1.00 38.69  ? 21   GLU D CB    1 
ATOM   4852 C  CG    . GLU F  3 21  ? -11.405 9.797   38.222  1.00 40.29  ? 21   GLU D CG    1 
ATOM   4853 C  CD    . GLU F  3 21  ? -12.160 9.629   36.934  1.00 41.37  ? 21   GLU D CD    1 
ATOM   4854 O  OE1   . GLU F  3 21  ? -13.035 8.737   36.887  1.00 42.03  ? 21   GLU D OE1   1 
ATOM   4855 O  OE2   . GLU F  3 21  ? -11.878 10.379  35.974  1.00 42.12  ? 21   GLU D OE2   1 
ATOM   4856 N  N     . GLY F  3 22  ? -9.815  6.328   41.002  1.00 38.08  ? 22   GLY D N     1 
ATOM   4857 C  CA    . GLY F  3 22  ? -9.991  5.113   41.776  1.00 38.07  ? 22   GLY D CA    1 
ATOM   4858 C  C     . GLY F  3 22  ? -11.104 4.214   41.260  1.00 39.14  ? 22   GLY D C     1 
ATOM   4859 O  O     . GLY F  3 22  ? -11.698 3.461   42.029  1.00 39.22  ? 22   GLY D O     1 
ATOM   4860 N  N     . VAL F  3 23  ? -11.404 4.284   39.965  1.00 39.25  ? 23   VAL D N     1 
ATOM   4861 C  CA    . VAL F  3 23  ? -12.336 3.322   39.392  1.00 40.73  ? 23   VAL D CA    1 
ATOM   4862 C  C     . VAL F  3 23  ? -11.554 2.251   38.641  1.00 41.53  ? 23   VAL D C     1 
ATOM   4863 O  O     . VAL F  3 23  ? -10.511 2.528   38.039  1.00 41.92  ? 23   VAL D O     1 
ATOM   4864 C  CB    . VAL F  3 23  ? -13.450 3.962   38.486  1.00 40.96  ? 23   VAL D CB    1 
ATOM   4865 C  CG1   . VAL F  3 23  ? -13.667 5.427   38.830  1.00 40.82  ? 23   VAL D CG1   1 
ATOM   4866 C  CG2   . VAL F  3 23  ? -13.137 3.794   37.020  1.00 39.84  ? 23   VAL D CG2   1 
ATOM   4867 N  N     . THR F  3 24  ? -12.054 1.023   38.715  1.00 41.99  ? 24   THR D N     1 
ATOM   4868 C  CA    . THR F  3 24  ? -11.428 -0.130  38.078  1.00 41.69  ? 24   THR D CA    1 
ATOM   4869 C  C     . THR F  3 24  ? -11.357 0.040   36.555  1.00 40.56  ? 24   THR D C     1 
ATOM   4870 O  O     . THR F  3 24  ? -12.385 0.113   35.892  1.00 39.69  ? 24   THR D O     1 
ATOM   4871 C  CB    . THR F  3 24  ? -12.211 -1.420  38.430  1.00 41.86  ? 24   THR D CB    1 
ATOM   4872 O  OG1   . THR F  3 24  ? -12.023 -1.728  39.815  1.00 41.02  ? 24   THR D OG1   1 
ATOM   4873 C  CG2   . THR F  3 24  ? -11.740 -2.591  37.584  1.00 42.53  ? 24   THR D CG2   1 
ATOM   4874 N  N     . PRO F  3 25  ? -10.137 0.117   36.002  1.00 40.01  ? 25   PRO D N     1 
ATOM   4875 C  CA    . PRO F  3 25  ? -9.985  0.273   34.562  1.00 40.37  ? 25   PRO D CA    1 
ATOM   4876 C  C     . PRO F  3 25  ? -10.373 -0.988  33.790  1.00 40.46  ? 25   PRO D C     1 
ATOM   4877 O  O     . PRO F  3 25  ? -9.644  -1.980  33.787  1.00 40.51  ? 25   PRO D O     1 
ATOM   4878 C  CB    . PRO F  3 25  ? -8.491  0.593   34.394  1.00 40.53  ? 25   PRO D CB    1 
ATOM   4879 C  CG    . PRO F  3 25  ? -8.003  0.946   35.772  1.00 40.54  ? 25   PRO D CG    1 
ATOM   4880 C  CD    . PRO F  3 25  ? -8.834  0.097   36.677  1.00 40.32  ? 25   PRO D CD    1 
ATOM   4881 N  N     . LEU F  3 26  ? -11.548 -0.946  33.170  1.00 40.51  ? 26   LEU D N     1 
ATOM   4882 C  CA    . LEU F  3 26  ? -12.024 -2.032  32.324  1.00 40.36  ? 26   LEU D CA    1 
ATOM   4883 C  C     . LEU F  3 26  ? -12.220 -1.455  30.940  1.00 39.80  ? 26   LEU D C     1 
ATOM   4884 O  O     . LEU F  3 26  ? -12.355 -0.242  30.779  1.00 40.28  ? 26   LEU D O     1 
ATOM   4885 C  CB    . LEU F  3 26  ? -13.363 -2.598  32.825  1.00 39.64  ? 26   LEU D CB    1 
ATOM   4886 C  CG    . LEU F  3 26  ? -13.448 -3.267  34.198  1.00 39.84  ? 26   LEU D CG    1 
ATOM   4887 C  CD1   . LEU F  3 26  ? -14.803 -3.922  34.383  1.00 40.12  ? 26   LEU D CD1   1 
ATOM   4888 C  CD2   . LEU F  3 26  ? -12.349 -4.294  34.372  1.00 40.40  ? 26   LEU D CD2   1 
ATOM   4889 N  N     . ARG F  3 27  ? -12.249 -2.328  29.944  1.00 39.14  ? 27   ARG D N     1 
ATOM   4890 C  CA    . ARG F  3 27  ? -12.530 -1.915  28.584  1.00 38.48  ? 27   ARG D CA    1 
ATOM   4891 C  C     . ARG F  3 27  ? -13.894 -1.234  28.483  1.00 38.04  ? 27   ARG D C     1 
ATOM   4892 O  O     . ARG F  3 27  ? -14.068 -0.293  27.703  1.00 37.83  ? 27   ARG D O     1 
ATOM   4893 C  CB    . ARG F  3 27  ? -12.440 -3.120  27.647  1.00 38.46  ? 27   ARG D CB    1 
ATOM   4894 C  CG    . ARG F  3 27  ? -11.022 -3.416  27.208  1.00 39.08  ? 27   ARG D CG    1 
ATOM   4895 C  CD    . ARG F  3 27  ? -10.862 -4.835  26.759  1.00 38.49  ? 27   ARG D CD    1 
ATOM   4896 N  NE    . ARG F  3 27  ? -10.901 -5.725  27.901  1.00 40.30  ? 27   ARG D NE    1 
ATOM   4897 C  CZ    . ARG F  3 27  ? -10.475 -6.982  27.888  1.00 40.64  ? 27   ARG D CZ    1 
ATOM   4898 N  NH1   . ARG F  3 27  ? -9.961  -7.504  26.782  1.00 40.40  ? 27   ARG D NH1   1 
ATOM   4899 N  NH2   . ARG F  3 27  ? -10.563 -7.713  28.988  1.00 40.75  ? 27   ARG D NH2   1 
ATOM   4900 N  N     . ALA F  3 28  ? -14.851 -1.704  29.282  1.00 37.61  ? 28   ALA D N     1 
ATOM   4901 C  CA    . ALA F  3 28  ? -16.193 -1.113  29.316  1.00 37.60  ? 28   ALA D CA    1 
ATOM   4902 C  C     . ALA F  3 28  ? -16.114 0.355   29.704  1.00 37.28  ? 28   ALA D C     1 
ATOM   4903 O  O     . ALA F  3 28  ? -16.844 1.190   29.176  1.00 36.79  ? 28   ALA D O     1 
ATOM   4904 C  CB    . ALA F  3 28  ? -17.100 -1.878  30.285  1.00 36.54  ? 28   ALA D CB    1 
ATOM   4905 N  N     . ARG F  3 29  ? -15.205 0.654   30.627  1.00 38.27  ? 29   ARG D N     1 
ATOM   4906 C  CA    . ARG F  3 29  ? -14.978 2.014   31.091  1.00 38.56  ? 29   ARG D CA    1 
ATOM   4907 C  C     . ARG F  3 29  ? -14.447 2.898   29.961  1.00 38.53  ? 29   ARG D C     1 
ATOM   4908 O  O     . ARG F  3 29  ? -14.925 4.016   29.773  1.00 39.00  ? 29   ARG D O     1 
ATOM   4909 C  CB    . ARG F  3 29  ? -14.021 2.004   32.286  1.00 39.47  ? 29   ARG D CB    1 
ATOM   4910 C  CG    . ARG F  3 29  ? -14.505 2.829   33.471  1.00 42.03  ? 29   ARG D CG    1 
ATOM   4911 C  CD    . ARG F  3 29  ? -16.009 2.629   33.733  1.00 41.79  ? 29   ARG D CD    1 
ATOM   4912 N  NE    . ARG F  3 29  ? -16.304 1.252   34.097  1.00 42.41  ? 29   ARG D NE    1 
ATOM   4913 C  CZ    . ARG F  3 29  ? -17.409 0.602   33.743  1.00 42.57  ? 29   ARG D CZ    1 
ATOM   4914 N  NH1   . ARG F  3 29  ? -18.336 1.204   33.004  1.00 41.60  ? 29   ARG D NH1   1 
ATOM   4915 N  NH2   . ARG F  3 29  ? -17.577 -0.658  34.123  1.00 41.58  ? 29   ARG D NH2   1 
ATOM   4916 N  N     . ILE F  3 30  ? -13.476 2.390   29.197  1.00 37.80  ? 30   ILE D N     1 
ATOM   4917 C  CA    . ILE F  3 30  ? -12.966 3.111   28.019  1.00 36.55  ? 30   ILE D CA    1 
ATOM   4918 C  C     . ILE F  3 30  ? -14.028 3.341   26.940  1.00 35.62  ? 30   ILE D C     1 
ATOM   4919 O  O     . ILE F  3 30  ? -14.113 4.429   26.376  1.00 34.97  ? 30   ILE D O     1 
ATOM   4920 C  CB    . ILE F  3 30  ? -11.775 2.390   27.358  1.00 35.57  ? 30   ILE D CB    1 
ATOM   4921 C  CG1   . ILE F  3 30  ? -10.628 2.216   28.349  1.00 35.04  ? 30   ILE D CG1   1 
ATOM   4922 C  CG2   . ILE F  3 30  ? -11.289 3.184   26.135  1.00 35.87  ? 30   ILE D CG2   1 
ATOM   4923 C  CD1   . ILE F  3 30  ? -9.500  1.378   27.804  1.00 33.22  ? 30   ILE D CD1   1 
ATOM   4924 N  N     . ALA F  3 31  ? -14.810 2.303   26.649  1.00 35.74  ? 31   ALA D N     1 
ATOM   4925 C  CA    . ALA F  3 31  ? -15.908 2.381   25.686  1.00 38.01  ? 31   ALA D CA    1 
ATOM   4926 C  C     . ALA F  3 31  ? -16.864 3.509   26.058  1.00 39.75  ? 31   ALA D C     1 
ATOM   4927 O  O     . ALA F  3 31  ? -17.269 4.319   25.212  1.00 39.25  ? 31   ALA D O     1 
ATOM   4928 C  CB    . ALA F  3 31  ? -16.667 1.052   25.639  1.00 36.75  ? 31   ALA D CB    1 
ATOM   4929 N  N     . GLU F  3 32  ? -17.208 3.541   27.344  1.00 40.87  ? 32   GLU D N     1 
ATOM   4930 C  CA    . GLU F  3 32  ? -18.062 4.558   27.931  1.00 41.80  ? 32   GLU D CA    1 
ATOM   4931 C  C     . GLU F  3 32  ? -17.576 5.981   27.674  1.00 41.74  ? 32   GLU D C     1 
ATOM   4932 O  O     . GLU F  3 32  ? -18.306 6.814   27.130  1.00 41.56  ? 32   GLU D O     1 
ATOM   4933 C  CB    . GLU F  3 32  ? -18.073 4.339   29.425  1.00 43.67  ? 32   GLU D CB    1 
ATOM   4934 C  CG    . GLU F  3 32  ? -19.426 4.374   30.058  1.00 45.93  ? 32   GLU D CG    1 
ATOM   4935 C  CD    . GLU F  3 32  ? -19.379 3.728   31.411  1.00 47.35  ? 32   GLU D CD    1 
ATOM   4936 O  OE1   . GLU F  3 32  ? -18.665 4.274   32.288  1.00 47.49  ? 32   GLU D OE1   1 
ATOM   4937 O  OE2   . GLU F  3 32  ? -20.025 2.665   31.583  1.00 48.00  ? 32   GLU D OE2   1 
ATOM   4938 N  N     . ARG F  3 33  ? -16.339 6.249   28.078  1.00 40.65  ? 33   ARG D N     1 
ATOM   4939 C  CA    . ARG F  3 33  ? -15.807 7.605   28.099  1.00 40.28  ? 33   ARG D CA    1 
ATOM   4940 C  C     . ARG F  3 33  ? -15.388 8.168   26.750  1.00 40.00  ? 33   ARG D C     1 
ATOM   4941 O  O     . ARG F  3 33  ? -15.420 9.385   26.547  1.00 38.32  ? 33   ARG D O     1 
ATOM   4942 C  CB    . ARG F  3 33  ? -14.626 7.673   29.052  1.00 41.14  ? 33   ARG D CB    1 
ATOM   4943 C  CG    . ARG F  3 33  ? -14.998 7.306   30.461  1.00 42.35  ? 33   ARG D CG    1 
ATOM   4944 C  CD    . ARG F  3 33  ? -14.202 8.138   31.410  1.00 43.07  ? 33   ARG D CD    1 
ATOM   4945 N  NE    . ARG F  3 33  ? -14.654 7.978   32.779  1.00 42.29  ? 33   ARG D NE    1 
ATOM   4946 C  CZ    . ARG F  3 33  ? -13.982 8.437   33.824  1.00 42.06  ? 33   ARG D CZ    1 
ATOM   4947 N  NH1   . ARG F  3 33  ? -12.827 9.079   33.644  1.00 39.89  ? 33   ARG D NH1   1 
ATOM   4948 N  NH2   . ARG F  3 33  ? -14.466 8.243   35.045  1.00 42.36  ? 33   ARG D NH2   1 
ATOM   4949 N  N     . LEU F  3 34  ? -14.966 7.295   25.841  1.00 39.33  ? 34   LEU D N     1 
ATOM   4950 C  CA    . LEU F  3 34  ? -14.607 7.739   24.500  1.00 38.92  ? 34   LEU D CA    1 
ATOM   4951 C  C     . LEU F  3 34  ? -15.741 7.428   23.544  1.00 38.53  ? 34   LEU D C     1 
ATOM   4952 O  O     . LEU F  3 34  ? -15.657 7.718   22.353  1.00 38.50  ? 34   LEU D O     1 
ATOM   4953 C  CB    . LEU F  3 34  ? -13.300 7.093   24.032  1.00 38.42  ? 34   LEU D CB    1 
ATOM   4954 C  CG    . LEU F  3 34  ? -12.148 7.205   25.039  1.00 38.47  ? 34   LEU D CG    1 
ATOM   4955 C  CD1   . LEU F  3 34  ? -10.949 6.409   24.559  1.00 38.99  ? 34   LEU D CD1   1 
ATOM   4956 C  CD2   . LEU F  3 34  ? -11.768 8.657   25.311  1.00 36.36  ? 34   LEU D CD2   1 
ATOM   4957 N  N     . ASP F  3 35  ? -16.802 6.835   24.081  1.00 38.67  ? 35   ASP D N     1 
ATOM   4958 C  CA    . ASP F  3 35  ? -17.989 6.534   23.300  1.00 40.38  ? 35   ASP D CA    1 
ATOM   4959 C  C     . ASP F  3 35  ? -17.626 5.713   22.061  1.00 39.71  ? 35   ASP D C     1 
ATOM   4960 O  O     . ASP F  3 35  ? -17.818 6.156   20.926  1.00 39.85  ? 35   ASP D O     1 
ATOM   4961 C  CB    . ASP F  3 35  ? -18.716 7.825   22.893  1.00 42.84  ? 35   ASP D CB    1 
ATOM   4962 C  CG    . ASP F  3 35  ? -20.138 7.568   22.404  1.00 44.52  ? 35   ASP D CG    1 
ATOM   4963 O  OD1   . ASP F  3 35  ? -20.631 8.343   21.551  1.00 44.53  ? 35   ASP D OD1   1 
ATOM   4964 O  OD2   . ASP F  3 35  ? -20.759 6.586   22.878  1.00 45.33  ? 35   ASP D OD2   1 
ATOM   4965 N  N     . GLN F  3 36  ? -17.082 4.524   22.295  1.00 38.24  ? 36   GLN D N     1 
ATOM   4966 C  CA    . GLN F  3 36  ? -16.796 3.580   21.227  1.00 37.70  ? 36   GLN D CA    1 
ATOM   4967 C  C     . GLN F  3 36  ? -17.426 2.223   21.558  1.00 37.77  ? 36   GLN D C     1 
ATOM   4968 O  O     . GLN F  3 36  ? -17.926 2.009   22.667  1.00 37.43  ? 36   GLN D O     1 
ATOM   4969 C  CB    . GLN F  3 36  ? -15.286 3.467   20.992  1.00 36.79  ? 36   GLN D CB    1 
ATOM   4970 C  CG    . GLN F  3 36  ? -14.673 4.714   20.355  1.00 35.78  ? 36   GLN D CG    1 
ATOM   4971 C  CD    . GLN F  3 36  ? -13.174 4.595   20.121  1.00 35.75  ? 36   GLN D CD    1 
ATOM   4972 O  OE1   . GLN F  3 36  ? -12.522 3.671   20.615  1.00 34.80  ? 36   GLN D OE1   1 
ATOM   4973 N  NE2   . GLN F  3 36  ? -12.619 5.543   19.370  1.00 35.06  ? 36   GLN D NE2   1 
ATOM   4974 N  N     . SER F  3 37  ? -17.426 1.319   20.586  1.00 37.27  ? 37   SER D N     1 
ATOM   4975 C  CA    . SER F  3 37  ? -18.050 0.014   20.756  1.00 36.09  ? 37   SER D CA    1 
ATOM   4976 C  C     . SER F  3 37  ? -17.121 -0.972  21.479  1.00 35.25  ? 37   SER D C     1 
ATOM   4977 O  O     . SER F  3 37  ? -15.893 -0.835  21.447  1.00 33.96  ? 37   SER D O     1 
ATOM   4978 C  CB    . SER F  3 37  ? -18.472 -0.539  19.391  1.00 37.24  ? 37   SER D CB    1 
ATOM   4979 O  OG    . SER F  3 37  ? -17.352 -0.706  18.530  1.00 37.18  ? 37   SER D OG    1 
ATOM   4980 N  N     . GLY F  3 38  ? -17.716 -1.959  22.140  1.00 34.27  ? 38   GLY D N     1 
ATOM   4981 C  CA    . GLY F  3 38  ? -16.946 -2.990  22.818  1.00 33.47  ? 38   GLY D CA    1 
ATOM   4982 C  C     . GLY F  3 38  ? -15.829 -3.550  21.951  1.00 34.07  ? 38   GLY D C     1 
ATOM   4983 O  O     . GLY F  3 38  ? -14.668 -3.539  22.353  1.00 33.99  ? 38   GLY D O     1 
ATOM   4984 N  N     . PRO F  3 39  ? -16.184 -4.071  20.761  1.00 34.10  ? 39   PRO D N     1 
ATOM   4985 C  CA    . PRO F  3 39  ? -15.243 -4.586  19.776  1.00 33.18  ? 39   PRO D CA    1 
ATOM   4986 C  C     . PRO F  3 39  ? -14.082 -3.645  19.471  1.00 33.08  ? 39   PRO D C     1 
ATOM   4987 O  O     . PRO F  3 39  ? -12.925 -4.081  19.476  1.00 32.85  ? 39   PRO D O     1 
ATOM   4988 C  CB    . PRO F  3 39  ? -16.116 -4.753  18.535  1.00 33.33  ? 39   PRO D CB    1 
ATOM   4989 C  CG    . PRO F  3 39  ? -17.445 -5.098  19.089  1.00 34.07  ? 39   PRO D CG    1 
ATOM   4990 C  CD    . PRO F  3 39  ? -17.581 -4.232  20.308  1.00 34.17  ? 39   PRO D CD    1 
ATOM   4991 N  N     . THR F  3 40  ? -14.385 -2.377  19.188  1.00 32.30  ? 40   THR D N     1 
ATOM   4992 C  CA    . THR F  3 40  ? -13.342 -1.401  18.896  1.00 31.25  ? 40   THR D CA    1 
ATOM   4993 C  C     . THR F  3 40  ? -12.321 -1.363  20.020  1.00 30.87  ? 40   THR D C     1 
ATOM   4994 O  O     . THR F  3 40  ? -11.131 -1.530  19.778  1.00 31.62  ? 40   THR D O     1 
ATOM   4995 C  CB    . THR F  3 40  ? -13.897 0.031   18.679  1.00 31.12  ? 40   THR D CB    1 
ATOM   4996 O  OG1   . THR F  3 40  ? -14.976 0.001   17.742  1.00 32.39  ? 40   THR D OG1   1 
ATOM   4997 C  CG2   . THR F  3 40  ? -12.819 0.939   18.139  1.00 30.32  ? 40   THR D CG2   1 
ATOM   4998 N  N     . VAL F  3 41  ? -12.770 -1.142  21.252  1.00 31.50  ? 41   VAL D N     1 
ATOM   4999 C  CA    . VAL F  3 41  ? -11.812 -1.004  22.356  1.00 32.12  ? 41   VAL D CA    1 
ATOM   5000 C  C     . VAL F  3 41  ? -11.098 -2.312  22.681  1.00 31.54  ? 41   VAL D C     1 
ATOM   5001 O  O     . VAL F  3 41  ? -9.930  -2.307  23.067  1.00 32.06  ? 41   VAL D O     1 
ATOM   5002 C  CB    . VAL F  3 41  ? -12.396 -0.270  23.631  1.00 33.00  ? 41   VAL D CB    1 
ATOM   5003 C  CG1   . VAL F  3 41  ? -13.887 -0.014  23.507  1.00 31.60  ? 41   VAL D CG1   1 
ATOM   5004 C  CG2   . VAL F  3 41  ? -12.036 -0.996  24.928  1.00 31.59  ? 41   VAL D CG2   1 
ATOM   5005 N  N     . SER F  3 42  ? -11.786 -3.430  22.482  1.00 31.38  ? 42   SER D N     1 
ATOM   5006 C  CA    . SER F  3 42  ? -11.161 -4.740  22.630  1.00 31.98  ? 42   SER D CA    1 
ATOM   5007 C  C     . SER F  3 42  ? -10.019 -4.928  21.637  1.00 32.49  ? 42   SER D C     1 
ATOM   5008 O  O     . SER F  3 42  ? -8.953  -5.432  22.011  1.00 33.19  ? 42   SER D O     1 
ATOM   5009 C  CB    . SER F  3 42  ? -12.181 -5.863  22.469  1.00 32.34  ? 42   SER D CB    1 
ATOM   5010 O  OG    . SER F  3 42  ? -12.751 -6.209  23.718  1.00 32.73  ? 42   SER D OG    1 
ATOM   5011 N  N     . GLN F  3 43  ? -10.237 -4.520  20.385  1.00 32.40  ? 43   GLN D N     1 
ATOM   5012 C  CA    . GLN F  3 43  ? -9.190  -4.596  19.354  1.00 33.37  ? 43   GLN D CA    1 
ATOM   5013 C  C     . GLN F  3 43  ? -8.062  -3.624  19.624  1.00 32.41  ? 43   GLN D C     1 
ATOM   5014 O  O     . GLN F  3 43  ? -6.886  -3.969  19.489  1.00 32.45  ? 43   GLN D O     1 
ATOM   5015 C  CB    . GLN F  3 43  ? -9.741  -4.310  17.955  1.00 35.00  ? 43   GLN D CB    1 
ATOM   5016 C  CG    . GLN F  3 43  ? -10.307 -5.516  17.229  1.00 37.55  ? 43   GLN D CG    1 
ATOM   5017 C  CD    . GLN F  3 43  ? -9.245  -6.515  16.810  1.00 39.30  ? 43   GLN D CD    1 
ATOM   5018 O  OE1   . GLN F  3 43  ? -9.427  -7.725  16.968  1.00 40.95  ? 43   GLN D OE1   1 
ATOM   5019 N  NE2   . GLN F  3 43  ? -8.127  -6.018  16.279  1.00 39.57  ? 43   GLN D NE2   1 
ATOM   5020 N  N     . THR F  3 44  ? -8.418  -2.399  19.986  1.00 31.69  ? 44   THR D N     1 
ATOM   5021 C  CA    . THR F  3 44  ? -7.398  -1.391  20.223  1.00 31.99  ? 44   THR D CA    1 
ATOM   5022 C  C     . THR F  3 44  ? -6.526  -1.758  21.422  1.00 31.42  ? 44   THR D C     1 
ATOM   5023 O  O     . THR F  3 44  ? -5.303  -1.621  21.375  1.00 32.20  ? 44   THR D O     1 
ATOM   5024 C  CB    . THR F  3 44  ? -7.993  0.017   20.353  1.00 31.46  ? 44   THR D CB    1 
ATOM   5025 O  OG1   . THR F  3 44  ? -8.632  0.369   19.116  1.00 30.97  ? 44   THR D OG1   1 
ATOM   5026 C  CG2   . THR F  3 44  ? -6.896  1.026   20.663  1.00 30.95  ? 44   THR D CG2   1 
ATOM   5027 N  N     . VAL F  3 45  ? -7.153  -2.262  22.475  1.00 31.17  ? 45   VAL D N     1 
ATOM   5028 C  CA    . VAL F  3 45  ? -6.413  -2.747  23.643  1.00 31.74  ? 45   VAL D CA    1 
ATOM   5029 C  C     . VAL F  3 45  ? -5.381  -3.846  23.300  1.00 31.53  ? 45   VAL D C     1 
ATOM   5030 O  O     . VAL F  3 45  ? -4.260  -3.831  23.816  1.00 31.20  ? 45   VAL D O     1 
ATOM   5031 C  CB    . VAL F  3 45  ? -7.383  -3.199  24.768  1.00 31.45  ? 45   VAL D CB    1 
ATOM   5032 C  CG1   . VAL F  3 45  ? -6.673  -4.027  25.826  1.00 30.86  ? 45   VAL D CG1   1 
ATOM   5033 C  CG2   . VAL F  3 45  ? -8.029  -1.985  25.403  1.00 32.31  ? 45   VAL D CG2   1 
ATOM   5034 N  N     . SER F  3 46  ? -5.746  -4.784  22.431  1.00 31.64  ? 46   SER D N     1 
ATOM   5035 C  CA    . SER F  3 46  ? -4.818  -5.853  22.074  1.00 34.17  ? 46   SER D CA    1 
ATOM   5036 C  C     . SER F  3 46  ? -3.621  -5.387  21.238  1.00 34.41  ? 46   SER D C     1 
ATOM   5037 O  O     . SER F  3 46  ? -2.529  -5.946  21.361  1.00 34.74  ? 46   SER D O     1 
ATOM   5038 C  CB    . SER F  3 46  ? -5.534  -7.029  21.411  1.00 35.44  ? 46   SER D CB    1 
ATOM   5039 O  OG    . SER F  3 46  ? -6.692  -6.594  20.740  1.00 37.99  ? 46   SER D OG    1 
ATOM   5040 N  N     . ARG F  3 47  ? -3.809  -4.366  20.403  1.00 34.21  ? 47   ARG D N     1 
ATOM   5041 C  CA    . ARG F  3 47  ? -2.674  -3.776  19.700  1.00 34.69  ? 47   ARG D CA    1 
ATOM   5042 C  C     . ARG F  3 47  ? -1.677  -3.198  20.694  1.00 35.03  ? 47   ARG D C     1 
ATOM   5043 O  O     . ARG F  3 47  ? -0.465  -3.281  20.487  1.00 35.30  ? 47   ARG D O     1 
ATOM   5044 C  CB    . ARG F  3 47  ? -3.116  -2.658  18.758  1.00 35.16  ? 47   ARG D CB    1 
ATOM   5045 C  CG    . ARG F  3 47  ? -3.856  -3.123  17.538  1.00 35.93  ? 47   ARG D CG    1 
ATOM   5046 C  CD    . ARG F  3 47  ? -3.787  -2.074  16.431  1.00 34.89  ? 47   ARG D CD    1 
ATOM   5047 N  NE    . ARG F  3 47  ? -4.497  -0.835  16.749  1.00 33.99  ? 47   ARG D NE    1 
ATOM   5048 C  CZ    . ARG F  3 47  ? -5.824  -0.709  16.794  1.00 33.58  ? 47   ARG D CZ    1 
ATOM   5049 N  NH1   . ARG F  3 47  ? -6.608  -1.754  16.584  1.00 32.67  ? 47   ARG D NH1   1 
ATOM   5050 N  NH2   . ARG F  3 47  ? -6.374  0.468   17.066  1.00 33.06  ? 47   ARG D NH2   1 
ATOM   5051 N  N     . MET F  3 48  ? -2.205  -2.593  21.758  1.00 35.27  ? 48   MET D N     1 
ATOM   5052 C  CA    . MET F  3 48  ? -1.398  -1.903  22.761  1.00 35.76  ? 48   MET D CA    1 
ATOM   5053 C  C     . MET F  3 48  ? -0.726  -2.903  23.676  1.00 36.47  ? 48   MET D C     1 
ATOM   5054 O  O     . MET F  3 48  ? 0.428   -2.738  24.056  1.00 36.99  ? 48   MET D O     1 
ATOM   5055 C  CB    . MET F  3 48  ? -2.267  -0.946  23.580  1.00 35.63  ? 48   MET D CB    1 
ATOM   5056 C  CG    . MET F  3 48  ? -2.967  0.117   22.744  1.00 35.47  ? 48   MET D CG    1 
ATOM   5057 S  SD    . MET F  3 48  ? -4.160  1.086   23.684  1.00 35.15  ? 48   MET D SD    1 
ATOM   5058 C  CE    . MET F  3 48  ? -3.121  1.751   24.988  1.00 34.85  ? 48   MET D CE    1 
ATOM   5059 N  N     . GLU F  3 49  ? -1.466  -3.937  24.041  1.00 37.37  ? 49   GLU D N     1 
ATOM   5060 C  CA    . GLU F  3 49  ? -0.885  -5.056  24.743  1.00 39.16  ? 49   GLU D CA    1 
ATOM   5061 C  C     . GLU F  3 49  ? 0.243   -5.615  23.881  1.00 39.82  ? 49   GLU D C     1 
ATOM   5062 O  O     . GLU F  3 49  ? 1.369   -5.787  24.352  1.00 40.08  ? 49   GLU D O     1 
ATOM   5063 C  CB    . GLU F  3 49  ? -1.949  -6.116  24.998  1.00 39.79  ? 49   GLU D CB    1 
ATOM   5064 C  CG    . GLU F  3 49  ? -1.451  -7.282  25.785  1.00 43.06  ? 49   GLU D CG    1 
ATOM   5065 C  CD    . GLU F  3 49  ? -2.576  -8.153  26.295  1.00 45.47  ? 49   GLU D CD    1 
ATOM   5066 O  OE1   . GLU F  3 49  ? -2.342  -8.911  27.266  1.00 46.59  ? 49   GLU D OE1   1 
ATOM   5067 O  OE2   . GLU F  3 49  ? -3.689  -8.077  25.730  1.00 46.33  ? 49   GLU D OE2   1 
ATOM   5068 N  N     . ARG F  3 50  ? -0.071  -5.867  22.610  1.00 39.91  ? 50   ARG D N     1 
ATOM   5069 C  CA    . ARG F  3 50  ? 0.916   -6.282  21.615  1.00 39.91  ? 50   ARG D CA    1 
ATOM   5070 C  C     . ARG F  3 50  ? 2.165   -5.406  21.634  1.00 38.94  ? 50   ARG D C     1 
ATOM   5071 O  O     . ARG F  3 50  ? 3.276   -5.913  21.655  1.00 37.63  ? 50   ARG D O     1 
ATOM   5072 C  CB    . ARG F  3 50  ? 0.298   -6.276  20.213  1.00 40.54  ? 50   ARG D CB    1 
ATOM   5073 C  CG    . ARG F  3 50  ? 1.226   -6.784  19.106  1.00 41.63  ? 50   ARG D CG    1 
ATOM   5074 C  CD    . ARG F  3 50  ? 0.708   -6.390  17.722  1.00 41.39  ? 50   ARG D CD    1 
ATOM   5075 N  NE    . ARG F  3 50  ? 0.942   -4.973  17.456  1.00 41.92  ? 50   ARG D NE    1 
ATOM   5076 C  CZ    . ARG F  3 50  ? 0.397   -4.290  16.452  1.00 42.08  ? 50   ARG D CZ    1 
ATOM   5077 N  NH1   . ARG F  3 50  ? -0.431  -4.885  15.606  1.00 42.24  ? 50   ARG D NH1   1 
ATOM   5078 N  NH2   . ARG F  3 50  ? 0.673   -3.002  16.300  1.00 41.11  ? 50   ARG D NH2   1 
ATOM   5079 N  N     . ASP F  3 51  ? 1.984   -4.090  21.631  1.00 39.22  ? 51   ASP D N     1 
ATOM   5080 C  CA    . ASP F  3 51  ? 3.128   -3.169  21.607  1.00 39.74  ? 51   ASP D CA    1 
ATOM   5081 C  C     . ASP F  3 51  ? 3.721   -2.875  22.989  1.00 39.13  ? 51   ASP D C     1 
ATOM   5082 O  O     . ASP F  3 51  ? 4.522   -1.951  23.141  1.00 39.18  ? 51   ASP D O     1 
ATOM   5083 C  CB    . ASP F  3 51  ? 2.755   -1.869  20.896  1.00 40.81  ? 51   ASP D CB    1 
ATOM   5084 C  CG    . ASP F  3 51  ? 2.242   -2.112  19.499  1.00 42.29  ? 51   ASP D CG    1 
ATOM   5085 O  OD1   . ASP F  3 51  ? 2.504   -3.208  18.960  1.00 44.07  ? 51   ASP D OD1   1 
ATOM   5086 O  OD2   . ASP F  3 51  ? 1.575   -1.224  18.935  1.00 42.54  ? 51   ASP D OD2   1 
ATOM   5087 N  N     . GLY F  3 52  ? 3.332   -3.665  23.989  1.00 38.09  ? 52   GLY D N     1 
ATOM   5088 C  CA    . GLY F  3 52  ? 3.875   -3.524  25.337  1.00 37.28  ? 52   GLY D CA    1 
ATOM   5089 C  C     . GLY F  3 52  ? 3.494   -2.226  26.031  1.00 36.73  ? 52   GLY D C     1 
ATOM   5090 O  O     . GLY F  3 52  ? 4.273   -1.678  26.810  1.00 35.79  ? 52   GLY D O     1 
ATOM   5091 N  N     . LEU F  3 53  ? 2.297   -1.724  25.738  1.00 35.97  ? 53   LEU D N     1 
ATOM   5092 C  CA    . LEU F  3 53  ? 1.801   -0.511  26.372  1.00 35.37  ? 53   LEU D CA    1 
ATOM   5093 C  C     . LEU F  3 53  ? 0.988   -0.824  27.632  1.00 35.71  ? 53   LEU D C     1 
ATOM   5094 O  O     . LEU F  3 53  ? 1.008   -0.061  28.600  1.00 33.96  ? 53   LEU D O     1 
ATOM   5095 C  CB    . LEU F  3 53  ? 0.974   0.294   25.382  1.00 35.13  ? 53   LEU D CB    1 
ATOM   5096 C  CG    . LEU F  3 53  ? 1.772   0.887   24.221  1.00 33.79  ? 53   LEU D CG    1 
ATOM   5097 C  CD1   . LEU F  3 53  ? 0.834   1.356   23.140  1.00 33.80  ? 53   LEU D CD1   1 
ATOM   5098 C  CD2   . LEU F  3 53  ? 2.647   2.024   24.710  1.00 33.49  ? 53   LEU D CD2   1 
ATOM   5099 N  N     . LEU F  3 54  ? 0.294   -1.961  27.617  1.00 36.31  ? 54   LEU D N     1 
ATOM   5100 C  CA    . LEU F  3 54  ? -0.520  -2.378  28.755  1.00 37.53  ? 54   LEU D CA    1 
ATOM   5101 C  C     . LEU F  3 54  ? -0.643  -3.897  28.911  1.00 39.17  ? 54   LEU D C     1 
ATOM   5102 O  O     . LEU F  3 54  ? -0.317  -4.663  28.003  1.00 38.99  ? 54   LEU D O     1 
ATOM   5103 C  CB    . LEU F  3 54  ? -1.907  -1.733  28.687  1.00 35.76  ? 54   LEU D CB    1 
ATOM   5104 C  CG    . LEU F  3 54  ? -2.699  -1.873  27.393  1.00 35.40  ? 54   LEU D CG    1 
ATOM   5105 C  CD1   . LEU F  3 54  ? -3.128  -3.304  27.213  1.00 34.71  ? 54   LEU D CD1   1 
ATOM   5106 C  CD2   . LEU F  3 54  ? -3.912  -0.942  27.392  1.00 33.60  ? 54   LEU D CD2   1 
ATOM   5107 N  N     . ARG F  3 55  ? -1.102  -4.326  30.082  1.00 41.34  ? 55   ARG D N     1 
ATOM   5108 C  CA    . ARG F  3 55  ? -1.392  -5.729  30.321  1.00 44.26  ? 55   ARG D CA    1 
ATOM   5109 C  C     . ARG F  3 55  ? -2.878  -5.829  30.637  1.00 44.50  ? 55   ARG D C     1 
ATOM   5110 O  O     . ARG F  3 55  ? -3.431  -4.953  31.284  1.00 43.69  ? 55   ARG D O     1 
ATOM   5111 C  CB    . ARG F  3 55  ? -0.569  -6.284  31.498  1.00 46.12  ? 55   ARG D CB    1 
ATOM   5112 C  CG    . ARG F  3 55  ? 0.471   -5.314  32.088  1.00 49.32  ? 55   ARG D CG    1 
ATOM   5113 C  CD    . ARG F  3 55  ? 1.271   -5.953  33.229  1.00 51.46  ? 55   ARG D CD    1 
ATOM   5114 N  NE    . ARG F  3 55  ? 1.594   -5.010  34.309  1.00 53.05  ? 55   ARG D NE    1 
ATOM   5115 C  CZ    . ARG F  3 55  ? 2.690   -4.252  34.351  1.00 54.30  ? 55   ARG D CZ    1 
ATOM   5116 N  NH1   . ARG F  3 55  ? 3.583   -4.311  33.368  1.00 54.81  ? 55   ARG D NH1   1 
ATOM   5117 N  NH2   . ARG F  3 55  ? 2.897   -3.429  35.375  1.00 54.42  ? 55   ARG D NH2   1 
ATOM   5118 N  N     . VAL F  3 56  ? -3.530  -6.878  30.153  1.00 46.38  ? 56   VAL D N     1 
ATOM   5119 C  CA    . VAL F  3 56  ? -4.877  -7.199  30.601  1.00 47.51  ? 56   VAL D CA    1 
ATOM   5120 C  C     . VAL F  3 56  ? -4.725  -8.283  31.661  1.00 49.09  ? 56   VAL D C     1 
ATOM   5121 O  O     . VAL F  3 56  ? -4.342  -9.411  31.348  1.00 50.21  ? 56   VAL D O     1 
ATOM   5122 C  CB    . VAL F  3 56  ? -5.751  -7.717  29.454  1.00 47.46  ? 56   VAL D CB    1 
ATOM   5123 C  CG1   . VAL F  3 56  ? -7.174  -7.975  29.937  1.00 46.78  ? 56   VAL D CG1   1 
ATOM   5124 C  CG2   . VAL F  3 56  ? -5.740  -6.727  28.288  1.00 47.28  ? 56   VAL D CG2   1 
ATOM   5125 N  N     . ALA F  3 57  ? -4.992  -7.934  32.915  1.00 48.98  ? 57   ALA D N     1 
ATOM   5126 C  CA    . ALA F  3 57  ? -4.774  -8.861  34.015  1.00 49.82  ? 57   ALA D CA    1 
ATOM   5127 C  C     . ALA F  3 57  ? -5.773  -10.009 33.957  1.00 50.94  ? 57   ALA D C     1 
ATOM   5128 O  O     . ALA F  3 57  ? -6.809  -9.913  33.287  1.00 51.28  ? 57   ALA D O     1 
ATOM   5129 C  CB    . ALA F  3 57  ? -4.851  -8.140  35.355  1.00 49.04  ? 57   ALA D CB    1 
ATOM   5130 N  N     . GLY F  3 58  ? -5.444  -11.100 34.644  1.00 51.56  ? 58   GLY D N     1 
ATOM   5131 C  CA    . GLY F  3 58  ? -6.329  -12.254 34.733  1.00 52.46  ? 58   GLY D CA    1 
ATOM   5132 C  C     . GLY F  3 58  ? -7.769  -11.870 35.023  1.00 53.02  ? 58   GLY D C     1 
ATOM   5133 O  O     . GLY F  3 58  ? -8.688  -12.464 34.472  1.00 53.18  ? 58   GLY D O     1 
ATOM   5134 N  N     . ASP F  3 59  ? -7.966  -10.868 35.879  1.00 53.49  ? 59   ASP D N     1 
ATOM   5135 C  CA    . ASP F  3 59  ? -9.316  -10.403 36.232  1.00 54.65  ? 59   ASP D CA    1 
ATOM   5136 C  C     . ASP F  3 59  ? -9.842  -9.309  35.289  1.00 54.47  ? 59   ASP D C     1 
ATOM   5137 O  O     . ASP F  3 59  ? -10.877 -8.690  35.557  1.00 54.53  ? 59   ASP D O     1 
ATOM   5138 C  CB    . ASP F  3 59  ? -9.377  -9.936  37.695  1.00 54.96  ? 59   ASP D CB    1 
ATOM   5139 C  CG    . ASP F  3 59  ? -8.199  -9.059  38.084  1.00 55.88  ? 59   ASP D CG    1 
ATOM   5140 O  OD1   . ASP F  3 59  ? -7.973  -8.870  39.301  1.00 56.76  ? 59   ASP D OD1   1 
ATOM   5141 O  OD2   . ASP F  3 59  ? -7.495  -8.560  37.180  1.00 56.09  ? 59   ASP D OD2   1 
ATOM   5142 N  N     . ARG F  3 60  ? -9.111  -9.080  34.198  1.00 53.65  ? 60   ARG D N     1 
ATOM   5143 C  CA    . ARG F  3 60  ? -9.522  -8.179  33.116  1.00 52.76  ? 60   ARG D CA    1 
ATOM   5144 C  C     . ARG F  3 60  ? -9.252  -6.696  33.359  1.00 51.45  ? 60   ARG D C     1 
ATOM   5145 O  O     . ARG F  3 60  ? -9.517  -5.873  32.488  1.00 51.25  ? 60   ARG D O     1 
ATOM   5146 C  CB    . ARG F  3 60  ? -10.983 -8.413  32.721  1.00 53.78  ? 60   ARG D CB    1 
ATOM   5147 C  CG    . ARG F  3 60  ? -11.217 -9.761  32.064  1.00 56.15  ? 60   ARG D CG    1 
ATOM   5148 C  CD    . ARG F  3 60  ? -12.673 -9.950  31.673  1.00 57.92  ? 60   ARG D CD    1 
ATOM   5149 N  NE    . ARG F  3 60  ? -13.585 -9.428  32.684  1.00 59.19  ? 60   ARG D NE    1 
ATOM   5150 C  CZ    . ARG F  3 60  ? -14.906 -9.582  32.651  1.00 60.42  ? 60   ARG D CZ    1 
ATOM   5151 N  NH1   . ARG F  3 60  ? -15.658 -9.062  33.617  1.00 60.52  ? 60   ARG D NH1   1 
ATOM   5152 N  NH2   . ARG F  3 60  ? -15.478 -10.255 31.654  1.00 59.99  ? 60   ARG D NH2   1 
ATOM   5153 N  N     . HIS F  3 61  ? -8.724  -6.355  34.531  1.00 49.92  ? 61   HIS D N     1 
ATOM   5154 C  CA    . HIS F  3 61  ? -8.332  -4.980  34.805  1.00 48.58  ? 61   HIS D CA    1 
ATOM   5155 C  C     . HIS F  3 61  ? -7.202  -4.611  33.853  1.00 47.69  ? 61   HIS D C     1 
ATOM   5156 O  O     . HIS F  3 61  ? -6.242  -5.369  33.701  1.00 47.24  ? 61   HIS D O     1 
ATOM   5157 C  CB    . HIS F  3 61  ? -7.854  -4.823  36.249  1.00 48.94  ? 61   HIS D CB    1 
ATOM   5158 C  CG    . HIS F  3 61  ? -8.895  -5.152  37.275  1.00 49.84  ? 61   HIS D CG    1 
ATOM   5159 N  ND1   . HIS F  3 61  ? -8.691  -4.959  38.626  1.00 52.07  ? 61   HIS D ND1   1 
ATOM   5160 C  CD2   . HIS F  3 61  ? -10.144 -5.659  37.151  1.00 49.58  ? 61   HIS D CD2   1 
ATOM   5161 C  CE1   . HIS F  3 61  ? -9.774  -5.332  39.287  1.00 50.78  ? 61   HIS D CE1   1 
ATOM   5162 N  NE2   . HIS F  3 61  ? -10.667 -5.766  38.417  1.00 49.47  ? 61   HIS D NE2   1 
ATOM   5163 N  N     . LEU F  3 62  ? -7.321  -3.457  33.205  1.00 45.08  ? 62   LEU D N     1 
ATOM   5164 C  CA    . LEU F  3 62  ? -6.269  -2.977  32.326  1.00 43.84  ? 62   LEU D CA    1 
ATOM   5165 C  C     . LEU F  3 62  ? -5.149  -2.385  33.165  1.00 43.83  ? 62   LEU D C     1 
ATOM   5166 O  O     . LEU F  3 62  ? -5.398  -1.637  34.101  1.00 45.17  ? 62   LEU D O     1 
ATOM   5167 C  CB    . LEU F  3 62  ? -6.812  -1.936  31.347  1.00 42.54  ? 62   LEU D CB    1 
ATOM   5168 C  CG    . LEU F  3 62  ? -8.019  -2.386  30.526  1.00 41.64  ? 62   LEU D CG    1 
ATOM   5169 C  CD1   . LEU F  3 62  ? -8.502  -1.269  29.627  1.00 41.41  ? 62   LEU D CD1   1 
ATOM   5170 C  CD2   . LEU F  3 62  ? -7.695  -3.629  29.718  1.00 40.79  ? 62   LEU D CD2   1 
ATOM   5171 N  N     . GLU F  3 63  ? -3.914  -2.718  32.826  1.00 43.80  ? 63   GLU D N     1 
ATOM   5172 C  CA    . GLU F  3 63  ? -2.788  -2.317  33.644  1.00 44.58  ? 63   GLU D CA    1 
ATOM   5173 C  C     . GLU F  3 63  ? -1.658  -1.762  32.780  1.00 43.49  ? 63   GLU D C     1 
ATOM   5174 O  O     . GLU F  3 63  ? -1.186  -2.436  31.870  1.00 44.38  ? 63   GLU D O     1 
ATOM   5175 C  CB    . GLU F  3 63  ? -2.305  -3.513  34.463  1.00 45.90  ? 63   GLU D CB    1 
ATOM   5176 C  CG    . GLU F  3 63  ? -1.566  -3.138  35.730  1.00 49.63  ? 63   GLU D CG    1 
ATOM   5177 C  CD    . GLU F  3 63  ? -0.982  -4.349  36.451  1.00 51.66  ? 63   GLU D CD    1 
ATOM   5178 O  OE1   . GLU F  3 63  ? -1.149  -5.488  35.948  1.00 51.96  ? 63   GLU D OE1   1 
ATOM   5179 O  OE2   . GLU F  3 63  ? -0.353  -4.151  37.520  1.00 52.19  ? 63   GLU D OE2   1 
ATOM   5180 N  N     . LEU F  3 64  ? -1.222  -0.540  33.065  1.00 41.33  ? 64   LEU D N     1 
ATOM   5181 C  CA    . LEU F  3 64  ? -0.154  0.078   32.286  1.00 40.70  ? 64   LEU D CA    1 
ATOM   5182 C  C     . LEU F  3 64  ? 1.197   -0.541  32.604  1.00 40.82  ? 64   LEU D C     1 
ATOM   5183 O  O     . LEU F  3 64  ? 1.523   -0.774  33.768  1.00 41.19  ? 64   LEU D O     1 
ATOM   5184 C  CB    . LEU F  3 64  ? -0.095  1.596   32.518  1.00 39.85  ? 64   LEU D CB    1 
ATOM   5185 C  CG    . LEU F  3 64  ? -1.356  2.394   32.169  1.00 39.18  ? 64   LEU D CG    1 
ATOM   5186 C  CD1   . LEU F  3 64  ? -1.123  3.888   32.312  1.00 38.92  ? 64   LEU D CD1   1 
ATOM   5187 C  CD2   . LEU F  3 64  ? -1.810  2.056   30.767  1.00 38.91  ? 64   LEU D CD2   1 
ATOM   5188 N  N     . THR F  3 65  ? 1.971   -0.815  31.558  1.00 39.88  ? 65   THR D N     1 
ATOM   5189 C  CA    . THR F  3 65  ? 3.356   -1.217  31.715  1.00 39.00  ? 65   THR D CA    1 
ATOM   5190 C  C     . THR F  3 65  ? 4.141   0.040   32.023  1.00 40.23  ? 65   THR D C     1 
ATOM   5191 O  O     . THR F  3 65  ? 3.611   1.145   31.910  1.00 39.44  ? 65   THR D O     1 
ATOM   5192 C  CB    . THR F  3 65  ? 3.918   -1.830  30.428  1.00 37.31  ? 65   THR D CB    1 
ATOM   5193 O  OG1   . THR F  3 65  ? 3.838   -0.865  29.374  1.00 36.55  ? 65   THR D OG1   1 
ATOM   5194 C  CG2   . THR F  3 65  ? 3.144   -3.067  30.039  1.00 36.29  ? 65   THR D CG2   1 
ATOM   5195 N  N     . GLU F  3 66  ? 5.404   -0.111  32.401  1.00 41.89  ? 66   GLU D N     1 
ATOM   5196 C  CA    . GLU F  3 66  ? 6.197   1.066   32.716  1.00 44.35  ? 66   GLU D CA    1 
ATOM   5197 C  C     . GLU F  3 66  ? 6.334   1.982   31.499  1.00 43.56  ? 66   GLU D C     1 
ATOM   5198 O  O     . GLU F  3 66  ? 6.480   3.195   31.637  1.00 44.40  ? 66   GLU D O     1 
ATOM   5199 C  CB    . GLU F  3 66  ? 7.564   0.692   33.288  1.00 46.19  ? 66   GLU D CB    1 
ATOM   5200 C  CG    . GLU F  3 66  ? 7.997   1.639   34.416  1.00 50.46  ? 66   GLU D CG    1 
ATOM   5201 C  CD    . GLU F  3 66  ? 6.934   1.774   35.528  1.00 52.01  ? 66   GLU D CD    1 
ATOM   5202 O  OE1   . GLU F  3 66  ? 6.521   0.736   36.101  1.00 51.96  ? 66   GLU D OE1   1 
ATOM   5203 O  OE2   . GLU F  3 66  ? 6.518   2.920   35.830  1.00 53.04  ? 66   GLU D OE2   1 
ATOM   5204 N  N     . LYS F  3 67  ? 6.274   1.389   30.310  1.00 42.81  ? 67   LYS D N     1 
ATOM   5205 C  CA    . LYS F  3 67  ? 6.349   2.136   29.061  1.00 40.90  ? 67   LYS D CA    1 
ATOM   5206 C  C     . LYS F  3 67  ? 5.008   2.821   28.777  1.00 39.97  ? 67   LYS D C     1 
ATOM   5207 O  O     . LYS F  3 67  ? 4.967   3.977   28.368  1.00 39.83  ? 67   LYS D O     1 
ATOM   5208 C  CB    . LYS F  3 67  ? 6.734   1.196   27.923  1.00 40.83  ? 67   LYS D CB    1 
ATOM   5209 C  CG    . LYS F  3 67  ? 6.987   1.870   26.590  1.00 41.04  ? 67   LYS D CG    1 
ATOM   5210 C  CD    . LYS F  3 67  ? 7.160   0.826   25.503  1.00 41.80  ? 67   LYS D CD    1 
ATOM   5211 C  CE    . LYS F  3 67  ? 7.251   1.453   24.124  1.00 42.71  ? 67   LYS D CE    1 
ATOM   5212 N  NZ    . LYS F  3 67  ? 6.838   0.467   23.086  1.00 43.22  ? 67   LYS D NZ    1 
ATOM   5213 N  N     . GLY F  3 68  ? 3.915   2.104   29.014  1.00 39.13  ? 68   GLY D N     1 
ATOM   5214 C  CA    . GLY F  3 68  ? 2.581   2.671   28.891  1.00 38.17  ? 68   GLY D CA    1 
ATOM   5215 C  C     . GLY F  3 68  ? 2.321   3.778   29.894  1.00 38.13  ? 68   GLY D C     1 
ATOM   5216 O  O     . GLY F  3 68  ? 1.724   4.802   29.557  1.00 39.12  ? 68   GLY D O     1 
ATOM   5217 N  N     . ARG F  3 69  ? 2.764   3.573   31.131  1.00 37.92  ? 69   ARG D N     1 
ATOM   5218 C  CA    . ARG F  3 69  ? 2.615   4.576   32.183  1.00 37.54  ? 69   ARG D CA    1 
ATOM   5219 C  C     . ARG F  3 69  ? 3.377   5.849   31.828  1.00 37.44  ? 69   ARG D C     1 
ATOM   5220 O  O     . ARG F  3 69  ? 2.843   6.947   31.965  1.00 37.82  ? 69   ARG D O     1 
ATOM   5221 C  CB    . ARG F  3 69  ? 3.089   4.028   33.535  1.00 38.45  ? 69   ARG D CB    1 
ATOM   5222 C  CG    . ARG F  3 69  ? 3.016   5.030   34.682  1.00 39.27  ? 69   ARG D CG    1 
ATOM   5223 C  CD    . ARG F  3 69  ? 3.024   4.338   36.046  1.00 40.02  ? 69   ARG D CD    1 
ATOM   5224 N  NE    . ARG F  3 69  ? 1.892   3.425   36.189  1.00 40.79  ? 69   ARG D NE    1 
ATOM   5225 C  CZ    . ARG F  3 69  ? 0.671   3.798   36.566  1.00 41.17  ? 69   ARG D CZ    1 
ATOM   5226 N  NH1   . ARG F  3 69  ? 0.421   5.072   36.854  1.00 40.53  ? 69   ARG D NH1   1 
ATOM   5227 N  NH2   . ARG F  3 69  ? -0.299  2.897   36.657  1.00 40.58  ? 69   ARG D NH2   1 
ATOM   5228 N  N     . ALA F  3 70  ? 4.613   5.702   31.353  1.00 36.08  ? 70   ALA D N     1 
ATOM   5229 C  CA    . ALA F  3 70  ? 5.427   6.859   31.005  1.00 35.73  ? 70   ALA D CA    1 
ATOM   5230 C  C     . ALA F  3 70  ? 4.783   7.701   29.895  1.00 35.99  ? 70   ALA D C     1 
ATOM   5231 O  O     . ALA F  3 70  ? 4.901   8.928   29.892  1.00 35.82  ? 70   ALA D O     1 
ATOM   5232 C  CB    . ALA F  3 70  ? 6.838   6.428   30.615  1.00 35.88  ? 70   ALA D CB    1 
ATOM   5233 N  N     . LEU F  3 71  ? 4.095   7.046   28.960  1.00 35.60  ? 71   LEU D N     1 
ATOM   5234 C  CA    . LEU F  3 71  ? 3.421   7.772   27.887  1.00 35.07  ? 71   LEU D CA    1 
ATOM   5235 C  C     . LEU F  3 71  ? 2.118   8.441   28.384  1.00 34.06  ? 71   LEU D C     1 
ATOM   5236 O  O     . LEU F  3 71  ? 1.799   9.556   27.978  1.00 31.35  ? 71   LEU D O     1 
ATOM   5237 C  CB    . LEU F  3 71  ? 3.168   6.867   26.669  1.00 35.76  ? 71   LEU D CB    1 
ATOM   5238 C  CG    . LEU F  3 71  ? 3.283   7.491   25.260  1.00 37.73  ? 71   LEU D CG    1 
ATOM   5239 C  CD1   . LEU F  3 71  ? 2.438   6.741   24.208  1.00 37.09  ? 71   LEU D CD1   1 
ATOM   5240 C  CD2   . LEU F  3 71  ? 2.946   8.997   25.220  1.00 37.41  ? 71   LEU D CD2   1 
ATOM   5241 N  N     . ALA F  3 72  ? 1.382   7.763   29.269  1.00 33.53  ? 72   ALA D N     1 
ATOM   5242 C  CA    . ALA F  3 72  ? 0.156   8.330   29.853  1.00 32.92  ? 72   ALA D CA    1 
ATOM   5243 C  C     . ALA F  3 72  ? 0.459   9.564   30.703  1.00 32.62  ? 72   ALA D C     1 
ATOM   5244 O  O     . ALA F  3 72  ? -0.269  10.564  30.666  1.00 31.40  ? 72   ALA D O     1 
ATOM   5245 C  CB    . ALA F  3 72  ? -0.567  7.292   30.692  1.00 31.91  ? 72   ALA D CB    1 
ATOM   5246 N  N     . ILE F  3 73  ? 1.530   9.473   31.485  1.00 31.75  ? 73   ILE D N     1 
ATOM   5247 C  CA    . ILE F  3 73  ? 1.973   10.584  32.316  1.00 31.99  ? 73   ILE D CA    1 
ATOM   5248 C  C     . ILE F  3 73  ? 2.279   11.795  31.438  1.00 32.09  ? 73   ILE D C     1 
ATOM   5249 O  O     . ILE F  3 73  ? 1.843   12.900  31.730  1.00 32.26  ? 73   ILE D O     1 
ATOM   5250 C  CB    . ILE F  3 73  ? 3.216   10.189  33.149  1.00 31.39  ? 73   ILE D CB    1 
ATOM   5251 C  CG1   . ILE F  3 73  ? 2.788   9.379   34.377  1.00 32.25  ? 73   ILE D CG1   1 
ATOM   5252 C  CG2   . ILE F  3 73  ? 4.023   11.416  33.560  1.00 30.22  ? 73   ILE D CG2   1 
ATOM   5253 C  CD1   . ILE F  3 73  ? 3.902   8.513   34.976  1.00 32.18  ? 73   ILE D CD1   1 
ATOM   5254 N  N     . ALA F  3 74  ? 3.010   11.560  30.351  1.00 31.71  ? 74   ALA D N     1 
ATOM   5255 C  CA    . ALA F  3 74  ? 3.420   12.614  29.424  1.00 32.58  ? 74   ALA D CA    1 
ATOM   5256 C  C     . ALA F  3 74  ? 2.254   13.312  28.700  1.00 32.35  ? 74   ALA D C     1 
ATOM   5257 O  O     . ALA F  3 74  ? 2.335   14.497  28.383  1.00 32.30  ? 74   ALA D O     1 
ATOM   5258 C  CB    . ALA F  3 74  ? 4.415   12.051  28.405  1.00 33.10  ? 74   ALA D CB    1 
ATOM   5259 N  N     . VAL F  3 75  ? 1.182   12.575  28.428  1.00 31.76  ? 75   VAL D N     1 
ATOM   5260 C  CA    . VAL F  3 75  ? 0.014   13.154  27.784  1.00 31.73  ? 75   VAL D CA    1 
ATOM   5261 C  C     . VAL F  3 75  ? -0.816  13.956  28.796  1.00 32.62  ? 75   VAL D C     1 
ATOM   5262 O  O     . VAL F  3 75  ? -1.336  15.035  28.477  1.00 31.85  ? 75   VAL D O     1 
ATOM   5263 C  CB    . VAL F  3 75  ? -0.866  12.075  27.119  1.00 31.16  ? 75   VAL D CB    1 
ATOM   5264 C  CG1   . VAL F  3 75  ? -2.017  12.721  26.365  1.00 31.59  ? 75   VAL D CG1   1 
ATOM   5265 C  CG2   . VAL F  3 75  ? -0.038  11.227  26.179  1.00 31.54  ? 75   VAL D CG2   1 
ATOM   5266 N  N     . MET F  3 76  ? -0.944  13.425  30.011  1.00 32.62  ? 76   MET D N     1 
ATOM   5267 C  CA    . MET F  3 76  ? -1.651  14.130  31.073  1.00 33.13  ? 76   MET D CA    1 
ATOM   5268 C  C     . MET F  3 76  ? -0.936  15.439  31.360  1.00 32.82  ? 76   MET D C     1 
ATOM   5269 O  O     . MET F  3 76  ? -1.560  16.498  31.468  1.00 32.88  ? 76   MET D O     1 
ATOM   5270 C  CB    . MET F  3 76  ? -1.733  13.281  32.341  1.00 35.57  ? 76   MET D CB    1 
ATOM   5271 C  CG    . MET F  3 76  ? -2.609  13.893  33.431  1.00 37.70  ? 76   MET D CG    1 
ATOM   5272 S  SD    . MET F  3 76  ? -4.322  14.083  32.890  1.00 40.62  ? 76   MET D SD    1 
ATOM   5273 C  CE    . MET F  3 76  ? -4.977  12.501  33.407  1.00 39.05  ? 76   MET D CE    1 
ATOM   5274 N  N     . ARG F  3 77  ? 0.385   15.368  31.457  1.00 31.39  ? 77   ARG D N     1 
ATOM   5275 C  CA    . ARG F  3 77  ? 1.179   16.563  31.671  1.00 30.30  ? 77   ARG D CA    1 
ATOM   5276 C  C     . ARG F  3 77  ? 0.940   17.599  30.574  1.00 30.56  ? 77   ARG D C     1 
ATOM   5277 O  O     . ARG F  3 77  ? 0.826   18.784  30.857  1.00 30.28  ? 77   ARG D O     1 
ATOM   5278 C  CB    . ARG F  3 77  ? 2.652   16.201  31.737  1.00 28.98  ? 77   ARG D CB    1 
ATOM   5279 C  CG    . ARG F  3 77  ? 3.550   17.346  32.137  1.00 28.12  ? 77   ARG D CG    1 
ATOM   5280 C  CD    . ARG F  3 77  ? 4.972   16.867  32.126  1.00 28.52  ? 77   ARG D CD    1 
ATOM   5281 N  NE    . ARG F  3 77  ? 5.425   16.621  30.761  1.00 28.22  ? 77   ARG D NE    1 
ATOM   5282 C  CZ    . ARG F  3 77  ? 6.126   15.560  30.378  1.00 28.74  ? 77   ARG D CZ    1 
ATOM   5283 N  NH1   . ARG F  3 77  ? 6.461   14.614  31.261  1.00 27.58  ? 77   ARG D NH1   1 
ATOM   5284 N  NH2   . ARG F  3 77  ? 6.485   15.442  29.101  1.00 27.68  ? 77   ARG D NH2   1 
ATOM   5285 N  N     . LYS F  3 78  ? 0.879   17.151  29.321  1.00 31.13  ? 78   LYS D N     1 
ATOM   5286 C  CA    . LYS F  3 78  ? 0.636   18.059  28.202  1.00 31.97  ? 78   LYS D CA    1 
ATOM   5287 C  C     . LYS F  3 78  ? -0.777  18.643  28.275  1.00 31.37  ? 78   LYS D C     1 
ATOM   5288 O  O     . LYS F  3 78  ? -0.988  19.826  28.023  1.00 28.87  ? 78   LYS D O     1 
ATOM   5289 C  CB    . LYS F  3 78  ? 0.853   17.342  26.861  1.00 31.70  ? 78   LYS D CB    1 
ATOM   5290 C  CG    . LYS F  3 78  ? 2.286   16.929  26.617  1.00 32.94  ? 78   LYS D CG    1 
ATOM   5291 C  CD    . LYS F  3 78  ? 2.442   16.048  25.381  1.00 33.10  ? 78   LYS D CD    1 
ATOM   5292 C  CE    . LYS F  3 78  ? 3.749   15.258  25.437  1.00 33.18  ? 78   LYS D CE    1 
ATOM   5293 N  NZ    . LYS F  3 78  ? 4.953   16.128  25.432  1.00 33.30  ? 78   LYS D NZ    1 
ATOM   5294 N  N     . HIS F  3 79  ? -1.733  17.792  28.629  1.00 32.81  ? 79   HIS D N     1 
ATOM   5295 C  CA    . HIS F  3 79  ? -3.124  18.180  28.738  1.00 34.95  ? 79   HIS D CA    1 
ATOM   5296 C  C     . HIS F  3 79  ? -3.286  19.308  29.748  1.00 35.12  ? 79   HIS D C     1 
ATOM   5297 O  O     . HIS F  3 79  ? -3.968  20.300  29.488  1.00 35.61  ? 79   HIS D O     1 
ATOM   5298 C  CB    . HIS F  3 79  ? -3.957  16.974  29.160  1.00 38.22  ? 79   HIS D CB    1 
ATOM   5299 C  CG    . HIS F  3 79  ? -5.414  17.269  29.300  1.00 41.41  ? 79   HIS D CG    1 
ATOM   5300 N  ND1   . HIS F  3 79  ? -6.268  17.323  28.222  1.00 43.05  ? 79   HIS D ND1   1 
ATOM   5301 C  CD2   . HIS F  3 79  ? -6.171  17.529  30.392  1.00 42.92  ? 79   HIS D CD2   1 
ATOM   5302 C  CE1   . HIS F  3 79  ? -7.487  17.609  28.641  1.00 43.35  ? 79   HIS D CE1   1 
ATOM   5303 N  NE2   . HIS F  3 79  ? -7.456  17.741  29.954  1.00 46.27  ? 79   HIS D NE2   1 
ATOM   5304 N  N     . ARG F  3 80  ? -2.634  19.166  30.894  1.00 33.88  ? 80   ARG D N     1 
ATOM   5305 C  CA    . ARG F  3 80  ? -2.814  20.110  31.991  1.00 33.02  ? 80   ARG D CA    1 
ATOM   5306 C  C     . ARG F  3 80  ? -1.960  21.375  31.875  1.00 32.25  ? 80   ARG D C     1 
ATOM   5307 O  O     . ARG F  3 80  ? -2.375  22.445  32.327  1.00 30.95  ? 80   ARG D O     1 
ATOM   5308 C  CB    . ARG F  3 80  ? -2.624  19.402  33.341  1.00 32.23  ? 80   ARG D CB    1 
ATOM   5309 C  CG    . ARG F  3 80  ? -3.798  18.495  33.681  1.00 29.57  ? 80   ARG D CG    1 
ATOM   5310 C  CD    . ARG F  3 80  ? -3.591  17.682  34.945  1.00 28.45  ? 80   ARG D CD    1 
ATOM   5311 N  NE    . ARG F  3 80  ? -4.760  16.832  35.148  1.00 28.64  ? 80   ARG D NE    1 
ATOM   5312 C  CZ    . ARG F  3 80  ? -4.827  15.787  35.968  1.00 28.93  ? 80   ARG D CZ    1 
ATOM   5313 N  NH1   . ARG F  3 80  ? -3.774  15.414  36.712  1.00 27.86  ? 80   ARG D NH1   1 
ATOM   5314 N  NH2   . ARG F  3 80  ? -5.964  15.104  36.037  1.00 27.69  ? 80   ARG D NH2   1 
ATOM   5315 N  N     . LEU F  3 81  ? -0.781  21.262  31.269  1.00 30.92  ? 81   LEU D N     1 
ATOM   5316 C  CA    . LEU F  3 81  ? -0.008  22.460  30.945  1.00 31.17  ? 81   LEU D CA    1 
ATOM   5317 C  C     . LEU F  3 81  ? -0.723  23.299  29.881  1.00 31.82  ? 81   LEU D C     1 
ATOM   5318 O  O     . LEU F  3 81  ? -0.563  24.517  29.824  1.00 31.68  ? 81   LEU D O     1 
ATOM   5319 C  CB    . LEU F  3 81  ? 1.395   22.100  30.464  1.00 29.80  ? 81   LEU D CB    1 
ATOM   5320 C  CG    . LEU F  3 81  ? 2.417   21.717  31.531  1.00 29.59  ? 81   LEU D CG    1 
ATOM   5321 C  CD1   . LEU F  3 81  ? 3.673   21.186  30.868  1.00 27.89  ? 81   LEU D CD1   1 
ATOM   5322 C  CD2   . LEU F  3 81  ? 2.724   22.883  32.469  1.00 28.02  ? 81   LEU D CD2   1 
ATOM   5323 N  N     . ALA F  3 82  ? -1.504  22.628  29.040  1.00 32.82  ? 82   ALA D N     1 
ATOM   5324 C  CA    . ALA F  3 82  ? -2.279  23.281  28.000  1.00 33.45  ? 82   ALA D CA    1 
ATOM   5325 C  C     . ALA F  3 82  ? -3.460  24.000  28.620  1.00 33.89  ? 82   ALA D C     1 
ATOM   5326 O  O     . ALA F  3 82  ? -3.740  25.147  28.293  1.00 35.18  ? 82   ALA D O     1 
ATOM   5327 C  CB    . ALA F  3 82  ? -2.759  22.257  26.969  1.00 33.39  ? 82   ALA D CB    1 
ATOM   5328 N  N     . GLU F  3 83  ? -4.163  23.314  29.511  1.00 35.12  ? 83   GLU D N     1 
ATOM   5329 C  CA    . GLU F  3 83  ? -5.264  23.924  30.241  1.00 34.97  ? 83   GLU D CA    1 
ATOM   5330 C  C     . GLU F  3 83  ? -4.809  25.214  30.923  1.00 34.77  ? 83   GLU D C     1 
ATOM   5331 O  O     . GLU F  3 83  ? -5.418  26.276  30.736  1.00 33.21  ? 83   GLU D O     1 
ATOM   5332 C  CB    . GLU F  3 83  ? -5.843  22.936  31.244  1.00 36.02  ? 83   GLU D CB    1 
ATOM   5333 C  CG    . GLU F  3 83  ? -6.754  21.903  30.609  1.00 38.71  ? 83   GLU D CG    1 
ATOM   5334 C  CD    . GLU F  3 83  ? -7.144  20.813  31.574  1.00 40.32  ? 83   GLU D CD    1 
ATOM   5335 O  OE1   . GLU F  3 83  ? -6.465  20.688  32.610  1.00 41.80  ? 83   GLU D OE1   1 
ATOM   5336 O  OE2   . GLU F  3 83  ? -8.120  20.077  31.303  1.00 45.53  ? 83   GLU D OE2   1 
ATOM   5337 N  N     . ARG F  3 84  ? -3.722  25.125  31.684  1.00 34.63  ? 84   ARG D N     1 
ATOM   5338 C  CA    . ARG F  3 84  ? -3.118  26.305  32.288  1.00 36.05  ? 84   ARG D CA    1 
ATOM   5339 C  C     . ARG F  3 84  ? -2.971  27.422  31.272  1.00 36.35  ? 84   ARG D C     1 
ATOM   5340 O  O     . ARG F  3 84  ? -3.440  28.536  31.489  1.00 36.73  ? 84   ARG D O     1 
ATOM   5341 C  CB    . ARG F  3 84  ? -1.746  25.970  32.874  1.00 37.43  ? 84   ARG D CB    1 
ATOM   5342 C  CG    . ARG F  3 84  ? -1.780  25.322  34.245  1.00 40.00  ? 84   ARG D CG    1 
ATOM   5343 C  CD    . ARG F  3 84  ? -1.433  26.316  35.350  1.00 41.09  ? 84   ARG D CD    1 
ATOM   5344 N  NE    . ARG F  3 84  ? -2.467  27.320  35.570  1.00 41.77  ? 84   ARG D NE    1 
ATOM   5345 C  CZ    . ARG F  3 84  ? -3.344  27.284  36.570  1.00 42.51  ? 84   ARG D CZ    1 
ATOM   5346 N  NH1   . ARG F  3 84  ? -3.320  26.281  37.438  1.00 42.50  ? 84   ARG D NH1   1 
ATOM   5347 N  NH2   . ARG F  3 84  ? -4.249  28.248  36.697  1.00 41.49  ? 84   ARG D NH2   1 
ATOM   5348 N  N     . LEU F  3 85  ? -2.302  27.113  30.164  1.00 36.86  ? 85   LEU D N     1 
ATOM   5349 C  CA    . LEU F  3 85  ? -2.067  28.069  29.085  1.00 36.36  ? 85   LEU D CA    1 
ATOM   5350 C  C     . LEU F  3 85  ? -3.360  28.668  28.530  1.00 36.13  ? 85   LEU D C     1 
ATOM   5351 O  O     . LEU F  3 85  ? -3.404  29.838  28.165  1.00 35.40  ? 85   LEU D O     1 
ATOM   5352 C  CB    . LEU F  3 85  ? -1.303  27.380  27.953  1.00 36.81  ? 85   LEU D CB    1 
ATOM   5353 C  CG    . LEU F  3 85  ? -1.039  28.214  26.698  1.00 37.33  ? 85   LEU D CG    1 
ATOM   5354 C  CD1   . LEU F  3 85  ? 0.081   29.224  26.945  1.00 36.40  ? 85   LEU D CD1   1 
ATOM   5355 C  CD2   . LEU F  3 85  ? -0.710  27.302  25.519  1.00 37.19  ? 85   LEU D CD2   1 
ATOM   5356 N  N     . LEU F  3 86  ? -4.408  27.856  28.463  1.00 36.27  ? 86   LEU D N     1 
ATOM   5357 C  CA    . LEU F  3 86  ? -5.661  28.277  27.854  1.00 37.65  ? 86   LEU D CA    1 
ATOM   5358 C  C     . LEU F  3 86  ? -6.457  29.251  28.733  1.00 38.91  ? 86   LEU D C     1 
ATOM   5359 O  O     . LEU F  3 86  ? -7.142  30.151  28.234  1.00 38.04  ? 86   LEU D O     1 
ATOM   5360 C  CB    . LEU F  3 86  ? -6.500  27.051  27.478  1.00 36.34  ? 86   LEU D CB    1 
ATOM   5361 C  CG    . LEU F  3 86  ? -6.022  26.330  26.215  1.00 35.72  ? 86   LEU D CG    1 
ATOM   5362 C  CD1   . LEU F  3 86  ? -6.707  24.989  26.038  1.00 34.98  ? 86   LEU D CD1   1 
ATOM   5363 C  CD2   . LEU F  3 86  ? -6.249  27.212  24.998  1.00 36.05  ? 86   LEU D CD2   1 
ATOM   5364 N  N     . VAL F  3 87  ? -6.350  29.069  30.044  1.00 40.46  ? 87   VAL D N     1 
ATOM   5365 C  CA    . VAL F  3 87  ? -7.046  29.920  31.003  1.00 41.58  ? 87   VAL D CA    1 
ATOM   5366 C  C     . VAL F  3 87  ? -6.227  31.175  31.316  1.00 42.85  ? 87   VAL D C     1 
ATOM   5367 O  O     . VAL F  3 87  ? -6.717  32.298  31.172  1.00 43.45  ? 87   VAL D O     1 
ATOM   5368 C  CB    . VAL F  3 87  ? -7.342  29.150  32.312  1.00 40.49  ? 87   VAL D CB    1 
ATOM   5369 C  CG1   . VAL F  3 87  ? -7.733  30.105  33.426  1.00 40.90  ? 87   VAL D CG1   1 
ATOM   5370 C  CG2   . VAL F  3 87  ? -8.425  28.121  32.084  1.00 40.00  ? 87   VAL D CG2   1 
ATOM   5371 N  N     . ASP F  3 88  ? -4.976  30.967  31.724  1.00 43.75  ? 88   ASP D N     1 
ATOM   5372 C  CA    . ASP F  3 88  ? -4.111  32.031  32.221  1.00 44.89  ? 88   ASP D CA    1 
ATOM   5373 C  C     . ASP F  3 88  ? -3.642  32.995  31.145  1.00 44.80  ? 88   ASP D C     1 
ATOM   5374 O  O     . ASP F  3 88  ? -3.535  34.185  31.399  1.00 45.66  ? 88   ASP D O     1 
ATOM   5375 C  CB    . ASP F  3 88  ? -2.877  31.444  32.913  1.00 46.88  ? 88   ASP D CB    1 
ATOM   5376 C  CG    . ASP F  3 88  ? -3.223  30.595  34.124  1.00 48.43  ? 88   ASP D CG    1 
ATOM   5377 O  OD1   . ASP F  3 88  ? -4.424  30.386  34.409  1.00 48.89  ? 88   ASP D OD1   1 
ATOM   5378 O  OD2   . ASP F  3 88  ? -2.274  30.129  34.793  1.00 49.87  ? 88   ASP D OD2   1 
ATOM   5379 N  N     . VAL F  3 89  ? -3.341  32.490  29.953  1.00 44.92  ? 89   VAL D N     1 
ATOM   5380 C  CA    . VAL F  3 89  ? -2.814  33.342  28.882  1.00 44.20  ? 89   VAL D CA    1 
ATOM   5381 C  C     . VAL F  3 89  ? -3.837  33.662  27.793  1.00 43.88  ? 89   VAL D C     1 
ATOM   5382 O  O     . VAL F  3 89  ? -4.079  34.827  27.475  1.00 44.48  ? 89   VAL D O     1 
ATOM   5383 C  CB    . VAL F  3 89  ? -1.567  32.725  28.222  1.00 44.40  ? 89   VAL D CB    1 
ATOM   5384 C  CG1   . VAL F  3 89  ? -1.102  33.589  27.067  1.00 45.01  ? 89   VAL D CG1   1 
ATOM   5385 C  CG2   . VAL F  3 89  ? -0.452  32.555  29.240  1.00 45.05  ? 89   VAL D CG2   1 
ATOM   5386 N  N     . ILE F  3 90  ? -4.433  32.623  27.224  1.00 43.71  ? 90   ILE D N     1 
ATOM   5387 C  CA    . ILE F  3 90  ? -5.313  32.779  26.070  1.00 43.10  ? 90   ILE D CA    1 
ATOM   5388 C  C     . ILE F  3 90  ? -6.711  33.283  26.460  1.00 43.40  ? 90   ILE D C     1 
ATOM   5389 O  O     . ILE F  3 90  ? -7.279  34.145  25.791  1.00 43.63  ? 90   ILE D O     1 
ATOM   5390 C  CB    . ILE F  3 90  ? -5.357  31.472  25.232  1.00 42.32  ? 90   ILE D CB    1 
ATOM   5391 C  CG1   . ILE F  3 90  ? -3.967  31.194  24.648  1.00 41.95  ? 90   ILE D CG1   1 
ATOM   5392 C  CG2   . ILE F  3 90  ? -6.376  31.568  24.116  1.00 41.98  ? 90   ILE D CG2   1 
ATOM   5393 C  CD1   . ILE F  3 90  ? -3.704  29.752  24.291  1.00 41.54  ? 90   ILE D CD1   1 
ATOM   5394 N  N     . GLY F  3 91  ? -7.252  32.761  27.554  1.00 44.06  ? 91   GLY D N     1 
ATOM   5395 C  CA    . GLY F  3 91  ? -8.536  33.232  28.051  1.00 44.85  ? 91   GLY D CA    1 
ATOM   5396 C  C     . GLY F  3 91  ? -9.710  32.584  27.348  1.00 46.30  ? 91   GLY D C     1 
ATOM   5397 O  O     . GLY F  3 91  ? -10.709 33.237  27.048  1.00 47.61  ? 91   GLY D O     1 
ATOM   5398 N  N     . LEU F  3 92  ? -9.600  31.293  27.075  1.00 46.36  ? 92   LEU D N     1 
ATOM   5399 C  CA    . LEU F  3 92  ? -10.699 30.579  26.458  1.00 46.95  ? 92   LEU D CA    1 
ATOM   5400 C  C     . LEU F  3 92  ? -11.738 30.281  27.533  1.00 48.08  ? 92   LEU D C     1 
ATOM   5401 O  O     . LEU F  3 92  ? -11.390 29.836  28.621  1.00 48.67  ? 92   LEU D O     1 
ATOM   5402 C  CB    . LEU F  3 92  ? -10.201 29.280  25.816  1.00 46.45  ? 92   LEU D CB    1 
ATOM   5403 C  CG    . LEU F  3 92  ? -11.205 28.513  24.949  1.00 46.11  ? 92   LEU D CG    1 
ATOM   5404 C  CD1   . LEU F  3 92  ? -11.359 29.177  23.588  1.00 45.16  ? 92   LEU D CD1   1 
ATOM   5405 C  CD2   . LEU F  3 92  ? -10.801 27.049  24.811  1.00 46.23  ? 92   LEU D CD2   1 
ATOM   5406 N  N     . PRO F  3 93  ? -13.019 30.550  27.242  1.00 48.85  ? 93   PRO D N     1 
ATOM   5407 C  CA    . PRO F  3 93  ? -14.085 30.239  28.186  1.00 49.45  ? 93   PRO D CA    1 
ATOM   5408 C  C     . PRO F  3 93  ? -13.906 28.871  28.853  1.00 50.47  ? 93   PRO D C     1 
ATOM   5409 O  O     . PRO F  3 93  ? -13.506 27.907  28.205  1.00 49.83  ? 93   PRO D O     1 
ATOM   5410 C  CB    . PRO F  3 93  ? -15.333 30.254  27.305  1.00 48.68  ? 93   PRO D CB    1 
ATOM   5411 C  CG    . PRO F  3 93  ? -15.021 31.274  26.265  1.00 48.75  ? 93   PRO D CG    1 
ATOM   5412 C  CD    . PRO F  3 93  ? -13.536 31.190  26.017  1.00 48.84  ? 93   PRO D CD    1 
ATOM   5413 N  N     . TRP F  3 94  ? -14.215 28.806  30.144  1.00 52.38  ? 94   TRP D N     1 
ATOM   5414 C  CA    . TRP F  3 94  ? -14.042 27.600  30.954  1.00 53.88  ? 94   TRP D CA    1 
ATOM   5415 C  C     . TRP F  3 94  ? -14.645 26.347  30.348  1.00 53.86  ? 94   TRP D C     1 
ATOM   5416 O  O     . TRP F  3 94  ? -14.049 25.272  30.401  1.00 54.63  ? 94   TRP D O     1 
ATOM   5417 C  CB    . TRP F  3 94  ? -14.655 27.810  32.339  1.00 55.07  ? 94   TRP D CB    1 
ATOM   5418 C  CG    . TRP F  3 94  ? -13.733 28.483  33.284  1.00 56.13  ? 94   TRP D CG    1 
ATOM   5419 C  CD1   . TRP F  3 94  ? -13.739 29.804  33.644  1.00 56.11  ? 94   TRP D CD1   1 
ATOM   5420 C  CD2   . TRP F  3 94  ? -12.645 27.876  33.995  1.00 56.32  ? 94   TRP D CD2   1 
ATOM   5421 N  NE1   . TRP F  3 94  ? -12.724 30.051  34.539  1.00 56.92  ? 94   TRP D NE1   1 
ATOM   5422 C  CE2   . TRP F  3 94  ? -12.039 28.884  34.772  1.00 56.47  ? 94   TRP D CE2   1 
ATOM   5423 C  CE3   . TRP F  3 94  ? -12.129 26.577  34.054  1.00 56.09  ? 94   TRP D CE3   1 
ATOM   5424 C  CZ2   . TRP F  3 94  ? -10.942 28.632  35.598  1.00 55.96  ? 94   TRP D CZ2   1 
ATOM   5425 C  CZ3   . TRP F  3 94  ? -11.039 26.332  34.876  1.00 56.03  ? 94   TRP D CZ3   1 
ATOM   5426 C  CH2   . TRP F  3 94  ? -10.461 27.354  35.636  1.00 55.69  ? 94   TRP D CH2   1 
ATOM   5427 N  N     . GLU F  3 95  ? -15.837 26.488  29.789  1.00 53.73  ? 95   GLU D N     1 
ATOM   5428 C  CA    . GLU F  3 95  ? -16.598 25.349  29.308  1.00 53.95  ? 95   GLU D CA    1 
ATOM   5429 C  C     . GLU F  3 95  ? -15.929 24.701  28.100  1.00 53.88  ? 95   GLU D C     1 
ATOM   5430 O  O     . GLU F  3 95  ? -16.299 23.600  27.690  1.00 53.20  ? 95   GLU D O     1 
ATOM   5431 C  CB    . GLU F  3 95  ? -18.035 25.775  28.969  1.00 54.70  ? 95   GLU D CB    1 
ATOM   5432 C  CG    . GLU F  3 95  ? -18.167 26.795  27.822  1.00 55.82  ? 95   GLU D CG    1 
ATOM   5433 C  CD    . GLU F  3 95  ? -18.102 28.266  28.272  1.00 56.85  ? 95   GLU D CD    1 
ATOM   5434 O  OE1   . GLU F  3 95  ? -18.393 29.150  27.424  1.00 56.74  ? 95   GLU D OE1   1 
ATOM   5435 O  OE2   . GLU F  3 95  ? -17.764 28.540  29.454  1.00 56.03  ? 95   GLU D OE2   1 
ATOM   5436 N  N     . GLU F  3 96  ? -14.931 25.384  27.545  1.00 53.40  ? 96   GLU D N     1 
ATOM   5437 C  CA    . GLU F  3 96  ? -14.296 24.932  26.317  1.00 52.68  ? 96   GLU D CA    1 
ATOM   5438 C  C     . GLU F  3 96  ? -12.841 24.492  26.434  1.00 51.58  ? 96   GLU D C     1 
ATOM   5439 O  O     . GLU F  3 96  ? -12.302 23.940  25.480  1.00 51.78  ? 96   GLU D O     1 
ATOM   5440 C  CB    . GLU F  3 96  ? -14.408 26.008  25.242  1.00 53.83  ? 96   GLU D CB    1 
ATOM   5441 C  CG    . GLU F  3 96  ? -15.701 25.946  24.474  1.00 55.75  ? 96   GLU D CG    1 
ATOM   5442 C  CD    . GLU F  3 96  ? -16.093 27.287  23.903  1.00 56.27  ? 96   GLU D CD    1 
ATOM   5443 O  OE1   . GLU F  3 96  ? -15.326 27.831  23.081  1.00 56.14  ? 96   GLU D OE1   1 
ATOM   5444 O  OE2   . GLU F  3 96  ? -17.173 27.793  24.284  1.00 57.01  ? 96   GLU D OE2   1 
ATOM   5445 N  N     . VAL F  3 97  ? -12.187 24.728  27.567  1.00 49.80  ? 97   VAL D N     1 
ATOM   5446 C  CA    . VAL F  3 97  ? -10.755 24.421  27.606  1.00 49.50  ? 97   VAL D CA    1 
ATOM   5447 C  C     . VAL F  3 97  ? -10.425 22.927  27.642  1.00 48.67  ? 97   VAL D C     1 
ATOM   5448 O  O     . VAL F  3 97  ? -9.422  22.521  27.065  1.00 48.43  ? 97   VAL D O     1 
ATOM   5449 C  CB    . VAL F  3 97  ? -9.951  25.195  28.687  1.00 49.12  ? 97   VAL D CB    1 
ATOM   5450 C  CG1   . VAL F  3 97  ? -10.327 26.673  28.687  1.00 48.57  ? 97   VAL D CG1   1 
ATOM   5451 C  CG2   . VAL F  3 97  ? -10.119 24.566  30.052  1.00 49.56  ? 97   VAL D CG2   1 
ATOM   5452 N  N     . HIS F  3 98  ? -11.257 22.110  28.286  1.00 47.60  ? 98   HIS D N     1 
ATOM   5453 C  CA    . HIS F  3 98  ? -10.968 20.678  28.310  1.00 47.25  ? 98   HIS D CA    1 
ATOM   5454 C  C     . HIS F  3 98  ? -11.026 20.057  26.915  1.00 45.42  ? 98   HIS D C     1 
ATOM   5455 O  O     . HIS F  3 98  ? -10.196 19.212  26.578  1.00 44.84  ? 98   HIS D O     1 
ATOM   5456 C  CB    . HIS F  3 98  ? -11.861 19.895  29.277  1.00 48.74  ? 98   HIS D CB    1 
ATOM   5457 C  CG    . HIS F  3 98  ? -11.578 18.422  29.279  1.00 50.42  ? 98   HIS D CG    1 
ATOM   5458 N  ND1   . HIS F  3 98  ? -10.498 17.869  29.939  1.00 51.89  ? 98   HIS D ND1   1 
ATOM   5459 C  CD2   . HIS F  3 98  ? -12.213 17.393  28.668  1.00 50.72  ? 98   HIS D CD2   1 
ATOM   5460 C  CE1   . HIS F  3 98  ? -10.493 16.561  29.748  1.00 50.85  ? 98   HIS D CE1   1 
ATOM   5461 N  NE2   . HIS F  3 98  ? -11.520 16.247  28.978  1.00 51.19  ? 98   HIS D NE2   1 
ATOM   5462 N  N     . ALA F  3 99  ? -12.006 20.480  26.117  1.00 42.91  ? 99   ALA D N     1 
ATOM   5463 C  CA    . ALA F  3 99  ? -12.152 20.013  24.737  1.00 40.27  ? 99   ALA D CA    1 
ATOM   5464 C  C     . ALA F  3 99  ? -10.951 20.404  23.890  1.00 38.25  ? 99   ALA D C     1 
ATOM   5465 O  O     . ALA F  3 99  ? -10.504 19.627  23.054  1.00 38.22  ? 99   ALA D O     1 
ATOM   5466 C  CB    . ALA F  3 99  ? -13.428 20.573  24.112  1.00 40.32  ? 99   ALA D CB    1 
ATOM   5467 N  N     . GLU F  3 100 ? -10.448 21.617  24.101  1.00 36.06  ? 100  GLU D N     1 
ATOM   5468 C  CA    . GLU F  3 100 ? -9.299  22.118  23.362  1.00 34.37  ? 100  GLU D CA    1 
ATOM   5469 C  C     . GLU F  3 100 ? -8.008  21.412  23.775  1.00 33.59  ? 100  GLU D C     1 
ATOM   5470 O  O     . GLU F  3 100 ? -7.209  21.026  22.923  1.00 34.85  ? 100  GLU D O     1 
ATOM   5471 C  CB    . GLU F  3 100 ? -9.152  23.627  23.548  1.00 33.75  ? 100  GLU D CB    1 
ATOM   5472 C  CG    . GLU F  3 100 ? -8.107  24.266  22.636  1.00 34.64  ? 100  GLU D CG    1 
ATOM   5473 C  CD    . GLU F  3 100 ? -8.666  24.626  21.269  1.00 35.58  ? 100  GLU D CD    1 
ATOM   5474 O  OE1   . GLU F  3 100 ? -9.874  24.917  21.195  1.00 36.29  ? 100  GLU D OE1   1 
ATOM   5475 O  OE2   . GLU F  3 100 ? -7.909  24.633  20.273  1.00 36.35  ? 100  GLU D OE2   1 
ATOM   5476 N  N     . ALA F  3 101 ? -7.808  21.248  25.080  1.00 32.38  ? 101  ALA D N     1 
ATOM   5477 C  CA    . ALA F  3 101 ? -6.635  20.569  25.610  1.00 31.15  ? 101  ALA D CA    1 
ATOM   5478 C  C     . ALA F  3 101 ? -6.700  19.067  25.365  1.00 31.80  ? 101  ALA D C     1 
ATOM   5479 O  O     . ALA F  3 101 ? -5.691  18.374  25.468  1.00 32.29  ? 101  ALA D O     1 
ATOM   5480 C  CB    . ALA F  3 101 ? -6.488  20.850  27.088  1.00 31.27  ? 101  ALA D CB    1 
ATOM   5481 N  N     . CYS F  3 102 ? -7.886  18.560  25.047  1.00 32.08  ? 102  CYS D N     1 
ATOM   5482 C  CA    . CYS F  3 102 ? -8.048  17.149  24.703  1.00 33.05  ? 102  CYS D CA    1 
ATOM   5483 C  C     . CYS F  3 102 ? -7.470  16.826  23.315  1.00 32.33  ? 102  CYS D C     1 
ATOM   5484 O  O     . CYS F  3 102 ? -7.265  15.655  22.969  1.00 33.65  ? 102  CYS D O     1 
ATOM   5485 C  CB    . CYS F  3 102 ? -9.515  16.734  24.774  1.00 33.43  ? 102  CYS D CB    1 
ATOM   5486 S  SG    . CYS F  3 102 ? -9.753  14.950  24.733  1.00 36.92  ? 102  CYS D SG    1 
ATOM   5487 N  N     . ARG F  3 103 ? -7.203  17.871  22.538  1.00 30.85  ? 103  ARG D N     1 
ATOM   5488 C  CA    . ARG F  3 103 ? -6.603  17.730  21.222  1.00 30.33  ? 103  ARG D CA    1 
ATOM   5489 C  C     . ARG F  3 103 ? -5.140  18.143  21.276  1.00 30.89  ? 103  ARG D C     1 
ATOM   5490 O  O     . ARG F  3 103 ? -4.291  17.526  20.646  1.00 30.93  ? 103  ARG D O     1 
ATOM   5491 C  CB    . ARG F  3 103 ? -7.333  18.600  20.193  1.00 29.04  ? 103  ARG D CB    1 
ATOM   5492 C  CG    . ARG F  3 103 ? -8.749  18.152  19.883  1.00 29.70  ? 103  ARG D CG    1 
ATOM   5493 C  CD    . ARG F  3 103 ? -9.315  18.847  18.631  1.00 28.48  ? 103  ARG D CD    1 
ATOM   5494 N  NE    . ARG F  3 103 ? -9.208  20.302  18.687  1.00 28.65  ? 103  ARG D NE    1 
ATOM   5495 C  CZ    . ARG F  3 103 ? -10.132 21.105  19.215  1.00 28.99  ? 103  ARG D CZ    1 
ATOM   5496 N  NH1   . ARG F  3 103 ? -9.944  22.421  19.216  1.00 28.52  ? 103  ARG D NH1   1 
ATOM   5497 N  NH2   . ARG F  3 103 ? -11.238 20.596  19.750  1.00 26.60  ? 103  ARG D NH2   1 
ATOM   5498 N  N     . TRP F  3 104 ? -4.854  19.196  22.034  1.00 31.64  ? 104  TRP D N     1 
ATOM   5499 C  CA    . TRP F  3 104 ? -3.511  19.761  22.095  1.00 31.13  ? 104  TRP D CA    1 
ATOM   5500 C  C     . TRP F  3 104 ? -2.514  18.842  22.780  1.00 31.22  ? 104  TRP D C     1 
ATOM   5501 O  O     . TRP F  3 104 ? -1.311  18.912  22.509  1.00 30.66  ? 104  TRP D O     1 
ATOM   5502 C  CB    . TRP F  3 104 ? -3.549  21.105  22.815  1.00 32.42  ? 104  TRP D CB    1 
ATOM   5503 C  CG    . TRP F  3 104 ? -4.236  22.172  22.014  1.00 33.04  ? 104  TRP D CG    1 
ATOM   5504 C  CD1   . TRP F  3 104 ? -5.265  22.001  21.132  1.00 32.59  ? 104  TRP D CD1   1 
ATOM   5505 C  CD2   . TRP F  3 104 ? -3.953  23.573  22.033  1.00 32.95  ? 104  TRP D CD2   1 
ATOM   5506 N  NE1   . TRP F  3 104 ? -5.630  23.205  20.595  1.00 33.14  ? 104  TRP D NE1   1 
ATOM   5507 C  CE2   . TRP F  3 104 ? -4.841  24.189  21.130  1.00 33.27  ? 104  TRP D CE2   1 
ATOM   5508 C  CE3   . TRP F  3 104 ? -3.033  24.369  22.729  1.00 33.41  ? 104  TRP D CE3   1 
ATOM   5509 C  CZ2   . TRP F  3 104 ? -4.844  25.567  20.903  1.00 33.81  ? 104  TRP D CZ2   1 
ATOM   5510 C  CZ3   . TRP F  3 104 ? -3.030  25.741  22.500  1.00 33.13  ? 104  TRP D CZ3   1 
ATOM   5511 C  CH2   . TRP F  3 104 ? -3.928  26.326  21.595  1.00 33.50  ? 104  TRP D CH2   1 
ATOM   5512 N  N     . GLU F  3 105 ? -3.014  17.994  23.675  1.00 30.26  ? 105  GLU D N     1 
ATOM   5513 C  CA    . GLU F  3 105 ? -2.161  17.111  24.452  1.00 31.19  ? 105  GLU D CA    1 
ATOM   5514 C  C     . GLU F  3 105 ? -1.391  16.168  23.541  1.00 31.14  ? 105  GLU D C     1 
ATOM   5515 O  O     . GLU F  3 105 ? -0.342  15.653  23.920  1.00 30.60  ? 105  GLU D O     1 
ATOM   5516 C  CB    . GLU F  3 105 ? -3.001  16.304  25.432  1.00 32.29  ? 105  GLU D CB    1 
ATOM   5517 C  CG    . GLU F  3 105 ? -4.143  15.585  24.774  1.00 34.55  ? 105  GLU D CG    1 
ATOM   5518 C  CD    . GLU F  3 105 ? -4.993  14.811  25.756  1.00 36.25  ? 105  GLU D CD    1 
ATOM   5519 O  OE1   . GLU F  3 105 ? -4.562  14.632  26.912  1.00 37.21  ? 105  GLU D OE1   1 
ATOM   5520 O  OE2   . GLU F  3 105 ? -6.096  14.370  25.363  1.00 37.51  ? 105  GLU D OE2   1 
ATOM   5521 N  N     . HIS F  3 106 ? -1.919  15.969  22.332  1.00 30.59  ? 106  HIS D N     1 
ATOM   5522 C  CA    . HIS F  3 106 ? -1.389  15.001  21.383  1.00 30.33  ? 106  HIS D CA    1 
ATOM   5523 C  C     . HIS F  3 106 ? -0.404  15.588  20.378  1.00 30.45  ? 106  HIS D C     1 
ATOM   5524 O  O     . HIS F  3 106 ? 0.106   14.859  19.531  1.00 30.90  ? 106  HIS D O     1 
ATOM   5525 C  CB    . HIS F  3 106 ? -2.532  14.325  20.622  1.00 29.55  ? 106  HIS D CB    1 
ATOM   5526 C  CG    . HIS F  3 106 ? -3.597  13.764  21.510  1.00 29.34  ? 106  HIS D CG    1 
ATOM   5527 N  ND1   . HIS F  3 106 ? -3.401  12.645  22.287  1.00 28.25  ? 106  HIS D ND1   1 
ATOM   5528 C  CD2   . HIS F  3 106 ? -4.871  14.164  21.740  1.00 30.07  ? 106  HIS D CD2   1 
ATOM   5529 C  CE1   . HIS F  3 106 ? -4.503  12.383  22.967  1.00 30.14  ? 106  HIS D CE1   1 
ATOM   5530 N  NE2   . HIS F  3 106 ? -5.412  13.293  22.659  1.00 32.57  ? 106  HIS D NE2   1 
ATOM   5531 N  N     . VAL F  3 107 ? -0.146  16.890  20.452  1.00 29.89  ? 107  VAL D N     1 
ATOM   5532 C  CA    . VAL F  3 107 ? 0.714   17.534  19.464  1.00 31.02  ? 107  VAL D CA    1 
ATOM   5533 C  C     . VAL F  3 107 ? 1.798   18.402  20.083  1.00 32.89  ? 107  VAL D C     1 
ATOM   5534 O  O     . VAL F  3 107 ? 2.688   18.875  19.383  1.00 33.83  ? 107  VAL D O     1 
ATOM   5535 C  CB    . VAL F  3 107 ? -0.093  18.379  18.433  1.00 30.13  ? 107  VAL D CB    1 
ATOM   5536 C  CG1   . VAL F  3 107 ? -1.199  17.545  17.801  1.00 29.78  ? 107  VAL D CG1   1 
ATOM   5537 C  CG2   . VAL F  3 107 ? -0.662  19.638  19.072  1.00 29.40  ? 107  VAL D CG2   1 
ATOM   5538 N  N     . MET F  3 108 ? 1.718   18.623  21.388  1.00 35.21  ? 108  MET D N     1 
ATOM   5539 C  CA    . MET F  3 108 ? 2.667   19.498  22.063  1.00 37.65  ? 108  MET D CA    1 
ATOM   5540 C  C     . MET F  3 108 ? 3.986   18.793  22.280  1.00 36.57  ? 108  MET D C     1 
ATOM   5541 O  O     . MET F  3 108 ? 4.020   17.715  22.863  1.00 37.34  ? 108  MET D O     1 
ATOM   5542 C  CB    . MET F  3 108 ? 2.126   19.927  23.427  1.00 40.32  ? 108  MET D CB    1 
ATOM   5543 C  CG    . MET F  3 108 ? 1.241   21.152  23.414  1.00 44.25  ? 108  MET D CG    1 
ATOM   5544 S  SD    . MET F  3 108 ? 0.781   21.636  25.100  1.00 48.93  ? 108  MET D SD    1 
ATOM   5545 C  CE    . MET F  3 108 ? 2.350   21.446  25.961  1.00 45.43  ? 108  MET D CE    1 
ATOM   5546 N  N     . SER F  3 109 ? 5.076   19.414  21.852  1.00 36.14  ? 109  SER D N     1 
ATOM   5547 C  CA    . SER F  3 109 ? 6.390   18.850  22.118  1.00 36.11  ? 109  SER D CA    1 
ATOM   5548 C  C     . SER F  3 109 ? 6.781   19.130  23.566  1.00 37.29  ? 109  SER D C     1 
ATOM   5549 O  O     . SER F  3 109 ? 6.234   20.037  24.193  1.00 36.69  ? 109  SER D O     1 
ATOM   5550 C  CB    . SER F  3 109 ? 7.431   19.446  21.181  1.00 34.19  ? 109  SER D CB    1 
ATOM   5551 O  OG    . SER F  3 109 ? 7.619   20.811  21.476  1.00 32.32  ? 109  SER D OG    1 
ATOM   5552 N  N     . GLU F  3 110 ? 7.721   18.341  24.084  1.00 38.47  ? 110  GLU D N     1 
ATOM   5553 C  CA    . GLU F  3 110 ? 8.305   18.575  25.395  1.00 39.95  ? 110  GLU D CA    1 
ATOM   5554 C  C     . GLU F  3 110 ? 9.070   19.895  25.410  1.00 40.81  ? 110  GLU D C     1 
ATOM   5555 O  O     . GLU F  3 110 ? 9.177   20.541  26.451  1.00 41.41  ? 110  GLU D O     1 
ATOM   5556 C  CB    . GLU F  3 110 ? 9.245   17.431  25.778  1.00 41.67  ? 110  GLU D CB    1 
ATOM   5557 C  CG    . GLU F  3 110 ? 8.549   16.093  26.013  1.00 44.53  ? 110  GLU D CG    1 
ATOM   5558 C  CD    . GLU F  3 110 ? 9.470   15.048  26.639  1.00 46.40  ? 110  GLU D CD    1 
ATOM   5559 O  OE1   . GLU F  3 110 ? 10.699  15.114  26.399  1.00 47.05  ? 110  GLU D OE1   1 
ATOM   5560 O  OE2   . GLU F  3 110 ? 8.962   14.160  27.366  1.00 47.86  ? 110  GLU D OE2   1 
ATOM   5561 N  N     . ASP F  3 111 ? 9.610   20.281  24.254  1.00 40.78  ? 111  ASP D N     1 
ATOM   5562 C  CA    . ASP F  3 111 ? 10.293  21.565  24.110  1.00 40.98  ? 111  ASP D CA    1 
ATOM   5563 C  C     . ASP F  3 111 ? 9.344   22.695  24.484  1.00 40.56  ? 111  ASP D C     1 
ATOM   5564 O  O     . ASP F  3 111 ? 9.735   23.649  25.152  1.00 40.85  ? 111  ASP D O     1 
ATOM   5565 C  CB    . ASP F  3 111 ? 10.792  21.778  22.674  1.00 42.40  ? 111  ASP D CB    1 
ATOM   5566 C  CG    . ASP F  3 111 ? 12.035  20.958  22.341  1.00 43.66  ? 111  ASP D CG    1 
ATOM   5567 O  OD1   . ASP F  3 111 ? 12.587  21.150  21.237  1.00 45.02  ? 111  ASP D OD1   1 
ATOM   5568 O  OD2   . ASP F  3 111 ? 12.463  20.121  23.162  1.00 44.51  ? 111  ASP D OD2   1 
ATOM   5569 N  N     . VAL F  3 112 ? 8.096   22.591  24.048  1.00 39.66  ? 112  VAL D N     1 
ATOM   5570 C  CA    . VAL F  3 112 ? 7.102   23.592  24.410  1.00 39.85  ? 112  VAL D CA    1 
ATOM   5571 C  C     . VAL F  3 112 ? 6.680   23.441  25.873  1.00 39.28  ? 112  VAL D C     1 
ATOM   5572 O  O     . VAL F  3 112 ? 6.391   24.424  26.552  1.00 38.56  ? 112  VAL D O     1 
ATOM   5573 C  CB    . VAL F  3 112 ? 5.863   23.569  23.479  1.00 38.82  ? 112  VAL D CB    1 
ATOM   5574 C  CG1   . VAL F  3 112 ? 4.609   23.962  24.252  1.00 38.90  ? 112  VAL D CG1   1 
ATOM   5575 C  CG2   . VAL F  3 112 ? 6.077   24.493  22.302  1.00 37.64  ? 112  VAL D CG2   1 
ATOM   5576 N  N     . GLU F  3 113 ? 6.670   22.209  26.361  1.00 39.72  ? 113  GLU D N     1 
ATOM   5577 C  CA    . GLU F  3 113 ? 6.260   21.961  27.730  1.00 40.43  ? 113  GLU D CA    1 
ATOM   5578 C  C     . GLU F  3 113 ? 7.189   22.645  28.724  1.00 40.76  ? 113  GLU D C     1 
ATOM   5579 O  O     . GLU F  3 113 ? 6.729   23.222  29.704  1.00 40.99  ? 113  GLU D O     1 
ATOM   5580 C  CB    . GLU F  3 113 ? 6.212   20.470  28.011  1.00 41.24  ? 113  GLU D CB    1 
ATOM   5581 C  CG    . GLU F  3 113 ? 4.964   19.794  27.543  1.00 41.76  ? 113  GLU D CG    1 
ATOM   5582 C  CD    . GLU F  3 113 ? 4.913   18.362  28.008  1.00 43.31  ? 113  GLU D CD    1 
ATOM   5583 O  OE1   . GLU F  3 113 ? 4.186   18.079  28.987  1.00 44.67  ? 113  GLU D OE1   1 
ATOM   5584 O  OE2   . GLU F  3 113 ? 5.618   17.520  27.414  1.00 43.64  ? 113  GLU D OE2   1 
ATOM   5585 N  N     . ARG F  3 114 ? 8.492   22.579  28.464  1.00 40.38  ? 114  ARG D N     1 
ATOM   5586 C  CA    . ARG F  3 114 ? 9.488   23.225  29.315  1.00 40.19  ? 114  ARG D CA    1 
ATOM   5587 C  C     . ARG F  3 114 ? 9.423   24.755  29.268  1.00 40.68  ? 114  ARG D C     1 
ATOM   5588 O  O     . ARG F  3 114 ? 9.700   25.423  30.266  1.00 41.95  ? 114  ARG D O     1 
ATOM   5589 C  CB    . ARG F  3 114 ? 10.897  22.709  28.983  1.00 39.90  ? 114  ARG D CB    1 
ATOM   5590 C  CG    . ARG F  3 114 ? 11.119  21.267  29.435  1.00 39.76  ? 114  ARG D CG    1 
ATOM   5591 C  CD    . ARG F  3 114 ? 12.529  20.763  29.173  1.00 40.61  ? 114  ARG D CD    1 
ATOM   5592 N  NE    . ARG F  3 114 ? 12.731  20.456  27.760  1.00 42.48  ? 114  ARG D NE    1 
ATOM   5593 C  CZ    . ARG F  3 114 ? 12.579  19.251  27.213  1.00 42.12  ? 114  ARG D CZ    1 
ATOM   5594 N  NH1   . ARG F  3 114 ? 12.238  18.205  27.957  1.00 41.98  ? 114  ARG D NH1   1 
ATOM   5595 N  NH2   . ARG F  3 114 ? 12.778  19.093  25.914  1.00 42.12  ? 114  ARG D NH2   1 
ATOM   5596 N  N     . ARG F  3 115 ? 9.054   25.314  28.119  1.00 41.14  ? 115  ARG D N     1 
ATOM   5597 C  CA    . ARG F  3 115 ? 8.839   26.757  28.008  1.00 41.26  ? 115  ARG D CA    1 
ATOM   5598 C  C     . ARG F  3 115 ? 7.593   27.194  28.783  1.00 41.40  ? 115  ARG D C     1 
ATOM   5599 O  O     . ARG F  3 115 ? 7.571   28.264  29.387  1.00 40.21  ? 115  ARG D O     1 
ATOM   5600 C  CB    . ARG F  3 115 ? 8.718   27.182  26.542  1.00 42.69  ? 115  ARG D CB    1 
ATOM   5601 C  CG    . ARG F  3 115 ? 10.036  27.196  25.772  1.00 43.66  ? 115  ARG D CG    1 
ATOM   5602 C  CD    . ARG F  3 115 ? 11.020  28.144  26.418  1.00 45.16  ? 115  ARG D CD    1 
ATOM   5603 N  NE    . ARG F  3 115 ? 10.449  29.479  26.567  1.00 46.88  ? 115  ARG D NE    1 
ATOM   5604 C  CZ    . ARG F  3 115 ? 10.951  30.426  27.355  1.00 46.61  ? 115  ARG D CZ    1 
ATOM   5605 N  NH1   . ARG F  3 115 ? 12.036  30.182  28.073  1.00 46.28  ? 115  ARG D NH1   1 
ATOM   5606 N  NH2   . ARG F  3 115 ? 10.364  31.616  27.424  1.00 46.63  ? 115  ARG D NH2   1 
ATOM   5607 N  N     . LEU F  3 116 ? 6.558   26.359  28.758  1.00 41.74  ? 116  LEU D N     1 
ATOM   5608 C  CA    . LEU F  3 116 ? 5.321   26.626  29.492  1.00 41.73  ? 116  LEU D CA    1 
ATOM   5609 C  C     . LEU F  3 116 ? 5.516   26.564  31.007  1.00 42.41  ? 116  LEU D C     1 
ATOM   5610 O  O     . LEU F  3 116 ? 4.868   27.302  31.753  1.00 41.53  ? 116  LEU D O     1 
ATOM   5611 C  CB    . LEU F  3 116 ? 4.223   25.659  29.058  1.00 40.83  ? 116  LEU D CB    1 
ATOM   5612 C  CG    . LEU F  3 116 ? 3.606   26.008  27.707  1.00 40.40  ? 116  LEU D CG    1 
ATOM   5613 C  CD1   . LEU F  3 116 ? 2.446   25.073  27.374  1.00 40.73  ? 116  LEU D CD1   1 
ATOM   5614 C  CD2   . LEU F  3 116 ? 3.153   27.450  27.717  1.00 40.08  ? 116  LEU D CD2   1 
ATOM   5615 N  N     . VAL F  3 117 ? 6.415   25.688  31.452  1.00 42.91  ? 117  VAL D N     1 
ATOM   5616 C  CA    . VAL F  3 117 ? 6.788   25.617  32.858  1.00 43.41  ? 117  VAL D CA    1 
ATOM   5617 C  C     . VAL F  3 117 ? 7.472   26.909  33.312  1.00 44.48  ? 117  VAL D C     1 
ATOM   5618 O  O     . VAL F  3 117 ? 7.156   27.433  34.375  1.00 45.55  ? 117  VAL D O     1 
ATOM   5619 C  CB    . VAL F  3 117 ? 7.672   24.389  33.152  1.00 42.73  ? 117  VAL D CB    1 
ATOM   5620 C  CG1   . VAL F  3 117 ? 8.192   24.433  34.569  1.00 42.66  ? 117  VAL D CG1   1 
ATOM   5621 C  CG2   . VAL F  3 117 ? 6.879   23.109  32.933  1.00 42.06  ? 117  VAL D CG2   1 
ATOM   5622 N  N     . LYS F  3 118 ? 8.394   27.422  32.500  1.00 46.18  ? 118  LYS D N     1 
ATOM   5623 C  CA    . LYS F  3 118 ? 9.026   28.727  32.751  1.00 47.81  ? 118  LYS D CA    1 
ATOM   5624 C  C     . LYS F  3 118 ? 8.022   29.883  32.696  1.00 47.59  ? 118  LYS D C     1 
ATOM   5625 O  O     . LYS F  3 118 ? 7.893   30.653  33.650  1.00 47.60  ? 118  LYS D O     1 
ATOM   5626 C  CB    . LYS F  3 118 ? 10.139  29.007  31.731  1.00 49.03  ? 118  LYS D CB    1 
ATOM   5627 C  CG    . LYS F  3 118 ? 11.503  28.391  32.044  1.00 51.72  ? 118  LYS D CG    1 
ATOM   5628 C  CD    . LYS F  3 118 ? 12.383  28.369  30.778  1.00 53.19  ? 118  LYS D CD    1 
ATOM   5629 C  CE    . LYS F  3 118 ? 13.767  27.759  31.021  1.00 54.44  ? 118  LYS D CE    1 
ATOM   5630 N  NZ    . LYS F  3 118 ? 14.725  28.721  31.656  1.00 55.33  ? 118  LYS D NZ    1 
ATOM   5631 N  N     . VAL F  3 119 ? 7.321   29.999  31.572  1.00 46.55  ? 119  VAL D N     1 
ATOM   5632 C  CA    . VAL F  3 119 ? 6.467   31.155  31.306  1.00 47.03  ? 119  VAL D CA    1 
ATOM   5633 C  C     . VAL F  3 119 ? 5.239   31.259  32.222  1.00 47.80  ? 119  VAL D C     1 
ATOM   5634 O  O     . VAL F  3 119 ? 4.715   32.349  32.436  1.00 47.78  ? 119  VAL D O     1 
ATOM   5635 C  CB    . VAL F  3 119 ? 6.037   31.206  29.816  1.00 46.46  ? 119  VAL D CB    1 
ATOM   5636 C  CG1   . VAL F  3 119 ? 4.936   32.221  29.599  1.00 46.30  ? 119  VAL D CG1   1 
ATOM   5637 C  CG2   . VAL F  3 119 ? 7.231   31.524  28.938  1.00 46.68  ? 119  VAL D CG2   1 
ATOM   5638 N  N     . LEU F  3 120 ? 4.779   30.137  32.762  1.00 48.35  ? 120  LEU D N     1 
ATOM   5639 C  CA    . LEU F  3 120 ? 3.617   30.164  33.641  1.00 48.97  ? 120  LEU D CA    1 
ATOM   5640 C  C     . LEU F  3 120 ? 4.055   30.112  35.100  1.00 49.84  ? 120  LEU D C     1 
ATOM   5641 O  O     . LEU F  3 120 ? 3.312   29.652  35.966  1.00 49.91  ? 120  LEU D O     1 
ATOM   5642 C  CB    . LEU F  3 120 ? 2.653   29.012  33.326  1.00 48.74  ? 120  LEU D CB    1 
ATOM   5643 C  CG    . LEU F  3 120 ? 2.037   28.922  31.923  1.00 48.60  ? 120  LEU D CG    1 
ATOM   5644 C  CD1   . LEU F  3 120 ? 1.277   27.617  31.769  1.00 49.19  ? 120  LEU D CD1   1 
ATOM   5645 C  CD2   . LEU F  3 120 ? 1.128   30.103  31.613  1.00 48.41  ? 120  LEU D CD2   1 
ATOM   5646 N  N     . ASN F  3 121 ? 5.265   30.601  35.360  1.00 50.90  ? 121  ASN D N     1 
ATOM   5647 C  CA    . ASN F  3 121 ? 5.847   30.601  36.705  1.00 51.45  ? 121  ASN D CA    1 
ATOM   5648 C  C     . ASN F  3 121 ? 5.643   29.282  37.457  1.00 50.33  ? 121  ASN D C     1 
ATOM   5649 O  O     . ASN F  3 121 ? 4.960   29.235  38.482  1.00 49.66  ? 121  ASN D O     1 
ATOM   5650 C  CB    . ASN F  3 121 ? 5.352   31.803  37.531  1.00 53.40  ? 121  ASN D CB    1 
ATOM   5651 C  CG    . ASN F  3 121 ? 6.053   33.117  37.147  1.00 55.36  ? 121  ASN D CG    1 
ATOM   5652 O  OD1   . ASN F  3 121 ? 7.201   33.370  37.543  1.00 55.72  ? 121  ASN D OD1   1 
ATOM   5653 N  ND2   . ASN F  3 121 ? 5.355   33.961  36.384  1.00 54.66  ? 121  ASN D ND2   1 
ATOM   5654 N  N     . ASN F  3 122 ? 6.243   28.220  36.919  1.00 48.95  ? 122  ASN D N     1 
ATOM   5655 C  CA    . ASN F  3 122 ? 6.344   26.913  37.579  1.00 47.11  ? 122  ASN D CA    1 
ATOM   5656 C  C     . ASN F  3 122 ? 5.036   26.326  38.123  1.00 44.87  ? 122  ASN D C     1 
ATOM   5657 O  O     . ASN F  3 122 ? 4.898   26.096  39.326  1.00 43.67  ? 122  ASN D O     1 
ATOM   5658 C  CB    . ASN F  3 122 ? 7.423   26.949  38.664  1.00 48.83  ? 122  ASN D CB    1 
ATOM   5659 C  CG    . ASN F  3 122 ? 8.749   27.487  38.145  1.00 50.38  ? 122  ASN D CG    1 
ATOM   5660 O  OD1   . ASN F  3 122 ? 9.369   26.901  37.252  1.00 50.82  ? 122  ASN D OD1   1 
ATOM   5661 N  ND2   . ASN F  3 122 ? 9.186   28.614  38.698  1.00 50.74  ? 122  ASN D ND2   1 
ATOM   5662 N  N     . PRO F  3 123 ? 4.082   26.055  37.222  1.00 43.21  ? 123  PRO D N     1 
ATOM   5663 C  CA    . PRO F  3 123 ? 2.780   25.543  37.635  1.00 42.61  ? 123  PRO D CA    1 
ATOM   5664 C  C     . PRO F  3 123 ? 2.877   24.115  38.154  1.00 41.31  ? 123  PRO D C     1 
ATOM   5665 O  O     . PRO F  3 123 ? 3.675   23.320  37.643  1.00 41.25  ? 123  PRO D O     1 
ATOM   5666 C  CB    . PRO F  3 123 ? 1.959   25.592  36.344  1.00 42.80  ? 123  PRO D CB    1 
ATOM   5667 C  CG    . PRO F  3 123 ? 2.960   25.534  35.252  1.00 42.69  ? 123  PRO D CG    1 
ATOM   5668 C  CD    . PRO F  3 123 ? 4.191   26.204  35.759  1.00 42.66  ? 123  PRO D CD    1 
ATOM   5669 N  N     . THR F  3 124 ? 2.086   23.796  39.172  1.00 38.88  ? 124  THR D N     1 
ATOM   5670 C  CA    . THR F  3 124 ? 2.048   22.434  39.686  1.00 37.44  ? 124  THR D CA    1 
ATOM   5671 C  C     . THR F  3 124 ? 0.668   21.819  39.508  1.00 36.50  ? 124  THR D C     1 
ATOM   5672 O  O     . THR F  3 124 ? 0.499   20.614  39.683  1.00 36.94  ? 124  THR D O     1 
ATOM   5673 C  CB    . THR F  3 124 ? 2.454   22.350  41.177  1.00 37.64  ? 124  THR D CB    1 
ATOM   5674 O  OG1   . THR F  3 124 ? 1.611   23.204  41.957  1.00 37.66  ? 124  THR D OG1   1 
ATOM   5675 C  CG2   . THR F  3 124 ? 3.906   22.760  41.372  1.00 37.58  ? 124  THR D CG2   1 
ATOM   5676 N  N     . THR F  3 125 ? -0.322  22.641  39.165  1.00 35.34  ? 125  THR D N     1 
ATOM   5677 C  CA    . THR F  3 125 ? -1.690  22.148  39.032  1.00 35.23  ? 125  THR D CA    1 
ATOM   5678 C  C     . THR F  3 125 ? -2.402  22.741  37.829  1.00 35.62  ? 125  THR D C     1 
ATOM   5679 O  O     . THR F  3 125 ? -2.067  23.838  37.381  1.00 35.75  ? 125  THR D O     1 
ATOM   5680 C  CB    . THR F  3 125 ? -2.555  22.461  40.281  1.00 35.93  ? 125  THR D CB    1 
ATOM   5681 O  OG1   . THR F  3 125 ? -2.900  23.853  40.298  1.00 35.48  ? 125  THR D OG1   1 
ATOM   5682 C  CG2   . THR F  3 125 ? -1.839  22.075  41.581  1.00 35.76  ? 125  THR D CG2   1 
ATOM   5683 N  N     . SER F  3 126 ? -3.392  22.015  37.313  1.00 35.67  ? 126  SER D N     1 
ATOM   5684 C  CA    . SER F  3 126 ? -4.262  22.546  36.275  1.00 35.90  ? 126  SER D CA    1 
ATOM   5685 C  C     . SER F  3 126 ? -5.213  23.564  36.905  1.00 37.18  ? 126  SER D C     1 
ATOM   5686 O  O     . SER F  3 126 ? -5.419  23.544  38.124  1.00 37.39  ? 126  SER D O     1 
ATOM   5687 C  CB    . SER F  3 126 ? -5.056  21.424  35.612  1.00 36.03  ? 126  SER D CB    1 
ATOM   5688 O  OG    . SER F  3 126 ? -6.144  21.007  36.424  1.00 36.97  ? 126  SER D OG    1 
ATOM   5689 N  N     . PRO F  3 127 ? -5.783  24.471  36.084  1.00 37.25  ? 127  PRO D N     1 
ATOM   5690 C  CA    . PRO F  3 127 ? -6.756  25.444  36.580  1.00 36.98  ? 127  PRO D CA    1 
ATOM   5691 C  C     . PRO F  3 127 ? -8.009  24.810  37.208  1.00 37.26  ? 127  PRO D C     1 
ATOM   5692 O  O     . PRO F  3 127 ? -8.865  25.521  37.715  1.00 38.12  ? 127  PRO D O     1 
ATOM   5693 C  CB    . PRO F  3 127 ? -7.119  26.258  35.323  1.00 36.63  ? 127  PRO D CB    1 
ATOM   5694 C  CG    . PRO F  3 127 ? -6.700  25.431  34.170  1.00 36.02  ? 127  PRO D CG    1 
ATOM   5695 C  CD    . PRO F  3 127 ? -5.512  24.652  34.646  1.00 37.12  ? 127  PRO D CD    1 
ATOM   5696 N  N     . PHE F  3 128 ? -8.112  23.488  37.178  1.00 37.65  ? 128  PHE D N     1 
ATOM   5697 C  CA    . PHE F  3 128 ? -9.223  22.790  37.819  1.00 38.07  ? 128  PHE D CA    1 
ATOM   5698 C  C     . PHE F  3 128 ? -8.771  22.164  39.136  1.00 37.62  ? 128  PHE D C     1 
ATOM   5699 O  O     . PHE F  3 128 ? -9.549  21.495  39.815  1.00 36.54  ? 128  PHE D O     1 
ATOM   5700 C  CB    . PHE F  3 128 ? -9.779  21.699  36.900  1.00 39.30  ? 128  PHE D CB    1 
ATOM   5701 C  CG    . PHE F  3 128 ? -10.262 22.212  35.584  1.00 41.44  ? 128  PHE D CG    1 
ATOM   5702 C  CD1   . PHE F  3 128 ? -9.375  22.428  34.541  1.00 42.34  ? 128  PHE D CD1   1 
ATOM   5703 C  CD2   . PHE F  3 128 ? -11.604 22.483  35.384  1.00 42.50  ? 128  PHE D CD2   1 
ATOM   5704 C  CE1   . PHE F  3 128 ? -9.819  22.906  33.319  1.00 43.28  ? 128  PHE D CE1   1 
ATOM   5705 C  CE2   . PHE F  3 128 ? -12.061 22.956  34.160  1.00 43.34  ? 128  PHE D CE2   1 
ATOM   5706 C  CZ    . PHE F  3 128 ? -11.167 23.172  33.128  1.00 43.68  ? 128  PHE D CZ    1 
ATOM   5707 N  N     . GLY F  3 129 ? -7.497  22.360  39.467  1.00 37.40  ? 129  GLY D N     1 
ATOM   5708 C  CA    . GLY F  3 129 ? -6.946  21.889  40.730  1.00 36.50  ? 129  GLY D CA    1 
ATOM   5709 C  C     . GLY F  3 129 ? -6.185  20.575  40.669  1.00 36.03  ? 129  GLY D C     1 
ATOM   5710 O  O     . GLY F  3 129 ? -5.512  20.208  41.625  1.00 35.90  ? 129  GLY D O     1 
ATOM   5711 N  N     . ASN F  3 130 ? -6.282  19.856  39.554  1.00 35.41  ? 130  ASN D N     1 
ATOM   5712 C  CA    . ASN F  3 130 ? -5.596  18.568  39.445  1.00 33.89  ? 130  ASN D CA    1 
ATOM   5713 C  C     . ASN F  3 130 ? -4.092  18.747  39.236  1.00 33.28  ? 130  ASN D C     1 
ATOM   5714 O  O     . ASN F  3 130 ? -3.664  19.599  38.448  1.00 32.50  ? 130  ASN D O     1 
ATOM   5715 C  CB    . ASN F  3 130 ? -6.197  17.691  38.338  1.00 34.12  ? 130  ASN D CB    1 
ATOM   5716 C  CG    . ASN F  3 130 ? -7.704  17.846  38.216  1.00 34.94  ? 130  ASN D CG    1 
ATOM   5717 O  OD1   . ASN F  3 130 ? -8.192  18.891  37.783  1.00 36.20  ? 130  ASN D OD1   1 
ATOM   5718 N  ND2   . ASN F  3 130 ? -8.448  16.801  38.572  1.00 33.33  ? 130  ASN D ND2   1 
ATOM   5719 N  N     . PRO F  3 131 ? -3.287  17.938  39.945  1.00 32.41  ? 131  PRO D N     1 
ATOM   5720 C  CA    . PRO F  3 131 ? -1.833  18.057  39.895  1.00 32.23  ? 131  PRO D CA    1 
ATOM   5721 C  C     . PRO F  3 131 ? -1.314  17.640  38.534  1.00 31.02  ? 131  PRO D C     1 
ATOM   5722 O  O     . PRO F  3 131 ? -1.852  16.721  37.928  1.00 30.70  ? 131  PRO D O     1 
ATOM   5723 C  CB    . PRO F  3 131 ? -1.350  17.076  40.981  1.00 32.81  ? 131  PRO D CB    1 
ATOM   5724 C  CG    . PRO F  3 131 ? -2.453  16.082  41.122  1.00 33.69  ? 131  PRO D CG    1 
ATOM   5725 C  CD    . PRO F  3 131 ? -3.734  16.837  40.823  1.00 33.34  ? 131  PRO D CD    1 
ATOM   5726 N  N     . ILE F  3 132 ? -0.303  18.352  38.047  1.00 30.22  ? 132  ILE D N     1 
ATOM   5727 C  CA    . ILE F  3 132 ? 0.357   18.009  36.800  1.00 28.95  ? 132  ILE D CA    1 
ATOM   5728 C  C     . ILE F  3 132 ? 1.422   16.950  37.104  1.00 29.97  ? 132  ILE D C     1 
ATOM   5729 O  O     . ILE F  3 132 ? 2.331   17.196  37.905  1.00 28.45  ? 132  ILE D O     1 
ATOM   5730 C  CB    . ILE F  3 132 ? 1.022   19.253  36.169  1.00 27.96  ? 132  ILE D CB    1 
ATOM   5731 C  CG1   . ILE F  3 132 ? 0.038   20.426  36.126  1.00 27.45  ? 132  ILE D CG1   1 
ATOM   5732 C  CG2   . ILE F  3 132 ? 1.528   18.945  34.771  1.00 27.36  ? 132  ILE D CG2   1 
ATOM   5733 C  CD1   . ILE F  3 132 ? 0.643   21.718  35.661  1.00 25.57  ? 132  ILE D CD1   1 
ATOM   5734 N  N     . PRO F  3 133 ? 1.309   15.765  36.477  1.00 30.31  ? 133  PRO D N     1 
ATOM   5735 C  CA    . PRO F  3 133 ? 2.297   14.719  36.700  1.00 31.26  ? 133  PRO D CA    1 
ATOM   5736 C  C     . PRO F  3 133 ? 3.475   14.837  35.730  1.00 32.61  ? 133  PRO D C     1 
ATOM   5737 O  O     . PRO F  3 133 ? 3.391   15.578  34.743  1.00 32.60  ? 133  PRO D O     1 
ATOM   5738 C  CB    . PRO F  3 133 ? 1.511   13.433  36.435  1.00 31.51  ? 133  PRO D CB    1 
ATOM   5739 C  CG    . PRO F  3 133 ? 0.282   13.851  35.628  1.00 31.47  ? 133  PRO D CG    1 
ATOM   5740 C  CD    . PRO F  3 133 ? 0.267   15.347  35.524  1.00 30.95  ? 133  PRO D CD    1 
ATOM   5741 N  N     . GLY F  3 134 ? 4.568   14.135  36.035  1.00 32.61  ? 134  GLY D N     1 
ATOM   5742 C  CA    . GLY F  3 134 ? 5.735   14.055  35.161  1.00 32.73  ? 134  GLY D CA    1 
ATOM   5743 C  C     . GLY F  3 134 ? 6.567   15.310  34.986  1.00 34.20  ? 134  GLY D C     1 
ATOM   5744 O  O     . GLY F  3 134 ? 7.295   15.444  34.003  1.00 35.18  ? 134  GLY D O     1 
ATOM   5745 N  N     . LEU F  3 135 ? 6.485   16.239  35.927  1.00 35.17  ? 135  LEU D N     1 
ATOM   5746 C  CA    . LEU F  3 135 ? 7.261   17.468  35.799  1.00 35.91  ? 135  LEU D CA    1 
ATOM   5747 C  C     . LEU F  3 135 ? 8.754   17.173  35.973  1.00 37.31  ? 135  LEU D C     1 
ATOM   5748 O  O     . LEU F  3 135 ? 9.602   17.811  35.345  1.00 37.57  ? 135  LEU D O     1 
ATOM   5749 C  CB    . LEU F  3 135 ? 6.773   18.535  36.788  1.00 34.15  ? 135  LEU D CB    1 
ATOM   5750 C  CG    . LEU F  3 135 ? 5.450   19.256  36.465  1.00 33.76  ? 135  LEU D CG    1 
ATOM   5751 C  CD1   . LEU F  3 135 ? 4.987   20.146  37.626  1.00 32.53  ? 135  LEU D CD1   1 
ATOM   5752 C  CD2   . LEU F  3 135 ? 5.533   20.067  35.173  1.00 31.59  ? 135  LEU D CD2   1 
ATOM   5753 N  N     . VAL F  3 136 ? 9.061   16.193  36.820  1.00 39.14  ? 136  VAL D N     1 
ATOM   5754 C  CA    . VAL F  3 136 ? 10.434  15.738  37.038  1.00 40.79  ? 136  VAL D CA    1 
ATOM   5755 C  C     . VAL F  3 136 ? 11.009  15.131  35.766  1.00 41.84  ? 136  VAL D C     1 
ATOM   5756 O  O     . VAL F  3 136 ? 12.076  15.532  35.296  1.00 41.03  ? 136  VAL D O     1 
ATOM   5757 C  CB    . VAL F  3 136 ? 10.494  14.664  38.133  1.00 41.04  ? 136  VAL D CB    1 
ATOM   5758 C  CG1   . VAL F  3 136 ? 11.919  14.116  38.262  1.00 41.77  ? 136  VAL D CG1   1 
ATOM   5759 C  CG2   . VAL F  3 136 ? 10.004  15.226  39.453  1.00 41.24  ? 136  VAL D CG2   1 
ATOM   5760 N  N     . GLU F  3 137 ? 10.288  14.155  35.220  1.00 43.66  ? 137  GLU D N     1 
ATOM   5761 C  CA    . GLU F  3 137 ? 10.667  13.506  33.972  1.00 45.80  ? 137  GLU D CA    1 
ATOM   5762 C  C     . GLU F  3 137 ? 10.850  14.538  32.865  1.00 47.18  ? 137  GLU D C     1 
ATOM   5763 O  O     . GLU F  3 137 ? 11.846  14.512  32.150  1.00 47.80  ? 137  GLU D O     1 
ATOM   5764 C  CB    . GLU F  3 137 ? 9.618   12.468  33.568  1.00 46.44  ? 137  GLU D CB    1 
ATOM   5765 C  CG    . GLU F  3 137 ? 9.491   11.265  34.515  1.00 47.76  ? 137  GLU D CG    1 
ATOM   5766 C  CD    . GLU F  3 137 ? 8.577   11.522  35.716  1.00 48.67  ? 137  GLU D CD    1 
ATOM   5767 O  OE1   . GLU F  3 137 ? 8.640   12.627  36.300  1.00 48.74  ? 137  GLU D OE1   1 
ATOM   5768 O  OE2   . GLU F  3 137 ? 7.796   10.612  36.082  1.00 49.07  ? 137  GLU D OE2   1 
ATOM   5769 N  N     . LEU F  3 138 ? 9.899   15.461  32.742  1.00 48.84  ? 138  LEU D N     1 
ATOM   5770 C  CA    . LEU F  3 138 ? 9.975   16.521  31.737  1.00 50.81  ? 138  LEU D CA    1 
ATOM   5771 C  C     . LEU F  3 138 ? 11.378  17.112  31.660  1.00 53.28  ? 138  LEU D C     1 
ATOM   5772 O  O     . LEU F  3 138 ? 11.866  17.447  30.582  1.00 53.72  ? 138  LEU D O     1 
ATOM   5773 C  CB    . LEU F  3 138 ? 8.982   17.639  32.056  1.00 49.29  ? 138  LEU D CB    1 
ATOM   5774 C  CG    . LEU F  3 138 ? 8.306   18.368  30.892  1.00 48.54  ? 138  LEU D CG    1 
ATOM   5775 C  CD1   . LEU F  3 138 ? 7.967   19.795  31.285  1.00 47.77  ? 138  LEU D CD1   1 
ATOM   5776 C  CD2   . LEU F  3 138 ? 9.144   18.344  29.624  1.00 47.59  ? 138  LEU D CD2   1 
ATOM   5777 N  N     . GLY F  3 139 ? 12.028  17.229  32.812  1.00 56.48  ? 139  GLY D N     1 
ATOM   5778 C  CA    . GLY F  3 139 ? 13.326  17.881  32.889  1.00 59.93  ? 139  GLY D CA    1 
ATOM   5779 C  C     . GLY F  3 139 ? 13.105  19.329  33.264  1.00 62.88  ? 139  GLY D C     1 
ATOM   5780 O  O     . GLY F  3 139 ? 13.126  20.213  32.405  1.00 63.35  ? 139  GLY D O     1 
ATOM   5781 N  N     . VAL F  3 140 ? 12.866  19.563  34.553  1.00 65.17  ? 140  VAL D N     1 
ATOM   5782 C  CA    . VAL F  3 140 ? 12.599  20.905  35.070  1.00 67.08  ? 140  VAL D CA    1 
ATOM   5783 C  C     . VAL F  3 140 ? 13.572  21.249  36.195  1.00 67.76  ? 140  VAL D C     1 
ATOM   5784 O  O     . VAL F  3 140 ? 14.365  22.185  36.076  1.00 68.64  ? 140  VAL D O     1 
ATOM   5785 C  CB    . VAL F  3 140 ? 11.143  21.044  35.594  1.00 67.80  ? 140  VAL D CB    1 
ATOM   5786 C  CG1   . VAL F  3 140 ? 10.948  22.392  36.298  1.00 68.30  ? 140  VAL D CG1   1 
ATOM   5787 C  CG2   . VAL F  3 140 ? 10.129  20.868  34.456  1.00 67.30  ? 140  VAL D CG2   1 
HETATM 5788 NI NI    . NI  G  4 .   ? -5.982  -28.969 -6.921  1.00 49.22  ? 1001 NI  A NI    1 
HETATM 5789 NI NI    . NI  H  4 .   ? -3.450  -20.644 -8.823  1.00 28.47  ? 1002 NI  A NI    1 
HETATM 5790 NI NI    . NI  I  4 .   ? -26.531 -15.653 -1.660  1.00 45.57  ? 1003 NI  A NI    1 
HETATM 5791 NA NA    . NA  J  5 .   ? -1.956  -10.671 5.839   1.00 50.06  ? 2001 NA  A NA    1 
HETATM 5792 NI NI    . NI  K  4 .   ? 11.953  -20.626 -27.262 1.00 49.55  ? 1001 NI  B NI    1 
HETATM 5793 NI NI    . NI  L  4 .   ? 8.567   -15.786 -20.550 1.00 29.83  ? 1002 NI  B NI    1 
HETATM 5794 NI NI    . NI  M  4 .   ? 31.095  -5.595  -21.204 1.00 52.36  ? 1003 NI  B NI    1 
HETATM 5795 NI NI    . NI  N  4 .   ? 5.797   28.088  9.343   1.00 55.78  ? 1001 NI  C NI    1 
HETATM 5796 NI NI    . NI  O  4 .   ? 0.811   20.488  9.598   1.00 36.73  ? 1002 NI  C NI    1 
HETATM 5797 NI NI    . NI  P  4 .   ? -3.905  25.424  -14.838 1.00 53.10  ? 1003 NI  C NI    1 
HETATM 5798 NA NA    . NA  Q  5 .   ? 8.304   6.827   0.628   1.00 48.04  ? 2001 NA  C NA    1 
HETATM 5799 NI NI    . NI  R  4 .   ? -8.960  18.313  31.194  1.00 56.49  ? 1001 NI  D NI    1 
HETATM 5800 NI NI    . NI  S  4 .   ? -7.044  13.876  23.738  1.00 34.98  ? 1002 NI  D NI    1 
HETATM 5801 NI NI    . NI  T  4 .   ? -6.754  -5.210  39.183  1.00 58.00  ? 1003 NI  D NI    1 
HETATM 5802 NA NA    . NA  U  5 .   ? -20.794 3.865   19.132  1.00 49.97  ? 2001 NA  D NA    1 
HETATM 5803 O  O     . HOH V  6 .   ? 9.275   -3.731  -16.664 1.00 25.39  ? 34   HOH E O     1 
HETATM 5804 O  O     . HOH V  6 .   ? 9.607   0.039   -7.204  1.00 20.82  ? 35   HOH E O     1 
HETATM 5805 O  O     . HOH V  6 .   ? -10.226 11.951  3.342   1.00 29.33  ? 36   HOH E O     1 
HETATM 5806 O  O     . HOH V  6 .   ? 5.652   0.497   -25.759 1.00 32.01  ? 37   HOH E O     1 
HETATM 5807 O  O     . HOH V  6 .   ? -13.205 -13.495 13.549  1.00 35.25  ? 38   HOH E O     1 
HETATM 5808 O  O     . HOH V  6 .   ? 0.558   2.477   -18.251 1.00 28.78  ? 39   HOH E O     1 
HETATM 5809 O  O     . HOH V  6 .   ? -3.634  5.189   -0.886  1.00 33.79  ? 40   HOH E O     1 
HETATM 5810 O  O     . HOH V  6 .   ? -5.187  12.290  8.545   1.00 29.42  ? 41   HOH E O     1 
HETATM 5811 O  O     . HOH V  6 .   ? 1.968   0.942   4.431   1.00 25.31  ? 42   HOH E O     1 
HETATM 5812 O  O     . HOH V  6 .   ? -17.403 -1.400  -0.131  1.00 31.70  ? 43   HOH E O     1 
HETATM 5813 O  O     . HOH V  6 .   ? -12.415 -4.671  5.493   1.00 20.46  ? 44   HOH E O     1 
HETATM 5814 O  O     . HOH V  6 .   ? -2.215  4.875   7.102   1.00 24.90  ? 45   HOH E O     1 
HETATM 5815 O  O     . HOH V  6 .   ? -20.191 -4.842  1.718   1.00 27.59  ? 46   HOH E O     1 
HETATM 5816 O  O     . HOH V  6 .   ? -19.598 -2.372  8.542   1.00 28.35  ? 47   HOH E O     1 
HETATM 5817 O  O     . HOH V  6 .   ? -16.508 -18.012 15.126  1.00 33.78  ? 48   HOH E O     1 
HETATM 5818 O  O     . HOH V  6 .   ? -5.527  5.950   8.447   1.00 22.92  ? 49   HOH E O     1 
HETATM 5819 O  O     . HOH V  6 .   ? 20.546  10.728  -20.692 1.00 40.56  ? 50   HOH E O     1 
HETATM 5820 O  O     . HOH V  6 .   ? -1.447  10.529  1.851   1.00 40.95  ? 51   HOH E O     1 
HETATM 5821 O  O     . HOH V  6 .   ? -21.202 -4.580  9.061   1.00 39.03  ? 52   HOH E O     1 
HETATM 5822 O  O     . HOH V  6 .   ? -15.475 3.023   8.646   1.00 32.69  ? 53   HOH E O     1 
HETATM 5823 O  O     . HOH V  6 .   ? -16.222 -4.600  27.245  1.00 40.17  ? 54   HOH E O     1 
HETATM 5824 O  O     . HOH V  6 .   ? 7.805   6.069   -1.465  1.00 26.22  ? 55   HOH E O     1 
HETATM 5825 O  O     . HOH V  6 .   ? 6.971   2.480   -25.374 1.00 36.46  ? 56   HOH E O     1 
HETATM 5826 O  O     . HOH V  6 .   ? -11.487 -5.224  31.081  1.00 27.72  ? 57   HOH E O     1 
HETATM 5827 O  O     . HOH V  6 .   ? 8.096   5.953   2.946   1.00 54.58  ? 58   HOH E O     1 
HETATM 5828 O  O     . HOH W  6 .   ? -5.726  -8.993  -3.748  1.00 28.97  ? 34   HOH F O     1 
HETATM 5829 O  O     . HOH W  6 .   ? -3.794  12.888  -14.236 1.00 34.94  ? 35   HOH F O     1 
HETATM 5830 O  O     . HOH W  6 .   ? -11.121 -2.535  15.595  1.00 26.12  ? 36   HOH F O     1 
HETATM 5831 O  O     . HOH W  6 .   ? 0.898   -5.450  -9.244  1.00 29.83  ? 37   HOH F O     1 
HETATM 5832 O  O     . HOH W  6 .   ? 1.600   7.392   -9.943  1.00 28.70  ? 38   HOH F O     1 
HETATM 5833 O  O     . HOH W  6 .   ? 22.432  -0.958  -20.905 1.00 33.07  ? 39   HOH F O     1 
HETATM 5834 O  O     . HOH W  6 .   ? -1.943  1.029   17.774  1.00 33.36  ? 40   HOH F O     1 
HETATM 5835 O  O     . HOH W  6 .   ? 0.930   8.187   -17.747 1.00 42.77  ? 41   HOH F O     1 
HETATM 5836 O  O     . HOH W  6 .   ? 6.751   15.513  -17.923 1.00 37.95  ? 42   HOH F O     1 
HETATM 5837 O  O     . HOH W  6 .   ? -5.994  7.973   -10.134 1.00 30.21  ? 43   HOH F O     1 
HETATM 5838 O  O     . HOH W  6 .   ? 16.264  6.370   -16.845 1.00 40.44  ? 44   HOH F O     1 
HETATM 5839 O  O     . HOH W  6 .   ? 25.684  22.286  -36.091 1.00 46.83  ? 45   HOH F O     1 
HETATM 5840 O  O     . HOH W  6 .   ? 24.976  6.325   -27.089 1.00 38.50  ? 46   HOH F O     1 
HETATM 5841 O  O     . HOH W  6 .   ? -6.728  4.467   10.579  1.00 41.60  ? 47   HOH F O     1 
HETATM 5842 O  O     . HOH W  6 .   ? -13.118 -4.159  16.378  1.00 30.25  ? 48   HOH F O     1 
HETATM 5843 O  O     . HOH W  6 .   ? -21.170 1.548   19.207  1.00 32.44  ? 49   HOH F O     1 
HETATM 5844 O  O     . HOH W  6 .   ? -3.199  -9.152  6.595   1.00 43.55  ? 50   HOH F O     1 
HETATM 5845 O  O     . HOH W  6 .   ? -0.322  -11.277 5.191   1.00 43.06  ? 51   HOH F O     1 
HETATM 5846 O  O     . HOH X  6 .   ? 6.167   -9.559  -12.724 1.00 18.11  ? 2002 HOH A O     1 
HETATM 5847 O  O     . HOH X  6 .   ? -18.506 -10.827 1.124   1.00 25.39  ? 2003 HOH A O     1 
HETATM 5848 O  O     . HOH X  6 .   ? 0.554   -29.696 -3.380  1.00 22.30  ? 2004 HOH A O     1 
HETATM 5849 O  O     . HOH X  6 .   ? 2.076   -12.508 -12.497 1.00 32.86  ? 2005 HOH A O     1 
HETATM 5850 O  O     . HOH X  6 .   ? -21.173 -11.393 -18.143 1.00 25.36  ? 2006 HOH A O     1 
HETATM 5851 O  O     . HOH X  6 .   ? -2.009  -10.787 -10.522 1.00 24.25  ? 2007 HOH A O     1 
HETATM 5852 O  O     . HOH X  6 .   ? -14.074 -22.464 -22.212 1.00 34.45  ? 2008 HOH A O     1 
HETATM 5853 O  O     . HOH X  6 .   ? -17.267 -31.359 -18.179 1.00 28.12  ? 2009 HOH A O     1 
HETATM 5854 O  O     . HOH X  6 .   ? -5.613  -19.595 -16.997 1.00 37.40  ? 2010 HOH A O     1 
HETATM 5855 O  O     . HOH X  6 .   ? -24.401 -12.372 -11.187 1.00 39.06  ? 2011 HOH A O     1 
HETATM 5856 O  O     . HOH X  6 .   ? -19.430 -18.544 4.314   1.00 26.43  ? 2012 HOH A O     1 
HETATM 5857 O  O     . HOH X  6 .   ? -2.139  -19.305 -8.150  1.00 29.49  ? 2013 HOH A O     1 
HETATM 5858 O  O     . HOH X  6 .   ? -20.559 -7.917  9.733   1.00 30.01  ? 2014 HOH A O     1 
HETATM 5859 O  O     . HOH X  6 .   ? -0.929  -31.884 -3.854  1.00 27.35  ? 2015 HOH A O     1 
HETATM 5860 O  O     . HOH X  6 .   ? -7.070  -40.522 -18.534 1.00 46.32  ? 2016 HOH A O     1 
HETATM 5861 O  O     . HOH X  6 .   ? -13.519 -7.990  -17.793 1.00 41.16  ? 2017 HOH A O     1 
HETATM 5862 O  O     . HOH X  6 .   ? -15.908 -5.759  -1.892  1.00 24.15  ? 2018 HOH A O     1 
HETATM 5863 O  O     . HOH X  6 .   ? 1.859   -22.585 -5.648  1.00 32.30  ? 2019 HOH A O     1 
HETATM 5864 O  O     . HOH X  6 .   ? -18.817 -29.466 -19.729 1.00 34.76  ? 2020 HOH A O     1 
HETATM 5865 O  O     . HOH X  6 .   ? -8.968  -20.151 -21.468 1.00 34.88  ? 2021 HOH A O     1 
HETATM 5866 O  O     . HOH X  6 .   ? -6.438  -19.748 -24.473 1.00 36.28  ? 2022 HOH A O     1 
HETATM 5867 O  O     . HOH X  6 .   ? 0.341   -20.109 -7.081  1.00 33.67  ? 2023 HOH A O     1 
HETATM 5868 O  O     . HOH X  6 .   ? -4.245  -16.048 -17.715 1.00 27.07  ? 2024 HOH A O     1 
HETATM 5869 O  O     . HOH X  6 .   ? -7.077  -2.846  -0.170  1.00 26.92  ? 2025 HOH A O     1 
HETATM 5870 O  O     . HOH X  6 .   ? -21.560 -4.190  4.518   1.00 49.25  ? 2026 HOH A O     1 
HETATM 5871 O  O     . HOH X  6 .   ? -19.190 -27.177 -16.848 1.00 40.25  ? 2027 HOH A O     1 
HETATM 5872 O  O     . HOH X  6 .   ? -3.098  -12.357 6.777   1.00 30.53  ? 2028 HOH A O     1 
HETATM 5873 O  O     . HOH X  6 .   ? -1.232  -11.150 7.644   1.00 30.97  ? 2029 HOH A O     1 
HETATM 5874 O  O     . HOH X  6 .   ? -8.008  -30.584 -6.747  1.00 48.90  ? 2030 HOH A O     1 
HETATM 5875 O  O     . HOH X  6 .   ? -8.671  -31.886 -3.727  1.00 35.70  ? 2031 HOH A O     1 
HETATM 5876 O  O     . HOH Y  6 .   ? 16.522  2.347   -20.933 1.00 21.08  ? 1004 HOH B O     1 
HETATM 5877 O  O     . HOH Y  6 .   ? 9.660   -0.152  -13.821 1.00 36.71  ? 1005 HOH B O     1 
HETATM 5878 O  O     . HOH Y  6 .   ? 23.663  -28.223 -19.808 1.00 24.92  ? 1006 HOH B O     1 
HETATM 5879 O  O     . HOH Y  6 .   ? 9.669   -9.783  -11.209 1.00 19.59  ? 1007 HOH B O     1 
HETATM 5880 O  O     . HOH Y  6 .   ? 11.966  -24.911 -7.573  1.00 30.21  ? 1008 HOH B O     1 
HETATM 5881 O  O     . HOH Y  6 .   ? 31.193  -4.580  -19.111 1.00 34.78  ? 1009 HOH B O     1 
HETATM 5882 O  O     . HOH Y  6 .   ? 10.075  4.253   -15.890 1.00 17.88  ? 1010 HOH B O     1 
HETATM 5883 O  O     . HOH Y  6 .   ? 28.113  -14.106 -13.643 1.00 35.29  ? 1011 HOH B O     1 
HETATM 5884 O  O     . HOH Y  6 .   ? 23.918  -5.521  -7.856  1.00 36.42  ? 1012 HOH B O     1 
HETATM 5885 O  O     . HOH Y  6 .   ? 14.162  -7.627  -9.046  1.00 34.49  ? 1013 HOH B O     1 
HETATM 5886 O  O     . HOH Y  6 .   ? 24.353  -3.621  -28.337 1.00 31.18  ? 1014 HOH B O     1 
HETATM 5887 O  O     . HOH Y  6 .   ? 4.345   -30.698 -32.571 1.00 33.28  ? 1015 HOH B O     1 
HETATM 5888 O  O     . HOH Y  6 .   ? 14.877  -22.622 -10.389 1.00 39.74  ? 1016 HOH B O     1 
HETATM 5889 O  O     . HOH Y  6 .   ? 8.475   6.146   -12.340 1.00 29.61  ? 1017 HOH B O     1 
HETATM 5890 O  O     . HOH Y  6 .   ? 14.459  -22.388 -28.213 1.00 51.54  ? 1018 HOH B O     1 
HETATM 5891 O  O     . HOH Y  6 .   ? 33.171  -4.578  -21.046 1.00 34.30  ? 1019 HOH B O     1 
HETATM 5892 O  O     . HOH Y  6 .   ? 17.919  -33.542 -27.289 1.00 36.29  ? 1020 HOH B O     1 
HETATM 5893 O  O     . HOH Y  6 .   ? 7.156   -21.700 -31.722 1.00 39.85  ? 1021 HOH B O     1 
HETATM 5894 O  O     . HOH Y  6 .   ? 10.550  1.053   -9.102  1.00 30.88  ? 1022 HOH B O     1 
HETATM 5895 O  O     . HOH Y  6 .   ? 25.745  -10.811 -18.426 1.00 32.84  ? 1023 HOH B O     1 
HETATM 5896 O  O     . HOH Y  6 .   ? 10.650  -14.072 -25.960 1.00 36.82  ? 1024 HOH B O     1 
HETATM 5897 O  O     . HOH Y  6 .   ? 19.845  -17.343 -8.503  1.00 38.75  ? 1025 HOH B O     1 
HETATM 5898 O  O     . HOH Y  6 .   ? 5.973   -14.318 -20.652 1.00 40.95  ? 1026 HOH B O     1 
HETATM 5899 O  O     . HOH Y  6 .   ? 7.468   -0.068  -27.126 1.00 46.86  ? 1027 HOH B O     1 
HETATM 5900 O  O     . HOH Y  6 .   ? 14.199  -19.316 -26.989 1.00 47.87  ? 1028 HOH B O     1 
HETATM 5901 O  O     . HOH Y  6 .   ? 10.257  -15.831 -23.895 1.00 53.15  ? 1029 HOH B O     1 
HETATM 5902 O  O     . HOH Y  6 .   ? 29.928  -6.840  -20.553 1.00 25.63  ? 1030 HOH B O     1 
HETATM 5903 O  O     . HOH Z  6 .   ? 6.070   26.108  -11.636 1.00 37.57  ? 2002 HOH C O     1 
HETATM 5904 O  O     . HOH Z  6 .   ? -5.130  12.331  -8.258  1.00 24.08  ? 2003 HOH C O     1 
HETATM 5905 O  O     . HOH Z  6 .   ? 0.888   11.486  -7.546  1.00 23.91  ? 2004 HOH C O     1 
HETATM 5906 O  O     . HOH Z  6 .   ? -16.741 24.754  -3.214  1.00 27.85  ? 2005 HOH C O     1 
HETATM 5907 O  O     . HOH Z  6 .   ? -7.383  22.837  12.282  1.00 35.43  ? 2006 HOH C O     1 
HETATM 5908 O  O     . HOH Z  6 .   ? -4.962  34.026  1.046   1.00 42.25  ? 2007 HOH C O     1 
HETATM 5909 O  O     . HOH Z  6 .   ? -4.804  7.661   15.929  1.00 33.86  ? 2008 HOH C O     1 
HETATM 5910 O  O     . HOH Z  6 .   ? -0.949  16.622  -10.518 1.00 33.51  ? 2009 HOH C O     1 
HETATM 5911 O  O     . HOH Z  6 .   ? 5.158   22.484  -10.458 1.00 41.20  ? 2010 HOH C O     1 
HETATM 5912 O  O     . HOH Z  6 .   ? -15.866 25.944  -5.910  1.00 32.98  ? 2011 HOH C O     1 
HETATM 5913 O  O     . HOH Z  6 .   ? 10.975  24.453  12.765  1.00 33.50  ? 2012 HOH C O     1 
HETATM 5914 O  O     . HOH Z  6 .   ? -11.438 26.272  11.762  1.00 35.81  ? 2013 HOH C O     1 
HETATM 5915 O  O     . HOH Z  6 .   ? 4.015   13.239  -17.447 1.00 35.10  ? 2014 HOH C O     1 
HETATM 5916 O  O     . HOH Z  6 .   ? -12.259 11.030  -7.274  1.00 28.04  ? 2015 HOH C O     1 
HETATM 5917 O  O     . HOH Z  6 .   ? -7.300  13.900  6.417   1.00 27.60  ? 2016 HOH C O     1 
HETATM 5918 O  O     . HOH Z  6 .   ? -1.507  30.820  -2.202  1.00 50.16  ? 2017 HOH C O     1 
HETATM 5919 O  O     . HOH Z  6 .   ? 9.253   8.756   -0.728  1.00 37.93  ? 2018 HOH C O     1 
HETATM 5920 O  O     . HOH Z  6 .   ? 8.980   8.223   3.593   1.00 36.18  ? 2019 HOH C O     1 
HETATM 5921 O  O     . HOH Z  6 .   ? 1.525   18.388  10.236  1.00 48.85  ? 2020 HOH C O     1 
HETATM 5922 O  O     . HOH Z  6 .   ? 4.988   29.933  7.181   1.00 40.31  ? 2021 HOH C O     1 
HETATM 5923 O  O     . HOH Z  6 .   ? -1.889  27.440  -14.747 1.00 41.08  ? 2022 HOH C O     1 
HETATM 5924 O  O     . HOH Z  6 .   ? -5.448  24.085  -15.187 1.00 18.86  ? 2023 HOH C O     1 
HETATM 5925 O  O     . HOH Z  6 .   ? -5.513  25.711  -16.653 1.00 32.33  ? 2024 HOH C O     1 
HETATM 5926 O  O     . HOH Z  6 .   ? 8.735   9.794   6.411   1.00 53.11  ? 2025 HOH C O     1 
HETATM 5927 O  O     . HOH AA 6 .   ? -9.886  2.591   18.834  1.00 26.56  ? 2002 HOH D O     1 
HETATM 5928 O  O     . HOH AA 6 .   ? -14.445 7.458   18.020  1.00 31.55  ? 2003 HOH D O     1 
HETATM 5929 O  O     . HOH AA 6 .   ? 7.081   14.534  38.676  1.00 38.60  ? 2004 HOH D O     1 
HETATM 5930 O  O     . HOH AA 6 .   ? 10.540  18.522  22.114  1.00 28.49  ? 2005 HOH D O     1 
HETATM 5931 O  O     . HOH AA 6 .   ? -8.225  13.424  21.855  1.00 26.82  ? 2006 HOH D O     1 
HETATM 5932 O  O     . HOH AA 6 .   ? 5.199   0.002   21.379  1.00 36.80  ? 2007 HOH D O     1 
HETATM 5933 O  O     . HOH AA 6 .   ? -5.126  24.493  41.909  1.00 25.83  ? 2008 HOH D O     1 
HETATM 5934 O  O     . HOH AA 6 .   ? -9.251  -1.267  16.587  1.00 22.16  ? 2009 HOH D O     1 
HETATM 5935 O  O     . HOH AA 6 .   ? -1.228  12.774  38.846  1.00 36.82  ? 2010 HOH D O     1 
HETATM 5936 O  O     . HOH AA 6 .   ? -7.098  19.184  34.664  1.00 44.06  ? 2011 HOH D O     1 
HETATM 5937 O  O     . HOH AA 6 .   ? 1.303   13.850  23.081  1.00 31.06  ? 2012 HOH D O     1 
HETATM 5938 O  O     . HOH AA 6 .   ? 2.217   -5.716  27.352  1.00 47.83  ? 2013 HOH D O     1 
HETATM 5939 O  O     . HOH AA 6 .   ? -22.784 4.592   18.982  1.00 41.65  ? 2014 HOH D O     1 
HETATM 5940 O  O     . HOH AA 6 .   ? -21.266 3.822   21.010  1.00 45.51  ? 2015 HOH D O     1 
HETATM 5941 O  O     . HOH AA 6 .   ? -7.709  16.872  34.174  1.00 46.86  ? 2016 HOH D O     1 
HETATM 5942 O  O     . HOH AA 6 .   ? -9.910  18.302  33.640  1.00 33.91  ? 2017 HOH D O     1 
HETATM 5943 O  O     . HOH AA 6 .   ? -6.029  -7.367  40.706  1.00 34.13  ? 2018 HOH D O     1 
HETATM 5944 O  O     . HOH AA 6 .   ? -6.943  -3.604  41.303  1.00 34.10  ? 2019 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   E . n 
A 1 2   DC  2   2   2   DC  C   E . n 
A 1 3   DC  3   3   3   DC  C   E . n 
A 1 4   DT  4   4   4   DT  T   E . n 
A 1 5   DG  5   5   5   DG  G   E . n 
A 1 6   DT  6   6   6   DT  T   E . n 
A 1 7   DT  7   7   7   DT  T   E . n 
A 1 8   DA  8   8   8   DA  A   E . n 
A 1 9   DG  9   9   9   DG  G   E . n 
A 1 10  DC  10  10  10  DC  C   E . n 
A 1 11  DA  11  11  11  DA  A   E . n 
A 1 12  DC  12  12  12  DC  C   E . n 
A 1 13  DA  13  13  13  DA  A   E . n 
A 1 14  DG  14  14  14  DG  G   E . n 
A 1 15  DG  15  15  15  DG  G   E . n 
A 1 16  DC  16  16  16  DC  C   E . n 
A 1 17  DT  17  17  17  DT  T   E . n 
A 1 18  DG  18  18  18  DG  G   E . n 
A 1 19  DC  19  19  19  DC  C   E . n 
A 1 20  DC  20  20  20  DC  C   E . n 
A 1 21  DC  21  21  21  DC  C   E . n 
A 1 22  DT  22  22  22  DT  T   E . n 
A 1 23  DA  23  23  23  DA  A   E . n 
A 1 24  DA  24  24  24  DA  A   E . n 
A 1 25  DT  25  25  25  DT  T   E . n 
A 1 26  DT  26  26  26  DT  T   E . n 
A 1 27  DT  27  27  27  DT  T   E . n 
A 1 28  DT  28  28  28  DT  T   E . n 
A 1 29  DA  29  29  29  DA  A   E . n 
A 1 30  DG  30  30  30  DG  G   E . n 
A 1 31  DT  31  31  31  DT  T   E . n 
A 1 32  DG  32  32  32  DG  G   E . n 
A 1 33  DG  33  33  33  DG  G   E . n 
B 2 1   DC  1   1   1   DC  C   F . n 
B 2 2   DA  2   2   2   DA  A   F . n 
B 2 3   DC  3   3   3   DC  C   F . n 
B 2 4   DT  4   4   4   DT  T   F . n 
B 2 5   DA  5   5   5   DA  A   F . n 
B 2 6   DA  6   6   6   DA  A   F . n 
B 2 7   DA  7   7   7   DA  A   F . n 
B 2 8   DA  8   8   8   DA  A   F . n 
B 2 9   DT  9   9   9   DT  T   F . n 
B 2 10  DT  10  10  10  DT  T   F . n 
B 2 11  DA  11  11  11  DA  A   F . n 
B 2 12  DG  12  12  12  DG  G   F . n 
B 2 13  DG  13  13  13  DG  G   F . n 
B 2 14  DG  14  14  14  DG  G   F . n 
B 2 15  DC  15  15  15  DC  C   F . n 
B 2 16  DA  16  16  16  DA  A   F . n 
B 2 17  DG  17  17  17  DG  G   F . n 
B 2 18  DC  18  18  18  DC  C   F . n 
B 2 19  DC  19  19  19  DC  C   F . n 
B 2 20  DT  20  20  20  DT  T   F . n 
B 2 21  DG  21  21  21  DG  G   F . n 
B 2 22  DT  22  22  22  DT  T   F . n 
B 2 23  DG  23  23  23  DG  G   F . n 
B 2 24  DC  24  24  24  DC  C   F . n 
B 2 25  DT  25  25  25  DT  T   F . n 
B 2 26  DA  26  26  26  DA  A   F . n 
B 2 27  DA  27  27  27  DA  A   F . n 
B 2 28  DC  28  28  28  DC  C   F . n 
B 2 29  DA  29  29  29  DA  A   F . n 
B 2 30  DG  30  30  30  DG  G   F . n 
B 2 31  DG  31  31  31  DG  G   F . n 
B 2 32  DG  32  32  32  DG  G   F . n 
B 2 33  DC  33  33  33  DC  C   F . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   ASN 2   2   2   ASN ASN A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   VAL 5   5   5   VAL VAL A . n 
C 3 6   ASP 6   6   6   ASP ASP A . n 
C 3 7   THR 7   7   7   THR THR A . n 
C 3 8   THR 8   8   8   THR THR A . n 
C 3 9   GLU 9   9   9   GLU GLU A . n 
C 3 10  MET 10  10  10  MET MET A . n 
C 3 11  TYR 11  11  11  TYR TYR A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  ARG 13  13  13  ARG ARG A . n 
C 3 14  THR 14  14  14  THR THR A . n 
C 3 15  ILE 15  15  15  ILE ILE A . n 
C 3 16  TYR 16  16  16  TYR TYR A . n 
C 3 17  ASP 17  17  17  ASP ASP A . n 
C 3 18  LEU 18  18  18  LEU LEU A . n 
C 3 19  GLU 19  19  19  GLU GLU A . n 
C 3 20  GLU 20  20  20  GLU GLU A . n 
C 3 21  GLU 21  21  21  GLU GLU A . n 
C 3 22  GLY 22  22  22  GLY GLY A . n 
C 3 23  VAL 23  23  23  VAL VAL A . n 
C 3 24  THR 24  24  24  THR THR A . n 
C 3 25  PRO 25  25  25  PRO PRO A . n 
C 3 26  LEU 26  26  26  LEU LEU A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  ALA 28  28  28  ALA ALA A . n 
C 3 29  ARG 29  29  29  ARG ARG A . n 
C 3 30  ILE 30  30  30  ILE ILE A . n 
C 3 31  ALA 31  31  31  ALA ALA A . n 
C 3 32  GLU 32  32  32  GLU GLU A . n 
C 3 33  ARG 33  33  33  ARG ARG A . n 
C 3 34  LEU 34  34  34  LEU LEU A . n 
C 3 35  ASP 35  35  35  ASP ASP A . n 
C 3 36  GLN 36  36  36  GLN GLN A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  GLY 38  38  38  GLY GLY A . n 
C 3 39  PRO 39  39  39  PRO PRO A . n 
C 3 40  THR 40  40  40  THR THR A . n 
C 3 41  VAL 41  41  41  VAL VAL A . n 
C 3 42  SER 42  42  42  SER SER A . n 
C 3 43  GLN 43  43  43  GLN GLN A . n 
C 3 44  THR 44  44  44  THR THR A . n 
C 3 45  VAL 45  45  45  VAL VAL A . n 
C 3 46  SER 46  46  46  SER SER A . n 
C 3 47  ARG 47  47  47  ARG ARG A . n 
C 3 48  MET 48  48  48  MET MET A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  ARG 50  50  50  ARG ARG A . n 
C 3 51  ASP 51  51  51  ASP ASP A . n 
C 3 52  GLY 52  52  52  GLY GLY A . n 
C 3 53  LEU 53  53  53  LEU LEU A . n 
C 3 54  LEU 54  54  54  LEU LEU A . n 
C 3 55  ARG 55  55  55  ARG ARG A . n 
C 3 56  VAL 56  56  56  VAL VAL A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLY 58  58  58  GLY GLY A . n 
C 3 59  ASP 59  59  59  ASP ASP A . n 
C 3 60  ARG 60  60  60  ARG ARG A . n 
C 3 61  HIS 61  61  61  HIS HIS A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  GLU 63  63  63  GLU GLU A . n 
C 3 64  LEU 64  64  64  LEU LEU A . n 
C 3 65  THR 65  65  65  THR THR A . n 
C 3 66  GLU 66  66  66  GLU GLU A . n 
C 3 67  LYS 67  67  67  LYS LYS A . n 
C 3 68  GLY 68  68  68  GLY GLY A . n 
C 3 69  ARG 69  69  69  ARG ARG A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ALA 72  72  72  ALA ALA A . n 
C 3 73  ILE 73  73  73  ILE ILE A . n 
C 3 74  ALA 74  74  74  ALA ALA A . n 
C 3 75  VAL 75  75  75  VAL VAL A . n 
C 3 76  MET 76  76  76  MET MET A . n 
C 3 77  ARG 77  77  77  ARG ARG A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  HIS 79  79  79  HIS HIS A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  LEU 81  81  81  LEU LEU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  GLU 83  83  83  GLU GLU A . n 
C 3 84  ARG 84  84  84  ARG ARG A . n 
C 3 85  LEU 85  85  85  LEU LEU A . n 
C 3 86  LEU 86  86  86  LEU LEU A . n 
C 3 87  VAL 87  87  87  VAL VAL A . n 
C 3 88  ASP 88  88  88  ASP ASP A . n 
C 3 89  VAL 89  89  89  VAL VAL A . n 
C 3 90  ILE 90  90  90  ILE ILE A . n 
C 3 91  GLY 91  91  91  GLY GLY A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  PRO 93  93  93  PRO PRO A . n 
C 3 94  TRP 94  94  94  TRP TRP A . n 
C 3 95  GLU 95  95  95  GLU GLU A . n 
C 3 96  GLU 96  96  96  GLU GLU A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  HIS 98  98  98  HIS HIS A . n 
C 3 99  ALA 99  99  99  ALA ALA A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ALA 101 101 101 ALA ALA A . n 
C 3 102 CYS 102 102 102 CYS CYS A . n 
C 3 103 ARG 103 103 103 ARG ARG A . n 
C 3 104 TRP 104 104 104 TRP TRP A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 HIS 106 106 106 HIS HIS A . n 
C 3 107 VAL 107 107 107 VAL VAL A . n 
C 3 108 MET 108 108 108 MET MET A . n 
C 3 109 SER 109 109 109 SER SER A . n 
C 3 110 GLU 110 110 110 GLU GLU A . n 
C 3 111 ASP 111 111 111 ASP ASP A . n 
C 3 112 VAL 112 112 112 VAL VAL A . n 
C 3 113 GLU 113 113 113 GLU GLU A . n 
C 3 114 ARG 114 114 114 ARG ARG A . n 
C 3 115 ARG 115 115 115 ARG ARG A . n 
C 3 116 LEU 116 116 116 LEU LEU A . n 
C 3 117 VAL 117 117 117 VAL VAL A . n 
C 3 118 LYS 118 118 118 LYS LYS A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 LEU 120 120 120 LEU LEU A . n 
C 3 121 ASN 121 121 121 ASN ASN A . n 
C 3 122 ASN 122 122 122 ASN ASN A . n 
C 3 123 PRO 123 123 123 PRO PRO A . n 
C 3 124 THR 124 124 124 THR THR A . n 
C 3 125 THR 125 125 125 THR THR A . n 
C 3 126 SER 126 126 126 SER SER A . n 
C 3 127 PRO 127 127 127 PRO PRO A . n 
C 3 128 PHE 128 128 128 PHE PHE A . n 
C 3 129 GLY 129 129 129 GLY GLY A . n 
C 3 130 ASN 130 130 130 ASN ASN A . n 
C 3 131 PRO 131 131 131 PRO PRO A . n 
C 3 132 ILE 132 132 132 ILE ILE A . n 
C 3 133 PRO 133 133 133 PRO PRO A . n 
C 3 134 GLY 134 134 134 GLY GLY A . n 
C 3 135 LEU 135 135 135 LEU LEU A . n 
C 3 136 VAL 136 136 136 VAL VAL A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 LEU 138 138 138 LEU LEU A . n 
C 3 139 GLY 139 139 139 GLY GLY A . n 
C 3 140 VAL 140 140 140 VAL VAL A . n 
C 3 141 ALA 141 141 ?   ?   ?   A . n 
C 3 142 SER 142 142 ?   ?   ?   A . n 
C 3 143 GLU 143 143 ?   ?   ?   A . n 
C 3 144 ASN 144 144 ?   ?   ?   A . n 
C 3 145 LEU 145 145 ?   ?   ?   A . n 
C 3 146 TYR 146 146 ?   ?   ?   A . n 
C 3 147 PHE 147 147 ?   ?   ?   A . n 
C 3 148 GLN 148 148 ?   ?   ?   A . n 
C 3 149 GLY 149 149 ?   ?   ?   A . n 
C 3 150 GLY 150 150 ?   ?   ?   A . n 
C 3 151 GLY 151 151 ?   ?   ?   A . n 
C 3 152 HIS 152 152 ?   ?   ?   A . n 
C 3 153 HIS 153 153 ?   ?   ?   A . n 
C 3 154 HIS 154 154 ?   ?   ?   A . n 
C 3 155 HIS 155 155 ?   ?   ?   A . n 
C 3 156 HIS 156 156 ?   ?   ?   A . n 
C 3 157 HIS 157 157 ?   ?   ?   A . n 
D 3 1   MET 1   1   1   MET MET B . n 
D 3 2   ASN 2   2   2   ASN ASN B . n 
D 3 3   GLU 3   3   3   GLU GLU B . n 
D 3 4   LEU 4   4   4   LEU LEU B . n 
D 3 5   VAL 5   5   5   VAL VAL B . n 
D 3 6   ASP 6   6   6   ASP ASP B . n 
D 3 7   THR 7   7   7   THR THR B . n 
D 3 8   THR 8   8   8   THR THR B . n 
D 3 9   GLU 9   9   9   GLU GLU B . n 
D 3 10  MET 10  10  10  MET MET B . n 
D 3 11  TYR 11  11  11  TYR TYR B . n 
D 3 12  LEU 12  12  12  LEU LEU B . n 
D 3 13  ARG 13  13  13  ARG ARG B . n 
D 3 14  THR 14  14  14  THR THR B . n 
D 3 15  ILE 15  15  15  ILE ILE B . n 
D 3 16  TYR 16  16  16  TYR TYR B . n 
D 3 17  ASP 17  17  17  ASP ASP B . n 
D 3 18  LEU 18  18  18  LEU LEU B . n 
D 3 19  GLU 19  19  19  GLU GLU B . n 
D 3 20  GLU 20  20  20  GLU GLU B . n 
D 3 21  GLU 21  21  21  GLU GLU B . n 
D 3 22  GLY 22  22  22  GLY GLY B . n 
D 3 23  VAL 23  23  23  VAL VAL B . n 
D 3 24  THR 24  24  24  THR THR B . n 
D 3 25  PRO 25  25  25  PRO PRO B . n 
D 3 26  LEU 26  26  26  LEU LEU B . n 
D 3 27  ARG 27  27  27  ARG ARG B . n 
D 3 28  ALA 28  28  28  ALA ALA B . n 
D 3 29  ARG 29  29  29  ARG ARG B . n 
D 3 30  ILE 30  30  30  ILE ILE B . n 
D 3 31  ALA 31  31  31  ALA ALA B . n 
D 3 32  GLU 32  32  32  GLU GLU B . n 
D 3 33  ARG 33  33  33  ARG ARG B . n 
D 3 34  LEU 34  34  34  LEU LEU B . n 
D 3 35  ASP 35  35  35  ASP ASP B . n 
D 3 36  GLN 36  36  36  GLN GLN B . n 
D 3 37  SER 37  37  37  SER SER B . n 
D 3 38  GLY 38  38  38  GLY GLY B . n 
D 3 39  PRO 39  39  39  PRO PRO B . n 
D 3 40  THR 40  40  40  THR THR B . n 
D 3 41  VAL 41  41  41  VAL VAL B . n 
D 3 42  SER 42  42  42  SER SER B . n 
D 3 43  GLN 43  43  43  GLN GLN B . n 
D 3 44  THR 44  44  44  THR THR B . n 
D 3 45  VAL 45  45  45  VAL VAL B . n 
D 3 46  SER 46  46  46  SER SER B . n 
D 3 47  ARG 47  47  47  ARG ARG B . n 
D 3 48  MET 48  48  48  MET MET B . n 
D 3 49  GLU 49  49  49  GLU GLU B . n 
D 3 50  ARG 50  50  50  ARG ARG B . n 
D 3 51  ASP 51  51  51  ASP ASP B . n 
D 3 52  GLY 52  52  52  GLY GLY B . n 
D 3 53  LEU 53  53  53  LEU LEU B . n 
D 3 54  LEU 54  54  54  LEU LEU B . n 
D 3 55  ARG 55  55  55  ARG ARG B . n 
D 3 56  VAL 56  56  56  VAL VAL B . n 
D 3 57  ALA 57  57  57  ALA ALA B . n 
D 3 58  GLY 58  58  58  GLY GLY B . n 
D 3 59  ASP 59  59  59  ASP ASP B . n 
D 3 60  ARG 60  60  60  ARG ARG B . n 
D 3 61  HIS 61  61  61  HIS HIS B . n 
D 3 62  LEU 62  62  62  LEU LEU B . n 
D 3 63  GLU 63  63  63  GLU GLU B . n 
D 3 64  LEU 64  64  64  LEU LEU B . n 
D 3 65  THR 65  65  65  THR THR B . n 
D 3 66  GLU 66  66  66  GLU GLU B . n 
D 3 67  LYS 67  67  67  LYS LYS B . n 
D 3 68  GLY 68  68  68  GLY GLY B . n 
D 3 69  ARG 69  69  69  ARG ARG B . n 
D 3 70  ALA 70  70  70  ALA ALA B . n 
D 3 71  LEU 71  71  71  LEU LEU B . n 
D 3 72  ALA 72  72  72  ALA ALA B . n 
D 3 73  ILE 73  73  73  ILE ILE B . n 
D 3 74  ALA 74  74  74  ALA ALA B . n 
D 3 75  VAL 75  75  75  VAL VAL B . n 
D 3 76  MET 76  76  76  MET MET B . n 
D 3 77  ARG 77  77  77  ARG ARG B . n 
D 3 78  LYS 78  78  78  LYS LYS B . n 
D 3 79  HIS 79  79  79  HIS HIS B . n 
D 3 80  ARG 80  80  80  ARG ARG B . n 
D 3 81  LEU 81  81  81  LEU LEU B . n 
D 3 82  ALA 82  82  82  ALA ALA B . n 
D 3 83  GLU 83  83  83  GLU GLU B . n 
D 3 84  ARG 84  84  84  ARG ARG B . n 
D 3 85  LEU 85  85  85  LEU LEU B . n 
D 3 86  LEU 86  86  86  LEU LEU B . n 
D 3 87  VAL 87  87  87  VAL VAL B . n 
D 3 88  ASP 88  88  88  ASP ASP B . n 
D 3 89  VAL 89  89  89  VAL VAL B . n 
D 3 90  ILE 90  90  90  ILE ILE B . n 
D 3 91  GLY 91  91  91  GLY GLY B . n 
D 3 92  LEU 92  92  92  LEU LEU B . n 
D 3 93  PRO 93  93  93  PRO PRO B . n 
D 3 94  TRP 94  94  94  TRP TRP B . n 
D 3 95  GLU 95  95  95  GLU GLU B . n 
D 3 96  GLU 96  96  96  GLU GLU B . n 
D 3 97  VAL 97  97  97  VAL VAL B . n 
D 3 98  HIS 98  98  98  HIS HIS B . n 
D 3 99  ALA 99  99  99  ALA ALA B . n 
D 3 100 GLU 100 100 100 GLU GLU B . n 
D 3 101 ALA 101 101 101 ALA ALA B . n 
D 3 102 CYS 102 102 102 CYS CYS B . n 
D 3 103 ARG 103 103 103 ARG ARG B . n 
D 3 104 TRP 104 104 104 TRP TRP B . n 
D 3 105 GLU 105 105 105 GLU GLU B . n 
D 3 106 HIS 106 106 106 HIS HIS B . n 
D 3 107 VAL 107 107 107 VAL VAL B . n 
D 3 108 MET 108 108 108 MET MET B . n 
D 3 109 SER 109 109 109 SER SER B . n 
D 3 110 GLU 110 110 110 GLU GLU B . n 
D 3 111 ASP 111 111 111 ASP ASP B . n 
D 3 112 VAL 112 112 112 VAL VAL B . n 
D 3 113 GLU 113 113 113 GLU GLU B . n 
D 3 114 ARG 114 114 114 ARG ARG B . n 
D 3 115 ARG 115 115 115 ARG ARG B . n 
D 3 116 LEU 116 116 116 LEU LEU B . n 
D 3 117 VAL 117 117 117 VAL VAL B . n 
D 3 118 LYS 118 118 118 LYS LYS B . n 
D 3 119 VAL 119 119 119 VAL VAL B . n 
D 3 120 LEU 120 120 120 LEU LEU B . n 
D 3 121 ASN 121 121 121 ASN ASN B . n 
D 3 122 ASN 122 122 122 ASN ASN B . n 
D 3 123 PRO 123 123 123 PRO PRO B . n 
D 3 124 THR 124 124 124 THR THR B . n 
D 3 125 THR 125 125 125 THR THR B . n 
D 3 126 SER 126 126 126 SER SER B . n 
D 3 127 PRO 127 127 127 PRO PRO B . n 
D 3 128 PHE 128 128 128 PHE PHE B . n 
D 3 129 GLY 129 129 129 GLY GLY B . n 
D 3 130 ASN 130 130 130 ASN ASN B . n 
D 3 131 PRO 131 131 131 PRO PRO B . n 
D 3 132 ILE 132 132 132 ILE ILE B . n 
D 3 133 PRO 133 133 133 PRO PRO B . n 
D 3 134 GLY 134 134 134 GLY GLY B . n 
D 3 135 LEU 135 135 135 LEU LEU B . n 
D 3 136 VAL 136 136 136 VAL VAL B . n 
D 3 137 GLU 137 137 137 GLU GLU B . n 
D 3 138 LEU 138 138 138 LEU LEU B . n 
D 3 139 GLY 139 139 139 GLY GLY B . n 
D 3 140 VAL 140 140 140 VAL VAL B . n 
D 3 141 ALA 141 141 ?   ?   ?   B . n 
D 3 142 SER 142 142 ?   ?   ?   B . n 
D 3 143 GLU 143 143 ?   ?   ?   B . n 
D 3 144 ASN 144 144 ?   ?   ?   B . n 
D 3 145 LEU 145 145 ?   ?   ?   B . n 
D 3 146 TYR 146 146 ?   ?   ?   B . n 
D 3 147 PHE 147 147 ?   ?   ?   B . n 
D 3 148 GLN 148 148 ?   ?   ?   B . n 
D 3 149 GLY 149 149 ?   ?   ?   B . n 
D 3 150 GLY 150 150 ?   ?   ?   B . n 
D 3 151 GLY 151 151 ?   ?   ?   B . n 
D 3 152 HIS 152 152 ?   ?   ?   B . n 
D 3 153 HIS 153 153 ?   ?   ?   B . n 
D 3 154 HIS 154 154 ?   ?   ?   B . n 
D 3 155 HIS 155 155 ?   ?   ?   B . n 
D 3 156 HIS 156 156 ?   ?   ?   B . n 
D 3 157 HIS 157 157 ?   ?   ?   B . n 
E 3 1   MET 1   1   1   MET MET C . n 
E 3 2   ASN 2   2   2   ASN ASN C . n 
E 3 3   GLU 3   3   3   GLU GLU C . n 
E 3 4   LEU 4   4   4   LEU LEU C . n 
E 3 5   VAL 5   5   5   VAL VAL C . n 
E 3 6   ASP 6   6   6   ASP ASP C . n 
E 3 7   THR 7   7   7   THR THR C . n 
E 3 8   THR 8   8   8   THR THR C . n 
E 3 9   GLU 9   9   9   GLU GLU C . n 
E 3 10  MET 10  10  10  MET MET C . n 
E 3 11  TYR 11  11  11  TYR TYR C . n 
E 3 12  LEU 12  12  12  LEU LEU C . n 
E 3 13  ARG 13  13  13  ARG ARG C . n 
E 3 14  THR 14  14  14  THR THR C . n 
E 3 15  ILE 15  15  15  ILE ILE C . n 
E 3 16  TYR 16  16  16  TYR TYR C . n 
E 3 17  ASP 17  17  17  ASP ASP C . n 
E 3 18  LEU 18  18  18  LEU LEU C . n 
E 3 19  GLU 19  19  19  GLU GLU C . n 
E 3 20  GLU 20  20  20  GLU GLU C . n 
E 3 21  GLU 21  21  21  GLU GLU C . n 
E 3 22  GLY 22  22  22  GLY GLY C . n 
E 3 23  VAL 23  23  23  VAL VAL C . n 
E 3 24  THR 24  24  24  THR THR C . n 
E 3 25  PRO 25  25  25  PRO PRO C . n 
E 3 26  LEU 26  26  26  LEU LEU C . n 
E 3 27  ARG 27  27  27  ARG ARG C . n 
E 3 28  ALA 28  28  28  ALA ALA C . n 
E 3 29  ARG 29  29  29  ARG ARG C . n 
E 3 30  ILE 30  30  30  ILE ILE C . n 
E 3 31  ALA 31  31  31  ALA ALA C . n 
E 3 32  GLU 32  32  32  GLU GLU C . n 
E 3 33  ARG 33  33  33  ARG ARG C . n 
E 3 34  LEU 34  34  34  LEU LEU C . n 
E 3 35  ASP 35  35  35  ASP ASP C . n 
E 3 36  GLN 36  36  36  GLN GLN C . n 
E 3 37  SER 37  37  37  SER SER C . n 
E 3 38  GLY 38  38  38  GLY GLY C . n 
E 3 39  PRO 39  39  39  PRO PRO C . n 
E 3 40  THR 40  40  40  THR THR C . n 
E 3 41  VAL 41  41  41  VAL VAL C . n 
E 3 42  SER 42  42  42  SER SER C . n 
E 3 43  GLN 43  43  43  GLN GLN C . n 
E 3 44  THR 44  44  44  THR THR C . n 
E 3 45  VAL 45  45  45  VAL VAL C . n 
E 3 46  SER 46  46  46  SER SER C . n 
E 3 47  ARG 47  47  47  ARG ARG C . n 
E 3 48  MET 48  48  48  MET MET C . n 
E 3 49  GLU 49  49  49  GLU GLU C . n 
E 3 50  ARG 50  50  50  ARG ARG C . n 
E 3 51  ASP 51  51  51  ASP ASP C . n 
E 3 52  GLY 52  52  52  GLY GLY C . n 
E 3 53  LEU 53  53  53  LEU LEU C . n 
E 3 54  LEU 54  54  54  LEU LEU C . n 
E 3 55  ARG 55  55  55  ARG ARG C . n 
E 3 56  VAL 56  56  56  VAL VAL C . n 
E 3 57  ALA 57  57  57  ALA ALA C . n 
E 3 58  GLY 58  58  58  GLY GLY C . n 
E 3 59  ASP 59  59  59  ASP ASP C . n 
E 3 60  ARG 60  60  60  ARG ARG C . n 
E 3 61  HIS 61  61  61  HIS HIS C . n 
E 3 62  LEU 62  62  62  LEU LEU C . n 
E 3 63  GLU 63  63  63  GLU GLU C . n 
E 3 64  LEU 64  64  64  LEU LEU C . n 
E 3 65  THR 65  65  65  THR THR C . n 
E 3 66  GLU 66  66  66  GLU GLU C . n 
E 3 67  LYS 67  67  67  LYS LYS C . n 
E 3 68  GLY 68  68  68  GLY GLY C . n 
E 3 69  ARG 69  69  69  ARG ARG C . n 
E 3 70  ALA 70  70  70  ALA ALA C . n 
E 3 71  LEU 71  71  71  LEU LEU C . n 
E 3 72  ALA 72  72  72  ALA ALA C . n 
E 3 73  ILE 73  73  73  ILE ILE C . n 
E 3 74  ALA 74  74  74  ALA ALA C . n 
E 3 75  VAL 75  75  75  VAL VAL C . n 
E 3 76  MET 76  76  76  MET MET C . n 
E 3 77  ARG 77  77  77  ARG ARG C . n 
E 3 78  LYS 78  78  78  LYS LYS C . n 
E 3 79  HIS 79  79  79  HIS HIS C . n 
E 3 80  ARG 80  80  80  ARG ARG C . n 
E 3 81  LEU 81  81  81  LEU LEU C . n 
E 3 82  ALA 82  82  82  ALA ALA C . n 
E 3 83  GLU 83  83  83  GLU GLU C . n 
E 3 84  ARG 84  84  84  ARG ARG C . n 
E 3 85  LEU 85  85  85  LEU LEU C . n 
E 3 86  LEU 86  86  86  LEU LEU C . n 
E 3 87  VAL 87  87  87  VAL VAL C . n 
E 3 88  ASP 88  88  88  ASP ASP C . n 
E 3 89  VAL 89  89  89  VAL VAL C . n 
E 3 90  ILE 90  90  90  ILE ILE C . n 
E 3 91  GLY 91  91  91  GLY GLY C . n 
E 3 92  LEU 92  92  92  LEU LEU C . n 
E 3 93  PRO 93  93  93  PRO PRO C . n 
E 3 94  TRP 94  94  94  TRP TRP C . n 
E 3 95  GLU 95  95  95  GLU GLU C . n 
E 3 96  GLU 96  96  96  GLU GLU C . n 
E 3 97  VAL 97  97  97  VAL VAL C . n 
E 3 98  HIS 98  98  98  HIS HIS C . n 
E 3 99  ALA 99  99  99  ALA ALA C . n 
E 3 100 GLU 100 100 100 GLU GLU C . n 
E 3 101 ALA 101 101 101 ALA ALA C . n 
E 3 102 CYS 102 102 102 CYS CYS C . n 
E 3 103 ARG 103 103 103 ARG ARG C . n 
E 3 104 TRP 104 104 104 TRP TRP C . n 
E 3 105 GLU 105 105 105 GLU GLU C . n 
E 3 106 HIS 106 106 106 HIS HIS C . n 
E 3 107 VAL 107 107 107 VAL VAL C . n 
E 3 108 MET 108 108 108 MET MET C . n 
E 3 109 SER 109 109 109 SER SER C . n 
E 3 110 GLU 110 110 110 GLU GLU C . n 
E 3 111 ASP 111 111 111 ASP ASP C . n 
E 3 112 VAL 112 112 112 VAL VAL C . n 
E 3 113 GLU 113 113 113 GLU GLU C . n 
E 3 114 ARG 114 114 114 ARG ARG C . n 
E 3 115 ARG 115 115 115 ARG ARG C . n 
E 3 116 LEU 116 116 116 LEU LEU C . n 
E 3 117 VAL 117 117 117 VAL VAL C . n 
E 3 118 LYS 118 118 118 LYS LYS C . n 
E 3 119 VAL 119 119 119 VAL VAL C . n 
E 3 120 LEU 120 120 120 LEU LEU C . n 
E 3 121 ASN 121 121 121 ASN ASN C . n 
E 3 122 ASN 122 122 122 ASN ASN C . n 
E 3 123 PRO 123 123 123 PRO PRO C . n 
E 3 124 THR 124 124 124 THR THR C . n 
E 3 125 THR 125 125 125 THR THR C . n 
E 3 126 SER 126 126 126 SER SER C . n 
E 3 127 PRO 127 127 127 PRO PRO C . n 
E 3 128 PHE 128 128 128 PHE PHE C . n 
E 3 129 GLY 129 129 129 GLY GLY C . n 
E 3 130 ASN 130 130 130 ASN ASN C . n 
E 3 131 PRO 131 131 131 PRO PRO C . n 
E 3 132 ILE 132 132 132 ILE ILE C . n 
E 3 133 PRO 133 133 133 PRO PRO C . n 
E 3 134 GLY 134 134 134 GLY GLY C . n 
E 3 135 LEU 135 135 135 LEU LEU C . n 
E 3 136 VAL 136 136 136 VAL VAL C . n 
E 3 137 GLU 137 137 137 GLU GLU C . n 
E 3 138 LEU 138 138 138 LEU LEU C . n 
E 3 139 GLY 139 139 139 GLY GLY C . n 
E 3 140 VAL 140 140 140 VAL VAL C . n 
E 3 141 ALA 141 141 ?   ?   ?   C . n 
E 3 142 SER 142 142 ?   ?   ?   C . n 
E 3 143 GLU 143 143 ?   ?   ?   C . n 
E 3 144 ASN 144 144 ?   ?   ?   C . n 
E 3 145 LEU 145 145 ?   ?   ?   C . n 
E 3 146 TYR 146 146 ?   ?   ?   C . n 
E 3 147 PHE 147 147 ?   ?   ?   C . n 
E 3 148 GLN 148 148 ?   ?   ?   C . n 
E 3 149 GLY 149 149 ?   ?   ?   C . n 
E 3 150 GLY 150 150 ?   ?   ?   C . n 
E 3 151 GLY 151 151 ?   ?   ?   C . n 
E 3 152 HIS 152 152 ?   ?   ?   C . n 
E 3 153 HIS 153 153 ?   ?   ?   C . n 
E 3 154 HIS 154 154 ?   ?   ?   C . n 
E 3 155 HIS 155 155 ?   ?   ?   C . n 
E 3 156 HIS 156 156 ?   ?   ?   C . n 
E 3 157 HIS 157 157 ?   ?   ?   C . n 
F 3 1   MET 1   1   1   MET MET D . n 
F 3 2   ASN 2   2   2   ASN ASN D . n 
F 3 3   GLU 3   3   3   GLU GLU D . n 
F 3 4   LEU 4   4   4   LEU LEU D . n 
F 3 5   VAL 5   5   5   VAL VAL D . n 
F 3 6   ASP 6   6   6   ASP ASP D . n 
F 3 7   THR 7   7   7   THR THR D . n 
F 3 8   THR 8   8   8   THR THR D . n 
F 3 9   GLU 9   9   9   GLU GLU D . n 
F 3 10  MET 10  10  10  MET MET D . n 
F 3 11  TYR 11  11  11  TYR TYR D . n 
F 3 12  LEU 12  12  12  LEU LEU D . n 
F 3 13  ARG 13  13  13  ARG ARG D . n 
F 3 14  THR 14  14  14  THR THR D . n 
F 3 15  ILE 15  15  15  ILE ILE D . n 
F 3 16  TYR 16  16  16  TYR TYR D . n 
F 3 17  ASP 17  17  17  ASP ASP D . n 
F 3 18  LEU 18  18  18  LEU LEU D . n 
F 3 19  GLU 19  19  19  GLU GLU D . n 
F 3 20  GLU 20  20  20  GLU GLU D . n 
F 3 21  GLU 21  21  21  GLU GLU D . n 
F 3 22  GLY 22  22  22  GLY GLY D . n 
F 3 23  VAL 23  23  23  VAL VAL D . n 
F 3 24  THR 24  24  24  THR THR D . n 
F 3 25  PRO 25  25  25  PRO PRO D . n 
F 3 26  LEU 26  26  26  LEU LEU D . n 
F 3 27  ARG 27  27  27  ARG ARG D . n 
F 3 28  ALA 28  28  28  ALA ALA D . n 
F 3 29  ARG 29  29  29  ARG ARG D . n 
F 3 30  ILE 30  30  30  ILE ILE D . n 
F 3 31  ALA 31  31  31  ALA ALA D . n 
F 3 32  GLU 32  32  32  GLU GLU D . n 
F 3 33  ARG 33  33  33  ARG ARG D . n 
F 3 34  LEU 34  34  34  LEU LEU D . n 
F 3 35  ASP 35  35  35  ASP ASP D . n 
F 3 36  GLN 36  36  36  GLN GLN D . n 
F 3 37  SER 37  37  37  SER SER D . n 
F 3 38  GLY 38  38  38  GLY GLY D . n 
F 3 39  PRO 39  39  39  PRO PRO D . n 
F 3 40  THR 40  40  40  THR THR D . n 
F 3 41  VAL 41  41  41  VAL VAL D . n 
F 3 42  SER 42  42  42  SER SER D . n 
F 3 43  GLN 43  43  43  GLN GLN D . n 
F 3 44  THR 44  44  44  THR THR D . n 
F 3 45  VAL 45  45  45  VAL VAL D . n 
F 3 46  SER 46  46  46  SER SER D . n 
F 3 47  ARG 47  47  47  ARG ARG D . n 
F 3 48  MET 48  48  48  MET MET D . n 
F 3 49  GLU 49  49  49  GLU GLU D . n 
F 3 50  ARG 50  50  50  ARG ARG D . n 
F 3 51  ASP 51  51  51  ASP ASP D . n 
F 3 52  GLY 52  52  52  GLY GLY D . n 
F 3 53  LEU 53  53  53  LEU LEU D . n 
F 3 54  LEU 54  54  54  LEU LEU D . n 
F 3 55  ARG 55  55  55  ARG ARG D . n 
F 3 56  VAL 56  56  56  VAL VAL D . n 
F 3 57  ALA 57  57  57  ALA ALA D . n 
F 3 58  GLY 58  58  58  GLY GLY D . n 
F 3 59  ASP 59  59  59  ASP ASP D . n 
F 3 60  ARG 60  60  60  ARG ARG D . n 
F 3 61  HIS 61  61  61  HIS HIS D . n 
F 3 62  LEU 62  62  62  LEU LEU D . n 
F 3 63  GLU 63  63  63  GLU GLU D . n 
F 3 64  LEU 64  64  64  LEU LEU D . n 
F 3 65  THR 65  65  65  THR THR D . n 
F 3 66  GLU 66  66  66  GLU GLU D . n 
F 3 67  LYS 67  67  67  LYS LYS D . n 
F 3 68  GLY 68  68  68  GLY GLY D . n 
F 3 69  ARG 69  69  69  ARG ARG D . n 
F 3 70  ALA 70  70  70  ALA ALA D . n 
F 3 71  LEU 71  71  71  LEU LEU D . n 
F 3 72  ALA 72  72  72  ALA ALA D . n 
F 3 73  ILE 73  73  73  ILE ILE D . n 
F 3 74  ALA 74  74  74  ALA ALA D . n 
F 3 75  VAL 75  75  75  VAL VAL D . n 
F 3 76  MET 76  76  76  MET MET D . n 
F 3 77  ARG 77  77  77  ARG ARG D . n 
F 3 78  LYS 78  78  78  LYS LYS D . n 
F 3 79  HIS 79  79  79  HIS HIS D . n 
F 3 80  ARG 80  80  80  ARG ARG D . n 
F 3 81  LEU 81  81  81  LEU LEU D . n 
F 3 82  ALA 82  82  82  ALA ALA D . n 
F 3 83  GLU 83  83  83  GLU GLU D . n 
F 3 84  ARG 84  84  84  ARG ARG D . n 
F 3 85  LEU 85  85  85  LEU LEU D . n 
F 3 86  LEU 86  86  86  LEU LEU D . n 
F 3 87  VAL 87  87  87  VAL VAL D . n 
F 3 88  ASP 88  88  88  ASP ASP D . n 
F 3 89  VAL 89  89  89  VAL VAL D . n 
F 3 90  ILE 90  90  90  ILE ILE D . n 
F 3 91  GLY 91  91  91  GLY GLY D . n 
F 3 92  LEU 92  92  92  LEU LEU D . n 
F 3 93  PRO 93  93  93  PRO PRO D . n 
F 3 94  TRP 94  94  94  TRP TRP D . n 
F 3 95  GLU 95  95  95  GLU GLU D . n 
F 3 96  GLU 96  96  96  GLU GLU D . n 
F 3 97  VAL 97  97  97  VAL VAL D . n 
F 3 98  HIS 98  98  98  HIS HIS D . n 
F 3 99  ALA 99  99  99  ALA ALA D . n 
F 3 100 GLU 100 100 100 GLU GLU D . n 
F 3 101 ALA 101 101 101 ALA ALA D . n 
F 3 102 CYS 102 102 102 CYS CYS D . n 
F 3 103 ARG 103 103 103 ARG ARG D . n 
F 3 104 TRP 104 104 104 TRP TRP D . n 
F 3 105 GLU 105 105 105 GLU GLU D . n 
F 3 106 HIS 106 106 106 HIS HIS D . n 
F 3 107 VAL 107 107 107 VAL VAL D . n 
F 3 108 MET 108 108 108 MET MET D . n 
F 3 109 SER 109 109 109 SER SER D . n 
F 3 110 GLU 110 110 110 GLU GLU D . n 
F 3 111 ASP 111 111 111 ASP ASP D . n 
F 3 112 VAL 112 112 112 VAL VAL D . n 
F 3 113 GLU 113 113 113 GLU GLU D . n 
F 3 114 ARG 114 114 114 ARG ARG D . n 
F 3 115 ARG 115 115 115 ARG ARG D . n 
F 3 116 LEU 116 116 116 LEU LEU D . n 
F 3 117 VAL 117 117 117 VAL VAL D . n 
F 3 118 LYS 118 118 118 LYS LYS D . n 
F 3 119 VAL 119 119 119 VAL VAL D . n 
F 3 120 LEU 120 120 120 LEU LEU D . n 
F 3 121 ASN 121 121 121 ASN ASN D . n 
F 3 122 ASN 122 122 122 ASN ASN D . n 
F 3 123 PRO 123 123 123 PRO PRO D . n 
F 3 124 THR 124 124 124 THR THR D . n 
F 3 125 THR 125 125 125 THR THR D . n 
F 3 126 SER 126 126 126 SER SER D . n 
F 3 127 PRO 127 127 127 PRO PRO D . n 
F 3 128 PHE 128 128 128 PHE PHE D . n 
F 3 129 GLY 129 129 129 GLY GLY D . n 
F 3 130 ASN 130 130 130 ASN ASN D . n 
F 3 131 PRO 131 131 131 PRO PRO D . n 
F 3 132 ILE 132 132 132 ILE ILE D . n 
F 3 133 PRO 133 133 133 PRO PRO D . n 
F 3 134 GLY 134 134 134 GLY GLY D . n 
F 3 135 LEU 135 135 135 LEU LEU D . n 
F 3 136 VAL 136 136 136 VAL VAL D . n 
F 3 137 GLU 137 137 137 GLU GLU D . n 
F 3 138 LEU 138 138 138 LEU LEU D . n 
F 3 139 GLY 139 139 139 GLY GLY D . n 
F 3 140 VAL 140 140 140 VAL VAL D . n 
F 3 141 ALA 141 141 ?   ?   ?   D . n 
F 3 142 SER 142 142 ?   ?   ?   D . n 
F 3 143 GLU 143 143 ?   ?   ?   D . n 
F 3 144 ASN 144 144 ?   ?   ?   D . n 
F 3 145 LEU 145 145 ?   ?   ?   D . n 
F 3 146 TYR 146 146 ?   ?   ?   D . n 
F 3 147 PHE 147 147 ?   ?   ?   D . n 
F 3 148 GLN 148 148 ?   ?   ?   D . n 
F 3 149 GLY 149 149 ?   ?   ?   D . n 
F 3 150 GLY 150 150 ?   ?   ?   D . n 
F 3 151 GLY 151 151 ?   ?   ?   D . n 
F 3 152 HIS 152 152 ?   ?   ?   D . n 
F 3 153 HIS 153 153 ?   ?   ?   D . n 
F 3 154 HIS 154 154 ?   ?   ?   D . n 
F 3 155 HIS 155 155 ?   ?   ?   D . n 
F 3 156 HIS 156 156 ?   ?   ?   D . n 
F 3 157 HIS 157 157 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  4 NI  1  1001 1001 NI  NI  A . 
H  4 NI  1  1002 1002 NI  NI  A . 
I  4 NI  1  1003 1003 NI  NI  A . 
J  5 NA  1  2001 2001 NA  NA  A . 
K  4 NI  1  1001 1001 NI  NI  B . 
L  4 NI  1  1002 1002 NI  NI  B . 
M  4 NI  1  1003 1003 NI  NI  B . 
N  4 NI  1  1001 1001 NI  NI  C . 
O  4 NI  1  1002 1002 NI  NI  C . 
P  4 NI  1  1003 1003 NI  NI  C . 
Q  5 NA  1  2001 2001 NA  NA  C . 
R  4 NI  1  1001 1001 NI  NI  D . 
S  4 NI  1  1002 1002 NI  NI  D . 
T  4 NI  1  1003 1003 NI  NI  D . 
U  5 NA  1  2001 2001 NA  NA  D . 
V  6 HOH 1  34   5    HOH HOH E . 
V  6 HOH 2  35   11   HOH HOH E . 
V  6 HOH 3  36   16   HOH HOH E . 
V  6 HOH 4  37   20   HOH HOH E . 
V  6 HOH 5  38   25   HOH HOH E . 
V  6 HOH 6  39   26   HOH HOH E . 
V  6 HOH 7  40   30   HOH HOH E . 
V  6 HOH 8  41   32   HOH HOH E . 
V  6 HOH 9  42   39   HOH HOH E . 
V  6 HOH 10 43   44   HOH HOH E . 
V  6 HOH 11 44   47   HOH HOH E . 
V  6 HOH 12 45   50   HOH HOH E . 
V  6 HOH 13 46   53   HOH HOH E . 
V  6 HOH 14 47   61   HOH HOH E . 
V  6 HOH 15 48   71   HOH HOH E . 
V  6 HOH 16 49   72   HOH HOH E . 
V  6 HOH 17 50   74   HOH HOH E . 
V  6 HOH 18 51   78   HOH HOH E . 
V  6 HOH 19 52   92   HOH HOH E . 
V  6 HOH 20 53   103  HOH HOH E . 
V  6 HOH 21 54   105  HOH HOH E . 
V  6 HOH 22 55   113  HOH HOH E . 
V  6 HOH 23 56   124  HOH HOH E . 
V  6 HOH 24 57   134  HOH HOH E . 
V  6 HOH 25 58   140  HOH HOH E . 
W  6 HOH 1  34   1    HOH HOH F . 
W  6 HOH 2  35   2    HOH HOH F . 
W  6 HOH 3  36   3    HOH HOH F . 
W  6 HOH 4  37   14   HOH HOH F . 
W  6 HOH 5  38   15   HOH HOH F . 
W  6 HOH 6  39   19   HOH HOH F . 
W  6 HOH 7  40   35   HOH HOH F . 
W  6 HOH 8  41   46   HOH HOH F . 
W  6 HOH 9  42   58   HOH HOH F . 
W  6 HOH 10 43   64   HOH HOH F . 
W  6 HOH 11 44   67   HOH HOH F . 
W  6 HOH 12 45   73   HOH HOH F . 
W  6 HOH 13 46   82   HOH HOH F . 
W  6 HOH 14 47   88   HOH HOH F . 
W  6 HOH 15 48   109  HOH HOH F . 
W  6 HOH 16 49   119  HOH HOH F . 
W  6 HOH 17 50   121  HOH HOH F . 
W  6 HOH 18 51   122  HOH HOH F . 
X  6 HOH 1  2002 4    HOH HOH A . 
X  6 HOH 2  2003 6    HOH HOH A . 
X  6 HOH 3  2004 12   HOH HOH A . 
X  6 HOH 4  2005 23   HOH HOH A . 
X  6 HOH 5  2006 24   HOH HOH A . 
X  6 HOH 6  2007 31   HOH HOH A . 
X  6 HOH 7  2008 34   HOH HOH A . 
X  6 HOH 8  2009 37   HOH HOH A . 
X  6 HOH 9  2010 49   HOH HOH A . 
X  6 HOH 10 2011 55   HOH HOH A . 
X  6 HOH 11 2012 57   HOH HOH A . 
X  6 HOH 12 2013 60   HOH HOH A . 
X  6 HOH 13 2014 62   HOH HOH A . 
X  6 HOH 14 2015 66   HOH HOH A . 
X  6 HOH 15 2016 68   HOH HOH A . 
X  6 HOH 16 2017 69   HOH HOH A . 
X  6 HOH 17 2018 76   HOH HOH A . 
X  6 HOH 18 2019 77   HOH HOH A . 
X  6 HOH 19 2020 80   HOH HOH A . 
X  6 HOH 20 2021 81   HOH HOH A . 
X  6 HOH 21 2022 83   HOH HOH A . 
X  6 HOH 22 2023 93   HOH HOH A . 
X  6 HOH 23 2024 94   HOH HOH A . 
X  6 HOH 24 2025 98   HOH HOH A . 
X  6 HOH 25 2026 102  HOH HOH A . 
X  6 HOH 26 2027 107  HOH HOH A . 
X  6 HOH 27 2028 115  HOH HOH A . 
X  6 HOH 28 2029 123  HOH HOH A . 
X  6 HOH 29 2030 136  HOH HOH A . 
X  6 HOH 30 2031 137  HOH HOH A . 
Y  6 HOH 1  1004 9    HOH HOH B . 
Y  6 HOH 2  1005 10   HOH HOH B . 
Y  6 HOH 3  1006 17   HOH HOH B . 
Y  6 HOH 4  1007 21   HOH HOH B . 
Y  6 HOH 5  1008 27   HOH HOH B . 
Y  6 HOH 6  1009 33   HOH HOH B . 
Y  6 HOH 7  1010 36   HOH HOH B . 
Y  6 HOH 8  1011 40   HOH HOH B . 
Y  6 HOH 9  1012 51   HOH HOH B . 
Y  6 HOH 10 1013 54   HOH HOH B . 
Y  6 HOH 11 1014 56   HOH HOH B . 
Y  6 HOH 12 1015 59   HOH HOH B . 
Y  6 HOH 13 1016 65   HOH HOH B . 
Y  6 HOH 14 1017 70   HOH HOH B . 
Y  6 HOH 15 1018 79   HOH HOH B . 
Y  6 HOH 16 1019 85   HOH HOH B . 
Y  6 HOH 17 1020 87   HOH HOH B . 
Y  6 HOH 18 1021 100  HOH HOH B . 
Y  6 HOH 19 1022 106  HOH HOH B . 
Y  6 HOH 20 1023 108  HOH HOH B . 
Y  6 HOH 21 1024 110  HOH HOH B . 
Y  6 HOH 22 1025 112  HOH HOH B . 
Y  6 HOH 23 1026 116  HOH HOH B . 
Y  6 HOH 24 1027 125  HOH HOH B . 
Y  6 HOH 25 1028 138  HOH HOH B . 
Y  6 HOH 26 1029 139  HOH HOH B . 
Y  6 HOH 27 1030 142  HOH HOH B . 
Z  6 HOH 1  2002 7    HOH HOH C . 
Z  6 HOH 2  2003 13   HOH HOH C . 
Z  6 HOH 3  2004 22   HOH HOH C . 
Z  6 HOH 4  2005 28   HOH HOH C . 
Z  6 HOH 5  2006 29   HOH HOH C . 
Z  6 HOH 6  2007 38   HOH HOH C . 
Z  6 HOH 7  2008 42   HOH HOH C . 
Z  6 HOH 8  2009 43   HOH HOH C . 
Z  6 HOH 9  2010 52   HOH HOH C . 
Z  6 HOH 10 2011 86   HOH HOH C . 
Z  6 HOH 11 2012 89   HOH HOH C . 
Z  6 HOH 12 2013 90   HOH HOH C . 
Z  6 HOH 13 2014 96   HOH HOH C . 
Z  6 HOH 14 2015 101  HOH HOH C . 
Z  6 HOH 15 2016 104  HOH HOH C . 
Z  6 HOH 16 2017 111  HOH HOH C . 
Z  6 HOH 17 2018 117  HOH HOH C . 
Z  6 HOH 18 2019 118  HOH HOH C . 
Z  6 HOH 19 2020 126  HOH HOH C . 
Z  6 HOH 20 2021 127  HOH HOH C . 
Z  6 HOH 21 2022 128  HOH HOH C . 
Z  6 HOH 22 2023 129  HOH HOH C . 
Z  6 HOH 23 2024 130  HOH HOH C . 
Z  6 HOH 24 2025 141  HOH HOH C . 
AA 6 HOH 1  2002 8    HOH HOH D . 
AA 6 HOH 2  2003 18   HOH HOH D . 
AA 6 HOH 3  2004 41   HOH HOH D . 
AA 6 HOH 4  2005 45   HOH HOH D . 
AA 6 HOH 5  2006 48   HOH HOH D . 
AA 6 HOH 6  2007 63   HOH HOH D . 
AA 6 HOH 7  2008 75   HOH HOH D . 
AA 6 HOH 8  2009 84   HOH HOH D . 
AA 6 HOH 9  2010 91   HOH HOH D . 
AA 6 HOH 10 2011 95   HOH HOH D . 
AA 6 HOH 11 2012 97   HOH HOH D . 
AA 6 HOH 12 2013 99   HOH HOH D . 
AA 6 HOH 13 2014 114  HOH HOH D . 
AA 6 HOH 14 2015 120  HOH HOH D . 
AA 6 HOH 15 2016 131  HOH HOH D . 
AA 6 HOH 16 2017 132  HOH HOH D . 
AA 6 HOH 17 2018 133  HOH HOH D . 
AA 6 HOH 18 2019 135  HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 O   ? X  HOH .   ? A HOH 2030 ? 1_555 87.6  ? 
2  OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 84.0  ? 
3  O   ? X  HOH .   ? A HOH 2030 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 127.1 ? 
4  OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 120.3 ? 
5  O   ? X  HOH .   ? A HOH 2030 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 136.5 ? 
6  NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 90.9  ? 
7  SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 88.5  ? 
8  SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 94.7  ? 
9  OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 89.6  ? 
10 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? X  HOH .   ? A HOH 2013 ? 1_555 89.2  ? 
11 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? X  HOH .   ? A HOH 2013 ? 1_555 172.8 ? 
12 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? X  HOH .   ? A HOH 2013 ? 1_555 83.8  ? 
13 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 177.0 ? 
14 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 93.1  ? 
15 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 82.8  ? 
16 O   ? X  HOH .   ? A HOH 2013 ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 89.0  ? 
17 O   ? X  HOH .   ? A HOH 2029 ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? W  HOH .   ? F HOH 51   ? 1_555 85.3  ? 
18 O   ? X  HOH .   ? A HOH 2029 ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? W  HOH .   ? F HOH 50   ? 1_555 93.6  ? 
19 O   ? W  HOH .   ? F HOH 51   ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? W  HOH .   ? F HOH 50   ? 1_555 151.6 ? 
20 O   ? X  HOH .   ? A HOH 2029 ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? X  HOH .   ? A HOH 2028 ? 1_555 68.1  ? 
21 O   ? W  HOH .   ? F HOH 51   ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? X  HOH .   ? A HOH 2028 ? 1_555 110.4 ? 
22 O   ? W  HOH .   ? F HOH 50   ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 O   ? X  HOH .   ? A HOH 2028 ? 1_555 95.3  ? 
23 O   ? X  HOH .   ? A HOH 2029 ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 OP1 ? B  DC  19  ? F DC  19   ? 1_555 145.8 ? 
24 O   ? W  HOH .   ? F HOH 51   ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 OP1 ? B  DC  19  ? F DC  19   ? 1_555 65.4  ? 
25 O   ? W  HOH .   ? F HOH 50   ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 OP1 ? B  DC  19  ? F DC  19   ? 1_555 103.9 ? 
26 O   ? X  HOH .   ? A HOH 2028 ? 1_555 NA ? J NA . ? A NA 2001 ? 1_555 OP1 ? B  DC  19  ? F DC  19   ? 1_555 137.2 ? 
27 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 O   ? Y  HOH .   ? B HOH 1028 ? 1_555 149.1 ? 
28 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 105.4 ? 
29 O   ? Y  HOH .   ? B HOH 1028 ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 105.5 ? 
30 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 82.7  ? 
31 O   ? Y  HOH .   ? B HOH 1028 ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 91.0  ? 
32 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 NI ? K NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 103.7 ? 
33 SD  ? D  MET 10  ? B MET 10   ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 87.9  ? 
34 SD  ? D  MET 10  ? B MET 10   ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 O   ? D  CYS 102 ? B CYS 102  ? 1_555 177.6 ? 
35 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 O   ? D  CYS 102 ? B CYS 102  ? 1_555 90.3  ? 
36 SD  ? D  MET 10  ? B MET 10   ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 92.1  ? 
37 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 82.2  ? 
38 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 86.2  ? 
39 SD  ? D  MET 10  ? B MET 10   ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 101.1 ? 
40 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 103.5 ? 
41 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 80.8  ? 
42 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 NI ? L NI . ? B NI 1002 ? 1_555 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 165.8 ? 
43 O   ? Y  HOH .   ? B HOH 1030 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 O   ? Y  HOH .   ? B HOH 1019 ? 1_555 147.9 ? 
44 O   ? Y  HOH .   ? B HOH 1030 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 O   ? Y  HOH .   ? B HOH 1009 ? 1_555 90.2  ? 
45 O   ? Y  HOH .   ? B HOH 1019 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 O   ? Y  HOH .   ? B HOH 1009 ? 1_555 73.1  ? 
46 O   ? Y  HOH .   ? B HOH 1030 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 ND1 ? D  HIS 61  ? B HIS 61   ? 1_555 106.5 ? 
47 O   ? Y  HOH .   ? B HOH 1019 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 ND1 ? D  HIS 61  ? B HIS 61   ? 1_555 104.1 ? 
48 O   ? Y  HOH .   ? B HOH 1009 ? 1_555 NI ? M NI . ? B NI 1003 ? 1_555 ND1 ? D  HIS 61  ? B HIS 61   ? 1_555 104.2 ? 
49 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 NI ? N NI . ? C NI 1001 ? 1_555 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 136.8 ? 
50 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 NI ? N NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 88.9  ? 
51 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 NI ? N NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 95.9  ? 
52 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 85.6  ? 
53 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 O   ? E  CYS 102 ? C CYS 102  ? 1_555 87.5  ? 
54 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 O   ? E  CYS 102 ? C CYS 102  ? 1_555 94.5  ? 
55 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 O   ? Z  HOH .   ? C HOH 2020 ? 1_555 90.8  ? 
56 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 O   ? Z  HOH .   ? C HOH 2020 ? 1_555 175.8 ? 
57 O   ? E  CYS 102 ? C CYS 102  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 O   ? Z  HOH .   ? C HOH 2020 ? 1_555 83.2  ? 
58 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 86.1  ? 
59 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 87.0  ? 
60 O   ? E  CYS 102 ? C CYS 102  ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 173.3 ? 
61 O   ? Z  HOH .   ? C HOH 2020 ? 1_555 NI ? O NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 94.8  ? 
62 O   ? Z  HOH .   ? C HOH 2024 ? 1_555 NI ? P NI . ? C NI 1003 ? 1_555 O   ? Z  HOH .   ? C HOH 2023 ? 1_555 57.4  ? 
63 O   ? Z  HOH .   ? C HOH 2024 ? 1_555 NI ? P NI . ? C NI 1003 ? 1_555 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 133.5 ? 
64 O   ? Z  HOH .   ? C HOH 2023 ? 1_555 NI ? P NI . ? C NI 1003 ? 1_555 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 102.1 ? 
65 O   ? V  HOH .   ? E HOH 55   ? 1_555 NA ? Q NA . ? C NA 2001 ? 1_555 O   ? Z  HOH .   ? C HOH 2018 ? 1_555 81.0  ? 
66 O   ? V  HOH .   ? E HOH 55   ? 1_555 NA ? Q NA . ? C NA 2001 ? 1_555 O   ? V  HOH .   ? E HOH 58   ? 1_555 136.1 ? 
67 O   ? Z  HOH .   ? C HOH 2018 ? 1_555 NA ? Q NA . ? C NA 2001 ? 1_555 O   ? V  HOH .   ? E HOH 58   ? 1_555 142.7 ? 
68 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 88.3  ? 
69 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 O   ? AA HOH .   ? D HOH 2017 ? 1_555 146.7 ? 
70 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 O   ? AA HOH .   ? D HOH 2017 ? 1_555 96.2  ? 
71 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 97.0  ? 
72 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 123.8 ? 
73 O   ? AA HOH .   ? D HOH 2017 ? 1_555 NI ? R NI . ? D NI 1001 ? 1_555 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 107.5 ? 
74 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 O   ? F  CYS 102 ? D CYS 102  ? 1_555 98.8  ? 
75 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 SD  ? F  MET 10  ? D MET 10   ? 1_555 91.4  ? 
76 O   ? F  CYS 102 ? D CYS 102  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 SD  ? F  MET 10  ? D MET 10   ? 1_555 164.5 ? 
77 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 97.2  ? 
78 O   ? F  CYS 102 ? D CYS 102  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 98.2  ? 
79 SD  ? F  MET 10  ? D MET 10   ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 92.0  ? 
80 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 O   ? AA HOH .   ? D HOH 2006 ? 1_555 176.3 ? 
81 O   ? F  CYS 102 ? D CYS 102  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 O   ? AA HOH .   ? D HOH 2006 ? 1_555 78.2  ? 
82 SD  ? F  MET 10  ? D MET 10   ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 O   ? AA HOH .   ? D HOH 2006 ? 1_555 91.1  ? 
83 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 NI ? S NI . ? D NI 1002 ? 1_555 O   ? AA HOH .   ? D HOH 2006 ? 1_555 85.4  ? 
84 O   ? AA HOH .   ? D HOH 2019 ? 1_555 NI ? T NI . ? D NI 1003 ? 1_555 O   ? AA HOH .   ? D HOH 2018 ? 1_555 92.9  ? 
85 O   ? AA HOH .   ? D HOH 2019 ? 1_555 NI ? T NI . ? D NI 1003 ? 1_555 ND1 ? F  HIS 61  ? D HIS 61   ? 1_555 94.4  ? 
86 O   ? AA HOH .   ? D HOH 2018 ? 1_555 NI ? T NI . ? D NI 1003 ? 1_555 ND1 ? F  HIS 61  ? D HIS 61   ? 1_555 120.2 ? 
87 O   ? AA HOH .   ? D HOH 2014 ? 1_555 NA ? U NA . ? D NA 2001 ? 1_555 O   ? AA HOH .   ? D HOH 2015 ? 1_555 81.2  ? 
88 O   ? AA HOH .   ? D HOH 2014 ? 1_555 NA ? U NA . ? D NA 2001 ? 1_555 O   ? W  HOH .   ? F HOH 49   ? 1_555 100.9 ? 
89 O   ? AA HOH .   ? D HOH 2015 ? 1_555 NA ? U NA . ? D NA 2001 ? 1_555 O   ? W  HOH .   ? F HOH 49   ? 1_555 84.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             2.400 
_diffrn_reflns.pdbx_d_res_low              50.000 
_diffrn_reflns.pdbx_number_obs             34892 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.075 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.05 
_diffrn_reflns.av_sigmaI_over_netI         8.90 
_diffrn_reflns.pdbx_redundancy             ? 
_diffrn_reflns.pdbx_percent_possible_obs   90.40 
_diffrn_reflns.number                      65232 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 5.17 50.00 ? ? 0.043 ? 1.035 ? 98.50 
1 4.10 5.17  ? ? 0.050 ? 1.040 ? 97.70 
1 3.58 4.10  ? ? 0.061 ? 1.050 ? 97.50 
1 3.26 3.58  ? ? 0.086 ? 1.055 ? 97.40 
1 3.02 3.26  ? ? 0.122 ? 1.039 ? 97.50 
1 2.85 3.02  ? ? 0.169 ? 1.076 ? 97.80 
1 2.70 2.85  ? ? 0.211 ? 1.065 ? 95.40 
1 2.59 2.70  ? ? 0.254 ? 1.059 ? 86.80 
1 2.49 2.59  ? ? 0.286 ? 1.018 ? 74.70 
1 2.40 2.49  ? ? 0.296 ? 1.001 ? 60.70 
# 
_pdbx_phasing_MR.entry_id                     2ISZ 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.261 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.835 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           48.840 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        48.840 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
MOLREP      .        ?                other   'A. Vagin'           alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html      Fortran_77 ? 3 
REFMAC      5.2.0005 ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?          ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 B ASP 111  ? ? NH1 B ARG 115  ? ? 2.18 
2 1 O   C HOH 2023 ? ? O   C HOH 2024 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            F 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             13 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            F 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             13 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.383 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.036 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" E DC 1  ? ? "C4'" E DC 1  ? ? "C3'" E DC 1  ? ? 100.60 104.50 -3.90 0.40 N 
2  1 "O4'" E DC 1  ? ? "C1'" E DC 1  ? ? N1    E DC 1  ? ? 110.41 108.30 2.11  0.30 N 
3  1 "O4'" E DT 4  ? ? "C1'" E DT 4  ? ? N1    E DT 4  ? ? 110.83 108.30 2.53  0.30 N 
4  1 "O4'" E DG 5  ? ? "C1'" E DG 5  ? ? N9    E DG 5  ? ? 110.22 108.30 1.92  0.30 N 
5  1 "O4'" E DA 8  ? ? "C1'" E DA 8  ? ? N9    E DA 8  ? ? 110.50 108.30 2.20  0.30 N 
6  1 "O4'" E DG 9  ? ? "C1'" E DG 9  ? ? N9    E DG 9  ? ? 113.45 108.30 5.15  0.30 N 
7  1 "C3'" E DG 14 ? ? "C2'" E DG 14 ? ? "C1'" E DG 14 ? ? 96.51  102.40 -5.89 0.80 N 
8  1 "O4'" E DG 14 ? ? "C1'" E DG 14 ? ? N9    E DG 14 ? ? 110.90 108.30 2.60  0.30 N 
9  1 "C3'" E DC 19 ? ? "C2'" E DC 19 ? ? "C1'" E DC 19 ? ? 96.02  102.40 -6.38 0.80 N 
10 1 "O4'" E DC 19 ? ? "C1'" E DC 19 ? ? N1    E DC 19 ? ? 110.27 108.30 1.97  0.30 N 
11 1 "O4'" E DC 20 ? ? "C4'" E DC 20 ? ? "C3'" E DC 20 ? ? 100.55 104.50 -3.95 0.40 N 
12 1 "C4'" E DC 20 ? ? "C3'" E DC 20 ? ? "C2'" E DC 20 ? ? 96.73  102.20 -5.47 0.70 N 
13 1 "O4'" E DC 20 ? ? "C1'" E DC 20 ? ? N1    E DC 20 ? ? 111.23 108.30 2.93  0.30 N 
14 1 "O4'" E DA 24 ? ? "C1'" E DA 24 ? ? N9    E DA 24 ? ? 110.79 108.30 2.49  0.30 N 
15 1 "O4'" E DT 25 ? ? "C1'" E DT 25 ? ? N1    E DT 25 ? ? 110.63 108.30 2.33  0.30 N 
16 1 "O4'" E DG 30 ? ? "C1'" E DG 30 ? ? N9    E DG 30 ? ? 111.54 108.30 3.24  0.30 N 
17 1 "O4'" E DT 31 ? ? "C1'" E DT 31 ? ? N1    E DT 31 ? ? 110.52 108.30 2.22  0.30 N 
18 1 "O4'" F DG 12 ? ? "C1'" F DG 12 ? ? N9    F DG 12 ? ? 114.44 108.30 6.14  0.30 N 
19 1 "O4'" F DC 15 ? ? "C1'" F DC 15 ? ? N1    F DC 15 ? ? 112.54 108.30 4.24  0.30 N 
20 1 "C3'" F DG 17 ? ? "C2'" F DG 17 ? ? "C1'" F DG 17 ? ? 97.48  102.40 -4.92 0.80 N 
21 1 "O4'" F DG 17 ? ? "C1'" F DG 17 ? ? N9    F DG 17 ? ? 111.86 108.30 3.56  0.30 N 
22 1 "O4'" F DG 21 ? ? "C1'" F DG 21 ? ? N9    F DG 21 ? ? 111.00 108.30 2.70  0.30 N 
23 1 "O4'" F DG 23 ? ? "C4'" F DG 23 ? ? "C3'" F DG 23 ? ? 100.82 104.50 -3.68 0.40 N 
24 1 "O4'" F DC 24 ? ? "C1'" F DC 24 ? ? N1    F DC 24 ? ? 110.18 108.30 1.88  0.30 N 
25 1 "O4'" F DC 28 ? ? "C1'" F DC 28 ? ? N1    F DC 28 ? ? 110.47 108.30 2.17  0.30 N 
26 1 "O4'" F DG 30 ? ? "C1'" F DG 30 ? ? N9    F DG 30 ? ? 110.38 108.30 2.08  0.30 N 
27 1 "O4'" F DG 31 ? ? "C1'" F DG 31 ? ? N9    F DG 31 ? ? 113.58 108.30 5.28  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 5   ? ? 57.91  -61.54  
2  1 ARG A 60  ? ? 81.66  3.84    
3  1 THR A 65  ? ? -68.91 -165.17 
4  1 GLU A 95  ? ? -68.95 5.04    
5  1 VAL B 5   ? ? 72.38  -56.38  
6  1 PRO B 25  ? ? -69.67 94.42   
7  1 ARG B 60  ? ? 87.24  -13.30  
8  1 VAL C 5   ? ? 71.34  -55.21  
9  1 ASN C 121 ? ? 66.88  72.75   
10 1 ASN C 122 ? ? 27.22  72.79   
11 1 VAL D 5   ? ? 74.98  -60.44  
12 1 ARG D 60  ? ? 81.95  -2.45   
13 1 PRO D 127 ? ? -59.71 -3.24   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C TRP 94 ? CD1 ? E TRP 94 CD1 
2 1 Y 1 C TRP 94 ? CD2 ? E TRP 94 CD2 
3 1 Y 1 C TRP 94 ? NE1 ? E TRP 94 NE1 
4 1 Y 1 C TRP 94 ? CE2 ? E TRP 94 CE2 
5 1 Y 1 C TRP 94 ? CE3 ? E TRP 94 CE3 
6 1 Y 1 C TRP 94 ? CZ2 ? E TRP 94 CZ2 
7 1 Y 1 C TRP 94 ? CZ3 ? E TRP 94 CZ3 
8 1 Y 1 C TRP 94 ? CH2 ? E TRP 94 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 141 ? C ALA 141 
2  1 Y 1 A SER 142 ? C SER 142 
3  1 Y 1 A GLU 143 ? C GLU 143 
4  1 Y 1 A ASN 144 ? C ASN 144 
5  1 Y 1 A LEU 145 ? C LEU 145 
6  1 Y 1 A TYR 146 ? C TYR 146 
7  1 Y 1 A PHE 147 ? C PHE 147 
8  1 Y 1 A GLN 148 ? C GLN 148 
9  1 Y 1 A GLY 149 ? C GLY 149 
10 1 Y 1 A GLY 150 ? C GLY 150 
11 1 Y 1 A GLY 151 ? C GLY 151 
12 1 Y 1 A HIS 152 ? C HIS 152 
13 1 Y 1 A HIS 153 ? C HIS 153 
14 1 Y 1 A HIS 154 ? C HIS 154 
15 1 Y 1 A HIS 155 ? C HIS 155 
16 1 Y 1 A HIS 156 ? C HIS 156 
17 1 Y 1 A HIS 157 ? C HIS 157 
18 1 Y 1 B ALA 141 ? D ALA 141 
19 1 Y 1 B SER 142 ? D SER 142 
20 1 Y 1 B GLU 143 ? D GLU 143 
21 1 Y 1 B ASN 144 ? D ASN 144 
22 1 Y 1 B LEU 145 ? D LEU 145 
23 1 Y 1 B TYR 146 ? D TYR 146 
24 1 Y 1 B PHE 147 ? D PHE 147 
25 1 Y 1 B GLN 148 ? D GLN 148 
26 1 Y 1 B GLY 149 ? D GLY 149 
27 1 Y 1 B GLY 150 ? D GLY 150 
28 1 Y 1 B GLY 151 ? D GLY 151 
29 1 Y 1 B HIS 152 ? D HIS 152 
30 1 Y 1 B HIS 153 ? D HIS 153 
31 1 Y 1 B HIS 154 ? D HIS 154 
32 1 Y 1 B HIS 155 ? D HIS 155 
33 1 Y 1 B HIS 156 ? D HIS 156 
34 1 Y 1 B HIS 157 ? D HIS 157 
35 1 Y 1 C ALA 141 ? E ALA 141 
36 1 Y 1 C SER 142 ? E SER 142 
37 1 Y 1 C GLU 143 ? E GLU 143 
38 1 Y 1 C ASN 144 ? E ASN 144 
39 1 Y 1 C LEU 145 ? E LEU 145 
40 1 Y 1 C TYR 146 ? E TYR 146 
41 1 Y 1 C PHE 147 ? E PHE 147 
42 1 Y 1 C GLN 148 ? E GLN 148 
43 1 Y 1 C GLY 149 ? E GLY 149 
44 1 Y 1 C GLY 150 ? E GLY 150 
45 1 Y 1 C GLY 151 ? E GLY 151 
46 1 Y 1 C HIS 152 ? E HIS 152 
47 1 Y 1 C HIS 153 ? E HIS 153 
48 1 Y 1 C HIS 154 ? E HIS 154 
49 1 Y 1 C HIS 155 ? E HIS 155 
50 1 Y 1 C HIS 156 ? E HIS 156 
51 1 Y 1 C HIS 157 ? E HIS 157 
52 1 Y 1 D ALA 141 ? F ALA 141 
53 1 Y 1 D SER 142 ? F SER 142 
54 1 Y 1 D GLU 143 ? F GLU 143 
55 1 Y 1 D ASN 144 ? F ASN 144 
56 1 Y 1 D LEU 145 ? F LEU 145 
57 1 Y 1 D TYR 146 ? F TYR 146 
58 1 Y 1 D PHE 147 ? F PHE 147 
59 1 Y 1 D GLN 148 ? F GLN 148 
60 1 Y 1 D GLY 149 ? F GLY 149 
61 1 Y 1 D GLY 150 ? F GLY 150 
62 1 Y 1 D GLY 151 ? F GLY 151 
63 1 Y 1 D HIS 152 ? F HIS 152 
64 1 Y 1 D HIS 153 ? F HIS 153 
65 1 Y 1 D HIS 154 ? F HIS 154 
66 1 Y 1 D HIS 155 ? F HIS 155 
67 1 Y 1 D HIS 156 ? F HIS 156 
68 1 Y 1 D HIS 157 ? F HIS 157 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2ISZ 'double helix'        
2ISZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 B DG 32 1_555 0.015  -0.391 0.004  -6.267  -14.230 7.860  1  E_DC1:DG32_F  E 1  ? F 32 ? 19 1 
1 A DC 2  1_555 B DG 31 1_555 0.677  -0.542 0.256  -14.243 -18.613 -5.302 2  E_DC2:DG31_F  E 2  ? F 31 ? 19 1 
1 A DC 3  1_555 B DG 30 1_555 -0.389 -0.120 0.660  -19.438 -16.509 9.341  3  E_DC3:DG30_F  E 3  ? F 30 ? 19 1 
1 A DT 4  1_555 B DA 29 1_555 -0.641 -0.004 0.282  -7.661  -0.578  3.629  4  E_DT4:DA29_F  E 4  ? F 29 ? 20 1 
1 A DG 5  1_555 B DC 28 1_555 -0.375 -0.216 -0.300 -6.586  -10.230 5.067  5  E_DG5:DC28_F  E 5  ? F 28 ? 19 1 
1 A DT 6  1_555 B DA 27 1_555 0.170  -0.369 0.101  -5.781  -14.162 3.921  6  E_DT6:DA27_F  E 6  ? F 27 ? 20 1 
1 A DT 7  1_555 B DA 26 1_555 -0.151 -0.276 -0.157 -2.173  -9.288  0.997  7  E_DT7:DA26_F  E 7  ? F 26 ? 20 1 
1 A DA 8  1_555 B DT 25 1_555 0.251  -0.088 0.278  -1.188  1.420   -2.061 8  E_DA8:DT25_F  E 8  ? F 25 ? 20 1 
1 A DG 9  1_555 B DC 24 1_555 -0.328 -0.066 0.237  12.700  -8.617  3.527  9  E_DG9:DC24_F  E 9  ? F 24 ? 19 1 
1 A DC 10 1_555 B DG 23 1_555 0.293  0.048  0.223  6.672   -15.004 4.027  10 E_DC10:DG23_F E 10 ? F 23 ? 19 1 
1 A DA 11 1_555 B DT 22 1_555 -0.152 -0.176 -0.178 -14.578 -11.190 2.899  11 E_DA11:DT22_F E 11 ? F 22 ? 20 1 
1 A DC 12 1_555 B DG 21 1_555 -0.183 -0.160 0.124  -2.892  -3.481  0.845  12 E_DC12:DG21_F E 12 ? F 21 ? 19 1 
1 A DA 13 1_555 B DT 20 1_555 0.115  -0.189 -0.190 -0.494  -1.104  -2.593 13 E_DA13:DT20_F E 13 ? F 20 ? 20 1 
1 A DG 14 1_555 B DC 19 1_555 -0.314 -0.149 0.108  12.958  -8.112  1.070  14 E_DG14:DC19_F E 14 ? F 19 ? 19 1 
1 A DG 15 1_555 B DC 18 1_555 -0.144 -0.203 0.000  -2.929  -13.618 0.143  15 E_DG15:DC18_F E 15 ? F 18 ? 19 1 
1 A DC 16 1_555 B DG 17 1_555 0.108  -0.286 0.072  -11.811 -8.231  2.003  16 E_DC16:DG17_F E 16 ? F 17 ? 19 1 
1 A DT 17 1_555 B DA 16 1_555 0.046  -0.139 -0.134 2.054   4.062   -1.770 17 E_DT17:DA16_F E 17 ? F 16 ? 20 1 
1 A DG 18 1_555 B DC 15 1_555 -0.067 -0.125 0.110  4.097   0.534   -1.203 18 E_DG18:DC15_F E 18 ? F 15 ? 19 1 
1 A DC 19 1_555 B DG 14 1_555 0.578  -0.207 -0.277 16.450  -8.461  3.652  19 E_DC19:DG14_F E 19 ? F 14 ? 19 1 
1 A DC 20 1_555 B DG 13 1_555 0.013  -0.162 0.228  0.474   -14.423 -0.108 20 E_DC20:DG13_F E 20 ? F 13 ? 19 1 
1 A DC 21 1_555 B DG 12 1_555 0.070  -0.020 0.054  -10.581 -4.222  5.204  21 E_DC21:DG12_F E 21 ? F 12 ? 19 1 
1 A DT 22 1_555 B DA 11 1_555 -0.039 -0.314 0.008  5.409   -3.476  -2.318 22 E_DT22:DA11_F E 22 ? F 11 ? 20 1 
1 A DA 23 1_555 B DT 10 1_555 0.061  -0.290 0.061  6.647   -17.942 4.619  23 E_DA23:DT10_F E 23 ? F 10 ? 20 1 
1 A DA 24 1_555 B DT 9  1_555 -0.137 -0.373 0.106  3.034   -12.870 1.443  24 E_DA24:DT9_F  E 24 ? F 9  ? 20 1 
1 A DT 25 1_555 B DA 8  1_555 -0.076 -0.198 -0.129 -0.855  -15.371 1.904  25 E_DT25:DA8_F  E 25 ? F 8  ? 20 1 
1 A DT 26 1_555 B DA 7  1_555 -0.181 -0.324 -0.055 1.073   -19.101 5.301  26 E_DT26:DA7_F  E 26 ? F 7  ? 20 1 
1 A DT 27 1_555 B DA 6  1_555 -0.120 0.040  0.136  -4.869  -18.493 2.136  27 E_DT27:DA6_F  E 27 ? F 6  ? 20 1 
1 A DT 28 1_555 B DA 5  1_555 0.063  0.051  -0.218 -7.757  -15.880 5.815  28 E_DT28:DA5_F  E 28 ? F 5  ? 20 1 
1 A DA 29 1_555 B DT 4  1_555 0.152  -0.161 -0.119 -5.706  -12.902 -1.312 29 E_DA29:DT4_F  E 29 ? F 4  ? 20 1 
1 A DG 30 1_555 B DC 3  1_555 0.435  0.098  -0.172 -10.142 -12.399 -5.732 30 E_DG30:DC3_F  E 30 ? F 3  ? 19 1 
1 A DT 31 1_555 B DA 2  1_555 -1.038 0.085  0.165  -3.841  -11.499 14.893 31 E_DT31:DA2_F  E 31 ? F 2  ? ?  ? 
1 A DG 32 1_555 B DC 1  1_555 -0.383 0.127  0.037  1.635   -8.921  1.485  32 E_DG32:DC1_F  E 32 ? F 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 B DG 32 1_555 A DC 2  1_555 B DG 31 1_555 -0.398 -0.846 3.517 -1.442 4.243  38.732 -1.814 0.411  3.421 6.371  
2.165  38.981 1  EE_DC1DC2:DG31DG32_FF   E 1  ? F 32 ? E 2  ? F 31 ? 
1 A DC 2  1_555 B DG 31 1_555 A DC 3  1_555 B DG 30 1_555 0.536  -1.201 3.191 -0.492 12.473 26.706 -4.759 -1.150 2.393 25.320 
0.999  29.432 2  EE_DC2DC3:DG30DG31_FF   E 2  ? F 31 ? E 3  ? F 30 ? 
1 A DC 3  1_555 B DG 30 1_555 A DT 4  1_555 B DA 29 1_555 -0.017 -0.038 3.145 2.236  13.073 28.715 -2.406 0.431  2.851 24.759 
-4.235 31.572 3  EE_DC3DT4:DA29DG30_FF   E 3  ? F 30 ? E 4  ? F 29 ? 
1 A DT 4  1_555 B DA 29 1_555 A DG 5  1_555 B DC 28 1_555 0.740  -0.548 3.309 5.243  10.032 29.300 -2.913 -0.377 3.046 18.964 
-9.911 31.366 4  EE_DT4DG5:DC28DA29_FF   E 4  ? F 29 ? E 5  ? F 28 ? 
1 A DG 5  1_555 B DC 28 1_555 A DT 6  1_555 B DA 27 1_555 -0.739 -0.658 3.310 -2.907 2.198  33.023 -1.525 0.798  3.312 3.852  
5.095  33.218 5  EE_DG5DT6:DA27DC28_FF   E 5  ? F 28 ? E 6  ? F 27 ? 
1 A DT 6  1_555 B DA 27 1_555 A DT 7  1_555 B DA 26 1_555 -0.473 -0.225 3.143 1.132  6.893  31.680 -1.558 1.037  3.010 12.438 
-2.042 32.421 6  EE_DT6DT7:DA26DA27_FF   E 6  ? F 27 ? E 7  ? F 26 ? 
1 A DT 7  1_555 B DA 26 1_555 A DA 8  1_555 B DT 25 1_555 0.170  -0.489 3.245 -2.957 2.719  35.180 -1.197 -0.707 3.175 4.480  
4.873  35.402 7  EE_DT7DA8:DT25DA26_FF   E 7  ? F 26 ? E 8  ? F 25 ? 
1 A DA 8  1_555 B DT 25 1_555 A DG 9  1_555 B DC 24 1_555 0.907  -0.642 3.166 1.023  8.955  27.045 -3.237 -1.622 2.843 18.507 
-2.114 28.481 8  EE_DA8DG9:DC24DT25_FF   E 8  ? F 25 ? E 9  ? F 24 ? 
1 A DG 9  1_555 B DC 24 1_555 A DC 10 1_555 B DG 23 1_555 0.495  -1.309 3.476 -1.675 -1.969 32.043 -1.986 -1.216 3.519 -3.559 
3.029  32.144 9  EE_DG9DC10:DG23DC24_FF  E 9  ? F 24 ? E 10 ? F 23 ? 
1 A DC 10 1_555 B DG 23 1_555 A DA 11 1_555 B DT 22 1_555 -0.327 -1.038 3.624 4.145  7.803  35.057 -2.853 1.154  3.268 12.706 
-6.750 36.120 10 EE_DC10DA11:DT22DG23_FF E 10 ? F 23 ? E 11 ? F 22 ? 
1 A DA 11 1_555 B DT 22 1_555 A DC 12 1_555 B DG 21 1_555 -0.540 -0.586 3.112 -1.996 8.813  27.188 -3.042 0.671  2.819 18.124 
4.104  28.624 11 EE_DA11DC12:DG21DT22_FF E 11 ? F 22 ? E 12 ? F 21 ? 
1 A DC 12 1_555 B DG 21 1_555 A DA 13 1_555 B DT 20 1_555 -0.381 -0.527 3.319 2.018  -1.364 36.339 -0.651 0.894  3.311 -2.184 
-3.231 36.418 12 EE_DC12DA13:DT20DG21_FF E 12 ? F 21 ? E 13 ? F 20 ? 
1 A DA 13 1_555 B DT 20 1_555 A DG 14 1_555 B DC 19 1_555 0.948  -0.507 3.218 -3.690 4.603  25.858 -2.263 -2.994 2.924 10.118 
8.112  26.511 13 EE_DA13DG14:DC19DT20_FF E 13 ? F 20 ? E 14 ? F 19 ? 
1 A DG 14 1_555 B DC 19 1_555 A DG 15 1_555 B DC 18 1_555 -0.108 -1.457 3.740 -3.683 2.218  33.023 -2.960 -0.506 3.628 3.881  
6.446  33.294 14 EE_DG14DG15:DC18DC19_FF E 14 ? F 19 ? E 15 ? F 18 ? 
1 A DG 15 1_555 B DC 18 1_555 A DC 16 1_555 B DG 17 1_555 0.363  -1.284 3.473 3.510  0.999  36.532 -2.183 -0.067 3.457 1.588  
-5.581 36.708 15 EE_DG15DC16:DG17DC18_FF E 15 ? F 18 ? E 16 ? F 17 ? 
1 A DC 16 1_555 B DG 17 1_555 A DT 17 1_555 B DA 16 1_555 -0.807 -0.694 3.215 3.871  3.204  26.231 -2.299 2.708  2.963 6.977  
-8.431 26.700 16 EE_DC16DT17:DA16DG17_FF E 16 ? F 17 ? E 17 ? F 16 ? 
1 A DT 17 1_555 B DA 16 1_555 A DG 18 1_555 B DC 15 1_555 0.261  -0.710 3.323 -0.641 1.572  36.406 -1.355 -0.508 3.286 2.515  
1.025  36.444 17 EE_DT17DG18:DC15DA16_FF E 17 ? F 16 ? E 18 ? F 15 ? 
1 A DG 18 1_555 B DC 15 1_555 A DC 19 1_555 B DG 14 1_555 0.467  -0.343 3.091 2.610  9.218  27.728 -2.542 -0.395 2.863 18.546 
-5.251 29.306 18 EE_DG18DC19:DG14DC15_FF E 18 ? F 15 ? E 19 ? F 14 ? 
1 A DC 19 1_555 B DG 14 1_555 A DC 20 1_555 B DG 13 1_555 0.080  -1.263 3.604 -5.688 4.293  36.048 -2.637 -0.965 3.385 6.855  
9.082  36.723 19 EE_DC19DC20:DG13DG14_FF E 19 ? F 14 ? E 20 ? F 13 ? 
1 A DC 20 1_555 B DG 13 1_555 A DC 21 1_555 B DG 12 1_555 -0.409 -1.648 3.632 3.759  -0.133 26.712 -3.496 1.936  3.550 -0.285 
-8.086 26.971 20 EE_DC20DC21:DG12DG13_FF E 20 ? F 13 ? E 21 ? F 12 ? 
1 A DC 21 1_555 B DG 12 1_555 A DT 22 1_555 B DA 11 1_555 -1.212 -0.437 3.094 0.340  10.720 28.163 -2.863 2.398  2.734 21.087 
-0.669 30.097 21 EE_DC21DT22:DA11DG12_FF E 21 ? F 12 ? E 22 ? F 11 ? 
1 A DT 22 1_555 B DA 11 1_555 A DA 23 1_555 B DT 10 1_555 -0.053 -0.124 3.345 1.631  6.876  33.237 -1.334 0.358  3.249 11.854 
-2.812 33.959 22 EE_DT22DA23:DT10DA11_FF E 22 ? F 11 ? E 23 ? F 10 ? 
1 A DA 23 1_555 B DT 10 1_555 A DA 24 1_555 B DT 9  1_555 0.349  -0.427 3.341 -0.912 1.947  31.538 -1.151 -0.813 3.298 3.576  
1.676  31.610 23 EE_DA23DA24:DT9DT10_FF  E 23 ? F 10 ? E 24 ? F 9  ? 
1 A DA 24 1_555 B DT 9  1_555 A DT 25 1_555 B DA 8  1_555 0.450  -0.904 3.408 2.731  -3.510 33.006 -0.957 -0.302 3.507 -6.143 
-4.779 33.296 24 EE_DA24DT25:DA8DT9_FF   E 24 ? F 9  ? E 25 ? F 8  ? 
1 A DT 25 1_555 B DA 8  1_555 A DT 26 1_555 B DA 7  1_555 -0.113 -0.454 3.260 -0.711 -0.639 33.372 -0.685 0.079  3.269 -1.112 
1.238  33.386 25 EE_DT25DT26:DA7DA8_FF   E 25 ? F 8  ? E 26 ? F 7  ? 
1 A DT 26 1_555 B DA 7  1_555 A DT 27 1_555 B DA 6  1_555 -0.399 -0.376 3.442 -2.592 -1.751 37.052 -0.342 0.260  3.474 -2.750 
4.071  37.179 26 EE_DT26DT27:DA6DA7_FF   E 26 ? F 7  ? E 27 ? F 6  ? 
1 A DT 27 1_555 B DA 6  1_555 A DT 28 1_555 B DA 5  1_555 0.099  -0.038 3.228 3.468  1.179  36.138 -0.224 0.320  3.220 1.894  
-5.573 36.317 27 EE_DT27DT28:DA5DA6_FF   E 27 ? F 6  ? E 28 ? F 5  ? 
1 A DT 28 1_555 B DA 5  1_555 A DA 29 1_555 B DT 4  1_555 -0.439 0.904  3.232 -3.576 4.407  40.107 0.809  0.230  3.334 6.388  
5.182  40.490 28 EE_DT28DA29:DT4DA5_FF   E 28 ? F 5  ? E 29 ? F 4  ? 
1 A DA 29 1_555 B DT 4  1_555 A DG 30 1_555 B DC 3  1_555 -0.280 -0.477 3.451 -0.706 0.877  31.225 -1.060 0.378  3.442 1.629  
1.312  31.245 29 EE_DA29DG30:DC3DT4_FF   E 29 ? F 4  ? E 30 ? F 3  ? 
1 A DG 30 1_555 B DC 3  1_555 A DT 31 1_555 B DA 2  1_555 1.070  -0.312 3.021 0.917  0.123  30.813 -0.608 -1.847 3.049 0.231  
-1.725 30.827 30 EE_DG30DT31:DA2DC3_FF   E 30 ? F 3  ? E 31 ? F 2  ? 
1 A DT 31 1_555 B DA 2  1_555 A DG 32 1_555 B DC 1  1_555 -0.021 0.447  3.274 1.839  0.972  43.272 0.510  0.208  3.279 1.318  
-2.491 43.320 31 EE_DT31DG32:DC1DA2_FF   E 31 ? F 2  ? E 32 ? F 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'NICKEL (II) ION' NI  
5 'SODIUM ION'      NA  
6 water             HOH 
#