data_2IT0
# 
_entry.id   2IT0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IT0         
NDB   PD0885       
RCSB  RCSB039978   
WWPDB D_1000039978 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FX7 'Crystal structure of the cobalt-activated full-length IdeR'                    unspecified 
PDB 1U8R 'Crystal structure of a full-length IdeR-DNA complex'                           unspecified 
PDB 2ISY 'Crystal structure of the nickel-activated two-domain iron-dependent regulator' unspecified 
PDB 2ISZ 'Crystal structure of a two-domain IdeR-DNA complex crystal form I'             unspecified 
# 
_pdbx_database_status.entry_id                        2IT0 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wisedchaisri, G.' 1 
'Chou, C.J.'       2 
'Wu, M.'           3 
'Roach, C.'        4 
'Rice, A.E.'       5 
'Holmes, R.K.'     6 
'Beeson, C.'       7 
'Hol, W.G.'        8 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                436 
_citation.page_last                 447 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17209554 
_citation.pdbx_database_id_DOI      10.1021/bi0609826 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wisedchaisri, G.' 1 
primary 'Chou, C.J.'       2 
primary 'Wu, M.'           3 
primary 'Roach, C.'        4 
primary 'Rice, A.E.'       5 
primary 'Holmes, R.K.'     6 
primary 'Beeson, C.'       7 
primary 'Hol, W.G.'        8 
# 
_cell.length_a           54.009 
_cell.length_b           70.363 
_cell.length_c           79.569 
_cell.angle_alpha        108.950 
_cell.angle_beta         103.080 
_cell.angle_gamma        94.840 
_cell.entry_id           2IT0 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         2IT0 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'mbtA/mbtB operator strand 1'   10112.492 1  ? ? ? ? 
2 polymer     syn 'mbtA/mbtB operator strand 2'   10188.573 1  ? ? ? ? 
3 polymer     man 'Iron-dependent repressor ideR' 17855.262 4  ? ? ? ? 
4 non-polymer syn 'NICKEL (II) ION'               58.693    12 ? ? ? ? 
5 non-polymer syn 'ACETATE ION'                   59.044    10 ? ? ? ? 
6 water       nat water                           18.015    33 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DA)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DC)(DT)(DG)(DC)(DC)
(DC)(DT)(DA)(DA)(DT)(DT)(DT)(DT)(DA)(DG)(DT)(DG)(DG)
;
CCCTGTTAGCACAGGCTGCCCTAATTTTAGTGG E       ? 
2 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DT)(DA)(DA)(DA)(DA)(DT)(DT)(DA)(DG)(DG)(DG)(DC)(DA)(DG)(DC)(DC)(DT)
(DG)(DT)(DG)(DC)(DT)(DA)(DA)(DC)(DA)(DG)(DG)(DG)(DC)
;
CACTAAAATTAGGGCAGCCTGTGCTAACAGGGC F       ? 
3 'polypeptide(L)'        no no 
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYFQGGGHHHHHH
;
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYFQGGGHHHHHH
;
A,B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DC  n 
1 3   DC  n 
1 4   DT  n 
1 5   DG  n 
1 6   DT  n 
1 7   DT  n 
1 8   DA  n 
1 9   DG  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DA  n 
1 14  DG  n 
1 15  DG  n 
1 16  DC  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DC  n 
1 21  DC  n 
1 22  DT  n 
1 23  DA  n 
1 24  DA  n 
1 25  DT  n 
1 26  DT  n 
1 27  DT  n 
1 28  DT  n 
1 29  DA  n 
1 30  DG  n 
1 31  DT  n 
1 32  DG  n 
1 33  DG  n 
2 1   DC  n 
2 2   DA  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  DG  n 
2 14  DG  n 
2 15  DC  n 
2 16  DA  n 
2 17  DG  n 
2 18  DC  n 
2 19  DC  n 
2 20  DT  n 
2 21  DG  n 
2 22  DT  n 
2 23  DG  n 
2 24  DC  n 
2 25  DT  n 
2 26  DA  n 
2 27  DA  n 
2 28  DC  n 
2 29  DA  n 
2 30  DG  n 
2 31  DG  n 
2 32  DG  n 
2 33  DC  n 
3 1   MET n 
3 2   ASN n 
3 3   GLU n 
3 4   LEU n 
3 5   VAL n 
3 6   ASP n 
3 7   THR n 
3 8   THR n 
3 9   GLU n 
3 10  MET n 
3 11  TYR n 
3 12  LEU n 
3 13  ARG n 
3 14  THR n 
3 15  ILE n 
3 16  TYR n 
3 17  ASP n 
3 18  LEU n 
3 19  GLU n 
3 20  GLU n 
3 21  GLU n 
3 22  GLY n 
3 23  VAL n 
3 24  THR n 
3 25  PRO n 
3 26  LEU n 
3 27  ARG n 
3 28  ALA n 
3 29  ARG n 
3 30  ILE n 
3 31  ALA n 
3 32  GLU n 
3 33  ARG n 
3 34  LEU n 
3 35  ASP n 
3 36  GLN n 
3 37  SER n 
3 38  GLY n 
3 39  PRO n 
3 40  THR n 
3 41  VAL n 
3 42  SER n 
3 43  GLN n 
3 44  THR n 
3 45  VAL n 
3 46  SER n 
3 47  ARG n 
3 48  MET n 
3 49  GLU n 
3 50  ARG n 
3 51  ASP n 
3 52  GLY n 
3 53  LEU n 
3 54  LEU n 
3 55  ARG n 
3 56  VAL n 
3 57  ALA n 
3 58  GLY n 
3 59  ASP n 
3 60  ARG n 
3 61  HIS n 
3 62  LEU n 
3 63  GLU n 
3 64  LEU n 
3 65  THR n 
3 66  GLU n 
3 67  LYS n 
3 68  GLY n 
3 69  ARG n 
3 70  ALA n 
3 71  LEU n 
3 72  ALA n 
3 73  ILE n 
3 74  ALA n 
3 75  VAL n 
3 76  MET n 
3 77  ARG n 
3 78  LYS n 
3 79  HIS n 
3 80  ARG n 
3 81  LEU n 
3 82  ALA n 
3 83  GLU n 
3 84  ARG n 
3 85  LEU n 
3 86  LEU n 
3 87  VAL n 
3 88  ASP n 
3 89  VAL n 
3 90  ILE n 
3 91  GLY n 
3 92  LEU n 
3 93  PRO n 
3 94  TRP n 
3 95  GLU n 
3 96  GLU n 
3 97  VAL n 
3 98  HIS n 
3 99  ALA n 
3 100 GLU n 
3 101 ALA n 
3 102 CYS n 
3 103 ARG n 
3 104 TRP n 
3 105 GLU n 
3 106 HIS n 
3 107 VAL n 
3 108 MET n 
3 109 SER n 
3 110 GLU n 
3 111 ASP n 
3 112 VAL n 
3 113 GLU n 
3 114 ARG n 
3 115 ARG n 
3 116 LEU n 
3 117 VAL n 
3 118 LYS n 
3 119 VAL n 
3 120 LEU n 
3 121 ASN n 
3 122 ASN n 
3 123 PRO n 
3 124 THR n 
3 125 THR n 
3 126 SER n 
3 127 PRO n 
3 128 PHE n 
3 129 GLY n 
3 130 ASN n 
3 131 PRO n 
3 132 ILE n 
3 133 PRO n 
3 134 GLY n 
3 135 LEU n 
3 136 VAL n 
3 137 GLU n 
3 138 LEU n 
3 139 GLY n 
3 140 VAL n 
3 141 ALA n 
3 142 SER n 
3 143 GLU n 
3 144 ASN n 
3 145 LEU n 
3 146 TYR n 
3 147 PHE n 
3 148 GLN n 
3 149 GLY n 
3 150 GLY n 
3 151 GLY n 
3 152 HIS n 
3 153 HIS n 
3 154 HIS n 
3 155 HIS n 
3 156 HIS n 
3 157 HIS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Mycobacterium 
_entity_src_gen.pdbx_gene_src_gene                 IdeR,dtxR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1773 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAER36 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP IDER_MYCTU P0A672 1 
;MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
;
? 
2 1 PDB 2IT0       2IT0   ? ? ? 
3 2 PDB 2IT0       2IT0   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IT0 A 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
2 1 2IT0 B 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
3 1 2IT0 C 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
4 1 2IT0 D 1 ? 140 ? P0A672 1 ? 140 ? 1 140 
5 2 2IT0 E 1 ? 33  ? 2IT0   1 ? 33  ? 1 33  
6 3 2IT0 F 1 ? 33  ? 2IT0   1 ? 33  ? 1 33  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IT0 ALA A 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 1  
1 2IT0 SER A 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 2  
1 2IT0 GLU A 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 3  
1 2IT0 ASN A 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 4  
1 2IT0 LEU A 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 5  
1 2IT0 TYR A 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 6  
1 2IT0 PHE A 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 7  
1 2IT0 GLN A 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 8  
1 2IT0 GLY A 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 9  
1 2IT0 GLY A 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 10 
1 2IT0 GLY A 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 11 
1 2IT0 HIS A 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 12 
1 2IT0 HIS A 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 13 
1 2IT0 HIS A 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 14 
1 2IT0 HIS A 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 15 
1 2IT0 HIS A 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 16 
1 2IT0 HIS A 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 17 
2 2IT0 ALA B 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 18 
2 2IT0 SER B 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 19 
2 2IT0 GLU B 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 20 
2 2IT0 ASN B 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 21 
2 2IT0 LEU B 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 22 
2 2IT0 TYR B 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 23 
2 2IT0 PHE B 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 24 
2 2IT0 GLN B 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 25 
2 2IT0 GLY B 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 26 
2 2IT0 GLY B 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 27 
2 2IT0 GLY B 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 28 
2 2IT0 HIS B 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 29 
2 2IT0 HIS B 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 30 
2 2IT0 HIS B 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 31 
2 2IT0 HIS B 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 32 
2 2IT0 HIS B 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 33 
2 2IT0 HIS B 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 34 
3 2IT0 ALA C 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 35 
3 2IT0 SER C 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 36 
3 2IT0 GLU C 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 37 
3 2IT0 ASN C 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 38 
3 2IT0 LEU C 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 39 
3 2IT0 TYR C 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 40 
3 2IT0 PHE C 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 41 
3 2IT0 GLN C 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 42 
3 2IT0 GLY C 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 43 
3 2IT0 GLY C 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 44 
3 2IT0 GLY C 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 45 
3 2IT0 HIS C 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 46 
3 2IT0 HIS C 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 47 
3 2IT0 HIS C 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 48 
3 2IT0 HIS C 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 49 
3 2IT0 HIS C 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 50 
3 2IT0 HIS C 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 51 
4 2IT0 ALA D 141 ? UNP P0A672 ? ? 'EXPRESSION TAG' 141 52 
4 2IT0 SER D 142 ? UNP P0A672 ? ? 'EXPRESSION TAG' 142 53 
4 2IT0 GLU D 143 ? UNP P0A672 ? ? 'EXPRESSION TAG' 143 54 
4 2IT0 ASN D 144 ? UNP P0A672 ? ? 'EXPRESSION TAG' 144 55 
4 2IT0 LEU D 145 ? UNP P0A672 ? ? 'EXPRESSION TAG' 145 56 
4 2IT0 TYR D 146 ? UNP P0A672 ? ? 'EXPRESSION TAG' 146 57 
4 2IT0 PHE D 147 ? UNP P0A672 ? ? 'EXPRESSION TAG' 147 58 
4 2IT0 GLN D 148 ? UNP P0A672 ? ? 'EXPRESSION TAG' 148 59 
4 2IT0 GLY D 149 ? UNP P0A672 ? ? 'EXPRESSION TAG' 149 60 
4 2IT0 GLY D 150 ? UNP P0A672 ? ? 'EXPRESSION TAG' 150 61 
4 2IT0 GLY D 151 ? UNP P0A672 ? ? 'EXPRESSION TAG' 151 62 
4 2IT0 HIS D 152 ? UNP P0A672 ? ? 'EXPRESSION TAG' 152 63 
4 2IT0 HIS D 153 ? UNP P0A672 ? ? 'EXPRESSION TAG' 153 64 
4 2IT0 HIS D 154 ? UNP P0A672 ? ? 'EXPRESSION TAG' 154 65 
4 2IT0 HIS D 155 ? UNP P0A672 ? ? 'EXPRESSION TAG' 155 66 
4 2IT0 HIS D 156 ? UNP P0A672 ? ? 'EXPRESSION TAG' 156 67 
4 2IT0 HIS D 157 ? UNP P0A672 ? ? 'EXPRESSION TAG' 157 68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                        ? 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NI  non-polymer         . 'NICKEL (II) ION'                    ? 'Ni 2'            58.693  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2IT0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.97 
_exptl_crystal.density_percent_sol   58.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'26% PEG 4000, 0.2 M sodium acetate, 0.1 M Tris HCl pH 8.5, 5% glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'   ? ? ? 
1 2 1 'Na acetate' ? ? ? 
1 3 1 'Tris HCl'   ? ? ? 
1 4 2 'PEG 4000'   ? ? ? 
1 5 2 'Na acetate' ? ? ? 
1 6 2 'Tris HCl'   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1217 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1217 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
# 
_reflns.entry_id                     2IT0 
_reflns.d_resolution_high            2.600 
_reflns.d_resolution_low             72.481 
_reflns.number_obs                   31514 
_reflns.pdbx_Rmerge_I_obs            0.126 
_reflns.pdbx_netI_over_sigmaI        3.800 
_reflns.pdbx_Rsym_value              0.126 
_reflns.pdbx_redundancy              1.900 
_reflns.percent_possible_obs         96.300 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.60 2.74  ? 8746 ? 0.348 2.0  0.348 ? 1.90 ? 4585 95.90 ? 1  
2.74 2.91  ? 8272 ? 0.263 2.8  0.263 ? 1.90 ? 4345 96.00 ? 2  
2.91 3.11  ? 7788 ? 0.207 3.5  0.207 ? 1.90 ? 4093 96.30 ? 3  
3.11 3.36  ? 7229 ? 0.108 6.8  0.108 ? 1.90 ? 3821 96.50 ? 4  
3.36 3.68  ? 6543 ? 0.087 7.9  0.087 ? 1.90 ? 3493 96.50 ? 5  
3.68 4.11  ? 5990 ? 0.063 11.1 0.063 ? 1.90 ? 3188 96.10 ? 6  
4.11 4.75  ? 5062 ? 0.082 7.9  0.082 ? 1.80 ? 2786 96.20 ? 7  
4.75 5.81  ? 3862 ? 0.151 2.2  0.151 ? 1.60 ? 2346 96.00 ? 8  
5.81 8.22  ? 3635 ? 0.055 13.2 0.055 ? 2.00 ? 1850 98.10 ? 9  
8.22 37.91 ? 1960 ? 0.053 10.3 0.053 ? 1.90 ? 1007 97.20 ? 10 
# 
_refine.entry_id                                 2IT0 
_refine.ls_d_res_high                            2.600 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.330 
_refine.ls_number_reflns_obs                     31507 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1595 
_refine.B_iso_mean                               25.542 
_refine.aniso_B[1][1]                            0.650 
_refine.aniso_B[2][2]                            -0.160 
_refine.aniso_B[3][3]                            0.050 
_refine.aniso_B[1][2]                            0.090 
_refine.aniso_B[1][3]                            1.630 
_refine.aniso_B[2][3]                            -0.320 
_refine.correlation_coeff_Fo_to_Fc               0.900 
_refine.correlation_coeff_Fo_to_Fc_free          0.852 
_refine.pdbx_overall_ESU_R                       0.590 
_refine.pdbx_overall_ESU_R_Free                  0.326 
_refine.overall_SU_ML                            0.227 
_refine.overall_SU_B                             10.597 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2ISZ 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4484 
_refine_hist.pdbx_number_atoms_nucleic_acid   1347 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             33 
_refine_hist.number_atoms_total               5916 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         6128 0.007  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      8534 1.190  2.263  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   560  4.723  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   219  33.173 22.694 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   820  16.986 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   60   18.756 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           978  0.068  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     4143 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            2798 0.246  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          4060 0.324  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    394  0.199  0.500  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.038  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   68   0.222  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 8    0.256  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2901 0.935  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4571 1.540  4.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4008 0.946  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3963 1.424  4.000  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
1 'LOOSE POSITIONAL' A 1089 0.540 5.000  ? ? ? ? ? 1 'X-RAY DIFFRACTION' 1  
2 'LOOSE POSITIONAL' B 1089 0.570 5.000  ? ? ? ? ? 1 'X-RAY DIFFRACTION' 2  
3 'LOOSE POSITIONAL' C 1089 0.500 5.000  ? ? ? ? ? 1 'X-RAY DIFFRACTION' 3  
4 'LOOSE POSITIONAL' D 1089 0.440 5.000  ? ? ? ? ? 1 'X-RAY DIFFRACTION' 4  
1 'LOOSE THERMAL'    A 1089 3.130 10.000 ? ? ? ? ? 1 'X-RAY DIFFRACTION' 5  
2 'LOOSE THERMAL'    B 1089 3.920 10.000 ? ? ? ? ? 1 'X-RAY DIFFRACTION' 6  
3 'LOOSE THERMAL'    C 1089 3.430 10.000 ? ? ? ? ? 1 'X-RAY DIFFRACTION' 7  
4 'LOOSE THERMAL'    D 1089 2.840 10.000 ? ? ? ? ? 1 'X-RAY DIFFRACTION' 8  
1 'LOOSE POSITIONAL' A 62   0.580 5.000  ? ? ? ? ? 2 'X-RAY DIFFRACTION' 9  
1 'LOOSE THERMAL'    A 62   1.220 10.000 ? ? ? ? ? 2 'X-RAY DIFFRACTION' 10 
# 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.667 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.780 
_refine_ls_shell.number_reflns_R_work             2184 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.R_factor_R_free                  0.387 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             131 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2315 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
2 1 A 
2 2 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 1 C 3   C 139 6 . . GLU GLY A 3   A 139 1 ? 
2 1 D 3   D 139 6 . . GLU GLY B 3   B 139 1 ? 
3 1 E 3   E 139 6 . . GLU GLY C 3   C 139 1 ? 
4 1 F 3   F 139 6 . . GLU GLY D 3   D 139 1 ? 
1 1 C 140 C 147 6 . . VAL PHE A 140 A 147 2 ? 
2 1 D 140 D 147 6 . . VAL PHE B 140 B 147 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2IT0 
_struct.title                     'Crystal structure of a two-domain IdeR-DNA complex crystal form II' 
_struct.pdbx_descriptor           'Iron-dependent repressor ideR/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IT0 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'DNA-binding protein, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 6 ? 
HA N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one biological double-dimer two-domain IdeR-DNA complex' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 6   ? GLU C 21  ? ASP A 6   GLU A 21  1 ? 16 
HELX_P HELX_P2  2  LEU C 26  ? LEU C 34  ? LEU A 26  LEU A 34  1 ? 9  
HELX_P HELX_P3  3  SER C 37  ? ASP C 51  ? SER A 37  ASP A 51  1 ? 15 
HELX_P HELX_P4  4  THR C 65  ? VAL C 89  ? THR A 65  VAL A 89  1 ? 25 
HELX_P HELX_P5  5  PRO C 93  ? GLU C 105 ? PRO A 93  GLU A 105 1 ? 13 
HELX_P HELX_P6  6  SER C 109 ? LEU C 120 ? SER A 109 LEU A 120 1 ? 12 
HELX_P HELX_P7  7  GLY C 134 ? GLY C 139 ? GLY A 134 GLY A 139 1 ? 6  
HELX_P HELX_P8  8  ASP D 6   ? GLY D 22  ? ASP B 6   GLY B 22  1 ? 17 
HELX_P HELX_P9  9  LEU D 26  ? LEU D 34  ? LEU B 26  LEU B 34  1 ? 9  
HELX_P HELX_P10 10 SER D 37  ? ASP D 51  ? SER B 37  ASP B 51  1 ? 15 
HELX_P HELX_P11 11 THR D 65  ? VAL D 89  ? THR B 65  VAL B 89  1 ? 25 
HELX_P HELX_P12 12 PRO D 93  ? GLU D 105 ? PRO B 93  GLU B 105 1 ? 13 
HELX_P HELX_P13 13 SER D 109 ? LEU D 120 ? SER B 109 LEU B 120 1 ? 12 
HELX_P HELX_P14 14 GLY D 134 ? GLY D 139 ? GLY B 134 GLY B 139 1 ? 6  
HELX_P HELX_P15 15 ASP E 6   ? GLY E 22  ? ASP C 6   GLY C 22  1 ? 17 
HELX_P HELX_P16 16 LEU E 26  ? LEU E 34  ? LEU C 26  LEU C 34  1 ? 9  
HELX_P HELX_P17 17 SER E 37  ? ASP E 51  ? SER C 37  ASP C 51  1 ? 15 
HELX_P HELX_P18 18 THR E 65  ? VAL E 89  ? THR C 65  VAL C 89  1 ? 25 
HELX_P HELX_P19 19 PRO E 93  ? GLU E 95  ? PRO C 93  GLU C 95  5 ? 3  
HELX_P HELX_P20 20 GLU E 96  ? GLU E 105 ? GLU C 96  GLU C 105 1 ? 10 
HELX_P HELX_P21 21 SER E 109 ? ASN E 121 ? SER C 109 ASN C 121 1 ? 13 
HELX_P HELX_P22 22 GLY E 134 ? GLY E 139 ? GLY C 134 GLY C 139 1 ? 6  
HELX_P HELX_P23 23 ASP F 6   ? GLY F 22  ? ASP D 6   GLY D 22  1 ? 17 
HELX_P HELX_P24 24 LEU F 26  ? ASP F 35  ? LEU D 26  ASP D 35  1 ? 10 
HELX_P HELX_P25 25 SER F 37  ? ASP F 51  ? SER D 37  ASP D 51  1 ? 15 
HELX_P HELX_P26 26 THR F 65  ? VAL F 89  ? THR D 65  VAL D 89  1 ? 25 
HELX_P HELX_P27 27 PRO F 93  ? GLU F 95  ? PRO D 93  GLU D 95  5 ? 3  
HELX_P HELX_P28 28 GLU F 96  ? GLU F 105 ? GLU D 96  GLU D 105 1 ? 10 
HELX_P HELX_P29 29 SER F 109 ? LEU F 120 ? SER D 109 LEU D 120 1 ? 12 
HELX_P HELX_P30 30 GLY F 134 ? GLY F 139 ? GLY D 134 GLY D 139 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G NI .  NI ? ? ? 1_555 J  ACT .   OXT ? ? A NI 1001 A ACT 2001 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc2  metalc ? ? G NI .  NI ? ? ? 1_555 C  HIS 79  NE2 ? ? A NI 1001 A HIS 79   1_555 ? ? ? ? ? ? ?            2.024 ? 
metalc3  metalc ? ? G NI .  NI ? ? ? 1_555 C  GLU 83  OE2 ? ? A NI 1001 A GLU 83   1_555 ? ? ? ? ? ? ?            1.952 ? 
metalc4  metalc ? ? G NI .  NI ? ? ? 1_555 C  HIS 98  ND1 ? ? A NI 1001 A HIS 98   1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc5  metalc ? ? G NI .  NI ? ? ? 1_555 J  ACT .   O   ? ? A NI 1001 A ACT 2001 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc6  metalc ? ? H NI .  NI ? ? ? 1_555 C  MET 10  SD  ? ? A NI 1002 A MET 10   1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc7  metalc ? ? H NI .  NI ? ? ? 1_555 C  GLU 105 OE2 ? ? A NI 1002 A GLU 105  1_555 ? ? ? ? ? ? ?            1.944 ? 
metalc8  metalc ? ? H NI .  NI ? ? ? 1_555 C  HIS 106 NE2 ? ? A NI 1002 A HIS 106  1_555 ? ? ? ? ? ? ?            2.024 ? 
metalc9  metalc ? ? H NI .  NI ? ? ? 1_555 C  CYS 102 SG  ? ? A NI 1002 A CYS 102  1_555 ? ? ? ? ? ? ?            2.750 ? 
metalc10 metalc ? ? H NI .  NI ? ? ? 1_555 C  CYS 102 O   ? ? A NI 1002 A CYS 102  1_555 ? ? ? ? ? ? ?            1.957 ? 
metalc11 metalc ? ? I NI .  NI ? ? ? 1_555 L  ACT .   O   ? ? A NI 1003 A ACT 2003 1_555 ? ? ? ? ? ? ?            2.083 ? 
metalc12 metalc ? ? I NI .  NI ? ? ? 1_555 L  ACT .   OXT ? ? A NI 1003 A ACT 2003 1_555 ? ? ? ? ? ? ?            2.739 ? 
metalc13 metalc ? ? I NI .  NI ? ? ? 1_555 K  ACT .   O   ? ? A NI 1003 A ACT 2002 1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc14 metalc ? ? I NI .  NI ? ? ? 1_555 C  HIS 61  ND1 ? ? A NI 1003 A HIS 61   1_555 ? ? ? ? ? ? ?            2.023 ? 
metalc15 metalc ? ? M NI .  NI ? ? ? 1_555 D  GLU 83  OE2 ? ? B NI 1001 B GLU 83   1_555 ? ? ? ? ? ? ?            1.948 ? 
metalc16 metalc ? ? M NI .  NI ? ? ? 1_555 D  HIS 98  ND1 ? ? B NI 1001 B HIS 98   1_555 ? ? ? ? ? ? ?            2.017 ? 
metalc17 metalc ? ? M NI .  NI ? ? ? 1_555 P  ACT .   O   ? ? B NI 1001 B ACT 2001 1_555 ? ? ? ? ? ? ?            2.485 ? 
metalc18 metalc ? ? M NI .  NI ? ? ? 1_555 P  ACT .   OXT ? ? B NI 1001 B ACT 2001 1_555 ? ? ? ? ? ? ?            2.454 ? 
metalc19 metalc ? ? M NI .  NI ? ? ? 1_555 D  HIS 79  NE2 ? ? B NI 1001 B HIS 79   1_555 ? ? ? ? ? ? ?            2.012 ? 
metalc20 metalc ? ? N NI .  NI ? ? ? 1_555 D  CYS 102 O   ? ? B NI 1002 B CYS 102  1_555 ? ? ? ? ? ? ?            1.949 ? 
metalc21 metalc ? ? N NI .  NI ? ? ? 1_555 D  CYS 102 SG  ? ? B NI 1002 B CYS 102  1_555 ? ? ? ? ? ? ?            2.725 ? 
metalc22 metalc ? ? N NI .  NI ? ? ? 1_555 D  HIS 106 NE2 ? ? B NI 1002 B HIS 106  1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc23 metalc ? ? N NI .  NI ? ? ? 1_555 D  MET 10  SD  ? ? B NI 1002 B MET 10   1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc24 metalc ? ? N NI .  NI ? ? ? 1_555 D  GLU 105 OE2 ? ? B NI 1002 B GLU 105  1_555 ? ? ? ? ? ? ?            1.941 ? 
metalc25 metalc ? ? O NI .  NI ? ? ? 1_555 Q  ACT .   O   ? ? B NI 1003 B ACT 2002 1_555 ? ? ? ? ? ? ?            1.926 ? 
metalc26 metalc ? ? O NI .  NI ? ? ? 1_555 Q  ACT .   OXT ? ? B NI 1003 B ACT 2002 1_555 ? ? ? ? ? ? ?            2.075 ? 
metalc27 metalc ? ? O NI .  NI ? ? ? 1_555 D  HIS 61  ND1 ? ? B NI 1003 B HIS 61   1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc28 metalc ? ? R NI .  NI ? ? ? 1_555 E  HIS 98  ND1 ? ? C NI 1001 C HIS 98   1_555 ? ? ? ? ? ? ?            2.025 ? 
metalc29 metalc ? ? R NI .  NI ? ? ? 1_555 U  ACT .   O   ? ? C NI 1001 C ACT 2001 1_555 ? ? ? ? ? ? ?            2.172 ? 
metalc30 metalc ? ? R NI .  NI ? ? ? 1_555 U  ACT .   OXT ? ? C NI 1001 C ACT 2001 1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc31 metalc ? ? R NI .  NI ? ? ? 1_555 E  GLU 83  OE2 ? ? C NI 1001 C GLU 83   1_555 ? ? ? ? ? ? ?            1.939 ? 
metalc32 metalc ? ? R NI .  NI ? ? ? 1_555 E  HIS 79  NE2 ? ? C NI 1001 C HIS 79   1_555 ? ? ? ? ? ? ?            2.015 ? 
metalc33 metalc ? ? S NI .  NI ? ? ? 1_555 E  GLU 105 OE2 ? ? C NI 1002 C GLU 105  1_555 ? ? ? ? ? ? ?            1.936 ? 
metalc34 metalc ? ? S NI .  NI ? ? ? 1_555 E  HIS 106 NE2 ? ? C NI 1002 C HIS 106  1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc35 metalc ? ? S NI .  NI ? ? ? 1_555 GA HOH .   O   ? ? C NI 1002 C HOH 2007 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc36 metalc ? ? S NI .  NI ? ? ? 1_555 E  CYS 102 O   ? ? C NI 1002 C CYS 102  1_555 ? ? ? ? ? ? ?            1.945 ? 
metalc37 metalc ? ? S NI .  NI ? ? ? 1_555 E  MET 10  SD  ? ? C NI 1002 C MET 10   1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc38 metalc ? ? T NI .  NI ? ? ? 1_555 W  ACT .   OXT ? ? C NI 1003 C ACT 2003 1_555 ? ? ? ? ? ? ?            2.501 ? 
metalc39 metalc ? ? T NI .  NI ? ? ? 1_555 E  HIS 61  ND1 ? ? C NI 1003 C HIS 61   1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc40 metalc ? ? T NI .  NI ? ? ? 1_555 V  ACT .   OXT ? ? C NI 1003 C ACT 2002 1_555 ? ? ? ? ? ? ?            2.479 ? 
metalc41 metalc ? ? T NI .  NI ? ? ? 1_555 W  ACT .   O   ? ? C NI 1003 C ACT 2003 1_555 ? ? ? ? ? ? ?            2.659 ? 
metalc42 metalc ? ? T NI .  NI ? ? ? 1_555 V  ACT .   O   ? ? C NI 1003 C ACT 2002 1_555 ? ? ? ? ? ? ?            2.388 ? 
metalc43 metalc ? ? X NI .  NI ? ? ? 1_555 F  HIS 98  ND1 ? ? D NI 1001 D HIS 98   1_555 ? ? ? ? ? ? ?            1.999 ? 
metalc44 metalc ? ? X NI .  NI ? ? ? 1_555 AA ACT .   O   ? ? D NI 1001 D ACT 2001 1_555 ? ? ? ? ? ? ?            2.482 ? 
metalc45 metalc ? ? X NI .  NI ? ? ? 1_555 F  HIS 79  NE2 ? ? D NI 1001 D HIS 79   1_555 ? ? ? ? ? ? ?            2.017 ? 
metalc46 metalc ? ? X NI .  NI ? ? ? 1_555 F  GLU 83  OE2 ? ? D NI 1001 D GLU 83   1_555 ? ? ? ? ? ? ?            1.943 ? 
metalc47 metalc ? ? X NI .  NI ? ? ? 1_555 AA ACT .   OXT ? ? D NI 1001 D ACT 2001 1_555 ? ? ? ? ? ? ?            1.872 ? 
metalc48 metalc ? ? Y NI .  NI ? ? ? 1_555 F  GLU 105 OE2 ? ? D NI 1002 D GLU 105  1_555 ? ? ? ? ? ? ?            1.943 ? 
metalc49 metalc ? ? Y NI .  NI ? ? ? 1_555 F  MET 10  SD  ? ? D NI 1002 D MET 10   1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc50 metalc ? ? Y NI .  NI ? ? ? 1_555 F  HIS 106 NE2 ? ? D NI 1002 D HIS 106  1_555 ? ? ? ? ? ? ?            2.014 ? 
metalc51 metalc ? ? Y NI .  NI ? ? ? 1_555 F  CYS 102 O   ? ? D NI 1002 D CYS 102  1_555 ? ? ? ? ? ? ?            1.948 ? 
metalc52 metalc ? ? Z NI .  NI ? ? ? 1_555 BA ACT .   OXT ? ? D NI 1003 D ACT 2002 1_555 ? ? ? ? ? ? ?            2.422 ? 
metalc53 metalc ? ? Z NI .  NI ? ? ? 1_555 BA ACT .   O   ? ? D NI 1003 D ACT 2002 1_555 ? ? ? ? ? ? ?            1.969 ? 
metalc54 metalc ? ? Z NI .  NI ? ? ? 1_555 F  HIS 61  ND1 ? ? D NI 1003 D HIS 61   1_555 ? ? ? ? ? ? ?            2.014 ? 
hydrog1  hydrog ? ? A DC 1  N3 ? ? ? 1_555 B  DG  32  N1  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC 1  N4 ? ? ? 1_555 B  DG  32  O6  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 1  O2 ? ? ? 1_555 B  DG  32  N2  ? ? E DC 1    F DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B  DG  31  N1  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B  DG  31  O6  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B  DG  31  N2  ? ? E DC 2    F DG  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B  DG  30  N1  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B  DG  30  O6  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B  DG  30  N2  ? ? E DC 3    F DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT 4  N3 ? ? ? 1_555 B  DA  29  N1  ? ? E DT 4    F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT 4  O4 ? ? ? 1_555 B  DA  29  N6  ? ? E DT 4    F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG 5  N1 ? ? ? 1_555 B  DC  28  N3  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG 5  N2 ? ? ? 1_555 B  DC  28  O2  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG 5  O6 ? ? ? 1_555 B  DC  28  N4  ? ? E DG 5    F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B  DA  27  N1  ? ? E DT 6    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B  DA  27  N6  ? ? E DT 6    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B  DA  26  N1  ? ? E DT 7    F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B  DA  26  N6  ? ? E DT 7    F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B  DT  25  N3  ? ? E DA 8    F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B  DT  25  O4  ? ? E DA 8    F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B  DC  24  N3  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B  DC  24  O2  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B  DC  24  N4  ? ? E DG 9    F DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B  DG  23  N1  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B  DG  23  O6  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B  DG  23  N2  ? ? E DC 10   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B  DT  22  N3  ? ? E DA 11   F DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B  DT  22  O4  ? ? E DA 11   F DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B  DG  21  N1  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B  DG  21  O6  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B  DG  21  N2  ? ? E DC 12   F DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B  DT  20  N3  ? ? E DA 13   F DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B  DT  20  O4  ? ? E DA 13   F DT  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B  DC  19  N3  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B  DC  19  O2  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B  DC  19  N4  ? ? E DG 14   F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B  DC  18  N3  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B  DC  18  O2  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B  DC  18  N4  ? ? E DG 15   F DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B  DG  17  N1  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B  DG  17  O6  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B  DG  17  N2  ? ? E DC 16   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DT 17 N3 ? ? ? 1_555 B  DA  16  N1  ? ? E DT 17   F DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DT 17 O4 ? ? ? 1_555 B  DA  16  N6  ? ? E DT 17   F DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A DG 18 N1 ? ? ? 1_555 B  DC  15  N3  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A DG 18 N2 ? ? ? 1_555 B  DC  15  O2  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A DG 18 O6 ? ? ? 1_555 B  DC  15  N4  ? ? E DG 18   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? A DC 19 N3 ? ? ? 1_555 B  DG  14  N1  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? A DC 19 N4 ? ? ? 1_555 B  DG  14  O6  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? A DC 19 O2 ? ? ? 1_555 B  DG  14  N2  ? ? E DC 19   F DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? A DC 20 N3 ? ? ? 1_555 B  DG  13  N1  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? A DC 20 N4 ? ? ? 1_555 B  DG  13  O6  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? A DC 20 O2 ? ? ? 1_555 B  DG  13  N2  ? ? E DC 20   F DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? A DC 21 N3 ? ? ? 1_555 B  DG  12  N1  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? A DC 21 N4 ? ? ? 1_555 B  DG  12  O6  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? A DC 21 O2 ? ? ? 1_555 B  DG  12  N2  ? ? E DC 21   F DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? A DT 22 N3 ? ? ? 1_555 B  DA  11  N1  ? ? E DT 22   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? A DT 22 O4 ? ? ? 1_555 B  DA  11  N6  ? ? E DT 22   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? A DA 23 N1 ? ? ? 1_555 B  DT  10  N3  ? ? E DA 23   F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? A DA 23 N6 ? ? ? 1_555 B  DT  10  O4  ? ? E DA 23   F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? A DA 24 N1 ? ? ? 1_555 B  DT  9   N3  ? ? E DA 24   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? A DA 24 N6 ? ? ? 1_555 B  DT  9   O4  ? ? E DA 24   F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? A DT 25 N3 ? ? ? 1_555 B  DA  8   N1  ? ? E DT 25   F DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? A DT 25 O4 ? ? ? 1_555 B  DA  8   N6  ? ? E DT 25   F DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? A DT 26 N3 ? ? ? 1_555 B  DA  7   N1  ? ? E DT 26   F DA  7    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog66 hydrog ? ? A DT 27 N3 ? ? ? 1_555 B  DA  6   N1  ? ? E DT 27   F DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? A DT 27 O4 ? ? ? 1_555 B  DA  6   N6  ? ? E DT 27   F DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? A DT 28 N3 ? ? ? 1_555 B  DA  5   N1  ? ? E DT 28   F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? A DT 28 O4 ? ? ? 1_555 B  DA  5   N6  ? ? E DT 28   F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? A DA 29 N1 ? ? ? 1_555 B  DT  4   N3  ? ? E DA 29   F DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? A DA 29 N6 ? ? ? 1_555 B  DT  4   O4  ? ? E DA 29   F DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? A DG 30 N1 ? ? ? 1_555 B  DC  3   N3  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? A DG 30 N2 ? ? ? 1_555 B  DC  3   O2  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? A DG 30 O6 ? ? ? 1_555 B  DC  3   N4  ? ? E DG 30   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? A DT 31 N3 ? ? ? 1_555 B  DA  2   N1  ? ? E DT 31   F DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? A DT 31 O4 ? ? ? 1_555 B  DA  2   N6  ? ? E DT 31   F DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ? ? A DG 32 N1 ? ? ? 1_555 B  DC  1   N3  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? A DG 32 N2 ? ? ? 1_555 B  DC  1   O2  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ? ? A DG 32 O6 ? ? ? 1_555 B  DC  1   N4  ? ? E DG 32   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 54 ? VAL C 56 ? LEU A 54 VAL A 56 
A 2 LEU C 62 ? LEU C 64 ? LEU A 62 LEU A 64 
B 1 LEU D 54 ? VAL D 56 ? LEU B 54 VAL B 56 
B 2 LEU D 62 ? LEU D 64 ? LEU B 62 LEU B 64 
C 1 LEU E 54 ? VAL E 56 ? LEU C 54 VAL C 56 
C 2 LEU E 62 ? LEU E 64 ? LEU C 62 LEU C 64 
D 1 LEU F 54 ? VAL F 56 ? LEU D 54 VAL D 56 
D 2 LEU F 62 ? LEU F 64 ? LEU D 62 LEU D 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 55 ? N ARG A 55 O GLU C 63 ? O GLU A 63 
B 1 2 N ARG D 55 ? N ARG B 55 O GLU D 63 ? O GLU B 63 
C 1 2 N ARG E 55 ? N ARG C 55 O GLU E 63 ? O GLU C 63 
D 1 2 N ARG F 55 ? N ARG D 55 O GLU F 63 ? O GLU D 63 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 1001'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 1002'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 1003'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 1001'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 1002'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 1003'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI C 1001'  
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI C 1002'  
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI C 1003'  
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI D 1001'  
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI D 1002'  
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI D 1003'  
BC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT A 2001' 
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACT A 2002' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT A 2003' 
BC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT B 2001' 
BC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACT B 2002' 
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ACT C 2001' 
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT C 2002' 
CC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACT C 2003' 
CC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT D 2001' 
CC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT D 2002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS C  79  ? HIS A 79   . ? 1_555 ? 
2  AC1 4 GLU C  83  ? GLU A 83   . ? 1_555 ? 
3  AC1 4 HIS C  98  ? HIS A 98   . ? 1_555 ? 
4  AC1 4 ACT J  .   ? ACT A 2001 . ? 1_555 ? 
5  AC2 4 MET C  10  ? MET A 10   . ? 1_555 ? 
6  AC2 4 CYS C  102 ? CYS A 102  . ? 1_555 ? 
7  AC2 4 GLU C  105 ? GLU A 105  . ? 1_555 ? 
8  AC2 4 HIS C  106 ? HIS A 106  . ? 1_555 ? 
9  AC3 4 HIS C  61  ? HIS A 61   . ? 1_555 ? 
10 AC3 4 GLU C  63  ? GLU A 63   . ? 1_555 ? 
11 AC3 4 ACT K  .   ? ACT A 2002 . ? 1_555 ? 
12 AC3 4 ACT L  .   ? ACT A 2003 . ? 1_555 ? 
13 AC4 4 HIS D  79  ? HIS B 79   . ? 1_555 ? 
14 AC4 4 GLU D  83  ? GLU B 83   . ? 1_555 ? 
15 AC4 4 HIS D  98  ? HIS B 98   . ? 1_555 ? 
16 AC4 4 ACT P  .   ? ACT B 2001 . ? 1_555 ? 
17 AC5 4 MET D  10  ? MET B 10   . ? 1_555 ? 
18 AC5 4 CYS D  102 ? CYS B 102  . ? 1_555 ? 
19 AC5 4 GLU D  105 ? GLU B 105  . ? 1_555 ? 
20 AC5 4 HIS D  106 ? HIS B 106  . ? 1_555 ? 
21 AC6 4 ASP D  59  ? ASP B 59   . ? 1_555 ? 
22 AC6 4 HIS D  61  ? HIS B 61   . ? 1_555 ? 
23 AC6 4 GLU D  63  ? GLU B 63   . ? 1_555 ? 
24 AC6 4 ACT Q  .   ? ACT B 2002 . ? 1_555 ? 
25 AC7 4 HIS E  79  ? HIS C 79   . ? 1_555 ? 
26 AC7 4 GLU E  83  ? GLU C 83   . ? 1_555 ? 
27 AC7 4 HIS E  98  ? HIS C 98   . ? 1_555 ? 
28 AC7 4 ACT U  .   ? ACT C 2001 . ? 1_555 ? 
29 AC8 5 MET E  10  ? MET C 10   . ? 1_555 ? 
30 AC8 5 CYS E  102 ? CYS C 102  . ? 1_555 ? 
31 AC8 5 GLU E  105 ? GLU C 105  . ? 1_555 ? 
32 AC8 5 HIS E  106 ? HIS C 106  . ? 1_555 ? 
33 AC8 5 HOH GA .   ? HOH C 2007 . ? 1_555 ? 
34 AC9 5 ASP E  59  ? ASP C 59   . ? 1_555 ? 
35 AC9 5 HIS E  61  ? HIS C 61   . ? 1_555 ? 
36 AC9 5 GLU E  63  ? GLU C 63   . ? 1_555 ? 
37 AC9 5 ACT V  .   ? ACT C 2002 . ? 1_555 ? 
38 AC9 5 ACT W  .   ? ACT C 2003 . ? 1_555 ? 
39 BC1 4 HIS F  79  ? HIS D 79   . ? 1_555 ? 
40 BC1 4 GLU F  83  ? GLU D 83   . ? 1_555 ? 
41 BC1 4 HIS F  98  ? HIS D 98   . ? 1_555 ? 
42 BC1 4 ACT AA .   ? ACT D 2001 . ? 1_555 ? 
43 BC2 5 MET F  10  ? MET D 10   . ? 1_555 ? 
44 BC2 5 ARG F  13  ? ARG D 13   . ? 1_555 ? 
45 BC2 5 CYS F  102 ? CYS D 102  . ? 1_555 ? 
46 BC2 5 GLU F  105 ? GLU D 105  . ? 1_555 ? 
47 BC2 5 HIS F  106 ? HIS D 106  . ? 1_555 ? 
48 BC3 4 ASP F  59  ? ASP D 59   . ? 1_555 ? 
49 BC3 4 HIS F  61  ? HIS D 61   . ? 1_555 ? 
50 BC3 4 GLU F  63  ? GLU D 63   . ? 1_555 ? 
51 BC3 4 ACT BA .   ? ACT D 2002 . ? 1_555 ? 
52 BC4 5 HIS C  79  ? HIS A 79   . ? 1_555 ? 
53 BC4 5 GLU C  83  ? GLU A 83   . ? 1_555 ? 
54 BC4 5 HIS C  98  ? HIS A 98   . ? 1_555 ? 
55 BC4 5 ASN C  130 ? ASN A 130  . ? 1_555 ? 
56 BC4 5 NI  G  .   ? NI  A 1001 . ? 1_555 ? 
57 BC5 3 HIS C  61  ? HIS A 61   . ? 1_555 ? 
58 BC5 3 GLU C  63  ? GLU A 63   . ? 1_555 ? 
59 BC5 3 NI  I  .   ? NI  A 1003 . ? 1_555 ? 
60 BC6 4 ASP C  59  ? ASP A 59   . ? 1_555 ? 
61 BC6 4 HIS C  61  ? HIS A 61   . ? 1_555 ? 
62 BC6 4 GLU C  63  ? GLU A 63   . ? 1_555 ? 
63 BC6 4 NI  I  .   ? NI  A 1003 . ? 1_555 ? 
64 BC7 5 HIS D  79  ? HIS B 79   . ? 1_555 ? 
65 BC7 5 GLU D  83  ? GLU B 83   . ? 1_555 ? 
66 BC7 5 HIS D  98  ? HIS B 98   . ? 1_555 ? 
67 BC7 5 ASN D  130 ? ASN B 130  . ? 1_555 ? 
68 BC7 5 NI  M  .   ? NI  B 1001 . ? 1_555 ? 
69 BC8 3 HIS D  61  ? HIS B 61   . ? 1_555 ? 
70 BC8 3 GLU D  63  ? GLU B 63   . ? 1_555 ? 
71 BC8 3 NI  O  .   ? NI  B 1003 . ? 1_555 ? 
72 BC9 6 HIS E  79  ? HIS C 79   . ? 1_555 ? 
73 BC9 6 ARG E  80  ? ARG C 80   . ? 1_555 ? 
74 BC9 6 GLU E  83  ? GLU C 83   . ? 1_555 ? 
75 BC9 6 HIS E  98  ? HIS C 98   . ? 1_555 ? 
76 BC9 6 ASN E  130 ? ASN C 130  . ? 1_555 ? 
77 BC9 6 NI  R  .   ? NI  C 1001 . ? 1_555 ? 
78 CC1 4 ASP C  88  ? ASP A 88   . ? 1_565 ? 
79 CC1 4 HIS E  61  ? HIS C 61   . ? 1_555 ? 
80 CC1 4 GLU E  63  ? GLU C 63   . ? 1_555 ? 
81 CC1 4 NI  T  .   ? NI  C 1003 . ? 1_555 ? 
82 CC2 3 ASP E  59  ? ASP C 59   . ? 1_555 ? 
83 CC2 3 GLU E  63  ? GLU C 63   . ? 1_555 ? 
84 CC2 3 NI  T  .   ? NI  C 1003 . ? 1_555 ? 
85 CC3 4 HIS F  79  ? HIS D 79   . ? 1_555 ? 
86 CC3 4 GLU F  83  ? GLU D 83   . ? 1_555 ? 
87 CC3 4 HIS F  98  ? HIS D 98   . ? 1_555 ? 
88 CC3 4 NI  X  .   ? NI  D 1001 . ? 1_555 ? 
89 CC4 4 ASP F  59  ? ASP D 59   . ? 1_555 ? 
90 CC4 4 HIS F  61  ? HIS D 61   . ? 1_555 ? 
91 CC4 4 GLU F  63  ? GLU D 63   . ? 1_555 ? 
92 CC4 4 NI  Z  .   ? NI  D 1003 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2IT0 
_atom_sites.fract_transf_matrix[1][1]   0.018515 
_atom_sites.fract_transf_matrix[1][2]   0.001568 
_atom_sites.fract_transf_matrix[1][3]   0.005194 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014263 
_atom_sites.fract_transf_matrix[2][3]   0.005403 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013797 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A  1 1   ? -35.351 -5.284  27.154  1.00 49.82 ? 1    DC  E "O5'" 1 
ATOM   2    C  "C5'" . DC  A  1 1   ? -34.689 -6.302  27.905  1.00 49.87 ? 1    DC  E "C5'" 1 
ATOM   3    C  "C4'" . DC  A  1 1   ? -34.577 -5.912  29.370  1.00 49.98 ? 1    DC  E "C4'" 1 
ATOM   4    O  "O4'" . DC  A  1 1   ? -34.779 -7.090  30.188  1.00 49.80 ? 1    DC  E "O4'" 1 
ATOM   5    C  "C3'" . DC  A  1 1   ? -33.221 -5.350  29.771  1.00 49.90 ? 1    DC  E "C3'" 1 
ATOM   6    O  "O3'" . DC  A  1 1   ? -33.293 -3.931  29.805  1.00 49.92 ? 1    DC  E "O3'" 1 
ATOM   7    C  "C2'" . DC  A  1 1   ? -32.930 -5.933  31.153  1.00 49.40 ? 1    DC  E "C2'" 1 
ATOM   8    C  "C1'" . DC  A  1 1   ? -33.784 -7.196  31.185  1.00 49.45 ? 1    DC  E "C1'" 1 
ATOM   9    N  N1    . DC  A  1 1   ? -33.062 -8.489  30.960  1.00 49.52 ? 1    DC  E N1    1 
ATOM   10   C  C2    . DC  A  1 1   ? -32.172 -8.966  31.934  1.00 49.38 ? 1    DC  E C2    1 
ATOM   11   O  O2    . DC  A  1 1   ? -31.983 -8.301  32.960  1.00 49.33 ? 1    DC  E O2    1 
ATOM   12   N  N3    . DC  A  1 1   ? -31.539 -10.151 31.726  1.00 49.09 ? 1    DC  E N3    1 
ATOM   13   C  C4    . DC  A  1 1   ? -31.764 -10.847 30.607  1.00 49.39 ? 1    DC  E C4    1 
ATOM   14   N  N4    . DC  A  1 1   ? -31.109 -12.006 30.456  1.00 49.29 ? 1    DC  E N4    1 
ATOM   15   C  C5    . DC  A  1 1   ? -32.669 -10.382 29.600  1.00 49.39 ? 1    DC  E C5    1 
ATOM   16   C  C6    . DC  A  1 1   ? -33.287 -9.211  29.817  1.00 49.42 ? 1    DC  E C6    1 
ATOM   17   P  P     . DC  A  1 2   ? -32.085 -3.080  29.176  1.00 51.18 ? 2    DC  E P     1 
ATOM   18   O  OP1   . DC  A  1 2   ? -32.445 -1.642  29.199  1.00 50.61 ? 2    DC  E OP1   1 
ATOM   19   O  OP2   . DC  A  1 2   ? -31.706 -3.725  27.893  1.00 50.79 ? 2    DC  E OP2   1 
ATOM   20   O  "O5'" . DC  A  1 2   ? -30.906 -3.327  30.232  1.00 49.44 ? 2    DC  E "O5'" 1 
ATOM   21   C  "C5'" . DC  A  1 2   ? -31.027 -2.820  31.561  1.00 47.40 ? 2    DC  E "C5'" 1 
ATOM   22   C  "C4'" . DC  A  1 2   ? -29.817 -3.261  32.351  1.00 45.81 ? 2    DC  E "C4'" 1 
ATOM   23   O  "O4'" . DC  A  1 2   ? -29.790 -4.714  32.392  1.00 44.71 ? 2    DC  E "O4'" 1 
ATOM   24   C  "C3'" . DC  A  1 2   ? -28.501 -2.821  31.714  1.00 45.20 ? 2    DC  E "C3'" 1 
ATOM   25   O  "O3'" . DC  A  1 2   ? -27.713 -2.110  32.668  1.00 45.18 ? 2    DC  E "O3'" 1 
ATOM   26   C  "C2'" . DC  A  1 2   ? -27.844 -4.131  31.278  1.00 44.38 ? 2    DC  E "C2'" 1 
ATOM   27   C  "C1'" . DC  A  1 2   ? -28.455 -5.142  32.241  1.00 42.59 ? 2    DC  E "C1'" 1 
ATOM   28   N  N1    . DC  A  1 2   ? -28.457 -6.529  31.717  1.00 41.39 ? 2    DC  E N1    1 
ATOM   29   C  C2    . DC  A  1 2   ? -27.671 -7.514  32.331  1.00 41.08 ? 2    DC  E C2    1 
ATOM   30   O  O2    . DC  A  1 2   ? -26.983 -7.217  33.319  1.00 40.85 ? 2    DC  E O2    1 
ATOM   31   N  N3    . DC  A  1 2   ? -27.687 -8.777  31.832  1.00 40.55 ? 2    DC  E N3    1 
ATOM   32   C  C4    . DC  A  1 2   ? -28.445 -9.064  30.772  1.00 41.05 ? 2    DC  E C4    1 
ATOM   33   N  N4    . DC  A  1 2   ? -28.431 -10.320 30.313  1.00 40.76 ? 2    DC  E N4    1 
ATOM   34   C  C5    . DC  A  1 2   ? -29.250 -8.072  30.133  1.00 41.01 ? 2    DC  E C5    1 
ATOM   35   C  C6    . DC  A  1 2   ? -29.226 -6.830  30.632  1.00 41.22 ? 2    DC  E C6    1 
ATOM   36   P  P     . DC  A  1 3   ? -26.440 -1.240  32.212  1.00 45.24 ? 3    DC  E P     1 
ATOM   37   O  OP1   . DC  A  1 3   ? -26.187 -0.255  33.291  1.00 44.65 ? 3    DC  E OP1   1 
ATOM   38   O  OP2   . DC  A  1 3   ? -26.683 -0.798  30.819  1.00 44.38 ? 3    DC  E OP2   1 
ATOM   39   O  "O5'" . DC  A  1 3   ? -25.232 -2.302  32.223  1.00 44.15 ? 3    DC  E "O5'" 1 
ATOM   40   C  "C5'" . DC  A  1 3   ? -25.180 -3.269  33.268  1.00 42.42 ? 3    DC  E "C5'" 1 
ATOM   41   C  "C4'" . DC  A  1 3   ? -23.751 -3.654  33.584  1.00 41.59 ? 3    DC  E "C4'" 1 
ATOM   42   O  "O4'" . DC  A  1 3   ? -23.541 -5.072  33.333  1.00 41.66 ? 3    DC  E "O4'" 1 
ATOM   43   C  "C3'" . DC  A  1 3   ? -22.712 -2.961  32.726  1.00 40.46 ? 3    DC  E "C3'" 1 
ATOM   44   O  "O3'" . DC  A  1 3   ? -21.492 -3.093  33.401  1.00 39.38 ? 3    DC  E "O3'" 1 
ATOM   45   C  "C2'" . DC  A  1 3   ? -22.734 -3.831  31.477  1.00 40.49 ? 3    DC  E "C2'" 1 
ATOM   46   C  "C1'" . DC  A  1 3   ? -22.917 -5.232  32.071  1.00 40.30 ? 3    DC  E "C1'" 1 
ATOM   47   N  N1    . DC  A  1 3   ? -23.766 -6.098  31.208  1.00 39.42 ? 3    DC  E N1    1 
ATOM   48   C  C2    . DC  A  1 3   ? -23.558 -7.483  31.160  1.00 39.08 ? 3    DC  E C2    1 
ATOM   49   O  O2    . DC  A  1 3   ? -22.671 -7.992  31.854  1.00 38.91 ? 3    DC  E O2    1 
ATOM   50   N  N3    . DC  A  1 3   ? -24.343 -8.234  30.346  1.00 39.10 ? 3    DC  E N3    1 
ATOM   51   C  C4    . DC  A  1 3   ? -25.293 -7.646  29.611  1.00 39.19 ? 3    DC  E C4    1 
ATOM   52   N  N4    . DC  A  1 3   ? -26.049 -8.414  28.821  1.00 39.30 ? 3    DC  E N4    1 
ATOM   53   C  C5    . DC  A  1 3   ? -25.512 -6.239  29.646  1.00 38.80 ? 3    DC  E C5    1 
ATOM   54   C  C6    . DC  A  1 3   ? -24.734 -5.509  30.449  1.00 38.92 ? 3    DC  E C6    1 
ATOM   55   P  P     . DT  A  1 4   ? -20.170 -2.440  32.795  1.00 39.03 ? 4    DT  E P     1 
ATOM   56   O  OP1   . DT  A  1 4   ? -19.294 -2.105  33.945  1.00 39.36 ? 4    DT  E OP1   1 
ATOM   57   O  OP2   . DT  A  1 4   ? -20.586 -1.419  31.809  1.00 37.88 ? 4    DT  E OP2   1 
ATOM   58   O  "O5'" . DT  A  1 4   ? -19.487 -3.664  32.023  1.00 37.93 ? 4    DT  E "O5'" 1 
ATOM   59   C  "C5'" . DT  A  1 4   ? -18.984 -4.769  32.764  1.00 35.15 ? 4    DT  E "C5'" 1 
ATOM   60   C  "C4'" . DT  A  1 4   ? -18.443 -5.810  31.801  1.00 33.67 ? 4    DT  E "C4'" 1 
ATOM   61   O  "O4'" . DT  A  1 4   ? -19.563 -6.426  31.115  1.00 32.69 ? 4    DT  E "O4'" 1 
ATOM   62   C  "C3'" . DT  A  1 4   ? -17.518 -5.249  30.724  1.00 32.58 ? 4    DT  E "C3'" 1 
ATOM   63   O  "O3'" . DT  A  1 4   ? -16.199 -5.782  30.900  1.00 31.52 ? 4    DT  E "O3'" 1 
ATOM   64   C  "C2'" . DT  A  1 4   ? -18.177 -5.637  29.393  1.00 32.11 ? 4    DT  E "C2'" 1 
ATOM   65   C  "C1'" . DT  A  1 4   ? -19.184 -6.719  29.791  1.00 31.58 ? 4    DT  E "C1'" 1 
ATOM   66   N  N1    . DT  A  1 4   ? -20.422 -6.826  28.925  1.00 30.94 ? 4    DT  E N1    1 
ATOM   67   C  C2    . DT  A  1 4   ? -20.764 -8.067  28.435  1.00 30.44 ? 4    DT  E C2    1 
ATOM   68   O  O2    . DT  A  1 4   ? -20.103 -9.055  28.675  1.00 30.70 ? 4    DT  E O2    1 
ATOM   69   N  N3    . DT  A  1 4   ? -21.892 -8.112  27.656  1.00 29.76 ? 4    DT  E N3    1 
ATOM   70   C  C4    . DT  A  1 4   ? -22.711 -7.045  27.325  1.00 30.38 ? 4    DT  E C4    1 
ATOM   71   O  O4    . DT  A  1 4   ? -23.706 -7.172  26.613  1.00 30.14 ? 4    DT  E O4    1 
ATOM   72   C  C5    . DT  A  1 4   ? -22.308 -5.769  27.867  1.00 30.35 ? 4    DT  E C5    1 
ATOM   73   C  C7    . DT  A  1 4   ? -23.033 -4.521  27.446  1.00 30.39 ? 4    DT  E C7    1 
ATOM   74   C  C6    . DT  A  1 4   ? -21.201 -5.720  28.634  1.00 30.72 ? 4    DT  E C6    1 
ATOM   75   P  P     . DG  A  1 5   ? -14.941 -5.201  30.090  1.00 30.12 ? 5    DG  E P     1 
ATOM   76   O  OP1   . DG  A  1 5   ? -13.721 -5.427  30.880  1.00 30.32 ? 5    DG  E OP1   1 
ATOM   77   O  OP2   . DG  A  1 5   ? -15.254 -3.841  29.617  1.00 31.19 ? 5    DG  E OP2   1 
ATOM   78   O  "O5'" . DG  A  1 5   ? -14.917 -6.149  28.806  1.00 30.97 ? 5    DG  E "O5'" 1 
ATOM   79   C  "C5'" . DG  A  1 5   ? -14.675 -7.543  28.987  1.00 30.13 ? 5    DG  E "C5'" 1 
ATOM   80   C  "C4'" . DG  A  1 5   ? -15.356 -8.420  27.946  1.00 29.33 ? 5    DG  E "C4'" 1 
ATOM   81   O  "O4'" . DG  A  1 5   ? -16.766 -8.146  27.773  1.00 28.58 ? 5    DG  E "O4'" 1 
ATOM   82   C  "C3'" . DG  A  1 5   ? -14.829 -8.300  26.533  1.00 28.77 ? 5    DG  E "C3'" 1 
ATOM   83   O  "O3'" . DG  A  1 5   ? -13.633 -9.027  26.497  1.00 29.51 ? 5    DG  E "O3'" 1 
ATOM   84   C  "C2'" . DG  A  1 5   ? -15.922 -9.020  25.751  1.00 28.26 ? 5    DG  E "C2'" 1 
ATOM   85   C  "C1'" . DG  A  1 5   ? -17.146 -8.918  26.658  1.00 26.42 ? 5    DG  E "C1'" 1 
ATOM   86   N  N9    . DG  A  1 5   ? -18.255 -8.253  26.006  1.00 25.88 ? 5    DG  E N9    1 
ATOM   87   C  C8    . DG  A  1 5   ? -18.543 -6.916  26.028  1.00 25.46 ? 5    DG  E C8    1 
ATOM   88   N  N7    . DG  A  1 5   ? -19.616 -6.616  25.349  1.00 25.44 ? 5    DG  E N7    1 
ATOM   89   C  C5    . DG  A  1 5   ? -20.059 -7.831  24.848  1.00 24.87 ? 5    DG  E C5    1 
ATOM   90   C  C6    . DG  A  1 5   ? -21.169 -8.116  24.034  1.00 24.96 ? 5    DG  E C6    1 
ATOM   91   O  O6    . DG  A  1 5   ? -22.009 -7.312  23.590  1.00 25.68 ? 5    DG  E O6    1 
ATOM   92   N  N1    . DG  A  1 5   ? -21.257 -9.475  23.748  1.00 24.74 ? 5    DG  E N1    1 
ATOM   93   C  C2    . DG  A  1 5   ? -20.375 -10.430 24.196  1.00 25.42 ? 5    DG  E C2    1 
ATOM   94   N  N2    . DG  A  1 5   ? -20.623 -11.695 23.825  1.00 25.66 ? 5    DG  E N2    1 
ATOM   95   N  N3    . DG  A  1 5   ? -19.320 -10.175 24.960  1.00 25.36 ? 5    DG  E N3    1 
ATOM   96   C  C4    . DG  A  1 5   ? -19.231 -8.852  25.242  1.00 25.64 ? 5    DG  E C4    1 
ATOM   97   P  P     . DT  A  1 6   ? -12.809 -9.190  25.142  1.00 28.96 ? 6    DT  E P     1 
ATOM   98   O  OP1   . DT  A  1 6   ? -11.462 -9.634  25.566  1.00 28.01 ? 6    DT  E OP1   1 
ATOM   99   O  OP2   . DT  A  1 6   ? -13.000 -7.973  24.321  1.00 28.68 ? 6    DT  E OP2   1 
ATOM   100  O  "O5'" . DT  A  1 6   ? -13.561 -10.382 24.390  1.00 29.21 ? 6    DT  E "O5'" 1 
ATOM   101  C  "C5'" . DT  A  1 6   ? -13.609 -11.695 24.917  1.00 30.23 ? 6    DT  E "C5'" 1 
ATOM   102  C  "C4'" . DT  A  1 6   ? -14.362 -12.575 23.939  1.00 31.16 ? 6    DT  E "C4'" 1 
ATOM   103  O  "O4'" . DT  A  1 6   ? -15.702 -12.064 23.691  1.00 31.55 ? 6    DT  E "O4'" 1 
ATOM   104  C  "C3'" . DT  A  1 6   ? -13.687 -12.642 22.581  1.00 32.10 ? 6    DT  E "C3'" 1 
ATOM   105  O  "O3'" . DT  A  1 6   ? -13.654 -13.989 22.163  1.00 34.08 ? 6    DT  E "O3'" 1 
ATOM   106  C  "C2'" . DT  A  1 6   ? -14.570 -11.799 21.665  1.00 31.65 ? 6    DT  E "C2'" 1 
ATOM   107  C  "C1'" . DT  A  1 6   ? -15.941 -11.964 22.301  1.00 30.73 ? 6    DT  E "C1'" 1 
ATOM   108  N  N1    . DT  A  1 6   ? -16.824 -10.796 22.025  1.00 30.71 ? 6    DT  E N1    1 
ATOM   109  C  C2    . DT  A  1 6   ? -17.913 -10.966 21.211  1.00 30.48 ? 6    DT  E C2    1 
ATOM   110  O  O2    . DT  A  1 6   ? -18.200 -12.028 20.707  1.00 30.78 ? 6    DT  E O2    1 
ATOM   111  N  N3    . DT  A  1 6   ? -18.667 -9.846  20.999  1.00 30.20 ? 6    DT  E N3    1 
ATOM   112  C  C4    . DT  A  1 6   ? -18.443 -8.588  21.508  1.00 30.25 ? 6    DT  E C4    1 
ATOM   113  O  O4    . DT  A  1 6   ? -19.186 -7.644  21.257  1.00 29.89 ? 6    DT  E O4    1 
ATOM   114  C  C5    . DT  A  1 6   ? -17.283 -8.475  22.352  1.00 30.41 ? 6    DT  E C5    1 
ATOM   115  C  C7    . DT  A  1 6   ? -16.940 -7.154  22.976  1.00 31.44 ? 6    DT  E C7    1 
ATOM   116  C  C6    . DT  A  1 6   ? -16.536 -9.564  22.566  1.00 30.45 ? 6    DT  E C6    1 
ATOM   117  P  P     . DT  A  1 7   ? -12.763 -14.351 20.894  1.00 35.49 ? 7    DT  E P     1 
ATOM   118  O  OP1   . DT  A  1 7   ? -12.345 -15.765 21.034  1.00 35.45 ? 7    DT  E OP1   1 
ATOM   119  O  OP2   . DT  A  1 7   ? -11.762 -13.266 20.722  1.00 34.90 ? 7    DT  E OP2   1 
ATOM   120  O  "O5'" . DT  A  1 7   ? -13.835 -14.281 19.706  1.00 34.83 ? 7    DT  E "O5'" 1 
ATOM   121  C  "C5'" . DT  A  1 7   ? -15.128 -14.836 19.897  1.00 33.57 ? 7    DT  E "C5'" 1 
ATOM   122  C  "C4'" . DT  A  1 7   ? -15.730 -15.228 18.561  1.00 33.43 ? 7    DT  E "C4'" 1 
ATOM   123  O  "O4'" . DT  A  1 7   ? -16.695 -14.217 18.180  1.00 33.10 ? 7    DT  E "O4'" 1 
ATOM   124  C  "C3'" . DT  A  1 7   ? -14.773 -15.315 17.372  1.00 33.19 ? 7    DT  E "C3'" 1 
ATOM   125  O  "O3'" . DT  A  1 7   ? -15.379 -16.183 16.358  1.00 32.70 ? 7    DT  E "O3'" 1 
ATOM   126  C  "C2'" . DT  A  1 7   ? -14.679 -13.830 16.992  1.00 33.02 ? 7    DT  E "C2'" 1 
ATOM   127  C  "C1'" . DT  A  1 7   ? -16.142 -13.415 17.152  1.00 32.84 ? 7    DT  E "C1'" 1 
ATOM   128  N  N1    . DT  A  1 7   ? -16.421 -11.990 17.509  1.00 32.81 ? 7    DT  E N1    1 
ATOM   129  C  C2    . DT  A  1 7   ? -17.651 -11.501 17.141  1.00 32.92 ? 7    DT  E C2    1 
ATOM   130  O  O2    . DT  A  1 7   ? -18.473 -12.183 16.551  1.00 33.22 ? 7    DT  E O2    1 
ATOM   131  N  N3    . DT  A  1 7   ? -17.881 -10.195 17.484  1.00 32.49 ? 7    DT  E N3    1 
ATOM   132  C  C4    . DT  A  1 7   ? -17.024 -9.349  18.155  1.00 32.22 ? 7    DT  E C4    1 
ATOM   133  O  O4    . DT  A  1 7   ? -17.342 -8.192  18.410  1.00 32.34 ? 7    DT  E O4    1 
ATOM   134  C  C5    . DT  A  1 7   ? -15.749 -9.922  18.520  1.00 32.44 ? 7    DT  E C5    1 
ATOM   135  C  C7    . DT  A  1 7   ? -14.780 -9.138  19.359  1.00 31.68 ? 7    DT  E C7    1 
ATOM   136  C  C6    . DT  A  1 7   ? -15.511 -11.201 18.184  1.00 32.68 ? 7    DT  E C6    1 
ATOM   137  P  P     . DA  A  1 8   ? -14.772 -16.542 14.897  1.00 31.81 ? 8    DA  E P     1 
ATOM   138  O  OP1   . DA  A  1 8   ? -15.086 -17.964 14.620  1.00 31.07 ? 8    DA  E OP1   1 
ATOM   139  O  OP2   . DA  A  1 8   ? -13.388 -16.018 14.787  1.00 29.79 ? 8    DA  E OP2   1 
ATOM   140  O  "O5'" . DA  A  1 8   ? -15.714 -15.705 13.911  1.00 29.50 ? 8    DA  E "O5'" 1 
ATOM   141  C  "C5'" . DA  A  1 8   ? -17.119 -15.905 13.864  1.00 26.66 ? 8    DA  E "C5'" 1 
ATOM   142  C  "C4'" . DA  A  1 8   ? -17.640 -14.958 12.807  1.00 24.96 ? 8    DA  E "C4'" 1 
ATOM   143  O  "O4'" . DA  A  1 8   ? -17.758 -13.616 13.354  1.00 25.07 ? 8    DA  E "O4'" 1 
ATOM   144  C  "C3'" . DA  A  1 8   ? -16.710 -14.814 11.608  1.00 23.74 ? 8    DA  E "C3'" 1 
ATOM   145  O  "O3'" . DA  A  1 8   ? -17.524 -14.884 10.441  1.00 22.96 ? 8    DA  E "O3'" 1 
ATOM   146  C  "C2'" . DA  A  1 8   ? -16.046 -13.449 11.802  1.00 23.06 ? 8    DA  E "C2'" 1 
ATOM   147  C  "C1'" . DA  A  1 8   ? -17.169 -12.675 12.478  1.00 22.98 ? 8    DA  E "C1'" 1 
ATOM   148  N  N9    . DA  A  1 8   ? -16.802 -11.499 13.276  1.00 22.77 ? 8    DA  E N9    1 
ATOM   149  C  C8    . DA  A  1 8   ? -15.702 -11.315 14.067  1.00 22.55 ? 8    DA  E C8    1 
ATOM   150  N  N7    . DA  A  1 8   ? -15.661 -10.144 14.666  1.00 22.33 ? 8    DA  E N7    1 
ATOM   151  C  C5    . DA  A  1 8   ? -16.818 -9.509  14.244  1.00 22.59 ? 8    DA  E C5    1 
ATOM   152  C  C6    . DA  A  1 8   ? -17.378 -8.237  14.518  1.00 22.40 ? 8    DA  E C6    1 
ATOM   153  N  N6    . DA  A  1 8   ? -16.816 -7.331  15.325  1.00 22.48 ? 8    DA  E N6    1 
ATOM   154  N  N1    . DA  A  1 8   ? -18.546 -7.914  13.928  1.00 22.33 ? 8    DA  E N1    1 
ATOM   155  C  C2    . DA  A  1 8   ? -19.121 -8.815  13.126  1.00 22.72 ? 8    DA  E C2    1 
ATOM   156  N  N3    . DA  A  1 8   ? -18.695 -10.039 12.791  1.00 23.07 ? 8    DA  E N3    1 
ATOM   157  C  C4    . DA  A  1 8   ? -17.527 -10.332 13.388  1.00 22.85 ? 8    DA  E C4    1 
ATOM   158  P  P     . DG  A  1 9   ? -16.917 -14.647 8.985   1.00 21.34 ? 9    DG  E P     1 
ATOM   159  O  OP1   . DG  A  1 9   ? -17.714 -15.481 8.054   1.00 20.55 ? 9    DG  E OP1   1 
ATOM   160  O  OP2   . DG  A  1 9   ? -15.445 -14.779 9.071   1.00 20.33 ? 9    DG  E OP2   1 
ATOM   161  O  "O5'" . DG  A  1 9   ? -17.271 -13.111 8.724   1.00 19.96 ? 9    DG  E "O5'" 1 
ATOM   162  C  "C5'" . DG  A  1 9   ? -18.594 -12.736 8.350   1.00 18.40 ? 9    DG  E "C5'" 1 
ATOM   163  C  "C4'" . DG  A  1 9   ? -18.639 -11.252 8.052   1.00 18.08 ? 9    DG  E "C4'" 1 
ATOM   164  O  "O4'" . DG  A  1 9   ? -18.280 -10.533 9.261   1.00 18.95 ? 9    DG  E "O4'" 1 
ATOM   165  C  "C3'" . DG  A  1 9   ? -17.647 -10.783 6.987   1.00 18.10 ? 9    DG  E "C3'" 1 
ATOM   166  O  "O3'" . DG  A  1 9   ? -18.238 -9.935  6.016   1.00 17.01 ? 9    DG  E "O3'" 1 
ATOM   167  C  "C2'" . DG  A  1 9   ? -16.640 -9.972  7.782   1.00 18.54 ? 9    DG  E "C2'" 1 
ATOM   168  C  "C1'" . DG  A  1 9   ? -17.563 -9.405  8.846   1.00 19.91 ? 9    DG  E "C1'" 1 
ATOM   169  N  N9    . DG  A  1 9   ? -16.790 -8.813  9.922   1.00 20.37 ? 9    DG  E N9    1 
ATOM   170  C  C8    . DG  A  1 9   ? -15.629 -9.326  10.459  1.00 20.80 ? 9    DG  E C8    1 
ATOM   171  N  N7    . DG  A  1 9   ? -15.110 -8.575  11.391  1.00 21.09 ? 9    DG  E N7    1 
ATOM   172  C  C5    . DG  A  1 9   ? -15.976 -7.488  11.466  1.00 20.78 ? 9    DG  E C5    1 
ATOM   173  C  C6    . DG  A  1 9   ? -15.916 -6.348  12.299  1.00 20.31 ? 9    DG  E C6    1 
ATOM   174  O  O6    . DG  A  1 9   ? -15.069 -6.071  13.164  1.00 20.23 ? 9    DG  E O6    1 
ATOM   175  N  N1    . DG  A  1 9   ? -16.983 -5.489  12.050  1.00 20.68 ? 9    DG  E N1    1 
ATOM   176  C  C2    . DG  A  1 9   ? -17.975 -5.700  11.116  1.00 20.64 ? 9    DG  E C2    1 
ATOM   177  N  N2    . DG  A  1 9   ? -18.907 -4.744  11.033  1.00 20.13 ? 9    DG  E N2    1 
ATOM   178  N  N3    . DG  A  1 9   ? -18.039 -6.765  10.319  1.00 20.68 ? 9    DG  E N3    1 
ATOM   179  C  C4    . DG  A  1 9   ? -17.009 -7.612  10.552  1.00 20.57 ? 9    DG  E C4    1 
ATOM   180  P  P     . DC  A  1 10  ? -17.670 -9.956  4.524   1.00 15.93 ? 10   DC  E P     1 
ATOM   181  O  OP1   . DC  A  1 10  ? -18.646 -10.710 3.704   1.00 17.32 ? 10   DC  E OP1   1 
ATOM   182  O  OP2   . DC  A  1 10  ? -16.249 -10.349 4.555   1.00 16.19 ? 10   DC  E OP2   1 
ATOM   183  O  "O5'" . DC  A  1 10  ? -17.717 -8.439  4.049   1.00 16.40 ? 10   DC  E "O5'" 1 
ATOM   184  C  "C5'" . DC  A  1 10  ? -16.854 -7.519  4.647   1.00 16.36 ? 10   DC  E "C5'" 1 
ATOM   185  C  "C4'" . DC  A  1 10  ? -17.650 -6.364  5.211   1.00 16.13 ? 10   DC  E "C4'" 1 
ATOM   186  O  "O4'" . DC  A  1 10  ? -17.633 -6.437  6.660   1.00 15.18 ? 10   DC  E "O4'" 1 
ATOM   187  C  "C3'" . DC  A  1 10  ? -17.047 -5.017  4.846   1.00 16.19 ? 10   DC  E "C3'" 1 
ATOM   188  O  "O3'" . DC  A  1 10  ? -17.630 -4.590  3.643   1.00 17.25 ? 10   DC  E "O3'" 1 
ATOM   189  C  "C2'" . DC  A  1 10  ? -17.435 -4.144  6.034   1.00 15.24 ? 10   DC  E "C2'" 1 
ATOM   190  C  "C1'" . DC  A  1 10  ? -17.427 -5.137  7.197   1.00 14.82 ? 10   DC  E "C1'" 1 
ATOM   191  N  N1    . DC  A  1 10  ? -16.172 -5.127  8.030   1.00 14.28 ? 10   DC  E N1    1 
ATOM   192  C  C2    . DC  A  1 10  ? -16.017 -4.131  8.991   1.00 14.14 ? 10   DC  E C2    1 
ATOM   193  O  O2    . DC  A  1 10  ? -16.913 -3.307  9.116   1.00 14.85 ? 10   DC  E O2    1 
ATOM   194  N  N3    . DC  A  1 10  ? -14.908 -4.099  9.763   1.00 14.53 ? 10   DC  E N3    1 
ATOM   195  C  C4    . DC  A  1 10  ? -13.960 -5.027  9.593   1.00 14.47 ? 10   DC  E C4    1 
ATOM   196  N  N4    . DC  A  1 10  ? -12.879 -4.953  10.374  1.00 13.54 ? 10   DC  E N4    1 
ATOM   197  C  C5    . DC  A  1 10  ? -14.085 -6.059  8.609   1.00 14.03 ? 10   DC  E C5    1 
ATOM   198  C  C6    . DC  A  1 10  ? -15.197 -6.075  7.860   1.00 14.18 ? 10   DC  E C6    1 
ATOM   199  P  P     . DA  A  1 11  ? -16.965 -3.410  2.799   1.00 18.91 ? 11   DA  E P     1 
ATOM   200  O  OP1   . DA  A  1 11  ? -17.794 -3.190  1.587   1.00 17.09 ? 11   DA  E OP1   1 
ATOM   201  O  OP2   . DA  A  1 11  ? -15.524 -3.740  2.705   1.00 18.28 ? 11   DA  E OP2   1 
ATOM   202  O  "O5'" . DA  A  1 11  ? -17.068 -2.116  3.733   1.00 17.54 ? 11   DA  E "O5'" 1 
ATOM   203  C  "C5'" . DA  A  1 11  ? -18.290 -1.493  4.047   1.00 16.88 ? 11   DA  E "C5'" 1 
ATOM   204  C  "C4'" . DA  A  1 11  ? -17.929 -0.192  4.738   1.00 18.03 ? 11   DA  E "C4'" 1 
ATOM   205  O  "O4'" . DA  A  1 11  ? -17.351 -0.453  6.042   1.00 15.76 ? 11   DA  E "O4'" 1 
ATOM   206  C  "C3'" . DA  A  1 11  ? -16.870 0.590   3.973   1.00 18.32 ? 11   DA  E "C3'" 1 
ATOM   207  O  "O3'" . DA  A  1 11  ? -17.504 1.534   3.128   1.00 19.75 ? 11   DA  E "O3'" 1 
ATOM   208  C  "C2'" . DA  A  1 11  ? -16.062 1.290   5.059   1.00 16.88 ? 11   DA  E "C2'" 1 
ATOM   209  C  "C1'" . DA  A  1 11  ? -16.254 0.407   6.277   1.00 15.79 ? 11   DA  E "C1'" 1 
ATOM   210  N  N9    . DA  A  1 11  ? -15.145 -0.461  6.654   1.00 16.57 ? 11   DA  E N9    1 
ATOM   211  C  C8    . DA  A  1 11  ? -14.926 -1.748  6.223   1.00 15.91 ? 11   DA  E C8    1 
ATOM   212  N  N7    . DA  A  1 11  ? -13.876 -2.316  6.763   1.00 15.49 ? 11   DA  E N7    1 
ATOM   213  C  C5    . DA  A  1 11  ? -13.366 -1.341  7.612   1.00 16.27 ? 11   DA  E C5    1 
ATOM   214  C  C6    . DA  A  1 11  ? -12.248 -1.317  8.477   1.00 15.78 ? 11   DA  E C6    1 
ATOM   215  N  N6    . DA  A  1 11  ? -11.416 -2.351  8.626   1.00 15.35 ? 11   DA  E N6    1 
ATOM   216  N  N1    . DA  A  1 11  ? -12.021 -0.191  9.184   1.00 15.55 ? 11   DA  E N1    1 
ATOM   217  C  C2    . DA  A  1 11  ? -12.858 0.839   9.030   1.00 15.68 ? 11   DA  E C2    1 
ATOM   218  N  N3    . DA  A  1 11  ? -13.938 0.942   8.252   1.00 15.93 ? 11   DA  E N3    1 
ATOM   219  C  C4    . DA  A  1 11  ? -14.141 -0.192  7.562   1.00 16.48 ? 11   DA  E C4    1 
ATOM   220  P  P     . DC  A  1 12  ? -16.685 2.188   1.923   1.00 21.77 ? 12   DC  E P     1 
ATOM   221  O  OP1   . DC  A  1 12  ? -17.612 3.108   1.226   1.00 21.88 ? 12   DC  E OP1   1 
ATOM   222  O  OP2   . DC  A  1 12  ? -16.013 1.104   1.168   1.00 20.14 ? 12   DC  E OP2   1 
ATOM   223  O  "O5'" . DC  A  1 12  ? -15.591 3.111   2.656   1.00 21.14 ? 12   DC  E "O5'" 1 
ATOM   224  C  "C5'" . DC  A  1 12  ? -16.025 4.086   3.612   1.00 20.91 ? 12   DC  E "C5'" 1 
ATOM   225  C  "C4'" . DC  A  1 12  ? -14.840 4.780   4.254   1.00 20.30 ? 12   DC  E "C4'" 1 
ATOM   226  O  "O4'" . DC  A  1 12  ? -14.144 3.826   5.096   1.00 20.20 ? 12   DC  E "O4'" 1 
ATOM   227  C  "C3'" . DC  A  1 12  ? -13.815 5.307   3.256   1.00 20.30 ? 12   DC  E "C3'" 1 
ATOM   228  O  "O3'" . DC  A  1 12  ? -13.571 6.672   3.558   1.00 19.62 ? 12   DC  E "O3'" 1 
ATOM   229  C  "C2'" . DC  A  1 12  ? -12.585 4.403   3.437   1.00 19.13 ? 12   DC  E "C2'" 1 
ATOM   230  C  "C1'" . DC  A  1 12  ? -12.752 3.873   4.862   1.00 18.49 ? 12   DC  E "C1'" 1 
ATOM   231  N  N1    . DC  A  1 12  ? -12.175 2.498   5.088   1.00 17.90 ? 12   DC  E N1    1 
ATOM   232  C  C2    . DC  A  1 12  ? -11.197 2.308   6.074   1.00 17.02 ? 12   DC  E C2    1 
ATOM   233  O  O2    . DC  A  1 12  ? -10.845 3.274   6.736   1.00 16.72 ? 12   DC  E O2    1 
ATOM   234  N  N3    . DC  A  1 12  ? -10.661 1.081   6.279   1.00 17.21 ? 12   DC  E N3    1 
ATOM   235  C  C4    . DC  A  1 12  ? -11.073 0.058   5.526   1.00 17.64 ? 12   DC  E C4    1 
ATOM   236  N  N4    . DC  A  1 12  ? -10.533 -1.147  5.750   1.00 17.00 ? 12   DC  E N4    1 
ATOM   237  C  C5    . DC  A  1 12  ? -12.070 0.228   4.514   1.00 17.08 ? 12   DC  E C5    1 
ATOM   238  C  C6    . DC  A  1 12  ? -12.586 1.444   4.328   1.00 17.07 ? 12   DC  E C6    1 
ATOM   239  P  P     . DA  A  1 13  ? -12.515 7.526   2.701   1.00 19.90 ? 13   DA  E P     1 
ATOM   240  O  OP1   . DA  A  1 13  ? -13.012 8.926   2.711   1.00 20.56 ? 13   DA  E OP1   1 
ATOM   241  O  OP2   . DA  A  1 13  ? -12.262 6.824   1.437   1.00 19.56 ? 13   DA  E OP2   1 
ATOM   242  O  "O5'" . DA  A  1 13  ? -11.188 7.496   3.598   1.00 18.73 ? 13   DA  E "O5'" 1 
ATOM   243  C  "C5'" . DA  A  1 13  ? -11.346 7.858   4.964   1.00 16.51 ? 13   DA  E "C5'" 1 
ATOM   244  C  "C4'" . DA  A  1 13  ? -10.016 8.090   5.644   1.00 15.78 ? 13   DA  E "C4'" 1 
ATOM   245  O  "O4'" . DA  A  1 13  ? -9.380  6.830   5.983   1.00 15.23 ? 13   DA  E "O4'" 1 
ATOM   246  C  "C3'" . DA  A  1 13  ? -8.984  8.838   4.826   1.00 15.13 ? 13   DA  E "C3'" 1 
ATOM   247  O  "O3'" . DA  A  1 13  ? -8.159  9.508   5.756   1.00 15.40 ? 13   DA  E "O3'" 1 
ATOM   248  C  "C2'" . DA  A  1 13  ? -8.262  7.686   4.132   1.00 15.31 ? 13   DA  E "C2'" 1 
ATOM   249  C  "C1'" . DA  A  1 13  ? -8.186  6.653   5.256   1.00 13.74 ? 13   DA  E "C1'" 1 
ATOM   250  N  N9    . DA  A  1 13  ? -8.188  5.252   4.849   1.00 13.46 ? 13   DA  E N9    1 
ATOM   251  C  C8    . DA  A  1 13  ? -8.917  4.652   3.857   1.00 13.05 ? 13   DA  E C8    1 
ATOM   252  N  N7    . DA  A  1 13  ? -8.720  3.357   3.750   1.00 12.02 ? 13   DA  E N7    1 
ATOM   253  C  C5    . DA  A  1 13  ? -7.811  3.088   4.745   1.00 12.69 ? 13   DA  E C5    1 
ATOM   254  C  C6    . DA  A  1 13  ? -7.187  1.902   5.158   1.00 12.90 ? 13   DA  E C6    1 
ATOM   255  N  N6    . DA  A  1 13  ? -7.404  0.714   4.588   1.00 13.07 ? 13   DA  E N6    1 
ATOM   256  N  N1    . DA  A  1 13  ? -6.329  1.982   6.192   1.00 12.78 ? 13   DA  E N1    1 
ATOM   257  C  C2    . DA  A  1 13  ? -6.100  3.165   6.764   1.00 12.95 ? 13   DA  E C2    1 
ATOM   258  N  N3    . DA  A  1 13  ? -6.621  4.354   6.468   1.00 14.15 ? 13   DA  E N3    1 
ATOM   259  C  C4    . DA  A  1 13  ? -7.474  4.240   5.435   1.00 13.71 ? 13   DA  E C4    1 
ATOM   260  P  P     . DG  A  1 14  ? -6.955  10.442  5.278   1.00 15.72 ? 14   DG  E P     1 
ATOM   261  O  OP1   . DG  A  1 14  ? -6.541  11.297  6.412   1.00 16.67 ? 14   DG  E OP1   1 
ATOM   262  O  OP2   . DG  A  1 14  ? -7.314  11.040  3.971   1.00 14.07 ? 14   DG  E OP2   1 
ATOM   263  O  "O5'" . DG  A  1 14  ? -5.793  9.371   5.142   1.00 15.12 ? 14   DG  E "O5'" 1 
ATOM   264  C  "C5'" . DG  A  1 14  ? -5.249  8.824   6.320   1.00 14.74 ? 14   DG  E "C5'" 1 
ATOM   265  C  "C4'" . DG  A  1 14  ? -4.005  8.047   5.954   1.00 14.87 ? 14   DG  E "C4'" 1 
ATOM   266  O  "O4'" . DG  A  1 14  ? -4.383  6.747   5.436   1.00 14.70 ? 14   DG  E "O4'" 1 
ATOM   267  C  "C3'" . DG  A  1 14  ? -3.195  8.689   4.831   1.00 15.40 ? 14   DG  E "C3'" 1 
ATOM   268  O  "O3'" . DG  A  1 14  ? -1.836  8.355   5.041   1.00 16.16 ? 14   DG  E "O3'" 1 
ATOM   269  C  "C2'" . DG  A  1 14  ? -3.757  7.972   3.603   1.00 14.11 ? 14   DG  E "C2'" 1 
ATOM   270  C  "C1'" . DG  A  1 14  ? -3.727  6.574   4.197   1.00 13.56 ? 14   DG  E "C1'" 1 
ATOM   271  N  N9    . DG  A  1 14  ? -4.405  5.541   3.427   1.00 13.74 ? 14   DG  E N9    1 
ATOM   272  C  C8    . DG  A  1 14  ? -5.397  5.720   2.486   1.00 13.44 ? 14   DG  E C8    1 
ATOM   273  N  N7    . DG  A  1 14  ? -5.823  4.604   1.964   1.00 13.15 ? 14   DG  E N7    1 
ATOM   274  C  C5    . DG  A  1 14  ? -5.061  3.621   2.594   1.00 13.29 ? 14   DG  E C5    1 
ATOM   275  C  C6    . DG  A  1 14  ? -5.079  2.218   2.435   1.00 12.64 ? 14   DG  E C6    1 
ATOM   276  O  O6    . DG  A  1 14  ? -5.787  1.550   1.679   1.00 13.30 ? 14   DG  E O6    1 
ATOM   277  N  N1    . DG  A  1 14  ? -4.165  1.583   3.266   1.00 13.23 ? 14   DG  E N1    1 
ATOM   278  C  C2    . DG  A  1 14  ? -3.321  2.228   4.142   1.00 13.18 ? 14   DG  E C2    1 
ATOM   279  N  N2    . DG  A  1 14  ? -2.501  1.448   4.853   1.00 12.62 ? 14   DG  E N2    1 
ATOM   280  N  N3    . DG  A  1 14  ? -3.299  3.548   4.311   1.00 13.59 ? 14   DG  E N3    1 
ATOM   281  C  C4    . DG  A  1 14  ? -4.187  4.180   3.503   1.00 13.56 ? 14   DG  E C4    1 
ATOM   282  P  P     . DG  A  1 15  ? -0.718  9.475   5.220   1.00 16.10 ? 15   DG  E P     1 
ATOM   283  O  OP1   . DG  A  1 15  ? -0.700  9.844   6.642   1.00 17.39 ? 15   DG  E OP1   1 
ATOM   284  O  OP2   . DG  A  1 15  ? -0.939  10.511  4.189   1.00 16.70 ? 15   DG  E OP2   1 
ATOM   285  O  "O5'" . DG  A  1 15  ? 0.638   8.665   4.900   1.00 16.10 ? 15   DG  E "O5'" 1 
ATOM   286  C  "C5'" . DG  A  1 15  ? 0.829   7.967   3.680   1.00 14.35 ? 15   DG  E "C5'" 1 
ATOM   287  C  "C4'" . DG  A  1 15  ? 1.262   6.530   3.924   1.00 14.55 ? 15   DG  E "C4'" 1 
ATOM   288  O  "O4'" . DG  A  1 15  ? 0.109   5.655   4.093   1.00 13.94 ? 15   DG  E "O4'" 1 
ATOM   289  C  "C3'" . DG  A  1 15  ? 2.037   5.895   2.767   1.00 13.58 ? 15   DG  E "C3'" 1 
ATOM   290  O  "O3'" . DG  A  1 15  ? 3.376   6.272   2.836   1.00 12.52 ? 15   DG  E "O3'" 1 
ATOM   291  C  "C2'" . DG  A  1 15  ? 1.864   4.412   3.046   1.00 13.04 ? 15   DG  E "C2'" 1 
ATOM   292  C  "C1'" . DG  A  1 15  ? 0.442   4.366   3.601   1.00 13.52 ? 15   DG  E "C1'" 1 
ATOM   293  N  N9    . DG  A  1 15  ? -0.501  4.011   2.558   1.00 14.07 ? 15   DG  E N9    1 
ATOM   294  C  C8    . DG  A  1 15  ? -1.409  4.836   1.942   1.00 14.12 ? 15   DG  E C8    1 
ATOM   295  N  N7    . DG  A  1 15  ? -2.121  4.223   1.037   1.00 13.93 ? 15   DG  E N7    1 
ATOM   296  C  C5    . DG  A  1 15  ? -1.647  2.924   1.051   1.00 13.30 ? 15   DG  E C5    1 
ATOM   297  C  C6    . DG  A  1 15  ? -2.033  1.812   0.294   1.00 13.47 ? 15   DG  E C6    1 
ATOM   298  O  O6    . DG  A  1 15  ? -2.897  1.764   -0.574  1.00 14.18 ? 15   DG  E O6    1 
ATOM   299  N  N1    . DG  A  1 15  ? -1.316  0.666   0.616   1.00 14.25 ? 15   DG  E N1    1 
ATOM   300  C  C2    . DG  A  1 15  ? -0.328  0.604   1.562   1.00 13.75 ? 15   DG  E C2    1 
ATOM   301  N  N2    . DG  A  1 15  ? 0.271   -0.582  1.732   1.00 13.81 ? 15   DG  E N2    1 
ATOM   302  N  N3    . DG  A  1 15  ? 0.049   1.647   2.281   1.00 14.36 ? 15   DG  E N3    1 
ATOM   303  C  C4    . DG  A  1 15  ? -0.650  2.770   1.975   1.00 14.11 ? 15   DG  E C4    1 
ATOM   304  P  P     . DC  A  1 16  ? 4.271   6.332   1.516   1.00 14.06 ? 16   DC  E P     1 
ATOM   305  O  OP1   . DC  A  1 16  ? 5.615   6.850   1.888   1.00 14.34 ? 16   DC  E OP1   1 
ATOM   306  O  OP2   . DC  A  1 16  ? 3.519   6.969   0.422   1.00 14.68 ? 16   DC  E OP2   1 
ATOM   307  O  "O5'" . DC  A  1 16  ? 4.420   4.779   1.161   1.00 13.79 ? 16   DC  E "O5'" 1 
ATOM   308  C  "C5'" . DC  A  1 16  ? 5.177   3.918   1.990   1.00 11.80 ? 16   DC  E "C5'" 1 
ATOM   309  C  "C4'" . DC  A  1 16  ? 5.036   2.533   1.415   1.00 12.38 ? 16   DC  E "C4'" 1 
ATOM   310  O  "O4'" . DC  A  1 16  ? 3.636   2.200   1.267   1.00 12.50 ? 16   DC  E "O4'" 1 
ATOM   311  C  "C3'" . DC  A  1 16  ? 5.544   2.429   -0.010  1.00 12.27 ? 16   DC  E "C3'" 1 
ATOM   312  O  "O3'" . DC  A  1 16  ? 6.951   2.285   0.009   1.00 11.44 ? 16   DC  E "O3'" 1 
ATOM   313  C  "C2'" . DC  A  1 16  ? 4.819   1.182   -0.515  1.00 11.70 ? 16   DC  E "C2'" 1 
ATOM   314  C  "C1'" . DC  A  1 16  ? 3.494   1.254   0.228   1.00 12.32 ? 16   DC  E "C1'" 1 
ATOM   315  N  N1    . DC  A  1 16  ? 2.356   1.693   -0.593  1.00 13.06 ? 16   DC  E N1    1 
ATOM   316  C  C2    . DC  A  1 16  ? 1.763   0.772   -1.447  1.00 14.18 ? 16   DC  E C2    1 
ATOM   317  O  O2    . DC  A  1 16  ? 2.243   -0.375  -1.477  1.00 15.00 ? 16   DC  E O2    1 
ATOM   318  N  N3    . DC  A  1 16  ? 0.702   1.166   -2.204  1.00 13.70 ? 16   DC  E N3    1 
ATOM   319  C  C4    . DC  A  1 16  ? 0.236   2.420   -2.109  1.00 13.87 ? 16   DC  E C4    1 
ATOM   320  N  N4    . DC  A  1 16  ? -0.824  2.765   -2.862  1.00 13.66 ? 16   DC  E N4    1 
ATOM   321  C  C5    . DC  A  1 16  ? 0.838   3.379   -1.240  1.00 13.53 ? 16   DC  E C5    1 
ATOM   322  C  C6    . DC  A  1 16  ? 1.878   2.967   -0.507  1.00 13.88 ? 16   DC  E C6    1 
ATOM   323  P  P     . DT  A  1 17  ? 7.778   2.304   -1.351  1.00 11.82 ? 17   DT  E P     1 
ATOM   324  O  OP1   . DT  A  1 17  ? 9.201   2.215   -0.959  1.00 11.51 ? 17   DT  E OP1   1 
ATOM   325  O  OP2   . DT  A  1 17  ? 7.297   3.412   -2.207  1.00 11.40 ? 17   DT  E OP2   1 
ATOM   326  O  "O5'" . DT  A  1 17  ? 7.345   0.928   -2.049  1.00 11.86 ? 17   DT  E "O5'" 1 
ATOM   327  C  "C5'" . DT  A  1 17  ? 7.718   -0.321  -1.476  1.00 10.88 ? 17   DT  E "C5'" 1 
ATOM   328  C  "C4'" . DT  A  1 17  ? 7.452   -1.429  -2.477  1.00 11.72 ? 17   DT  E "C4'" 1 
ATOM   329  O  "O4'" . DT  A  1 17  ? 6.050   -1.435  -2.871  1.00 11.78 ? 17   DT  E "O4'" 1 
ATOM   330  C  "C3'" . DT  A  1 17  ? 8.261   -1.328  -3.761  1.00 11.06 ? 17   DT  E "C3'" 1 
ATOM   331  O  "O3'" . DT  A  1 17  ? 8.678   -2.624  -4.091  1.00 10.53 ? 17   DT  E "O3'" 1 
ATOM   332  C  "C2'" . DT  A  1 17  ? 7.256   -0.808  -4.776  1.00 11.26 ? 17   DT  E "C2'" 1 
ATOM   333  C  "C1'" . DT  A  1 17  ? 5.932   -1.366  -4.274  1.00 12.86 ? 17   DT  E "C1'" 1 
ATOM   334  N  N1    . DT  A  1 17  ? 4.816   -0.439  -4.564  1.00 13.52 ? 17   DT  E N1    1 
ATOM   335  C  C2    . DT  A  1 17  ? 3.797   -0.762  -5.444  1.00 14.09 ? 17   DT  E C2    1 
ATOM   336  O  O2    . DT  A  1 17  ? 3.696   -1.816  -6.042  1.00 14.59 ? 17   DT  E O2    1 
ATOM   337  N  N3    . DT  A  1 17  ? 2.857   0.220   -5.606  1.00 14.95 ? 17   DT  E N3    1 
ATOM   338  C  C4    . DT  A  1 17  ? 2.831   1.454   -4.985  1.00 14.21 ? 17   DT  E C4    1 
ATOM   339  O  O4    . DT  A  1 17  ? 1.938   2.260   -5.195  1.00 14.49 ? 17   DT  E O4    1 
ATOM   340  C  C5    . DT  A  1 17  ? 3.925   1.732   -4.089  1.00 13.87 ? 17   DT  E C5    1 
ATOM   341  C  C7    . DT  A  1 17  ? 4.236   3.145   -3.716  1.00 13.10 ? 17   DT  E C7    1 
ATOM   342  C  C6    . DT  A  1 17  ? 4.845   0.780   -3.925  1.00 13.57 ? 17   DT  E C6    1 
ATOM   343  P  P     . DG  A  1 18  ? 9.579   -2.911  -5.381  1.00 12.20 ? 18   DG  E P     1 
ATOM   344  O  OP1   . DG  A  1 18  ? 10.331  -4.146  -5.094  1.00 12.43 ? 18   DG  E OP1   1 
ATOM   345  O  OP2   . DG  A  1 18  ? 10.264  -1.659  -5.816  1.00 10.69 ? 18   DG  E OP2   1 
ATOM   346  O  "O5'" . DG  A  1 18  ? 8.515   -3.377  -6.467  1.00 11.01 ? 18   DG  E "O5'" 1 
ATOM   347  C  "C5'" . DG  A  1 18  ? 7.918   -4.647  -6.330  1.00 9.74  ? 18   DG  E "C5'" 1 
ATOM   348  C  "C4'" . DG  A  1 18  ? 7.053   -4.895  -7.544  1.00 9.93  ? 18   DG  E "C4'" 1 
ATOM   349  O  "O4'" . DG  A  1 18  ? 6.004   -3.893  -7.590  1.00 9.85  ? 18   DG  E "O4'" 1 
ATOM   350  C  "C3'" . DG  A  1 18  ? 7.775   -4.800  -8.880  1.00 9.67  ? 18   DG  E "C3'" 1 
ATOM   351  O  "O3'" . DG  A  1 18  ? 7.241   -5.790  -9.727  1.00 10.17 ? 18   DG  E "O3'" 1 
ATOM   352  C  "C2'" . DG  A  1 18  ? 7.404   -3.412  -9.382  1.00 9.51  ? 18   DG  E "C2'" 1 
ATOM   353  C  "C1'" . DG  A  1 18  ? 5.977   -3.288  -8.861  1.00 9.95  ? 18   DG  E "C1'" 1 
ATOM   354  N  N9    . DG  A  1 18  ? 5.489   -1.917  -8.700  1.00 10.36 ? 18   DG  E N9    1 
ATOM   355  C  C8    . DG  A  1 18  ? 6.109   -0.888  -8.034  1.00 10.11 ? 18   DG  E C8    1 
ATOM   356  N  N7    . DG  A  1 18  ? 5.435   0.228   -8.057  1.00 10.03 ? 18   DG  E N7    1 
ATOM   357  C  C5    . DG  A  1 18  ? 4.290   -0.066  -8.782  1.00 10.41 ? 18   DG  E C5    1 
ATOM   358  C  C6    . DG  A  1 18  ? 3.177   0.756   -9.140  1.00 10.60 ? 18   DG  E C6    1 
ATOM   359  O  O6    . DG  A  1 18  ? 2.963   1.952   -8.891  1.00 10.52 ? 18   DG  E O6    1 
ATOM   360  N  N1    . DG  A  1 18  ? 2.226   0.048   -9.877  1.00 10.42 ? 18   DG  E N1    1 
ATOM   361  C  C2    . DG  A  1 18  ? 2.350   -1.276  -10.242 1.00 10.48 ? 18   DG  E C2    1 
ATOM   362  N  N2    . DG  A  1 18  ? 1.338   -1.776  -10.967 1.00 9.98  ? 18   DG  E N2    1 
ATOM   363  N  N3    . DG  A  1 18  ? 3.389   -2.051  -9.912  1.00 10.69 ? 18   DG  E N3    1 
ATOM   364  C  C4    . DG  A  1 18  ? 4.314   -1.387  -9.185  1.00 10.08 ? 18   DG  E C4    1 
ATOM   365  P  P     . DC  A  1 19  ? 8.083   -6.319  -10.966 1.00 10.64 ? 19   DC  E P     1 
ATOM   366  O  OP1   . DC  A  1 19  ? 7.719   -7.736  -11.180 1.00 11.12 ? 19   DC  E OP1   1 
ATOM   367  O  OP2   . DC  A  1 19  ? 9.490   -5.900  -10.786 1.00 10.56 ? 19   DC  E OP2   1 
ATOM   368  O  "O5'" . DC  A  1 19  ? 7.479   -5.505  -12.189 1.00 10.71 ? 19   DC  E "O5'" 1 
ATOM   369  C  "C5'" . DC  A  1 19  ? 6.099   -5.664  -12.466 1.00 10.51 ? 19   DC  E "C5'" 1 
ATOM   370  C  "C4'" . DC  A  1 19  ? 5.640   -4.559  -13.401 1.00 10.86 ? 19   DC  E "C4'" 1 
ATOM   371  O  "O4'" . DC  A  1 19  ? 5.401   -3.317  -12.688 1.00 9.54  ? 19   DC  E "O4'" 1 
ATOM   372  C  "C3'" . DC  A  1 19  ? 6.630   -4.216  -14.513 1.00 11.27 ? 19   DC  E "C3'" 1 
ATOM   373  O  "O3'" . DC  A  1 19  ? 5.826   -4.123  -15.627 1.00 12.80 ? 19   DC  E "O3'" 1 
ATOM   374  C  "C2'" . DC  A  1 19  ? 7.121   -2.822  -14.149 1.00 9.81  ? 19   DC  E "C2'" 1 
ATOM   375  C  "C1'" . DC  A  1 19  ? 5.825   -2.291  -13.552 1.00 9.96  ? 19   DC  E "C1'" 1 
ATOM   376  N  N1    . DC  A  1 19  ? 5.912   -1.010  -12.790 1.00 9.87  ? 19   DC  E N1    1 
ATOM   377  C  C2    . DC  A  1 19  ? 4.767   -0.206  -12.706 1.00 9.45  ? 19   DC  E C2    1 
ATOM   378  O  O2    . DC  A  1 19  ? 3.728   -0.577  -13.252 1.00 9.07  ? 19   DC  E O2    1 
ATOM   379  N  N3    . DC  A  1 19  ? 4.833   0.967   -12.028 1.00 10.59 ? 19   DC  E N3    1 
ATOM   380  C  C4    . DC  A  1 19  ? 5.987   1.329   -11.447 1.00 10.67 ? 19   DC  E C4    1 
ATOM   381  N  N4    . DC  A  1 19  ? 6.001   2.480   -10.781 1.00 10.04 ? 19   DC  E N4    1 
ATOM   382  C  C5    . DC  A  1 19  ? 7.166   0.523   -11.515 1.00 9.26  ? 19   DC  E C5    1 
ATOM   383  C  C6    . DC  A  1 19  ? 7.081   -0.628  -12.192 1.00 9.24  ? 19   DC  E C6    1 
ATOM   384  P  P     . DC  A  1 20  ? 6.023   -4.951  -16.971 1.00 13.84 ? 20   DC  E P     1 
ATOM   385  O  OP1   . DC  A  1 20  ? 4.822   -5.799  -17.117 1.00 12.38 ? 20   DC  E OP1   1 
ATOM   386  O  OP2   . DC  A  1 20  ? 7.369   -5.561  -17.040 1.00 14.30 ? 20   DC  E OP2   1 
ATOM   387  O  "O5'" . DC  A  1 20  ? 6.053   -3.698  -17.981 1.00 13.01 ? 20   DC  E "O5'" 1 
ATOM   388  C  "C5'" . DC  A  1 20  ? 4.978   -3.404  -18.838 1.00 14.84 ? 20   DC  E "C5'" 1 
ATOM   389  C  "C4'" . DC  A  1 20  ? 4.482   -1.957  -18.762 1.00 16.03 ? 20   DC  E "C4'" 1 
ATOM   390  O  "O4'" . DC  A  1 20  ? 4.431   -1.430  -17.414 1.00 15.96 ? 20   DC  E "O4'" 1 
ATOM   391  C  "C3'" . DC  A  1 20  ? 5.237   -0.848  -19.486 1.00 15.70 ? 20   DC  E "C3'" 1 
ATOM   392  O  "O3'" . DC  A  1 20  ? 5.107   -0.983  -20.882 1.00 16.52 ? 20   DC  E "O3'" 1 
ATOM   393  C  "C2'" . DC  A  1 20  ? 4.353   0.300   -19.029 1.00 15.83 ? 20   DC  E "C2'" 1 
ATOM   394  C  "C1'" . DC  A  1 20  ? 4.069   -0.063  -17.574 1.00 15.63 ? 20   DC  E "C1'" 1 
ATOM   395  N  N1    . DC  A  1 20  ? 4.824   0.808   -16.628 1.00 14.64 ? 20   DC  E N1    1 
ATOM   396  C  C2    . DC  A  1 20  ? 4.381   2.112   -16.380 1.00 15.63 ? 20   DC  E C2    1 
ATOM   397  O  O2    . DC  A  1 20  ? 3.353   2.509   -16.949 1.00 15.76 ? 20   DC  E O2    1 
ATOM   398  N  N3    . DC  A  1 20  ? 5.085   2.904   -15.523 1.00 15.68 ? 20   DC  E N3    1 
ATOM   399  C  C4    . DC  A  1 20  ? 6.183   2.415   -14.937 1.00 15.82 ? 20   DC  E C4    1 
ATOM   400  N  N4    . DC  A  1 20  ? 6.858   3.187   -14.085 1.00 15.41 ? 20   DC  E N4    1 
ATOM   401  C  C5    . DC  A  1 20  ? 6.648   1.095   -15.190 1.00 15.59 ? 20   DC  E C5    1 
ATOM   402  C  C6    . DC  A  1 20  ? 5.944   0.337   -16.030 1.00 15.02 ? 20   DC  E C6    1 
ATOM   403  P  P     . DC  A  1 21  ? 5.894   -0.020  -21.895 1.00 17.78 ? 21   DC  E P     1 
ATOM   404  O  OP1   . DC  A  1 21  ? 5.741   -0.652  -23.228 1.00 16.96 ? 21   DC  E OP1   1 
ATOM   405  O  OP2   . DC  A  1 21  ? 7.242   0.272   -21.365 1.00 16.50 ? 21   DC  E OP2   1 
ATOM   406  O  "O5'" . DC  A  1 21  ? 5.090   1.374   -21.838 1.00 17.68 ? 21   DC  E "O5'" 1 
ATOM   407  C  "C5'" . DC  A  1 21  ? 3.702   1.482   -22.156 1.00 17.24 ? 21   DC  E "C5'" 1 
ATOM   408  C  "C4'" . DC  A  1 21  ? 3.265   2.938   -22.108 1.00 17.99 ? 21   DC  E "C4'" 1 
ATOM   409  O  "O4'" . DC  A  1 21  ? 3.219   3.417   -20.739 1.00 19.10 ? 21   DC  E "O4'" 1 
ATOM   410  C  "C3'" . DC  A  1 21  ? 4.203   3.923   -22.778 1.00 18.37 ? 21   DC  E "C3'" 1 
ATOM   411  O  "O3'" . DC  A  1 21  ? 3.861   3.987   -24.125 1.00 19.41 ? 21   DC  E "O3'" 1 
ATOM   412  C  "C2'" . DC  A  1 21  ? 3.846   5.237   -22.095 1.00 17.53 ? 21   DC  E "C2'" 1 
ATOM   413  C  "C1'" . DC  A  1 21  ? 3.580   4.789   -20.675 1.00 16.86 ? 21   DC  E "C1'" 1 
ATOM   414  N  N1    . DC  A  1 21  ? 4.705   4.919   -19.687 1.00 16.87 ? 21   DC  E N1    1 
ATOM   415  C  C2    . DC  A  1 21  ? 4.960   6.163   -19.064 1.00 16.73 ? 21   DC  E C2    1 
ATOM   416  O  O2    . DC  A  1 21  ? 4.269   7.144   -19.366 1.00 17.32 ? 21   DC  E O2    1 
ATOM   417  N  N3    . DC  A  1 21  ? 5.958   6.267   -18.146 1.00 15.39 ? 21   DC  E N3    1 
ATOM   418  C  C4    . DC  A  1 21  ? 6.674   5.178   -17.847 1.00 16.07 ? 21   DC  E C4    1 
ATOM   419  N  N4    . DC  A  1 21  ? 7.640   5.315   -16.944 1.00 16.06 ? 21   DC  E N4    1 
ATOM   420  C  C5    . DC  A  1 21  ? 6.442   3.902   -18.461 1.00 16.26 ? 21   DC  E C5    1 
ATOM   421  C  C6    . DC  A  1 21  ? 5.451   3.815   -19.364 1.00 16.13 ? 21   DC  E C6    1 
ATOM   422  P  P     . DT  A  1 22  ? 4.791   4.710   -25.200 1.00 19.81 ? 22   DT  E P     1 
ATOM   423  O  OP1   . DT  A  1 22  ? 4.198   4.262   -26.483 1.00 19.49 ? 22   DT  E OP1   1 
ATOM   424  O  OP2   . DT  A  1 22  ? 6.213   4.464   -24.877 1.00 19.99 ? 22   DT  E OP2   1 
ATOM   425  O  "O5'" . DT  A  1 22  ? 4.543   6.288   -25.026 1.00 21.28 ? 22   DT  E "O5'" 1 
ATOM   426  C  "C5'" . DT  A  1 22  ? 3.231   6.861   -25.124 1.00 23.09 ? 22   DT  E "C5'" 1 
ATOM   427  C  "C4'" . DT  A  1 22  ? 3.238   8.352   -24.804 1.00 24.44 ? 22   DT  E "C4'" 1 
ATOM   428  O  "O4'" . DT  A  1 22  ? 3.711   8.635   -23.452 1.00 23.76 ? 22   DT  E "O4'" 1 
ATOM   429  C  "C3'" . DT  A  1 22  ? 4.109   9.181   -25.733 1.00 26.09 ? 22   DT  E "C3'" 1 
ATOM   430  O  "O3'" . DT  A  1 22  ? 3.387   10.356  -26.065 1.00 30.48 ? 22   DT  E "O3'" 1 
ATOM   431  C  "C2'" . DT  A  1 22  ? 5.351   9.509   -24.908 1.00 24.59 ? 22   DT  E "C2'" 1 
ATOM   432  C  "C1'" . DT  A  1 22  ? 4.849   9.481   -23.472 1.00 21.98 ? 22   DT  E "C1'" 1 
ATOM   433  N  N1    . DT  A  1 22  ? 5.858   8.927   -22.528 1.00 20.91 ? 22   DT  E N1    1 
ATOM   434  C  C2    . DT  A  1 22  ? 6.355   9.720   -21.509 1.00 20.90 ? 22   DT  E C2    1 
ATOM   435  O  O2    . DT  A  1 22  ? 6.011   10.869  -21.329 1.00 21.35 ? 22   DT  E O2    1 
ATOM   436  N  N3    . DT  A  1 22  ? 7.280   9.127   -20.684 1.00 20.23 ? 22   DT  E N3    1 
ATOM   437  C  C4    . DT  A  1 22  ? 7.748   7.832   -20.778 1.00 19.94 ? 22   DT  E C4    1 
ATOM   438  O  O4    . DT  A  1 22  ? 8.569   7.400   -19.983 1.00 20.34 ? 22   DT  E O4    1 
ATOM   439  C  C5    . DT  A  1 22  ? 7.198   7.043   -21.863 1.00 19.87 ? 22   DT  E C5    1 
ATOM   440  C  C7    . DT  A  1 22  ? 7.743   5.680   -22.163 1.00 17.85 ? 22   DT  E C7    1 
ATOM   441  C  C6    . DT  A  1 22  ? 6.291   7.622   -22.676 1.00 19.95 ? 22   DT  E C6    1 
ATOM   442  P  P     . DA  A  1 23  ? 3.918   11.371  -27.189 1.00 33.08 ? 23   DA  E P     1 
ATOM   443  O  OP1   . DA  A  1 23  ? 2.781   12.273  -27.504 1.00 33.14 ? 23   DA  E OP1   1 
ATOM   444  O  OP2   . DA  A  1 23  ? 4.595   10.572  -28.247 1.00 32.61 ? 23   DA  E OP2   1 
ATOM   445  O  "O5'" . DA  A  1 23  ? 4.998   12.252  -26.416 1.00 32.33 ? 23   DA  E "O5'" 1 
ATOM   446  C  "C5'" . DA  A  1 23  ? 4.571   12.984  -25.275 1.00 32.32 ? 23   DA  E "C5'" 1 
ATOM   447  C  "C4'" . DA  A  1 23  ? 5.596   14.062  -25.033 1.00 31.80 ? 23   DA  E "C4'" 1 
ATOM   448  O  "O4'" . DA  A  1 23  ? 6.420   13.651  -23.918 1.00 30.87 ? 23   DA  E "O4'" 1 
ATOM   449  C  "C3'" . DA  A  1 23  ? 6.499   14.215  -26.250 1.00 32.56 ? 23   DA  E "C3'" 1 
ATOM   450  O  "O3'" . DA  A  1 23  ? 6.301   15.529  -26.817 1.00 35.99 ? 23   DA  E "O3'" 1 
ATOM   451  C  "C2'" . DA  A  1 23  ? 7.923   13.919  -25.770 1.00 30.60 ? 23   DA  E "C2'" 1 
ATOM   452  C  "C1'" . DA  A  1 23  ? 7.798   13.652  -24.265 1.00 28.15 ? 23   DA  E "C1'" 1 
ATOM   453  N  N9    . DA  A  1 23  ? 8.424   12.397  -23.811 1.00 27.16 ? 23   DA  E N9    1 
ATOM   454  C  C8    . DA  A  1 23  ? 8.360   11.160  -24.401 1.00 26.08 ? 23   DA  E C8    1 
ATOM   455  N  N7    . DA  A  1 23  ? 9.030   10.236  -23.746 1.00 26.25 ? 23   DA  E N7    1 
ATOM   456  C  C5    . DA  A  1 23  ? 9.576   10.909  -22.659 1.00 26.14 ? 23   DA  E C5    1 
ATOM   457  C  C6    . DA  A  1 23  ? 10.401  10.505  -21.581 1.00 26.47 ? 23   DA  E C6    1 
ATOM   458  N  N6    . DA  A  1 23  ? 10.848  9.258   -21.401 1.00 26.53 ? 23   DA  E N6    1 
ATOM   459  N  N1    . DA  A  1 23  ? 10.762  11.432  -20.675 1.00 26.00 ? 23   DA  E N1    1 
ATOM   460  C  C2    . DA  A  1 23  ? 10.322  12.680  -20.839 1.00 26.26 ? 23   DA  E C2    1 
ATOM   461  N  N3    . DA  A  1 23  ? 9.547   13.178  -21.800 1.00 25.87 ? 23   DA  E N3    1 
ATOM   462  C  C4    . DA  A  1 23  ? 9.208   12.237  -22.689 1.00 25.99 ? 23   DA  E C4    1 
ATOM   463  P  P     . DA  A  1 24  ? 7.245   16.803  -26.523 1.00 38.41 ? 24   DA  E P     1 
ATOM   464  O  OP1   . DA  A  1 24  ? 6.353   17.987  -26.582 1.00 38.06 ? 24   DA  E OP1   1 
ATOM   465  O  OP2   . DA  A  1 24  ? 8.438   16.669  -27.407 1.00 36.71 ? 24   DA  E OP2   1 
ATOM   466  O  "O5'" . DA  A  1 24  ? 7.696   16.679  -24.980 1.00 37.75 ? 24   DA  E "O5'" 1 
ATOM   467  C  "C5'" . DA  A  1 24  ? 8.282   17.789  -24.298 1.00 36.86 ? 24   DA  E "C5'" 1 
ATOM   468  C  "C4'" . DA  A  1 24  ? 9.733   17.536  -23.912 1.00 36.17 ? 24   DA  E "C4'" 1 
ATOM   469  O  "O4'" . DA  A  1 24  ? 10.025  16.126  -23.720 1.00 35.83 ? 24   DA  E "O4'" 1 
ATOM   470  C  "C3'" . DA  A  1 24  ? 10.758  18.031  -24.931 1.00 36.27 ? 24   DA  E "C3'" 1 
ATOM   471  O  "O3'" . DA  A  1 24  ? 11.323  19.226  -24.392 1.00 37.61 ? 24   DA  E "O3'" 1 
ATOM   472  C  "C2'" . DA  A  1 24  ? 11.780  16.893  -25.066 1.00 34.95 ? 24   DA  E "C2'" 1 
ATOM   473  C  "C1'" . DA  A  1 24  ? 11.414  15.945  -23.924 1.00 33.01 ? 24   DA  E "C1'" 1 
ATOM   474  N  N9    . DA  A  1 24  ? 11.679  14.531  -24.194 1.00 32.16 ? 24   DA  E N9    1 
ATOM   475  C  C8    . DA  A  1 24  ? 11.295  13.796  -25.281 1.00 31.42 ? 24   DA  E C8    1 
ATOM   476  N  N7    . DA  A  1 24  ? 11.687  12.543  -25.238 1.00 31.14 ? 24   DA  E N7    1 
ATOM   477  C  C5    . DA  A  1 24  ? 12.379  12.445  -24.042 1.00 31.01 ? 24   DA  E C5    1 
ATOM   478  C  C6    . DA  A  1 24  ? 13.047  11.378  -23.404 1.00 31.43 ? 24   DA  E C6    1 
ATOM   479  N  N6    . DA  A  1 24  ? 13.136  10.141  -23.903 1.00 31.33 ? 24   DA  E N6    1 
ATOM   480  N  N1    . DA  A  1 24  ? 13.635  11.633  -22.218 1.00 31.73 ? 24   DA  E N1    1 
ATOM   481  C  C2    . DA  A  1 24  ? 13.566  12.867  -21.705 1.00 31.69 ? 24   DA  E C2    1 
ATOM   482  N  N3    . DA  A  1 24  ? 12.967  13.946  -22.206 1.00 31.74 ? 24   DA  E N3    1 
ATOM   483  C  C4    . DA  A  1 24  ? 12.388  13.663  -23.389 1.00 31.69 ? 24   DA  E C4    1 
ATOM   484  P  P     . DT  A  1 25  ? 12.650  19.910  -24.968 1.00 38.68 ? 25   DT  E P     1 
ATOM   485  O  OP1   . DT  A  1 25  ? 12.641  21.297  -24.455 1.00 38.89 ? 25   DT  E OP1   1 
ATOM   486  O  OP2   . DT  A  1 25  ? 12.763  19.654  -26.427 1.00 38.32 ? 25   DT  E OP2   1 
ATOM   487  O  "O5'" . DT  A  1 25  ? 13.812  19.101  -24.219 1.00 39.21 ? 25   DT  E "O5'" 1 
ATOM   488  C  "C5'" . DT  A  1 25  ? 13.768  18.937  -22.799 1.00 39.03 ? 25   DT  E "C5'" 1 
ATOM   489  C  "C4'" . DT  A  1 25  ? 14.915  18.060  -22.333 1.00 38.97 ? 25   DT  E "C4'" 1 
ATOM   490  O  "O4'" . DT  A  1 25  ? 14.735  16.703  -22.812 1.00 38.37 ? 25   DT  E "O4'" 1 
ATOM   491  C  "C3'" . DT  A  1 25  ? 16.287  18.484  -22.845 1.00 39.84 ? 25   DT  E "C3'" 1 
ATOM   492  O  "O3'" . DT  A  1 25  ? 17.194  18.475  -21.755 1.00 42.13 ? 25   DT  E "O3'" 1 
ATOM   493  C  "C2'" . DT  A  1 25  ? 16.662  17.412  -23.864 1.00 38.62 ? 25   DT  E "C2'" 1 
ATOM   494  C  "C1'" . DT  A  1 25  ? 15.988  16.203  -23.238 1.00 36.60 ? 25   DT  E "C1'" 1 
ATOM   495  N  N1    . DT  A  1 25  ? 15.768  15.048  -24.165 1.00 35.53 ? 25   DT  E N1    1 
ATOM   496  C  C2    . DT  A  1 25  ? 16.260  13.810  -23.806 1.00 34.86 ? 25   DT  E C2    1 
ATOM   497  O  O2    . DT  A  1 25  ? 16.875  13.597  -22.775 1.00 34.34 ? 25   DT  E O2    1 
ATOM   498  N  N3    . DT  A  1 25  ? 16.007  12.818  -24.713 1.00 34.59 ? 25   DT  E N3    1 
ATOM   499  C  C4    . DT  A  1 25  ? 15.325  12.937  -25.913 1.00 35.02 ? 25   DT  E C4    1 
ATOM   500  O  O4    . DT  A  1 25  ? 15.143  11.973  -26.659 1.00 34.78 ? 25   DT  E O4    1 
ATOM   501  C  C5    . DT  A  1 25  ? 14.832  14.260  -26.220 1.00 34.27 ? 25   DT  E C5    1 
ATOM   502  C  C7    . DT  A  1 25  ? 13.802  14.425  -27.300 1.00 33.81 ? 25   DT  E C7    1 
ATOM   503  C  C6    . DT  A  1 25  ? 15.081  15.240  -25.346 1.00 34.25 ? 25   DT  E C6    1 
ATOM   504  P  P     . DT  A  1 26  ? 18.512  19.380  -21.805 1.00 43.22 ? 26   DT  E P     1 
ATOM   505  O  OP1   . DT  A  1 26  ? 18.411  20.326  -20.664 1.00 41.85 ? 26   DT  E OP1   1 
ATOM   506  O  OP2   . DT  A  1 26  ? 18.678  19.861  -23.206 1.00 42.33 ? 26   DT  E OP2   1 
ATOM   507  O  "O5'" . DT  A  1 26  ? 19.678  18.311  -21.517 1.00 42.93 ? 26   DT  E "O5'" 1 
ATOM   508  C  "C5'" . DT  A  1 26  ? 19.532  17.361  -20.467 1.00 42.01 ? 26   DT  E "C5'" 1 
ATOM   509  C  "C4'" . DT  A  1 26  ? 20.299  16.095  -20.790 1.00 41.75 ? 26   DT  E "C4'" 1 
ATOM   510  O  "O4'" . DT  A  1 26  ? 19.669  15.343  -21.860 1.00 41.53 ? 26   DT  E "O4'" 1 
ATOM   511  C  "C3'" . DT  A  1 26  ? 21.730  16.314  -21.247 1.00 42.19 ? 26   DT  E "C3'" 1 
ATOM   512  O  "O3'" . DT  A  1 26  ? 22.521  15.503  -20.417 1.00 43.70 ? 26   DT  E "O3'" 1 
ATOM   513  C  "C2'" . DT  A  1 26  ? 21.757  15.799  -22.686 1.00 41.41 ? 26   DT  E "C2'" 1 
ATOM   514  C  "C1'" . DT  A  1 26  ? 20.683  14.724  -22.620 1.00 40.14 ? 26   DT  E "C1'" 1 
ATOM   515  N  N1    . DT  A  1 26  ? 20.090  14.342  -23.928 1.00 39.55 ? 26   DT  E N1    1 
ATOM   516  C  C2    . DT  A  1 26  ? 20.205  13.041  -24.386 1.00 39.60 ? 26   DT  E C2    1 
ATOM   517  O  O2    . DT  A  1 26  ? 20.791  12.146  -23.786 1.00 39.29 ? 26   DT  E O2    1 
ATOM   518  N  N3    . DT  A  1 26  ? 19.607  12.821  -25.606 1.00 39.17 ? 26   DT  E N3    1 
ATOM   519  C  C4    . DT  A  1 26  ? 18.924  13.741  -26.387 1.00 39.25 ? 26   DT  E C4    1 
ATOM   520  O  O4    . DT  A  1 26  ? 18.426  13.438  -27.469 1.00 39.50 ? 26   DT  E O4    1 
ATOM   521  C  C5    . DT  A  1 26  ? 18.842  15.078  -25.848 1.00 38.90 ? 26   DT  E C5    1 
ATOM   522  C  C7    . DT  A  1 26  ? 18.350  16.201  -26.716 1.00 38.29 ? 26   DT  E C7    1 
ATOM   523  C  C6    . DT  A  1 26  ? 19.416  15.306  -24.658 1.00 39.15 ? 26   DT  E C6    1 
ATOM   524  P  P     . DT  A  1 27  ? 23.899  16.057  -19.843 1.00 44.80 ? 27   DT  E P     1 
ATOM   525  O  OP1   . DT  A  1 27  ? 23.626  16.811  -18.593 1.00 44.56 ? 27   DT  E OP1   1 
ATOM   526  O  OP2   . DT  A  1 27  ? 24.581  16.712  -20.992 1.00 44.73 ? 27   DT  E OP2   1 
ATOM   527  O  "O5'" . DT  A  1 27  ? 24.676  14.707  -19.464 1.00 44.08 ? 27   DT  E "O5'" 1 
ATOM   528  C  "C5'" . DT  A  1 27  ? 23.974  13.467  -19.404 1.00 43.00 ? 27   DT  E "C5'" 1 
ATOM   529  C  "C4'" . DT  A  1 27  ? 24.321  12.575  -20.582 1.00 42.14 ? 27   DT  E "C4'" 1 
ATOM   530  O  "O4'" . DT  A  1 27  ? 23.797  13.089  -21.827 1.00 41.68 ? 27   DT  E "O4'" 1 
ATOM   531  C  "C3'" . DT  A  1 27  ? 25.807  12.393  -20.890 1.00 42.40 ? 27   DT  E "C3'" 1 
ATOM   532  O  "O3'" . DT  A  1 27  ? 26.254  11.258  -20.158 1.00 43.95 ? 27   DT  E "O3'" 1 
ATOM   533  C  "C2'" . DT  A  1 27  ? 25.870  12.165  -22.411 1.00 41.41 ? 27   DT  E "C2'" 1 
ATOM   534  C  "C1'" . DT  A  1 27  ? 24.380  12.186  -22.748 1.00 40.13 ? 27   DT  E "C1'" 1 
ATOM   535  N  N1    . DT  A  1 27  ? 23.893  12.412  -24.154 1.00 39.24 ? 27   DT  E N1    1 
ATOM   536  C  C2    . DT  A  1 27  ? 23.750  11.293  -24.948 1.00 38.80 ? 27   DT  E C2    1 
ATOM   537  O  O2    . DT  A  1 27  ? 24.037  10.177  -24.558 1.00 38.64 ? 27   DT  E O2    1 
ATOM   538  N  N3    . DT  A  1 27  ? 23.273  11.523  -26.215 1.00 37.89 ? 27   DT  E N3    1 
ATOM   539  C  C4    . DT  A  1 27  ? 22.913  12.746  -26.748 1.00 38.34 ? 27   DT  E C4    1 
ATOM   540  O  O4    . DT  A  1 27  ? 22.484  12.849  -27.896 1.00 38.53 ? 27   DT  E O4    1 
ATOM   541  C  C5    . DT  A  1 27  ? 23.077  13.880  -25.860 1.00 38.10 ? 27   DT  E C5    1 
ATOM   542  C  C7    . DT  A  1 27  ? 22.731  15.257  -26.336 1.00 37.79 ? 27   DT  E C7    1 
ATOM   543  C  C6    . DT  A  1 27  ? 23.548  13.668  -24.618 1.00 38.61 ? 27   DT  E C6    1 
ATOM   544  P  P     . DT  A  1 28  ? 27.813  10.967  -19.944 1.00 44.68 ? 28   DT  E P     1 
ATOM   545  O  OP1   . DT  A  1 28  ? 27.978  10.304  -18.630 1.00 44.24 ? 28   DT  E OP1   1 
ATOM   546  O  OP2   . DT  A  1 28  ? 28.522  12.238  -20.219 1.00 44.50 ? 28   DT  E OP2   1 
ATOM   547  O  "O5'" . DT  A  1 28  ? 28.147  9.930   -21.117 1.00 43.86 ? 28   DT  E "O5'" 1 
ATOM   548  C  "C5'" . DT  A  1 28  ? 27.458  8.705   -21.168 1.00 43.94 ? 28   DT  E "C5'" 1 
ATOM   549  C  "C4'" . DT  A  1 28  ? 27.664  8.067   -22.524 1.00 44.72 ? 28   DT  E "C4'" 1 
ATOM   550  O  "O4'" . DT  A  1 28  ? 26.983  8.826   -23.556 1.00 44.45 ? 28   DT  E "O4'" 1 
ATOM   551  C  "C3'" . DT  A  1 28  ? 29.118  7.992   -22.976 1.00 45.66 ? 28   DT  E "C3'" 1 
ATOM   552  O  "O3'" . DT  A  1 28  ? 29.390  6.654   -23.366 1.00 47.06 ? 28   DT  E "O3'" 1 
ATOM   553  C  "C2'" . DT  A  1 28  ? 29.171  8.953   -24.167 1.00 44.95 ? 28   DT  E "C2'" 1 
ATOM   554  C  "C1'" . DT  A  1 28  ? 27.771  8.744   -24.722 1.00 43.35 ? 28   DT  E "C1'" 1 
ATOM   555  N  N1    . DT  A  1 28  ? 27.318  9.788   -25.669 1.00 42.59 ? 28   DT  E N1    1 
ATOM   556  C  C2    . DT  A  1 28  ? 26.813  9.427   -26.902 1.00 42.14 ? 28   DT  E C2    1 
ATOM   557  O  O2    . DT  A  1 28  ? 26.718  8.274   -27.285 1.00 41.63 ? 28   DT  E O2    1 
ATOM   558  N  N3    . DT  A  1 28  ? 26.424  10.492  -27.681 1.00 41.88 ? 28   DT  E N3    1 
ATOM   559  C  C4    . DT  A  1 28  ? 26.488  11.837  -27.354 1.00 41.92 ? 28   DT  E C4    1 
ATOM   560  O  O4    . DT  A  1 28  ? 26.112  12.712  -28.126 1.00 42.12 ? 28   DT  E O4    1 
ATOM   561  C  C5    . DT  A  1 28  ? 27.030  12.139  -26.052 1.00 41.62 ? 28   DT  E C5    1 
ATOM   562  C  C7    . DT  A  1 28  ? 27.315  13.553  -25.647 1.00 41.11 ? 28   DT  E C7    1 
ATOM   563  C  C6    . DT  A  1 28  ? 27.410  11.112  -25.285 1.00 42.28 ? 28   DT  E C6    1 
ATOM   564  P  P     . DA  A  1 29  ? 30.824  6.277   -23.953 1.00 48.31 ? 29   DA  E P     1 
ATOM   565  O  OP1   . DA  A  1 29  ? 31.050  4.831   -23.715 1.00 48.20 ? 29   DA  E OP1   1 
ATOM   566  O  OP2   . DA  A  1 29  ? 31.765  7.276   -23.386 1.00 48.10 ? 29   DA  E OP2   1 
ATOM   567  O  "O5'" . DA  A  1 29  ? 30.667  6.507   -25.540 1.00 49.09 ? 29   DA  E "O5'" 1 
ATOM   568  C  "C5'" . DA  A  1 29  ? 29.558  5.939   -26.249 1.00 50.74 ? 29   DA  E "C5'" 1 
ATOM   569  C  "C4'" . DA  A  1 29  ? 29.936  5.343   -27.603 1.00 52.03 ? 29   DA  E "C4'" 1 
ATOM   570  O  "O4'" . DA  A  1 29  ? 29.445  6.191   -28.675 1.00 51.81 ? 29   DA  E "O4'" 1 
ATOM   571  C  "C3'" . DA  A  1 29  ? 31.425  5.144   -27.888 1.00 53.31 ? 29   DA  E "C3'" 1 
ATOM   572  O  "O3'" . DA  A  1 29  ? 31.638  3.872   -28.534 1.00 56.40 ? 29   DA  E "O3'" 1 
ATOM   573  C  "C2'" . DA  A  1 29  ? 31.821  6.337   -28.764 1.00 52.01 ? 29   DA  E "C2'" 1 
ATOM   574  C  "C1'" . DA  A  1 29  ? 30.505  6.940   -29.248 1.00 49.68 ? 29   DA  E "C1'" 1 
ATOM   575  N  N9    . DA  A  1 29  ? 30.340  8.347   -28.869 1.00 49.24 ? 29   DA  E N9    1 
ATOM   576  C  C8    . DA  A  1 29  ? 30.865  8.986   -27.772 1.00 48.43 ? 29   DA  E C8    1 
ATOM   577  N  N7    . DA  A  1 29  ? 30.544  10.257  -27.690 1.00 47.95 ? 29   DA  E N7    1 
ATOM   578  C  C5    . DA  A  1 29  ? 29.753  10.465  -28.808 1.00 48.16 ? 29   DA  E C5    1 
ATOM   579  C  C6    . DA  A  1 29  ? 29.093  11.606  -29.297 1.00 48.11 ? 29   DA  E C6    1 
ATOM   580  N  N6    . DA  A  1 29  ? 29.142  12.788  -28.682 1.00 48.34 ? 29   DA  E N6    1 
ATOM   581  N  N1    . DA  A  1 29  ? 28.384  11.479  -30.439 1.00 48.14 ? 29   DA  E N1    1 
ATOM   582  C  C2    . DA  A  1 29  ? 28.342  10.287  -31.052 1.00 48.03 ? 29   DA  E C2    1 
ATOM   583  N  N3    . DA  A  1 29  ? 28.915  9.140   -30.691 1.00 47.97 ? 29   DA  E N3    1 
ATOM   584  C  C4    . DA  A  1 29  ? 29.614  9.301   -29.550 1.00 48.66 ? 29   DA  E C4    1 
ATOM   585  P  P     . DG  A  1 30  ? 32.491  3.672   -29.885 1.00 58.97 ? 30   DG  E P     1 
ATOM   586  O  OP1   . DG  A  1 30  ? 32.803  2.231   -30.018 1.00 58.09 ? 30   DG  E OP1   1 
ATOM   587  O  OP2   . DG  A  1 30  ? 33.588  4.673   -29.927 1.00 58.53 ? 30   DG  E OP2   1 
ATOM   588  O  "O5'" . DG  A  1 30  ? 31.423  4.046   -31.018 1.00 59.76 ? 30   DG  E "O5'" 1 
ATOM   589  C  "C5'" . DG  A  1 30  ? 31.666  3.667   -32.365 1.00 61.00 ? 30   DG  E "C5'" 1 
ATOM   590  C  "C4'" . DG  A  1 30  ? 31.434  4.838   -33.304 1.00 61.77 ? 30   DG  E "C4'" 1 
ATOM   591  O  "O4'" . DG  A  1 30  ? 31.175  6.083   -32.582 1.00 61.47 ? 30   DG  E "O4'" 1 
ATOM   592  C  "C3'" . DG  A  1 30  ? 32.602  5.157   -34.232 1.00 62.52 ? 30   DG  E "C3'" 1 
ATOM   593  O  "O3'" . DG  A  1 30  ? 32.048  5.634   -35.444 1.00 64.60 ? 30   DG  E "O3'" 1 
ATOM   594  C  "C2'" . DG  A  1 30  ? 33.252  6.320   -33.499 1.00 62.00 ? 30   DG  E "C2'" 1 
ATOM   595  C  "C1'" . DG  A  1 30  ? 31.946  7.066   -33.250 1.00 60.34 ? 30   DG  E "C1'" 1 
ATOM   596  N  N9    . DG  A  1 30  ? 32.057  8.353   -32.551 1.00 59.97 ? 30   DG  E N9    1 
ATOM   597  C  C8    . DG  A  1 30  ? 32.753  8.650   -31.401 1.00 59.63 ? 30   DG  E C8    1 
ATOM   598  N  N7    . DG  A  1 30  ? 32.660  9.906   -31.043 1.00 59.41 ? 30   DG  E N7    1 
ATOM   599  C  C5    . DG  A  1 30  ? 31.858  10.481  -32.024 1.00 59.41 ? 30   DG  E C5    1 
ATOM   600  C  C6    . DG  A  1 30  ? 31.409  11.815  -32.173 1.00 59.36 ? 30   DG  E C6    1 
ATOM   601  O  O6    . DG  A  1 30  ? 31.641  12.788  -31.441 1.00 59.49 ? 30   DG  E O6    1 
ATOM   602  N  N1    . DG  A  1 30  ? 30.612  11.970  -33.307 1.00 59.41 ? 30   DG  E N1    1 
ATOM   603  C  C2    . DG  A  1 30  ? 30.289  10.964  -34.187 1.00 59.51 ? 30   DG  E C2    1 
ATOM   604  N  N2    . DG  A  1 30  ? 29.509  11.304  -35.224 1.00 59.51 ? 30   DG  E N2    1 
ATOM   605  N  N3    . DG  A  1 30  ? 30.703  9.709   -34.059 1.00 59.37 ? 30   DG  E N3    1 
ATOM   606  C  C4    . DG  A  1 30  ? 31.481  9.540   -32.959 1.00 59.60 ? 30   DG  E C4    1 
ATOM   607  P  P     . DT  A  1 31  ? 32.465  5.062   -36.879 1.00 66.19 ? 31   DT  E P     1 
ATOM   608  O  OP1   . DT  A  1 31  ? 32.642  3.591   -36.759 1.00 65.96 ? 31   DT  E OP1   1 
ATOM   609  O  OP2   . DT  A  1 31  ? 33.576  5.908   -37.388 1.00 65.51 ? 31   DT  E OP2   1 
ATOM   610  O  "O5'" . DT  A  1 31  ? 31.124  5.355   -37.721 1.00 65.52 ? 31   DT  E "O5'" 1 
ATOM   611  C  "C5'" . DT  A  1 31  ? 31.155  5.619   -39.121 1.00 65.09 ? 31   DT  E "C5'" 1 
ATOM   612  C  "C4'" . DT  A  1 31  ? 31.323  7.102   -39.407 1.00 64.68 ? 31   DT  E "C4'" 1 
ATOM   613  O  "O4'" . DT  A  1 31  ? 31.540  7.845   -38.177 1.00 63.83 ? 31   DT  E "O4'" 1 
ATOM   614  C  "C3'" . DT  A  1 31  ? 32.520  7.434   -40.301 1.00 65.15 ? 31   DT  E "C3'" 1 
ATOM   615  O  "O3'" . DT  A  1 31  ? 32.087  7.544   -41.691 1.00 66.21 ? 31   DT  E "O3'" 1 
ATOM   616  C  "C2'" . DT  A  1 31  ? 33.127  8.702   -39.673 1.00 64.25 ? 31   DT  E "C2'" 1 
ATOM   617  C  "C1'" . DT  A  1 31  ? 32.161  9.062   -38.537 1.00 62.80 ? 31   DT  E "C1'" 1 
ATOM   618  N  N1    . DT  A  1 31  ? 32.783  9.755   -37.334 1.00 61.88 ? 31   DT  E N1    1 
ATOM   619  C  C2    . DT  A  1 31  ? 32.367  11.038  -37.035 1.00 61.39 ? 31   DT  E C2    1 
ATOM   620  O  O2    . DT  A  1 31  ? 31.526  11.642  -37.681 1.00 61.10 ? 31   DT  E O2    1 
ATOM   621  N  N3    . DT  A  1 31  ? 32.976  11.601  -35.941 1.00 60.92 ? 31   DT  E N3    1 
ATOM   622  C  C4    . DT  A  1 31  ? 33.937  11.029  -35.129 1.00 61.22 ? 31   DT  E C4    1 
ATOM   623  O  O4    . DT  A  1 31  ? 34.419  11.623  -34.170 1.00 61.13 ? 31   DT  E O4    1 
ATOM   624  C  C5    . DT  A  1 31  ? 34.328  9.689   -35.490 1.00 61.03 ? 31   DT  E C5    1 
ATOM   625  C  C7    . DT  A  1 31  ? 35.262  8.932   -34.593 1.00 60.53 ? 31   DT  E C7    1 
ATOM   626  C  C6    . DT  A  1 31  ? 33.745  9.125   -36.562 1.00 61.25 ? 31   DT  E C6    1 
ATOM   627  P  P     . DG  A  1 32  ? 32.255  8.855   -42.606 1.00 66.72 ? 32   DG  E P     1 
ATOM   628  O  OP1   . DG  A  1 32  ? 31.717  8.561   -43.954 1.00 66.37 ? 32   DG  E OP1   1 
ATOM   629  O  OP2   . DG  A  1 32  ? 33.653  9.317   -42.452 1.00 66.55 ? 32   DG  E OP2   1 
ATOM   630  O  "O5'" . DG  A  1 32  ? 31.279  9.933   -41.937 1.00 66.62 ? 32   DG  E "O5'" 1 
ATOM   631  C  "C5'" . DG  A  1 32  ? 31.014  11.157  -42.627 1.00 67.00 ? 32   DG  E "C5'" 1 
ATOM   632  C  "C4'" . DG  A  1 32  ? 32.084  12.218  -42.379 1.00 66.99 ? 32   DG  E "C4'" 1 
ATOM   633  O  "O4'" . DG  A  1 32  ? 32.703  12.068  -41.073 1.00 66.60 ? 32   DG  E "O4'" 1 
ATOM   634  C  "C3'" . DG  A  1 32  ? 33.261  12.237  -43.362 1.00 67.27 ? 32   DG  E "C3'" 1 
ATOM   635  O  "O3'" . DG  A  1 32  ? 33.034  13.234  -44.391 1.00 68.48 ? 32   DG  E "O3'" 1 
ATOM   636  C  "C2'" . DG  A  1 32  ? 34.499  12.484  -42.482 1.00 66.52 ? 32   DG  E "C2'" 1 
ATOM   637  C  "C1'" . DG  A  1 32  ? 33.875  12.858  -41.135 1.00 65.09 ? 32   DG  E "C1'" 1 
ATOM   638  N  N9    . DG  A  1 32  ? 34.727  12.679  -39.949 1.00 64.71 ? 32   DG  E N9    1 
ATOM   639  C  C8    . DG  A  1 32  ? 35.470  11.572  -39.597 1.00 64.34 ? 32   DG  E C8    1 
ATOM   640  N  N7    . DG  A  1 32  ? 36.133  11.719  -38.479 1.00 64.11 ? 32   DG  E N7    1 
ATOM   641  C  C5    . DG  A  1 32  ? 35.815  13.007  -38.060 1.00 64.10 ? 32   DG  E C5    1 
ATOM   642  C  C6    . DG  A  1 32  ? 36.237  13.723  -36.911 1.00 64.18 ? 32   DG  E C6    1 
ATOM   643  O  O6    . DG  A  1 32  ? 37.001  13.349  -36.007 1.00 64.10 ? 32   DG  E O6    1 
ATOM   644  N  N1    . DG  A  1 32  ? 35.678  15.001  -36.867 1.00 64.09 ? 32   DG  E N1    1 
ATOM   645  C  C2    . DG  A  1 32  ? 34.823  15.518  -37.809 1.00 63.98 ? 32   DG  E C2    1 
ATOM   646  N  N2    . DG  A  1 32  ? 34.393  16.765  -37.589 1.00 64.17 ? 32   DG  E N2    1 
ATOM   647  N  N3    . DG  A  1 32  ? 34.415  14.861  -38.886 1.00 63.87 ? 32   DG  E N3    1 
ATOM   648  C  C4    . DG  A  1 32  ? 34.950  13.613  -38.950 1.00 64.25 ? 32   DG  E C4    1 
ATOM   649  P  P     . DG  A  1 33  ? 33.555  14.761  -44.341 1.00 69.40 ? 33   DG  E P     1 
ATOM   650  O  OP1   . DG  A  1 33  ? 32.923  15.487  -45.473 1.00 69.28 ? 33   DG  E OP1   1 
ATOM   651  O  OP2   . DG  A  1 33  ? 35.037  14.721  -44.259 1.00 68.99 ? 33   DG  E OP2   1 
ATOM   652  O  "O5'" . DG  A  1 33  ? 32.959  15.357  -42.965 1.00 67.92 ? 33   DG  E "O5'" 1 
ATOM   653  C  "C5'" . DG  A  1 33  ? 32.318  16.648  -42.910 1.00 65.40 ? 33   DG  E "C5'" 1 
ATOM   654  C  "C4'" . DG  A  1 33  ? 33.296  17.781  -42.604 1.00 63.39 ? 33   DG  E "C4'" 1 
ATOM   655  O  "O4'" . DG  A  1 33  ? 34.165  17.408  -41.497 1.00 62.28 ? 33   DG  E "O4'" 1 
ATOM   656  C  "C3'" . DG  A  1 33  ? 34.192  18.191  -43.778 1.00 62.32 ? 33   DG  E "C3'" 1 
ATOM   657  O  "O3'" . DG  A  1 33  ? 34.151  19.603  -43.994 1.00 61.49 ? 33   DG  E "O3'" 1 
ATOM   658  C  "C2'" . DG  A  1 33  ? 35.590  17.720  -43.379 1.00 61.43 ? 33   DG  E "C2'" 1 
ATOM   659  C  "C1'" . DG  A  1 33  ? 35.528  17.572  -41.857 1.00 60.44 ? 33   DG  E "C1'" 1 
ATOM   660  N  N9    . DG  A  1 33  ? 36.320  16.440  -41.353 1.00 59.98 ? 33   DG  E N9    1 
ATOM   661  C  C8    . DG  A  1 33  ? 36.445  15.201  -41.941 1.00 59.66 ? 33   DG  E C8    1 
ATOM   662  N  N7    . DG  A  1 33  ? 37.214  14.372  -41.289 1.00 59.45 ? 33   DG  E N7    1 
ATOM   663  C  C5    . DG  A  1 33  ? 37.636  15.111  -40.192 1.00 59.44 ? 33   DG  E C5    1 
ATOM   664  C  C6    . DG  A  1 33  ? 38.490  14.729  -39.131 1.00 59.52 ? 33   DG  E C6    1 
ATOM   665  O  O6    . DG  A  1 33  ? 39.045  13.630  -38.968 1.00 59.52 ? 33   DG  E O6    1 
ATOM   666  N  N1    . DG  A  1 33  ? 38.666  15.770  -38.214 1.00 59.50 ? 33   DG  E N1    1 
ATOM   667  C  C2    . DG  A  1 33  ? 38.086  17.017  -38.318 1.00 59.43 ? 33   DG  E C2    1 
ATOM   668  N  N2    . DG  A  1 33  ? 38.369  17.893  -37.345 1.00 59.41 ? 33   DG  E N2    1 
ATOM   669  N  N3    . DG  A  1 33  ? 37.282  17.387  -39.310 1.00 59.36 ? 33   DG  E N3    1 
ATOM   670  C  C4    . DG  A  1 33  ? 37.100  16.385  -40.212 1.00 59.59 ? 33   DG  E C4    1 
ATOM   671  O  "O5'" . DC  B  2 1   ? 38.020  22.159  -29.316 1.00 65.97 ? 1    DC  F "O5'" 1 
ATOM   672  C  "C5'" . DC  B  2 1   ? 36.915  21.306  -29.582 1.00 66.09 ? 1    DC  F "C5'" 1 
ATOM   673  C  "C4'" . DC  B  2 1   ? 36.450  21.455  -31.022 1.00 66.21 ? 1    DC  F "C4'" 1 
ATOM   674  O  "O4'" . DC  B  2 1   ? 37.150  20.508  -31.886 1.00 65.67 ? 1    DC  F "O4'" 1 
ATOM   675  C  "C3'" . DC  B  2 1   ? 34.951  21.228  -31.207 1.00 66.45 ? 1    DC  F "C3'" 1 
ATOM   676  O  "O3'" . DC  B  2 1   ? 34.335  22.371  -31.823 1.00 67.39 ? 1    DC  F "O3'" 1 
ATOM   677  C  "C2'" . DC  B  2 1   ? 34.871  19.970  -32.078 1.00 65.99 ? 1    DC  F "C2'" 1 
ATOM   678  C  "C1'" . DC  B  2 1   ? 36.237  19.862  -32.755 1.00 64.46 ? 1    DC  F "C1'" 1 
ATOM   679  N  N1    . DC  B  2 1   ? 36.653  18.428  -32.980 1.00 63.51 ? 1    DC  F N1    1 
ATOM   680  C  C2    . DC  B  2 1   ? 36.323  17.755  -34.174 1.00 62.71 ? 1    DC  F C2    1 
ATOM   681  O  O2    . DC  B  2 1   ? 35.694  18.336  -35.067 1.00 62.31 ? 1    DC  F O2    1 
ATOM   682  N  N3    . DC  B  2 1   ? 36.710  16.465  -34.328 1.00 62.32 ? 1    DC  F N3    1 
ATOM   683  C  C4    . DC  B  2 1   ? 37.391  15.848  -33.360 1.00 62.81 ? 1    DC  F C4    1 
ATOM   684  N  N4    . DC  B  2 1   ? 37.753  14.576  -33.557 1.00 62.84 ? 1    DC  F N4    1 
ATOM   685  C  C5    . DC  B  2 1   ? 37.733  16.507  -32.143 1.00 62.65 ? 1    DC  F C5    1 
ATOM   686  C  C6    . DC  B  2 1   ? 37.345  17.779  -31.997 1.00 62.88 ? 1    DC  F C6    1 
ATOM   687  P  P     . DA  B  2 2   ? 33.014  22.227  -32.731 1.00 67.96 ? 2    DA  F P     1 
ATOM   688  O  OP1   . DA  B  2 2   ? 32.308  23.527  -32.709 1.00 67.96 ? 2    DA  F OP1   1 
ATOM   689  O  OP2   . DA  B  2 2   ? 32.300  21.000  -32.305 1.00 67.94 ? 2    DA  F OP2   1 
ATOM   690  O  "O5'" . DA  B  2 2   ? 33.593  21.984  -34.208 1.00 67.53 ? 2    DA  F "O5'" 1 
ATOM   691  C  "C5'" . DA  B  2 2   ? 32.898  22.475  -35.358 1.00 66.94 ? 2    DA  F "C5'" 1 
ATOM   692  C  "C4'" . DA  B  2 2   ? 31.780  21.538  -35.798 1.00 66.25 ? 2    DA  F "C4'" 1 
ATOM   693  O  "O4'" . DA  B  2 2   ? 32.283  20.175  -35.860 1.00 65.98 ? 2    DA  F "O4'" 1 
ATOM   694  C  "C3'" . DA  B  2 2   ? 30.547  21.514  -34.889 1.00 65.93 ? 2    DA  F "C3'" 1 
ATOM   695  O  "O3'" . DA  B  2 2   ? 29.359  21.915  -35.606 1.00 65.79 ? 2    DA  F "O3'" 1 
ATOM   696  C  "C2'" . DA  B  2 2   ? 30.489  20.083  -34.352 1.00 65.61 ? 2    DA  F "C2'" 1 
ATOM   697  C  "C1'" . DA  B  2 2   ? 31.304  19.282  -35.364 1.00 64.96 ? 2    DA  F "C1'" 1 
ATOM   698  N  N9    . DA  B  2 2   ? 31.941  18.097  -34.781 1.00 64.71 ? 2    DA  F N9    1 
ATOM   699  C  C8    . DA  B  2 2   ? 32.579  18.026  -33.572 1.00 64.30 ? 2    DA  F C8    1 
ATOM   700  N  N7    . DA  B  2 2   ? 33.056  16.839  -33.289 1.00 64.16 ? 2    DA  F N7    1 
ATOM   701  C  C5    . DA  B  2 2   ? 32.705  16.074  -34.386 1.00 64.03 ? 2    DA  F C5    1 
ATOM   702  C  C6    . DA  B  2 2   ? 32.927  14.718  -34.690 1.00 64.20 ? 2    DA  F C6    1 
ATOM   703  N  N6    . DA  B  2 2   ? 33.584  13.889  -33.868 1.00 64.12 ? 2    DA  F N6    1 
ATOM   704  N  N1    . DA  B  2 2   ? 32.446  14.260  -35.871 1.00 64.42 ? 2    DA  F N1    1 
ATOM   705  C  C2    . DA  B  2 2   ? 31.791  15.108  -36.681 1.00 64.44 ? 2    DA  F C2    1 
ATOM   706  N  N3    . DA  B  2 2   ? 31.526  16.405  -36.500 1.00 64.15 ? 2    DA  F N3    1 
ATOM   707  C  C4    . DA  B  2 2   ? 32.014  16.829  -35.320 1.00 64.24 ? 2    DA  F C4    1 
ATOM   708  P  P     . DC  B  2 3   ? 28.206  20.890  -36.062 1.00 65.86 ? 3    DC  F P     1 
ATOM   709  O  OP1   . DC  B  2 3   ? 27.302  21.625  -36.982 1.00 65.60 ? 3    DC  F OP1   1 
ATOM   710  O  OP2   . DC  B  2 3   ? 27.648  20.244  -34.847 1.00 65.35 ? 3    DC  F OP2   1 
ATOM   711  O  "O5'" . DC  B  2 3   ? 29.021  19.775  -36.890 1.00 64.64 ? 3    DC  F "O5'" 1 
ATOM   712  C  "C5'" . DC  B  2 3   ? 28.542  19.193  -38.114 1.00 62.52 ? 3    DC  F "C5'" 1 
ATOM   713  C  "C4'" . DC  B  2 3   ? 27.745  17.913  -37.886 1.00 60.49 ? 3    DC  F "C4'" 1 
ATOM   714  O  "O4'" . DC  B  2 3   ? 28.448  16.978  -37.018 1.00 59.89 ? 3    DC  F "O4'" 1 
ATOM   715  C  "C3'" . DC  B  2 3   ? 26.363  18.121  -37.276 1.00 59.39 ? 3    DC  F "C3'" 1 
ATOM   716  O  "O3'" . DC  B  2 3   ? 25.416  17.464  -38.124 1.00 58.95 ? 3    DC  F "O3'" 1 
ATOM   717  C  "C2'" . DC  B  2 3   ? 26.483  17.533  -35.864 1.00 58.57 ? 3    DC  F "C2'" 1 
ATOM   718  C  "C1'" . DC  B  2 3   ? 27.587  16.488  -36.003 1.00 57.73 ? 3    DC  F "C1'" 1 
ATOM   719  N  N1    . DC  B  2 3   ? 28.398  16.233  -34.746 1.00 56.87 ? 3    DC  F N1    1 
ATOM   720  C  C2    . DC  B  2 3   ? 28.972  14.971  -34.510 1.00 56.30 ? 3    DC  F C2    1 
ATOM   721  O  O2    . DC  B  2 3   ? 28.803  14.069  -35.340 1.00 56.09 ? 3    DC  F O2    1 
ATOM   722  N  N3    . DC  B  2 3   ? 29.697  14.766  -33.376 1.00 55.76 ? 3    DC  F N3    1 
ATOM   723  C  C4    . DC  B  2 3   ? 29.867  15.756  -32.495 1.00 56.25 ? 3    DC  F C4    1 
ATOM   724  N  N4    . DC  B  2 3   ? 30.591  15.520  -31.391 1.00 55.89 ? 3    DC  F N4    1 
ATOM   725  C  C5    . DC  B  2 3   ? 29.293  17.044  -32.718 1.00 56.28 ? 3    DC  F C5    1 
ATOM   726  C  C6    . DC  B  2 3   ? 28.578  17.236  -33.836 1.00 56.58 ? 3    DC  F C6    1 
ATOM   727  P  P     . DT  B  2 4   ? 23.962  17.035  -37.606 1.00 58.79 ? 4    DT  F P     1 
ATOM   728  O  OP1   . DT  B  2 4   ? 23.037  17.091  -38.759 1.00 58.74 ? 4    DT  F OP1   1 
ATOM   729  O  OP2   . DT  B  2 4   ? 23.656  17.808  -36.376 1.00 59.00 ? 4    DT  F OP2   1 
ATOM   730  O  "O5'" . DT  B  2 4   ? 24.177  15.499  -37.202 1.00 57.99 ? 4    DT  F "O5'" 1 
ATOM   731  C  "C5'" . DT  B  2 4   ? 24.361  14.505  -38.224 1.00 56.32 ? 4    DT  F "C5'" 1 
ATOM   732  C  "C4'" . DT  B  2 4   ? 24.240  13.098  -37.658 1.00 54.50 ? 4    DT  F "C4'" 1 
ATOM   733  O  "O4'" . DT  B  2 4   ? 25.248  12.919  -36.622 1.00 53.95 ? 4    DT  F "O4'" 1 
ATOM   734  C  "C3'" . DT  B  2 4   ? 22.904  12.781  -36.988 1.00 53.55 ? 4    DT  F "C3'" 1 
ATOM   735  O  "O3'" . DT  B  2 4   ? 22.621  11.385  -37.052 1.00 52.88 ? 4    DT  F "O3'" 1 
ATOM   736  C  "C2'" . DT  B  2 4   ? 23.196  13.188  -35.552 1.00 52.97 ? 4    DT  F "C2'" 1 
ATOM   737  C  "C1'" . DT  B  2 4   ? 24.588  12.578  -35.420 1.00 51.63 ? 4    DT  F "C1'" 1 
ATOM   738  N  N1    . DT  B  2 4   ? 25.342  13.062  -34.231 1.00 50.64 ? 4    DT  F N1    1 
ATOM   739  C  C2    . DT  B  2 4   ? 26.272  12.230  -33.629 1.00 50.24 ? 4    DT  F C2    1 
ATOM   740  O  O2    . DT  B  2 4   ? 26.543  11.103  -34.020 1.00 49.75 ? 4    DT  F O2    1 
ATOM   741  N  N3    . DT  B  2 4   ? 26.888  12.775  -32.530 1.00 49.66 ? 4    DT  F N3    1 
ATOM   742  C  C4    . DT  B  2 4   ? 26.670  14.029  -31.984 1.00 49.98 ? 4    DT  F C4    1 
ATOM   743  O  O4    . DT  B  2 4   ? 27.283  14.412  -30.992 1.00 49.82 ? 4    DT  F O4    1 
ATOM   744  C  C5    . DT  B  2 4   ? 25.680  14.843  -32.659 1.00 49.89 ? 4    DT  F C5    1 
ATOM   745  C  C7    . DT  B  2 4   ? 25.314  16.202  -32.126 1.00 49.51 ? 4    DT  F C7    1 
ATOM   746  C  C6    . DT  B  2 4   ? 25.071  14.324  -33.736 1.00 50.06 ? 4    DT  F C6    1 
ATOM   747  P  P     . DA  B  2 5   ? 21.497  10.812  -38.048 1.00 52.85 ? 5    DA  F P     1 
ATOM   748  O  OP1   . DA  B  2 5   ? 22.046  10.879  -39.429 1.00 52.70 ? 5    DA  F OP1   1 
ATOM   749  O  OP2   . DA  B  2 5   ? 20.203  11.476  -37.739 1.00 51.69 ? 5    DA  F OP2   1 
ATOM   750  O  "O5'" . DA  B  2 5   ? 21.422  9.268   -37.606 1.00 50.12 ? 5    DA  F "O5'" 1 
ATOM   751  C  "C5'" . DA  B  2 5   ? 22.612  8.469   -37.658 1.00 46.63 ? 5    DA  F "C5'" 1 
ATOM   752  C  "C4'" . DA  B  2 5   ? 22.786  7.558   -36.446 1.00 43.51 ? 5    DA  F "C4'" 1 
ATOM   753  O  "O4'" . DA  B  2 5   ? 23.432  8.259   -35.347 1.00 41.64 ? 5    DA  F "O4'" 1 
ATOM   754  C  "C3'" . DA  B  2 5   ? 21.496  6.985   -35.873 1.00 42.47 ? 5    DA  F "C3'" 1 
ATOM   755  O  "O3'" . DA  B  2 5   ? 21.724  5.623   -35.538 1.00 42.13 ? 5    DA  F "O3'" 1 
ATOM   756  C  "C2'" . DA  B  2 5   ? 21.246  7.853   -34.638 1.00 41.09 ? 5    DA  F "C2'" 1 
ATOM   757  C  "C1'" . DA  B  2 5   ? 22.673  8.109   -34.165 1.00 38.43 ? 5    DA  F "C1'" 1 
ATOM   758  N  N9    . DA  B  2 5   ? 22.838  9.315   -33.360 1.00 37.40 ? 5    DA  F N9    1 
ATOM   759  C  C8    . DA  B  2 5   ? 22.208  10.518  -33.528 1.00 36.78 ? 5    DA  F C8    1 
ATOM   760  N  N7    . DA  B  2 5   ? 22.561  11.430  -32.651 1.00 36.34 ? 5    DA  F N7    1 
ATOM   761  C  C5    . DA  B  2 5   ? 23.485  10.783  -31.848 1.00 36.43 ? 5    DA  F C5    1 
ATOM   762  C  C6    . DA  B  2 5   ? 24.233  11.209  -30.728 1.00 36.46 ? 5    DA  F C6    1 
ATOM   763  N  N6    . DA  B  2 5   ? 24.152  12.441  -30.214 1.00 36.39 ? 5    DA  F N6    1 
ATOM   764  N  N1    . DA  B  2 5   ? 25.068  10.306  -30.158 1.00 36.65 ? 5    DA  F N1    1 
ATOM   765  C  C2    . DA  B  2 5   ? 25.148  9.065   -30.675 1.00 36.56 ? 5    DA  F C2    1 
ATOM   766  N  N3    . DA  B  2 5   ? 24.495  8.549   -31.723 1.00 36.28 ? 5    DA  F N3    1 
ATOM   767  C  C4    . DA  B  2 5   ? 23.671  9.472   -32.270 1.00 36.97 ? 5    DA  F C4    1 
ATOM   768  P  P     . DA  B  2 6   ? 20.485  4.636   -35.292 1.00 42.19 ? 6    DA  F P     1 
ATOM   769  O  OP1   . DA  B  2 6   ? 20.376  3.774   -36.499 1.00 41.26 ? 6    DA  F OP1   1 
ATOM   770  O  OP2   . DA  B  2 6   ? 19.323  5.438   -34.830 1.00 40.99 ? 6    DA  F OP2   1 
ATOM   771  O  "O5'" . DA  B  2 6   ? 20.982  3.756   -34.038 1.00 39.97 ? 6    DA  F "O5'" 1 
ATOM   772  C  "C5'" . DA  B  2 6   ? 22.378  3.563   -33.762 1.00 35.75 ? 6    DA  F "C5'" 1 
ATOM   773  C  "C4'" . DA  B  2 6   ? 22.680  3.724   -32.280 1.00 32.42 ? 6    DA  F "C4'" 1 
ATOM   774  O  "O4'" . DA  B  2 6   ? 22.577  5.116   -31.881 1.00 30.96 ? 6    DA  F "O4'" 1 
ATOM   775  C  "C3'" . DA  B  2 6   ? 21.742  2.979   -31.340 1.00 31.25 ? 6    DA  F "C3'" 1 
ATOM   776  O  "O3'" . DA  B  2 6   ? 22.544  2.173   -30.480 1.00 30.95 ? 6    DA  F "O3'" 1 
ATOM   777  C  "C2'" . DA  B  2 6   ? 20.989  4.092   -30.595 1.00 29.52 ? 6    DA  F "C2'" 1 
ATOM   778  C  "C1'" . DA  B  2 6   ? 22.050  5.184   -30.571 1.00 27.20 ? 6    DA  F "C1'" 1 
ATOM   779  N  N9    . DA  B  2 6   ? 21.618  6.571   -30.380 1.00 25.79 ? 6    DA  F N9    1 
ATOM   780  C  C8    . DA  B  2 6   ? 20.688  7.238   -31.127 1.00 25.56 ? 6    DA  F C8    1 
ATOM   781  N  N7    . DA  B  2 6   ? 20.516  8.490   -30.765 1.00 25.87 ? 6    DA  F N7    1 
ATOM   782  C  C5    . DA  B  2 6   ? 21.401  8.669   -29.710 1.00 25.10 ? 6    DA  F C5    1 
ATOM   783  C  C6    . DA  B  2 6   ? 21.695  9.784   -28.889 1.00 25.18 ? 6    DA  F C6    1 
ATOM   784  N  N6    . DA  B  2 6   ? 21.101  10.977  -29.015 1.00 25.14 ? 6    DA  F N6    1 
ATOM   785  N  N1    . DA  B  2 6   ? 22.627  9.628   -27.926 1.00 24.91 ? 6    DA  F N1    1 
ATOM   786  C  C2    . DA  B  2 6   ? 23.219  8.437   -27.805 1.00 25.28 ? 6    DA  F C2    1 
ATOM   787  N  N3    . DA  B  2 6   ? 23.025  7.321   -28.520 1.00 25.37 ? 6    DA  F N3    1 
ATOM   788  C  C4    . DA  B  2 6   ? 22.091  7.496   -29.467 1.00 25.00 ? 6    DA  F C4    1 
ATOM   789  P  P     . DA  B  2 7   ? 21.809  1.325   -29.352 1.00 31.36 ? 7    DA  F P     1 
ATOM   790  O  OP1   . DA  B  2 7   ? 22.611  0.146   -28.945 1.00 30.98 ? 7    DA  F OP1   1 
ATOM   791  O  OP2   . DA  B  2 7   ? 20.418  1.117   -29.826 1.00 31.03 ? 7    DA  F OP2   1 
ATOM   792  O  "O5'" . DA  B  2 7   ? 21.829  2.405   -28.164 1.00 29.21 ? 7    DA  F "O5'" 1 
ATOM   793  C  "C5'" . DA  B  2 7   ? 23.075  2.809   -27.666 1.00 26.82 ? 7    DA  F "C5'" 1 
ATOM   794  C  "C4'" . DA  B  2 7   ? 22.936  3.361   -26.264 1.00 25.78 ? 7    DA  F "C4'" 1 
ATOM   795  O  "O4'" . DA  B  2 7   ? 22.568  4.765   -26.346 1.00 24.80 ? 7    DA  F "O4'" 1 
ATOM   796  C  "C3'" . DA  B  2 7   ? 21.911  2.675   -25.365 1.00 25.17 ? 7    DA  F "C3'" 1 
ATOM   797  O  "O3'" . DA  B  2 7   ? 22.540  2.400   -24.102 1.00 25.87 ? 7    DA  F "O3'" 1 
ATOM   798  C  "C2'" . DA  B  2 7   ? 20.781  3.702   -25.268 1.00 24.11 ? 7    DA  F "C2'" 1 
ATOM   799  C  "C1'" . DA  B  2 7   ? 21.458  5.050   -25.527 1.00 21.78 ? 7    DA  F "C1'" 1 
ATOM   800  N  N9    . DA  B  2 7   ? 20.624  6.017   -26.247 1.00 20.69 ? 7    DA  F N9    1 
ATOM   801  C  C8    . DA  B  2 7   ? 19.842  5.766   -27.349 1.00 20.04 ? 7    DA  F C8    1 
ATOM   802  N  N7    . DA  B  2 7   ? 19.195  6.827   -27.794 1.00 19.92 ? 7    DA  F N7    1 
ATOM   803  C  C5    . DA  B  2 7   ? 19.578  7.844   -26.927 1.00 19.42 ? 7    DA  F C5    1 
ATOM   804  C  C6    . DA  B  2 7   ? 19.248  9.217   -26.863 1.00 19.70 ? 7    DA  F C6    1 
ATOM   805  N  N6    . DA  B  2 7   ? 18.418  9.800   -27.723 1.00 20.03 ? 7    DA  F N6    1 
ATOM   806  N  N1    . DA  B  2 7   ? 19.797  9.972   -25.885 1.00 20.15 ? 7    DA  F N1    1 
ATOM   807  C  C2    . DA  B  2 7   ? 20.636  9.364   -25.027 1.00 20.65 ? 7    DA  F C2    1 
ATOM   808  N  N3    . DA  B  2 7   ? 21.025  8.075   -24.988 1.00 20.01 ? 7    DA  F N3    1 
ATOM   809  C  C4    . DA  B  2 7   ? 20.457  7.361   -25.971 1.00 19.54 ? 7    DA  F C4    1 
ATOM   810  P  P     . DA  B  2 8   ? 21.800  1.705   -22.866 1.00 25.65 ? 8    DA  F P     1 
ATOM   811  O  OP1   . DA  B  2 8   ? 22.798  0.961   -22.067 1.00 27.17 ? 8    DA  F OP1   1 
ATOM   812  O  OP2   . DA  B  2 8   ? 20.611  0.965   -23.340 1.00 25.98 ? 8    DA  F OP2   1 
ATOM   813  O  "O5'" . DA  B  2 8   ? 21.374  3.015   -22.041 1.00 25.81 ? 8    DA  F "O5'" 1 
ATOM   814  C  "C5'" . DA  B  2 8   ? 22.177  4.207   -22.128 1.00 24.63 ? 8    DA  F "C5'" 1 
ATOM   815  C  "C4'" . DA  B  2 8   ? 21.668  5.358   -21.249 1.00 24.19 ? 8    DA  F "C4'" 1 
ATOM   816  O  "O4'" . DA  B  2 8   ? 21.025  6.377   -22.069 1.00 22.52 ? 8    DA  F "O4'" 1 
ATOM   817  C  "C3'" . DA  B  2 8   ? 20.652  5.018   -20.161 1.00 24.26 ? 8    DA  F "C3'" 1 
ATOM   818  O  "O3'" . DA  B  2 8   ? 20.837  5.850   -19.015 1.00 26.52 ? 8    DA  F "O3'" 1 
ATOM   819  C  "C2'" . DA  B  2 8   ? 19.349  5.388   -20.851 1.00 22.92 ? 8    DA  F "C2'" 1 
ATOM   820  C  "C1'" . DA  B  2 8   ? 19.761  6.682   -21.532 1.00 20.11 ? 8    DA  F "C1'" 1 
ATOM   821  N  N9    . DA  B  2 8   ? 18.831  7.067   -22.590 1.00 19.10 ? 8    DA  F N9    1 
ATOM   822  C  C8    . DA  B  2 8   ? 18.244  6.223   -23.496 1.00 18.87 ? 8    DA  F C8    1 
ATOM   823  N  N7    . DA  B  2 8   ? 17.428  6.837   -24.328 1.00 18.96 ? 8    DA  F N7    1 
ATOM   824  C  C5    . DA  B  2 8   ? 17.483  8.166   -23.936 1.00 18.12 ? 8    DA  F C5    1 
ATOM   825  C  C6    . DA  B  2 8   ? 16.847  9.321   -24.430 1.00 18.82 ? 8    DA  F C6    1 
ATOM   826  N  N6    . DA  B  2 8   ? 15.998  9.299   -25.464 1.00 18.65 ? 8    DA  F N6    1 
ATOM   827  N  N1    . DA  B  2 8   ? 17.119  10.497  -23.821 1.00 18.86 ? 8    DA  F N1    1 
ATOM   828  C  C2    . DA  B  2 8   ? 17.970  10.494  -22.791 1.00 18.57 ? 8    DA  F C2    1 
ATOM   829  N  N3    . DA  B  2 8   ? 18.624  9.469   -22.244 1.00 18.16 ? 8    DA  F N3    1 
ATOM   830  C  C4    . DA  B  2 8   ? 18.336  8.323   -22.866 1.00 17.74 ? 8    DA  F C4    1 
ATOM   831  P  P     . DT  B  2 9   ? 20.131  5.554   -17.589 1.00 27.77 ? 9    DT  F P     1 
ATOM   832  O  OP1   . DT  B  2 9   ? 21.120  4.857   -16.743 1.00 28.14 ? 9    DT  F OP1   1 
ATOM   833  O  OP2   . DT  B  2 9   ? 18.804  4.934   -17.783 1.00 26.86 ? 9    DT  F OP2   1 
ATOM   834  O  "O5'" . DT  B  2 9   ? 19.960  7.042   -17.024 1.00 27.21 ? 9    DT  F "O5'" 1 
ATOM   835  C  "C5'" . DT  B  2 9   ? 20.650  8.116   -17.656 1.00 26.31 ? 9    DT  F "C5'" 1 
ATOM   836  C  "C4'" . DT  B  2 9   ? 19.851  9.406   -17.611 1.00 25.38 ? 9    DT  F "C4'" 1 
ATOM   837  O  "O4'" . DT  B  2 9   ? 18.973  9.475   -18.759 1.00 25.49 ? 9    DT  F "O4'" 1 
ATOM   838  C  "C3'" . DT  B  2 9   ? 18.948  9.585   -16.403 1.00 25.30 ? 9    DT  F "C3'" 1 
ATOM   839  O  "O3'" . DT  B  2 9   ? 19.121  10.901  -15.946 1.00 26.55 ? 9    DT  F "O3'" 1 
ATOM   840  C  "C2'" . DT  B  2 9   ? 17.539  9.387   -16.963 1.00 24.63 ? 9    DT  F "C2'" 1 
ATOM   841  C  "C1'" . DT  B  2 9   ? 17.699  9.942   -18.362 1.00 22.98 ? 9    DT  F "C1'" 1 
ATOM   842  N  N1    . DT  B  2 9   ? 16.728  9.452   -19.383 1.00 22.16 ? 9    DT  F N1    1 
ATOM   843  C  C2    . DT  B  2 9   ? 15.877  10.351  -20.011 1.00 21.37 ? 9    DT  F C2    1 
ATOM   844  O  O2    . DT  B  2 9   ? 15.839  11.545  -19.772 1.00 21.25 ? 9    DT  F O2    1 
ATOM   845  N  N3    . DT  B  2 9   ? 15.040  9.793   -20.941 1.00 21.09 ? 9    DT  F N3    1 
ATOM   846  C  C4    . DT  B  2 9   ? 14.976  8.456   -21.307 1.00 21.72 ? 9    DT  F C4    1 
ATOM   847  O  O4    . DT  B  2 9   ? 14.191  8.029   -22.159 1.00 22.23 ? 9    DT  F O4    1 
ATOM   848  C  C5    . DT  B  2 9   ? 15.892  7.581   -20.625 1.00 20.70 ? 9    DT  F C5    1 
ATOM   849  C  C7    . DT  B  2 9   ? 15.897  6.132   -20.995 1.00 20.34 ? 9    DT  F C7    1 
ATOM   850  C  C6    . DT  B  2 9   ? 16.720  8.106   -19.711 1.00 20.86 ? 9    DT  F C6    1 
ATOM   851  P  P     . DT  B  2 10  ? 18.759  11.254  -14.435 1.00 28.52 ? 10   DT  F P     1 
ATOM   852  O  OP1   . DT  B  2 10  ? 19.932  11.889  -13.791 1.00 28.81 ? 10   DT  F OP1   1 
ATOM   853  O  OP2   . DT  B  2 10  ? 18.167  10.044  -13.833 1.00 28.31 ? 10   DT  F OP2   1 
ATOM   854  O  "O5'" . DT  B  2 10  ? 17.646  12.377  -14.632 1.00 28.58 ? 10   DT  F "O5'" 1 
ATOM   855  C  "C5'" . DT  B  2 10  ? 17.662  13.035  -15.890 1.00 28.90 ? 10   DT  F "C5'" 1 
ATOM   856  C  "C4'" . DT  B  2 10  ? 16.558  14.067  -16.009 1.00 29.44 ? 10   DT  F "C4'" 1 
ATOM   857  O  "O4'" . DT  B  2 10  ? 15.616  13.636  -17.031 1.00 29.27 ? 10   DT  F "O4'" 1 
ATOM   858  C  "C3'" . DT  B  2 10  ? 15.718  14.335  -14.760 1.00 29.57 ? 10   DT  F "C3'" 1 
ATOM   859  O  "O3'" . DT  B  2 10  ? 15.265  15.699  -14.858 1.00 31.00 ? 10   DT  F "O3'" 1 
ATOM   860  C  "C2'" . DT  B  2 10  ? 14.605  13.298  -14.923 1.00 28.75 ? 10   DT  F "C2'" 1 
ATOM   861  C  "C1'" . DT  B  2 10  ? 14.358  13.369  -16.434 1.00 27.75 ? 10   DT  F "C1'" 1 
ATOM   862  N  N1    . DT  B  2 10  ? 13.861  12.138  -17.115 1.00 27.08 ? 10   DT  F N1    1 
ATOM   863  C  C2    . DT  B  2 10  ? 13.119  12.312  -18.250 1.00 26.61 ? 10   DT  F C2    1 
ATOM   864  O  O2    . DT  B  2 10  ? 12.840  13.406  -18.691 1.00 26.79 ? 10   DT  F O2    1 
ATOM   865  N  N3    . DT  B  2 10  ? 12.704  11.157  -18.850 1.00 26.77 ? 10   DT  F N3    1 
ATOM   866  C  C4    . DT  B  2 10  ? 12.957  9.866   -18.446 1.00 26.23 ? 10   DT  F C4    1 
ATOM   867  O  O4    . DT  B  2 10  ? 12.527  8.899   -19.067 1.00 26.77 ? 10   DT  F O4    1 
ATOM   868  C  C5    . DT  B  2 10  ? 13.752  9.742   -17.257 1.00 26.07 ? 10   DT  F C5    1 
ATOM   869  C  C7    . DT  B  2 10  ? 14.331  8.406   -16.908 1.00 25.29 ? 10   DT  F C7    1 
ATOM   870  C  C6    . DT  B  2 10  ? 14.164  10.869  -16.652 1.00 26.78 ? 10   DT  F C6    1 
ATOM   871  P  P     . DA  B  2 11  ? 14.294  16.424  -13.798 1.00 32.92 ? 11   DA  F P     1 
ATOM   872  O  OP1   . DA  B  2 11  ? 14.475  17.894  -13.929 1.00 33.30 ? 11   DA  F OP1   1 
ATOM   873  O  OP2   . DA  B  2 11  ? 14.477  15.749  -12.490 1.00 32.31 ? 11   DA  F OP2   1 
ATOM   874  O  "O5'" . DA  B  2 11  ? 12.832  16.129  -14.363 1.00 30.67 ? 11   DA  F "O5'" 1 
ATOM   875  C  "C5'" . DA  B  2 11  ? 12.315  16.901  -15.427 1.00 28.76 ? 11   DA  F "C5'" 1 
ATOM   876  C  "C4'" . DA  B  2 11  ? 10.838  16.581  -15.500 1.00 28.13 ? 11   DA  F "C4'" 1 
ATOM   877  O  "O4'" . DA  B  2 11  ? 10.639  15.347  -16.244 1.00 27.73 ? 11   DA  F "O4'" 1 
ATOM   878  C  "C3'" . DA  B  2 11  ? 10.213  16.375  -14.113 1.00 27.20 ? 11   DA  F "C3'" 1 
ATOM   879  O  "O3'" . DA  B  2 11  ? 9.077   17.231  -13.965 1.00 24.69 ? 11   DA  F "O3'" 1 
ATOM   880  C  "C2'" . DA  B  2 11  ? 9.868   14.884  -14.059 1.00 27.23 ? 11   DA  F "C2'" 1 
ATOM   881  C  "C1'" . DA  B  2 11  ? 9.709   14.534  -15.541 1.00 27.17 ? 11   DA  F "C1'" 1 
ATOM   882  N  N9    . DA  B  2 11  ? 9.923   13.111  -15.848 1.00 26.69 ? 11   DA  F N9    1 
ATOM   883  C  C8    . DA  B  2 11  ? 10.779  12.239  -15.234 1.00 26.10 ? 11   DA  F C8    1 
ATOM   884  N  N7    . DA  B  2 11  ? 10.727  11.022  -15.731 1.00 26.34 ? 11   DA  F N7    1 
ATOM   885  C  C5    . DA  B  2 11  ? 9.775   11.095  -16.737 1.00 26.30 ? 11   DA  F C5    1 
ATOM   886  C  C6    . DA  B  2 11  ? 9.252   10.147  -17.649 1.00 26.69 ? 11   DA  F C6    1 
ATOM   887  N  N6    . DA  B  2 11  ? 9.632   8.868   -17.705 1.00 26.32 ? 11   DA  F N6    1 
ATOM   888  N  N1    . DA  B  2 11  ? 8.298   10.559  -18.511 1.00 26.78 ? 11   DA  F N1    1 
ATOM   889  C  C2    . DA  B  2 11  ? 7.903   11.836  -18.462 1.00 26.51 ? 11   DA  F C2    1 
ATOM   890  N  N3    . DA  B  2 11  ? 8.323   12.812  -17.656 1.00 25.93 ? 11   DA  F N3    1 
ATOM   891  C  C4    . DA  B  2 11  ? 9.267   12.375  -16.813 1.00 26.01 ? 11   DA  F C4    1 
ATOM   892  P  P     . DG  B  2 12  ? 8.120   17.175  -12.685 1.00 23.35 ? 12   DG  F P     1 
ATOM   893  O  OP1   . DG  B  2 12  ? 7.569   18.535  -12.518 1.00 24.37 ? 12   DG  F OP1   1 
ATOM   894  O  OP2   . DG  B  2 12  ? 8.766   16.503  -11.533 1.00 22.37 ? 12   DG  F OP2   1 
ATOM   895  O  "O5'" . DG  B  2 12  ? 6.957   16.235  -13.248 1.00 23.38 ? 12   DG  F "O5'" 1 
ATOM   896  C  "C5'" . DG  B  2 12  ? 6.074   16.651  -14.296 1.00 21.22 ? 12   DG  F "C5'" 1 
ATOM   897  C  "C4'" . DG  B  2 12  ? 5.081   15.530  -14.545 1.00 20.20 ? 12   DG  F "C4'" 1 
ATOM   898  O  "O4'" . DG  B  2 12  ? 5.803   14.394  -15.092 1.00 19.65 ? 12   DG  F "O4'" 1 
ATOM   899  C  "C3'" . DG  B  2 12  ? 4.378   15.022  -13.281 1.00 20.21 ? 12   DG  F "C3'" 1 
ATOM   900  O  "O3'" . DG  B  2 12  ? 2.972   15.085  -13.440 1.00 21.53 ? 12   DG  F "O3'" 1 
ATOM   901  C  "C2'" . DG  B  2 12  ? 4.820   13.574  -13.172 1.00 19.07 ? 12   DG  F "C2'" 1 
ATOM   902  C  "C1'" . DG  B  2 12  ? 5.181   13.231  -14.617 1.00 17.69 ? 12   DG  F "C1'" 1 
ATOM   903  N  N9    . DG  B  2 12  ? 5.999   12.018  -14.646 1.00 17.25 ? 12   DG  F N9    1 
ATOM   904  C  C8    . DG  B  2 12  ? 7.014   11.675  -13.773 1.00 17.02 ? 12   DG  F C8    1 
ATOM   905  N  N7    . DG  B  2 12  ? 7.536   10.500  -13.992 1.00 16.04 ? 12   DG  F N7    1 
ATOM   906  C  C5    . DG  B  2 12  ? 6.810   10.025  -15.072 1.00 16.60 ? 12   DG  F C5    1 
ATOM   907  C  C6    . DG  B  2 12  ? 6.914   8.797   -15.754 1.00 16.75 ? 12   DG  F C6    1 
ATOM   908  O  O6    . DG  B  2 12  ? 7.689   7.867   -15.541 1.00 17.00 ? 12   DG  F O6    1 
ATOM   909  N  N1    . DG  B  2 12  ? 5.993   8.696   -16.793 1.00 17.64 ? 12   DG  F N1    1 
ATOM   910  C  C2    . DG  B  2 12  ? 5.079   9.662   -17.126 1.00 16.89 ? 12   DG  F C2    1 
ATOM   911  N  N2    . DG  B  2 12  ? 4.291   9.364   -18.158 1.00 16.78 ? 12   DG  F N2    1 
ATOM   912  N  N3    . DG  B  2 12  ? 4.955   10.820  -16.493 1.00 17.09 ? 12   DG  F N3    1 
ATOM   913  C  C4    . DG  B  2 12  ? 5.853   10.934  -15.481 1.00 16.89 ? 12   DG  F C4    1 
ATOM   914  P  P     . DG  B  2 13  ? 1.976   14.859  -12.210 1.00 22.33 ? 13   DG  F P     1 
ATOM   915  O  OP1   . DG  B  2 13  ? 0.629   15.224  -12.682 1.00 22.88 ? 13   DG  F OP1   1 
ATOM   916  O  OP2   . DG  B  2 13  ? 2.530   15.482  -10.982 1.00 22.50 ? 13   DG  F OP2   1 
ATOM   917  O  "O5'" . DG  B  2 13  ? 2.022   13.271  -12.038 1.00 21.64 ? 13   DG  F "O5'" 1 
ATOM   918  C  "C5'" . DG  B  2 13  ? 0.873   12.490  -12.279 1.00 18.90 ? 13   DG  F "C5'" 1 
ATOM   919  C  "C4'" . DG  B  2 13  ? 0.911   11.797  -13.629 1.00 18.15 ? 13   DG  F "C4'" 1 
ATOM   920  O  "O4'" . DG  B  2 13  ? 2.250   11.441  -14.049 1.00 18.48 ? 13   DG  F "O4'" 1 
ATOM   921  C  "C3'" . DG  B  2 13  ? 0.196   10.465  -13.633 1.00 17.06 ? 13   DG  F "C3'" 1 
ATOM   922  O  "O3'" . DG  B  2 13  ? -1.158  10.744  -13.762 1.00 17.25 ? 13   DG  F "O3'" 1 
ATOM   923  C  "C2'" . DG  B  2 13  ? 0.745   9.812   -14.886 1.00 17.11 ? 13   DG  F "C2'" 1 
ATOM   924  C  "C1'" . DG  B  2 13  ? 2.202   10.258  -14.842 1.00 16.83 ? 13   DG  F "C1'" 1 
ATOM   925  N  N9    . DG  B  2 13  ? 3.132   9.254   -14.300 1.00 16.37 ? 13   DG  F N9    1 
ATOM   926  C  C8    . DG  B  2 13  ? 3.976   9.396   -13.226 1.00 16.23 ? 13   DG  F C8    1 
ATOM   927  N  N7    . DG  B  2 13  ? 4.699   8.332   -12.969 1.00 16.21 ? 13   DG  F N7    1 
ATOM   928  C  C5    . DG  B  2 13  ? 4.303   7.425   -13.933 1.00 15.64 ? 13   DG  F C5    1 
ATOM   929  C  C6    . DG  B  2 13  ? 4.741   6.106   -14.149 1.00 15.95 ? 13   DG  F C6    1 
ATOM   930  O  O6    . DG  B  2 13  ? 5.592   5.473   -13.515 1.00 16.39 ? 13   DG  F O6    1 
ATOM   931  N  N1    . DG  B  2 13  ? 4.091   5.517   -15.227 1.00 16.12 ? 13   DG  F N1    1 
ATOM   932  C  C2    . DG  B  2 13  ? 3.138   6.144   -15.991 1.00 16.20 ? 13   DG  F C2    1 
ATOM   933  N  N2    . DG  B  2 13  ? 2.628   5.424   -16.994 1.00 16.53 ? 13   DG  F N2    1 
ATOM   934  N  N3    . DG  B  2 13  ? 2.715   7.388   -15.805 1.00 16.10 ? 13   DG  F N3    1 
ATOM   935  C  C4    . DG  B  2 13  ? 3.343   7.969   -14.756 1.00 15.95 ? 13   DG  F C4    1 
ATOM   936  P  P     . DG  B  2 14  ? -2.197  9.926   -12.873 1.00 17.34 ? 14   DG  F P     1 
ATOM   937  O  OP1   . DG  B  2 14  ? -3.505  10.597  -13.009 1.00 17.54 ? 14   DG  F OP1   1 
ATOM   938  O  OP2   . DG  B  2 14  ? -1.614  9.684   -11.530 1.00 16.25 ? 14   DG  F OP2   1 
ATOM   939  O  "O5'" . DG  B  2 14  ? -2.253  8.539   -13.681 1.00 16.25 ? 14   DG  F "O5'" 1 
ATOM   940  C  "C5'" . DG  B  2 14  ? -2.704  8.517   -15.018 1.00 14.36 ? 14   DG  F "C5'" 1 
ATOM   941  C  "C4'" . DG  B  2 14  ? -2.611  7.108   -15.579 1.00 14.64 ? 14   DG  F "C4'" 1 
ATOM   942  O  "O4'" . DG  B  2 14  ? -1.225  6.730   -15.774 1.00 13.49 ? 14   DG  F "O4'" 1 
ATOM   943  C  "C3'" . DG  B  2 14  ? -3.217  6.045   -14.676 1.00 14.49 ? 14   DG  F "C3'" 1 
ATOM   944  O  "O3'" . DG  B  2 14  ? -4.575  5.760   -15.049 1.00 15.26 ? 14   DG  F "O3'" 1 
ATOM   945  C  "C2'" . DG  B  2 14  ? -2.347  4.819   -14.924 1.00 14.20 ? 14   DG  F "C2'" 1 
ATOM   946  C  "C1'" . DG  B  2 14  ? -1.015  5.385   -15.383 1.00 12.36 ? 14   DG  F "C1'" 1 
ATOM   947  N  N9    . DG  B  2 14  ? -0.018  5.360   -14.318 1.00 11.82 ? 14   DG  F N9    1 
ATOM   948  C  C8    . DG  B  2 14  ? 0.263   6.380   -13.446 1.00 11.44 ? 14   DG  F C8    1 
ATOM   949  N  N7    . DG  B  2 14  ? 1.208   6.090   -12.593 1.00 11.33 ? 14   DG  F N7    1 
ATOM   950  C  C5    . DG  B  2 14  ? 1.568   4.790   -12.911 1.00 11.62 ? 14   DG  F C5    1 
ATOM   951  C  C6    . DG  B  2 14  ? 2.548   3.949   -12.333 1.00 11.07 ? 14   DG  F C6    1 
ATOM   952  O  O6    . DG  B  2 14  ? 3.307   4.193   -11.400 1.00 11.37 ? 14   DG  F O6    1 
ATOM   953  N  N1    . DG  B  2 14  ? 2.603   2.710   -12.949 1.00 11.16 ? 14   DG  F N1    1 
ATOM   954  C  C2    . DG  B  2 14  ? 1.812   2.337   -14.002 1.00 11.06 ? 14   DG  F C2    1 
ATOM   955  N  N2    . DG  B  2 14  ? 2.016   1.100   -14.469 1.00 11.39 ? 14   DG  F N2    1 
ATOM   956  N  N3    . DG  B  2 14  ? 0.893   3.113   -14.562 1.00 11.32 ? 14   DG  F N3    1 
ATOM   957  C  C4    . DG  B  2 14  ? 0.819   4.324   -13.969 1.00 11.50 ? 14   DG  F C4    1 
ATOM   958  P  P     . DC  B  2 15  ? -5.532  5.141   -13.917 1.00 16.40 ? 15   DC  F P     1 
ATOM   959  O  OP1   . DC  B  2 15  ? -6.928  5.365   -14.340 1.00 16.57 ? 15   DC  F OP1   1 
ATOM   960  O  OP2   . DC  B  2 15  ? -5.040  5.640   -12.602 1.00 15.01 ? 15   DC  F OP2   1 
ATOM   961  O  "O5'" . DC  B  2 15  ? -5.297  3.562   -13.986 1.00 15.23 ? 15   DC  F "O5'" 1 
ATOM   962  C  "C5'" . DC  B  2 15  ? -4.897  2.880   -15.165 1.00 13.68 ? 15   DC  F "C5'" 1 
ATOM   963  C  "C4'" . DC  B  2 15  ? -4.520  1.486   -14.715 1.00 13.93 ? 15   DC  F "C4'" 1 
ATOM   964  O  "O4'" . DC  B  2 15  ? -3.158  1.572   -14.235 1.00 14.16 ? 15   DC  F "O4'" 1 
ATOM   965  C  "C3'" . DC  B  2 15  ? -5.359  0.945   -13.550 1.00 13.83 ? 15   DC  F "C3'" 1 
ATOM   966  O  "O3'" . DC  B  2 15  ? -5.780  -0.373  -13.841 1.00 15.07 ? 15   DC  F "O3'" 1 
ATOM   967  C  "C2'" . DC  B  2 15  ? -4.428  0.967   -12.342 1.00 12.89 ? 15   DC  F "C2'" 1 
ATOM   968  C  "C1'" . DC  B  2 15  ? -3.040  0.968   -12.974 1.00 12.32 ? 15   DC  F "C1'" 1 
ATOM   969  N  N1    . DC  B  2 15  ? -2.060  1.707   -12.134 1.00 12.21 ? 15   DC  F N1    1 
ATOM   970  C  C2    . DC  B  2 15  ? -0.921  1.019   -11.709 1.00 12.05 ? 15   DC  F C2    1 
ATOM   971  O  O2    . DC  B  2 15  ? -0.771  -0.151  -12.076 1.00 12.49 ? 15   DC  F O2    1 
ATOM   972  N  N3    . DC  B  2 15  ? -0.024  1.647   -10.911 1.00 12.41 ? 15   DC  F N3    1 
ATOM   973  C  C4    . DC  B  2 15  ? -0.229  2.911   -10.529 1.00 12.13 ? 15   DC  F C4    1 
ATOM   974  N  N4    . DC  B  2 15  ? 0.699   3.472   -9.745  1.00 11.85 ? 15   DC  F N4    1 
ATOM   975  C  C5    . DC  B  2 15  ? -1.388  3.634   -10.949 1.00 11.58 ? 15   DC  F C5    1 
ATOM   976  C  C6    . DC  B  2 15  ? -2.274  3.000   -11.742 1.00 11.65 ? 15   DC  F C6    1 
ATOM   977  P  P     . DA  B  2 16  ? -6.580  -1.288  -12.787 1.00 17.48 ? 16   DA  F P     1 
ATOM   978  O  OP1   . DA  B  2 16  ? -7.453  -2.196  -13.581 1.00 16.48 ? 16   DA  F OP1   1 
ATOM   979  O  OP2   . DA  B  2 16  ? -7.165  -0.465  -11.714 1.00 15.82 ? 16   DA  F OP2   1 
ATOM   980  O  "O5'" . DA  B  2 16  ? -5.388  -2.161  -12.167 1.00 16.09 ? 16   DA  F "O5'" 1 
ATOM   981  C  "C5'" . DA  B  2 16  ? -4.728  -3.096  -13.009 1.00 13.98 ? 16   DA  F "C5'" 1 
ATOM   982  C  "C4'" . DA  B  2 16  ? -3.829  -3.981  -12.176 1.00 12.99 ? 16   DA  F "C4'" 1 
ATOM   983  O  "O4'" . DA  B  2 16  ? -2.827  -3.170  -11.517 1.00 13.55 ? 16   DA  F "O4'" 1 
ATOM   984  C  "C3'" . DA  B  2 16  ? -4.503  -4.765  -11.064 1.00 12.48 ? 16   DA  F "C3'" 1 
ATOM   985  O  "O3'" . DA  B  2 16  ? -3.873  -5.999  -11.069 1.00 12.09 ? 16   DA  F "O3'" 1 
ATOM   986  C  "C2'" . DA  B  2 16  ? -4.148  -3.984  -9.796  1.00 12.67 ? 16   DA  F "C2'" 1 
ATOM   987  C  "C1'" . DA  B  2 16  ? -2.757  -3.466  -10.134 1.00 11.61 ? 16   DA  F "C1'" 1 
ATOM   988  N  N9    . DA  B  2 16  ? -2.376  -2.216  -9.486  1.00 10.89 ? 16   DA  F N9    1 
ATOM   989  C  C8    . DA  B  2 16  ? -3.074  -1.054  -9.547  1.00 10.76 ? 16   DA  F C8    1 
ATOM   990  N  N7    . DA  B  2 16  ? -2.515  -0.058  -8.901  1.00 11.15 ? 16   DA  F N7    1 
ATOM   991  C  C5    . DA  B  2 16  ? -1.358  -0.596  -8.377  1.00 10.91 ? 16   DA  F C5    1 
ATOM   992  C  C6    . DA  B  2 16  ? -0.329  -0.043  -7.581  1.00 10.59 ? 16   DA  F C6    1 
ATOM   993  N  N6    . DA  B  2 16  ? -0.317  1.220   -7.160  1.00 10.09 ? 16   DA  F N6    1 
ATOM   994  N  N1    . DA  B  2 16  ? 0.698   -0.854  -7.235  1.00 11.25 ? 16   DA  F N1    1 
ATOM   995  C  C2    . DA  B  2 16  ? 0.676   -2.133  -7.651  1.00 11.12 ? 16   DA  F C2    1 
ATOM   996  N  N3    . DA  B  2 16  ? -0.244  -2.761  -8.398  1.00 11.06 ? 16   DA  F N3    1 
ATOM   997  C  C4    . DA  B  2 16  ? -1.250  -1.932  -8.737  1.00 11.12 ? 16   DA  F C4    1 
ATOM   998  P  P     . DG  B  2 17  ? -4.485  -7.235  -10.287 1.00 13.21 ? 17   DG  F P     1 
ATOM   999  O  OP1   . DG  B  2 17  ? -3.996  -8.455  -10.964 1.00 14.61 ? 17   DG  F OP1   1 
ATOM   1000 O  OP2   . DG  B  2 17  ? -5.941  -7.071  -10.147 1.00 13.96 ? 17   DG  F OP2   1 
ATOM   1001 O  "O5'" . DG  B  2 17  ? -3.825  -7.095  -8.836  1.00 13.28 ? 17   DG  F "O5'" 1 
ATOM   1002 C  "C5'" . DG  B  2 17  ? -2.428  -7.023  -8.710  1.00 13.11 ? 17   DG  F "C5'" 1 
ATOM   1003 C  "C4'" . DG  B  2 17  ? -2.019  -6.718  -7.279  1.00 13.74 ? 17   DG  F "C4'" 1 
ATOM   1004 O  "O4'" . DG  B  2 17  ? -1.941  -5.275  -7.115  1.00 14.29 ? 17   DG  F "O4'" 1 
ATOM   1005 C  "C3'" . DG  B  2 17  ? -2.961  -7.202  -6.176  1.00 13.55 ? 17   DG  F "C3'" 1 
ATOM   1006 O  "O3'" . DG  B  2 17  ? -2.198  -7.631  -5.071  1.00 12.97 ? 17   DG  F "O3'" 1 
ATOM   1007 C  "C2'" . DG  B  2 17  ? -3.695  -5.919  -5.803  1.00 13.25 ? 17   DG  F "C2'" 1 
ATOM   1008 C  "C1'" . DG  B  2 17  ? -2.484  -5.012  -5.843  1.00 12.48 ? 17   DG  F "C1'" 1 
ATOM   1009 N  N9    . DG  B  2 17  ? -2.740  -3.596  -5.664  1.00 12.31 ? 17   DG  F N9    1 
ATOM   1010 C  C8    . DG  B  2 17  ? -3.826  -2.874  -6.071  1.00 12.21 ? 17   DG  F C8    1 
ATOM   1011 N  N7    . DG  B  2 17  ? -3.758  -1.616  -5.741  1.00 11.91 ? 17   DG  F N7    1 
ATOM   1012 C  C5    . DG  B  2 17  ? -2.555  -1.501  -5.071  1.00 12.03 ? 17   DG  F C5    1 
ATOM   1013 C  C6    . DG  B  2 17  ? -1.946  -0.381  -4.477  1.00 11.95 ? 17   DG  F C6    1 
ATOM   1014 O  O6    . DG  B  2 17  ? -2.376  0.773   -4.437  1.00 12.65 ? 17   DG  F O6    1 
ATOM   1015 N  N1    . DG  B  2 17  ? -0.717  -0.681  -3.896  1.00 12.10 ? 17   DG  F N1    1 
ATOM   1016 C  C2    . DG  B  2 17  ? -0.150  -1.932  -3.884  1.00 12.12 ? 17   DG  F C2    1 
ATOM   1017 N  N2    . DG  B  2 17  ? 1.037   -2.040  -3.271  1.00 11.99 ? 17   DG  F N2    1 
ATOM   1018 N  N3    . DG  B  2 17  ? -0.709  -2.998  -4.440  1.00 12.36 ? 17   DG  F N3    1 
ATOM   1019 C  C4    . DG  B  2 17  ? -1.907  -2.709  -5.016  1.00 12.81 ? 17   DG  F C4    1 
ATOM   1020 P  P     . DC  B  2 18  ? -2.052  -9.173  -4.663  1.00 13.15 ? 18   DC  F P     1 
ATOM   1021 O  OP1   . DC  B  2 18  ? -0.955  -9.690  -5.499  1.00 14.31 ? 18   DC  F OP1   1 
ATOM   1022 O  OP2   . DC  B  2 18  ? -3.342  -9.879  -4.659  1.00 12.26 ? 18   DC  F OP2   1 
ATOM   1023 O  "O5'" . DC  B  2 18  ? -1.524  -9.080  -3.144  1.00 13.88 ? 18   DC  F "O5'" 1 
ATOM   1024 C  "C5'" . DC  B  2 18  ? -2.009  -8.096  -2.251  1.00 13.83 ? 18   DC  F "C5'" 1 
ATOM   1025 C  "C4'" . DC  B  2 18  ? -0.896  -7.470  -1.442  1.00 14.32 ? 18   DC  F "C4'" 1 
ATOM   1026 O  "O4'" . DC  B  2 18  ? -0.516  -6.197  -2.027  1.00 14.65 ? 18   DC  F "O4'" 1 
ATOM   1027 C  "C3'" . DC  B  2 18  ? -1.288  -7.122  -0.010  1.00 14.12 ? 18   DC  F "C3'" 1 
ATOM   1028 O  "O3'" . DC  B  2 18  ? -1.091  -8.249  0.814   1.00 12.49 ? 18   DC  F "O3'" 1 
ATOM   1029 C  "C2'" . DC  B  2 18  ? -0.309  -6.000  0.325   1.00 13.88 ? 18   DC  F "C2'" 1 
ATOM   1030 C  "C1'" . DC  B  2 18  ? -0.218  -5.258  -1.001  1.00 15.41 ? 18   DC  F "C1'" 1 
ATOM   1031 N  N1    . DC  B  2 18  ? -1.175  -4.107  -1.140  1.00 16.66 ? 18   DC  F N1    1 
ATOM   1032 C  C2    . DC  B  2 18  ? -0.973  -2.883  -0.469  1.00 16.96 ? 18   DC  F C2    1 
ATOM   1033 O  O2    . DC  B  2 18  ? 0.010   -2.735  0.267   1.00 17.67 ? 18   DC  F O2    1 
ATOM   1034 N  N3    . DC  B  2 18  ? -1.864  -1.878  -0.644  1.00 16.69 ? 18   DC  F N3    1 
ATOM   1035 C  C4    . DC  B  2 18  ? -2.914  -2.060  -1.449  1.00 16.92 ? 18   DC  F C4    1 
ATOM   1036 N  N4    . DC  B  2 18  ? -3.787  -1.060  -1.608  1.00 16.97 ? 18   DC  F N4    1 
ATOM   1037 C  C5    . DC  B  2 18  ? -3.133  -3.286  -2.137  1.00 17.20 ? 18   DC  F C5    1 
ATOM   1038 C  C6    . DC  B  2 18  ? -2.249  -4.268  -1.960  1.00 16.60 ? 18   DC  F C6    1 
ATOM   1039 P  P     . DC  B  2 19  ? -1.851  -8.385  2.204   1.00 11.53 ? 19   DC  F P     1 
ATOM   1040 O  OP1   . DC  B  2 19  ? -1.291  -9.565  2.895   1.00 13.00 ? 19   DC  F OP1   1 
ATOM   1041 O  OP2   . DC  B  2 19  ? -3.299  -8.308  1.974   1.00 11.89 ? 19   DC  F OP2   1 
ATOM   1042 O  "O5'" . DC  B  2 19  ? -1.367  -7.095  3.030   1.00 12.72 ? 19   DC  F "O5'" 1 
ATOM   1043 C  "C5'" . DC  B  2 19  ? -0.040  -7.065  3.590   1.00 12.01 ? 19   DC  F "C5'" 1 
ATOM   1044 C  "C4'" . DC  B  2 19  ? 0.277   -5.703  4.186   1.00 12.02 ? 19   DC  F "C4'" 1 
ATOM   1045 O  "O4'" . DC  B  2 19  ? -0.075  -4.667  3.237   1.00 12.35 ? 19   DC  F "O4'" 1 
ATOM   1046 C  "C3'" . DC  B  2 19  ? -0.554  -5.354  5.405   1.00 11.32 ? 19   DC  F "C3'" 1 
ATOM   1047 O  "O3'" . DC  B  2 19  ? 0.037   -5.860  6.552   1.00 9.68  ? 19   DC  F "O3'" 1 
ATOM   1048 C  "C2'" . DC  B  2 19  ? -0.536  -3.835  5.410   1.00 11.75 ? 19   DC  F "C2'" 1 
ATOM   1049 C  "C1'" . DC  B  2 19  ? -0.441  -3.492  3.930   1.00 12.66 ? 19   DC  F "C1'" 1 
ATOM   1050 N  N1    . DC  B  2 19  ? -1.696  -2.973  3.318   1.00 13.82 ? 19   DC  F N1    1 
ATOM   1051 C  C2    . DC  B  2 19  ? -2.124  -1.663  3.595   1.00 13.94 ? 19   DC  F C2    1 
ATOM   1052 O  O2    . DC  B  2 19  ? -1.457  -0.959  4.360   1.00 13.59 ? 19   DC  F O2    1 
ATOM   1053 N  N3    . DC  B  2 19  ? -3.263  -1.200  3.012   1.00 13.91 ? 19   DC  F N3    1 
ATOM   1054 C  C4    . DC  B  2 19  ? -3.960  -1.984  2.187   1.00 13.75 ? 19   DC  F C4    1 
ATOM   1055 N  N4    . DC  B  2 19  ? -5.068  -1.476  1.644   1.00 13.27 ? 19   DC  F N4    1 
ATOM   1056 C  C5    . DC  B  2 19  ? -3.548  -3.324  1.889   1.00 13.85 ? 19   DC  F C5    1 
ATOM   1057 C  C6    . DC  B  2 19  ? -2.421  -3.771  2.467   1.00 14.45 ? 19   DC  F C6    1 
ATOM   1058 P  P     . DT  B  2 20  ? -0.900  -6.221  7.802   1.00 11.55 ? 20   DT  F P     1 
ATOM   1059 O  OP1   . DT  B  2 20  ? -0.222  -7.249  8.640   1.00 10.68 ? 20   DT  F OP1   1 
ATOM   1060 O  OP2   . DT  B  2 20  ? -2.256  -6.514  7.301   1.00 9.75  ? 20   DT  F OP2   1 
ATOM   1061 O  "O5'" . DT  B  2 20  ? -0.919  -4.845  8.622   1.00 10.84 ? 20   DT  F "O5'" 1 
ATOM   1062 C  "C5'" . DT  B  2 20  ? 0.225   -3.999  8.706   1.00 10.95 ? 20   DT  F "C5'" 1 
ATOM   1063 C  "C4'" . DT  B  2 20  ? -0.110  -2.727  9.477   1.00 12.05 ? 20   DT  F "C4'" 1 
ATOM   1064 O  "O4'" . DT  B  2 20  ? -0.900  -1.833  8.651   1.00 12.03 ? 20   DT  F "O4'" 1 
ATOM   1065 C  "C3'" . DT  B  2 20  ? -0.906  -2.882  10.773  1.00 12.42 ? 20   DT  F "C3'" 1 
ATOM   1066 O  "O3'" . DT  B  2 20  ? -0.472  -1.861  11.664  1.00 12.98 ? 20   DT  F "O3'" 1 
ATOM   1067 C  "C2'" . DT  B  2 20  ? -2.351  -2.665  10.321  1.00 12.10 ? 20   DT  F "C2'" 1 
ATOM   1068 C  "C1'" . DT  B  2 20  ? -2.161  -1.587  9.253   1.00 12.24 ? 20   DT  F "C1'" 1 
ATOM   1069 N  N1    . DT  B  2 20  ? -3.171  -1.633  8.163   1.00 11.94 ? 20   DT  F N1    1 
ATOM   1070 C  C2    . DT  B  2 20  ? -3.830  -0.474  7.778   1.00 12.31 ? 20   DT  F C2    1 
ATOM   1071 O  O2    . DT  B  2 20  ? -3.637  0.610   8.292   1.00 12.48 ? 20   DT  F O2    1 
ATOM   1072 N  N3    . DT  B  2 20  ? -4.739  -0.630  6.760   1.00 12.19 ? 20   DT  F N3    1 
ATOM   1073 C  C4    . DT  B  2 20  ? -5.025  -1.824  6.107   1.00 12.30 ? 20   DT  F C4    1 
ATOM   1074 O  O4    . DT  B  2 20  ? -5.839  -1.919  5.197   1.00 12.74 ? 20   DT  F O4    1 
ATOM   1075 C  C5    . DT  B  2 20  ? -4.299  -2.982  6.551   1.00 11.40 ? 20   DT  F C5    1 
ATOM   1076 C  C7    . DT  B  2 20  ? -4.659  -4.313  5.971   1.00 10.36 ? 20   DT  F C7    1 
ATOM   1077 C  C6    . DT  B  2 20  ? -3.414  -2.839  7.543   1.00 10.83 ? 20   DT  F C6    1 
ATOM   1078 P  P     . DG  B  2 21  ? -1.094  -1.660  13.135  1.00 14.57 ? 21   DG  F P     1 
ATOM   1079 O  OP1   . DG  B  2 21  ? 0.032   -1.233  13.999  1.00 15.52 ? 21   DG  F OP1   1 
ATOM   1080 O  OP2   . DG  B  2 21  ? -1.879  -2.846  13.535  1.00 13.29 ? 21   DG  F OP2   1 
ATOM   1081 O  "O5'" . DG  B  2 21  ? -2.084  -0.407  12.962  1.00 14.27 ? 21   DG  F "O5'" 1 
ATOM   1082 C  "C5'" . DG  B  2 21  ? -1.631  0.872   12.522  1.00 13.71 ? 21   DG  F "C5'" 1 
ATOM   1083 C  "C4'" . DG  B  2 21  ? -2.730  1.921   12.607  1.00 14.02 ? 21   DG  F "C4'" 1 
ATOM   1084 O  "O4'" . DG  B  2 21  ? -3.663  1.762   11.507  1.00 13.80 ? 21   DG  F "O4'" 1 
ATOM   1085 C  "C3'" . DG  B  2 21  ? -3.582  1.917   13.870  1.00 14.25 ? 21   DG  F "C3'" 1 
ATOM   1086 O  "O3'" . DG  B  2 21  ? -3.856  3.272   14.265  1.00 15.53 ? 21   DG  F "O3'" 1 
ATOM   1087 C  "C2'" . DG  B  2 21  ? -4.852  1.194   13.426  1.00 13.95 ? 21   DG  F "C2'" 1 
ATOM   1088 C  "C1'" . DG  B  2 21  ? -4.997  1.640   11.979  1.00 13.96 ? 21   DG  F "C1'" 1 
ATOM   1089 N  N9    . DG  B  2 21  ? -5.730  0.707   11.101  1.00 14.24 ? 21   DG  F N9    1 
ATOM   1090 C  C8    . DG  B  2 21  ? -5.582  -0.664  11.062  1.00 14.05 ? 21   DG  F C8    1 
ATOM   1091 N  N7    . DG  B  2 21  ? -6.348  -1.264  10.190  1.00 13.15 ? 21   DG  F N7    1 
ATOM   1092 C  C5    . DG  B  2 21  ? -7.054  -0.230  9.600   1.00 13.51 ? 21   DG  F C5    1 
ATOM   1093 C  C6    . DG  B  2 21  ? -8.039  -0.283  8.576   1.00 14.03 ? 21   DG  F C6    1 
ATOM   1094 O  O6    . DG  B  2 21  ? -8.478  -1.274  7.975   1.00 14.26 ? 21   DG  F O6    1 
ATOM   1095 N  N1    . DG  B  2 21  ? -8.533  0.975   8.254   1.00 13.76 ? 21   DG  F N1    1 
ATOM   1096 C  C2    . DG  B  2 21  ? -8.114  2.134   8.856   1.00 13.84 ? 21   DG  F C2    1 
ATOM   1097 N  N2    . DG  B  2 21  ? -8.710  3.242   8.394   1.00 13.21 ? 21   DG  F N2    1 
ATOM   1098 N  N3    . DG  B  2 21  ? -7.183  2.200   9.821   1.00 13.73 ? 21   DG  F N3    1 
ATOM   1099 C  C4    . DG  B  2 21  ? -6.696  0.985   10.149  1.00 13.13 ? 21   DG  F C4    1 
ATOM   1100 P  P     . DT  B  2 22  ? -4.457  3.608   15.715  1.00 16.47 ? 22   DT  F P     1 
ATOM   1101 O  OP1   . DT  B  2 22  ? -3.974  4.936   16.168  1.00 16.47 ? 22   DT  F OP1   1 
ATOM   1102 O  OP2   . DT  B  2 22  ? -4.216  2.435   16.590  1.00 16.83 ? 22   DT  F OP2   1 
ATOM   1103 O  "O5'" . DT  B  2 22  ? -6.010  3.723   15.367  1.00 16.15 ? 22   DT  F "O5'" 1 
ATOM   1104 C  "C5'" . DT  B  2 22  ? -6.396  4.597   14.301  1.00 15.49 ? 22   DT  F "C5'" 1 
ATOM   1105 C  "C4'" . DT  B  2 22  ? -7.885  4.487   14.028  1.00 15.38 ? 22   DT  F "C4'" 1 
ATOM   1106 O  "O4'" . DT  B  2 22  ? -8.171  3.436   13.056  1.00 15.99 ? 22   DT  F "O4'" 1 
ATOM   1107 C  "C3'" . DT  B  2 22  ? -8.734  4.127   15.242  1.00 15.44 ? 22   DT  F "C3'" 1 
ATOM   1108 O  "O3'" . DT  B  2 22  ? -9.927  4.798   15.055  1.00 15.74 ? 22   DT  F "O3'" 1 
ATOM   1109 C  "C2'" . DT  B  2 22  ? -8.999  2.636   15.066  1.00 15.16 ? 22   DT  F "C2'" 1 
ATOM   1110 C  "C1'" . DT  B  2 22  ? -9.245  2.661   13.561  1.00 14.50 ? 22   DT  F "C1'" 1 
ATOM   1111 N  N1    . DT  B  2 22  ? -9.342  1.310   12.899  1.00 13.83 ? 22   DT  F N1    1 
ATOM   1112 C  C2    . DT  B  2 22  ? -10.189 1.170   11.805  1.00 14.04 ? 22   DT  F C2    1 
ATOM   1113 O  O2    . DT  B  2 22  ? -10.849 2.079   11.321  1.00 13.13 ? 22   DT  F O2    1 
ATOM   1114 N  N3    . DT  B  2 22  ? -10.240 -0.095  11.270  1.00 13.78 ? 22   DT  F N3    1 
ATOM   1115 C  C4    . DT  B  2 22  ? -9.548  -1.203  11.707  1.00 13.00 ? 22   DT  F C4    1 
ATOM   1116 O  O4    . DT  B  2 22  ? -9.674  -2.276  11.140  1.00 13.40 ? 22   DT  F O4    1 
ATOM   1117 C  C5    . DT  B  2 22  ? -8.688  -1.003  12.856  1.00 12.93 ? 22   DT  F C5    1 
ATOM   1118 C  C7    . DT  B  2 22  ? -8.014  -2.185  13.504  1.00 10.39 ? 22   DT  F C7    1 
ATOM   1119 C  C6    . DT  B  2 22  ? -8.628  0.235   13.392  1.00 12.59 ? 22   DT  F C6    1 
ATOM   1120 P  P     . DG  B  2 23  ? -10.693 5.524   16.243  1.00 15.34 ? 23   DG  F P     1 
ATOM   1121 O  OP1   . DG  B  2 23  ? -10.948 6.895   15.770  1.00 16.26 ? 23   DG  F OP1   1 
ATOM   1122 O  OP2   . DG  B  2 23  ? -9.972  5.297   17.518  1.00 15.94 ? 23   DG  F OP2   1 
ATOM   1123 O  "O5'" . DG  B  2 23  ? -12.077 4.710   16.239  1.00 14.52 ? 23   DG  F "O5'" 1 
ATOM   1124 C  "C5'" . DG  B  2 23  ? -13.241 5.375   15.812  1.00 14.71 ? 23   DG  F "C5'" 1 
ATOM   1125 C  "C4'" . DG  B  2 23  ? -14.085 4.592   14.808  1.00 14.73 ? 23   DG  F "C4'" 1 
ATOM   1126 O  "O4'" . DG  B  2 23  ? -13.313 3.801   13.875  1.00 14.24 ? 23   DG  F "O4'" 1 
ATOM   1127 C  "C3'" . DG  B  2 23  ? -15.029 3.529   15.341  1.00 14.10 ? 23   DG  F "C3'" 1 
ATOM   1128 O  "O3'" . DG  B  2 23  ? -16.051 4.126   16.057  1.00 14.46 ? 23   DG  F "O3'" 1 
ATOM   1129 C  "C2'" . DG  B  2 23  ? -15.554 3.063   13.992  1.00 14.71 ? 23   DG  F "C2'" 1 
ATOM   1130 C  "C1'" . DG  B  2 23  ? -14.245 2.949   13.225  1.00 13.37 ? 23   DG  F "C1'" 1 
ATOM   1131 N  N9    . DG  B  2 23  ? -13.718 1.597   13.226  1.00 12.73 ? 23   DG  F N9    1 
ATOM   1132 C  C8    . DG  B  2 23  ? -12.690 1.121   13.993  1.00 12.98 ? 23   DG  F C8    1 
ATOM   1133 N  N7    . DG  B  2 23  ? -12.427 -0.138  13.784  1.00 13.51 ? 23   DG  F N7    1 
ATOM   1134 C  C5    . DG  B  2 23  ? -13.346 -0.523  12.812  1.00 13.28 ? 23   DG  F C5    1 
ATOM   1135 C  C6    . DG  B  2 23  ? -13.536 -1.774  12.180  1.00 12.79 ? 23   DG  F C6    1 
ATOM   1136 O  O6    . DG  B  2 23  ? -12.917 -2.833  12.346  1.00 12.25 ? 23   DG  F O6    1 
ATOM   1137 N  N1    . DG  B  2 23  ? -14.572 -1.718  11.255  1.00 13.35 ? 23   DG  F N1    1 
ATOM   1138 C  C2    . DG  B  2 23  ? -15.332 -0.609  10.978  1.00 13.56 ? 23   DG  F C2    1 
ATOM   1139 N  N2    . DG  B  2 23  ? -16.288 -0.771  10.049  1.00 13.47 ? 23   DG  F N2    1 
ATOM   1140 N  N3    . DG  B  2 23  ? -15.160 0.574   11.559  1.00 13.24 ? 23   DG  F N3    1 
ATOM   1141 C  C4    . DG  B  2 23  ? -14.150 0.540   12.461  1.00 13.14 ? 23   DG  F C4    1 
ATOM   1142 P  P     . DC  B  2 24  ? -17.153 3.271   16.819  1.00 16.10 ? 24   DC  F P     1 
ATOM   1143 O  OP1   . DC  B  2 24  ? -18.030 4.259   17.489  1.00 16.56 ? 24   DC  F OP1   1 
ATOM   1144 O  OP2   . DC  B  2 24  ? -16.493 2.247   17.659  1.00 16.09 ? 24   DC  F OP2   1 
ATOM   1145 O  "O5'" . DC  B  2 24  ? -17.931 2.528   15.622  1.00 16.32 ? 24   DC  F "O5'" 1 
ATOM   1146 C  "C5'" . DC  B  2 24  ? -18.734 3.232   14.670  1.00 17.69 ? 24   DC  F "C5'" 1 
ATOM   1147 C  "C4'" . DC  B  2 24  ? -19.503 2.270   13.780  1.00 18.91 ? 24   DC  F "C4'" 1 
ATOM   1148 O  "O4'" . DC  B  2 24  ? -18.556 1.506   12.989  1.00 19.44 ? 24   DC  F "O4'" 1 
ATOM   1149 C  "C3'" . DC  B  2 24  ? -20.340 1.234   14.524  1.00 19.46 ? 24   DC  F "C3'" 1 
ATOM   1150 O  "O3'" . DC  B  2 24  ? -21.668 1.683   14.668  1.00 20.71 ? 24   DC  F "O3'" 1 
ATOM   1151 C  "C2'" . DC  B  2 24  ? -20.333 0.042   13.584  1.00 19.38 ? 24   DC  F "C2'" 1 
ATOM   1152 C  "C1'" . DC  B  2 24  ? -19.003 0.164   12.859  1.00 19.37 ? 24   DC  F "C1'" 1 
ATOM   1153 N  N1    . DC  B  2 24  ? -17.987 -0.806  13.389  1.00 19.27 ? 24   DC  F N1    1 
ATOM   1154 C  C2    . DC  B  2 24  ? -18.014 -2.125  12.925  1.00 19.02 ? 24   DC  F C2    1 
ATOM   1155 O  O2    . DC  B  2 24  ? -18.859 -2.464  12.093  1.00 19.63 ? 24   DC  F O2    1 
ATOM   1156 N  N3    . DC  B  2 24  ? -17.107 -3.010  13.390  1.00 19.24 ? 24   DC  F N3    1 
ATOM   1157 C  C4    . DC  B  2 24  ? -16.204 -2.621  14.283  1.00 19.48 ? 24   DC  F C4    1 
ATOM   1158 N  N4    . DC  B  2 24  ? -15.336 -3.542  14.697  1.00 19.25 ? 24   DC  F N4    1 
ATOM   1159 C  C5    . DC  B  2 24  ? -16.160 -1.282  14.786  1.00 19.60 ? 24   DC  F C5    1 
ATOM   1160 C  C6    . DC  B  2 24  ? -17.062 -0.413  14.314  1.00 19.21 ? 24   DC  F C6    1 
ATOM   1161 P  P     . DT  B  2 25  ? -22.676 1.038   15.745  1.00 22.24 ? 25   DT  F P     1 
ATOM   1162 O  OP1   . DT  B  2 25  ? -23.776 2.031   15.850  1.00 21.24 ? 25   DT  F OP1   1 
ATOM   1163 O  OP2   . DT  B  2 25  ? -21.922 0.584   16.944  1.00 19.98 ? 25   DT  F OP2   1 
ATOM   1164 O  "O5'" . DT  B  2 25  ? -23.291 -0.266  15.013  1.00 23.87 ? 25   DT  F "O5'" 1 
ATOM   1165 C  "C5'" . DT  B  2 25  ? -23.907 -0.166  13.722  1.00 26.58 ? 25   DT  F "C5'" 1 
ATOM   1166 C  "C4'" . DT  B  2 25  ? -24.308 -1.517  13.158  1.00 28.35 ? 25   DT  F "C4'" 1 
ATOM   1167 O  "O4'" . DT  B  2 25  ? -23.145 -2.362  12.947  1.00 28.61 ? 25   DT  F "O4'" 1 
ATOM   1168 C  "C3'" . DT  B  2 25  ? -25.232 -2.314  14.064  1.00 30.82 ? 25   DT  F "C3'" 1 
ATOM   1169 O  "O3'" . DT  B  2 25  ? -26.177 -3.015  13.267  1.00 34.17 ? 25   DT  F "O3'" 1 
ATOM   1170 C  "C2'" . DT  B  2 25  ? -24.306 -3.293  14.781  1.00 29.83 ? 25   DT  F "C2'" 1 
ATOM   1171 C  "C1'" . DT  B  2 25  ? -23.255 -3.556  13.710  1.00 28.59 ? 25   DT  F "C1'" 1 
ATOM   1172 N  N1    . DT  B  2 25  ? -21.906 -3.941  14.276  1.00 28.23 ? 25   DT  F N1    1 
ATOM   1173 C  C2    . DT  B  2 25  ? -21.375 -5.187  13.959  1.00 27.89 ? 25   DT  F C2    1 
ATOM   1174 O  O2    . DT  B  2 25  ? -21.933 -6.014  13.247  1.00 27.04 ? 25   DT  F O2    1 
ATOM   1175 N  N3    . DT  B  2 25  ? -20.149 -5.444  14.522  1.00 27.34 ? 25   DT  F N3    1 
ATOM   1176 C  C4    . DT  B  2 25  ? -19.415 -4.608  15.343  1.00 27.43 ? 25   DT  F C4    1 
ATOM   1177 O  O4    . DT  B  2 25  ? -18.320 -4.944  15.790  1.00 27.63 ? 25   DT  F O4    1 
ATOM   1178 C  C5    . DT  B  2 25  ? -20.022 -3.328  15.635  1.00 27.07 ? 25   DT  F C5    1 
ATOM   1179 C  C7    . DT  B  2 25  ? -19.332 -2.377  16.573  1.00 26.00 ? 25   DT  F C7    1 
ATOM   1180 C  C6    . DT  B  2 25  ? -21.225 -3.058  15.099  1.00 26.80 ? 25   DT  F C6    1 
ATOM   1181 P  P     . DA  B  2 26  ? -27.436 -3.706  13.973  1.00 36.39 ? 26   DA  F P     1 
ATOM   1182 O  OP1   . DA  B  2 26  ? -28.606 -3.393  13.115  1.00 35.86 ? 26   DA  F OP1   1 
ATOM   1183 O  OP2   . DA  B  2 26  ? -27.392 -3.363  15.422  1.00 35.06 ? 26   DA  F OP2   1 
ATOM   1184 O  "O5'" . DA  B  2 26  ? -27.165 -5.275  13.823  1.00 35.80 ? 26   DA  F "O5'" 1 
ATOM   1185 C  "C5'" . DA  B  2 26  ? -26.592 -5.779  12.630  1.00 36.76 ? 26   DA  F "C5'" 1 
ATOM   1186 C  "C4'" . DA  B  2 26  ? -26.250 -7.236  12.859  1.00 37.40 ? 26   DA  F "C4'" 1 
ATOM   1187 O  "O4'" . DA  B  2 26  ? -24.916 -7.407  13.420  1.00 36.71 ? 26   DA  F "O4'" 1 
ATOM   1188 C  "C3'" . DA  B  2 26  ? -27.202 -7.921  13.829  1.00 38.10 ? 26   DA  F "C3'" 1 
ATOM   1189 O  "O3'" . DA  B  2 26  ? -27.439 -9.202  13.276  1.00 40.28 ? 26   DA  F "O3'" 1 
ATOM   1190 C  "C2'" . DA  B  2 26  ? -26.416 -7.974  15.140  1.00 37.06 ? 26   DA  F "C2'" 1 
ATOM   1191 C  "C1'" . DA  B  2 26  ? -24.982 -8.126  14.639  1.00 35.62 ? 26   DA  F "C1'" 1 
ATOM   1192 N  N9    . DA  B  2 26  ? -23.954 -7.597  15.531  1.00 34.85 ? 26   DA  F N9    1 
ATOM   1193 C  C8    . DA  B  2 26  ? -23.996 -6.445  16.260  1.00 34.85 ? 26   DA  F C8    1 
ATOM   1194 N  N7    . DA  B  2 26  ? -22.915 -6.226  16.974  1.00 34.88 ? 26   DA  F N7    1 
ATOM   1195 C  C5    . DA  B  2 26  ? -22.107 -7.312  16.687  1.00 34.78 ? 26   DA  F C5    1 
ATOM   1196 C  C6    . DA  B  2 26  ? -20.817 -7.681  17.117  1.00 34.94 ? 26   DA  F C6    1 
ATOM   1197 N  N6    . DA  B  2 26  ? -20.089 -6.956  17.970  1.00 34.93 ? 26   DA  F N6    1 
ATOM   1198 N  N1    . DA  B  2 26  ? -20.299 -8.835  16.644  1.00 35.02 ? 26   DA  F N1    1 
ATOM   1199 C  C2    . DA  B  2 26  ? -21.024 -9.562  15.788  1.00 34.99 ? 26   DA  F C2    1 
ATOM   1200 N  N3    . DA  B  2 26  ? -22.242 -9.311  15.310  1.00 35.01 ? 26   DA  F N3    1 
ATOM   1201 C  C4    . DA  B  2 26  ? -22.732 -8.162  15.800  1.00 34.66 ? 26   DA  F C4    1 
ATOM   1202 P  P     . DA  B  2 27  ? -28.621 -10.148 13.777  1.00 41.73 ? 27   DA  F P     1 
ATOM   1203 O  OP1   . DA  B  2 27  ? -29.171 -10.773 12.545  1.00 40.89 ? 27   DA  F OP1   1 
ATOM   1204 O  OP2   . DA  B  2 27  ? -29.499 -9.397  14.718  1.00 41.11 ? 27   DA  F OP2   1 
ATOM   1205 O  "O5'" . DA  B  2 27  ? -27.800 -11.255 14.590  1.00 41.09 ? 27   DA  F "O5'" 1 
ATOM   1206 C  "C5'" . DA  B  2 27  ? -26.499 -11.628 14.135  1.00 40.83 ? 27   DA  F "C5'" 1 
ATOM   1207 C  "C4'" . DA  B  2 27  ? -25.887 -12.590 15.132  1.00 40.61 ? 27   DA  F "C4'" 1 
ATOM   1208 O  "O4'" . DA  B  2 27  ? -24.860 -11.939 15.922  1.00 40.01 ? 27   DA  F "O4'" 1 
ATOM   1209 C  "C3'" . DA  B  2 27  ? -26.888 -13.132 16.140  1.00 40.87 ? 27   DA  F "C3'" 1 
ATOM   1210 O  "O3'" . DA  B  2 27  ? -26.531 -14.473 16.392  1.00 41.95 ? 27   DA  F "O3'" 1 
ATOM   1211 C  "C2'" . DA  B  2 27  ? -26.681 -12.226 17.354  1.00 39.92 ? 27   DA  F "C2'" 1 
ATOM   1212 C  "C1'" . DA  B  2 27  ? -25.170 -12.051 17.297  1.00 38.50 ? 27   DA  F "C1'" 1 
ATOM   1213 N  N9    . DA  B  2 27  ? -24.674 -10.857 17.972  1.00 37.72 ? 27   DA  F N9    1 
ATOM   1214 C  C8    . DA  B  2 27  ? -25.345 -9.685  18.160  1.00 37.32 ? 27   DA  F C8    1 
ATOM   1215 N  N7    . DA  B  2 27  ? -24.647 -8.778  18.797  1.00 37.33 ? 27   DA  F N7    1 
ATOM   1216 C  C5    . DA  B  2 27  ? -23.434 -9.399  19.041  1.00 37.29 ? 27   DA  F C5    1 
ATOM   1217 C  C6    . DA  B  2 27  ? -22.260 -8.962  19.689  1.00 37.36 ? 27   DA  F C6    1 
ATOM   1218 N  N6    . DA  B  2 27  ? -22.132 -7.742  20.219  1.00 37.08 ? 27   DA  F N6    1 
ATOM   1219 N  N1    . DA  B  2 27  ? -21.229 -9.830  19.767  1.00 37.08 ? 27   DA  F N1    1 
ATOM   1220 C  C2    . DA  B  2 27  ? -21.376 -11.049 19.231  1.00 37.19 ? 27   DA  F C2    1 
ATOM   1221 N  N3    . DA  B  2 27  ? -22.427 -11.572 18.599  1.00 36.90 ? 27   DA  F N3    1 
ATOM   1222 C  C4    . DA  B  2 27  ? -23.433 -10.685 18.538  1.00 37.29 ? 27   DA  F C4    1 
ATOM   1223 P  P     . DC  B  2 28  ? -27.510 -15.433 17.208  1.00 43.16 ? 28   DC  F P     1 
ATOM   1224 O  OP1   . DC  B  2 28  ? -27.547 -16.715 16.469  1.00 42.42 ? 28   DC  F OP1   1 
ATOM   1225 O  OP2   . DC  B  2 28  ? -28.756 -14.699 17.539  1.00 42.09 ? 28   DC  F OP2   1 
ATOM   1226 O  "O5'" . DC  B  2 28  ? -26.671 -15.646 18.556  1.00 44.07 ? 28   DC  F "O5'" 1 
ATOM   1227 C  "C5'" . DC  B  2 28  ? -25.351 -16.168 18.411  1.00 45.91 ? 28   DC  F "C5'" 1 
ATOM   1228 C  "C4'" . DC  B  2 28  ? -24.469 -15.841 19.601  1.00 47.06 ? 28   DC  F "C4'" 1 
ATOM   1229 O  "O4'" . DC  B  2 28  ? -24.239 -14.408 19.711  1.00 46.37 ? 28   DC  F "O4'" 1 
ATOM   1230 C  "C3'" . DC  B  2 28  ? -25.032 -16.274 20.956  1.00 48.50 ? 28   DC  F "C3'" 1 
ATOM   1231 O  "O3'" . DC  B  2 28  ? -23.988 -16.861 21.718  1.00 51.20 ? 28   DC  F "O3'" 1 
ATOM   1232 C  "C2'" . DC  B  2 28  ? -25.433 -14.949 21.589  1.00 47.39 ? 28   DC  F "C2'" 1 
ATOM   1233 C  "C1'" . DC  B  2 28  ? -24.224 -14.164 21.100  1.00 45.61 ? 28   DC  F "C1'" 1 
ATOM   1234 N  N1    . DC  B  2 28  ? -24.244 -12.718 21.447  1.00 44.85 ? 28   DC  F N1    1 
ATOM   1235 C  C2    . DC  B  2 28  ? -23.065 -12.147 21.940  1.00 44.06 ? 28   DC  F C2    1 
ATOM   1236 O  O2    . DC  B  2 28  ? -22.056 -12.863 22.044  1.00 43.13 ? 28   DC  F O2    1 
ATOM   1237 N  N3    . DC  B  2 28  ? -23.075 -10.830 22.279  1.00 43.88 ? 28   DC  F N3    1 
ATOM   1238 C  C4    . DC  B  2 28  ? -24.199 -10.114 22.146  1.00 44.23 ? 28   DC  F C4    1 
ATOM   1239 N  N4    . DC  B  2 28  ? -24.167 -8.824  22.489  1.00 44.02 ? 28   DC  F N4    1 
ATOM   1240 C  C5    . DC  B  2 28  ? -25.410 -10.687 21.650  1.00 43.83 ? 28   DC  F C5    1 
ATOM   1241 C  C6    . DC  B  2 28  ? -25.390 -11.982 21.319  1.00 44.20 ? 28   DC  F C6    1 
ATOM   1242 P  P     . DA  B  2 29  ? -24.308 -18.129 22.636  1.00 53.12 ? 29   DA  F P     1 
ATOM   1243 O  OP1   . DA  B  2 29  ? -24.984 -19.099 21.749  1.00 52.98 ? 29   DA  F OP1   1 
ATOM   1244 O  OP2   . DA  B  2 29  ? -24.995 -17.656 23.865  1.00 52.35 ? 29   DA  F OP2   1 
ATOM   1245 O  "O5'" . DA  B  2 29  ? -22.855 -18.704 23.030  1.00 53.31 ? 29   DA  F "O5'" 1 
ATOM   1246 C  "C5'" . DA  B  2 29  ? -21.692 -17.870 23.032  1.00 54.29 ? 29   DA  F "C5'" 1 
ATOM   1247 C  "C4'" . DA  B  2 29  ? -21.228 -17.487 24.436  1.00 54.75 ? 29   DA  F "C4'" 1 
ATOM   1248 O  "O4'" . DA  B  2 29  ? -21.360 -16.052 24.646  1.00 54.15 ? 29   DA  F "O4'" 1 
ATOM   1249 C  "C3'" . DA  B  2 29  ? -21.974 -18.120 25.601  1.00 55.49 ? 29   DA  F "C3'" 1 
ATOM   1250 O  "O3'" . DA  B  2 29  ? -21.043 -18.364 26.642  1.00 58.05 ? 29   DA  F "O3'" 1 
ATOM   1251 C  "C2'" . DA  B  2 29  ? -22.978 -17.039 25.993  1.00 54.35 ? 29   DA  F "C2'" 1 
ATOM   1252 C  "C1'" . DA  B  2 29  ? -22.125 -15.791 25.806  1.00 52.71 ? 29   DA  F "C1'" 1 
ATOM   1253 N  N9    . DA  B  2 29  ? -22.864 -14.535 25.628  1.00 52.18 ? 29   DA  F N9    1 
ATOM   1254 C  C8    . DA  B  2 29  ? -24.004 -14.326 24.900  1.00 51.79 ? 29   DA  F C8    1 
ATOM   1255 N  N7    . DA  B  2 29  ? -24.443 -13.087 24.927  1.00 51.52 ? 29   DA  F N7    1 
ATOM   1256 C  C5    . DA  B  2 29  ? -23.525 -12.429 25.730  1.00 51.79 ? 29   DA  F C5    1 
ATOM   1257 C  C6    . DA  B  2 29  ? -23.419 -11.085 26.155  1.00 51.84 ? 29   DA  F C6    1 
ATOM   1258 N  N6    . DA  B  2 29  ? -24.283 -10.121 25.812  1.00 51.55 ? 29   DA  F N6    1 
ATOM   1259 N  N1    . DA  B  2 29  ? -22.379 -10.768 26.955  1.00 51.74 ? 29   DA  F N1    1 
ATOM   1260 C  C2    . DA  B  2 29  ? -21.511 -11.728 27.300  1.00 51.71 ? 29   DA  F C2    1 
ATOM   1261 N  N3    . DA  B  2 29  ? -21.502 -13.016 26.965  1.00 51.57 ? 29   DA  F N3    1 
ATOM   1262 C  C4    . DA  B  2 29  ? -22.546 -13.307 26.170  1.00 51.92 ? 29   DA  F C4    1 
ATOM   1263 P  P     . DG  B  2 30  ? -21.337 -19.526 27.703  1.00 60.36 ? 30   DG  F P     1 
ATOM   1264 O  OP1   . DG  B  2 30  ? -20.825 -20.778 27.094  1.00 60.00 ? 30   DG  F OP1   1 
ATOM   1265 O  OP2   . DG  B  2 30  ? -22.768 -19.421 28.099  1.00 59.61 ? 30   DG  F OP2   1 
ATOM   1266 O  "O5'" . DG  B  2 30  ? -20.427 -19.158 28.984  1.00 60.54 ? 30   DG  F "O5'" 1 
ATOM   1267 C  "C5'" . DG  B  2 30  ? -19.932 -17.837 29.229  1.00 61.64 ? 30   DG  F "C5'" 1 
ATOM   1268 C  "C4'" . DG  B  2 30  ? -20.622 -17.131 30.397  1.00 62.67 ? 30   DG  F "C4'" 1 
ATOM   1269 O  "O4'" . DG  B  2 30  ? -21.377 -16.004 29.884  1.00 62.35 ? 30   DG  F "O4'" 1 
ATOM   1270 C  "C3'" . DG  B  2 30  ? -21.608 -17.934 31.261  1.00 63.44 ? 30   DG  F "C3'" 1 
ATOM   1271 O  "O3'" . DG  B  2 30  ? -21.026 -18.181 32.578  1.00 65.47 ? 30   DG  F "O3'" 1 
ATOM   1272 C  "C2'" . DG  B  2 30  ? -22.911 -17.119 31.258  1.00 62.40 ? 30   DG  F "C2'" 1 
ATOM   1273 C  "C1'" . DG  B  2 30  ? -22.434 -15.750 30.782  1.00 61.34 ? 30   DG  F "C1'" 1 
ATOM   1274 N  N9    . DG  B  2 30  ? -23.418 -14.931 30.079  1.00 60.93 ? 30   DG  F N9    1 
ATOM   1275 C  C8    . DG  B  2 30  ? -24.425 -15.349 29.246  1.00 60.56 ? 30   DG  F C8    1 
ATOM   1276 N  N7    . DG  B  2 30  ? -25.135 -14.364 28.766  1.00 60.39 ? 30   DG  F N7    1 
ATOM   1277 C  C5    . DG  B  2 30  ? -24.561 -13.225 29.311  1.00 60.39 ? 30   DG  F C5    1 
ATOM   1278 C  C6    . DG  B  2 30  ? -24.902 -11.860 29.151  1.00 60.66 ? 30   DG  F C6    1 
ATOM   1279 O  O6    . DG  B  2 30  ? -25.815 -11.376 28.467  1.00 60.54 ? 30   DG  F O6    1 
ATOM   1280 N  N1    . DG  B  2 30  ? -24.061 -11.020 29.888  1.00 60.78 ? 30   DG  F N1    1 
ATOM   1281 C  C2    . DG  B  2 30  ? -23.015 -11.450 30.677  1.00 60.71 ? 30   DG  F C2    1 
ATOM   1282 N  N2    . DG  B  2 30  ? -22.310 -10.497 31.311  1.00 60.50 ? 30   DG  F N2    1 
ATOM   1283 N  N3    . DG  B  2 30  ? -22.686 -12.730 30.830  1.00 60.51 ? 30   DG  F N3    1 
ATOM   1284 C  C4    . DG  B  2 30  ? -23.499 -13.556 30.121  1.00 60.64 ? 30   DG  F C4    1 
ATOM   1285 P  P     . DG  B  2 31  ? -21.473 -17.521 33.982  1.00 67.51 ? 31   DG  F P     1 
ATOM   1286 O  OP1   . DG  B  2 31  ? -20.701 -18.218 35.039  1.00 66.87 ? 31   DG  F OP1   1 
ATOM   1287 O  OP2   . DG  B  2 31  ? -22.957 -17.455 34.059  1.00 67.03 ? 31   DG  F OP2   1 
ATOM   1288 O  "O5'" . DG  B  2 31  ? -20.901 -16.027 33.885  1.00 67.65 ? 31   DG  F "O5'" 1 
ATOM   1289 C  "C5'" . DG  B  2 31  ? -20.121 -15.474 34.946  1.00 67.40 ? 31   DG  F "C5'" 1 
ATOM   1290 C  "C4'" . DG  B  2 31  ? -20.926 -14.421 35.683  1.00 67.59 ? 31   DG  F "C4'" 1 
ATOM   1291 O  "O4'" . DG  B  2 31  ? -21.763 -13.690 34.740  1.00 67.27 ? 31   DG  F "O4'" 1 
ATOM   1292 C  "C3'" . DG  B  2 31  ? -21.867 -14.989 36.743  1.00 68.03 ? 31   DG  F "C3'" 1 
ATOM   1293 O  "O3'" . DG  B  2 31  ? -21.790 -14.214 37.940  1.00 69.19 ? 31   DG  F "O3'" 1 
ATOM   1294 C  "C2'" . DG  B  2 31  ? -23.240 -14.885 36.082  1.00 67.16 ? 31   DG  F "C2'" 1 
ATOM   1295 C  "C1'" . DG  B  2 31  ? -23.075 -13.616 35.257  1.00 65.90 ? 31   DG  F "C1'" 1 
ATOM   1296 N  N9    . DG  B  2 31  ? -24.070 -13.536 34.193  1.00 65.49 ? 31   DG  F N9    1 
ATOM   1297 C  C8    . DG  B  2 31  ? -24.505 -14.569 33.400  1.00 65.23 ? 31   DG  F C8    1 
ATOM   1298 N  N7    . DG  B  2 31  ? -25.417 -14.213 32.542  1.00 65.20 ? 31   DG  F N7    1 
ATOM   1299 C  C5    . DG  B  2 31  ? -25.607 -12.860 32.786  1.00 65.10 ? 31   DG  F C5    1 
ATOM   1300 C  C6    . DG  B  2 31  ? -26.477 -11.937 32.162  1.00 65.06 ? 31   DG  F C6    1 
ATOM   1301 O  O6    . DG  B  2 31  ? -27.276 -12.143 31.241  1.00 65.04 ? 31   DG  F O6    1 
ATOM   1302 N  N1    . DG  B  2 31  ? -26.359 -10.661 32.704  1.00 65.11 ? 31   DG  F N1    1 
ATOM   1303 C  C2    . DG  B  2 31  ? -25.504 -10.324 33.727  1.00 65.27 ? 31   DG  F C2    1 
ATOM   1304 N  N2    . DG  B  2 31  ? -25.528 -9.043  34.120  1.00 65.23 ? 31   DG  F N2    1 
ATOM   1305 N  N3    . DG  B  2 31  ? -24.682 -11.181 34.323  1.00 65.22 ? 31   DG  F N3    1 
ATOM   1306 C  C4    . DG  B  2 31  ? -24.787 -12.428 33.803  1.00 65.25 ? 31   DG  F C4    1 
ATOM   1307 P  P     . DG  B  2 32  ? -23.054 -14.083 38.923  1.00 70.10 ? 32   DG  F P     1 
ATOM   1308 O  OP1   . DG  B  2 32  ? -22.531 -13.684 40.253  1.00 69.68 ? 32   DG  F OP1   1 
ATOM   1309 O  OP2   . DG  B  2 32  ? -23.900 -15.294 38.786  1.00 69.16 ? 32   DG  F OP2   1 
ATOM   1310 O  "O5'" . DG  B  2 32  ? -23.859 -12.853 38.296  1.00 69.69 ? 32   DG  F "O5'" 1 
ATOM   1311 C  "C5'" . DG  B  2 32  ? -23.564 -11.530 38.711  1.00 69.75 ? 32   DG  F "C5'" 1 
ATOM   1312 C  "C4'" . DG  B  2 32  ? -24.823 -10.685 38.668  1.00 69.73 ? 32   DG  F "C4'" 1 
ATOM   1313 O  "O4'" . DG  B  2 32  ? -25.478 -10.866 37.381  1.00 69.08 ? 32   DG  F "O4'" 1 
ATOM   1314 C  "C3'" . DG  B  2 32  ? -25.866 -11.040 39.727  1.00 70.09 ? 32   DG  F "C3'" 1 
ATOM   1315 O  "O3'" . DG  B  2 32  ? -26.445 -9.844  40.245  1.00 71.50 ? 32   DG  F "O3'" 1 
ATOM   1316 C  "C2'" . DG  B  2 32  ? -26.901 -11.825 38.932  1.00 69.13 ? 32   DG  F "C2'" 1 
ATOM   1317 C  "C1'" . DG  B  2 32  ? -26.855 -11.020 37.640  1.00 67.64 ? 32   DG  F "C1'" 1 
ATOM   1318 N  N9    . DG  B  2 32  ? -27.538 -11.666 36.527  1.00 67.18 ? 32   DG  F N9    1 
ATOM   1319 C  C8    . DG  B  2 32  ? -27.456 -12.982 36.140  1.00 66.89 ? 32   DG  F C8    1 
ATOM   1320 N  N7    . DG  B  2 32  ? -28.207 -13.263 35.109  1.00 66.87 ? 32   DG  F N7    1 
ATOM   1321 C  C5    . DG  B  2 32  ? -28.827 -12.058 34.798  1.00 66.81 ? 32   DG  F C5    1 
ATOM   1322 C  C6    . DG  B  2 32  ? -29.753 -11.743 33.775  1.00 66.79 ? 32   DG  F C6    1 
ATOM   1323 O  O6    . DG  B  2 32  ? -30.228 -12.493 32.907  1.00 66.77 ? 32   DG  F O6    1 
ATOM   1324 N  N1    . DG  B  2 32  ? -30.122 -10.400 33.819  1.00 66.66 ? 32   DG  F N1    1 
ATOM   1325 C  C2    . DG  B  2 32  ? -29.659 -9.483  34.734  1.00 66.65 ? 32   DG  F C2    1 
ATOM   1326 N  N2    . DG  B  2 32  ? -30.133 -8.235  34.620  1.00 66.71 ? 32   DG  F N2    1 
ATOM   1327 N  N3    . DG  B  2 32  ? -28.795 -9.764  35.698  1.00 66.30 ? 32   DG  F N3    1 
ATOM   1328 C  C4    . DG  B  2 32  ? -28.425 -11.066 35.666  1.00 66.76 ? 32   DG  F C4    1 
ATOM   1329 P  P     . DC  B  2 33  ? -27.218 -9.854  41.650  1.00 72.13 ? 33   DC  F P     1 
ATOM   1330 O  OP1   . DC  B  2 33  ? -26.310 -9.237  42.649  1.00 71.60 ? 33   DC  F OP1   1 
ATOM   1331 O  OP2   . DC  B  2 33  ? -27.754 -11.224 41.868  1.00 71.81 ? 33   DC  F OP2   1 
ATOM   1332 O  "O5'" . DC  B  2 33  ? -28.452 -8.862  41.391  1.00 71.75 ? 33   DC  F "O5'" 1 
ATOM   1333 C  "C5'" . DC  B  2 33  ? -28.316 -7.457  41.622  1.00 71.60 ? 33   DC  F "C5'" 1 
ATOM   1334 C  "C4'" . DC  B  2 33  ? -29.421 -6.680  40.924  1.00 71.41 ? 33   DC  F "C4'" 1 
ATOM   1335 O  "O4'" . DC  B  2 33  ? -29.648 -7.237  39.602  1.00 71.08 ? 33   DC  F "O4'" 1 
ATOM   1336 C  "C3'" . DC  B  2 33  ? -30.764 -6.689  41.654  1.00 71.55 ? 33   DC  F "C3'" 1 
ATOM   1337 O  "O3'" . DC  B  2 33  ? -31.247 -5.361  41.838  1.00 71.90 ? 33   DC  F "O3'" 1 
ATOM   1338 C  "C2'" . DC  B  2 33  ? -31.701 -7.508  40.765  1.00 71.11 ? 33   DC  F "C2'" 1 
ATOM   1339 C  "C1'" . DC  B  2 33  ? -31.013 -7.538  39.403  1.00 70.48 ? 33   DC  F "C1'" 1 
ATOM   1340 N  N1    . DC  B  2 33  ? -31.099 -8.874  38.759  1.00 70.04 ? 33   DC  F N1    1 
ATOM   1341 C  C2    . DC  B  2 33  ? -31.949 -9.068  37.662  1.00 69.89 ? 33   DC  F C2    1 
ATOM   1342 O  O2    . DC  B  2 33  ? -32.619 -8.121  37.231  1.00 69.84 ? 33   DC  F O2    1 
ATOM   1343 N  N3    . DC  B  2 33  ? -32.014 -10.300 37.096  1.00 69.76 ? 33   DC  F N3    1 
ATOM   1344 C  C4    . DC  B  2 33  ? -31.275 -11.302 37.583  1.00 70.01 ? 33   DC  F C4    1 
ATOM   1345 N  N4    . DC  B  2 33  ? -31.372 -12.495 36.986  1.00 70.06 ? 33   DC  F N4    1 
ATOM   1346 C  C5    . DC  B  2 33  ? -30.405 -11.126 38.701  1.00 69.99 ? 33   DC  F C5    1 
ATOM   1347 C  C6    . DC  B  2 33  ? -30.352 -9.907  39.251  1.00 70.15 ? 33   DC  F C6    1 
ATOM   1348 N  N     . GLU C  3 3   ? 2.949   -13.670 -6.856  1.00 29.35 ? 3    GLU A N     1 
ATOM   1349 C  CA    . GLU C  3 3   ? 2.637   -14.642 -5.763  1.00 29.89 ? 3    GLU A CA    1 
ATOM   1350 C  C     . GLU C  3 3   ? 1.449   -15.553 -6.097  1.00 28.46 ? 3    GLU A C     1 
ATOM   1351 O  O     . GLU C  3 3   ? 1.527   -16.778 -5.977  1.00 27.37 ? 3    GLU A O     1 
ATOM   1352 C  CB    . GLU C  3 3   ? 2.326   -13.898 -4.473  1.00 31.72 ? 3    GLU A CB    1 
ATOM   1353 C  CG    . GLU C  3 3   ? 1.918   -14.831 -3.349  1.00 34.24 ? 3    GLU A CG    1 
ATOM   1354 C  CD    . GLU C  3 3   ? 3.096   -15.234 -2.499  1.00 36.33 ? 3    GLU A CD    1 
ATOM   1355 O  OE1   . GLU C  3 3   ? 3.529   -16.408 -2.605  1.00 37.01 ? 3    GLU A OE1   1 
ATOM   1356 O  OE2   . GLU C  3 3   ? 3.597   -14.364 -1.742  1.00 36.55 ? 3    GLU A OE2   1 
ATOM   1357 N  N     . LEU C  3 4   ? 0.340   -14.932 -6.485  1.00 25.84 ? 4    LEU A N     1 
ATOM   1358 C  CA    . LEU C  3 4   ? -0.845  -15.654 -6.917  1.00 22.73 ? 4    LEU A CA    1 
ATOM   1359 C  C     . LEU C  3 4   ? -0.771  -15.852 -8.420  1.00 20.62 ? 4    LEU A C     1 
ATOM   1360 O  O     . LEU C  3 4   ? -1.613  -16.519 -9.014  1.00 18.54 ? 4    LEU A O     1 
ATOM   1361 C  CB    . LEU C  3 4   ? -2.089  -14.847 -6.582  1.00 23.12 ? 4    LEU A CB    1 
ATOM   1362 C  CG    . LEU C  3 4   ? -2.436  -14.673 -5.109  1.00 23.60 ? 4    LEU A CG    1 
ATOM   1363 C  CD1   . LEU C  3 4   ? -3.527  -13.630 -4.988  1.00 24.07 ? 4    LEU A CD1   1 
ATOM   1364 C  CD2   . LEU C  3 4   ? -2.879  -16.003 -4.487  1.00 23.60 ? 4    LEU A CD2   1 
ATOM   1365 N  N     . VAL C  3 5   ? 0.257   -15.259 -9.016  1.00 18.90 ? 5    VAL A N     1 
ATOM   1366 C  CA    . VAL C  3 5   ? 0.476   -15.275 -10.467 1.00 17.94 ? 5    VAL A CA    1 
ATOM   1367 C  C     . VAL C  3 5   ? -0.535  -14.390 -11.195 1.00 17.27 ? 5    VAL A C     1 
ATOM   1368 O  O     . VAL C  3 5   ? -0.148  -13.556 -11.989 1.00 17.78 ? 5    VAL A O     1 
ATOM   1369 C  CB    . VAL C  3 5   ? 0.556   -16.716 -11.076 1.00 16.79 ? 5    VAL A CB    1 
ATOM   1370 C  CG1   . VAL C  3 5   ? 0.954   -16.654 -12.542 1.00 14.66 ? 5    VAL A CG1   1 
ATOM   1371 C  CG2   . VAL C  3 5   ? 1.546   -17.568 -10.301 1.00 15.65 ? 5    VAL A CG2   1 
ATOM   1372 N  N     . ASP C  3 6   ? -1.822  -14.572 -10.915 1.00 18.31 ? 6    ASP A N     1 
ATOM   1373 C  CA    . ASP C  3 6   ? -2.859  -13.662 -11.416 1.00 18.45 ? 6    ASP A CA    1 
ATOM   1374 C  C     . ASP C  3 6   ? -3.948  -13.538 -10.359 1.00 17.08 ? 6    ASP A C     1 
ATOM   1375 O  O     . ASP C  3 6   ? -4.682  -14.490 -10.113 1.00 15.33 ? 6    ASP A O     1 
ATOM   1376 C  CB    . ASP C  3 6   ? -3.449  -14.167 -12.739 1.00 20.44 ? 6    ASP A CB    1 
ATOM   1377 C  CG    . ASP C  3 6   ? -4.458  -13.191 -13.358 1.00 21.38 ? 6    ASP A CG    1 
ATOM   1378 O  OD1   . ASP C  3 6   ? -5.021  -13.504 -14.424 1.00 21.66 ? 6    ASP A OD1   1 
ATOM   1379 O  OD2   . ASP C  3 6   ? -4.699  -12.110 -12.791 1.00 23.25 ? 6    ASP A OD2   1 
ATOM   1380 N  N     . THR C  3 7   ? -4.037  -12.365 -9.732  1.00 16.92 ? 7    THR A N     1 
ATOM   1381 C  CA    . THR C  3 7   ? -4.971  -12.152 -8.617  1.00 15.55 ? 7    THR A CA    1 
ATOM   1382 C  C     . THR C  3 7   ? -6.406  -12.455 -9.022  1.00 16.13 ? 7    THR A C     1 
ATOM   1383 O  O     . THR C  3 7   ? -7.055  -13.333 -8.435  1.00 16.58 ? 7    THR A O     1 
ATOM   1384 C  CB    . THR C  3 7   ? -4.904  -10.711 -8.041  1.00 14.03 ? 7    THR A CB    1 
ATOM   1385 O  OG1   . THR C  3 7   ? -3.602  -10.454 -7.515  1.00 12.61 ? 7    THR A OG1   1 
ATOM   1386 C  CG2   . THR C  3 7   ? -5.888  -10.558 -6.921  1.00 13.63 ? 7    THR A CG2   1 
ATOM   1387 N  N     . THR C  3 8   ? -6.893  -11.725 -10.025 1.00 15.73 ? 8    THR A N     1 
ATOM   1388 C  CA    . THR C  3 8   ? -8.269  -11.865 -10.490 1.00 16.16 ? 8    THR A CA    1 
ATOM   1389 C  C     . THR C  3 8   ? -8.674  -13.331 -10.614 1.00 16.82 ? 8    THR A C     1 
ATOM   1390 O  O     . THR C  3 8   ? -9.619  -13.785 -9.963  1.00 17.78 ? 8    THR A O     1 
ATOM   1391 C  CB    . THR C  3 8   ? -8.464  -11.178 -11.850 1.00 16.46 ? 8    THR A CB    1 
ATOM   1392 O  OG1   . THR C  3 8   ? -8.197  -9.782  -11.715 1.00 16.93 ? 8    THR A OG1   1 
ATOM   1393 C  CG2   . THR C  3 8   ? -9.876  -11.356 -12.350 1.00 15.62 ? 8    THR A CG2   1 
ATOM   1394 N  N     . GLU C  3 9   ? -7.949  -14.074 -11.441 1.00 16.96 ? 9    GLU A N     1 
ATOM   1395 C  CA    . GLU C  3 9   ? -8.267  -15.485 -11.660 1.00 16.29 ? 9    GLU A CA    1 
ATOM   1396 C  C     . GLU C  3 9   ? -8.304  -16.291 -10.375 1.00 15.00 ? 9    GLU A C     1 
ATOM   1397 O  O     . GLU C  3 9   ? -9.084  -17.239 -10.253 1.00 15.64 ? 9    GLU A O     1 
ATOM   1398 C  CB    . GLU C  3 9   ? -7.305  -16.119 -12.661 1.00 16.19 ? 9    GLU A CB    1 
ATOM   1399 C  CG    . GLU C  3 9   ? -7.600  -15.701 -14.082 1.00 16.71 ? 9    GLU A CG    1 
ATOM   1400 C  CD    . GLU C  3 9   ? -6.580  -16.215 -15.065 1.00 16.65 ? 9    GLU A CD    1 
ATOM   1401 O  OE1   . GLU C  3 9   ? -5.645  -16.916 -14.634 1.00 17.61 ? 9    GLU A OE1   1 
ATOM   1402 O  OE2   . GLU C  3 9   ? -6.715  -15.912 -16.266 1.00 16.74 ? 9    GLU A OE2   1 
ATOM   1403 N  N     . MET C  3 10  ? -7.483  -15.922 -9.408  1.00 13.21 ? 10   MET A N     1 
ATOM   1404 C  CA    . MET C  3 10  ? -7.475  -16.693 -8.181  1.00 14.17 ? 10   MET A CA    1 
ATOM   1405 C  C     . MET C  3 10  ? -8.743  -16.413 -7.398  1.00 13.77 ? 10   MET A C     1 
ATOM   1406 O  O     . MET C  3 10  ? -9.383  -17.322 -6.872  1.00 13.07 ? 10   MET A O     1 
ATOM   1407 C  CB    . MET C  3 10  ? -6.198  -16.447 -7.376  1.00 15.06 ? 10   MET A CB    1 
ATOM   1408 C  CG    . MET C  3 10  ? -5.028  -17.279 -7.898  1.00 15.19 ? 10   MET A CG    1 
ATOM   1409 S  SD    . MET C  3 10  ? -5.305  -19.055 -7.651  1.00 18.09 ? 10   MET A SD    1 
ATOM   1410 C  CE    . MET C  3 10  ? -4.700  -19.250 -5.977  1.00 16.52 ? 10   MET A CE    1 
ATOM   1411 N  N     . TYR C  3 11  ? -9.130  -15.144 -7.366  1.00 14.53 ? 11   TYR A N     1 
ATOM   1412 C  CA    . TYR C  3 11  ? -10.407 -14.772 -6.777  1.00 13.42 ? 11   TYR A CA    1 
ATOM   1413 C  C     . TYR C  3 11  ? -11.549 -15.551 -7.418  1.00 13.69 ? 11   TYR A C     1 
ATOM   1414 O  O     . TYR C  3 11  ? -12.268 -16.273 -6.732  1.00 14.04 ? 11   TYR A O     1 
ATOM   1415 C  CB    . TYR C  3 11  ? -10.630 -13.275 -6.910  1.00 12.39 ? 11   TYR A CB    1 
ATOM   1416 C  CG    . TYR C  3 11  ? -9.960  -12.490 -5.820  1.00 12.17 ? 11   TYR A CG    1 
ATOM   1417 C  CD1   . TYR C  3 11  ? -8.648  -12.767 -5.445  1.00 11.84 ? 11   TYR A CD1   1 
ATOM   1418 C  CD2   . TYR C  3 11  ? -10.632 -11.472 -5.161  1.00 12.08 ? 11   TYR A CD2   1 
ATOM   1419 C  CE1   . TYR C  3 11  ? -8.028  -12.048 -4.453  1.00 11.87 ? 11   TYR A CE1   1 
ATOM   1420 C  CE2   . TYR C  3 11  ? -10.019 -10.742 -4.157  1.00 12.62 ? 11   TYR A CE2   1 
ATOM   1421 C  CZ    . TYR C  3 11  ? -8.716  -11.034 -3.805  1.00 12.44 ? 11   TYR A CZ    1 
ATOM   1422 O  OH    . TYR C  3 11  ? -8.100  -10.317 -2.807  1.00 11.47 ? 11   TYR A OH    1 
ATOM   1423 N  N     . LEU C  3 12  ? -11.690 -15.417 -8.737  1.00 13.94 ? 12   LEU A N     1 
ATOM   1424 C  CA    . LEU C  3 12  ? -12.731 -16.123 -9.488  1.00 13.22 ? 12   LEU A CA    1 
ATOM   1425 C  C     . LEU C  3 12  ? -12.757 -17.592 -9.109  1.00 12.95 ? 12   LEU A C     1 
ATOM   1426 O  O     . LEU C  3 12  ? -13.806 -18.135 -8.760  1.00 10.95 ? 12   LEU A O     1 
ATOM   1427 C  CB    . LEU C  3 12  ? -12.517 -15.982 -11.006 1.00 13.29 ? 12   LEU A CB    1 
ATOM   1428 C  CG    . LEU C  3 12  ? -12.710 -14.609 -11.666 1.00 14.36 ? 12   LEU A CG    1 
ATOM   1429 C  CD1   . LEU C  3 12  ? -12.331 -14.632 -13.137 1.00 13.84 ? 12   LEU A CD1   1 
ATOM   1430 C  CD2   . LEU C  3 12  ? -14.137 -14.079 -11.495 1.00 14.05 ? 12   LEU A CD2   1 
ATOM   1431 N  N     . ARG C  3 13  ? -11.590 -18.224 -9.175  1.00 13.76 ? 13   ARG A N     1 
ATOM   1432 C  CA    . ARG C  3 13  ? -11.491 -19.655 -8.937  1.00 15.74 ? 13   ARG A CA    1 
ATOM   1433 C  C     . ARG C  3 13  ? -11.861 -19.958 -7.495  1.00 16.05 ? 13   ARG A C     1 
ATOM   1434 O  O     . ARG C  3 13  ? -12.513 -20.965 -7.222  1.00 16.66 ? 13   ARG A O     1 
ATOM   1435 C  CB    . ARG C  3 13  ? -10.078 -20.174 -9.267  1.00 17.51 ? 13   ARG A CB    1 
ATOM   1436 C  CG    . ARG C  3 13  ? -9.997  -21.648 -9.732  1.00 18.23 ? 13   ARG A CG    1 
ATOM   1437 C  CD    . ARG C  3 13  ? -9.547  -22.589 -8.620  1.00 18.98 ? 13   ARG A CD    1 
ATOM   1438 N  NE    . ARG C  3 13  ? -8.121  -22.458 -8.347  1.00 20.13 ? 13   ARG A NE    1 
ATOM   1439 C  CZ    . ARG C  3 13  ? -7.566  -22.611 -7.147  1.00 20.93 ? 13   ARG A CZ    1 
ATOM   1440 N  NH1   . ARG C  3 13  ? -8.323  -22.901 -6.100  1.00 19.91 ? 13   ARG A NH1   1 
ATOM   1441 N  NH2   . ARG C  3 13  ? -6.250  -22.460 -6.992  1.00 21.68 ? 13   ARG A NH2   1 
ATOM   1442 N  N     . THR C  3 14  ? -11.471 -19.083 -6.569  1.00 15.27 ? 14   THR A N     1 
ATOM   1443 C  CA    . THR C  3 14  ? -11.744 -19.359 -5.166  1.00 14.85 ? 14   THR A CA    1 
ATOM   1444 C  C     . THR C  3 14  ? -13.244 -19.308 -4.898  1.00 15.70 ? 14   THR A C     1 
ATOM   1445 O  O     . THR C  3 14  ? -13.782 -20.138 -4.167  1.00 15.96 ? 14   THR A O     1 
ATOM   1446 C  CB    . THR C  3 14  ? -10.990 -18.412 -4.213  1.00 14.59 ? 14   THR A CB    1 
ATOM   1447 O  OG1   . THR C  3 14  ? -9.592  -18.692 -4.278  1.00 13.81 ? 14   THR A OG1   1 
ATOM   1448 C  CG2   . THR C  3 14  ? -11.446 -18.628 -2.772  1.00 14.55 ? 14   THR A CG2   1 
ATOM   1449 N  N     . ILE C  3 15  ? -13.924 -18.342 -5.501  1.00 16.50 ? 15   ILE A N     1 
ATOM   1450 C  CA    . ILE C  3 15  ? -15.367 -18.233 -5.330  1.00 17.94 ? 15   ILE A CA    1 
ATOM   1451 C  C     . ILE C  3 15  ? -16.027 -19.469 -5.918  1.00 19.32 ? 15   ILE A C     1 
ATOM   1452 O  O     . ILE C  3 15  ? -16.935 -20.050 -5.306  1.00 18.70 ? 15   ILE A O     1 
ATOM   1453 C  CB    . ILE C  3 15  ? -15.929 -16.949 -5.980  1.00 17.46 ? 15   ILE A CB    1 
ATOM   1454 C  CG1   . ILE C  3 15  ? -15.444 -15.721 -5.206  1.00 16.39 ? 15   ILE A CG1   1 
ATOM   1455 C  CG2   . ILE C  3 15  ? -17.447 -16.989 -6.026  1.00 17.07 ? 15   ILE A CG2   1 
ATOM   1456 C  CD1   . ILE C  3 15  ? -15.477 -14.451 -5.984  1.00 14.90 ? 15   ILE A CD1   1 
ATOM   1457 N  N     . TYR C  3 16  ? -15.536 -19.886 -7.088  1.00 21.65 ? 16   TYR A N     1 
ATOM   1458 C  CA    . TYR C  3 16  ? -16.034 -21.096 -7.749  1.00 22.75 ? 16   TYR A CA    1 
ATOM   1459 C  C     . TYR C  3 16  ? -15.826 -22.310 -6.865  1.00 22.13 ? 16   TYR A C     1 
ATOM   1460 O  O     . TYR C  3 16  ? -16.717 -23.149 -6.734  1.00 21.50 ? 16   TYR A O     1 
ATOM   1461 C  CB    . TYR C  3 16  ? -15.371 -21.306 -9.109  1.00 25.32 ? 16   TYR A CB    1 
ATOM   1462 C  CG    . TYR C  3 16  ? -16.158 -22.223 -10.014 1.00 26.32 ? 16   TYR A CG    1 
ATOM   1463 C  CD1   . TYR C  3 16  ? -15.706 -23.495 -10.308 1.00 26.72 ? 16   TYR A CD1   1 
ATOM   1464 C  CD2   . TYR C  3 16  ? -17.369 -21.820 -10.558 1.00 26.87 ? 16   TYR A CD2   1 
ATOM   1465 C  CE1   . TYR C  3 16  ? -16.426 -24.343 -11.133 1.00 27.03 ? 16   TYR A CE1   1 
ATOM   1466 C  CE2   . TYR C  3 16  ? -18.101 -22.659 -11.384 1.00 27.52 ? 16   TYR A CE2   1 
ATOM   1467 C  CZ    . TYR C  3 16  ? -17.623 -23.923 -11.674 1.00 27.53 ? 16   TYR A CZ    1 
ATOM   1468 O  OH    . TYR C  3 16  ? -18.350 -24.771 -12.502 1.00 27.38 ? 16   TYR A OH    1 
ATOM   1469 N  N     . ASP C  3 17  ? -14.656 -22.385 -6.241  1.00 21.97 ? 17   ASP A N     1 
ATOM   1470 C  CA    . ASP C  3 17  ? -14.384 -23.428 -5.256  1.00 23.27 ? 17   ASP A CA    1 
ATOM   1471 C  C     . ASP C  3 17  ? -15.441 -23.460 -4.157  1.00 22.95 ? 17   ASP A C     1 
ATOM   1472 O  O     . ASP C  3 17  ? -15.865 -24.536 -3.732  1.00 22.79 ? 17   ASP A O     1 
ATOM   1473 C  CB    . ASP C  3 17  ? -12.998 -23.238 -4.625  1.00 24.46 ? 17   ASP A CB    1 
ATOM   1474 C  CG    . ASP C  3 17  ? -11.913 -24.022 -5.338  1.00 24.87 ? 17   ASP A CG    1 
ATOM   1475 O  OD1   . ASP C  3 17  ? -12.178 -25.152 -5.792  1.00 25.38 ? 17   ASP A OD1   1 
ATOM   1476 O  OD2   . ASP C  3 17  ? -10.783 -23.513 -5.425  1.00 26.11 ? 17   ASP A OD2   1 
ATOM   1477 N  N     . LEU C  3 18  ? -15.856 -22.276 -3.706  1.00 22.46 ? 18   LEU A N     1 
ATOM   1478 C  CA    . LEU C  3 18  ? -16.802 -22.140 -2.598  1.00 22.60 ? 18   LEU A CA    1 
ATOM   1479 C  C     . LEU C  3 18  ? -18.226 -22.543 -2.978  1.00 23.93 ? 18   LEU A C     1 
ATOM   1480 O  O     . LEU C  3 18  ? -19.005 -22.970 -2.125  1.00 23.59 ? 18   LEU A O     1 
ATOM   1481 C  CB    . LEU C  3 18  ? -16.786 -20.711 -2.045  1.00 20.85 ? 18   LEU A CB    1 
ATOM   1482 C  CG    . LEU C  3 18  ? -15.495 -20.281 -1.345  1.00 20.50 ? 18   LEU A CG    1 
ATOM   1483 C  CD1   . LEU C  3 18  ? -15.577 -18.839 -0.911  1.00 19.33 ? 18   LEU A CD1   1 
ATOM   1484 C  CD2   . LEU C  3 18  ? -15.166 -21.181 -0.152  1.00 19.63 ? 18   LEU A CD2   1 
ATOM   1485 N  N     . GLU C  3 19  ? -18.568 -22.393 -4.255  1.00 25.67 ? 19   GLU A N     1 
ATOM   1486 C  CA    . GLU C  3 19  ? -19.826 -22.920 -4.755  1.00 26.74 ? 19   GLU A CA    1 
ATOM   1487 C  C     . GLU C  3 19  ? -19.775 -24.427 -4.687  1.00 26.97 ? 19   GLU A C     1 
ATOM   1488 O  O     . GLU C  3 19  ? -20.665 -25.057 -4.128  1.00 27.78 ? 19   GLU A O     1 
ATOM   1489 C  CB    . GLU C  3 19  ? -20.076 -22.494 -6.194  1.00 27.92 ? 19   GLU A CB    1 
ATOM   1490 C  CG    . GLU C  3 19  ? -20.386 -21.029 -6.363  1.00 30.15 ? 19   GLU A CG    1 
ATOM   1491 C  CD    . GLU C  3 19  ? -20.781 -20.698 -7.789  1.00 32.14 ? 19   GLU A CD    1 
ATOM   1492 O  OE1   . GLU C  3 19  ? -21.253 -21.606 -8.517  1.00 33.30 ? 19   GLU A OE1   1 
ATOM   1493 O  OE2   . GLU C  3 19  ? -20.617 -19.528 -8.186  1.00 33.11 ? 19   GLU A OE2   1 
ATOM   1494 N  N     . GLU C  3 20  ? -18.728 -25.012 -5.254  1.00 27.31 ? 20   GLU A N     1 
ATOM   1495 C  CA    . GLU C  3 20  ? -18.584 -26.458 -5.200  1.00 27.88 ? 20   GLU A CA    1 
ATOM   1496 C  C     . GLU C  3 20  ? -18.832 -26.993 -3.792  1.00 27.18 ? 20   GLU A C     1 
ATOM   1497 O  O     . GLU C  3 20  ? -19.675 -27.855 -3.602  1.00 27.81 ? 20   GLU A O     1 
ATOM   1498 C  CB    . GLU C  3 20  ? -17.219 -26.911 -5.719  1.00 28.90 ? 20   GLU A CB    1 
ATOM   1499 C  CG    . GLU C  3 20  ? -17.252 -27.526 -7.100  1.00 30.93 ? 20   GLU A CG    1 
ATOM   1500 C  CD    . GLU C  3 20  ? -15.985 -28.313 -7.404  1.00 33.14 ? 20   GLU A CD    1 
ATOM   1501 O  OE1   . GLU C  3 20  ? -14.901 -27.694 -7.484  1.00 34.38 ? 20   GLU A OE1   1 
ATOM   1502 O  OE2   . GLU C  3 20  ? -16.065 -29.552 -7.561  1.00 33.66 ? 20   GLU A OE2   1 
ATOM   1503 N  N     . GLU C  3 21  ? -18.120 -26.480 -2.798  1.00 26.30 ? 21   GLU A N     1 
ATOM   1504 C  CA    . GLU C  3 21  ? -18.255 -27.040 -1.463  1.00 25.81 ? 21   GLU A CA    1 
ATOM   1505 C  C     . GLU C  3 21  ? -19.530 -26.587 -0.766  1.00 25.51 ? 21   GLU A C     1 
ATOM   1506 O  O     . GLU C  3 21  ? -19.790 -26.980 0.368   1.00 24.51 ? 21   GLU A O     1 
ATOM   1507 C  CB    . GLU C  3 21  ? -17.065 -26.673 -0.597  1.00 26.62 ? 21   GLU A CB    1 
ATOM   1508 C  CG    . GLU C  3 21  ? -15.725 -26.773 -1.269  1.00 27.53 ? 21   GLU A CG    1 
ATOM   1509 C  CD    . GLU C  3 21  ? -14.703 -25.943 -0.524  1.00 28.86 ? 21   GLU A CD    1 
ATOM   1510 O  OE1   . GLU C  3 21  ? -14.800 -25.865 0.720   1.00 29.12 ? 21   GLU A OE1   1 
ATOM   1511 O  OE2   . GLU C  3 21  ? -13.826 -25.343 -1.173  1.00 29.75 ? 21   GLU A OE2   1 
ATOM   1512 N  N     . GLY C  3 22  ? -20.318 -25.757 -1.441  1.00 25.30 ? 22   GLY A N     1 
ATOM   1513 C  CA    . GLY C  3 22  ? -21.533 -25.203 -0.849  1.00 25.43 ? 22   GLY A CA    1 
ATOM   1514 C  C     . GLY C  3 22  ? -21.309 -24.359 0.396   1.00 25.82 ? 22   GLY A C     1 
ATOM   1515 O  O     . GLY C  3 22  ? -22.066 -24.450 1.355   1.00 25.22 ? 22   GLY A O     1 
ATOM   1516 N  N     . VAL C  3 23  ? -20.261 -23.543 0.396   1.00 26.84 ? 23   VAL A N     1 
ATOM   1517 C  CA    . VAL C  3 23  ? -20.031 -22.623 1.505   1.00 27.59 ? 23   VAL A CA    1 
ATOM   1518 C  C     . VAL C  3 23  ? -20.261 -21.188 1.055   1.00 28.35 ? 23   VAL A C     1 
ATOM   1519 O  O     . VAL C  3 23  ? -19.876 -20.800 -0.054  1.00 28.71 ? 23   VAL A O     1 
ATOM   1520 C  CB    . VAL C  3 23  ? -18.638 -22.807 2.172   1.00 27.89 ? 23   VAL A CB    1 
ATOM   1521 C  CG1   . VAL C  3 23  ? -17.797 -23.805 1.422   1.00 27.66 ? 23   VAL A CG1   1 
ATOM   1522 C  CG2   . VAL C  3 23  ? -17.919 -21.472 2.321   1.00 28.06 ? 23   VAL A CG2   1 
ATOM   1523 N  N     . THR C  3 24  ? -20.919 -20.415 1.913   1.00 28.09 ? 24   THR A N     1 
ATOM   1524 C  CA    . THR C  3 24  ? -21.366 -19.077 1.554   1.00 27.96 ? 24   THR A CA    1 
ATOM   1525 C  C     . THR C  3 24  ? -20.199 -18.214 1.115   1.00 27.28 ? 24   THR A C     1 
ATOM   1526 O  O     . THR C  3 24  ? -19.244 -18.034 1.866   1.00 27.81 ? 24   THR A O     1 
ATOM   1527 C  CB    . THR C  3 24  ? -22.075 -18.403 2.723   1.00 28.68 ? 24   THR A CB    1 
ATOM   1528 O  OG1   . THR C  3 24  ? -22.752 -19.399 3.497   1.00 29.19 ? 24   THR A OG1   1 
ATOM   1529 C  CG2   . THR C  3 24  ? -23.082 -17.384 2.215   1.00 29.22 ? 24   THR A CG2   1 
ATOM   1530 N  N     . PRO C  3 25  ? -20.275 -17.682 -0.114  1.00 26.55 ? 25   PRO A N     1 
ATOM   1531 C  CA    . PRO C  3 25  ? -19.203 -16.918 -0.732  1.00 25.56 ? 25   PRO A CA    1 
ATOM   1532 C  C     . PRO C  3 25  ? -19.106 -15.501 -0.185  1.00 24.41 ? 25   PRO A C     1 
ATOM   1533 O  O     . PRO C  3 25  ? -19.738 -14.589 -0.710  1.00 23.95 ? 25   PRO A O     1 
ATOM   1534 C  CB    . PRO C  3 25  ? -19.603 -16.884 -2.215  1.00 26.08 ? 25   PRO A CB    1 
ATOM   1535 C  CG    . PRO C  3 25  ? -20.795 -17.798 -2.349  1.00 26.25 ? 25   PRO A CG    1 
ATOM   1536 C  CD    . PRO C  3 25  ? -21.433 -17.798 -1.010  1.00 26.86 ? 25   PRO A CD    1 
ATOM   1537 N  N     . LEU C  3 26  ? -18.307 -15.329 0.862   1.00 22.69 ? 26   LEU A N     1 
ATOM   1538 C  CA    . LEU C  3 26  ? -18.075 -14.023 1.441   1.00 21.48 ? 26   LEU A CA    1 
ATOM   1539 C  C     . LEU C  3 26  ? -16.631 -13.593 1.212   1.00 21.44 ? 26   LEU A C     1 
ATOM   1540 O  O     . LEU C  3 26  ? -15.735 -14.425 1.073   1.00 21.46 ? 26   LEU A O     1 
ATOM   1541 C  CB    . LEU C  3 26  ? -18.374 -14.044 2.933   1.00 20.58 ? 26   LEU A CB    1 
ATOM   1542 C  CG    . LEU C  3 26  ? -19.760 -14.527 3.371   1.00 19.92 ? 26   LEU A CG    1 
ATOM   1543 C  CD1   . LEU C  3 26  ? -19.888 -14.396 4.889   1.00 18.67 ? 26   LEU A CD1   1 
ATOM   1544 C  CD2   . LEU C  3 26  ? -20.875 -13.764 2.651   1.00 18.75 ? 26   LEU A CD2   1 
ATOM   1545 N  N     . ARG C  3 27  ? -16.404 -12.287 1.171   1.00 20.07 ? 27   ARG A N     1 
ATOM   1546 C  CA    . ARG C  3 27  ? -15.051 -11.792 1.054   1.00 18.04 ? 27   ARG A CA    1 
ATOM   1547 C  C     . ARG C  3 27  ? -14.160 -12.395 2.145   1.00 17.05 ? 27   ARG A C     1 
ATOM   1548 O  O     . ARG C  3 27  ? -12.970 -12.607 1.922   1.00 16.16 ? 27   ARG A O     1 
ATOM   1549 C  CB    . ARG C  3 27  ? -15.031 -10.264 1.088   1.00 16.78 ? 27   ARG A CB    1 
ATOM   1550 C  CG    . ARG C  3 27  ? -15.375 -9.646  -0.249  1.00 17.65 ? 27   ARG A CG    1 
ATOM   1551 C  CD    . ARG C  3 27  ? -15.773 -8.178  -0.127  1.00 17.88 ? 27   ARG A CD    1 
ATOM   1552 N  NE    . ARG C  3 27  ? -17.075 -8.017  0.510   1.00 18.04 ? 27   ARG A NE    1 
ATOM   1553 C  CZ    . ARG C  3 27  ? -17.764 -6.882  0.523   1.00 18.05 ? 27   ARG A CZ    1 
ATOM   1554 N  NH1   . ARG C  3 27  ? -17.278 -5.802  -0.074  1.00 17.25 ? 27   ARG A NH1   1 
ATOM   1555 N  NH2   . ARG C  3 27  ? -18.940 -6.830  1.132   1.00 18.06 ? 27   ARG A NH2   1 
ATOM   1556 N  N     . ALA C  3 28  ? -14.744 -12.682 3.309   1.00 16.68 ? 28   ALA A N     1 
ATOM   1557 C  CA    . ALA C  3 28  ? -13.991 -13.227 4.447   1.00 16.79 ? 28   ALA A CA    1 
ATOM   1558 C  C     . ALA C  3 28  ? -13.338 -14.564 4.108   1.00 17.29 ? 28   ALA A C     1 
ATOM   1559 O  O     . ALA C  3 28  ? -12.196 -14.820 4.503   1.00 16.55 ? 28   ALA A O     1 
ATOM   1560 C  CB    . ALA C  3 28  ? -14.876 -13.361 5.681   1.00 15.04 ? 28   ALA A CB    1 
ATOM   1561 N  N     . ARG C  3 29  ? -14.063 -15.405 3.366   1.00 17.62 ? 29   ARG A N     1 
ATOM   1562 C  CA    . ARG C  3 29  ? -13.527 -16.689 2.909   1.00 17.53 ? 29   ARG A CA    1 
ATOM   1563 C  C     . ARG C  3 29  ? -12.243 -16.490 2.103   1.00 17.48 ? 29   ARG A C     1 
ATOM   1564 O  O     . ARG C  3 29  ? -11.229 -17.150 2.355   1.00 18.22 ? 29   ARG A O     1 
ATOM   1565 C  CB    . ARG C  3 29  ? -14.553 -17.466 2.075   1.00 17.75 ? 29   ARG A CB    1 
ATOM   1566 C  CG    . ARG C  3 29  ? -15.893 -17.808 2.769   1.00 17.85 ? 29   ARG A CG    1 
ATOM   1567 C  CD    . ARG C  3 29  ? -15.757 -18.839 3.887   1.00 16.44 ? 29   ARG A CD    1 
ATOM   1568 N  NE    . ARG C  3 29  ? -14.944 -18.316 4.974   1.00 17.39 ? 29   ARG A NE    1 
ATOM   1569 C  CZ    . ARG C  3 29  ? -15.382 -17.485 5.920   1.00 17.79 ? 29   ARG A CZ    1 
ATOM   1570 N  NH1   . ARG C  3 29  ? -14.542 -17.055 6.850   1.00 17.47 ? 29   ARG A NH1   1 
ATOM   1571 N  NH2   . ARG C  3 29  ? -16.651 -17.085 5.944   1.00 17.27 ? 29   ARG A NH2   1 
ATOM   1572 N  N     . ILE C  3 30  ? -12.288 -15.573 1.143   1.00 16.19 ? 30   ILE A N     1 
ATOM   1573 C  CA    . ILE C  3 30  ? -11.136 -15.305 0.294   1.00 15.66 ? 30   ILE A CA    1 
ATOM   1574 C  C     . ILE C  3 30  ? -9.941  -14.863 1.135   1.00 16.65 ? 30   ILE A C     1 
ATOM   1575 O  O     . ILE C  3 30  ? -8.841  -15.417 1.022   1.00 15.87 ? 30   ILE A O     1 
ATOM   1576 C  CB    . ILE C  3 30  ? -11.459 -14.253 -0.780  1.00 15.20 ? 30   ILE A CB    1 
ATOM   1577 C  CG1   . ILE C  3 30  ? -12.733 -14.645 -1.537  1.00 14.67 ? 30   ILE A CG1   1 
ATOM   1578 C  CG2   . ILE C  3 30  ? -10.291 -14.092 -1.733  1.00 14.17 ? 30   ILE A CG2   1 
ATOM   1579 C  CD1   . ILE C  3 30  ? -13.016 -13.801 -2.768  1.00 14.19 ? 30   ILE A CD1   1 
ATOM   1580 N  N     . ALA C  3 31  ? -10.165 -13.875 1.994   1.00 17.67 ? 31   ALA A N     1 
ATOM   1581 C  CA    . ALA C  3 31  ? -9.133  -13.433 2.923   1.00 18.70 ? 31   ALA A CA    1 
ATOM   1582 C  C     . ALA C  3 31  ? -8.412  -14.630 3.574   1.00 19.15 ? 31   ALA A C     1 
ATOM   1583 O  O     . ALA C  3 31  ? -7.181  -14.689 3.576   1.00 18.56 ? 31   ALA A O     1 
ATOM   1584 C  CB    . ALA C  3 31  ? -9.734  -12.507 3.982   1.00 18.32 ? 31   ALA A CB    1 
ATOM   1585 N  N     . GLU C  3 32  ? -9.192  -15.578 4.097   1.00 20.21 ? 32   GLU A N     1 
ATOM   1586 C  CA    . GLU C  3 32  ? -8.675  -16.770 4.774   1.00 21.15 ? 32   GLU A CA    1 
ATOM   1587 C  C     . GLU C  3 32  ? -7.869  -17.675 3.872   1.00 21.45 ? 32   GLU A C     1 
ATOM   1588 O  O     . GLU C  3 32  ? -6.789  -18.115 4.251   1.00 21.67 ? 32   GLU A O     1 
ATOM   1589 C  CB    . GLU C  3 32  ? -9.818  -17.616 5.316   1.00 23.14 ? 32   GLU A CB    1 
ATOM   1590 C  CG    . GLU C  3 32  ? -10.653 -16.951 6.374   1.00 26.62 ? 32   GLU A CG    1 
ATOM   1591 C  CD    . GLU C  3 32  ? -11.704 -17.885 6.944   1.00 28.11 ? 32   GLU A CD    1 
ATOM   1592 O  OE1   . GLU C  3 32  ? -12.247 -18.732 6.182   1.00 26.60 ? 32   GLU A OE1   1 
ATOM   1593 O  OE2   . GLU C  3 32  ? -11.973 -17.764 8.166   1.00 29.39 ? 32   GLU A OE2   1 
ATOM   1594 N  N     . ARG C  3 33  ? -8.413  -17.970 2.692   1.00 20.62 ? 33   ARG A N     1 
ATOM   1595 C  CA    . ARG C  3 33  ? -7.861  -18.999 1.820   1.00 20.17 ? 33   ARG A CA    1 
ATOM   1596 C  C     . ARG C  3 33  ? -6.643  -18.538 1.029   1.00 20.39 ? 33   ARG A C     1 
ATOM   1597 O  O     . ARG C  3 33  ? -5.788  -19.337 0.654   1.00 20.81 ? 33   ARG A O     1 
ATOM   1598 C  CB    . ARG C  3 33  ? -8.943  -19.545 0.884   1.00 19.98 ? 33   ARG A CB    1 
ATOM   1599 C  CG    . ARG C  3 33  ? -10.039 -20.282 1.633   1.00 21.13 ? 33   ARG A CG    1 
ATOM   1600 C  CD    . ARG C  3 33  ? -10.886 -21.156 0.731   1.00 22.08 ? 33   ARG A CD    1 
ATOM   1601 N  NE    . ARG C  3 33  ? -11.911 -21.869 1.496   1.00 22.53 ? 33   ARG A NE    1 
ATOM   1602 C  CZ    . ARG C  3 33  ? -12.651 -22.869 1.020   1.00 21.94 ? 33   ARG A CZ    1 
ATOM   1603 N  NH1   . ARG C  3 33  ? -12.488 -23.283 -0.226  1.00 22.20 ? 33   ARG A NH1   1 
ATOM   1604 N  NH2   . ARG C  3 33  ? -13.552 -23.460 1.793   1.00 21.45 ? 33   ARG A NH2   1 
ATOM   1605 N  N     . LEU C  3 34  ? -6.561  -17.240 0.788   1.00 20.66 ? 34   LEU A N     1 
ATOM   1606 C  CA    . LEU C  3 34  ? -5.468  -16.690 0.007   1.00 19.69 ? 34   LEU A CA    1 
ATOM   1607 C  C     . LEU C  3 34  ? -4.511  -15.947 0.924   1.00 19.97 ? 34   LEU A C     1 
ATOM   1608 O  O     . LEU C  3 34  ? -3.539  -15.336 0.465   1.00 19.49 ? 34   LEU A O     1 
ATOM   1609 C  CB    . LEU C  3 34  ? -6.021  -15.772 -1.079  1.00 18.76 ? 34   LEU A CB    1 
ATOM   1610 C  CG    . LEU C  3 34  ? -6.941  -16.511 -2.055  1.00 18.71 ? 34   LEU A CG    1 
ATOM   1611 C  CD1   . LEU C  3 34  ? -7.386  -15.596 -3.191  1.00 18.12 ? 34   LEU A CD1   1 
ATOM   1612 C  CD2   . LEU C  3 34  ? -6.252  -17.768 -2.598  1.00 17.40 ? 34   LEU A CD2   1 
ATOM   1613 N  N     . ASP C  3 35  ? -4.792  -16.025 2.226   1.00 19.80 ? 35   ASP A N     1 
ATOM   1614 C  CA    . ASP C  3 35  ? -4.013  -15.330 3.251   1.00 20.70 ? 35   ASP A CA    1 
ATOM   1615 C  C     . ASP C  3 35  ? -3.776  -13.855 2.899   1.00 18.55 ? 35   ASP A C     1 
ATOM   1616 O  O     . ASP C  3 35  ? -2.637  -13.408 2.759   1.00 17.36 ? 35   ASP A O     1 
ATOM   1617 C  CB    . ASP C  3 35  ? -2.682  -16.051 3.515   1.00 23.41 ? 35   ASP A CB    1 
ATOM   1618 C  CG    . ASP C  3 35  ? -1.950  -15.487 4.719   1.00 26.76 ? 35   ASP A CG    1 
ATOM   1619 O  OD1   . ASP C  3 35  ? -2.574  -15.396 5.805   1.00 28.55 ? 35   ASP A OD1   1 
ATOM   1620 O  OD2   . ASP C  3 35  ? -0.760  -15.116 4.582   1.00 27.72 ? 35   ASP A OD2   1 
ATOM   1621 N  N     . GLN C  3 36  ? -4.861  -13.108 2.735   1.00 16.46 ? 36   GLN A N     1 
ATOM   1622 C  CA    . GLN C  3 36  ? -4.754  -11.686 2.437   1.00 14.98 ? 36   GLN A CA    1 
ATOM   1623 C  C     . GLN C  3 36  ? -5.634  -10.909 3.391   1.00 12.96 ? 36   GLN A C     1 
ATOM   1624 O  O     . GLN C  3 36  ? -6.614  -11.425 3.889   1.00 13.91 ? 36   GLN A O     1 
ATOM   1625 C  CB    . GLN C  3 36  ? -5.161  -11.396 0.992   1.00 14.65 ? 36   GLN A CB    1 
ATOM   1626 C  CG    . GLN C  3 36  ? -4.199  -11.901 -0.050  1.00 13.49 ? 36   GLN A CG    1 
ATOM   1627 C  CD    . GLN C  3 36  ? -4.580  -11.445 -1.451  1.00 15.32 ? 36   GLN A CD    1 
ATOM   1628 O  OE1   . GLN C  3 36  ? -5.765  -11.379 -1.787  1.00 15.03 ? 36   GLN A OE1   1 
ATOM   1629 N  NE2   . GLN C  3 36  ? -3.575  -11.126 -2.278  1.00 14.86 ? 36   GLN A NE2   1 
ATOM   1630 N  N     . SER C  3 37  ? -5.270  -9.669  3.658   1.00 12.89 ? 37   SER A N     1 
ATOM   1631 C  CA    . SER C  3 37  ? -6.053  -8.807  4.540   1.00 11.43 ? 37   SER A CA    1 
ATOM   1632 C  C     . SER C  3 37  ? -7.444  -8.559  3.955   1.00 11.22 ? 37   SER A C     1 
ATOM   1633 O  O     . SER C  3 37  ? -7.621  -8.562  2.737   1.00 10.48 ? 37   SER A O     1 
ATOM   1634 C  CB    . SER C  3 37  ? -5.356  -7.462  4.649   1.00 10.72 ? 37   SER A CB    1 
ATOM   1635 O  OG    . SER C  3 37  ? -5.660  -6.682  3.496   1.00 9.97  ? 37   SER A OG    1 
ATOM   1636 N  N     . GLY C  3 38  ? -8.418  -8.299  4.821   1.00 11.44 ? 38   GLY A N     1 
ATOM   1637 C  CA    . GLY C  3 38  ? -9.786  -7.990  4.377   1.00 10.86 ? 38   GLY A CA    1 
ATOM   1638 C  C     . GLY C  3 38  ? -9.865  -6.800  3.434   1.00 10.18 ? 38   GLY A C     1 
ATOM   1639 O  O     . GLY C  3 38  ? -10.474 -6.889  2.367   1.00 11.18 ? 38   GLY A O     1 
ATOM   1640 N  N     . PRO C  3 39  ? -9.244  -5.676  3.815   1.00 9.13  ? 39   PRO A N     1 
ATOM   1641 C  CA    . PRO C  3 39  ? -9.201  -4.507  2.939   1.00 9.81  ? 39   PRO A CA    1 
ATOM   1642 C  C     . PRO C  3 39  ? -8.618  -4.797  1.548   1.00 11.29 ? 39   PRO A C     1 
ATOM   1643 O  O     . PRO C  3 39  ? -9.063  -4.213  0.556   1.00 12.65 ? 39   PRO A O     1 
ATOM   1644 C  CB    . PRO C  3 39  ? -8.300  -3.532  3.705   1.00 8.91  ? 39   PRO A CB    1 
ATOM   1645 C  CG    . PRO C  3 39  ? -8.444  -3.936  5.138   1.00 8.04  ? 39   PRO A CG    1 
ATOM   1646 C  CD    . PRO C  3 39  ? -8.574  -5.431  5.103   1.00 8.04  ? 39   PRO A CD    1 
ATOM   1647 N  N     . THR C  3 40  ? -7.621  -5.671  1.464   1.00 12.23 ? 40   THR A N     1 
ATOM   1648 C  CA    . THR C  3 40  ? -7.078  -6.024  0.153   1.00 13.02 ? 40   THR A CA    1 
ATOM   1649 C  C     . THR C  3 40  ? -8.137  -6.682  -0.731  1.00 13.48 ? 40   THR A C     1 
ATOM   1650 O  O     . THR C  3 40  ? -8.351  -6.258  -1.864  1.00 14.62 ? 40   THR A O     1 
ATOM   1651 C  CB    . THR C  3 40  ? -5.886  -6.967  0.255   1.00 12.53 ? 40   THR A CB    1 
ATOM   1652 O  OG1   . THR C  3 40  ? -4.796  -6.284  0.882   1.00 12.69 ? 40   THR A OG1   1 
ATOM   1653 C  CG2   . THR C  3 40  ? -5.468  -7.411  -1.124  1.00 12.68 ? 40   THR A CG2   1 
ATOM   1654 N  N     . VAL C  3 41  ? -8.810  -7.705  -0.210  1.00 13.26 ? 41   VAL A N     1 
ATOM   1655 C  CA    . VAL C  3 41  ? -9.760  -8.441  -1.029  1.00 13.89 ? 41   VAL A CA    1 
ATOM   1656 C  C     . VAL C  3 41  ? -10.940 -7.553  -1.350  1.00 13.76 ? 41   VAL A C     1 
ATOM   1657 O  O     . VAL C  3 41  ? -11.442 -7.556  -2.463  1.00 13.61 ? 41   VAL A O     1 
ATOM   1658 C  CB    . VAL C  3 41  ? -10.238 -9.750  -0.369  1.00 13.51 ? 41   VAL A CB    1 
ATOM   1659 C  CG1   . VAL C  3 41  ? -9.422  -10.037 0.867   1.00 13.84 ? 41   VAL A CG1   1 
ATOM   1660 C  CG2   . VAL C  3 41  ? -11.716 -9.686  -0.048  1.00 12.54 ? 41   VAL A CG2   1 
ATOM   1661 N  N     . SER C  3 42  ? -11.366 -6.769  -0.373  1.00 14.64 ? 42   SER A N     1 
ATOM   1662 C  CA    . SER C  3 42  ? -12.442 -5.823  -0.604  1.00 14.57 ? 42   SER A CA    1 
ATOM   1663 C  C     . SER C  3 42  ? -12.120 -4.918  -1.794  1.00 13.68 ? 42   SER A C     1 
ATOM   1664 O  O     . SER C  3 42  ? -12.902 -4.822  -2.741  1.00 14.86 ? 42   SER A O     1 
ATOM   1665 C  CB    . SER C  3 42  ? -12.686 -4.990  0.640   1.00 14.35 ? 42   SER A CB    1 
ATOM   1666 O  OG    . SER C  3 42  ? -13.886 -4.272  0.492   1.00 16.57 ? 42   SER A OG    1 
ATOM   1667 N  N     . GLN C  3 43  ? -10.963 -4.273  -1.761  1.00 12.06 ? 43   GLN A N     1 
ATOM   1668 C  CA    . GLN C  3 43  ? -10.568 -3.412  -2.866  1.00 12.72 ? 43   GLN A CA    1 
ATOM   1669 C  C     . GLN C  3 43  ? -10.495 -4.164  -4.200  1.00 13.57 ? 43   GLN A C     1 
ATOM   1670 O  O     . GLN C  3 43  ? -10.865 -3.623  -5.243  1.00 12.87 ? 43   GLN A O     1 
ATOM   1671 C  CB    . GLN C  3 43  ? -9.222  -2.771  -2.580  1.00 13.16 ? 43   GLN A CB    1 
ATOM   1672 C  CG    . GLN C  3 43  ? -8.868  -1.663  -3.543  1.00 15.20 ? 43   GLN A CG    1 
ATOM   1673 C  CD    . GLN C  3 43  ? -7.426  -1.204  -3.376  1.00 16.90 ? 43   GLN A CD    1 
ATOM   1674 O  OE1   . GLN C  3 43  ? -6.507  -2.020  -3.370  1.00 18.24 ? 43   GLN A OE1   1 
ATOM   1675 N  NE2   . GLN C  3 43  ? -7.226  0.100   -3.219  1.00 16.71 ? 43   GLN A NE2   1 
ATOM   1676 N  N     . THR C  3 44  ? -10.004 -5.403  -4.169  1.00 12.64 ? 44   THR A N     1 
ATOM   1677 C  CA    . THR C  3 44  ? -9.818  -6.157  -5.394  1.00 13.46 ? 44   THR A CA    1 
ATOM   1678 C  C     . THR C  3 44  ? -11.157 -6.627  -5.953  1.00 12.95 ? 44   THR A C     1 
ATOM   1679 O  O     . THR C  3 44  ? -11.332 -6.741  -7.163  1.00 12.03 ? 44   THR A O     1 
ATOM   1680 C  CB    . THR C  3 44  ? -8.859  -7.361  -5.178  1.00 15.02 ? 44   THR A CB    1 
ATOM   1681 O  OG1   . THR C  3 44  ? -7.503  -6.892  -5.085  1.00 17.07 ? 44   THR A OG1   1 
ATOM   1682 C  CG2   . THR C  3 44  ? -8.954  -8.353  -6.329  1.00 14.40 ? 44   THR A CG2   1 
ATOM   1683 N  N     . VAL C  3 45  ? -12.093 -6.901  -5.052  1.00 13.18 ? 45   VAL A N     1 
ATOM   1684 C  CA    . VAL C  3 45  ? -13.417 -7.364  -5.425  1.00 13.61 ? 45   VAL A CA    1 
ATOM   1685 C  C     . VAL C  3 45  ? -14.213 -6.238  -6.069  1.00 13.92 ? 45   VAL A C     1 
ATOM   1686 O  O     . VAL C  3 45  ? -14.953 -6.459  -7.022  1.00 13.67 ? 45   VAL A O     1 
ATOM   1687 C  CB    . VAL C  3 45  ? -14.168 -7.930  -4.214  1.00 13.43 ? 45   VAL A CB    1 
ATOM   1688 C  CG1   . VAL C  3 45  ? -15.667 -7.968  -4.472  1.00 11.48 ? 45   VAL A CG1   1 
ATOM   1689 C  CG2   . VAL C  3 45  ? -13.617 -9.313  -3.867  1.00 13.72 ? 45   VAL A CG2   1 
ATOM   1690 N  N     . SER C  3 46  ? -14.041 -5.028  -5.553  1.00 14.45 ? 46   SER A N     1 
ATOM   1691 C  CA    . SER C  3 46  ? -14.597 -3.855  -6.201  1.00 16.19 ? 46   SER A CA    1 
ATOM   1692 C  C     . SER C  3 46  ? -14.115 -3.774  -7.626  1.00 16.83 ? 46   SER A C     1 
ATOM   1693 O  O     . SER C  3 46  ? -14.901 -3.531  -8.546  1.00 18.57 ? 46   SER A O     1 
ATOM   1694 C  CB    . SER C  3 46  ? -14.178 -2.591  -5.472  1.00 15.54 ? 46   SER A CB    1 
ATOM   1695 O  OG    . SER C  3 46  ? -14.899 -2.499  -4.266  1.00 17.35 ? 46   SER A OG    1 
ATOM   1696 N  N     . ARG C  3 47  ? -12.815 -3.973  -7.807  1.00 17.40 ? 47   ARG A N     1 
ATOM   1697 C  CA    . ARG C  3 47  ? -12.239 -3.939  -9.130  1.00 17.74 ? 47   ARG A CA    1 
ATOM   1698 C  C     . ARG C  3 47  ? -12.936 -4.914  -10.070 1.00 17.50 ? 47   ARG A C     1 
ATOM   1699 O  O     . ARG C  3 47  ? -13.316 -4.549  -11.174 1.00 17.82 ? 47   ARG A O     1 
ATOM   1700 C  CB    . ARG C  3 47  ? -10.757 -4.233  -9.071  1.00 18.40 ? 47   ARG A CB    1 
ATOM   1701 C  CG    . ARG C  3 47  ? -9.892  -3.000  -9.051  1.00 19.51 ? 47   ARG A CG    1 
ATOM   1702 C  CD    . ARG C  3 47  ? -8.582  -3.253  -9.806  1.00 20.76 ? 47   ARG A CD    1 
ATOM   1703 N  NE    . ARG C  3 47  ? -7.910  -4.473  -9.358  1.00 21.18 ? 47   ARG A NE    1 
ATOM   1704 C  CZ    . ARG C  3 47  ? -7.339  -4.616  -8.164  1.00 22.28 ? 47   ARG A CZ    1 
ATOM   1705 N  NH1   . ARG C  3 47  ? -7.358  -3.617  -7.278  1.00 21.36 ? 47   ARG A NH1   1 
ATOM   1706 N  NH2   . ARG C  3 47  ? -6.754  -5.765  -7.850  1.00 23.58 ? 47   ARG A NH2   1 
ATOM   1707 N  N     . MET C  3 48  ? -13.118 -6.147  -9.622  1.00 17.08 ? 48   MET A N     1 
ATOM   1708 C  CA    . MET C  3 48  ? -13.763 -7.157  -10.447 1.00 17.99 ? 48   MET A CA    1 
ATOM   1709 C  C     . MET C  3 48  ? -15.261 -6.882  -10.644 1.00 17.97 ? 48   MET A C     1 
ATOM   1710 O  O     . MET C  3 48  ? -15.850 -7.321  -11.635 1.00 16.21 ? 48   MET A O     1 
ATOM   1711 C  CB    . MET C  3 48  ? -13.536 -8.561  -9.862  1.00 17.57 ? 48   MET A CB    1 
ATOM   1712 C  CG    . MET C  3 48  ? -12.074 -8.950  -9.720  1.00 17.86 ? 48   MET A CG    1 
ATOM   1713 S  SD    . MET C  3 48  ? -11.840 -10.301 -8.542  1.00 19.83 ? 48   MET A SD    1 
ATOM   1714 C  CE    . MET C  3 48  ? -12.709 -11.651 -9.329  1.00 18.74 ? 48   MET A CE    1 
ATOM   1715 N  N     . GLU C  3 49  ? -15.882 -6.176  -9.697  1.00 18.37 ? 49   GLU A N     1 
ATOM   1716 C  CA    . GLU C  3 49  ? -17.277 -5.780  -9.868  1.00 19.77 ? 49   GLU A CA    1 
ATOM   1717 C  C     . GLU C  3 49  ? -17.294 -4.773  -11.009 1.00 19.28 ? 49   GLU A C     1 
ATOM   1718 O  O     . GLU C  3 49  ? -18.054 -4.902  -11.979 1.00 18.04 ? 49   GLU A O     1 
ATOM   1719 C  CB    . GLU C  3 49  ? -17.863 -5.180  -8.578  1.00 20.00 ? 49   GLU A CB    1 
ATOM   1720 C  CG    . GLU C  3 49  ? -19.381 -4.888  -8.651  1.00 22.12 ? 49   GLU A CG    1 
ATOM   1721 C  CD    . GLU C  3 49  ? -20.082 -4.795  -7.273  1.00 22.58 ? 49   GLU A CD    1 
ATOM   1722 O  OE1   . GLU C  3 49  ? -21.062 -5.537  -7.053  1.00 23.20 ? 49   GLU A OE1   1 
ATOM   1723 O  OE2   . GLU C  3 49  ? -19.668 -3.983  -6.411  1.00 23.13 ? 49   GLU A OE2   1 
ATOM   1724 N  N     . ARG C  3 50  ? -16.390 -3.806  -10.892 1.00 19.18 ? 50   ARG A N     1 
ATOM   1725 C  CA    . ARG C  3 50  ? -16.249 -2.732  -11.848 1.00 19.71 ? 50   ARG A CA    1 
ATOM   1726 C  C     . ARG C  3 50  ? -15.966 -3.251  -13.249 1.00 19.77 ? 50   ARG A C     1 
ATOM   1727 O  O     . ARG C  3 50  ? -16.209 -2.560  -14.226 1.00 20.06 ? 50   ARG A O     1 
ATOM   1728 C  CB    . ARG C  3 50  ? -15.128 -1.790  -11.416 1.00 18.88 ? 50   ARG A CB    1 
ATOM   1729 C  CG    . ARG C  3 50  ? -14.873 -0.663  -12.402 1.00 18.95 ? 50   ARG A CG    1 
ATOM   1730 C  CD    . ARG C  3 50  ? -13.476 -0.070  -12.238 1.00 20.44 ? 50   ARG A CD    1 
ATOM   1731 N  NE    . ARG C  3 50  ? -12.452 -0.879  -12.896 1.00 20.87 ? 50   ARG A NE    1 
ATOM   1732 C  CZ    . ARG C  3 50  ? -11.152 -0.794  -12.639 1.00 21.16 ? 50   ARG A CZ    1 
ATOM   1733 N  NH1   . ARG C  3 50  ? -10.708 0.052   -11.725 1.00 21.72 ? 50   ARG A NH1   1 
ATOM   1734 N  NH2   . ARG C  3 50  ? -10.295 -1.571  -13.282 1.00 21.70 ? 50   ARG A NH2   1 
ATOM   1735 N  N     . ASP C  3 51  ? -15.441 -4.462  -13.344 1.00 20.41 ? 51   ASP A N     1 
ATOM   1736 C  CA    . ASP C  3 51  ? -15.090 -5.028  -14.634 1.00 21.87 ? 51   ASP A CA    1 
ATOM   1737 C  C     . ASP C  3 51  ? -16.030 -6.157  -15.056 1.00 21.71 ? 51   ASP A C     1 
ATOM   1738 O  O     . ASP C  3 51  ? -15.683 -6.958  -15.922 1.00 21.97 ? 51   ASP A O     1 
ATOM   1739 C  CB    . ASP C  3 51  ? -13.633 -5.493  -14.627 1.00 23.69 ? 51   ASP A CB    1 
ATOM   1740 C  CG    . ASP C  3 51  ? -12.669 -4.350  -14.397 1.00 25.90 ? 51   ASP A CG    1 
ATOM   1741 O  OD1   . ASP C  3 51  ? -13.142 -3.193  -14.321 1.00 27.32 ? 51   ASP A OD1   1 
ATOM   1742 O  OD2   . ASP C  3 51  ? -11.448 -4.595  -14.282 1.00 26.37 ? 51   ASP A OD2   1 
ATOM   1743 N  N     . GLY C  3 52  ? -17.211 -6.212  -14.437 1.00 20.43 ? 52   GLY A N     1 
ATOM   1744 C  CA    . GLY C  3 52  ? -18.258 -7.155  -14.819 1.00 19.18 ? 52   GLY A CA    1 
ATOM   1745 C  C     . GLY C  3 52  ? -17.941 -8.625  -14.579 1.00 19.35 ? 52   GLY A C     1 
ATOM   1746 O  O     . GLY C  3 52  ? -18.522 -9.511  -15.224 1.00 19.22 ? 52   GLY A O     1 
ATOM   1747 N  N     . LEU C  3 53  ? -17.024 -8.893  -13.652 1.00 17.92 ? 53   LEU A N     1 
ATOM   1748 C  CA    . LEU C  3 53  ? -16.667 -10.266 -13.316 1.00 16.18 ? 53   LEU A CA    1 
ATOM   1749 C  C     . LEU C  3 53  ? -17.543 -10.830 -12.206 1.00 16.28 ? 53   LEU A C     1 
ATOM   1750 O  O     . LEU C  3 53  ? -17.713 -12.039 -12.109 1.00 16.56 ? 53   LEU A O     1 
ATOM   1751 C  CB    . LEU C  3 53  ? -15.180 -10.373 -12.951 1.00 15.52 ? 53   LEU A CB    1 
ATOM   1752 C  CG    . LEU C  3 53  ? -14.199 -9.727  -13.943 1.00 14.86 ? 53   LEU A CG    1 
ATOM   1753 C  CD1   . LEU C  3 53  ? -12.786 -10.016 -13.557 1.00 13.30 ? 53   LEU A CD1   1 
ATOM   1754 C  CD2   . LEU C  3 53  ? -14.440 -10.197 -15.362 1.00 14.95 ? 53   LEU A CD2   1 
ATOM   1755 N  N     . LEU C  3 54  ? -18.102 -9.956  -11.374 1.00 17.64 ? 54   LEU A N     1 
ATOM   1756 C  CA    . LEU C  3 54  ? -18.992 -10.385 -10.291 1.00 18.44 ? 54   LEU A CA    1 
ATOM   1757 C  C     . LEU C  3 54  ? -19.749 -9.221  -9.661  1.00 18.94 ? 54   LEU A C     1 
ATOM   1758 O  O     . LEU C  3 54  ? -19.451 -8.068  -9.926  1.00 18.69 ? 54   LEU A O     1 
ATOM   1759 C  CB    . LEU C  3 54  ? -18.208 -11.131 -9.209  1.00 18.18 ? 54   LEU A CB    1 
ATOM   1760 C  CG    . LEU C  3 54  ? -16.997 -10.446 -8.557  1.00 18.73 ? 54   LEU A CG    1 
ATOM   1761 C  CD1   . LEU C  3 54  ? -17.387 -9.323  -7.597  1.00 17.40 ? 54   LEU A CD1   1 
ATOM   1762 C  CD2   . LEU C  3 54  ? -16.170 -11.486 -7.815  1.00 18.69 ? 54   LEU A CD2   1 
ATOM   1763 N  N     . ARG C  3 55  ? -20.729 -9.534  -8.824  1.00 20.90 ? 55   ARG A N     1 
ATOM   1764 C  CA    . ARG C  3 55  ? -21.430 -8.515  -8.053  1.00 22.63 ? 55   ARG A CA    1 
ATOM   1765 C  C     . ARG C  3 55  ? -21.467 -8.876  -6.577  1.00 21.43 ? 55   ARG A C     1 
ATOM   1766 O  O     . ARG C  3 55  ? -21.420 -10.052 -6.204  1.00 21.00 ? 55   ARG A O     1 
ATOM   1767 C  CB    . ARG C  3 55  ? -22.850 -8.283  -8.581  1.00 23.43 ? 55   ARG A CB    1 
ATOM   1768 C  CG    . ARG C  3 55  ? -23.555 -9.549  -9.007  1.00 26.34 ? 55   ARG A CG    1 
ATOM   1769 C  CD    . ARG C  3 55  ? -25.065 -9.356  -9.220  1.00 26.27 ? 55   ARG A CD    1 
ATOM   1770 N  NE    . ARG C  3 55  ? -25.836 -9.571  -7.993  1.00 27.93 ? 55   ARG A NE    1 
ATOM   1771 C  CZ    . ARG C  3 55  ? -26.328 -8.590  -7.235  1.00 27.63 ? 55   ARG A CZ    1 
ATOM   1772 N  NH1   . ARG C  3 55  ? -27.021 -8.878  -6.138  1.00 26.45 ? 55   ARG A NH1   1 
ATOM   1773 N  NH2   . ARG C  3 55  ? -26.130 -7.320  -7.578  1.00 27.52 ? 55   ARG A NH2   1 
ATOM   1774 N  N     . VAL C  3 56  ? -21.529 -7.843  -5.745  1.00 20.88 ? 56   VAL A N     1 
ATOM   1775 C  CA    . VAL C  3 56  ? -21.615 -8.000  -4.309  1.00 20.74 ? 56   VAL A CA    1 
ATOM   1776 C  C     . VAL C  3 56  ? -23.070 -7.799  -3.937  1.00 21.76 ? 56   VAL A C     1 
ATOM   1777 O  O     . VAL C  3 56  ? -23.578 -6.682  -3.979  1.00 21.15 ? 56   VAL A O     1 
ATOM   1778 C  CB    . VAL C  3 56  ? -20.753 -6.941  -3.583  1.00 20.67 ? 56   VAL A CB    1 
ATOM   1779 C  CG1   . VAL C  3 56  ? -20.781 -7.144  -2.076  1.00 19.65 ? 56   VAL A CG1   1 
ATOM   1780 C  CG2   . VAL C  3 56  ? -19.323 -6.969  -4.098  1.00 20.37 ? 56   VAL A CG2   1 
ATOM   1781 N  N     . ALA C  3 57  ? -23.745 -8.887  -3.584  1.00 22.60 ? 57   ALA A N     1 
ATOM   1782 C  CA    . ALA C  3 57  ? -25.159 -8.826  -3.227  1.00 23.67 ? 57   ALA A CA    1 
ATOM   1783 C  C     . ALA C  3 57  ? -25.444 -7.864  -2.059  1.00 24.58 ? 57   ALA A C     1 
ATOM   1784 O  O     . ALA C  3 57  ? -24.520 -7.408  -1.369  1.00 24.96 ? 57   ALA A O     1 
ATOM   1785 C  CB    . ALA C  3 57  ? -25.684 -10.232 -2.923  1.00 23.21 ? 57   ALA A CB    1 
ATOM   1786 N  N     . GLY C  3 58  ? -26.723 -7.551  -1.852  1.00 24.69 ? 58   GLY A N     1 
ATOM   1787 C  CA    . GLY C  3 58  ? -27.138 -6.708  -0.733  1.00 25.01 ? 58   GLY A CA    1 
ATOM   1788 C  C     . GLY C  3 58  ? -26.783 -7.311  0.618   1.00 25.50 ? 58   GLY A C     1 
ATOM   1789 O  O     . GLY C  3 58  ? -26.490 -6.585  1.571   1.00 25.11 ? 58   GLY A O     1 
ATOM   1790 N  N     . ASP C  3 59  ? -26.808 -8.642  0.699   1.00 25.46 ? 59   ASP A N     1 
ATOM   1791 C  CA    . ASP C  3 59  ? -26.378 -9.361  1.906   1.00 25.25 ? 59   ASP A CA    1 
ATOM   1792 C  C     . ASP C  3 59  ? -24.903 -9.790  1.837   1.00 25.41 ? 59   ASP A C     1 
ATOM   1793 O  O     . ASP C  3 59  ? -24.474 -10.691 2.562   1.00 24.86 ? 59   ASP A O     1 
ATOM   1794 C  CB    . ASP C  3 59  ? -27.281 -10.576 2.181   1.00 24.19 ? 59   ASP A CB    1 
ATOM   1795 C  CG    . ASP C  3 59  ? -27.220 -11.636 1.077   1.00 24.72 ? 59   ASP A CG    1 
ATOM   1796 O  OD1   . ASP C  3 59  ? -26.564 -11.417 0.037   1.00 24.22 ? 59   ASP A OD1   1 
ATOM   1797 O  OD2   . ASP C  3 59  ? -27.842 -12.708 1.250   1.00 25.42 ? 59   ASP A OD2   1 
ATOM   1798 N  N     . ARG C  3 60  ? -24.149 -9.155  0.939   1.00 25.69 ? 60   ARG A N     1 
ATOM   1799 C  CA    . ARG C  3 60  ? -22.681 -9.311  0.848   1.00 25.46 ? 60   ARG A CA    1 
ATOM   1800 C  C     . ARG C  3 60  ? -22.211 -10.612 0.184   1.00 25.17 ? 60   ARG A C     1 
ATOM   1801 O  O     . ARG C  3 60  ? -21.010 -10.845 0.016   1.00 24.80 ? 60   ARG A O     1 
ATOM   1802 C  CB    . ARG C  3 60  ? -22.026 -9.086  2.217   1.00 24.69 ? 60   ARG A CB    1 
ATOM   1803 C  CG    . ARG C  3 60  ? -22.610 -7.865  2.912   1.00 25.75 ? 60   ARG A CG    1 
ATOM   1804 C  CD    . ARG C  3 60  ? -21.628 -7.102  3.778   1.00 25.49 ? 60   ARG A CD    1 
ATOM   1805 N  NE    . ARG C  3 60  ? -21.571 -7.633  5.132   1.00 25.72 ? 60   ARG A NE    1 
ATOM   1806 C  CZ    . ARG C  3 60  ? -21.326 -6.895  6.205   1.00 26.25 ? 60   ARG A CZ    1 
ATOM   1807 N  NH1   . ARG C  3 60  ? -21.272 -7.459  7.399   1.00 26.52 ? 60   ARG A NH1   1 
ATOM   1808 N  NH2   . ARG C  3 60  ? -21.134 -5.589  6.082   1.00 27.70 ? 60   ARG A NH2   1 
ATOM   1809 N  N     . HIS C  3 61  ? -23.166 -11.450 -0.205  1.00 24.88 ? 61   HIS A N     1 
ATOM   1810 C  CA    . HIS C  3 61  ? -22.869 -12.634 -1.001  1.00 24.06 ? 61   HIS A CA    1 
ATOM   1811 C  C     . HIS C  3 61  ? -22.149 -12.236 -2.289  1.00 23.30 ? 61   HIS A C     1 
ATOM   1812 O  O     . HIS C  3 61  ? -22.552 -11.301 -2.976  1.00 24.25 ? 61   HIS A O     1 
ATOM   1813 C  CB    . HIS C  3 61  ? -24.161 -13.396 -1.312  1.00 24.41 ? 61   HIS A CB    1 
ATOM   1814 C  CG    . HIS C  3 61  ? -24.780 -14.046 -0.111  1.00 24.44 ? 61   HIS A CG    1 
ATOM   1815 N  ND1   . HIS C  3 61  ? -25.846 -14.916 -0.200  1.00 25.91 ? 61   HIS A ND1   1 
ATOM   1816 C  CD2   . HIS C  3 61  ? -24.468 -13.965 1.203   1.00 23.35 ? 61   HIS A CD2   1 
ATOM   1817 C  CE1   . HIS C  3 61  ? -26.169 -15.332 1.011   1.00 24.77 ? 61   HIS A CE1   1 
ATOM   1818 N  NE2   . HIS C  3 61  ? -25.347 -14.772 1.879   1.00 22.98 ? 61   HIS A NE2   1 
ATOM   1819 N  N     . LEU C  3 62  ? -21.060 -12.928 -2.595  1.00 22.38 ? 62   LEU A N     1 
ATOM   1820 C  CA    . LEU C  3 62  ? -20.345 -12.716 -3.851  1.00 21.57 ? 62   LEU A CA    1 
ATOM   1821 C  C     . LEU C  3 62  ? -20.957 -13.598 -4.924  1.00 20.43 ? 62   LEU A C     1 
ATOM   1822 O  O     . LEU C  3 62  ? -21.033 -14.813 -4.760  1.00 20.41 ? 62   LEU A O     1 
ATOM   1823 C  CB    . LEU C  3 62  ? -18.864 -13.053 -3.693  1.00 20.34 ? 62   LEU A CB    1 
ATOM   1824 C  CG    . LEU C  3 62  ? -18.148 -12.172 -2.687  1.00 19.44 ? 62   LEU A CG    1 
ATOM   1825 C  CD1   . LEU C  3 62  ? -16.674 -12.422 -2.767  1.00 19.60 ? 62   LEU A CD1   1 
ATOM   1826 C  CD2   . LEU C  3 62  ? -18.465 -10.715 -2.976  1.00 18.92 ? 62   LEU A CD2   1 
ATOM   1827 N  N     . GLU C  3 63  ? -21.407 -12.983 -6.011  1.00 19.11 ? 63   GLU A N     1 
ATOM   1828 C  CA    . GLU C  3 63  ? -22.070 -13.727 -7.064  1.00 17.58 ? 63   GLU A CA    1 
ATOM   1829 C  C     . GLU C  3 63  ? -21.385 -13.485 -8.384  1.00 15.55 ? 63   GLU A C     1 
ATOM   1830 O  O     . GLU C  3 63  ? -21.234 -12.353 -8.821  1.00 14.99 ? 63   GLU A O     1 
ATOM   1831 C  CB    . GLU C  3 63  ? -23.560 -13.362 -7.141  1.00 18.14 ? 63   GLU A CB    1 
ATOM   1832 C  CG    . GLU C  3 63  ? -24.374 -13.881 -5.958  1.00 18.87 ? 63   GLU A CG    1 
ATOM   1833 C  CD    . GLU C  3 63  ? -25.823 -13.395 -5.949  1.00 19.55 ? 63   GLU A CD    1 
ATOM   1834 O  OE1   . GLU C  3 63  ? -26.594 -13.855 -5.076  1.00 20.39 ? 63   GLU A OE1   1 
ATOM   1835 O  OE2   . GLU C  3 63  ? -26.200 -12.566 -6.812  1.00 21.40 ? 63   GLU A OE2   1 
ATOM   1836 N  N     . LEU C  3 64  ? -20.953 -14.566 -9.009  1.00 14.94 ? 64   LEU A N     1 
ATOM   1837 C  CA    . LEU C  3 64  ? -20.325 -14.491 -10.312 1.00 14.30 ? 64   LEU A CA    1 
ATOM   1838 C  C     . LEU C  3 64  ? -21.313 -14.050 -11.368 1.00 14.83 ? 64   LEU A C     1 
ATOM   1839 O  O     . LEU C  3 64  ? -22.426 -14.558 -11.421 1.00 13.90 ? 64   LEU A O     1 
ATOM   1840 C  CB    . LEU C  3 64  ? -19.767 -15.860 -10.686 1.00 13.92 ? 64   LEU A CB    1 
ATOM   1841 C  CG    . LEU C  3 64  ? -18.479 -16.229 -9.967  1.00 14.06 ? 64   LEU A CG    1 
ATOM   1842 C  CD1   . LEU C  3 64  ? -18.187 -17.700 -10.143 1.00 14.46 ? 64   LEU A CD1   1 
ATOM   1843 C  CD2   . LEU C  3 64  ? -17.351 -15.384 -10.517 1.00 13.90 ? 64   LEU A CD2   1 
ATOM   1844 N  N     . THR C  3 65  ? -20.910 -13.092 -12.204 1.00 16.90 ? 65   THR A N     1 
ATOM   1845 C  CA    . THR C  3 65  ? -21.670 -12.769 -13.412 1.00 17.23 ? 65   THR A CA    1 
ATOM   1846 C  C     . THR C  3 65  ? -21.379 -13.833 -14.443 1.00 18.79 ? 65   THR A C     1 
ATOM   1847 O  O     . THR C  3 65  ? -20.389 -14.548 -14.336 1.00 19.96 ? 65   THR A O     1 
ATOM   1848 C  CB    . THR C  3 65  ? -21.250 -11.428 -14.050 1.00 16.11 ? 65   THR A CB    1 
ATOM   1849 O  OG1   . THR C  3 65  ? -19.915 -11.537 -14.569 1.00 15.23 ? 65   THR A OG1   1 
ATOM   1850 C  CG2   . THR C  3 65  ? -21.357 -10.279 -13.066 1.00 14.66 ? 65   THR A CG2   1 
ATOM   1851 N  N     . GLU C  3 66  ? -22.225 -13.931 -15.457 1.00 21.02 ? 66   GLU A N     1 
ATOM   1852 C  CA    . GLU C  3 66  ? -21.964 -14.866 -16.537 1.00 22.74 ? 66   GLU A CA    1 
ATOM   1853 C  C     . GLU C  3 66  ? -20.522 -14.731 -17.003 1.00 22.93 ? 66   GLU A C     1 
ATOM   1854 O  O     . GLU C  3 66  ? -19.831 -15.728 -17.213 1.00 23.27 ? 66   GLU A O     1 
ATOM   1855 C  CB    . GLU C  3 66  ? -22.945 -14.668 -17.693 1.00 23.03 ? 66   GLU A CB    1 
ATOM   1856 C  CG    . GLU C  3 66  ? -24.305 -15.301 -17.438 1.00 25.63 ? 66   GLU A CG    1 
ATOM   1857 C  CD    . GLU C  3 66  ? -24.203 -16.794 -17.131 1.00 27.98 ? 66   GLU A CD    1 
ATOM   1858 O  OE1   . GLU C  3 66  ? -24.001 -17.158 -15.947 1.00 27.94 ? 66   GLU A OE1   1 
ATOM   1859 O  OE2   . GLU C  3 66  ? -24.326 -17.607 -18.081 1.00 29.40 ? 66   GLU A OE2   1 
ATOM   1860 N  N     . LYS C  3 67  ? -20.055 -13.496 -17.125 1.00 23.38 ? 67   LYS A N     1 
ATOM   1861 C  CA    . LYS C  3 67  ? -18.706 -13.261 -17.617 1.00 23.31 ? 67   LYS A CA    1 
ATOM   1862 C  C     . LYS C  3 67  ? -17.658 -13.812 -16.651 1.00 23.01 ? 67   LYS A C     1 
ATOM   1863 O  O     . LYS C  3 67  ? -16.761 -14.545 -17.049 1.00 23.74 ? 67   LYS A O     1 
ATOM   1864 C  CB    . LYS C  3 67  ? -18.493 -11.781 -17.883 1.00 23.62 ? 67   LYS A CB    1 
ATOM   1865 C  CG    . LYS C  3 67  ? -17.221 -11.477 -18.636 1.00 25.52 ? 67   LYS A CG    1 
ATOM   1866 C  CD    . LYS C  3 67  ? -17.271 -10.086 -19.264 1.00 26.72 ? 67   LYS A CD    1 
ATOM   1867 C  CE    . LYS C  3 67  ? -15.931 -9.373  -19.137 1.00 27.32 ? 67   LYS A CE    1 
ATOM   1868 N  NZ    . LYS C  3 67  ? -15.821 -8.720  -17.804 1.00 27.55 ? 67   LYS A NZ    1 
ATOM   1869 N  N     . GLY C  3 68  ? -17.783 -13.472 -15.376 1.00 22.28 ? 68   GLY A N     1 
ATOM   1870 C  CA    . GLY C  3 68  ? -16.866 -13.981 -14.381 1.00 21.35 ? 68   GLY A CA    1 
ATOM   1871 C  C     . GLY C  3 68  ? -16.899 -15.491 -14.290 1.00 21.50 ? 68   GLY A C     1 
ATOM   1872 O  O     . GLY C  3 68  ? -15.877 -16.131 -14.038 1.00 21.96 ? 68   GLY A O     1 
ATOM   1873 N  N     . ARG C  3 69  ? -18.076 -16.069 -14.492 1.00 21.17 ? 69   ARG A N     1 
ATOM   1874 C  CA    . ARG C  3 69  ? -18.238 -17.508 -14.346 1.00 20.59 ? 69   ARG A CA    1 
ATOM   1875 C  C     . ARG C  3 69  ? -17.489 -18.257 -15.446 1.00 20.05 ? 69   ARG A C     1 
ATOM   1876 O  O     . ARG C  3 69  ? -16.760 -19.210 -15.171 1.00 21.73 ? 69   ARG A O     1 
ATOM   1877 C  CB    . ARG C  3 69  ? -19.718 -17.886 -14.333 1.00 20.60 ? 69   ARG A CB    1 
ATOM   1878 C  CG    . ARG C  3 69  ? -19.992 -19.349 -13.990 1.00 21.53 ? 69   ARG A CG    1 
ATOM   1879 C  CD    . ARG C  3 69  ? -21.484 -19.640 -13.857 1.00 22.02 ? 69   ARG A CD    1 
ATOM   1880 N  NE    . ARG C  3 69  ? -22.015 -19.142 -12.587 1.00 24.62 ? 69   ARG A NE    1 
ATOM   1881 C  CZ    . ARG C  3 69  ? -21.907 -19.785 -11.423 1.00 26.09 ? 69   ARG A CZ    1 
ATOM   1882 N  NH1   . ARG C  3 69  ? -21.292 -20.963 -11.358 1.00 26.91 ? 69   ARG A NH1   1 
ATOM   1883 N  NH2   . ARG C  3 69  ? -22.413 -19.252 -10.318 1.00 27.02 ? 69   ARG A NH2   1 
ATOM   1884 N  N     . ALA C  3 70  ? -17.658 -17.825 -16.689 1.00 18.42 ? 70   ALA A N     1 
ATOM   1885 C  CA    . ALA C  3 70  ? -16.974 -18.462 -17.797 1.00 17.34 ? 70   ALA A CA    1 
ATOM   1886 C  C     . ALA C  3 70  ? -15.497 -18.527 -17.467 1.00 18.10 ? 70   ALA A C     1 
ATOM   1887 O  O     . ALA C  3 70  ? -14.898 -19.607 -17.465 1.00 18.10 ? 70   ALA A O     1 
ATOM   1888 C  CB    . ALA C  3 70  ? -17.205 -17.700 -19.091 1.00 15.29 ? 70   ALA A CB    1 
ATOM   1889 N  N     . LEU C  3 71  ? -14.920 -17.369 -17.154 1.00 18.28 ? 71   LEU A N     1 
ATOM   1890 C  CA    . LEU C  3 71  ? -13.501 -17.285 -16.850 1.00 18.57 ? 71   LEU A CA    1 
ATOM   1891 C  C     . LEU C  3 71  ? -13.127 -18.218 -15.690 1.00 18.58 ? 71   LEU A C     1 
ATOM   1892 O  O     . LEU C  3 71  ? -12.103 -18.897 -15.738 1.00 19.49 ? 71   LEU A O     1 
ATOM   1893 C  CB    . LEU C  3 71  ? -13.076 -15.835 -16.562 1.00 18.89 ? 71   LEU A CB    1 
ATOM   1894 C  CG    . LEU C  3 71  ? -13.377 -14.756 -17.624 1.00 20.36 ? 71   LEU A CG    1 
ATOM   1895 C  CD1   . LEU C  3 71  ? -13.057 -13.353 -17.100 1.00 19.45 ? 71   LEU A CD1   1 
ATOM   1896 C  CD2   . LEU C  3 71  ? -12.663 -15.001 -18.965 1.00 19.40 ? 71   LEU A CD2   1 
ATOM   1897 N  N     . ALA C  3 72  ? -13.969 -18.267 -14.666 1.00 17.51 ? 72   ALA A N     1 
ATOM   1898 C  CA    . ALA C  3 72  ? -13.692 -19.101 -13.510 1.00 18.14 ? 72   ALA A CA    1 
ATOM   1899 C  C     . ALA C  3 72  ? -13.692 -20.581 -13.870 1.00 18.91 ? 72   ALA A C     1 
ATOM   1900 O  O     . ALA C  3 72  ? -12.822 -21.337 -13.425 1.00 18.95 ? 72   ALA A O     1 
ATOM   1901 C  CB    . ALA C  3 72  ? -14.692 -18.830 -12.410 1.00 18.24 ? 72   ALA A CB    1 
ATOM   1902 N  N     . ILE C  3 73  ? -14.673 -20.997 -14.669 1.00 18.74 ? 73   ILE A N     1 
ATOM   1903 C  CA    . ILE C  3 73  ? -14.714 -22.369 -15.145 1.00 17.66 ? 73   ILE A CA    1 
ATOM   1904 C  C     . ILE C  3 73  ? -13.450 -22.659 -15.949 1.00 17.08 ? 73   ILE A C     1 
ATOM   1905 O  O     . ILE C  3 73  ? -12.798 -23.690 -15.760 1.00 15.90 ? 73   ILE A O     1 
ATOM   1906 C  CB    . ILE C  3 73  ? -15.968 -22.639 -15.994 1.00 18.24 ? 73   ILE A CB    1 
ATOM   1907 C  CG1   . ILE C  3 73  ? -17.211 -22.751 -15.094 1.00 18.57 ? 73   ILE A CG1   1 
ATOM   1908 C  CG2   . ILE C  3 73  ? -15.804 -23.918 -16.781 1.00 18.20 ? 73   ILE A CG2   1 
ATOM   1909 C  CD1   . ILE C  3 73  ? -18.528 -22.916 -15.851 1.00 17.55 ? 73   ILE A CD1   1 
ATOM   1910 N  N     . ALA C  3 74  ? -13.086 -21.728 -16.822 1.00 16.12 ? 74   ALA A N     1 
ATOM   1911 C  CA    . ALA C  3 74  ? -11.917 -21.917 -17.664 1.00 17.19 ? 74   ALA A CA    1 
ATOM   1912 C  C     . ALA C  3 74  ? -10.645 -22.145 -16.835 1.00 18.01 ? 74   ALA A C     1 
ATOM   1913 O  O     . ALA C  3 74  ? -9.760  -22.910 -17.239 1.00 19.68 ? 74   ALA A O     1 
ATOM   1914 C  CB    . ALA C  3 74  ? -11.742 -20.744 -18.632 1.00 15.46 ? 74   ALA A CB    1 
ATOM   1915 N  N     . VAL C  3 75  ? -10.558 -21.489 -15.680 1.00 17.50 ? 75   VAL A N     1 
ATOM   1916 C  CA    . VAL C  3 75  ? -9.375  -21.593 -14.823 1.00 17.33 ? 75   VAL A CA    1 
ATOM   1917 C  C     . VAL C  3 75  ? -9.390  -22.919 -14.044 1.00 17.66 ? 75   VAL A C     1 
ATOM   1918 O  O     . VAL C  3 75  ? -8.400  -23.648 -14.002 1.00 16.53 ? 75   VAL A O     1 
ATOM   1919 C  CB    . VAL C  3 75  ? -9.277  -20.380 -13.857 1.00 16.52 ? 75   VAL A CB    1 
ATOM   1920 C  CG1   . VAL C  3 75  ? -8.148  -20.568 -12.867 1.00 16.28 ? 75   VAL A CG1   1 
ATOM   1921 C  CG2   . VAL C  3 75  ? -9.078  -19.094 -14.632 1.00 14.73 ? 75   VAL A CG2   1 
ATOM   1922 N  N     . MET C  3 76  ? -10.537 -23.212 -13.447 1.00 18.78 ? 76   MET A N     1 
ATOM   1923 C  CA    . MET C  3 76  ? -10.795 -24.463 -12.764 1.00 20.15 ? 76   MET A CA    1 
ATOM   1924 C  C     . MET C  3 76  ? -10.491 -25.666 -13.670 1.00 20.43 ? 76   MET A C     1 
ATOM   1925 O  O     . MET C  3 76  ? -9.967  -26.688 -13.228 1.00 20.50 ? 76   MET A O     1 
ATOM   1926 C  CB    . MET C  3 76  ? -12.262 -24.473 -12.331 1.00 22.68 ? 76   MET A CB    1 
ATOM   1927 C  CG    . MET C  3 76  ? -12.729 -25.757 -11.686 1.00 26.12 ? 76   MET A CG    1 
ATOM   1928 S  SD    . MET C  3 76  ? -11.924 -25.989 -10.112 1.00 31.29 ? 76   MET A SD    1 
ATOM   1929 C  CE    . MET C  3 76  ? -13.033 -25.068 -9.039  1.00 28.35 ? 76   MET A CE    1 
ATOM   1930 N  N     . ARG C  3 77  ? -10.834 -25.535 -14.944 1.00 19.92 ? 77   ARG A N     1 
ATOM   1931 C  CA    . ARG C  3 77  ? -10.604 -26.579 -15.923 1.00 18.96 ? 77   ARG A CA    1 
ATOM   1932 C  C     . ARG C  3 77  ? -9.106  -26.789 -16.145 1.00 18.99 ? 77   ARG A C     1 
ATOM   1933 O  O     . ARG C  3 77  ? -8.610  -27.929 -16.151 1.00 18.70 ? 77   ARG A O     1 
ATOM   1934 C  CB    . ARG C  3 77  ? -11.262 -26.168 -17.234 1.00 19.65 ? 77   ARG A CB    1 
ATOM   1935 C  CG    . ARG C  3 77  ? -11.345 -27.264 -18.270 1.00 19.90 ? 77   ARG A CG    1 
ATOM   1936 C  CD    . ARG C  3 77  ? -12.009 -26.738 -19.513 1.00 19.99 ? 77   ARG A CD    1 
ATOM   1937 N  NE    . ARG C  3 77  ? -11.224 -25.661 -20.108 1.00 19.61 ? 77   ARG A NE    1 
ATOM   1938 C  CZ    . ARG C  3 77  ? -11.737 -24.649 -20.794 1.00 18.74 ? 77   ARG A CZ    1 
ATOM   1939 N  NH1   . ARG C  3 77  ? -13.048 -24.557 -20.968 1.00 18.53 ? 77   ARG A NH1   1 
ATOM   1940 N  NH2   . ARG C  3 77  ? -10.936 -23.723 -21.298 1.00 18.77 ? 77   ARG A NH2   1 
ATOM   1941 N  N     . LYS C  3 78  ? -8.388  -25.690 -16.344 1.00 16.64 ? 78   LYS A N     1 
ATOM   1942 C  CA    . LYS C  3 78  ? -6.937  -25.763 -16.452 1.00 17.41 ? 78   LYS A CA    1 
ATOM   1943 C  C     . LYS C  3 78  ? -6.310  -26.368 -15.195 1.00 16.80 ? 78   LYS A C     1 
ATOM   1944 O  O     . LYS C  3 78  ? -5.395  -27.186 -15.282 1.00 15.78 ? 78   LYS A O     1 
ATOM   1945 C  CB    . LYS C  3 78  ? -6.347  -24.372 -16.685 1.00 18.33 ? 78   LYS A CB    1 
ATOM   1946 C  CG    . LYS C  3 78  ? -6.800  -23.718 -17.965 1.00 18.75 ? 78   LYS A CG    1 
ATOM   1947 C  CD    . LYS C  3 78  ? -6.347  -22.269 -18.008 1.00 18.74 ? 78   LYS A CD    1 
ATOM   1948 C  CE    . LYS C  3 78  ? -7.180  -21.472 -18.988 1.00 18.18 ? 78   LYS A CE    1 
ATOM   1949 N  NZ    . LYS C  3 78  ? -7.135  -22.089 -20.328 1.00 17.98 ? 78   LYS A NZ    1 
ATOM   1950 N  N     . HIS C  3 79  ? -6.806  -25.952 -14.029 1.00 15.99 ? 79   HIS A N     1 
ATOM   1951 C  CA    . HIS C  3 79  ? -6.257  -26.389 -12.761 1.00 15.48 ? 79   HIS A CA    1 
ATOM   1952 C  C     . HIS C  3 79  ? -6.240  -27.916 -12.713 1.00 15.85 ? 79   HIS A C     1 
ATOM   1953 O  O     . HIS C  3 79  ? -5.194  -28.550 -12.520 1.00 14.96 ? 79   HIS A O     1 
ATOM   1954 C  CB    . HIS C  3 79  ? -7.078  -25.799 -11.604 1.00 15.49 ? 79   HIS A CB    1 
ATOM   1955 C  CG    . HIS C  3 79  ? -6.649  -26.263 -10.243 1.00 15.52 ? 79   HIS A CG    1 
ATOM   1956 N  ND1   . HIS C  3 79  ? -5.503  -25.808 -9.628  1.00 15.16 ? 79   HIS A ND1   1 
ATOM   1957 C  CD2   . HIS C  3 79  ? -7.222  -27.130 -9.373  1.00 15.79 ? 79   HIS A CD2   1 
ATOM   1958 C  CE1   . HIS C  3 79  ? -5.382  -26.385 -8.443  1.00 15.90 ? 79   HIS A CE1   1 
ATOM   1959 N  NE2   . HIS C  3 79  ? -6.413  -27.188 -8.262  1.00 16.26 ? 79   HIS A NE2   1 
ATOM   1960 N  N     . ARG C  3 80  ? -7.408  -28.501 -12.925 1.00 16.21 ? 80   ARG A N     1 
ATOM   1961 C  CA    . ARG C  3 80  ? -7.580  -29.931 -12.775 1.00 15.49 ? 80   ARG A CA    1 
ATOM   1962 C  C     . ARG C  3 80  ? -6.994  -30.727 -13.933 1.00 16.75 ? 80   ARG A C     1 
ATOM   1963 O  O     . ARG C  3 80  ? -6.490  -31.835 -13.725 1.00 17.16 ? 80   ARG A O     1 
ATOM   1964 C  CB    . ARG C  3 80  ? -9.049  -30.233 -12.536 1.00 15.41 ? 80   ARG A CB    1 
ATOM   1965 C  CG    . ARG C  3 80  ? -9.508  -29.485 -11.312 1.00 14.16 ? 80   ARG A CG    1 
ATOM   1966 C  CD    . ARG C  3 80  ? -10.886 -29.817 -10.872 1.00 13.28 ? 80   ARG A CD    1 
ATOM   1967 N  NE    . ARG C  3 80  ? -11.142 -29.079 -9.646  1.00 13.14 ? 80   ARG A NE    1 
ATOM   1968 C  CZ    . ARG C  3 80  ? -12.283 -29.084 -8.971  1.00 13.10 ? 80   ARG A CZ    1 
ATOM   1969 N  NH1   . ARG C  3 80  ? -13.315 -29.794 -9.395  1.00 14.11 ? 80   ARG A NH1   1 
ATOM   1970 N  NH2   . ARG C  3 80  ? -12.390 -28.361 -7.870  1.00 13.88 ? 80   ARG A NH2   1 
ATOM   1971 N  N     . LEU C  3 81  ? -7.018  -30.163 -15.140 1.00 15.76 ? 81   LEU A N     1 
ATOM   1972 C  CA    . LEU C  3 81  ? -6.303  -30.805 -16.233 1.00 15.79 ? 81   LEU A CA    1 
ATOM   1973 C  C     . LEU C  3 81  ? -4.831  -30.932 -15.864 1.00 15.86 ? 81   LEU A C     1 
ATOM   1974 O  O     . LEU C  3 81  ? -4.212  -31.977 -16.060 1.00 16.38 ? 81   LEU A O     1 
ATOM   1975 C  CB    . LEU C  3 81  ? -6.475  -30.048 -17.550 1.00 15.48 ? 81   LEU A CB    1 
ATOM   1976 C  CG    . LEU C  3 81  ? -7.828  -30.212 -18.268 1.00 15.97 ? 81   LEU A CG    1 
ATOM   1977 C  CD1   . LEU C  3 81  ? -7.778  -29.585 -19.641 1.00 15.45 ? 81   LEU A CD1   1 
ATOM   1978 C  CD2   . LEU C  3 81  ? -8.248  -31.680 -18.382 1.00 15.03 ? 81   LEU A CD2   1 
ATOM   1979 N  N     . ALA C  3 82  ? -4.275  -29.868 -15.298 1.00 16.90 ? 82   ALA A N     1 
ATOM   1980 C  CA    . ALA C  3 82  ? -2.861  -29.862 -14.928 1.00 16.21 ? 82   ALA A CA    1 
ATOM   1981 C  C     . ALA C  3 82  ? -2.619  -30.854 -13.809 1.00 16.46 ? 82   ALA A C     1 
ATOM   1982 O  O     . ALA C  3 82  ? -1.544  -31.442 -13.718 1.00 15.93 ? 82   ALA A O     1 
ATOM   1983 C  CB    . ALA C  3 82  ? -2.421  -28.479 -14.511 1.00 15.43 ? 82   ALA A CB    1 
ATOM   1984 N  N     . GLU C  3 83  ? -3.625  -31.037 -12.957 1.00 16.82 ? 83   GLU A N     1 
ATOM   1985 C  CA    . GLU C  3 83  ? -3.491  -31.964 -11.846 1.00 17.31 ? 83   GLU A CA    1 
ATOM   1986 C  C     . GLU C  3 83  ? -3.383  -33.382 -12.383 1.00 18.05 ? 83   GLU A C     1 
ATOM   1987 O  O     . GLU C  3 83  ? -2.537  -34.152 -11.943 1.00 18.29 ? 83   GLU A O     1 
ATOM   1988 C  CB    . GLU C  3 83  ? -4.635  -31.801 -10.839 1.00 17.41 ? 83   GLU A CB    1 
ATOM   1989 C  CG    . GLU C  3 83  ? -4.438  -30.590 -9.881  1.00 17.26 ? 83   GLU A CG    1 
ATOM   1990 C  CD    . GLU C  3 83  ? -5.623  -30.320 -8.955  1.00 16.76 ? 83   GLU A CD    1 
ATOM   1991 O  OE1   . GLU C  3 83  ? -6.614  -31.082 -9.012  1.00 15.44 ? 83   GLU A OE1   1 
ATOM   1992 O  OE2   . GLU C  3 83  ? -5.560  -29.339 -8.169  1.00 18.19 ? 83   GLU A OE2   1 
ATOM   1993 N  N     . ARG C  3 84  ? -4.212  -33.708 -13.367 1.00 19.20 ? 84   ARG A N     1 
ATOM   1994 C  CA    . ARG C  3 84  ? -4.164  -35.016 -14.001 1.00 19.64 ? 84   ARG A CA    1 
ATOM   1995 C  C     . ARG C  3 84  ? -2.817  -35.227 -14.648 1.00 19.65 ? 84   ARG A C     1 
ATOM   1996 O  O     . ARG C  3 84  ? -2.212  -36.283 -14.495 1.00 20.54 ? 84   ARG A O     1 
ATOM   1997 C  CB    . ARG C  3 84  ? -5.252  -35.135 -15.060 1.00 21.12 ? 84   ARG A CB    1 
ATOM   1998 C  CG    . ARG C  3 84  ? -6.555  -35.710 -14.560 1.00 22.27 ? 84   ARG A CG    1 
ATOM   1999 C  CD    . ARG C  3 84  ? -6.730  -37.133 -15.046 1.00 23.03 ? 84   ARG A CD    1 
ATOM   2000 N  NE    . ARG C  3 84  ? -6.106  -38.083 -14.146 1.00 23.89 ? 84   ARG A NE    1 
ATOM   2001 C  CZ    . ARG C  3 84  ? -6.752  -38.738 -13.187 1.00 24.52 ? 84   ARG A CZ    1 
ATOM   2002 N  NH1   . ARG C  3 84  ? -8.055  -38.543 -13.002 1.00 22.88 ? 84   ARG A NH1   1 
ATOM   2003 N  NH2   . ARG C  3 84  ? -6.085  -39.589 -12.411 1.00 24.99 ? 84   ARG A NH2   1 
ATOM   2004 N  N     . LEU C  3 85  ? -2.347  -34.220 -15.375 1.00 19.37 ? 85   LEU A N     1 
ATOM   2005 C  CA    . LEU C  3 85  ? -1.043  -34.298 -16.033 1.00 19.39 ? 85   LEU A CA    1 
ATOM   2006 C  C     . LEU C  3 85  ? 0.107   -34.584 -15.059 1.00 20.27 ? 85   LEU A C     1 
ATOM   2007 O  O     . LEU C  3 85  ? 1.004   -35.378 -15.358 1.00 21.92 ? 85   LEU A O     1 
ATOM   2008 C  CB    . LEU C  3 85  ? -0.760  -33.017 -16.814 1.00 18.70 ? 85   LEU A CB    1 
ATOM   2009 C  CG    . LEU C  3 85  ? 0.621   -32.937 -17.468 1.00 18.57 ? 85   LEU A CG    1 
ATOM   2010 C  CD1   . LEU C  3 85  ? 0.775   -34.069 -18.464 1.00 18.11 ? 85   LEU A CD1   1 
ATOM   2011 C  CD2   . LEU C  3 85  ? 0.846   -31.580 -18.139 1.00 17.34 ? 85   LEU A CD2   1 
ATOM   2012 N  N     . LEU C  3 86  ? 0.072   -33.935 -13.900 1.00 20.30 ? 86   LEU A N     1 
ATOM   2013 C  CA    . LEU C  3 86  ? 1.108   -34.100 -12.875 1.00 20.65 ? 86   LEU A CA    1 
ATOM   2014 C  C     . LEU C  3 86  ? 1.069   -35.474 -12.193 1.00 20.48 ? 86   LEU A C     1 
ATOM   2015 O  O     . LEU C  3 86  ? 2.090   -35.977 -11.718 1.00 20.48 ? 86   LEU A O     1 
ATOM   2016 C  CB    . LEU C  3 86  ? 1.009   -32.976 -11.832 1.00 19.67 ? 86   LEU A CB    1 
ATOM   2017 C  CG    . LEU C  3 86  ? 1.229   -31.578 -12.425 1.00 19.48 ? 86   LEU A CG    1 
ATOM   2018 C  CD1   . LEU C  3 86  ? 0.446   -30.515 -11.695 1.00 18.73 ? 86   LEU A CD1   1 
ATOM   2019 C  CD2   . LEU C  3 86  ? 2.706   -31.248 -12.444 1.00 19.04 ? 86   LEU A CD2   1 
ATOM   2020 N  N     . VAL C  3 87  ? -0.105  -36.086 -12.155 1.00 19.78 ? 87   VAL A N     1 
ATOM   2021 C  CA    . VAL C  3 87  ? -0.240  -37.366 -11.493 1.00 19.82 ? 87   VAL A CA    1 
ATOM   2022 C  C     . VAL C  3 87  ? -0.069  -38.523 -12.476 1.00 20.65 ? 87   VAL A C     1 
ATOM   2023 O  O     . VAL C  3 87  ? 0.783   -39.387 -12.287 1.00 21.06 ? 87   VAL A O     1 
ATOM   2024 C  CB    . VAL C  3 87  ? -1.571  -37.447 -10.734 1.00 18.77 ? 87   VAL A CB    1 
ATOM   2025 C  CG1   . VAL C  3 87  ? -1.871  -38.877 -10.291 1.00 17.93 ? 87   VAL A CG1   1 
ATOM   2026 C  CG2   . VAL C  3 87  ? -1.527  -36.506 -9.539  1.00 18.66 ? 87   VAL A CG2   1 
ATOM   2027 N  N     . ASP C  3 88  ? -0.868  -38.519 -13.535 1.00 21.65 ? 88   ASP A N     1 
ATOM   2028 C  CA    . ASP C  3 88  ? -0.858  -39.590 -14.516 1.00 22.50 ? 88   ASP A CA    1 
ATOM   2029 C  C     . ASP C  3 88  ? 0.460   -39.687 -15.254 1.00 22.77 ? 88   ASP A C     1 
ATOM   2030 O  O     . ASP C  3 88  ? 0.970   -40.779 -15.477 1.00 24.40 ? 88   ASP A O     1 
ATOM   2031 C  CB    . ASP C  3 88  ? -1.974  -39.389 -15.537 1.00 23.08 ? 88   ASP A CB    1 
ATOM   2032 C  CG    . ASP C  3 88  ? -3.351  -39.642 -14.959 1.00 24.12 ? 88   ASP A CG    1 
ATOM   2033 O  OD1   . ASP C  3 88  ? -3.484  -39.738 -13.716 1.00 24.13 ? 88   ASP A OD1   1 
ATOM   2034 O  OD2   . ASP C  3 88  ? -4.306  -39.746 -15.761 1.00 25.24 ? 88   ASP A OD2   1 
ATOM   2035 N  N     . VAL C  3 89  ? 1.010   -38.544 -15.637 1.00 23.15 ? 89   VAL A N     1 
ATOM   2036 C  CA    . VAL C  3 89  ? 2.158   -38.525 -16.534 1.00 22.33 ? 89   VAL A CA    1 
ATOM   2037 C  C     . VAL C  3 89  ? 3.472   -38.202 -15.835 1.00 22.13 ? 89   VAL A C     1 
ATOM   2038 O  O     . VAL C  3 89  ? 4.470   -38.885 -16.042 1.00 22.87 ? 89   VAL A O     1 
ATOM   2039 C  CB    . VAL C  3 89  ? 1.941   -37.532 -17.692 1.00 22.07 ? 89   VAL A CB    1 
ATOM   2040 C  CG1   . VAL C  3 89  ? 3.155   -37.488 -18.595 1.00 21.39 ? 89   VAL A CG1   1 
ATOM   2041 C  CG2   . VAL C  3 89  ? 0.698   -37.907 -18.483 1.00 21.95 ? 89   VAL A CG2   1 
ATOM   2042 N  N     . ILE C  3 90  ? 3.478   -37.170 -15.004 1.00 21.40 ? 90   ILE A N     1 
ATOM   2043 C  CA    . ILE C  3 90  ? 4.736   -36.683 -14.444 1.00 21.55 ? 90   ILE A CA    1 
ATOM   2044 C  C     . ILE C  3 90  ? 5.154   -37.356 -13.124 1.00 21.79 ? 90   ILE A C     1 
ATOM   2045 O  O     . ILE C  3 90  ? 6.332   -37.605 -12.886 1.00 21.96 ? 90   ILE A O     1 
ATOM   2046 C  CB    . ILE C  3 90  ? 4.710   -35.138 -14.326 1.00 21.19 ? 90   ILE A CB    1 
ATOM   2047 C  CG1   . ILE C  3 90  ? 4.478   -34.520 -15.707 1.00 20.85 ? 90   ILE A CG1   1 
ATOM   2048 C  CG2   . ILE C  3 90  ? 5.997   -34.614 -13.727 1.00 20.96 ? 90   ILE A CG2   1 
ATOM   2049 C  CD1   . ILE C  3 90  ? 4.109   -33.052 -15.683 1.00 20.67 ? 90   ILE A CD1   1 
ATOM   2050 N  N     . GLY C  3 91  ? 4.193   -37.651 -12.261 1.00 23.17 ? 91   GLY A N     1 
ATOM   2051 C  CA    . GLY C  3 91  ? 4.500   -38.327 -11.006 1.00 23.00 ? 91   GLY A CA    1 
ATOM   2052 C  C     . GLY C  3 91  ? 4.944   -37.388 -9.902  1.00 23.55 ? 91   GLY A C     1 
ATOM   2053 O  O     . GLY C  3 91  ? 5.593   -37.808 -8.948  1.00 23.24 ? 91   GLY A O     1 
ATOM   2054 N  N     . LEU C  3 92  ? 4.602   -36.112 -10.021 1.00 23.71 ? 92   LEU A N     1 
ATOM   2055 C  CA    . LEU C  3 92  ? 4.839   -35.192 -8.923  1.00 25.46 ? 92   LEU A CA    1 
ATOM   2056 C  C     . LEU C  3 92  ? 4.182   -35.760 -7.672  1.00 26.71 ? 92   LEU A C     1 
ATOM   2057 O  O     . LEU C  3 92  ? 3.062   -36.247 -7.737  1.00 27.71 ? 92   LEU A O     1 
ATOM   2058 C  CB    . LEU C  3 92  ? 4.255   -33.821 -9.238  1.00 24.48 ? 92   LEU A CB    1 
ATOM   2059 C  CG    . LEU C  3 92  ? 4.731   -32.722 -8.302  1.00 24.38 ? 92   LEU A CG    1 
ATOM   2060 C  CD1   . LEU C  3 92  ? 6.225   -32.547 -8.429  1.00 24.68 ? 92   LEU A CD1   1 
ATOM   2061 C  CD2   . LEU C  3 92  ? 4.026   -31.436 -8.619  1.00 25.27 ? 92   LEU A CD2   1 
ATOM   2062 N  N     . PRO C  3 93  ? 4.885   -35.733 -6.533  1.00 28.32 ? 93   PRO A N     1 
ATOM   2063 C  CA    . PRO C  3 93  ? 4.283   -36.226 -5.300  1.00 29.58 ? 93   PRO A CA    1 
ATOM   2064 C  C     . PRO C  3 93  ? 2.933   -35.579 -5.046  1.00 30.06 ? 93   PRO A C     1 
ATOM   2065 O  O     . PRO C  3 93  ? 2.781   -34.386 -5.273  1.00 30.90 ? 93   PRO A O     1 
ATOM   2066 C  CB    . PRO C  3 93  ? 5.287   -35.792 -4.229  1.00 29.69 ? 93   PRO A CB    1 
ATOM   2067 C  CG    . PRO C  3 93  ? 6.586   -35.788 -4.942  1.00 29.20 ? 93   PRO A CG    1 
ATOM   2068 C  CD    . PRO C  3 93  ? 6.271   -35.280 -6.323  1.00 28.80 ? 93   PRO A CD    1 
ATOM   2069 N  N     . TRP C  3 94  ? 1.975   -36.372 -4.577  1.00 31.74 ? 94   TRP A N     1 
ATOM   2070 C  CA    . TRP C  3 94  ? 0.590   -35.937 -4.333  1.00 33.55 ? 94   TRP A CA    1 
ATOM   2071 C  C     . TRP C  3 94  ? 0.457   -34.597 -3.593  1.00 33.48 ? 94   TRP A C     1 
ATOM   2072 O  O     . TRP C  3 94  ? -0.297  -33.708 -4.005  1.00 32.61 ? 94   TRP A O     1 
ATOM   2073 C  CB    . TRP C  3 94  ? -0.144  -37.024 -3.547  1.00 35.59 ? 94   TRP A CB    1 
ATOM   2074 C  CG    . TRP C  3 94  ? -1.610  -37.158 -3.849  1.00 36.64 ? 94   TRP A CG    1 
ATOM   2075 C  CD1   . TRP C  3 94  ? -2.176  -37.676 -4.988  1.00 36.86 ? 94   TRP A CD1   1 
ATOM   2076 C  CD2   . TRP C  3 94  ? -2.702  -36.810 -2.982  1.00 36.57 ? 94   TRP A CD2   1 
ATOM   2077 N  NE1   . TRP C  3 94  ? -3.550  -37.656 -4.882  1.00 36.78 ? 94   TRP A NE1   1 
ATOM   2078 C  CE2   . TRP C  3 94  ? -3.896  -37.129 -3.663  1.00 36.57 ? 94   TRP A CE2   1 
ATOM   2079 C  CE3   . TRP C  3 94  ? -2.784  -36.253 -1.699  1.00 37.35 ? 94   TRP A CE3   1 
ATOM   2080 C  CZ2   . TRP C  3 94  ? -5.161  -36.909 -3.103  1.00 37.36 ? 94   TRP A CZ2   1 
ATOM   2081 C  CZ3   . TRP C  3 94  ? -4.045  -36.026 -1.140  1.00 37.34 ? 94   TRP A CZ3   1 
ATOM   2082 C  CH2   . TRP C  3 94  ? -5.216  -36.356 -1.844  1.00 37.42 ? 94   TRP A CH2   1 
ATOM   2083 N  N     . GLU C  3 95  ? 1.192   -34.455 -2.498  1.00 33.44 ? 95   GLU A N     1 
ATOM   2084 C  CA    . GLU C  3 95  ? 1.043   -33.285 -1.655  1.00 33.76 ? 95   GLU A CA    1 
ATOM   2085 C  C     . GLU C  3 95  ? 1.419   -31.999 -2.382  1.00 32.52 ? 95   GLU A C     1 
ATOM   2086 O  O     . GLU C  3 95  ? 0.904   -30.928 -2.058  1.00 32.50 ? 95   GLU A O     1 
ATOM   2087 C  CB    . GLU C  3 95  ? 1.826   -33.451 -0.347  1.00 35.43 ? 95   GLU A CB    1 
ATOM   2088 C  CG    . GLU C  3 95  ? 1.164   -34.430 0.625   1.00 37.91 ? 95   GLU A CG    1 
ATOM   2089 C  CD    . GLU C  3 95  ? -0.276  -34.044 1.004   1.00 39.53 ? 95   GLU A CD    1 
ATOM   2090 O  OE1   . GLU C  3 95  ? -0.461  -33.134 1.847   1.00 40.31 ? 95   GLU A OE1   1 
ATOM   2091 O  OE2   . GLU C  3 95  ? -1.226  -34.670 0.481   1.00 40.12 ? 95   GLU A OE2   1 
ATOM   2092 N  N     . GLU C  3 96  ? 2.288   -32.110 -3.383  1.00 30.41 ? 96   GLU A N     1 
ATOM   2093 C  CA    . GLU C  3 96  ? 2.708   -30.941 -4.149  1.00 29.23 ? 96   GLU A CA    1 
ATOM   2094 C  C     . GLU C  3 96  ? 1.887   -30.663 -5.426  1.00 26.95 ? 96   GLU A C     1 
ATOM   2095 O  O     . GLU C  3 96  ? 2.112   -29.653 -6.097  1.00 25.45 ? 96   GLU A O     1 
ATOM   2096 C  CB    . GLU C  3 96  ? 4.202   -31.024 -4.492  1.00 31.46 ? 96   GLU A CB    1 
ATOM   2097 C  CG    . GLU C  3 96  ? 5.139   -31.280 -3.298  1.00 34.57 ? 96   GLU A CG    1 
ATOM   2098 C  CD    . GLU C  3 96  ? 5.177   -30.139 -2.270  1.00 36.82 ? 96   GLU A CD    1 
ATOM   2099 O  OE1   . GLU C  3 96  ? 5.666   -30.373 -1.137  1.00 37.51 ? 96   GLU A OE1   1 
ATOM   2100 O  OE2   . GLU C  3 96  ? 4.721   -29.011 -2.585  1.00 38.14 ? 96   GLU A OE2   1 
ATOM   2101 N  N     . VAL C  3 97  ? 0.934   -31.530 -5.765  1.00 23.95 ? 97   VAL A N     1 
ATOM   2102 C  CA    . VAL C  3 97  ? 0.278   -31.399 -7.075  1.00 22.54 ? 97   VAL A CA    1 
ATOM   2103 C  C     . VAL C  3 97  ? -0.684  -30.211 -7.178  1.00 20.71 ? 97   VAL A C     1 
ATOM   2104 O  O     . VAL C  3 97  ? -0.631  -29.436 -8.136  1.00 20.49 ? 97   VAL A O     1 
ATOM   2105 C  CB    . VAL C  3 97  ? -0.411  -32.701 -7.558  1.00 22.67 ? 97   VAL A CB    1 
ATOM   2106 C  CG1   . VAL C  3 97  ? 0.468   -33.919 -7.274  1.00 22.10 ? 97   VAL A CG1   1 
ATOM   2107 C  CG2   . VAL C  3 97  ? -1.763  -32.854 -6.921  1.00 23.40 ? 97   VAL A CG2   1 
ATOM   2108 N  N     . HIS C  3 98  ? -1.559  -30.062 -6.196  1.00 18.95 ? 98   HIS A N     1 
ATOM   2109 C  CA    . HIS C  3 98  ? -2.463  -28.933 -6.197  1.00 16.81 ? 98   HIS A CA    1 
ATOM   2110 C  C     . HIS C  3 98  ? -1.673  -27.628 -6.246  1.00 16.41 ? 98   HIS A C     1 
ATOM   2111 O  O     . HIS C  3 98  ? -1.916  -26.782 -7.105  1.00 16.36 ? 98   HIS A O     1 
ATOM   2112 C  CB    . HIS C  3 98  ? -3.377  -28.959 -4.980  1.00 16.46 ? 98   HIS A CB    1 
ATOM   2113 C  CG    . HIS C  3 98  ? -4.155  -27.699 -4.810  1.00 16.70 ? 98   HIS A CG    1 
ATOM   2114 N  ND1   . HIS C  3 98  ? -5.251  -27.396 -5.586  1.00 18.01 ? 98   HIS A ND1   1 
ATOM   2115 C  CD2   . HIS C  3 98  ? -3.964  -26.639 -3.993  1.00 16.01 ? 98   HIS A CD2   1 
ATOM   2116 C  CE1   . HIS C  3 98  ? -5.718  -26.213 -5.236  1.00 17.58 ? 98   HIS A CE1   1 
ATOM   2117 N  NE2   . HIS C  3 98  ? -4.954  -25.733 -4.271  1.00 16.79 ? 98   HIS A NE2   1 
ATOM   2118 N  N     . ALA C  3 99  ? -0.723  -27.472 -5.328  1.00 15.79 ? 99   ALA A N     1 
ATOM   2119 C  CA    . ALA C  3 99  ? 0.135   -26.291 -5.321  1.00 16.08 ? 99   ALA A CA    1 
ATOM   2120 C  C     . ALA C  3 99  ? 0.695   -26.009 -6.700  1.00 16.98 ? 99   ALA A C     1 
ATOM   2121 O  O     . ALA C  3 99  ? 0.583   -24.887 -7.192  1.00 18.58 ? 99   ALA A O     1 
ATOM   2122 C  CB    . ALA C  3 99  ? 1.265   -26.433 -4.319  1.00 14.62 ? 99   ALA A CB    1 
ATOM   2123 N  N     . GLU C  3 100 ? 1.302   -27.011 -7.333  1.00 16.70 ? 100  GLU A N     1 
ATOM   2124 C  CA    . GLU C  3 100 ? 1.874   -26.779 -8.652  1.00 16.87 ? 100  GLU A CA    1 
ATOM   2125 C  C     . GLU C  3 100 ? 0.777   -26.323 -9.614  1.00 16.42 ? 100  GLU A C     1 
ATOM   2126 O  O     . GLU C  3 100 ? 0.947   -25.352 -10.355 1.00 16.11 ? 100  GLU A O     1 
ATOM   2127 C  CB    . GLU C  3 100 ? 2.573   -28.029 -9.188  1.00 17.87 ? 100  GLU A CB    1 
ATOM   2128 C  CG    . GLU C  3 100 ? 3.407   -27.792 -10.451 1.00 18.03 ? 100  GLU A CG    1 
ATOM   2129 C  CD    . GLU C  3 100 ? 4.837   -27.369 -10.153 1.00 18.57 ? 100  GLU A CD    1 
ATOM   2130 O  OE1   . GLU C  3 100 ? 5.454   -27.975 -9.253  1.00 19.78 ? 100  GLU A OE1   1 
ATOM   2131 O  OE2   . GLU C  3 100 ? 5.355   -26.456 -10.830 1.00 17.74 ? 100  GLU A OE2   1 
ATOM   2132 N  N     . ALA C  3 101 ? -0.355  -27.019 -9.585  1.00 15.89 ? 101  ALA A N     1 
ATOM   2133 C  CA    . ALA C  3 101 ? -1.470  -26.684 -10.470 1.00 15.97 ? 101  ALA A CA    1 
ATOM   2134 C  C     . ALA C  3 101 ? -1.987  -25.261 -10.225 1.00 15.48 ? 101  ALA A C     1 
ATOM   2135 O  O     . ALA C  3 101 ? -2.322  -24.538 -11.173 1.00 14.65 ? 101  ALA A O     1 
ATOM   2136 C  CB    . ALA C  3 101 ? -2.592  -27.704 -10.345 1.00 14.79 ? 101  ALA A CB    1 
ATOM   2137 N  N     . CYS C  3 102 ? -2.025  -24.865 -8.957  1.00 14.57 ? 102  CYS A N     1 
ATOM   2138 C  CA    . CYS C  3 102 ? -2.444  -23.515 -8.577  1.00 15.26 ? 102  CYS A CA    1 
ATOM   2139 C  C     . CYS C  3 102 ? -1.676  -22.435 -9.344  1.00 15.13 ? 102  CYS A C     1 
ATOM   2140 O  O     . CYS C  3 102 ? -2.173  -21.313 -9.534  1.00 16.67 ? 102  CYS A O     1 
ATOM   2141 C  CB    . CYS C  3 102 ? -2.260  -23.312 -7.074  1.00 15.11 ? 102  CYS A CB    1 
ATOM   2142 S  SG    . CYS C  3 102 ? -2.920  -21.786 -6.478  1.00 12.51 ? 102  CYS A SG    1 
ATOM   2143 N  N     . ARG C  3 103 ? -0.471  -22.781 -9.780  1.00 14.29 ? 103  ARG A N     1 
ATOM   2144 C  CA    . ARG C  3 103 ? 0.329   -21.888 -10.600 1.00 14.69 ? 103  ARG A CA    1 
ATOM   2145 C  C     . ARG C  3 103 ? 0.143   -22.161 -12.089 1.00 14.94 ? 103  ARG A C     1 
ATOM   2146 O  O     . ARG C  3 103 ? 0.118   -21.223 -12.892 1.00 15.22 ? 103  ARG A O     1 
ATOM   2147 C  CB    . ARG C  3 103 ? 1.814   -21.972 -10.221 1.00 14.91 ? 103  ARG A CB    1 
ATOM   2148 C  CG    . ARG C  3 103 ? 2.115   -21.495 -8.803  1.00 15.17 ? 103  ARG A CG    1 
ATOM   2149 C  CD    . ARG C  3 103 ? 3.599   -21.261 -8.584  1.00 15.74 ? 103  ARG A CD    1 
ATOM   2150 N  NE    . ARG C  3 103 ? 4.408   -22.398 -9.016  1.00 16.12 ? 103  ARG A NE    1 
ATOM   2151 C  CZ    . ARG C  3 103 ? 4.663   -23.462 -8.264  1.00 15.86 ? 103  ARG A CZ    1 
ATOM   2152 N  NH1   . ARG C  3 103 ? 5.410   -24.454 -8.745  1.00 15.28 ? 103  ARG A NH1   1 
ATOM   2153 N  NH2   . ARG C  3 103 ? 4.166   -23.540 -7.036  1.00 15.07 ? 103  ARG A NH2   1 
ATOM   2154 N  N     . TRP C  3 104 ? 0.007   -23.434 -12.460 1.00 15.12 ? 104  TRP A N     1 
ATOM   2155 C  CA    . TRP C  3 104 ? -0.161  -23.810 -13.877 1.00 15.20 ? 104  TRP A CA    1 
ATOM   2156 C  C     . TRP C  3 104 ? -1.485  -23.308 -14.459 1.00 14.80 ? 104  TRP A C     1 
ATOM   2157 O  O     . TRP C  3 104 ? -1.541  -22.834 -15.596 1.00 14.57 ? 104  TRP A O     1 
ATOM   2158 C  CB    . TRP C  3 104 ? -0.004  -25.322 -14.066 1.00 16.39 ? 104  TRP A CB    1 
ATOM   2159 C  CG    . TRP C  3 104 ? 1.415   -25.775 -13.924 1.00 17.12 ? 104  TRP A CG    1 
ATOM   2160 C  CD1   . TRP C  3 104 ? 2.361   -25.242 -13.096 1.00 17.56 ? 104  TRP A CD1   1 
ATOM   2161 C  CD2   . TRP C  3 104 ? 2.052   -26.849 -14.617 1.00 16.96 ? 104  TRP A CD2   1 
ATOM   2162 N  NE1   . TRP C  3 104 ? 3.546   -25.912 -13.235 1.00 17.61 ? 104  TRP A NE1   1 
ATOM   2163 C  CE2   . TRP C  3 104 ? 3.386   -26.907 -14.159 1.00 16.97 ? 104  TRP A CE2   1 
ATOM   2164 C  CE3   . TRP C  3 104 ? 1.623   -27.778 -15.568 1.00 17.61 ? 104  TRP A CE3   1 
ATOM   2165 C  CZ2   . TRP C  3 104 ? 4.299   -27.850 -14.625 1.00 16.64 ? 104  TRP A CZ2   1 
ATOM   2166 C  CZ3   . TRP C  3 104 ? 2.534   -28.716 -16.038 1.00 17.47 ? 104  TRP A CZ3   1 
ATOM   2167 C  CH2   . TRP C  3 104 ? 3.859   -28.741 -15.564 1.00 17.46 ? 104  TRP A CH2   1 
ATOM   2168 N  N     . GLU C  3 105 ? -2.540  -23.395 -13.659 1.00 14.39 ? 105  GLU A N     1 
ATOM   2169 C  CA    . GLU C  3 105 ? -3.860  -22.908 -14.052 1.00 14.96 ? 105  GLU A CA    1 
ATOM   2170 C  C     . GLU C  3 105 ? -3.836  -21.529 -14.701 1.00 14.01 ? 105  GLU A C     1 
ATOM   2171 O  O     . GLU C  3 105 ? -4.770  -21.153 -15.403 1.00 14.34 ? 105  GLU A O     1 
ATOM   2172 C  CB    . GLU C  3 105 ? -4.801  -22.874 -12.842 1.00 15.74 ? 105  GLU A CB    1 
ATOM   2173 C  CG    . GLU C  3 105 ? -4.351  -21.938 -11.724 1.00 15.85 ? 105  GLU A CG    1 
ATOM   2174 C  CD    . GLU C  3 105 ? -5.197  -22.068 -10.469 1.00 16.08 ? 105  GLU A CD    1 
ATOM   2175 O  OE1   . GLU C  3 105 ? -6.275  -22.710 -10.546 1.00 16.08 ? 105  GLU A OE1   1 
ATOM   2176 O  OE2   . GLU C  3 105 ? -4.779  -21.530 -9.409  1.00 16.50 ? 105  GLU A OE2   1 
ATOM   2177 N  N     . HIS C  3 106 ? -2.774  -20.769 -14.475 1.00 13.09 ? 106  HIS A N     1 
ATOM   2178 C  CA    . HIS C  3 106 ? -2.794  -19.373 -14.896 1.00 11.29 ? 106  HIS A CA    1 
ATOM   2179 C  C     . HIS C  3 106 ? -2.028  -19.179 -16.196 1.00 10.81 ? 106  HIS A C     1 
ATOM   2180 O  O     . HIS C  3 106 ? -2.048  -18.104 -16.789 1.00 9.55  ? 106  HIS A O     1 
ATOM   2181 C  CB    . HIS C  3 106 ? -2.285  -18.449 -13.772 1.00 9.73  ? 106  HIS A CB    1 
ATOM   2182 C  CG    . HIS C  3 106 ? -2.958  -18.679 -12.451 1.00 8.69  ? 106  HIS A CG    1 
ATOM   2183 N  ND1   . HIS C  3 106 ? -4.298  -18.435 -12.246 1.00 8.62  ? 106  HIS A ND1   1 
ATOM   2184 C  CD2   . HIS C  3 106 ? -2.478  -19.145 -11.272 1.00 9.28  ? 106  HIS A CD2   1 
ATOM   2185 C  CE1   . HIS C  3 106 ? -4.615  -18.746 -11.000 1.00 9.12  ? 106  HIS A CE1   1 
ATOM   2186 N  NE2   . HIS C  3 106 ? -3.528  -19.179 -10.386 1.00 9.69  ? 106  HIS A NE2   1 
ATOM   2187 N  N     . VAL C  3 107 ? -1.371  -20.229 -16.665 1.00 10.80 ? 107  VAL A N     1 
ATOM   2188 C  CA    . VAL C  3 107 ? -0.528  -20.063 -17.842 1.00 11.91 ? 107  VAL A CA    1 
ATOM   2189 C  C     . VAL C  3 107 ? -0.859  -20.993 -19.008 1.00 13.60 ? 107  VAL A C     1 
ATOM   2190 O  O     . VAL C  3 107 ? -0.336  -20.817 -20.107 1.00 12.52 ? 107  VAL A O     1 
ATOM   2191 C  CB    . VAL C  3 107 ? 0.985   -20.152 -17.485 1.00 11.16 ? 107  VAL A CB    1 
ATOM   2192 C  CG1   . VAL C  3 107 ? 1.355   -19.051 -16.517 1.00 9.34  ? 107  VAL A CG1   1 
ATOM   2193 C  CG2   . VAL C  3 107 ? 1.343   -21.527 -16.923 1.00 9.15  ? 107  VAL A CG2   1 
ATOM   2194 N  N     . MET C  3 108 ? -1.722  -21.977 -18.764 1.00 16.19 ? 108  MET A N     1 
ATOM   2195 C  CA    . MET C  3 108 ? -2.081  -22.951 -19.794 1.00 19.75 ? 108  MET A CA    1 
ATOM   2196 C  C     . MET C  3 108 ? -3.062  -22.360 -20.784 1.00 19.09 ? 108  MET A C     1 
ATOM   2197 O  O     . MET C  3 108 ? -4.115  -21.851 -20.387 1.00 20.32 ? 108  MET A O     1 
ATOM   2198 C  CB    . MET C  3 108 ? -2.748  -24.186 -19.181 1.00 20.49 ? 108  MET A CB    1 
ATOM   2199 C  CG    . MET C  3 108 ? -1.842  -25.124 -18.428 1.00 21.96 ? 108  MET A CG    1 
ATOM   2200 S  SD    . MET C  3 108 ? -2.775  -26.516 -17.730 1.00 24.67 ? 108  MET A SD    1 
ATOM   2201 C  CE    . MET C  3 108 ? -3.574  -27.198 -19.186 1.00 21.62 ? 108  MET A CE    1 
ATOM   2202 N  N     . SER C  3 109 ? -2.733  -22.452 -22.067 1.00 18.15 ? 109  SER A N     1 
ATOM   2203 C  CA    . SER C  3 109 ? -3.670  -22.082 -23.117 1.00 17.99 ? 109  SER A CA    1 
ATOM   2204 C  C     . SER C  3 109 ? -4.713  -23.170 -23.298 1.00 17.80 ? 109  SER A C     1 
ATOM   2205 O  O     . SER C  3 109 ? -4.572  -24.264 -22.780 1.00 17.38 ? 109  SER A O     1 
ATOM   2206 C  CB    . SER C  3 109 ? -2.940  -21.847 -24.440 1.00 17.85 ? 109  SER A CB    1 
ATOM   2207 O  OG    . SER C  3 109 ? -2.414  -23.055 -24.949 1.00 17.49 ? 109  SER A OG    1 
ATOM   2208 N  N     . GLU C  3 110 ? -5.764  -22.854 -24.038 1.00 19.36 ? 110  GLU A N     1 
ATOM   2209 C  CA    . GLU C  3 110 ? -6.794  -23.822 -24.361 1.00 20.13 ? 110  GLU A CA    1 
ATOM   2210 C  C     . GLU C  3 110 ? -6.269  -24.853 -25.341 1.00 20.27 ? 110  GLU A C     1 
ATOM   2211 O  O     . GLU C  3 110 ? -6.718  -25.999 -25.354 1.00 20.58 ? 110  GLU A O     1 
ATOM   2212 C  CB    . GLU C  3 110 ? -7.991  -23.108 -24.967 1.00 21.69 ? 110  GLU A CB    1 
ATOM   2213 C  CG    . GLU C  3 110 ? -8.411  -21.910 -24.163 1.00 23.40 ? 110  GLU A CG    1 
ATOM   2214 C  CD    . GLU C  3 110 ? -9.913  -21.758 -24.101 1.00 24.98 ? 110  GLU A CD    1 
ATOM   2215 O  OE1   . GLU C  3 110 ? -10.571 -21.951 -25.145 1.00 25.74 ? 110  GLU A OE1   1 
ATOM   2216 O  OE2   . GLU C  3 110 ? -10.432 -21.445 -23.004 1.00 25.84 ? 110  GLU A OE2   1 
ATOM   2217 N  N     . ASP C  3 111 ? -5.320  -24.438 -26.171 1.00 20.86 ? 111  ASP A N     1 
ATOM   2218 C  CA    . ASP C  3 111 ? -4.653  -25.356 -27.073 1.00 20.88 ? 111  ASP A CA    1 
ATOM   2219 C  C     . ASP C  3 111 ? -4.058  -26.533 -26.296 1.00 21.18 ? 111  ASP A C     1 
ATOM   2220 O  O     . ASP C  3 111 ? -4.311  -27.704 -26.618 1.00 22.16 ? 111  ASP A O     1 
ATOM   2221 C  CB    . ASP C  3 111 ? -3.581  -24.622 -27.875 1.00 22.22 ? 111  ASP A CB    1 
ATOM   2222 C  CG    . ASP C  3 111 ? -4.123  -24.021 -29.172 1.00 23.56 ? 111  ASP A CG    1 
ATOM   2223 O  OD1   . ASP C  3 111 ? -5.265  -24.348 -29.558 1.00 23.51 ? 111  ASP A OD1   1 
ATOM   2224 O  OD2   . ASP C  3 111 ? -3.399  -23.228 -29.816 1.00 24.48 ? 111  ASP A OD2   1 
ATOM   2225 N  N     . VAL C  3 112 ? -3.282  -26.228 -25.264 1.00 19.55 ? 112  VAL A N     1 
ATOM   2226 C  CA    . VAL C  3 112 ? -2.742  -27.266 -24.397 1.00 19.64 ? 112  VAL A CA    1 
ATOM   2227 C  C     . VAL C  3 112 ? -3.837  -28.074 -23.698 1.00 20.18 ? 112  VAL A C     1 
ATOM   2228 O  O     . VAL C  3 112 ? -3.712  -29.290 -23.538 1.00 21.06 ? 112  VAL A O     1 
ATOM   2229 C  CB    . VAL C  3 112 ? -1.809  -26.673 -23.334 1.00 20.05 ? 112  VAL A CB    1 
ATOM   2230 C  CG1   . VAL C  3 112 ? -1.384  -27.729 -22.350 1.00 19.16 ? 112  VAL A CG1   1 
ATOM   2231 C  CG2   . VAL C  3 112 ? -0.588  -26.046 -23.999 1.00 20.81 ? 112  VAL A CG2   1 
ATOM   2232 N  N     . GLU C  3 113 ? -4.908  -27.407 -23.278 1.00 19.90 ? 113  GLU A N     1 
ATOM   2233 C  CA    . GLU C  3 113 ? -5.986  -28.100 -22.590 1.00 20.42 ? 113  GLU A CA    1 
ATOM   2234 C  C     . GLU C  3 113 ? -6.610  -29.169 -23.486 1.00 20.44 ? 113  GLU A C     1 
ATOM   2235 O  O     . GLU C  3 113 ? -7.011  -30.229 -23.013 1.00 19.34 ? 113  GLU A O     1 
ATOM   2236 C  CB    . GLU C  3 113 ? -7.074  -27.128 -22.140 1.00 21.20 ? 113  GLU A CB    1 
ATOM   2237 C  CG    . GLU C  3 113 ? -6.679  -26.128 -21.088 1.00 21.83 ? 113  GLU A CG    1 
ATOM   2238 C  CD    . GLU C  3 113 ? -7.872  -25.333 -20.605 1.00 22.75 ? 113  GLU A CD    1 
ATOM   2239 O  OE1   . GLU C  3 113 ? -8.787  -25.953 -20.037 1.00 23.91 ? 113  GLU A OE1   1 
ATOM   2240 O  OE2   . GLU C  3 113 ? -7.913  -24.097 -20.802 1.00 23.65 ? 113  GLU A OE2   1 
ATOM   2241 N  N     . ARG C  3 114 ? -6.707  -28.877 -24.778 1.00 21.06 ? 114  ARG A N     1 
ATOM   2242 C  CA    . ARG C  3 114 ? -7.297  -29.825 -25.717 1.00 22.21 ? 114  ARG A CA    1 
ATOM   2243 C  C     . ARG C  3 114 ? -6.361  -31.004 -25.994 1.00 22.69 ? 114  ARG A C     1 
ATOM   2244 O  O     . ARG C  3 114 ? -6.805  -32.154 -26.085 1.00 23.48 ? 114  ARG A O     1 
ATOM   2245 C  CB    . ARG C  3 114 ? -7.734  -29.125 -27.010 1.00 22.26 ? 114  ARG A CB    1 
ATOM   2246 C  CG    . ARG C  3 114 ? -9.070  -28.378 -26.863 1.00 22.66 ? 114  ARG A CG    1 
ATOM   2247 C  CD    . ARG C  3 114 ? -9.577  -27.782 -28.179 1.00 21.97 ? 114  ARG A CD    1 
ATOM   2248 N  NE    . ARG C  3 114 ? -8.820  -26.590 -28.538 1.00 21.82 ? 114  ARG A NE    1 
ATOM   2249 C  CZ    . ARG C  3 114 ? -9.146  -25.361 -28.159 1.00 21.18 ? 114  ARG A CZ    1 
ATOM   2250 N  NH1   . ARG C  3 114 ? -10.229 -25.163 -27.426 1.00 20.47 ? 114  ARG A NH1   1 
ATOM   2251 N  NH2   . ARG C  3 114 ? -8.390  -24.334 -28.517 1.00 20.49 ? 114  ARG A NH2   1 
ATOM   2252 N  N     . ARG C  3 115 ? -5.068  -30.724 -26.101 1.00 22.28 ? 115  ARG A N     1 
ATOM   2253 C  CA    . ARG C  3 115 ? -4.095  -31.788 -26.271 1.00 22.58 ? 115  ARG A CA    1 
ATOM   2254 C  C     . ARG C  3 115 ? -4.098  -32.700 -25.049 1.00 23.24 ? 115  ARG A C     1 
ATOM   2255 O  O     . ARG C  3 115 ? -3.984  -33.924 -25.177 1.00 23.18 ? 115  ARG A O     1 
ATOM   2256 C  CB    . ARG C  3 115 ? -2.698  -31.222 -26.520 1.00 22.48 ? 115  ARG A CB    1 
ATOM   2257 C  CG    . ARG C  3 115 ? -2.519  -30.571 -27.903 1.00 23.12 ? 115  ARG A CG    1 
ATOM   2258 C  CD    . ARG C  3 115 ? -2.837  -31.538 -29.046 1.00 22.46 ? 115  ARG A CD    1 
ATOM   2259 N  NE    . ARG C  3 115 ? -2.039  -32.754 -28.937 1.00 23.42 ? 115  ARG A NE    1 
ATOM   2260 C  CZ    . ARG C  3 115 ? -2.304  -33.896 -29.562 1.00 23.16 ? 115  ARG A CZ    1 
ATOM   2261 N  NH1   . ARG C  3 115 ? -3.354  -33.998 -30.370 1.00 24.36 ? 115  ARG A NH1   1 
ATOM   2262 N  NH2   . ARG C  3 115 ? -1.515  -34.941 -29.374 1.00 22.56 ? 115  ARG A NH2   1 
ATOM   2263 N  N     . LEU C  3 116 ? -4.248  -32.103 -23.867 1.00 23.34 ? 116  LEU A N     1 
ATOM   2264 C  CA    . LEU C  3 116 ? -4.258  -32.873 -22.629 1.00 22.84 ? 116  LEU A CA    1 
ATOM   2265 C  C     . LEU C  3 116 ? -5.490  -33.777 -22.512 1.00 22.77 ? 116  LEU A C     1 
ATOM   2266 O  O     . LEU C  3 116 ? -5.390  -34.895 -22.009 1.00 22.19 ? 116  LEU A O     1 
ATOM   2267 C  CB    . LEU C  3 116 ? -4.151  -31.952 -21.417 1.00 23.56 ? 116  LEU A CB    1 
ATOM   2268 C  CG    . LEU C  3 116 ? -2.785  -31.324 -21.128 1.00 24.80 ? 116  LEU A CG    1 
ATOM   2269 C  CD1   . LEU C  3 116 ? -2.852  -30.456 -19.883 1.00 24.60 ? 116  LEU A CD1   1 
ATOM   2270 C  CD2   . LEU C  3 116 ? -1.700  -32.374 -20.967 1.00 24.45 ? 116  LEU A CD2   1 
ATOM   2271 N  N     . VAL C  3 117 ? -6.645  -33.305 -22.982 1.00 22.75 ? 117  VAL A N     1 
ATOM   2272 C  CA    . VAL C  3 117 ? -7.849  -34.134 -22.990 1.00 23.45 ? 117  VAL A CA    1 
ATOM   2273 C  C     . VAL C  3 117 ? -7.601  -35.422 -23.787 1.00 25.39 ? 117  VAL A C     1 
ATOM   2274 O  O     . VAL C  3 117 ? -7.971  -36.525 -23.350 1.00 25.66 ? 117  VAL A O     1 
ATOM   2275 C  CB    . VAL C  3 117 ? -9.085  -33.376 -23.549 1.00 22.70 ? 117  VAL A CB    1 
ATOM   2276 C  CG1   . VAL C  3 117 ? -10.230 -34.329 -23.793 1.00 21.88 ? 117  VAL A CG1   1 
ATOM   2277 C  CG2   . VAL C  3 117 ? -9.529  -32.308 -22.584 1.00 22.03 ? 117  VAL A CG2   1 
ATOM   2278 N  N     . LYS C  3 118 ? -6.966  -35.279 -24.950 1.00 25.92 ? 118  LYS A N     1 
ATOM   2279 C  CA    . LYS C  3 118 ? -6.614  -36.431 -25.757 1.00 26.95 ? 118  LYS A CA    1 
ATOM   2280 C  C     . LYS C  3 118 ? -5.611  -37.313 -25.032 1.00 26.58 ? 118  LYS A C     1 
ATOM   2281 O  O     . LYS C  3 118 ? -5.870  -38.480 -24.769 1.00 27.77 ? 118  LYS A O     1 
ATOM   2282 C  CB    . LYS C  3 118 ? -6.043  -35.993 -27.102 1.00 28.57 ? 118  LYS A CB    1 
ATOM   2283 C  CG    . LYS C  3 118 ? -7.073  -35.388 -28.030 1.00 30.40 ? 118  LYS A CG    1 
ATOM   2284 C  CD    . LYS C  3 118 ? -6.513  -35.230 -29.430 1.00 32.19 ? 118  LYS A CD    1 
ATOM   2285 C  CE    . LYS C  3 118 ? -7.351  -34.238 -30.240 1.00 34.03 ? 118  LYS A CE    1 
ATOM   2286 N  NZ    . LYS C  3 118 ? -8.795  -34.640 -30.314 1.00 34.84 ? 118  LYS A NZ    1 
ATOM   2287 N  N     . VAL C  3 119 ? -4.472  -36.735 -24.692 1.00 26.45 ? 119  VAL A N     1 
ATOM   2288 C  CA    . VAL C  3 119 ? -3.361  -37.476 -24.115 1.00 26.12 ? 119  VAL A CA    1 
ATOM   2289 C  C     . VAL C  3 119 ? -3.692  -38.153 -22.778 1.00 26.15 ? 119  VAL A C     1 
ATOM   2290 O  O     . VAL C  3 119 ? -3.058  -39.131 -22.392 1.00 26.44 ? 119  VAL A O     1 
ATOM   2291 C  CB    . VAL C  3 119 ? -2.133  -36.559 -23.977 1.00 26.02 ? 119  VAL A CB    1 
ATOM   2292 C  CG1   . VAL C  3 119 ? -1.043  -37.227 -23.155 1.00 26.43 ? 119  VAL A CG1   1 
ATOM   2293 C  CG2   . VAL C  3 119 ? -1.617  -36.184 -25.350 1.00 25.09 ? 119  VAL A CG2   1 
ATOM   2294 N  N     . LEU C  3 120 ? -4.690  -37.645 -22.074 1.00 26.40 ? 120  LEU A N     1 
ATOM   2295 C  CA    . LEU C  3 120 ? -5.083  -38.253 -20.810 1.00 26.76 ? 120  LEU A CA    1 
ATOM   2296 C  C     . LEU C  3 120 ? -6.357  -39.084 -20.954 1.00 26.92 ? 120  LEU A C     1 
ATOM   2297 O  O     . LEU C  3 120 ? -7.033  -39.380 -19.970 1.00 26.26 ? 120  LEU A O     1 
ATOM   2298 C  CB    . LEU C  3 120 ? -5.246  -37.176 -19.747 1.00 26.72 ? 120  LEU A CB    1 
ATOM   2299 C  CG    . LEU C  3 120 ? -3.988  -36.308 -19.638 1.00 26.40 ? 120  LEU A CG    1 
ATOM   2300 C  CD1   . LEU C  3 120 ? -4.279  -35.005 -18.892 1.00 25.63 ? 120  LEU A CD1   1 
ATOM   2301 C  CD2   . LEU C  3 120 ? -2.860  -37.098 -18.976 1.00 26.02 ? 120  LEU A CD2   1 
ATOM   2302 N  N     . ASN C  3 121 ? -6.659  -39.452 -22.197 1.00 27.58 ? 121  ASN A N     1 
ATOM   2303 C  CA    . ASN C  3 121 ? -7.788  -40.313 -22.539 1.00 28.31 ? 121  ASN A CA    1 
ATOM   2304 C  C     . ASN C  3 121 ? -9.129  -39.831 -22.007 1.00 28.39 ? 121  ASN A C     1 
ATOM   2305 O  O     . ASN C  3 121 ? -9.882  -40.612 -21.420 1.00 29.54 ? 121  ASN A O     1 
ATOM   2306 C  CB    . ASN C  3 121 ? -7.530  -41.761 -22.102 1.00 28.97 ? 121  ASN A CB    1 
ATOM   2307 C  CG    . ASN C  3 121 ? -6.237  -42.323 -22.677 1.00 30.13 ? 121  ASN A CG    1 
ATOM   2308 O  OD1   . ASN C  3 121 ? -5.318  -42.676 -21.935 1.00 29.91 ? 121  ASN A OD1   1 
ATOM   2309 N  ND2   . ASN C  3 121 ? -6.155  -42.397 -24.008 1.00 30.52 ? 121  ASN A ND2   1 
ATOM   2310 N  N     . ASN C  3 122 ? -9.429  -38.553 -22.223 1.00 27.48 ? 122  ASN A N     1 
ATOM   2311 C  CA    . ASN C  3 122 ? -10.735 -38.000 -21.863 1.00 26.42 ? 122  ASN A CA    1 
ATOM   2312 C  C     . ASN C  3 122 ? -11.032 -38.063 -20.379 1.00 25.83 ? 122  ASN A C     1 
ATOM   2313 O  O     . ASN C  3 122 ? -12.039 -38.643 -19.976 1.00 24.72 ? 122  ASN A O     1 
ATOM   2314 C  CB    . ASN C  3 122 ? -11.840 -38.749 -22.594 1.00 26.50 ? 122  ASN A CB    1 
ATOM   2315 C  CG    . ASN C  3 122 ? -11.705 -38.669 -24.089 1.00 27.38 ? 122  ASN A CG    1 
ATOM   2316 O  OD1   . ASN C  3 122 ? -10.956 -37.846 -24.624 1.00 27.61 ? 122  ASN A OD1   1 
ATOM   2317 N  ND2   . ASN C  3 122 ? -12.438 -39.526 -24.782 1.00 28.26 ? 122  ASN A ND2   1 
ATOM   2318 N  N     . PRO C  3 123 ? -10.169 -37.457 -19.554 1.00 25.83 ? 123  PRO A N     1 
ATOM   2319 C  CA    . PRO C  3 123 ? -10.428 -37.553 -18.133 1.00 26.04 ? 123  PRO A CA    1 
ATOM   2320 C  C     . PRO C  3 123 ? -11.605 -36.660 -17.805 1.00 26.78 ? 123  PRO A C     1 
ATOM   2321 O  O     . PRO C  3 123 ? -11.777 -35.606 -18.429 1.00 27.05 ? 123  PRO A O     1 
ATOM   2322 C  CB    . PRO C  3 123 ? -9.156  -36.986 -17.509 1.00 25.54 ? 123  PRO A CB    1 
ATOM   2323 C  CG    . PRO C  3 123 ? -8.648  -36.028 -18.521 1.00 25.74 ? 123  PRO A CG    1 
ATOM   2324 C  CD    . PRO C  3 123 ? -8.981  -36.640 -19.850 1.00 26.05 ? 123  PRO A CD    1 
ATOM   2325 N  N     . THR C  3 124 ? -12.421 -37.081 -16.850 1.00 26.22 ? 124  THR A N     1 
ATOM   2326 C  CA    . THR C  3 124 ? -13.539 -36.264 -16.432 1.00 26.37 ? 124  THR A CA    1 
ATOM   2327 C  C     . THR C  3 124 ? -13.281 -35.716 -15.037 1.00 26.20 ? 124  THR A C     1 
ATOM   2328 O  O     . THR C  3 124 ? -14.007 -34.846 -14.559 1.00 26.76 ? 124  THR A O     1 
ATOM   2329 C  CB    . THR C  3 124 ? -14.842 -37.069 -16.435 1.00 26.38 ? 124  THR A CB    1 
ATOM   2330 O  OG1   . THR C  3 124 ? -14.705 -38.181 -15.550 1.00 26.90 ? 124  THR A OG1   1 
ATOM   2331 C  CG2   . THR C  3 124 ? -15.143 -37.590 -17.829 1.00 26.62 ? 124  THR A CG2   1 
ATOM   2332 N  N     . THR C  3 125 ? -12.246 -36.231 -14.381 1.00 25.33 ? 125  THR A N     1 
ATOM   2333 C  CA    . THR C  3 125 ? -11.978 -35.851 -13.004 1.00 24.76 ? 125  THR A CA    1 
ATOM   2334 C  C     . THR C  3 125 ? -10.498 -35.630 -12.722 1.00 24.90 ? 125  THR A C     1 
ATOM   2335 O  O     . THR C  3 125 ? -9.628  -36.305 -13.279 1.00 24.55 ? 125  THR A O     1 
ATOM   2336 C  CB    . THR C  3 125 ? -12.479 -36.914 -12.012 1.00 24.05 ? 125  THR A CB    1 
ATOM   2337 O  OG1   . THR C  3 125 ? -11.626 -38.056 -12.085 1.00 24.39 ? 125  THR A OG1   1 
ATOM   2338 C  CG2   . THR C  3 125 ? -13.894 -37.332 -12.332 1.00 23.94 ? 125  THR A CG2   1 
ATOM   2339 N  N     . SER C  3 126 ? -10.228 -34.675 -11.839 1.00 24.51 ? 126  SER A N     1 
ATOM   2340 C  CA    . SER C  3 126 ? -8.898  -34.496 -11.293 1.00 24.19 ? 126  SER A CA    1 
ATOM   2341 C  C     . SER C  3 126 ? -8.570  -35.736 -10.478 1.00 23.13 ? 126  SER A C     1 
ATOM   2342 O  O     . SER C  3 126 ? -9.473  -36.439 -10.044 1.00 22.28 ? 126  SER A O     1 
ATOM   2343 C  CB    . SER C  3 126 ? -8.865  -33.282 -10.373 1.00 23.88 ? 126  SER A CB    1 
ATOM   2344 O  OG    . SER C  3 126 ? -9.174  -33.682 -9.053  1.00 24.86 ? 126  SER A OG    1 
ATOM   2345 N  N     . PRO C  3 127 ? -7.276  -36.003 -10.262 1.00 23.35 ? 127  PRO A N     1 
ATOM   2346 C  CA    . PRO C  3 127 ? -6.832  -37.130 -9.442  1.00 23.70 ? 127  PRO A CA    1 
ATOM   2347 C  C     . PRO C  3 127 ? -7.388  -37.101 -8.018  1.00 23.78 ? 127  PRO A C     1 
ATOM   2348 O  O     . PRO C  3 127 ? -7.356  -38.107 -7.325  1.00 23.48 ? 127  PRO A O     1 
ATOM   2349 C  CB    . PRO C  3 127 ? -5.308  -36.967 -9.416  1.00 22.88 ? 127  PRO A CB    1 
ATOM   2350 C  CG    . PRO C  3 127 ? -5.062  -35.564 -9.817  1.00 23.41 ? 127  PRO A CG    1 
ATOM   2351 C  CD    . PRO C  3 127 ? -6.138  -35.248 -10.799 1.00 23.07 ? 127  PRO A CD    1 
ATOM   2352 N  N     . PHE C  3 128 ? -7.907  -35.965 -7.584  1.00 25.15 ? 128  PHE A N     1 
ATOM   2353 C  CA    . PHE C  3 128 ? -8.471  -35.891 -6.241  1.00 26.20 ? 128  PHE A CA    1 
ATOM   2354 C  C     . PHE C  3 128 ? -9.932  -36.326 -6.172  1.00 25.94 ? 128  PHE A C     1 
ATOM   2355 O  O     . PHE C  3 128 ? -10.497 -36.393 -5.088  1.00 25.83 ? 128  PHE A O     1 
ATOM   2356 C  CB    . PHE C  3 128 ? -8.320  -34.488 -5.675  1.00 27.46 ? 128  PHE A CB    1 
ATOM   2357 C  CG    . PHE C  3 128 ? -6.893  -34.053 -5.521  1.00 29.05 ? 128  PHE A CG    1 
ATOM   2358 C  CD1   . PHE C  3 128 ? -6.225  -33.431 -6.567  1.00 29.32 ? 128  PHE A CD1   1 
ATOM   2359 C  CD2   . PHE C  3 128 ? -6.220  -34.252 -4.324  1.00 29.12 ? 128  PHE A CD2   1 
ATOM   2360 C  CE1   . PHE C  3 128 ? -4.910  -33.022 -6.421  1.00 29.46 ? 128  PHE A CE1   1 
ATOM   2361 C  CE2   . PHE C  3 128 ? -4.908  -33.845 -4.172  1.00 29.41 ? 128  PHE A CE2   1 
ATOM   2362 C  CZ    . PHE C  3 128 ? -4.250  -33.234 -5.222  1.00 29.23 ? 128  PHE A CZ    1 
ATOM   2363 N  N     . GLY C  3 129 ? -10.535 -36.625 -7.321  1.00 25.26 ? 129  GLY A N     1 
ATOM   2364 C  CA    . GLY C  3 129 ? -11.925 -37.062 -7.365  1.00 25.08 ? 129  GLY A CA    1 
ATOM   2365 C  C     . GLY C  3 129 ? -12.874 -36.003 -7.905  1.00 25.28 ? 129  GLY A C     1 
ATOM   2366 O  O     . GLY C  3 129 ? -13.938 -36.328 -8.425  1.00 25.58 ? 129  GLY A O     1 
ATOM   2367 N  N     . ASN C  3 130 ? -12.477 -34.738 -7.791  1.00 25.21 ? 130  ASN A N     1 
ATOM   2368 C  CA    . ASN C  3 130 ? -13.285 -33.593 -8.239  1.00 25.35 ? 130  ASN A CA    1 
ATOM   2369 C  C     . ASN C  3 130 ? -13.486 -33.509 -9.753  1.00 24.49 ? 130  ASN A C     1 
ATOM   2370 O  O     . ASN C  3 130 ? -12.541 -33.711 -10.515 1.00 24.10 ? 130  ASN A O     1 
ATOM   2371 C  CB    . ASN C  3 130 ? -12.630 -32.297 -7.760  1.00 26.21 ? 130  ASN A CB    1 
ATOM   2372 C  CG    . ASN C  3 130 ? -12.275 -32.336 -6.294  1.00 26.71 ? 130  ASN A CG    1 
ATOM   2373 O  OD1   . ASN C  3 130 ? -11.111 -32.208 -5.921  1.00 28.27 ? 130  ASN A OD1   1 
ATOM   2374 N  ND2   . ASN C  3 130 ? -13.276 -32.528 -5.451  1.00 27.12 ? 130  ASN A ND2   1 
ATOM   2375 N  N     . PRO C  3 131 ? -14.712 -33.171 -10.192 1.00 23.75 ? 131  PRO A N     1 
ATOM   2376 C  CA    . PRO C  3 131 ? -15.034 -33.134 -11.621 1.00 22.98 ? 131  PRO A CA    1 
ATOM   2377 C  C     . PRO C  3 131 ? -14.282 -32.031 -12.353 1.00 22.79 ? 131  PRO A C     1 
ATOM   2378 O  O     . PRO C  3 131 ? -14.073 -30.946 -11.803 1.00 22.83 ? 131  PRO A O     1 
ATOM   2379 C  CB    . PRO C  3 131 ? -16.546 -32.824 -11.655 1.00 22.96 ? 131  PRO A CB    1 
ATOM   2380 C  CG    . PRO C  3 131 ? -17.040 -32.946 -10.266 1.00 22.88 ? 131  PRO A CG    1 
ATOM   2381 C  CD    . PRO C  3 131 ? -15.856 -32.779 -9.350  1.00 23.82 ? 131  PRO A CD    1 
ATOM   2382 N  N     . ILE C  3 132 ? -13.881 -32.304 -13.589 1.00 21.77 ? 132  ILE A N     1 
ATOM   2383 C  CA    . ILE C  3 132 ? -13.310 -31.271 -14.435 1.00 21.12 ? 132  ILE A CA    1 
ATOM   2384 C  C     . ILE C  3 132 ? -14.419 -30.528 -15.173 1.00 21.64 ? 132  ILE A C     1 
ATOM   2385 O  O     . ILE C  3 132 ? -15.073 -31.099 -16.046 1.00 23.70 ? 132  ILE A O     1 
ATOM   2386 C  CB    . ILE C  3 132 ? -12.344 -31.862 -15.454 1.00 20.17 ? 132  ILE A CB    1 
ATOM   2387 C  CG1   . ILE C  3 132 ? -11.224 -32.620 -14.737 1.00 19.88 ? 132  ILE A CG1   1 
ATOM   2388 C  CG2   . ILE C  3 132 ? -11.778 -30.767 -16.343 1.00 19.15 ? 132  ILE A CG2   1 
ATOM   2389 C  CD1   . ILE C  3 132 ? -10.202 -33.178 -15.666 1.00 18.87 ? 132  ILE A CD1   1 
ATOM   2390 N  N     . PRO C  3 133 ? -14.629 -29.246 -14.836 1.00 20.91 ? 133  PRO A N     1 
ATOM   2391 C  CA    . PRO C  3 133 ? -15.747 -28.499 -15.400 1.00 20.27 ? 133  PRO A CA    1 
ATOM   2392 C  C     . PRO C  3 133 ? -15.416 -27.937 -16.764 1.00 19.92 ? 133  PRO A C     1 
ATOM   2393 O  O     . PRO C  3 133 ? -14.252 -27.899 -17.135 1.00 20.68 ? 133  PRO A O     1 
ATOM   2394 C  CB    . PRO C  3 133 ? -15.920 -27.351 -14.405 1.00 20.12 ? 133  PRO A CB    1 
ATOM   2395 C  CG    . PRO C  3 133 ? -14.535 -27.077 -13.936 1.00 20.32 ? 133  PRO A CG    1 
ATOM   2396 C  CD    . PRO C  3 133 ? -13.830 -28.424 -13.905 1.00 20.34 ? 133  PRO A CD    1 
ATOM   2397 N  N     . GLY C  3 134 ? -16.437 -27.510 -17.504 1.00 20.02 ? 134  GLY A N     1 
ATOM   2398 C  CA    . GLY C  3 134 ? -16.252 -26.732 -18.731 1.00 18.97 ? 134  GLY A CA    1 
ATOM   2399 C  C     . GLY C  3 134 ? -15.584 -27.375 -19.937 1.00 19.43 ? 134  GLY A C     1 
ATOM   2400 O  O     . GLY C  3 134 ? -15.002 -26.680 -20.775 1.00 20.31 ? 134  GLY A O     1 
ATOM   2401 N  N     . LEU C  3 135 ? -15.670 -28.693 -20.053 1.00 18.84 ? 135  LEU A N     1 
ATOM   2402 C  CA    . LEU C  3 135 ? -15.129 -29.368 -21.228 1.00 19.23 ? 135  LEU A CA    1 
ATOM   2403 C  C     . LEU C  3 135 ? -15.988 -29.161 -22.480 1.00 20.06 ? 135  LEU A C     1 
ATOM   2404 O  O     . LEU C  3 135 ? -15.490 -29.288 -23.595 1.00 21.11 ? 135  LEU A O     1 
ATOM   2405 C  CB    . LEU C  3 135 ? -14.954 -30.857 -20.959 1.00 19.00 ? 135  LEU A CB    1 
ATOM   2406 C  CG    . LEU C  3 135 ? -14.085 -31.186 -19.748 1.00 19.40 ? 135  LEU A CG    1 
ATOM   2407 C  CD1   . LEU C  3 135 ? -14.409 -32.568 -19.219 1.00 18.93 ? 135  LEU A CD1   1 
ATOM   2408 C  CD2   . LEU C  3 135 ? -12.605 -31.062 -20.094 1.00 18.93 ? 135  LEU A CD2   1 
ATOM   2409 N  N     . VAL C  3 136 ? -17.270 -28.849 -22.302 1.00 20.16 ? 136  VAL A N     1 
ATOM   2410 C  CA    . VAL C  3 136 ? -18.141 -28.558 -23.439 1.00 21.15 ? 136  VAL A CA    1 
ATOM   2411 C  C     . VAL C  3 136 ? -17.710 -27.250 -24.059 1.00 22.04 ? 136  VAL A C     1 
ATOM   2412 O  O     . VAL C  3 136 ? -17.611 -27.124 -25.285 1.00 22.16 ? 136  VAL A O     1 
ATOM   2413 C  CB    . VAL C  3 136 ? -19.628 -28.437 -23.024 1.00 21.41 ? 136  VAL A CB    1 
ATOM   2414 C  CG1   . VAL C  3 136 ? -20.445 -27.720 -24.104 1.00 20.61 ? 136  VAL A CG1   1 
ATOM   2415 C  CG2   . VAL C  3 136 ? -20.210 -29.808 -22.724 1.00 21.37 ? 136  VAL A CG2   1 
ATOM   2416 N  N     . GLU C  3 137 ? -17.455 -26.273 -23.200 1.00 22.47 ? 137  GLU A N     1 
ATOM   2417 C  CA    . GLU C  3 137 ? -17.014 -24.972 -23.662 1.00 24.44 ? 137  GLU A CA    1 
ATOM   2418 C  C     . GLU C  3 137 ? -15.663 -25.120 -24.342 1.00 24.62 ? 137  GLU A C     1 
ATOM   2419 O  O     . GLU C  3 137 ? -15.433 -24.564 -25.409 1.00 25.16 ? 137  GLU A O     1 
ATOM   2420 C  CB    . GLU C  3 137 ? -16.934 -23.984 -22.496 1.00 25.32 ? 137  GLU A CB    1 
ATOM   2421 C  CG    . GLU C  3 137 ? -18.264 -23.727 -21.789 1.00 25.29 ? 137  GLU A CG    1 
ATOM   2422 C  CD    . GLU C  3 137 ? -18.654 -24.837 -20.827 1.00 26.36 ? 137  GLU A CD    1 
ATOM   2423 O  OE1   . GLU C  3 137 ? -18.344 -26.025 -21.100 1.00 26.79 ? 137  GLU A OE1   1 
ATOM   2424 O  OE2   . GLU C  3 137 ? -19.286 -24.519 -19.797 1.00 25.99 ? 137  GLU A OE2   1 
ATOM   2425 N  N     . LEU C  3 138 ? -14.774 -25.893 -23.728 1.00 25.20 ? 138  LEU A N     1 
ATOM   2426 C  CA    . LEU C  3 138 ? -13.490 -26.208 -24.343 1.00 24.49 ? 138  LEU A CA    1 
ATOM   2427 C  C     . LEU C  3 138 ? -13.741 -26.702 -25.757 1.00 24.49 ? 138  LEU A C     1 
ATOM   2428 O  O     . LEU C  3 138 ? -12.947 -26.452 -26.656 1.00 23.60 ? 138  LEU A O     1 
ATOM   2429 C  CB    . LEU C  3 138 ? -12.769 -27.291 -23.541 1.00 23.55 ? 138  LEU A CB    1 
ATOM   2430 C  CG    . LEU C  3 138 ? -11.254 -27.180 -23.353 1.00 23.34 ? 138  LEU A CG    1 
ATOM   2431 C  CD1   . LEU C  3 138 ? -10.663 -28.537 -23.012 1.00 22.81 ? 138  LEU A CD1   1 
ATOM   2432 C  CD2   . LEU C  3 138 ? -10.562 -26.607 -24.561 1.00 23.22 ? 138  LEU A CD2   1 
ATOM   2433 N  N     . GLY C  3 139 ? -14.857 -27.405 -25.938 1.00 25.81 ? 139  GLY A N     1 
ATOM   2434 C  CA    . GLY C  3 139 ? -15.242 -27.966 -27.234 1.00 27.45 ? 139  GLY A CA    1 
ATOM   2435 C  C     . GLY C  3 139 ? -14.825 -29.418 -27.472 1.00 28.57 ? 139  GLY A C     1 
ATOM   2436 O  O     . GLY C  3 139 ? -14.785 -29.881 -28.620 1.00 29.23 ? 139  GLY A O     1 
ATOM   2437 N  N     . VAL C  3 140 ? -14.510 -30.150 -26.406 1.00 27.87 ? 140  VAL A N     1 
ATOM   2438 C  CA    . VAL C  3 140 ? -14.022 -31.523 -26.576 1.00 27.96 ? 140  VAL A CA    1 
ATOM   2439 C  C     . VAL C  3 140 ? -15.101 -32.561 -26.288 1.00 28.60 ? 140  VAL A C     1 
ATOM   2440 O  O     . VAL C  3 140 ? -14.913 -33.751 -26.533 1.00 28.05 ? 140  VAL A O     1 
ATOM   2441 C  CB    . VAL C  3 140 ? -12.773 -31.818 -25.706 1.00 27.03 ? 140  VAL A CB    1 
ATOM   2442 C  CG1   . VAL C  3 140 ? -11.632 -30.889 -26.079 1.00 25.97 ? 140  VAL A CG1   1 
ATOM   2443 C  CG2   . VAL C  3 140 ? -13.109 -31.718 -24.217 1.00 26.67 ? 140  VAL A CG2   1 
ATOM   2444 N  N     . ALA C  3 141 ? -16.235 -32.101 -25.770 1.00 29.71 ? 141  ALA A N     1 
ATOM   2445 C  CA    . ALA C  3 141 ? -17.302 -33.001 -25.380 1.00 30.37 ? 141  ALA A CA    1 
ATOM   2446 C  C     . ALA C  3 141 ? -18.667 -32.352 -25.559 1.00 30.90 ? 141  ALA A C     1 
ATOM   2447 O  O     . ALA C  3 141 ? -18.771 -31.147 -25.764 1.00 30.38 ? 141  ALA A O     1 
ATOM   2448 C  CB    . ALA C  3 141 ? -17.103 -33.443 -23.935 1.00 30.20 ? 141  ALA A CB    1 
ATOM   2449 N  N     . SER C  3 142 ? -19.711 -33.169 -25.483 1.00 31.99 ? 142  SER A N     1 
ATOM   2450 C  CA    . SER C  3 142 ? -21.074 -32.673 -25.503 1.00 33.30 ? 142  SER A CA    1 
ATOM   2451 C  C     . SER C  3 142 ? -21.801 -33.109 -24.245 1.00 34.13 ? 142  SER A C     1 
ATOM   2452 O  O     . SER C  3 142 ? -21.699 -34.254 -23.826 1.00 34.17 ? 142  SER A O     1 
ATOM   2453 C  CB    . SER C  3 142 ? -21.815 -33.201 -26.727 1.00 34.07 ? 142  SER A CB    1 
ATOM   2454 O  OG    . SER C  3 142 ? -21.540 -32.407 -27.866 1.00 34.89 ? 142  SER A OG    1 
ATOM   2455 N  N     . GLU C  3 143 ? -22.536 -32.191 -23.633 1.00 35.73 ? 143  GLU A N     1 
ATOM   2456 C  CA    . GLU C  3 143 ? -23.333 -32.548 -22.474 1.00 36.55 ? 143  GLU A CA    1 
ATOM   2457 C  C     . GLU C  3 143 ? -24.457 -33.486 -22.904 1.00 37.03 ? 143  GLU A C     1 
ATOM   2458 O  O     . GLU C  3 143 ? -25.202 -33.195 -23.846 1.00 37.07 ? 143  GLU A O     1 
ATOM   2459 C  CB    . GLU C  3 143 ? -23.913 -31.299 -21.807 1.00 36.94 ? 143  GLU A CB    1 
ATOM   2460 N  N     . ASN C  3 144 ? -24.560 -34.624 -22.231 1.00 36.74 ? 144  ASN A N     1 
ATOM   2461 C  CA    . ASN C  3 144 ? -25.698 -35.497 -22.436 1.00 37.53 ? 144  ASN A CA    1 
ATOM   2462 C  C     . ASN C  3 144 ? -26.200 -35.985 -21.080 1.00 36.91 ? 144  ASN A C     1 
ATOM   2463 O  O     . ASN C  3 144 ? -25.423 -36.447 -20.248 1.00 37.03 ? 144  ASN A O     1 
ATOM   2464 C  CB    . ASN C  3 144 ? -25.353 -36.641 -23.399 1.00 38.94 ? 144  ASN A CB    1 
ATOM   2465 C  CG    . ASN C  3 144 ? -25.381 -38.003 -22.736 1.00 40.25 ? 144  ASN A CG    1 
ATOM   2466 O  OD1   . ASN C  3 144 ? -24.354 -38.679 -22.618 1.00 40.57 ? 144  ASN A OD1   1 
ATOM   2467 N  ND2   . ASN C  3 144 ? -26.567 -38.422 -22.309 1.00 40.94 ? 144  ASN A ND2   1 
ATOM   2468 N  N     . LEU C  3 145 ? -27.501 -35.858 -20.859 1.00 35.95 ? 145  LEU A N     1 
ATOM   2469 C  CA    . LEU C  3 145 ? -28.056 -35.996 -19.523 1.00 35.00 ? 145  LEU A CA    1 
ATOM   2470 C  C     . LEU C  3 145 ? -28.448 -37.406 -19.147 1.00 34.24 ? 145  LEU A C     1 
ATOM   2471 O  O     . LEU C  3 145 ? -28.958 -38.169 -19.963 1.00 33.79 ? 145  LEU A O     1 
ATOM   2472 C  CB    . LEU C  3 145 ? -29.260 -35.076 -19.367 1.00 36.04 ? 145  LEU A CB    1 
ATOM   2473 C  CG    . LEU C  3 145 ? -28.916 -33.591 -19.286 1.00 36.37 ? 145  LEU A CG    1 
ATOM   2474 C  CD1   . LEU C  3 145 ? -30.186 -32.751 -19.325 1.00 36.06 ? 145  LEU A CD1   1 
ATOM   2475 C  CD2   . LEU C  3 145 ? -28.090 -33.311 -18.027 1.00 36.12 ? 145  LEU A CD2   1 
ATOM   2476 N  N     . TYR C  3 146 ? -28.210 -37.737 -17.889 1.00 33.77 ? 146  TYR A N     1 
ATOM   2477 C  CA    . TYR C  3 146 ? -28.564 -39.036 -17.354 1.00 33.47 ? 146  TYR A CA    1 
ATOM   2478 C  C     . TYR C  3 146 ? -29.534 -38.823 -16.196 1.00 32.39 ? 146  TYR A C     1 
ATOM   2479 O  O     . TYR C  3 146 ? -29.336 -37.937 -15.370 1.00 32.11 ? 146  TYR A O     1 
ATOM   2480 C  CB    . TYR C  3 146 ? -27.303 -39.779 -16.888 1.00 34.81 ? 146  TYR A CB    1 
ATOM   2481 C  CG    . TYR C  3 146 ? -27.575 -41.154 -16.327 1.00 34.95 ? 146  TYR A CG    1 
ATOM   2482 C  CD1   . TYR C  3 146 ? -27.667 -42.256 -17.171 1.00 34.85 ? 146  TYR A CD1   1 
ATOM   2483 C  CD2   . TYR C  3 146 ? -27.758 -41.349 -14.957 1.00 34.77 ? 146  TYR A CD2   1 
ATOM   2484 C  CE1   . TYR C  3 146 ? -27.931 -43.512 -16.677 1.00 35.33 ? 146  TYR A CE1   1 
ATOM   2485 C  CE2   . TYR C  3 146 ? -28.023 -42.604 -14.443 1.00 35.25 ? 146  TYR A CE2   1 
ATOM   2486 C  CZ    . TYR C  3 146 ? -28.108 -43.690 -15.310 1.00 35.98 ? 146  TYR A CZ    1 
ATOM   2487 O  OH    . TYR C  3 146 ? -28.366 -44.964 -14.824 1.00 35.83 ? 146  TYR A OH    1 
ATOM   2488 N  N     . PHE C  3 147 ? -30.578 -39.640 -16.137 1.00 31.61 ? 147  PHE A N     1 
ATOM   2489 C  CA    . PHE C  3 147 ? -31.643 -39.450 -15.163 1.00 31.00 ? 147  PHE A CA    1 
ATOM   2490 C  C     . PHE C  3 147 ? -31.587 -40.493 -14.053 1.00 30.78 ? 147  PHE A C     1 
ATOM   2491 O  O     . PHE C  3 147 ? -32.247 -41.526 -14.131 1.00 31.29 ? 147  PHE A O     1 
ATOM   2492 C  CB    . PHE C  3 147 ? -33.010 -39.451 -15.868 1.00 30.04 ? 147  PHE A CB    1 
ATOM   2493 C  CG    . PHE C  3 147 ? -33.152 -38.370 -16.910 1.00 30.12 ? 147  PHE A CG    1 
ATOM   2494 C  CD1   . PHE C  3 147 ? -32.569 -38.510 -18.167 1.00 30.79 ? 147  PHE A CD1   1 
ATOM   2495 C  CD2   . PHE C  3 147 ? -33.848 -37.205 -16.634 1.00 30.08 ? 147  PHE A CD2   1 
ATOM   2496 C  CE1   . PHE C  3 147 ? -32.678 -37.506 -19.132 1.00 30.21 ? 147  PHE A CE1   1 
ATOM   2497 C  CE2   . PHE C  3 147 ? -33.961 -36.198 -17.593 1.00 29.91 ? 147  PHE A CE2   1 
ATOM   2498 C  CZ    . PHE C  3 147 ? -33.376 -36.351 -18.841 1.00 29.91 ? 147  PHE A CZ    1 
ATOM   2499 N  N     . GLU D  3 3   ? 1.592   -10.310 -18.234 1.00 30.73 ? 3    GLU B N     1 
ATOM   2500 C  CA    . GLU D  3 3   ? 1.788   -10.967 -19.558 1.00 31.45 ? 3    GLU B CA    1 
ATOM   2501 C  C     . GLU D  3 3   ? 3.202   -11.512 -19.701 1.00 30.14 ? 3    GLU B C     1 
ATOM   2502 O  O     . GLU D  3 3   ? 3.400   -12.567 -20.297 1.00 31.67 ? 3    GLU B O     1 
ATOM   2503 C  CB    . GLU D  3 3   ? 1.473   -10.013 -20.708 1.00 32.01 ? 3    GLU B CB    1 
ATOM   2504 C  CG    . GLU D  3 3   ? 2.016   -10.468 -22.061 1.00 33.91 ? 3    GLU B CG    1 
ATOM   2505 C  CD    . GLU D  3 3   ? 1.664   -9.501  -23.191 1.00 34.85 ? 3    GLU B CD    1 
ATOM   2506 O  OE1   . GLU D  3 3   ? 1.389   -8.311  -22.906 1.00 35.79 ? 3    GLU B OE1   1 
ATOM   2507 O  OE2   . GLU D  3 3   ? 1.663   -9.929  -24.367 1.00 36.12 ? 3    GLU B OE2   1 
ATOM   2508 N  N     . LEU D  3 4   ? 4.189   -10.800 -19.166 1.00 27.49 ? 4    LEU B N     1 
ATOM   2509 C  CA    . LEU D  3 4   ? 5.513   -11.387 -19.040 1.00 24.81 ? 4    LEU B CA    1 
ATOM   2510 C  C     . LEU D  3 4   ? 5.452   -12.512 -18.014 1.00 24.25 ? 4    LEU B C     1 
ATOM   2511 O  O     . LEU D  3 4   ? 6.253   -13.448 -18.048 1.00 25.10 ? 4    LEU B O     1 
ATOM   2512 C  CB    . LEU D  3 4   ? 6.543   -10.353 -18.605 1.00 23.70 ? 4    LEU B CB    1 
ATOM   2513 C  CG    . LEU D  3 4   ? 7.039   -9.333  -19.628 1.00 23.71 ? 4    LEU B CG    1 
ATOM   2514 C  CD1   . LEU D  3 4   ? 8.290   -8.657  -19.081 1.00 23.02 ? 4    LEU B CD1   1 
ATOM   2515 C  CD2   . LEU D  3 4   ? 7.318   -9.967  -20.989 1.00 22.47 ? 4    LEU B CD2   1 
ATOM   2516 N  N     . VAL D  3 5   ? 4.478   -12.413 -17.117 1.00 22.34 ? 5    VAL B N     1 
ATOM   2517 C  CA    . VAL D  3 5   ? 4.315   -13.334 -15.991 1.00 21.44 ? 5    VAL B CA    1 
ATOM   2518 C  C     . VAL D  3 5   ? 5.277   -13.034 -14.858 1.00 20.33 ? 5    VAL B C     1 
ATOM   2519 O  O     . VAL D  3 5   ? 4.846   -12.738 -13.750 1.00 20.17 ? 5    VAL B O     1 
ATOM   2520 C  CB    . VAL D  3 5   ? 4.412   -14.813 -16.373 1.00 21.23 ? 5    VAL B CB    1 
ATOM   2521 C  CG1   . VAL D  3 5   ? 4.107   -15.662 -15.147 1.00 21.26 ? 5    VAL B CG1   1 
ATOM   2522 C  CG2   . VAL D  3 5   ? 3.426   -15.139 -17.486 1.00 21.22 ? 5    VAL B CG2   1 
ATOM   2523 N  N     . ASP D  3 6   ? 6.575   -13.125 -15.132 1.00 20.52 ? 6    ASP B N     1 
ATOM   2524 C  CA    . ASP D  3 6   ? 7.580   -12.534 -14.248 1.00 19.79 ? 6    ASP B CA    1 
ATOM   2525 C  C     . ASP D  3 6   ? 8.585   -11.688 -15.024 1.00 18.25 ? 6    ASP B C     1 
ATOM   2526 O  O     . ASP D  3 6   ? 9.464   -12.204 -15.715 1.00 17.35 ? 6    ASP B O     1 
ATOM   2527 C  CB    . ASP D  3 6   ? 8.298   -13.573 -13.379 1.00 21.34 ? 6    ASP B CB    1 
ATOM   2528 C  CG    . ASP D  3 6   ? 9.238   -12.926 -12.381 1.00 22.85 ? 6    ASP B CG    1 
ATOM   2529 O  OD1   . ASP D  3 6   ? 8.869   -12.817 -11.194 1.00 24.45 ? 6    ASP B OD1   1 
ATOM   2530 O  OD2   . ASP D  3 6   ? 10.331  -12.474 -12.787 1.00 23.55 ? 6    ASP B OD2   1 
ATOM   2531 N  N     . THR D  3 7   ? 8.422   -10.376 -14.895 1.00 16.82 ? 7    THR B N     1 
ATOM   2532 C  CA    . THR D  3 7   ? 9.297   -9.387  -15.507 1.00 15.54 ? 7    THR B CA    1 
ATOM   2533 C  C     . THR D  3 7   ? 10.782  -9.673  -15.257 1.00 15.15 ? 7    THR B C     1 
ATOM   2534 O  O     . THR D  3 7   ? 11.590  -9.694  -16.181 1.00 12.90 ? 7    THR B O     1 
ATOM   2535 C  CB    . THR D  3 7   ? 8.942   -7.979  -14.959 1.00 14.85 ? 7    THR B CB    1 
ATOM   2536 O  OG1   . THR D  3 7   ? 7.626   -7.629  -15.387 1.00 14.37 ? 7    THR B OG1   1 
ATOM   2537 C  CG2   . THR D  3 7   ? 9.919   -6.926  -15.446 1.00 14.26 ? 7    THR B CG2   1 
ATOM   2538 N  N     . THR D  3 8   ? 11.120  -9.885  -13.988 1.00 16.17 ? 8    THR B N     1 
ATOM   2539 C  CA    . THR D  3 8   ? 12.501  -10.061 -13.539 1.00 15.60 ? 8    THR B CA    1 
ATOM   2540 C  C     . THR D  3 8   ? 13.142  -11.283 -14.173 1.00 15.49 ? 8    THR B C     1 
ATOM   2541 O  O     . THR D  3 8   ? 14.251  -11.207 -14.702 1.00 15.62 ? 8    THR B O     1 
ATOM   2542 C  CB    . THR D  3 8   ? 12.547  -10.181 -12.004 1.00 16.07 ? 8    THR B CB    1 
ATOM   2543 O  OG1   . THR D  3 8   ? 12.410  -8.879  -11.434 1.00 16.01 ? 8    THR B OG1   1 
ATOM   2544 C  CG2   . THR D  3 8   ? 13.847  -10.795 -11.521 1.00 16.54 ? 8    THR B CG2   1 
ATOM   2545 N  N     . GLU D  3 9   ? 12.443  -12.407 -14.124 1.00 14.58 ? 9    GLU B N     1 
ATOM   2546 C  CA    . GLU D  3 9   ? 12.940  -13.621 -14.749 1.00 15.70 ? 9    GLU B CA    1 
ATOM   2547 C  C     . GLU D  3 9   ? 13.056  -13.444 -16.266 1.00 16.90 ? 9    GLU B C     1 
ATOM   2548 O  O     . GLU D  3 9   ? 13.995  -13.956 -16.894 1.00 17.85 ? 9    GLU B O     1 
ATOM   2549 C  CB    . GLU D  3 9   ? 12.039  -14.814 -14.417 1.00 15.94 ? 9    GLU B CB    1 
ATOM   2550 C  CG    . GLU D  3 9   ? 11.945  -15.143 -12.928 1.00 15.25 ? 9    GLU B CG    1 
ATOM   2551 C  CD    . GLU D  3 9   ? 11.257  -16.458 -12.665 1.00 15.57 ? 9    GLU B CD    1 
ATOM   2552 O  OE1   . GLU D  3 9   ? 10.582  -16.989 -13.586 1.00 16.13 ? 9    GLU B OE1   1 
ATOM   2553 O  OE2   . GLU D  3 9   ? 11.399  -16.972 -11.536 1.00 14.97 ? 9    GLU B OE2   1 
ATOM   2554 N  N     . MET D  3 10  ? 12.117  -12.710 -16.857 1.00 16.49 ? 10   MET B N     1 
ATOM   2555 C  CA    . MET D  3 10  ? 12.176  -12.471 -18.291 1.00 16.11 ? 10   MET B CA    1 
ATOM   2556 C  C     . MET D  3 10  ? 13.356  -11.582 -18.663 1.00 16.35 ? 10   MET B C     1 
ATOM   2557 O  O     . MET D  3 10  ? 14.033  -11.828 -19.664 1.00 17.39 ? 10   MET B O     1 
ATOM   2558 C  CB    . MET D  3 10  ? 10.858  -11.914 -18.815 1.00 15.96 ? 10   MET B CB    1 
ATOM   2559 C  CG    . MET D  3 10  ? 9.781   -12.988 -18.972 1.00 16.96 ? 10   MET B CG    1 
ATOM   2560 S  SD    . MET D  3 10  ? 10.274  -14.377 -20.042 1.00 17.60 ? 10   MET B SD    1 
ATOM   2561 C  CE    . MET D  3 10  ? 10.868  -13.511 -21.501 1.00 16.64 ? 10   MET B CE    1 
ATOM   2562 N  N     . TYR D  3 11  ? 13.625  -10.558 -17.861 1.00 15.78 ? 11   TYR B N     1 
ATOM   2563 C  CA    . TYR D  3 11  ? 14.803  -9.737  -18.118 1.00 16.16 ? 11   TYR B CA    1 
ATOM   2564 C  C     . TYR D  3 11  ? 16.074  -10.583 -18.076 1.00 17.13 ? 11   TYR B C     1 
ATOM   2565 O  O     . TYR D  3 11  ? 16.921  -10.451 -18.950 1.00 17.89 ? 11   TYR B O     1 
ATOM   2566 C  CB    . TYR D  3 11  ? 14.921  -8.598  -17.120 1.00 15.48 ? 11   TYR B CB    1 
ATOM   2567 C  CG    . TYR D  3 11  ? 14.163  -7.355  -17.504 1.00 15.95 ? 11   TYR B CG    1 
ATOM   2568 C  CD1   . TYR D  3 11  ? 12.820  -7.412  -17.869 1.00 16.58 ? 11   TYR B CD1   1 
ATOM   2569 C  CD2   . TYR D  3 11  ? 14.772  -6.118  -17.472 1.00 15.44 ? 11   TYR B CD2   1 
ATOM   2570 C  CE1   . TYR D  3 11  ? 12.120  -6.269  -18.203 1.00 15.54 ? 11   TYR B CE1   1 
ATOM   2571 C  CE2   . TYR D  3 11  ? 14.076  -4.975  -17.811 1.00 16.04 ? 11   TYR B CE2   1 
ATOM   2572 C  CZ    . TYR D  3 11  ? 12.755  -5.060  -18.171 1.00 15.41 ? 11   TYR B CZ    1 
ATOM   2573 O  OH    . TYR D  3 11  ? 12.074  -3.921  -18.504 1.00 16.35 ? 11   TYR B OH    1 
ATOM   2574 N  N     . LEU D  3 12  ? 16.195  -11.441 -17.061 1.00 16.69 ? 12   LEU B N     1 
ATOM   2575 C  CA    . LEU D  3 12  ? 17.350  -12.305 -16.915 1.00 16.48 ? 12   LEU B CA    1 
ATOM   2576 C  C     . LEU D  3 12  ? 17.425  -13.247 -18.095 1.00 18.76 ? 12   LEU B C     1 
ATOM   2577 O  O     . LEU D  3 12  ? 18.444  -13.308 -18.779 1.00 19.28 ? 12   LEU B O     1 
ATOM   2578 C  CB    . LEU D  3 12  ? 17.254  -13.139 -15.641 1.00 16.04 ? 12   LEU B CB    1 
ATOM   2579 C  CG    . LEU D  3 12  ? 17.182  -12.479 -14.266 1.00 15.34 ? 12   LEU B CG    1 
ATOM   2580 C  CD1   . LEU D  3 12  ? 16.769  -13.503 -13.250 1.00 14.79 ? 12   LEU B CD1   1 
ATOM   2581 C  CD2   . LEU D  3 12  ? 18.495  -11.858 -13.881 1.00 14.57 ? 12   LEU B CD2   1 
ATOM   2582 N  N     . ARG D  3 13  ? 16.350  -13.991 -18.339 1.00 20.30 ? 13   ARG B N     1 
ATOM   2583 C  CA    . ARG D  3 13  ? 16.364  -14.934 -19.445 1.00 22.28 ? 13   ARG B CA    1 
ATOM   2584 C  C     . ARG D  3 13  ? 16.709  -14.199 -20.735 1.00 22.94 ? 13   ARG B C     1 
ATOM   2585 O  O     . ARG D  3 13  ? 17.481  -14.707 -21.547 1.00 23.25 ? 13   ARG B O     1 
ATOM   2586 C  CB    . ARG D  3 13  ? 15.037  -15.678 -19.581 1.00 23.33 ? 13   ARG B CB    1 
ATOM   2587 C  CG    . ARG D  3 13  ? 15.199  -17.167 -19.912 1.00 25.76 ? 13   ARG B CG    1 
ATOM   2588 C  CD    . ARG D  3 13  ? 14.002  -17.706 -20.705 1.00 27.71 ? 13   ARG B CD    1 
ATOM   2589 N  NE    . ARG D  3 13  ? 14.116  -17.395 -22.129 1.00 29.45 ? 13   ARG B NE    1 
ATOM   2590 C  CZ    . ARG D  3 13  ? 13.109  -17.008 -22.913 1.00 29.78 ? 13   ARG B CZ    1 
ATOM   2591 N  NH1   . ARG D  3 13  ? 13.340  -16.749 -24.197 1.00 29.93 ? 13   ARG B NH1   1 
ATOM   2592 N  NH2   . ARG D  3 13  ? 11.877  -16.873 -22.430 1.00 30.00 ? 13   ARG B NH2   1 
ATOM   2593 N  N     . THR D  3 14  ? 16.166  -12.995 -20.918 1.00 23.08 ? 14   THR B N     1 
ATOM   2594 C  CA    . THR D  3 14  ? 16.483  -12.222 -22.126 1.00 24.30 ? 14   THR B CA    1 
ATOM   2595 C  C     . THR D  3 14  ? 17.984  -11.997 -22.218 1.00 25.30 ? 14   THR B C     1 
ATOM   2596 O  O     . THR D  3 14  ? 18.600  -12.302 -23.236 1.00 27.20 ? 14   THR B O     1 
ATOM   2597 C  CB    . THR D  3 14  ? 15.754  -10.850 -22.196 1.00 23.34 ? 14   THR B CB    1 
ATOM   2598 O  OG1   . THR D  3 14  ? 14.351  -11.050 -22.374 1.00 22.62 ? 14   THR B OG1   1 
ATOM   2599 C  CG2   . THR D  3 14  ? 16.252  -10.051 -23.377 1.00 22.62 ? 14   THR B CG2   1 
ATOM   2600 N  N     . ILE D  3 15  ? 18.567  -11.465 -21.147 1.00 25.81 ? 15   ILE B N     1 
ATOM   2601 C  CA    . ILE D  3 15  ? 20.015  -11.306 -21.047 1.00 26.99 ? 15   ILE B CA    1 
ATOM   2602 C  C     . ILE D  3 15  ? 20.790  -12.596 -21.380 1.00 28.56 ? 15   ILE B C     1 
ATOM   2603 O  O     . ILE D  3 15  ? 21.873  -12.546 -21.964 1.00 28.17 ? 15   ILE B O     1 
ATOM   2604 C  CB    . ILE D  3 15  ? 20.421  -10.806 -19.649 1.00 25.80 ? 15   ILE B CB    1 
ATOM   2605 C  CG1   . ILE D  3 15  ? 19.900  -9.380  -19.436 1.00 25.26 ? 15   ILE B CG1   1 
ATOM   2606 C  CG2   . ILE D  3 15  ? 21.937  -10.850 -19.483 1.00 25.25 ? 15   ILE B CG2   1 
ATOM   2607 C  CD1   . ILE D  3 15  ? 19.778  -8.949  -17.984 1.00 24.38 ? 15   ILE B CD1   1 
ATOM   2608 N  N     . TYR D  3 16  ? 20.226  -13.746 -21.024 1.00 30.54 ? 16   TYR B N     1 
ATOM   2609 C  CA    . TYR D  3 16  ? 20.898  -15.018 -21.276 1.00 32.66 ? 16   TYR B CA    1 
ATOM   2610 C  C     . TYR D  3 16  ? 20.745  -15.464 -22.733 1.00 33.06 ? 16   TYR B C     1 
ATOM   2611 O  O     . TYR D  3 16  ? 21.661  -16.046 -23.309 1.00 32.93 ? 16   TYR B O     1 
ATOM   2612 C  CB    . TYR D  3 16  ? 20.420  -16.110 -20.306 1.00 33.72 ? 16   TYR B CB    1 
ATOM   2613 C  CG    . TYR D  3 16  ? 21.403  -17.254 -20.171 1.00 34.49 ? 16   TYR B CG    1 
ATOM   2614 C  CD1   . TYR D  3 16  ? 21.040  -18.563 -20.494 1.00 34.84 ? 16   TYR B CD1   1 
ATOM   2615 C  CD2   . TYR D  3 16  ? 22.706  -17.020 -19.740 1.00 34.41 ? 16   TYR B CD2   1 
ATOM   2616 C  CE1   . TYR D  3 16  ? 21.949  -19.609 -20.380 1.00 34.66 ? 16   TYR B CE1   1 
ATOM   2617 C  CE2   . TYR D  3 16  ? 23.618  -18.050 -19.628 1.00 34.67 ? 16   TYR B CE2   1 
ATOM   2618 C  CZ    . TYR D  3 16  ? 23.237  -19.339 -19.944 1.00 35.10 ? 16   TYR B CZ    1 
ATOM   2619 O  OH    . TYR D  3 16  ? 24.158  -20.354 -19.822 1.00 35.56 ? 16   TYR B OH    1 
ATOM   2620 N  N     . ASP D  3 17  ? 19.587  -15.190 -23.327 1.00 33.86 ? 17   ASP B N     1 
ATOM   2621 C  CA    . ASP D  3 17  ? 19.401  -15.458 -24.743 1.00 33.16 ? 17   ASP B CA    1 
ATOM   2622 C  C     . ASP D  3 17  ? 20.467  -14.694 -25.491 1.00 33.10 ? 17   ASP B C     1 
ATOM   2623 O  O     . ASP D  3 17  ? 21.136  -15.251 -26.365 1.00 33.16 ? 17   ASP B O     1 
ATOM   2624 C  CB    . ASP D  3 17  ? 18.009  -15.036 -25.221 1.00 33.50 ? 17   ASP B CB    1 
ATOM   2625 C  CG    . ASP D  3 17  ? 16.954  -16.091 -24.936 1.00 34.69 ? 17   ASP B CG    1 
ATOM   2626 O  OD1   . ASP D  3 17  ? 17.340  -17.226 -24.584 1.00 35.68 ? 17   ASP B OD1   1 
ATOM   2627 O  OD2   . ASP D  3 17  ? 15.744  -15.795 -25.059 1.00 34.50 ? 17   ASP B OD2   1 
ATOM   2628 N  N     . LEU D  3 18  ? 20.642  -13.430 -25.115 1.00 32.48 ? 18   LEU B N     1 
ATOM   2629 C  CA    . LEU D  3 18  ? 21.565  -12.541 -25.807 1.00 33.33 ? 18   LEU B CA    1 
ATOM   2630 C  C     . LEU D  3 18  ? 23.009  -13.007 -25.717 1.00 34.26 ? 18   LEU B C     1 
ATOM   2631 O  O     . LEU D  3 18  ? 23.765  -12.889 -26.684 1.00 34.55 ? 18   LEU B O     1 
ATOM   2632 C  CB    . LEU D  3 18  ? 21.457  -11.123 -25.260 1.00 33.04 ? 18   LEU B CB    1 
ATOM   2633 C  CG    . LEU D  3 18  ? 20.087  -10.463 -25.341 1.00 32.70 ? 18   LEU B CG    1 
ATOM   2634 C  CD1   . LEU D  3 18  ? 20.268  -8.963  -25.220 1.00 32.99 ? 18   LEU B CD1   1 
ATOM   2635 C  CD2   . LEU D  3 18  ? 19.399  -10.808 -26.641 1.00 31.81 ? 18   LEU B CD2   1 
ATOM   2636 N  N     . GLU D  3 19  ? 23.391  -13.523 -24.552 1.00 35.53 ? 19   GLU B N     1 
ATOM   2637 C  CA    . GLU D  3 19  ? 24.741  -14.049 -24.350 1.00 36.54 ? 19   GLU B CA    1 
ATOM   2638 C  C     . GLU D  3 19  ? 24.966  -15.276 -25.228 1.00 36.30 ? 19   GLU B C     1 
ATOM   2639 O  O     . GLU D  3 19  ? 25.997  -15.393 -25.888 1.00 36.05 ? 19   GLU B O     1 
ATOM   2640 C  CB    . GLU D  3 19  ? 24.986  -14.361 -22.869 1.00 36.27 ? 19   GLU B CB    1 
ATOM   2641 C  CG    . GLU D  3 19  ? 25.066  -13.099 -22.006 1.00 37.52 ? 19   GLU B CG    1 
ATOM   2642 C  CD    . GLU D  3 19  ? 25.276  -13.378 -20.520 1.00 37.88 ? 19   GLU B CD    1 
ATOM   2643 O  OE1   . GLU D  3 19  ? 25.727  -12.446 -19.811 1.00 37.12 ? 19   GLU B OE1   1 
ATOM   2644 O  OE2   . GLU D  3 19  ? 24.989  -14.515 -20.061 1.00 38.64 ? 19   GLU B OE2   1 
ATOM   2645 N  N     . GLU D  3 20  ? 23.982  -16.173 -25.236 1.00 36.75 ? 20   GLU B N     1 
ATOM   2646 C  CA    . GLU D  3 20  ? 23.960  -17.329 -26.134 1.00 37.84 ? 20   GLU B CA    1 
ATOM   2647 C  C     . GLU D  3 20  ? 24.114  -16.933 -27.610 1.00 38.25 ? 20   GLU B C     1 
ATOM   2648 O  O     . GLU D  3 20  ? 24.791  -17.623 -28.381 1.00 38.31 ? 20   GLU B O     1 
ATOM   2649 C  CB    . GLU D  3 20  ? 22.651  -18.119 -25.958 1.00 37.83 ? 20   GLU B CB    1 
ATOM   2650 C  CG    . GLU D  3 20  ? 22.719  -19.301 -24.979 1.00 37.98 ? 20   GLU B CG    1 
ATOM   2651 C  CD    . GLU D  3 20  ? 21.557  -20.272 -25.149 1.00 37.72 ? 20   GLU B CD    1 
ATOM   2652 O  OE1   . GLU D  3 20  ? 20.593  -19.928 -25.862 1.00 37.71 ? 20   GLU B OE1   1 
ATOM   2653 O  OE2   . GLU D  3 20  ? 21.607  -21.378 -24.570 1.00 38.11 ? 20   GLU B OE2   1 
ATOM   2654 N  N     . GLU D  3 21  ? 23.475  -15.827 -27.992 1.00 38.01 ? 21   GLU B N     1 
ATOM   2655 C  CA    . GLU D  3 21  ? 23.432  -15.389 -29.385 1.00 37.12 ? 21   GLU B CA    1 
ATOM   2656 C  C     . GLU D  3 21  ? 24.637  -14.558 -29.777 1.00 36.64 ? 21   GLU B C     1 
ATOM   2657 O  O     . GLU D  3 21  ? 24.876  -14.343 -30.964 1.00 37.55 ? 21   GLU B O     1 
ATOM   2658 C  CB    . GLU D  3 21  ? 22.167  -14.583 -29.663 1.00 37.41 ? 21   GLU B CB    1 
ATOM   2659 C  CG    . GLU D  3 21  ? 20.893  -15.404 -29.702 1.00 37.72 ? 21   GLU B CG    1 
ATOM   2660 C  CD    . GLU D  3 21  ? 19.661  -14.532 -29.845 1.00 37.82 ? 21   GLU B CD    1 
ATOM   2661 O  OE1   . GLU D  3 21  ? 19.765  -13.459 -30.485 1.00 37.95 ? 21   GLU B OE1   1 
ATOM   2662 O  OE2   . GLU D  3 21  ? 18.596  -14.918 -29.313 1.00 37.36 ? 21   GLU B OE2   1 
ATOM   2663 N  N     . GLY D  3 22  ? 25.382  -14.075 -28.788 1.00 35.57 ? 22   GLY B N     1 
ATOM   2664 C  CA    . GLY D  3 22  ? 26.596  -13.311 -29.060 1.00 34.28 ? 22   GLY B CA    1 
ATOM   2665 C  C     . GLY D  3 22  ? 26.469  -11.801 -28.963 1.00 33.88 ? 22   GLY B C     1 
ATOM   2666 O  O     . GLY D  3 22  ? 27.474  -11.094 -28.897 1.00 34.00 ? 22   GLY B O     1 
ATOM   2667 N  N     . VAL D  3 23  ? 25.243  -11.287 -28.940 1.00 33.89 ? 23   VAL B N     1 
ATOM   2668 C  CA    . VAL D  3 23  ? 25.046  -9.829  -28.896 1.00 33.30 ? 23   VAL B CA    1 
ATOM   2669 C  C     . VAL D  3 23  ? 25.310  -9.197  -27.515 1.00 32.48 ? 23   VAL B C     1 
ATOM   2670 O  O     . VAL D  3 23  ? 25.001  -9.788  -26.476 1.00 32.09 ? 23   VAL B O     1 
ATOM   2671 C  CB    . VAL D  3 23  ? 23.659  -9.407  -29.468 1.00 33.56 ? 23   VAL B CB    1 
ATOM   2672 C  CG1   . VAL D  3 23  ? 22.643  -10.556 -29.380 1.00 33.19 ? 23   VAL B CG1   1 
ATOM   2673 C  CG2   . VAL D  3 23  ? 23.146  -8.142  -28.788 1.00 33.51 ? 23   VAL B CG2   1 
ATOM   2674 N  N     . THR D  3 24  ? 25.911  -8.007  -27.531 1.00 31.44 ? 24   THR B N     1 
ATOM   2675 C  CA    . THR D  3 24  ? 26.170  -7.224  -26.329 1.00 30.70 ? 24   THR B CA    1 
ATOM   2676 C  C     . THR D  3 24  ? 24.850  -6.887  -25.651 1.00 31.35 ? 24   THR B C     1 
ATOM   2677 O  O     . THR D  3 24  ? 23.924  -6.399  -26.304 1.00 31.80 ? 24   THR B O     1 
ATOM   2678 C  CB    . THR D  3 24  ? 26.865  -5.892  -26.678 1.00 30.65 ? 24   THR B CB    1 
ATOM   2679 O  OG1   . THR D  3 24  ? 27.708  -6.064  -27.821 1.00 30.03 ? 24   THR B OG1   1 
ATOM   2680 C  CG2   . THR D  3 24  ? 27.696  -5.390  -25.515 1.00 30.80 ? 24   THR B CG2   1 
ATOM   2681 N  N     . PRO D  3 25  ? 24.752  -7.139  -24.335 1.00 31.09 ? 25   PRO B N     1 
ATOM   2682 C  CA    . PRO D  3 25  ? 23.500  -6.925  -23.607 1.00 30.22 ? 25   PRO B CA    1 
ATOM   2683 C  C     . PRO D  3 25  ? 23.336  -5.508  -23.042 1.00 29.40 ? 25   PRO B C     1 
ATOM   2684 O  O     . PRO D  3 25  ? 23.893  -5.189  -21.988 1.00 29.44 ? 25   PRO B O     1 
ATOM   2685 C  CB    . PRO D  3 25  ? 23.584  -7.953  -22.474 1.00 29.62 ? 25   PRO B CB    1 
ATOM   2686 C  CG    . PRO D  3 25  ? 25.045  -8.126  -22.223 1.00 30.20 ? 25   PRO B CG    1 
ATOM   2687 C  CD    . PRO D  3 25  ? 25.810  -7.663  -23.457 1.00 31.21 ? 25   PRO B CD    1 
ATOM   2688 N  N     . LEU D  3 26  ? 22.564  -4.676  -23.741 1.00 28.29 ? 26   LEU B N     1 
ATOM   2689 C  CA    . LEU D  3 26  ? 22.277  -3.312  -23.291 1.00 27.42 ? 26   LEU B CA    1 
ATOM   2690 C  C     . LEU D  3 26  ? 20.816  -3.182  -22.922 1.00 27.06 ? 26   LEU B C     1 
ATOM   2691 O  O     . LEU D  3 26  ? 19.969  -3.909  -23.445 1.00 28.12 ? 26   LEU B O     1 
ATOM   2692 C  CB    . LEU D  3 26  ? 22.587  -2.302  -24.389 1.00 26.67 ? 26   LEU B CB    1 
ATOM   2693 C  CG    . LEU D  3 26  ? 24.053  -2.174  -24.771 1.00 27.52 ? 26   LEU B CG    1 
ATOM   2694 C  CD1   . LEU D  3 26  ? 24.222  -1.168  -25.911 1.00 27.03 ? 26   LEU B CD1   1 
ATOM   2695 C  CD2   . LEU D  3 26  ? 24.874  -1.780  -23.543 1.00 27.44 ? 26   LEU B CD2   1 
ATOM   2696 N  N     . ARG D  3 27  ? 20.517  -2.252  -22.025 1.00 26.57 ? 27   ARG B N     1 
ATOM   2697 C  CA    . ARG D  3 27  ? 19.133  -1.945  -21.695 1.00 26.02 ? 27   ARG B CA    1 
ATOM   2698 C  C     . ARG D  3 27  ? 18.317  -1.772  -22.985 1.00 26.10 ? 27   ARG B C     1 
ATOM   2699 O  O     . ARG D  3 27  ? 17.140  -2.169  -23.065 1.00 25.84 ? 27   ARG B O     1 
ATOM   2700 C  CB    . ARG D  3 27  ? 19.059  -0.705  -20.793 1.00 25.89 ? 27   ARG B CB    1 
ATOM   2701 C  CG    . ARG D  3 27  ? 19.378  -1.007  -19.329 1.00 26.29 ? 27   ARG B CG    1 
ATOM   2702 C  CD    . ARG D  3 27  ? 19.925  0.201   -18.574 1.00 27.05 ? 27   ARG B CD    1 
ATOM   2703 N  NE    . ARG D  3 27  ? 21.229  0.615   -19.086 1.00 28.36 ? 27   ARG B NE    1 
ATOM   2704 C  CZ    . ARG D  3 27  ? 22.009  1.537   -18.524 1.00 29.06 ? 27   ARG B CZ    1 
ATOM   2705 N  NH1   . ARG D  3 27  ? 21.630  2.151   -17.408 1.00 28.86 ? 27   ARG B NH1   1 
ATOM   2706 N  NH2   . ARG D  3 27  ? 23.173  1.852   -19.086 1.00 29.25 ? 27   ARG B NH2   1 
ATOM   2707 N  N     . ALA D  3 28  ? 18.967  -1.230  -24.011 1.00 25.37 ? 28   ALA B N     1 
ATOM   2708 C  CA    . ALA D  3 28  ? 18.300  -0.972  -25.279 1.00 25.16 ? 28   ALA B CA    1 
ATOM   2709 C  C     . ALA D  3 28  ? 17.927  -2.232  -26.086 1.00 24.98 ? 28   ALA B C     1 
ATOM   2710 O  O     . ALA D  3 28  ? 17.069  -2.158  -26.977 1.00 24.90 ? 28   ALA B O     1 
ATOM   2711 C  CB    . ALA D  3 28  ? 19.119  -0.014  -26.115 1.00 25.70 ? 28   ALA B CB    1 
ATOM   2712 N  N     . ARG D  3 29  ? 18.551  -3.373  -25.782 1.00 23.90 ? 29   ARG B N     1 
ATOM   2713 C  CA    . ARG D  3 29  ? 18.214  -4.629  -26.467 1.00 24.01 ? 29   ARG B CA    1 
ATOM   2714 C  C     . ARG D  3 29  ? 16.973  -5.222  -25.856 1.00 24.68 ? 29   ARG B C     1 
ATOM   2715 O  O     . ARG D  3 29  ? 16.149  -5.844  -26.546 1.00 25.20 ? 29   ARG B O     1 
ATOM   2716 C  CB    . ARG D  3 29  ? 19.327  -5.667  -26.335 1.00 24.84 ? 29   ARG B CB    1 
ATOM   2717 C  CG    . ARG D  3 29  ? 20.671  -5.242  -26.873 1.00 25.47 ? 29   ARG B CG    1 
ATOM   2718 C  CD    . ARG D  3 29  ? 20.667  -5.143  -28.387 1.00 25.24 ? 29   ARG B CD    1 
ATOM   2719 N  NE    . ARG D  3 29  ? 21.223  -3.849  -28.738 1.00 25.30 ? 29   ARG B NE    1 
ATOM   2720 C  CZ    . ARG D  3 29  ? 20.508  -2.847  -29.221 1.00 25.17 ? 29   ARG B CZ    1 
ATOM   2721 N  NH1   . ARG D  3 29  ? 19.215  -3.017  -29.461 1.00 24.55 ? 29   ARG B NH1   1 
ATOM   2722 N  NH2   . ARG D  3 29  ? 21.095  -1.686  -29.480 1.00 25.62 ? 29   ARG B NH2   1 
ATOM   2723 N  N     . ILE D  3 30  ? 16.868  -5.056  -24.539 1.00 24.81 ? 30   ILE B N     1 
ATOM   2724 C  CA    . ILE D  3 30  ? 15.724  -5.538  -23.787 1.00 23.55 ? 30   ILE B CA    1 
ATOM   2725 C  C     . ILE D  3 30  ? 14.511  -4.769  -24.265 1.00 23.07 ? 30   ILE B C     1 
ATOM   2726 O  O     . ILE D  3 30  ? 13.454  -5.344  -24.505 1.00 22.49 ? 30   ILE B O     1 
ATOM   2727 C  CB    . ILE D  3 30  ? 15.930  -5.322  -22.281 1.00 23.91 ? 30   ILE B CB    1 
ATOM   2728 C  CG1   . ILE D  3 30  ? 17.336  -5.775  -21.879 1.00 23.79 ? 30   ILE B CG1   1 
ATOM   2729 C  CG2   . ILE D  3 30  ? 14.875  -6.067  -21.477 1.00 22.82 ? 30   ILE B CG2   1 
ATOM   2730 C  CD1   . ILE D  3 30  ? 17.424  -6.304  -20.460 1.00 23.29 ? 30   ILE B CD1   1 
ATOM   2731 N  N     . ALA D  3 31  ? 14.686  -3.462  -24.431 1.00 23.87 ? 31   ALA B N     1 
ATOM   2732 C  CA    . ALA D  3 31  ? 13.634  -2.614  -24.970 1.00 24.11 ? 31   ALA B CA    1 
ATOM   2733 C  C     . ALA D  3 31  ? 13.023  -3.249  -26.217 1.00 25.30 ? 31   ALA B C     1 
ATOM   2734 O  O     . ALA D  3 31  ? 11.797  -3.399  -26.311 1.00 25.66 ? 31   ALA B O     1 
ATOM   2735 C  CB    . ALA D  3 31  ? 14.175  -1.233  -25.276 1.00 23.18 ? 31   ALA B CB    1 
ATOM   2736 N  N     . GLU D  3 32  ? 13.881  -3.651  -27.153 1.00 26.06 ? 32   GLU B N     1 
ATOM   2737 C  CA    . GLU D  3 32  ? 13.430  -4.212  -28.427 1.00 26.61 ? 32   GLU B CA    1 
ATOM   2738 C  C     . GLU D  3 32  ? 12.945  -5.647  -28.304 1.00 26.98 ? 32   GLU B C     1 
ATOM   2739 O  O     . GLU D  3 32  ? 11.972  -6.025  -28.945 1.00 27.74 ? 32   GLU B O     1 
ATOM   2740 C  CB    . GLU D  3 32  ? 14.537  -4.128  -29.470 1.00 27.47 ? 32   GLU B CB    1 
ATOM   2741 C  CG    . GLU D  3 32  ? 15.203  -2.765  -29.534 1.00 28.16 ? 32   GLU B CG    1 
ATOM   2742 C  CD    . GLU D  3 32  ? 16.542  -2.812  -30.232 1.00 28.50 ? 32   GLU B CD    1 
ATOM   2743 O  OE1   . GLU D  3 32  ? 17.081  -3.929  -30.408 1.00 29.07 ? 32   GLU B OE1   1 
ATOM   2744 O  OE2   . GLU D  3 32  ? 17.058  -1.734  -30.596 1.00 28.64 ? 32   GLU B OE2   1 
ATOM   2745 N  N     . ARG D  3 33  ? 13.610  -6.456  -27.487 1.00 27.18 ? 33   ARG B N     1 
ATOM   2746 C  CA    . ARG D  3 33  ? 13.164  -7.840  -27.321 1.00 27.30 ? 33   ARG B CA    1 
ATOM   2747 C  C     . ARG D  3 33  ? 11.820  -7.932  -26.632 1.00 25.76 ? 33   ARG B C     1 
ATOM   2748 O  O     . ARG D  3 33  ? 10.882  -8.516  -27.157 1.00 25.12 ? 33   ARG B O     1 
ATOM   2749 C  CB    . ARG D  3 33  ? 14.177  -8.660  -26.537 1.00 28.66 ? 33   ARG B CB    1 
ATOM   2750 C  CG    . ARG D  3 33  ? 15.363  -9.062  -27.354 1.00 31.17 ? 33   ARG B CG    1 
ATOM   2751 C  CD    . ARG D  3 33  ? 14.966  -9.953  -28.521 1.00 32.83 ? 33   ARG B CD    1 
ATOM   2752 N  NE    . ARG D  3 33  ? 16.161  -10.301 -29.282 1.00 34.73 ? 33   ARG B NE    1 
ATOM   2753 C  CZ    . ARG D  3 33  ? 16.978  -11.296 -28.957 1.00 35.47 ? 33   ARG B CZ    1 
ATOM   2754 N  NH1   . ARG D  3 33  ? 16.707  -12.054 -27.896 1.00 35.78 ? 33   ARG B NH1   1 
ATOM   2755 N  NH2   . ARG D  3 33  ? 18.058  -11.537 -29.692 1.00 35.66 ? 33   ARG B NH2   1 
ATOM   2756 N  N     . LEU D  3 34  ? 11.734  -7.355  -25.443 1.00 24.28 ? 34   LEU B N     1 
ATOM   2757 C  CA    . LEU D  3 34  ? 10.530  -7.463  -24.651 1.00 22.29 ? 34   LEU B CA    1 
ATOM   2758 C  C     . LEU D  3 34  ? 9.561   -6.340  -24.995 1.00 22.72 ? 34   LEU B C     1 
ATOM   2759 O  O     . LEU D  3 34  ? 8.529   -6.196  -24.344 1.00 23.82 ? 34   LEU B O     1 
ATOM   2760 C  CB    . LEU D  3 34  ? 10.887  -7.457  -23.168 1.00 20.99 ? 34   LEU B CB    1 
ATOM   2761 C  CG    . LEU D  3 34  ? 11.790  -8.620  -22.744 1.00 20.10 ? 34   LEU B CG    1 
ATOM   2762 C  CD1   . LEU D  3 34  ? 12.142  -8.576  -21.267 1.00 20.42 ? 34   LEU B CD1   1 
ATOM   2763 C  CD2   . LEU D  3 34  ? 11.108  -9.916  -23.064 1.00 20.12 ? 34   LEU B CD2   1 
ATOM   2764 N  N     . ASP D  3 35  ? 9.894   -5.554  -26.023 1.00 21.20 ? 35   ASP B N     1 
ATOM   2765 C  CA    . ASP D  3 35  ? 9.025   -4.477  -26.490 1.00 20.94 ? 35   ASP B CA    1 
ATOM   2766 C  C     . ASP D  3 35  ? 8.535   -3.600  -25.338 1.00 20.35 ? 35   ASP B C     1 
ATOM   2767 O  O     . ASP D  3 35  ? 7.346   -3.555  -25.036 1.00 19.71 ? 35   ASP B O     1 
ATOM   2768 C  CB    . ASP D  3 35  ? 7.828   -5.035  -27.267 1.00 21.52 ? 35   ASP B CB    1 
ATOM   2769 C  CG    . ASP D  3 35  ? 6.958   -3.931  -27.899 1.00 22.98 ? 35   ASP B CG    1 
ATOM   2770 O  OD1   . ASP D  3 35  ? 5.772   -4.211  -28.195 1.00 22.80 ? 35   ASP B OD1   1 
ATOM   2771 O  OD2   . ASP D  3 35  ? 7.448   -2.790  -28.098 1.00 22.82 ? 35   ASP B OD2   1 
ATOM   2772 N  N     . GLN D  3 36  ? 9.463   -2.907  -24.694 1.00 19.39 ? 36   GLN B N     1 
ATOM   2773 C  CA    . GLN D  3 36  ? 9.130   -2.047  -23.569 1.00 18.31 ? 36   GLN B CA    1 
ATOM   2774 C  C     . GLN D  3 36  ? 9.851   -0.721  -23.751 1.00 17.77 ? 36   GLN B C     1 
ATOM   2775 O  O     . GLN D  3 36  ? 10.875  -0.660  -24.412 1.00 18.57 ? 36   GLN B O     1 
ATOM   2776 C  CB    . GLN D  3 36  ? 9.533   -2.702  -22.238 1.00 17.88 ? 36   GLN B CB    1 
ATOM   2777 C  CG    . GLN D  3 36  ? 8.742   -3.967  -21.863 1.00 16.34 ? 36   GLN B CG    1 
ATOM   2778 C  CD    . GLN D  3 36  ? 8.998   -4.411  -20.422 1.00 16.57 ? 36   GLN B CD    1 
ATOM   2779 O  OE1   . GLN D  3 36  ? 9.972   -3.997  -19.791 1.00 14.43 ? 36   GLN B OE1   1 
ATOM   2780 N  NE2   . GLN D  3 36  ? 8.118   -5.261  -19.899 1.00 16.47 ? 36   GLN B NE2   1 
ATOM   2781 N  N     . SER D  3 37  ? 9.316   0.342   -23.174 1.00 17.55 ? 37   SER B N     1 
ATOM   2782 C  CA    . SER D  3 37  ? 9.917   1.652   -23.338 1.00 16.75 ? 37   SER B CA    1 
ATOM   2783 C  C     . SER D  3 37  ? 11.284  1.713   -22.658 1.00 17.34 ? 37   SER B C     1 
ATOM   2784 O  O     . SER D  3 37  ? 11.532  1.017   -21.664 1.00 17.22 ? 37   SER B O     1 
ATOM   2785 C  CB    . SER D  3 37  ? 9.020   2.712   -22.726 1.00 16.27 ? 37   SER B CB    1 
ATOM   2786 O  OG    . SER D  3 37  ? 9.303   2.830   -21.346 1.00 16.02 ? 37   SER B OG    1 
ATOM   2787 N  N     . GLY D  3 38  ? 12.156  2.563   -23.192 1.00 16.26 ? 38   GLY B N     1 
ATOM   2788 C  CA    . GLY D  3 38  ? 13.467  2.762   -22.616 1.00 15.98 ? 38   GLY B CA    1 
ATOM   2789 C  C     . GLY D  3 38  ? 13.353  3.062   -21.143 1.00 16.44 ? 38   GLY B C     1 
ATOM   2790 O  O     . GLY D  3 38  ? 13.887  2.330   -20.300 1.00 17.15 ? 38   GLY B O     1 
ATOM   2791 N  N     . PRO D  3 39  ? 12.643  4.144   -20.817 1.00 17.29 ? 39   PRO B N     1 
ATOM   2792 C  CA    . PRO D  3 39  ? 12.499  4.546   -19.415 1.00 17.14 ? 39   PRO B CA    1 
ATOM   2793 C  C     . PRO D  3 39  ? 12.057  3.362   -18.558 1.00 16.78 ? 39   PRO B C     1 
ATOM   2794 O  O     . PRO D  3 39  ? 12.560  3.174   -17.450 1.00 17.25 ? 39   PRO B O     1 
ATOM   2795 C  CB    . PRO D  3 39  ? 11.407  5.617   -19.470 1.00 17.34 ? 39   PRO B CB    1 
ATOM   2796 C  CG    . PRO D  3 39  ? 11.545  6.199   -20.881 1.00 17.83 ? 39   PRO B CG    1 
ATOM   2797 C  CD    . PRO D  3 39  ? 11.935  5.045   -21.750 1.00 16.66 ? 39   PRO B CD    1 
ATOM   2798 N  N     . THR D  3 40  ? 11.142  2.553   -19.076 1.00 15.75 ? 40   THR B N     1 
ATOM   2799 C  CA    . THR D  3 40  ? 10.717  1.370   -18.343 1.00 16.12 ? 40   THR B CA    1 
ATOM   2800 C  C     . THR D  3 40  ? 11.882  0.405   -18.130 1.00 16.33 ? 40   THR B C     1 
ATOM   2801 O  O     . THR D  3 40  ? 12.117  -0.078  -17.013 1.00 16.14 ? 40   THR B O     1 
ATOM   2802 C  CB    . THR D  3 40  ? 9.580   0.620   -19.051 1.00 15.84 ? 40   THR B CB    1 
ATOM   2803 O  OG1   . THR D  3 40  ? 8.380   1.410   -19.007 1.00 15.21 ? 40   THR B OG1   1 
ATOM   2804 C  CG2   . THR D  3 40  ? 9.338   -0.733  -18.362 1.00 15.33 ? 40   THR B CG2   1 
ATOM   2805 N  N     . VAL D  3 41  ? 12.620  0.130   -19.198 1.00 15.68 ? 41   VAL B N     1 
ATOM   2806 C  CA    . VAL D  3 41  ? 13.695  -0.837  -19.094 1.00 16.15 ? 41   VAL B CA    1 
ATOM   2807 C  C     . VAL D  3 41  ? 14.787  -0.380  -18.133 1.00 16.56 ? 41   VAL B C     1 
ATOM   2808 O  O     . VAL D  3 41  ? 15.302  -1.180  -17.357 1.00 17.00 ? 41   VAL B O     1 
ATOM   2809 C  CB    . VAL D  3 41  ? 14.296  -1.194  -20.450 1.00 15.74 ? 41   VAL B CB    1 
ATOM   2810 C  CG1   . VAL D  3 41  ? 15.536  -2.053  -20.236 1.00 14.93 ? 41   VAL B CG1   1 
ATOM   2811 C  CG2   . VAL D  3 41  ? 13.263  -1.927  -21.294 1.00 14.89 ? 41   VAL B CG2   1 
ATOM   2812 N  N     . SER D  3 42  ? 15.128  0.902   -18.156 1.00 16.11 ? 42   SER B N     1 
ATOM   2813 C  CA    . SER D  3 42  ? 16.104  1.381   -17.199 1.00 16.29 ? 42   SER B CA    1 
ATOM   2814 C  C     . SER D  3 42  ? 15.578  1.225   -15.775 1.00 17.11 ? 42   SER B C     1 
ATOM   2815 O  O     . SER D  3 42  ? 16.309  0.776   -14.891 1.00 19.38 ? 42   SER B O     1 
ATOM   2816 C  CB    . SER D  3 42  ? 16.482  2.825   -17.471 1.00 16.55 ? 42   SER B CB    1 
ATOM   2817 O  OG    . SER D  3 42  ? 17.310  2.925   -18.621 1.00 18.59 ? 42   SER B OG    1 
ATOM   2818 N  N     . GLN D  3 43  ? 14.306  1.558   -15.559 1.00 16.50 ? 43   GLN B N     1 
ATOM   2819 C  CA    . GLN D  3 43  ? 13.737  1.537   -14.212 1.00 15.84 ? 43   GLN B CA    1 
ATOM   2820 C  C     . GLN D  3 43  ? 13.697  0.132   -13.638 1.00 15.35 ? 43   GLN B C     1 
ATOM   2821 O  O     . GLN D  3 43  ? 14.057  -0.094  -12.475 1.00 14.94 ? 43   GLN B O     1 
ATOM   2822 C  CB    . GLN D  3 43  ? 12.336  2.136   -14.181 1.00 15.17 ? 43   GLN B CB    1 
ATOM   2823 C  CG    . GLN D  3 43  ? 11.778  2.201   -12.783 1.00 15.31 ? 43   GLN B CG    1 
ATOM   2824 C  CD    . GLN D  3 43  ? 10.453  2.916   -12.717 1.00 16.89 ? 43   GLN B CD    1 
ATOM   2825 O  OE1   . GLN D  3 43  ? 9.463   2.482   -13.318 1.00 17.44 ? 43   GLN B OE1   1 
ATOM   2826 N  NE2   . GLN D  3 43  ? 10.421  4.027   -11.985 1.00 16.39 ? 43   GLN B NE2   1 
ATOM   2827 N  N     . THR D  3 44  ? 13.267  -0.809  -14.467 1.00 14.26 ? 44   THR B N     1 
ATOM   2828 C  CA    . THR D  3 44  ? 13.210  -2.198  -14.055 1.00 14.19 ? 44   THR B CA    1 
ATOM   2829 C  C     . THR D  3 44  ? 14.601  -2.729  -13.737 1.00 14.30 ? 44   THR B C     1 
ATOM   2830 O  O     . THR D  3 44  ? 14.775  -3.491  -12.795 1.00 15.07 ? 44   THR B O     1 
ATOM   2831 C  CB    . THR D  3 44  ? 12.560  -3.075  -15.132 1.00 13.66 ? 44   THR B CB    1 
ATOM   2832 O  OG1   . THR D  3 44  ? 11.203  -2.659  -15.337 1.00 11.60 ? 44   THR B OG1   1 
ATOM   2833 C  CG2   . THR D  3 44  ? 12.589  -4.525  -14.698 1.00 13.44 ? 44   THR B CG2   1 
ATOM   2834 N  N     . VAL D  3 45  ? 15.589  -2.313  -14.519 1.00 15.23 ? 45   VAL B N     1 
ATOM   2835 C  CA    . VAL D  3 45  ? 16.960  -2.761  -14.311 1.00 15.85 ? 45   VAL B CA    1 
ATOM   2836 C  C     . VAL D  3 45  ? 17.528  -2.245  -12.984 1.00 17.42 ? 45   VAL B C     1 
ATOM   2837 O  O     . VAL D  3 45  ? 18.315  -2.941  -12.333 1.00 18.37 ? 45   VAL B O     1 
ATOM   2838 C  CB    . VAL D  3 45  ? 17.874  -2.391  -15.510 1.00 14.94 ? 45   VAL B CB    1 
ATOM   2839 C  CG1   . VAL D  3 45  ? 19.336  -2.474  -15.129 1.00 13.81 ? 45   VAL B CG1   1 
ATOM   2840 C  CG2   . VAL D  3 45  ? 17.588  -3.307  -16.698 1.00 13.94 ? 45   VAL B CG2   1 
ATOM   2841 N  N     . SER D  3 46  ? 17.111  -1.048  -12.571 1.00 17.53 ? 46   SER B N     1 
ATOM   2842 C  CA    . SER D  3 46  ? 17.549  -0.486  -11.285 1.00 17.49 ? 46   SER B CA    1 
ATOM   2843 C  C     . SER D  3 46  ? 17.088  -1.335  -10.119 1.00 17.21 ? 46   SER B C     1 
ATOM   2844 O  O     . SER D  3 46  ? 17.821  -1.503  -9.134  1.00 18.44 ? 46   SER B O     1 
ATOM   2845 C  CB    . SER D  3 46  ? 17.023  0.934   -11.088 1.00 17.38 ? 46   SER B CB    1 
ATOM   2846 O  OG    . SER D  3 46  ? 17.619  1.811   -12.009 1.00 18.05 ? 46   SER B OG    1 
ATOM   2847 N  N     . ARG D  3 47  ? 15.866  -1.850  -10.222 1.00 15.57 ? 47   ARG B N     1 
ATOM   2848 C  CA    . ARG D  3 47  ? 15.327  -2.755  -9.211  1.00 15.64 ? 47   ARG B CA    1 
ATOM   2849 C  C     . ARG D  3 47  ? 16.134  -4.055  -9.133  1.00 15.48 ? 47   ARG B C     1 
ATOM   2850 O  O     . ARG D  3 47  ? 16.365  -4.586  -8.058  1.00 15.70 ? 47   ARG B O     1 
ATOM   2851 C  CB    . ARG D  3 47  ? 13.852  -3.065  -9.492  1.00 14.53 ? 47   ARG B CB    1 
ATOM   2852 C  CG    . ARG D  3 47  ? 12.895  -2.008  -8.996  1.00 14.10 ? 47   ARG B CG    1 
ATOM   2853 C  CD    . ARG D  3 47  ? 11.489  -2.576  -8.816  1.00 14.43 ? 47   ARG B CD    1 
ATOM   2854 N  NE    . ARG D  3 47  ? 11.006  -3.192  -10.044 1.00 15.06 ? 47   ARG B NE    1 
ATOM   2855 C  CZ    . ARG D  3 47  ? 10.647  -2.513  -11.127 1.00 14.25 ? 47   ARG B CZ    1 
ATOM   2856 N  NH1   . ARG D  3 47  ? 10.711  -1.191  -11.123 1.00 14.36 ? 47   ARG B NH1   1 
ATOM   2857 N  NH2   . ARG D  3 47  ? 10.237  -3.158  -12.214 1.00 14.39 ? 47   ARG B NH2   1 
ATOM   2858 N  N     . MET D  3 48  ? 16.557  -4.555  -10.285 1.00 16.57 ? 48   MET B N     1 
ATOM   2859 C  CA    . MET D  3 48  ? 17.331  -5.776  -10.350 1.00 18.38 ? 48   MET B CA    1 
ATOM   2860 C  C     . MET D  3 48  ? 18.757  -5.526  -9.850  1.00 19.28 ? 48   MET B C     1 
ATOM   2861 O  O     . MET D  3 48  ? 19.378  -6.403  -9.242  1.00 18.10 ? 48   MET B O     1 
ATOM   2862 C  CB    . MET D  3 48  ? 17.337  -6.319  -11.785 1.00 19.08 ? 48   MET B CB    1 
ATOM   2863 C  CG    . MET D  3 48  ? 15.946  -6.483  -12.400 1.00 18.76 ? 48   MET B CG    1 
ATOM   2864 S  SD    . MET D  3 48  ? 15.982  -7.255  -14.036 1.00 18.57 ? 48   MET B SD    1 
ATOM   2865 C  CE    . MET D  3 48  ? 16.884  -8.749  -13.649 1.00 17.60 ? 48   MET B CE    1 
ATOM   2866 N  N     . GLU D  3 49  ? 19.271  -4.328  -10.112 1.00 20.46 ? 49   GLU B N     1 
ATOM   2867 C  CA    . GLU D  3 49  ? 20.540  -3.922  -9.532  1.00 22.29 ? 49   GLU B CA    1 
ATOM   2868 C  C     . GLU D  3 49  ? 20.368  -3.762  -8.027  1.00 22.38 ? 49   GLU B C     1 
ATOM   2869 O  O     . GLU D  3 49  ? 21.182  -4.244  -7.247  1.00 22.77 ? 49   GLU B O     1 
ATOM   2870 C  CB    . GLU D  3 49  ? 21.067  -2.626  -10.156 1.00 23.76 ? 49   GLU B CB    1 
ATOM   2871 C  CG    . GLU D  3 49  ? 22.374  -2.143  -9.509  1.00 26.38 ? 49   GLU B CG    1 
ATOM   2872 C  CD    . GLU D  3 49  ? 23.269  -1.333  -10.448 1.00 27.59 ? 49   GLU B CD    1 
ATOM   2873 O  OE1   . GLU D  3 49  ? 24.339  -1.853  -10.841 1.00 28.63 ? 49   GLU B OE1   1 
ATOM   2874 O  OE2   . GLU D  3 49  ? 22.913  -0.179  -10.784 1.00 28.24 ? 49   GLU B OE2   1 
ATOM   2875 N  N     . ARG D  3 50  ? 19.293  -3.100  -7.621  1.00 21.76 ? 50   ARG B N     1 
ATOM   2876 C  CA    . ARG D  3 50  ? 19.008  -2.950  -6.209  1.00 21.76 ? 50   ARG B CA    1 
ATOM   2877 C  C     . ARG D  3 50  ? 18.931  -4.313  -5.507  1.00 21.86 ? 50   ARG B C     1 
ATOM   2878 O  O     . ARG D  3 50  ? 19.404  -4.465  -4.376  1.00 21.57 ? 50   ARG B O     1 
ATOM   2879 C  CB    . ARG D  3 50  ? 17.697  -2.191  -6.025  1.00 21.37 ? 50   ARG B CB    1 
ATOM   2880 C  CG    . ARG D  3 50  ? 17.276  -1.997  -4.583  1.00 20.49 ? 50   ARG B CG    1 
ATOM   2881 C  CD    . ARG D  3 50  ? 15.834  -1.562  -4.517  1.00 20.48 ? 50   ARG B CD    1 
ATOM   2882 N  NE    . ARG D  3 50  ? 14.941  -2.668  -4.843  1.00 21.65 ? 50   ARG B NE    1 
ATOM   2883 C  CZ    . ARG D  3 50  ? 13.630  -2.548  -5.034  1.00 22.00 ? 50   ARG B CZ    1 
ATOM   2884 N  NH1   . ARG D  3 50  ? 13.039  -1.361  -4.949  1.00 22.59 ? 50   ARG B NH1   1 
ATOM   2885 N  NH2   . ARG D  3 50  ? 12.908  -3.616  -5.326  1.00 20.98 ? 50   ARG B NH2   1 
ATOM   2886 N  N     . ASP D  3 51  ? 18.336  -5.299  -6.182  1.00 20.97 ? 51   ASP B N     1 
ATOM   2887 C  CA    . ASP D  3 51  ? 18.062  -6.594  -5.559  1.00 20.74 ? 51   ASP B CA    1 
ATOM   2888 C  C     . ASP D  3 51  ? 19.184  -7.602  -5.786  1.00 20.06 ? 51   ASP B C     1 
ATOM   2889 O  O     . ASP D  3 51  ? 19.038  -8.779  -5.478  1.00 20.40 ? 51   ASP B O     1 
ATOM   2890 C  CB    . ASP D  3 51  ? 16.707  -7.158  -6.021  1.00 21.31 ? 51   ASP B CB    1 
ATOM   2891 C  CG    . ASP D  3 51  ? 15.529  -6.248  -5.653  1.00 22.82 ? 51   ASP B CG    1 
ATOM   2892 O  OD1   . ASP D  3 51  ? 15.700  -5.382  -4.766  1.00 23.93 ? 51   ASP B OD1   1 
ATOM   2893 O  OD2   . ASP D  3 51  ? 14.430  -6.389  -6.244  1.00 22.00 ? 51   ASP B OD2   1 
ATOM   2894 N  N     . GLY D  3 52  ? 20.302  -7.136  -6.327  1.00 20.11 ? 52   GLY B N     1 
ATOM   2895 C  CA    . GLY D  3 52  ? 21.487  -7.969  -6.477  1.00 19.87 ? 52   GLY B CA    1 
ATOM   2896 C  C     . GLY D  3 52  ? 21.340  -9.063  -7.517  1.00 20.66 ? 52   GLY B C     1 
ATOM   2897 O  O     . GLY D  3 52  ? 21.915  -10.138 -7.380  1.00 21.30 ? 52   GLY B O     1 
ATOM   2898 N  N     . LEU D  3 53  ? 20.563  -8.801  -8.557  1.00 19.99 ? 53   LEU B N     1 
ATOM   2899 C  CA    . LEU D  3 53  ? 20.418  -9.765  -9.629  1.00 20.08 ? 53   LEU B CA    1 
ATOM   2900 C  C     . LEU D  3 53  ? 21.408  -9.481  -10.750 1.00 21.44 ? 53   LEU B C     1 
ATOM   2901 O  O     . LEU D  3 53  ? 21.823  -10.392 -11.472 1.00 20.94 ? 53   LEU B O     1 
ATOM   2902 C  CB    . LEU D  3 53  ? 18.986  -9.773  -10.157 1.00 19.10 ? 53   LEU B CB    1 
ATOM   2903 C  CG    . LEU D  3 53  ? 17.978  -10.331 -9.149  1.00 17.93 ? 53   LEU B CG    1 
ATOM   2904 C  CD1   . LEU D  3 53  ? 16.576  -10.217 -9.683  1.00 16.79 ? 53   LEU B CD1   1 
ATOM   2905 C  CD2   . LEU D  3 53  ? 18.306  -11.770 -8.800  1.00 17.74 ? 53   LEU B CD2   1 
ATOM   2906 N  N     . LEU D  3 54  ? 21.794  -8.216  -10.885 1.00 22.99 ? 54   LEU B N     1 
ATOM   2907 C  CA    . LEU D  3 54  ? 22.751  -7.819  -11.913 1.00 24.36 ? 54   LEU B CA    1 
ATOM   2908 C  C     . LEU D  3 54  ? 23.440  -6.508  -11.567 1.00 25.21 ? 54   LEU B C     1 
ATOM   2909 O  O     . LEU D  3 54  ? 23.053  -5.838  -10.619 1.00 24.97 ? 54   LEU B O     1 
ATOM   2910 C  CB    . LEU D  3 54  ? 22.070  -7.731  -13.288 1.00 24.26 ? 54   LEU B CB    1 
ATOM   2911 C  CG    . LEU D  3 54  ? 20.772  -6.928  -13.400 1.00 24.37 ? 54   LEU B CG    1 
ATOM   2912 C  CD1   . LEU D  3 54  ? 21.055  -5.437  -13.341 1.00 23.97 ? 54   LEU B CD1   1 
ATOM   2913 C  CD2   . LEU D  3 54  ? 20.023  -7.282  -14.678 1.00 24.09 ? 54   LEU B CD2   1 
ATOM   2914 N  N     . ARG D  3 55  ? 24.471  -6.164  -12.337 1.00 27.54 ? 55   ARG B N     1 
ATOM   2915 C  CA    . ARG D  3 55  ? 25.182  -4.896  -12.193 1.00 29.94 ? 55   ARG B CA    1 
ATOM   2916 C  C     . ARG D  3 55  ? 25.305  -4.229  -13.549 1.00 30.32 ? 55   ARG B C     1 
ATOM   2917 O  O     . ARG D  3 55  ? 25.603  -4.880  -14.546 1.00 30.79 ? 55   ARG B O     1 
ATOM   2918 C  CB    . ARG D  3 55  ? 26.576  -5.090  -11.574 1.00 30.36 ? 55   ARG B CB    1 
ATOM   2919 C  CG    . ARG D  3 55  ? 26.720  -4.562  -10.132 1.00 32.40 ? 55   ARG B CG    1 
ATOM   2920 C  CD    . ARG D  3 55  ? 28.178  -4.630  -9.598  1.00 33.17 ? 55   ARG B CD    1 
ATOM   2921 N  NE    . ARG D  3 55  ? 29.163  -4.082  -10.543 1.00 35.36 ? 55   ARG B NE    1 
ATOM   2922 C  CZ    . ARG D  3 55  ? 30.163  -4.774  -11.103 1.00 35.88 ? 55   ARG B CZ    1 
ATOM   2923 N  NH1   . ARG D  3 55  ? 30.356  -6.061  -10.815 1.00 35.83 ? 55   ARG B NH1   1 
ATOM   2924 N  NH2   . ARG D  3 55  ? 30.987  -4.171  -11.950 1.00 35.26 ? 55   ARG B NH2   1 
ATOM   2925 N  N     . VAL D  3 56  ? 25.055  -2.928  -13.596 1.00 31.32 ? 56   VAL B N     1 
ATOM   2926 C  CA    . VAL D  3 56  ? 25.279  -2.183  -14.820 1.00 32.40 ? 56   VAL B CA    1 
ATOM   2927 C  C     . VAL D  3 56  ? 26.695  -1.632  -14.757 1.00 33.32 ? 56   VAL B C     1 
ATOM   2928 O  O     . VAL D  3 56  ? 26.970  -0.725  -13.970 1.00 33.67 ? 56   VAL B O     1 
ATOM   2929 C  CB    . VAL D  3 56  ? 24.282  -1.014  -14.979 1.00 32.53 ? 56   VAL B CB    1 
ATOM   2930 C  CG1   . VAL D  3 56  ? 24.493  -0.314  -16.325 1.00 32.26 ? 56   VAL B CG1   1 
ATOM   2931 C  CG2   . VAL D  3 56  ? 22.852  -1.503  -14.846 1.00 31.51 ? 56   VAL B CG2   1 
ATOM   2932 N  N     . ALA D  3 57  ? 27.586  -2.190  -15.576 1.00 34.12 ? 57   ALA B N     1 
ATOM   2933 C  CA    . ALA D  3 57  ? 29.015  -1.855  -15.536 1.00 35.78 ? 57   ALA B CA    1 
ATOM   2934 C  C     . ALA D  3 57  ? 29.309  -0.437  -16.038 1.00 36.66 ? 57   ALA B C     1 
ATOM   2935 O  O     . ALA D  3 57  ? 28.463  0.196   -16.670 1.00 38.28 ? 57   ALA B O     1 
ATOM   2936 C  CB    . ALA D  3 57  ? 29.835  -2.895  -16.326 1.00 35.26 ? 57   ALA B CB    1 
ATOM   2937 N  N     . GLY D  3 58  ? 30.511  0.059   -15.758 1.00 37.11 ? 58   GLY B N     1 
ATOM   2938 C  CA    . GLY D  3 58  ? 30.899  1.412   -16.164 1.00 36.26 ? 58   GLY B CA    1 
ATOM   2939 C  C     . GLY D  3 58  ? 30.717  1.686   -17.648 1.00 36.38 ? 58   GLY B C     1 
ATOM   2940 O  O     . GLY D  3 58  ? 30.451  2.816   -18.046 1.00 35.76 ? 58   GLY B O     1 
ATOM   2941 N  N     . ASP D  3 59  ? 30.866  0.658   -18.477 1.00 36.49 ? 59   ASP B N     1 
ATOM   2942 C  CA    . ASP D  3 59  ? 30.683  0.844   -19.910 1.00 37.77 ? 59   ASP B CA    1 
ATOM   2943 C  C     . ASP D  3 59  ? 29.271  0.446   -20.343 1.00 38.57 ? 59   ASP B C     1 
ATOM   2944 O  O     . ASP D  3 59  ? 29.051  0.047   -21.487 1.00 39.12 ? 59   ASP B O     1 
ATOM   2945 C  CB    . ASP D  3 59  ? 31.772  0.117   -20.723 1.00 37.74 ? 59   ASP B CB    1 
ATOM   2946 C  CG    . ASP D  3 59  ? 31.639  -1.399  -20.692 1.00 38.25 ? 59   ASP B CG    1 
ATOM   2947 O  OD1   . ASP D  3 59  ? 32.448  -2.062  -21.370 1.00 38.03 ? 59   ASP B OD1   1 
ATOM   2948 O  OD2   . ASP D  3 59  ? 30.743  -1.939  -20.008 1.00 38.92 ? 59   ASP B OD2   1 
ATOM   2949 N  N     . ARG D  3 60  ? 28.334  0.544   -19.399 1.00 38.95 ? 60   ARG B N     1 
ATOM   2950 C  CA    . ARG D  3 60  ? 26.907  0.271   -19.619 1.00 39.07 ? 60   ARG B CA    1 
ATOM   2951 C  C     . ARG D  3 60  ? 26.546  -1.186  -19.956 1.00 37.79 ? 60   ARG B C     1 
ATOM   2952 O  O     . ARG D  3 60  ? 25.396  -1.479  -20.275 1.00 37.61 ? 60   ARG B O     1 
ATOM   2953 C  CB    . ARG D  3 60  ? 26.321  1.224   -20.669 1.00 40.03 ? 60   ARG B CB    1 
ATOM   2954 C  CG    . ARG D  3 60  ? 26.364  2.714   -20.293 1.00 41.20 ? 60   ARG B CG    1 
ATOM   2955 C  CD    . ARG D  3 60  ? 25.946  3.600   -21.485 1.00 41.24 ? 60   ARG B CD    1 
ATOM   2956 N  NE    . ARG D  3 60  ? 26.673  3.257   -22.714 1.00 42.00 ? 60   ARG B NE    1 
ATOM   2957 C  CZ    . ARG D  3 60  ? 26.222  3.485   -23.948 1.00 42.40 ? 60   ARG B CZ    1 
ATOM   2958 N  NH1   . ARG D  3 60  ? 26.948  3.133   -25.008 1.00 41.82 ? 60   ARG B NH1   1 
ATOM   2959 N  NH2   . ARG D  3 60  ? 25.039  4.060   -24.125 1.00 42.97 ? 60   ARG B NH2   1 
ATOM   2960 N  N     . HIS D  3 61  ? 27.516  -2.094  -19.883 1.00 37.18 ? 61   HIS B N     1 
ATOM   2961 C  CA    . HIS D  3 61  ? 27.239  -3.521  -20.111 1.00 36.31 ? 61   HIS B CA    1 
ATOM   2962 C  C     . HIS D  3 61  ? 26.389  -4.087  -18.975 1.00 34.45 ? 61   HIS B C     1 
ATOM   2963 O  O     . HIS D  3 61  ? 26.573  -3.717  -17.816 1.00 34.43 ? 61   HIS B O     1 
ATOM   2964 C  CB    . HIS D  3 61  ? 28.533  -4.342  -20.204 1.00 37.11 ? 61   HIS B CB    1 
ATOM   2965 C  CG    . HIS D  3 61  ? 29.267  -4.188  -21.499 1.00 38.37 ? 61   HIS B CG    1 
ATOM   2966 N  ND1   . HIS D  3 61  ? 30.639  -4.297  -21.592 1.00 39.33 ? 61   HIS B ND1   1 
ATOM   2967 C  CD2   . HIS D  3 61  ? 28.821  -3.936  -22.752 1.00 38.17 ? 61   HIS B CD2   1 
ATOM   2968 C  CE1   . HIS D  3 61  ? 31.003  -4.121  -22.852 1.00 38.43 ? 61   HIS B CE1   1 
ATOM   2969 N  NE2   . HIS D  3 61  ? 29.919  -3.904  -23.575 1.00 37.53 ? 61   HIS B NE2   1 
ATOM   2970 N  N     . LEU D  3 62  ? 25.472  -4.989  -19.306 1.00 31.67 ? 62   LEU B N     1 
ATOM   2971 C  CA    . LEU D  3 62  ? 24.642  -5.612  -18.296 1.00 29.39 ? 62   LEU B CA    1 
ATOM   2972 C  C     . LEU D  3 62  ? 25.201  -6.972  -17.952 1.00 29.02 ? 62   LEU B C     1 
ATOM   2973 O  O     . LEU D  3 62  ? 25.258  -7.865  -18.801 1.00 29.02 ? 62   LEU B O     1 
ATOM   2974 C  CB    . LEU D  3 62  ? 23.196  -5.742  -18.774 1.00 29.46 ? 62   LEU B CB    1 
ATOM   2975 C  CG    . LEU D  3 62  ? 22.432  -4.440  -19.043 1.00 28.51 ? 62   LEU B CG    1 
ATOM   2976 C  CD1   . LEU D  3 62  ? 20.972  -4.737  -19.279 1.00 27.69 ? 62   LEU B CD1   1 
ATOM   2977 C  CD2   . LEU D  3 62  ? 22.598  -3.458  -17.894 1.00 28.07 ? 62   LEU B CD2   1 
ATOM   2978 N  N     . GLU D  3 63  ? 25.618  -7.125  -16.699 1.00 27.66 ? 63   GLU B N     1 
ATOM   2979 C  CA    . GLU D  3 63  ? 26.236  -8.357  -16.243 1.00 25.93 ? 63   GLU B CA    1 
ATOM   2980 C  C     . GLU D  3 63  ? 25.454  -8.981  -15.121 1.00 24.48 ? 63   GLU B C     1 
ATOM   2981 O  O     . GLU D  3 63  ? 25.053  -8.306  -14.175 1.00 23.96 ? 63   GLU B O     1 
ATOM   2982 C  CB    . GLU D  3 63  ? 27.658  -8.092  -15.773 1.00 27.06 ? 63   GLU B CB    1 
ATOM   2983 C  CG    . GLU D  3 63  ? 28.673  -8.111  -16.894 1.00 29.25 ? 63   GLU B CG    1 
ATOM   2984 C  CD    . GLU D  3 63  ? 29.872  -7.237  -16.601 1.00 29.89 ? 63   GLU B CD    1 
ATOM   2985 O  OE1   . GLU D  3 63  ? 30.306  -7.175  -15.426 1.00 29.35 ? 63   GLU B OE1   1 
ATOM   2986 O  OE2   . GLU D  3 63  ? 30.372  -6.609  -17.560 1.00 31.32 ? 63   GLU B OE2   1 
ATOM   2987 N  N     . LEU D  3 64  ? 25.257  -10.286 -15.216 1.00 22.79 ? 64   LEU B N     1 
ATOM   2988 C  CA    . LEU D  3 64  ? 24.525  -10.997 -14.192 1.00 21.15 ? 64   LEU B CA    1 
ATOM   2989 C  C     . LEU D  3 64  ? 25.434  -11.334 -13.018 1.00 20.69 ? 64   LEU B C     1 
ATOM   2990 O  O     . LEU D  3 64  ? 26.634  -11.530 -13.182 1.00 20.55 ? 64   LEU B O     1 
ATOM   2991 C  CB    . LEU D  3 64  ? 23.879  -12.250 -14.770 1.00 20.71 ? 64   LEU B CB    1 
ATOM   2992 C  CG    . LEU D  3 64  ? 23.066  -11.968 -16.037 1.00 21.04 ? 64   LEU B CG    1 
ATOM   2993 C  CD1   . LEU D  3 64  ? 22.294  -13.208 -16.472 1.00 21.73 ? 64   LEU B CD1   1 
ATOM   2994 C  CD2   . LEU D  3 64  ? 22.126  -10.783 -15.861 1.00 19.88 ? 64   LEU B CD2   1 
ATOM   2995 N  N     . THR D  3 65  ? 24.848  -11.357 -11.831 1.00 19.80 ? 65   THR B N     1 
ATOM   2996 C  CA    . THR D  3 65  ? 25.559  -11.699 -10.629 1.00 19.73 ? 65   THR B CA    1 
ATOM   2997 C  C     . THR D  3 65  ? 25.473  -13.202 -10.492 1.00 20.35 ? 65   THR B C     1 
ATOM   2998 O  O     . THR D  3 65  ? 24.765  -13.854 -11.255 1.00 20.61 ? 65   THR B O     1 
ATOM   2999 C  CB    . THR D  3 65  ? 24.903  -11.038 -9.391  1.00 19.42 ? 65   THR B CB    1 
ATOM   3000 O  OG1   . THR D  3 65  ? 23.554  -11.508 -9.250  1.00 18.75 ? 65   THR B OG1   1 
ATOM   3001 C  CG2   . THR D  3 65  ? 24.906  -9.520  -9.527  1.00 17.85 ? 65   THR B CG2   1 
ATOM   3002 N  N     . GLU D  3 66  ? 26.176  -13.764 -9.520  1.00 21.28 ? 66   GLU B N     1 
ATOM   3003 C  CA    . GLU D  3 66  ? 26.081  -15.196 -9.325  1.00 22.58 ? 66   GLU B CA    1 
ATOM   3004 C  C     . GLU D  3 66  ? 24.612  -15.555 -9.143  1.00 21.44 ? 66   GLU B C     1 
ATOM   3005 O  O     . GLU D  3 66  ? 24.103  -16.456 -9.794  1.00 21.58 ? 66   GLU B O     1 
ATOM   3006 C  CB    . GLU D  3 66  ? 26.928  -15.656 -8.138  1.00 23.64 ? 66   GLU B CB    1 
ATOM   3007 C  CG    . GLU D  3 66  ? 27.136  -17.155 -8.074  1.00 26.06 ? 66   GLU B CG    1 
ATOM   3008 C  CD    . GLU D  3 66  ? 28.550  -17.548 -7.640  1.00 28.43 ? 66   GLU B CD    1 
ATOM   3009 O  OE1   . GLU D  3 66  ? 28.721  -18.704 -7.188  1.00 29.63 ? 66   GLU B OE1   1 
ATOM   3010 O  OE2   . GLU D  3 66  ? 29.487  -16.716 -7.756  1.00 28.37 ? 66   GLU B OE2   1 
ATOM   3011 N  N     . LYS D  3 67  ? 23.933  -14.816 -8.275  1.00 21.34 ? 67   LYS B N     1 
ATOM   3012 C  CA    . LYS D  3 67  ? 22.526  -15.053 -7.993  1.00 21.18 ? 67   LYS B CA    1 
ATOM   3013 C  C     . LYS D  3 67  ? 21.673  -14.883 -9.246  1.00 21.40 ? 67   LYS B C     1 
ATOM   3014 O  O     . LYS D  3 67  ? 20.762  -15.673 -9.505  1.00 21.01 ? 67   LYS B O     1 
ATOM   3015 C  CB    . LYS D  3 67  ? 22.037  -14.086 -6.920  1.00 20.37 ? 67   LYS B CB    1 
ATOM   3016 C  CG    . LYS D  3 67  ? 20.667  -14.413 -6.381  1.00 21.05 ? 67   LYS B CG    1 
ATOM   3017 C  CD    . LYS D  3 67  ? 20.112  -13.243 -5.614  1.00 22.81 ? 67   LYS B CD    1 
ATOM   3018 C  CE    . LYS D  3 67  ? 18.736  -13.549 -5.055  1.00 23.68 ? 67   LYS B CE    1 
ATOM   3019 N  NZ    . LYS D  3 67  ? 18.161  -12.317 -4.450  1.00 24.69 ? 67   LYS B NZ    1 
ATOM   3020 N  N     . GLY D  3 68  ? 21.971  -13.833 -10.005 1.00 20.82 ? 68   GLY B N     1 
ATOM   3021 C  CA    . GLY D  3 68  ? 21.233  -13.522 -11.212 1.00 21.09 ? 68   GLY B CA    1 
ATOM   3022 C  C     . GLY D  3 68  ? 21.432  -14.584 -12.273 1.00 22.08 ? 68   GLY B C     1 
ATOM   3023 O  O     . GLY D  3 68  ? 20.463  -15.031 -12.914 1.00 22.47 ? 68   GLY B O     1 
ATOM   3024 N  N     . ARG D  3 69  ? 22.689  -14.984 -12.460 1.00 21.31 ? 69   ARG B N     1 
ATOM   3025 C  CA    . ARG D  3 69  ? 23.030  -16.037 -13.409 1.00 20.72 ? 69   ARG B CA    1 
ATOM   3026 C  C     . ARG D  3 69  ? 22.360  -17.357 -13.016 1.00 18.95 ? 69   ARG B C     1 
ATOM   3027 O  O     . ARG D  3 69  ? 21.790  -18.058 -13.853 1.00 19.09 ? 69   ARG B O     1 
ATOM   3028 C  CB    . ARG D  3 69  ? 24.552  -16.194 -13.519 1.00 22.25 ? 69   ARG B CB    1 
ATOM   3029 C  CG    . ARG D  3 69  ? 25.008  -17.371 -14.372 1.00 23.28 ? 69   ARG B CG    1 
ATOM   3030 C  CD    . ARG D  3 69  ? 26.420  -17.174 -14.878 1.00 25.23 ? 69   ARG B CD    1 
ATOM   3031 N  NE    . ARG D  3 69  ? 26.526  -15.984 -15.722 1.00 27.61 ? 69   ARG B NE    1 
ATOM   3032 C  CZ    . ARG D  3 69  ? 25.963  -15.863 -16.924 1.00 28.91 ? 69   ARG B CZ    1 
ATOM   3033 N  NH1   . ARG D  3 69  ? 25.244  -16.858 -17.423 1.00 29.66 ? 69   ARG B NH1   1 
ATOM   3034 N  NH2   . ARG D  3 69  ? 26.109  -14.745 -17.628 1.00 29.45 ? 69   ARG B NH2   1 
ATOM   3035 N  N     . ALA D  3 70  ? 22.405  -17.688 -11.736 1.00 17.40 ? 70   ALA B N     1 
ATOM   3036 C  CA    . ALA D  3 70  ? 21.752  -18.899 -11.277 1.00 16.79 ? 70   ALA B CA    1 
ATOM   3037 C  C     . ALA D  3 70  ? 20.286  -18.928 -11.742 1.00 16.38 ? 70   ALA B C     1 
ATOM   3038 O  O     . ALA D  3 70  ? 19.860  -19.859 -12.424 1.00 17.76 ? 70   ALA B O     1 
ATOM   3039 C  CB    . ALA D  3 70  ? 21.860  -19.025 -9.773  1.00 14.92 ? 70   ALA B CB    1 
ATOM   3040 N  N     . LEU D  3 71  ? 19.531  -17.894 -11.398 1.00 15.68 ? 71   LEU B N     1 
ATOM   3041 C  CA    . LEU D  3 71  ? 18.132  -17.805 -11.778 1.00 15.25 ? 71   LEU B CA    1 
ATOM   3042 C  C     . LEU D  3 71  ? 17.976  -17.898 -13.304 1.00 14.73 ? 71   LEU B C     1 
ATOM   3043 O  O     . LEU D  3 71  ? 17.072  -18.555 -13.818 1.00 12.30 ? 71   LEU B O     1 
ATOM   3044 C  CB    . LEU D  3 71  ? 17.544  -16.488 -11.269 1.00 15.66 ? 71   LEU B CB    1 
ATOM   3045 C  CG    . LEU D  3 71  ? 16.207  -16.553 -10.518 1.00 16.44 ? 71   LEU B CG    1 
ATOM   3046 C  CD1   . LEU D  3 71  ? 15.477  -15.222 -10.621 1.00 16.00 ? 71   LEU B CD1   1 
ATOM   3047 C  CD2   . LEU D  3 71  ? 15.314  -17.689 -11.012 1.00 16.04 ? 71   LEU B CD2   1 
ATOM   3048 N  N     . ALA D  3 72  ? 18.871  -17.234 -14.021 1.00 14.73 ? 72   ALA B N     1 
ATOM   3049 C  CA    . ALA D  3 72  ? 18.794  -17.200 -15.468 1.00 15.45 ? 72   ALA B CA    1 
ATOM   3050 C  C     . ALA D  3 72  ? 18.766  -18.620 -16.023 1.00 16.19 ? 72   ALA B C     1 
ATOM   3051 O  O     . ALA D  3 72  ? 17.874  -18.983 -16.790 1.00 16.17 ? 72   ALA B O     1 
ATOM   3052 C  CB    . ALA D  3 72  ? 19.967  -16.403 -16.050 1.00 14.37 ? 72   ALA B CB    1 
ATOM   3053 N  N     . ILE D  3 73  ? 19.749  -19.415 -15.617 1.00 17.00 ? 73   ILE B N     1 
ATOM   3054 C  CA    . ILE D  3 73  ? 19.851  -20.802 -16.023 1.00 17.38 ? 73   ILE B CA    1 
ATOM   3055 C  C     . ILE D  3 73  ? 18.618  -21.573 -15.562 1.00 17.32 ? 73   ILE B C     1 
ATOM   3056 O  O     . ILE D  3 73  ? 17.960  -22.244 -16.355 1.00 18.03 ? 73   ILE B O     1 
ATOM   3057 C  CB    . ILE D  3 73  ? 21.118  -21.441 -15.420 1.00 18.48 ? 73   ILE B CB    1 
ATOM   3058 C  CG1   . ILE D  3 73  ? 22.371  -20.736 -15.958 1.00 18.56 ? 73   ILE B CG1   1 
ATOM   3059 C  CG2   . ILE D  3 73  ? 21.158  -22.942 -15.690 1.00 17.98 ? 73   ILE B CG2   1 
ATOM   3060 C  CD1   . ILE D  3 73  ? 23.642  -21.070 -15.194 1.00 18.01 ? 73   ILE B CD1   1 
ATOM   3061 N  N     . ALA D  3 74  ? 18.286  -21.468 -14.282 1.00 16.56 ? 74   ALA B N     1 
ATOM   3062 C  CA    . ALA D  3 74  ? 17.146  -22.214 -13.766 1.00 16.31 ? 74   ALA B CA    1 
ATOM   3063 C  C     . ALA D  3 74  ? 15.860  -21.967 -14.584 1.00 16.23 ? 74   ALA B C     1 
ATOM   3064 O  O     . ALA D  3 74  ? 15.053  -22.876 -14.746 1.00 17.23 ? 74   ALA B O     1 
ATOM   3065 C  CB    . ALA D  3 74  ? 16.939  -21.934 -12.280 1.00 14.18 ? 74   ALA B CB    1 
ATOM   3066 N  N     . VAL D  3 75  ? 15.684  -20.755 -15.111 1.00 16.18 ? 75   VAL B N     1 
ATOM   3067 C  CA    . VAL D  3 75  ? 14.516  -20.438 -15.940 1.00 16.84 ? 75   VAL B CA    1 
ATOM   3068 C  C     . VAL D  3 75  ? 14.657  -20.989 -17.369 1.00 18.62 ? 75   VAL B C     1 
ATOM   3069 O  O     . VAL D  3 75  ? 13.684  -21.463 -17.969 1.00 16.68 ? 75   VAL B O     1 
ATOM   3070 C  CB    . VAL D  3 75  ? 14.223  -18.917 -15.989 1.00 15.93 ? 75   VAL B CB    1 
ATOM   3071 C  CG1   . VAL D  3 75  ? 13.092  -18.629 -16.943 1.00 15.21 ? 75   VAL B CG1   1 
ATOM   3072 C  CG2   . VAL D  3 75  ? 13.863  -18.397 -14.615 1.00 14.97 ? 75   VAL B CG2   1 
ATOM   3073 N  N     . MET D  3 76  ? 15.872  -20.921 -17.911 1.00 20.48 ? 76   MET B N     1 
ATOM   3074 C  CA    . MET D  3 76  ? 16.144  -21.494 -19.216 1.00 21.64 ? 76   MET B CA    1 
ATOM   3075 C  C     . MET D  3 76  ? 15.886  -22.990 -19.167 1.00 21.73 ? 76   MET B C     1 
ATOM   3076 O  O     . MET D  3 76  ? 15.186  -23.542 -20.023 1.00 23.37 ? 76   MET B O     1 
ATOM   3077 C  CB    . MET D  3 76  ? 17.586  -21.255 -19.615 1.00 25.09 ? 76   MET B CB    1 
ATOM   3078 C  CG    . MET D  3 76  ? 17.884  -21.724 -21.016 1.00 29.17 ? 76   MET B CG    1 
ATOM   3079 S  SD    . MET D  3 76  ? 17.072  -20.657 -22.226 1.00 34.18 ? 76   MET B SD    1 
ATOM   3080 C  CE    . MET D  3 76  ? 18.225  -19.278 -22.275 1.00 31.80 ? 76   MET B CE    1 
ATOM   3081 N  N     . ARG D  3 77  ? 16.444  -23.642 -18.149 1.00 19.38 ? 77   ARG B N     1 
ATOM   3082 C  CA    . ARG D  3 77  ? 16.271  -25.071 -17.982 1.00 17.41 ? 77   ARG B CA    1 
ATOM   3083 C  C     . ARG D  3 77  ? 14.801  -25.431 -17.891 1.00 17.11 ? 77   ARG B C     1 
ATOM   3084 O  O     . ARG D  3 77  ? 14.359  -26.371 -18.546 1.00 17.41 ? 77   ARG B O     1 
ATOM   3085 C  CB    . ARG D  3 77  ? 17.004  -25.574 -16.744 1.00 17.63 ? 77   ARG B CB    1 
ATOM   3086 C  CG    . ARG D  3 77  ? 17.011  -27.097 -16.613 1.00 16.59 ? 77   ARG B CG    1 
ATOM   3087 C  CD    . ARG D  3 77  ? 17.548  -27.541 -15.266 1.00 16.97 ? 77   ARG B CD    1 
ATOM   3088 N  NE    . ARG D  3 77  ? 16.752  -27.024 -14.155 1.00 16.61 ? 77   ARG B NE    1 
ATOM   3089 C  CZ    . ARG D  3 77  ? 17.249  -26.344 -13.129 1.00 15.80 ? 77   ARG B CZ    1 
ATOM   3090 N  NH1   . ARG D  3 77  ? 18.544  -26.101 -13.051 1.00 16.26 ? 77   ARG B NH1   1 
ATOM   3091 N  NH2   . ARG D  3 77  ? 16.450  -25.920 -12.173 1.00 16.20 ? 77   ARG B NH2   1 
ATOM   3092 N  N     . LYS D  3 78  ? 14.051  -24.690 -17.076 1.00 16.36 ? 78   LYS B N     1 
ATOM   3093 C  CA    . LYS D  3 78  ? 12.601  -24.864 -17.009 1.00 16.63 ? 78   LYS B CA    1 
ATOM   3094 C  C     . LYS D  3 78  ? 11.975  -24.715 -18.395 1.00 16.21 ? 78   LYS B C     1 
ATOM   3095 O  O     . LYS D  3 78  ? 11.080  -25.470 -18.771 1.00 16.50 ? 78   LYS B O     1 
ATOM   3096 C  CB    . LYS D  3 78  ? 11.971  -23.853 -16.047 1.00 16.05 ? 78   LYS B CB    1 
ATOM   3097 C  CG    . LYS D  3 78  ? 12.395  -24.021 -14.599 1.00 14.81 ? 78   LYS B CG    1 
ATOM   3098 C  CD    . LYS D  3 78  ? 11.786  -22.946 -13.717 1.00 13.98 ? 78   LYS B CD    1 
ATOM   3099 C  CE    . LYS D  3 78  ? 12.581  -22.772 -12.431 1.00 13.35 ? 78   LYS B CE    1 
ATOM   3100 N  NZ    . LYS D  3 78  ? 12.172  -23.728 -11.371 1.00 12.23 ? 78   LYS B NZ    1 
ATOM   3101 N  N     . HIS D  3 79  ? 12.476  -23.760 -19.166 1.00 15.80 ? 79   HIS B N     1 
ATOM   3102 C  CA    . HIS D  3 79  ? 11.848  -23.418 -20.436 1.00 16.39 ? 79   HIS B CA    1 
ATOM   3103 C  C     . HIS D  3 79  ? 12.034  -24.485 -21.530 1.00 15.85 ? 79   HIS B C     1 
ATOM   3104 O  O     . HIS D  3 79  ? 11.124  -24.735 -22.324 1.00 15.24 ? 79   HIS B O     1 
ATOM   3105 C  CB    . HIS D  3 79  ? 12.348  -22.059 -20.916 1.00 16.08 ? 79   HIS B CB    1 
ATOM   3106 C  CG    . HIS D  3 79  ? 12.096  -21.801 -22.364 1.00 15.71 ? 79   HIS B CG    1 
ATOM   3107 N  ND1   . HIS D  3 79  ? 11.043  -21.036 -22.809 1.00 16.72 ? 79   HIS B ND1   1 
ATOM   3108 C  CD2   . HIS D  3 79  ? 12.764  -22.202 -23.468 1.00 16.51 ? 79   HIS B CD2   1 
ATOM   3109 C  CE1   . HIS D  3 79  ? 11.073  -20.974 -24.128 1.00 16.56 ? 79   HIS B CE1   1 
ATOM   3110 N  NE2   . HIS D  3 79  ? 12.109  -21.672 -24.553 1.00 17.09 ? 79   HIS B NE2   1 
ATOM   3111 N  N     . ARG D  3 80  ? 13.208  -25.103 -21.584 1.00 13.92 ? 80   ARG B N     1 
ATOM   3112 C  CA    . ARG D  3 80  ? 13.455  -26.111 -22.611 1.00 12.08 ? 80   ARG B CA    1 
ATOM   3113 C  C     . ARG D  3 80  ? 12.928  -27.484 -22.172 1.00 11.78 ? 80   ARG B C     1 
ATOM   3114 O  O     . ARG D  3 80  ? 12.551  -28.314 -23.001 1.00 11.24 ? 80   ARG B O     1 
ATOM   3115 C  CB    . ARG D  3 80  ? 14.933  -26.114 -23.009 1.00 12.10 ? 80   ARG B CB    1 
ATOM   3116 C  CG    . ARG D  3 80  ? 15.378  -24.741 -23.515 1.00 11.02 ? 80   ARG B CG    1 
ATOM   3117 C  CD    . ARG D  3 80  ? 16.861  -24.619 -23.840 1.00 11.45 ? 80   ARG B CD    1 
ATOM   3118 N  NE    . ARG D  3 80  ? 17.126  -23.324 -24.470 1.00 12.84 ? 80   ARG B NE    1 
ATOM   3119 C  CZ    . ARG D  3 80  ? 18.318  -22.876 -24.861 1.00 13.87 ? 80   ARG B CZ    1 
ATOM   3120 N  NH1   . ARG D  3 80  ? 19.424  -23.599 -24.698 1.00 14.59 ? 80   ARG B NH1   1 
ATOM   3121 N  NH2   . ARG D  3 80  ? 18.402  -21.684 -25.425 1.00 14.07 ? 80   ARG B NH2   1 
ATOM   3122 N  N     . LEU D  3 81  ? 12.848  -27.708 -20.864 1.00 10.88 ? 81   LEU B N     1 
ATOM   3123 C  CA    . LEU D  3 81  ? 12.136  -28.881 -20.366 1.00 10.43 ? 81   LEU B CA    1 
ATOM   3124 C  C     . LEU D  3 81  ? 10.652  -28.824 -20.716 1.00 11.02 ? 81   LEU B C     1 
ATOM   3125 O  O     . LEU D  3 81  ? 10.104  -29.766 -21.272 1.00 10.46 ? 81   LEU B O     1 
ATOM   3126 C  CB    . LEU D  3 81  ? 12.321  -29.040 -18.860 1.00 9.88  ? 81   LEU B CB    1 
ATOM   3127 C  CG    . LEU D  3 81  ? 13.624  -29.727 -18.437 1.00 10.01 ? 81   LEU B CG    1 
ATOM   3128 C  CD1   . LEU D  3 81  ? 13.744  -29.798 -16.930 1.00 8.15  ? 81   LEU B CD1   1 
ATOM   3129 C  CD2   . LEU D  3 81  ? 13.712  -31.115 -19.065 1.00 9.47  ? 81   LEU B CD2   1 
ATOM   3130 N  N     . ALA D  3 82  ? 9.998   -27.716 -20.392 1.00 12.65 ? 82   ALA B N     1 
ATOM   3131 C  CA    . ALA D  3 82  ? 8.606   -27.542 -20.773 1.00 13.03 ? 82   ALA B CA    1 
ATOM   3132 C  C     . ALA D  3 82  ? 8.462   -27.799 -22.271 1.00 13.53 ? 82   ALA B C     1 
ATOM   3133 O  O     . ALA D  3 82  ? 7.565   -28.527 -22.711 1.00 13.31 ? 82   ALA B O     1 
ATOM   3134 C  CB    . ALA D  3 82  ? 8.138   -26.144 -20.422 1.00 13.95 ? 82   ALA B CB    1 
ATOM   3135 N  N     . GLU D  3 83  ? 9.369   -27.223 -23.051 1.00 13.41 ? 83   GLU B N     1 
ATOM   3136 C  CA    . GLU D  3 83  ? 9.326   -27.396 -24.496 1.00 14.94 ? 83   GLU B CA    1 
ATOM   3137 C  C     . GLU D  3 83  ? 9.400   -28.871 -24.910 1.00 16.72 ? 83   GLU B C     1 
ATOM   3138 O  O     . GLU D  3 83  ? 8.687   -29.293 -25.822 1.00 17.67 ? 83   GLU B O     1 
ATOM   3139 C  CB    . GLU D  3 83  ? 10.398  -26.548 -25.194 1.00 14.31 ? 83   GLU B CB    1 
ATOM   3140 C  CG    . GLU D  3 83  ? 9.968   -25.105 -25.486 1.00 13.93 ? 83   GLU B CG    1 
ATOM   3141 C  CD    . GLU D  3 83  ? 11.114  -24.231 -25.966 1.00 14.85 ? 83   GLU B CD    1 
ATOM   3142 O  OE1   . GLU D  3 83  ? 12.240  -24.766 -26.091 1.00 15.67 ? 83   GLU B OE1   1 
ATOM   3143 O  OE2   . GLU D  3 83  ? 10.902  -23.011 -26.210 1.00 14.78 ? 83   GLU B OE2   1 
ATOM   3144 N  N     . ARG D  3 84  ? 10.243  -29.656 -24.241 1.00 17.68 ? 84   ARG B N     1 
ATOM   3145 C  CA    . ARG D  3 84  ? 10.306  -31.091 -24.509 1.00 18.60 ? 84   ARG B CA    1 
ATOM   3146 C  C     . ARG D  3 84  ? 8.974   -31.737 -24.215 1.00 19.05 ? 84   ARG B C     1 
ATOM   3147 O  O     . ARG D  3 84  ? 8.422   -32.483 -25.034 1.00 18.96 ? 84   ARG B O     1 
ATOM   3148 C  CB    . ARG D  3 84  ? 11.383  -31.754 -23.658 1.00 20.35 ? 84   ARG B CB    1 
ATOM   3149 C  CG    . ARG D  3 84  ? 12.744  -31.817 -24.329 1.00 22.66 ? 84   ARG B CG    1 
ATOM   3150 C  CD    . ARG D  3 84  ? 13.085  -33.222 -24.799 1.00 22.90 ? 84   ARG B CD    1 
ATOM   3151 N  NE    . ARG D  3 84  ? 12.570  -33.550 -26.124 1.00 24.24 ? 84   ARG B NE    1 
ATOM   3152 C  CZ    . ARG D  3 84  ? 13.259  -33.425 -27.256 1.00 23.83 ? 84   ARG B CZ    1 
ATOM   3153 N  NH1   . ARG D  3 84  ? 14.497  -32.945 -27.247 1.00 22.75 ? 84   ARG B NH1   1 
ATOM   3154 N  NH2   . ARG D  3 84  ? 12.695  -33.770 -28.405 1.00 23.77 ? 84   ARG B NH2   1 
ATOM   3155 N  N     . LEU D  3 85  ? 8.455   -31.437 -23.033 1.00 19.49 ? 85   LEU B N     1 
ATOM   3156 C  CA    . LEU D  3 85  ? 7.197   -32.013 -22.593 1.00 19.75 ? 85   LEU B CA    1 
ATOM   3157 C  C     . LEU D  3 85  ? 6.106   -31.766 -23.620 1.00 19.13 ? 85   LEU B C     1 
ATOM   3158 O  O     . LEU D  3 85  ? 5.455   -32.692 -24.080 1.00 18.03 ? 85   LEU B O     1 
ATOM   3159 C  CB    . LEU D  3 85  ? 6.782   -31.419 -21.245 1.00 19.70 ? 85   LEU B CB    1 
ATOM   3160 C  CG    . LEU D  3 85  ? 5.526   -32.031 -20.623 1.00 19.71 ? 85   LEU B CG    1 
ATOM   3161 C  CD1   . LEU D  3 85  ? 5.795   -33.480 -20.275 1.00 19.19 ? 85   LEU B CD1   1 
ATOM   3162 C  CD2   . LEU D  3 85  ? 5.075   -31.236 -19.399 1.00 19.59 ? 85   LEU B CD2   1 
ATOM   3163 N  N     . LEU D  3 86  ? 5.920   -30.500 -23.973 1.00 20.05 ? 86   LEU B N     1 
ATOM   3164 C  CA    . LEU D  3 86  ? 4.831   -30.113 -24.846 1.00 20.73 ? 86   LEU B CA    1 
ATOM   3165 C  C     . LEU D  3 86  ? 4.917   -30.826 -26.177 1.00 20.81 ? 86   LEU B C     1 
ATOM   3166 O  O     . LEU D  3 86  ? 3.902   -31.211 -26.749 1.00 21.49 ? 86   LEU B O     1 
ATOM   3167 C  CB    . LEU D  3 86  ? 4.854   -28.613 -25.090 1.00 21.49 ? 86   LEU B CB    1 
ATOM   3168 C  CG    . LEU D  3 86  ? 4.574   -27.693 -23.910 1.00 22.26 ? 86   LEU B CG    1 
ATOM   3169 C  CD1   . LEU D  3 86  ? 4.976   -26.276 -24.297 1.00 23.08 ? 86   LEU B CD1   1 
ATOM   3170 C  CD2   . LEU D  3 86  ? 3.117   -27.760 -23.499 1.00 22.21 ? 86   LEU B CD2   1 
ATOM   3171 N  N     . VAL D  3 87  ? 6.132   -30.995 -26.676 1.00 20.52 ? 87   VAL B N     1 
ATOM   3172 C  CA    . VAL D  3 87  ? 6.301   -31.591 -27.980 1.00 20.28 ? 87   VAL B CA    1 
ATOM   3173 C  C     . VAL D  3 87  ? 6.208   -33.097 -27.916 1.00 21.04 ? 87   VAL B C     1 
ATOM   3174 O  O     . VAL D  3 87  ? 5.348   -33.686 -28.573 1.00 20.99 ? 87   VAL B O     1 
ATOM   3175 C  CB    . VAL D  3 87  ? 7.618   -31.168 -28.634 1.00 19.85 ? 87   VAL B CB    1 
ATOM   3176 C  CG1   . VAL D  3 87  ? 7.931   -32.057 -29.831 1.00 18.00 ? 87   VAL B CG1   1 
ATOM   3177 C  CG2   . VAL D  3 87  ? 7.525   -29.718 -29.057 1.00 19.13 ? 87   VAL B CG2   1 
ATOM   3178 N  N     . ASP D  3 88  ? 7.073   -33.713 -27.111 1.00 21.61 ? 88   ASP B N     1 
ATOM   3179 C  CA    . ASP D  3 88  ? 7.187   -35.177 -27.076 1.00 22.53 ? 88   ASP B CA    1 
ATOM   3180 C  C     . ASP D  3 88  ? 5.992   -35.878 -26.437 1.00 22.22 ? 88   ASP B C     1 
ATOM   3181 O  O     . ASP D  3 88  ? 5.690   -37.019 -26.795 1.00 23.10 ? 88   ASP B O     1 
ATOM   3182 C  CB    . ASP D  3 88  ? 8.466   -35.622 -26.351 1.00 23.99 ? 88   ASP B CB    1 
ATOM   3183 C  CG    . ASP D  3 88  ? 9.737   -35.146 -27.041 1.00 25.94 ? 88   ASP B CG    1 
ATOM   3184 O  OD1   . ASP D  3 88  ? 9.676   -34.692 -28.211 1.00 26.59 ? 88   ASP B OD1   1 
ATOM   3185 O  OD2   . ASP D  3 88  ? 10.805  -35.226 -26.401 1.00 26.54 ? 88   ASP B OD2   1 
ATOM   3186 N  N     . VAL D  3 89  ? 5.330   -35.208 -25.491 1.00 20.77 ? 89   VAL B N     1 
ATOM   3187 C  CA    . VAL D  3 89  ? 4.270   -35.828 -24.693 1.00 19.42 ? 89   VAL B CA    1 
ATOM   3188 C  C     . VAL D  3 89  ? 2.900   -35.242 -25.002 1.00 19.76 ? 89   VAL B C     1 
ATOM   3189 O  O     . VAL D  3 89  ? 1.926   -35.977 -25.183 1.00 20.42 ? 89   VAL B O     1 
ATOM   3190 C  CB    . VAL D  3 89  ? 4.540   -35.702 -23.162 1.00 18.67 ? 89   VAL B CB    1 
ATOM   3191 C  CG1   . VAL D  3 89  ? 3.381   -36.259 -22.358 1.00 17.46 ? 89   VAL B CG1   1 
ATOM   3192 C  CG2   . VAL D  3 89  ? 5.827   -36.407 -22.781 1.00 17.30 ? 89   VAL B CG2   1 
ATOM   3193 N  N     . ILE D  3 90  ? 2.833   -33.919 -25.074 1.00 19.08 ? 90   ILE B N     1 
ATOM   3194 C  CA    . ILE D  3 90  ? 1.553   -33.228 -25.180 1.00 18.13 ? 90   ILE B CA    1 
ATOM   3195 C  C     . ILE D  3 90  ? 1.091   -33.015 -26.619 1.00 17.75 ? 90   ILE B C     1 
ATOM   3196 O  O     . ILE D  3 90  ? -0.099  -32.896 -26.874 1.00 17.13 ? 90   ILE B O     1 
ATOM   3197 C  CB    . ILE D  3 90  ? 1.567   -31.902 -24.381 1.00 17.89 ? 90   ILE B CB    1 
ATOM   3198 C  CG1   . ILE D  3 90  ? 1.627   -32.215 -22.879 1.00 17.51 ? 90   ILE B CG1   1 
ATOM   3199 C  CG2   . ILE D  3 90  ? 0.344   -31.044 -24.718 1.00 17.52 ? 90   ILE B CG2   1 
ATOM   3200 C  CD1   . ILE D  3 90  ? 1.907   -31.028 -21.999 1.00 17.30 ? 90   ILE B CD1   1 
ATOM   3201 N  N     . GLY D  3 91  ? 2.033   -32.973 -27.552 1.00 18.14 ? 91   GLY B N     1 
ATOM   3202 C  CA    . GLY D  3 91  ? 1.700   -32.925 -28.968 1.00 18.61 ? 91   GLY B CA    1 
ATOM   3203 C  C     . GLY D  3 91  ? 1.179   -31.591 -29.463 1.00 20.41 ? 91   GLY B C     1 
ATOM   3204 O  O     . GLY D  3 91  ? 0.527   -31.519 -30.502 1.00 20.33 ? 91   GLY B O     1 
ATOM   3205 N  N     . LEU D  3 92  ? 1.462   -30.528 -28.721 1.00 22.11 ? 92   LEU B N     1 
ATOM   3206 C  CA    . LEU D  3 92  ? 1.149   -29.177 -29.168 1.00 23.19 ? 92   LEU B CA    1 
ATOM   3207 C  C     . LEU D  3 92  ? 1.913   -28.906 -30.462 1.00 24.56 ? 92   LEU B C     1 
ATOM   3208 O  O     . LEU D  3 92  ? 3.073   -29.297 -30.594 1.00 25.30 ? 92   LEU B O     1 
ATOM   3209 C  CB    . LEU D  3 92  ? 1.542   -28.166 -28.085 1.00 22.61 ? 92   LEU B CB    1 
ATOM   3210 C  CG    . LEU D  3 92  ? 1.186   -26.678 -28.234 1.00 23.02 ? 92   LEU B CG    1 
ATOM   3211 C  CD1   . LEU D  3 92  ? -0.319  -26.419 -28.242 1.00 22.26 ? 92   LEU B CD1   1 
ATOM   3212 C  CD2   . LEU D  3 92  ? 1.824   -25.903 -27.112 1.00 22.69 ? 92   LEU B CD2   1 
ATOM   3213 N  N     . PRO D  3 93  ? 1.247   -28.290 -31.448 1.00 25.67 ? 93   PRO B N     1 
ATOM   3214 C  CA    . PRO D  3 93  ? 1.919   -27.847 -32.676 1.00 26.02 ? 93   PRO B CA    1 
ATOM   3215 C  C     . PRO D  3 93  ? 3.123   -26.931 -32.415 1.00 26.56 ? 93   PRO B C     1 
ATOM   3216 O  O     . PRO D  3 93  ? 3.055   -26.041 -31.575 1.00 26.62 ? 93   PRO B O     1 
ATOM   3217 C  CB    . PRO D  3 93  ? 0.813   -27.088 -33.425 1.00 25.61 ? 93   PRO B CB    1 
ATOM   3218 C  CG    . PRO D  3 93  ? -0.463  -27.720 -32.939 1.00 25.76 ? 93   PRO B CG    1 
ATOM   3219 C  CD    . PRO D  3 93  ? -0.207  -28.035 -31.483 1.00 26.10 ? 93   PRO B CD    1 
ATOM   3220 N  N     . TRP D  3 94  ? 4.206   -27.153 -33.153 1.00 27.52 ? 94   TRP B N     1 
ATOM   3221 C  CA    . TRP D  3 94  ? 5.466   -26.438 -32.965 1.00 28.49 ? 94   TRP B CA    1 
ATOM   3222 C  C     . TRP D  3 94  ? 5.337   -24.929 -32.813 1.00 28.81 ? 94   TRP B C     1 
ATOM   3223 O  O     . TRP D  3 94  ? 6.001   -24.318 -31.972 1.00 28.03 ? 94   TRP B O     1 
ATOM   3224 C  CB    . TRP D  3 94  ? 6.396   -26.726 -34.138 1.00 29.29 ? 94   TRP B CB    1 
ATOM   3225 C  CG    . TRP D  3 94  ? 6.889   -28.123 -34.147 1.00 30.12 ? 94   TRP B CG    1 
ATOM   3226 C  CD1   . TRP D  3 94  ? 6.351   -29.179 -34.822 1.00 29.90 ? 94   TRP B CD1   1 
ATOM   3227 C  CD2   . TRP D  3 94  ? 8.024   -28.632 -33.438 1.00 29.99 ? 94   TRP B CD2   1 
ATOM   3228 N  NE1   . TRP D  3 94  ? 7.082   -30.311 -34.577 1.00 29.98 ? 94   TRP B NE1   1 
ATOM   3229 C  CE2   . TRP D  3 94  ? 8.118   -30.003 -33.734 1.00 29.78 ? 94   TRP B CE2   1 
ATOM   3230 C  CE3   . TRP D  3 94  ? 8.973   -28.059 -32.583 1.00 29.91 ? 94   TRP B CE3   1 
ATOM   3231 C  CZ2   . TRP D  3 94  ? 9.121   -30.815 -33.205 1.00 29.83 ? 94   TRP B CZ2   1 
ATOM   3232 C  CZ3   . TRP D  3 94  ? 9.969   -28.867 -32.056 1.00 29.98 ? 94   TRP B CZ3   1 
ATOM   3233 C  CH2   . TRP D  3 94  ? 10.035  -30.229 -32.371 1.00 29.90 ? 94   TRP B CH2   1 
ATOM   3234 N  N     . GLU D  3 95  ? 4.497   -24.331 -33.645 1.00 29.06 ? 95   GLU B N     1 
ATOM   3235 C  CA    . GLU D  3 95  ? 4.418   -22.886 -33.729 1.00 29.93 ? 95   GLU B CA    1 
ATOM   3236 C  C     . GLU D  3 95  ? 3.942   -22.251 -32.419 1.00 29.67 ? 95   GLU B C     1 
ATOM   3237 O  O     . GLU D  3 95  ? 4.167   -21.067 -32.182 1.00 29.39 ? 95   GLU B O     1 
ATOM   3238 C  CB    . GLU D  3 95  ? 3.558   -22.452 -34.920 1.00 31.56 ? 95   GLU B CB    1 
ATOM   3239 C  CG    . GLU D  3 95  ? 2.151   -23.044 -34.949 1.00 35.13 ? 95   GLU B CG    1 
ATOM   3240 C  CD    . GLU D  3 95  ? 2.035   -24.329 -35.777 1.00 36.94 ? 95   GLU B CD    1 
ATOM   3241 O  OE1   . GLU D  3 95  ? 2.872   -25.260 -35.625 1.00 37.56 ? 95   GLU B OE1   1 
ATOM   3242 O  OE2   . GLU D  3 95  ? 1.081   -24.408 -36.579 1.00 37.77 ? 95   GLU B OE2   1 
ATOM   3243 N  N     . GLU D  3 96  ? 3.312   -23.037 -31.554 1.00 28.41 ? 96   GLU B N     1 
ATOM   3244 C  CA    . GLU D  3 96  ? 2.899   -22.508 -30.264 1.00 28.13 ? 96   GLU B CA    1 
ATOM   3245 C  C     . GLU D  3 96  ? 3.801   -22.871 -29.080 1.00 25.99 ? 96   GLU B C     1 
ATOM   3246 O  O     . GLU D  3 96  ? 3.764   -22.189 -28.053 1.00 25.88 ? 96   GLU B O     1 
ATOM   3247 C  CB    . GLU D  3 96  ? 1.450   -22.885 -29.942 1.00 30.76 ? 96   GLU B CB    1 
ATOM   3248 C  CG    . GLU D  3 96  ? 0.409   -22.078 -30.705 1.00 33.31 ? 96   GLU B CG    1 
ATOM   3249 C  CD    . GLU D  3 96  ? -0.218  -22.870 -31.847 1.00 35.17 ? 96   GLU B CD    1 
ATOM   3250 O  OE1   . GLU D  3 96  ? -0.597  -24.046 -31.619 1.00 35.14 ? 96   GLU B OE1   1 
ATOM   3251 O  OE2   . GLU D  3 96  ? -0.343  -22.310 -32.964 1.00 35.90 ? 96   GLU B OE2   1 
ATOM   3252 N  N     . VAL D  3 97  ? 4.610   -23.921 -29.217 1.00 22.70 ? 97   VAL B N     1 
ATOM   3253 C  CA    . VAL D  3 97  ? 5.283   -24.488 -28.047 1.00 20.69 ? 97   VAL B CA    1 
ATOM   3254 C  C     . VAL D  3 97  ? 6.305   -23.566 -27.379 1.00 19.86 ? 97   VAL B C     1 
ATOM   3255 O  O     . VAL D  3 97  ? 6.455   -23.596 -26.161 1.00 20.18 ? 97   VAL B O     1 
ATOM   3256 C  CB    . VAL D  3 97  ? 5.892   -25.926 -28.276 1.00 20.77 ? 97   VAL B CB    1 
ATOM   3257 C  CG1   . VAL D  3 97  ? 5.357   -26.574 -29.544 1.00 20.16 ? 97   VAL B CG1   1 
ATOM   3258 C  CG2   . VAL D  3 97  ? 7.412   -25.898 -28.277 1.00 19.39 ? 97   VAL B CG2   1 
ATOM   3259 N  N     . HIS D  3 98  ? 6.988   -22.721 -28.140 1.00 18.59 ? 98   HIS B N     1 
ATOM   3260 C  CA    . HIS D  3 98  ? 7.861   -21.756 -27.482 1.00 17.90 ? 98   HIS B CA    1 
ATOM   3261 C  C     . HIS D  3 98  ? 7.056   -20.762 -26.658 1.00 17.73 ? 98   HIS B C     1 
ATOM   3262 O  O     . HIS D  3 98  ? 7.286   -20.610 -25.456 1.00 17.73 ? 98   HIS B O     1 
ATOM   3263 C  CB    . HIS D  3 98  ? 8.754   -20.983 -28.450 1.00 17.04 ? 98   HIS B CB    1 
ATOM   3264 C  CG    . HIS D  3 98  ? 9.500   -19.868 -27.786 1.00 16.65 ? 98   HIS B CG    1 
ATOM   3265 N  ND1   . HIS D  3 98  ? 10.567  -20.089 -26.943 1.00 16.82 ? 98   HIS B ND1   1 
ATOM   3266 C  CD2   . HIS D  3 98  ? 9.300   -18.529 -27.794 1.00 16.57 ? 98   HIS B CD2   1 
ATOM   3267 C  CE1   . HIS D  3 98  ? 11.012  -18.933 -26.485 1.00 16.47 ? 98   HIS B CE1   1 
ATOM   3268 N  NE2   . HIS D  3 98  ? 10.257  -17.971 -26.983 1.00 15.88 ? 98   HIS B NE2   1 
ATOM   3269 N  N     . ALA D  3 99  ? 6.119   -20.079 -27.311 1.00 17.10 ? 99   ALA B N     1 
ATOM   3270 C  CA    . ALA D  3 99  ? 5.286   -19.109 -26.622 1.00 16.93 ? 99   ALA B CA    1 
ATOM   3271 C  C     . ALA D  3 99  ? 4.673   -19.725 -25.369 1.00 17.23 ? 99   ALA B C     1 
ATOM   3272 O  O     . ALA D  3 99  ? 4.641   -19.091 -24.316 1.00 17.86 ? 99   ALA B O     1 
ATOM   3273 C  CB    . ALA D  3 99  ? 4.212   -18.574 -27.539 1.00 16.66 ? 99   ALA B CB    1 
ATOM   3274 N  N     . GLU D  3 100 ? 4.207   -20.966 -25.465 1.00 16.43 ? 100  GLU B N     1 
ATOM   3275 C  CA    . GLU D  3 100 ? 3.706   -21.628 -24.276 1.00 17.09 ? 100  GLU B CA    1 
ATOM   3276 C  C     . GLU D  3 100 ? 4.813   -21.728 -23.228 1.00 17.44 ? 100  GLU B C     1 
ATOM   3277 O  O     . GLU D  3 100 ? 4.680   -21.203 -22.124 1.00 19.51 ? 100  GLU B O     1 
ATOM   3278 C  CB    . GLU D  3 100 ? 3.117   -23.005 -24.587 1.00 16.53 ? 100  GLU B CB    1 
ATOM   3279 C  CG    . GLU D  3 100 ? 2.337   -23.615 -23.421 1.00 16.56 ? 100  GLU B CG    1 
ATOM   3280 C  CD    . GLU D  3 100 ? 0.867   -23.192 -23.385 1.00 17.40 ? 100  GLU B CD    1 
ATOM   3281 O  OE1   . GLU D  3 100 ? 0.314   -22.830 -24.441 1.00 17.44 ? 100  GLU B OE1   1 
ATOM   3282 O  OE2   . GLU D  3 100 ? 0.248   -23.241 -22.300 1.00 17.79 ? 100  GLU B OE2   1 
ATOM   3283 N  N     . ALA D  3 101 ? 5.911   -22.381 -23.574 1.00 16.87 ? 101  ALA B N     1 
ATOM   3284 C  CA    . ALA D  3 101 ? 7.027   -22.518 -22.644 1.00 17.18 ? 101  ALA B CA    1 
ATOM   3285 C  C     . ALA D  3 101 ? 7.445   -21.188 -21.997 1.00 17.81 ? 101  ALA B C     1 
ATOM   3286 O  O     . ALA D  3 101 ? 7.937   -21.178 -20.873 1.00 18.62 ? 101  ALA B O     1 
ATOM   3287 C  CB    . ALA D  3 101 ? 8.210   -23.152 -23.344 1.00 16.63 ? 101  ALA B CB    1 
ATOM   3288 N  N     . CYS D  3 102 ? 7.242   -20.076 -22.706 1.00 17.55 ? 102  CYS B N     1 
ATOM   3289 C  CA    . CYS D  3 102 ? 7.623   -18.742 -22.225 1.00 16.65 ? 102  CYS B CA    1 
ATOM   3290 C  C     . CYS D  3 102 ? 6.863   -18.320 -20.974 1.00 15.65 ? 102  CYS B C     1 
ATOM   3291 O  O     . CYS D  3 102 ? 7.336   -17.474 -20.200 1.00 15.34 ? 102  CYS B O     1 
ATOM   3292 C  CB    . CYS D  3 102 ? 7.394   -17.693 -23.312 1.00 17.04 ? 102  CYS B CB    1 
ATOM   3293 S  SG    . CYS D  3 102 ? 8.058   -16.075 -22.904 1.00 18.11 ? 102  CYS B SG    1 
ATOM   3294 N  N     . ARG D  3 103 ? 5.685   -18.906 -20.796 1.00 13.77 ? 103  ARG B N     1 
ATOM   3295 C  CA    . ARG D  3 103 ? 4.864   -18.658 -19.627 1.00 13.89 ? 103  ARG B CA    1 
ATOM   3296 C  C     . ARG D  3 103 ? 5.085   -19.746 -18.577 1.00 13.61 ? 103  ARG B C     1 
ATOM   3297 O  O     . ARG D  3 103 ? 5.096   -19.477 -17.375 1.00 13.47 ? 103  ARG B O     1 
ATOM   3298 C  CB    . ARG D  3 103 ? 3.378   -18.618 -20.013 1.00 14.11 ? 103  ARG B CB    1 
ATOM   3299 C  CG    . ARG D  3 103 ? 3.014   -17.606 -21.087 1.00 13.83 ? 103  ARG B CG    1 
ATOM   3300 C  CD    . ARG D  3 103 ? 1.484   -17.414 -21.155 1.00 14.78 ? 103  ARG B CD    1 
ATOM   3301 N  NE    . ARG D  3 103 ? 0.774   -18.665 -21.425 1.00 15.13 ? 103  ARG B NE    1 
ATOM   3302 C  CZ    . ARG D  3 103 ? 0.580   -19.158 -22.647 1.00 15.61 ? 103  ARG B CZ    1 
ATOM   3303 N  NH1   . ARG D  3 103 ? -0.062  -20.309 -22.817 1.00 15.33 ? 103  ARG B NH1   1 
ATOM   3304 N  NH2   . ARG D  3 103 ? 1.033   -18.500 -23.705 1.00 14.38 ? 103  ARG B NH2   1 
ATOM   3305 N  N     . TRP D  3 104 ? 5.252   -20.979 -19.035 1.00 13.99 ? 104  TRP B N     1 
ATOM   3306 C  CA    . TRP D  3 104 ? 5.390   -22.108 -18.125 1.00 14.92 ? 104  TRP B CA    1 
ATOM   3307 C  C     . TRP D  3 104 ? 6.702   -22.005 -17.367 1.00 15.46 ? 104  TRP B C     1 
ATOM   3308 O  O     . TRP D  3 104 ? 6.791   -22.417 -16.207 1.00 15.55 ? 104  TRP B O     1 
ATOM   3309 C  CB    . TRP D  3 104 ? 5.329   -23.425 -18.893 1.00 15.33 ? 104  TRP B CB    1 
ATOM   3310 C  CG    . TRP D  3 104 ? 3.959   -23.813 -19.330 1.00 15.42 ? 104  TRP B CG    1 
ATOM   3311 C  CD1   . TRP D  3 104 ? 2.945   -22.979 -19.705 1.00 15.60 ? 104  TRP B CD1   1 
ATOM   3312 C  CD2   . TRP D  3 104 ? 3.453   -25.143 -19.468 1.00 15.27 ? 104  TRP B CD2   1 
ATOM   3313 N  NE1   . TRP D  3 104 ? 1.831   -23.707 -20.036 1.00 15.48 ? 104  TRP B NE1   1 
ATOM   3314 C  CE2   . TRP D  3 104 ? 2.120   -25.039 -19.909 1.00 14.81 ? 104  TRP B CE2   1 
ATOM   3315 C  CE3   . TRP D  3 104 ? 3.997   -26.412 -19.253 1.00 15.71 ? 104  TRP B CE3   1 
ATOM   3316 C  CZ2   . TRP D  3 104 ? 1.327   -26.148 -20.145 1.00 15.32 ? 104  TRP B CZ2   1 
ATOM   3317 C  CZ3   . TRP D  3 104 ? 3.206   -27.518 -19.482 1.00 15.99 ? 104  TRP B CZ3   1 
ATOM   3318 C  CH2   . TRP D  3 104 ? 1.884   -27.380 -19.925 1.00 16.16 ? 104  TRP B CH2   1 
ATOM   3319 N  N     . GLU D  3 105 ? 7.711   -21.436 -18.023 1.00 15.28 ? 105  GLU B N     1 
ATOM   3320 C  CA    . GLU D  3 105 ? 9.028   -21.253 -17.414 1.00 16.63 ? 105  GLU B CA    1 
ATOM   3321 C  C     . GLU D  3 105 ? 8.981   -20.482 -16.091 1.00 16.52 ? 105  GLU B C     1 
ATOM   3322 O  O     . GLU D  3 105 ? 9.899   -20.585 -15.264 1.00 16.05 ? 105  GLU B O     1 
ATOM   3323 C  CB    . GLU D  3 105 ? 9.964   -20.528 -18.377 1.00 17.31 ? 105  GLU B CB    1 
ATOM   3324 C  CG    . GLU D  3 105 ? 9.484   -19.146 -18.764 1.00 18.68 ? 105  GLU B CG    1 
ATOM   3325 C  CD    . GLU D  3 105 ? 10.433  -18.452 -19.724 1.00 19.80 ? 105  GLU B CD    1 
ATOM   3326 O  OE1   . GLU D  3 105 ? 11.498  -19.037 -20.011 1.00 18.66 ? 105  GLU B OE1   1 
ATOM   3327 O  OE2   . GLU D  3 105 ? 10.115  -17.326 -20.189 1.00 20.34 ? 105  GLU B OE2   1 
ATOM   3328 N  N     . HIS D  3 106 ? 7.922   -19.707 -15.887 1.00 15.51 ? 106  HIS B N     1 
ATOM   3329 C  CA    . HIS D  3 106 ? 7.899   -18.832 -14.730 1.00 16.18 ? 106  HIS B CA    1 
ATOM   3330 C  C     . HIS D  3 106 ? 7.170   -19.443 -13.542 1.00 16.19 ? 106  HIS B C     1 
ATOM   3331 O  O     . HIS D  3 106 ? 7.157   -18.868 -12.466 1.00 17.31 ? 106  HIS B O     1 
ATOM   3332 C  CB    . HIS D  3 106 ? 7.354   -17.441 -15.096 1.00 15.33 ? 106  HIS B CB    1 
ATOM   3333 C  CG    . HIS D  3 106 ? 8.046   -16.818 -16.268 1.00 14.71 ? 106  HIS B CG    1 
ATOM   3334 N  ND1   . HIS D  3 106 ? 9.358   -16.407 -16.222 1.00 14.72 ? 106  HIS B ND1   1 
ATOM   3335 C  CD2   . HIS D  3 106 ? 7.617   -16.560 -17.528 1.00 15.62 ? 106  HIS B CD2   1 
ATOM   3336 C  CE1   . HIS D  3 106 ? 9.709   -15.919 -17.401 1.00 14.69 ? 106  HIS B CE1   1 
ATOM   3337 N  NE2   . HIS D  3 106 ? 8.671   -16.002 -18.214 1.00 15.79 ? 106  HIS B NE2   1 
ATOM   3338 N  N     . VAL D  3 107 ? 6.604   -20.630 -13.720 1.00 16.68 ? 107  VAL B N     1 
ATOM   3339 C  CA    . VAL D  3 107 ? 5.783   -21.220 -12.667 1.00 16.71 ? 107  VAL B CA    1 
ATOM   3340 C  C     . VAL D  3 107 ? 6.227   -22.623 -12.230 1.00 17.95 ? 107  VAL B C     1 
ATOM   3341 O  O     . VAL D  3 107 ? 5.758   -23.136 -11.207 1.00 18.14 ? 107  VAL B O     1 
ATOM   3342 C  CB    . VAL D  3 107 ? 4.304   -21.308 -13.095 1.00 15.76 ? 107  VAL B CB    1 
ATOM   3343 C  CG1   . VAL D  3 107 ? 3.750   -19.931 -13.450 1.00 15.47 ? 107  VAL B CG1   1 
ATOM   3344 C  CG2   . VAL D  3 107 ? 4.152   -22.260 -14.250 1.00 14.32 ? 107  VAL B CG2   1 
ATOM   3345 N  N     . MET D  3 108 ? 7.109   -23.247 -13.003 1.00 16.91 ? 108  MET B N     1 
ATOM   3346 C  CA    . MET D  3 108 ? 7.505   -24.621 -12.714 1.00 18.54 ? 108  MET B CA    1 
ATOM   3347 C  C     . MET D  3 108 ? 8.548   -24.695 -11.596 1.00 16.59 ? 108  MET B C     1 
ATOM   3348 O  O     . MET D  3 108 ? 9.540   -23.974 -11.604 1.00 16.09 ? 108  MET B O     1 
ATOM   3349 C  CB    . MET D  3 108 ? 8.063   -25.325 -13.968 1.00 19.73 ? 108  MET B CB    1 
ATOM   3350 C  CG    . MET D  3 108 ? 7.233   -25.211 -15.247 1.00 19.78 ? 108  MET B CG    1 
ATOM   3351 S  SD    . MET D  3 108 ? 8.236   -25.648 -16.703 1.00 20.84 ? 108  MET B SD    1 
ATOM   3352 C  CE    . MET D  3 108 ? 8.830   -27.273 -16.222 1.00 19.78 ? 108  MET B CE    1 
ATOM   3353 N  N     . SER D  3 109 ? 8.324   -25.603 -10.662 1.00 15.62 ? 109  SER B N     1 
ATOM   3354 C  CA    . SER D  3 109 ? 9.244   -25.842 -9.570  1.00 15.71 ? 109  SER B CA    1 
ATOM   3355 C  C     . SER D  3 109 ? 10.336  -26.837 -9.962  1.00 17.33 ? 109  SER B C     1 
ATOM   3356 O  O     . SER D  3 109 ? 10.228  -27.554 -10.962 1.00 17.59 ? 109  SER B O     1 
ATOM   3357 C  CB    . SER D  3 109 ? 8.469   -26.421 -8.403  1.00 14.95 ? 109  SER B CB    1 
ATOM   3358 O  OG    . SER D  3 109 ? 7.981   -27.704 -8.753  1.00 13.47 ? 109  SER B OG    1 
ATOM   3359 N  N     . GLU D  3 110 ? 11.381  -26.897 -9.152  1.00 18.92 ? 110  GLU B N     1 
ATOM   3360 C  CA    . GLU D  3 110 ? 12.446  -27.855 -9.371  1.00 20.65 ? 110  GLU B CA    1 
ATOM   3361 C  C     . GLU D  3 110 ? 11.970  -29.293 -9.194  1.00 21.06 ? 110  GLU B C     1 
ATOM   3362 O  O     . GLU D  3 110 ? 12.520  -30.209 -9.819  1.00 22.67 ? 110  GLU B O     1 
ATOM   3363 C  CB    . GLU D  3 110 ? 13.625  -27.570 -8.448  1.00 22.43 ? 110  GLU B CB    1 
ATOM   3364 C  CG    . GLU D  3 110 ? 14.295  -26.234 -8.712  1.00 24.88 ? 110  GLU B CG    1 
ATOM   3365 C  CD    . GLU D  3 110 ? 15.673  -26.150 -8.098  1.00 26.72 ? 110  GLU B CD    1 
ATOM   3366 O  OE1   . GLU D  3 110 ? 16.027  -27.041 -7.295  1.00 28.12 ? 110  GLU B OE1   1 
ATOM   3367 O  OE2   . GLU D  3 110 ? 16.409  -25.198 -8.423  1.00 28.33 ? 110  GLU B OE2   1 
ATOM   3368 N  N     . ASP D  3 111 ? 10.951  -29.498 -8.362  1.00 20.47 ? 111  ASP B N     1 
ATOM   3369 C  CA    . ASP D  3 111 ? 10.366  -30.834 -8.204  1.00 20.93 ? 111  ASP B CA    1 
ATOM   3370 C  C     . ASP D  3 111 ? 9.853   -31.375 -9.539  1.00 20.81 ? 111  ASP B C     1 
ATOM   3371 O  O     . ASP D  3 111 ? 10.228  -32.470 -9.955  1.00 20.91 ? 111  ASP B O     1 
ATOM   3372 C  CB    . ASP D  3 111 ? 9.241   -30.837 -7.166  1.00 21.90 ? 111  ASP B CB    1 
ATOM   3373 C  CG    . ASP D  3 111 ? 9.732   -31.155 -5.762  1.00 24.38 ? 111  ASP B CG    1 
ATOM   3374 O  OD1   . ASP D  3 111 ? 8.999   -31.854 -5.018  1.00 26.04 ? 111  ASP B OD1   1 
ATOM   3375 O  OD2   . ASP D  3 111 ? 10.841  -30.710 -5.389  1.00 25.26 ? 111  ASP B OD2   1 
ATOM   3376 N  N     . VAL D  3 112 ? 8.996   -30.603 -10.205 1.00 20.22 ? 112  VAL B N     1 
ATOM   3377 C  CA    . VAL D  3 112 ? 8.480   -30.986 -11.515 1.00 20.06 ? 112  VAL B CA    1 
ATOM   3378 C  C     . VAL D  3 112 ? 9.615   -31.221 -12.509 1.00 19.67 ? 112  VAL B C     1 
ATOM   3379 O  O     . VAL D  3 112 ? 9.604   -32.203 -13.246 1.00 18.98 ? 112  VAL B O     1 
ATOM   3380 C  CB    . VAL D  3 112 ? 7.471   -29.940 -12.084 1.00 19.50 ? 112  VAL B CB    1 
ATOM   3381 C  CG1   . VAL D  3 112 ? 7.514   -29.904 -13.593 1.00 19.09 ? 112  VAL B CG1   1 
ATOM   3382 C  CG2   . VAL D  3 112 ? 6.080   -30.273 -11.649 1.00 19.06 ? 112  VAL B CG2   1 
ATOM   3383 N  N     . GLU D  3 113 ? 10.590  -30.317 -12.515 1.00 19.94 ? 113  GLU B N     1 
ATOM   3384 C  CA    . GLU D  3 113 ? 11.720  -30.411 -13.426 1.00 20.26 ? 113  GLU B CA    1 
ATOM   3385 C  C     . GLU D  3 113 ? 12.420  -31.760 -13.333 1.00 20.62 ? 113  GLU B C     1 
ATOM   3386 O  O     . GLU D  3 113 ? 12.592  -32.455 -14.342 1.00 19.89 ? 113  GLU B O     1 
ATOM   3387 C  CB    . GLU D  3 113 ? 12.721  -29.307 -13.138 1.00 20.14 ? 113  GLU B CB    1 
ATOM   3388 C  CG    . GLU D  3 113 ? 12.463  -28.034 -13.884 1.00 20.50 ? 113  GLU B CG    1 
ATOM   3389 C  CD    . GLU D  3 113 ? 13.492  -26.980 -13.559 1.00 20.89 ? 113  GLU B CD    1 
ATOM   3390 O  OE1   . GLU D  3 113 ? 14.254  -26.580 -14.469 1.00 21.29 ? 113  GLU B OE1   1 
ATOM   3391 O  OE2   . GLU D  3 113 ? 13.546  -26.565 -12.382 1.00 20.98 ? 113  GLU B OE2   1 
ATOM   3392 N  N     . ARG D  3 114 ? 12.824  -32.124 -12.117 1.00 20.92 ? 114  ARG B N     1 
ATOM   3393 C  CA    . ARG D  3 114 ? 13.509  -33.387 -11.897 1.00 20.71 ? 114  ARG B CA    1 
ATOM   3394 C  C     . ARG D  3 114 ? 12.664  -34.524 -12.450 1.00 20.74 ? 114  ARG B C     1 
ATOM   3395 O  O     . ARG D  3 114 ? 13.140  -35.332 -13.243 1.00 20.78 ? 114  ARG B O     1 
ATOM   3396 C  CB    . ARG D  3 114 ? 13.835  -33.583 -10.416 1.00 20.52 ? 114  ARG B CB    1 
ATOM   3397 C  CG    . ARG D  3 114 ? 15.003  -32.733 -9.950  1.00 21.97 ? 114  ARG B CG    1 
ATOM   3398 C  CD    . ARG D  3 114 ? 15.408  -32.977 -8.495  1.00 22.13 ? 114  ARG B CD    1 
ATOM   3399 N  NE    . ARG D  3 114 ? 14.626  -32.155 -7.579  1.00 24.60 ? 114  ARG B NE    1 
ATOM   3400 C  CZ    . ARG D  3 114 ? 15.038  -30.999 -7.057  1.00 25.60 ? 114  ARG B CZ    1 
ATOM   3401 N  NH1   . ARG D  3 114 ? 16.244  -30.518 -7.349  1.00 25.26 ? 114  ARG B NH1   1 
ATOM   3402 N  NH2   . ARG D  3 114 ? 14.238  -30.320 -6.235  1.00 25.71 ? 114  ARG B NH2   1 
ATOM   3403 N  N     . ARG D  3 115 ? 11.396  -34.564 -12.065 1.00 21.95 ? 115  ARG B N     1 
ATOM   3404 C  CA    . ARG D  3 115 ? 10.506  -35.619 -12.536 1.00 23.89 ? 115  ARG B CA    1 
ATOM   3405 C  C     . ARG D  3 115 ? 10.332  -35.632 -14.056 1.00 23.45 ? 115  ARG B C     1 
ATOM   3406 O  O     . ARG D  3 115 ? 10.119  -36.690 -14.655 1.00 23.56 ? 115  ARG B O     1 
ATOM   3407 C  CB    . ARG D  3 115 ? 9.155   -35.559 -11.817 1.00 25.57 ? 115  ARG B CB    1 
ATOM   3408 C  CG    . ARG D  3 115 ? 9.061   -36.555 -10.660 1.00 29.11 ? 115  ARG B CG    1 
ATOM   3409 C  CD    . ARG D  3 115 ? 8.164   -36.051 -9.534  1.00 31.29 ? 115  ARG B CD    1 
ATOM   3410 N  NE    . ARG D  3 115 ? 8.372   -36.803 -8.294  1.00 33.59 ? 115  ARG B NE    1 
ATOM   3411 C  CZ    . ARG D  3 115 ? 9.140   -36.390 -7.282  1.00 34.37 ? 115  ARG B CZ    1 
ATOM   3412 N  NH1   . ARG D  3 115 ? 9.779   -35.220 -7.343  1.00 34.05 ? 115  ARG B NH1   1 
ATOM   3413 N  NH2   . ARG D  3 115 ? 9.261   -37.145 -6.199  1.00 34.32 ? 115  ARG B NH2   1 
ATOM   3414 N  N     . LEU D  3 116 ? 10.430  -34.458 -14.670 1.00 21.59 ? 116  LEU B N     1 
ATOM   3415 C  CA    . LEU D  3 116 ? 10.321  -34.351 -16.109 1.00 20.29 ? 116  LEU B CA    1 
ATOM   3416 C  C     . LEU D  3 116 ? 11.522  -34.999 -16.782 1.00 21.04 ? 116  LEU B C     1 
ATOM   3417 O  O     . LEU D  3 116 ? 11.386  -35.646 -17.825 1.00 20.71 ? 116  LEU B O     1 
ATOM   3418 C  CB    . LEU D  3 116 ? 10.204  -32.886 -16.532 1.00 18.55 ? 116  LEU B CB    1 
ATOM   3419 C  CG    . LEU D  3 116 ? 8.797   -32.310 -16.653 1.00 16.59 ? 116  LEU B CG    1 
ATOM   3420 C  CD1   . LEU D  3 116 ? 8.872   -30.857 -17.040 1.00 15.83 ? 116  LEU B CD1   1 
ATOM   3421 C  CD2   . LEU D  3 116 ? 7.996   -33.086 -17.676 1.00 16.03 ? 116  LEU B CD2   1 
ATOM   3422 N  N     . VAL D  3 117 ? 12.697  -34.829 -16.183 1.00 21.01 ? 117  VAL B N     1 
ATOM   3423 C  CA    . VAL D  3 117 ? 13.905  -35.394 -16.748 1.00 21.76 ? 117  VAL B CA    1 
ATOM   3424 C  C     . VAL D  3 117 ? 13.792  -36.903 -16.878 1.00 23.62 ? 117  VAL B C     1 
ATOM   3425 O  O     . VAL D  3 117 ? 14.215  -37.469 -17.890 1.00 25.03 ? 117  VAL B O     1 
ATOM   3426 C  CB    . VAL D  3 117 ? 15.145  -35.031 -15.925 1.00 21.59 ? 117  VAL B CB    1 
ATOM   3427 C  CG1   . VAL D  3 117 ? 16.352  -35.853 -16.372 1.00 20.62 ? 117  VAL B CG1   1 
ATOM   3428 C  CG2   . VAL D  3 117 ? 15.434  -33.548 -16.054 1.00 21.44 ? 117  VAL B CG2   1 
ATOM   3429 N  N     . LYS D  3 118 ? 13.217  -37.555 -15.868 1.00 24.61 ? 118  LYS B N     1 
ATOM   3430 C  CA    . LYS D  3 118 ? 13.072  -39.014 -15.891 1.00 26.09 ? 118  LYS B CA    1 
ATOM   3431 C  C     . LYS D  3 118 ? 12.055  -39.495 -16.918 1.00 24.75 ? 118  LYS B C     1 
ATOM   3432 O  O     . LYS D  3 118 ? 12.336  -40.406 -17.692 1.00 23.83 ? 118  LYS B O     1 
ATOM   3433 C  CB    . LYS D  3 118 ? 12.741  -39.583 -14.502 1.00 26.89 ? 118  LYS B CB    1 
ATOM   3434 C  CG    . LYS D  3 118 ? 13.899  -40.361 -13.876 1.00 29.39 ? 118  LYS B CG    1 
ATOM   3435 C  CD    . LYS D  3 118 ? 13.666  -40.667 -12.403 1.00 29.80 ? 118  LYS B CD    1 
ATOM   3436 C  CE    . LYS D  3 118 ? 14.995  -40.831 -11.649 1.00 31.30 ? 118  LYS B CE    1 
ATOM   3437 N  NZ    . LYS D  3 118 ? 14.791  -40.938 -10.163 1.00 32.20 ? 118  LYS B NZ    1 
ATOM   3438 N  N     . VAL D  3 119 ? 10.879  -38.876 -16.920 1.00 24.57 ? 119  VAL B N     1 
ATOM   3439 C  CA    . VAL D  3 119 ? 9.794   -39.263 -17.827 1.00 24.62 ? 119  VAL B CA    1 
ATOM   3440 C  C     . VAL D  3 119 ? 10.064  -38.959 -19.309 1.00 24.35 ? 119  VAL B C     1 
ATOM   3441 O  O     . VAL D  3 119 ? 9.534   -39.630 -20.196 1.00 23.64 ? 119  VAL B O     1 
ATOM   3442 C  CB    . VAL D  3 119 ? 8.472   -38.616 -17.400 1.00 24.52 ? 119  VAL B CB    1 
ATOM   3443 C  CG1   . VAL D  3 119 ? 7.496   -38.574 -18.563 1.00 25.61 ? 119  VAL B CG1   1 
ATOM   3444 C  CG2   . VAL D  3 119 ? 7.891   -39.376 -16.231 1.00 24.90 ? 119  VAL B CG2   1 
ATOM   3445 N  N     . LEU D  3 120 ? 10.888  -37.948 -19.570 1.00 24.39 ? 120  LEU B N     1 
ATOM   3446 C  CA    . LEU D  3 120 ? 11.287  -37.616 -20.935 1.00 24.68 ? 120  LEU B CA    1 
ATOM   3447 C  C     . LEU D  3 120 ? 12.537  -38.389 -21.359 1.00 24.54 ? 120  LEU B C     1 
ATOM   3448 O  O     . LEU D  3 120 ? 13.155  -38.066 -22.369 1.00 23.51 ? 120  LEU B O     1 
ATOM   3449 C  CB    . LEU D  3 120 ? 11.531  -36.112 -21.070 1.00 24.40 ? 120  LEU B CB    1 
ATOM   3450 C  CG    . LEU D  3 120 ? 10.390  -35.193 -20.632 1.00 24.55 ? 120  LEU B CG    1 
ATOM   3451 C  CD1   . LEU D  3 120 ? 10.830  -33.740 -20.608 1.00 23.86 ? 120  LEU B CD1   1 
ATOM   3452 C  CD2   . LEU D  3 120 ? 9.172   -35.383 -21.536 1.00 24.73 ? 120  LEU B CD2   1 
ATOM   3453 N  N     . ASN D  3 121 ? 12.884  -39.415 -20.585 1.00 25.55 ? 121  ASN B N     1 
ATOM   3454 C  CA    . ASN D  3 121 ? 14.091  -40.222 -20.800 1.00 27.36 ? 121  ASN B CA    1 
ATOM   3455 C  C     . ASN D  3 121 ? 15.338  -39.363 -20.923 1.00 26.76 ? 121  ASN B C     1 
ATOM   3456 O  O     . ASN D  3 121 ? 16.006  -39.382 -21.957 1.00 27.14 ? 121  ASN B O     1 
ATOM   3457 C  CB    . ASN D  3 121 ? 13.966  -41.130 -22.032 1.00 29.08 ? 121  ASN B CB    1 
ATOM   3458 C  CG    . ASN D  3 121 ? 12.517  -41.441 -22.392 1.00 31.39 ? 121  ASN B CG    1 
ATOM   3459 O  OD1   . ASN D  3 121 ? 12.021  -40.990 -23.429 1.00 32.57 ? 121  ASN B OD1   1 
ATOM   3460 N  ND2   . ASN D  3 121 ? 11.828  -42.202 -21.538 1.00 30.92 ? 121  ASN B ND2   1 
ATOM   3461 N  N     . ASN D  3 122 ? 15.622  -38.592 -19.875 1.00 25.26 ? 122  ASN B N     1 
ATOM   3462 C  CA    . ASN D  3 122 ? 16.882  -37.856 -19.758 1.00 24.61 ? 122  ASN B CA    1 
ATOM   3463 C  C     . ASN D  3 122 ? 17.273  -37.016 -20.970 1.00 22.98 ? 122  ASN B C     1 
ATOM   3464 O  O     . ASN D  3 122 ? 18.347  -37.213 -21.536 1.00 22.82 ? 122  ASN B O     1 
ATOM   3465 C  CB    . ASN D  3 122 ? 18.024  -38.817 -19.412 1.00 25.24 ? 122  ASN B CB    1 
ATOM   3466 C  CG    . ASN D  3 122 ? 17.825  -39.492 -18.068 1.00 26.09 ? 122  ASN B CG    1 
ATOM   3467 O  OD1   . ASN D  3 122 ? 17.014  -39.047 -17.246 1.00 26.26 ? 122  ASN B OD1   1 
ATOM   3468 N  ND2   . ASN D  3 122 ? 18.554  -40.573 -17.841 1.00 25.13 ? 122  ASN B ND2   1 
ATOM   3469 N  N     . PRO D  3 123 ? 16.421  -36.048 -21.343 1.00 21.83 ? 123  PRO B N     1 
ATOM   3470 C  CA    . PRO D  3 123 ? 16.700  -35.209 -22.497 1.00 20.60 ? 123  PRO B CA    1 
ATOM   3471 C  C     . PRO D  3 123 ? 17.818  -34.247 -22.177 1.00 20.37 ? 123  PRO B C     1 
ATOM   3472 O  O     . PRO D  3 123 ? 17.965  -33.840 -21.023 1.00 20.71 ? 123  PRO B O     1 
ATOM   3473 C  CB    . PRO D  3 123 ? 15.402  -34.424 -22.675 1.00 19.48 ? 123  PRO B CB    1 
ATOM   3474 C  CG    . PRO D  3 123 ? 14.851  -34.326 -21.303 1.00 20.79 ? 123  PRO B CG    1 
ATOM   3475 C  CD    . PRO D  3 123 ? 15.168  -35.654 -20.670 1.00 21.73 ? 123  PRO B CD    1 
ATOM   3476 N  N     . THR D  3 124 ? 18.592  -33.884 -23.192 1.00 20.84 ? 124  THR B N     1 
ATOM   3477 C  CA    . THR D  3 124 ? 19.644  -32.885 -23.051 1.00 21.41 ? 124  THR B CA    1 
ATOM   3478 C  C     . THR D  3 124 ? 19.382  -31.675 -23.929 1.00 21.03 ? 124  THR B C     1 
ATOM   3479 O  O     . THR D  3 124 ? 20.171  -30.741 -23.940 1.00 22.16 ? 124  THR B O     1 
ATOM   3480 C  CB    . THR D  3 124 ? 21.012  -33.450 -23.461 1.00 22.15 ? 124  THR B CB    1 
ATOM   3481 O  OG1   . THR D  3 124 ? 20.913  -33.995 -24.782 1.00 24.00 ? 124  THR B OG1   1 
ATOM   3482 C  CG2   . THR D  3 124 ? 21.452  -34.540 -22.506 1.00 21.83 ? 124  THR B CG2   1 
ATOM   3483 N  N     . THR D  3 125 ? 18.292  -31.698 -24.685 1.00 20.88 ? 125  THR B N     1 
ATOM   3484 C  CA    . THR D  3 125 ? 17.999  -30.614 -25.612 1.00 21.09 ? 125  THR B CA    1 
ATOM   3485 C  C     . THR D  3 125 ? 16.517  -30.344 -25.677 1.00 22.09 ? 125  THR B C     1 
ATOM   3486 O  O     . THR D  3 125 ? 15.701  -31.251 -25.522 1.00 23.14 ? 125  THR B O     1 
ATOM   3487 C  CB    . THR D  3 125 ? 18.396  -30.959 -27.057 1.00 20.70 ? 125  THR B CB    1 
ATOM   3488 O  OG1   . THR D  3 125 ? 17.473  -31.929 -27.574 1.00 19.55 ? 125  THR B OG1   1 
ATOM   3489 C  CG2   . THR D  3 125 ? 19.819  -31.488 -27.139 1.00 19.39 ? 125  THR B CG2   1 
ATOM   3490 N  N     . SER D  3 126 ? 16.169  -29.090 -25.937 1.00 22.32 ? 126  SER B N     1 
ATOM   3491 C  CA    . SER D  3 126 ? 14.807  -28.758 -26.278 1.00 22.43 ? 126  SER B CA    1 
ATOM   3492 C  C     . SER D  3 126 ? 14.581  -29.316 -27.677 1.00 22.48 ? 126  SER B C     1 
ATOM   3493 O  O     . SER D  3 126 ? 15.538  -29.538 -28.423 1.00 21.48 ? 126  SER B O     1 
ATOM   3494 C  CB    . SER D  3 126 ? 14.596  -27.242 -26.263 1.00 22.48 ? 126  SER B CB    1 
ATOM   3495 O  OG    . SER D  3 126 ? 14.272  -26.750 -27.549 1.00 23.15 ? 126  SER B OG    1 
ATOM   3496 N  N     . PRO D  3 127 ? 13.316  -29.543 -28.043 1.00 21.93 ? 127  PRO B N     1 
ATOM   3497 C  CA    . PRO D  3 127 ? 13.032  -30.132 -29.340 1.00 21.30 ? 127  PRO B CA    1 
ATOM   3498 C  C     . PRO D  3 127 ? 13.529  -29.268 -30.505 1.00 21.17 ? 127  PRO B C     1 
ATOM   3499 O  O     . PRO D  3 127 ? 13.605  -29.743 -31.637 1.00 21.86 ? 127  PRO B O     1 
ATOM   3500 C  CB    . PRO D  3 127 ? 11.503  -30.252 -29.341 1.00 21.22 ? 127  PRO B CB    1 
ATOM   3501 C  CG    . PRO D  3 127 ? 11.035  -29.285 -28.319 1.00 21.36 ? 127  PRO B CG    1 
ATOM   3502 C  CD    . PRO D  3 127 ? 12.095  -29.252 -27.277 1.00 21.43 ? 127  PRO B CD    1 
ATOM   3503 N  N     . PHE D  3 128 ? 13.871  -28.014 -30.237 1.00 21.09 ? 128  PHE B N     1 
ATOM   3504 C  CA    . PHE D  3 128 ? 14.438  -27.153 -31.276 1.00 20.91 ? 128  PHE B CA    1 
ATOM   3505 C  C     . PHE D  3 128 ? 15.942  -27.387 -31.393 1.00 20.61 ? 128  PHE B C     1 
ATOM   3506 O  O     . PHE D  3 128 ? 16.595  -26.863 -32.289 1.00 20.05 ? 128  PHE B O     1 
ATOM   3507 C  CB    . PHE D  3 128 ? 14.155  -25.672 -30.989 1.00 21.53 ? 128  PHE B CB    1 
ATOM   3508 C  CG    . PHE D  3 128 ? 12.692  -25.312 -31.005 1.00 22.00 ? 128  PHE B CG    1 
ATOM   3509 C  CD1   . PHE D  3 128 ? 11.998  -25.111 -29.820 1.00 22.62 ? 128  PHE B CD1   1 
ATOM   3510 C  CD2   . PHE D  3 128 ? 12.012  -25.166 -32.199 1.00 22.22 ? 128  PHE B CD2   1 
ATOM   3511 C  CE1   . PHE D  3 128 ? 10.654  -24.772 -29.827 1.00 22.18 ? 128  PHE B CE1   1 
ATOM   3512 C  CE2   . PHE D  3 128 ? 10.668  -24.832 -32.213 1.00 22.35 ? 128  PHE B CE2   1 
ATOM   3513 C  CZ    . PHE D  3 128 ? 9.988   -24.634 -31.026 1.00 22.12 ? 128  PHE B CZ    1 
ATOM   3514 N  N     . GLY D  3 129 ? 16.493  -28.167 -30.470 1.00 20.30 ? 129  GLY B N     1 
ATOM   3515 C  CA    . GLY D  3 129 ? 17.904  -28.519 -30.526 1.00 19.93 ? 129  GLY B CA    1 
ATOM   3516 C  C     . GLY D  3 129 ? 18.788  -27.760 -29.556 1.00 19.48 ? 129  GLY B C     1 
ATOM   3517 O  O     . GLY D  3 129 ? 19.950  -28.116 -29.360 1.00 19.57 ? 129  GLY B O     1 
ATOM   3518 N  N     . ASN D  3 130 ? 18.248  -26.707 -28.957 1.00 18.82 ? 130  ASN B N     1 
ATOM   3519 C  CA    . ASN D  3 130 ? 19.008  -25.894 -28.013 1.00 19.95 ? 130  ASN B CA    1 
ATOM   3520 C  C     . ASN D  3 130 ? 19.269  -26.647 -26.716 1.00 20.32 ? 130  ASN B C     1 
ATOM   3521 O  O     . ASN D  3 130 ? 18.347  -27.208 -26.128 1.00 21.00 ? 130  ASN B O     1 
ATOM   3522 C  CB    . ASN D  3 130 ? 18.262  -24.595 -27.734 1.00 21.18 ? 130  ASN B CB    1 
ATOM   3523 C  CG    . ASN D  3 130 ? 17.597  -24.035 -28.980 1.00 23.23 ? 130  ASN B CG    1 
ATOM   3524 O  OD1   . ASN D  3 130 ? 16.631  -24.617 -29.501 1.00 24.07 ? 130  ASN B OD1   1 
ATOM   3525 N  ND2   . ASN D  3 130 ? 18.116  -22.908 -29.477 1.00 22.73 ? 130  ASN B ND2   1 
ATOM   3526 N  N     . PRO D  3 131 ? 20.528  -26.658 -26.259 1.00 20.37 ? 131  PRO B N     1 
ATOM   3527 C  CA    . PRO D  3 131 ? 20.933  -27.459 -25.100 1.00 19.79 ? 131  PRO B CA    1 
ATOM   3528 C  C     . PRO D  3 131 ? 20.213  -27.052 -23.812 1.00 19.56 ? 131  PRO B C     1 
ATOM   3529 O  O     . PRO D  3 131 ? 19.938  -25.876 -23.599 1.00 19.74 ? 131  PRO B O     1 
ATOM   3530 C  CB    . PRO D  3 131 ? 22.431  -27.155 -24.975 1.00 20.33 ? 131  PRO B CB    1 
ATOM   3531 C  CG    . PRO D  3 131 ? 22.607  -25.822 -25.660 1.00 20.69 ? 131  PRO B CG    1 
ATOM   3532 C  CD    . PRO D  3 131 ? 21.646  -25.876 -26.809 1.00 20.57 ? 131  PRO B CD    1 
ATOM   3533 N  N     . ILE D  3 132 ? 19.906  -28.027 -22.965 1.00 18.78 ? 132  ILE B N     1 
ATOM   3534 C  CA    . ILE D  3 132 ? 19.321  -27.750 -21.661 1.00 18.46 ? 132  ILE B CA    1 
ATOM   3535 C  C     . ILE D  3 132 ? 20.410  -27.488 -20.620 1.00 18.02 ? 132  ILE B C     1 
ATOM   3536 O  O     . ILE D  3 132 ? 21.163  -28.383 -20.262 1.00 18.99 ? 132  ILE B O     1 
ATOM   3537 C  CB    . ILE D  3 132 ? 18.427  -28.913 -21.187 1.00 17.80 ? 132  ILE B CB    1 
ATOM   3538 C  CG1   . ILE D  3 132 ? 17.310  -29.168 -22.206 1.00 18.23 ? 132  ILE B CG1   1 
ATOM   3539 C  CG2   . ILE D  3 132 ? 17.855  -28.611 -19.815 1.00 16.30 ? 132  ILE B CG2   1 
ATOM   3540 C  CD1   . ILE D  3 132 ? 16.392  -30.342 -21.861 1.00 17.90 ? 132  ILE B CD1   1 
ATOM   3541 N  N     . PRO D  3 133 ? 20.483  -26.257 -20.113 1.00 17.97 ? 133  PRO B N     1 
ATOM   3542 C  CA    . PRO D  3 133 ? 21.511  -25.913 -19.146 1.00 17.40 ? 133  PRO B CA    1 
ATOM   3543 C  C     . PRO D  3 133 ? 21.090  -26.339 -17.748 1.00 18.14 ? 133  PRO B C     1 
ATOM   3544 O  O     . PRO D  3 133 ? 19.959  -26.779 -17.553 1.00 18.32 ? 133  PRO B O     1 
ATOM   3545 C  CB    . PRO D  3 133 ? 21.537  -24.397 -19.224 1.00 16.87 ? 133  PRO B CB    1 
ATOM   3546 C  CG    . PRO D  3 133 ? 20.109  -24.046 -19.456 1.00 17.21 ? 133  PRO B CG    1 
ATOM   3547 C  CD    . PRO D  3 133 ? 19.590  -25.118 -20.392 1.00 17.57 ? 133  PRO B CD    1 
ATOM   3548 N  N     . GLY D  3 134 ? 22.003  -26.222 -16.789 1.00 18.94 ? 134  GLY B N     1 
ATOM   3549 C  CA    . GLY D  3 134 ? 21.701  -26.465 -15.377 1.00 18.81 ? 134  GLY B CA    1 
ATOM   3550 C  C     . GLY D  3 134 ? 21.142  -27.824 -14.992 1.00 19.59 ? 134  GLY B C     1 
ATOM   3551 O  O     . GLY D  3 134 ? 20.456  -27.954 -13.970 1.00 20.28 ? 134  GLY B O     1 
ATOM   3552 N  N     . LEU D  3 135 ? 21.415  -28.848 -15.792 1.00 20.07 ? 135  LEU B N     1 
ATOM   3553 C  CA    . LEU D  3 135 ? 20.984  -30.193 -15.418 1.00 20.14 ? 135  LEU B CA    1 
ATOM   3554 C  C     . LEU D  3 135 ? 21.830  -30.744 -14.278 1.00 20.97 ? 135  LEU B C     1 
ATOM   3555 O  O     . LEU D  3 135 ? 21.367  -31.568 -13.494 1.00 21.03 ? 135  LEU B O     1 
ATOM   3556 C  CB    . LEU D  3 135 ? 21.025  -31.128 -16.608 1.00 19.72 ? 135  LEU B CB    1 
ATOM   3557 C  CG    . LEU D  3 135 ? 19.884  -30.858 -17.576 1.00 19.93 ? 135  LEU B CG    1 
ATOM   3558 C  CD1   . LEU D  3 135 ? 20.088  -31.619 -18.880 1.00 19.32 ? 135  LEU B CD1   1 
ATOM   3559 C  CD2   . LEU D  3 135 ? 18.579  -31.244 -16.912 1.00 18.76 ? 135  LEU B CD2   1 
ATOM   3560 N  N     . VAL D  3 136 ? 23.070  -30.276 -14.188 1.00 22.14 ? 136  VAL B N     1 
ATOM   3561 C  CA    . VAL D  3 136 ? 23.957  -30.676 -13.104 1.00 22.72 ? 136  VAL B CA    1 
ATOM   3562 C  C     . VAL D  3 136 ? 23.500  -30.045 -11.796 1.00 23.27 ? 136  VAL B C     1 
ATOM   3563 O  O     . VAL D  3 136 ? 23.238  -30.741 -10.828 1.00 23.66 ? 136  VAL B O     1 
ATOM   3564 C  CB    . VAL D  3 136 ? 25.433  -30.302 -13.379 1.00 22.18 ? 136  VAL B CB    1 
ATOM   3565 C  CG1   . VAL D  3 136 ? 26.305  -30.707 -12.207 1.00 22.02 ? 136  VAL B CG1   1 
ATOM   3566 C  CG2   . VAL D  3 136 ? 25.923  -30.969 -14.650 1.00 21.84 ? 136  VAL B CG2   1 
ATOM   3567 N  N     . GLU D  3 137 ? 23.382  -28.727 -11.760 1.00 24.65 ? 137  GLU B N     1 
ATOM   3568 C  CA    . GLU D  3 137 ? 22.958  -28.098 -10.519 1.00 26.14 ? 137  GLU B CA    1 
ATOM   3569 C  C     . GLU D  3 137 ? 21.514  -28.449 -10.149 1.00 26.43 ? 137  GLU B C     1 
ATOM   3570 O  O     . GLU D  3 137 ? 21.165  -28.472 -8.973  1.00 27.28 ? 137  GLU B O     1 
ATOM   3571 C  CB    . GLU D  3 137 ? 23.227  -26.585 -10.500 1.00 26.14 ? 137  GLU B CB    1 
ATOM   3572 C  CG    . GLU D  3 137 ? 22.927  -25.851 -11.772 1.00 27.01 ? 137  GLU B CG    1 
ATOM   3573 C  CD    . GLU D  3 137 ? 24.044  -25.946 -12.798 1.00 28.28 ? 137  GLU B CD    1 
ATOM   3574 O  OE1   . GLU D  3 137 ? 24.245  -27.044 -13.377 1.00 28.18 ? 137  GLU B OE1   1 
ATOM   3575 O  OE2   . GLU D  3 137 ? 24.692  -24.904 -13.056 1.00 28.73 ? 137  GLU B OE2   1 
ATOM   3576 N  N     . LEU D  3 138 ? 20.684  -28.762 -11.138 1.00 26.70 ? 138  LEU B N     1 
ATOM   3577 C  CA    . LEU D  3 138 ? 19.361  -29.287 -10.836 1.00 26.73 ? 138  LEU B CA    1 
ATOM   3578 C  C     . LEU D  3 138 ? 19.504  -30.461 -9.863  1.00 27.54 ? 138  LEU B C     1 
ATOM   3579 O  O     . LEU D  3 138 ? 18.785  -30.543 -8.875  1.00 28.93 ? 138  LEU B O     1 
ATOM   3580 C  CB    . LEU D  3 138 ? 18.645  -29.741 -12.111 1.00 26.46 ? 138  LEU B CB    1 
ATOM   3581 C  CG    . LEU D  3 138 ? 17.104  -29.719 -12.158 1.00 25.85 ? 138  LEU B CG    1 
ATOM   3582 C  CD1   . LEU D  3 138 ? 16.576  -30.962 -12.848 1.00 24.98 ? 138  LEU B CD1   1 
ATOM   3583 C  CD2   . LEU D  3 138 ? 16.462  -29.571 -10.791 1.00 24.82 ? 138  LEU B CD2   1 
ATOM   3584 N  N     . GLY D  3 139 ? 20.441  -31.364 -10.144 1.00 27.69 ? 139  GLY B N     1 
ATOM   3585 C  CA    . GLY D  3 139 ? 20.712  -32.499 -9.267  1.00 27.25 ? 139  GLY B CA    1 
ATOM   3586 C  C     . GLY D  3 139 ? 20.527  -33.868 -9.911  1.00 28.26 ? 139  GLY B C     1 
ATOM   3587 O  O     . GLY D  3 139 ? 20.514  -34.884 -9.211  1.00 28.10 ? 139  GLY B O     1 
ATOM   3588 N  N     . VAL D  3 140 ? 20.404  -33.910 -11.239 1.00 28.01 ? 140  VAL B N     1 
ATOM   3589 C  CA    . VAL D  3 140 ? 20.027  -35.153 -11.935 1.00 27.81 ? 140  VAL B CA    1 
ATOM   3590 C  C     . VAL D  3 140 ? 21.076  -35.762 -12.875 1.00 27.73 ? 140  VAL B C     1 
ATOM   3591 O  O     . VAL D  3 140 ? 20.835  -36.805 -13.493 1.00 26.92 ? 140  VAL B O     1 
ATOM   3592 C  CB    . VAL D  3 140 ? 18.746  -34.956 -12.756 1.00 26.94 ? 140  VAL B CB    1 
ATOM   3593 C  CG1   . VAL D  3 140 ? 17.614  -34.523 -11.852 1.00 26.42 ? 140  VAL B CG1   1 
ATOM   3594 C  CG2   . VAL D  3 140 ? 18.992  -33.948 -13.878 1.00 25.53 ? 140  VAL B CG2   1 
ATOM   3595 N  N     . ALA D  3 141 ? 22.225  -35.110 -12.990 1.00 28.20 ? 141  ALA B N     1 
ATOM   3596 C  CA    . ALA D  3 141 ? 23.258  -35.553 -13.918 1.00 28.92 ? 141  ALA B CA    1 
ATOM   3597 C  C     . ALA D  3 141 ? 24.619  -35.025 -13.521 1.00 29.22 ? 141  ALA B C     1 
ATOM   3598 O  O     . ALA D  3 141 ? 24.731  -33.983 -12.880 1.00 29.71 ? 141  ALA B O     1 
ATOM   3599 C  CB    . ALA D  3 141 ? 22.927  -35.109 -15.337 1.00 28.79 ? 141  ALA B CB    1 
ATOM   3600 N  N     . SER D  3 142 ? 25.656  -35.750 -13.909 1.00 30.41 ? 142  SER B N     1 
ATOM   3601 C  CA    . SER D  3 142 ? 27.013  -35.262 -13.745 1.00 31.65 ? 142  SER B CA    1 
ATOM   3602 C  C     . SER D  3 142 ? 27.706  -35.225 -15.097 1.00 33.16 ? 142  SER B C     1 
ATOM   3603 O  O     . SER D  3 142 ? 27.354  -35.980 -16.016 1.00 32.85 ? 142  SER B O     1 
ATOM   3604 C  CB    . SER D  3 142 ? 27.792  -36.108 -12.738 1.00 30.91 ? 142  SER B CB    1 
ATOM   3605 O  OG    . SER D  3 142 ? 27.727  -37.475 -13.068 1.00 30.55 ? 142  SER B OG    1 
ATOM   3606 N  N     . GLU D  3 143 ? 28.670  -34.321 -15.219 1.00 34.93 ? 143  GLU B N     1 
ATOM   3607 C  CA    . GLU D  3 143 ? 29.393  -34.139 -16.462 1.00 37.94 ? 143  GLU B CA    1 
ATOM   3608 C  C     . GLU D  3 143 ? 30.468  -35.209 -16.622 1.00 38.06 ? 143  GLU B C     1 
ATOM   3609 O  O     . GLU D  3 143 ? 31.351  -35.335 -15.774 1.00 38.12 ? 143  GLU B O     1 
ATOM   3610 C  CB    . GLU D  3 143 ? 30.038  -32.750 -16.493 1.00 40.25 ? 143  GLU B CB    1 
ATOM   3611 C  CG    . GLU D  3 143 ? 30.161  -32.156 -17.893 1.00 43.61 ? 143  GLU B CG    1 
ATOM   3612 C  CD    . GLU D  3 143 ? 31.258  -31.108 -18.000 1.00 45.20 ? 143  GLU B CD    1 
ATOM   3613 O  OE1   . GLU D  3 143 ? 32.334  -31.312 -17.387 1.00 45.67 ? 143  GLU B OE1   1 
ATOM   3614 O  OE2   . GLU D  3 143 ? 31.046  -30.091 -18.711 1.00 45.92 ? 143  GLU B OE2   1 
ATOM   3615 N  N     . ASN D  3 144 ? 30.394  -35.995 -17.693 1.00 37.89 ? 144  ASN B N     1 
ATOM   3616 C  CA    . ASN D  3 144 ? 31.502  -36.897 -18.000 1.00 38.24 ? 144  ASN B CA    1 
ATOM   3617 C  C     . ASN D  3 144 ? 32.027  -36.757 -19.434 1.00 36.92 ? 144  ASN B C     1 
ATOM   3618 O  O     . ASN D  3 144 ? 31.386  -37.166 -20.395 1.00 36.93 ? 144  ASN B O     1 
ATOM   3619 C  CB    . ASN D  3 144 ? 31.200  -38.353 -17.601 1.00 39.65 ? 144  ASN B CB    1 
ATOM   3620 C  CG    . ASN D  3 144 ? 30.619  -39.173 -18.735 1.00 41.32 ? 144  ASN B CG    1 
ATOM   3621 O  OD1   . ASN D  3 144 ? 29.404  -39.189 -18.955 1.00 42.22 ? 144  ASN B OD1   1 
ATOM   3622 N  ND2   . ASN D  3 144 ? 31.486  -39.881 -19.454 1.00 41.61 ? 144  ASN B ND2   1 
ATOM   3623 N  N     . LEU D  3 145 ? 33.207  -36.157 -19.546 1.00 35.89 ? 145  LEU B N     1 
ATOM   3624 C  CA    . LEU D  3 145 ? 33.830  -35.830 -20.824 1.00 34.80 ? 145  LEU B CA    1 
ATOM   3625 C  C     . LEU D  3 145 ? 34.065  -37.043 -21.709 1.00 34.56 ? 145  LEU B C     1 
ATOM   3626 O  O     . LEU D  3 145 ? 34.384  -38.127 -21.221 1.00 33.18 ? 145  LEU B O     1 
ATOM   3627 C  CB    . LEU D  3 145 ? 35.183  -35.167 -20.567 1.00 34.04 ? 145  LEU B CB    1 
ATOM   3628 C  CG    . LEU D  3 145 ? 35.242  -34.207 -19.381 1.00 33.14 ? 145  LEU B CG    1 
ATOM   3629 C  CD1   . LEU D  3 145 ? 36.614  -34.229 -18.717 1.00 32.71 ? 145  LEU B CD1   1 
ATOM   3630 C  CD2   . LEU D  3 145 ? 34.857  -32.810 -19.823 1.00 32.66 ? 145  LEU B CD2   1 
ATOM   3631 N  N     . TYR D  3 146 ? 33.910  -36.853 -23.016 1.00 35.35 ? 146  TYR B N     1 
ATOM   3632 C  CA    . TYR D  3 146 ? 34.432  -37.822 -23.973 1.00 36.23 ? 146  TYR B CA    1 
ATOM   3633 C  C     . TYR D  3 146 ? 35.371  -37.161 -24.983 1.00 35.42 ? 146  TYR B C     1 
ATOM   3634 O  O     . TYR D  3 146 ? 35.104  -36.061 -25.475 1.00 34.75 ? 146  TYR B O     1 
ATOM   3635 C  CB    . TYR D  3 146 ? 33.322  -38.652 -24.631 1.00 38.65 ? 146  TYR B CB    1 
ATOM   3636 C  CG    . TYR D  3 146 ? 32.567  -38.009 -25.770 1.00 39.81 ? 146  TYR B CG    1 
ATOM   3637 C  CD1   . TYR D  3 146 ? 31.333  -37.409 -25.554 1.00 40.56 ? 146  TYR B CD1   1 
ATOM   3638 C  CD2   . TYR D  3 146 ? 33.061  -38.044 -27.075 1.00 40.68 ? 146  TYR B CD2   1 
ATOM   3639 C  CE1   . TYR D  3 146 ? 30.611  -36.833 -26.599 1.00 40.74 ? 146  TYR B CE1   1 
ATOM   3640 C  CE2   . TYR D  3 146 ? 32.349  -37.465 -28.131 1.00 41.02 ? 146  TYR B CE2   1 
ATOM   3641 C  CZ    . TYR D  3 146 ? 31.120  -36.865 -27.881 1.00 40.68 ? 146  TYR B CZ    1 
ATOM   3642 O  OH    . TYR D  3 146 ? 30.398  -36.293 -28.904 1.00 40.29 ? 146  TYR B OH    1 
ATOM   3643 N  N     . PHE D  3 147 ? 36.493  -37.823 -25.249 1.00 34.14 ? 147  PHE B N     1 
ATOM   3644 C  CA    . PHE D  3 147 ? 37.535  -37.254 -26.098 1.00 33.10 ? 147  PHE B CA    1 
ATOM   3645 C  C     . PHE D  3 147 ? 37.373  -37.738 -27.531 1.00 32.37 ? 147  PHE B C     1 
ATOM   3646 O  O     . PHE D  3 147 ? 38.005  -37.209 -28.443 1.00 33.36 ? 147  PHE B O     1 
ATOM   3647 C  CB    . PHE D  3 147 ? 38.930  -37.623 -25.569 1.00 31.94 ? 147  PHE B CB    1 
ATOM   3648 C  CG    . PHE D  3 147 ? 39.228  -37.089 -24.186 1.00 31.16 ? 147  PHE B CG    1 
ATOM   3649 C  CD1   . PHE D  3 147 ? 38.671  -37.681 -23.059 1.00 31.23 ? 147  PHE B CD1   1 
ATOM   3650 C  CD2   . PHE D  3 147 ? 40.076  -36.007 -24.013 1.00 30.79 ? 147  PHE B CD2   1 
ATOM   3651 C  CE1   . PHE D  3 147 ? 38.941  -37.191 -21.784 1.00 30.79 ? 147  PHE B CE1   1 
ATOM   3652 C  CE2   . PHE D  3 147 ? 40.349  -35.512 -22.741 1.00 30.63 ? 147  PHE B CE2   1 
ATOM   3653 C  CZ    . PHE D  3 147 ? 39.779  -36.105 -21.628 1.00 30.74 ? 147  PHE B CZ    1 
ATOM   3654 N  N     . GLU E  3 3   ? 1.413   11.532  11.475  1.00 26.82 ? 3    GLU C N     1 
ATOM   3655 C  CA    . GLU E  3 3   ? 2.643   12.354  11.217  1.00 27.66 ? 3    GLU C CA    1 
ATOM   3656 C  C     . GLU E  3 3   ? 2.301   13.690  10.550  1.00 26.03 ? 3    GLU C C     1 
ATOM   3657 O  O     . GLU E  3 3   ? 2.728   14.744  11.004  1.00 25.79 ? 3    GLU C O     1 
ATOM   3658 C  CB    . GLU E  3 3   ? 3.654   11.571  10.375  1.00 29.86 ? 3    GLU C CB    1 
ATOM   3659 C  CG    . GLU E  3 3   ? 4.668   12.441  9.635   1.00 32.95 ? 3    GLU C CG    1 
ATOM   3660 C  CD    . GLU E  3 3   ? 5.621   13.176  10.574  1.00 34.56 ? 3    GLU C CD    1 
ATOM   3661 O  OE1   . GLU E  3 3   ? 5.632   14.430  10.553  1.00 35.37 ? 3    GLU C OE1   1 
ATOM   3662 O  OE2   . GLU E  3 3   ? 6.358   12.500  11.330  1.00 35.06 ? 3    GLU C OE2   1 
ATOM   3663 N  N     . LEU E  3 4   ? 1.532   13.638  9.468   1.00 24.36 ? 4    LEU C N     1 
ATOM   3664 C  CA    . LEU E  3 4   ? 0.963   14.842  8.870   1.00 22.02 ? 4    LEU C CA    1 
ATOM   3665 C  C     . LEU E  3 4   ? -0.131  15.413  9.772   1.00 21.03 ? 4    LEU C C     1 
ATOM   3666 O  O     . LEU E  3 4   ? -0.521  16.577  9.642   1.00 20.72 ? 4    LEU C O     1 
ATOM   3667 C  CB    . LEU E  3 4   ? 0.386   14.525  7.485   1.00 21.57 ? 4    LEU C CB    1 
ATOM   3668 C  CG    . LEU E  3 4   ? 1.379   14.223  6.350   1.00 21.29 ? 4    LEU C CG    1 
ATOM   3669 C  CD1   . LEU E  3 4   ? 0.653   13.757  5.100   1.00 21.23 ? 4    LEU C CD1   1 
ATOM   3670 C  CD2   . LEU E  3 4   ? 2.264   15.428  6.028   1.00 21.04 ? 4    LEU C CD2   1 
ATOM   3671 N  N     . VAL E  3 5   ? -0.610  14.578  10.691  1.00 19.45 ? 5    VAL C N     1 
ATOM   3672 C  CA    . VAL E  3 5   ? -1.705  14.920  11.607  1.00 17.91 ? 5    VAL C CA    1 
ATOM   3673 C  C     . VAL E  3 5   ? -3.044  14.987  10.886  1.00 17.44 ? 5    VAL C C     1 
ATOM   3674 O  O     . VAL E  3 5   ? -4.001  14.375  11.331  1.00 16.36 ? 5    VAL C O     1 
ATOM   3675 C  CB    . VAL E  3 5   ? -1.453  16.207  12.428  1.00 17.51 ? 5    VAL C CB    1 
ATOM   3676 C  CG1   . VAL E  3 5   ? -2.676  16.535  13.258  1.00 16.35 ? 5    VAL C CG1   1 
ATOM   3677 C  CG2   . VAL E  3 5   ? -0.244  16.033  13.330  1.00 16.86 ? 5    VAL C CG2   1 
ATOM   3678 N  N     . ASP E  3 6   ? -3.115  15.714  9.774   1.00 17.69 ? 6    ASP C N     1 
ATOM   3679 C  CA    . ASP E  3 6   ? -4.277  15.615  8.897   1.00 18.55 ? 6    ASP C CA    1 
ATOM   3680 C  C     . ASP E  3 6   ? -3.886  15.700  7.432   1.00 18.12 ? 6    ASP C C     1 
ATOM   3681 O  O     . ASP E  3 6   ? -3.642  16.787  6.915   1.00 17.71 ? 6    ASP C O     1 
ATOM   3682 C  CB    . ASP E  3 6   ? -5.327  16.680  9.212   1.00 20.24 ? 6    ASP C CB    1 
ATOM   3683 C  CG    . ASP E  3 6   ? -6.596  16.516  8.378   1.00 21.31 ? 6    ASP C CG    1 
ATOM   3684 O  OD1   . ASP E  3 6   ? -7.595  17.189  8.690   1.00 21.87 ? 6    ASP C OD1   1 
ATOM   3685 O  OD2   . ASP E  3 6   ? -6.602  15.713  7.412   1.00 23.00 ? 6    ASP C OD2   1 
ATOM   3686 N  N     . THR E  3 7   ? -3.864  14.548  6.766   1.00 17.78 ? 7    THR C N     1 
ATOM   3687 C  CA    . THR E  3 7   ? -3.429  14.473  5.376   1.00 16.88 ? 7    THR C CA    1 
ATOM   3688 C  C     . THR E  3 7   ? -4.082  15.542  4.513   1.00 17.12 ? 7    THR C C     1 
ATOM   3689 O  O     . THR E  3 7   ? -3.394  16.343  3.875   1.00 18.49 ? 7    THR C O     1 
ATOM   3690 C  CB    . THR E  3 7   ? -3.738  13.102  4.752   1.00 16.23 ? 7    THR C CB    1 
ATOM   3691 O  OG1   . THR E  3 7   ? -3.145  12.063  5.537   1.00 15.77 ? 7    THR C OG1   1 
ATOM   3692 C  CG2   . THR E  3 7   ? -3.188  13.034  3.340   1.00 16.80 ? 7    THR C CG2   1 
ATOM   3693 N  N     . THR E  3 8   ? -5.407  15.547  4.486   1.00 16.23 ? 8    THR C N     1 
ATOM   3694 C  CA    . THR E  3 8   ? -6.136  16.432  3.594   1.00 16.56 ? 8    THR C CA    1 
ATOM   3695 C  C     . THR E  3 8   ? -5.649  17.872  3.721   1.00 17.20 ? 8    THR C C     1 
ATOM   3696 O  O     . THR E  3 8   ? -5.243  18.500  2.740   1.00 17.72 ? 8    THR C O     1 
ATOM   3697 C  CB    . THR E  3 8   ? -7.641  16.387  3.895   1.00 17.14 ? 8    THR C CB    1 
ATOM   3698 O  OG1   . THR E  3 8   ? -8.105  15.047  3.759   1.00 15.86 ? 8    THR C OG1   1 
ATOM   3699 C  CG2   . THR E  3 8   ? -8.420  17.291  2.941   1.00 16.07 ? 8    THR C CG2   1 
ATOM   3700 N  N     . GLU E  3 9   ? -5.696  18.398  4.937   1.00 17.72 ? 9    GLU C N     1 
ATOM   3701 C  CA    . GLU E  3 9   ? -5.326  19.787  5.159   1.00 17.79 ? 9    GLU C CA    1 
ATOM   3702 C  C     . GLU E  3 9   ? -3.893  20.053  4.746   1.00 16.93 ? 9    GLU C C     1 
ATOM   3703 O  O     . GLU E  3 9   ? -3.594  21.131  4.225   1.00 17.01 ? 9    GLU C O     1 
ATOM   3704 C  CB    . GLU E  3 9   ? -5.523  20.177  6.622   1.00 18.47 ? 9    GLU C CB    1 
ATOM   3705 C  CG    . GLU E  3 9   ? -6.948  20.054  7.085   1.00 17.76 ? 9    GLU C CG    1 
ATOM   3706 C  CD    . GLU E  3 9   ? -7.120  20.545  8.500   1.00 18.43 ? 9    GLU C CD    1 
ATOM   3707 O  OE1   . GLU E  3 9   ? -6.100  20.709  9.212   1.00 18.60 ? 9    GLU C OE1   1 
ATOM   3708 O  OE2   . GLU E  3 9   ? -8.279  20.769  8.898   1.00 18.14 ? 9    GLU C OE2   1 
ATOM   3709 N  N     . MET E  3 10  ? -3.008  19.088  4.985   1.00 14.80 ? 10   MET C N     1 
ATOM   3710 C  CA    . MET E  3 10  ? -1.612  19.262  4.602   1.00 15.77 ? 10   MET C CA    1 
ATOM   3711 C  C     . MET E  3 10  ? -1.496  19.374  3.091   1.00 16.19 ? 10   MET C C     1 
ATOM   3712 O  O     . MET E  3 10  ? -0.661  20.129  2.572   1.00 15.49 ? 10   MET C O     1 
ATOM   3713 C  CB    . MET E  3 10  ? -0.729  18.120  5.117   1.00 16.67 ? 10   MET C CB    1 
ATOM   3714 C  CG    . MET E  3 10  ? -0.227  18.315  6.533   1.00 17.05 ? 10   MET C CG    1 
ATOM   3715 S  SD    . MET E  3 10  ? 0.236   20.020  6.862   1.00 20.04 ? 10   MET C SD    1 
ATOM   3716 C  CE    . MET E  3 10  ? 1.705   20.204  5.854   1.00 17.13 ? 10   MET C CE    1 
ATOM   3717 N  N     . TYR E  3 11  ? -2.330  18.614  2.385   1.00 15.99 ? 11   TYR C N     1 
ATOM   3718 C  CA    . TYR E  3 11  ? -2.376  18.702  0.931   1.00 16.25 ? 11   TYR C CA    1 
ATOM   3719 C  C     . TYR E  3 11  ? -2.881  20.077  0.526   1.00 16.28 ? 11   TYR C C     1 
ATOM   3720 O  O     . TYR E  3 11  ? -2.258  20.761  -0.274  1.00 17.38 ? 11   TYR C O     1 
ATOM   3721 C  CB    . TYR E  3 11  ? -3.267  17.606  0.337   1.00 15.72 ? 11   TYR C CB    1 
ATOM   3722 C  CG    . TYR E  3 11  ? -2.543  16.315  0.029   1.00 15.38 ? 11   TYR C CG    1 
ATOM   3723 C  CD1   . TYR E  3 11  ? -1.763  15.680  0.999   1.00 15.80 ? 11   TYR C CD1   1 
ATOM   3724 C  CD2   . TYR E  3 11  ? -2.640  15.724  -1.229  1.00 14.39 ? 11   TYR C CD2   1 
ATOM   3725 C  CE1   . TYR E  3 11  ? -1.097  14.492  0.726   1.00 15.02 ? 11   TYR C CE1   1 
ATOM   3726 C  CE2   . TYR E  3 11  ? -1.986  14.540  -1.509  1.00 14.76 ? 11   TYR C CE2   1 
ATOM   3727 C  CZ    . TYR E  3 11  ? -1.220  13.929  -0.527  1.00 15.42 ? 11   TYR C CZ    1 
ATOM   3728 O  OH    . TYR E  3 11  ? -0.567  12.753  -0.801  1.00 15.89 ? 11   TYR C OH    1 
ATOM   3729 N  N     . LEU E  3 12  ? -4.003  20.489  1.097   1.00 16.36 ? 12   LEU C N     1 
ATOM   3730 C  CA    . LEU E  3 12  ? -4.528  21.816  0.806   1.00 16.48 ? 12   LEU C CA    1 
ATOM   3731 C  C     . LEU E  3 12  ? -3.472  22.874  1.095   1.00 16.85 ? 12   LEU C C     1 
ATOM   3732 O  O     . LEU E  3 12  ? -3.203  23.723  0.256   1.00 17.58 ? 12   LEU C O     1 
ATOM   3733 C  CB    . LEU E  3 12  ? -5.838  22.080  1.565   1.00 15.45 ? 12   LEU C CB    1 
ATOM   3734 C  CG    . LEU E  3 12  ? -6.996  21.166  1.125   1.00 15.01 ? 12   LEU C CG    1 
ATOM   3735 C  CD1   . LEU E  3 12  ? -8.067  21.042  2.180   1.00 15.22 ? 12   LEU C CD1   1 
ATOM   3736 C  CD2   . LEU E  3 12  ? -7.605  21.617  -0.196  1.00 14.94 ? 12   LEU C CD2   1 
ATOM   3737 N  N     . ARG E  3 13  ? -2.831  22.803  2.254   1.00 17.94 ? 13   ARG C N     1 
ATOM   3738 C  CA    . ARG E  3 13  ? -1.864  23.838  2.604   1.00 19.43 ? 13   ARG C CA    1 
ATOM   3739 C  C     . ARG E  3 13  ? -0.594  23.739  1.763   1.00 19.44 ? 13   ARG C C     1 
ATOM   3740 O  O     . ARG E  3 13  ? 0.055   24.749  1.476   1.00 19.35 ? 13   ARG C O     1 
ATOM   3741 C  CB    . ARG E  3 13  ? -1.542  23.822  4.102   1.00 20.95 ? 13   ARG C CB    1 
ATOM   3742 C  CG    . ARG E  3 13  ? -1.112  25.191  4.644   1.00 23.40 ? 13   ARG C CG    1 
ATOM   3743 C  CD    . ARG E  3 13  ? 0.424   25.355  4.684   1.00 24.91 ? 13   ARG C CD    1 
ATOM   3744 N  NE    . ARG E  3 13  ? 0.979   24.802  5.917   1.00 26.15 ? 13   ARG C NE    1 
ATOM   3745 C  CZ    . ARG E  3 13  ? 2.210   24.317  6.041   1.00 27.80 ? 13   ARG C CZ    1 
ATOM   3746 N  NH1   . ARG E  3 13  ? 3.038   24.305  5.000   1.00 27.84 ? 13   ARG C NH1   1 
ATOM   3747 N  NH2   . ARG E  3 13  ? 2.614   23.832  7.213   1.00 28.64 ? 13   ARG C NH2   1 
ATOM   3748 N  N     . THR E  3 14  ? -0.239  22.525  1.359   1.00 19.18 ? 14   THR C N     1 
ATOM   3749 C  CA    . THR E  3 14  ? 0.965   22.341  0.565   1.00 19.33 ? 14   THR C CA    1 
ATOM   3750 C  C     . THR E  3 14  ? 0.776   23.016  -0.784  1.00 19.43 ? 14   THR C C     1 
ATOM   3751 O  O     . THR E  3 14  ? 1.663   23.722  -1.275  1.00 18.76 ? 14   THR C O     1 
ATOM   3752 C  CB    . THR E  3 14  ? 1.283   20.861  0.365   1.00 19.73 ? 14   THR C CB    1 
ATOM   3753 O  OG1   . THR E  3 14  ? 1.548   20.252  1.639   1.00 18.86 ? 14   THR C OG1   1 
ATOM   3754 C  CG2   . THR E  3 14  ? 2.484   20.702  -0.551  1.00 18.81 ? 14   THR C CG2   1 
ATOM   3755 N  N     . ILE E  3 15  ? -0.401  22.814  -1.365  1.00 18.64 ? 15   ILE C N     1 
ATOM   3756 C  CA    . ILE E  3 15  ? -0.768  23.499  -2.600  1.00 19.37 ? 15   ILE C CA    1 
ATOM   3757 C  C     . ILE E  3 15  ? -0.719  25.022  -2.448  1.00 20.49 ? 15   ILE C C     1 
ATOM   3758 O  O     . ILE E  3 15  ? -0.143  25.712  -3.286  1.00 19.74 ? 15   ILE C O     1 
ATOM   3759 C  CB    . ILE E  3 15  ? -2.166  23.056  -3.093  1.00 18.29 ? 15   ILE C CB    1 
ATOM   3760 C  CG1   . ILE E  3 15  ? -2.084  21.628  -3.650  1.00 16.62 ? 15   ILE C CG1   1 
ATOM   3761 C  CG2   . ILE E  3 15  ? -2.705  24.039  -4.132  1.00 16.67 ? 15   ILE C CG2   1 
ATOM   3762 C  CD1   . ILE E  3 15  ? -3.412  20.957  -3.846  1.00 15.56 ? 15   ILE C CD1   1 
ATOM   3763 N  N     . TYR E  3 16  ? -1.327  25.532  -1.375  1.00 23.36 ? 16   TYR C N     1 
ATOM   3764 C  CA    . TYR E  3 16  ? -1.335  26.965  -1.078  1.00 24.23 ? 16   TYR C CA    1 
ATOM   3765 C  C     . TYR E  3 16  ? 0.092   27.475  -1.070  1.00 24.70 ? 16   TYR C C     1 
ATOM   3766 O  O     . TYR E  3 16  ? 0.408   28.438  -1.773  1.00 24.47 ? 16   TYR C O     1 
ATOM   3767 C  CB    . TYR E  3 16  ? -2.000  27.242  0.274   1.00 26.76 ? 16   TYR C CB    1 
ATOM   3768 C  CG    . TYR E  3 16  ? -2.518  28.654  0.411   1.00 27.61 ? 16   TYR C CG    1 
ATOM   3769 C  CD1   . TYR E  3 16  ? -1.722  29.665  0.926   1.00 28.05 ? 16   TYR C CD1   1 
ATOM   3770 C  CD2   . TYR E  3 16  ? -3.804  28.979  0.004   1.00 28.30 ? 16   TYR C CD2   1 
ATOM   3771 C  CE1   . TYR E  3 16  ? -2.201  30.965  1.043   1.00 28.53 ? 16   TYR C CE1   1 
ATOM   3772 C  CE2   . TYR E  3 16  ? -4.287  30.265  0.114   1.00 28.65 ? 16   TYR C CE2   1 
ATOM   3773 C  CZ    . TYR E  3 16  ? -3.486  31.255  0.633   1.00 28.41 ? 16   TYR C CZ    1 
ATOM   3774 O  OH    . TYR E  3 16  ? -3.980  32.536  0.725   1.00 28.39 ? 16   TYR C OH    1 
ATOM   3775 N  N     . ASP E  3 17  ? 0.949   26.814  -0.288  1.00 24.87 ? 17   ASP C N     1 
ATOM   3776 C  CA    . ASP E  3 17  ? 2.394   27.087  -0.277  1.00 25.67 ? 17   ASP C CA    1 
ATOM   3777 C  C     . ASP E  3 17  ? 2.982   27.203  -1.680  1.00 25.41 ? 17   ASP C C     1 
ATOM   3778 O  O     . ASP E  3 17  ? 3.714   28.143  -1.980  1.00 25.82 ? 17   ASP C O     1 
ATOM   3779 C  CB    . ASP E  3 17  ? 3.153   25.974  0.447   1.00 26.87 ? 17   ASP C CB    1 
ATOM   3780 C  CG    . ASP E  3 17  ? 3.067   26.076  1.951   1.00 28.17 ? 17   ASP C CG    1 
ATOM   3781 O  OD1   . ASP E  3 17  ? 2.780   27.171  2.488   1.00 28.34 ? 17   ASP C OD1   1 
ATOM   3782 O  OD2   . ASP E  3 17  ? 3.316   25.040  2.601   1.00 29.42 ? 17   ASP C OD2   1 
ATOM   3783 N  N     . LEU E  3 18  ? 2.683   26.225  -2.527  1.00 25.05 ? 18   LEU C N     1 
ATOM   3784 C  CA    . LEU E  3 18  ? 3.197   26.220  -3.891  1.00 25.33 ? 18   LEU C CA    1 
ATOM   3785 C  C     . LEU E  3 18  ? 2.779   27.464  -4.673  1.00 25.70 ? 18   LEU C C     1 
ATOM   3786 O  O     . LEU E  3 18  ? 3.612   28.114  -5.300  1.00 25.86 ? 18   LEU C O     1 
ATOM   3787 C  CB    . LEU E  3 18  ? 2.779   24.942  -4.628  1.00 23.74 ? 18   LEU C CB    1 
ATOM   3788 C  CG    . LEU E  3 18  ? 3.371   23.643  -4.072  1.00 22.62 ? 18   LEU C CG    1 
ATOM   3789 C  CD1   . LEU E  3 18  ? 2.659   22.460  -4.660  1.00 22.56 ? 18   LEU C CD1   1 
ATOM   3790 C  CD2   . LEU E  3 18  ? 4.872   23.527  -4.316  1.00 22.24 ? 18   LEU C CD2   1 
ATOM   3791 N  N     . GLU E  3 19  ? 1.492   27.789  -4.639  1.00 27.14 ? 19   GLU C N     1 
ATOM   3792 C  CA    . GLU E  3 19  ? 0.997   29.001  -5.291  1.00 28.89 ? 19   GLU C CA    1 
ATOM   3793 C  C     . GLU E  3 19  ? 1.722   30.211  -4.750  1.00 28.47 ? 19   GLU C C     1 
ATOM   3794 O  O     . GLU E  3 19  ? 2.151   31.081  -5.496  1.00 28.60 ? 19   GLU C O     1 
ATOM   3795 C  CB    . GLU E  3 19  ? -0.492  29.191  -5.027  1.00 29.88 ? 19   GLU C CB    1 
ATOM   3796 C  CG    . GLU E  3 19  ? -1.307  27.954  -5.251  1.00 32.23 ? 19   GLU C CG    1 
ATOM   3797 C  CD    . GLU E  3 19  ? -2.774  28.264  -5.455  1.00 34.17 ? 19   GLU C CD    1 
ATOM   3798 O  OE1   . GLU E  3 19  ? -3.140  29.470  -5.509  1.00 35.07 ? 19   GLU C OE1   1 
ATOM   3799 O  OE2   . GLU E  3 19  ? -3.559  27.295  -5.570  1.00 35.03 ? 19   GLU C OE2   1 
ATOM   3800 N  N     . GLU E  3 20  ? 1.827   30.260  -3.430  1.00 28.89 ? 20   GLU C N     1 
ATOM   3801 C  CA    . GLU E  3 20  ? 2.544   31.314  -2.744  1.00 29.51 ? 20   GLU C CA    1 
ATOM   3802 C  C     . GLU E  3 20  ? 4.000   31.354  -3.219  1.00 28.96 ? 20   GLU C C     1 
ATOM   3803 O  O     . GLU E  3 20  ? 4.565   32.426  -3.417  1.00 28.95 ? 20   GLU C O     1 
ATOM   3804 C  CB    . GLU E  3 20  ? 2.455   31.080  -1.232  1.00 30.49 ? 20   GLU C CB    1 
ATOM   3805 C  CG    . GLU E  3 20  ? 2.943   32.217  -0.355  1.00 31.51 ? 20   GLU C CG    1 
ATOM   3806 C  CD    . GLU E  3 20  ? 2.122   32.334  0.916   1.00 32.16 ? 20   GLU C CD    1 
ATOM   3807 O  OE1   . GLU E  3 20  ? 2.679   32.701  1.971   1.00 31.97 ? 20   GLU C OE1   1 
ATOM   3808 O  OE2   . GLU E  3 20  ? 0.908   32.055  0.850   1.00 32.66 ? 20   GLU C OE2   1 
ATOM   3809 N  N     . GLU E  3 21  ? 4.591   30.185  -3.437  1.00 28.38 ? 21   GLU C N     1 
ATOM   3810 C  CA    . GLU E  3 21  ? 5.983   30.112  -3.868  1.00 28.05 ? 21   GLU C CA    1 
ATOM   3811 C  C     . GLU E  3 21  ? 6.152   30.291  -5.362  1.00 27.11 ? 21   GLU C C     1 
ATOM   3812 O  O     . GLU E  3 21  ? 7.275   30.285  -5.869  1.00 27.56 ? 21   GLU C O     1 
ATOM   3813 C  CB    . GLU E  3 21  ? 6.610   28.792  -3.440  1.00 28.60 ? 21   GLU C CB    1 
ATOM   3814 C  CG    . GLU E  3 21  ? 6.794   28.706  -1.941  1.00 30.35 ? 21   GLU C CG    1 
ATOM   3815 C  CD    . GLU E  3 21  ? 7.273   27.353  -1.512  1.00 30.59 ? 21   GLU C CD    1 
ATOM   3816 O  OE1   . GLU E  3 21  ? 7.889   26.658  -2.343  1.00 30.92 ? 21   GLU C OE1   1 
ATOM   3817 O  OE2   . GLU E  3 21  ? 7.027   26.985  -0.350  1.00 31.32 ? 21   GLU C OE2   1 
ATOM   3818 N  N     . GLY E  3 22  ? 5.039   30.430  -6.069  1.00 24.84 ? 22   GLY C N     1 
ATOM   3819 C  CA    . GLY E  3 22  ? 5.092   30.627  -7.506  1.00 23.95 ? 22   GLY C CA    1 
ATOM   3820 C  C     . GLY E  3 22  ? 5.275   29.370  -8.334  1.00 23.26 ? 22   GLY C C     1 
ATOM   3821 O  O     . GLY E  3 22  ? 5.219   29.429  -9.560  1.00 23.75 ? 22   GLY C O     1 
ATOM   3822 N  N     . VAL E  3 23  ? 5.497   28.231  -7.690  1.00 22.58 ? 23   VAL C N     1 
ATOM   3823 C  CA    . VAL E  3 23  ? 5.690   27.001  -8.454  1.00 23.29 ? 23   VAL C CA    1 
ATOM   3824 C  C     . VAL E  3 23  ? 4.352   26.362  -8.830  1.00 24.28 ? 23   VAL C C     1 
ATOM   3825 O  O     . VAL E  3 23  ? 3.396   26.405  -8.053  1.00 25.16 ? 23   VAL C O     1 
ATOM   3826 C  CB    . VAL E  3 23  ? 6.693   26.009  -7.786  1.00 21.94 ? 23   VAL C CB    1 
ATOM   3827 C  CG1   . VAL E  3 23  ? 7.258   26.583  -6.509  1.00 21.35 ? 23   VAL C CG1   1 
ATOM   3828 C  CG2   . VAL E  3 23  ? 6.067   24.644  -7.574  1.00 20.37 ? 23   VAL C CG2   1 
ATOM   3829 N  N     . THR E  3 24  ? 4.282   25.809  -10.040 1.00 24.15 ? 24   THR C N     1 
ATOM   3830 C  CA    . THR E  3 24  ? 3.053   25.195  -10.526 1.00 24.09 ? 24   THR C CA    1 
ATOM   3831 C  C     . THR E  3 24  ? 2.679   24.010  -9.654  1.00 24.10 ? 24   THR C C     1 
ATOM   3832 O  O     . THR E  3 24  ? 3.499   23.124  -9.425  1.00 24.29 ? 24   THR C O     1 
ATOM   3833 C  CB    . THR E  3 24  ? 3.172   24.750  -12.002 1.00 24.04 ? 24   THR C CB    1 
ATOM   3834 O  OG1   . THR E  3 24  ? 3.007   25.890  -12.856 1.00 25.31 ? 24   THR C OG1   1 
ATOM   3835 C  CG2   . THR E  3 24  ? 2.099   23.745  -12.348 1.00 22.53 ? 24   THR C CG2   1 
ATOM   3836 N  N     . PRO E  3 25  ? 1.435   24.003  -9.151  1.00 23.90 ? 25   PRO C N     1 
ATOM   3837 C  CA    . PRO E  3 25  ? 0.967   22.943  -8.278  1.00 23.66 ? 25   PRO C CA    1 
ATOM   3838 C  C     . PRO E  3 25  ? 0.587   21.696  -9.060  1.00 23.40 ? 25   PRO C C     1 
ATOM   3839 O  O     . PRO E  3 25  ? -0.436  21.674  -9.753  1.00 23.93 ? 25   PRO C O     1 
ATOM   3840 C  CB    . PRO E  3 25  ? -0.271  23.560  -7.595  1.00 23.38 ? 25   PRO C CB    1 
ATOM   3841 C  CG    . PRO E  3 25  ? -0.315  24.997  -8.043  1.00 23.02 ? 25   PRO C CG    1 
ATOM   3842 C  CD    . PRO E  3 25  ? 0.397   25.021  -9.353  1.00 23.27 ? 25   PRO C CD    1 
ATOM   3843 N  N     . LEU E  3 26  ? 1.432   20.675  -8.938  1.00 23.14 ? 26   LEU C N     1 
ATOM   3844 C  CA    . LEU E  3 26  ? 1.202   19.350  -9.499  1.00 21.39 ? 26   LEU C CA    1 
ATOM   3845 C  C     . LEU E  3 26  ? 1.442   18.311  -8.424  1.00 19.56 ? 26   LEU C C     1 
ATOM   3846 O  O     . LEU E  3 26  ? 2.210   18.532  -7.487  1.00 18.56 ? 26   LEU C O     1 
ATOM   3847 C  CB    . LEU E  3 26  ? 2.183   19.082  -10.640 1.00 21.69 ? 26   LEU C CB    1 
ATOM   3848 C  CG    . LEU E  3 26  ? 2.313   20.177  -11.696 1.00 21.64 ? 26   LEU C CG    1 
ATOM   3849 C  CD1   . LEU E  3 26  ? 3.563   19.959  -12.537 1.00 21.53 ? 26   LEU C CD1   1 
ATOM   3850 C  CD2   . LEU E  3 26  ? 1.057   20.237  -12.561 1.00 21.00 ? 26   LEU C CD2   1 
ATOM   3851 N  N     . ARG E  3 27  ? 0.817   17.157  -8.585  1.00 18.41 ? 27   ARG C N     1 
ATOM   3852 C  CA    . ARG E  3 27  ? 1.021   16.051  -7.661  1.00 17.29 ? 27   ARG C CA    1 
ATOM   3853 C  C     . ARG E  3 27  ? 2.502   15.718  -7.360  1.00 17.00 ? 27   ARG C C     1 
ATOM   3854 O  O     . ARG E  3 27  ? 2.819   15.288  -6.257  1.00 16.72 ? 27   ARG C O     1 
ATOM   3855 C  CB    . ARG E  3 27  ? 0.253   14.822  -8.135  1.00 16.14 ? 27   ARG C CB    1 
ATOM   3856 C  CG    . ARG E  3 27  ? -1.232  14.883  -7.805  1.00 17.42 ? 27   ARG C CG    1 
ATOM   3857 C  CD    . ARG E  3 27  ? -2.058  13.991  -8.725  1.00 16.93 ? 27   ARG C CD    1 
ATOM   3858 N  NE    . ARG E  3 27  ? -1.828  14.339  -10.122 1.00 17.33 ? 27   ARG C NE    1 
ATOM   3859 C  CZ    . ARG E  3 27  ? -2.429  13.755  -11.151 1.00 16.91 ? 27   ARG C CZ    1 
ATOM   3860 N  NH1   . ARG E  3 27  ? -3.310  12.791  -10.949 1.00 16.10 ? 27   ARG C NH1   1 
ATOM   3861 N  NH2   . ARG E  3 27  ? -2.149  14.143  -12.385 1.00 16.88 ? 27   ARG C NH2   1 
ATOM   3862 N  N     . ALA E  3 28  ? 3.406   15.924  -8.314  1.00 16.23 ? 28   ALA C N     1 
ATOM   3863 C  CA    . ALA E  3 28  ? 4.819   15.633  -8.056  1.00 17.26 ? 28   ALA C CA    1 
ATOM   3864 C  C     . ALA E  3 28  ? 5.398   16.565  -6.989  1.00 17.65 ? 28   ALA C C     1 
ATOM   3865 O  O     . ALA E  3 28  ? 6.153   16.135  -6.099  1.00 16.66 ? 28   ALA C O     1 
ATOM   3866 C  CB    . ALA E  3 28  ? 5.634   15.714  -9.329  1.00 16.96 ? 28   ALA C CB    1 
ATOM   3867 N  N     . ARG E  3 29  ? 5.027   17.840  -7.075  1.00 16.81 ? 29   ARG C N     1 
ATOM   3868 C  CA    . ARG E  3 29  ? 5.453   18.818  -6.083  1.00 16.75 ? 29   ARG C CA    1 
ATOM   3869 C  C     . ARG E  3 29  ? 5.070   18.402  -4.667  1.00 16.80 ? 29   ARG C C     1 
ATOM   3870 O  O     . ARG E  3 29  ? 5.823   18.635  -3.728  1.00 16.92 ? 29   ARG C O     1 
ATOM   3871 C  CB    . ARG E  3 29  ? 4.886   20.195  -6.411  1.00 16.10 ? 29   ARG C CB    1 
ATOM   3872 C  CG    . ARG E  3 29  ? 5.374   20.765  -7.741  1.00 15.98 ? 29   ARG C CG    1 
ATOM   3873 C  CD    . ARG E  3 29  ? 6.885   21.005  -7.754  1.00 14.74 ? 29   ARG C CD    1 
ATOM   3874 N  NE    . ARG E  3 29  ? 7.658   19.782  -7.922  1.00 14.14 ? 29   ARG C NE    1 
ATOM   3875 C  CZ    . ARG E  3 29  ? 7.795   19.141  -9.079  1.00 14.78 ? 29   ARG C CZ    1 
ATOM   3876 N  NH1   . ARG E  3 29  ? 8.520   18.029  -9.136  1.00 15.28 ? 29   ARG C NH1   1 
ATOM   3877 N  NH2   . ARG E  3 29  ? 7.200   19.596  -10.174 1.00 12.35 ? 29   ARG C NH2   1 
ATOM   3878 N  N     . ILE E  3 30  ? 3.905   17.773  -4.526  1.00 16.80 ? 30   ILE C N     1 
ATOM   3879 C  CA    . ILE E  3 30  ? 3.423   17.311  -3.231  1.00 15.92 ? 30   ILE C CA    1 
ATOM   3880 C  C     . ILE E  3 30  ? 4.122   16.021  -2.817  1.00 17.07 ? 30   ILE C C     1 
ATOM   3881 O  O     . ILE E  3 30  ? 4.482   15.835  -1.652  1.00 17.18 ? 30   ILE C O     1 
ATOM   3882 C  CB    . ILE E  3 30  ? 1.913   17.069  -3.271  1.00 15.81 ? 30   ILE C CB    1 
ATOM   3883 C  CG1   . ILE E  3 30  ? 1.173   18.353  -3.650  1.00 15.28 ? 30   ILE C CG1   1 
ATOM   3884 C  CG2   . ILE E  3 30  ? 1.410   16.501  -1.938  1.00 14.70 ? 30   ILE C CG2   1 
ATOM   3885 C  CD1   . ILE E  3 30  ? -0.326  18.167  -3.736  1.00 14.96 ? 30   ILE C CD1   1 
ATOM   3886 N  N     . ALA E  3 31  ? 4.307   15.121  -3.772  1.00 18.32 ? 31   ALA C N     1 
ATOM   3887 C  CA    . ALA E  3 31  ? 5.066   13.902  -3.519  1.00 19.49 ? 31   ALA C CA    1 
ATOM   3888 C  C     . ALA E  3 31  ? 6.404   14.259  -2.877  1.00 20.28 ? 31   ALA C C     1 
ATOM   3889 O  O     . ALA E  3 31  ? 6.814   13.639  -1.906  1.00 20.90 ? 31   ALA C O     1 
ATOM   3890 C  CB    . ALA E  3 31  ? 5.274   13.107  -4.812  1.00 17.38 ? 31   ALA C CB    1 
ATOM   3891 N  N     . GLU E  3 32  ? 7.071   15.275  -3.408  1.00 21.82 ? 32   GLU C N     1 
ATOM   3892 C  CA    . GLU E  3 32  ? 8.381   15.660  -2.903  1.00 23.33 ? 32   GLU C CA    1 
ATOM   3893 C  C     . GLU E  3 32  ? 8.305   16.247  -1.499  1.00 24.45 ? 32   GLU C C     1 
ATOM   3894 O  O     . GLU E  3 32  ? 8.990   15.782  -0.578  1.00 24.80 ? 32   GLU C O     1 
ATOM   3895 C  CB    . GLU E  3 32  ? 9.043   16.662  -3.848  1.00 24.02 ? 32   GLU C CB    1 
ATOM   3896 C  CG    . GLU E  3 32  ? 9.352   16.078  -5.203  1.00 25.38 ? 32   GLU C CG    1 
ATOM   3897 C  CD    . GLU E  3 32  ? 9.828   17.110  -6.207  1.00 26.52 ? 32   GLU C CD    1 
ATOM   3898 O  OE1   . GLU E  3 32  ? 9.628   18.332  -5.986  1.00 26.08 ? 32   GLU C OE1   1 
ATOM   3899 O  OE2   . GLU E  3 32  ? 10.394  16.676  -7.235  1.00 27.30 ? 32   GLU C OE2   1 
ATOM   3900 N  N     . ARG E  3 33  ? 7.467   17.266  -1.338  1.00 23.80 ? 33   ARG C N     1 
ATOM   3901 C  CA    . ARG E  3 33  ? 7.414   18.008  -0.087  1.00 24.03 ? 33   ARG C CA    1 
ATOM   3902 C  C     . ARG E  3 33  ? 6.932   17.204  1.119   1.00 23.89 ? 33   ARG C C     1 
ATOM   3903 O  O     . ARG E  3 33  ? 7.330   17.482  2.251   1.00 23.48 ? 33   ARG C O     1 
ATOM   3904 C  CB    . ARG E  3 33  ? 6.583   19.285  -0.255  1.00 24.89 ? 33   ARG C CB    1 
ATOM   3905 C  CG    . ARG E  3 33  ? 7.430   20.479  -0.672  1.00 25.34 ? 33   ARG C CG    1 
ATOM   3906 C  CD    . ARG E  3 33  ? 6.633   21.478  -1.469  1.00 24.94 ? 33   ARG C CD    1 
ATOM   3907 N  NE    . ARG E  3 33  ? 7.509   22.391  -2.189  1.00 24.63 ? 33   ARG C NE    1 
ATOM   3908 C  CZ    . ARG E  3 33  ? 7.618   23.689  -1.930  1.00 24.50 ? 33   ARG C CZ    1 
ATOM   3909 N  NH1   . ARG E  3 33  ? 6.893   24.245  -0.969  1.00 24.36 ? 33   ARG C NH1   1 
ATOM   3910 N  NH2   . ARG E  3 33  ? 8.444   24.435  -2.648  1.00 24.42 ? 33   ARG C NH2   1 
ATOM   3911 N  N     . LEU E  3 34  ? 6.088   16.204  0.877   1.00 22.65 ? 34   LEU C N     1 
ATOM   3912 C  CA    . LEU E  3 34  ? 5.559   15.395  1.966   1.00 21.01 ? 34   LEU C CA    1 
ATOM   3913 C  C     . LEU E  3 34  ? 6.265   14.046  2.063   1.00 20.54 ? 34   LEU C C     1 
ATOM   3914 O  O     . LEU E  3 34  ? 5.927   13.217  2.909   1.00 19.54 ? 34   LEU C O     1 
ATOM   3915 C  CB    . LEU E  3 34  ? 4.048   15.229  1.811   1.00 20.63 ? 34   LEU C CB    1 
ATOM   3916 C  CG    . LEU E  3 34  ? 3.336   16.582  1.835   1.00 20.75 ? 34   LEU C CG    1 
ATOM   3917 C  CD1   . LEU E  3 34  ? 1.836   16.410  1.942   1.00 20.09 ? 34   LEU C CD1   1 
ATOM   3918 C  CD2   . LEU E  3 34  ? 3.854   17.449  2.986   1.00 20.60 ? 34   LEU C CD2   1 
ATOM   3919 N  N     . ASP E  3 35  ? 7.267   13.853  1.204   1.00 20.98 ? 35   ASP C N     1 
ATOM   3920 C  CA    . ASP E  3 35  ? 8.007   12.591  1.118   1.00 21.01 ? 35   ASP C CA    1 
ATOM   3921 C  C     . ASP E  3 35  ? 7.051   11.405  1.165   1.00 20.29 ? 35   ASP C C     1 
ATOM   3922 O  O     . ASP E  3 35  ? 7.110   10.593  2.083   1.00 20.31 ? 35   ASP C O     1 
ATOM   3923 C  CB    . ASP E  3 35  ? 9.052   12.486  2.234   1.00 22.82 ? 35   ASP C CB    1 
ATOM   3924 C  CG    . ASP E  3 35  ? 9.987   11.283  2.065   1.00 24.65 ? 35   ASP C CG    1 
ATOM   3925 O  OD1   . ASP E  3 35  ? 10.302  10.896  0.916   1.00 24.54 ? 35   ASP C OD1   1 
ATOM   3926 O  OD2   . ASP E  3 35  ? 10.417  10.727  3.099   1.00 25.54 ? 35   ASP C OD2   1 
ATOM   3927 N  N     . GLN E  3 36  ? 6.152   11.344  0.184   1.00 18.86 ? 36   GLN C N     1 
ATOM   3928 C  CA    . GLN E  3 36  ? 5.240   10.217  0.012   1.00 17.81 ? 36   GLN C CA    1 
ATOM   3929 C  C     . GLN E  3 36  ? 5.318   9.693   -1.427  1.00 17.97 ? 36   GLN C C     1 
ATOM   3930 O  O     . GLN E  3 36  ? 5.644   10.440  -2.355  1.00 18.64 ? 36   GLN C O     1 
ATOM   3931 C  CB    . GLN E  3 36  ? 3.802   10.624  0.333   1.00 17.22 ? 36   GLN C CB    1 
ATOM   3932 C  CG    . GLN E  3 36  ? 3.562   11.056  1.768   1.00 16.01 ? 36   GLN C CG    1 
ATOM   3933 C  CD    . GLN E  3 36  ? 2.082   11.272  2.074   1.00 15.57 ? 36   GLN C CD    1 
ATOM   3934 O  OE1   . GLN E  3 36  ? 1.297   11.624  1.189   1.00 14.06 ? 36   GLN C OE1   1 
ATOM   3935 N  NE2   . GLN E  3 36  ? 1.698   11.057  3.330   1.00 13.73 ? 36   GLN C NE2   1 
ATOM   3936 N  N     . SER E  3 37  ? 5.007   8.417   -1.618  1.00 16.29 ? 37   SER C N     1 
ATOM   3937 C  CA    . SER E  3 37  ? 5.080   7.819   -2.946  1.00 15.55 ? 37   SER C CA    1 
ATOM   3938 C  C     . SER E  3 37  ? 4.157   8.504   -3.945  1.00 14.91 ? 37   SER C C     1 
ATOM   3939 O  O     . SER E  3 37  ? 3.115   9.055   -3.582  1.00 14.80 ? 37   SER C O     1 
ATOM   3940 C  CB    . SER E  3 37  ? 4.690   6.351   -2.877  1.00 15.73 ? 37   SER C CB    1 
ATOM   3941 O  OG    . SER E  3 37  ? 3.285   6.215   -3.014  1.00 14.60 ? 37   SER C OG    1 
ATOM   3942 N  N     . GLY E  3 38  ? 4.526   8.429   -5.216  1.00 14.77 ? 38   GLY C N     1 
ATOM   3943 C  CA    . GLY E  3 38  ? 3.710   9.007   -6.283  1.00 14.24 ? 38   GLY C CA    1 
ATOM   3944 C  C     . GLY E  3 38  ? 2.279   8.520   -6.229  1.00 13.28 ? 38   GLY C C     1 
ATOM   3945 O  O     . GLY E  3 38  ? 1.347   9.313   -6.199  1.00 14.45 ? 38   GLY C O     1 
ATOM   3946 N  N     . PRO E  3 39  ? 2.093   7.198   -6.223  1.00 12.72 ? 39   PRO C N     1 
ATOM   3947 C  CA    . PRO E  3 39  ? 0.754   6.616   -6.159  1.00 12.56 ? 39   PRO C CA    1 
ATOM   3948 C  C     . PRO E  3 39  ? -0.071  7.052   -4.944  1.00 12.35 ? 39   PRO C C     1 
ATOM   3949 O  O     . PRO E  3 39  ? -1.289  7.168   -5.050  1.00 14.04 ? 39   PRO C O     1 
ATOM   3950 C  CB    . PRO E  3 39  ? 1.032   5.112   -6.119  1.00 12.01 ? 39   PRO C CB    1 
ATOM   3951 C  CG    . PRO E  3 39  ? 2.362   4.978   -6.784  1.00 12.39 ? 39   PRO C CG    1 
ATOM   3952 C  CD    . PRO E  3 39  ? 3.136   6.168   -6.318  1.00 11.21 ? 39   PRO C CD    1 
ATOM   3953 N  N     . THR E  3 40  ? 0.577   7.293   -3.810  1.00 11.85 ? 40   THR C N     1 
ATOM   3954 C  CA    . THR E  3 40  ? -0.121  7.772   -2.623  1.00 11.75 ? 40   THR C CA    1 
ATOM   3955 C  C     . THR E  3 40  ? -0.753  9.148   -2.888  1.00 13.26 ? 40   THR C C     1 
ATOM   3956 O  O     . THR E  3 40  ? -1.938  9.350   -2.619  1.00 13.35 ? 40   THR C O     1 
ATOM   3957 C  CB    . THR E  3 40  ? 0.829   7.839   -1.414  1.00 12.11 ? 40   THR C CB    1 
ATOM   3958 O  OG1   . THR E  3 40  ? 1.331   6.526   -1.124  1.00 13.12 ? 40   THR C OG1   1 
ATOM   3959 C  CG2   . THR E  3 40  ? 0.126   8.375   -0.196  1.00 11.35 ? 40   THR C CG2   1 
ATOM   3960 N  N     . VAL E  3 41  ? 0.014   10.084  -3.452  1.00 13.90 ? 41   VAL C N     1 
ATOM   3961 C  CA    . VAL E  3 41  ? -0.539  11.408  -3.726  1.00 14.74 ? 41   VAL C CA    1 
ATOM   3962 C  C     . VAL E  3 41  ? -1.702  11.356  -4.708  1.00 14.82 ? 41   VAL C C     1 
ATOM   3963 O  O     . VAL E  3 41  ? -2.742  11.943  -4.441  1.00 15.55 ? 41   VAL C O     1 
ATOM   3964 C  CB    . VAL E  3 41  ? 0.515   12.468  -4.164  1.00 15.57 ? 41   VAL C CB    1 
ATOM   3965 C  CG1   . VAL E  3 41  ? 1.786   12.361  -3.324  1.00 15.15 ? 41   VAL C CG1   1 
ATOM   3966 C  CG2   . VAL E  3 41  ? 0.819   12.363  -5.643  1.00 16.83 ? 41   VAL C CG2   1 
ATOM   3967 N  N     . SER E  3 42  ? -1.553  10.638  -5.819  1.00 15.38 ? 42   SER C N     1 
ATOM   3968 C  CA    . SER E  3 42  ? -2.662  10.495  -6.765  1.00 15.87 ? 42   SER C CA    1 
ATOM   3969 C  C     . SER E  3 42  ? -3.922  10.063  -6.048  1.00 15.99 ? 42   SER C C     1 
ATOM   3970 O  O     . SER E  3 42  ? -4.987  10.628  -6.257  1.00 16.53 ? 42   SER C O     1 
ATOM   3971 C  CB    . SER E  3 42  ? -2.349  9.458   -7.839  1.00 16.49 ? 42   SER C CB    1 
ATOM   3972 O  OG    . SER E  3 42  ? -1.606  10.026  -8.899  1.00 19.59 ? 42   SER C OG    1 
ATOM   3973 N  N     . GLN E  3 43  ? -3.791  9.052   -5.195  1.00 16.82 ? 43   GLN C N     1 
ATOM   3974 C  CA    . GLN E  3 43  ? -4.946  8.451   -4.550  1.00 17.41 ? 43   GLN C CA    1 
ATOM   3975 C  C     . GLN E  3 43  ? -5.550  9.394   -3.521  1.00 15.63 ? 43   GLN C C     1 
ATOM   3976 O  O     . GLN E  3 43  ? -6.763  9.489   -3.406  1.00 15.79 ? 43   GLN C O     1 
ATOM   3977 C  CB    . GLN E  3 43  ? -4.596  7.076   -3.958  1.00 17.36 ? 43   GLN C CB    1 
ATOM   3978 C  CG    . GLN E  3 43  ? -4.368  6.010   -5.040  1.00 19.94 ? 43   GLN C CG    1 
ATOM   3979 C  CD    . GLN E  3 43  ? -3.832  4.676   -4.509  1.00 21.24 ? 43   GLN C CD    1 
ATOM   3980 O  OE1   . GLN E  3 43  ? -3.482  4.548   -3.331  1.00 24.11 ? 43   GLN C OE1   1 
ATOM   3981 N  NE2   . GLN E  3 43  ? -3.756  3.679   -5.389  1.00 21.79 ? 43   GLN C NE2   1 
ATOM   3982 N  N     . THR E  3 44  ? -4.704  10.119  -2.804  1.00 14.90 ? 44   THR C N     1 
ATOM   3983 C  CA    . THR E  3 44  ? -5.198  11.051  -1.809  1.00 15.96 ? 44   THR C CA    1 
ATOM   3984 C  C     . THR E  3 44  ? -5.907  12.230  -2.489  1.00 15.64 ? 44   THR C C     1 
ATOM   3985 O  O     . THR E  3 44  ? -6.899  12.751  -1.991  1.00 14.65 ? 44   THR C O     1 
ATOM   3986 C  CB    . THR E  3 44  ? -4.061  11.527  -0.869  1.00 16.49 ? 44   THR C CB    1 
ATOM   3987 O  OG1   . THR E  3 44  ? -3.718  10.460  0.031   1.00 16.61 ? 44   THR C OG1   1 
ATOM   3988 C  CG2   . THR E  3 44  ? -4.492  12.762  -0.062  1.00 15.46 ? 44   THR C CG2   1 
ATOM   3989 N  N     . VAL E  3 45  ? -5.392  12.618  -3.647  1.00 16.14 ? 45   VAL C N     1 
ATOM   3990 C  CA    . VAL E  3 45  ? -5.935  13.725  -4.411  1.00 15.43 ? 45   VAL C CA    1 
ATOM   3991 C  C     . VAL E  3 45  ? -7.249  13.318  -5.059  1.00 16.53 ? 45   VAL C C     1 
ATOM   3992 O  O     . VAL E  3 45  ? -8.210  14.091  -5.069  1.00 16.68 ? 45   VAL C O     1 
ATOM   3993 C  CB    . VAL E  3 45  ? -4.925  14.198  -5.474  1.00 14.26 ? 45   VAL C CB    1 
ATOM   3994 C  CG1   . VAL E  3 45  ? -5.599  15.097  -6.488  1.00 13.39 ? 45   VAL C CG1   1 
ATOM   3995 C  CG2   . VAL E  3 45  ? -3.745  14.918  -4.802  1.00 12.51 ? 45   VAL C CG2   1 
ATOM   3996 N  N     . SER E  3 46  ? -7.292  12.097  -5.581  1.00 17.15 ? 46   SER C N     1 
ATOM   3997 C  CA    . SER E  3 46  ? -8.537  11.543  -6.105  1.00 19.00 ? 46   SER C CA    1 
ATOM   3998 C  C     . SER E  3 46  ? -9.637  11.715  -5.083  1.00 19.67 ? 46   SER C C     1 
ATOM   3999 O  O     . SER E  3 46  ? -10.740 12.175  -5.407  1.00 19.01 ? 46   SER C O     1 
ATOM   4000 C  CB    . SER E  3 46  ? -8.399  10.055  -6.411  1.00 18.34 ? 46   SER C CB    1 
ATOM   4001 O  OG    . SER E  3 46  ? -7.626  9.861   -7.573  1.00 20.70 ? 46   SER C OG    1 
ATOM   4002 N  N     . ARG E  3 47  ? -9.334  11.333  -3.844  1.00 19.27 ? 47   ARG C N     1 
ATOM   4003 C  CA    . ARG E  3 47  ? -10.323 11.433  -2.789  1.00 20.23 ? 47   ARG C CA    1 
ATOM   4004 C  C     . ARG E  3 47  ? -10.770 12.879  -2.588  1.00 19.92 ? 47   ARG C C     1 
ATOM   4005 O  O     . ARG E  3 47  ? -11.963 13.168  -2.495  1.00 20.36 ? 47   ARG C O     1 
ATOM   4006 C  CB    . ARG E  3 47  ? -9.798  10.819  -1.500  1.00 19.41 ? 47   ARG C CB    1 
ATOM   4007 C  CG    . ARG E  3 47  ? -9.502  9.341   -1.644  1.00 19.72 ? 47   ARG C CG    1 
ATOM   4008 C  CD    . ARG E  3 47  ? -9.513  8.656   -0.298  1.00 20.14 ? 47   ARG C CD    1 
ATOM   4009 N  NE    . ARG E  3 47  ? -8.584  9.278   0.642   1.00 20.38 ? 47   ARG C NE    1 
ATOM   4010 C  CZ    . ARG E  3 47  ? -7.308  8.928   0.764   1.00 20.25 ? 47   ARG C CZ    1 
ATOM   4011 N  NH1   . ARG E  3 47  ? -6.814  7.966   -0.002  1.00 19.67 ? 47   ARG C NH1   1 
ATOM   4012 N  NH2   . ARG E  3 47  ? -6.527  9.538   1.649   1.00 20.79 ? 47   ARG C NH2   1 
ATOM   4013 N  N     . MET E  3 48  ? -9.811  13.787  -2.561  1.00 19.44 ? 48   MET C N     1 
ATOM   4014 C  CA    . MET E  3 48  ? -10.121 15.182  -2.357  1.00 21.08 ? 48   MET C CA    1 
ATOM   4015 C  C     . MET E  3 48  ? -10.953 15.715  -3.516  1.00 21.74 ? 48   MET C C     1 
ATOM   4016 O  O     . MET E  3 48  ? -11.826 16.560  -3.331  1.00 20.55 ? 48   MET C O     1 
ATOM   4017 C  CB    . MET E  3 48  ? -8.831  15.970  -2.174  1.00 21.01 ? 48   MET C CB    1 
ATOM   4018 C  CG    . MET E  3 48  ? -8.025  15.475  -0.992  1.00 20.99 ? 48   MET C CG    1 
ATOM   4019 S  SD    . MET E  3 48  ? -6.461  16.335  -0.797  1.00 21.08 ? 48   MET C SD    1 
ATOM   4020 C  CE    . MET E  3 48  ? -7.028  17.991  -0.448  1.00 21.67 ? 48   MET C CE    1 
ATOM   4021 N  N     . GLU E  3 49  ? -10.676 15.197  -4.708  1.00 23.34 ? 49   GLU C N     1 
ATOM   4022 C  CA    . GLU E  3 49  ? -11.479 15.466  -5.893  1.00 24.01 ? 49   GLU C CA    1 
ATOM   4023 C  C     . GLU E  3 49  ? -12.896 14.928  -5.671  1.00 24.64 ? 49   GLU C C     1 
ATOM   4024 O  O     . GLU E  3 49  ? -13.878 15.669  -5.746  1.00 24.60 ? 49   GLU C O     1 
ATOM   4025 C  CB    . GLU E  3 49  ? -10.841 14.767  -7.090  1.00 24.32 ? 49   GLU C CB    1 
ATOM   4026 C  CG    . GLU E  3 49  ? -11.321 15.234  -8.444  1.00 25.62 ? 49   GLU C CG    1 
ATOM   4027 C  CD    . GLU E  3 49  ? -10.297 14.967  -9.539  1.00 26.45 ? 49   GLU C CD    1 
ATOM   4028 O  OE1   . GLU E  3 49  ? -10.519 15.428  -10.672 1.00 26.49 ? 49   GLU C OE1   1 
ATOM   4029 O  OE2   . GLU E  3 49  ? -9.264  14.302  -9.266  1.00 27.77 ? 49   GLU C OE2   1 
ATOM   4030 N  N     . ARG E  3 50  ? -12.986 13.633  -5.383  1.00 24.38 ? 50   ARG C N     1 
ATOM   4031 C  CA    . ARG E  3 50  ? -14.251 12.980  -5.105  1.00 23.94 ? 50   ARG C CA    1 
ATOM   4032 C  C     . ARG E  3 50  ? -15.058 13.790  -4.100  1.00 24.87 ? 50   ARG C C     1 
ATOM   4033 O  O     . ARG E  3 50  ? -16.282 13.805  -4.149  1.00 24.81 ? 50   ARG C O     1 
ATOM   4034 C  CB    . ARG E  3 50  ? -13.992 11.572  -4.561  1.00 23.49 ? 50   ARG C CB    1 
ATOM   4035 C  CG    . ARG E  3 50  ? -15.220 10.846  -4.036  1.00 22.26 ? 50   ARG C CG    1 
ATOM   4036 C  CD    . ARG E  3 50  ? -14.828 9.801   -3.008  1.00 22.25 ? 50   ARG C CD    1 
ATOM   4037 N  NE    . ARG E  3 50  ? -14.387 10.415  -1.757  1.00 22.84 ? 50   ARG C NE    1 
ATOM   4038 C  CZ    . ARG E  3 50  ? -13.804 9.760   -0.752  1.00 22.97 ? 50   ARG C CZ    1 
ATOM   4039 N  NH1   . ARG E  3 50  ? -13.566 8.455   -0.848  1.00 22.04 ? 50   ARG C NH1   1 
ATOM   4040 N  NH2   . ARG E  3 50  ? -13.448 10.417  0.350   1.00 22.05 ? 50   ARG C NH2   1 
ATOM   4041 N  N     . ASP E  3 51  ? -14.364 14.469  -3.194  1.00 26.39 ? 51   ASP C N     1 
ATOM   4042 C  CA    . ASP E  3 51  ? -15.018 15.198  -2.113  1.00 27.36 ? 51   ASP C CA    1 
ATOM   4043 C  C     . ASP E  3 51  ? -15.015 16.693  -2.373  1.00 27.48 ? 51   ASP C C     1 
ATOM   4044 O  O     . ASP E  3 51  ? -14.894 17.489  -1.444  1.00 28.93 ? 51   ASP C O     1 
ATOM   4045 C  CB    . ASP E  3 51  ? -14.322 14.908  -0.784  1.00 28.91 ? 51   ASP C CB    1 
ATOM   4046 C  CG    . ASP E  3 51  ? -14.402 13.443  -0.391  1.00 30.51 ? 51   ASP C CG    1 
ATOM   4047 O  OD1   . ASP E  3 51  ? -15.462 12.813  -0.622  1.00 31.23 ? 51   ASP C OD1   1 
ATOM   4048 O  OD2   . ASP E  3 51  ? -13.404 12.924  0.154   1.00 31.36 ? 51   ASP C OD2   1 
ATOM   4049 N  N     . GLY E  3 52  ? -15.118 17.064  -3.644  1.00 26.41 ? 52   GLY C N     1 
ATOM   4050 C  CA    . GLY E  3 52  ? -15.245 18.456  -4.051  1.00 25.02 ? 52   GLY C CA    1 
ATOM   4051 C  C     . GLY E  3 52  ? -14.330 19.459  -3.380  1.00 24.63 ? 52   GLY C C     1 
ATOM   4052 O  O     . GLY E  3 52  ? -14.738 20.593  -3.121  1.00 25.14 ? 52   GLY C O     1 
ATOM   4053 N  N     . LEU E  3 53  ? -13.089 19.062  -3.107  1.00 23.72 ? 53   LEU C N     1 
ATOM   4054 C  CA    . LEU E  3 53  ? -12.122 19.988  -2.523  1.00 22.53 ? 53   LEU C CA    1 
ATOM   4055 C  C     . LEU E  3 53  ? -11.183 20.573  -3.556  1.00 22.31 ? 53   LEU C C     1 
ATOM   4056 O  O     . LEU E  3 53  ? -10.541 21.597  -3.304  1.00 22.28 ? 53   LEU C O     1 
ATOM   4057 C  CB    . LEU E  3 53  ? -11.304 19.316  -1.425  1.00 22.91 ? 53   LEU C CB    1 
ATOM   4058 C  CG    . LEU E  3 53  ? -12.072 18.841  -0.194  1.00 23.12 ? 53   LEU C CG    1 
ATOM   4059 C  CD1   . LEU E  3 53  ? -11.085 18.337  0.835   1.00 21.94 ? 53   LEU C CD1   1 
ATOM   4060 C  CD2   . LEU E  3 53  ? -12.930 19.969  0.369   1.00 22.72 ? 53   LEU C CD2   1 
ATOM   4061 N  N     . LEU E  3 54  ? -11.096 19.920  -4.712  1.00 21.68 ? 54   LEU C N     1 
ATOM   4062 C  CA    . LEU E  3 54  ? -10.181 20.350  -5.759  1.00 22.14 ? 54   LEU C CA    1 
ATOM   4063 C  C     . LEU E  3 54  ? -10.411 19.606  -7.053  1.00 23.04 ? 54   LEU C C     1 
ATOM   4064 O  O     . LEU E  3 54  ? -11.195 18.663  -7.109  1.00 24.00 ? 54   LEU C O     1 
ATOM   4065 C  CB    . LEU E  3 54  ? -8.717  20.182  -5.322  1.00 21.76 ? 54   LEU C CB    1 
ATOM   4066 C  CG    . LEU E  3 54  ? -8.140  18.802  -4.998  1.00 21.89 ? 54   LEU C CG    1 
ATOM   4067 C  CD1   . LEU E  3 54  ? -8.200  17.856  -6.179  1.00 22.02 ? 54   LEU C CD1   1 
ATOM   4068 C  CD2   . LEU E  3 54  ? -6.699  18.931  -4.531  1.00 22.51 ? 54   LEU C CD2   1 
ATOM   4069 N  N     . ARG E  3 55  ? -9.718  20.035  -8.099  1.00 24.87 ? 55   ARG C N     1 
ATOM   4070 C  CA    . ARG E  3 55  ? -9.703  19.293  -9.346  1.00 26.63 ? 55   ARG C CA    1 
ATOM   4071 C  C     . ARG E  3 55  ? -8.298  19.133  -9.919  1.00 25.02 ? 55   ARG C C     1 
ATOM   4072 O  O     . ARG E  3 55  ? -7.379  19.917  -9.643  1.00 23.69 ? 55   ARG C O     1 
ATOM   4073 C  CB    . ARG E  3 55  ? -10.666 19.901  -10.378 1.00 28.28 ? 55   ARG C CB    1 
ATOM   4074 C  CG    . ARG E  3 55  ? -10.261 21.261  -10.929 1.00 30.67 ? 55   ARG C CG    1 
ATOM   4075 C  CD    . ARG E  3 55  ? -11.473 22.040  -11.495 1.00 31.42 ? 55   ARG C CD    1 
ATOM   4076 N  NE    . ARG E  3 55  ? -11.184 23.479  -11.604 1.00 34.42 ? 55   ARG C NE    1 
ATOM   4077 C  CZ    . ARG E  3 55  ? -11.619 24.410  -10.750 1.00 35.42 ? 55   ARG C CZ    1 
ATOM   4078 N  NH1   . ARG E  3 55  ? -12.391 24.075  -9.718  1.00 35.45 ? 55   ARG C NH1   1 
ATOM   4079 N  NH2   . ARG E  3 55  ? -11.289 25.686  -10.933 1.00 35.73 ? 55   ARG C NH2   1 
ATOM   4080 N  N     . VAL E  3 56  ? -8.145  18.075  -10.698 1.00 24.18 ? 56   VAL C N     1 
ATOM   4081 C  CA    . VAL E  3 56  ? -6.977  17.886  -11.519 1.00 22.96 ? 56   VAL C CA    1 
ATOM   4082 C  C     . VAL E  3 56  ? -7.398  18.277  -12.927 1.00 23.15 ? 56   VAL C C     1 
ATOM   4083 O  O     . VAL E  3 56  ? -8.206  17.593  -13.547 1.00 22.57 ? 56   VAL C O     1 
ATOM   4084 C  CB    . VAL E  3 56  ? -6.549  16.418  -11.494 1.00 22.27 ? 56   VAL C CB    1 
ATOM   4085 C  CG1   . VAL E  3 56  ? -5.285  16.214  -12.296 1.00 22.84 ? 56   VAL C CG1   1 
ATOM   4086 C  CG2   . VAL E  3 56  ? -6.355  15.958  -10.068 1.00 21.82 ? 56   VAL C CG2   1 
ATOM   4087 N  N     . ALA E  3 57  ? -6.882  19.395  -13.423 1.00 23.88 ? 57   ALA C N     1 
ATOM   4088 C  CA    . ALA E  3 57  ? -7.262  19.871  -14.755 1.00 25.15 ? 57   ALA C CA    1 
ATOM   4089 C  C     . ALA E  3 57  ? -6.743  18.953  -15.858 1.00 25.88 ? 57   ALA C C     1 
ATOM   4090 O  O     . ALA E  3 57  ? -6.037  17.980  -15.578 1.00 27.38 ? 57   ALA C O     1 
ATOM   4091 C  CB    . ALA E  3 57  ? -6.774  21.289  -14.973 1.00 24.89 ? 57   ALA C CB    1 
ATOM   4092 N  N     . GLY E  3 58  ? -7.103  19.262  -17.103 1.00 25.91 ? 58   GLY C N     1 
ATOM   4093 C  CA    . GLY E  3 58  ? -6.594  18.542  -18.268 1.00 25.80 ? 58   GLY C CA    1 
ATOM   4094 C  C     . GLY E  3 58  ? -5.079  18.630  -18.406 1.00 26.98 ? 58   GLY C C     1 
ATOM   4095 O  O     . GLY E  3 58  ? -4.433  17.669  -18.837 1.00 27.09 ? 58   GLY C O     1 
ATOM   4096 N  N     . ASP E  3 59  ? -4.504  19.773  -18.034 1.00 26.90 ? 59   ASP C N     1 
ATOM   4097 C  CA    . ASP E  3 59  ? -3.047  19.936  -18.052 1.00 27.49 ? 59   ASP C CA    1 
ATOM   4098 C  C     . ASP E  3 59  ? -2.387  19.438  -16.752 1.00 27.22 ? 59   ASP C C     1 
ATOM   4099 O  O     . ASP E  3 59  ? -1.214  19.708  -16.497 1.00 26.43 ? 59   ASP C O     1 
ATOM   4100 C  CB    . ASP E  3 59  ? -2.660  21.392  -18.346 1.00 28.27 ? 59   ASP C CB    1 
ATOM   4101 C  CG    . ASP E  3 59  ? -3.198  22.360  -17.311 1.00 29.81 ? 59   ASP C CG    1 
ATOM   4102 O  OD1   . ASP E  3 59  ? -3.767  21.898  -16.302 1.00 30.72 ? 59   ASP C OD1   1 
ATOM   4103 O  OD2   . ASP E  3 59  ? -3.054  23.589  -17.496 1.00 30.92 ? 59   ASP C OD2   1 
ATOM   4104 N  N     . ARG E  3 60  ? -3.160  18.713  -15.945 1.00 26.93 ? 60   ARG C N     1 
ATOM   4105 C  CA    . ARG E  3 60  ? -2.699  18.110  -14.680 1.00 27.39 ? 60   ARG C CA    1 
ATOM   4106 C  C     . ARG E  3 60  ? -2.362  19.107  -13.570 1.00 26.70 ? 60   ARG C C     1 
ATOM   4107 O  O     . ARG E  3 60  ? -1.757  18.751  -12.559 1.00 26.32 ? 60   ARG C O     1 
ATOM   4108 C  CB    . ARG E  3 60  ? -1.556  17.111  -14.908 1.00 27.59 ? 60   ARG C CB    1 
ATOM   4109 C  CG    . ARG E  3 60  ? -1.867  16.127  -16.030 1.00 29.10 ? 60   ARG C CG    1 
ATOM   4110 C  CD    . ARG E  3 60  ? -1.195  14.782  -15.859 1.00 29.56 ? 60   ARG C CD    1 
ATOM   4111 N  NE    . ARG E  3 60  ? 0.191   14.769  -16.317 1.00 29.91 ? 60   ARG C NE    1 
ATOM   4112 C  CZ    . ARG E  3 60  ? 0.776   13.709  -16.875 1.00 31.06 ? 60   ARG C CZ    1 
ATOM   4113 N  NH1   . ARG E  3 60  ? 2.048   13.774  -17.247 1.00 31.39 ? 60   ARG C NH1   1 
ATOM   4114 N  NH2   . ARG E  3 60  ? 0.088   12.579  -17.067 1.00 30.76 ? 60   ARG C NH2   1 
ATOM   4115 N  N     . HIS E  3 61  ? -2.776  20.353  -13.771 1.00 25.16 ? 61   HIS C N     1 
ATOM   4116 C  CA    . HIS E  3 61  ? -2.710  21.381  -12.744 1.00 24.18 ? 61   HIS C CA    1 
ATOM   4117 C  C     . HIS E  3 61  ? -3.669  21.091  -11.584 1.00 23.50 ? 61   HIS C C     1 
ATOM   4118 O  O     . HIS E  3 61  ? -4.798  20.636  -11.791 1.00 23.51 ? 61   HIS C O     1 
ATOM   4119 C  CB    . HIS E  3 61  ? -3.069  22.729  -13.365 1.00 24.48 ? 61   HIS C CB    1 
ATOM   4120 C  CG    . HIS E  3 61  ? -2.021  23.269  -14.284 1.00 24.60 ? 61   HIS C CG    1 
ATOM   4121 N  ND1   . HIS E  3 61  ? -2.023  24.574  -14.727 1.00 25.22 ? 61   HIS C ND1   1 
ATOM   4122 C  CD2   . HIS E  3 61  ? -0.929  22.685  -14.831 1.00 24.01 ? 61   HIS C CD2   1 
ATOM   4123 C  CE1   . HIS E  3 61  ? -0.979  24.767  -15.514 1.00 25.08 ? 61   HIS C CE1   1 
ATOM   4124 N  NE2   . HIS E  3 61  ? -0.300  23.637  -15.592 1.00 23.75 ? 61   HIS C NE2   1 
ATOM   4125 N  N     . LEU E  3 62  ? -3.219  21.356  -10.362 1.00 22.63 ? 62   LEU C N     1 
ATOM   4126 C  CA    . LEU E  3 62  ? -4.096  21.244  -9.194  1.00 22.46 ? 62   LEU C CA    1 
ATOM   4127 C  C     . LEU E  3 62  ? -4.764  22.581  -8.872  1.00 21.81 ? 62   LEU C C     1 
ATOM   4128 O  O     . LEU E  3 62  ? -4.096  23.566  -8.575  1.00 22.53 ? 62   LEU C O     1 
ATOM   4129 C  CB    . LEU E  3 62  ? -3.328  20.716  -7.980  1.00 22.24 ? 62   LEU C CB    1 
ATOM   4130 C  CG    . LEU E  3 62  ? -2.833  19.272  -8.117  1.00 21.72 ? 62   LEU C CG    1 
ATOM   4131 C  CD1   . LEU E  3 62  ? -2.191  18.790  -6.831  1.00 21.40 ? 62   LEU C CD1   1 
ATOM   4132 C  CD2   . LEU E  3 62  ? -3.966  18.360  -8.516  1.00 21.12 ? 62   LEU C CD2   1 
ATOM   4133 N  N     . GLU E  3 63  ? -6.086  22.617  -8.946  1.00 20.69 ? 63   GLU C N     1 
ATOM   4134 C  CA    . GLU E  3 63  ? -6.804  23.857  -8.729  1.00 19.38 ? 63   GLU C CA    1 
ATOM   4135 C  C     . GLU E  3 63  ? -7.830  23.644  -7.623  1.00 18.71 ? 63   GLU C C     1 
ATOM   4136 O  O     . GLU E  3 63  ? -8.612  22.694  -7.675  1.00 17.96 ? 63   GLU C O     1 
ATOM   4137 C  CB    . GLU E  3 63  ? -7.477  24.290  -10.029 1.00 20.44 ? 63   GLU C CB    1 
ATOM   4138 C  CG    . GLU E  3 63  ? -6.678  23.917  -11.278 1.00 21.73 ? 63   GLU C CG    1 
ATOM   4139 C  CD    . GLU E  3 63  ? -7.014  24.779  -12.487 1.00 22.76 ? 63   GLU C CD    1 
ATOM   4140 O  OE1   . GLU E  3 63  ? -6.108  25.508  -12.961 1.00 23.90 ? 63   GLU C OE1   1 
ATOM   4141 O  OE2   . GLU E  3 63  ? -8.174  24.730  -12.959 1.00 22.27 ? 63   GLU C OE2   1 
ATOM   4142 N  N     . LEU E  3 64  ? -7.821  24.503  -6.609  1.00 17.27 ? 64   LEU C N     1 
ATOM   4143 C  CA    . LEU E  3 64  ? -8.762  24.337  -5.501  1.00 17.33 ? 64   LEU C CA    1 
ATOM   4144 C  C     . LEU E  3 64  ? -10.155 24.829  -5.875  1.00 17.41 ? 64   LEU C C     1 
ATOM   4145 O  O     . LEU E  3 64  ? -10.308 25.827  -6.572  1.00 17.56 ? 64   LEU C O     1 
ATOM   4146 C  CB    . LEU E  3 64  ? -8.280  25.075  -4.250  1.00 17.21 ? 64   LEU C CB    1 
ATOM   4147 C  CG    . LEU E  3 64  ? -6.890  24.750  -3.703  1.00 17.11 ? 64   LEU C CG    1 
ATOM   4148 C  CD1   . LEU E  3 64  ? -6.604  25.558  -2.436  1.00 16.29 ? 64   LEU C CD1   1 
ATOM   4149 C  CD2   . LEU E  3 64  ? -6.770  23.257  -3.432  1.00 17.71 ? 64   LEU C CD2   1 
ATOM   4150 N  N     . THR E  3 65  ? -11.171 24.121  -5.408  1.00 18.04 ? 65   THR C N     1 
ATOM   4151 C  CA    . THR E  3 65  ? -12.544 24.578  -5.547  1.00 18.57 ? 65   THR C CA    1 
ATOM   4152 C  C     . THR E  3 65  ? -12.804 25.646  -4.490  1.00 20.22 ? 65   THR C C     1 
ATOM   4153 O  O     . THR E  3 65  ? -12.003 25.818  -3.574  1.00 21.90 ? 65   THR C O     1 
ATOM   4154 C  CB    . THR E  3 65  ? -13.540 23.423  -5.332  1.00 17.69 ? 65   THR C CB    1 
ATOM   4155 O  OG1   . THR E  3 65  ? -13.351 22.863  -4.023  1.00 16.76 ? 65   THR C OG1   1 
ATOM   4156 C  CG2   . THR E  3 65  ? -13.355 22.344  -6.389  1.00 15.76 ? 65   THR C CG2   1 
ATOM   4157 N  N     . GLU E  3 66  ? -13.919 26.362  -4.606  1.00 21.99 ? 66   GLU C N     1 
ATOM   4158 C  CA    . GLU E  3 66  ? -14.276 27.359  -3.604  1.00 22.35 ? 66   GLU C CA    1 
ATOM   4159 C  C     . GLU E  3 66  ? -14.238 26.715  -2.236  1.00 22.06 ? 66   GLU C C     1 
ATOM   4160 O  O     . GLU E  3 66  ? -13.681 27.264  -1.283  1.00 20.81 ? 66   GLU C O     1 
ATOM   4161 C  CB    . GLU E  3 66  ? -15.666 27.918  -3.875  1.00 23.07 ? 66   GLU C CB    1 
ATOM   4162 C  CG    . GLU E  3 66  ? -15.757 28.699  -5.162  1.00 26.37 ? 66   GLU C CG    1 
ATOM   4163 C  CD    . GLU E  3 66  ? -17.159 29.219  -5.429  1.00 28.35 ? 66   GLU C CD    1 
ATOM   4164 O  OE1   . GLU E  3 66  ? -17.421 29.683  -6.560  1.00 29.06 ? 66   GLU C OE1   1 
ATOM   4165 O  OE2   . GLU E  3 66  ? -18.003 29.161  -4.508  1.00 29.73 ? 66   GLU C OE2   1 
ATOM   4166 N  N     . LYS E  3 67  ? -14.834 25.533  -2.158  1.00 23.08 ? 67   LYS C N     1 
ATOM   4167 C  CA    . LYS E  3 67  ? -14.892 24.790  -0.912  1.00 23.91 ? 67   LYS C CA    1 
ATOM   4168 C  C     . LYS E  3 67  ? -13.492 24.573  -0.364  1.00 23.92 ? 67   LYS C C     1 
ATOM   4169 O  O     . LYS E  3 67  ? -13.211 24.886  0.797   1.00 24.80 ? 67   LYS C O     1 
ATOM   4170 C  CB    . LYS E  3 67  ? -15.585 23.445  -1.130  1.00 23.95 ? 67   LYS C CB    1 
ATOM   4171 C  CG    . LYS E  3 67  ? -15.652 22.601  0.124   1.00 24.71 ? 67   LYS C CG    1 
ATOM   4172 C  CD    . LYS E  3 67  ? -16.354 21.277  -0.130  1.00 25.25 ? 67   LYS C CD    1 
ATOM   4173 C  CE    . LYS E  3 67  ? -16.596 20.540  1.181   1.00 25.88 ? 67   LYS C CE    1 
ATOM   4174 N  NZ    . LYS E  3 67  ? -17.048 19.139  0.951   1.00 27.07 ? 67   LYS C NZ    1 
ATOM   4175 N  N     . GLY E  3 68  ? -12.620 24.052  -1.223  1.00 23.30 ? 68   GLY C N     1 
ATOM   4176 C  CA    . GLY E  3 68  ? -11.269 23.691  -0.839  1.00 23.28 ? 68   GLY C CA    1 
ATOM   4177 C  C     . GLY E  3 68  ? -10.420 24.892  -0.498  1.00 23.77 ? 68   GLY C C     1 
ATOM   4178 O  O     . GLY E  3 68  ? -9.616  24.858  0.440   1.00 24.22 ? 68   GLY C O     1 
ATOM   4179 N  N     . ARG E  3 69  ? -10.586 25.961  -1.260  1.00 23.40 ? 69   ARG C N     1 
ATOM   4180 C  CA    . ARG E  3 69  ? -9.813  27.151  -0.997  1.00 23.38 ? 69   ARG C CA    1 
ATOM   4181 C  C     . ARG E  3 69  ? -10.183 27.763  0.343   1.00 22.55 ? 69   ARG C C     1 
ATOM   4182 O  O     . ARG E  3 69  ? -9.335  28.344  1.026   1.00 21.99 ? 69   ARG C O     1 
ATOM   4183 C  CB    . ARG E  3 69  ? -10.009 28.186  -2.081  1.00 24.11 ? 69   ARG C CB    1 
ATOM   4184 C  CG    . ARG E  3 69  ? -9.323  29.462  -1.702  1.00 25.50 ? 69   ARG C CG    1 
ATOM   4185 C  CD    . ARG E  3 69  ? -8.937  30.233  -2.895  1.00 26.32 ? 69   ARG C CD    1 
ATOM   4186 N  NE    . ARG E  3 69  ? -8.100  29.465  -3.807  1.00 27.58 ? 69   ARG C NE    1 
ATOM   4187 C  CZ    . ARG E  3 69  ? -6.816  29.203  -3.596  1.00 28.28 ? 69   ARG C CZ    1 
ATOM   4188 N  NH1   . ARG E  3 69  ? -6.225  29.626  -2.480  1.00 28.19 ? 69   ARG C NH1   1 
ATOM   4189 N  NH2   . ARG E  3 69  ? -6.128  28.512  -4.497  1.00 27.65 ? 69   ARG C NH2   1 
ATOM   4190 N  N     . ALA E  3 70  ? -11.450 27.634  0.716   1.00 21.30 ? 70   ALA C N     1 
ATOM   4191 C  CA    . ALA E  3 70  ? -11.892 28.115  2.016   1.00 20.90 ? 70   ALA C CA    1 
ATOM   4192 C  C     . ALA E  3 70  ? -11.158 27.373  3.125   1.00 20.87 ? 70   ALA C C     1 
ATOM   4193 O  O     . ALA E  3 70  ? -10.618 27.984  4.035   1.00 20.74 ? 70   ALA C O     1 
ATOM   4194 C  CB    . ALA E  3 70  ? -13.390 27.960  2.169   1.00 19.70 ? 70   ALA C CB    1 
ATOM   4195 N  N     . LEU E  3 71  ? -11.125 26.050  3.034   1.00 21.82 ? 71   LEU C N     1 
ATOM   4196 C  CA    . LEU E  3 71  ? -10.487 25.249  4.070   1.00 21.85 ? 71   LEU C CA    1 
ATOM   4197 C  C     . LEU E  3 71  ? -8.997  25.555  4.148   1.00 21.26 ? 71   LEU C C     1 
ATOM   4198 O  O     . LEU E  3 71  ? -8.444  25.713  5.234   1.00 20.66 ? 71   LEU C O     1 
ATOM   4199 C  CB    . LEU E  3 71  ? -10.728 23.751  3.824   1.00 23.18 ? 71   LEU C CB    1 
ATOM   4200 C  CG    . LEU E  3 71  ? -12.192 23.290  3.667   1.00 24.55 ? 71   LEU C CG    1 
ATOM   4201 C  CD1   . LEU E  3 71  ? -12.280 21.773  3.717   1.00 24.73 ? 71   LEU C CD1   1 
ATOM   4202 C  CD2   . LEU E  3 71  ? -13.138 23.905  4.705   1.00 24.21 ? 71   LEU C CD2   1 
ATOM   4203 N  N     . ALA E  3 72  ? -8.364  25.654  2.981   1.00 20.85 ? 72   ALA C N     1 
ATOM   4204 C  CA    . ALA E  3 72  ? -6.929  25.878  2.877   1.00 20.89 ? 72   ALA C CA    1 
ATOM   4205 C  C     . ALA E  3 72  ? -6.533  27.184  3.540   1.00 21.23 ? 72   ALA C C     1 
ATOM   4206 O  O     . ALA E  3 72  ? -5.524  27.255  4.248   1.00 21.45 ? 72   ALA C O     1 
ATOM   4207 C  CB    . ALA E  3 72  ? -6.493  25.874  1.414   1.00 20.22 ? 72   ALA C CB    1 
ATOM   4208 N  N     . ILE E  3 73  ? -7.330  28.216  3.289   1.00 21.20 ? 73   ILE C N     1 
ATOM   4209 C  CA    . ILE E  3 73  ? -7.117  29.511  3.898   1.00 22.25 ? 73   ILE C CA    1 
ATOM   4210 C  C     . ILE E  3 73  ? -7.185  29.392  5.422   1.00 22.68 ? 73   ILE C C     1 
ATOM   4211 O  O     . ILE E  3 73  ? -6.275  29.838  6.131   1.00 22.50 ? 73   ILE C O     1 
ATOM   4212 C  CB    . ILE E  3 73  ? -8.155  30.532  3.398   1.00 22.34 ? 73   ILE C CB    1 
ATOM   4213 C  CG1   . ILE E  3 73  ? -7.936  30.800  1.910   1.00 22.15 ? 73   ILE C CG1   1 
ATOM   4214 C  CG2   . ILE E  3 73  ? -8.064  31.837  4.199   1.00 21.91 ? 73   ILE C CG2   1 
ATOM   4215 C  CD1   . ILE E  3 73  ? -8.933  31.757  1.318   1.00 23.13 ? 73   ILE C CD1   1 
ATOM   4216 N  N     . ALA E  3 74  ? -8.263  28.780  5.906   1.00 22.34 ? 74   ALA C N     1 
ATOM   4217 C  CA    . ALA E  3 74  ? -8.462  28.550  7.334   1.00 22.81 ? 74   ALA C CA    1 
ATOM   4218 C  C     . ALA E  3 74  ? -7.221  27.943  7.985   1.00 22.67 ? 74   ALA C C     1 
ATOM   4219 O  O     . ALA E  3 74  ? -6.839  28.329  9.093   1.00 23.01 ? 74   ALA C O     1 
ATOM   4220 C  CB    . ALA E  3 74  ? -9.684  27.654  7.571   1.00 21.81 ? 74   ALA C CB    1 
ATOM   4221 N  N     . VAL E  3 75  ? -6.585  27.007  7.287   1.00 22.35 ? 75   VAL C N     1 
ATOM   4222 C  CA    . VAL E  3 75  ? -5.427  26.309  7.841   1.00 22.73 ? 75   VAL C CA    1 
ATOM   4223 C  C     . VAL E  3 75  ? -4.202  27.210  7.871   1.00 22.88 ? 75   VAL C C     1 
ATOM   4224 O  O     . VAL E  3 75  ? -3.501  27.286  8.880   1.00 22.86 ? 75   VAL C O     1 
ATOM   4225 C  CB    . VAL E  3 75  ? -5.107  25.013  7.068   1.00 22.11 ? 75   VAL C CB    1 
ATOM   4226 C  CG1   . VAL E  3 75  ? -3.803  24.414  7.557   1.00 22.38 ? 75   VAL C CG1   1 
ATOM   4227 C  CG2   . VAL E  3 75  ? -6.238  24.015  7.216   1.00 21.09 ? 75   VAL C CG2   1 
ATOM   4228 N  N     . MET E  3 76  ? -3.949  27.899  6.767   1.00 23.03 ? 76   MET C N     1 
ATOM   4229 C  CA    . MET E  3 76  ? -2.820  28.813  6.717   1.00 23.20 ? 76   MET C CA    1 
ATOM   4230 C  C     . MET E  3 76  ? -2.991  29.907  7.755   1.00 22.18 ? 76   MET C C     1 
ATOM   4231 O  O     . MET E  3 76  ? -2.026  30.420  8.314   1.00 21.56 ? 76   MET C O     1 
ATOM   4232 C  CB    . MET E  3 76  ? -2.702  29.447  5.343   1.00 24.50 ? 76   MET C CB    1 
ATOM   4233 C  CG    . MET E  3 76  ? -1.561  30.429  5.273   1.00 26.24 ? 76   MET C CG    1 
ATOM   4234 S  SD    . MET E  3 76  ? 0.008   29.571  5.360   1.00 28.09 ? 76   MET C SD    1 
ATOM   4235 C  CE    . MET E  3 76  ? 0.277   29.265  3.616   1.00 27.62 ? 76   MET C CE    1 
ATOM   4236 N  N     . ARG E  3 77  ? -4.240  30.260  8.005   1.00 21.30 ? 77   ARG C N     1 
ATOM   4237 C  CA    . ARG E  3 77  ? -4.540  31.312  8.943   1.00 20.58 ? 77   ARG C CA    1 
ATOM   4238 C  C     . ARG E  3 77  ? -4.189  30.843  10.352  1.00 21.26 ? 77   ARG C C     1 
ATOM   4239 O  O     . ARG E  3 77  ? -3.599  31.590  11.137  1.00 21.52 ? 77   ARG C O     1 
ATOM   4240 C  CB    . ARG E  3 77  ? -6.013  31.683  8.844   1.00 19.51 ? 77   ARG C CB    1 
ATOM   4241 C  CG    . ARG E  3 77  ? -6.400  32.880  9.665   1.00 19.02 ? 77   ARG C CG    1 
ATOM   4242 C  CD    . ARG E  3 77  ? -7.888  33.138  9.551   1.00 18.40 ? 77   ARG C CD    1 
ATOM   4243 N  NE    . ARG E  3 77  ? -8.691  32.008  9.994   1.00 16.79 ? 77   ARG C NE    1 
ATOM   4244 C  CZ    . ARG E  3 77  ? -9.864  31.696  9.460   1.00 17.76 ? 77   ARG C CZ    1 
ATOM   4245 N  NH1   . ARG E  3 77  ? -10.339 32.425  8.461   1.00 18.20 ? 77   ARG C NH1   1 
ATOM   4246 N  NH2   . ARG E  3 77  ? -10.557 30.654  9.907   1.00 18.04 ? 77   ARG C NH2   1 
ATOM   4247 N  N     . LYS E  3 78  ? -4.549  29.602  10.670  1.00 20.61 ? 78   LYS C N     1 
ATOM   4248 C  CA    . LYS E  3 78  ? -4.205  29.046  11.969  1.00 20.03 ? 78   LYS C CA    1 
ATOM   4249 C  C     . LYS E  3 78  ? -2.693  28.888  12.042  1.00 20.43 ? 78   LYS C C     1 
ATOM   4250 O  O     . LYS E  3 78  ? -2.073  29.165  13.062  1.00 21.42 ? 78   LYS C O     1 
ATOM   4251 C  CB    . LYS E  3 78  ? -4.889  27.694  12.188  1.00 18.82 ? 78   LYS C CB    1 
ATOM   4252 C  CG    . LYS E  3 78  ? -6.409  27.742  12.253  1.00 17.19 ? 78   LYS C CG    1 
ATOM   4253 C  CD    . LYS E  3 78  ? -6.984  26.351  12.092  1.00 16.73 ? 78   LYS C CD    1 
ATOM   4254 C  CE    . LYS E  3 78  ? -8.404  26.368  11.553  1.00 16.47 ? 78   LYS C CE    1 
ATOM   4255 N  NZ    . LYS E  3 78  ? -9.397  26.673  12.616  1.00 16.03 ? 78   LYS C NZ    1 
ATOM   4256 N  N     . HIS E  3 79  ? -2.101  28.452  10.938  1.00 20.87 ? 79   HIS C N     1 
ATOM   4257 C  CA    . HIS E  3 79  ? -0.676  28.220  10.901  1.00 20.76 ? 79   HIS C CA    1 
ATOM   4258 C  C     . HIS E  3 79  ? 0.030   29.488  11.338  1.00 20.69 ? 79   HIS C C     1 
ATOM   4259 O  O     . HIS E  3 79  ? 0.799   29.493  12.294  1.00 20.43 ? 79   HIS C O     1 
ATOM   4260 C  CB    . HIS E  3 79  ? -0.250  27.813  9.494   1.00 20.64 ? 79   HIS C CB    1 
ATOM   4261 C  CG    . HIS E  3 79  ? 1.227   27.609  9.337   1.00 20.85 ? 79   HIS C CG    1 
ATOM   4262 N  ND1   . HIS E  3 79  ? 1.869   26.460  9.746   1.00 20.78 ? 79   HIS C ND1   1 
ATOM   4263 C  CD2   . HIS E  3 79  ? 2.182   28.397  8.788   1.00 20.76 ? 79   HIS C CD2   1 
ATOM   4264 C  CE1   . HIS E  3 79  ? 3.157   26.555  9.465   1.00 21.00 ? 79   HIS C CE1   1 
ATOM   4265 N  NE2   . HIS E  3 79  ? 3.373   27.720  8.885   1.00 21.36 ? 79   HIS C NE2   1 
ATOM   4266 N  N     . ARG E  3 80  ? -0.268  30.580  10.654  1.00 21.37 ? 80   ARG C N     1 
ATOM   4267 C  CA    . ARG E  3 80  ? 0.418   31.823  10.933  1.00 21.32 ? 80   ARG C CA    1 
ATOM   4268 C  C     . ARG E  3 80  ? 0.033   32.465  12.265  1.00 20.89 ? 80   ARG C C     1 
ATOM   4269 O  O     . ARG E  3 80  ? 0.862   33.123  12.895  1.00 20.96 ? 80   ARG C O     1 
ATOM   4270 C  CB    . ARG E  3 80  ? 0.312   32.769  9.744   1.00 22.03 ? 80   ARG C CB    1 
ATOM   4271 C  CG    . ARG E  3 80  ? 1.457   32.504  8.762   1.00 23.32 ? 80   ARG C CG    1 
ATOM   4272 C  CD    . ARG E  3 80  ? 1.083   32.662  7.301   1.00 23.09 ? 80   ARG C CD    1 
ATOM   4273 N  NE    . ARG E  3 80  ? 2.070   31.993  6.456   1.00 23.32 ? 80   ARG C NE    1 
ATOM   4274 C  CZ    . ARG E  3 80  ? 2.022   31.959  5.129   1.00 23.23 ? 80   ARG C CZ    1 
ATOM   4275 N  NH1   . ARG E  3 80  ? 1.034   32.564  4.486   1.00 23.48 ? 80   ARG C NH1   1 
ATOM   4276 N  NH2   . ARG E  3 80  ? 2.960   31.318  4.444   1.00 22.74 ? 80   ARG C NH2   1 
ATOM   4277 N  N     . LEU E  3 81  ? -1.195  32.238  12.721  1.00 20.20 ? 81   LEU C N     1 
ATOM   4278 C  CA    . LEU E  3 81  ? -1.560  32.663  14.068  1.00 20.00 ? 81   LEU C CA    1 
ATOM   4279 C  C     . LEU E  3 81  ? -0.732  31.883  15.090  1.00 20.87 ? 81   LEU C C     1 
ATOM   4280 O  O     . LEU E  3 81  ? -0.280  32.437  16.095  1.00 20.95 ? 81   LEU C O     1 
ATOM   4281 C  CB    . LEU E  3 81  ? -3.060  32.508  14.326  1.00 18.61 ? 81   LEU C CB    1 
ATOM   4282 C  CG    . LEU E  3 81  ? -3.969  33.518  13.612  1.00 18.02 ? 81   LEU C CG    1 
ATOM   4283 C  CD1   . LEU E  3 81  ? -5.332  33.624  14.278  1.00 17.04 ? 81   LEU C CD1   1 
ATOM   4284 C  CD2   . LEU E  3 81  ? -3.315  34.880  13.576  1.00 18.01 ? 81   LEU C CD2   1 
ATOM   4285 N  N     . ALA E  3 82  ? -0.513  30.601  14.811  1.00 21.91 ? 82   ALA C N     1 
ATOM   4286 C  CA    . ALA E  3 82  ? 0.284   29.747  15.684  1.00 22.53 ? 82   ALA C CA    1 
ATOM   4287 C  C     . ALA E  3 82  ? 1.691   30.301  15.784  1.00 24.05 ? 82   ALA C C     1 
ATOM   4288 O  O     . ALA E  3 82  ? 2.190   30.572  16.874  1.00 24.22 ? 82   ALA C O     1 
ATOM   4289 C  CB    . ALA E  3 82  ? 0.316   28.330  15.151  1.00 21.16 ? 82   ALA C CB    1 
ATOM   4290 N  N     . GLU E  3 83  ? 2.325   30.471  14.629  1.00 25.72 ? 83   GLU C N     1 
ATOM   4291 C  CA    . GLU E  3 83  ? 3.673   30.994  14.575  1.00 26.14 ? 83   GLU C CA    1 
ATOM   4292 C  C     . GLU E  3 83  ? 3.784   32.275  15.404  1.00 27.28 ? 83   GLU C C     1 
ATOM   4293 O  O     . GLU E  3 83  ? 4.724   32.436  16.177  1.00 27.59 ? 83   GLU C O     1 
ATOM   4294 C  CB    . GLU E  3 83  ? 4.093   31.217  13.126  1.00 25.55 ? 83   GLU C CB    1 
ATOM   4295 C  CG    . GLU E  3 83  ? 4.374   29.921  12.380  1.00 25.40 ? 83   GLU C CG    1 
ATOM   4296 C  CD    . GLU E  3 83  ? 4.612   30.113  10.878  1.00 25.38 ? 83   GLU C CD    1 
ATOM   4297 O  OE1   . GLU E  3 83  ? 4.229   31.163  10.325  1.00 24.55 ? 83   GLU C OE1   1 
ATOM   4298 O  OE2   . GLU E  3 83  ? 5.176   29.196  10.243  1.00 25.96 ? 83   GLU C OE2   1 
ATOM   4299 N  N     . ARG E  3 84  ? 2.813   33.171  15.259  1.00 28.56 ? 84   ARG C N     1 
ATOM   4300 C  CA    . ARG E  3 84  ? 2.787   34.417  16.033  1.00 30.27 ? 84   ARG C CA    1 
ATOM   4301 C  C     . ARG E  3 84  ? 2.802   34.145  17.539  1.00 30.46 ? 84   ARG C C     1 
ATOM   4302 O  O     . ARG E  3 84  ? 3.741   34.527  18.249  1.00 30.72 ? 84   ARG C O     1 
ATOM   4303 C  CB    . ARG E  3 84  ? 1.538   35.226  15.682  1.00 31.52 ? 84   ARG C CB    1 
ATOM   4304 C  CG    . ARG E  3 84  ? 1.740   36.311  14.650  1.00 33.16 ? 84   ARG C CG    1 
ATOM   4305 C  CD    . ARG E  3 84  ? 1.980   37.657  15.319  1.00 34.29 ? 84   ARG C CD    1 
ATOM   4306 N  NE    . ARG E  3 84  ? 3.398   37.889  15.548  1.00 35.69 ? 84   ARG C NE    1 
ATOM   4307 C  CZ    . ARG E  3 84  ? 4.142   38.722  14.829  1.00 36.17 ? 84   ARG C CZ    1 
ATOM   4308 N  NH1   . ARG E  3 84  ? 3.588   39.420  13.840  1.00 36.24 ? 84   ARG C NH1   1 
ATOM   4309 N  NH2   . ARG E  3 84  ? 5.437   38.860  15.106  1.00 35.98 ? 84   ARG C NH2   1 
ATOM   4310 N  N     . LEU E  3 85  ? 1.738   33.495  18.005  1.00 29.98 ? 85   LEU C N     1 
ATOM   4311 C  CA    . LEU E  3 85  ? 1.596   33.049  19.385  1.00 29.67 ? 85   LEU C CA    1 
ATOM   4312 C  C     . LEU E  3 85  ? 2.866   32.416  19.965  1.00 29.68 ? 85   LEU C C     1 
ATOM   4313 O  O     . LEU E  3 85  ? 3.177   32.598  21.142  1.00 30.15 ? 85   LEU C O     1 
ATOM   4314 C  CB    . LEU E  3 85  ? 0.454   32.038  19.466  1.00 29.51 ? 85   LEU C CB    1 
ATOM   4315 C  CG    . LEU E  3 85  ? 0.315   31.328  20.810  1.00 29.72 ? 85   LEU C CG    1 
ATOM   4316 C  CD1   . LEU E  3 85  ? -0.054  32.334  21.901  1.00 29.22 ? 85   LEU C CD1   1 
ATOM   4317 C  CD2   . LEU E  3 85  ? -0.705  30.208  20.717  1.00 28.85 ? 85   LEU C CD2   1 
ATOM   4318 N  N     . LEU E  3 86  ? 3.590   31.671  19.137  1.00 29.41 ? 86   LEU C N     1 
ATOM   4319 C  CA    . LEU E  3 86  ? 4.776   30.948  19.588  1.00 29.50 ? 86   LEU C CA    1 
ATOM   4320 C  C     . LEU E  3 86  ? 5.980   31.859  19.791  1.00 29.63 ? 86   LEU C C     1 
ATOM   4321 O  O     . LEU E  3 86  ? 6.835   31.591  20.633  1.00 29.73 ? 86   LEU C O     1 
ATOM   4322 C  CB    . LEU E  3 86  ? 5.130   29.833  18.599  1.00 28.76 ? 86   LEU C CB    1 
ATOM   4323 C  CG    . LEU E  3 86  ? 4.155   28.656  18.521  1.00 28.25 ? 86   LEU C CG    1 
ATOM   4324 C  CD1   . LEU E  3 86  ? 4.354   27.876  17.232  1.00 27.15 ? 86   LEU C CD1   1 
ATOM   4325 C  CD2   . LEU E  3 86  ? 4.322   27.758  19.738  1.00 28.35 ? 86   LEU C CD2   1 
ATOM   4326 N  N     . VAL E  3 87  ? 6.052   32.931  19.013  1.00 29.67 ? 87   VAL C N     1 
ATOM   4327 C  CA    . VAL E  3 87  ? 7.184   33.834  19.109  1.00 30.22 ? 87   VAL C CA    1 
ATOM   4328 C  C     . VAL E  3 87  ? 6.926   34.982  20.088  1.00 30.87 ? 87   VAL C C     1 
ATOM   4329 O  O     . VAL E  3 87  ? 7.700   35.180  21.022  1.00 31.09 ? 87   VAL C O     1 
ATOM   4330 C  CB    . VAL E  3 87  ? 7.581   34.376  17.737  1.00 30.32 ? 87   VAL C CB    1 
ATOM   4331 C  CG1   . VAL E  3 87  ? 8.808   35.273  17.855  1.00 30.12 ? 87   VAL C CG1   1 
ATOM   4332 C  CG2   . VAL E  3 87  ? 7.854   33.221  16.795  1.00 30.30 ? 87   VAL C CG2   1 
ATOM   4333 N  N     . ASP E  3 88  ? 5.834   35.717  19.883  1.00 30.86 ? 88   ASP C N     1 
ATOM   4334 C  CA    . ASP E  3 88  ? 5.517   36.872  20.718  1.00 31.55 ? 88   ASP C CA    1 
ATOM   4335 C  C     . ASP E  3 88  ? 5.266   36.515  22.181  1.00 31.89 ? 88   ASP C C     1 
ATOM   4336 O  O     . ASP E  3 88  ? 5.600   37.284  23.078  1.00 32.67 ? 88   ASP C O     1 
ATOM   4337 C  CB    . ASP E  3 88  ? 4.274   37.596  20.194  1.00 32.90 ? 88   ASP C CB    1 
ATOM   4338 C  CG    . ASP E  3 88  ? 4.451   38.138  18.791  1.00 33.98 ? 88   ASP C CG    1 
ATOM   4339 O  OD1   . ASP E  3 88  ? 3.440   38.604  18.218  1.00 34.66 ? 88   ASP C OD1   1 
ATOM   4340 O  OD2   . ASP E  3 88  ? 5.584   38.093  18.262  1.00 34.08 ? 88   ASP C OD2   1 
ATOM   4341 N  N     . VAL E  3 89  ? 4.653   35.361  22.421  1.00 31.59 ? 89   VAL C N     1 
ATOM   4342 C  CA    . VAL E  3 89  ? 4.127   35.049  23.744  1.00 29.37 ? 89   VAL C CA    1 
ATOM   4343 C  C     . VAL E  3 89  ? 4.799   33.849  24.398  1.00 28.96 ? 89   VAL C C     1 
ATOM   4344 O  O     . VAL E  3 89  ? 5.266   33.935  25.532  1.00 29.64 ? 89   VAL C O     1 
ATOM   4345 C  CB    . VAL E  3 89  ? 2.606   34.829  23.692  1.00 29.15 ? 89   VAL C CB    1 
ATOM   4346 C  CG1   . VAL E  3 89  ? 2.098   34.294  25.026  1.00 29.42 ? 89   VAL C CG1   1 
ATOM   4347 C  CG2   . VAL E  3 89  ? 1.892   36.129  23.326  1.00 28.69 ? 89   VAL C CG2   1 
ATOM   4348 N  N     . ILE E  3 90  ? 4.849   32.726  23.694  1.00 27.34 ? 90   ILE C N     1 
ATOM   4349 C  CA    . ILE E  3 90  ? 5.429   31.537  24.279  1.00 26.83 ? 90   ILE C CA    1 
ATOM   4350 C  C     . ILE E  3 90  ? 6.946   31.641  24.357  1.00 27.14 ? 90   ILE C C     1 
ATOM   4351 O  O     . ILE E  3 90  ? 7.562   31.168  25.304  1.00 27.91 ? 90   ILE C O     1 
ATOM   4352 C  CB    . ILE E  3 90  ? 4.996   30.265  23.535  1.00 26.63 ? 90   ILE C CB    1 
ATOM   4353 C  CG1   . ILE E  3 90  ? 3.489   30.050  23.719  1.00 25.70 ? 90   ILE C CG1   1 
ATOM   4354 C  CG2   . ILE E  3 90  ? 5.789   29.049  24.041  1.00 25.88 ? 90   ILE C CG2   1 
ATOM   4355 C  CD1   . ILE E  3 90  ? 2.991   28.710  23.231  1.00 25.18 ? 90   ILE C CD1   1 
ATOM   4356 N  N     . GLY E  3 91  ? 7.545   32.285  23.369  1.00 27.64 ? 91   GLY C N     1 
ATOM   4357 C  CA    . GLY E  3 91  ? 8.980   32.455  23.358  1.00 27.59 ? 91   GLY C CA    1 
ATOM   4358 C  C     . GLY E  3 91  ? 9.679   31.199  22.892  1.00 29.02 ? 91   GLY C C     1 
ATOM   4359 O  O     . GLY E  3 91  ? 10.758  30.863  23.383  1.00 29.76 ? 91   GLY C O     1 
ATOM   4360 N  N     . LEU E  3 92  ? 9.070   30.489  21.947  1.00 28.93 ? 92   LEU C N     1 
ATOM   4361 C  CA    . LEU E  3 92  ? 9.759   29.372  21.315  1.00 29.68 ? 92   LEU C CA    1 
ATOM   4362 C  C     . LEU E  3 92  ? 10.798  29.933  20.349  1.00 30.99 ? 92   LEU C C     1 
ATOM   4363 O  O     . LEU E  3 92  ? 10.495  30.857  19.582  1.00 30.56 ? 92   LEU C O     1 
ATOM   4364 C  CB    . LEU E  3 92  ? 8.778   28.454  20.578  1.00 28.97 ? 92   LEU C CB    1 
ATOM   4365 C  CG    . LEU E  3 92  ? 9.372   27.160  20.012  1.00 28.32 ? 92   LEU C CG    1 
ATOM   4366 C  CD1   . LEU E  3 92  ? 9.930   26.264  21.111  1.00 27.84 ? 92   LEU C CD1   1 
ATOM   4367 C  CD2   . LEU E  3 92  ? 8.350   26.411  19.190  1.00 28.97 ? 92   LEU C CD2   1 
ATOM   4368 N  N     . PRO E  3 93  ? 12.034  29.402  20.405  1.00 31.85 ? 93   PRO C N     1 
ATOM   4369 C  CA    . PRO E  3 93  ? 13.095  29.835  19.509  1.00 33.12 ? 93   PRO C CA    1 
ATOM   4370 C  C     . PRO E  3 93  ? 12.649  29.916  18.046  1.00 35.16 ? 93   PRO C C     1 
ATOM   4371 O  O     . PRO E  3 93  ? 12.053  28.983  17.512  1.00 35.00 ? 93   PRO C O     1 
ATOM   4372 C  CB    . PRO E  3 93  ? 14.168  28.757  19.688  1.00 32.59 ? 93   PRO C CB    1 
ATOM   4373 C  CG    . PRO E  3 93  ? 13.986  28.280  21.073  1.00 32.30 ? 93   PRO C CG    1 
ATOM   4374 C  CD    . PRO E  3 93  ? 12.501  28.376  21.354  1.00 32.51 ? 93   PRO C CD    1 
ATOM   4375 N  N     . TRP E  3 94  ? 12.924  31.065  17.441  1.00 37.57 ? 94   TRP C N     1 
ATOM   4376 C  CA    . TRP E  3 94  ? 12.783  31.329  16.013  1.00 39.99 ? 94   TRP C CA    1 
ATOM   4377 C  C     . TRP E  3 94  ? 12.666  30.091  15.127  1.00 40.13 ? 94   TRP C C     1 
ATOM   4378 O  O     . TRP E  3 94  ? 11.694  29.923  14.385  1.00 39.57 ? 94   TRP C O     1 
ATOM   4379 C  CB    . TRP E  3 94  ? 14.020  32.125  15.574  1.00 42.87 ? 94   TRP C CB    1 
ATOM   4380 C  CG    . TRP E  3 94  ? 13.855  32.912  14.328  1.00 43.52 ? 94   TRP C CG    1 
ATOM   4381 C  CD1   . TRP E  3 94  ? 14.484  32.700  13.133  1.00 44.12 ? 94   TRP C CD1   1 
ATOM   4382 C  CD2   . TRP E  3 94  ? 13.013  34.056  14.145  1.00 44.17 ? 94   TRP C CD2   1 
ATOM   4383 N  NE1   . TRP E  3 94  ? 14.081  33.642  12.212  1.00 44.60 ? 94   TRP C NE1   1 
ATOM   4384 C  CE2   . TRP E  3 94  ? 13.179  34.488  12.808  1.00 44.62 ? 94   TRP C CE2   1 
ATOM   4385 C  CE3   . TRP E  3 94  ? 12.135  34.759  14.980  1.00 44.08 ? 94   TRP C CE3   1 
ATOM   4386 C  CZ2   . TRP E  3 94  ? 12.495  35.594  12.286  1.00 44.16 ? 94   TRP C CZ2   1 
ATOM   4387 C  CZ3   . TRP E  3 94  ? 11.453  35.856  14.462  1.00 44.11 ? 94   TRP C CZ3   1 
ATOM   4388 C  CH2   . TRP E  3 94  ? 11.641  36.264  13.128  1.00 44.13 ? 94   TRP C CH2   1 
ATOM   4389 N  N     . GLU E  3 95  ? 13.679  29.235  15.216  1.00 40.62 ? 95   GLU C N     1 
ATOM   4390 C  CA    . GLU E  3 95  ? 13.930  28.177  14.237  1.00 40.76 ? 95   GLU C CA    1 
ATOM   4391 C  C     . GLU E  3 95  ? 12.914  27.039  14.239  1.00 39.42 ? 95   GLU C C     1 
ATOM   4392 O  O     . GLU E  3 95  ? 12.739  26.353  13.230  1.00 39.76 ? 95   GLU C O     1 
ATOM   4393 C  CB    . GLU E  3 95  ? 15.340  27.609  14.446  1.00 42.51 ? 95   GLU C CB    1 
ATOM   4394 C  CG    . GLU E  3 95  ? 16.408  28.674  14.728  1.00 44.74 ? 95   GLU C CG    1 
ATOM   4395 C  CD    . GLU E  3 95  ? 16.639  29.613  13.547  1.00 46.13 ? 95   GLU C CD    1 
ATOM   4396 O  OE1   . GLU E  3 95  ? 16.436  29.181  12.385  1.00 46.53 ? 95   GLU C OE1   1 
ATOM   4397 O  OE2   . GLU E  3 95  ? 17.027  30.782  13.783  1.00 46.52 ? 95   GLU C OE2   1 
ATOM   4398 N  N     . GLU E  3 96  ? 12.254  26.827  15.368  1.00 37.69 ? 96   GLU C N     1 
ATOM   4399 C  CA    . GLU E  3 96  ? 11.377  25.676  15.500  1.00 36.44 ? 96   GLU C CA    1 
ATOM   4400 C  C     . GLU E  3 96  ? 9.906   26.055  15.454  1.00 34.04 ? 96   GLU C C     1 
ATOM   4401 O  O     . GLU E  3 96  ? 9.041   25.184  15.483  1.00 33.69 ? 96   GLU C O     1 
ATOM   4402 C  CB    . GLU E  3 96  ? 11.692  24.920  16.784  1.00 38.11 ? 96   GLU C CB    1 
ATOM   4403 C  CG    . GLU E  3 96  ? 13.153  24.528  16.909  1.00 40.28 ? 96   GLU C CG    1 
ATOM   4404 C  CD    . GLU E  3 96  ? 13.626  24.514  18.356  1.00 42.23 ? 96   GLU C CD    1 
ATOM   4405 O  OE1   . GLU E  3 96  ? 12.798  24.806  19.253  1.00 42.86 ? 96   GLU C OE1   1 
ATOM   4406 O  OE2   . GLU E  3 96  ? 14.824  24.221  18.596  1.00 42.83 ? 96   GLU C OE2   1 
ATOM   4407 N  N     . VAL E  3 97  ? 9.621   27.350  15.366  1.00 31.21 ? 97   VAL C N     1 
ATOM   4408 C  CA    . VAL E  3 97  ? 8.232   27.798  15.361  1.00 29.24 ? 97   VAL C CA    1 
ATOM   4409 C  C     . VAL E  3 97  ? 7.432   27.199  14.207  1.00 27.54 ? 97   VAL C C     1 
ATOM   4410 O  O     . VAL E  3 97  ? 6.278   26.810  14.390  1.00 27.83 ? 97   VAL C O     1 
ATOM   4411 C  CB    . VAL E  3 97  ? 8.094   29.336  15.379  1.00 29.33 ? 97   VAL C CB    1 
ATOM   4412 C  CG1   . VAL E  3 97  ? 8.554   29.889  16.713  1.00 29.06 ? 97   VAL C CG1   1 
ATOM   4413 C  CG2   . VAL E  3 97  ? 8.878   29.965  14.232  1.00 30.82 ? 97   VAL C CG2   1 
ATOM   4414 N  N     . HIS E  3 98  ? 8.034   27.098  13.026  1.00 25.45 ? 98   HIS C N     1 
ATOM   4415 C  CA    . HIS E  3 98  ? 7.287   26.550  11.895  1.00 23.05 ? 98   HIS C CA    1 
ATOM   4416 C  C     . HIS E  3 98  ? 6.953   25.078  12.089  1.00 22.13 ? 98   HIS C C     1 
ATOM   4417 O  O     . HIS E  3 98  ? 5.808   24.671  11.885  1.00 22.30 ? 98   HIS C O     1 
ATOM   4418 C  CB    . HIS E  3 98  ? 7.995   26.750  10.562  1.00 21.14 ? 98   HIS C CB    1 
ATOM   4419 C  CG    . HIS E  3 98  ? 7.286   26.094  9.420   1.00 20.53 ? 98   HIS C CG    1 
ATOM   4420 N  ND1   . HIS E  3 98  ? 6.392   26.768  8.613   1.00 21.44 ? 98   HIS C ND1   1 
ATOM   4421 C  CD2   . HIS E  3 98  ? 7.316   24.817  8.967   1.00 18.99 ? 98   HIS C CD2   1 
ATOM   4422 C  CE1   . HIS E  3 98  ? 5.917   25.936  7.702   1.00 19.58 ? 98   HIS C CE1   1 
ATOM   4423 N  NE2   . HIS E  3 98  ? 6.462   24.748  7.895   1.00 19.07 ? 98   HIS C NE2   1 
ATOM   4424 N  N     . ALA E  3 99  ? 7.951   24.287  12.473  1.00 21.48 ? 99   ALA C N     1 
ATOM   4425 C  CA    . ALA E  3 99  ? 7.748   22.858  12.700  1.00 21.17 ? 99   ALA C CA    1 
ATOM   4426 C  C     . ALA E  3 99  ? 6.575   22.630  13.647  1.00 21.03 ? 99   ALA C C     1 
ATOM   4427 O  O     . ALA E  3 99  ? 5.733   21.766  13.404  1.00 20.83 ? 99   ALA C O     1 
ATOM   4428 C  CB    . ALA E  3 99  ? 9.020   22.200  13.244  1.00 20.52 ? 99   ALA C CB    1 
ATOM   4429 N  N     . GLU E  3 100 ? 6.513   23.421  14.716  1.00 21.03 ? 100  GLU C N     1 
ATOM   4430 C  CA    . GLU E  3 100 ? 5.448   23.267  15.704  1.00 21.05 ? 100  GLU C CA    1 
ATOM   4431 C  C     . GLU E  3 100 ? 4.087   23.649  15.126  1.00 20.54 ? 100  GLU C C     1 
ATOM   4432 O  O     . GLU E  3 100 ? 3.099   22.930  15.300  1.00 20.56 ? 100  GLU C O     1 
ATOM   4433 C  CB    . GLU E  3 100 ? 5.743   24.095  16.951  1.00 20.77 ? 100  GLU C CB    1 
ATOM   4434 C  CG    . GLU E  3 100 ? 4.753   23.882  18.077  1.00 21.30 ? 100  GLU C CG    1 
ATOM   4435 C  CD    . GLU E  3 100 ? 5.190   22.814  19.053  1.00 22.04 ? 100  GLU C CD    1 
ATOM   4436 O  OE1   . GLU E  3 100 ? 6.391   22.473  19.047  1.00 22.85 ? 100  GLU C OE1   1 
ATOM   4437 O  OE2   . GLU E  3 100 ? 4.339   22.330  19.840  1.00 21.64 ? 100  GLU C OE2   1 
ATOM   4438 N  N     . ALA E  3 101 ? 4.041   24.779  14.430  1.00 20.50 ? 101  ALA C N     1 
ATOM   4439 C  CA    . ALA E  3 101 ? 2.795   25.255  13.838  1.00 20.43 ? 101  ALA C CA    1 
ATOM   4440 C  C     . ALA E  3 101 ? 2.255   24.279  12.794  1.00 20.47 ? 101  ALA C C     1 
ATOM   4441 O  O     . ALA E  3 101 ? 1.044   24.122  12.655  1.00 20.84 ? 101  ALA C O     1 
ATOM   4442 C  CB    . ALA E  3 101 ? 2.989   26.629  13.230  1.00 20.33 ? 101  ALA C CB    1 
ATOM   4443 N  N     . CYS E  3 102 ? 3.157   23.627  12.067  1.00 20.15 ? 102  CYS C N     1 
ATOM   4444 C  CA    . CYS E  3 102 ? 2.759   22.645  11.067  1.00 20.09 ? 102  CYS C CA    1 
ATOM   4445 C  C     . CYS E  3 102 ? 1.830   21.584  11.661  1.00 20.12 ? 102  CYS C C     1 
ATOM   4446 O  O     . CYS E  3 102 ? 0.984   21.015  10.955  1.00 20.85 ? 102  CYS C O     1 
ATOM   4447 C  CB    . CYS E  3 102 ? 3.982   21.989  10.430  1.00 19.97 ? 102  CYS C CB    1 
ATOM   4448 S  SG    . CYS E  3 102 ? 3.557   20.754  9.199   1.00 19.87 ? 102  CYS C SG    1 
ATOM   4449 N  N     . ARG E  3 103 ? 1.983   21.327  12.957  1.00 19.08 ? 103  ARG C N     1 
ATOM   4450 C  CA    . ARG E  3 103 ? 1.084   20.421  13.658  1.00 18.97 ? 103  ARG C CA    1 
ATOM   4451 C  C     . ARG E  3 103 ? -0.118  21.150  14.276  1.00 18.27 ? 103  ARG C C     1 
ATOM   4452 O  O     . ARG E  3 103 ? -1.211  20.602  14.338  1.00 17.16 ? 103  ARG C O     1 
ATOM   4453 C  CB    . ARG E  3 103 ? 1.834   19.613  14.728  1.00 19.28 ? 103  ARG C CB    1 
ATOM   4454 C  CG    . ARG E  3 103 ? 2.782   18.539  14.187  1.00 19.65 ? 103  ARG C CG    1 
ATOM   4455 C  CD    . ARG E  3 103 ? 3.246   17.569  15.287  1.00 19.18 ? 103  ARG C CD    1 
ATOM   4456 N  NE    . ARG E  3 103 ? 3.682   18.299  16.469  1.00 20.32 ? 103  ARG C NE    1 
ATOM   4457 C  CZ    . ARG E  3 103 ? 4.836   18.954  16.558  1.00 21.37 ? 103  ARG C CZ    1 
ATOM   4458 N  NH1   . ARG E  3 103 ? 5.146   19.621  17.670  1.00 21.73 ? 103  ARG C NH1   1 
ATOM   4459 N  NH2   . ARG E  3 103 ? 5.679   18.947  15.533  1.00 20.30 ? 103  ARG C NH2   1 
ATOM   4460 N  N     . TRP E  3 104 ? 0.078   22.388  14.723  1.00 18.81 ? 104  TRP C N     1 
ATOM   4461 C  CA    . TRP E  3 104 ? -0.993  23.117  15.422  1.00 18.54 ? 104  TRP C CA    1 
ATOM   4462 C  C     . TRP E  3 104 ? -2.120  23.572  14.498  1.00 18.19 ? 104  TRP C C     1 
ATOM   4463 O  O     . TRP E  3 104 ? -3.293  23.541  14.878  1.00 17.50 ? 104  TRP C O     1 
ATOM   4464 C  CB    . TRP E  3 104 ? -0.430  24.310  16.193  1.00 18.75 ? 104  TRP C CB    1 
ATOM   4465 C  CG    . TRP E  3 104 ? 0.352   23.923  17.411  1.00 19.32 ? 104  TRP C CG    1 
ATOM   4466 C  CD1   . TRP E  3 104 ? 1.102   22.792  17.582  1.00 19.48 ? 104  TRP C CD1   1 
ATOM   4467 C  CD2   . TRP E  3 104 ? 0.485   24.675  18.620  1.00 19.05 ? 104  TRP C CD2   1 
ATOM   4468 N  NE1   . TRP E  3 104 ? 1.683   22.790  18.826  1.00 18.96 ? 104  TRP C NE1   1 
ATOM   4469 C  CE2   . TRP E  3 104 ? 1.324   23.937  19.483  1.00 19.39 ? 104  TRP C CE2   1 
ATOM   4470 C  CE3   . TRP E  3 104 ? -0.024  25.899  19.060  1.00 19.56 ? 104  TRP C CE3   1 
ATOM   4471 C  CZ2   . TRP E  3 104 ? 1.663   24.383  20.765  1.00 19.51 ? 104  TRP C CZ2   1 
ATOM   4472 C  CZ3   . TRP E  3 104 ? 0.314   26.343  20.338  1.00 19.76 ? 104  TRP C CZ3   1 
ATOM   4473 C  CH2   . TRP E  3 104 ? 1.150   25.583  21.173  1.00 19.64 ? 104  TRP C CH2   1 
ATOM   4474 N  N     . GLU E  3 105 ? -1.753  23.997  13.293  1.00 17.61 ? 105  GLU C N     1 
ATOM   4475 C  CA    . GLU E  3 105 ? -2.716  24.460  12.299  1.00 18.89 ? 105  GLU C CA    1 
ATOM   4476 C  C     . GLU E  3 105 ? -3.890  23.498  12.193  1.00 18.67 ? 105  GLU C C     1 
ATOM   4477 O  O     . GLU E  3 105 ? -5.006  23.894  11.848  1.00 19.14 ? 105  GLU C O     1 
ATOM   4478 C  CB    . GLU E  3 105 ? -2.036  24.594  10.933  1.00 19.88 ? 105  GLU C CB    1 
ATOM   4479 C  CG    . GLU E  3 105 ? -1.318  23.306  10.471  1.00 21.65 ? 105  GLU C CG    1 
ATOM   4480 C  CD    . GLU E  3 105 ? -0.474  23.480  9.209   1.00 21.93 ? 105  GLU C CD    1 
ATOM   4481 O  OE1   . GLU E  3 105 ? -0.385  24.622  8.698   1.00 23.40 ? 105  GLU C OE1   1 
ATOM   4482 O  OE2   . GLU E  3 105 ? 0.099   22.469  8.724   1.00 22.02 ? 105  GLU C OE2   1 
ATOM   4483 N  N     . HIS E  3 106 ? -3.640  22.230  12.504  1.00 17.84 ? 106  HIS C N     1 
ATOM   4484 C  CA    . HIS E  3 106 ? -4.639  21.198  12.294  1.00 16.90 ? 106  HIS C CA    1 
ATOM   4485 C  C     . HIS E  3 106 ? -5.574  20.998  13.491  1.00 17.13 ? 106  HIS C C     1 
ATOM   4486 O  O     . HIS E  3 106 ? -6.520  20.224  13.403  1.00 18.33 ? 106  HIS C O     1 
ATOM   4487 C  CB    . HIS E  3 106 ? -3.972  19.867  11.888  1.00 16.72 ? 106  HIS C CB    1 
ATOM   4488 C  CG    . HIS E  3 106 ? -2.902  20.011  10.847  1.00 15.64 ? 106  HIS C CG    1 
ATOM   4489 N  ND1   . HIS E  3 106 ? -3.168  20.394  9.551   1.00 15.93 ? 106  HIS C ND1   1 
ATOM   4490 C  CD2   . HIS E  3 106 ? -1.563  19.822  10.914  1.00 16.07 ? 106  HIS C CD2   1 
ATOM   4491 C  CE1   . HIS E  3 106 ? -2.037  20.445  8.866   1.00 16.00 ? 106  HIS C CE1   1 
ATOM   4492 N  NE2   . HIS E  3 106 ? -1.048  20.098  9.670   1.00 16.32 ? 106  HIS C NE2   1 
ATOM   4493 N  N     . VAL E  3 107 ? -5.338  21.698  14.598  1.00 17.96 ? 107  VAL C N     1 
ATOM   4494 C  CA    . VAL E  3 107 ? -6.131  21.457  15.819  1.00 18.41 ? 107  VAL C CA    1 
ATOM   4495 C  C     . VAL E  3 107 ? -6.755  22.685  16.485  1.00 19.09 ? 107  VAL C C     1 
ATOM   4496 O  O     . VAL E  3 107 ? -7.682  22.557  17.273  1.00 18.03 ? 107  VAL C O     1 
ATOM   4497 C  CB    . VAL E  3 107 ? -5.333  20.661  16.887  1.00 18.38 ? 107  VAL C CB    1 
ATOM   4498 C  CG1   . VAL E  3 107 ? -5.256  19.196  16.512  1.00 18.86 ? 107  VAL C CG1   1 
ATOM   4499 C  CG2   . VAL E  3 107 ? -3.943  21.232  17.059  1.00 17.54 ? 107  VAL C CG2   1 
ATOM   4500 N  N     . MET E  3 108 ? -6.244  23.870  16.182  1.00 21.40 ? 108  MET C N     1 
ATOM   4501 C  CA    . MET E  3 108 ? -6.835  25.100  16.707  1.00 24.63 ? 108  MET C CA    1 
ATOM   4502 C  C     . MET E  3 108 ? -8.249  25.322  16.175  1.00 24.22 ? 108  MET C C     1 
ATOM   4503 O  O     . MET E  3 108 ? -8.503  25.159  14.976  1.00 24.52 ? 108  MET C O     1 
ATOM   4504 C  CB    . MET E  3 108 ? -5.988  26.307  16.313  1.00 25.47 ? 108  MET C CB    1 
ATOM   4505 C  CG    . MET E  3 108 ? -4.600  26.342  16.913  1.00 27.36 ? 108  MET C CG    1 
ATOM   4506 S  SD    . MET E  3 108 ? -3.718  27.826  16.379  1.00 29.15 ? 108  MET C SD    1 
ATOM   4507 C  CE    . MET E  3 108 ? -5.103  28.936  16.100  1.00 27.08 ? 108  MET C CE    1 
ATOM   4508 N  N     . SER E  3 109 ? -9.166  25.712  17.054  1.00 23.81 ? 109  SER C N     1 
ATOM   4509 C  CA    . SER E  3 109 ? -10.503 26.098  16.613  1.00 23.39 ? 109  SER C CA    1 
ATOM   4510 C  C     . SER E  3 109 ? -10.501 27.570  16.200  1.00 23.94 ? 109  SER C C     1 
ATOM   4511 O  O     . SER E  3 109 ? -9.522  28.290  16.414  1.00 22.61 ? 109  SER C O     1 
ATOM   4512 C  CB    . SER E  3 109 ? -11.527 25.871  17.720  1.00 22.19 ? 109  SER C CB    1 
ATOM   4513 O  OG    . SER E  3 109 ? -11.309 26.787  18.775  1.00 21.70 ? 109  SER C OG    1 
ATOM   4514 N  N     . GLU E  3 110 ? -11.602 28.011  15.604  1.00 25.80 ? 110  GLU C N     1 
ATOM   4515 C  CA    . GLU E  3 110 ? -11.736 29.402  15.181  1.00 27.48 ? 110  GLU C CA    1 
ATOM   4516 C  C     . GLU E  3 110 ? -11.938 30.354  16.373  1.00 27.54 ? 110  GLU C C     1 
ATOM   4517 O  O     . GLU E  3 110 ? -11.606 31.541  16.293  1.00 27.75 ? 110  GLU C O     1 
ATOM   4518 C  CB    . GLU E  3 110 ? -12.851 29.537  14.137  1.00 27.10 ? 110  GLU C CB    1 
ATOM   4519 C  CG    . GLU E  3 110 ? -12.485 28.875  12.816  1.00 29.03 ? 110  GLU C CG    1 
ATOM   4520 C  CD    . GLU E  3 110 ? -13.515 29.073  11.710  1.00 29.91 ? 110  GLU C CD    1 
ATOM   4521 O  OE1   . GLU E  3 110 ? -14.735 29.057  12.005  1.00 31.28 ? 110  GLU C OE1   1 
ATOM   4522 O  OE2   . GLU E  3 110 ? -13.097 29.232  10.538  1.00 30.10 ? 110  GLU C OE2   1 
ATOM   4523 N  N     . ASP E  3 111 ? -12.467 29.823  17.475  1.00 27.36 ? 111  ASP C N     1 
ATOM   4524 C  CA    . ASP E  3 111 ? -12.614 30.588  18.710  1.00 27.14 ? 111  ASP C CA    1 
ATOM   4525 C  C     . ASP E  3 111 ? -11.263 31.046  19.217  1.00 27.21 ? 111  ASP C C     1 
ATOM   4526 O  O     . ASP E  3 111 ? -11.068 32.232  19.485  1.00 29.12 ? 111  ASP C O     1 
ATOM   4527 C  CB    . ASP E  3 111 ? -13.300 29.761  19.790  1.00 27.78 ? 111  ASP C CB    1 
ATOM   4528 C  CG    . ASP E  3 111 ? -14.753 29.511  19.487  1.00 29.34 ? 111  ASP C CG    1 
ATOM   4529 O  OD1   . ASP E  3 111 ? -15.436 30.460  19.046  1.00 30.52 ? 111  ASP C OD1   1 
ATOM   4530 O  OD2   . ASP E  3 111 ? -15.216 28.367  19.683  1.00 30.17 ? 111  ASP C OD2   1 
ATOM   4531 N  N     . VAL E  3 112 ? -10.337 30.105  19.357  1.00 26.00 ? 112  VAL C N     1 
ATOM   4532 C  CA    . VAL E  3 112 ? -8.978  30.421  19.765  1.00 25.29 ? 112  VAL C CA    1 
ATOM   4533 C  C     . VAL E  3 112 ? -8.350  31.382  18.770  1.00 25.79 ? 112  VAL C C     1 
ATOM   4534 O  O     . VAL E  3 112 ? -7.659  32.325  19.156  1.00 26.36 ? 112  VAL C O     1 
ATOM   4535 C  CB    . VAL E  3 112 ? -8.113  29.160  19.843  1.00 25.13 ? 112  VAL C CB    1 
ATOM   4536 C  CG1   . VAL E  3 112 ? -6.651  29.526  19.886  1.00 24.55 ? 112  VAL C CG1   1 
ATOM   4537 C  CG2   . VAL E  3 112 ? -8.500  28.329  21.051  1.00 25.44 ? 112  VAL C CG2   1 
ATOM   4538 N  N     . GLU E  3 113 ? -8.598  31.142  17.486  1.00 26.22 ? 113  GLU C N     1 
ATOM   4539 C  CA    . GLU E  3 113 ? -8.133  32.044  16.439  1.00 26.82 ? 113  GLU C CA    1 
ATOM   4540 C  C     . GLU E  3 113 ? -8.542  33.477  16.756  1.00 26.60 ? 113  GLU C C     1 
ATOM   4541 O  O     . GLU E  3 113 ? -7.707  34.383  16.754  1.00 25.76 ? 113  GLU C O     1 
ATOM   4542 C  CB    . GLU E  3 113 ? -8.696  31.643  15.067  1.00 27.08 ? 113  GLU C CB    1 
ATOM   4543 C  CG    . GLU E  3 113 ? -8.029  30.438  14.415  1.00 26.78 ? 113  GLU C CG    1 
ATOM   4544 C  CD    . GLU E  3 113 ? -8.304  30.361  12.917  1.00 27.27 ? 113  GLU C CD    1 
ATOM   4545 O  OE1   . GLU E  3 113 ? -7.657  31.106  12.152  1.00 27.31 ? 113  GLU C OE1   1 
ATOM   4546 O  OE2   . GLU E  3 113 ? -9.158  29.550  12.497  1.00 27.15 ? 113  GLU C OE2   1 
ATOM   4547 N  N     . ARG E  3 114 ? -9.831  33.669  17.032  1.00 26.99 ? 114  ARG C N     1 
ATOM   4548 C  CA    . ARG E  3 114 ? -10.369 34.997  17.310  1.00 27.72 ? 114  ARG C CA    1 
ATOM   4549 C  C     . ARG E  3 114 ? -9.825  35.554  18.609  1.00 28.24 ? 114  ARG C C     1 
ATOM   4550 O  O     . ARG E  3 114 ? -9.616  36.761  18.734  1.00 29.48 ? 114  ARG C O     1 
ATOM   4551 C  CB    . ARG E  3 114 ? -11.899 34.993  17.309  1.00 27.72 ? 114  ARG C CB    1 
ATOM   4552 C  CG    . ARG E  3 114 ? -12.490 35.197  15.917  1.00 28.22 ? 114  ARG C CG    1 
ATOM   4553 C  CD    . ARG E  3 114 ? -14.005 35.129  15.903  1.00 27.84 ? 114  ARG C CD    1 
ATOM   4554 N  NE    . ARG E  3 114 ? -14.505 33.785  16.177  1.00 28.51 ? 114  ARG C NE    1 
ATOM   4555 C  CZ    . ARG E  3 114 ? -15.033 32.968  15.267  1.00 27.79 ? 114  ARG C CZ    1 
ATOM   4556 N  NH1   . ARG E  3 114 ? -15.141 33.338  13.997  1.00 26.60 ? 114  ARG C NH1   1 
ATOM   4557 N  NH2   . ARG E  3 114 ? -15.459 31.770  15.639  1.00 27.71 ? 114  ARG C NH2   1 
ATOM   4558 N  N     . ARG E  3 115 ? -9.573  34.674  19.567  1.00 28.26 ? 115  ARG C N     1 
ATOM   4559 C  CA    . ARG E  3 115 ? -8.937  35.088  20.813  1.00 28.79 ? 115  ARG C CA    1 
ATOM   4560 C  C     . ARG E  3 115 ? -7.489  35.529  20.577  1.00 29.29 ? 115  ARG C C     1 
ATOM   4561 O  O     . ARG E  3 115 ? -6.939  36.319  21.349  1.00 29.99 ? 115  ARG C O     1 
ATOM   4562 C  CB    . ARG E  3 115 ? -8.982  33.960  21.850  1.00 28.03 ? 115  ARG C CB    1 
ATOM   4563 C  CG    . ARG E  3 115 ? -10.377 33.656  22.387  1.00 27.74 ? 115  ARG C CG    1 
ATOM   4564 C  CD    . ARG E  3 115 ? -10.966 34.857  23.086  1.00 27.67 ? 115  ARG C CD    1 
ATOM   4565 N  NE    . ARG E  3 115 ? -10.003 35.424  24.022  1.00 28.39 ? 115  ARG C NE    1 
ATOM   4566 C  CZ    . ARG E  3 115 ? -10.084 36.645  24.536  1.00 28.16 ? 115  ARG C CZ    1 
ATOM   4567 N  NH1   . ARG E  3 115 ? -11.098 37.442  24.209  1.00 28.01 ? 115  ARG C NH1   1 
ATOM   4568 N  NH2   . ARG E  3 115 ? -9.149  37.065  25.377  1.00 27.51 ? 115  ARG C NH2   1 
ATOM   4569 N  N     . LEU E  3 116 ? -6.868  35.018  19.518  1.00 28.50 ? 116  LEU C N     1 
ATOM   4570 C  CA    . LEU E  3 116 ? -5.476  35.341  19.253  1.00 27.87 ? 116  LEU C CA    1 
ATOM   4571 C  C     . LEU E  3 116 ? -5.391  36.688  18.584  1.00 27.96 ? 116  LEU C C     1 
ATOM   4572 O  O     . LEU E  3 116 ? -4.496  37.484  18.866  1.00 27.43 ? 116  LEU C O     1 
ATOM   4573 C  CB    . LEU E  3 116 ? -4.834  34.290  18.361  1.00 27.45 ? 116  LEU C CB    1 
ATOM   4574 C  CG    . LEU E  3 116 ? -4.663  32.918  18.992  1.00 27.45 ? 116  LEU C CG    1 
ATOM   4575 C  CD1   . LEU E  3 116 ? -3.778  32.063  18.097  1.00 27.53 ? 116  LEU C CD1   1 
ATOM   4576 C  CD2   . LEU E  3 116 ? -4.064  33.062  20.374  1.00 27.46 ? 116  LEU C CD2   1 
ATOM   4577 N  N     . VAL E  3 117 ? -6.331  36.931  17.681  1.00 28.39 ? 117  VAL C N     1 
ATOM   4578 C  CA    . VAL E  3 117 ? -6.424  38.217  17.022  1.00 28.71 ? 117  VAL C CA    1 
ATOM   4579 C  C     . VAL E  3 117 ? -6.426  39.324  18.087  1.00 28.64 ? 117  VAL C C     1 
ATOM   4580 O  O     . VAL E  3 117 ? -5.634  40.269  18.003  1.00 26.99 ? 117  VAL C O     1 
ATOM   4581 C  CB    . VAL E  3 117 ? -7.699  38.314  16.151  1.00 29.02 ? 117  VAL C CB    1 
ATOM   4582 C  CG1   . VAL E  3 117 ? -7.607  39.504  15.199  1.00 28.43 ? 117  VAL C CG1   1 
ATOM   4583 C  CG2   . VAL E  3 117 ? -7.919  37.026  15.380  1.00 28.30 ? 117  VAL C CG2   1 
ATOM   4584 N  N     . LYS E  3 118 ? -7.309  39.192  19.082  1.00 28.62 ? 118  LYS C N     1 
ATOM   4585 C  CA    . LYS E  3 118 ? -7.346  40.129  20.210  1.00 30.36 ? 118  LYS C CA    1 
ATOM   4586 C  C     . LYS E  3 118 ? -5.994  40.111  20.908  1.00 30.54 ? 118  LYS C C     1 
ATOM   4587 O  O     . LYS E  3 118 ? -5.243  41.081  20.866  1.00 30.70 ? 118  LYS C O     1 
ATOM   4588 C  CB    . LYS E  3 118 ? -8.440  39.777  21.238  1.00 30.85 ? 118  LYS C CB    1 
ATOM   4589 C  CG    . LYS E  3 118 ? -9.839  39.445  20.692  1.00 33.49 ? 118  LYS C CG    1 
ATOM   4590 C  CD    . LYS E  3 118 ? -10.775 40.653  20.600  1.00 34.92 ? 118  LYS C CD    1 
ATOM   4591 C  CE    . LYS E  3 118 ? -10.706 41.330  19.220  1.00 36.34 ? 118  LYS C CE    1 
ATOM   4592 N  NZ    . LYS E  3 118 ? -11.874 42.241  18.952  1.00 36.46 ? 118  LYS C NZ    1 
ATOM   4593 N  N     . VAL E  3 119 ? -5.686  38.980  21.528  1.00 31.31 ? 119  VAL C N     1 
ATOM   4594 C  CA    . VAL E  3 119 ? -4.534  38.859  22.407  1.00 31.76 ? 119  VAL C CA    1 
ATOM   4595 C  C     . VAL E  3 119 ? -3.254  39.366  21.767  1.00 32.27 ? 119  VAL C C     1 
ATOM   4596 O  O     . VAL E  3 119 ? -2.437  40.001  22.427  1.00 33.47 ? 119  VAL C O     1 
ATOM   4597 C  CB    . VAL E  3 119 ? -4.344  37.398  22.876  1.00 31.31 ? 119  VAL C CB    1 
ATOM   4598 C  CG1   . VAL E  3 119 ? -3.025  37.239  23.614  1.00 31.04 ? 119  VAL C CG1   1 
ATOM   4599 C  CG2   . VAL E  3 119 ? -5.505  36.982  23.759  1.00 30.76 ? 119  VAL C CG2   1 
ATOM   4600 N  N     . LEU E  3 120 ? -3.093  39.102  20.478  1.00 32.83 ? 120  LEU C N     1 
ATOM   4601 C  CA    . LEU E  3 120 ? -1.841  39.392  19.793  1.00 33.44 ? 120  LEU C CA    1 
ATOM   4602 C  C     . LEU E  3 120 ? -1.820  40.752  19.097  1.00 34.54 ? 120  LEU C C     1 
ATOM   4603 O  O     . LEU E  3 120 ? -0.819  41.124  18.492  1.00 35.53 ? 120  LEU C O     1 
ATOM   4604 C  CB    . LEU E  3 120 ? -1.524  38.276  18.799  1.00 33.12 ? 120  LEU C CB    1 
ATOM   4605 C  CG    . LEU E  3 120 ? -1.219  36.935  19.468  1.00 32.39 ? 120  LEU C CG    1 
ATOM   4606 C  CD1   . LEU E  3 120 ? -1.259  35.807  18.463  1.00 32.18 ? 120  LEU C CD1   1 
ATOM   4607 C  CD2   . LEU E  3 120 ? 0.134   37.004  20.143  1.00 32.37 ? 120  LEU C CD2   1 
ATOM   4608 N  N     . ASN E  3 121 ? -2.923  41.489  19.178  1.00 35.36 ? 121  ASN C N     1 
ATOM   4609 C  CA    . ASN E  3 121 ? -2.956  42.864  18.685  1.00 36.31 ? 121  ASN C CA    1 
ATOM   4610 C  C     . ASN E  3 121 ? -3.218  42.991  17.192  1.00 36.47 ? 121  ASN C C     1 
ATOM   4611 O  O     . ASN E  3 121 ? -2.414  43.569  16.458  1.00 35.90 ? 121  ASN C O     1 
ATOM   4612 C  CB    . ASN E  3 121 ? -1.662  43.591  19.050  1.00 37.26 ? 121  ASN C CB    1 
ATOM   4613 C  CG    . ASN E  3 121 ? -1.512  43.777  20.544  1.00 38.61 ? 121  ASN C CG    1 
ATOM   4614 O  OD1   . ASN E  3 121 ? -0.471  43.444  21.123  1.00 39.03 ? 121  ASN C OD1   1 
ATOM   4615 N  ND2   . ASN E  3 121 ? -2.565  44.292  21.187  1.00 38.02 ? 121  ASN C ND2   1 
ATOM   4616 N  N     . ASN E  3 122 ? -4.360  42.463  16.760  1.00 36.62 ? 122  ASN C N     1 
ATOM   4617 C  CA    . ASN E  3 122 ? -4.747  42.485  15.351  1.00 36.21 ? 122  ASN C CA    1 
ATOM   4618 C  C     . ASN E  3 122 ? -3.547  42.328  14.414  1.00 35.32 ? 122  ASN C C     1 
ATOM   4619 O  O     . ASN E  3 122 ? -3.220  43.233  13.642  1.00 35.33 ? 122  ASN C O     1 
ATOM   4620 C  CB    . ASN E  3 122 ? -5.549  43.750  15.047  1.00 36.62 ? 122  ASN C CB    1 
ATOM   4621 C  CG    . ASN E  3 122 ? -6.718  43.936  16.003  1.00 37.31 ? 122  ASN C CG    1 
ATOM   4622 O  OD1   . ASN E  3 122 ? -7.344  42.964  16.434  1.00 37.71 ? 122  ASN C OD1   1 
ATOM   4623 N  ND2   . ASN E  3 122 ? -7.013  45.185  16.346  1.00 37.65 ? 122  ASN C ND2   1 
ATOM   4624 N  N     . PRO E  3 123 ? -2.878  41.172  14.491  1.00 34.56 ? 123  PRO C N     1 
ATOM   4625 C  CA    . PRO E  3 123 ? -1.704  40.921  13.668  1.00 34.59 ? 123  PRO C CA    1 
ATOM   4626 C  C     . PRO E  3 123 ? -2.149  40.571  12.258  1.00 34.45 ? 123  PRO C C     1 
ATOM   4627 O  O     . PRO E  3 123 ? -3.239  40.026  12.070  1.00 34.43 ? 123  PRO C O     1 
ATOM   4628 C  CB    . PRO E  3 123 ? -1.067  39.708  14.336  1.00 34.75 ? 123  PRO C CB    1 
ATOM   4629 C  CG    . PRO E  3 123 ? -2.229  38.969  14.925  1.00 34.91 ? 123  PRO C CG    1 
ATOM   4630 C  CD    . PRO E  3 123 ? -3.215  40.023  15.350  1.00 34.56 ? 123  PRO C CD    1 
ATOM   4631 N  N     . THR E  3 124 ? -1.324  40.904  11.274  1.00 33.96 ? 124  THR C N     1 
ATOM   4632 C  CA    . THR E  3 124 ? -1.703  40.726  9.880   1.00 33.35 ? 124  THR C CA    1 
ATOM   4633 C  C     . THR E  3 124 ? -0.638  39.919  9.161   1.00 32.84 ? 124  THR C C     1 
ATOM   4634 O  O     . THR E  3 124 ? -0.794  39.562  7.992   1.00 32.87 ? 124  THR C O     1 
ATOM   4635 C  CB    . THR E  3 124 ? -1.867  42.084  9.168   1.00 33.53 ? 124  THR C CB    1 
ATOM   4636 O  OG1   . THR E  3 124 ? -0.620  42.792  9.197   1.00 33.19 ? 124  THR C OG1   1 
ATOM   4637 C  CG2   . THR E  3 124 ? -2.953  42.929  9.848   1.00 33.49 ? 124  THR C CG2   1 
ATOM   4638 N  N     . THR E  3 125 ? 0.448   39.635  9.871   1.00 32.02 ? 125  THR C N     1 
ATOM   4639 C  CA    . THR E  3 125 ? 1.581   38.945  9.285   1.00 31.42 ? 125  THR C CA    1 
ATOM   4640 C  C     . THR E  3 125 ? 2.135   37.918  10.249  1.00 31.57 ? 125  THR C C     1 
ATOM   4641 O  O     . THR E  3 125 ? 2.166   38.144  11.459  1.00 31.50 ? 125  THR C O     1 
ATOM   4642 C  CB    . THR E  3 125 ? 2.747   39.916  8.974   1.00 31.27 ? 125  THR C CB    1 
ATOM   4643 O  OG1   . THR E  3 125 ? 3.678   39.899  10.061  1.00 30.31 ? 125  THR C OG1   1 
ATOM   4644 C  CG2   . THR E  3 125 ? 2.245   41.344  8.764   1.00 30.78 ? 125  THR C CG2   1 
ATOM   4645 N  N     . SER E  3 126 ? 2.584   36.797  9.696   1.00 31.68 ? 126  SER C N     1 
ATOM   4646 C  CA    . SER E  3 126 ? 3.388   35.838  10.426  1.00 31.47 ? 126  SER C CA    1 
ATOM   4647 C  C     . SER E  3 126 ? 4.653   36.520  10.933  1.00 32.00 ? 126  SER C C     1 
ATOM   4648 O  O     . SER E  3 126 ? 5.043   37.552  10.415  1.00 32.87 ? 126  SER C O     1 
ATOM   4649 C  CB    . SER E  3 126 ? 3.779   34.708  9.495   1.00 31.33 ? 126  SER C CB    1 
ATOM   4650 O  OG    . SER E  3 126 ? 5.104   34.295  9.767   1.00 32.43 ? 126  SER C OG    1 
ATOM   4651 N  N     . PRO E  3 127 ? 5.312   35.936  11.943  1.00 32.82 ? 127  PRO C N     1 
ATOM   4652 C  CA    . PRO E  3 127 ? 6.567   36.498  12.432  1.00 33.05 ? 127  PRO C CA    1 
ATOM   4653 C  C     . PRO E  3 127 ? 7.709   36.370  11.427  1.00 34.25 ? 127  PRO C C     1 
ATOM   4654 O  O     . PRO E  3 127 ? 8.849   36.143  11.827  1.00 35.40 ? 127  PRO C O     1 
ATOM   4655 C  CB    . PRO E  3 127 ? 6.882   35.631  13.660  1.00 32.74 ? 127  PRO C CB    1 
ATOM   4656 C  CG    . PRO E  3 127 ? 5.601   34.950  14.005  1.00 32.51 ? 127  PRO C CG    1 
ATOM   4657 C  CD    . PRO E  3 127 ? 4.922   34.735  12.700  1.00 32.32 ? 127  PRO C CD    1 
ATOM   4658 N  N     . PHE E  3 128 ? 7.414   36.503  10.137  1.00 35.11 ? 128  PHE C N     1 
ATOM   4659 C  CA    . PHE E  3 128 ? 8.445   36.376  9.105   1.00 35.33 ? 128  PHE C CA    1 
ATOM   4660 C  C     . PHE E  3 128 ? 8.179   37.302  7.932   1.00 34.93 ? 128  PHE C C     1 
ATOM   4661 O  O     . PHE E  3 128 ? 8.970   37.359  6.995   1.00 34.98 ? 128  PHE C O     1 
ATOM   4662 C  CB    . PHE E  3 128 ? 8.504   34.949  8.562   1.00 36.35 ? 128  PHE C CB    1 
ATOM   4663 C  CG    . PHE E  3 128 ? 8.952   33.925  9.559   1.00 37.14 ? 128  PHE C CG    1 
ATOM   4664 C  CD1   . PHE E  3 128 ? 8.059   32.982  10.048  1.00 37.01 ? 128  PHE C CD1   1 
ATOM   4665 C  CD2   . PHE E  3 128 ? 10.276  33.880  9.987   1.00 37.64 ? 128  PHE C CD2   1 
ATOM   4666 C  CE1   . PHE E  3 128 ? 8.476   32.014  10.960  1.00 37.53 ? 128  PHE C CE1   1 
ATOM   4667 C  CE2   . PHE E  3 128 ? 10.699  32.916  10.903  1.00 37.16 ? 128  PHE C CE2   1 
ATOM   4668 C  CZ    . PHE E  3 128 ? 9.798   31.983  11.389  1.00 37.02 ? 128  PHE C CZ    1 
ATOM   4669 N  N     . GLY E  3 129 ? 7.056   38.009  7.974   1.00 34.34 ? 129  GLY C N     1 
ATOM   4670 C  CA    . GLY E  3 129 ? 6.656   38.861  6.863   1.00 34.20 ? 129  GLY C CA    1 
ATOM   4671 C  C     . GLY E  3 129 ? 5.516   38.257  6.060   1.00 34.13 ? 129  GLY C C     1 
ATOM   4672 O  O     . GLY E  3 129 ? 4.870   38.941  5.260   1.00 34.85 ? 129  GLY C O     1 
ATOM   4673 N  N     . ASN E  3 130 ? 5.262   36.972  6.278   1.00 33.53 ? 130  ASN C N     1 
ATOM   4674 C  CA    . ASN E  3 130 ? 4.189   36.279  5.573   1.00 32.22 ? 130  ASN C CA    1 
ATOM   4675 C  C     . ASN E  3 130 ? 2.819   36.710  6.036   1.00 30.36 ? 130  ASN C C     1 
ATOM   4676 O  O     . ASN E  3 130 ? 2.510   36.646  7.220   1.00 30.10 ? 130  ASN C O     1 
ATOM   4677 C  CB    . ASN E  3 130 ? 4.350   34.773  5.714   1.00 33.30 ? 130  ASN C CB    1 
ATOM   4678 C  CG    . ASN E  3 130 ? 5.667   34.295  5.158   1.00 34.45 ? 130  ASN C CG    1 
ATOM   4679 O  OD1   . ASN E  3 130 ? 6.612   34.048  5.905   1.00 35.34 ? 130  ASN C OD1   1 
ATOM   4680 N  ND2   . ASN E  3 130 ? 5.757   34.212  3.833   1.00 34.25 ? 130  ASN C ND2   1 
ATOM   4681 N  N     . PRO E  3 131 ? 1.993   37.163  5.089   1.00 29.16 ? 131  PRO C N     1 
ATOM   4682 C  CA    . PRO E  3 131 ? 0.637   37.631  5.359   1.00 28.64 ? 131  PRO C CA    1 
ATOM   4683 C  C     . PRO E  3 131 ? -0.262  36.536  5.930   1.00 28.32 ? 131  PRO C C     1 
ATOM   4684 O  O     . PRO E  3 131 ? -0.082  35.349  5.622   1.00 28.81 ? 131  PRO C O     1 
ATOM   4685 C  CB    . PRO E  3 131 ? 0.130   38.060  3.970   1.00 28.80 ? 131  PRO C CB    1 
ATOM   4686 C  CG    . PRO E  3 131 ? 1.003   37.325  2.999   1.00 28.78 ? 131  PRO C CG    1 
ATOM   4687 C  CD    . PRO E  3 131 ? 2.344   37.261  3.663   1.00 28.38 ? 131  PRO C CD    1 
ATOM   4688 N  N     . ILE E  3 132 ? -1.227  36.936  6.751   1.00 26.84 ? 132  ILE C N     1 
ATOM   4689 C  CA    . ILE E  3 132 ? -2.198  35.994  7.283   1.00 25.45 ? 132  ILE C CA    1 
ATOM   4690 C  C     . ILE E  3 132 ? -3.487  36.092  6.496   1.00 25.24 ? 132  ILE C C     1 
ATOM   4691 O  O     . ILE E  3 132 ? -4.128  37.138  6.483   1.00 26.13 ? 132  ILE C O     1 
ATOM   4692 C  CB    . ILE E  3 132 ? -2.484  36.249  8.756   1.00 24.68 ? 132  ILE C CB    1 
ATOM   4693 C  CG1   . ILE E  3 132 ? -1.174  36.249  9.545   1.00 24.99 ? 132  ILE C CG1   1 
ATOM   4694 C  CG2   . ILE E  3 132 ? -3.430  35.196  9.288   1.00 24.32 ? 132  ILE C CG2   1 
ATOM   4695 C  CD1   . ILE E  3 132 ? -1.314  36.770  10.963  1.00 25.71 ? 132  ILE C CD1   1 
ATOM   4696 N  N     . PRO E  3 133 ? -3.869  34.994  5.829   1.00 25.23 ? 133  PRO C N     1 
ATOM   4697 C  CA    . PRO E  3 133 ? -5.030  35.020  4.938   1.00 24.90 ? 133  PRO C CA    1 
ATOM   4698 C  C     . PRO E  3 133 ? -6.377  35.054  5.669   1.00 24.56 ? 133  PRO C C     1 
ATOM   4699 O  O     . PRO E  3 133 ? -6.473  34.621  6.817   1.00 24.07 ? 133  PRO C O     1 
ATOM   4700 C  CB    . PRO E  3 133 ? -4.884  33.714  4.141   1.00 24.50 ? 133  PRO C CB    1 
ATOM   4701 C  CG    . PRO E  3 133 ? -4.149  32.802  5.072   1.00 24.35 ? 133  PRO C CG    1 
ATOM   4702 C  CD    . PRO E  3 133 ? -3.220  33.669  5.869   1.00 24.02 ? 133  PRO C CD    1 
ATOM   4703 N  N     . GLY E  3 134 ? -7.396  35.580  4.990   1.00 24.46 ? 134  GLY C N     1 
ATOM   4704 C  CA    . GLY E  3 134 ? -8.783  35.521  5.448   1.00 24.44 ? 134  GLY C CA    1 
ATOM   4705 C  C     . GLY E  3 134 ? -9.116  35.938  6.868   1.00 24.23 ? 134  GLY C C     1 
ATOM   4706 O  O     . GLY E  3 134 ? -9.977  35.333  7.499   1.00 24.02 ? 134  GLY C O     1 
ATOM   4707 N  N     . LEU E  3 135 ? -8.454  36.978  7.374   1.00 25.36 ? 135  LEU C N     1 
ATOM   4708 C  CA    . LEU E  3 135 ? -8.782  37.515  8.699   1.00 25.94 ? 135  LEU C CA    1 
ATOM   4709 C  C     . LEU E  3 135 ? -10.180 38.104  8.692   1.00 27.24 ? 135  LEU C C     1 
ATOM   4710 O  O     . LEU E  3 135 ? -10.871 38.096  9.709   1.00 28.28 ? 135  LEU C O     1 
ATOM   4711 C  CB    . LEU E  3 135 ? -7.785  38.583  9.123   1.00 25.26 ? 135  LEU C CB    1 
ATOM   4712 C  CG    . LEU E  3 135 ? -6.401  38.072  9.505   1.00 25.37 ? 135  LEU C CG    1 
ATOM   4713 C  CD1   . LEU E  3 135 ? -5.408  39.218  9.542   1.00 24.38 ? 135  LEU C CD1   1 
ATOM   4714 C  CD2   . LEU E  3 135 ? -6.454  37.334  10.839  1.00 25.36 ? 135  LEU C CD2   1 
ATOM   4715 N  N     . VAL E  3 136 ? -10.595 38.606  7.533   1.00 28.09 ? 136  VAL C N     1 
ATOM   4716 C  CA    . VAL E  3 136 ? -11.933 39.148  7.381   1.00 28.50 ? 136  VAL C CA    1 
ATOM   4717 C  C     . VAL E  3 136 ? -12.990 38.082  7.631   1.00 29.24 ? 136  VAL C C     1 
ATOM   4718 O  O     . VAL E  3 136 ? -13.854 38.266  8.487   1.00 31.31 ? 136  VAL C O     1 
ATOM   4719 C  CB    . VAL E  3 136 ? -12.142 39.819  6.001   1.00 28.89 ? 136  VAL C CB    1 
ATOM   4720 C  CG1   . VAL E  3 136 ? -13.629 40.072  5.737   1.00 28.13 ? 136  VAL C CG1   1 
ATOM   4721 C  CG2   . VAL E  3 136 ? -11.343 41.123  5.915   1.00 28.02 ? 136  VAL C CG2   1 
ATOM   4722 N  N     . GLU E  3 137 ? -12.928 36.964  6.916   1.00 29.51 ? 137  GLU C N     1 
ATOM   4723 C  CA    . GLU E  3 137 ? -13.944 35.927  7.115   1.00 29.62 ? 137  GLU C CA    1 
ATOM   4724 C  C     . GLU E  3 137 ? -13.887 35.301  8.512   1.00 29.21 ? 137  GLU C C     1 
ATOM   4725 O  O     . GLU E  3 137 ? -14.889 34.804  9.000   1.00 28.70 ? 137  GLU C O     1 
ATOM   4726 C  CB    . GLU E  3 137 ? -13.905 34.856  6.020   1.00 30.23 ? 137  GLU C CB    1 
ATOM   4727 C  CG    . GLU E  3 137 ? -12.564 34.706  5.336   1.00 32.62 ? 137  GLU C CG    1 
ATOM   4728 C  CD    . GLU E  3 137 ? -12.427 35.600  4.120   1.00 33.85 ? 137  GLU C CD    1 
ATOM   4729 O  OE1   . GLU E  3 137 ? -11.624 36.561  4.171   1.00 34.93 ? 137  GLU C OE1   1 
ATOM   4730 O  OE2   . GLU E  3 137 ? -13.131 35.346  3.117   1.00 33.99 ? 137  GLU C OE2   1 
ATOM   4731 N  N     . LEU E  3 138 ? -12.725 35.339  9.162   1.00 30.00 ? 138  LEU C N     1 
ATOM   4732 C  CA    . LEU E  3 138 ? -12.619 34.850  10.540  1.00 29.69 ? 138  LEU C CA    1 
ATOM   4733 C  C     . LEU E  3 138 ? -13.675 35.535  11.399  1.00 30.73 ? 138  LEU C C     1 
ATOM   4734 O  O     . LEU E  3 138 ? -14.449 34.876  12.093  1.00 30.84 ? 138  LEU C O     1 
ATOM   4735 C  CB    . LEU E  3 138 ? -11.233 35.139  11.119  1.00 28.07 ? 138  LEU C CB    1 
ATOM   4736 C  CG    . LEU E  3 138 ? -10.587 34.180  12.130  1.00 27.00 ? 138  LEU C CG    1 
ATOM   4737 C  CD1   . LEU E  3 138 ? -9.447  34.882  12.844  1.00 26.52 ? 138  LEU C CD1   1 
ATOM   4738 C  CD2   . LEU E  3 138 ? -11.550 33.604  13.139  1.00 25.34 ? 138  LEU C CD2   1 
ATOM   4739 N  N     . GLY E  3 139 ? -13.707 36.865  11.340  1.00 32.11 ? 139  GLY C N     1 
ATOM   4740 C  CA    . GLY E  3 139 ? -14.632 37.647  12.156  1.00 32.90 ? 139  GLY C CA    1 
ATOM   4741 C  C     . GLY E  3 139 ? -14.234 37.619  13.619  1.00 33.52 ? 139  GLY C C     1 
ATOM   4742 O  O     . GLY E  3 139 ? -14.931 38.169  14.472  1.00 35.12 ? 139  GLY C O     1 
ATOM   4743 N  N     . GLU F  3 3   ? -10.283 12.072  14.558  1.00 25.46 ? 3    GLU D N     1 
ATOM   4744 C  CA    . GLU F  3 3   ? -11.167 12.824  15.504  1.00 26.42 ? 3    GLU D CA    1 
ATOM   4745 C  C     . GLU F  3 3   ? -10.638 12.828  16.953  1.00 25.20 ? 3    GLU D C     1 
ATOM   4746 O  O     . GLU F  3 3   ? -10.657 13.862  17.616  1.00 23.86 ? 3    GLU D O     1 
ATOM   4747 C  CB    . GLU F  3 3   ? -12.609 12.308  15.425  1.00 28.83 ? 3    GLU D CB    1 
ATOM   4748 C  CG    . GLU F  3 3   ? -13.547 12.757  16.560  1.00 30.63 ? 3    GLU D CG    1 
ATOM   4749 C  CD    . GLU F  3 3   ? -13.582 14.267  16.782  1.00 31.98 ? 3    GLU D CD    1 
ATOM   4750 O  OE1   . GLU F  3 3   ? -14.192 14.701  17.785  1.00 32.66 ? 3    GLU D OE1   1 
ATOM   4751 O  OE2   . GLU F  3 3   ? -12.997 15.024  15.975  1.00 33.18 ? 3    GLU D OE2   1 
ATOM   4752 N  N     . LEU F  3 4   ? -10.161 11.678  17.431  1.00 23.20 ? 4    LEU D N     1 
ATOM   4753 C  CA    . LEU F  3 4   ? -9.365  11.633  18.657  1.00 20.77 ? 4    LEU D CA    1 
ATOM   4754 C  C     . LEU F  3 4   ? -7.992  12.266  18.452  1.00 20.09 ? 4    LEU D C     1 
ATOM   4755 O  O     . LEU F  3 4   ? -7.275  12.537  19.416  1.00 20.36 ? 4    LEU D O     1 
ATOM   4756 C  CB    . LEU F  3 4   ? -9.170  10.195  19.126  1.00 19.88 ? 4    LEU D CB    1 
ATOM   4757 C  CG    . LEU F  3 4   ? -10.400 9.439   19.613  1.00 20.19 ? 4    LEU D CG    1 
ATOM   4758 C  CD1   . LEU F  3 4   ? -10.006 8.023   19.988  1.00 21.11 ? 4    LEU D CD1   1 
ATOM   4759 C  CD2   . LEU F  3 4   ? -11.072 10.153  20.785  1.00 19.39 ? 4    LEU D CD2   1 
ATOM   4760 N  N     . VAL F  3 5   ? -7.639  12.496  17.190  1.00 19.76 ? 5    VAL D N     1 
ATOM   4761 C  CA    . VAL F  3 5   ? -6.302  12.961  16.791  1.00 19.37 ? 5    VAL D CA    1 
ATOM   4762 C  C     . VAL F  3 5   ? -5.244  11.883  16.996  1.00 19.11 ? 5    VAL D C     1 
ATOM   4763 O  O     . VAL F  3 5   ? -4.550  11.515  16.064  1.00 18.88 ? 5    VAL D O     1 
ATOM   4764 C  CB    . VAL F  3 5   ? -5.854  14.248  17.499  1.00 18.70 ? 5    VAL D CB    1 
ATOM   4765 C  CG1   . VAL F  3 5   ? -4.492  14.680  16.955  1.00 18.37 ? 5    VAL D CG1   1 
ATOM   4766 C  CG2   . VAL F  3 5   ? -6.879  15.353  17.302  1.00 18.05 ? 5    VAL D CG2   1 
ATOM   4767 N  N     . ASP F  3 6   ? -5.108  11.397  18.219  1.00 19.70 ? 6    ASP D N     1 
ATOM   4768 C  CA    . ASP F  3 6   ? -4.273  10.239  18.469  1.00 20.57 ? 6    ASP D CA    1 
ATOM   4769 C  C     . ASP F  3 6   ? -5.042  9.243   19.318  1.00 20.60 ? 6    ASP D C     1 
ATOM   4770 O  O     . ASP F  3 6   ? -5.271  9.461   20.513  1.00 21.15 ? 6    ASP D O     1 
ATOM   4771 C  CB    . ASP F  3 6   ? -2.959  10.622  19.148  1.00 22.10 ? 6    ASP D CB    1 
ATOM   4772 C  CG    . ASP F  3 6   ? -2.000  9.437   19.275  1.00 23.73 ? 6    ASP D CG    1 
ATOM   4773 O  OD1   . ASP F  3 6   ? -0.835  9.566   18.848  1.00 24.89 ? 6    ASP D OD1   1 
ATOM   4774 O  OD2   . ASP F  3 6   ? -2.403  8.370   19.792  1.00 24.60 ? 6    ASP D OD2   1 
ATOM   4775 N  N     . THR F  3 7   ? -5.450  8.153   18.683  1.00 19.40 ? 7    THR D N     1 
ATOM   4776 C  CA    . THR F  3 7   ? -6.175  7.101   19.361  1.00 18.66 ? 7    THR D CA    1 
ATOM   4777 C  C     . THR F  3 7   ? -5.395  6.591   20.576  1.00 17.81 ? 7    THR D C     1 
ATOM   4778 O  O     . THR F  3 7   ? -5.888  6.622   21.703  1.00 18.79 ? 7    THR D O     1 
ATOM   4779 C  CB    . THR F  3 7   ? -6.481  5.947   18.384  1.00 18.36 ? 7    THR D CB    1 
ATOM   4780 O  OG1   . THR F  3 7   ? -7.335  6.433   17.343  1.00 18.67 ? 7    THR D OG1   1 
ATOM   4781 C  CG2   . THR F  3 7   ? -7.166  4.801   19.091  1.00 17.91 ? 7    THR D CG2   1 
ATOM   4782 N  N     . THR F  3 8   ? -4.175  6.140   20.348  1.00 16.29 ? 8    THR D N     1 
ATOM   4783 C  CA    . THR F  3 8   ? -3.389  5.544   21.410  1.00 17.48 ? 8    THR D CA    1 
ATOM   4784 C  C     . THR F  3 8   ? -3.259  6.468   22.624  1.00 18.46 ? 8    THR D C     1 
ATOM   4785 O  O     . THR F  3 8   ? -3.624  6.100   23.754  1.00 18.52 ? 8    THR D O     1 
ATOM   4786 C  CB    . THR F  3 8   ? -1.998  5.145   20.894  1.00 17.38 ? 8    THR D CB    1 
ATOM   4787 O  OG1   . THR F  3 8   ? -2.157  4.269   19.773  1.00 16.50 ? 8    THR D OG1   1 
ATOM   4788 C  CG2   . THR F  3 8   ? -1.206  4.449   21.973  1.00 15.87 ? 8    THR D CG2   1 
ATOM   4789 N  N     . GLU F  3 9   ? -2.749  7.669   22.386  1.00 17.92 ? 9    GLU D N     1 
ATOM   4790 C  CA    . GLU F  3 9   ? -2.577  8.639   23.454  1.00 18.44 ? 9    GLU D CA    1 
ATOM   4791 C  C     . GLU F  3 9   ? -3.883  8.916   24.185  1.00 19.07 ? 9    GLU D C     1 
ATOM   4792 O  O     . GLU F  3 9   ? -3.890  9.108   25.402  1.00 20.42 ? 9    GLU D O     1 
ATOM   4793 C  CB    . GLU F  3 9   ? -1.989  9.938   22.915  1.00 18.68 ? 9    GLU D CB    1 
ATOM   4794 C  CG    . GLU F  3 9   ? -0.520  9.843   22.563  1.00 18.28 ? 9    GLU D CG    1 
ATOM   4795 C  CD    . GLU F  3 9   ? 0.082   11.192  22.244  1.00 18.76 ? 9    GLU D CD    1 
ATOM   4796 O  OE1   . GLU F  3 9   ? -0.659  12.206  22.267  1.00 18.53 ? 9    GLU D OE1   1 
ATOM   4797 O  OE2   . GLU F  3 9   ? 1.297   11.234  21.972  1.00 18.29 ? 9    GLU D OE2   1 
ATOM   4798 N  N     . MET F  3 10  ? -4.992  8.929   23.456  1.00 19.42 ? 10   MET D N     1 
ATOM   4799 C  CA    . MET F  3 10  ? -6.277  9.148   24.101  1.00 19.45 ? 10   MET D CA    1 
ATOM   4800 C  C     . MET F  3 10  ? -6.639  7.974   24.986  1.00 18.99 ? 10   MET D C     1 
ATOM   4801 O  O     . MET F  3 10  ? -7.199  8.160   26.054  1.00 19.57 ? 10   MET D O     1 
ATOM   4802 C  CB    . MET F  3 10  ? -7.387  9.431   23.089  1.00 20.28 ? 10   MET D CB    1 
ATOM   4803 C  CG    . MET F  3 10  ? -7.433  10.881  22.645  1.00 21.70 ? 10   MET D CG    1 
ATOM   4804 S  SD    . MET F  3 10  ? -7.487  12.022  24.049  1.00 24.06 ? 10   MET D SD    1 
ATOM   4805 C  CE    . MET F  3 10  ? -9.233  11.967  24.494  1.00 21.47 ? 10   MET D CE    1 
ATOM   4806 N  N     . TYR F  3 11  ? -6.324  6.759   24.557  1.00 18.88 ? 11   TYR D N     1 
ATOM   4807 C  CA    . TYR F  3 11  ? -6.607  5.622   25.415  1.00 18.87 ? 11   TYR D CA    1 
ATOM   4808 C  C     . TYR F  3 11  ? -5.765  5.720   26.672  1.00 19.17 ? 11   TYR D C     1 
ATOM   4809 O  O     . TYR F  3 11  ? -6.237  5.434   27.766  1.00 19.94 ? 11   TYR D O     1 
ATOM   4810 C  CB    . TYR F  3 11  ? -6.346  4.303   24.700  1.00 18.78 ? 11   TYR D CB    1 
ATOM   4811 C  CG    . TYR F  3 11  ? -7.523  3.791   23.901  1.00 18.44 ? 11   TYR D CG    1 
ATOM   4812 C  CD1   . TYR F  3 11  ? -8.213  4.624   23.033  1.00 18.44 ? 11   TYR D CD1   1 
ATOM   4813 C  CD2   . TYR F  3 11  ? -7.925  2.470   23.997  1.00 17.73 ? 11   TYR D CD2   1 
ATOM   4814 C  CE1   . TYR F  3 11  ? -9.284  4.156   22.290  1.00 18.79 ? 11   TYR D CE1   1 
ATOM   4815 C  CE2   . TYR F  3 11  ? -8.990  1.993   23.262  1.00 18.71 ? 11   TYR D CE2   1 
ATOM   4816 C  CZ    . TYR F  3 11  ? -9.667  2.839   22.405  1.00 18.86 ? 11   TYR D CZ    1 
ATOM   4817 O  OH    . TYR F  3 11  ? -10.736 2.371   21.673  1.00 18.58 ? 11   TYR D OH    1 
ATOM   4818 N  N     . LEU F  3 12  ? -4.519  6.147   26.507  1.00 19.41 ? 12   LEU D N     1 
ATOM   4819 C  CA    . LEU F  3 12  ? -3.606  6.278   27.627  1.00 19.52 ? 12   LEU D CA    1 
ATOM   4820 C  C     . LEU F  3 12  ? -4.112  7.317   28.636  1.00 20.37 ? 12   LEU D C     1 
ATOM   4821 O  O     . LEU F  3 12  ? -4.285  7.011   29.816  1.00 21.03 ? 12   LEU D O     1 
ATOM   4822 C  CB    . LEU F  3 12  ? -2.202  6.625   27.124  1.00 18.94 ? 12   LEU D CB    1 
ATOM   4823 C  CG    . LEU F  3 12  ? -1.521  5.513   26.321  1.00 18.88 ? 12   LEU D CG    1 
ATOM   4824 C  CD1   . LEU F  3 12  ? -0.448  6.066   25.405  1.00 19.18 ? 12   LEU D CD1   1 
ATOM   4825 C  CD2   . LEU F  3 12  ? -0.934  4.460   27.240  1.00 18.24 ? 12   LEU D CD2   1 
ATOM   4826 N  N     . ARG F  3 13  ? -4.361  8.538   28.179  1.00 19.76 ? 13   ARG D N     1 
ATOM   4827 C  CA    . ARG F  3 13  ? -4.862  9.570   29.085  1.00 20.65 ? 13   ARG D CA    1 
ATOM   4828 C  C     . ARG F  3 13  ? -6.185  9.143   29.761  1.00 19.97 ? 13   ARG D C     1 
ATOM   4829 O  O     . ARG F  3 13  ? -6.393  9.421   30.936  1.00 20.36 ? 13   ARG D O     1 
ATOM   4830 C  CB    . ARG F  3 13  ? -5.027  10.922  28.364  1.00 20.66 ? 13   ARG D CB    1 
ATOM   4831 C  CG    . ARG F  3 13  ? -4.945  12.157  29.285  1.00 20.77 ? 13   ARG D CG    1 
ATOM   4832 C  CD    . ARG F  3 13  ? -5.714  13.350  28.699  1.00 21.29 ? 13   ARG D CD    1 
ATOM   4833 N  NE    . ARG F  3 13  ? -7.155  13.094  28.692  1.00 21.73 ? 13   ARG D NE    1 
ATOM   4834 C  CZ    . ARG F  3 13  ? -8.017  13.570  27.796  1.00 21.82 ? 13   ARG D CZ    1 
ATOM   4835 N  NH1   . ARG F  3 13  ? -9.303  13.257  27.894  1.00 22.14 ? 13   ARG D NH1   1 
ATOM   4836 N  NH2   . ARG F  3 13  ? -7.610  14.343  26.798  1.00 21.81 ? 13   ARG D NH2   1 
ATOM   4837 N  N     . THR F  3 14  ? -7.069  8.473   29.021  1.00 18.83 ? 14   THR D N     1 
ATOM   4838 C  CA    . THR F  3 14  ? -8.354  8.058   29.574  1.00 17.30 ? 14   THR D CA    1 
ATOM   4839 C  C     . THR F  3 14  ? -8.112  7.090   30.714  1.00 18.16 ? 14   THR D C     1 
ATOM   4840 O  O     . THR F  3 14  ? -8.729  7.212   31.776  1.00 18.36 ? 14   THR D O     1 
ATOM   4841 C  CB    . THR F  3 14  ? -9.274  7.378   28.534  1.00 15.94 ? 14   THR D CB    1 
ATOM   4842 O  OG1   . THR F  3 14  ? -9.776  8.346   27.610  1.00 15.24 ? 14   THR D OG1   1 
ATOM   4843 C  CG2   . THR F  3 14  ? -10.458 6.743   29.219  1.00 14.96 ? 14   THR D CG2   1 
ATOM   4844 N  N     . ILE F  3 15  ? -7.212  6.132   30.498  1.00 17.94 ? 15   ILE D N     1 
ATOM   4845 C  CA    . ILE F  3 15  ? -6.896  5.157   31.534  1.00 19.38 ? 15   ILE D CA    1 
ATOM   4846 C  C     . ILE F  3 15  ? -6.322  5.884   32.740  1.00 20.68 ? 15   ILE D C     1 
ATOM   4847 O  O     . ILE F  3 15  ? -6.602  5.536   33.888  1.00 20.89 ? 15   ILE D O     1 
ATOM   4848 C  CB    . ILE F  3 15  ? -5.892  4.095   31.054  1.00 18.80 ? 15   ILE D CB    1 
ATOM   4849 C  CG1   . ILE F  3 15  ? -6.520  3.221   29.977  1.00 19.60 ? 15   ILE D CG1   1 
ATOM   4850 C  CG2   . ILE F  3 15  ? -5.468  3.204   32.195  1.00 17.78 ? 15   ILE D CG2   1 
ATOM   4851 C  CD1   . ILE F  3 15  ? -5.555  2.210   29.382  1.00 19.82 ? 15   ILE D CD1   1 
ATOM   4852 N  N     . TYR F  3 16  ? -5.526  6.908   32.469  1.00 22.77 ? 16   TYR D N     1 
ATOM   4853 C  CA    . TYR F  3 16  ? -4.957  7.717   33.526  1.00 24.22 ? 16   TYR D CA    1 
ATOM   4854 C  C     . TYR F  3 16  ? -6.040  8.454   34.316  1.00 24.59 ? 16   TYR D C     1 
ATOM   4855 O  O     . TYR F  3 16  ? -6.065  8.399   35.549  1.00 24.41 ? 16   TYR D O     1 
ATOM   4856 C  CB    . TYR F  3 16  ? -3.941  8.698   32.960  1.00 25.58 ? 16   TYR D CB    1 
ATOM   4857 C  CG    . TYR F  3 16  ? -2.952  9.119   34.002  1.00 26.79 ? 16   TYR D CG    1 
ATOM   4858 C  CD1   . TYR F  3 16  ? -3.089  10.332  34.666  1.00 27.01 ? 16   TYR D CD1   1 
ATOM   4859 C  CD2   . TYR F  3 16  ? -1.898  8.284   34.356  1.00 26.23 ? 16   TYR D CD2   1 
ATOM   4860 C  CE1   . TYR F  3 16  ? -2.189  10.712  35.628  1.00 27.21 ? 16   TYR D CE1   1 
ATOM   4861 C  CE2   . TYR F  3 16  ? -0.997  8.651   35.319  1.00 26.53 ? 16   TYR D CE2   1 
ATOM   4862 C  CZ    . TYR F  3 16  ? -1.141  9.869   35.948  1.00 27.27 ? 16   TYR D CZ    1 
ATOM   4863 O  OH    . TYR F  3 16  ? -0.240  10.245  36.917  1.00 28.04 ? 16   TYR D OH    1 
ATOM   4864 N  N     . ASP F  3 17  ? -6.934  9.135   33.604  1.00 24.41 ? 17   ASP D N     1 
ATOM   4865 C  CA    . ASP F  3 17  ? -8.070  9.793   34.237  1.00 25.86 ? 17   ASP D CA    1 
ATOM   4866 C  C     . ASP F  3 17  ? -8.809  8.845   35.183  1.00 25.98 ? 17   ASP D C     1 
ATOM   4867 O  O     . ASP F  3 17  ? -9.187  9.219   36.292  1.00 25.84 ? 17   ASP D O     1 
ATOM   4868 C  CB    . ASP F  3 17  ? -9.034  10.331  33.181  1.00 26.59 ? 17   ASP D CB    1 
ATOM   4869 C  CG    . ASP F  3 17  ? -8.395  11.378  32.291  1.00 27.88 ? 17   ASP D CG    1 
ATOM   4870 O  OD1   . ASP F  3 17  ? -7.410  12.008  32.734  1.00 28.80 ? 17   ASP D OD1   1 
ATOM   4871 O  OD2   . ASP F  3 17  ? -8.874  11.570  31.148  1.00 28.53 ? 17   ASP D OD2   1 
ATOM   4872 N  N     . LEU F  3 18  ? -9.004  7.612   34.736  1.00 25.84 ? 18   LEU D N     1 
ATOM   4873 C  CA    . LEU F  3 18  ? -9.706  6.620   35.526  1.00 25.98 ? 18   LEU D CA    1 
ATOM   4874 C  C     . LEU F  3 18  ? -8.958  6.277   36.812  1.00 26.22 ? 18   LEU D C     1 
ATOM   4875 O  O     . LEU F  3 18  ? -9.576  6.026   37.845  1.00 26.07 ? 18   LEU D O     1 
ATOM   4876 C  CB    . LEU F  3 18  ? -9.963  5.366   34.688  1.00 25.37 ? 18   LEU D CB    1 
ATOM   4877 C  CG    . LEU F  3 18  ? -10.802 5.612   33.429  1.00 25.12 ? 18   LEU D CG    1 
ATOM   4878 C  CD1   . LEU F  3 18  ? -10.979 4.322   32.661  1.00 24.96 ? 18   LEU D CD1   1 
ATOM   4879 C  CD2   . LEU F  3 18  ? -12.158 6.219   33.771  1.00 24.50 ? 18   LEU D CD2   1 
ATOM   4880 N  N     . GLU F  3 19  ? -7.631  6.259   36.752  1.00 27.06 ? 19   GLU D N     1 
ATOM   4881 C  CA    . GLU F  3 19  ? -6.834  6.058   37.961  1.00 28.82 ? 19   GLU D CA    1 
ATOM   4882 C  C     . GLU F  3 19  ? -7.000  7.262   38.869  1.00 28.33 ? 19   GLU D C     1 
ATOM   4883 O  O     . GLU F  3 19  ? -7.203  7.124   40.073  1.00 27.43 ? 19   GLU D O     1 
ATOM   4884 C  CB    . GLU F  3 19  ? -5.352  5.895   37.639  1.00 29.54 ? 19   GLU D CB    1 
ATOM   4885 C  CG    . GLU F  3 19  ? -5.011  4.651   36.865  1.00 32.56 ? 19   GLU D CG    1 
ATOM   4886 C  CD    . GLU F  3 19  ? -3.538  4.324   36.953  1.00 34.15 ? 19   GLU D CD    1 
ATOM   4887 O  OE1   . GLU F  3 19  ? -3.056  3.512   36.134  1.00 35.58 ? 19   GLU D OE1   1 
ATOM   4888 O  OE2   . GLU F  3 19  ? -2.859  4.882   37.847  1.00 35.42 ? 19   GLU D OE2   1 
ATOM   4889 N  N     . GLU F  3 20  ? -6.901  8.444   38.274  1.00 28.44 ? 20   GLU D N     1 
ATOM   4890 C  CA    . GLU F  3 20  ? -7.007  9.672   39.026  1.00 28.50 ? 20   GLU D CA    1 
ATOM   4891 C  C     . GLU F  3 20  ? -8.322  9.704   39.773  1.00 28.18 ? 20   GLU D C     1 
ATOM   4892 O  O     . GLU F  3 20  ? -8.346  9.974   40.963  1.00 28.83 ? 20   GLU D O     1 
ATOM   4893 C  CB    . GLU F  3 20  ? -6.904  10.886  38.112  1.00 28.75 ? 20   GLU D CB    1 
ATOM   4894 C  CG    . GLU F  3 20  ? -6.885  12.190  38.877  1.00 29.05 ? 20   GLU D CG    1 
ATOM   4895 C  CD    . GLU F  3 20  ? -6.883  13.399  37.974  1.00 30.08 ? 20   GLU D CD    1 
ATOM   4896 O  OE1   . GLU F  3 20  ? -7.976  13.797  37.500  1.00 29.75 ? 20   GLU D OE1   1 
ATOM   4897 O  OE2   . GLU F  3 20  ? -5.783  13.958  37.753  1.00 30.75 ? 20   GLU D OE2   1 
ATOM   4898 N  N     . GLU F  3 21  ? -9.411  9.412   39.075  1.00 27.63 ? 21   GLU D N     1 
ATOM   4899 C  CA    . GLU F  3 21  ? -10.729 9.450   39.680  1.00 27.84 ? 21   GLU D CA    1 
ATOM   4900 C  C     . GLU F  3 21  ? -10.986 8.259   40.587  1.00 28.65 ? 21   GLU D C     1 
ATOM   4901 O  O     . GLU F  3 21  ? -11.954 8.250   41.347  1.00 29.46 ? 21   GLU D O     1 
ATOM   4902 C  CB    . GLU F  3 21  ? -11.801 9.487   38.607  1.00 27.73 ? 21   GLU D CB    1 
ATOM   4903 C  CG    . GLU F  3 21  ? -11.694 10.641  37.658  1.00 28.06 ? 21   GLU D CG    1 
ATOM   4904 C  CD    . GLU F  3 21  ? -12.624 10.461  36.496  1.00 28.84 ? 21   GLU D CD    1 
ATOM   4905 O  OE1   . GLU F  3 21  ? -13.477 9.550   36.572  1.00 28.98 ? 21   GLU D OE1   1 
ATOM   4906 O  OE2   . GLU F  3 21  ? -12.508 11.216  35.510  1.00 29.84 ? 21   GLU D OE2   1 
ATOM   4907 N  N     . GLY F  3 22  ? -10.127 7.249   40.489  1.00 29.52 ? 22   GLY D N     1 
ATOM   4908 C  CA    . GLY F  3 22  ? -10.247 6.050   41.306  1.00 28.51 ? 22   GLY D CA    1 
ATOM   4909 C  C     . GLY F  3 22  ? -11.309 5.076   40.830  1.00 28.70 ? 22   GLY D C     1 
ATOM   4910 O  O     . GLY F  3 22  ? -11.658 4.137   41.544  1.00 28.72 ? 22   GLY D O     1 
ATOM   4911 N  N     . VAL F  3 23  ? -11.834 5.277   39.626  1.00 28.58 ? 23   VAL D N     1 
ATOM   4912 C  CA    . VAL F  3 23  ? -12.775 4.298   39.085  1.00 28.56 ? 23   VAL D CA    1 
ATOM   4913 C  C     . VAL F  3 23  ? -12.060 3.089   38.469  1.00 28.96 ? 23   VAL D C     1 
ATOM   4914 O  O     . VAL F  3 23  ? -10.950 3.196   37.937  1.00 29.06 ? 23   VAL D O     1 
ATOM   4915 C  CB    . VAL F  3 23  ? -13.800 4.923   38.117  1.00 27.89 ? 23   VAL D CB    1 
ATOM   4916 C  CG1   . VAL F  3 23  ? -13.375 6.308   37.713  1.00 28.10 ? 23   VAL D CG1   1 
ATOM   4917 C  CG2   . VAL F  3 23  ? -14.026 4.020   36.907  1.00 27.70 ? 23   VAL D CG2   1 
ATOM   4918 N  N     . THR F  3 24  ? -12.692 1.929   38.583  1.00 29.32 ? 24   THR D N     1 
ATOM   4919 C  CA    . THR F  3 24  ? -12.120 0.693   38.066  1.00 29.34 ? 24   THR D CA    1 
ATOM   4920 C  C     . THR F  3 24  ? -11.876 0.808   36.562  1.00 28.39 ? 24   THR D C     1 
ATOM   4921 O  O     . THR F  3 24  ? -12.787 1.127   35.799  1.00 28.87 ? 24   THR D O     1 
ATOM   4922 C  CB    . THR F  3 24  ? -13.043 -0.508  38.379  1.00 29.84 ? 24   THR D CB    1 
ATOM   4923 O  OG1   . THR F  3 24  ? -13.264 -0.580  39.793  1.00 29.96 ? 24   THR D OG1   1 
ATOM   4924 C  CG2   . THR F  3 24  ? -12.419 -1.800  37.911  1.00 30.32 ? 24   THR D CG2   1 
ATOM   4925 N  N     . PRO F  3 25  ? -10.636 0.549   36.132  1.00 27.63 ? 25   PRO D N     1 
ATOM   4926 C  CA    . PRO F  3 25  ? -10.227 0.692   34.734  1.00 26.62 ? 25   PRO D CA    1 
ATOM   4927 C  C     . PRO F  3 25  ? -10.660 -0.447  33.799  1.00 25.98 ? 25   PRO D C     1 
ATOM   4928 O  O     . PRO F  3 25  ? -9.867  -1.332  33.487  1.00 25.76 ? 25   PRO D O     1 
ATOM   4929 C  CB    . PRO F  3 25  ? -8.692  0.758   34.820  1.00 27.05 ? 25   PRO D CB    1 
ATOM   4930 C  CG    . PRO F  3 25  ? -8.339  0.666   36.290  1.00 27.62 ? 25   PRO D CG    1 
ATOM   4931 C  CD    . PRO F  3 25  ? -9.526  0.106   36.989  1.00 28.01 ? 25   PRO D CD    1 
ATOM   4932 N  N     . LEU F  3 26  ? -11.900 -0.416  33.328  1.00 25.36 ? 26   LEU D N     1 
ATOM   4933 C  CA    . LEU F  3 26  ? -12.350 -1.435  32.391  1.00 24.94 ? 26   LEU D CA    1 
ATOM   4934 C  C     . LEU F  3 26  ? -12.492 -0.846  31.004  1.00 25.73 ? 26   LEU D C     1 
ATOM   4935 O  O     . LEU F  3 26  ? -12.623 0.366   30.844  1.00 26.02 ? 26   LEU D O     1 
ATOM   4936 C  CB    . LEU F  3 26  ? -13.687 -2.033  32.825  1.00 24.26 ? 26   LEU D CB    1 
ATOM   4937 C  CG    . LEU F  3 26  ? -13.758 -2.698  34.199  1.00 23.48 ? 26   LEU D CG    1 
ATOM   4938 C  CD1   . LEU F  3 26  ? -15.127 -3.338  34.408  1.00 22.34 ? 26   LEU D CD1   1 
ATOM   4939 C  CD2   . LEU F  3 26  ? -12.635 -3.719  34.363  1.00 22.94 ? 26   LEU D CD2   1 
ATOM   4940 N  N     . ARG F  3 27  ? -12.470 -1.717  30.000  1.00 25.87 ? 27   ARG D N     1 
ATOM   4941 C  CA    . ARG F  3 27  ? -12.700 -1.320  28.616  1.00 24.50 ? 27   ARG D CA    1 
ATOM   4942 C  C     . ARG F  3 27  ? -14.066 -0.653  28.431  1.00 24.22 ? 27   ARG D C     1 
ATOM   4943 O  O     . ARG F  3 27  ? -14.200 0.340   27.691  1.00 23.68 ? 27   ARG D O     1 
ATOM   4944 C  CB    . ARG F  3 27  ? -12.582 -2.539  27.709  1.00 24.56 ? 27   ARG D CB    1 
ATOM   4945 C  CG    . ARG F  3 27  ? -11.151 -2.942  27.434  1.00 25.00 ? 27   ARG D CG    1 
ATOM   4946 C  CD    . ARG F  3 27  ? -11.069 -4.342  26.886  1.00 25.21 ? 27   ARG D CD    1 
ATOM   4947 N  NE    . ARG F  3 27  ? -11.239 -5.327  27.946  1.00 25.89 ? 27   ARG D NE    1 
ATOM   4948 C  CZ    . ARG F  3 27  ? -10.841 -6.591  27.861  1.00 25.87 ? 27   ARG D CZ    1 
ATOM   4949 N  NH1   . ARG F  3 27  ? -10.242 -7.028  26.757  1.00 24.83 ? 27   ARG D NH1   1 
ATOM   4950 N  NH2   . ARG F  3 27  ? -11.040 -7.415  28.884  1.00 26.10 ? 27   ARG D NH2   1 
ATOM   4951 N  N     . ALA F  3 28  ? -15.078 -1.192  29.106  1.00 22.97 ? 28   ALA D N     1 
ATOM   4952 C  CA    . ALA F  3 28  ? -16.407 -0.613  29.011  1.00 22.99 ? 28   ALA D CA    1 
ATOM   4953 C  C     . ALA F  3 28  ? -16.275 0.842   29.395  1.00 22.72 ? 28   ALA D C     1 
ATOM   4954 O  O     . ALA F  3 28  ? -16.946 1.702   28.842  1.00 23.50 ? 28   ALA D O     1 
ATOM   4955 C  CB    . ALA F  3 28  ? -17.379 -1.325  29.920  1.00 21.95 ? 28   ALA D CB    1 
ATOM   4956 N  N     . ARG F  3 29  ? -15.366 1.105   30.326  1.00 22.85 ? 29   ARG D N     1 
ATOM   4957 C  CA    . ARG F  3 29  ? -15.114 2.450   30.811  1.00 22.93 ? 29   ARG D CA    1 
ATOM   4958 C  C     . ARG F  3 29  ? -14.587 3.367   29.700  1.00 23.10 ? 29   ARG D C     1 
ATOM   4959 O  O     . ARG F  3 29  ? -14.983 4.532   29.609  1.00 22.60 ? 29   ARG D O     1 
ATOM   4960 C  CB    . ARG F  3 29  ? -14.131 2.391   31.977  1.00 23.52 ? 29   ARG D CB    1 
ATOM   4961 C  CG    . ARG F  3 29  ? -14.514 3.253   33.155  1.00 25.01 ? 29   ARG D CG    1 
ATOM   4962 C  CD    . ARG F  3 29  ? -15.978 3.047   33.534  1.00 25.27 ? 29   ARG D CD    1 
ATOM   4963 N  NE    . ARG F  3 29  ? -16.299 1.633   33.689  1.00 25.37 ? 29   ARG D NE    1 
ATOM   4964 C  CZ    . ARG F  3 29  ? -17.490 1.119   33.419  1.00 25.31 ? 29   ARG D CZ    1 
ATOM   4965 N  NH1   . ARG F  3 29  ? -18.461 1.910   32.972  1.00 24.88 ? 29   ARG D NH1   1 
ATOM   4966 N  NH2   . ARG F  3 29  ? -17.700 -0.179  33.576  1.00 24.51 ? 29   ARG D NH2   1 
ATOM   4967 N  N     . ILE F  3 30  ? -13.713 2.837   28.844  1.00 22.78 ? 30   ILE D N     1 
ATOM   4968 C  CA    . ILE F  3 30  ? -13.189 3.623   27.735  1.00 22.67 ? 30   ILE D CA    1 
ATOM   4969 C  C     . ILE F  3 30  ? -14.229 3.845   26.630  1.00 23.14 ? 30   ILE D C     1 
ATOM   4970 O  O     . ILE F  3 30  ? -14.234 4.879   25.962  1.00 23.38 ? 30   ILE D O     1 
ATOM   4971 C  CB    . ILE F  3 30  ? -11.891 3.027   27.168  1.00 22.61 ? 30   ILE D CB    1 
ATOM   4972 C  CG1   . ILE F  3 30  ? -10.772 3.140   28.202  1.00 22.14 ? 30   ILE D CG1   1 
ATOM   4973 C  CG2   . ILE F  3 30  ? -11.462 3.761   25.900  1.00 21.59 ? 30   ILE D CG2   1 
ATOM   4974 C  CD1   . ILE F  3 30  ? -9.485  2.430   27.796  1.00 22.03 ? 30   ILE D CD1   1 
ATOM   4975 N  N     . ALA F  3 31  ? -15.125 2.882   26.455  1.00 23.72 ? 31   ALA D N     1 
ATOM   4976 C  CA    . ALA F  3 31  ? -16.172 3.013   25.453  1.00 23.88 ? 31   ALA D CA    1 
ATOM   4977 C  C     . ALA F  3 31  ? -17.108 4.175   25.777  1.00 24.97 ? 31   ALA D C     1 
ATOM   4978 O  O     . ALA F  3 31  ? -17.533 4.909   24.879  1.00 26.18 ? 31   ALA D O     1 
ATOM   4979 C  CB    . ALA F  3 31  ? -16.955 1.703   25.310  1.00 23.08 ? 31   ALA D CB    1 
ATOM   4980 N  N     . GLU F  3 32  ? -17.432 4.352   27.055  1.00 25.33 ? 32   GLU D N     1 
ATOM   4981 C  CA    . GLU F  3 32  ? -18.362 5.418   27.438  1.00 25.93 ? 32   GLU D CA    1 
ATOM   4982 C  C     . GLU F  3 32  ? -17.793 6.798   27.156  1.00 25.51 ? 32   GLU D C     1 
ATOM   4983 O  O     . GLU F  3 32  ? -18.434 7.622   26.503  1.00 24.46 ? 32   GLU D O     1 
ATOM   4984 C  CB    . GLU F  3 32  ? -18.722 5.318   28.912  1.00 27.11 ? 32   GLU D CB    1 
ATOM   4985 C  CG    . GLU F  3 32  ? -19.767 4.285   29.212  1.00 28.96 ? 32   GLU D CG    1 
ATOM   4986 C  CD    . GLU F  3 32  ? -19.745 3.853   30.667  1.00 30.54 ? 32   GLU D CD    1 
ATOM   4987 O  OE1   . GLU F  3 32  ? -19.122 4.569   31.494  1.00 30.63 ? 32   GLU D OE1   1 
ATOM   4988 O  OE2   . GLU F  3 32  ? -20.344 2.792   30.973  1.00 30.96 ? 32   GLU D OE2   1 
ATOM   4989 N  N     . ARG F  3 33  ? -16.584 7.038   27.658  1.00 25.46 ? 33   ARG D N     1 
ATOM   4990 C  CA    . ARG F  3 33  ? -15.943 8.347   27.559  1.00 25.22 ? 33   ARG D CA    1 
ATOM   4991 C  C     . ARG F  3 33  ? -15.503 8.714   26.145  1.00 24.84 ? 33   ARG D C     1 
ATOM   4992 O  O     . ARG F  3 33  ? -15.693 9.844   25.696  1.00 24.71 ? 33   ARG D O     1 
ATOM   4993 C  CB    . ARG F  3 33  ? -14.766 8.409   28.518  1.00 25.34 ? 33   ARG D CB    1 
ATOM   4994 C  CG    . ARG F  3 33  ? -15.143 7.917   29.888  1.00 25.44 ? 33   ARG D CG    1 
ATOM   4995 C  CD    . ARG F  3 33  ? -14.361 8.606   30.964  1.00 24.85 ? 33   ARG D CD    1 
ATOM   4996 N  NE    . ARG F  3 33  ? -14.845 8.183   32.267  1.00 24.46 ? 33   ARG D NE    1 
ATOM   4997 C  CZ    . ARG F  3 33  ? -14.439 8.695   33.422  1.00 23.54 ? 33   ARG D CZ    1 
ATOM   4998 N  NH1   . ARG F  3 33  ? -13.528 9.654   33.444  1.00 22.17 ? 33   ARG D NH1   1 
ATOM   4999 N  NH2   . ARG F  3 33  ? -14.944 8.232   34.556  1.00 23.60 ? 33   ARG D NH2   1 
ATOM   5000 N  N     . LEU F  3 34  ? -14.927 7.759   25.431  1.00 24.05 ? 34   LEU D N     1 
ATOM   5001 C  CA    . LEU F  3 34  ? -14.526 8.029   24.060  1.00 23.49 ? 34   LEU D CA    1 
ATOM   5002 C  C     . LEU F  3 34  ? -15.647 7.738   23.060  1.00 23.53 ? 34   LEU D C     1 
ATOM   5003 O  O     . LEU F  3 34  ? -15.499 7.979   21.861  1.00 25.17 ? 34   LEU D O     1 
ATOM   5004 C  CB    . LEU F  3 34  ? -13.240 7.280   23.728  1.00 22.73 ? 34   LEU D CB    1 
ATOM   5005 C  CG    . LEU F  3 34  ? -12.130 7.685   24.703  1.00 22.49 ? 34   LEU D CG    1 
ATOM   5006 C  CD1   . LEU F  3 34  ? -10.792 7.061   24.341  1.00 22.71 ? 34   LEU D CD1   1 
ATOM   5007 C  CD2   . LEU F  3 34  ? -12.015 9.194   24.737  1.00 22.28 ? 34   LEU D CD2   1 
ATOM   5008 N  N     . ASP F  3 35  ? -16.767 7.226   23.563  1.00 22.02 ? 35   ASP D N     1 
ATOM   5009 C  CA    . ASP F  3 35  ? -17.948 6.980   22.741  1.00 21.98 ? 35   ASP D CA    1 
ATOM   5010 C  C     . ASP F  3 35  ? -17.679 6.060   21.557  1.00 21.05 ? 35   ASP D C     1 
ATOM   5011 O  O     . ASP F  3 35  ? -18.110 6.328   20.437  1.00 20.73 ? 35   ASP D O     1 
ATOM   5012 C  CB    . ASP F  3 35  ? -18.544 8.296   22.242  1.00 23.47 ? 35   ASP D CB    1 
ATOM   5013 C  CG    . ASP F  3 35  ? -19.881 8.103   21.533  1.00 24.70 ? 35   ASP D CG    1 
ATOM   5014 O  OD1   . ASP F  3 35  ? -20.270 8.996   20.758  1.00 26.35 ? 35   ASP D OD1   1 
ATOM   5015 O  OD2   . ASP F  3 35  ? -20.542 7.063   21.737  1.00 25.52 ? 35   ASP D OD2   1 
ATOM   5016 N  N     . GLN F  3 36  ? -16.964 4.977   21.803  1.00 19.67 ? 36   GLN D N     1 
ATOM   5017 C  CA    . GLN F  3 36  ? -16.719 4.007   20.760  1.00 19.31 ? 36   GLN D CA    1 
ATOM   5018 C  C     . GLN F  3 36  ? -17.395 2.713   21.181  1.00 19.76 ? 36   GLN D C     1 
ATOM   5019 O  O     . GLN F  3 36  ? -17.903 2.613   22.302  1.00 19.26 ? 36   GLN D O     1 
ATOM   5020 C  CB    . GLN F  3 36  ? -15.216 3.803   20.548  1.00 19.16 ? 36   GLN D CB    1 
ATOM   5021 C  CG    . GLN F  3 36  ? -14.448 5.082   20.221  1.00 17.91 ? 36   GLN D CG    1 
ATOM   5022 C  CD    . GLN F  3 36  ? -12.955 4.841   20.020  1.00 17.37 ? 36   GLN D CD    1 
ATOM   5023 O  OE1   . GLN F  3 36  ? -12.361 3.989   20.677  1.00 15.93 ? 36   GLN D OE1   1 
ATOM   5024 N  NE2   . GLN F  3 36  ? -12.345 5.600   19.115  1.00 15.43 ? 36   GLN D NE2   1 
ATOM   5025 N  N     . SER F  3 37  ? -17.415 1.730   20.284  1.00 19.82 ? 37   SER D N     1 
ATOM   5026 C  CA    . SER F  3 37  ? -18.089 0.466   20.561  1.00 19.06 ? 37   SER D CA    1 
ATOM   5027 C  C     . SER F  3 37  ? -17.165 -0.486  21.313  1.00 18.54 ? 37   SER D C     1 
ATOM   5028 O  O     . SER F  3 37  ? -15.941 -0.337  21.281  1.00 18.28 ? 37   SER D O     1 
ATOM   5029 C  CB    . SER F  3 37  ? -18.550 -0.186  19.264  1.00 19.09 ? 37   SER D CB    1 
ATOM   5030 O  OG    . SER F  3 37  ? -17.438 -0.741  18.593  1.00 19.77 ? 37   SER D OG    1 
ATOM   5031 N  N     . GLY F  3 38  ? -17.757 -1.462  21.992  1.00 18.07 ? 38   GLY D N     1 
ATOM   5032 C  CA    . GLY F  3 38  ? -16.978 -2.466  22.698  1.00 17.71 ? 38   GLY D CA    1 
ATOM   5033 C  C     . GLY F  3 38  ? -15.969 -3.113  21.766  1.00 17.76 ? 38   GLY D C     1 
ATOM   5034 O  O     . GLY F  3 38  ? -14.777 -3.143  22.058  1.00 18.12 ? 38   GLY D O     1 
ATOM   5035 N  N     . PRO F  3 39  ? -16.441 -3.636  20.625  1.00 17.20 ? 39   PRO D N     1 
ATOM   5036 C  CA    . PRO F  3 39  ? -15.488 -4.271  19.720  1.00 16.97 ? 39   PRO D CA    1 
ATOM   5037 C  C     . PRO F  3 39  ? -14.331 -3.331  19.375  1.00 17.58 ? 39   PRO D C     1 
ATOM   5038 O  O     . PRO F  3 39  ? -13.161 -3.744  19.407  1.00 17.99 ? 39   PRO D O     1 
ATOM   5039 C  CB    . PRO F  3 39  ? -16.337 -4.591  18.489  1.00 16.42 ? 39   PRO D CB    1 
ATOM   5040 C  CG    . PRO F  3 39  ? -17.759 -4.700  19.042  1.00 17.12 ? 39   PRO D CG    1 
ATOM   5041 C  CD    . PRO F  3 39  ? -17.831 -3.688  20.128  1.00 15.72 ? 39   PRO D CD    1 
ATOM   5042 N  N     . THR F  3 40  ? -14.650 -2.074  19.073  1.00 17.87 ? 40   THR D N     1 
ATOM   5043 C  CA    . THR F  3 40  ? -13.623 -1.088  18.716  1.00 17.79 ? 40   THR D CA    1 
ATOM   5044 C  C     . THR F  3 40  ? -12.574 -0.920  19.810  1.00 18.23 ? 40   THR D C     1 
ATOM   5045 O  O     . THR F  3 40  ? -11.374 -0.924  19.524  1.00 19.09 ? 40   THR D O     1 
ATOM   5046 C  CB    . THR F  3 40  ? -14.215 0.303   18.408  1.00 17.87 ? 40   THR D CB    1 
ATOM   5047 O  OG1   . THR F  3 40  ? -14.925 0.270   17.165  1.00 18.16 ? 40   THR D OG1   1 
ATOM   5048 C  CG2   . THR F  3 40  ? -13.106 1.337   18.311  1.00 17.94 ? 40   THR D CG2   1 
ATOM   5049 N  N     . VAL F  3 41  ? -13.006 -0.767  21.058  1.00 17.41 ? 41   VAL D N     1 
ATOM   5050 C  CA    . VAL F  3 41  ? -12.026 -0.563  22.119  1.00 18.14 ? 41   VAL D CA    1 
ATOM   5051 C  C     . VAL F  3 41  ? -11.219 -1.814  22.464  1.00 18.68 ? 41   VAL D C     1 
ATOM   5052 O  O     . VAL F  3 41  ? -10.019 -1.724  22.742  1.00 19.05 ? 41   VAL D O     1 
ATOM   5053 C  CB    . VAL F  3 41  ? -12.609 0.141   23.374  1.00 17.79 ? 41   VAL D CB    1 
ATOM   5054 C  CG1   . VAL F  3 41  ? -14.106 0.262   23.287  1.00 17.20 ? 41   VAL D CG1   1 
ATOM   5055 C  CG2   . VAL F  3 41  ? -12.153 -0.556  24.646  1.00 17.28 ? 41   VAL D CG2   1 
ATOM   5056 N  N     . SER F  3 42  ? -11.857 -2.979  22.407  1.00 18.94 ? 42   SER D N     1 
ATOM   5057 C  CA    . SER F  3 42  ? -11.140 -4.237  22.588  1.00 19.56 ? 42   SER D CA    1 
ATOM   5058 C  C     . SER F  3 42  ? -9.996  -4.368  21.593  1.00 20.03 ? 42   SER D C     1 
ATOM   5059 O  O     . SER F  3 42  ? -8.857  -4.644  21.976  1.00 19.53 ? 42   SER D O     1 
ATOM   5060 C  CB    . SER F  3 42  ? -12.082 -5.416  22.429  1.00 20.13 ? 42   SER D CB    1 
ATOM   5061 O  OG    . SER F  3 42  ? -13.048 -5.426  23.463  1.00 22.11 ? 42   SER D OG    1 
ATOM   5062 N  N     . GLN F  3 43  ? -10.294 -4.160  20.314  1.00 20.47 ? 43   GLN D N     1 
ATOM   5063 C  CA    . GLN F  3 43  ? -9.248  -4.223  19.283  1.00 21.95 ? 43   GLN D CA    1 
ATOM   5064 C  C     . GLN F  3 43  ? -8.069  -3.325  19.627  1.00 21.39 ? 43   GLN D C     1 
ATOM   5065 O  O     . GLN F  3 43  ? -6.937  -3.789  19.816  1.00 21.86 ? 43   GLN D O     1 
ATOM   5066 C  CB    . GLN F  3 43  ? -9.799  -3.812  17.919  1.00 22.16 ? 43   GLN D CB    1 
ATOM   5067 C  CG    . GLN F  3 43  ? -10.474 -4.936  17.165  1.00 23.59 ? 43   GLN D CG    1 
ATOM   5068 C  CD    . GLN F  3 43  ? -9.536  -6.092  16.888  1.00 24.35 ? 43   GLN D CD    1 
ATOM   5069 O  OE1   . GLN F  3 43  ? -9.830  -7.227  17.255  1.00 25.86 ? 43   GLN D OE1   1 
ATOM   5070 N  NE2   . GLN F  3 43  ? -8.400  -5.814  16.240  1.00 23.96 ? 43   GLN D NE2   1 
ATOM   5071 N  N     . THR F  3 44  ? -8.354  -2.031  19.712  1.00 19.79 ? 44   THR D N     1 
ATOM   5072 C  CA    . THR F  3 44  ? -7.335  -1.051  19.999  1.00 18.38 ? 44   THR D CA    1 
ATOM   5073 C  C     . THR F  3 44  ? -6.570  -1.398  21.268  1.00 19.06 ? 44   THR D C     1 
ATOM   5074 O  O     . THR F  3 44  ? -5.353  -1.217  21.323  1.00 20.07 ? 44   THR D O     1 
ATOM   5075 C  CB    . THR F  3 44  ? -7.928  0.357   20.088  1.00 17.06 ? 44   THR D CB    1 
ATOM   5076 O  OG1   . THR F  3 44  ? -8.539  0.684   18.833  1.00 15.62 ? 44   THR D OG1   1 
ATOM   5077 C  CG2   . THR F  3 44  ? -6.846  1.373   20.403  1.00 15.20 ? 44   THR D CG2   1 
ATOM   5078 N  N     . VAL F  3 45  ? -7.260  -1.921  22.277  1.00 19.13 ? 45   VAL D N     1 
ATOM   5079 C  CA    . VAL F  3 45  ? -6.570  -2.217  23.527  1.00 19.19 ? 45   VAL D CA    1 
ATOM   5080 C  C     . VAL F  3 45  ? -5.564  -3.320  23.303  1.00 19.65 ? 45   VAL D C     1 
ATOM   5081 O  O     . VAL F  3 45  ? -4.403  -3.207  23.709  1.00 21.11 ? 45   VAL D O     1 
ATOM   5082 C  CB    . VAL F  3 45  ? -7.517  -2.582  24.688  1.00 18.24 ? 45   VAL D CB    1 
ATOM   5083 C  CG1   . VAL F  3 45  ? -6.773  -3.395  25.738  1.00 16.52 ? 45   VAL D CG1   1 
ATOM   5084 C  CG2   . VAL F  3 45  ? -8.069  -1.322  25.310  1.00 17.70 ? 45   VAL D CG2   1 
ATOM   5085 N  N     . SER F  3 46  ? -6.001  -4.378  22.635  1.00 19.78 ? 46   SER D N     1 
ATOM   5086 C  CA    . SER F  3 46  ? -5.120  -5.503  22.399  1.00 20.09 ? 46   SER D CA    1 
ATOM   5087 C  C     . SER F  3 46  ? -3.962  -5.090  21.500  1.00 20.32 ? 46   SER D C     1 
ATOM   5088 O  O     . SER F  3 46  ? -2.894  -5.679  21.576  1.00 21.50 ? 46   SER D O     1 
ATOM   5089 C  CB    . SER F  3 46  ? -5.882  -6.690  21.817  1.00 19.92 ? 46   SER D CB    1 
ATOM   5090 O  OG    . SER F  3 46  ? -6.053  -6.545  20.430  1.00 19.65 ? 46   SER D OG    1 
ATOM   5091 N  N     . ARG F  3 47  ? -4.160  -4.068  20.667  1.00 21.02 ? 47   ARG D N     1 
ATOM   5092 C  CA    . ARG F  3 47  ? -3.041  -3.492  19.910  1.00 22.27 ? 47   ARG D CA    1 
ATOM   5093 C  C     . ARG F  3 47  ? -1.995  -2.838  20.803  1.00 23.58 ? 47   ARG D C     1 
ATOM   5094 O  O     . ARG F  3 47  ? -0.796  -2.930  20.531  1.00 24.63 ? 47   ARG D O     1 
ATOM   5095 C  CB    . ARG F  3 47  ? -3.518  -2.465  18.884  1.00 21.99 ? 47   ARG D CB    1 
ATOM   5096 C  CG    . ARG F  3 47  ? -3.589  -2.990  17.458  1.00 21.49 ? 47   ARG D CG    1 
ATOM   5097 C  CD    . ARG F  3 47  ? -3.548  -1.851  16.418  1.00 21.70 ? 47   ARG D CD    1 
ATOM   5098 N  NE    . ARG F  3 47  ? -4.299  -0.651  16.806  1.00 20.62 ? 47   ARG D NE    1 
ATOM   5099 C  CZ    . ARG F  3 47  ? -5.626  -0.563  16.833  1.00 19.60 ? 47   ARG D CZ    1 
ATOM   5100 N  NH1   . ARG F  3 47  ? -6.379  -1.605  16.510  1.00 18.95 ? 47   ARG D NH1   1 
ATOM   5101 N  NH2   . ARG F  3 47  ? -6.202  0.572   17.198  1.00 19.64 ? 47   ARG D NH2   1 
ATOM   5102 N  N     . MET F  3 48  ? -2.454  -2.155  21.850  1.00 24.83 ? 48   MET D N     1 
ATOM   5103 C  CA    . MET F  3 48  ? -1.563  -1.464  22.777  1.00 26.06 ? 48   MET D CA    1 
ATOM   5104 C  C     . MET F  3 48  ? -0.870  -2.482  23.655  1.00 27.01 ? 48   MET D C     1 
ATOM   5105 O  O     . MET F  3 48  ? 0.285   -2.293  24.057  1.00 26.84 ? 48   MET D O     1 
ATOM   5106 C  CB    . MET F  3 48  ? -2.351  -0.485  23.644  1.00 26.32 ? 48   MET D CB    1 
ATOM   5107 C  CG    . MET F  3 48  ? -2.997  0.634   22.862  1.00 26.07 ? 48   MET D CG    1 
ATOM   5108 S  SD    . MET F  3 48  ? -4.247  1.512   23.810  1.00 26.76 ? 48   MET D SD    1 
ATOM   5109 C  CE    . MET F  3 48  ? -3.228  2.411   24.982  1.00 26.54 ? 48   MET D CE    1 
ATOM   5110 N  N     . GLU F  3 49  ? -1.600  -3.558  23.954  1.00 27.68 ? 49   GLU D N     1 
ATOM   5111 C  CA    . GLU F  3 49  ? -1.039  -4.734  24.614  1.00 28.66 ? 49   GLU D CA    1 
ATOM   5112 C  C     . GLU F  3 49  ? 0.098   -5.311  23.773  1.00 28.23 ? 49   GLU D C     1 
ATOM   5113 O  O     . GLU F  3 49  ? 1.192   -5.570  24.277  1.00 28.07 ? 49   GLU D O     1 
ATOM   5114 C  CB    . GLU F  3 49  ? -2.130  -5.779  24.810  1.00 30.03 ? 49   GLU D CB    1 
ATOM   5115 C  CG    . GLU F  3 49  ? -1.736  -6.980  25.642  1.00 31.80 ? 49   GLU D CG    1 
ATOM   5116 C  CD    . GLU F  3 49  ? -2.956  -7.709  26.189  1.00 33.32 ? 49   GLU D CD    1 
ATOM   5117 O  OE1   . GLU F  3 49  ? -2.831  -8.348  27.251  1.00 34.60 ? 49   GLU D OE1   1 
ATOM   5118 O  OE2   . GLU F  3 49  ? -4.048  -7.631  25.573  1.00 34.53 ? 49   GLU D OE2   1 
ATOM   5119 N  N     . ARG F  3 50  ? -0.167  -5.494  22.483  1.00 27.58 ? 50   ARG D N     1 
ATOM   5120 C  CA    . ARG F  3 50  ? 0.848   -5.977  21.562  1.00 27.65 ? 50   ARG D CA    1 
ATOM   5121 C  C     . ARG F  3 50  ? 2.091   -5.097  21.632  1.00 26.66 ? 50   ARG D C     1 
ATOM   5122 O  O     . ARG F  3 50  ? 3.209   -5.596  21.627  1.00 26.66 ? 50   ARG D O     1 
ATOM   5123 C  CB    . ARG F  3 50  ? 0.304   -6.022  20.133  1.00 27.55 ? 50   ARG D CB    1 
ATOM   5124 C  CG    . ARG F  3 50  ? 1.359   -6.286  19.057  1.00 27.24 ? 50   ARG D CG    1 
ATOM   5125 C  CD    . ARG F  3 50  ? 0.832   -5.876  17.687  1.00 27.30 ? 50   ARG D CD    1 
ATOM   5126 N  NE    . ARG F  3 50  ? 0.767   -4.420  17.553  1.00 27.82 ? 50   ARG D NE    1 
ATOM   5127 C  CZ    . ARG F  3 50  ? 0.031   -3.777  16.651  1.00 27.46 ? 50   ARG D CZ    1 
ATOM   5128 N  NH1   . ARG F  3 50  ? -0.724  -4.453  15.801  1.00 28.20 ? 50   ARG D NH1   1 
ATOM   5129 N  NH2   . ARG F  3 50  ? 0.041   -2.454  16.602  1.00 27.14 ? 50   ARG D NH2   1 
ATOM   5130 N  N     . ASP F  3 51  ? 1.893   -3.789  21.720  1.00 25.82 ? 51   ASP D N     1 
ATOM   5131 C  CA    . ASP F  3 51  ? 3.021   -2.862  21.711  1.00 25.84 ? 51   ASP D CA    1 
ATOM   5132 C  C     . ASP F  3 51  ? 3.549   -2.569  23.117  1.00 25.46 ? 51   ASP D C     1 
ATOM   5133 O  O     . ASP F  3 51  ? 4.368   -1.673  23.310  1.00 24.82 ? 51   ASP D O     1 
ATOM   5134 C  CB    . ASP F  3 51  ? 2.656   -1.572  20.967  1.00 25.62 ? 51   ASP D CB    1 
ATOM   5135 C  CG    . ASP F  3 51  ? 2.263   -1.828  19.515  1.00 26.31 ? 51   ASP D CG    1 
ATOM   5136 O  OD1   . ASP F  3 51  ? 2.625   -2.898  18.975  1.00 26.37 ? 51   ASP D OD1   1 
ATOM   5137 O  OD2   . ASP F  3 51  ? 1.588   -0.964  18.913  1.00 25.95 ? 51   ASP D OD2   1 
ATOM   5138 N  N     . GLY F  3 52  ? 3.076   -3.339  24.092  1.00 26.00 ? 52   GLY D N     1 
ATOM   5139 C  CA    . GLY F  3 52  ? 3.589   -3.254  25.460  1.00 26.01 ? 52   GLY D CA    1 
ATOM   5140 C  C     . GLY F  3 52  ? 3.277   -1.961  26.188  1.00 25.57 ? 52   GLY D C     1 
ATOM   5141 O  O     . GLY F  3 52  ? 4.093   -1.467  26.958  1.00 25.39 ? 52   GLY D O     1 
ATOM   5142 N  N     . LEU F  3 53  ? 2.095   -1.409  25.949  1.00 25.23 ? 53   LEU D N     1 
ATOM   5143 C  CA    . LEU F  3 53  ? 1.697   -0.173  26.622  1.00 25.56 ? 53   LEU D CA    1 
ATOM   5144 C  C     . LEU F  3 53  ? 0.853   -0.477  27.846  1.00 24.77 ? 53   LEU D C     1 
ATOM   5145 O  O     . LEU F  3 53  ? 0.868   0.255   28.829  1.00 25.68 ? 53   LEU D O     1 
ATOM   5146 C  CB    . LEU F  3 53  ? 0.936   0.754   25.664  1.00 25.26 ? 53   LEU D CB    1 
ATOM   5147 C  CG    . LEU F  3 53  ? 1.768   1.310   24.504  1.00 25.52 ? 53   LEU D CG    1 
ATOM   5148 C  CD1   . LEU F  3 53  ? 0.929   2.202   23.591  1.00 24.69 ? 53   LEU D CD1   1 
ATOM   5149 C  CD2   . LEU F  3 53  ? 2.968   2.081   25.047  1.00 25.61 ? 53   LEU D CD2   1 
ATOM   5150 N  N     . LEU F  3 54  ? 0.114   -1.569  27.776  1.00 25.37 ? 54   LEU D N     1 
ATOM   5151 C  CA    . LEU F  3 54  ? -0.754  -1.970  28.861  1.00 26.35 ? 54   LEU D CA    1 
ATOM   5152 C  C     . LEU F  3 54  ? -0.929  -3.482  28.821  1.00 27.81 ? 54   LEU D C     1 
ATOM   5153 O  O     . LEU F  3 54  ? -0.484  -4.147  27.882  1.00 27.61 ? 54   LEU D O     1 
ATOM   5154 C  CB    . LEU F  3 54  ? -2.110  -1.272  28.737  1.00 25.62 ? 54   LEU D CB    1 
ATOM   5155 C  CG    . LEU F  3 54  ? -2.802  -1.374  27.371  1.00 25.58 ? 54   LEU D CG    1 
ATOM   5156 C  CD1   . LEU F  3 54  ? -3.602  -2.662  27.239  1.00 25.86 ? 54   LEU D CD1   1 
ATOM   5157 C  CD2   . LEU F  3 54  ? -3.705  -0.183  27.142  1.00 25.51 ? 54   LEU D CD2   1 
ATOM   5158 N  N     . ARG F  3 55  ? -1.578  -4.022  29.845  1.00 29.50 ? 55   ARG D N     1 
ATOM   5159 C  CA    . ARG F  3 55  ? -1.901  -5.431  29.862  1.00 30.75 ? 55   ARG D CA    1 
ATOM   5160 C  C     . ARG F  3 55  ? -3.231  -5.657  30.558  1.00 30.60 ? 55   ARG D C     1 
ATOM   5161 O  O     . ARG F  3 55  ? -3.574  -4.942  31.490  1.00 30.90 ? 55   ARG D O     1 
ATOM   5162 C  CB    . ARG F  3 55  ? -0.780  -6.226  30.531  1.00 32.67 ? 55   ARG D CB    1 
ATOM   5163 C  CG    . ARG F  3 55  ? -0.370  -5.718  31.908  1.00 34.71 ? 55   ARG D CG    1 
ATOM   5164 C  CD    . ARG F  3 55  ? 1.160   -5.698  32.056  1.00 36.82 ? 55   ARG D CD    1 
ATOM   5165 N  NE    . ARG F  3 55  ? 1.816   -6.784  31.322  1.00 37.84 ? 55   ARG D NE    1 
ATOM   5166 C  CZ    . ARG F  3 55  ? 2.080   -7.981  31.841  1.00 38.85 ? 55   ARG D CZ    1 
ATOM   5167 N  NH1   . ARG F  3 55  ? 1.747   -8.248  33.103  1.00 38.70 ? 55   ARG D NH1   1 
ATOM   5168 N  NH2   . ARG F  3 55  ? 2.675   -8.912  31.101  1.00 38.45 ? 55   ARG D NH2   1 
ATOM   5169 N  N     . VAL F  3 56  ? -3.985  -6.640  30.082  1.00 30.48 ? 56   VAL D N     1 
ATOM   5170 C  CA    . VAL F  3 56  ? -5.220  -7.026  30.728  1.00 31.70 ? 56   VAL D CA    1 
ATOM   5171 C  C     . VAL F  3 56  ? -4.910  -8.089  31.778  1.00 32.58 ? 56   VAL D C     1 
ATOM   5172 O  O     . VAL F  3 56  ? -4.278  -9.097  31.474  1.00 33.24 ? 56   VAL D O     1 
ATOM   5173 C  CB    . VAL F  3 56  ? -6.222  -7.587  29.707  1.00 31.86 ? 56   VAL D CB    1 
ATOM   5174 C  CG1   . VAL F  3 56  ? -7.618  -7.624  30.303  1.00 31.31 ? 56   VAL D CG1   1 
ATOM   5175 C  CG2   . VAL F  3 56  ? -6.205  -6.744  28.435  1.00 31.85 ? 56   VAL D CG2   1 
ATOM   5176 N  N     . ALA F  3 57  ? -5.341  -7.863  33.015  1.00 33.44 ? 57   ALA D N     1 
ATOM   5177 C  CA    . ALA F  3 57  ? -5.076  -8.816  34.088  1.00 34.58 ? 57   ALA D CA    1 
ATOM   5178 C  C     . ALA F  3 57  ? -6.032  -10.002 34.020  1.00 35.83 ? 57   ALA D C     1 
ATOM   5179 O  O     . ALA F  3 57  ? -6.614  -10.290 32.968  1.00 36.98 ? 57   ALA D O     1 
ATOM   5180 C  CB    . ALA F  3 57  ? -5.170  -8.133  35.441  1.00 34.00 ? 57   ALA D CB    1 
ATOM   5181 N  N     . GLY F  3 58  ? -6.189  -10.694 35.142  1.00 36.51 ? 58   GLY D N     1 
ATOM   5182 C  CA    . GLY F  3 58  ? -7.159  -11.779 35.233  1.00 37.09 ? 58   GLY D CA    1 
ATOM   5183 C  C     . GLY F  3 58  ? -8.576  -11.248 35.355  1.00 37.67 ? 58   GLY D C     1 
ATOM   5184 O  O     . GLY F  3 58  ? -9.488  -11.724 34.672  1.00 38.18 ? 58   GLY D O     1 
ATOM   5185 N  N     . ASP F  3 59  ? -8.763  -10.257 36.225  1.00 37.52 ? 59   ASP D N     1 
ATOM   5186 C  CA    . ASP F  3 59  ? -10.070 -9.610  36.388  1.00 37.25 ? 59   ASP D CA    1 
ATOM   5187 C  C     . ASP F  3 59  ? -10.416 -8.660  35.237  1.00 36.49 ? 59   ASP D C     1 
ATOM   5188 O  O     . ASP F  3 59  ? -11.392 -7.922  35.318  1.00 36.22 ? 59   ASP D O     1 
ATOM   5189 C  CB    . ASP F  3 59  ? -10.160 -8.873  37.735  1.00 37.65 ? 59   ASP D CB    1 
ATOM   5190 C  CG    . ASP F  3 59  ? -8.876  -8.125  38.092  1.00 38.76 ? 59   ASP D CG    1 
ATOM   5191 O  OD1   . ASP F  3 59  ? -8.835  -7.494  39.175  1.00 39.39 ? 59   ASP D OD1   1 
ATOM   5192 O  OD2   . ASP F  3 59  ? -7.906  -8.167  37.299  1.00 38.64 ? 59   ASP D OD2   1 
ATOM   5193 N  N     . ARG F  3 60  ? -9.618  -8.689  34.170  1.00 36.47 ? 60   ARG D N     1 
ATOM   5194 C  CA    . ARG F  3 60  ? -9.833  -7.831  32.992  1.00 36.50 ? 60   ARG D CA    1 
ATOM   5195 C  C     . ARG F  3 60  ? -9.530  -6.360  33.279  1.00 35.00 ? 60   ARG D C     1 
ATOM   5196 O  O     . ARG F  3 60  ? -9.965  -5.468  32.547  1.00 34.11 ? 60   ARG D O     1 
ATOM   5197 C  CB    . ARG F  3 60  ? -11.261 -7.975  32.442  1.00 36.88 ? 60   ARG D CB    1 
ATOM   5198 C  CG    . ARG F  3 60  ? -11.626 -9.382  31.993  1.00 37.27 ? 60   ARG D CG    1 
ATOM   5199 C  CD    . ARG F  3 60  ? -13.073 -9.457  31.530  1.00 37.53 ? 60   ARG D CD    1 
ATOM   5200 N  NE    . ARG F  3 60  ? -13.989 -8.858  32.500  1.00 38.38 ? 60   ARG D NE    1 
ATOM   5201 C  CZ    . ARG F  3 60  ? -15.315 -8.994  32.472  1.00 38.69 ? 60   ARG D CZ    1 
ATOM   5202 N  NH1   . ARG F  3 60  ? -16.060 -8.401  33.404  1.00 38.09 ? 60   ARG D NH1   1 
ATOM   5203 N  NH2   . ARG F  3 60  ? -15.896 -9.719  31.513  1.00 37.82 ? 60   ARG D NH2   1 
ATOM   5204 N  N     . HIS F  3 61  ? -8.790  -6.124  34.357  1.00 33.51 ? 61   HIS D N     1 
ATOM   5205 C  CA    . HIS F  3 61  ? -8.339  -4.793  34.720  1.00 32.23 ? 61   HIS D CA    1 
ATOM   5206 C  C     . HIS F  3 61  ? -7.257  -4.339  33.748  1.00 31.96 ? 61   HIS D C     1 
ATOM   5207 O  O     . HIS F  3 61  ? -6.239  -5.017  33.575  1.00 32.69 ? 61   HIS D O     1 
ATOM   5208 C  CB    . HIS F  3 61  ? -7.756  -4.807  36.136  1.00 32.57 ? 61   HIS D CB    1 
ATOM   5209 C  CG    . HIS F  3 61  ? -8.785  -4.800  37.222  1.00 31.91 ? 61   HIS D CG    1 
ATOM   5210 N  ND1   . HIS F  3 61  ? -8.469  -4.555  38.539  1.00 32.69 ? 61   HIS D ND1   1 
ATOM   5211 C  CD2   . HIS F  3 61  ? -10.123 -4.994  37.186  1.00 31.58 ? 61   HIS D CD2   1 
ATOM   5212 C  CE1   . HIS F  3 61  ? -9.566  -4.605  39.270  1.00 31.51 ? 61   HIS D CE1   1 
ATOM   5213 N  NE2   . HIS F  3 61  ? -10.584 -4.870  38.473  1.00 31.30 ? 61   HIS D NE2   1 
ATOM   5214 N  N     . LEU F  3 62  ? -7.472  -3.193  33.117  1.00 29.98 ? 62   LEU D N     1 
ATOM   5215 C  CA    . LEU F  3 62  ? -6.465  -2.614  32.257  1.00 28.46 ? 62   LEU D CA    1 
ATOM   5216 C  C     . LEU F  3 62  ? -5.470  -1.872  33.129  1.00 29.03 ? 62   LEU D C     1 
ATOM   5217 O  O     . LEU F  3 62  ? -5.835  -0.953  33.865  1.00 29.78 ? 62   LEU D O     1 
ATOM   5218 C  CB    . LEU F  3 62  ? -7.108  -1.649  31.266  1.00 27.64 ? 62   LEU D CB    1 
ATOM   5219 C  CG    . LEU F  3 62  ? -8.310  -2.199  30.505  1.00 26.66 ? 62   LEU D CG    1 
ATOM   5220 C  CD1   . LEU F  3 62  ? -8.942  -1.113  29.684  1.00 26.74 ? 62   LEU D CD1   1 
ATOM   5221 C  CD2   . LEU F  3 62  ? -7.897  -3.352  29.628  1.00 26.59 ? 62   LEU D CD2   1 
ATOM   5222 N  N     . GLU F  3 63  ? -4.211  -2.281  33.054  1.00 28.99 ? 63   GLU D N     1 
ATOM   5223 C  CA    . GLU F  3 63  ? -3.161  -1.672  33.857  1.00 29.20 ? 63   GLU D CA    1 
ATOM   5224 C  C     . GLU F  3 63  ? -2.023  -1.232  32.953  1.00 28.24 ? 63   GLU D C     1 
ATOM   5225 O  O     . GLU F  3 63  ? -1.699  -1.913  31.988  1.00 30.29 ? 63   GLU D O     1 
ATOM   5226 C  CB    . GLU F  3 63  ? -2.680  -2.659  34.929  1.00 29.96 ? 63   GLU D CB    1 
ATOM   5227 C  CG    . GLU F  3 63  ? -3.718  -2.881  36.042  1.00 31.05 ? 63   GLU D CG    1 
ATOM   5228 C  CD    . GLU F  3 63  ? -3.536  -4.188  36.803  1.00 31.22 ? 63   GLU D CD    1 
ATOM   5229 O  OE1   . GLU F  3 63  ? -2.574  -4.926  36.506  1.00 31.12 ? 63   GLU D OE1   1 
ATOM   5230 O  OE2   . GLU F  3 63  ? -4.367  -4.478  37.698  1.00 32.41 ? 63   GLU D OE2   1 
ATOM   5231 N  N     . LEU F  3 64  ? -1.429  -0.086  33.250  1.00 26.21 ? 64   LEU D N     1 
ATOM   5232 C  CA    . LEU F  3 64  ? -0.395  0.464   32.393  1.00 23.83 ? 64   LEU D CA    1 
ATOM   5233 C  C     . LEU F  3 64  ? 0.968   -0.108  32.731  1.00 23.63 ? 64   LEU D C     1 
ATOM   5234 O  O     . LEU F  3 64  ? 1.296   -0.295  33.900  1.00 24.10 ? 64   LEU D O     1 
ATOM   5235 C  CB    . LEU F  3 64  ? -0.334  1.985   32.536  1.00 22.80 ? 64   LEU D CB    1 
ATOM   5236 C  CG    . LEU F  3 64  ? -1.571  2.824   32.231  1.00 22.17 ? 64   LEU D CG    1 
ATOM   5237 C  CD1   . LEU F  3 64  ? -1.257  4.291   32.486  1.00 22.31 ? 64   LEU D CD1   1 
ATOM   5238 C  CD2   . LEU F  3 64  ? -2.045  2.619   30.800  1.00 22.14 ? 64   LEU D CD2   1 
ATOM   5239 N  N     . THR F  3 65  ? 1.766   -0.348  31.698  1.00 23.20 ? 65   THR D N     1 
ATOM   5240 C  CA    . THR F  3 65  ? 3.146   -0.759  31.851  1.00 22.74 ? 65   THR D CA    1 
ATOM   5241 C  C     . THR F  3 65  ? 3.986   0.426   32.314  1.00 25.25 ? 65   THR D C     1 
ATOM   5242 O  O     . THR F  3 65  ? 3.472   1.525   32.514  1.00 25.99 ? 65   THR D O     1 
ATOM   5243 C  CB    . THR F  3 65  ? 3.723   -1.274  30.509  1.00 22.09 ? 65   THR D CB    1 
ATOM   5244 O  OG1   . THR F  3 65  ? 3.612   -0.250  29.509  1.00 20.73 ? 65   THR D OG1   1 
ATOM   5245 C  CG2   . THR F  3 65  ? 2.991   -2.513  30.040  1.00 19.70 ? 65   THR D CG2   1 
ATOM   5246 N  N     . GLU F  3 66  ? 5.286   0.203   32.475  1.00 27.54 ? 66   GLU D N     1 
ATOM   5247 C  CA    . GLU F  3 66  ? 6.216   1.274   32.818  1.00 28.60 ? 66   GLU D CA    1 
ATOM   5248 C  C     . GLU F  3 66  ? 6.185   2.290   31.692  1.00 28.14 ? 66   GLU D C     1 
ATOM   5249 O  O     . GLU F  3 66  ? 5.929   3.471   31.905  1.00 28.85 ? 66   GLU D O     1 
ATOM   5250 C  CB    . GLU F  3 66  ? 7.627   0.697   32.976  1.00 31.11 ? 66   GLU D CB    1 
ATOM   5251 C  CG    . GLU F  3 66  ? 8.756   1.709   33.039  1.00 33.90 ? 66   GLU D CG    1 
ATOM   5252 C  CD    . GLU F  3 66  ? 8.824   2.393   34.386  1.00 35.70 ? 66   GLU D CD    1 
ATOM   5253 O  OE1   . GLU F  3 66  ? 7.749   2.504   35.018  1.00 36.93 ? 66   GLU D OE1   1 
ATOM   5254 O  OE2   . GLU F  3 66  ? 9.933   2.811   34.813  1.00 35.79 ? 66   GLU D OE2   1 
ATOM   5255 N  N     . LYS F  3 67  ? 6.428   1.798   30.484  1.00 27.58 ? 67   LYS D N     1 
ATOM   5256 C  CA    . LYS F  3 67  ? 6.421   2.603   29.272  1.00 26.48 ? 67   LYS D CA    1 
ATOM   5257 C  C     . LYS F  3 67  ? 5.100   3.355   29.100  1.00 25.63 ? 67   LYS D C     1 
ATOM   5258 O  O     . LYS F  3 67  ? 5.084   4.576   28.932  1.00 25.02 ? 67   LYS D O     1 
ATOM   5259 C  CB    . LYS F  3 67  ? 6.664   1.676   28.087  1.00 26.63 ? 67   LYS D CB    1 
ATOM   5260 C  CG    . LYS F  3 67  ? 6.717   2.335   26.731  1.00 28.16 ? 67   LYS D CG    1 
ATOM   5261 C  CD    . LYS F  3 67  ? 6.901   1.266   25.666  1.00 28.96 ? 67   LYS D CD    1 
ATOM   5262 C  CE    . LYS F  3 67  ? 6.840   1.830   24.262  1.00 29.93 ? 67   LYS D CE    1 
ATOM   5263 N  NZ    . LYS F  3 67  ? 6.709   0.709   23.279  1.00 30.10 ? 67   LYS D NZ    1 
ATOM   5264 N  N     . GLY F  3 68  ? 3.998   2.615   29.152  1.00 25.06 ? 68   GLY D N     1 
ATOM   5265 C  CA    . GLY F  3 68  ? 2.659   3.183   29.001  1.00 24.64 ? 68   GLY D CA    1 
ATOM   5266 C  C     . GLY F  3 68  ? 2.272   4.228   30.036  1.00 24.48 ? 68   GLY D C     1 
ATOM   5267 O  O     . GLY F  3 68  ? 1.522   5.160   29.731  1.00 22.93 ? 68   GLY D O     1 
ATOM   5268 N  N     . ARG F  3 69  ? 2.770   4.075   31.264  1.00 24.55 ? 69   ARG D N     1 
ATOM   5269 C  CA    . ARG F  3 69  ? 2.540   5.082   32.299  1.00 24.33 ? 69   ARG D CA    1 
ATOM   5270 C  C     . ARG F  3 69  ? 3.273   6.371   31.946  1.00 23.51 ? 69   ARG D C     1 
ATOM   5271 O  O     . ARG F  3 69  ? 2.689   7.458   31.969  1.00 24.39 ? 69   ARG D O     1 
ATOM   5272 C  CB    . ARG F  3 69  ? 2.966   4.580   33.685  1.00 24.76 ? 69   ARG D CB    1 
ATOM   5273 C  CG    . ARG F  3 69  ? 2.744   5.602   34.810  1.00 25.14 ? 69   ARG D CG    1 
ATOM   5274 C  CD    . ARG F  3 69  ? 2.836   4.985   36.210  1.00 25.39 ? 69   ARG D CD    1 
ATOM   5275 N  NE    . ARG F  3 69  ? 1.808   3.970   36.470  1.00 25.72 ? 69   ARG D NE    1 
ATOM   5276 C  CZ    . ARG F  3 69  ? 0.501   4.218   36.546  1.00 25.66 ? 69   ARG D CZ    1 
ATOM   5277 N  NH1   . ARG F  3 69  ? 0.042   5.443   36.358  1.00 26.78 ? 69   ARG D NH1   1 
ATOM   5278 N  NH2   . ARG F  3 69  ? -0.356  3.241   36.794  1.00 25.24 ? 69   ARG D NH2   1 
ATOM   5279 N  N     . ALA F  3 70  ? 4.551   6.253   31.609  1.00 22.22 ? 70   ALA D N     1 
ATOM   5280 C  CA    . ALA F  3 70  ? 5.319   7.431   31.254  1.00 22.26 ? 70   ALA D CA    1 
ATOM   5281 C  C     . ALA F  3 70  ? 4.542   8.213   30.208  1.00 22.69 ? 70   ALA D C     1 
ATOM   5282 O  O     . ALA F  3 70  ? 4.178   9.372   30.433  1.00 22.41 ? 70   ALA D O     1 
ATOM   5283 C  CB    . ALA F  3 70  ? 6.689   7.050   30.732  1.00 21.27 ? 70   ALA D CB    1 
ATOM   5284 N  N     . LEU F  3 71  ? 4.265   7.564   29.075  1.00 22.59 ? 71   LEU D N     1 
ATOM   5285 C  CA    . LEU F  3 71  ? 3.609   8.228   27.957  1.00 21.87 ? 71   LEU D CA    1 
ATOM   5286 C  C     . LEU F  3 71  ? 2.340   8.957   28.392  1.00 21.36 ? 71   LEU D C     1 
ATOM   5287 O  O     . LEU F  3 71  ? 2.089   10.101  27.988  1.00 20.72 ? 71   LEU D O     1 
ATOM   5288 C  CB    . LEU F  3 71  ? 3.305   7.235   26.840  1.00 23.17 ? 71   LEU D CB    1 
ATOM   5289 C  CG    . LEU F  3 71  ? 4.546   6.633   26.177  1.00 24.27 ? 71   LEU D CG    1 
ATOM   5290 C  CD1   . LEU F  3 71  ? 4.186   5.878   24.905  1.00 24.01 ? 71   LEU D CD1   1 
ATOM   5291 C  CD2   . LEU F  3 71  ? 5.556   7.724   25.879  1.00 24.39 ? 71   LEU D CD2   1 
ATOM   5292 N  N     . ALA F  3 72  ? 1.540   8.307   29.228  1.00 19.83 ? 72   ALA D N     1 
ATOM   5293 C  CA    . ALA F  3 72  ? 0.286   8.919   29.641  1.00 19.59 ? 72   ALA D CA    1 
ATOM   5294 C  C     . ALA F  3 72  ? 0.566   10.205  30.412  1.00 19.37 ? 72   ALA D C     1 
ATOM   5295 O  O     . ALA F  3 72  ? -0.025  11.254  30.136  1.00 18.29 ? 72   ALA D O     1 
ATOM   5296 C  CB    . ALA F  3 72  ? -0.539  7.954   30.467  1.00 19.02 ? 72   ALA D CB    1 
ATOM   5297 N  N     . ILE F  3 73  ? 1.484   10.118  31.369  1.00 18.52 ? 73   ILE D N     1 
ATOM   5298 C  CA    . ILE F  3 73  ? 1.825   11.267  32.179  1.00 18.04 ? 73   ILE D CA    1 
ATOM   5299 C  C     . ILE F  3 73  ? 2.120   12.446  31.273  1.00 18.11 ? 73   ILE D C     1 
ATOM   5300 O  O     . ILE F  3 73  ? 1.561   13.527  31.447  1.00 19.42 ? 73   ILE D O     1 
ATOM   5301 C  CB    . ILE F  3 73  ? 3.020   10.972  33.091  1.00 18.50 ? 73   ILE D CB    1 
ATOM   5302 C  CG1   . ILE F  3 73  ? 2.610   9.987   34.199  1.00 19.31 ? 73   ILE D CG1   1 
ATOM   5303 C  CG2   . ILE F  3 73  ? 3.557   12.257  33.688  1.00 18.00 ? 73   ILE D CG2   1 
ATOM   5304 C  CD1   . ILE F  3 73  ? 3.750   9.525   35.099  1.00 18.99 ? 73   ILE D CD1   1 
ATOM   5305 N  N     . ALA F  3 74  ? 2.978   12.220  30.285  1.00 18.34 ? 74   ALA D N     1 
ATOM   5306 C  CA    . ALA F  3 74  ? 3.338   13.238  29.304  1.00 17.70 ? 74   ALA D CA    1 
ATOM   5307 C  C     . ALA F  3 74  ? 2.145   13.845  28.529  1.00 19.02 ? 74   ALA D C     1 
ATOM   5308 O  O     . ALA F  3 74  ? 2.135   15.035  28.234  1.00 19.79 ? 74   ALA D O     1 
ATOM   5309 C  CB    . ALA F  3 74  ? 4.362   12.683  28.354  1.00 16.69 ? 74   ALA D CB    1 
ATOM   5310 N  N     . VAL F  3 75  ? 1.143   13.041  28.195  1.00 20.24 ? 75   VAL D N     1 
ATOM   5311 C  CA    . VAL F  3 75  ? -0.005  13.570  27.466  1.00 21.75 ? 75   VAL D CA    1 
ATOM   5312 C  C     . VAL F  3 75  ? -0.913  14.362  28.410  1.00 23.18 ? 75   VAL D C     1 
ATOM   5313 O  O     . VAL F  3 75  ? -1.597  15.306  27.996  1.00 24.16 ? 75   VAL D O     1 
ATOM   5314 C  CB    . VAL F  3 75  ? -0.808  12.452  26.756  1.00 21.76 ? 75   VAL D CB    1 
ATOM   5315 C  CG1   . VAL F  3 75  ? -1.980  13.042  25.979  1.00 21.45 ? 75   VAL D CG1   1 
ATOM   5316 C  CG2   . VAL F  3 75  ? 0.097   11.655  25.826  1.00 21.47 ? 75   VAL D CG2   1 
ATOM   5317 N  N     . MET F  3 76  ? -0.913  13.981  29.681  1.00 24.65 ? 76   MET D N     1 
ATOM   5318 C  CA    . MET F  3 76  ? -1.685  14.703  30.693  1.00 25.88 ? 76   MET D CA    1 
ATOM   5319 C  C     . MET F  3 76  ? -0.988  16.019  31.009  1.00 24.40 ? 76   MET D C     1 
ATOM   5320 O  O     . MET F  3 76  ? -1.628  17.055  31.175  1.00 24.18 ? 76   MET D O     1 
ATOM   5321 C  CB    . MET F  3 76  ? -1.821  13.868  31.963  1.00 29.09 ? 76   MET D CB    1 
ATOM   5322 C  CG    . MET F  3 76  ? -2.519  14.583  33.095  1.00 32.42 ? 76   MET D CG    1 
ATOM   5323 S  SD    . MET F  3 76  ? -4.274  14.219  33.151  1.00 37.57 ? 76   MET D SD    1 
ATOM   5324 C  CE    . MET F  3 76  ? -4.347  13.048  34.511  1.00 35.76 ? 76   MET D CE    1 
ATOM   5325 N  N     . ARG F  3 77  ? 0.335   15.977  31.070  1.00 22.99 ? 77   ARG D N     1 
ATOM   5326 C  CA    . ARG F  3 77  ? 1.104   17.185  31.310  1.00 22.12 ? 77   ARG D CA    1 
ATOM   5327 C  C     . ARG F  3 77  ? 0.776   18.235  30.247  1.00 21.36 ? 77   ARG D C     1 
ATOM   5328 O  O     . ARG F  3 77  ? 0.539   19.404  30.564  1.00 20.42 ? 77   ARG D O     1 
ATOM   5329 C  CB    . ARG F  3 77  ? 2.604   16.875  31.329  1.00 21.97 ? 77   ARG D CB    1 
ATOM   5330 C  CG    . ARG F  3 77  ? 3.441   18.016  31.887  1.00 21.97 ? 77   ARG D CG    1 
ATOM   5331 C  CD    . ARG F  3 77  ? 4.919   17.673  31.953  1.00 22.00 ? 77   ARG D CD    1 
ATOM   5332 N  NE    . ARG F  3 77  ? 5.417   17.131  30.693  1.00 21.48 ? 77   ARG D NE    1 
ATOM   5333 C  CZ    . ARG F  3 77  ? 5.928   15.914  30.557  1.00 21.39 ? 77   ARG D CZ    1 
ATOM   5334 N  NH1   . ARG F  3 77  ? 6.023   15.115  31.604  1.00 21.37 ? 77   ARG D NH1   1 
ATOM   5335 N  NH2   . ARG F  3 77  ? 6.348   15.496  29.372  1.00 22.84 ? 77   ARG D NH2   1 
ATOM   5336 N  N     . LYS F  3 78  ? 0.748   17.796  28.990  1.00 20.81 ? 78   LYS D N     1 
ATOM   5337 C  CA    . LYS F  3 78  ? 0.423   18.670  27.861  1.00 21.35 ? 78   LYS D CA    1 
ATOM   5338 C  C     . LYS F  3 78  ? -1.008  19.199  27.933  1.00 21.14 ? 78   LYS D C     1 
ATOM   5339 O  O     . LYS F  3 78  ? -1.235  20.409  27.819  1.00 19.51 ? 78   LYS D O     1 
ATOM   5340 C  CB    . LYS F  3 78  ? 0.651   17.946  26.528  1.00 21.08 ? 78   LYS D CB    1 
ATOM   5341 C  CG    . LYS F  3 78  ? 2.090   17.462  26.335  1.00 20.72 ? 78   LYS D CG    1 
ATOM   5342 C  CD    . LYS F  3 78  ? 2.214   16.458  25.199  1.00 19.22 ? 78   LYS D CD    1 
ATOM   5343 C  CE    . LYS F  3 78  ? 3.495   15.652  25.310  1.00 18.07 ? 78   LYS D CE    1 
ATOM   5344 N  NZ    . LYS F  3 78  ? 4.615   16.384  24.702  1.00 17.37 ? 78   LYS D NZ    1 
ATOM   5345 N  N     . HIS F  3 79  ? -1.958  18.284  28.130  1.00 21.43 ? 79   HIS D N     1 
ATOM   5346 C  CA    . HIS F  3 79  ? -3.381  18.627  28.227  1.00 22.28 ? 79   HIS D CA    1 
ATOM   5347 C  C     . HIS F  3 79  ? -3.653  19.755  29.231  1.00 23.05 ? 79   HIS D C     1 
ATOM   5348 O  O     . HIS F  3 79  ? -4.467  20.655  28.979  1.00 23.52 ? 79   HIS D O     1 
ATOM   5349 C  CB    . HIS F  3 79  ? -4.196  17.387  28.602  1.00 21.54 ? 79   HIS D CB    1 
ATOM   5350 C  CG    . HIS F  3 79  ? -5.606  17.685  29.005  1.00 21.05 ? 79   HIS D CG    1 
ATOM   5351 N  ND1   . HIS F  3 79  ? -6.604  17.942  28.092  1.00 20.89 ? 79   HIS D ND1   1 
ATOM   5352 C  CD2   . HIS F  3 79  ? -6.186  17.764  30.227  1.00 21.97 ? 79   HIS D CD2   1 
ATOM   5353 C  CE1   . HIS F  3 79  ? -7.737  18.169  28.733  1.00 22.07 ? 79   HIS D CE1   1 
ATOM   5354 N  NE2   . HIS F  3 79  ? -7.510  18.069  30.031  1.00 22.96 ? 79   HIS D NE2   1 
ATOM   5355 N  N     . ARG F  3 80  ? -2.958  19.714  30.359  1.00 22.08 ? 80   ARG D N     1 
ATOM   5356 C  CA    . ARG F  3 80  ? -3.224  20.657  31.426  1.00 21.84 ? 80   ARG D CA    1 
ATOM   5357 C  C     . ARG F  3 80  ? -2.425  21.954  31.304  1.00 21.61 ? 80   ARG D C     1 
ATOM   5358 O  O     . ARG F  3 80  ? -2.922  23.025  31.659  1.00 21.26 ? 80   ARG D O     1 
ATOM   5359 C  CB    . ARG F  3 80  ? -3.065  19.975  32.790  1.00 21.62 ? 80   ARG D CB    1 
ATOM   5360 C  CG    . ARG F  3 80  ? -4.322  19.202  33.161  1.00 21.23 ? 80   ARG D CG    1 
ATOM   5361 C  CD    . ARG F  3 80  ? -4.106  18.133  34.203  1.00 21.32 ? 80   ARG D CD    1 
ATOM   5362 N  NE    . ARG F  3 80  ? -5.329  17.358  34.394  1.00 22.02 ? 80   ARG D NE    1 
ATOM   5363 C  CZ    . ARG F  3 80  ? -5.489  16.385  35.289  1.00 21.99 ? 80   ARG D CZ    1 
ATOM   5364 N  NH1   . ARG F  3 80  ? -4.498  16.046  36.107  1.00 21.37 ? 80   ARG D NH1   1 
ATOM   5365 N  NH2   . ARG F  3 80  ? -6.652  15.748  35.364  1.00 21.07 ? 80   ARG D NH2   1 
ATOM   5366 N  N     . LEU F  3 81  ? -1.202  21.874  30.790  1.00 21.47 ? 81   LEU D N     1 
ATOM   5367 C  CA    . LEU F  3 81  ? -0.470  23.095  30.469  1.00 21.56 ? 81   LEU D CA    1 
ATOM   5368 C  C     . LEU F  3 81  ? -1.198  23.845  29.350  1.00 22.22 ? 81   LEU D C     1 
ATOM   5369 O  O     . LEU F  3 81  ? -1.306  25.068  29.373  1.00 21.78 ? 81   LEU D O     1 
ATOM   5370 C  CB    . LEU F  3 81  ? 0.965   22.785  30.066  1.00 21.58 ? 81   LEU D CB    1 
ATOM   5371 C  CG    . LEU F  3 81  ? 1.912   22.371  31.198  1.00 22.52 ? 81   LEU D CG    1 
ATOM   5372 C  CD1   . LEU F  3 81  ? 3.289   22.065  30.625  1.00 21.32 ? 81   LEU D CD1   1 
ATOM   5373 C  CD2   . LEU F  3 81  ? 2.000   23.451  32.295  1.00 22.29 ? 81   LEU D CD2   1 
ATOM   5374 N  N     . ALA F  3 82  ? -1.710  23.099  28.375  1.00 23.31 ? 82   ALA D N     1 
ATOM   5375 C  CA    . ALA F  3 82  ? -2.550  23.673  27.335  1.00 23.59 ? 82   ALA D CA    1 
ATOM   5376 C  C     . ALA F  3 82  ? -3.768  24.367  27.948  1.00 24.55 ? 82   ALA D C     1 
ATOM   5377 O  O     . ALA F  3 82  ? -4.162  25.457  27.511  1.00 24.71 ? 82   ALA D O     1 
ATOM   5378 C  CB    . ALA F  3 82  ? -2.991  22.597  26.363  1.00 23.50 ? 82   ALA D CB    1 
ATOM   5379 N  N     . GLU F  3 83  ? -4.366  23.731  28.957  1.00 24.69 ? 83   GLU D N     1 
ATOM   5380 C  CA    . GLU F  3 83  ? -5.522  24.309  29.642  1.00 24.31 ? 83   GLU D CA    1 
ATOM   5381 C  C     . GLU F  3 83  ? -5.132  25.631  30.325  1.00 24.10 ? 83   GLU D C     1 
ATOM   5382 O  O     . GLU F  3 83  ? -5.794  26.655  30.135  1.00 24.09 ? 83   GLU D O     1 
ATOM   5383 C  CB    . GLU F  3 83  ? -6.178  23.287  30.598  1.00 24.09 ? 83   GLU D CB    1 
ATOM   5384 C  CG    . GLU F  3 83  ? -7.139  22.295  29.876  1.00 24.58 ? 83   GLU D CG    1 
ATOM   5385 C  CD    . GLU F  3 83  ? -7.685  21.160  30.759  1.00 25.34 ? 83   GLU D CD    1 
ATOM   5386 O  OE1   . GLU F  3 83  ? -7.252  21.019  31.924  1.00 27.60 ? 83   GLU D OE1   1 
ATOM   5387 O  OE2   . GLU F  3 83  ? -8.552  20.388  30.285  1.00 25.78 ? 83   GLU D OE2   1 
ATOM   5388 N  N     . ARG F  3 84  ? -4.025  25.623  31.065  1.00 23.61 ? 84   ARG D N     1 
ATOM   5389 C  CA    . ARG F  3 84  ? -3.509  26.846  31.683  1.00 23.83 ? 84   ARG D CA    1 
ATOM   5390 C  C     . ARG F  3 84  ? -3.359  27.978  30.669  1.00 23.33 ? 84   ARG D C     1 
ATOM   5391 O  O     . ARG F  3 84  ? -3.885  29.076  30.858  1.00 23.30 ? 84   ARG D O     1 
ATOM   5392 C  CB    . ARG F  3 84  ? -2.168  26.578  32.384  1.00 24.26 ? 84   ARG D CB    1 
ATOM   5393 C  CG    . ARG F  3 84  ? -2.289  25.989  33.796  1.00 25.40 ? 84   ARG D CG    1 
ATOM   5394 C  CD    . ARG F  3 84  ? -1.906  26.971  34.909  1.00 25.14 ? 84   ARG D CD    1 
ATOM   5395 N  NE    . ARG F  3 84  ? -2.893  28.021  35.144  1.00 25.62 ? 84   ARG D NE    1 
ATOM   5396 C  CZ    . ARG F  3 84  ? -3.773  28.032  36.146  1.00 25.62 ? 84   ARG D CZ    1 
ATOM   5397 N  NH1   . ARG F  3 84  ? -3.829  27.032  37.018  1.00 25.24 ? 84   ARG D NH1   1 
ATOM   5398 N  NH2   . ARG F  3 84  ? -4.617  29.048  36.266  1.00 25.83 ? 84   ARG D NH2   1 
ATOM   5399 N  N     . LEU F  3 85  ? -2.639  27.695  29.589  1.00 23.89 ? 85   LEU D N     1 
ATOM   5400 C  CA    . LEU F  3 85  ? -2.361  28.680  28.550  1.00 23.69 ? 85   LEU D CA    1 
ATOM   5401 C  C     . LEU F  3 85  ? -3.630  29.239  27.937  1.00 23.51 ? 85   LEU D C     1 
ATOM   5402 O  O     . LEU F  3 85  ? -3.711  30.428  27.634  1.00 22.54 ? 85   LEU D O     1 
ATOM   5403 C  CB    . LEU F  3 85  ? -1.518  28.049  27.450  1.00 24.12 ? 85   LEU D CB    1 
ATOM   5404 C  CG    . LEU F  3 85  ? -1.389  28.894  26.179  1.00 24.60 ? 85   LEU D CG    1 
ATOM   5405 C  CD1   . LEU F  3 85  ? -0.472  30.096  26.415  1.00 23.21 ? 85   LEU D CD1   1 
ATOM   5406 C  CD2   . LEU F  3 85  ? -0.910  28.028  25.009  1.00 23.59 ? 85   LEU D CD2   1 
ATOM   5407 N  N     . LEU F  3 86  ? -4.617  28.368  27.754  1.00 24.03 ? 86   LEU D N     1 
ATOM   5408 C  CA    . LEU F  3 86  ? -5.869  28.755  27.131  1.00 24.39 ? 86   LEU D CA    1 
ATOM   5409 C  C     . LEU F  3 86  ? -6.695  29.683  28.013  1.00 25.89 ? 86   LEU D C     1 
ATOM   5410 O  O     . LEU F  3 86  ? -7.396  30.566  27.510  1.00 25.93 ? 86   LEU D O     1 
ATOM   5411 C  CB    . LEU F  3 86  ? -6.675  27.518  26.744  1.00 23.68 ? 86   LEU D CB    1 
ATOM   5412 C  CG    . LEU F  3 86  ? -6.074  26.633  25.645  1.00 22.71 ? 86   LEU D CG    1 
ATOM   5413 C  CD1   . LEU F  3 86  ? -6.975  25.446  25.411  1.00 22.70 ? 86   LEU D CD1   1 
ATOM   5414 C  CD2   . LEU F  3 86  ? -5.873  27.396  24.356  1.00 21.87 ? 86   LEU D CD2   1 
ATOM   5415 N  N     . VAL F  3 87  ? -6.611  29.491  29.329  1.00 27.57 ? 87   VAL D N     1 
ATOM   5416 C  CA    . VAL F  3 87  ? -7.316  30.379  30.258  1.00 27.88 ? 87   VAL D CA    1 
ATOM   5417 C  C     . VAL F  3 87  ? -6.516  31.633  30.594  1.00 28.53 ? 87   VAL D C     1 
ATOM   5418 O  O     . VAL F  3 87  ? -6.956  32.746  30.301  1.00 27.74 ? 87   VAL D O     1 
ATOM   5419 C  CB    . VAL F  3 87  ? -7.720  29.673  31.555  1.00 27.21 ? 87   VAL D CB    1 
ATOM   5420 C  CG1   . VAL F  3 87  ? -8.501  30.628  32.433  1.00 26.10 ? 87   VAL D CG1   1 
ATOM   5421 C  CG2   . VAL F  3 87  ? -8.559  28.456  31.236  1.00 27.60 ? 87   VAL D CG2   1 
ATOM   5422 N  N     . ASP F  3 88  ? -5.343  31.443  31.199  1.00 29.33 ? 88   ASP D N     1 
ATOM   5423 C  CA    . ASP F  3 88  ? -4.532  32.556  31.702  1.00 29.89 ? 88   ASP D CA    1 
ATOM   5424 C  C     . ASP F  3 88  ? -4.122  33.541  30.606  1.00 30.20 ? 88   ASP D C     1 
ATOM   5425 O  O     . ASP F  3 88  ? -4.148  34.755  30.810  1.00 30.17 ? 88   ASP D O     1 
ATOM   5426 C  CB    . ASP F  3 88  ? -3.282  32.045  32.433  1.00 30.72 ? 88   ASP D CB    1 
ATOM   5427 C  CG    . ASP F  3 88  ? -3.605  31.352  33.758  1.00 31.90 ? 88   ASP D CG    1 
ATOM   5428 O  OD1   . ASP F  3 88  ? -4.776  30.954  33.979  1.00 32.35 ? 88   ASP D OD1   1 
ATOM   5429 O  OD2   . ASP F  3 88  ? -2.676  31.195  34.581  1.00 31.79 ? 88   ASP D OD2   1 
ATOM   5430 N  N     . VAL F  3 89  ? -3.743  33.022  29.444  1.00 29.92 ? 89   VAL D N     1 
ATOM   5431 C  CA    . VAL F  3 89  ? -3.232  33.881  28.382  1.00 29.20 ? 89   VAL D CA    1 
ATOM   5432 C  C     . VAL F  3 89  ? -4.250  34.158  27.273  1.00 28.95 ? 89   VAL D C     1 
ATOM   5433 O  O     . VAL F  3 89  ? -4.691  35.290  27.096  1.00 29.38 ? 89   VAL D O     1 
ATOM   5434 C  CB    . VAL F  3 89  ? -1.946  33.316  27.786  1.00 28.36 ? 89   VAL D CB    1 
ATOM   5435 C  CG1   . VAL F  3 89  ? -1.473  34.189  26.658  1.00 28.50 ? 89   VAL D CG1   1 
ATOM   5436 C  CG2   . VAL F  3 89  ? -0.890  33.226  28.858  1.00 28.34 ? 89   VAL D CG2   1 
ATOM   5437 N  N     . ILE F  3 90  ? -4.630  33.119  26.543  1.00 28.70 ? 90   ILE D N     1 
ATOM   5438 C  CA    . ILE F  3 90  ? -5.492  33.274  25.374  1.00 28.42 ? 90   ILE D CA    1 
ATOM   5439 C  C     . ILE F  3 90  ? -6.891  33.807  25.700  1.00 28.13 ? 90   ILE D C     1 
ATOM   5440 O  O     . ILE F  3 90  ? -7.509  34.489  24.886  1.00 28.39 ? 90   ILE D O     1 
ATOM   5441 C  CB    . ILE F  3 90  ? -5.549  31.968  24.556  1.00 28.75 ? 90   ILE D CB    1 
ATOM   5442 C  CG1   . ILE F  3 90  ? -4.121  31.563  24.162  1.00 29.01 ? 90   ILE D CG1   1 
ATOM   5443 C  CG2   . ILE F  3 90  ? -6.414  32.148  23.321  1.00 28.97 ? 90   ILE D CG2   1 
ATOM   5444 C  CD1   . ILE F  3 90  ? -4.027  30.376  23.239  1.00 29.37 ? 90   ILE D CD1   1 
ATOM   5445 N  N     . GLY F  3 91  ? -7.377  33.511  26.896  1.00 28.30 ? 91   GLY D N     1 
ATOM   5446 C  CA    . GLY F  3 91  ? -8.648  34.045  27.343  1.00 28.22 ? 91   GLY D CA    1 
ATOM   5447 C  C     . GLY F  3 91  ? -9.816  33.371  26.660  1.00 29.32 ? 91   GLY D C     1 
ATOM   5448 O  O     . GLY F  3 91  ? -10.859 33.998  26.431  1.00 30.31 ? 91   GLY D O     1 
ATOM   5449 N  N     . LEU F  3 92  ? -9.651  32.093  26.333  1.00 28.88 ? 92   LEU D N     1 
ATOM   5450 C  CA    . LEU F  3 92  ? -10.738 31.321  25.743  1.00 28.89 ? 92   LEU D CA    1 
ATOM   5451 C  C     . LEU F  3 92  ? -11.802 31.130  26.805  1.00 28.97 ? 92   LEU D C     1 
ATOM   5452 O  O     . LEU F  3 92  ? -11.472 30.921  27.964  1.00 28.34 ? 92   LEU D O     1 
ATOM   5453 C  CB    . LEU F  3 92  ? -10.233 29.965  25.237  1.00 28.56 ? 92   LEU D CB    1 
ATOM   5454 C  CG    . LEU F  3 92  ? -11.217 29.118  24.419  1.00 28.58 ? 92   LEU D CG    1 
ATOM   5455 C  CD1   . LEU F  3 92  ? -11.524 29.778  23.091  1.00 27.94 ? 92   LEU D CD1   1 
ATOM   5456 C  CD2   . LEU F  3 92  ? -10.685 27.710  24.193  1.00 28.44 ? 92   LEU D CD2   1 
ATOM   5457 N  N     . PRO F  3 93  ? -13.085 31.242  26.429  1.00 30.31 ? 93   PRO D N     1 
ATOM   5458 C  CA    . PRO F  3 93  ? -14.113 30.993  27.437  1.00 31.55 ? 93   PRO D CA    1 
ATOM   5459 C  C     . PRO F  3 93  ? -13.890 29.675  28.179  1.00 34.06 ? 93   PRO D C     1 
ATOM   5460 O  O     . PRO F  3 93  ? -13.428 28.687  27.594  1.00 35.52 ? 93   PRO D O     1 
ATOM   5461 C  CB    . PRO F  3 93  ? -15.409 30.954  26.621  1.00 30.55 ? 93   PRO D CB    1 
ATOM   5462 C  CG    . PRO F  3 93  ? -15.129 31.829  25.449  1.00 29.87 ? 93   PRO D CG    1 
ATOM   5463 C  CD    . PRO F  3 93  ? -13.665 31.629  25.130  1.00 30.09 ? 93   PRO D CD    1 
ATOM   5464 N  N     . TRP F  3 94  ? -14.220 29.689  29.466  1.00 35.94 ? 94   TRP D N     1 
ATOM   5465 C  CA    . TRP F  3 94  ? -14.071 28.557  30.384  1.00 36.59 ? 94   TRP D CA    1 
ATOM   5466 C  C     . TRP F  3 94  ? -14.675 27.233  29.895  1.00 36.36 ? 94   TRP D C     1 
ATOM   5467 O  O     . TRP F  3 94  ? -14.049 26.176  29.987  1.00 35.41 ? 94   TRP D O     1 
ATOM   5468 C  CB    . TRP F  3 94  ? -14.731 28.944  31.706  1.00 37.14 ? 94   TRP D CB    1 
ATOM   5469 C  CG    . TRP F  3 94  ? -14.358 28.120  32.879  1.00 37.44 ? 94   TRP D CG    1 
ATOM   5470 C  CD1   . TRP F  3 94  ? -15.043 27.051  33.381  1.00 37.62 ? 94   TRP D CD1   1 
ATOM   5471 C  CD2   . TRP F  3 94  ? -13.225 28.313  33.734  1.00 37.43 ? 94   TRP D CD2   1 
ATOM   5472 N  NE1   . TRP F  3 94  ? -14.399 26.556  34.495  1.00 37.84 ? 94   TRP D NE1   1 
ATOM   5473 C  CE2   . TRP F  3 94  ? -13.280 27.313  34.732  1.00 37.93 ? 94   TRP D CE2   1 
ATOM   5474 C  CE3   . TRP F  3 94  ? -12.169 29.229  33.752  1.00 37.38 ? 94   TRP D CE3   1 
ATOM   5475 C  CZ2   . TRP F  3 94  ? -12.316 27.206  35.741  1.00 37.39 ? 94   TRP D CZ2   1 
ATOM   5476 C  CZ3   . TRP F  3 94  ? -11.211 29.121  34.753  1.00 37.41 ? 94   TRP D CZ3   1 
ATOM   5477 C  CH2   . TRP F  3 94  ? -11.293 28.117  35.732  1.00 37.39 ? 94   TRP D CH2   1 
ATOM   5478 N  N     . GLU F  3 95  ? -15.900 27.286  29.391  1.00 36.64 ? 95   GLU D N     1 
ATOM   5479 C  CA    . GLU F  3 95  ? -16.620 26.056  29.079  1.00 37.23 ? 95   GLU D CA    1 
ATOM   5480 C  C     . GLU F  3 95  ? -16.097 25.359  27.830  1.00 35.89 ? 95   GLU D C     1 
ATOM   5481 O  O     . GLU F  3 95  ? -16.702 24.397  27.361  1.00 35.54 ? 95   GLU D O     1 
ATOM   5482 C  CB    . GLU F  3 95  ? -18.134 26.299  28.966  1.00 38.83 ? 95   GLU D CB    1 
ATOM   5483 C  CG    . GLU F  3 95  ? -18.554 27.332  27.921  1.00 40.59 ? 95   GLU D CG    1 
ATOM   5484 C  CD    . GLU F  3 95  ? -18.636 28.753  28.480  1.00 41.95 ? 95   GLU D CD    1 
ATOM   5485 O  OE1   . GLU F  3 95  ? -19.316 29.598  27.852  1.00 42.64 ? 95   GLU D OE1   1 
ATOM   5486 O  OE2   . GLU F  3 95  ? -18.027 29.027  29.542  1.00 41.98 ? 95   GLU D OE2   1 
ATOM   5487 N  N     . GLU F  3 96  ? -14.968 25.828  27.307  1.00 34.33 ? 96   GLU D N     1 
ATOM   5488 C  CA    . GLU F  3 96  ? -14.430 25.268  26.072  1.00 32.87 ? 96   GLU D CA    1 
ATOM   5489 C  C     . GLU F  3 96  ? -12.950 24.932  26.143  1.00 31.14 ? 96   GLU D C     1 
ATOM   5490 O  O     . GLU F  3 96  ? -12.409 24.316  25.224  1.00 31.10 ? 96   GLU D O     1 
ATOM   5491 C  CB    . GLU F  3 96  ? -14.675 26.215  24.903  1.00 34.30 ? 96   GLU D CB    1 
ATOM   5492 C  CG    . GLU F  3 96  ? -16.114 26.282  24.457  1.00 36.49 ? 96   GLU D CG    1 
ATOM   5493 C  CD    . GLU F  3 96  ? -16.392 27.504  23.598  1.00 38.45 ? 96   GLU D CD    1 
ATOM   5494 O  OE1   . GLU F  3 96  ? -15.445 28.028  22.964  1.00 39.57 ? 96   GLU D OE1   1 
ATOM   5495 O  OE2   . GLU F  3 96  ? -17.561 27.945  23.557  1.00 39.36 ? 96   GLU D OE2   1 
ATOM   5496 N  N     . VAL F  3 97  ? -12.290 25.331  27.224  1.00 28.28 ? 97   VAL D N     1 
ATOM   5497 C  CA    . VAL F  3 97  ? -10.849 25.127  27.319  1.00 26.42 ? 97   VAL D CA    1 
ATOM   5498 C  C     . VAL F  3 97  ? -10.429 23.650  27.302  1.00 24.87 ? 97   VAL D C     1 
ATOM   5499 O  O     . VAL F  3 97  ? -9.451  23.276  26.648  1.00 24.57 ? 97   VAL D O     1 
ATOM   5500 C  CB    . VAL F  3 97  ? -10.223 25.907  28.502  1.00 26.76 ? 97   VAL D CB    1 
ATOM   5501 C  CG1   . VAL F  3 97  ? -11.269 26.243  29.541  1.00 27.82 ? 97   VAL D CG1   1 
ATOM   5502 C  CG2   . VAL F  3 97  ? -9.052  25.145  29.115  1.00 26.24 ? 97   VAL D CG2   1 
ATOM   5503 N  N     . HIS F  3 98  ? -11.178 22.804  27.989  1.00 23.66 ? 98   HIS D N     1 
ATOM   5504 C  CA    . HIS F  3 98  ? -10.859 21.386  27.994  1.00 22.31 ? 98   HIS D CA    1 
ATOM   5505 C  C     . HIS F  3 98  ? -10.912 20.773  26.591  1.00 22.14 ? 98   HIS D C     1 
ATOM   5506 O  O     . HIS F  3 98  ? -9.911  20.260  26.086  1.00 22.52 ? 98   HIS D O     1 
ATOM   5507 C  CB    . HIS F  3 98  ? -11.801 20.627  28.903  1.00 21.49 ? 98   HIS D CB    1 
ATOM   5508 C  CG    . HIS F  3 98  ? -11.659 19.150  28.779  1.00 22.21 ? 98   HIS D CG    1 
ATOM   5509 N  ND1   . HIS F  3 98  ? -10.717 18.438  29.484  1.00 22.30 ? 98   HIS D ND1   1 
ATOM   5510 C  CD2   . HIS F  3 98  ? -12.303 18.253  27.997  1.00 21.61 ? 98   HIS D CD2   1 
ATOM   5511 C  CE1   . HIS F  3 98  ? -10.801 17.162  29.163  1.00 21.97 ? 98   HIS D CE1   1 
ATOM   5512 N  NE2   . HIS F  3 98  ? -11.756 17.023  28.263  1.00 22.00 ? 98   HIS D NE2   1 
ATOM   5513 N  N     . ALA F  3 99  ? -12.090 20.825  25.977  1.00 21.39 ? 99   ALA D N     1 
ATOM   5514 C  CA    . ALA F  3 99  ? -12.299 20.307  24.632  1.00 20.56 ? 99   ALA D CA    1 
ATOM   5515 C  C     . ALA F  3 99  ? -11.161 20.689  23.690  1.00 21.29 ? 99   ALA D C     1 
ATOM   5516 O  O     . ALA F  3 99  ? -10.645 19.842  22.955  1.00 22.33 ? 99   ALA D O     1 
ATOM   5517 C  CB    . ALA F  3 99  ? -13.627 20.797  24.085  1.00 19.91 ? 99   ALA D CB    1 
ATOM   5518 N  N     . GLU F  3 100 ? -10.776 21.964  23.709  1.00 20.97 ? 100  GLU D N     1 
ATOM   5519 C  CA    . GLU F  3 100 ? -9.660  22.452  22.902  1.00 19.56 ? 100  GLU D CA    1 
ATOM   5520 C  C     . GLU F  3 100 ? -8.364  21.714  23.254  1.00 19.84 ? 100  GLU D C     1 
ATOM   5521 O  O     . GLU F  3 100 ? -7.685  21.160  22.385  1.00 19.52 ? 100  GLU D O     1 
ATOM   5522 C  CB    . GLU F  3 100 ? -9.484  23.953  23.113  1.00 18.52 ? 100  GLU D CB    1 
ATOM   5523 C  CG    . GLU F  3 100 ? -8.427  24.593  22.236  1.00 19.35 ? 100  GLU D CG    1 
ATOM   5524 C  CD    . GLU F  3 100 ? -8.927  24.905  20.835  1.00 20.47 ? 100  GLU D CD    1 
ATOM   5525 O  OE1   . GLU F  3 100 ? -10.110 25.261  20.678  1.00 20.26 ? 100  GLU D OE1   1 
ATOM   5526 O  OE2   . GLU F  3 100 ? -8.129  24.808  19.882  1.00 21.73 ? 100  GLU D OE2   1 
ATOM   5527 N  N     . ALA F  3 101 ? -8.033  21.710  24.540  1.00 19.94 ? 101  ALA D N     1 
ATOM   5528 C  CA    . ALA F  3 101 ? -6.828  21.062  25.033  1.00 19.02 ? 101  ALA D CA    1 
ATOM   5529 C  C     . ALA F  3 101 ? -6.878  19.543  24.837  1.00 19.56 ? 101  ALA D C     1 
ATOM   5530 O  O     . ALA F  3 101 ? -5.840  18.872  24.846  1.00 19.18 ? 101  ALA D O     1 
ATOM   5531 C  CB    . ALA F  3 101 ? -6.629  21.398  26.496  1.00 19.04 ? 101  ALA D CB    1 
ATOM   5532 N  N     . CYS F  3 102 ? -8.079  18.993  24.663  1.00 18.76 ? 102  CYS D N     1 
ATOM   5533 C  CA    . CYS F  3 102 ? -8.203  17.563  24.372  1.00 18.79 ? 102  CYS D CA    1 
ATOM   5534 C  C     . CYS F  3 102 ? -7.485  17.211  23.071  1.00 19.06 ? 102  CYS D C     1 
ATOM   5535 O  O     . CYS F  3 102 ? -6.996  16.085  22.899  1.00 19.82 ? 102  CYS D O     1 
ATOM   5536 C  CB    . CYS F  3 102 ? -9.666  17.145  24.281  1.00 18.59 ? 102  CYS D CB    1 
ATOM   5537 S  SG    . CYS F  3 102 ? -9.851  15.396  24.029  1.00 17.21 ? 102  CYS D SG    1 
ATOM   5538 N  N     . ARG F  3 103 ? -7.433  18.192  22.169  1.00 18.76 ? 103  ARG D N     1 
ATOM   5539 C  CA    . ARG F  3 103 ? -6.769  18.069  20.877  1.00 18.55 ? 103  ARG D CA    1 
ATOM   5540 C  C     . ARG F  3 103 ? -5.309  18.518  20.931  1.00 18.82 ? 103  ARG D C     1 
ATOM   5541 O  O     . ARG F  3 103 ? -4.429  17.831  20.417  1.00 20.00 ? 103  ARG D O     1 
ATOM   5542 C  CB    . ARG F  3 103 ? -7.521  18.876  19.808  1.00 17.95 ? 103  ARG D CB    1 
ATOM   5543 C  CG    . ARG F  3 103 ? -8.910  18.349  19.478  1.00 17.46 ? 103  ARG D CG    1 
ATOM   5544 C  CD    . ARG F  3 103 ? -9.457  18.956  18.182  1.00 18.29 ? 103  ARG D CD    1 
ATOM   5545 N  NE    . ARG F  3 103 ? -9.413  20.418  18.201  1.00 18.72 ? 103  ARG D NE    1 
ATOM   5546 C  CZ    . ARG F  3 103 ? -10.241 21.188  18.901  1.00 18.94 ? 103  ARG D CZ    1 
ATOM   5547 N  NH1   . ARG F  3 103 ? -10.115 22.504  18.864  1.00 19.18 ? 103  ARG D NH1   1 
ATOM   5548 N  NH2   . ARG F  3 103 ? -11.193 20.644  19.647  1.00 20.29 ? 103  ARG D NH2   1 
ATOM   5549 N  N     . TRP F  3 104 ? -5.057  19.671  21.547  1.00 18.84 ? 104  TRP D N     1 
ATOM   5550 C  CA    . TRP F  3 104 ? -3.708  20.239  21.623  1.00 18.65 ? 104  TRP D CA    1 
ATOM   5551 C  C     . TRP F  3 104 ? -2.724  19.320  22.343  1.00 18.62 ? 104  TRP D C     1 
ATOM   5552 O  O     . TRP F  3 104 ? -1.529  19.319  22.051  1.00 18.78 ? 104  TRP D O     1 
ATOM   5553 C  CB    . TRP F  3 104 ? -3.735  21.597  22.334  1.00 19.05 ? 104  TRP D CB    1 
ATOM   5554 C  CG    . TRP F  3 104 ? -4.363  22.704  21.549  1.00 18.96 ? 104  TRP D CG    1 
ATOM   5555 C  CD1   . TRP F  3 104 ? -5.396  22.599  20.667  1.00 19.09 ? 104  TRP D CD1   1 
ATOM   5556 C  CD2   . TRP F  3 104 ? -4.027  24.095  21.611  1.00 19.58 ? 104  TRP D CD2   1 
ATOM   5557 N  NE1   . TRP F  3 104 ? -5.713  23.832  20.158  1.00 19.32 ? 104  TRP D NE1   1 
ATOM   5558 C  CE2   . TRP F  3 104 ? -4.887  24.771  20.719  1.00 19.94 ? 104  TRP D CE2   1 
ATOM   5559 C  CE3   . TRP F  3 104 ? -3.075  24.836  22.325  1.00 19.63 ? 104  TRP D CE3   1 
ATOM   5560 C  CZ2   . TRP F  3 104 ? -4.823  26.158  20.520  1.00 19.45 ? 104  TRP D CZ2   1 
ATOM   5561 C  CZ3   . TRP F  3 104 ? -3.008  26.214  22.122  1.00 19.00 ? 104  TRP D CZ3   1 
ATOM   5562 C  CH2   . TRP F  3 104 ? -3.878  26.857  21.232  1.00 19.24 ? 104  TRP D CH2   1 
ATOM   5563 N  N     . GLU F  3 105 ? -3.229  18.547  23.296  1.00 18.97 ? 105  GLU D N     1 
ATOM   5564 C  CA    . GLU F  3 105 ? -2.397  17.628  24.062  1.00 19.82 ? 105  GLU D CA    1 
ATOM   5565 C  C     . GLU F  3 105 ? -1.646  16.670  23.145  1.00 20.08 ? 105  GLU D C     1 
ATOM   5566 O  O     . GLU F  3 105 ? -0.593  16.141  23.506  1.00 20.41 ? 105  GLU D O     1 
ATOM   5567 C  CB    . GLU F  3 105 ? -3.263  16.819  25.024  1.00 20.34 ? 105  GLU D CB    1 
ATOM   5568 C  CG    . GLU F  3 105 ? -4.104  15.781  24.328  1.00 21.37 ? 105  GLU D CG    1 
ATOM   5569 C  CD    . GLU F  3 105 ? -5.190  15.205  25.208  1.00 21.32 ? 105  GLU D CD    1 
ATOM   5570 O  OE1   . GLU F  3 105 ? -5.006  15.213  26.442  1.00 20.40 ? 105  GLU D OE1   1 
ATOM   5571 O  OE2   . GLU F  3 105 ? -6.216  14.733  24.653  1.00 21.39 ? 105  GLU D OE2   1 
ATOM   5572 N  N     . HIS F  3 106 ? -2.192  16.456  21.952  1.00 19.78 ? 106  HIS D N     1 
ATOM   5573 C  CA    . HIS F  3 106 ? -1.672  15.429  21.068  1.00 19.14 ? 106  HIS D CA    1 
ATOM   5574 C  C     . HIS F  3 106 ? -0.639  15.956  20.066  1.00 18.70 ? 106  HIS D C     1 
ATOM   5575 O  O     . HIS F  3 106 ? -0.049  15.170  19.321  1.00 18.68 ? 106  HIS D O     1 
ATOM   5576 C  CB    . HIS F  3 106 ? -2.821  14.691  20.366  1.00 19.06 ? 106  HIS D CB    1 
ATOM   5577 C  CG    . HIS F  3 106 ? -3.855  14.143  21.304  1.00 18.76 ? 106  HIS D CG    1 
ATOM   5578 N  ND1   . HIS F  3 106 ? -3.604  13.091  22.158  1.00 19.26 ? 106  HIS D ND1   1 
ATOM   5579 C  CD2   . HIS F  3 106 ? -5.144  14.500  21.521  1.00 19.19 ? 106  HIS D CD2   1 
ATOM   5580 C  CE1   . HIS F  3 106 ? -4.690  12.828  22.864  1.00 18.72 ? 106  HIS D CE1   1 
ATOM   5581 N  NE2   . HIS F  3 106 ? -5.639  13.670  22.498  1.00 18.45 ? 106  HIS D NE2   1 
ATOM   5582 N  N     . VAL F  3 107 ? -0.403  17.271  20.064  1.00 18.41 ? 107  VAL D N     1 
ATOM   5583 C  CA    . VAL F  3 107 ? 0.559   17.882  19.128  1.00 17.71 ? 107  VAL D CA    1 
ATOM   5584 C  C     . VAL F  3 107 ? 1.673   18.699  19.779  1.00 19.25 ? 107  VAL D C     1 
ATOM   5585 O  O     . VAL F  3 107 ? 2.656   19.047  19.121  1.00 19.36 ? 107  VAL D O     1 
ATOM   5586 C  CB    . VAL F  3 107 ? -0.124  18.777  18.080  1.00 15.96 ? 107  VAL D CB    1 
ATOM   5587 C  CG1   . VAL F  3 107 ? -0.875  17.931  17.079  1.00 15.76 ? 107  VAL D CG1   1 
ATOM   5588 C  CG2   . VAL F  3 107 ? -1.032  19.806  18.748  1.00 15.20 ? 107  VAL D CG2   1 
ATOM   5589 N  N     . MET F  3 108 ? 1.508   19.016  21.055  1.00 21.28 ? 108  MET D N     1 
ATOM   5590 C  CA    . MET F  3 108 ? 2.485   19.817  21.783  1.00 24.81 ? 108  MET D CA    1 
ATOM   5591 C  C     . MET F  3 108 ? 3.840   19.138  21.883  1.00 23.66 ? 108  MET D C     1 
ATOM   5592 O  O     . MET F  3 108 ? 3.919   17.955  22.206  1.00 24.14 ? 108  MET D O     1 
ATOM   5593 C  CB    . MET F  3 108 ? 2.005   20.068  23.206  1.00 25.98 ? 108  MET D CB    1 
ATOM   5594 C  CG    . MET F  3 108 ? 0.907   21.074  23.358  1.00 27.83 ? 108  MET D CG    1 
ATOM   5595 S  SD    . MET F  3 108 ? 0.749   21.485  25.110  1.00 30.32 ? 108  MET D SD    1 
ATOM   5596 C  CE    . MET F  3 108 ? 2.454   21.810  25.552  1.00 28.36 ? 108  MET D CE    1 
ATOM   5597 N  N     . SER F  3 109 ? 4.896   19.902  21.634  1.00 23.29 ? 109  SER D N     1 
ATOM   5598 C  CA    . SER F  3 109 ? 6.258   19.439  21.862  1.00 24.50 ? 109  SER D CA    1 
ATOM   5599 C  C     . SER F  3 109 ? 6.685   19.728  23.303  1.00 25.62 ? 109  SER D C     1 
ATOM   5600 O  O     . SER F  3 109 ? 6.198   20.681  23.922  1.00 26.07 ? 109  SER D O     1 
ATOM   5601 C  CB    . SER F  3 109 ? 7.228   20.131  20.892  1.00 23.68 ? 109  SER D CB    1 
ATOM   5602 O  OG    . SER F  3 109 ? 7.502   21.470  21.284  1.00 20.49 ? 109  SER D OG    1 
ATOM   5603 N  N     . GLU F  3 110 ? 7.600   18.915  23.830  1.00 25.99 ? 110  GLU D N     1 
ATOM   5604 C  CA    . GLU F  3 110 ? 8.207   19.184  25.134  1.00 26.76 ? 110  GLU D CA    1 
ATOM   5605 C  C     . GLU F  3 110 ? 8.871   20.571  25.161  1.00 26.58 ? 110  GLU D C     1 
ATOM   5606 O  O     . GLU F  3 110 ? 8.864   21.262  26.180  1.00 26.80 ? 110  GLU D O     1 
ATOM   5607 C  CB    . GLU F  3 110 ? 9.231   18.098  25.503  1.00 27.40 ? 110  GLU D CB    1 
ATOM   5608 C  CG    . GLU F  3 110 ? 8.635   16.704  25.771  1.00 28.52 ? 110  GLU D CG    1 
ATOM   5609 C  CD    . GLU F  3 110 ? 9.507   15.846  26.688  1.00 28.42 ? 110  GLU D CD    1 
ATOM   5610 O  OE1   . GLU F  3 110 ? 10.332  16.410  27.438  1.00 29.63 ? 110  GLU D OE1   1 
ATOM   5611 O  OE2   . GLU F  3 110 ? 9.362   14.607  26.670  1.00 29.04 ? 110  GLU D OE2   1 
ATOM   5612 N  N     . ASP F  3 111 ? 9.450   20.974  24.038  1.00 26.50 ? 111  ASP D N     1 
ATOM   5613 C  CA    . ASP F  3 111 ? 9.992   22.314  23.920  1.00 27.09 ? 111  ASP D CA    1 
ATOM   5614 C  C     . ASP F  3 111 ? 8.944   23.331  24.340  1.00 26.76 ? 111  ASP D C     1 
ATOM   5615 O  O     . ASP F  3 111 ? 9.208   24.215  25.157  1.00 27.48 ? 111  ASP D O     1 
ATOM   5616 C  CB    . ASP F  3 111 ? 10.439  22.590  22.485  1.00 28.39 ? 111  ASP D CB    1 
ATOM   5617 C  CG    . ASP F  3 111 ? 11.786  21.972  22.165  1.00 29.90 ? 111  ASP D CG    1 
ATOM   5618 O  OD1   . ASP F  3 111 ? 12.036  21.688  20.973  1.00 30.77 ? 111  ASP D OD1   1 
ATOM   5619 O  OD2   . ASP F  3 111 ? 12.589  21.766  23.103  1.00 30.27 ? 111  ASP D OD2   1 
ATOM   5620 N  N     . VAL F  3 112 ? 7.748   23.197  23.782  1.00 25.47 ? 112  VAL D N     1 
ATOM   5621 C  CA    . VAL F  3 112 ? 6.659   24.107  24.101  1.00 24.52 ? 112  VAL D CA    1 
ATOM   5622 C  C     . VAL F  3 112 ? 6.241   23.969  25.564  1.00 24.12 ? 112  VAL D C     1 
ATOM   5623 O  O     . VAL F  3 112 ? 5.842   24.948  26.199  1.00 24.83 ? 112  VAL D O     1 
ATOM   5624 C  CB    . VAL F  3 112 ? 5.444   23.925  23.134  1.00 23.52 ? 112  VAL D CB    1 
ATOM   5625 C  CG1   . VAL F  3 112 ? 4.186   24.508  23.728  1.00 22.78 ? 112  VAL D CG1   1 
ATOM   5626 C  CG2   . VAL F  3 112 ? 5.738   24.580  21.805  1.00 22.54 ? 112  VAL D CG2   1 
ATOM   5627 N  N     . GLU F  3 113 ? 6.344   22.758  26.102  1.00 23.51 ? 113  GLU D N     1 
ATOM   5628 C  CA    . GLU F  3 113 ? 5.998   22.524  27.503  1.00 23.18 ? 113  GLU D CA    1 
ATOM   5629 C  C     . GLU F  3 113 ? 6.915   23.272  28.476  1.00 22.60 ? 113  GLU D C     1 
ATOM   5630 O  O     . GLU F  3 113 ? 6.448   24.033  29.325  1.00 20.67 ? 113  GLU D O     1 
ATOM   5631 C  CB    . GLU F  3 113 ? 5.982   21.030  27.813  1.00 23.75 ? 113  GLU D CB    1 
ATOM   5632 C  CG    . GLU F  3 113 ? 4.670   20.369  27.458  1.00 24.75 ? 113  GLU D CG    1 
ATOM   5633 C  CD    . GLU F  3 113 ? 4.626   18.913  27.848  1.00 25.73 ? 113  GLU D CD    1 
ATOM   5634 O  OE1   . GLU F  3 113 ? 3.928   18.598  28.837  1.00 26.58 ? 113  GLU D OE1   1 
ATOM   5635 O  OE2   . GLU F  3 113 ? 5.289   18.087  27.179  1.00 25.92 ? 113  GLU D OE2   1 
ATOM   5636 N  N     . ARG F  3 114 ? 8.221   23.070  28.337  1.00 22.74 ? 114  ARG D N     1 
ATOM   5637 C  CA    . ARG F  3 114 ? 9.173   23.777  29.174  1.00 22.76 ? 114  ARG D CA    1 
ATOM   5638 C  C     . ARG F  3 114 ? 8.972   25.289  29.098  1.00 23.49 ? 114  ARG D C     1 
ATOM   5639 O  O     . ARG F  3 114 ? 9.038   25.983  30.121  1.00 24.08 ? 114  ARG D O     1 
ATOM   5640 C  CB    . ARG F  3 114 ? 10.605  23.346  28.856  1.00 21.76 ? 114  ARG D CB    1 
ATOM   5641 C  CG    . ARG F  3 114 ? 10.934  22.007  29.493  1.00 22.43 ? 114  ARG D CG    1 
ATOM   5642 C  CD    . ARG F  3 114 ? 12.316  21.491  29.144  1.00 22.93 ? 114  ARG D CD    1 
ATOM   5643 N  NE    . ARG F  3 114 ? 12.360  20.991  27.775  1.00 23.90 ? 114  ARG D NE    1 
ATOM   5644 C  CZ    . ARG F  3 114 ? 12.337  19.706  27.433  1.00 22.73 ? 114  ARG D CZ    1 
ATOM   5645 N  NH1   . ARG F  3 114 ? 12.291  18.762  28.363  1.00 22.39 ? 114  ARG D NH1   1 
ATOM   5646 N  NH2   . ARG F  3 114 ? 12.372  19.373  26.152  1.00 22.41 ? 114  ARG D NH2   1 
ATOM   5647 N  N     . ARG F  3 115 ? 8.680   25.800  27.905  1.00 23.70 ? 115  ARG D N     1 
ATOM   5648 C  CA    . ARG F  3 115 ? 8.415   27.227  27.747  1.00 24.82 ? 115  ARG D CA    1 
ATOM   5649 C  C     . ARG F  3 115 ? 7.162   27.648  28.502  1.00 25.64 ? 115  ARG D C     1 
ATOM   5650 O  O     . ARG F  3 115 ? 7.118   28.718  29.122  1.00 26.46 ? 115  ARG D O     1 
ATOM   5651 C  CB    . ARG F  3 115 ? 8.271   27.603  26.277  1.00 25.77 ? 115  ARG D CB    1 
ATOM   5652 C  CG    . ARG F  3 115 ? 9.581   27.676  25.520  1.00 26.72 ? 115  ARG D CG    1 
ATOM   5653 C  CD    . ARG F  3 115 ? 10.483  28.711  26.136  1.00 27.56 ? 115  ARG D CD    1 
ATOM   5654 N  NE    . ARG F  3 115 ? 9.794   29.983  26.332  1.00 28.36 ? 115  ARG D NE    1 
ATOM   5655 C  CZ    . ARG F  3 115 ? 10.387  31.094  26.758  1.00 28.67 ? 115  ARG D CZ    1 
ATOM   5656 N  NH1   . ARG F  3 115 ? 11.688  31.090  27.032  1.00 28.49 ? 115  ARG D NH1   1 
ATOM   5657 N  NH2   . ARG F  3 115 ? 9.682   32.208  26.907  1.00 28.69 ? 115  ARG D NH2   1 
ATOM   5658 N  N     . LEU F  3 116 ? 6.138   26.811  28.454  1.00 25.18 ? 116  LEU D N     1 
ATOM   5659 C  CA    . LEU F  3 116 ? 4.911   27.130  29.163  1.00 25.54 ? 116  LEU D CA    1 
ATOM   5660 C  C     . LEU F  3 116 ? 5.148   27.255  30.677  1.00 26.40 ? 116  LEU D C     1 
ATOM   5661 O  O     . LEU F  3 116 ? 4.644   28.189  31.320  1.00 26.14 ? 116  LEU D O     1 
ATOM   5662 C  CB    . LEU F  3 116 ? 3.812   26.119  28.825  1.00 24.47 ? 116  LEU D CB    1 
ATOM   5663 C  CG    . LEU F  3 116 ? 3.347   26.212  27.370  1.00 22.99 ? 116  LEU D CG    1 
ATOM   5664 C  CD1   . LEU F  3 116 ? 1.884   25.840  27.234  1.00 22.05 ? 116  LEU D CD1   1 
ATOM   5665 C  CD2   . LEU F  3 116 ? 3.569   27.623  26.868  1.00 22.60 ? 116  LEU D CD2   1 
ATOM   5666 N  N     . VAL F  3 117 ? 5.938   26.335  31.231  1.00 27.10 ? 117  VAL D N     1 
ATOM   5667 C  CA    . VAL F  3 117 ? 6.270   26.371  32.656  1.00 27.70 ? 117  VAL D CA    1 
ATOM   5668 C  C     . VAL F  3 117 ? 6.800   27.745  33.038  1.00 28.41 ? 117  VAL D C     1 
ATOM   5669 O  O     . VAL F  3 117 ? 6.289   28.375  33.961  1.00 29.36 ? 117  VAL D O     1 
ATOM   5670 C  CB    . VAL F  3 117 ? 7.295   25.283  33.058  1.00 27.36 ? 117  VAL D CB    1 
ATOM   5671 C  CG1   . VAL F  3 117 ? 7.910   25.609  34.408  1.00 26.96 ? 117  VAL D CG1   1 
ATOM   5672 C  CG2   . VAL F  3 117 ? 6.642   23.907  33.095  1.00 25.62 ? 117  VAL D CG2   1 
ATOM   5673 N  N     . LYS F  3 118 ? 7.814   28.211  32.319  1.00 29.34 ? 118  LYS D N     1 
ATOM   5674 C  CA    . LYS F  3 118 ? 8.336   29.562  32.530  1.00 30.32 ? 118  LYS D CA    1 
ATOM   5675 C  C     . LYS F  3 118 ? 7.243   30.621  32.380  1.00 29.43 ? 118  LYS D C     1 
ATOM   5676 O  O     . LYS F  3 118 ? 6.901   31.308  33.335  1.00 29.38 ? 118  LYS D O     1 
ATOM   5677 C  CB    . LYS F  3 118 ? 9.495   29.865  31.571  1.00 30.14 ? 118  LYS D CB    1 
ATOM   5678 C  CG    . LYS F  3 118 ? 10.876  29.505  32.103  1.00 31.05 ? 118  LYS D CG    1 
ATOM   5679 C  CD    . LYS F  3 118 ? 11.920  29.584  30.984  1.00 32.03 ? 118  LYS D CD    1 
ATOM   5680 C  CE    . LYS F  3 118 ? 13.364  29.516  31.503  1.00 33.01 ? 118  LYS D CE    1 
ATOM   5681 N  NZ    . LYS F  3 118 ? 13.812  30.787  32.155  1.00 33.62 ? 118  LYS D NZ    1 
ATOM   5682 N  N     . VAL F  3 119 ? 6.688   30.739  31.181  1.00 30.01 ? 119  VAL D N     1 
ATOM   5683 C  CA    . VAL F  3 119 ? 5.734   31.806  30.878  1.00 29.95 ? 119  VAL D CA    1 
ATOM   5684 C  C     . VAL F  3 119 ? 4.496   31.795  31.781  1.00 30.50 ? 119  VAL D C     1 
ATOM   5685 O  O     . VAL F  3 119 ? 3.938   32.846  32.099  1.00 30.85 ? 119  VAL D O     1 
ATOM   5686 C  CB    . VAL F  3 119 ? 5.312   31.761  29.399  1.00 29.64 ? 119  VAL D CB    1 
ATOM   5687 C  CG1   . VAL F  3 119 ? 4.247   32.802  29.107  1.00 29.40 ? 119  VAL D CG1   1 
ATOM   5688 C  CG2   . VAL F  3 119 ? 6.529   31.967  28.505  1.00 30.04 ? 119  VAL D CG2   1 
ATOM   5689 N  N     . LEU F  3 120 ? 4.068   30.614  32.208  1.00 30.73 ? 120  LEU D N     1 
ATOM   5690 C  CA    . LEU F  3 120 ? 2.901   30.531  33.074  1.00 31.12 ? 120  LEU D CA    1 
ATOM   5691 C  C     . LEU F  3 120 ? 3.257   30.655  34.560  1.00 32.53 ? 120  LEU D C     1 
ATOM   5692 O  O     . LEU F  3 120 ? 2.402   30.461  35.426  1.00 32.48 ? 120  LEU D O     1 
ATOM   5693 C  CB    . LEU F  3 120 ? 2.126   29.242  32.803  1.00 30.53 ? 120  LEU D CB    1 
ATOM   5694 C  CG    . LEU F  3 120 ? 1.501   29.158  31.412  1.00 30.18 ? 120  LEU D CG    1 
ATOM   5695 C  CD1   . LEU F  3 120 ? 0.815   27.823  31.218  1.00 30.04 ? 120  LEU D CD1   1 
ATOM   5696 C  CD2   . LEU F  3 120 ? 0.529   30.317  31.161  1.00 29.64 ? 120  LEU D CD2   1 
ATOM   5697 N  N     . ASN F  3 121 ? 4.520   30.974  34.846  1.00 33.50 ? 121  ASN D N     1 
ATOM   5698 C  CA    . ASN F  3 121 ? 4.976   31.243  36.217  1.00 34.10 ? 121  ASN D CA    1 
ATOM   5699 C  C     . ASN F  3 121 ? 5.001   30.026  37.142  1.00 33.48 ? 121  ASN D C     1 
ATOM   5700 O  O     . ASN F  3 121 ? 4.590   30.112  38.296  1.00 33.28 ? 121  ASN D O     1 
ATOM   5701 C  CB    . ASN F  3 121 ? 4.148   32.370  36.847  1.00 35.26 ? 121  ASN D CB    1 
ATOM   5702 C  CG    . ASN F  3 121 ? 4.338   33.709  36.135  1.00 37.21 ? 121  ASN D CG    1 
ATOM   5703 O  OD1   . ASN F  3 121 ? 5.470   34.143  35.881  1.00 38.22 ? 121  ASN D OD1   1 
ATOM   5704 N  ND2   . ASN F  3 121 ? 3.228   34.372  35.812  1.00 37.05 ? 121  ASN D ND2   1 
ATOM   5705 N  N     . ASN F  3 122 ? 5.512   28.908  36.633  1.00 32.86 ? 122  ASN D N     1 
ATOM   5706 C  CA    . ASN F  3 122 ? 5.527   27.638  37.363  1.00 32.29 ? 122  ASN D CA    1 
ATOM   5707 C  C     . ASN F  3 122 ? 4.147   27.280  37.867  1.00 32.10 ? 122  ASN D C     1 
ATOM   5708 O  O     . ASN F  3 122 ? 3.835   27.501  39.041  1.00 31.53 ? 122  ASN D O     1 
ATOM   5709 C  CB    . ASN F  3 122 ? 6.494   27.668  38.543  1.00 32.48 ? 122  ASN D CB    1 
ATOM   5710 C  CG    . ASN F  3 122 ? 7.812   28.314  38.201  1.00 32.62 ? 122  ASN D CG    1 
ATOM   5711 O  OD1   . ASN F  3 122 ? 8.586   27.803  37.387  1.00 31.92 ? 122  ASN D OD1   1 
ATOM   5712 N  ND2   . ASN F  3 122 ? 8.083   29.446  38.833  1.00 32.76 ? 122  ASN D ND2   1 
ATOM   5713 N  N     . PRO F  3 123 ? 3.306   26.732  36.974  1.00 32.35 ? 123  PRO D N     1 
ATOM   5714 C  CA    . PRO F  3 123 ? 1.980   26.305  37.380  1.00 31.66 ? 123  PRO D CA    1 
ATOM   5715 C  C     . PRO F  3 123 ? 2.070   24.879  37.889  1.00 30.83 ? 123  PRO D C     1 
ATOM   5716 O  O     . PRO F  3 123 ? 3.015   24.165  37.551  1.00 31.32 ? 123  PRO D O     1 
ATOM   5717 C  CB    . PRO F  3 123 ? 1.180   26.374  36.078  1.00 32.11 ? 123  PRO D CB    1 
ATOM   5718 C  CG    . PRO F  3 123 ? 2.196   26.144  34.988  1.00 31.86 ? 123  PRO D CG    1 
ATOM   5719 C  CD    . PRO F  3 123 ? 3.560   26.471  35.544  1.00 32.29 ? 123  PRO D CD    1 
ATOM   5720 N  N     . THR F  3 124 ? 1.113   24.477  38.711  1.00 29.70 ? 124  THR D N     1 
ATOM   5721 C  CA    . THR F  3 124 ? 1.119   23.141  39.282  1.00 28.96 ? 124  THR D CA    1 
ATOM   5722 C  C     . THR F  3 124 ? -0.231  22.494  39.032  1.00 28.73 ? 124  THR D C     1 
ATOM   5723 O  O     . THR F  3 124 ? -0.401  21.287  39.201  1.00 30.12 ? 124  THR D O     1 
ATOM   5724 C  CB    . THR F  3 124 ? 1.440   23.160  40.805  1.00 28.53 ? 124  THR D CB    1 
ATOM   5725 O  OG1   . THR F  3 124 ? 0.604   24.115  41.473  1.00 27.45 ? 124  THR D OG1   1 
ATOM   5726 C  CG2   . THR F  3 124 ? 2.891   23.530  41.036  1.00 27.30 ? 124  THR D CG2   1 
ATOM   5727 N  N     . THR F  3 125 ? -1.187  23.308  38.609  1.00 27.39 ? 125  THR D N     1 
ATOM   5728 C  CA    . THR F  3 125 ? -2.538  22.837  38.401  1.00 27.31 ? 125  THR D CA    1 
ATOM   5729 C  C     . THR F  3 125 ? -3.107  23.412  37.118  1.00 27.23 ? 125  THR D C     1 
ATOM   5730 O  O     . THR F  3 125 ? -2.710  24.494  36.684  1.00 27.68 ? 125  THR D O     1 
ATOM   5731 C  CB    . THR F  3 125 ? -3.484  23.228  39.582  1.00 27.23 ? 125  THR D CB    1 
ATOM   5732 O  OG1   . THR F  3 125 ? -3.444  24.647  39.801  1.00 26.86 ? 125  THR D OG1   1 
ATOM   5733 C  CG2   . THR F  3 125 ? -3.088  22.511  40.857  1.00 26.50 ? 125  THR D CG2   1 
ATOM   5734 N  N     . SER F  3 126 ? -4.028  22.669  36.512  1.00 26.22 ? 126  SER D N     1 
ATOM   5735 C  CA    . SER F  3 126 ? -4.862  23.194  35.452  1.00 25.33 ? 126  SER D CA    1 
ATOM   5736 C  C     . SER F  3 126 ? -5.767  24.237  36.075  1.00 25.67 ? 126  SER D C     1 
ATOM   5737 O  O     . SER F  3 126 ? -5.984  24.236  37.283  1.00 24.21 ? 126  SER D O     1 
ATOM   5738 C  CB    . SER F  3 126 ? -5.726  22.082  34.844  1.00 25.22 ? 126  SER D CB    1 
ATOM   5739 O  OG    . SER F  3 126 ? -6.883  21.839  35.630  1.00 24.17 ? 126  SER D OG    1 
ATOM   5740 N  N     . PRO F  3 127 ? -6.305  25.137  35.249  1.00 25.90 ? 127  PRO D N     1 
ATOM   5741 C  CA    . PRO F  3 127 ? -7.288  26.107  35.718  1.00 26.00 ? 127  PRO D CA    1 
ATOM   5742 C  C     . PRO F  3 127 ? -8.484  25.465  36.433  1.00 26.18 ? 127  PRO D C     1 
ATOM   5743 O  O     . PRO F  3 127 ? -9.134  26.120  37.246  1.00 26.69 ? 127  PRO D O     1 
ATOM   5744 C  CB    . PRO F  3 127 ? -7.748  26.798  34.426  1.00 25.86 ? 127  PRO D CB    1 
ATOM   5745 C  CG    . PRO F  3 127 ? -7.223  25.943  33.301  1.00 25.83 ? 127  PRO D CG    1 
ATOM   5746 C  CD    . PRO F  3 127 ? -5.992  25.303  33.824  1.00 25.07 ? 127  PRO D CD    1 
ATOM   5747 N  N     . PHE F  3 128 ? -8.775  24.202  36.139  1.00 26.57 ? 128  PHE D N     1 
ATOM   5748 C  CA    . PHE F  3 128 ? -9.926  23.529  36.750  1.00 26.90 ? 128  PHE D CA    1 
ATOM   5749 C  C     . PHE F  3 128 ? -9.634  23.050  38.160  1.00 26.53 ? 128  PHE D C     1 
ATOM   5750 O  O     . PHE F  3 128 ? -10.551 22.775  38.922  1.00 26.88 ? 128  PHE D O     1 
ATOM   5751 C  CB    . PHE F  3 128 ? -10.383 22.351  35.893  1.00 27.98 ? 128  PHE D CB    1 
ATOM   5752 C  CG    . PHE F  3 128 ? -10.731 22.737  34.491  1.00 28.99 ? 128  PHE D CG    1 
ATOM   5753 C  CD1   . PHE F  3 128 ? -9.848  22.484  33.447  1.00 29.14 ? 128  PHE D CD1   1 
ATOM   5754 C  CD2   . PHE F  3 128 ? -11.934 23.380  34.217  1.00 28.93 ? 128  PHE D CD2   1 
ATOM   5755 C  CE1   . PHE F  3 128 ? -10.163 22.843  32.151  1.00 29.36 ? 128  PHE D CE1   1 
ATOM   5756 C  CE2   . PHE F  3 128 ? -12.264 23.744  32.928  1.00 29.38 ? 128  PHE D CE2   1 
ATOM   5757 C  CZ    . PHE F  3 128 ? -11.374 23.476  31.885  1.00 29.44 ? 128  PHE D CZ    1 
ATOM   5758 N  N     . GLY F  3 129 ? -8.354  22.944  38.497  1.00 26.06 ? 129  GLY D N     1 
ATOM   5759 C  CA    . GLY F  3 129 ? -7.951  22.532  39.827  1.00 24.98 ? 129  GLY D CA    1 
ATOM   5760 C  C     . GLY F  3 129 ? -6.992  21.361  39.841  1.00 24.70 ? 129  GLY D C     1 
ATOM   5761 O  O     . GLY F  3 129 ? -6.039  21.362  40.614  1.00 25.70 ? 129  GLY D O     1 
ATOM   5762 N  N     . ASN F  3 130 ? -7.242  20.370  38.986  1.00 23.99 ? 130  ASN D N     1 
ATOM   5763 C  CA    . ASN F  3 130 ? -6.480  19.112  38.963  1.00 23.51 ? 130  ASN D CA    1 
ATOM   5764 C  C     . ASN F  3 130 ? -4.973  19.314  38.837  1.00 23.53 ? 130  ASN D C     1 
ATOM   5765 O  O     . ASN F  3 130 ? -4.524  20.237  38.164  1.00 23.75 ? 130  ASN D O     1 
ATOM   5766 C  CB    . ASN F  3 130 ? -6.967  18.212  37.823  1.00 23.46 ? 130  ASN D CB    1 
ATOM   5767 C  CG    . ASN F  3 130 ? -8.475  18.209  37.683  1.00 24.00 ? 130  ASN D CG    1 
ATOM   5768 O  OD1   . ASN F  3 130 ? -9.077  19.186  37.227  1.00 24.21 ? 130  ASN D OD1   1 
ATOM   5769 N  ND2   . ASN F  3 130 ? -9.099  17.098  38.061  1.00 25.10 ? 130  ASN D ND2   1 
ATOM   5770 N  N     . PRO F  3 131 ? -4.175  18.444  39.476  1.00 23.81 ? 131  PRO D N     1 
ATOM   5771 C  CA    . PRO F  3 131 ? -2.737  18.719  39.428  1.00 24.24 ? 131  PRO D CA    1 
ATOM   5772 C  C     . PRO F  3 131 ? -2.176  18.461  38.037  1.00 24.95 ? 131  PRO D C     1 
ATOM   5773 O  O     . PRO F  3 131 ? -2.875  17.930  37.171  1.00 25.12 ? 131  PRO D O     1 
ATOM   5774 C  CB    . PRO F  3 131 ? -2.148  17.740  40.451  1.00 23.40 ? 131  PRO D CB    1 
ATOM   5775 C  CG    . PRO F  3 131 ? -3.139  16.646  40.545  1.00 23.52 ? 131  PRO D CG    1 
ATOM   5776 C  CD    . PRO F  3 131 ? -4.491  17.223  40.235  1.00 23.19 ? 131  PRO D CD    1 
ATOM   5777 N  N     . ILE F  3 132 ? -0.929  18.859  37.822  1.00 25.09 ? 132  ILE D N     1 
ATOM   5778 C  CA    . ILE F  3 132 ? -0.271  18.648  36.542  1.00 24.17 ? 132  ILE D CA    1 
ATOM   5779 C  C     . ILE F  3 132 ? 0.926   17.745  36.776  1.00 24.24 ? 132  ILE D C     1 
ATOM   5780 O  O     . ILE F  3 132 ? 1.886   18.135  37.448  1.00 25.15 ? 132  ILE D O     1 
ATOM   5781 C  CB    . ILE F  3 132 ? 0.183   19.982  35.906  1.00 24.20 ? 132  ILE D CB    1 
ATOM   5782 C  CG1   . ILE F  3 132 ? -1.028  20.879  35.617  1.00 23.84 ? 132  ILE D CG1   1 
ATOM   5783 C  CG2   . ILE F  3 132 ? 0.999   19.728  34.646  1.00 22.92 ? 132  ILE D CG2   1 
ATOM   5784 C  CD1   . ILE F  3 132 ? -0.667  22.283  35.185  1.00 24.18 ? 132  ILE D CD1   1 
ATOM   5785 N  N     . PRO F  3 133 ? 0.881   16.535  36.206  1.00 23.45 ? 133  PRO D N     1 
ATOM   5786 C  CA    . PRO F  3 133 ? 1.863   15.515  36.499  1.00 22.36 ? 133  PRO D CA    1 
ATOM   5787 C  C     . PRO F  3 133 ? 3.054   15.689  35.588  1.00 22.69 ? 133  PRO D C     1 
ATOM   5788 O  O     . PRO F  3 133 ? 3.022   16.528  34.683  1.00 22.29 ? 133  PRO D O     1 
ATOM   5789 C  CB    . PRO F  3 133 ? 1.127   14.234  36.121  1.00 23.38 ? 133  PRO D CB    1 
ATOM   5790 C  CG    . PRO F  3 133 ? 0.263   14.635  34.964  1.00 22.20 ? 133  PRO D CG    1 
ATOM   5791 C  CD    . PRO F  3 133 ? -0.098  16.089  35.194  1.00 22.96 ? 133  PRO D CD    1 
ATOM   5792 N  N     . GLY F  3 134 ? 4.099   14.903  35.823  1.00 23.23 ? 134  GLY D N     1 
ATOM   5793 C  CA    . GLY F  3 134 ? 5.246   14.850  34.909  1.00 24.28 ? 134  GLY D CA    1 
ATOM   5794 C  C     . GLY F  3 134 ? 6.148   16.069  34.862  1.00 24.99 ? 134  GLY D C     1 
ATOM   5795 O  O     . GLY F  3 134 ? 7.080   16.128  34.052  1.00 24.80 ? 134  GLY D O     1 
ATOM   5796 N  N     . LEU F  3 135 ? 5.885   17.038  35.736  1.00 26.07 ? 135  LEU D N     1 
ATOM   5797 C  CA    . LEU F  3 135 ? 6.664   18.273  35.770  1.00 26.61 ? 135  LEU D CA    1 
ATOM   5798 C  C     . LEU F  3 135 ? 8.136   17.999  36.047  1.00 27.96 ? 135  LEU D C     1 
ATOM   5799 O  O     . LEU F  3 135 ? 9.013   18.596  35.415  1.00 28.84 ? 135  LEU D O     1 
ATOM   5800 C  CB    . LEU F  3 135 ? 6.102   19.236  36.809  1.00 26.30 ? 135  LEU D CB    1 
ATOM   5801 C  CG    . LEU F  3 135 ? 4.741   19.848  36.463  1.00 26.50 ? 135  LEU D CG    1 
ATOM   5802 C  CD1   . LEU F  3 135 ? 4.159   20.600  37.655  1.00 26.32 ? 135  LEU D CD1   1 
ATOM   5803 C  CD2   . LEU F  3 135 ? 4.863   20.756  35.246  1.00 25.69 ? 135  LEU D CD2   1 
ATOM   5804 N  N     . VAL F  3 136 ? 8.407   17.091  36.982  1.00 28.18 ? 136  VAL D N     1 
ATOM   5805 C  CA    . VAL F  3 136 ? 9.784   16.734  37.300  1.00 28.55 ? 136  VAL D CA    1 
ATOM   5806 C  C     . VAL F  3 136 ? 10.446  16.050  36.109  1.00 28.64 ? 136  VAL D C     1 
ATOM   5807 O  O     . VAL F  3 136 ? 11.536  16.439  35.691  1.00 28.83 ? 136  VAL D O     1 
ATOM   5808 C  CB    . VAL F  3 136 ? 9.878   15.835  38.555  1.00 28.55 ? 136  VAL D CB    1 
ATOM   5809 C  CG1   . VAL F  3 136 ? 11.332  15.515  38.875  1.00 26.88 ? 136  VAL D CG1   1 
ATOM   5810 C  CG2   . VAL F  3 136 ? 9.199   16.512  39.735  1.00 28.08 ? 136  VAL D CG2   1 
ATOM   5811 N  N     . GLU F  3 137 ? 9.779   15.044  35.554  1.00 28.88 ? 137  GLU D N     1 
ATOM   5812 C  CA    . GLU F  3 137 ? 10.300  14.342  34.381  1.00 29.72 ? 137  GLU D CA    1 
ATOM   5813 C  C     . GLU F  3 137 ? 10.633  15.337  33.273  1.00 29.80 ? 137  GLU D C     1 
ATOM   5814 O  O     . GLU F  3 137 ? 11.539  15.113  32.475  1.00 29.51 ? 137  GLU D O     1 
ATOM   5815 C  CB    . GLU F  3 137 ? 9.291   13.307  33.859  1.00 30.09 ? 137  GLU D CB    1 
ATOM   5816 C  CG    . GLU F  3 137 ? 8.881   12.220  34.854  1.00 30.83 ? 137  GLU D CG    1 
ATOM   5817 C  CD    . GLU F  3 137 ? 7.777   12.666  35.820  1.00 31.59 ? 137  GLU D CD    1 
ATOM   5818 O  OE1   . GLU F  3 137 ? 7.877   13.784  36.389  1.00 31.80 ? 137  GLU D OE1   1 
ATOM   5819 O  OE2   . GLU F  3 137 ? 6.811   11.889  36.016  1.00 31.26 ? 137  GLU D OE2   1 
ATOM   5820 N  N     . LEU F  3 138 ? 9.895   16.442  33.241  1.00 30.97 ? 138  LEU D N     1 
ATOM   5821 C  CA    . LEU F  3 138 ? 10.022  17.424  32.173  1.00 31.84 ? 138  LEU D CA    1 
ATOM   5822 C  C     . LEU F  3 138 ? 11.433  18.028  32.089  1.00 33.12 ? 138  LEU D C     1 
ATOM   5823 O  O     . LEU F  3 138 ? 12.179  17.729  31.158  1.00 33.23 ? 138  LEU D O     1 
ATOM   5824 C  CB    . LEU F  3 138 ? 8.972   18.524  32.340  1.00 30.73 ? 138  LEU D CB    1 
ATOM   5825 C  CG    . LEU F  3 138 ? 8.226   18.984  31.088  1.00 30.38 ? 138  LEU D CG    1 
ATOM   5826 C  CD1   . LEU F  3 138 ? 7.753   20.405  31.269  1.00 29.73 ? 138  LEU D CD1   1 
ATOM   5827 C  CD2   . LEU F  3 138 ? 9.081   18.861  29.829  1.00 30.50 ? 138  LEU D CD2   1 
ATOM   5828 N  N     . GLY F  3 139 ? 11.789  18.873  33.058  1.00 33.99 ? 139  GLY D N     1 
ATOM   5829 C  CA    . GLY F  3 139 ? 13.074  19.565  33.044  1.00 34.26 ? 139  GLY D CA    1 
ATOM   5830 C  C     . GLY F  3 139 ? 12.922  21.008  32.592  1.00 35.64 ? 139  GLY D C     1 
ATOM   5831 O  O     . GLY F  3 139 ? 13.909  21.692  32.288  1.00 36.82 ? 139  GLY D O     1 
HETATM 5832 NI NI    . NI  G  4 .   ? -6.531  -28.481 -6.709  1.00 20.09 ? 1001 NI  A NI    1 
HETATM 5833 NI NI    . NI  H  4 .   ? -3.546  -20.229 -8.656  1.00 15.43 ? 1002 NI  A NI    1 
HETATM 5834 NI NI    . NI  I  4 .   ? -27.214 -15.098 -1.679  1.00 29.65 ? 1003 NI  A NI    1 
HETATM 5835 C  C     . ACT J  5 .   ? -8.491  -29.316 -5.628  1.00 27.22 ? 2001 ACT A C     1 
HETATM 5836 O  O     . ACT J  5 .   ? -8.204  -28.104 -5.466  1.00 26.26 ? 2001 ACT A O     1 
HETATM 5837 O  OXT   . ACT J  5 .   ? -8.520  -29.719 -6.830  1.00 25.24 ? 2001 ACT A OXT   1 
HETATM 5838 C  CH3   . ACT J  5 .   ? -8.774  -30.206 -4.441  1.00 24.99 ? 2001 ACT A CH3   1 
HETATM 5839 C  C     . ACT K  5 .   ? -26.096 -17.643 -2.192  1.00 41.40 ? 2002 ACT A C     1 
HETATM 5840 O  O     . ACT K  5 .   ? -26.170 -16.610 -2.903  1.00 41.27 ? 2002 ACT A O     1 
HETATM 5841 O  OXT   . ACT K  5 .   ? -25.731 -17.464 -1.008  1.00 40.84 ? 2002 ACT A OXT   1 
HETATM 5842 C  CH3   . ACT K  5 .   ? -26.429 -19.011 -2.718  1.00 40.19 ? 2002 ACT A CH3   1 
HETATM 5843 C  C     . ACT L  5 .   ? -29.242 -13.723 -2.059  1.00 21.36 ? 2003 ACT A C     1 
HETATM 5844 O  O     . ACT L  5 .   ? -28.066 -13.282 -2.239  1.00 20.23 ? 2003 ACT A O     1 
HETATM 5845 O  OXT   . ACT L  5 .   ? -29.578 -13.975 -0.870  1.00 20.07 ? 2003 ACT A OXT   1 
HETATM 5846 C  CH3   . ACT L  5 .   ? -30.207 -13.954 -3.189  1.00 19.57 ? 2003 ACT A CH3   1 
HETATM 5847 NI NI    . NI  M  4 .   ? 12.009  -21.444 -26.550 1.00 16.57 ? 1001 NI  B NI    1 
HETATM 5848 NI NI    . NI  N  4 .   ? 8.659   -16.043 -20.246 1.00 16.89 ? 1002 NI  B NI    1 
HETATM 5849 NI NI    . NI  O  4 .   ? 31.782  -5.219  -20.191 1.00 42.02 ? 1003 NI  B NI    1 
HETATM 5850 C  C     . ACT P  5 .   ? 14.193  -21.444 -27.892 1.00 18.15 ? 2001 ACT B C     1 
HETATM 5851 O  O     . ACT P  5 .   ? 14.287  -22.330 -27.000 1.00 18.22 ? 2001 ACT B O     1 
HETATM 5852 O  OXT   . ACT P  5 .   ? 13.953  -20.274 -27.484 1.00 16.25 ? 2001 ACT B OXT   1 
HETATM 5853 C  CH3   . ACT P  5 .   ? 14.350  -21.780 -29.353 1.00 16.42 ? 2001 ACT B CH3   1 
HETATM 5854 C  C     . ACT Q  5 .   ? 31.250  -7.097  -21.533 1.00 11.15 ? 2002 ACT B C     1 
HETATM 5855 O  O     . ACT Q  5 .   ? 32.029  -6.180  -21.842 1.00 8.26  ? 2002 ACT B O     1 
HETATM 5856 O  OXT   . ACT Q  5 .   ? 30.937  -7.109  -20.328 1.00 11.16 ? 2002 ACT B OXT   1 
HETATM 5857 C  CH3   . ACT Q  5 .   ? 30.732  -8.107  -22.523 1.00 12.79 ? 2002 ACT B CH3   1 
HETATM 5858 NI NI    . NI  R  4 .   ? 5.219   28.413  8.470   1.00 27.04 ? 1001 NI  C NI    1 
HETATM 5859 NI NI    . NI  S  4 .   ? 0.781   20.686  9.049   1.00 19.78 ? 1002 NI  C NI    1 
HETATM 5860 NI NI    . NI  T  4 .   ? -3.658  25.689  -15.164 1.00 23.53 ? 1003 NI  C NI    1 
HETATM 5861 C  C     . ACT U  5 .   ? 6.563   29.986  6.860   1.00 40.30 ? 2001 ACT C C     1 
HETATM 5862 O  O     . ACT U  5 .   ? 7.078   29.098  7.579   1.00 39.84 ? 2001 ACT C O     1 
HETATM 5863 O  OXT   . ACT U  5 .   ? 5.325   30.144  7.002   1.00 39.99 ? 2001 ACT C OXT   1 
HETATM 5864 C  CH3   . ACT U  5 .   ? 7.383   30.801  5.898   1.00 38.94 ? 2001 ACT C CH3   1 
HETATM 5865 C  C     . ACT V  5 .   ? -2.414  26.974  -13.085 1.00 23.63 ? 2002 ACT C C     1 
HETATM 5866 O  O     . ACT V  5 .   ? -3.568  26.490  -12.916 1.00 22.19 ? 2002 ACT C O     1 
HETATM 5867 O  OXT   . ACT V  5 .   ? -2.188  27.450  -14.224 1.00 22.84 ? 2002 ACT C OXT   1 
HETATM 5868 C  CH3   . ACT V  5 .   ? -1.357  26.973  -12.013 1.00 21.45 ? 2002 ACT C CH3   1 
HETATM 5869 C  C     . ACT W  5 .   ? -5.502  25.709  -17.219 1.00 20.84 ? 2003 ACT C C     1 
HETATM 5870 O  O     . ACT W  5 .   ? -4.389  26.007  -17.701 1.00 19.42 ? 2003 ACT C O     1 
HETATM 5871 O  OXT   . ACT W  5 .   ? -5.507  24.672  -16.506 1.00 21.24 ? 2003 ACT C OXT   1 
HETATM 5872 C  CH3   . ACT W  5 .   ? -6.732  26.536  -17.476 1.00 19.16 ? 2003 ACT C CH3   1 
HETATM 5873 NI NI    . NI  X  4 .   ? -9.261  18.665  30.835  1.00 25.38 ? 1001 NI  D NI    1 
HETATM 5874 NI NI    . NI  Y  4 .   ? -7.434  14.216  23.230  1.00 19.50 ? 1002 NI  D NI    1 
HETATM 5875 NI NI    . NI  Z  4 .   ? -6.803  -4.777  39.648  1.00 37.15 ? 1003 NI  D NI    1 
HETATM 5876 C  C     . ACT AA 5 .   ? -9.808  18.122  32.976  1.00 29.94 ? 2001 ACT D C     1 
HETATM 5877 O  O     . ACT AA 5 .   ? -8.680  18.606  33.247  1.00 30.00 ? 2001 ACT D O     1 
HETATM 5878 O  OXT   . ACT AA 5 .   ? -9.824  17.319  32.008  1.00 28.51 ? 2001 ACT D OXT   1 
HETATM 5879 C  CH3   . ACT AA 5 .   ? -11.050 18.483  33.752  1.00 28.80 ? 2001 ACT D CH3   1 
HETATM 5880 C  C     . ACT BA 5 .   ? -5.648  -6.686  39.628  1.00 28.99 ? 2002 ACT D C     1 
HETATM 5881 O  O     . ACT BA 5 .   ? -6.323  -6.378  38.607  1.00 27.45 ? 2002 ACT D O     1 
HETATM 5882 O  OXT   . ACT BA 5 .   ? -4.685  -5.930  39.875  1.00 29.29 ? 2002 ACT D OXT   1 
HETATM 5883 C  CH3   . ACT BA 5 .   ? -5.951  -7.859  40.518  1.00 26.81 ? 2002 ACT D CH3   1 
HETATM 5884 O  O     . HOH CA 6 .   ? -9.147  -0.047  1.982   1.00 9.71  ? 34   HOH E O     1 
HETATM 5885 O  O     . HOH CA 6 .   ? -12.046 -4.308  6.187   1.00 11.28 ? 35   HOH E O     1 
HETATM 5886 O  O     . HOH CA 6 .   ? 7.542   3.441   -5.188  1.00 8.83  ? 36   HOH E O     1 
HETATM 5887 O  O     . HOH CA 6 .   ? 2.507   -1.488  3.048   1.00 5.19  ? 37   HOH E O     1 
HETATM 5888 O  O     . HOH DA 6 .   ? -0.551  16.781  -10.973 1.00 10.33 ? 34   HOH F O     1 
HETATM 5889 O  O     . HOH DA 6 .   ? 16.608  4.066   -25.312 1.00 19.77 ? 35   HOH F O     1 
HETATM 5890 O  O     . HOH DA 6 .   ? -2.616  2.642   9.519   1.00 9.69  ? 36   HOH F O     1 
HETATM 5891 O  O     . HOH DA 6 .   ? -7.349  5.380   -16.786 1.00 26.33 ? 37   HOH F O     1 
HETATM 5892 O  O     . HOH EA 6 .   ? -7.371  1.666   -1.407  1.00 11.81 ? 2004 HOH A O     1 
HETATM 5893 O  O     . HOH EA 6 .   ? 8.525   -39.823 -11.540 1.00 13.00 ? 2005 HOH A O     1 
HETATM 5894 O  O     . HOH EA 6 .   ? -7.936  -8.260  7.704   1.00 3.30  ? 2006 HOH A O     1 
HETATM 5895 O  O     . HOH EA 6 .   ? -18.737 -28.504 -19.713 1.00 12.39 ? 2007 HOH A O     1 
HETATM 5896 O  O     . HOH EA 6 .   ? -17.416 -27.042 -10.938 1.00 27.90 ? 2008 HOH A O     1 
HETATM 5897 O  O     . HOH EA 6 .   ? 0.889   -10.628 -14.141 1.00 13.41 ? 2009 HOH A O     1 
HETATM 5898 O  O     . HOH FA 6 .   ? 25.070  -13.192 -6.342  1.00 8.17  ? 2003 HOH B O     1 
HETATM 5899 O  O     . HOH FA 6 .   ? 25.164  -28.036 -15.988 1.00 16.03 ? 2004 HOH B O     1 
HETATM 5900 O  O     . HOH FA 6 .   ? 9.822   -10.166 -11.286 1.00 2.00  ? 2005 HOH B O     1 
HETATM 5901 O  O     . HOH FA 6 .   ? 28.987  3.933   -22.288 1.00 19.10 ? 2006 HOH B O     1 
HETATM 5902 O  O     . HOH FA 6 .   ? 1.527   -7.317  -19.647 1.00 19.05 ? 2007 HOH B O     1 
HETATM 5903 O  O     . HOH FA 6 .   ? 5.903   -20.339 -30.130 1.00 8.09  ? 2008 HOH B O     1 
HETATM 5904 O  O     . HOH FA 6 .   ? 9.555   -3.704  -16.860 1.00 10.50 ? 2009 HOH B O     1 
HETATM 5905 O  O     . HOH FA 6 .   ? 14.151  -23.080 -9.268  1.00 12.89 ? 2010 HOH B O     1 
HETATM 5906 O  O     . HOH FA 6 .   ? 2.931   -11.071 -11.086 1.00 17.96 ? 2011 HOH B O     1 
HETATM 5907 O  O     . HOH FA 6 .   ? 5.932   -0.052  -26.895 1.00 21.08 ? 2012 HOH B O     1 
HETATM 5908 O  O     . HOH GA 6 .   ? 1.569   11.104  -18.406 1.00 24.93 ? 2004 HOH C O     1 
HETATM 5909 O  O     . HOH GA 6 .   ? -9.121  22.470  14.134  1.00 13.56 ? 2005 HOH C O     1 
HETATM 5910 O  O     . HOH GA 6 .   ? -5.640  8.787   -9.025  1.00 20.28 ? 2006 HOH C O     1 
HETATM 5911 O  O     . HOH GA 6 .   ? 1.567   18.734  10.040  1.00 20.08 ? 2007 HOH C O     1 
HETATM 5912 O  O     . HOH HA 6 .   ? 8.630   17.085  22.201  1.00 32.22 ? 2003 HOH D O     1 
HETATM 5913 O  O     . HOH HA 6 .   ? -9.087  -0.622  16.937  1.00 18.36 ? 2004 HOH D O     1 
HETATM 5914 O  O     . HOH HA 6 .   ? 3.028   10.020  24.532  1.00 24.94 ? 2005 HOH D O     1 
HETATM 5915 O  O     . HOH HA 6 .   ? -5.825  10.795  42.046  1.00 12.07 ? 2006 HOH D O     1 
HETATM 5916 O  O     . HOH HA 6 .   ? -12.490 15.544  36.887  1.00 8.94  ? 2007 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   E . n 
A 1 2   DC  2   2   2   DC  C   E . n 
A 1 3   DC  3   3   3   DC  C   E . n 
A 1 4   DT  4   4   4   DT  T   E . n 
A 1 5   DG  5   5   5   DG  G   E . n 
A 1 6   DT  6   6   6   DT  T   E . n 
A 1 7   DT  7   7   7   DT  T   E . n 
A 1 8   DA  8   8   8   DA  A   E . n 
A 1 9   DG  9   9   9   DG  G   E . n 
A 1 10  DC  10  10  10  DC  C   E . n 
A 1 11  DA  11  11  11  DA  A   E . n 
A 1 12  DC  12  12  12  DC  C   E . n 
A 1 13  DA  13  13  13  DA  A   E . n 
A 1 14  DG  14  14  14  DG  G   E . n 
A 1 15  DG  15  15  15  DG  G   E . n 
A 1 16  DC  16  16  16  DC  C   E . n 
A 1 17  DT  17  17  17  DT  T   E . n 
A 1 18  DG  18  18  18  DG  G   E . n 
A 1 19  DC  19  19  19  DC  C   E . n 
A 1 20  DC  20  20  20  DC  C   E . n 
A 1 21  DC  21  21  21  DC  C   E . n 
A 1 22  DT  22  22  22  DT  T   E . n 
A 1 23  DA  23  23  23  DA  A   E . n 
A 1 24  DA  24  24  24  DA  A   E . n 
A 1 25  DT  25  25  25  DT  T   E . n 
A 1 26  DT  26  26  26  DT  T   E . n 
A 1 27  DT  27  27  27  DT  T   E . n 
A 1 28  DT  28  28  28  DT  T   E . n 
A 1 29  DA  29  29  29  DA  A   E . n 
A 1 30  DG  30  30  30  DG  G   E . n 
A 1 31  DT  31  31  31  DT  T   E . n 
A 1 32  DG  32  32  32  DG  G   E . n 
A 1 33  DG  33  33  33  DG  G   E . n 
B 2 1   DC  1   1   1   DC  C   F . n 
B 2 2   DA  2   2   2   DA  A   F . n 
B 2 3   DC  3   3   3   DC  C   F . n 
B 2 4   DT  4   4   4   DT  T   F . n 
B 2 5   DA  5   5   5   DA  A   F . n 
B 2 6   DA  6   6   6   DA  A   F . n 
B 2 7   DA  7   7   7   DA  A   F . n 
B 2 8   DA  8   8   8   DA  A   F . n 
B 2 9   DT  9   9   9   DT  T   F . n 
B 2 10  DT  10  10  10  DT  T   F . n 
B 2 11  DA  11  11  11  DA  A   F . n 
B 2 12  DG  12  12  12  DG  G   F . n 
B 2 13  DG  13  13  13  DG  G   F . n 
B 2 14  DG  14  14  14  DG  G   F . n 
B 2 15  DC  15  15  15  DC  C   F . n 
B 2 16  DA  16  16  16  DA  A   F . n 
B 2 17  DG  17  17  17  DG  G   F . n 
B 2 18  DC  18  18  18  DC  C   F . n 
B 2 19  DC  19  19  19  DC  C   F . n 
B 2 20  DT  20  20  20  DT  T   F . n 
B 2 21  DG  21  21  21  DG  G   F . n 
B 2 22  DT  22  22  22  DT  T   F . n 
B 2 23  DG  23  23  23  DG  G   F . n 
B 2 24  DC  24  24  24  DC  C   F . n 
B 2 25  DT  25  25  25  DT  T   F . n 
B 2 26  DA  26  26  26  DA  A   F . n 
B 2 27  DA  27  27  27  DA  A   F . n 
B 2 28  DC  28  28  28  DC  C   F . n 
B 2 29  DA  29  29  29  DA  A   F . n 
B 2 30  DG  30  30  30  DG  G   F . n 
B 2 31  DG  31  31  31  DG  G   F . n 
B 2 32  DG  32  32  32  DG  G   F . n 
B 2 33  DC  33  33  33  DC  C   F . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   ASN 2   2   ?   ?   ?   A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   VAL 5   5   5   VAL VAL A . n 
C 3 6   ASP 6   6   6   ASP ASP A . n 
C 3 7   THR 7   7   7   THR THR A . n 
C 3 8   THR 8   8   8   THR THR A . n 
C 3 9   GLU 9   9   9   GLU GLU A . n 
C 3 10  MET 10  10  10  MET MET A . n 
C 3 11  TYR 11  11  11  TYR TYR A . n 
C 3 12  LEU 12  12  12  LEU LEU A . n 
C 3 13  ARG 13  13  13  ARG ARG A . n 
C 3 14  THR 14  14  14  THR THR A . n 
C 3 15  ILE 15  15  15  ILE ILE A . n 
C 3 16  TYR 16  16  16  TYR TYR A . n 
C 3 17  ASP 17  17  17  ASP ASP A . n 
C 3 18  LEU 18  18  18  LEU LEU A . n 
C 3 19  GLU 19  19  19  GLU GLU A . n 
C 3 20  GLU 20  20  20  GLU GLU A . n 
C 3 21  GLU 21  21  21  GLU GLU A . n 
C 3 22  GLY 22  22  22  GLY GLY A . n 
C 3 23  VAL 23  23  23  VAL VAL A . n 
C 3 24  THR 24  24  24  THR THR A . n 
C 3 25  PRO 25  25  25  PRO PRO A . n 
C 3 26  LEU 26  26  26  LEU LEU A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  ALA 28  28  28  ALA ALA A . n 
C 3 29  ARG 29  29  29  ARG ARG A . n 
C 3 30  ILE 30  30  30  ILE ILE A . n 
C 3 31  ALA 31  31  31  ALA ALA A . n 
C 3 32  GLU 32  32  32  GLU GLU A . n 
C 3 33  ARG 33  33  33  ARG ARG A . n 
C 3 34  LEU 34  34  34  LEU LEU A . n 
C 3 35  ASP 35  35  35  ASP ASP A . n 
C 3 36  GLN 36  36  36  GLN GLN A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  GLY 38  38  38  GLY GLY A . n 
C 3 39  PRO 39  39  39  PRO PRO A . n 
C 3 40  THR 40  40  40  THR THR A . n 
C 3 41  VAL 41  41  41  VAL VAL A . n 
C 3 42  SER 42  42  42  SER SER A . n 
C 3 43  GLN 43  43  43  GLN GLN A . n 
C 3 44  THR 44  44  44  THR THR A . n 
C 3 45  VAL 45  45  45  VAL VAL A . n 
C 3 46  SER 46  46  46  SER SER A . n 
C 3 47  ARG 47  47  47  ARG ARG A . n 
C 3 48  MET 48  48  48  MET MET A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  ARG 50  50  50  ARG ARG A . n 
C 3 51  ASP 51  51  51  ASP ASP A . n 
C 3 52  GLY 52  52  52  GLY GLY A . n 
C 3 53  LEU 53  53  53  LEU LEU A . n 
C 3 54  LEU 54  54  54  LEU LEU A . n 
C 3 55  ARG 55  55  55  ARG ARG A . n 
C 3 56  VAL 56  56  56  VAL VAL A . n 
C 3 57  ALA 57  57  57  ALA ALA A . n 
C 3 58  GLY 58  58  58  GLY GLY A . n 
C 3 59  ASP 59  59  59  ASP ASP A . n 
C 3 60  ARG 60  60  60  ARG ARG A . n 
C 3 61  HIS 61  61  61  HIS HIS A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  GLU 63  63  63  GLU GLU A . n 
C 3 64  LEU 64  64  64  LEU LEU A . n 
C 3 65  THR 65  65  65  THR THR A . n 
C 3 66  GLU 66  66  66  GLU GLU A . n 
C 3 67  LYS 67  67  67  LYS LYS A . n 
C 3 68  GLY 68  68  68  GLY GLY A . n 
C 3 69  ARG 69  69  69  ARG ARG A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ALA 72  72  72  ALA ALA A . n 
C 3 73  ILE 73  73  73  ILE ILE A . n 
C 3 74  ALA 74  74  74  ALA ALA A . n 
C 3 75  VAL 75  75  75  VAL VAL A . n 
C 3 76  MET 76  76  76  MET MET A . n 
C 3 77  ARG 77  77  77  ARG ARG A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  HIS 79  79  79  HIS HIS A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  LEU 81  81  81  LEU LEU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  GLU 83  83  83  GLU GLU A . n 
C 3 84  ARG 84  84  84  ARG ARG A . n 
C 3 85  LEU 85  85  85  LEU LEU A . n 
C 3 86  LEU 86  86  86  LEU LEU A . n 
C 3 87  VAL 87  87  87  VAL VAL A . n 
C 3 88  ASP 88  88  88  ASP ASP A . n 
C 3 89  VAL 89  89  89  VAL VAL A . n 
C 3 90  ILE 90  90  90  ILE ILE A . n 
C 3 91  GLY 91  91  91  GLY GLY A . n 
C 3 92  LEU 92  92  92  LEU LEU A . n 
C 3 93  PRO 93  93  93  PRO PRO A . n 
C 3 94  TRP 94  94  94  TRP TRP A . n 
C 3 95  GLU 95  95  95  GLU GLU A . n 
C 3 96  GLU 96  96  96  GLU GLU A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  HIS 98  98  98  HIS HIS A . n 
C 3 99  ALA 99  99  99  ALA ALA A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ALA 101 101 101 ALA ALA A . n 
C 3 102 CYS 102 102 102 CYS CYS A . n 
C 3 103 ARG 103 103 103 ARG ARG A . n 
C 3 104 TRP 104 104 104 TRP TRP A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 HIS 106 106 106 HIS HIS A . n 
C 3 107 VAL 107 107 107 VAL VAL A . n 
C 3 108 MET 108 108 108 MET MET A . n 
C 3 109 SER 109 109 109 SER SER A . n 
C 3 110 GLU 110 110 110 GLU GLU A . n 
C 3 111 ASP 111 111 111 ASP ASP A . n 
C 3 112 VAL 112 112 112 VAL VAL A . n 
C 3 113 GLU 113 113 113 GLU GLU A . n 
C 3 114 ARG 114 114 114 ARG ARG A . n 
C 3 115 ARG 115 115 115 ARG ARG A . n 
C 3 116 LEU 116 116 116 LEU LEU A . n 
C 3 117 VAL 117 117 117 VAL VAL A . n 
C 3 118 LYS 118 118 118 LYS LYS A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 LEU 120 120 120 LEU LEU A . n 
C 3 121 ASN 121 121 121 ASN ASN A . n 
C 3 122 ASN 122 122 122 ASN ASN A . n 
C 3 123 PRO 123 123 123 PRO PRO A . n 
C 3 124 THR 124 124 124 THR THR A . n 
C 3 125 THR 125 125 125 THR THR A . n 
C 3 126 SER 126 126 126 SER SER A . n 
C 3 127 PRO 127 127 127 PRO PRO A . n 
C 3 128 PHE 128 128 128 PHE PHE A . n 
C 3 129 GLY 129 129 129 GLY GLY A . n 
C 3 130 ASN 130 130 130 ASN ASN A . n 
C 3 131 PRO 131 131 131 PRO PRO A . n 
C 3 132 ILE 132 132 132 ILE ILE A . n 
C 3 133 PRO 133 133 133 PRO PRO A . n 
C 3 134 GLY 134 134 134 GLY GLY A . n 
C 3 135 LEU 135 135 135 LEU LEU A . n 
C 3 136 VAL 136 136 136 VAL VAL A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 LEU 138 138 138 LEU LEU A . n 
C 3 139 GLY 139 139 139 GLY GLY A . n 
C 3 140 VAL 140 140 140 VAL VAL A . n 
C 3 141 ALA 141 141 141 ALA ALA A . n 
C 3 142 SER 142 142 142 SER SER A . n 
C 3 143 GLU 143 143 143 GLU GLU A . n 
C 3 144 ASN 144 144 144 ASN ASN A . n 
C 3 145 LEU 145 145 145 LEU LEU A . n 
C 3 146 TYR 146 146 146 TYR TYR A . n 
C 3 147 PHE 147 147 147 PHE PHE A . n 
C 3 148 GLN 148 148 ?   ?   ?   A . n 
C 3 149 GLY 149 149 ?   ?   ?   A . n 
C 3 150 GLY 150 150 ?   ?   ?   A . n 
C 3 151 GLY 151 151 ?   ?   ?   A . n 
C 3 152 HIS 152 152 ?   ?   ?   A . n 
C 3 153 HIS 153 153 ?   ?   ?   A . n 
C 3 154 HIS 154 154 ?   ?   ?   A . n 
C 3 155 HIS 155 155 ?   ?   ?   A . n 
C 3 156 HIS 156 156 ?   ?   ?   A . n 
C 3 157 HIS 157 157 ?   ?   ?   A . n 
D 3 1   MET 1   1   ?   ?   ?   B . n 
D 3 2   ASN 2   2   ?   ?   ?   B . n 
D 3 3   GLU 3   3   3   GLU GLU B . n 
D 3 4   LEU 4   4   4   LEU LEU B . n 
D 3 5   VAL 5   5   5   VAL VAL B . n 
D 3 6   ASP 6   6   6   ASP ASP B . n 
D 3 7   THR 7   7   7   THR THR B . n 
D 3 8   THR 8   8   8   THR THR B . n 
D 3 9   GLU 9   9   9   GLU GLU B . n 
D 3 10  MET 10  10  10  MET MET B . n 
D 3 11  TYR 11  11  11  TYR TYR B . n 
D 3 12  LEU 12  12  12  LEU LEU B . n 
D 3 13  ARG 13  13  13  ARG ARG B . n 
D 3 14  THR 14  14  14  THR THR B . n 
D 3 15  ILE 15  15  15  ILE ILE B . n 
D 3 16  TYR 16  16  16  TYR TYR B . n 
D 3 17  ASP 17  17  17  ASP ASP B . n 
D 3 18  LEU 18  18  18  LEU LEU B . n 
D 3 19  GLU 19  19  19  GLU GLU B . n 
D 3 20  GLU 20  20  20  GLU GLU B . n 
D 3 21  GLU 21  21  21  GLU GLU B . n 
D 3 22  GLY 22  22  22  GLY GLY B . n 
D 3 23  VAL 23  23  23  VAL VAL B . n 
D 3 24  THR 24  24  24  THR THR B . n 
D 3 25  PRO 25  25  25  PRO PRO B . n 
D 3 26  LEU 26  26  26  LEU LEU B . n 
D 3 27  ARG 27  27  27  ARG ARG B . n 
D 3 28  ALA 28  28  28  ALA ALA B . n 
D 3 29  ARG 29  29  29  ARG ARG B . n 
D 3 30  ILE 30  30  30  ILE ILE B . n 
D 3 31  ALA 31  31  31  ALA ALA B . n 
D 3 32  GLU 32  32  32  GLU GLU B . n 
D 3 33  ARG 33  33  33  ARG ARG B . n 
D 3 34  LEU 34  34  34  LEU LEU B . n 
D 3 35  ASP 35  35  35  ASP ASP B . n 
D 3 36  GLN 36  36  36  GLN GLN B . n 
D 3 37  SER 37  37  37  SER SER B . n 
D 3 38  GLY 38  38  38  GLY GLY B . n 
D 3 39  PRO 39  39  39  PRO PRO B . n 
D 3 40  THR 40  40  40  THR THR B . n 
D 3 41  VAL 41  41  41  VAL VAL B . n 
D 3 42  SER 42  42  42  SER SER B . n 
D 3 43  GLN 43  43  43  GLN GLN B . n 
D 3 44  THR 44  44  44  THR THR B . n 
D 3 45  VAL 45  45  45  VAL VAL B . n 
D 3 46  SER 46  46  46  SER SER B . n 
D 3 47  ARG 47  47  47  ARG ARG B . n 
D 3 48  MET 48  48  48  MET MET B . n 
D 3 49  GLU 49  49  49  GLU GLU B . n 
D 3 50  ARG 50  50  50  ARG ARG B . n 
D 3 51  ASP 51  51  51  ASP ASP B . n 
D 3 52  GLY 52  52  52  GLY GLY B . n 
D 3 53  LEU 53  53  53  LEU LEU B . n 
D 3 54  LEU 54  54  54  LEU LEU B . n 
D 3 55  ARG 55  55  55  ARG ARG B . n 
D 3 56  VAL 56  56  56  VAL VAL B . n 
D 3 57  ALA 57  57  57  ALA ALA B . n 
D 3 58  GLY 58  58  58  GLY GLY B . n 
D 3 59  ASP 59  59  59  ASP ASP B . n 
D 3 60  ARG 60  60  60  ARG ARG B . n 
D 3 61  HIS 61  61  61  HIS HIS B . n 
D 3 62  LEU 62  62  62  LEU LEU B . n 
D 3 63  GLU 63  63  63  GLU GLU B . n 
D 3 64  LEU 64  64  64  LEU LEU B . n 
D 3 65  THR 65  65  65  THR THR B . n 
D 3 66  GLU 66  66  66  GLU GLU B . n 
D 3 67  LYS 67  67  67  LYS LYS B . n 
D 3 68  GLY 68  68  68  GLY GLY B . n 
D 3 69  ARG 69  69  69  ARG ARG B . n 
D 3 70  ALA 70  70  70  ALA ALA B . n 
D 3 71  LEU 71  71  71  LEU LEU B . n 
D 3 72  ALA 72  72  72  ALA ALA B . n 
D 3 73  ILE 73  73  73  ILE ILE B . n 
D 3 74  ALA 74  74  74  ALA ALA B . n 
D 3 75  VAL 75  75  75  VAL VAL B . n 
D 3 76  MET 76  76  76  MET MET B . n 
D 3 77  ARG 77  77  77  ARG ARG B . n 
D 3 78  LYS 78  78  78  LYS LYS B . n 
D 3 79  HIS 79  79  79  HIS HIS B . n 
D 3 80  ARG 80  80  80  ARG ARG B . n 
D 3 81  LEU 81  81  81  LEU LEU B . n 
D 3 82  ALA 82  82  82  ALA ALA B . n 
D 3 83  GLU 83  83  83  GLU GLU B . n 
D 3 84  ARG 84  84  84  ARG ARG B . n 
D 3 85  LEU 85  85  85  LEU LEU B . n 
D 3 86  LEU 86  86  86  LEU LEU B . n 
D 3 87  VAL 87  87  87  VAL VAL B . n 
D 3 88  ASP 88  88  88  ASP ASP B . n 
D 3 89  VAL 89  89  89  VAL VAL B . n 
D 3 90  ILE 90  90  90  ILE ILE B . n 
D 3 91  GLY 91  91  91  GLY GLY B . n 
D 3 92  LEU 92  92  92  LEU LEU B . n 
D 3 93  PRO 93  93  93  PRO PRO B . n 
D 3 94  TRP 94  94  94  TRP TRP B . n 
D 3 95  GLU 95  95  95  GLU GLU B . n 
D 3 96  GLU 96  96  96  GLU GLU B . n 
D 3 97  VAL 97  97  97  VAL VAL B . n 
D 3 98  HIS 98  98  98  HIS HIS B . n 
D 3 99  ALA 99  99  99  ALA ALA B . n 
D 3 100 GLU 100 100 100 GLU GLU B . n 
D 3 101 ALA 101 101 101 ALA ALA B . n 
D 3 102 CYS 102 102 102 CYS CYS B . n 
D 3 103 ARG 103 103 103 ARG ARG B . n 
D 3 104 TRP 104 104 104 TRP TRP B . n 
D 3 105 GLU 105 105 105 GLU GLU B . n 
D 3 106 HIS 106 106 106 HIS HIS B . n 
D 3 107 VAL 107 107 107 VAL VAL B . n 
D 3 108 MET 108 108 108 MET MET B . n 
D 3 109 SER 109 109 109 SER SER B . n 
D 3 110 GLU 110 110 110 GLU GLU B . n 
D 3 111 ASP 111 111 111 ASP ASP B . n 
D 3 112 VAL 112 112 112 VAL VAL B . n 
D 3 113 GLU 113 113 113 GLU GLU B . n 
D 3 114 ARG 114 114 114 ARG ARG B . n 
D 3 115 ARG 115 115 115 ARG ARG B . n 
D 3 116 LEU 116 116 116 LEU LEU B . n 
D 3 117 VAL 117 117 117 VAL VAL B . n 
D 3 118 LYS 118 118 118 LYS LYS B . n 
D 3 119 VAL 119 119 119 VAL VAL B . n 
D 3 120 LEU 120 120 120 LEU LEU B . n 
D 3 121 ASN 121 121 121 ASN ASN B . n 
D 3 122 ASN 122 122 122 ASN ASN B . n 
D 3 123 PRO 123 123 123 PRO PRO B . n 
D 3 124 THR 124 124 124 THR THR B . n 
D 3 125 THR 125 125 125 THR THR B . n 
D 3 126 SER 126 126 126 SER SER B . n 
D 3 127 PRO 127 127 127 PRO PRO B . n 
D 3 128 PHE 128 128 128 PHE PHE B . n 
D 3 129 GLY 129 129 129 GLY GLY B . n 
D 3 130 ASN 130 130 130 ASN ASN B . n 
D 3 131 PRO 131 131 131 PRO PRO B . n 
D 3 132 ILE 132 132 132 ILE ILE B . n 
D 3 133 PRO 133 133 133 PRO PRO B . n 
D 3 134 GLY 134 134 134 GLY GLY B . n 
D 3 135 LEU 135 135 135 LEU LEU B . n 
D 3 136 VAL 136 136 136 VAL VAL B . n 
D 3 137 GLU 137 137 137 GLU GLU B . n 
D 3 138 LEU 138 138 138 LEU LEU B . n 
D 3 139 GLY 139 139 139 GLY GLY B . n 
D 3 140 VAL 140 140 140 VAL VAL B . n 
D 3 141 ALA 141 141 141 ALA ALA B . n 
D 3 142 SER 142 142 142 SER SER B . n 
D 3 143 GLU 143 143 143 GLU GLU B . n 
D 3 144 ASN 144 144 144 ASN ASN B . n 
D 3 145 LEU 145 145 145 LEU LEU B . n 
D 3 146 TYR 146 146 146 TYR TYR B . n 
D 3 147 PHE 147 147 147 PHE PHE B . n 
D 3 148 GLN 148 148 ?   ?   ?   B . n 
D 3 149 GLY 149 149 ?   ?   ?   B . n 
D 3 150 GLY 150 150 ?   ?   ?   B . n 
D 3 151 GLY 151 151 ?   ?   ?   B . n 
D 3 152 HIS 152 152 ?   ?   ?   B . n 
D 3 153 HIS 153 153 ?   ?   ?   B . n 
D 3 154 HIS 154 154 ?   ?   ?   B . n 
D 3 155 HIS 155 155 ?   ?   ?   B . n 
D 3 156 HIS 156 156 ?   ?   ?   B . n 
D 3 157 HIS 157 157 ?   ?   ?   B . n 
E 3 1   MET 1   1   ?   ?   ?   C . n 
E 3 2   ASN 2   2   ?   ?   ?   C . n 
E 3 3   GLU 3   3   3   GLU GLU C . n 
E 3 4   LEU 4   4   4   LEU LEU C . n 
E 3 5   VAL 5   5   5   VAL VAL C . n 
E 3 6   ASP 6   6   6   ASP ASP C . n 
E 3 7   THR 7   7   7   THR THR C . n 
E 3 8   THR 8   8   8   THR THR C . n 
E 3 9   GLU 9   9   9   GLU GLU C . n 
E 3 10  MET 10  10  10  MET MET C . n 
E 3 11  TYR 11  11  11  TYR TYR C . n 
E 3 12  LEU 12  12  12  LEU LEU C . n 
E 3 13  ARG 13  13  13  ARG ARG C . n 
E 3 14  THR 14  14  14  THR THR C . n 
E 3 15  ILE 15  15  15  ILE ILE C . n 
E 3 16  TYR 16  16  16  TYR TYR C . n 
E 3 17  ASP 17  17  17  ASP ASP C . n 
E 3 18  LEU 18  18  18  LEU LEU C . n 
E 3 19  GLU 19  19  19  GLU GLU C . n 
E 3 20  GLU 20  20  20  GLU GLU C . n 
E 3 21  GLU 21  21  21  GLU GLU C . n 
E 3 22  GLY 22  22  22  GLY GLY C . n 
E 3 23  VAL 23  23  23  VAL VAL C . n 
E 3 24  THR 24  24  24  THR THR C . n 
E 3 25  PRO 25  25  25  PRO PRO C . n 
E 3 26  LEU 26  26  26  LEU LEU C . n 
E 3 27  ARG 27  27  27  ARG ARG C . n 
E 3 28  ALA 28  28  28  ALA ALA C . n 
E 3 29  ARG 29  29  29  ARG ARG C . n 
E 3 30  ILE 30  30  30  ILE ILE C . n 
E 3 31  ALA 31  31  31  ALA ALA C . n 
E 3 32  GLU 32  32  32  GLU GLU C . n 
E 3 33  ARG 33  33  33  ARG ARG C . n 
E 3 34  LEU 34  34  34  LEU LEU C . n 
E 3 35  ASP 35  35  35  ASP ASP C . n 
E 3 36  GLN 36  36  36  GLN GLN C . n 
E 3 37  SER 37  37  37  SER SER C . n 
E 3 38  GLY 38  38  38  GLY GLY C . n 
E 3 39  PRO 39  39  39  PRO PRO C . n 
E 3 40  THR 40  40  40  THR THR C . n 
E 3 41  VAL 41  41  41  VAL VAL C . n 
E 3 42  SER 42  42  42  SER SER C . n 
E 3 43  GLN 43  43  43  GLN GLN C . n 
E 3 44  THR 44  44  44  THR THR C . n 
E 3 45  VAL 45  45  45  VAL VAL C . n 
E 3 46  SER 46  46  46  SER SER C . n 
E 3 47  ARG 47  47  47  ARG ARG C . n 
E 3 48  MET 48  48  48  MET MET C . n 
E 3 49  GLU 49  49  49  GLU GLU C . n 
E 3 50  ARG 50  50  50  ARG ARG C . n 
E 3 51  ASP 51  51  51  ASP ASP C . n 
E 3 52  GLY 52  52  52  GLY GLY C . n 
E 3 53  LEU 53  53  53  LEU LEU C . n 
E 3 54  LEU 54  54  54  LEU LEU C . n 
E 3 55  ARG 55  55  55  ARG ARG C . n 
E 3 56  VAL 56  56  56  VAL VAL C . n 
E 3 57  ALA 57  57  57  ALA ALA C . n 
E 3 58  GLY 58  58  58  GLY GLY C . n 
E 3 59  ASP 59  59  59  ASP ASP C . n 
E 3 60  ARG 60  60  60  ARG ARG C . n 
E 3 61  HIS 61  61  61  HIS HIS C . n 
E 3 62  LEU 62  62  62  LEU LEU C . n 
E 3 63  GLU 63  63  63  GLU GLU C . n 
E 3 64  LEU 64  64  64  LEU LEU C . n 
E 3 65  THR 65  65  65  THR THR C . n 
E 3 66  GLU 66  66  66  GLU GLU C . n 
E 3 67  LYS 67  67  67  LYS LYS C . n 
E 3 68  GLY 68  68  68  GLY GLY C . n 
E 3 69  ARG 69  69  69  ARG ARG C . n 
E 3 70  ALA 70  70  70  ALA ALA C . n 
E 3 71  LEU 71  71  71  LEU LEU C . n 
E 3 72  ALA 72  72  72  ALA ALA C . n 
E 3 73  ILE 73  73  73  ILE ILE C . n 
E 3 74  ALA 74  74  74  ALA ALA C . n 
E 3 75  VAL 75  75  75  VAL VAL C . n 
E 3 76  MET 76  76  76  MET MET C . n 
E 3 77  ARG 77  77  77  ARG ARG C . n 
E 3 78  LYS 78  78  78  LYS LYS C . n 
E 3 79  HIS 79  79  79  HIS HIS C . n 
E 3 80  ARG 80  80  80  ARG ARG C . n 
E 3 81  LEU 81  81  81  LEU LEU C . n 
E 3 82  ALA 82  82  82  ALA ALA C . n 
E 3 83  GLU 83  83  83  GLU GLU C . n 
E 3 84  ARG 84  84  84  ARG ARG C . n 
E 3 85  LEU 85  85  85  LEU LEU C . n 
E 3 86  LEU 86  86  86  LEU LEU C . n 
E 3 87  VAL 87  87  87  VAL VAL C . n 
E 3 88  ASP 88  88  88  ASP ASP C . n 
E 3 89  VAL 89  89  89  VAL VAL C . n 
E 3 90  ILE 90  90  90  ILE ILE C . n 
E 3 91  GLY 91  91  91  GLY GLY C . n 
E 3 92  LEU 92  92  92  LEU LEU C . n 
E 3 93  PRO 93  93  93  PRO PRO C . n 
E 3 94  TRP 94  94  94  TRP TRP C . n 
E 3 95  GLU 95  95  95  GLU GLU C . n 
E 3 96  GLU 96  96  96  GLU GLU C . n 
E 3 97  VAL 97  97  97  VAL VAL C . n 
E 3 98  HIS 98  98  98  HIS HIS C . n 
E 3 99  ALA 99  99  99  ALA ALA C . n 
E 3 100 GLU 100 100 100 GLU GLU C . n 
E 3 101 ALA 101 101 101 ALA ALA C . n 
E 3 102 CYS 102 102 102 CYS CYS C . n 
E 3 103 ARG 103 103 103 ARG ARG C . n 
E 3 104 TRP 104 104 104 TRP TRP C . n 
E 3 105 GLU 105 105 105 GLU GLU C . n 
E 3 106 HIS 106 106 106 HIS HIS C . n 
E 3 107 VAL 107 107 107 VAL VAL C . n 
E 3 108 MET 108 108 108 MET MET C . n 
E 3 109 SER 109 109 109 SER SER C . n 
E 3 110 GLU 110 110 110 GLU GLU C . n 
E 3 111 ASP 111 111 111 ASP ASP C . n 
E 3 112 VAL 112 112 112 VAL VAL C . n 
E 3 113 GLU 113 113 113 GLU GLU C . n 
E 3 114 ARG 114 114 114 ARG ARG C . n 
E 3 115 ARG 115 115 115 ARG ARG C . n 
E 3 116 LEU 116 116 116 LEU LEU C . n 
E 3 117 VAL 117 117 117 VAL VAL C . n 
E 3 118 LYS 118 118 118 LYS LYS C . n 
E 3 119 VAL 119 119 119 VAL VAL C . n 
E 3 120 LEU 120 120 120 LEU LEU C . n 
E 3 121 ASN 121 121 121 ASN ASN C . n 
E 3 122 ASN 122 122 122 ASN ASN C . n 
E 3 123 PRO 123 123 123 PRO PRO C . n 
E 3 124 THR 124 124 124 THR THR C . n 
E 3 125 THR 125 125 125 THR THR C . n 
E 3 126 SER 126 126 126 SER SER C . n 
E 3 127 PRO 127 127 127 PRO PRO C . n 
E 3 128 PHE 128 128 128 PHE PHE C . n 
E 3 129 GLY 129 129 129 GLY GLY C . n 
E 3 130 ASN 130 130 130 ASN ASN C . n 
E 3 131 PRO 131 131 131 PRO PRO C . n 
E 3 132 ILE 132 132 132 ILE ILE C . n 
E 3 133 PRO 133 133 133 PRO PRO C . n 
E 3 134 GLY 134 134 134 GLY GLY C . n 
E 3 135 LEU 135 135 135 LEU LEU C . n 
E 3 136 VAL 136 136 136 VAL VAL C . n 
E 3 137 GLU 137 137 137 GLU GLU C . n 
E 3 138 LEU 138 138 138 LEU LEU C . n 
E 3 139 GLY 139 139 139 GLY GLY C . n 
E 3 140 VAL 140 140 ?   ?   ?   C . n 
E 3 141 ALA 141 141 ?   ?   ?   C . n 
E 3 142 SER 142 142 ?   ?   ?   C . n 
E 3 143 GLU 143 143 ?   ?   ?   C . n 
E 3 144 ASN 144 144 ?   ?   ?   C . n 
E 3 145 LEU 145 145 ?   ?   ?   C . n 
E 3 146 TYR 146 146 ?   ?   ?   C . n 
E 3 147 PHE 147 147 ?   ?   ?   C . n 
E 3 148 GLN 148 148 ?   ?   ?   C . n 
E 3 149 GLY 149 149 ?   ?   ?   C . n 
E 3 150 GLY 150 150 ?   ?   ?   C . n 
E 3 151 GLY 151 151 ?   ?   ?   C . n 
E 3 152 HIS 152 152 ?   ?   ?   C . n 
E 3 153 HIS 153 153 ?   ?   ?   C . n 
E 3 154 HIS 154 154 ?   ?   ?   C . n 
E 3 155 HIS 155 155 ?   ?   ?   C . n 
E 3 156 HIS 156 156 ?   ?   ?   C . n 
E 3 157 HIS 157 157 ?   ?   ?   C . n 
F 3 1   MET 1   1   ?   ?   ?   D . n 
F 3 2   ASN 2   2   ?   ?   ?   D . n 
F 3 3   GLU 3   3   3   GLU GLU D . n 
F 3 4   LEU 4   4   4   LEU LEU D . n 
F 3 5   VAL 5   5   5   VAL VAL D . n 
F 3 6   ASP 6   6   6   ASP ASP D . n 
F 3 7   THR 7   7   7   THR THR D . n 
F 3 8   THR 8   8   8   THR THR D . n 
F 3 9   GLU 9   9   9   GLU GLU D . n 
F 3 10  MET 10  10  10  MET MET D . n 
F 3 11  TYR 11  11  11  TYR TYR D . n 
F 3 12  LEU 12  12  12  LEU LEU D . n 
F 3 13  ARG 13  13  13  ARG ARG D . n 
F 3 14  THR 14  14  14  THR THR D . n 
F 3 15  ILE 15  15  15  ILE ILE D . n 
F 3 16  TYR 16  16  16  TYR TYR D . n 
F 3 17  ASP 17  17  17  ASP ASP D . n 
F 3 18  LEU 18  18  18  LEU LEU D . n 
F 3 19  GLU 19  19  19  GLU GLU D . n 
F 3 20  GLU 20  20  20  GLU GLU D . n 
F 3 21  GLU 21  21  21  GLU GLU D . n 
F 3 22  GLY 22  22  22  GLY GLY D . n 
F 3 23  VAL 23  23  23  VAL VAL D . n 
F 3 24  THR 24  24  24  THR THR D . n 
F 3 25  PRO 25  25  25  PRO PRO D . n 
F 3 26  LEU 26  26  26  LEU LEU D . n 
F 3 27  ARG 27  27  27  ARG ARG D . n 
F 3 28  ALA 28  28  28  ALA ALA D . n 
F 3 29  ARG 29  29  29  ARG ARG D . n 
F 3 30  ILE 30  30  30  ILE ILE D . n 
F 3 31  ALA 31  31  31  ALA ALA D . n 
F 3 32  GLU 32  32  32  GLU GLU D . n 
F 3 33  ARG 33  33  33  ARG ARG D . n 
F 3 34  LEU 34  34  34  LEU LEU D . n 
F 3 35  ASP 35  35  35  ASP ASP D . n 
F 3 36  GLN 36  36  36  GLN GLN D . n 
F 3 37  SER 37  37  37  SER SER D . n 
F 3 38  GLY 38  38  38  GLY GLY D . n 
F 3 39  PRO 39  39  39  PRO PRO D . n 
F 3 40  THR 40  40  40  THR THR D . n 
F 3 41  VAL 41  41  41  VAL VAL D . n 
F 3 42  SER 42  42  42  SER SER D . n 
F 3 43  GLN 43  43  43  GLN GLN D . n 
F 3 44  THR 44  44  44  THR THR D . n 
F 3 45  VAL 45  45  45  VAL VAL D . n 
F 3 46  SER 46  46  46  SER SER D . n 
F 3 47  ARG 47  47  47  ARG ARG D . n 
F 3 48  MET 48  48  48  MET MET D . n 
F 3 49  GLU 49  49  49  GLU GLU D . n 
F 3 50  ARG 50  50  50  ARG ARG D . n 
F 3 51  ASP 51  51  51  ASP ASP D . n 
F 3 52  GLY 52  52  52  GLY GLY D . n 
F 3 53  LEU 53  53  53  LEU LEU D . n 
F 3 54  LEU 54  54  54  LEU LEU D . n 
F 3 55  ARG 55  55  55  ARG ARG D . n 
F 3 56  VAL 56  56  56  VAL VAL D . n 
F 3 57  ALA 57  57  57  ALA ALA D . n 
F 3 58  GLY 58  58  58  GLY GLY D . n 
F 3 59  ASP 59  59  59  ASP ASP D . n 
F 3 60  ARG 60  60  60  ARG ARG D . n 
F 3 61  HIS 61  61  61  HIS HIS D . n 
F 3 62  LEU 62  62  62  LEU LEU D . n 
F 3 63  GLU 63  63  63  GLU GLU D . n 
F 3 64  LEU 64  64  64  LEU LEU D . n 
F 3 65  THR 65  65  65  THR THR D . n 
F 3 66  GLU 66  66  66  GLU GLU D . n 
F 3 67  LYS 67  67  67  LYS LYS D . n 
F 3 68  GLY 68  68  68  GLY GLY D . n 
F 3 69  ARG 69  69  69  ARG ARG D . n 
F 3 70  ALA 70  70  70  ALA ALA D . n 
F 3 71  LEU 71  71  71  LEU LEU D . n 
F 3 72  ALA 72  72  72  ALA ALA D . n 
F 3 73  ILE 73  73  73  ILE ILE D . n 
F 3 74  ALA 74  74  74  ALA ALA D . n 
F 3 75  VAL 75  75  75  VAL VAL D . n 
F 3 76  MET 76  76  76  MET MET D . n 
F 3 77  ARG 77  77  77  ARG ARG D . n 
F 3 78  LYS 78  78  78  LYS LYS D . n 
F 3 79  HIS 79  79  79  HIS HIS D . n 
F 3 80  ARG 80  80  80  ARG ARG D . n 
F 3 81  LEU 81  81  81  LEU LEU D . n 
F 3 82  ALA 82  82  82  ALA ALA D . n 
F 3 83  GLU 83  83  83  GLU GLU D . n 
F 3 84  ARG 84  84  84  ARG ARG D . n 
F 3 85  LEU 85  85  85  LEU LEU D . n 
F 3 86  LEU 86  86  86  LEU LEU D . n 
F 3 87  VAL 87  87  87  VAL VAL D . n 
F 3 88  ASP 88  88  88  ASP ASP D . n 
F 3 89  VAL 89  89  89  VAL VAL D . n 
F 3 90  ILE 90  90  90  ILE ILE D . n 
F 3 91  GLY 91  91  91  GLY GLY D . n 
F 3 92  LEU 92  92  92  LEU LEU D . n 
F 3 93  PRO 93  93  93  PRO PRO D . n 
F 3 94  TRP 94  94  94  TRP TRP D . n 
F 3 95  GLU 95  95  95  GLU GLU D . n 
F 3 96  GLU 96  96  96  GLU GLU D . n 
F 3 97  VAL 97  97  97  VAL VAL D . n 
F 3 98  HIS 98  98  98  HIS HIS D . n 
F 3 99  ALA 99  99  99  ALA ALA D . n 
F 3 100 GLU 100 100 100 GLU GLU D . n 
F 3 101 ALA 101 101 101 ALA ALA D . n 
F 3 102 CYS 102 102 102 CYS CYS D . n 
F 3 103 ARG 103 103 103 ARG ARG D . n 
F 3 104 TRP 104 104 104 TRP TRP D . n 
F 3 105 GLU 105 105 105 GLU GLU D . n 
F 3 106 HIS 106 106 106 HIS HIS D . n 
F 3 107 VAL 107 107 107 VAL VAL D . n 
F 3 108 MET 108 108 108 MET MET D . n 
F 3 109 SER 109 109 109 SER SER D . n 
F 3 110 GLU 110 110 110 GLU GLU D . n 
F 3 111 ASP 111 111 111 ASP ASP D . n 
F 3 112 VAL 112 112 112 VAL VAL D . n 
F 3 113 GLU 113 113 113 GLU GLU D . n 
F 3 114 ARG 114 114 114 ARG ARG D . n 
F 3 115 ARG 115 115 115 ARG ARG D . n 
F 3 116 LEU 116 116 116 LEU LEU D . n 
F 3 117 VAL 117 117 117 VAL VAL D . n 
F 3 118 LYS 118 118 118 LYS LYS D . n 
F 3 119 VAL 119 119 119 VAL VAL D . n 
F 3 120 LEU 120 120 120 LEU LEU D . n 
F 3 121 ASN 121 121 121 ASN ASN D . n 
F 3 122 ASN 122 122 122 ASN ASN D . n 
F 3 123 PRO 123 123 123 PRO PRO D . n 
F 3 124 THR 124 124 124 THR THR D . n 
F 3 125 THR 125 125 125 THR THR D . n 
F 3 126 SER 126 126 126 SER SER D . n 
F 3 127 PRO 127 127 127 PRO PRO D . n 
F 3 128 PHE 128 128 128 PHE PHE D . n 
F 3 129 GLY 129 129 129 GLY GLY D . n 
F 3 130 ASN 130 130 130 ASN ASN D . n 
F 3 131 PRO 131 131 131 PRO PRO D . n 
F 3 132 ILE 132 132 132 ILE ILE D . n 
F 3 133 PRO 133 133 133 PRO PRO D . n 
F 3 134 GLY 134 134 134 GLY GLY D . n 
F 3 135 LEU 135 135 135 LEU LEU D . n 
F 3 136 VAL 136 136 136 VAL VAL D . n 
F 3 137 GLU 137 137 137 GLU GLU D . n 
F 3 138 LEU 138 138 138 LEU LEU D . n 
F 3 139 GLY 139 139 139 GLY GLY D . n 
F 3 140 VAL 140 140 ?   ?   ?   D . n 
F 3 141 ALA 141 141 ?   ?   ?   D . n 
F 3 142 SER 142 142 ?   ?   ?   D . n 
F 3 143 GLU 143 143 ?   ?   ?   D . n 
F 3 144 ASN 144 144 ?   ?   ?   D . n 
F 3 145 LEU 145 145 ?   ?   ?   D . n 
F 3 146 TYR 146 146 ?   ?   ?   D . n 
F 3 147 PHE 147 147 ?   ?   ?   D . n 
F 3 148 GLN 148 148 ?   ?   ?   D . n 
F 3 149 GLY 149 149 ?   ?   ?   D . n 
F 3 150 GLY 150 150 ?   ?   ?   D . n 
F 3 151 GLY 151 151 ?   ?   ?   D . n 
F 3 152 HIS 152 152 ?   ?   ?   D . n 
F 3 153 HIS 153 153 ?   ?   ?   D . n 
F 3 154 HIS 154 154 ?   ?   ?   D . n 
F 3 155 HIS 155 155 ?   ?   ?   D . n 
F 3 156 HIS 156 156 ?   ?   ?   D . n 
F 3 157 HIS 157 157 ?   ?   ?   D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OXT ? J  ACT .   ? A ACT 2001 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 110.3 ? 
2  OXT ? J  ACT .   ? A ACT 2001 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 98.7  ? 
3  NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 71.2  ? 
4  OXT ? J  ACT .   ? A ACT 2001 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 148.2 ? 
5  NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 92.7  ? 
6  OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 109.7 ? 
7  OXT ? J  ACT .   ? A ACT 2001 ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 O   ? J  ACT .   ? A ACT 2001 ? 1_555 56.9  ? 
8  NE2 ? C  HIS 79  ? A HIS 79   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 O   ? J  ACT .   ? A ACT 2001 ? 1_555 112.5 ? 
9  OE2 ? C  GLU 83  ? A GLU 83   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 O   ? J  ACT .   ? A ACT 2001 ? 1_555 155.5 ? 
10 ND1 ? C  HIS 98  ? A HIS 98   ? 1_555 NI ? G NI . ? A NI 1001 ? 1_555 O   ? J  ACT .   ? A ACT 2001 ? 1_555 94.5  ? 
11 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 91.5  ? 
12 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 96.5  ? 
13 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 91.2  ? 
14 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 SG  ? C  CYS 102 ? A CYS 102  ? 1_555 96.6  ? 
15 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 SG  ? C  CYS 102 ? A CYS 102  ? 1_555 94.1  ? 
16 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 SG  ? C  CYS 102 ? A CYS 102  ? 1_555 165.7 ? 
17 SD  ? C  MET 10  ? A MET 10   ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 175.7 ? 
18 OE2 ? C  GLU 105 ? A GLU 105  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 84.3  ? 
19 NE2 ? C  HIS 106 ? A HIS 106  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 84.1  ? 
20 SG  ? C  CYS 102 ? A CYS 102  ? 1_555 NI ? H NI . ? A NI 1002 ? 1_555 O   ? C  CYS 102 ? A CYS 102  ? 1_555 83.2  ? 
21 O   ? L  ACT .   ? A ACT 2003 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 OXT ? L  ACT .   ? A ACT 2003 ? 1_555 50.9  ? 
22 O   ? L  ACT .   ? A ACT 2003 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 O   ? K  ACT .   ? A ACT 2002 ? 1_555 129.9 ? 
23 OXT ? L  ACT .   ? A ACT 2003 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 O   ? K  ACT .   ? A ACT 2002 ? 1_555 148.5 ? 
24 O   ? L  ACT .   ? A ACT 2003 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 ND1 ? C  HIS 61  ? A HIS 61   ? 1_555 113.3 ? 
25 OXT ? L  ACT .   ? A ACT 2003 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 ND1 ? C  HIS 61  ? A HIS 61   ? 1_555 109.3 ? 
26 O   ? K  ACT .   ? A ACT 2002 ? 1_555 NI ? I NI . ? A NI 1003 ? 1_555 ND1 ? C  HIS 61  ? A HIS 61   ? 1_555 98.5  ? 
27 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 99.7  ? 
28 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 O   ? P  ACT .   ? B ACT 2001 ? 1_555 105.4 ? 
29 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 O   ? P  ACT .   ? B ACT 2001 ? 1_555 149.2 ? 
30 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 OXT ? P  ACT .   ? B ACT 2001 ? 1_555 154.2 ? 
31 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 OXT ? P  ACT .   ? B ACT 2001 ? 1_555 99.9  ? 
32 O   ? P  ACT .   ? B ACT 2001 ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 OXT ? P  ACT .   ? B ACT 2001 ? 1_555 51.3  ? 
33 OE2 ? D  GLU 83  ? B GLU 83   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 76.3  ? 
34 ND1 ? D  HIS 98  ? B HIS 98   ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 107.8 ? 
35 O   ? P  ACT .   ? B ACT 2001 ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 95.4  ? 
36 OXT ? P  ACT .   ? B ACT 2001 ? 1_555 NI ? M NI . ? B NI 1001 ? 1_555 NE2 ? D  HIS 79  ? B HIS 79   ? 1_555 113.1 ? 
37 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 82.2  ? 
38 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 89.7  ? 
39 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 167.6 ? 
40 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 SD  ? D  MET 10  ? B MET 10   ? 1_555 173.5 ? 
41 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 SD  ? D  MET 10  ? B MET 10   ? 1_555 104.3 ? 
42 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 SD  ? D  MET 10  ? B MET 10   ? 1_555 83.9  ? 
43 O   ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 91.3  ? 
44 SG  ? D  CYS 102 ? B CYS 102  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 100.7 ? 
45 NE2 ? D  HIS 106 ? B HIS 106  ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 88.8  ? 
46 SD  ? D  MET 10  ? B MET 10   ? 1_555 NI ? N NI . ? B NI 1002 ? 1_555 OE2 ? D  GLU 105 ? B GLU 105  ? 1_555 87.1  ? 
47 O   ? Q  ACT .   ? B ACT 2002 ? 1_555 NI ? O NI . ? B NI 1003 ? 1_555 OXT ? Q  ACT .   ? B ACT 2002 ? 1_555 62.7  ? 
48 O   ? Q  ACT .   ? B ACT 2002 ? 1_555 NI ? O NI . ? B NI 1003 ? 1_555 ND1 ? D  HIS 61  ? B HIS 61   ? 1_555 73.0  ? 
49 OXT ? Q  ACT .   ? B ACT 2002 ? 1_555 NI ? O NI . ? B NI 1003 ? 1_555 ND1 ? D  HIS 61  ? B HIS 61   ? 1_555 98.0  ? 
50 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 O   ? U  ACT .   ? C ACT 2001 ? 1_555 77.8  ? 
51 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 OXT ? U  ACT .   ? C ACT 2001 ? 1_555 129.6 ? 
52 O   ? U  ACT .   ? C ACT 2001 ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 OXT ? U  ACT .   ? C ACT 2001 ? 1_555 57.0  ? 
53 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 106.0 ? 
54 O   ? U  ACT .   ? C ACT 2001 ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 105.5 ? 
55 OXT ? U  ACT .   ? C ACT 2001 ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 106.5 ? 
56 ND1 ? E  HIS 98  ? C HIS 98   ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 103.7 ? 
57 O   ? U  ACT .   ? C ACT 2001 ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 167.7 ? 
58 OXT ? U  ACT .   ? C ACT 2001 ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 116.0 ? 
59 OE2 ? E  GLU 83  ? C GLU 83   ? 1_555 NI ? R NI . ? C NI 1001 ? 1_555 NE2 ? E  HIS 79  ? C HIS 79   ? 1_555 86.0  ? 
60 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 90.0  ? 
61 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 O   ? GA HOH .   ? C HOH 2007 ? 1_555 164.4 ? 
62 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 O   ? GA HOH .   ? C HOH 2007 ? 1_555 86.0  ? 
63 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 O   ? E  CYS 102 ? C CYS 102  ? 1_555 92.6  ? 
64 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 O   ? E  CYS 102 ? C CYS 102  ? 1_555 80.9  ? 
65 O   ? GA HOH .   ? C HOH 2007 ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 O   ? E  CYS 102 ? C CYS 102  ? 1_555 71.9  ? 
66 OE2 ? E  GLU 105 ? C GLU 105  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 91.3  ? 
67 NE2 ? E  HIS 106 ? C HIS 106  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 89.6  ? 
68 O   ? GA HOH .   ? C HOH 2007 ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 103.7 ? 
69 O   ? E  CYS 102 ? C CYS 102  ? 1_555 NI ? S NI . ? C NI 1002 ? 1_555 SD  ? E  MET 10  ? C MET 10   ? 1_555 169.8 ? 
70 OXT ? W  ACT .   ? C ACT 2003 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 119.2 ? 
71 OXT ? W  ACT .   ? C ACT 2003 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 OXT ? V  ACT .   ? C ACT 2002 ? 1_555 158.6 ? 
72 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 OXT ? V  ACT .   ? C ACT 2002 ? 1_555 80.3  ? 
73 OXT ? W  ACT .   ? C ACT 2003 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? W  ACT .   ? C ACT 2003 ? 1_555 48.2  ? 
74 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? W  ACT .   ? C ACT 2003 ? 1_555 119.6 ? 
75 OXT ? V  ACT .   ? C ACT 2002 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? W  ACT .   ? C ACT 2003 ? 1_555 116.1 ? 
76 OXT ? W  ACT .   ? C ACT 2003 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? V  ACT .   ? C ACT 2002 ? 1_555 132.0 ? 
77 ND1 ? E  HIS 61  ? C HIS 61   ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? V  ACT .   ? C ACT 2002 ? 1_555 87.2  ? 
78 OXT ? V  ACT .   ? C ACT 2002 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? V  ACT .   ? C ACT 2002 ? 1_555 51.9  ? 
79 O   ? W  ACT .   ? C ACT 2003 ? 1_555 NI ? T NI . ? C NI 1003 ? 1_555 O   ? V  ACT .   ? C ACT 2002 ? 1_555 150.3 ? 
80 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 O   ? AA ACT .   ? D ACT 2001 ? 1_555 145.5 ? 
81 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 109.2 ? 
82 O   ? AA ACT .   ? D ACT 2001 ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 100.2 ? 
83 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 100.1 ? 
84 O   ? AA ACT .   ? D ACT 2001 ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 102.2 ? 
85 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 80.4  ? 
86 ND1 ? F  HIS 98  ? D HIS 98   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OXT ? AA ACT .   ? D ACT 2001 ? 1_555 97.1  ? 
87 O   ? AA ACT .   ? D ACT 2001 ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OXT ? AA ACT .   ? D ACT 2001 ? 1_555 56.2  ? 
88 NE2 ? F  HIS 79  ? D HIS 79   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OXT ? AA ACT .   ? D ACT 2001 ? 1_555 107.4 ? 
89 OE2 ? F  GLU 83  ? D GLU 83   ? 1_555 NI ? X NI . ? D NI 1001 ? 1_555 OXT ? AA ACT .   ? D ACT 2001 ? 1_555 157.6 ? 
90 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 SD  ? F  MET 10  ? D MET 10   ? 1_555 90.4  ? 
91 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 77.3  ? 
92 SD  ? F  MET 10  ? D MET 10   ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 83.9  ? 
93 OE2 ? F  GLU 105 ? D GLU 105  ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 O   ? F  CYS 102 ? D CYS 102  ? 1_555 74.2  ? 
94 SD  ? F  MET 10  ? D MET 10   ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 O   ? F  CYS 102 ? D CYS 102  ? 1_555 164.4 ? 
95 NE2 ? F  HIS 106 ? D HIS 106  ? 1_555 NI ? Y NI . ? D NI 1002 ? 1_555 O   ? F  CYS 102 ? D CYS 102  ? 1_555 89.9  ? 
96 OXT ? BA ACT .   ? D ACT 2002 ? 1_555 NI ? Z NI . ? D NI 1003 ? 1_555 O   ? BA ACT .   ? D ACT 2002 ? 1_555 56.6  ? 
97 OXT ? BA ACT .   ? D ACT 2002 ? 1_555 NI ? Z NI . ? D NI 1003 ? 1_555 ND1 ? F  HIS 61  ? D HIS 61   ? 1_555 145.8 ? 
98 O   ? BA ACT .   ? D ACT 2002 ? 1_555 NI ? Z NI . ? D NI 1003 ? 1_555 ND1 ? F  HIS 61  ? D HIS 61   ? 1_555 90.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             2.600 
_diffrn_reflns.pdbx_d_res_low              72.481 
_diffrn_reflns.pdbx_number_obs             31514 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.126 
_diffrn_reflns.pdbx_Rsym_value             0.126 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         3.80 
_diffrn_reflns.pdbx_redundancy             1.90 
_diffrn_reflns.pdbx_percent_possible_obs   96.30 
_diffrn_reflns.number                      59087 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 8.22 37.91 ? ? 0.053 0.053 ? 1.90 97.20 
1 5.81 8.22  ? ? 0.055 0.055 ? 2.00 98.10 
1 4.75 5.81  ? ? 0.151 0.151 ? 1.60 96.00 
1 4.11 4.75  ? ? 0.082 0.082 ? 1.80 96.20 
1 3.68 4.11  ? ? 0.063 0.063 ? 1.90 96.10 
1 3.36 3.68  ? ? 0.087 0.087 ? 1.90 96.50 
1 3.11 3.36  ? ? 0.108 0.108 ? 1.90 96.50 
1 2.91 3.11  ? ? 0.207 0.207 ? 1.90 96.30 
1 2.74 2.91  ? ? 0.263 0.263 ? 1.90 96.00 
1 2.60 2.74  ? ? 0.348 0.348 ? 1.90 95.90 
# 
_pdbx_phasing_MR.entry_id                     2IT0 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.354 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.701 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           37.910 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        37.910 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       .         ?                other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk    'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
MOLREP      .         ?                other   'A. Vagin'        alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 2 
REFMAC      5.2.0005  ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html             Fortran_77 ? 3 
PDB_EXTRACT 2.000     'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/            C++        ? 4 
MOSFLM      .         ?                ?       ?                 ?                        'data reduction'  ? ?          ? 5 
CCP4        '(SCALA)' ?                ?       ?                 ?                        'data scaling'    ? ?          ? 6 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" E DC 19 ? ? "C3'" E DC 19 ? ? 1.377 1.419 -0.042 0.006 N 
2 1 "O3'" F DT 22 ? ? "C3'" F DT 22 ? ? 1.381 1.419 -0.038 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" E DG 9  ? ? "C1'" E DG 9  ? ? N9    E DG 9  ? ? 112.45 108.30 4.15  0.30 N 
2  1 "C3'" E DG 14 ? ? "C2'" E DG 14 ? ? "C1'" E DG 14 ? ? 96.33  102.40 -6.07 0.80 N 
3  1 "O4'" E DC 20 ? ? "C4'" E DC 20 ? ? "C3'" E DC 20 ? ? 101.23 104.50 -3.27 0.40 N 
4  1 "C4'" E DC 20 ? ? "C3'" E DC 20 ? ? "C2'" E DC 20 ? ? 96.82  102.20 -5.38 0.70 N 
5  1 "O4'" E DC 20 ? ? "C1'" E DC 20 ? ? N1    E DC 20 ? ? 111.16 108.30 2.86  0.30 N 
6  1 "C1'" E DT 27 ? ? "O4'" E DT 27 ? ? "C4'" E DT 27 ? ? 100.62 110.10 -9.48 1.00 N 
7  1 "O4'" E DT 27 ? ? "C1'" E DT 27 ? ? N1    E DT 27 ? ? 112.26 108.30 3.96  0.30 N 
8  1 "C3'" E DG 30 ? ? "C2'" E DG 30 ? ? "C1'" E DG 30 ? ? 94.98  102.40 -7.42 0.80 N 
9  1 "O4'" E DG 30 ? ? "C1'" E DG 30 ? ? N9    E DG 30 ? ? 115.13 108.30 6.83  0.30 N 
10 1 "O4'" E DT 31 ? ? "C1'" E DT 31 ? ? N1    E DT 31 ? ? 111.75 108.30 3.45  0.30 N 
11 1 "O4'" E DG 32 ? ? "C1'" E DG 32 ? ? N9    E DG 32 ? ? 112.12 108.30 3.82  0.30 N 
12 1 "O4'" F DC 1  ? ? "C1'" F DC 1  ? ? N1    F DC 1  ? ? 110.30 108.30 2.00  0.30 N 
13 1 "O4'" F DA 2  ? ? "C1'" F DA 2  ? ? N9    F DA 2  ? ? 110.42 108.30 2.12  0.30 N 
14 1 "O4'" F DT 4  ? ? "C1'" F DT 4  ? ? N1    F DT 4  ? ? 111.37 108.30 3.07  0.30 N 
15 1 "O4'" F DA 8  ? ? "C1'" F DA 8  ? ? N9    F DA 8  ? ? 110.66 108.30 2.36  0.30 N 
16 1 "O4'" F DA 11 ? ? "C1'" F DA 11 ? ? N9    F DA 11 ? ? 110.78 108.30 2.48  0.30 N 
17 1 "O4'" F DG 12 ? ? "C1'" F DG 12 ? ? N9    F DG 12 ? ? 115.66 108.30 7.36  0.30 N 
18 1 "O4'" F DC 15 ? ? "C1'" F DC 15 ? ? N1    F DC 15 ? ? 110.43 108.30 2.13  0.30 N 
19 1 "C3'" F DG 17 ? ? "C2'" F DG 17 ? ? "C1'" F DG 17 ? ? 96.47  102.40 -5.93 0.80 N 
20 1 "O4'" F DG 17 ? ? "C1'" F DG 17 ? ? N9    F DG 17 ? ? 111.23 108.30 2.93  0.30 N 
21 1 N3    F DT 20 ? ? C4    F DT 20 ? ? O4    F DT 20 ? ? 123.52 119.90 3.62  0.60 N 
22 1 C5    F DT 20 ? ? C4    F DT 20 ? ? O4    F DT 20 ? ? 120.19 124.90 -4.71 0.70 N 
23 1 "C3'" F DT 22 ? ? "C2'" F DT 22 ? ? "C1'" F DT 22 ? ? 97.23  102.40 -5.17 0.80 N 
24 1 "O4'" F DT 22 ? ? "C1'" F DT 22 ? ? N1    F DT 22 ? ? 112.47 108.30 4.17  0.30 N 
25 1 "O4'" F DG 23 ? ? "C4'" F DG 23 ? ? "C3'" F DG 23 ? ? 100.10 104.50 -4.40 0.40 N 
26 1 "C4'" F DG 23 ? ? "C3'" F DG 23 ? ? "C2'" F DG 23 ? ? 96.76  102.20 -5.44 0.70 N 
27 1 "O4'" F DC 24 ? ? "C1'" F DC 24 ? ? N1    F DC 24 ? ? 111.42 108.30 3.12  0.30 N 
28 1 "O4'" F DT 25 ? ? "C1'" F DT 25 ? ? N1    F DT 25 ? ? 110.22 108.30 1.92  0.30 N 
29 1 "C3'" F DC 28 ? ? "C2'" F DC 28 ? ? "C1'" F DC 28 ? ? 96.09  102.40 -6.31 0.80 N 
30 1 "O4'" F DC 28 ? ? "C1'" F DC 28 ? ? N1    F DC 28 ? ? 113.44 108.30 5.14  0.30 N 
31 1 "C3'" F DG 30 ? ? "O3'" F DG 30 ? ? P     F DG 31 ? ? 127.20 119.70 7.50  1.20 Y 
32 1 "O4'" F DG 31 ? ? "C1'" F DG 31 ? ? N9    F DG 31 ? ? 111.69 108.30 3.39  0.30 N 
33 1 "O4'" F DG 32 ? ? "C1'" F DG 32 ? ? N9    F DG 32 ? ? 111.47 108.30 3.17  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 5   ? ? 71.75   -51.00  
2  1 ARG A 60  ? ? 76.92   -1.22   
3  1 VAL B 5   ? ? 78.28   -61.35  
4  1 VAL C 5   ? ? 71.68   -50.03  
5  1 TRP C 94  ? ? -16.77  -57.63  
6  1 ASN C 121 ? ? 83.67   58.89   
7  1 ASN C 122 ? ? 35.36   63.40   
8  1 PRO C 127 ? ? -68.56  36.15   
9  1 PHE C 128 ? ? -145.92 -3.57   
10 1 VAL D 5   ? ? 69.51   -57.65  
11 1 ALA D 57  ? ? -78.73  -158.95 
12 1 VAL D 89  ? ? -102.44 -65.41  
13 1 ASN D 122 ? ? 52.66   79.95   
14 1 LEU D 138 ? ? -60.48  -71.77  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 143 ? CG  ? C GLU 143 CG  
2 1 Y 1 A GLU 143 ? CD  ? C GLU 143 CD  
3 1 Y 1 A GLU 143 ? OE1 ? C GLU 143 OE1 
4 1 Y 1 A GLU 143 ? OE2 ? C GLU 143 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? C MET 1   
2  1 Y 1 A ASN 2   ? C ASN 2   
3  1 Y 1 A GLN 148 ? C GLN 148 
4  1 Y 1 A GLY 149 ? C GLY 149 
5  1 Y 1 A GLY 150 ? C GLY 150 
6  1 Y 1 A GLY 151 ? C GLY 151 
7  1 Y 1 A HIS 152 ? C HIS 152 
8  1 Y 1 A HIS 153 ? C HIS 153 
9  1 Y 1 A HIS 154 ? C HIS 154 
10 1 Y 1 A HIS 155 ? C HIS 155 
11 1 Y 1 A HIS 156 ? C HIS 156 
12 1 Y 1 A HIS 157 ? C HIS 157 
13 1 Y 1 B MET 1   ? D MET 1   
14 1 Y 1 B ASN 2   ? D ASN 2   
15 1 Y 1 B GLN 148 ? D GLN 148 
16 1 Y 1 B GLY 149 ? D GLY 149 
17 1 Y 1 B GLY 150 ? D GLY 150 
18 1 Y 1 B GLY 151 ? D GLY 151 
19 1 Y 1 B HIS 152 ? D HIS 152 
20 1 Y 1 B HIS 153 ? D HIS 153 
21 1 Y 1 B HIS 154 ? D HIS 154 
22 1 Y 1 B HIS 155 ? D HIS 155 
23 1 Y 1 B HIS 156 ? D HIS 156 
24 1 Y 1 B HIS 157 ? D HIS 157 
25 1 Y 1 C MET 1   ? E MET 1   
26 1 Y 1 C ASN 2   ? E ASN 2   
27 1 Y 1 C VAL 140 ? E VAL 140 
28 1 Y 1 C ALA 141 ? E ALA 141 
29 1 Y 1 C SER 142 ? E SER 142 
30 1 Y 1 C GLU 143 ? E GLU 143 
31 1 Y 1 C ASN 144 ? E ASN 144 
32 1 Y 1 C LEU 145 ? E LEU 145 
33 1 Y 1 C TYR 146 ? E TYR 146 
34 1 Y 1 C PHE 147 ? E PHE 147 
35 1 Y 1 C GLN 148 ? E GLN 148 
36 1 Y 1 C GLY 149 ? E GLY 149 
37 1 Y 1 C GLY 150 ? E GLY 150 
38 1 Y 1 C GLY 151 ? E GLY 151 
39 1 Y 1 C HIS 152 ? E HIS 152 
40 1 Y 1 C HIS 153 ? E HIS 153 
41 1 Y 1 C HIS 154 ? E HIS 154 
42 1 Y 1 C HIS 155 ? E HIS 155 
43 1 Y 1 C HIS 156 ? E HIS 156 
44 1 Y 1 C HIS 157 ? E HIS 157 
45 1 Y 1 D MET 1   ? F MET 1   
46 1 Y 1 D ASN 2   ? F ASN 2   
47 1 Y 1 D VAL 140 ? F VAL 140 
48 1 Y 1 D ALA 141 ? F ALA 141 
49 1 Y 1 D SER 142 ? F SER 142 
50 1 Y 1 D GLU 143 ? F GLU 143 
51 1 Y 1 D ASN 144 ? F ASN 144 
52 1 Y 1 D LEU 145 ? F LEU 145 
53 1 Y 1 D TYR 146 ? F TYR 146 
54 1 Y 1 D PHE 147 ? F PHE 147 
55 1 Y 1 D GLN 148 ? F GLN 148 
56 1 Y 1 D GLY 149 ? F GLY 149 
57 1 Y 1 D GLY 150 ? F GLY 150 
58 1 Y 1 D GLY 151 ? F GLY 151 
59 1 Y 1 D HIS 152 ? F HIS 152 
60 1 Y 1 D HIS 153 ? F HIS 153 
61 1 Y 1 D HIS 154 ? F HIS 154 
62 1 Y 1 D HIS 155 ? F HIS 155 
63 1 Y 1 D HIS 156 ? F HIS 156 
64 1 Y 1 D HIS 157 ? F HIS 157 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2IT0 'double helix'        
2IT0 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 B DG 32 1_555 0.722  -0.669 0.315  -0.944  -17.179 -0.184  1  E_DC1:DG32_F  E 1  ? F 32 ? 19 1 
1 A DC 2  1_555 B DG 31 1_555 -0.199 -0.549 0.005  2.145   -4.142  -3.523  2  E_DC2:DG31_F  E 2  ? F 31 ? 19 1 
1 A DC 3  1_555 B DG 30 1_555 -0.277 -0.116 -0.193 -3.445  -2.952  3.269   3  E_DC3:DG30_F  E 3  ? F 30 ? 19 1 
1 A DT 4  1_555 B DA 29 1_555 0.263  -0.159 0.184  2.209   -0.871  5.071   4  E_DT4:DA29_F  E 4  ? F 29 ? 20 1 
1 A DG 5  1_555 B DC 28 1_555 0.355  -0.252 -0.321 -12.528 -14.529 2.966   5  E_DG5:DC28_F  E 5  ? F 28 ? 19 1 
1 A DT 6  1_555 B DA 27 1_555 -0.563 -0.070 0.401  -11.961 -7.784  2.808   6  E_DT6:DA27_F  E 6  ? F 27 ? 20 1 
1 A DT 7  1_555 B DA 26 1_555 -0.302 -0.044 -0.128 -3.019  -12.683 1.045   7  E_DT7:DA26_F  E 7  ? F 26 ? 20 1 
1 A DA 8  1_555 B DT 25 1_555 0.390  0.023  0.212  -1.832  2.394   -6.113  8  E_DA8:DT25_F  E 8  ? F 25 ? 20 1 
1 A DG 9  1_555 B DC 24 1_555 -0.160 -0.145 0.367  13.534  -3.534  3.633   9  E_DG9:DC24_F  E 9  ? F 24 ? 19 1 
1 A DC 10 1_555 B DG 23 1_555 0.359  -0.197 -0.141 11.938  -18.691 1.158   10 E_DC10:DG23_F E 10 ? F 23 ? 19 1 
1 A DA 11 1_555 B DT 22 1_555 -0.153 -0.172 0.113  -11.055 -10.064 4.023   11 E_DA11:DT22_F E 11 ? F 22 ? 20 1 
1 A DC 12 1_555 B DG 21 1_555 0.307  -0.087 -0.094 -0.444  -6.023  2.503   12 E_DC12:DG21_F E 12 ? F 21 ? 19 1 
1 A DA 13 1_555 B DT 20 1_555 -0.236 0.051  -0.278 2.747   -0.704  -4.142  13 E_DA13:DT20_F E 13 ? F 20 ? 20 1 
1 A DG 14 1_555 B DC 19 1_555 0.168  0.027  0.146  17.246  -5.809  4.156   14 E_DG14:DC19_F E 14 ? F 19 ? 19 1 
1 A DG 15 1_555 B DC 18 1_555 -0.081 -0.086 0.299  2.904   -10.823 3.049   15 E_DG15:DC18_F E 15 ? F 18 ? 19 1 
1 A DC 16 1_555 B DG 17 1_555 -0.069 -0.083 0.083  -12.123 -3.800  1.678   16 E_DC16:DG17_F E 16 ? F 17 ? 19 1 
1 A DT 17 1_555 B DA 16 1_555 0.315  -0.059 0.183  -5.125  6.727   3.013   17 E_DT17:DA16_F E 17 ? F 16 ? 20 1 
1 A DG 18 1_555 B DC 15 1_555 -0.191 -0.083 -0.186 0.876   -4.054  -0.813  18 E_DG18:DC15_F E 18 ? F 15 ? 19 1 
1 A DC 19 1_555 B DG 14 1_555 0.625  0.009  -0.494 22.324  -15.927 6.900   19 E_DC19:DG14_F E 19 ? F 14 ? 19 1 
1 A DC 20 1_555 B DG 13 1_555 0.358  -0.321 0.070  -1.054  -12.724 -6.136  20 E_DC20:DG13_F E 20 ? F 13 ? 19 1 
1 A DC 21 1_555 B DG 12 1_555 0.311  -0.213 0.273  -11.579 1.974   2.503   21 E_DC21:DG12_F E 21 ? F 12 ? 19 1 
1 A DT 22 1_555 B DA 11 1_555 -0.229 -0.129 0.166  5.278   -1.624  0.448   22 E_DT22:DA11_F E 22 ? F 11 ? 20 1 
1 A DA 23 1_555 B DT 10 1_555 0.084  -0.284 -0.467 -0.620  -12.819 5.035   23 E_DA23:DT10_F E 23 ? F 10 ? 20 1 
1 A DA 24 1_555 B DT 9  1_555 -0.054 -0.294 0.350  10.304  -13.786 2.179   24 E_DA24:DT9_F  E 24 ? F 9  ? 20 1 
1 A DT 25 1_555 B DA 8  1_555 0.226  -0.226 0.106  0.519   -11.281 3.686   25 E_DT25:DA8_F  E 25 ? F 8  ? 20 1 
1 A DT 26 1_555 B DA 7  1_555 0.433  0.021  0.509  -3.610  -8.542  14.259  26 E_DT26:DA7_F  E 26 ? F 7  ? ?  1 
1 A DT 27 1_555 B DA 6  1_555 -0.450 -0.348 0.360  -8.979  -22.087 -9.377  27 E_DT27:DA6_F  E 27 ? F 6  ? 20 1 
1 A DT 28 1_555 B DA 5  1_555 -0.559 -0.123 0.269  -14.341 -16.281 -4.265  28 E_DT28:DA5_F  E 28 ? F 5  ? 20 1 
1 A DA 29 1_555 B DT 4  1_555 0.859  -0.065 -0.561 -9.892  -2.825  9.885   29 E_DA29:DT4_F  E 29 ? F 4  ? 20 1 
1 A DG 30 1_555 B DC 3  1_555 -0.594 -0.192 0.035  -2.158  -5.192  -0.928  30 E_DG30:DC3_F  E 30 ? F 3  ? 19 1 
1 A DT 31 1_555 B DA 2  1_555 0.302  -0.449 -0.361 5.092   -12.992 -10.037 31 E_DT31:DA2_F  E 31 ? F 2  ? 20 1 
1 A DG 32 1_555 B DC 1  1_555 -0.328 -0.023 -0.158 -3.297  -7.427  -6.912  32 E_DG32:DC1_F  E 32 ? F 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 B DG 32 1_555 A DC 2  1_555 B DG 31 1_555 -0.613 -1.490 3.197 1.443  9.587  28.129 -4.716 1.468  2.529 19.025 
-2.863  29.721 1  EE_DC1DC2:DG31DG32_FF   E 1  ? F 32 ? E 2  ? F 31 ? 
1 A DC 2  1_555 B DG 31 1_555 A DC 3  1_555 B DG 30 1_555 0.279  -0.259 3.394 4.639  11.036 37.359 -1.755 0.158  3.205 16.710 
-7.025  39.165 2  EE_DC2DC3:DG30DG31_FF   E 2  ? F 31 ? E 3  ? F 30 ? 
1 A DC 3  1_555 B DG 30 1_555 A DT 4  1_555 B DA 29 1_555 0.358  -0.127 3.408 -4.191 6.670  27.645 -1.802 -1.692 3.203 13.612 
8.552   28.724 3  EE_DC3DT4:DA29DG30_FF   E 3  ? F 30 ? E 4  ? F 29 ? 
1 A DT 4  1_555 B DA 29 1_555 A DG 5  1_555 B DC 28 1_555 0.635  -0.487 3.670 6.198  6.423  33.928 -1.896 -0.006 3.579 10.776 
-10.400 35.049 4  EE_DT4DG5:DC28DA29_FF   E 4  ? F 29 ? E 5  ? F 28 ? 
1 A DG 5  1_555 B DC 28 1_555 A DT 6  1_555 B DA 27 1_555 -0.737 -0.876 3.243 -4.670 4.270  25.472 -3.072 0.375  3.139 9.499  
10.388  26.234 5  EE_DG5DT6:DA27DC28_FF   E 5  ? F 28 ? E 6  ? F 27 ? 
1 A DT 6  1_555 B DA 27 1_555 A DT 7  1_555 B DA 26 1_555 -0.460 -0.257 3.007 4.338  6.421  33.771 -1.326 1.377  2.833 10.876 
-7.347  34.624 6  EE_DT6DT7:DA26DA27_FF   E 6  ? F 27 ? E 7  ? F 26 ? 
1 A DT 7  1_555 B DA 26 1_555 A DA 8  1_555 B DT 25 1_555 -0.153 -0.229 3.302 -3.795 3.028  36.093 -0.791 -0.288 3.272 4.860  
6.091   36.407 7  EE_DT7DA8:DT25DA26_FF   E 7  ? F 26 ? E 8  ? F 25 ? 
1 A DA 8  1_555 B DT 25 1_555 A DG 9  1_555 B DC 24 1_555 0.939  -0.989 2.996 -2.473 7.630  26.450 -3.673 -2.487 2.521 16.207 
5.254   27.619 8  EE_DA8DG9:DC24DT25_FF   E 8  ? F 25 ? E 9  ? F 24 ? 
1 A DG 9  1_555 B DC 24 1_555 A DC 10 1_555 B DG 23 1_555 0.371  -1.444 3.461 3.252  -2.364 30.797 -2.207 -0.019 3.578 -4.428 
-6.091  31.052 9  EE_DG9DC10:DG23DC24_FF  E 9  ? F 24 ? E 10 ? F 23 ? 
1 A DC 10 1_555 B DG 23 1_555 A DA 11 1_555 B DT 22 1_555 -0.081 -0.957 3.716 0.235  10.189 37.503 -2.809 0.154  3.353 15.501 
-0.358  38.815 10 EE_DC10DA11:DT22DG23_FF E 10 ? F 23 ? E 11 ? F 22 ? 
1 A DA 11 1_555 B DT 22 1_555 A DC 12 1_555 B DG 21 1_555 -0.401 -0.464 3.093 1.991  8.244  26.272 -2.827 1.289  2.784 17.565 
-4.241  27.584 11 EE_DA11DC12:DG21DT22_FF E 11 ? F 22 ? E 12 ? F 21 ? 
1 A DC 12 1_555 B DG 21 1_555 A DA 13 1_555 B DT 20 1_555 -0.486 -0.348 3.393 0.750  -2.390 34.666 -0.203 0.933  3.398 -4.004 
-1.257  34.754 12 EE_DC12DA13:DT20DG21_FF E 12 ? F 21 ? E 13 ? F 20 ? 
1 A DA 13 1_555 B DT 20 1_555 A DG 14 1_555 B DC 19 1_555 1.106  -0.421 3.181 -5.361 6.947  30.610 -1.951 -2.930 2.792 12.831 
9.903   31.814 13 EE_DA13DG14:DC19DT20_FF E 13 ? F 20 ? E 14 ? F 19 ? 
1 A DG 14 1_555 B DC 19 1_555 A DG 15 1_555 B DC 18 1_555 -0.170 -1.430 3.585 -4.782 0.127  30.335 -2.728 -0.711 3.564 0.240  
9.068   30.701 14 EE_DG14DG15:DC18DC19_FF E 14 ? F 19 ? E 15 ? F 18 ? 
1 A DG 15 1_555 B DC 18 1_555 A DC 16 1_555 B DG 17 1_555 0.395  -1.667 3.615 5.226  2.796  35.246 -3.159 0.182  3.498 4.578  
-8.556  35.726 15 EE_DG15DC16:DG17DC18_FF E 15 ? F 18 ? E 16 ? F 17 ? 
1 A DC 16 1_555 B DG 17 1_555 A DT 17 1_555 B DA 16 1_555 -0.914 -0.811 3.367 -0.764 4.892  28.996 -2.660 1.635  3.213 9.681  
1.511   29.407 16 EE_DC16DT17:DA16DG17_FF E 16 ? F 17 ? E 17 ? F 16 ? 
1 A DT 17 1_555 B DA 16 1_555 A DG 18 1_555 B DC 15 1_555 -0.111 -0.625 3.179 2.302  -2.016 33.177 -0.763 0.567  3.196 -3.522 
-4.021  33.314 17 EE_DT17DG18:DC15DA16_FF E 17 ? F 16 ? E 18 ? F 15 ? 
1 A DG 18 1_555 B DC 15 1_555 A DC 19 1_555 B DG 14 1_555 0.600  -0.337 2.903 2.691  7.820  28.041 -2.170 -0.673 2.755 15.711 
-5.406  29.212 18 EE_DG18DC19:DG14DC15_FF E 18 ? F 15 ? E 19 ? F 14 ? 
1 A DC 19 1_555 B DG 14 1_555 A DC 20 1_555 B DG 13 1_555 -0.354 -1.027 3.836 -7.593 7.035  38.907 -2.418 -0.484 3.608 10.341 
11.161  40.209 19 EE_DC19DC20:DG13DG14_FF E 19 ? F 14 ? E 20 ? F 13 ? 
1 A DC 20 1_555 B DG 13 1_555 A DC 21 1_555 B DG 12 1_555 -0.611 -1.778 3.567 -0.646 1.569  27.281 -4.183 1.120  3.475 3.323  
1.367   27.332 20 EE_DC20DC21:DG12DG13_FF E 20 ? F 13 ? E 21 ? F 12 ? 
1 A DC 21 1_555 B DG 12 1_555 A DT 22 1_555 B DA 11 1_555 -0.917 -0.651 3.070 1.509  5.088  25.062 -2.783 2.459  2.825 11.560 
-3.429  25.609 21 EE_DC21DT22:DA11DG12_FF E 21 ? F 12 ? E 22 ? F 11 ? 
1 A DT 22 1_555 B DA 11 1_555 A DA 23 1_555 B DT 10 1_555 -0.187 -0.280 3.502 4.711  11.617 32.576 -2.333 1.068  3.165 19.818 
-8.036  34.844 22 EE_DT22DA23:DT10DA11_FF E 22 ? F 11 ? E 23 ? F 10 ? 
1 A DA 23 1_555 B DT 10 1_555 A DA 24 1_555 B DT 9  1_555 0.406  -0.117 2.861 -5.815 -4.317 34.049 0.375  -1.449 2.750 -7.270 
9.793   34.788 23 EE_DA23DA24:DT9DT10_FF  E 23 ? F 10 ? E 24 ? F 9  ? 
1 A DA 24 1_555 B DT 9  1_555 A DT 25 1_555 B DA 8  1_555 0.574  -0.750 3.609 3.302  -1.859 34.233 -0.944 -0.395 3.681 -3.146 
-5.587  34.436 24 EE_DA24DT25:DA8DT9_FF   E 24 ? F 9  ? E 25 ? F 8  ? 
1 A DT 25 1_555 B DA 8  1_555 A DT 26 1_555 B DA 7  1_555 0.187  -0.663 3.423 -2.796 -1.095 32.585 -0.980 -0.838 3.415 -1.947 
4.969   32.719 25 EE_DT25DT26:DA7DA8_FF   E 25 ? F 8  ? E 26 ? F 7  ? 
1 A DT 26 1_555 B DA 7  1_555 A DT 27 1_555 B DA 6  1_555 -1.090 -0.755 3.245 -0.174 -2.588 30.552 -0.916 2.028  3.302 -4.901 
0.330   30.659 26 EE_DT26DT27:DA6DA7_FF   E 26 ? F 7  ? E 27 ? F 6  ? 
1 A DT 27 1_555 B DA 6  1_555 A DT 28 1_555 B DA 5  1_555 -0.008 -0.243 3.332 1.089  -1.572 38.817 -0.170 0.147  3.337 -2.364 
-1.637  38.862 27 EE_DT27DT28:DA5DA6_FF   E 27 ? F 6  ? E 28 ? F 5  ? 
1 A DT 28 1_555 B DA 5  1_555 A DA 29 1_555 B DT 4  1_555 0.781  0.783  3.293 6.986  6.229  46.276 0.448  -0.381 3.441 7.831  
-8.784  47.162 28 EE_DT28DA29:DT4DA5_FF   E 28 ? F 5  ? E 29 ? F 4  ? 
1 A DA 29 1_555 B DT 4  1_555 A DG 30 1_555 B DC 3  1_555 -0.305 -0.196 3.169 -5.498 0.746  21.131 -0.802 -1.300 3.136 1.991  
14.669  21.839 29 EE_DA29DG30:DC3DT4_FF   E 29 ? F 4  ? E 30 ? F 3  ? 
1 A DG 30 1_555 B DC 3  1_555 A DT 31 1_555 B DA 2  1_555 -1.119 -0.051 3.144 3.587  -0.713 42.045 -0.001 1.904  3.043 -0.991 
-4.988  42.197 30 EE_DG30DT31:DA2DC3_FF   E 30 ? F 3  ? E 31 ? F 2  ? 
1 A DT 31 1_555 B DA 2  1_555 A DG 32 1_555 B DC 1  1_555 1.031  -0.635 3.716 3.241  2.361  33.386 -1.540 -1.177 3.745 4.092  
-5.617  33.620 31 EE_DT31DG32:DC1DA2_FF   E 31 ? F 2  ? E 32 ? F 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'NICKEL (II) ION' NI  
5 'ACETATE ION'     ACT 
6 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  4 NI  1  1001 1001 NI  NI  A . 
H  4 NI  1  1002 1002 NI  NI  A . 
I  4 NI  1  1003 1003 NI  NI  A . 
J  5 ACT 1  2001 2001 ACT ACT A . 
K  5 ACT 1  2002 2002 ACT ACT A . 
L  5 ACT 1  2003 2003 ACT ACT A . 
M  4 NI  1  1001 1001 NI  NI  B . 
N  4 NI  1  1002 1002 NI  NI  B . 
O  4 NI  1  1003 1003 NI  NI  B . 
P  5 ACT 1  2001 2001 ACT ACT B . 
Q  5 ACT 1  2002 2002 ACT ACT B . 
R  4 NI  1  1001 1001 NI  NI  C . 
S  4 NI  1  1002 1002 NI  NI  C . 
T  4 NI  1  1003 1003 NI  NI  C . 
U  5 ACT 1  2001 2001 ACT ACT C . 
V  5 ACT 1  2002 2002 ACT ACT C . 
W  5 ACT 1  2003 2003 ACT ACT C . 
X  4 NI  1  1001 1001 NI  NI  D . 
Y  4 NI  1  1002 1002 NI  NI  D . 
Z  4 NI  1  1003 1003 NI  NI  D . 
AA 5 ACT 1  2001 2001 ACT ACT D . 
BA 5 ACT 1  2002 2002 ACT ACT D . 
CA 6 HOH 1  34   5    HOH HOH E . 
CA 6 HOH 2  35   10   HOH HOH E . 
CA 6 HOH 3  36   14   HOH HOH E . 
CA 6 HOH 4  37   24   HOH HOH E . 
DA 6 HOH 1  34   6    HOH HOH F . 
DA 6 HOH 2  35   13   HOH HOH F . 
DA 6 HOH 3  36   18   HOH HOH F . 
DA 6 HOH 4  37   26   HOH HOH F . 
EA 6 HOH 1  2004 8    HOH HOH A . 
EA 6 HOH 2  2005 9    HOH HOH A . 
EA 6 HOH 3  2006 15   HOH HOH A . 
EA 6 HOH 4  2007 20   HOH HOH A . 
EA 6 HOH 5  2008 23   HOH HOH A . 
EA 6 HOH 6  2009 30   HOH HOH A . 
FA 6 HOH 1  2003 1    HOH HOH B . 
FA 6 HOH 2  2004 2    HOH HOH B . 
FA 6 HOH 3  2005 3    HOH HOH B . 
FA 6 HOH 4  2006 7    HOH HOH B . 
FA 6 HOH 5  2007 12   HOH HOH B . 
FA 6 HOH 6  2008 16   HOH HOH B . 
FA 6 HOH 7  2009 19   HOH HOH B . 
FA 6 HOH 8  2010 28   HOH HOH B . 
FA 6 HOH 9  2011 29   HOH HOH B . 
FA 6 HOH 10 2012 31   HOH HOH B . 
GA 6 HOH 1  2004 22   HOH HOH C . 
GA 6 HOH 2  2005 25   HOH HOH C . 
GA 6 HOH 3  2006 27   HOH HOH C . 
GA 6 HOH 4  2007 32   HOH HOH C . 
HA 6 HOH 1  2003 4    HOH HOH D . 
HA 6 HOH 2  2004 11   HOH HOH D . 
HA 6 HOH 3  2005 17   HOH HOH D . 
HA 6 HOH 4  2006 21   HOH HOH D . 
HA 6 HOH 5  2007 33   HOH HOH D . 
#