data_2IUI
# 
_entry.id   2IUI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IUI         
PDBE  EBI-28972    
WWPDB D_1290028972 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A0N unspecified 
;NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, FAMILY OF 25 STRUCTURES
;
PDB 1AZG unspecified 
;NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, MINIMIZED AVERAGE (PROBMAP) STRUCTURE
;
PDB 1H9O unspecified 
;PHOSPHATIDYLINOSITOL 3-KINASE, P85-ALPHA SUBUNIT: C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYR751 PHOSPHOPEPTIDE FROM THE PDGF RECEPTOR, CRYSTAL STRUCTURE AT 1.79 A
;
PDB 1PBW unspecified 'STRUCTURE OF BCR-HOMOLOGY (BH) DOMAIN' 
PDB 1PHT unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN, RESIDUES 1-85' 
PDB 1PIC unspecified 
;PHOSPHATIDYLINOSITOL 3-KINASE, P85-ALPHA SUBUNIT: C-TERMINAL SH2 DOMAIN COMPLEXED WITH A TYR751 PHOSPHOPEPTIDE FROM THE PDGF RECEPTOR, NMR, MINIMIZED MEAN STRUCTURE
;
PDB 1PKS unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE (PI3K) (SH3 DOMAIN) (NMR, MINIMIZED AVERAGE STRUCTURE)' 
PDB 1PKT unspecified 'PHOSPHATIDYLINOSITOL 3-KINASE (PI3K) (SH3 DOMAIN) (NMR, 30 STRUCTURES)' 
PDB 2IUG unspecified 'CRYSTAL STRUCTURE OF THE PI3-KINASE P85 N -TERMINAL SH2 DOMAIN' 
PDB 2IUH unspecified 
'CRYSTAL STRUCTURE OF THE PI3-KINASE P85 N -TERMINAL SH2 DOMAIN IN COMPLEX WITH C- KIT PHOSPHOTYROSYL PEPTIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IUI 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-06-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nolte, R.T.'      1 ? 
'Eck, M.J.'        2 ? 
'Schlessinger, J.' 3 ? 
'Shoelson, S.E.'   4 ? 
'Harrison, S.C.'   5 ? 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            3 
_citation.page_first                364 
_citation.page_last                 ? 
_citation.year                      1996 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8599763 
_citation.pdbx_database_id_DOI      10.1038/NSB0496-364 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nolte, R.T.'      1 
primary 'Eck, M.J.'        2 
primary 'Schlessinger, J.' 3 
primary 'Shoelson, S.E.'   4 
primary 'Harrison, S.C.'   5 
# 
_cell.entry_id           2IUI 
_cell.length_a           40.760 
_cell.length_b           61.940 
_cell.length_c           108.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2IUI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Phosphatidylinositol 3-kinase regulatory subunit alpha' 13939.569 2   ?        ? 
'N-TERMINAL SH2 DOMAIN, RESIDUES 321-440' ? 
2 polymer syn 'Platelet-derived growth factor receptor beta'           1392.554  2   2.7.10.1 ? ? ? 
3 water   nat water                                                    18.015    117 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PtdIns-3-kinase regulatory subunit p85-alpha
;
2 
;PDGFR-beta,Beta platelet-derived growth factor receptor,Beta-type platelet-derived growth factor receptor,CD140 antigen-like family member B,Platelet-derived growth factor receptor 1,PDGFR-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED
;
;GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED
;
A,B ? 
2 'polypeptide(L)' no yes 'SID(PTR)VPMLDMK' SIDYVPMLDMK C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   ASN n 
1 4   ASN n 
1 5   ASN n 
1 6   MET n 
1 7   SER n 
1 8   LEU n 
1 9   GLN n 
1 10  ASN n 
1 11  ALA n 
1 12  GLU n 
1 13  TRP n 
1 14  TYR n 
1 15  TRP n 
1 16  GLY n 
1 17  ASP n 
1 18  ILE n 
1 19  SER n 
1 20  ARG n 
1 21  GLU n 
1 22  GLU n 
1 23  VAL n 
1 24  ASN n 
1 25  GLU n 
1 26  LYS n 
1 27  LEU n 
1 28  ARG n 
1 29  ASP n 
1 30  THR n 
1 31  ALA n 
1 32  ASP n 
1 33  GLY n 
1 34  THR n 
1 35  PHE n 
1 36  LEU n 
1 37  VAL n 
1 38  ARG n 
1 39  ASP n 
1 40  ALA n 
1 41  SER n 
1 42  THR n 
1 43  LYS n 
1 44  MET n 
1 45  HIS n 
1 46  GLY n 
1 47  ASP n 
1 48  TYR n 
1 49  THR n 
1 50  LEU n 
1 51  THR n 
1 52  LEU n 
1 53  ARG n 
1 54  LYS n 
1 55  GLY n 
1 56  GLY n 
1 57  ASN n 
1 58  ASN n 
1 59  LYS n 
1 60  LEU n 
1 61  ILE n 
1 62  LYS n 
1 63  ILE n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  ASP n 
1 68  GLY n 
1 69  LYS n 
1 70  TYR n 
1 71  GLY n 
1 72  PHE n 
1 73  SER n 
1 74  ASP n 
1 75  PRO n 
1 76  LEU n 
1 77  THR n 
1 78  PHE n 
1 79  SER n 
1 80  SER n 
1 81  VAL n 
1 82  VAL n 
1 83  GLU n 
1 84  LEU n 
1 85  ILE n 
1 86  ASN n 
1 87  HIS n 
1 88  TYR n 
1 89  ARG n 
1 90  ASN n 
1 91  GLU n 
1 92  SER n 
1 93  LEU n 
1 94  ALA n 
1 95  GLN n 
1 96  TYR n 
1 97  ASN n 
1 98  PRO n 
1 99  LYS n 
1 100 LEU n 
1 101 ASP n 
1 102 VAL n 
1 103 LYS n 
1 104 LEU n 
1 105 LEU n 
1 106 TYR n 
1 107 PRO n 
1 108 VAL n 
1 109 SER n 
1 110 LYS n 
1 111 TYR n 
1 112 GLN n 
1 113 GLN n 
1 114 ASP n 
1 115 GLN n 
1 116 VAL n 
1 117 VAL n 
1 118 LYS n 
1 119 GLU n 
1 120 ASP n 
2 1   SER n 
2 2   ILE n 
2 3   ASP n 
2 4   PTR n 
2 5   VAL n 
2 6   PRO n 
2 7   MET n 
2 8   LEU n 
2 9   ASP n 
2 10  MET n 
2 11  LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   120 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PIK3R1, GRB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       11 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP P85A_HUMAN  P27986 ? 1 
;GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED
;
321 
2 UNP PGFRB_HUMAN P09619 ? 2 SVDYVPMLDMK 748 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IUI A 1 ? 120 ? P27986 321 ? 440 ? 0    119  
2 1 2IUI B 1 ? 120 ? P27986 321 ? 440 ? 1000 1119 
3 2 2IUI C 1 ? 11  ? P09619 748 ? 758 ? 201  211  
4 2 2IUI D 1 ? 11  ? P09619 748 ? 758 ? 1201 1211 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2IUI ASN A 10 ? UNP P27986 ASP 330 conflict 9    1 
2 2IUI ASN B 10 ? UNP P27986 ASP 330 conflict 1009 2 
3 2IUI ILE C 2  ? UNP P09619 VAL 749 conflict 202  3 
4 2IUI ILE D 2  ? UNP P09619 VAL 749 conflict 1202 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2IUI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M SODIUM ACETATE PH 4.6, 0.2M AMMONIUM ACETATE, 30% PEG4000' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           278.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2IUI 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   12930 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.3700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              0.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.31000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.920 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2IUI 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     00000 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    00000 
_refine.ls_R_factor_obs                          0.1784 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1784 
_refine.ls_R_factor_R_free                       0.2484 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.01 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THIS COODINATES FILE WAS DEPOSITED 10 YEARS AFTER THE PUBLICATION OF THE WORK. SOME OF THE DATA ARE MISSING AND ARE SHOWN AS '00000'.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1970 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               2087 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.65  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2IUI 
_struct.title                     
'Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with PDGFR phosphotyrosyl peptide' 
_struct.pdbx_descriptor           'PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT, PDGFR PHOSPHOTYROSYL PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IUI 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'TRANSFERASE, PHOSPHORYLATION, P85, SH2, PI3K, SH2 DOMAIN, SH3 DOMAIN, PI3-KINASE, DISEASE MUTATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 6  ? ALA A 11 ? MET A 5    ALA A 10   1 ? 6  
HELX_P HELX_P2 2 SER A 19 ? ARG A 28 ? SER A 18   ARG A 27   1 ? 10 
HELX_P HELX_P3 3 SER A 80 ? ASN A 90 ? SER A 79   ASN A 89   1 ? 11 
HELX_P HELX_P4 4 ASN B 5  ? ASN B 10 ? ASN B 1004 ASN B 1009 1 ? 6  
HELX_P HELX_P5 5 SER B 19 ? ARG B 28 ? SER B 1018 ARG B 1027 1 ? 10 
HELX_P HELX_P6 6 SER B 80 ? ASN B 90 ? SER B 1079 ASN B 1089 1 ? 11 
HELX_P HELX_P7 7 LEU B 93 ? ASN B 97 ? LEU B 1092 ASN B 1096 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C ASP 3 C ? ? ? 1_555 C PTR 4 N ? ? C ASP 203  C PTR 204  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2 covale ? ? C PTR 4 C ? ? ? 1_555 C VAL 5 N ? ? C PTR 204  C VAL 205  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3 covale ? ? D ASP 3 C ? ? ? 1_555 D PTR 4 N ? ? D ASP 1203 D PTR 1204 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4 covale ? ? D PTR 4 C ? ? ? 1_555 D VAL 5 N ? ? D PTR 1204 D VAL 1205 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 74 A . ? ASP 73   A PRO 75 A ? PRO 74   A 1 1.86 
2 ASP 74 B . ? ASP 1073 B PRO 75 B ? PRO 1074 B 1 3.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
BA ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LYS A 69  ? GLY A 71  ? LYS A 68   GLY A 70   
AA 2 ASN A 57  ? ARG A 66  ? ASN A 56   ARG A 65   
AA 3 TYR A 48  ? LYS A 54  ? TYR A 47   LYS A 53   
AA 4 THR A 34  ? ASP A 39  ? THR A 33   ASP A 38   
AA 5 TYR A 106 ? PRO A 107 ? TYR A 105  PRO A 106  
BA 1 LYS B 69  ? GLY B 71  ? LYS B 1068 GLY B 1070 
BA 2 ASN B 57  ? ARG B 66  ? ASN B 1056 ARG B 1065 
BA 3 TYR B 48  ? LYS B 54  ? TYR B 1047 LYS B 1053 
BA 4 THR B 34  ? ASP B 39  ? THR B 1033 ASP B 1038 
BA 5 TYR B 106 ? PRO B 107 ? TYR B 1105 PRO B 1106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 71 ? N GLY A 70   O PHE A 64  ? O PHE A 63   
AA 2 3 N ILE A 63 ? N ILE A 62   O TYR A 48  ? O TYR A 47   
AA 3 4 N ARG A 53 ? N ARG A 52   O THR A 34  ? O THR A 33   
AA 4 5 N PHE A 35 ? N PHE A 34   O TYR A 106 ? O TYR A 105  
BA 1 2 N GLY B 71 ? N GLY B 1070 O PHE B 64  ? O PHE B 1063 
BA 2 3 N ILE B 63 ? N ILE B 1062 O TYR B 48  ? O TYR B 1047 
BA 3 4 N ARG B 53 ? N ARG B 1052 O THR B 34  ? O THR B 1033 
BA 4 5 N PHE B 35 ? N PHE B 1034 O TYR B 106 ? O TYR B 1105 
# 
_database_PDB_matrix.entry_id          2IUI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IUI 
_atom_sites.fract_transf_matrix[1][1]   0.024534 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016145 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009228 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 6   ? 16.703 -11.933 13.060  1.00 66.26 ? 5    MET A N   1 
ATOM   2    C CA  . MET A 1 6   ? 17.101 -11.312 11.798  1.00 64.94 ? 5    MET A CA  1 
ATOM   3    C C   . MET A 1 6   ? 16.869 -9.806  11.842  1.00 62.35 ? 5    MET A C   1 
ATOM   4    O O   . MET A 1 6   ? 15.767 -9.317  11.542  1.00 63.64 ? 5    MET A O   1 
ATOM   5    C CB  . MET A 1 6   ? 16.330 -11.927 10.621  1.00 67.13 ? 5    MET A CB  1 
ATOM   6    C CG  . MET A 1 6   ? 16.697 -11.341 9.262   1.00 65.94 ? 5    MET A CG  1 
ATOM   7    S SD  . MET A 1 6   ? 18.480 -11.128 9.070   1.00 67.30 ? 5    MET A SD  1 
ATOM   8    C CE  . MET A 1 6   ? 18.702 -11.830 7.451   1.00 65.39 ? 5    MET A CE  1 
ATOM   9    N N   . SER A 1 7   ? 17.937 -9.069  12.128  1.00 56.50 ? 6    SER A N   1 
ATOM   10   C CA  . SER A 1 7   ? 17.858 -7.622  12.326  1.00 50.82 ? 6    SER A CA  1 
ATOM   11   C C   . SER A 1 7   ? 17.209 -6.933  11.134  1.00 48.23 ? 6    SER A C   1 
ATOM   12   O O   . SER A 1 7   ? 16.395 -6.028  11.295  1.00 47.64 ? 6    SER A O   1 
ATOM   13   C CB  . SER A 1 7   ? 19.254 -7.061  12.518  1.00 49.26 ? 6    SER A CB  1 
ATOM   14   O OG  . SER A 1 7   ? 20.046 -7.353  11.378  1.00 47.39 ? 6    SER A OG  1 
ATOM   15   N N   . LEU A 1 8   ? 17.536 -7.434  9.946   1.00 45.89 ? 7    LEU A N   1 
ATOM   16   C CA  . LEU A 1 8   ? 17.034 -6.897  8.679   1.00 42.70 ? 7    LEU A CA  1 
ATOM   17   C C   . LEU A 1 8   ? 15.519 -7.041  8.484   1.00 41.92 ? 7    LEU A C   1 
ATOM   18   O O   . LEU A 1 8   ? 14.853 -6.101  8.107   1.00 42.51 ? 7    LEU A O   1 
ATOM   19   C CB  . LEU A 1 8   ? 17.789 -7.533  7.493   1.00 36.92 ? 7    LEU A CB  1 
ATOM   20   C CG  . LEU A 1 8   ? 17.442 -7.042  6.079   1.00 31.36 ? 7    LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 8   ? 17.613 -5.542  6.002   1.00 27.44 ? 7    LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 8   ? 18.325 -7.708  5.057   1.00 25.37 ? 7    LEU A CD2 1 
ATOM   23   N N   . GLN A 1 9   ? 14.959 -8.177  8.861   1.00 43.86 ? 8    GLN A N   1 
ATOM   24   C CA  . GLN A 1 9   ? 13.530 -8.397  8.656   1.00 47.38 ? 8    GLN A CA  1 
ATOM   25   C C   . GLN A 1 9   ? 12.672 -7.542  9.577   1.00 48.67 ? 8    GLN A C   1 
ATOM   26   O O   . GLN A 1 9   ? 11.510 -7.273  9.280   1.00 48.87 ? 8    GLN A O   1 
ATOM   27   C CB  . GLN A 1 9   ? 13.170 -9.876  8.849   1.00 51.30 ? 8    GLN A CB  1 
ATOM   28   C CG  . GLN A 1 9   ? 13.165 -10.684 7.560   1.00 58.40 ? 8    GLN A CG  1 
ATOM   29   C CD  . GLN A 1 9   ? 11.965 -10.393 6.661   1.00 62.88 ? 8    GLN A CD  1 
ATOM   30   O OE1 . GLN A 1 9   ? 11.055 -9.647  7.028   1.00 62.10 ? 8    GLN A OE1 1 
ATOM   31   N NE2 . GLN A 1 9   ? 11.971 -10.975 5.463   1.00 65.84 ? 8    GLN A NE2 1 
ATOM   32   N N   . ASN A 1 10  ? 13.234 -7.152  10.718  1.00 49.20 ? 9    ASN A N   1 
ATOM   33   C CA  . ASN A 1 10  ? 12.507 -6.314  11.674  1.00 46.80 ? 9    ASN A CA  1 
ATOM   34   C C   . ASN A 1 10  ? 12.762 -4.827  11.477  1.00 45.29 ? 9    ASN A C   1 
ATOM   35   O O   . ASN A 1 10  ? 12.142 -3.990  12.142  1.00 44.23 ? 9    ASN A O   1 
ATOM   36   C CB  . ASN A 1 10  ? 12.874 -6.711  13.098  1.00 49.11 ? 9    ASN A CB  1 
ATOM   37   C CG  . ASN A 1 10  ? 12.484 -8.126  13.412  1.00 50.86 ? 9    ASN A CG  1 
ATOM   38   O OD1 . ASN A 1 10  ? 11.344 -8.539  13.174  1.00 51.37 ? 9    ASN A OD1 1 
ATOM   39   N ND2 . ASN A 1 10  ? 13.430 -8.892  13.929  1.00 51.67 ? 9    ASN A ND2 1 
ATOM   40   N N   . ALA A 1 11  ? 13.734 -4.513  10.622  1.00 42.72 ? 10   ALA A N   1 
ATOM   41   C CA  . ALA A 1 11  ? 14.015 -3.141  10.215  1.00 38.77 ? 10   ALA A CA  1 
ATOM   42   C C   . ALA A 1 11  ? 12.775 -2.507  9.577   1.00 36.80 ? 10   ALA A C   1 
ATOM   43   O O   . ALA A 1 11  ? 12.222 -3.030  8.614   1.00 34.08 ? 10   ALA A O   1 
ATOM   44   C CB  . ALA A 1 11  ? 15.189 -3.124  9.235   1.00 34.64 ? 10   ALA A CB  1 
ATOM   45   N N   . GLU A 1 12  ? 12.315 -1.406  10.159  1.00 36.38 ? 11   GLU A N   1 
ATOM   46   C CA  . GLU A 1 12  ? 11.094 -0.732  9.700   1.00 36.26 ? 11   GLU A CA  1 
ATOM   47   C C   . GLU A 1 12  ? 11.162 -0.303  8.254   1.00 34.69 ? 11   GLU A C   1 
ATOM   48   O O   . GLU A 1 12  ? 10.139 -0.078  7.628   1.00 34.91 ? 11   GLU A O   1 
ATOM   49   C CB  . GLU A 1 12  ? 10.789 0.504   10.562  1.00 38.06 ? 11   GLU A CB  1 
ATOM   50   C CG  . GLU A 1 12  ? 11.867 1.579   10.520  1.00 43.27 ? 11   GLU A CG  1 
ATOM   51   C CD  . GLU A 1 12  ? 11.519 2.799   11.351  1.00 47.57 ? 11   GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 12  ? 12.450 3.566   11.708  1.00 48.37 ? 11   GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 12  ? 10.316 2.990   11.659  1.00 48.77 ? 11   GLU A OE2 1 
ATOM   54   N N   . TRP A 1 13  ? 12.381 -0.076  7.770   1.00 34.66 ? 12   TRP A N   1 
ATOM   55   C CA  . TRP A 1 13  ? 12.608 0.492   6.430   1.00 33.09 ? 12   TRP A CA  1 
ATOM   56   C C   . TRP A 1 13  ? 12.865 -0.564  5.342   1.00 32.52 ? 12   TRP A C   1 
ATOM   57   O O   . TRP A 1 13  ? 12.844 -0.241  4.155   1.00 32.85 ? 12   TRP A O   1 
ATOM   58   C CB  . TRP A 1 13  ? 13.776 1.492   6.463   1.00 28.11 ? 12   TRP A CB  1 
ATOM   59   C CG  . TRP A 1 13  ? 14.905 1.060   7.342   1.00 29.78 ? 12   TRP A CG  1 
ATOM   60   C CD1 . TRP A 1 13  ? 15.223 1.572   8.572   1.00 28.21 ? 12   TRP A CD1 1 
ATOM   61   C CD2 . TRP A 1 13  ? 15.912 0.089   7.037   1.00 31.82 ? 12   TRP A CD2 1 
ATOM   62   N NE1 . TRP A 1 13  ? 16.372 0.990   9.038   1.00 30.43 ? 12   TRP A NE1 1 
ATOM   63   C CE2 . TRP A 1 13  ? 16.819 0.074   8.125   1.00 32.74 ? 12   TRP A CE2 1 
ATOM   64   C CE3 . TRP A 1 13  ? 16.152 -0.766  5.951   1.00 32.43 ? 12   TRP A CE3 1 
ATOM   65   C CZ2 . TRP A 1 13  ? 17.948 -0.768  8.153   1.00 34.64 ? 12   TRP A CZ2 1 
ATOM   66   C CZ3 . TRP A 1 13  ? 17.268 -1.601  5.982   1.00 32.84 ? 12   TRP A CZ3 1 
ATOM   67   C CH2 . TRP A 1 13  ? 18.152 -1.595  7.078   1.00 32.91 ? 12   TRP A CH2 1 
ATOM   68   N N   . TYR A 1 14  ? 13.048 -1.821  5.750   1.00 30.03 ? 13   TYR A N   1 
ATOM   69   C CA  . TYR A 1 14  ? 13.099 -2.923  4.813   1.00 26.16 ? 13   TYR A CA  1 
ATOM   70   C C   . TYR A 1 14  ? 11.710 -3.434  4.424   1.00 27.46 ? 13   TYR A C   1 
ATOM   71   O O   . TYR A 1 14  ? 10.995 -3.986  5.261   1.00 27.68 ? 13   TYR A O   1 
ATOM   72   C CB  . TYR A 1 14  ? 13.908 -4.064  5.394   1.00 26.56 ? 13   TYR A CB  1 
ATOM   73   C CG  . TYR A 1 14  ? 13.870 -5.327  4.539   1.00 32.02 ? 13   TYR A CG  1 
ATOM   74   C CD1 . TYR A 1 14  ? 14.486 -5.367  3.287   1.00 31.08 ? 13   TYR A CD1 1 
ATOM   75   C CD2 . TYR A 1 14  ? 13.325 -6.516  5.040   1.00 32.76 ? 13   TYR A CD2 1 
ATOM   76   C CE1 . TYR A 1 14  ? 14.565 -6.540  2.570   1.00 32.09 ? 13   TYR A CE1 1 
ATOM   77   C CE2 . TYR A 1 14  ? 13.403 -7.694  4.332   1.00 31.26 ? 13   TYR A CE2 1 
ATOM   78   C CZ  . TYR A 1 14  ? 14.020 -7.700  3.095   1.00 34.59 ? 13   TYR A CZ  1 
ATOM   79   O OH  . TYR A 1 14  ? 14.050 -8.860  2.359   1.00 40.47 ? 13   TYR A OH  1 
ATOM   80   N N   . TRP A 1 15  ? 11.409 -3.398  3.123   1.00 26.11 ? 14   TRP A N   1 
ATOM   81   C CA  . TRP A 1 15  ? 10.130 -3.880  2.608   1.00 26.30 ? 14   TRP A CA  1 
ATOM   82   C C   . TRP A 1 15  ? 10.158 -5.210  1.838   1.00 30.26 ? 14   TRP A C   1 
ATOM   83   O O   . TRP A 1 15  ? 9.149  -5.648  1.293   1.00 31.32 ? 14   TRP A O   1 
ATOM   84   C CB  . TRP A 1 15  ? 9.505  -2.792  1.757   1.00 24.36 ? 14   TRP A CB  1 
ATOM   85   C CG  . TRP A 1 15  ? 9.130  -1.605  2.552   1.00 23.18 ? 14   TRP A CG  1 
ATOM   86   C CD1 . TRP A 1 15  ? 9.976  -0.753  3.210   1.00 22.80 ? 14   TRP A CD1 1 
ATOM   87   C CD2 . TRP A 1 15  ? 7.802  -1.167  2.872   1.00 25.78 ? 14   TRP A CD2 1 
ATOM   88   N NE1 . TRP A 1 15  ? 9.261  0.191   3.907   1.00 24.85 ? 14   TRP A NE1 1 
ATOM   89   C CE2 . TRP A 1 15  ? 7.924  -0.042  3.717   1.00 25.47 ? 14   TRP A CE2 1 
ATOM   90   C CE3 . TRP A 1 15  ? 6.523  -1.634  2.536   1.00 27.97 ? 14   TRP A CE3 1 
ATOM   91   C CZ2 . TRP A 1 15  ? 6.812  0.635   4.230   1.00 25.20 ? 14   TRP A CZ2 1 
ATOM   92   C CZ3 . TRP A 1 15  ? 5.416  -0.965  3.062   1.00 31.59 ? 14   TRP A CZ3 1 
ATOM   93   C CH2 . TRP A 1 15  ? 5.570  0.155   3.896   1.00 30.27 ? 14   TRP A CH2 1 
ATOM   94   N N   . GLY A 1 16  ? 11.299 -5.886  1.853   1.00 34.21 ? 15   GLY A N   1 
ATOM   95   C CA  . GLY A 1 16  ? 11.417 -7.154  1.151   1.00 37.07 ? 15   GLY A CA  1 
ATOM   96   C C   . GLY A 1 16  ? 11.116 -7.118  -0.346  1.00 39.99 ? 15   GLY A C   1 
ATOM   97   O O   . GLY A 1 16  ? 11.719 -6.361  -1.108  1.00 40.25 ? 15   GLY A O   1 
ATOM   98   N N   . ASP A 1 17  ? 10.201 -7.976  -0.776  1.00 41.89 ? 16   ASP A N   1 
ATOM   99   C CA  . ASP A 1 17  ? 10.034 -8.253  -2.195  1.00 43.77 ? 16   ASP A CA  1 
ATOM   100  C C   . ASP A 1 17  ? 8.956  -7.403  -2.879  1.00 43.51 ? 16   ASP A C   1 
ATOM   101  O O   . ASP A 1 17  ? 7.983  -7.948  -3.403  1.00 45.10 ? 16   ASP A O   1 
ATOM   102  C CB  . ASP A 1 17  ? 9.727  -9.743  -2.387  1.00 46.97 ? 16   ASP A CB  1 
ATOM   103  C CG  . ASP A 1 17  ? 9.866  -10.188 -3.829  1.00 49.85 ? 16   ASP A CG  1 
ATOM   104  O OD1 . ASP A 1 17  ? 10.977 -10.615 -4.216  1.00 52.11 ? 16   ASP A OD1 1 
ATOM   105  O OD2 . ASP A 1 17  ? 8.861  -10.117 -4.565  1.00 49.39 ? 16   ASP A OD2 1 
ATOM   106  N N   . ILE A 1 18  ? 9.079  -6.079  -2.831  1.00 41.99 ? 17   ILE A N   1 
ATOM   107  C CA  . ILE A 1 18  ? 8.108  -5.228  -3.516  1.00 41.86 ? 17   ILE A CA  1 
ATOM   108  C C   . ILE A 1 18  ? 8.654  -4.644  -4.797  1.00 41.20 ? 17   ILE A C   1 
ATOM   109  O O   . ILE A 1 18  ? 9.847  -4.733  -5.059  1.00 43.38 ? 17   ILE A O   1 
ATOM   110  C CB  . ILE A 1 18  ? 7.581  -4.061  -2.628  1.00 42.10 ? 17   ILE A CB  1 
ATOM   111  C CG1 . ILE A 1 18  ? 8.706  -3.123  -2.207  1.00 39.43 ? 17   ILE A CG1 1 
ATOM   112  C CG2 . ILE A 1 18  ? 6.849  -4.611  -1.422  1.00 47.66 ? 17   ILE A CG2 1 
ATOM   113  C CD1 . ILE A 1 18  ? 8.158  -1.779  -1.743  1.00 32.62 ? 17   ILE A CD1 1 
ATOM   114  N N   . SER A 1 19  ? 7.782  -4.056  -5.607  1.00 39.14 ? 18   SER A N   1 
ATOM   115  C CA  . SER A 1 19  ? 8.179  -3.650  -6.955  1.00 39.29 ? 18   SER A CA  1 
ATOM   116  C C   . SER A 1 19  ? 8.656  -2.210  -7.027  1.00 36.73 ? 18   SER A C   1 
ATOM   117  O O   . SER A 1 19  ? 8.335  -1.395  -6.167  1.00 37.02 ? 18   SER A O   1 
ATOM   118  C CB  . SER A 1 19  ? 7.024  -3.852  -7.939  1.00 37.91 ? 18   SER A CB  1 
ATOM   119  O OG  . SER A 1 19  ? 5.991  -2.916  -7.704  1.00 36.33 ? 18   SER A OG  1 
ATOM   120  N N   . ARG A 1 20  ? 9.420  -1.911  -8.068  1.00 32.02 ? 19   ARG A N   1 
ATOM   121  C CA  . ARG A 1 20  ? 9.837  -0.558  -8.370  1.00 28.49 ? 19   ARG A CA  1 
ATOM   122  C C   . ARG A 1 20  ? 8.652  0.392   -8.351  1.00 29.13 ? 19   ARG A C   1 
ATOM   123  O O   . ARG A 1 20  ? 8.738  1.516   -7.864  1.00 31.27 ? 19   ARG A O   1 
ATOM   124  C CB  . ARG A 1 20  ? 10.485 -0.533  -9.745  1.00 28.59 ? 19   ARG A CB  1 
ATOM   125  C CG  . ARG A 1 20  ? 11.846 0.115   -9.815  1.00 30.04 ? 19   ARG A CG  1 
ATOM   126  C CD  . ARG A 1 20  ? 12.135 0.564   -11.241 1.00 30.96 ? 19   ARG A CD  1 
ATOM   127  N NE  . ARG A 1 20  ? 13.563 0.623   -11.548 1.00 32.66 ? 19   ARG A NE  1 
ATOM   128  C CZ  . ARG A 1 20  ? 14.362 -0.437  -11.591 1.00 33.37 ? 19   ARG A CZ  1 
ATOM   129  N NH1 . ARG A 1 20  ? 15.610 -0.308  -12.042 1.00 30.68 ? 19   ARG A NH1 1 
ATOM   130  N NH2 . ARG A 1 20  ? 13.937 -1.608  -11.107 1.00 33.49 ? 19   ARG A NH2 1 
ATOM   131  N N   . GLU A 1 21  ? 7.528  -0.077  -8.863  1.00 30.38 ? 20   GLU A N   1 
ATOM   132  C CA  . GLU A 1 21  ? 6.323  0.748   -8.964  1.00 33.35 ? 20   GLU A CA  1 
ATOM   133  C C   . GLU A 1 21  ? 5.701  1.039   -7.587  1.00 34.44 ? 20   GLU A C   1 
ATOM   134  O O   . GLU A 1 21  ? 5.417  2.207   -7.259  1.00 35.82 ? 20   GLU A O   1 
ATOM   135  C CB  . GLU A 1 21  ? 5.287  0.054   -9.861  1.00 33.06 ? 20   GLU A CB  1 
ATOM   136  C CG  . GLU A 1 21  ? 4.191  0.968   -10.335 1.00 34.92 ? 20   GLU A CG  1 
ATOM   137  C CD  . GLU A 1 21  ? 3.060  0.235   -11.027 1.00 35.18 ? 20   GLU A CD  1 
ATOM   138  O OE1 . GLU A 1 21  ? 2.817  -0.947  -10.711 1.00 36.11 ? 20   GLU A OE1 1 
ATOM   139  O OE2 . GLU A 1 21  ? 2.392  0.863   -11.869 1.00 33.94 ? 20   GLU A OE2 1 
ATOM   140  N N   . GLU A 1 22  ? 5.583  0.004   -6.753  1.00 33.90 ? 21   GLU A N   1 
ATOM   141  C CA  . GLU A 1 22  ? 5.151  0.201   -5.367  1.00 34.04 ? 21   GLU A CA  1 
ATOM   142  C C   . GLU A 1 22  ? 6.056  1.202   -4.615  1.00 32.67 ? 21   GLU A C   1 
ATOM   143  O O   . GLU A 1 22  ? 5.567  2.157   -4.018  1.00 33.29 ? 21   GLU A O   1 
ATOM   144  C CB  . GLU A 1 22  ? 5.128  -1.133  -4.623  1.00 36.64 ? 21   GLU A CB  1 
ATOM   145  C CG  . GLU A 1 22  ? 4.101  -2.145  -5.119  1.00 40.57 ? 21   GLU A CG  1 
ATOM   146  C CD  . GLU A 1 22  ? 4.238  -3.508  -4.440  1.00 39.79 ? 21   GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 22  ? 3.867  -3.607  -3.259  1.00 40.83 ? 21   GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 22  ? 4.769  -4.448  -5.067  1.00 38.38 ? 21   GLU A OE2 1 
ATOM   149  N N   . VAL A 1 23  ? 7.373  1.034   -4.713  1.00 31.05 ? 22   VAL A N   1 
ATOM   150  C CA  . VAL A 1 23  ? 8.294  1.971   -4.099  1.00 28.23 ? 22   VAL A CA  1 
ATOM   151  C C   . VAL A 1 23  ? 8.070  3.396   -4.570  1.00 28.94 ? 22   VAL A C   1 
ATOM   152  O O   . VAL A 1 23  ? 8.114  4.316   -3.764  1.00 31.97 ? 22   VAL A O   1 
ATOM   153  C CB  . VAL A 1 23  ? 9.771  1.608   -4.355  1.00 27.05 ? 22   VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 23  ? 10.674 2.670   -3.757  1.00 29.45 ? 22   VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 23  ? 10.108 0.301   -3.733  1.00 28.74 ? 22   VAL A CG2 1 
ATOM   156  N N   . ASN A 1 24  ? 7.790  3.582   -5.859  1.00 27.63 ? 23   ASN A N   1 
ATOM   157  C CA  . ASN A 1 24  ? 7.536  4.928   -6.409  1.00 27.87 ? 23   ASN A CA  1 
ATOM   158  C C   . ASN A 1 24  ? 6.311  5.612   -5.788  1.00 29.26 ? 23   ASN A C   1 
ATOM   159  O O   . ASN A 1 24  ? 6.316  6.825   -5.538  1.00 28.26 ? 23   ASN A O   1 
ATOM   160  C CB  . ASN A 1 24  ? 7.359  4.884   -7.934  1.00 28.87 ? 23   ASN A CB  1 
ATOM   161  C CG  . ASN A 1 24  ? 8.658  4.602   -8.676  1.00 30.74 ? 23   ASN A CG  1 
ATOM   162  O OD1 . ASN A 1 24  ? 9.761  4.705   -8.126  1.00 29.98 ? 23   ASN A OD1 1 
ATOM   163  N ND2 . ASN A 1 24  ? 8.531  4.215   -9.922  1.00 31.44 ? 23   ASN A ND2 1 
ATOM   164  N N   . GLU A 1 25  ? 5.288  4.819   -5.489  1.00 31.40 ? 24   GLU A N   1 
ATOM   165  C CA  . GLU A 1 25  ? 4.110  5.312   -4.785  1.00 33.09 ? 24   GLU A CA  1 
ATOM   166  C C   . GLU A 1 25  ? 4.444  5.821   -3.396  1.00 32.00 ? 24   GLU A C   1 
ATOM   167  O O   . GLU A 1 25  ? 3.888  6.806   -2.935  1.00 35.80 ? 24   GLU A O   1 
ATOM   168  C CB  . GLU A 1 25  ? 3.080  4.202   -4.654  1.00 39.27 ? 24   GLU A CB  1 
ATOM   169  C CG  . GLU A 1 25  ? 2.186  4.068   -5.859  1.00 46.96 ? 24   GLU A CG  1 
ATOM   170  C CD  . GLU A 1 25  ? 1.422  5.341   -6.172  1.00 50.14 ? 24   GLU A CD  1 
ATOM   171  O OE1 . GLU A 1 25  ? 0.933  6.014   -5.233  1.00 52.93 ? 24   GLU A OE1 1 
ATOM   172  O OE2 . GLU A 1 25  ? 1.300  5.648   -7.370  1.00 48.77 ? 24   GLU A OE2 1 
ATOM   173  N N   . LYS A 1 26  ? 5.254  5.058   -2.678  1.00 32.85 ? 25   LYS A N   1 
ATOM   174  C CA  . LYS A 1 26  ? 5.667  5.433   -1.330  1.00 30.94 ? 25   LYS A CA  1 
ATOM   175  C C   . LYS A 1 26  ? 6.566  6.665   -1.315  1.00 28.62 ? 25   LYS A C   1 
ATOM   176  O O   . LYS A 1 26  ? 6.436  7.515   -0.444  1.00 29.13 ? 25   LYS A O   1 
ATOM   177  C CB  . LYS A 1 26  ? 6.394  4.268   -0.650  1.00 32.51 ? 25   LYS A CB  1 
ATOM   178  C CG  . LYS A 1 26  ? 5.497  3.081   -0.364  1.00 33.09 ? 25   LYS A CG  1 
ATOM   179  C CD  . LYS A 1 26  ? 6.285  1.915   0.177   1.00 35.29 ? 25   LYS A CD  1 
ATOM   180  C CE  . LYS A 1 26  ? 5.620  0.608   -0.183  1.00 36.11 ? 25   LYS A CE  1 
ATOM   181  N NZ  . LYS A 1 26  ? 4.252  0.580   0.396   1.00 40.76 ? 25   LYS A NZ  1 
ATOM   182  N N   . LEU A 1 27  ? 7.472  6.759   -2.282  1.00 25.91 ? 26   LEU A N   1 
ATOM   183  C CA  . LEU A 1 27  ? 8.429  7.854   -2.330  1.00 23.76 ? 26   LEU A CA  1 
ATOM   184  C C   . LEU A 1 27  ? 7.892  9.112   -3.017  1.00 25.53 ? 26   LEU A C   1 
ATOM   185  O O   . LEU A 1 27  ? 8.501  10.182  -2.946  1.00 27.25 ? 26   LEU A O   1 
ATOM   186  C CB  . LEU A 1 27  ? 9.722  7.383   -3.012  1.00 23.34 ? 26   LEU A CB  1 
ATOM   187  C CG  . LEU A 1 27  ? 10.669 6.430   -2.234  1.00 24.83 ? 26   LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 27  ? 12.105 6.725   -2.596  1.00 21.35 ? 26   LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 27  ? 10.513 6.600   -0.743  1.00 25.02 ? 26   LEU A CD2 1 
ATOM   190  N N   . ARG A 1 28  ? 6.730  9.004   -3.650  1.00 26.52 ? 27   ARG A N   1 
ATOM   191  C CA  . ARG A 1 28  ? 6.133  10.143  -4.340  1.00 26.35 ? 27   ARG A CA  1 
ATOM   192  C C   . ARG A 1 28  ? 5.896  11.347  -3.444  1.00 24.52 ? 27   ARG A C   1 
ATOM   193  O O   . ARG A 1 28  ? 5.070  11.289  -2.519  1.00 21.73 ? 27   ARG A O   1 
ATOM   194  C CB  . ARG A 1 28  ? 4.800  9.765   -5.006  1.00 30.22 ? 27   ARG A CB  1 
ATOM   195  C CG  . ARG A 1 28  ? 4.217  10.904  -5.833  1.00 35.52 ? 27   ARG A CG  1 
ATOM   196  C CD  . ARG A 1 28  ? 3.112  10.455  -6.763  1.00 39.86 ? 27   ARG A CD  1 
ATOM   197  N NE  . ARG A 1 28  ? 3.507  9.302   -7.553  1.00 46.12 ? 27   ARG A NE  1 
ATOM   198  C CZ  . ARG A 1 28  ? 2.732  8.243   -7.739  1.00 49.88 ? 27   ARG A CZ  1 
ATOM   199  N NH1 . ARG A 1 28  ? 3.185  7.188   -8.405  1.00 50.19 ? 27   ARG A NH1 1 
ATOM   200  N NH2 . ARG A 1 28  ? 1.492  8.253   -7.269  1.00 51.60 ? 27   ARG A NH2 1 
ATOM   201  N N   . ASP A 1 29  ? 6.557  12.453  -3.797  1.00 22.89 ? 28   ASP A N   1 
ATOM   202  C CA  . ASP A 1 29  ? 6.312  13.787  -3.239  1.00 22.64 ? 28   ASP A CA  1 
ATOM   203  C C   . ASP A 1 29  ? 6.984  14.003  -1.889  1.00 23.08 ? 28   ASP A C   1 
ATOM   204  O O   . ASP A 1 29  ? 6.760  15.017  -1.228  1.00 24.17 ? 28   ASP A O   1 
ATOM   205  C CB  . ASP A 1 29  ? 4.805  14.072  -3.111  1.00 24.74 ? 28   ASP A CB  1 
ATOM   206  C CG  . ASP A 1 29  ? 4.129  14.340  -4.444  1.00 23.80 ? 28   ASP A CG  1 
ATOM   207  O OD1 . ASP A 1 29  ? 4.835  14.598  -5.436  1.00 25.39 ? 28   ASP A OD1 1 
ATOM   208  O OD2 . ASP A 1 29  ? 2.882  14.310  -4.475  1.00 24.02 ? 28   ASP A OD2 1 
ATOM   209  N N   . THR A 1 30  ? 7.836  13.059  -1.515  1.00 21.49 ? 29   THR A N   1 
ATOM   210  C CA  . THR A 1 30  ? 8.468  13.069  -0.202  1.00 18.74 ? 29   THR A CA  1 
ATOM   211  C C   . THR A 1 30  ? 9.748  13.882  -0.204  1.00 20.77 ? 29   THR A C   1 
ATOM   212  O O   . THR A 1 30  ? 10.287 14.209  -1.272  1.00 23.33 ? 29   THR A O   1 
ATOM   213  C CB  . THR A 1 30  ? 8.814  11.659  0.256   1.00 12.48 ? 29   THR A CB  1 
ATOM   214  O OG1 . THR A 1 30  ? 9.767  11.091  -0.637  1.00 6.99  ? 29   THR A OG1 1 
ATOM   215  C CG2 . THR A 1 30  ? 7.579  10.808  0.280   1.00 13.28 ? 29   THR A CG2 1 
ATOM   216  N N   . ALA A 1 31  ? 10.197 14.260  0.992   1.00 20.87 ? 30   ALA A N   1 
ATOM   217  C CA  . ALA A 1 31  ? 11.390 15.085  1.160   1.00 19.04 ? 30   ALA A CA  1 
ATOM   218  C C   . ALA A 1 31  ? 12.661 14.341  0.781   1.00 19.25 ? 30   ALA A C   1 
ATOM   219  O O   . ALA A 1 31  ? 12.733 13.115  0.922   1.00 21.83 ? 30   ALA A O   1 
ATOM   220  C CB  . ALA A 1 31  ? 11.483 15.570  2.610   1.00 17.34 ? 30   ALA A CB  1 
ATOM   221  N N   . ASP A 1 32  ? 13.697 15.090  0.418   1.00 18.81 ? 31   ASP A N   1 
ATOM   222  C CA  . ASP A 1 32  ? 14.997 14.478  0.216   1.00 19.15 ? 31   ASP A CA  1 
ATOM   223  C C   . ASP A 1 32  ? 15.442 13.805  1.498   1.00 21.40 ? 31   ASP A C   1 
ATOM   224  O O   . ASP A 1 32  ? 15.358 14.427  2.591   1.00 19.81 ? 31   ASP A O   1 
ATOM   225  C CB  . ASP A 1 32  ? 16.048 15.506  -0.155  1.00 21.10 ? 31   ASP A CB  1 
ATOM   226  C CG  . ASP A 1 32  ? 15.895 16.027  -1.551  1.00 25.68 ? 31   ASP A CG  1 
ATOM   227  O OD1 . ASP A 1 32  ? 14.960 15.610  -2.289  1.00 26.18 ? 31   ASP A OD1 1 
ATOM   228  O OD2 . ASP A 1 32  ? 16.727 16.896  -1.906  1.00 28.47 ? 31   ASP A OD2 1 
ATOM   229  N N   . GLY A 1 33  ? 16.050 12.626  1.340   1.00 19.69 ? 32   GLY A N   1 
ATOM   230  C CA  . GLY A 1 33  ? 16.518 11.883  2.490   1.00 18.98 ? 32   GLY A CA  1 
ATOM   231  C C   . GLY A 1 33  ? 15.616 10.719  2.823   1.00 17.70 ? 32   GLY A C   1 
ATOM   232  O O   . GLY A 1 33  ? 15.985 9.863   3.626   1.00 20.26 ? 32   GLY A O   1 
ATOM   233  N N   . THR A 1 34  ? 14.397 10.736  2.297   1.00 16.71 ? 33   THR A N   1 
ATOM   234  C CA  . THR A 1 34  ? 13.456 9.622   2.453   1.00 17.98 ? 33   THR A CA  1 
ATOM   235  C C   . THR A 1 34  ? 13.939 8.399   1.681   1.00 20.73 ? 33   THR A C   1 
ATOM   236  O O   . THR A 1 34  ? 14.479 8.519   0.591   1.00 23.34 ? 33   THR A O   1 
ATOM   237  C CB  . THR A 1 34  ? 12.062 10.026  1.932   1.00 18.41 ? 33   THR A CB  1 
ATOM   238  O OG1 . THR A 1 34  ? 11.701 11.312  2.462   1.00 15.28 ? 33   THR A OG1 1 
ATOM   239  C CG2 . THR A 1 34  ? 11.012 8.996   2.341   1.00 16.89 ? 33   THR A CG2 1 
ATOM   240  N N   . PHE A 1 35  ? 13.814 7.225   2.281   1.00 22.80 ? 34   PHE A N   1 
ATOM   241  C CA  . PHE A 1 35  ? 14.473 6.030   1.750   1.00 21.47 ? 34   PHE A CA  1 
ATOM   242  C C   . PHE A 1 35  ? 13.812 4.733   2.224   1.00 22.70 ? 34   PHE A C   1 
ATOM   243  O O   . PHE A 1 35  ? 13.117 4.721   3.249   1.00 23.08 ? 34   PHE A O   1 
ATOM   244  C CB  . PHE A 1 35  ? 15.963 6.018   2.128   1.00 16.53 ? 34   PHE A CB  1 
ATOM   245  C CG  . PHE A 1 35  ? 16.228 5.639   3.560   1.00 21.45 ? 34   PHE A CG  1 
ATOM   246  C CD1 . PHE A 1 35  ? 16.477 4.303   3.909   1.00 21.95 ? 34   PHE A CD1 1 
ATOM   247  C CD2 . PHE A 1 35  ? 16.194 6.600   4.569   1.00 18.96 ? 34   PHE A CD2 1 
ATOM   248  C CE1 . PHE A 1 35  ? 16.680 3.936   5.241   1.00 20.24 ? 34   PHE A CE1 1 
ATOM   249  C CE2 . PHE A 1 35  ? 16.390 6.238   5.906   1.00 23.42 ? 34   PHE A CE2 1 
ATOM   250  C CZ  . PHE A 1 35  ? 16.629 4.912   6.245   1.00 21.73 ? 34   PHE A CZ  1 
ATOM   251  N N   . LEU A 1 36  ? 13.906 3.695   1.397   1.00 22.62 ? 35   LEU A N   1 
ATOM   252  C CA  . LEU A 1 36  ? 13.613 2.338   1.845   1.00 23.16 ? 35   LEU A CA  1 
ATOM   253  C C   . LEU A 1 36  ? 14.537 1.357   1.152   1.00 22.57 ? 35   LEU A C   1 
ATOM   254  O O   . LEU A 1 36  ? 15.259 1.714   0.228   1.00 22.67 ? 35   LEU A O   1 
ATOM   255  C CB  . LEU A 1 36  ? 12.149 1.951   1.577   1.00 23.11 ? 35   LEU A CB  1 
ATOM   256  C CG  . LEU A 1 36  ? 11.591 2.018   0.151   1.00 23.94 ? 35   LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 36  ? 11.740 0.680   -0.566  1.00 20.83 ? 35   LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 36  ? 10.129 2.405   0.224   1.00 24.54 ? 35   LEU A CD2 1 
ATOM   259  N N   . VAL A 1 37  ? 14.567 0.133   1.666   1.00 22.68 ? 36   VAL A N   1 
ATOM   260  C CA  . VAL A 1 37  ? 15.333 -0.940  1.047   1.00 18.56 ? 36   VAL A CA  1 
ATOM   261  C C   . VAL A 1 37  ? 14.442 -2.113  0.628   1.00 19.92 ? 36   VAL A C   1 
ATOM   262  O O   . VAL A 1 37  ? 13.544 -2.522  1.353   1.00 19.34 ? 36   VAL A O   1 
ATOM   263  C CB  . VAL A 1 37  ? 16.416 -1.427  1.982   1.00 16.77 ? 36   VAL A CB  1 
ATOM   264  C CG1 . VAL A 1 37  ? 17.225 -2.544  1.317   1.00 12.65 ? 36   VAL A CG1 1 
ATOM   265  C CG2 . VAL A 1 37  ? 17.297 -0.257  2.410   1.00 16.10 ? 36   VAL A CG2 1 
ATOM   266  N N   . ARG A 1 38  ? 14.604 -2.542  -0.614  1.00 21.71 ? 37   ARG A N   1 
ATOM   267  C CA  . ARG A 1 38  ? 13.892 -3.700  -1.122  1.00 22.60 ? 37   ARG A CA  1 
ATOM   268  C C   . ARG A 1 38  ? 14.892 -4.706  -1.651  1.00 26.30 ? 37   ARG A C   1 
ATOM   269  O O   . ARG A 1 38  ? 16.106 -4.459  -1.598  1.00 27.13 ? 37   ARG A O   1 
ATOM   270  C CB  . ARG A 1 38  ? 12.922 -3.295  -2.223  1.00 22.31 ? 37   ARG A CB  1 
ATOM   271  C CG  . ARG A 1 38  ? 13.559 -2.673  -3.465  1.00 19.97 ? 37   ARG A CG  1 
ATOM   272  C CD  . ARG A 1 38  ? 12.534 -2.625  -4.597  1.00 17.77 ? 37   ARG A CD  1 
ATOM   273  N NE  . ARG A 1 38  ? 13.066 -1.993  -5.790  1.00 15.09 ? 37   ARG A NE  1 
ATOM   274  C CZ  . ARG A 1 38  ? 14.078 -2.471  -6.493  1.00 18.34 ? 37   ARG A CZ  1 
ATOM   275  N NH1 . ARG A 1 38  ? 14.607 -1.737  -7.472  1.00 21.07 ? 37   ARG A NH1 1 
ATOM   276  N NH2 . ARG A 1 38  ? 14.557 -3.677  -6.226  1.00 16.79 ? 37   ARG A NH2 1 
ATOM   277  N N   . ASP A 1 39  ? 14.397 -5.885  -2.027  1.00 27.99 ? 38   ASP A N   1 
ATOM   278  C CA  . ASP A 1 39  ? 15.246 -6.924  -2.597  1.00 28.30 ? 38   ASP A CA  1 
ATOM   279  C C   . ASP A 1 39  ? 15.630 -6.526  -4.010  1.00 29.14 ? 38   ASP A C   1 
ATOM   280  O O   . ASP A 1 39  ? 14.875 -5.829  -4.685  1.00 31.86 ? 38   ASP A O   1 
ATOM   281  C CB  . ASP A 1 39  ? 14.491 -8.255  -2.637  1.00 29.97 ? 38   ASP A CB  1 
ATOM   282  C CG  . ASP A 1 39  ? 14.052 -8.723  -1.261  1.00 30.66 ? 38   ASP A CG  1 
ATOM   283  O OD1 . ASP A 1 39  ? 14.778 -8.460  -0.290  1.00 29.88 ? 38   ASP A OD1 1 
ATOM   284  O OD2 . ASP A 1 39  ? 12.980 -9.353  -1.171  1.00 33.91 ? 38   ASP A OD2 1 
ATOM   285  N N   . ALA A 1 40  ? 16.840 -6.885  -4.424  1.00 29.37 ? 39   ALA A N   1 
ATOM   286  C CA  . ALA A 1 40  ? 17.273 -6.570  -5.771  1.00 30.25 ? 39   ALA A CA  1 
ATOM   287  C C   . ALA A 1 40  ? 16.445 -7.372  -6.770  1.00 34.37 ? 39   ALA A C   1 
ATOM   288  O O   . ALA A 1 40  ? 15.972 -8.460  -6.460  1.00 36.68 ? 39   ALA A O   1 
ATOM   289  C CB  . ALA A 1 40  ? 18.719 -6.874  -5.924  1.00 28.06 ? 39   ALA A CB  1 
ATOM   290  N N   . SER A 1 41  ? 16.238 -6.822  -7.959  1.00 38.53 ? 40   SER A N   1 
ATOM   291  C CA  . SER A 1 41  ? 15.465 -7.523  -8.986  1.00 43.23 ? 40   SER A CA  1 
ATOM   292  C C   . SER A 1 41  ? 16.186 -8.797  -9.445  1.00 46.66 ? 40   SER A C   1 
ATOM   293  O O   . SER A 1 41  ? 15.565 -9.700  -10.005 1.00 47.05 ? 40   SER A O   1 
ATOM   294  C CB  . SER A 1 41  ? 15.184 -6.603  -10.183 1.00 39.71 ? 40   SER A CB  1 
ATOM   295  O OG  . SER A 1 41  ? 16.380 -6.225  -10.834 1.00 38.38 ? 40   SER A OG  1 
ATOM   296  N N   . THR A 1 42  ? 17.461 -8.912  -9.070  1.00 49.84 ? 41   THR A N   1 
ATOM   297  C CA  . THR A 1 42  ? 18.259 -10.111 -9.336  1.00 54.44 ? 41   THR A CA  1 
ATOM   298  C C   . THR A 1 42  ? 17.700 -11.335 -8.602  1.00 58.27 ? 41   THR A C   1 
ATOM   299  O O   . THR A 1 42  ? 16.861 -11.207 -7.709  1.00 58.48 ? 41   THR A O   1 
ATOM   300  C CB  . THR A 1 42  ? 19.745 -9.931  -8.900  1.00 54.32 ? 41   THR A CB  1 
ATOM   301  O OG1 . THR A 1 42  ? 19.896 -10.309 -7.525  1.00 57.71 ? 41   THR A OG1 1 
ATOM   302  C CG2 . THR A 1 42  ? 20.196 -8.490  -9.058  1.00 53.77 ? 41   THR A CG2 1 
ATOM   303  N N   . LYS A 1 43  ? 18.183 -12.518 -8.975  1.00 62.51 ? 42   LYS A N   1 
ATOM   304  C CA  . LYS A 1 43  ? 17.837 -13.753 -8.275  1.00 64.62 ? 42   LYS A CA  1 
ATOM   305  C C   . LYS A 1 43  ? 18.783 -13.970 -7.111  1.00 65.04 ? 42   LYS A C   1 
ATOM   306  O O   . LYS A 1 43  ? 19.983 -14.160 -7.318  1.00 63.11 ? 42   LYS A O   1 
ATOM   307  C CB  . LYS A 1 43  ? 17.913 -14.962 -9.216  1.00 66.85 ? 42   LYS A CB  1 
ATOM   308  C CG  . LYS A 1 43  ? 16.601 -15.322 -9.902  1.00 70.79 ? 42   LYS A CG  1 
ATOM   309  C CD  . LYS A 1 43  ? 15.401 -15.211 -8.956  1.00 73.87 ? 42   LYS A CD  1 
ATOM   310  C CE  . LYS A 1 43  ? 15.468 -16.203 -7.794  1.00 73.51 ? 42   LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 43  ? 14.292 -16.053 -6.885  1.00 74.45 ? 42   LYS A NZ  1 
ATOM   312  N N   . MET A 1 44  ? 18.272 -13.676 -5.918  1.00 67.23 ? 43   MET A N   1 
ATOM   313  C CA  . MET A 1 44  ? 18.918 -13.984 -4.632  1.00 70.16 ? 43   MET A CA  1 
ATOM   314  C C   . MET A 1 44  ? 20.442 -14.212 -4.619  1.00 71.35 ? 43   MET A C   1 
ATOM   315  O O   . MET A 1 44  ? 20.940 -15.226 -4.108  1.00 69.63 ? 43   MET A O   1 
ATOM   316  C CB  . MET A 1 44  ? 18.196 -15.161 -3.952  1.00 71.19 ? 43   MET A CB  1 
ATOM   317  C CG  . MET A 1 44  ? 18.609 -15.407 -2.504  1.00 71.88 ? 43   MET A CG  1 
ATOM   318  S SD  . MET A 1 44  ? 19.326 -13.933 -1.724  1.00 74.43 ? 43   MET A SD  1 
ATOM   319  C CE  . MET A 1 44  ? 18.940 -14.224 0.016   1.00 70.81 ? 43   MET A CE  1 
ATOM   320  N N   . HIS A 1 45  ? 21.176 -13.184 -5.046  1.00 72.40 ? 44   HIS A N   1 
ATOM   321  C CA  . HIS A 1 45  ? 22.599 -13.054 -4.722  1.00 70.18 ? 44   HIS A CA  1 
ATOM   322  C C   . HIS A 1 45  ? 22.739 -12.473 -3.307  1.00 67.29 ? 44   HIS A C   1 
ATOM   323  O O   . HIS A 1 45  ? 23.825 -12.029 -2.915  1.00 67.45 ? 44   HIS A O   1 
ATOM   324  C CB  . HIS A 1 45  ? 23.285 -12.128 -5.732  1.00 72.34 ? 44   HIS A CB  1 
ATOM   325  C CG  . HIS A 1 45  ? 24.770 -12.318 -5.824  1.00 75.35 ? 44   HIS A CG  1 
ATOM   326  N ND1 . HIS A 1 45  ? 25.545 -12.698 -4.748  1.00 77.75 ? 44   HIS A ND1 1 
ATOM   327  C CD2 . HIS A 1 45  ? 25.624 -12.177 -6.867  1.00 77.06 ? 44   HIS A CD2 1 
ATOM   328  C CE1 . HIS A 1 45  ? 26.810 -12.785 -5.122  1.00 79.14 ? 44   HIS A CE1 1 
ATOM   329  N NE2 . HIS A 1 45  ? 26.885 -12.473 -6.405  1.00 77.56 ? 44   HIS A NE2 1 
ATOM   330  N N   . GLY A 1 46  ? 21.656 -12.567 -2.528  1.00 63.38 ? 45   GLY A N   1 
ATOM   331  C CA  . GLY A 1 46  ? 21.518 -11.817 -1.285  1.00 57.70 ? 45   GLY A CA  1 
ATOM   332  C C   . GLY A 1 46  ? 21.642 -10.323 -1.495  1.00 53.06 ? 45   GLY A C   1 
ATOM   333  O O   . GLY A 1 46  ? 22.344 -9.634  -0.749  1.00 51.02 ? 45   GLY A O   1 
ATOM   334  N N   . ASP A 1 47  ? 21.086 -9.862  -2.613  1.00 50.77 ? 46   ASP A N   1 
ATOM   335  C CA  . ASP A 1 47  ? 21.304 -8.500  -3.090  1.00 45.93 ? 46   ASP A CA  1 
ATOM   336  C C   . ASP A 1 47  ? 20.073 -7.635  -2.856  1.00 41.02 ? 46   ASP A C   1 
ATOM   337  O O   . ASP A 1 47  ? 18.933 -8.109  -2.983  1.00 37.31 ? 46   ASP A O   1 
ATOM   338  C CB  . ASP A 1 47  ? 21.666 -8.513  -4.574  1.00 46.52 ? 46   ASP A CB  1 
ATOM   339  C CG  . ASP A 1 47  ? 23.069 -7.998  -4.829  1.00 49.91 ? 46   ASP A CG  1 
ATOM   340  O OD1 . ASP A 1 47  ? 23.215 -6.761  -4.988  1.00 53.33 ? 46   ASP A OD1 1 
ATOM   341  O OD2 . ASP A 1 47  ? 24.025 -8.817  -4.845  1.00 46.19 ? 46   ASP A OD2 1 
ATOM   342  N N   . TYR A 1 48  ? 20.304 -6.415  -2.382  1.00 33.46 ? 47   TYR A N   1 
ATOM   343  C CA  . TYR A 1 48  ? 19.210 -5.527  -2.026  1.00 28.84 ? 47   TYR A CA  1 
ATOM   344  C C   . TYR A 1 48  ? 19.390 -4.205  -2.750  1.00 26.68 ? 47   TYR A C   1 
ATOM   345  O O   . TYR A 1 48  ? 20.510 -3.862  -3.144  1.00 28.04 ? 47   TYR A O   1 
ATOM   346  C CB  . TYR A 1 48  ? 19.197 -5.288  -0.514  1.00 30.01 ? 47   TYR A CB  1 
ATOM   347  C CG  . TYR A 1 48  ? 19.089 -6.547  0.320   1.00 29.31 ? 47   TYR A CG  1 
ATOM   348  C CD1 . TYR A 1 48  ? 20.224 -7.135  0.884   1.00 28.05 ? 47   TYR A CD1 1 
ATOM   349  C CD2 . TYR A 1 48  ? 17.852 -7.152  0.541   1.00 27.21 ? 47   TYR A CD2 1 
ATOM   350  C CE1 . TYR A 1 48  ? 20.132 -8.298  1.639   1.00 29.88 ? 47   TYR A CE1 1 
ATOM   351  C CE2 . TYR A 1 48  ? 17.745 -8.321  1.297   1.00 29.82 ? 47   TYR A CE2 1 
ATOM   352  C CZ  . TYR A 1 48  ? 18.898 -8.895  1.834   1.00 29.83 ? 47   TYR A CZ  1 
ATOM   353  O OH  . TYR A 1 48  ? 18.820 -10.116 2.468   1.00 29.63 ? 47   TYR A OH  1 
ATOM   354  N N   . THR A 1 49  ? 18.306 -3.444  -2.873  1.00 22.58 ? 48   THR A N   1 
ATOM   355  C CA  . THR A 1 49  ? 18.356 -2.138  -3.524  1.00 22.28 ? 48   THR A CA  1 
ATOM   356  C C   . THR A 1 49  ? 17.856 -1.029  -2.626  1.00 23.74 ? 48   THR A C   1 
ATOM   357  O O   . THR A 1 49  ? 16.701 -1.046  -2.209  1.00 24.21 ? 48   THR A O   1 
ATOM   358  C CB  . THR A 1 49  ? 17.534 -2.120  -4.799  1.00 20.30 ? 48   THR A CB  1 
ATOM   359  O OG1 . THR A 1 49  ? 18.037 -3.107  -5.699  1.00 24.56 ? 48   THR A OG1 1 
ATOM   360  C CG2 . THR A 1 49  ? 17.617 -0.756  -5.474  1.00 20.05 ? 48   THR A CG2 1 
ATOM   361  N N   . LEU A 1 50  ? 18.744 -0.081  -2.320  1.00 23.28 ? 49   LEU A N   1 
ATOM   362  C CA  . LEU A 1 50  ? 18.366 1.116   -1.593  1.00 21.40 ? 49   LEU A CA  1 
ATOM   363  C C   . LEU A 1 50  ? 17.773 2.160   -2.562  1.00 22.77 ? 49   LEU A C   1 
ATOM   364  O O   . LEU A 1 50  ? 18.292 2.370   -3.662  1.00 22.07 ? 49   LEU A O   1 
ATOM   365  C CB  . LEU A 1 50  ? 19.576 1.683   -0.846  1.00 18.53 ? 49   LEU A CB  1 
ATOM   366  C CG  . LEU A 1 50  ? 19.491 3.111   -0.267  1.00 21.16 ? 49   LEU A CG  1 
ATOM   367  C CD1 . LEU A 1 50  ? 18.444 3.171   0.836   1.00 18.02 ? 49   LEU A CD1 1 
ATOM   368  C CD2 . LEU A 1 50  ? 20.845 3.559   0.258   1.00 16.18 ? 49   LEU A CD2 1 
ATOM   369  N N   . THR A 1 51  ? 16.581 2.657   -2.244  1.00 22.01 ? 50   THR A N   1 
ATOM   370  C CA  . THR A 1 51  ? 15.950 3.692   -3.055  1.00 20.39 ? 50   THR A CA  1 
ATOM   371  C C   . THR A 1 51  ? 15.878 4.930   -2.203  1.00 21.37 ? 50   THR A C   1 
ATOM   372  O O   . THR A 1 51  ? 15.346 4.891   -1.108  1.00 23.26 ? 50   THR A O   1 
ATOM   373  C CB  . THR A 1 51  ? 14.526 3.305   -3.463  1.00 19.27 ? 50   THR A CB  1 
ATOM   374  O OG1 . THR A 1 51  ? 14.536 2.008   -4.064  1.00 23.86 ? 50   THR A OG1 1 
ATOM   375  C CG2 . THR A 1 51  ? 13.945 4.317   -4.449  1.00 18.03 ? 50   THR A CG2 1 
ATOM   376  N N   . LEU A 1 52  ? 16.365 6.036   -2.752  1.00 22.33 ? 51   LEU A N   1 
ATOM   377  C CA  . LEU A 1 52  ? 16.543 7.278   -2.012  1.00 23.95 ? 51   LEU A CA  1 
ATOM   378  C C   . LEU A 1 52  ? 15.943 8.467   -2.759  1.00 24.79 ? 51   LEU A C   1 
ATOM   379  O O   . LEU A 1 52  ? 16.205 8.667   -3.940  1.00 25.08 ? 51   LEU A O   1 
ATOM   380  C CB  . LEU A 1 52  ? 18.025 7.516   -1.790  1.00 24.07 ? 51   LEU A CB  1 
ATOM   381  C CG  . LEU A 1 52  ? 18.473 8.853   -1.242  1.00 23.22 ? 51   LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 52  ? 18.081 8.970   0.225   1.00 25.28 ? 51   LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 52  ? 19.984 8.948   -1.425  1.00 25.00 ? 51   LEU A CD2 1 
ATOM   384  N N   . ARG A 1 53  ? 15.176 9.276   -2.042  1.00 24.64 ? 52   ARG A N   1 
ATOM   385  C CA  . ARG A 1 53  ? 14.626 10.506  -2.583  1.00 21.78 ? 52   ARG A CA  1 
ATOM   386  C C   . ARG A 1 53  ? 15.674 11.621  -2.551  1.00 20.89 ? 52   ARG A C   1 
ATOM   387  O O   . ARG A 1 53  ? 16.264 11.908  -1.508  1.00 23.49 ? 52   ARG A O   1 
ATOM   388  C CB  . ARG A 1 53  ? 13.411 10.930  -1.774  1.00 21.86 ? 52   ARG A CB  1 
ATOM   389  C CG  . ARG A 1 53  ? 12.644 12.035  -2.402  1.00 21.43 ? 52   ARG A CG  1 
ATOM   390  C CD  . ARG A 1 53  ? 11.804 11.507  -3.514  1.00 24.35 ? 52   ARG A CD  1 
ATOM   391  N NE  . ARG A 1 53  ? 10.768 12.465  -3.869  1.00 30.60 ? 52   ARG A NE  1 
ATOM   392  C CZ  . ARG A 1 53  ? 10.149 12.513  -5.038  1.00 28.32 ? 52   ARG A CZ  1 
ATOM   393  N NH1 . ARG A 1 53  ? 9.262  13.464  -5.256  1.00 31.84 ? 52   ARG A NH1 1 
ATOM   394  N NH2 . ARG A 1 53  ? 10.342 11.570  -5.938  1.00 28.39 ? 52   ARG A NH2 1 
ATOM   395  N N   . LYS A 1 54  ? 15.945 12.195  -3.714  1.00 18.45 ? 53   LYS A N   1 
ATOM   396  C CA  . LYS A 1 54  ? 16.960 13.230  -3.846  1.00 20.29 ? 53   LYS A CA  1 
ATOM   397  C C   . LYS A 1 54  ? 16.692 14.087  -5.079  1.00 22.88 ? 53   LYS A C   1 
ATOM   398  O O   . LYS A 1 54  ? 16.724 13.612  -6.206  1.00 25.79 ? 53   LYS A O   1 
ATOM   399  C CB  . LYS A 1 54  ? 18.339 12.583  -3.956  1.00 17.06 ? 53   LYS A CB  1 
ATOM   400  C CG  . LYS A 1 54  ? 19.495 13.559  -4.116  1.00 14.74 ? 53   LYS A CG  1 
ATOM   401  C CD  . LYS A 1 54  ? 19.484 14.666  -3.086  1.00 13.10 ? 53   LYS A CD  1 
ATOM   402  C CE  . LYS A 1 54  ? 20.815 15.381  -3.087  1.00 16.81 ? 53   LYS A CE  1 
ATOM   403  N NZ  . LYS A 1 54  ? 20.623 16.845  -3.067  1.00 23.05 ? 53   LYS A NZ  1 
ATOM   404  N N   . GLY A 1 55  ? 16.433 15.364  -4.856  1.00 23.81 ? 54   GLY A N   1 
ATOM   405  C CA  . GLY A 1 55  ? 16.247 16.260  -5.975  1.00 23.99 ? 54   GLY A CA  1 
ATOM   406  C C   . GLY A 1 55  ? 14.976 15.986  -6.754  1.00 24.87 ? 54   GLY A C   1 
ATOM   407  O O   . GLY A 1 55  ? 14.905 16.234  -7.953  1.00 27.01 ? 54   GLY A O   1 
ATOM   408  N N   . GLY A 1 56  ? 13.943 15.505  -6.080  1.00 24.20 ? 55   GLY A N   1 
ATOM   409  C CA  . GLY A 1 56  ? 12.691 15.306  -6.784  1.00 23.33 ? 55   GLY A CA  1 
ATOM   410  C C   . GLY A 1 56  ? 12.562 14.002  -7.555  1.00 22.99 ? 55   GLY A C   1 
ATOM   411  O O   . GLY A 1 56  ? 11.504 13.731  -8.129  1.00 21.17 ? 55   GLY A O   1 
ATOM   412  N N   . ASN A 1 57  ? 13.594 13.156  -7.514  1.00 24.23 ? 56   ASN A N   1 
ATOM   413  C CA  . ASN A 1 57  ? 13.489 11.822  -8.104  1.00 26.14 ? 56   ASN A CA  1 
ATOM   414  C C   . ASN A 1 57  ? 14.086 10.710  -7.250  1.00 25.32 ? 56   ASN A C   1 
ATOM   415  O O   . ASN A 1 57  ? 14.709 10.984  -6.229  1.00 29.14 ? 56   ASN A O   1 
ATOM   416  C CB  . ASN A 1 57  ? 14.098 11.797  -9.515  1.00 32.72 ? 56   ASN A CB  1 
ATOM   417  C CG  . ASN A 1 57  ? 15.484 12.402  -9.576  1.00 40.43 ? 56   ASN A CG  1 
ATOM   418  O OD1 . ASN A 1 57  ? 16.448 11.729  -9.937  1.00 43.87 ? 56   ASN A OD1 1 
ATOM   419  N ND2 . ASN A 1 57  ? 15.574 13.697  -9.348  1.00 46.28 ? 56   ASN A ND2 1 
ATOM   420  N N   . ASN A 1 58  ? 13.795 9.461   -7.617  1.00 22.68 ? 57   ASN A N   1 
ATOM   421  C CA  . ASN A 1 58  ? 14.227 8.304   -6.837  1.00 22.02 ? 57   ASN A CA  1 
ATOM   422  C C   . ASN A 1 58  ? 15.531 7.682   -7.345  1.00 22.45 ? 57   ASN A C   1 
ATOM   423  O O   . ASN A 1 58  ? 15.549 6.977   -8.360  1.00 26.58 ? 57   ASN A O   1 
ATOM   424  C CB  . ASN A 1 58  ? 13.146 7.225   -6.824  1.00 22.14 ? 57   ASN A CB  1 
ATOM   425  C CG  . ASN A 1 58  ? 11.786 7.771   -6.523  1.00 21.24 ? 57   ASN A CG  1 
ATOM   426  O OD1 . ASN A 1 58  ? 11.651 8.771   -5.832  1.00 22.90 ? 57   ASN A OD1 1 
ATOM   427  N ND2 . ASN A 1 58  ? 10.760 7.095   -7.002  1.00 24.22 ? 57   ASN A ND2 1 
ATOM   428  N N   . LYS A 1 59  ? 16.579 7.840   -6.551  1.00 21.39 ? 58   LYS A N   1 
ATOM   429  C CA  . LYS A 1 59  ? 17.860 7.231   -6.826  1.00 18.04 ? 58   LYS A CA  1 
ATOM   430  C C   . LYS A 1 59  ? 17.886 5.739   -6.462  1.00 19.26 ? 58   LYS A C   1 
ATOM   431  O O   . LYS A 1 59  ? 17.546 5.341   -5.360  1.00 21.22 ? 58   LYS A O   1 
ATOM   432  C CB  . LYS A 1 59  ? 18.931 7.979   -6.056  1.00 18.37 ? 58   LYS A CB  1 
ATOM   433  C CG  . LYS A 1 59  ? 18.758 9.496   -6.113  1.00 20.09 ? 58   LYS A CG  1 
ATOM   434  C CD  . LYS A 1 59  ? 18.834 9.972   -7.536  1.00 20.73 ? 58   LYS A CD  1 
ATOM   435  C CE  . LYS A 1 59  ? 19.000 11.468  -7.602  1.00 24.61 ? 58   LYS A CE  1 
ATOM   436  N NZ  . LYS A 1 59  ? 19.023 11.911  -9.014  1.00 30.67 ? 58   LYS A NZ  1 
ATOM   437  N N   . LEU A 1 60  ? 18.225 4.912   -7.437  1.00 21.27 ? 59   LEU A N   1 
ATOM   438  C CA  . LEU A 1 60  ? 18.403 3.484   -7.225  1.00 20.67 ? 59   LEU A CA  1 
ATOM   439  C C   . LEU A 1 60  ? 19.860 3.227   -6.907  1.00 21.55 ? 59   LEU A C   1 
ATOM   440  O O   . LEU A 1 60  ? 20.730 3.460   -7.733  1.00 22.08 ? 59   LEU A O   1 
ATOM   441  C CB  . LEU A 1 60  ? 18.000 2.693   -8.470  1.00 23.66 ? 59   LEU A CB  1 
ATOM   442  C CG  . LEU A 1 60  ? 16.521 2.516   -8.805  1.00 26.23 ? 59   LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 60  ? 15.862 1.668   -7.753  1.00 27.42 ? 59   LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 60  ? 15.831 3.864   -8.892  1.00 30.94 ? 59   LEU A CD2 1 
ATOM   445  N N   . ILE A 1 61  ? 20.125 2.815   -5.670  1.00 23.41 ? 60   ILE A N   1 
ATOM   446  C CA  . ILE A 1 61  ? 21.481 2.488   -5.222  1.00 21.60 ? 60   ILE A CA  1 
ATOM   447  C C   . ILE A 1 61  ? 21.607 1.000   -4.878  1.00 21.55 ? 60   ILE A C   1 
ATOM   448  O O   . ILE A 1 61  ? 20.869 0.473   -4.027  1.00 22.78 ? 60   ILE A O   1 
ATOM   449  C CB  . ILE A 1 61  ? 21.871 3.333   -3.990  1.00 20.19 ? 60   ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 61  ? 21.646 4.819   -4.260  1.00 21.27 ? 60   ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 61  ? 23.336 3.145   -3.670  1.00 19.23 ? 60   ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 61  ? 21.525 5.643   -2.993  1.00 18.97 ? 60   ILE A CD1 1 
ATOM   453  N N   . LYS A 1 62  ? 22.535 0.318   -5.538  1.00 19.52 ? 61   LYS A N   1 
ATOM   454  C CA  . LYS A 1 62  ? 22.666 -1.127  -5.359  1.00 22.40 ? 61   LYS A CA  1 
ATOM   455  C C   . LYS A 1 62  ? 23.492 -1.501  -4.115  1.00 22.96 ? 61   LYS A C   1 
ATOM   456  O O   . LYS A 1 62  ? 24.587 -0.976  -3.897  1.00 23.50 ? 61   LYS A O   1 
ATOM   457  C CB  . LYS A 1 62  ? 23.283 -1.752  -6.613  1.00 25.93 ? 61   LYS A CB  1 
ATOM   458  C CG  . LYS A 1 62  ? 23.589 -3.244  -6.495  1.00 30.06 ? 61   LYS A CG  1 
ATOM   459  C CD  . LYS A 1 62  ? 22.676 -4.103  -7.373  1.00 31.11 ? 61   LYS A CD  1 
ATOM   460  C CE  . LYS A 1 62  ? 21.460 -4.615  -6.615  1.00 31.77 ? 61   LYS A CE  1 
ATOM   461  N NZ  . LYS A 1 62  ? 20.345 -3.632  -6.586  1.00 30.33 ? 61   LYS A NZ  1 
ATOM   462  N N   . ILE A 1 63  ? 22.957 -2.394  -3.290  1.00 21.75 ? 62   ILE A N   1 
ATOM   463  C CA  . ILE A 1 63  ? 23.715 -2.897  -2.164  1.00 24.98 ? 62   ILE A CA  1 
ATOM   464  C C   . ILE A 1 63  ? 24.328 -4.258  -2.479  1.00 26.87 ? 62   ILE A C   1 
ATOM   465  O O   . ILE A 1 63  ? 23.627 -5.266  -2.573  1.00 30.01 ? 62   ILE A O   1 
ATOM   466  C CB  . ILE A 1 63  ? 22.864 -2.993  -0.881  1.00 20.02 ? 62   ILE A CB  1 
ATOM   467  C CG1 . ILE A 1 63  ? 22.249 -1.645  -0.554  1.00 18.80 ? 62   ILE A CG1 1 
ATOM   468  C CG2 . ILE A 1 63  ? 23.740 -3.398  0.283   1.00 16.06 ? 62   ILE A CG2 1 
ATOM   469  C CD1 . ILE A 1 63  ? 21.129 -1.749  0.428   1.00 20.35 ? 62   ILE A CD1 1 
ATOM   470  N N   . PHE A 1 64  ? 25.630 -4.256  -2.747  1.00 27.52 ? 63   PHE A N   1 
ATOM   471  C CA  . PHE A 1 64  ? 26.321 -5.469  -3.149  1.00 27.82 ? 63   PHE A CA  1 
ATOM   472  C C   . PHE A 1 64  ? 26.555 -6.370  -1.953  1.00 29.61 ? 63   PHE A C   1 
ATOM   473  O O   . PHE A 1 64  ? 26.695 -5.929  -0.816  1.00 28.29 ? 63   PHE A O   1 
ATOM   474  C CB  . PHE A 1 64  ? 27.652 -5.133  -3.805  1.00 27.82 ? 63   PHE A CB  1 
ATOM   475  C CG  . PHE A 1 64  ? 27.517 -4.294  -5.051  1.00 31.59 ? 63   PHE A CG  1 
ATOM   476  C CD1 . PHE A 1 64  ? 27.636 -2.904  -4.994  1.00 27.16 ? 63   PHE A CD1 1 
ATOM   477  C CD2 . PHE A 1 64  ? 27.317 -4.893  -6.296  1.00 32.59 ? 63   PHE A CD2 1 
ATOM   478  C CE1 . PHE A 1 64  ? 27.565 -2.139  -6.152  1.00 26.04 ? 63   PHE A CE1 1 
ATOM   479  C CE2 . PHE A 1 64  ? 27.241 -4.128  -7.464  1.00 26.61 ? 63   PHE A CE2 1 
ATOM   480  C CZ  . PHE A 1 64  ? 27.365 -2.757  -7.390  1.00 25.90 ? 63   PHE A CZ  1 
ATOM   481  N N   . HIS A 1 65  ? 26.670 -7.651  -2.244  1.00 35.22 ? 64   HIS A N   1 
ATOM   482  C CA  . HIS A 1 65  ? 26.820 -8.683  -1.228  1.00 35.98 ? 64   HIS A CA  1 
ATOM   483  C C   . HIS A 1 65  ? 27.852 -9.699  -1.730  1.00 35.14 ? 64   HIS A C   1 
ATOM   484  O O   . HIS A 1 65  ? 27.596 -10.444 -2.660  1.00 36.32 ? 64   HIS A O   1 
ATOM   485  C CB  . HIS A 1 65  ? 25.466 -9.355  -0.996  1.00 34.82 ? 64   HIS A CB  1 
ATOM   486  C CG  . HIS A 1 65  ? 25.505 -10.475 -0.013  1.00 35.95 ? 64   HIS A CG  1 
ATOM   487  N ND1 . HIS A 1 65  ? 26.406 -10.517 1.031   1.00 35.19 ? 64   HIS A ND1 1 
ATOM   488  C CD2 . HIS A 1 65  ? 24.737 -11.577 0.105   1.00 36.38 ? 64   HIS A CD2 1 
ATOM   489  C CE1 . HIS A 1 65  ? 26.184 -11.598 1.751   1.00 35.75 ? 64   HIS A CE1 1 
ATOM   490  N NE2 . HIS A 1 65  ? 25.172 -12.257 1.217   1.00 37.36 ? 64   HIS A NE2 1 
ATOM   491  N N   . ARG A 1 66  ? 29.074 -9.581  -1.246  1.00 34.69 ? 65   ARG A N   1 
ATOM   492  C CA  . ARG A 1 66  ? 30.137 -10.463 -1.681  1.00 38.93 ? 65   ARG A CA  1 
ATOM   493  C C   . ARG A 1 66  ? 31.021 -10.887 -0.513  1.00 41.46 ? 65   ARG A C   1 
ATOM   494  O O   . ARG A 1 66  ? 31.146 -10.157 0.473   1.00 41.98 ? 65   ARG A O   1 
ATOM   495  C CB  . ARG A 1 66  ? 30.969 -9.795  -2.778  1.00 39.36 ? 65   ARG A CB  1 
ATOM   496  C CG  . ARG A 1 66  ? 30.448 -10.030 -4.183  1.00 41.08 ? 65   ARG A CG  1 
ATOM   497  C CD  . ARG A 1 66  ? 29.754 -8.809  -4.723  1.00 46.48 ? 65   ARG A CD  1 
ATOM   498  N NE  . ARG A 1 66  ? 29.251 -9.007  -6.088  1.00 49.81 ? 65   ARG A NE  1 
ATOM   499  C CZ  . ARG A 1 66  ? 27.977 -9.249  -6.395  1.00 50.81 ? 65   ARG A CZ  1 
ATOM   500  N NH1 . ARG A 1 66  ? 27.609 -9.272  -7.664  1.00 50.01 ? 65   ARG A NH1 1 
ATOM   501  N NH2 . ARG A 1 66  ? 27.066 -9.455  -5.446  1.00 49.39 ? 65   ARG A NH2 1 
ATOM   502  N N   . ASP A 1 67  ? 31.623 -12.073 -0.617  1.00 43.68 ? 66   ASP A N   1 
ATOM   503  C CA  . ASP A 1 67  ? 32.180 -12.762 0.553   1.00 45.25 ? 66   ASP A CA  1 
ATOM   504  C C   . ASP A 1 67  ? 31.066 -12.890 1.598   1.00 43.00 ? 66   ASP A C   1 
ATOM   505  O O   . ASP A 1 67  ? 29.979 -13.387 1.286   1.00 45.24 ? 66   ASP A O   1 
ATOM   506  C CB  . ASP A 1 67  ? 33.374 -11.975 1.123   1.00 52.64 ? 66   ASP A CB  1 
ATOM   507  C CG  . ASP A 1 67  ? 34.630 -12.070 0.247   1.00 59.20 ? 66   ASP A CG  1 
ATOM   508  O OD1 . ASP A 1 67  ? 35.031 -11.038 -0.334  1.00 60.82 ? 66   ASP A OD1 1 
ATOM   509  O OD2 . ASP A 1 67  ? 35.245 -13.160 0.198   1.00 63.14 ? 66   ASP A OD2 1 
ATOM   510  N N   . GLY A 1 68  ? 31.249 -12.281 2.762   1.00 37.71 ? 67   GLY A N   1 
ATOM   511  C CA  . GLY A 1 68  ? 30.133 -12.187 3.687   1.00 34.12 ? 67   GLY A CA  1 
ATOM   512  C C   . GLY A 1 68  ? 29.826 -10.753 4.067   1.00 32.88 ? 67   GLY A C   1 
ATOM   513  O O   . GLY A 1 68  ? 29.269 -10.509 5.139   1.00 34.43 ? 67   GLY A O   1 
ATOM   514  N N   . LYS A 1 69  ? 30.212 -9.813  3.200   1.00 30.63 ? 68   LYS A N   1 
ATOM   515  C CA  . LYS A 1 69  ? 30.127 -8.382  3.487   1.00 29.63 ? 68   LYS A CA  1 
ATOM   516  C C   . LYS A 1 69  ? 29.140 -7.638  2.593   1.00 31.48 ? 68   LYS A C   1 
ATOM   517  O O   . LYS A 1 69  ? 28.607 -8.207  1.620   1.00 35.97 ? 68   LYS A O   1 
ATOM   518  C CB  . LYS A 1 69  ? 31.496 -7.735  3.369   1.00 29.60 ? 68   LYS A CB  1 
ATOM   519  C CG  . LYS A 1 69  ? 32.577 -8.405  4.194   1.00 34.55 ? 68   LYS A CG  1 
ATOM   520  C CD  . LYS A 1 69  ? 32.300 -8.286  5.674   1.00 39.12 ? 68   LYS A CD  1 
ATOM   521  C CE  . LYS A 1 69  ? 33.560 -7.948  6.448   1.00 40.45 ? 68   LYS A CE  1 
ATOM   522  N NZ  . LYS A 1 69  ? 33.221 -7.422  7.801   1.00 42.34 ? 68   LYS A NZ  1 
ATOM   523  N N   . TYR A 1 70  ? 28.803 -6.417  3.012   1.00 28.13 ? 69   TYR A N   1 
ATOM   524  C CA  . TYR A 1 70  ? 27.823 -5.558  2.335   1.00 25.03 ? 69   TYR A CA  1 
ATOM   525  C C   . TYR A 1 70  ? 28.380 -4.156  2.081   1.00 26.70 ? 69   TYR A C   1 
ATOM   526  O O   . TYR A 1 70  ? 29.294 -3.701  2.784   1.00 29.55 ? 69   TYR A O   1 
ATOM   527  C CB  . TYR A 1 70  ? 26.567 -5.429  3.180   1.00 21.26 ? 69   TYR A CB  1 
ATOM   528  C CG  . TYR A 1 70  ? 25.816 -6.716  3.309   1.00 21.72 ? 69   TYR A CG  1 
ATOM   529  C CD1 . TYR A 1 70  ? 26.130 -7.637  4.316   1.00 18.25 ? 69   TYR A CD1 1 
ATOM   530  C CD2 . TYR A 1 70  ? 24.811 -7.039  2.405   1.00 23.36 ? 69   TYR A CD2 1 
ATOM   531  C CE1 . TYR A 1 70  ? 25.475 -8.839  4.412   1.00 18.83 ? 69   TYR A CE1 1 
ATOM   532  C CE2 . TYR A 1 70  ? 24.135 -8.247  2.495   1.00 24.96 ? 69   TYR A CE2 1 
ATOM   533  C CZ  . TYR A 1 70  ? 24.478 -9.146  3.497   1.00 26.66 ? 69   TYR A CZ  1 
ATOM   534  O OH  . TYR A 1 70  ? 23.836 -10.362 3.551   1.00 30.28 ? 69   TYR A OH  1 
ATOM   535  N N   . GLY A 1 71  ? 27.848 -3.485  1.065   1.00 21.76 ? 70   GLY A N   1 
ATOM   536  C CA  . GLY A 1 71  ? 28.354 -2.169  0.717   1.00 21.05 ? 70   GLY A CA  1 
ATOM   537  C C   . GLY A 1 71  ? 27.993 -1.692  -0.682  1.00 21.15 ? 70   GLY A C   1 
ATOM   538  O O   . GLY A 1 71  ? 27.494 -2.454  -1.511  1.00 21.56 ? 70   GLY A O   1 
ATOM   539  N N   . PHE A 1 72  ? 28.269 -0.421  -0.948  1.00 19.57 ? 71   PHE A N   1 
ATOM   540  C CA  . PHE A 1 72  ? 27.879 0.227   -2.192  1.00 19.01 ? 71   PHE A CA  1 
ATOM   541  C C   . PHE A 1 72  ? 28.896 0.075   -3.324  1.00 21.04 ? 71   PHE A C   1 
ATOM   542  O O   . PHE A 1 72  ? 28.545 0.151   -4.504  1.00 20.20 ? 71   PHE A O   1 
ATOM   543  C CB  . PHE A 1 72  ? 27.623 1.696   -1.937  1.00 17.11 ? 71   PHE A CB  1 
ATOM   544  C CG  . PHE A 1 72  ? 26.542 1.954   -0.928  1.00 17.65 ? 71   PHE A CG  1 
ATOM   545  C CD1 . PHE A 1 72  ? 26.664 3.002   -0.022  1.00 19.92 ? 71   PHE A CD1 1 
ATOM   546  C CD2 . PHE A 1 72  ? 25.348 1.250   -0.978  1.00 18.04 ? 71   PHE A CD2 1 
ATOM   547  C CE1 . PHE A 1 72  ? 25.627 3.358   0.790   1.00 13.31 ? 71   PHE A CE1 1 
ATOM   548  C CE2 . PHE A 1 72  ? 24.297 1.604   -0.170  1.00 17.30 ? 71   PHE A CE2 1 
ATOM   549  C CZ  . PHE A 1 72  ? 24.436 2.673   0.716   1.00 17.27 ? 71   PHE A CZ  1 
ATOM   550  N N   . SER A 1 73  ? 30.128 -0.261  -2.964  1.00 21.13 ? 72   SER A N   1 
ATOM   551  C CA  . SER A 1 73  ? 31.208 -0.358  -3.934  1.00 19.92 ? 72   SER A CA  1 
ATOM   552  C C   . SER A 1 73  ? 32.396 -1.051  -3.284  1.00 23.64 ? 72   SER A C   1 
ATOM   553  O O   . SER A 1 73  ? 32.408 -1.255  -2.071  1.00 24.82 ? 72   SER A O   1 
ATOM   554  C CB  . SER A 1 73  ? 31.620 1.044   -4.373  1.00 17.97 ? 72   SER A CB  1 
ATOM   555  O OG  . SER A 1 73  ? 32.265 1.702   -3.298  1.00 16.51 ? 72   SER A OG  1 
ATOM   556  N N   . ASP A 1 74  ? 33.419 -1.345  -4.082  1.00 26.68 ? 73   ASP A N   1 
ATOM   557  C CA  . ASP A 1 74  ? 34.701 -1.897  -3.620  1.00 27.75 ? 73   ASP A CA  1 
ATOM   558  C C   . ASP A 1 74  ? 35.461 -0.930  -2.666  1.00 26.23 ? 73   ASP A C   1 
ATOM   559  O O   . ASP A 1 74  ? 35.755 0.202   -3.042  1.00 28.14 ? 73   ASP A O   1 
ATOM   560  C CB  . ASP A 1 74  ? 35.559 -2.155  -4.862  1.00 32.39 ? 73   ASP A CB  1 
ATOM   561  C CG  . ASP A 1 74  ? 36.337 -3.456  -4.801  1.00 37.92 ? 73   ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 74  ? 36.568 -3.973  -3.689  1.00 41.21 ? 73   ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 74  ? 36.769 -3.925  -5.879  1.00 38.17 ? 73   ASP A OD2 1 
ATOM   564  N N   . PRO A 1 75  ? 35.785 -1.360  -1.431  1.00 24.12 ? 74   PRO A N   1 
ATOM   565  C CA  . PRO A 1 75  ? 35.583 -2.651  -0.770  1.00 23.22 ? 74   PRO A CA  1 
ATOM   566  C C   . PRO A 1 75  ? 34.268 -2.755  -0.004  1.00 21.38 ? 74   PRO A C   1 
ATOM   567  O O   . PRO A 1 75  ? 33.767 -1.766  0.517   1.00 19.55 ? 74   PRO A O   1 
ATOM   568  C CB  . PRO A 1 75  ? 36.782 -2.753  0.169   1.00 22.37 ? 74   PRO A CB  1 
ATOM   569  C CG  . PRO A 1 75  ? 37.000 -1.343  0.596   1.00 23.56 ? 74   PRO A CG  1 
ATOM   570  C CD  . PRO A 1 75  ? 36.587 -0.464  -0.570  1.00 27.00 ? 74   PRO A CD  1 
ATOM   571  N N   . LEU A 1 76  ? 33.722 -3.963  0.074   1.00 23.44 ? 75   LEU A N   1 
ATOM   572  C CA  . LEU A 1 76  ? 32.532 -4.240  0.891   1.00 25.53 ? 75   LEU A CA  1 
ATOM   573  C C   . LEU A 1 76  ? 32.966 -4.522  2.322   1.00 28.66 ? 75   LEU A C   1 
ATOM   574  O O   . LEU A 1 76  ? 33.708 -5.477  2.568   1.00 30.82 ? 75   LEU A O   1 
ATOM   575  C CB  . LEU A 1 76  ? 31.786 -5.459  0.351   1.00 19.90 ? 75   LEU A CB  1 
ATOM   576  C CG  . LEU A 1 76  ? 31.504 -5.397  -1.154  1.00 22.82 ? 75   LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 76  ? 30.740 -6.623  -1.527  1.00 19.82 ? 75   LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 76  ? 30.715 -4.135  -1.536  1.00 17.59 ? 75   LEU A CD2 1 
ATOM   579  N N   . THR A 1 77  ? 32.597 -3.632  3.243   1.00 28.71 ? 76   THR A N   1 
ATOM   580  C CA  . THR A 1 77  ? 33.142 -3.661  4.607   1.00 25.00 ? 76   THR A CA  1 
ATOM   581  C C   . THR A 1 77  ? 32.122 -3.766  5.722   1.00 25.22 ? 76   THR A C   1 
ATOM   582  O O   . THR A 1 77  ? 32.502 -3.883  6.873   1.00 29.01 ? 76   THR A O   1 
ATOM   583  C CB  . THR A 1 77  ? 34.042 -2.425  4.920   1.00 21.35 ? 76   THR A CB  1 
ATOM   584  O OG1 . THR A 1 77  ? 33.247 -1.233  4.942   1.00 20.31 ? 76   THR A OG1 1 
ATOM   585  C CG2 . THR A 1 77  ? 35.116 -2.269  3.906   1.00 19.97 ? 76   THR A CG2 1 
ATOM   586  N N   . PHE A 1 78  ? 30.837 -3.712  5.401   1.00 26.75 ? 77   PHE A N   1 
ATOM   587  C CA  . PHE A 1 78  ? 29.804 -3.732  6.447   1.00 29.79 ? 77   PHE A CA  1 
ATOM   588  C C   . PHE A 1 78  ? 29.296 -5.139  6.636   1.00 29.19 ? 77   PHE A C   1 
ATOM   589  O O   . PHE A 1 78  ? 29.105 -5.849  5.666   1.00 31.70 ? 77   PHE A O   1 
ATOM   590  C CB  . PHE A 1 78  ? 28.614 -2.812  6.097   1.00 29.53 ? 77   PHE A CB  1 
ATOM   591  C CG  . PHE A 1 78  ? 28.959 -1.349  6.080   1.00 29.77 ? 77   PHE A CG  1 
ATOM   592  C CD1 . PHE A 1 78  ? 29.544 -0.772  4.959   1.00 28.66 ? 77   PHE A CD1 1 
ATOM   593  C CD2 . PHE A 1 78  ? 28.727 -0.556  7.198   1.00 30.38 ? 77   PHE A CD2 1 
ATOM   594  C CE1 . PHE A 1 78  ? 29.889 0.568   4.940   1.00 30.47 ? 77   PHE A CE1 1 
ATOM   595  C CE2 . PHE A 1 78  ? 29.068 0.796   7.195   1.00 32.16 ? 77   PHE A CE2 1 
ATOM   596  C CZ  . PHE A 1 78  ? 29.651 1.363   6.061   1.00 33.94 ? 77   PHE A CZ  1 
ATOM   597  N N   . SER A 1 79  ? 29.098 -5.553  7.880   1.00 29.52 ? 78   SER A N   1 
ATOM   598  C CA  . SER A 1 79  ? 28.735 -6.942  8.136   1.00 33.18 ? 78   SER A CA  1 
ATOM   599  C C   . SER A 1 79  ? 27.240 -7.238  8.036   1.00 33.35 ? 78   SER A C   1 
ATOM   600  O O   . SER A 1 79  ? 26.832 -8.391  7.935   1.00 36.70 ? 78   SER A O   1 
ATOM   601  C CB  . SER A 1 79  ? 29.274 -7.389  9.490   1.00 36.37 ? 78   SER A CB  1 
ATOM   602  O OG  . SER A 1 79  ? 30.703 -7.363  9.500   1.00 42.07 ? 78   SER A OG  1 
ATOM   603  N N   . SER A 1 80  ? 26.428 -6.191  7.981   1.00 32.13 ? 79   SER A N   1 
ATOM   604  C CA  . SER A 1 80  ? 24.997 -6.344  7.714   1.00 29.77 ? 79   SER A CA  1 
ATOM   605  C C   . SER A 1 80  ? 24.428 -5.128  6.987   1.00 27.28 ? 79   SER A C   1 
ATOM   606  O O   . SER A 1 80  ? 24.963 -4.034  7.065   1.00 29.39 ? 79   SER A O   1 
ATOM   607  C CB  . SER A 1 80  ? 24.237 -6.537  9.023   1.00 30.84 ? 79   SER A CB  1 
ATOM   608  O OG  . SER A 1 80  ? 24.368 -5.391  9.848   1.00 32.32 ? 79   SER A OG  1 
ATOM   609  N N   . VAL A 1 81  ? 23.270 -5.299  6.378   1.00 24.36 ? 80   VAL A N   1 
ATOM   610  C CA  . VAL A 1 81  ? 22.626 -4.190  5.698   1.00 19.66 ? 80   VAL A CA  1 
ATOM   611  C C   . VAL A 1 81  ? 22.123 -3.153  6.675   1.00 22.10 ? 80   VAL A C   1 
ATOM   612  O O   . VAL A 1 81  ? 22.097 -1.968  6.335   1.00 25.38 ? 80   VAL A O   1 
ATOM   613  C CB  . VAL A 1 81  ? 21.443 -4.625  4.837   1.00 15.30 ? 80   VAL A CB  1 
ATOM   614  C CG1 . VAL A 1 81  ? 20.944 -3.454  4.060   1.00 15.61 ? 80   VAL A CG1 1 
ATOM   615  C CG2 . VAL A 1 81  ? 21.844 -5.749  3.911   1.00 9.57  ? 80   VAL A CG2 1 
ATOM   616  N N   . VAL A 1 82  ? 21.723 -3.570  7.878   1.00 23.26 ? 81   VAL A N   1 
ATOM   617  C CA  . VAL A 1 82  ? 21.324 -2.586  8.906   1.00 26.42 ? 81   VAL A CA  1 
ATOM   618  C C   . VAL A 1 82  ? 22.533 -1.731  9.368   1.00 25.30 ? 81   VAL A C   1 
ATOM   619  O O   . VAL A 1 82  ? 22.458 -0.508  9.398   1.00 24.08 ? 81   VAL A O   1 
ATOM   620  C CB  . VAL A 1 82  ? 20.626 -3.258  10.156  1.00 26.31 ? 81   VAL A CB  1 
ATOM   621  C CG1 . VAL A 1 82  ? 19.496 -4.172  9.710   1.00 22.34 ? 81   VAL A CG1 1 
ATOM   622  C CG2 . VAL A 1 82  ? 21.626 -4.038  10.989  1.00 29.05 ? 81   VAL A CG2 1 
ATOM   623  N N   . GLU A 1 83  ? 23.686 -2.374  9.504   1.00 23.43 ? 82   GLU A N   1 
ATOM   624  C CA  . GLU A 1 83  ? 24.898 -1.694  9.897   1.00 23.67 ? 82   GLU A CA  1 
ATOM   625  C C   . GLU A 1 83  ? 25.227 -0.626  8.859   1.00 25.05 ? 82   GLU A C   1 
ATOM   626  O O   . GLU A 1 83  ? 25.573 0.519   9.189   1.00 28.39 ? 82   GLU A O   1 
ATOM   627  C CB  . GLU A 1 83  ? 26.013 -2.720  9.990   1.00 27.90 ? 82   GLU A CB  1 
ATOM   628  C CG  . GLU A 1 83  ? 27.324 -2.259  10.604  1.00 38.18 ? 82   GLU A CG  1 
ATOM   629  C CD  . GLU A 1 83  ? 28.441 -3.300  10.419  1.00 47.01 ? 82   GLU A CD  1 
ATOM   630  O OE1 . GLU A 1 83  ? 28.173 -4.525  10.570  1.00 49.44 ? 82   GLU A OE1 1 
ATOM   631  O OE2 . GLU A 1 83  ? 29.580 -2.891  10.082  1.00 49.35 ? 82   GLU A OE2 1 
ATOM   632  N N   . LEU A 1 84  ? 25.079 -1.004  7.595   1.00 25.87 ? 83   LEU A N   1 
ATOM   633  C CA  . LEU A 1 84  ? 25.310 -0.102  6.451   1.00 21.80 ? 83   LEU A CA  1 
ATOM   634  C C   . LEU A 1 84  ? 24.354 1.105   6.417   1.00 19.94 ? 83   LEU A C   1 
ATOM   635  O O   . LEU A 1 84  ? 24.781 2.239   6.337   1.00 20.68 ? 83   LEU A O   1 
ATOM   636  C CB  . LEU A 1 84  ? 25.174 -0.919  5.170   1.00 22.26 ? 83   LEU A CB  1 
ATOM   637  C CG  . LEU A 1 84  ? 25.279 -0.258  3.816   1.00 23.43 ? 83   LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 84  ? 26.593 0.506   3.680   1.00 25.01 ? 83   LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 84  ? 25.201 -1.344  2.784   1.00 26.69 ? 83   LEU A CD2 1 
ATOM   640  N N   . ILE A 1 85  ? 23.064 0.838   6.540   1.00 18.84 ? 84   ILE A N   1 
ATOM   641  C CA  . ILE A 1 85  ? 22.058 1.886   6.489   1.00 20.67 ? 84   ILE A CA  1 
ATOM   642  C C   . ILE A 1 85  ? 22.201 2.793   7.707   1.00 21.84 ? 84   ILE A C   1 
ATOM   643  O O   . ILE A 1 85  ? 22.285 4.022   7.584   1.00 24.88 ? 84   ILE A O   1 
ATOM   644  C CB  . ILE A 1 85  ? 20.626 1.260   6.419   1.00 23.51 ? 84   ILE A CB  1 
ATOM   645  C CG1 . ILE A 1 85  ? 20.437 0.570   5.059   1.00 25.13 ? 84   ILE A CG1 1 
ATOM   646  C CG2 . ILE A 1 85  ? 19.541 2.303   6.697   1.00 21.97 ? 84   ILE A CG2 1 
ATOM   647  C CD1 . ILE A 1 85  ? 20.729 1.440   3.860   1.00 23.17 ? 84   ILE A CD1 1 
ATOM   648  N N   . ASN A 1 86  ? 22.372 2.179   8.869   1.00 20.77 ? 85   ASN A N   1 
ATOM   649  C CA  . ASN A 1 86  ? 22.597 2.931   10.098  1.00 21.07 ? 85   ASN A CA  1 
ATOM   650  C C   . ASN A 1 86  ? 23.793 3.860   9.992   1.00 18.76 ? 85   ASN A C   1 
ATOM   651  O O   . ASN A 1 86  ? 23.679 5.035   10.354  1.00 19.71 ? 85   ASN A O   1 
ATOM   652  C CB  . ASN A 1 86  ? 22.773 1.981   11.287  1.00 21.18 ? 85   ASN A CB  1 
ATOM   653  C CG  . ASN A 1 86  ? 21.458 1.486   11.799  1.00 22.57 ? 85   ASN A CG  1 
ATOM   654  O OD1 . ASN A 1 86  ? 20.404 2.051   11.459  1.00 20.48 ? 85   ASN A OD1 1 
ATOM   655  N ND2 . ASN A 1 86  ? 21.481 0.415   12.574  1.00 24.62 ? 85   ASN A ND2 1 
ATOM   656  N N   . HIS A 1 87  ? 24.856 3.403   9.335   1.00 14.77 ? 86   HIS A N   1 
ATOM   657  C CA  . HIS A 1 87  ? 25.995 4.273   9.144   1.00 18.17 ? 86   HIS A CA  1 
ATOM   658  C C   . HIS A 1 87  ? 25.645 5.567   8.372   1.00 20.81 ? 86   HIS A C   1 
ATOM   659  O O   . HIS A 1 87  ? 25.882 6.680   8.883   1.00 20.36 ? 86   HIS A O   1 
ATOM   660  C CB  . HIS A 1 87  ? 27.121 3.534   8.442   1.00 16.47 ? 86   HIS A CB  1 
ATOM   661  C CG  . HIS A 1 87  ? 28.406 4.322   8.383   1.00 16.82 ? 86   HIS A CG  1 
ATOM   662  N ND1 . HIS A 1 87  ? 29.332 4.312   9.409   1.00 13.58 ? 86   HIS A ND1 1 
ATOM   663  C CD2 . HIS A 1 87  ? 28.841 5.238   7.498   1.00 19.05 ? 86   HIS A CD2 1 
ATOM   664  C CE1 . HIS A 1 87  ? 30.287 5.178   9.138   1.00 15.05 ? 86   HIS A CE1 1 
ATOM   665  N NE2 . HIS A 1 87  ? 30.021 5.758   7.990   1.00 16.66 ? 86   HIS A NE2 1 
ATOM   666  N N   . TYR A 1 88  ? 24.956 5.414   7.233   1.00 19.88 ? 87   TYR A N   1 
ATOM   667  C CA  . TYR A 1 88  ? 24.623 6.533   6.356   1.00 20.00 ? 87   TYR A CA  1 
ATOM   668  C C   . TYR A 1 88  ? 23.352 7.287   6.726   1.00 21.37 ? 87   TYR A C   1 
ATOM   669  O O   . TYR A 1 88  ? 22.978 8.293   6.084   1.00 18.35 ? 87   TYR A O   1 
ATOM   670  C CB  . TYR A 1 88  ? 24.585 6.050   4.907   1.00 13.83 ? 87   TYR A CB  1 
ATOM   671  C CG  . TYR A 1 88  ? 25.953 5.699   4.426   1.00 14.70 ? 87   TYR A CG  1 
ATOM   672  C CD1 . TYR A 1 88  ? 26.389 4.372   4.409   1.00 10.16 ? 87   TYR A CD1 1 
ATOM   673  C CD2 . TYR A 1 88  ? 26.895 6.706   4.195   1.00 11.28 ? 87   TYR A CD2 1 
ATOM   674  C CE1 . TYR A 1 88  ? 27.752 4.058   4.196   1.00 9.20  ? 87   TYR A CE1 1 
ATOM   675  C CE2 . TYR A 1 88  ? 28.261 6.398   3.975   1.00 8.44  ? 87   TYR A CE2 1 
ATOM   676  C CZ  . TYR A 1 88  ? 28.669 5.070   3.981   1.00 9.57  ? 87   TYR A CZ  1 
ATOM   677  O OH  . TYR A 1 88  ? 29.971 4.768   3.696   1.00 14.01 ? 87   TYR A OH  1 
ATOM   678  N N   . ARG A 1 89  ? 22.780 6.906   7.861   1.00 22.87 ? 88   ARG A N   1 
ATOM   679  C CA  . ARG A 1 89  ? 21.856 7.802   8.540   1.00 24.44 ? 88   ARG A CA  1 
ATOM   680  C C   . ARG A 1 89  ? 22.589 9.020   9.124   1.00 22.85 ? 88   ARG A C   1 
ATOM   681  O O   . ARG A 1 89  ? 22.044 10.117  9.144   1.00 23.50 ? 88   ARG A O   1 
ATOM   682  C CB  . ARG A 1 89  ? 21.129 7.053   9.647   1.00 25.91 ? 88   ARG A CB  1 
ATOM   683  C CG  . ARG A 1 89  ? 20.404 5.806   9.181   1.00 27.18 ? 88   ARG A CG  1 
ATOM   684  C CD  . ARG A 1 89  ? 18.938 6.075   8.892   1.00 32.79 ? 88   ARG A CD  1 
ATOM   685  N NE  . ARG A 1 89  ? 18.323 7.025   9.825   1.00 37.25 ? 88   ARG A NE  1 
ATOM   686  C CZ  . ARG A 1 89  ? 17.195 6.798   10.503  1.00 39.47 ? 88   ARG A CZ  1 
ATOM   687  N NH1 . ARG A 1 89  ? 16.607 7.787   11.166  1.00 40.33 ? 88   ARG A NH1 1 
ATOM   688  N NH2 . ARG A 1 89  ? 16.652 5.590   10.538  1.00 39.14 ? 88   ARG A NH2 1 
ATOM   689  N N   . ASN A 1 90  ? 23.853 8.846   9.503   1.00 22.39 ? 89   ASN A N   1 
ATOM   690  C CA  . ASN A 1 90  ? 24.600 9.919   10.151  1.00 23.17 ? 89   ASN A CA  1 
ATOM   691  C C   . ASN A 1 90  ? 25.723 10.511  9.321   1.00 23.46 ? 89   ASN A C   1 
ATOM   692  O O   . ASN A 1 90  ? 26.497 11.331  9.797   1.00 24.45 ? 89   ASN A O   1 
ATOM   693  C CB  . ASN A 1 90  ? 25.161 9.432   11.480  1.00 25.80 ? 89   ASN A CB  1 
ATOM   694  C CG  . ASN A 1 90  ? 24.145 9.525   12.599  1.00 31.36 ? 89   ASN A CG  1 
ATOM   695  O OD1 . ASN A 1 90  ? 23.510 10.558  12.782  1.00 36.04 ? 89   ASN A OD1 1 
ATOM   696  N ND2 . ASN A 1 90  ? 23.858 8.397   13.230  1.00 37.58 ? 89   ASN A ND2 1 
ATOM   697  N N   . GLU A 1 91  ? 25.839 10.066  8.083   1.00 26.70 ? 90   GLU A N   1 
ATOM   698  C CA  . GLU A 1 91  ? 26.915 10.511  7.210   1.00 28.10 ? 90   GLU A CA  1 
ATOM   699  C C   . GLU A 1 91  ? 26.437 10.541  5.764   1.00 27.32 ? 90   GLU A C   1 
ATOM   700  O O   . GLU A 1 91  ? 25.843 9.581   5.281   1.00 27.53 ? 90   GLU A O   1 
ATOM   701  C CB  . GLU A 1 91  ? 28.114 9.571   7.341   1.00 31.19 ? 90   GLU A CB  1 
ATOM   702  C CG  . GLU A 1 91  ? 29.435 10.204  6.959   1.00 38.23 ? 90   GLU A CG  1 
ATOM   703  C CD  . GLU A 1 91  ? 30.430 9.204   6.410   1.00 40.10 ? 90   GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 91  ? 30.792 9.327   5.222   1.00 40.88 ? 90   GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 91  ? 30.880 8.322   7.172   1.00 44.14 ? 90   GLU A OE2 1 
ATOM   706  N N   . SER A 1 92  ? 26.641 11.665  5.091   1.00 26.09 ? 91   SER A N   1 
ATOM   707  C CA  . SER A 1 92  ? 26.143 11.789  3.735   1.00 25.97 ? 91   SER A CA  1 
ATOM   708  C C   . SER A 1 92  ? 26.781 10.752  2.799   1.00 25.28 ? 91   SER A C   1 
ATOM   709  O O   . SER A 1 92  ? 27.841 10.185  3.113   1.00 22.28 ? 91   SER A O   1 
ATOM   710  C CB  . SER A 1 92  ? 26.381 13.195  3.206   1.00 24.82 ? 91   SER A CB  1 
ATOM   711  O OG  . SER A 1 92  ? 27.700 13.351  2.754   1.00 27.60 ? 91   SER A OG  1 
ATOM   712  N N   . LEU A 1 93  ? 26.148 10.523  1.645   1.00 24.69 ? 92   LEU A N   1 
ATOM   713  C CA  . LEU A 1 93  ? 26.652 9.589   0.632   1.00 21.87 ? 92   LEU A CA  1 
ATOM   714  C C   . LEU A 1 93  ? 27.504 10.291  -0.418  1.00 21.74 ? 92   LEU A C   1 
ATOM   715  O O   . LEU A 1 93  ? 27.820 9.718   -1.464  1.00 25.57 ? 92   LEU A O   1 
ATOM   716  C CB  . LEU A 1 93  ? 25.481 8.886   -0.049  1.00 20.35 ? 92   LEU A CB  1 
ATOM   717  C CG  . LEU A 1 93  ? 24.633 8.013   0.874   1.00 21.32 ? 92   LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 93  ? 23.163 8.136   0.530   1.00 20.40 ? 92   LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 93  ? 25.082 6.588   0.767   1.00 22.57 ? 92   LEU A CD2 1 
ATOM   720  N N   . ALA A 1 94  ? 27.901 11.522  -0.122  1.00 21.98 ? 93   ALA A N   1 
ATOM   721  C CA  . ALA A 1 94  ? 28.611 12.363  -1.075  1.00 19.20 ? 93   ALA A CA  1 
ATOM   722  C C   . ALA A 1 94  ? 29.928 11.758  -1.582  1.00 19.98 ? 93   ALA A C   1 
ATOM   723  O O   . ALA A 1 94  ? 30.260 11.884  -2.766  1.00 22.81 ? 93   ALA A O   1 
ATOM   724  C CB  . ALA A 1 94  ? 28.864 13.720  -0.451  1.00 17.52 ? 93   ALA A CB  1 
ATOM   725  N N   . GLN A 1 95  ? 30.632 11.030  -0.721  1.00 18.28 ? 94   GLN A N   1 
ATOM   726  C CA  . GLN A 1 95  ? 31.905 10.446  -1.123  1.00 18.77 ? 94   GLN A CA  1 
ATOM   727  C C   . GLN A 1 95  ? 31.789 9.311   -2.127  1.00 17.42 ? 94   GLN A C   1 
ATOM   728  O O   . GLN A 1 95  ? 32.752 8.951   -2.777  1.00 21.41 ? 94   GLN A O   1 
ATOM   729  C CB  . GLN A 1 95  ? 32.692 9.984   0.097   1.00 24.22 ? 94   GLN A CB  1 
ATOM   730  C CG  . GLN A 1 95  ? 33.164 11.128  0.996   1.00 32.17 ? 94   GLN A CG  1 
ATOM   731  C CD  . GLN A 1 95  ? 33.813 12.270  0.216   1.00 34.02 ? 94   GLN A CD  1 
ATOM   732  O OE1 . GLN A 1 95  ? 33.250 13.356  0.111   1.00 32.52 ? 94   GLN A OE1 1 
ATOM   733  N NE2 . GLN A 1 95  ? 35.005 12.030  -0.321  1.00 34.10 ? 94   GLN A NE2 1 
ATOM   734  N N   . TYR A 1 96  ? 30.586 8.813   -2.336  1.00 17.11 ? 95   TYR A N   1 
ATOM   735  C CA  . TYR A 1 96  ? 30.342 7.830   -3.395  1.00 16.03 ? 95   TYR A CA  1 
ATOM   736  C C   . TYR A 1 96  ? 29.982 8.474   -4.724  1.00 17.13 ? 95   TYR A C   1 
ATOM   737  O O   . TYR A 1 96  ? 30.325 7.955   -5.779  1.00 16.85 ? 95   TYR A O   1 
ATOM   738  C CB  . TYR A 1 96  ? 29.239 6.875   -2.979  1.00 16.88 ? 95   TYR A CB  1 
ATOM   739  C CG  . TYR A 1 96  ? 29.633 6.016   -1.812  1.00 19.98 ? 95   TYR A CG  1 
ATOM   740  C CD1 . TYR A 1 96  ? 29.144 6.280   -0.532  1.00 22.72 ? 95   TYR A CD1 1 
ATOM   741  C CD2 . TYR A 1 96  ? 30.435 4.896   -1.992  1.00 21.53 ? 95   TYR A CD2 1 
ATOM   742  C CE1 . TYR A 1 96  ? 29.439 5.437   0.542   1.00 18.03 ? 95   TYR A CE1 1 
ATOM   743  C CE2 . TYR A 1 96  ? 30.743 4.052   -0.934  1.00 21.25 ? 95   TYR A CE2 1 
ATOM   744  C CZ  . TYR A 1 96  ? 30.240 4.325   0.323   1.00 20.83 ? 95   TYR A CZ  1 
ATOM   745  O OH  . TYR A 1 96  ? 30.481 3.446   1.342   1.00 20.56 ? 95   TYR A OH  1 
ATOM   746  N N   . ASN A 1 97  ? 29.443 9.685   -4.657  1.00 20.11 ? 96   ASN A N   1 
ATOM   747  C CA  . ASN A 1 97  ? 28.887 10.357  -5.821  1.00 18.58 ? 96   ASN A CA  1 
ATOM   748  C C   . ASN A 1 97  ? 28.478 11.775  -5.390  1.00 19.87 ? 96   ASN A C   1 
ATOM   749  O O   . ASN A 1 97  ? 27.603 11.941  -4.530  1.00 19.21 ? 96   ASN A O   1 
ATOM   750  C CB  . ASN A 1 97  ? 27.655 9.580   -6.271  1.00 20.99 ? 96   ASN A CB  1 
ATOM   751  C CG  . ASN A 1 97  ? 27.048 10.124  -7.513  1.00 19.21 ? 96   ASN A CG  1 
ATOM   752  O OD1 . ASN A 1 97  ? 26.837 11.321  -7.645  1.00 23.19 ? 96   ASN A OD1 1 
ATOM   753  N ND2 . ASN A 1 97  ? 26.843 9.254   -8.480  1.00 23.28 ? 96   ASN A ND2 1 
ATOM   754  N N   . PRO A 1 98  ? 29.137 12.811  -5.932  1.00 23.03 ? 97   PRO A N   1 
ATOM   755  C CA  . PRO A 1 98  ? 28.929 14.204  -5.497  1.00 23.79 ? 97   PRO A CA  1 
ATOM   756  C C   . PRO A 1 98  ? 27.475 14.706  -5.566  1.00 24.83 ? 97   PRO A C   1 
ATOM   757  O O   . PRO A 1 98  ? 27.087 15.659  -4.878  1.00 23.73 ? 97   PRO A O   1 
ATOM   758  C CB  . PRO A 1 98  ? 29.858 15.009  -6.414  1.00 22.77 ? 97   PRO A CB  1 
ATOM   759  C CG  . PRO A 1 98  ? 30.265 14.040  -7.520  1.00 23.83 ? 97   PRO A CG  1 
ATOM   760  C CD  . PRO A 1 98  ? 30.260 12.700  -6.873  1.00 22.63 ? 97   PRO A CD  1 
ATOM   761  N N   . LYS A 1 99  ? 26.667 14.060  -6.394  1.00 27.51 ? 98   LYS A N   1 
ATOM   762  C CA  . LYS A 1 99  ? 25.245 14.382  -6.503  1.00 27.86 ? 98   LYS A CA  1 
ATOM   763  C C   . LYS A 1 99  ? 24.451 13.954  -5.263  1.00 27.25 ? 98   LYS A C   1 
ATOM   764  O O   . LYS A 1 99  ? 23.275 14.295  -5.106  1.00 25.55 ? 98   LYS A O   1 
ATOM   765  C CB  . LYS A 1 99  ? 24.684 13.670  -7.731  1.00 31.57 ? 98   LYS A CB  1 
ATOM   766  C CG  . LYS A 1 99  ? 24.761 14.433  -8.996  1.00 34.71 ? 98   LYS A CG  1 
ATOM   767  C CD  . LYS A 1 99  ? 23.336 14.685  -9.428  1.00 45.27 ? 98   LYS A CD  1 
ATOM   768  C CE  . LYS A 1 99  ? 23.184 14.705  -10.926 1.00 49.85 ? 98   LYS A CE  1 
ATOM   769  N NZ  . LYS A 1 99  ? 23.898 13.577  -11.579 1.00 48.87 ? 98   LYS A NZ  1 
ATOM   770  N N   . LEU A 1 100 ? 25.052 13.080  -4.467  1.00 24.34 ? 99   LEU A N   1 
ATOM   771  C CA  . LEU A 1 100 ? 24.363 12.439  -3.355  1.00 23.47 ? 99   LEU A CA  1 
ATOM   772  C C   . LEU A 1 100 ? 24.759 13.066  -2.006  1.00 24.10 ? 99   LEU A C   1 
ATOM   773  O O   . LEU A 1 100 ? 25.154 12.373  -1.057  1.00 22.70 ? 99   LEU A O   1 
ATOM   774  C CB  . LEU A 1 100 ? 24.662 10.925  -3.370  1.00 20.21 ? 99   LEU A CB  1 
ATOM   775  C CG  . LEU A 1 100 ? 24.002 10.102  -4.478  1.00 14.45 ? 99   LEU A CG  1 
ATOM   776  C CD1 . LEU A 1 100 ? 24.333 8.641   -4.304  1.00 18.82 ? 99   LEU A CD1 1 
ATOM   777  C CD2 . LEU A 1 100 ? 22.511 10.273  -4.424  1.00 11.61 ? 99   LEU A CD2 1 
ATOM   778  N N   . ASP A 1 101 ? 24.685 14.389  -1.938  1.00 25.47 ? 100  ASP A N   1 
ATOM   779  C CA  . ASP A 1 101 ? 24.959 15.098  -0.684  1.00 27.44 ? 100  ASP A CA  1 
ATOM   780  C C   . ASP A 1 101 ? 23.760 15.052  0.272   1.00 27.61 ? 100  ASP A C   1 
ATOM   781  O O   . ASP A 1 101 ? 23.119 16.071  0.523   1.00 28.65 ? 100  ASP A O   1 
ATOM   782  C CB  . ASP A 1 101 ? 25.378 16.555  -0.961  1.00 26.51 ? 100  ASP A CB  1 
ATOM   783  C CG  . ASP A 1 101 ? 24.377 17.303  -1.810  1.00 31.91 ? 100  ASP A CG  1 
ATOM   784  O OD1 . ASP A 1 101 ? 23.881 18.351  -1.348  1.00 37.02 ? 100  ASP A OD1 1 
ATOM   785  O OD2 . ASP A 1 101 ? 24.082 16.863  -2.939  1.00 36.62 ? 100  ASP A OD2 1 
ATOM   786  N N   . VAL A 1 102 ? 23.367 13.831  0.644   1.00 24.96 ? 101  VAL A N   1 
ATOM   787  C CA  . VAL A 1 102 ? 22.307 13.574  1.616   1.00 21.20 ? 101  VAL A CA  1 
ATOM   788  C C   . VAL A 1 102 ? 22.699 12.433  2.533   1.00 21.69 ? 101  VAL A C   1 
ATOM   789  O O   . VAL A 1 102 ? 23.555 11.615  2.207   1.00 22.66 ? 101  VAL A O   1 
ATOM   790  C CB  . VAL A 1 102 ? 20.991 13.096  0.973   1.00 20.75 ? 101  VAL A CB  1 
ATOM   791  C CG1 . VAL A 1 102 ? 20.087 14.261  0.728   1.00 23.97 ? 101  VAL A CG1 1 
ATOM   792  C CG2 . VAL A 1 102 ? 21.267 12.313  -0.281  1.00 20.23 ? 101  VAL A CG2 1 
ATOM   793  N N   . LYS A 1 103 ? 22.057 12.400  3.688   1.00 20.76 ? 102  LYS A N   1 
ATOM   794  C CA  . LYS A 1 103 ? 22.031 11.222  4.533   1.00 21.40 ? 102  LYS A CA  1 
ATOM   795  C C   . LYS A 1 103 ? 20.715 10.490  4.295   1.00 20.37 ? 102  LYS A C   1 
ATOM   796  O O   . LYS A 1 103 ? 19.723 11.095  3.851   1.00 18.82 ? 102  LYS A O   1 
ATOM   797  C CB  . LYS A 1 103 ? 22.117 11.643  6.008   1.00 19.56 ? 102  LYS A CB  1 
ATOM   798  C CG  . LYS A 1 103 ? 23.235 12.605  6.291   1.00 22.46 ? 102  LYS A CG  1 
ATOM   799  C CD  . LYS A 1 103 ? 23.163 13.103  7.716   1.00 24.73 ? 102  LYS A CD  1 
ATOM   800  C CE  . LYS A 1 103 ? 24.337 14.018  7.999   1.00 27.19 ? 102  LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 103 ? 24.038 14.875  9.165   1.00 37.54 ? 102  LYS A NZ  1 
ATOM   802  N N   . LEU A 1 104 ? 20.637 9.255   4.776   1.00 20.02 ? 103  LEU A N   1 
ATOM   803  C CA  . LEU A 1 104 ? 19.333 8.601   4.933   1.00 23.08 ? 103  LEU A CA  1 
ATOM   804  C C   . LEU A 1 104 ? 18.521 9.163   6.145   1.00 23.95 ? 103  LEU A C   1 
ATOM   805  O O   . LEU A 1 104 ? 18.711 8.768   7.301   1.00 27.13 ? 103  LEU A O   1 
ATOM   806  C CB  . LEU A 1 104 ? 19.548 7.086   5.048   1.00 19.73 ? 103  LEU A CB  1 
ATOM   807  C CG  . LEU A 1 104 ? 20.581 6.544   4.046   1.00 18.51 ? 103  LEU A CG  1 
ATOM   808  C CD1 . LEU A 1 104 ? 20.750 5.037   4.222   1.00 17.32 ? 103  LEU A CD1 1 
ATOM   809  C CD2 . LEU A 1 104 ? 20.166 6.895   2.630   1.00 12.48 ? 103  LEU A CD2 1 
ATOM   810  N N   . LEU A 1 105 ? 17.713 10.178  5.889   1.00 22.07 ? 104  LEU A N   1 
ATOM   811  C CA  . LEU A 1 105 ? 17.089 10.931  6.971   1.00 21.38 ? 104  LEU A CA  1 
ATOM   812  C C   . LEU A 1 105 ? 15.762 10.354  7.436   1.00 24.04 ? 104  LEU A C   1 
ATOM   813  O O   . LEU A 1 105 ? 15.546 10.173  8.637   1.00 30.20 ? 104  LEU A O   1 
ATOM   814  C CB  . LEU A 1 105 ? 16.868 12.389  6.558   1.00 17.28 ? 104  LEU A CB  1 
ATOM   815  C CG  . LEU A 1 105 ? 18.062 13.313  6.383   1.00 15.12 ? 104  LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 105 ? 17.568 14.698  6.003   1.00 16.88 ? 104  LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 105 ? 18.878 13.359  7.664   1.00 12.22 ? 104  LEU A CD2 1 
ATOM   818  N N   . TYR A 1 106 ? 14.837 10.174  6.497   1.00 22.83 ? 105  TYR A N   1 
ATOM   819  C CA  . TYR A 1 106 ? 13.484 9.720   6.819   1.00 20.70 ? 105  TYR A CA  1 
ATOM   820  C C   . TYR A 1 106 ? 13.173 8.314   6.280   1.00 22.71 ? 105  TYR A C   1 
ATOM   821  O O   . TYR A 1 106 ? 12.912 8.134   5.087   1.00 19.49 ? 105  TYR A O   1 
ATOM   822  C CB  . TYR A 1 106 ? 12.469 10.712  6.277   1.00 16.87 ? 105  TYR A CB  1 
ATOM   823  C CG  . TYR A 1 106 ? 12.887 12.141  6.452   1.00 19.43 ? 105  TYR A CG  1 
ATOM   824  C CD1 . TYR A 1 106 ? 12.945 12.721  7.717   1.00 17.83 ? 105  TYR A CD1 1 
ATOM   825  C CD2 . TYR A 1 106 ? 13.188 12.944  5.348   1.00 17.16 ? 105  TYR A CD2 1 
ATOM   826  C CE1 . TYR A 1 106 ? 13.295 14.068  7.878   1.00 15.66 ? 105  TYR A CE1 1 
ATOM   827  C CE2 . TYR A 1 106 ? 13.538 14.292  5.513   1.00 18.17 ? 105  TYR A CE2 1 
ATOM   828  C CZ  . TYR A 1 106 ? 13.587 14.835  6.791   1.00 19.30 ? 105  TYR A CZ  1 
ATOM   829  O OH  . TYR A 1 106 ? 13.922 16.157  6.972   1.00 21.49 ? 105  TYR A OH  1 
ATOM   830  N N   . PRO A 1 107 ? 13.101 7.309   7.170   1.00 23.54 ? 106  PRO A N   1 
ATOM   831  C CA  . PRO A 1 107 ? 12.766 5.941   6.766   1.00 27.48 ? 106  PRO A CA  1 
ATOM   832  C C   . PRO A 1 107 ? 11.305 5.828   6.363   1.00 30.35 ? 106  PRO A C   1 
ATOM   833  O O   . PRO A 1 107 ? 10.448 6.403   7.020   1.00 38.51 ? 106  PRO A O   1 
ATOM   834  C CB  . PRO A 1 107 ? 13.052 5.121   8.024   1.00 25.74 ? 106  PRO A CB  1 
ATOM   835  C CG  . PRO A 1 107 ? 13.892 6.009   8.901   1.00 20.42 ? 106  PRO A CG  1 
ATOM   836  C CD  . PRO A 1 107 ? 13.387 7.376   8.612   1.00 23.21 ? 106  PRO A CD  1 
ATOM   837  N N   . VAL A 1 108 ? 11.004 5.118   5.282   1.00 29.76 ? 107  VAL A N   1 
ATOM   838  C CA  . VAL A 1 108 ? 9.608  4.788   5.002   1.00 31.41 ? 107  VAL A CA  1 
ATOM   839  C C   . VAL A 1 108 ? 9.269  3.525   5.769   1.00 33.02 ? 107  VAL A C   1 
ATOM   840  O O   . VAL A 1 108 ? 9.808  2.462   5.504   1.00 31.75 ? 107  VAL A O   1 
ATOM   841  C CB  . VAL A 1 108 ? 9.327  4.576   3.489   1.00 30.68 ? 107  VAL A CB  1 
ATOM   842  C CG1 . VAL A 1 108 ? 7.843  4.240   3.271   1.00 28.35 ? 107  VAL A CG1 1 
ATOM   843  C CG2 . VAL A 1 108 ? 9.712  5.812   2.701   1.00 27.11 ? 107  VAL A CG2 1 
ATOM   844  N N   . SER A 1 109 ? 8.465  3.690   6.810   1.00 38.29 ? 108  SER A N   1 
ATOM   845  C CA  . SER A 1 109 ? 8.250  2.643   7.815   1.00 41.34 ? 108  SER A CA  1 
ATOM   846  C C   . SER A 1 109 ? 7.055  1.764   7.505   1.00 41.24 ? 108  SER A C   1 
ATOM   847  O O   . SER A 1 109 ? 5.929  2.231   7.533   1.00 41.32 ? 108  SER A O   1 
ATOM   848  C CB  . SER A 1 109 ? 8.043  3.269   9.196   1.00 41.76 ? 108  SER A CB  1 
ATOM   849  O OG  . SER A 1 109 ? 7.715  2.282   10.152  1.00 44.81 ? 108  SER A OG  1 
ATOM   850  N N   . LYS A 1 110 ? 7.296  0.462   7.403   1.00 42.58 ? 109  LYS A N   1 
ATOM   851  C CA  . LYS A 1 110 ? 6.228  -0.516  7.209   1.00 45.74 ? 109  LYS A CA  1 
ATOM   852  C C   . LYS A 1 110 ? 5.314  -0.725  8.423   1.00 48.61 ? 109  LYS A C   1 
ATOM   853  O O   . LYS A 1 110 ? 4.254  -1.328  8.312   1.00 49.83 ? 109  LYS A O   1 
ATOM   854  C CB  . LYS A 1 110 ? 6.807  -1.859  6.761   1.00 45.48 ? 109  LYS A CB  1 
ATOM   855  C CG  . LYS A 1 110 ? 7.670  -2.531  7.791   1.00 43.65 ? 109  LYS A CG  1 
ATOM   856  C CD  . LYS A 1 110 ? 8.430  -3.680  7.190   1.00 39.90 ? 109  LYS A CD  1 
ATOM   857  C CE  . LYS A 1 110 ? 9.353  -4.274  8.217   1.00 41.18 ? 109  LYS A CE  1 
ATOM   858  N NZ  . LYS A 1 110 ? 10.220 -5.290  7.596   1.00 45.72 ? 109  LYS A NZ  1 
ATOM   859  N N   . TYR A 1 111 ? 5.696  -0.171  9.565   1.00 51.10 ? 110  TYR A N   1 
ATOM   860  C CA  . TYR A 1 111 ? 4.823  -0.148  10.734  1.00 53.60 ? 110  TYR A CA  1 
ATOM   861  C C   . TYR A 1 111 ? 4.007  1.138   10.826  1.00 58.39 ? 110  TYR A C   1 
ATOM   862  O O   . TYR A 1 111 ? 3.210  1.308   11.753  1.00 62.52 ? 110  TYR A O   1 
ATOM   863  C CB  . TYR A 1 111 ? 5.643  -0.278  12.008  1.00 51.19 ? 110  TYR A CB  1 
ATOM   864  C CG  . TYR A 1 111 ? 6.616  -1.415  11.988  1.00 50.37 ? 110  TYR A CG  1 
ATOM   865  C CD1 . TYR A 1 111 ? 7.955  -1.204  12.296  1.00 49.43 ? 110  TYR A CD1 1 
ATOM   866  C CD2 . TYR A 1 111 ? 6.198  -2.707  11.702  1.00 49.12 ? 110  TYR A CD2 1 
ATOM   867  C CE1 . TYR A 1 111 ? 8.854  -2.245  12.321  1.00 48.54 ? 110  TYR A CE1 1 
ATOM   868  C CE2 . TYR A 1 111 ? 7.091  -3.761  11.734  1.00 50.44 ? 110  TYR A CE2 1 
ATOM   869  C CZ  . TYR A 1 111 ? 8.427  -3.516  12.043  1.00 49.10 ? 110  TYR A CZ  1 
ATOM   870  O OH  . TYR A 1 111 ? 9.343  -4.543  12.070  1.00 50.57 ? 110  TYR A OH  1 
ATOM   871  N N   . GLN A 1 112 ? 4.237  2.054   9.890   1.00 61.05 ? 111  GLN A N   1 
ATOM   872  C CA  . GLN A 1 112 ? 3.819  3.442   10.043  1.00 62.74 ? 111  GLN A CA  1 
ATOM   873  C C   . GLN A 1 112 ? 3.697  4.126   8.685   1.00 63.42 ? 111  GLN A C   1 
ATOM   874  O O   . GLN A 1 112 ? 3.317  5.297   8.591   1.00 64.53 ? 111  GLN A O   1 
ATOM   875  C CB  . GLN A 1 112 ? 4.832  4.181   10.919  1.00 63.53 ? 111  GLN A CB  1 
ATOM   876  C CG  . GLN A 1 112 ? 4.622  5.676   11.044  1.00 66.01 ? 111  GLN A CG  1 
ATOM   877  C CD  . GLN A 1 112 ? 5.729  6.470   10.376  1.00 69.84 ? 111  GLN A CD  1 
ATOM   878  O OE1 . GLN A 1 112 ? 6.350  6.007   9.419   1.00 72.52 ? 111  GLN A OE1 1 
ATOM   879  N NE2 . GLN A 1 112 ? 6.007  7.658   10.898  1.00 72.31 ? 111  GLN A NE2 1 
ATOM   880  N N   . ASN B 1 3   ? 41.701 -4.828  17.740  1.00 73.30 ? 1002 ASN B N   1 
ATOM   881  C CA  . ASN B 1 3   ? 40.219 -4.990  17.580  1.00 72.62 ? 1002 ASN B CA  1 
ATOM   882  C C   . ASN B 1 3   ? 39.630 -3.739  16.916  1.00 71.97 ? 1002 ASN B C   1 
ATOM   883  O O   . ASN B 1 3   ? 40.159 -2.644  17.097  1.00 72.11 ? 1002 ASN B O   1 
ATOM   884  C CB  . ASN B 1 3   ? 39.555 -5.216  18.949  1.00 73.63 ? 1002 ASN B CB  1 
ATOM   885  C CG  . ASN B 1 3   ? 40.242 -6.310  19.767  1.00 74.29 ? 1002 ASN B CG  1 
ATOM   886  O OD1 . ASN B 1 3   ? 41.465 -6.465  19.715  1.00 74.24 ? 1002 ASN B OD1 1 
ATOM   887  N ND2 . ASN B 1 3   ? 39.462 -7.061  20.527  1.00 74.04 ? 1002 ASN B ND2 1 
ATOM   888  N N   . ASN B 1 4   ? 38.605 -3.915  16.082  1.00 70.58 ? 1003 ASN B N   1 
ATOM   889  C CA  . ASN B 1 4   ? 37.963 -2.781  15.400  1.00 68.73 ? 1003 ASN B CA  1 
ATOM   890  C C   . ASN B 1 4   ? 36.988 -2.026  16.310  1.00 66.87 ? 1003 ASN B C   1 
ATOM   891  O O   . ASN B 1 4   ? 36.445 -2.600  17.250  1.00 65.85 ? 1003 ASN B O   1 
ATOM   892  C CB  . ASN B 1 4   ? 37.231 -3.253  14.124  1.00 70.17 ? 1003 ASN B CB  1 
ATOM   893  C CG  . ASN B 1 4   ? 35.857 -3.874  14.409  1.00 69.92 ? 1003 ASN B CG  1 
ATOM   894  O OD1 . ASN B 1 4   ? 34.871 -3.169  14.609  1.00 67.73 ? 1003 ASN B OD1 1 
ATOM   895  N ND2 . ASN B 1 4   ? 35.778 -5.189  14.335  1.00 72.17 ? 1003 ASN B ND2 1 
ATOM   896  N N   . ASN B 1 5   ? 36.789 -0.741  16.035  1.00 64.53 ? 1004 ASN B N   1 
ATOM   897  C CA  . ASN B 1 5   ? 35.680 0.002   16.625  1.00 62.42 ? 1004 ASN B CA  1 
ATOM   898  C C   . ASN B 1 5   ? 34.665 0.410   15.555  1.00 61.17 ? 1004 ASN B C   1 
ATOM   899  O O   . ASN B 1 5   ? 34.004 1.445   15.670  1.00 60.51 ? 1004 ASN B O   1 
ATOM   900  C CB  . ASN B 1 5   ? 36.187 1.242   17.387  1.00 63.19 ? 1004 ASN B CB  1 
ATOM   901  C CG  . ASN B 1 5   ? 36.745 2.324   16.464  1.00 64.18 ? 1004 ASN B CG  1 
ATOM   902  O OD1 . ASN B 1 5   ? 37.255 2.036   15.381  1.00 64.13 ? 1004 ASN B OD1 1 
ATOM   903  N ND2 . ASN B 1 5   ? 36.684 3.571   16.913  1.00 62.31 ? 1004 ASN B ND2 1 
ATOM   904  N N   . MET B 1 6   ? 34.546 -0.422  14.520  1.00 59.61 ? 1005 MET B N   1 
ATOM   905  C CA  . MET B 1 6   ? 33.541 -0.223  13.471  1.00 56.60 ? 1005 MET B CA  1 
ATOM   906  C C   . MET B 1 6   ? 32.147 -0.634  13.922  1.00 51.98 ? 1005 MET B C   1 
ATOM   907  O O   . MET B 1 6   ? 31.208 0.146   13.824  1.00 52.24 ? 1005 MET B O   1 
ATOM   908  C CB  . MET B 1 6   ? 33.890 -1.015  12.204  1.00 59.95 ? 1005 MET B CB  1 
ATOM   909  C CG  . MET B 1 6   ? 32.805 -0.919  11.127  1.00 63.48 ? 1005 MET B CG  1 
ATOM   910  S SD  . MET B 1 6   ? 33.034 -1.998  9.709   1.00 68.86 ? 1005 MET B SD  1 
ATOM   911  C CE  . MET B 1 6   ? 34.640 -1.417  9.117   1.00 66.97 ? 1005 MET B CE  1 
ATOM   912  N N   . SER B 1 7   ? 32.007 -1.894  14.321  1.00 47.02 ? 1006 SER B N   1 
ATOM   913  C CA  . SER B 1 7   ? 30.726 -2.394  14.795  1.00 43.57 ? 1006 SER B CA  1 
ATOM   914  C C   . SER B 1 7   ? 30.207 -1.504  15.918  1.00 39.97 ? 1006 SER B C   1 
ATOM   915  O O   . SER B 1 7   ? 29.040 -1.104  15.911  1.00 41.45 ? 1006 SER B O   1 
ATOM   916  C CB  . SER B 1 7   ? 30.854 -3.839  15.304  1.00 46.90 ? 1006 SER B CB  1 
ATOM   917  O OG  . SER B 1 7   ? 31.659 -3.921  16.482  1.00 51.41 ? 1006 SER B OG  1 
ATOM   918  N N   . LEU B 1 8   ? 31.105 -1.092  16.802  1.00 33.98 ? 1007 LEU B N   1 
ATOM   919  C CA  . LEU B 1 8   ? 30.710 -0.291  17.943  1.00 30.99 ? 1007 LEU B CA  1 
ATOM   920  C C   . LEU B 1 8   ? 30.185 1.098   17.564  1.00 29.69 ? 1007 LEU B C   1 
ATOM   921  O O   . LEU B 1 8   ? 29.165 1.542   18.068  1.00 30.45 ? 1007 LEU B O   1 
ATOM   922  C CB  . LEU B 1 8   ? 31.890 -0.170  18.909  1.00 28.25 ? 1007 LEU B CB  1 
ATOM   923  C CG  . LEU B 1 8   ? 31.684 0.713   20.143  1.00 21.36 ? 1007 LEU B CG  1 
ATOM   924  C CD1 . LEU B 1 8   ? 30.469 0.221   20.914  1.00 18.80 ? 1007 LEU B CD1 1 
ATOM   925  C CD2 . LEU B 1 8   ? 32.939 0.684   20.981  1.00 20.74 ? 1007 LEU B CD2 1 
ATOM   926  N N   . GLN B 1 9   ? 30.828 1.748   16.607  1.00 30.59 ? 1008 GLN B N   1 
ATOM   927  C CA  . GLN B 1 9   ? 30.435 3.100   16.248  1.00 29.80 ? 1008 GLN B CA  1 
ATOM   928  C C   . GLN B 1 9   ? 29.086 3.148   15.548  1.00 28.33 ? 1008 GLN B C   1 
ATOM   929  O O   . GLN B 1 9   ? 28.394 4.154   15.636  1.00 31.50 ? 1008 GLN B O   1 
ATOM   930  C CB  . GLN B 1 9   ? 31.504 3.767   15.376  1.00 36.93 ? 1008 GLN B CB  1 
ATOM   931  C CG  . GLN B 1 9   ? 32.521 4.608   16.166  1.00 41.88 ? 1008 GLN B CG  1 
ATOM   932  C CD  . GLN B 1 9   ? 31.978 5.984   16.566  1.00 45.71 ? 1008 GLN B CD  1 
ATOM   933  O OE1 . GLN B 1 9   ? 30.860 6.359   16.208  1.00 47.84 ? 1008 GLN B OE1 1 
ATOM   934  N NE2 . GLN B 1 9   ? 32.769 6.735   17.319  1.00 44.52 ? 1008 GLN B NE2 1 
ATOM   935  N N   . ASN B 1 10  ? 28.685 2.057   14.896  1.00 22.07 ? 1009 ASN B N   1 
ATOM   936  C CA  . ASN B 1 10  ? 27.376 2.018   14.225  1.00 20.59 ? 1009 ASN B CA  1 
ATOM   937  C C   . ASN B 1 10  ? 26.300 1.449   15.132  1.00 21.85 ? 1009 ASN B C   1 
ATOM   938  O O   . ASN B 1 10  ? 25.156 1.261   14.703  1.00 24.41 ? 1009 ASN B O   1 
ATOM   939  C CB  . ASN B 1 10  ? 27.418 1.169   12.939  1.00 22.30 ? 1009 ASN B CB  1 
ATOM   940  C CG  . ASN B 1 10  ? 28.413 1.688   11.928  1.00 23.40 ? 1009 ASN B CG  1 
ATOM   941  O OD1 . ASN B 1 10  ? 28.453 2.884   11.627  1.00 18.28 ? 1009 ASN B OD1 1 
ATOM   942  N ND2 . ASN B 1 10  ? 29.315 0.830   11.507  1.00 26.55 ? 1009 ASN B ND2 1 
ATOM   943  N N   . ALA B 1 11  ? 26.700 0.986   16.309  1.00 24.49 ? 1010 ALA B N   1 
ATOM   944  C CA  . ALA B 1 11  ? 25.753 0.448   17.268  1.00 26.00 ? 1010 ALA B CA  1 
ATOM   945  C C   . ALA B 1 11  ? 24.794 1.561   17.632  1.00 26.18 ? 1010 ALA B C   1 
ATOM   946  O O   . ALA B 1 11  ? 25.229 2.645   17.988  1.00 29.45 ? 1010 ALA B O   1 
ATOM   947  C CB  . ALA B 1 11  ? 26.499 -0.037  18.503  1.00 24.59 ? 1010 ALA B CB  1 
ATOM   948  N N   . GLU B 1 12  ? 23.494 1.306   17.517  1.00 27.34 ? 1011 GLU B N   1 
ATOM   949  C CA  . GLU B 1 12  ? 22.483 2.338   17.779  1.00 31.46 ? 1011 GLU B CA  1 
ATOM   950  C C   . GLU B 1 12  ? 22.486 2.865   19.213  1.00 32.08 ? 1011 GLU B C   1 
ATOM   951  O O   . GLU B 1 12  ? 21.919 3.936   19.487  1.00 31.42 ? 1011 GLU B O   1 
ATOM   952  C CB  . GLU B 1 12  ? 21.081 1.805   17.476  1.00 30.72 ? 1011 GLU B CB  1 
ATOM   953  C CG  . GLU B 1 12  ? 20.675 0.634   18.331  1.00 31.91 ? 1011 GLU B CG  1 
ATOM   954  C CD  . GLU B 1 12  ? 19.229 0.226   18.133  1.00 34.91 ? 1011 GLU B CD  1 
ATOM   955  O OE1 . GLU B 1 12  ? 18.884 -0.916  18.502  1.00 40.53 ? 1011 GLU B OE1 1 
ATOM   956  O OE2 . GLU B 1 12  ? 18.421 1.048   17.649  1.00 37.82 ? 1011 GLU B OE2 1 
ATOM   957  N N   . TRP B 1 13  ? 22.994 2.038   20.129  1.00 30.23 ? 1012 TRP B N   1 
ATOM   958  C CA  . TRP B 1 13  ? 22.965 2.325   21.561  1.00 28.85 ? 1012 TRP B CA  1 
ATOM   959  C C   . TRP B 1 13  ? 24.235 2.972   22.108  1.00 27.17 ? 1012 TRP B C   1 
ATOM   960  O O   . TRP B 1 13  ? 24.297 3.319   23.277  1.00 30.05 ? 1012 TRP B O   1 
ATOM   961  C CB  . TRP B 1 13  ? 22.669 1.044   22.341  1.00 26.92 ? 1012 TRP B CB  1 
ATOM   962  C CG  . TRP B 1 13  ? 23.332 -0.188  21.777  1.00 23.03 ? 1012 TRP B CG  1 
ATOM   963  C CD1 . TRP B 1 13  ? 22.726 -1.200  21.089  1.00 19.51 ? 1012 TRP B CD1 1 
ATOM   964  C CD2 . TRP B 1 13  ? 24.703 -0.579  21.947  1.00 20.04 ? 1012 TRP B CD2 1 
ATOM   965  N NE1 . TRP B 1 13  ? 23.630 -2.214  20.842  1.00 15.52 ? 1012 TRP B NE1 1 
ATOM   966  C CE2 . TRP B 1 13  ? 24.847 -1.867  21.370  1.00 16.64 ? 1012 TRP B CE2 1 
ATOM   967  C CE3 . TRP B 1 13  ? 25.825 0.024   22.538  1.00 14.62 ? 1012 TRP B CE3 1 
ATOM   968  C CZ2 . TRP B 1 13  ? 26.061 -2.556  21.367  1.00 15.46 ? 1012 TRP B CZ2 1 
ATOM   969  C CZ3 . TRP B 1 13  ? 27.032 -0.657  22.535  1.00 17.49 ? 1012 TRP B CZ3 1 
ATOM   970  C CH2 . TRP B 1 13  ? 27.140 -1.935  21.945  1.00 16.55 ? 1012 TRP B CH2 1 
ATOM   971  N N   . TYR B 1 14  ? 25.271 3.072   21.291  1.00 26.84 ? 1013 TYR B N   1 
ATOM   972  C CA  . TYR B 1 14  ? 26.507 3.724   21.707  1.00 26.89 ? 1013 TYR B CA  1 
ATOM   973  C C   . TYR B 1 14  ? 26.409 5.195   21.353  1.00 27.41 ? 1013 TYR B C   1 
ATOM   974  O O   . TYR B 1 14  ? 26.110 5.533   20.214  1.00 33.00 ? 1013 TYR B O   1 
ATOM   975  C CB  . TYR B 1 14  ? 27.706 3.082   20.999  1.00 24.83 ? 1013 TYR B CB  1 
ATOM   976  C CG  . TYR B 1 14  ? 29.024 3.821   21.142  1.00 27.12 ? 1013 TYR B CG  1 
ATOM   977  C CD1 . TYR B 1 14  ? 29.691 3.890   22.370  1.00 27.98 ? 1013 TYR B CD1 1 
ATOM   978  C CD2 . TYR B 1 14  ? 29.628 4.416   20.031  1.00 31.74 ? 1013 TYR B CD2 1 
ATOM   979  C CE1 . TYR B 1 14  ? 30.925 4.535   22.487  1.00 29.05 ? 1013 TYR B CE1 1 
ATOM   980  C CE2 . TYR B 1 14  ? 30.867 5.063   20.135  1.00 31.47 ? 1013 TYR B CE2 1 
ATOM   981  C CZ  . TYR B 1 14  ? 31.506 5.120   21.365  1.00 31.51 ? 1013 TYR B CZ  1 
ATOM   982  O OH  . TYR B 1 14  ? 32.715 5.771   21.459  1.00 30.85 ? 1013 TYR B OH  1 
ATOM   983  N N   . TRP B 1 15  ? 26.620 6.069   22.332  1.00 24.41 ? 1014 TRP B N   1 
ATOM   984  C CA  . TRP B 1 15  ? 26.571 7.503   22.071  1.00 22.01 ? 1014 TRP B CA  1 
ATOM   985  C C   . TRP B 1 15  ? 27.902 8.238   22.207  1.00 23.21 ? 1014 TRP B C   1 
ATOM   986  O O   . TRP B 1 15  ? 27.937 9.458   22.309  1.00 26.01 ? 1014 TRP B O   1 
ATOM   987  C CB  . TRP B 1 15  ? 25.564 8.180   22.974  1.00 18.28 ? 1014 TRP B CB  1 
ATOM   988  C CG  . TRP B 1 15  ? 24.187 7.734   22.754  1.00 18.50 ? 1014 TRP B CG  1 
ATOM   989  C CD1 . TRP B 1 15  ? 23.672 6.491   22.972  1.00 19.98 ? 1014 TRP B CD1 1 
ATOM   990  C CD2 . TRP B 1 15  ? 23.106 8.552   22.306  1.00 17.37 ? 1014 TRP B CD2 1 
ATOM   991  N NE1 . TRP B 1 15  ? 22.314 6.489   22.672  1.00 20.91 ? 1014 TRP B NE1 1 
ATOM   992  C CE2 . TRP B 1 15  ? 21.946 7.740   22.267  1.00 16.43 ? 1014 TRP B CE2 1 
ATOM   993  C CE3 . TRP B 1 15  ? 23.004 9.897   21.920  1.00 13.12 ? 1014 TRP B CE3 1 
ATOM   994  C CZ2 . TRP B 1 15  ? 20.716 8.225   21.871  1.00 17.51 ? 1014 TRP B CZ2 1 
ATOM   995  C CZ3 . TRP B 1 15  ? 21.786 10.374  21.523  1.00 16.55 ? 1014 TRP B CZ3 1 
ATOM   996  C CH2 . TRP B 1 15  ? 20.648 9.537   21.503  1.00 20.14 ? 1014 TRP B CH2 1 
ATOM   997  N N   . GLY B 1 16  ? 29.005 7.507   22.215  1.00 25.79 ? 1015 GLY B N   1 
ATOM   998  C CA  . GLY B 1 16  ? 30.305 8.155   22.292  1.00 26.63 ? 1015 GLY B CA  1 
ATOM   999  C C   . GLY B 1 16  ? 30.495 9.027   23.517  1.00 28.96 ? 1015 GLY B C   1 
ATOM   1000 O O   . GLY B 1 16  ? 30.189 8.652   24.630  1.00 30.46 ? 1015 GLY B O   1 
ATOM   1001 N N   . ASP B 1 17  ? 30.959 10.236  23.283  1.00 35.09 ? 1016 ASP B N   1 
ATOM   1002 C CA  . ASP B 1 17  ? 31.457 11.103  24.334  1.00 36.26 ? 1016 ASP B CA  1 
ATOM   1003 C C   . ASP B 1 17  ? 30.400 12.070  24.810  1.00 34.98 ? 1016 ASP B C   1 
ATOM   1004 O O   . ASP B 1 17  ? 30.550 13.271  24.644  1.00 39.81 ? 1016 ASP B O   1 
ATOM   1005 C CB  . ASP B 1 17  ? 32.656 11.886  23.817  1.00 43.42 ? 1016 ASP B CB  1 
ATOM   1006 C CG  . ASP B 1 17  ? 33.396 12.602  24.915  1.00 52.31 ? 1016 ASP B CG  1 
ATOM   1007 O OD1 . ASP B 1 17  ? 34.334 11.997  25.484  1.00 59.59 ? 1016 ASP B OD1 1 
ATOM   1008 O OD2 . ASP B 1 17  ? 33.063 13.777  25.186  1.00 56.30 ? 1016 ASP B OD2 1 
ATOM   1009 N N   . ILE B 1 18  ? 29.306 11.561  25.365  1.00 32.85 ? 1017 ILE B N   1 
ATOM   1010 C CA  . ILE B 1 18  ? 28.368 12.438  26.068  1.00 29.43 ? 1017 ILE B CA  1 
ATOM   1011 C C   . ILE B 1 18  ? 28.535 12.452  27.608  1.00 29.15 ? 1017 ILE B C   1 
ATOM   1012 O O   . ILE B 1 18  ? 29.306 11.671  28.179  1.00 27.26 ? 1017 ILE B O   1 
ATOM   1013 C CB  . ILE B 1 18  ? 26.919 12.126  25.690  1.00 27.75 ? 1017 ILE B CB  1 
ATOM   1014 C CG1 . ILE B 1 18  ? 26.564 10.673  26.019  1.00 26.85 ? 1017 ILE B CG1 1 
ATOM   1015 C CG2 . ILE B 1 18  ? 26.726 12.389  24.200  1.00 25.22 ? 1017 ILE B CG2 1 
ATOM   1016 C CD1 . ILE B 1 18  ? 25.063 10.416  26.082  1.00 23.57 ? 1017 ILE B CD1 1 
ATOM   1017 N N   . SER B 1 19  ? 27.902 13.415  28.261  1.00 27.62 ? 1018 SER B N   1 
ATOM   1018 C CA  . SER B 1 19  ? 28.072 13.581  29.695  1.00 27.96 ? 1018 SER B CA  1 
ATOM   1019 C C   . SER B 1 19  ? 27.045 12.777  30.505  1.00 27.76 ? 1018 SER B C   1 
ATOM   1020 O O   . SER B 1 19  ? 25.933 12.553  30.038  1.00 30.55 ? 1018 SER B O   1 
ATOM   1021 C CB  . SER B 1 19  ? 27.926 15.056  30.048  1.00 27.08 ? 1018 SER B CB  1 
ATOM   1022 O OG  . SER B 1 19  ? 26.565 15.458  29.885  1.00 32.81 ? 1018 SER B OG  1 
ATOM   1023 N N   . ARG B 1 20  ? 27.345 12.538  31.783  1.00 25.95 ? 1019 ARG B N   1 
ATOM   1024 C CA  . ARG B 1 20  ? 26.399 11.918  32.729  1.00 26.73 ? 1019 ARG B CA  1 
ATOM   1025 C C   . ARG B 1 20  ? 25.033 12.585  32.733  1.00 27.38 ? 1019 ARG B C   1 
ATOM   1026 O O   . ARG B 1 20  ? 24.002 11.931  32.855  1.00 27.39 ? 1019 ARG B O   1 
ATOM   1027 C CB  . ARG B 1 20  ? 26.960 11.992  34.143  1.00 29.36 ? 1019 ARG B CB  1 
ATOM   1028 C CG  . ARG B 1 20  ? 27.090 10.680  34.863  1.00 30.91 ? 1019 ARG B CG  1 
ATOM   1029 C CD  . ARG B 1 20  ? 27.149 10.952  36.343  1.00 33.11 ? 1019 ARG B CD  1 
ATOM   1030 N NE  . ARG B 1 20  ? 27.846 9.916   37.090  1.00 35.83 ? 1019 ARG B NE  1 
ATOM   1031 C CZ  . ARG B 1 20  ? 29.132 9.627   36.934  1.00 38.16 ? 1019 ARG B CZ  1 
ATOM   1032 N NH1 . ARG B 1 20  ? 29.725 8.776   37.765  1.00 36.33 ? 1019 ARG B NH1 1 
ATOM   1033 N NH2 . ARG B 1 20  ? 29.814 10.164  35.926  1.00 37.95 ? 1019 ARG B NH2 1 
ATOM   1034 N N   . GLU B 1 21  ? 25.039 13.906  32.618  1.00 29.70 ? 1020 GLU B N   1 
ATOM   1035 C CA  . GLU B 1 21  ? 23.823 14.712  32.703  1.00 33.04 ? 1020 GLU B CA  1 
ATOM   1036 C C   . GLU B 1 21  ? 22.951 14.585  31.455  1.00 33.39 ? 1020 GLU B C   1 
ATOM   1037 O O   . GLU B 1 21  ? 21.720 14.577  31.548  1.00 32.50 ? 1020 GLU B O   1 
ATOM   1038 C CB  . GLU B 1 21  ? 24.198 16.176  32.937  1.00 39.31 ? 1020 GLU B CB  1 
ATOM   1039 C CG  . GLU B 1 21  ? 23.015 17.058  33.248  1.00 46.03 ? 1020 GLU B CG  1 
ATOM   1040 C CD  . GLU B 1 21  ? 23.340 18.539  33.188  1.00 51.76 ? 1020 GLU B CD  1 
ATOM   1041 O OE1 . GLU B 1 21  ? 24.266 18.941  32.434  1.00 52.99 ? 1020 GLU B OE1 1 
ATOM   1042 O OE2 . GLU B 1 21  ? 22.598 19.315  33.831  1.00 53.55 ? 1020 GLU B OE2 1 
ATOM   1043 N N   . GLU B 1 22  ? 23.599 14.457  30.297  1.00 34.29 ? 1021 GLU B N   1 
ATOM   1044 C CA  . GLU B 1 22  ? 22.923 14.131  29.037  1.00 36.52 ? 1021 GLU B CA  1 
ATOM   1045 C C   . GLU B 1 22  ? 22.241 12.765  29.082  1.00 34.40 ? 1021 GLU B C   1 
ATOM   1046 O O   . GLU B 1 22  ? 21.041 12.656  28.833  1.00 36.04 ? 1021 GLU B O   1 
ATOM   1047 C CB  . GLU B 1 22  ? 23.925 14.178  27.873  1.00 37.56 ? 1021 GLU B CB  1 
ATOM   1048 C CG  . GLU B 1 22  ? 24.437 15.580  27.581  1.00 42.47 ? 1021 GLU B CG  1 
ATOM   1049 C CD  . GLU B 1 22  ? 25.419 15.624  26.443  1.00 45.33 ? 1021 GLU B CD  1 
ATOM   1050 O OE1 . GLU B 1 22  ? 24.986 15.426  25.285  1.00 53.67 ? 1021 GLU B OE1 1 
ATOM   1051 O OE2 . GLU B 1 22  ? 26.623 15.879  26.686  1.00 45.60 ? 1021 GLU B OE2 1 
ATOM   1052 N N   . VAL B 1 23  ? 22.980 11.753  29.524  1.00 32.65 ? 1022 VAL B N   1 
ATOM   1053 C CA  . VAL B 1 23  ? 22.432 10.413  29.699  1.00 32.33 ? 1022 VAL B CA  1 
ATOM   1054 C C   . VAL B 1 23  ? 21.208 10.413  30.617  1.00 32.83 ? 1022 VAL B C   1 
ATOM   1055 O O   . VAL B 1 23  ? 20.211 9.743   30.334  1.00 31.84 ? 1022 VAL B O   1 
ATOM   1056 C CB  . VAL B 1 23  ? 23.493 9.474   30.284  1.00 33.09 ? 1022 VAL B CB  1 
ATOM   1057 C CG1 . VAL B 1 23  ? 22.902 8.111   30.582  1.00 36.18 ? 1022 VAL B CG1 1 
ATOM   1058 C CG2 . VAL B 1 23  ? 24.645 9.348   29.315  1.00 35.11 ? 1022 VAL B CG2 1 
ATOM   1059 N N   . ASN B 1 24  ? 21.262 11.214  31.681  1.00 32.59 ? 1023 ASN B N   1 
ATOM   1060 C CA  . ASN B 1 24  ? 20.160 11.303  32.630  1.00 32.41 ? 1023 ASN B CA  1 
ATOM   1061 C C   . ASN B 1 24  ? 18.888 11.832  31.992  1.00 33.13 ? 1023 ASN B C   1 
ATOM   1062 O O   . ASN B 1 24  ? 17.785 11.345  32.290  1.00 35.96 ? 1023 ASN B O   1 
ATOM   1063 C CB  . ASN B 1 24  ? 20.548 12.180  33.813  1.00 32.23 ? 1023 ASN B CB  1 
ATOM   1064 C CG  . ASN B 1 24  ? 21.545 11.507  34.735  1.00 34.59 ? 1023 ASN B CG  1 
ATOM   1065 O OD1 . ASN B 1 24  ? 21.734 10.294  34.694  1.00 37.66 ? 1023 ASN B OD1 1 
ATOM   1066 N ND2 . ASN B 1 24  ? 22.163 12.290  35.601  1.00 38.78 ? 1023 ASN B ND2 1 
ATOM   1067 N N   . GLU B 1 25  ? 19.037 12.779  31.067  1.00 31.47 ? 1024 GLU B N   1 
ATOM   1068 C CA  . GLU B 1 25  ? 17.896 13.284  30.301  1.00 31.54 ? 1024 GLU B CA  1 
ATOM   1069 C C   . GLU B 1 25  ? 17.246 12.179  29.486  1.00 31.17 ? 1024 GLU B C   1 
ATOM   1070 O O   . GLU B 1 25  ? 16.035 12.153  29.319  1.00 32.20 ? 1024 GLU B O   1 
ATOM   1071 C CB  . GLU B 1 25  ? 18.338 14.407  29.354  1.00 33.14 ? 1024 GLU B CB  1 
ATOM   1072 C CG  . GLU B 1 25  ? 18.292 15.803  29.950  1.00 40.39 ? 1024 GLU B CG  1 
ATOM   1073 C CD  . GLU B 1 25  ? 16.932 16.179  30.535  1.00 42.76 ? 1024 GLU B CD  1 
ATOM   1074 O OE1 . GLU B 1 25  ? 15.902 15.809  29.938  1.00 41.14 ? 1024 GLU B OE1 1 
ATOM   1075 O OE2 . GLU B 1 25  ? 16.892 16.896  31.566  1.00 42.69 ? 1024 GLU B OE2 1 
ATOM   1076 N N   . LYS B 1 26  ? 18.084 11.357  28.864  1.00 31.22 ? 1025 LYS B N   1 
ATOM   1077 C CA  . LYS B 1 26  ? 17.625 10.298  27.981  1.00 30.47 ? 1025 LYS B CA  1 
ATOM   1078 C C   . LYS B 1 26  ? 16.939 9.194   28.760  1.00 31.17 ? 1025 LYS B C   1 
ATOM   1079 O O   . LYS B 1 26  ? 15.931 8.634   28.306  1.00 31.62 ? 1025 LYS B O   1 
ATOM   1080 C CB  . LYS B 1 26  ? 18.801 9.717   27.203  1.00 30.74 ? 1025 LYS B CB  1 
ATOM   1081 C CG  . LYS B 1 26  ? 19.374 10.680  26.184  1.00 31.73 ? 1025 LYS B CG  1 
ATOM   1082 C CD  . LYS B 1 26  ? 20.589 10.103  25.493  1.00 33.46 ? 1025 LYS B CD  1 
ATOM   1083 C CE  . LYS B 1 26  ? 21.458 11.216  24.933  1.00 34.89 ? 1025 LYS B CE  1 
ATOM   1084 N NZ  . LYS B 1 26  ? 20.718 12.110  24.006  1.00 38.01 ? 1025 LYS B NZ  1 
ATOM   1085 N N   . LEU B 1 27  ? 17.486 8.888   29.939  1.00 31.35 ? 1026 LEU B N   1 
ATOM   1086 C CA  . LEU B 1 27  ? 16.985 7.785   30.739  1.00 31.64 ? 1026 LEU B CA  1 
ATOM   1087 C C   . LEU B 1 27  ? 15.856 8.198   31.681  1.00 32.87 ? 1026 LEU B C   1 
ATOM   1088 O O   . LEU B 1 27  ? 15.098 7.347   32.163  1.00 35.21 ? 1026 LEU B O   1 
ATOM   1089 C CB  . LEU B 1 27  ? 18.132 7.128   31.523  1.00 30.26 ? 1026 LEU B CB  1 
ATOM   1090 C CG  . LEU B 1 27  ? 19.164 6.295   30.727  1.00 28.11 ? 1026 LEU B CG  1 
ATOM   1091 C CD1 . LEU B 1 27  ? 19.834 5.288   31.638  1.00 30.62 ? 1026 LEU B CD1 1 
ATOM   1092 C CD2 . LEU B 1 27  ? 18.482 5.566   29.573  1.00 28.43 ? 1026 LEU B CD2 1 
ATOM   1093 N N   . ARG B 1 28  ? 15.630 9.496   31.808  1.00 30.78 ? 1027 ARG B N   1 
ATOM   1094 C CA  . ARG B 1 28  ? 14.529 9.966   32.632  1.00 34.76 ? 1027 ARG B CA  1 
ATOM   1095 C C   . ARG B 1 28  ? 13.182 9.343   32.285  1.00 34.82 ? 1027 ARG B C   1 
ATOM   1096 O O   . ARG B 1 28  ? 12.716 9.423   31.156  1.00 38.13 ? 1027 ARG B O   1 
ATOM   1097 C CB  . ARG B 1 28  ? 14.402 11.492  32.581  1.00 36.34 ? 1027 ARG B CB  1 
ATOM   1098 C CG  . ARG B 1 28  ? 13.299 12.026  33.501  1.00 40.24 ? 1027 ARG B CG  1 
ATOM   1099 C CD  . ARG B 1 28  ? 13.486 13.496  33.851  1.00 44.72 ? 1027 ARG B CD  1 
ATOM   1100 N NE  . ARG B 1 28  ? 14.881 13.838  34.120  1.00 46.75 ? 1027 ARG B NE  1 
ATOM   1101 C CZ  . ARG B 1 28  ? 15.505 14.883  33.586  1.00 47.85 ? 1027 ARG B CZ  1 
ATOM   1102 N NH1 . ARG B 1 28  ? 16.802 15.082  33.812  1.00 44.37 ? 1027 ARG B NH1 1 
ATOM   1103 N NH2 . ARG B 1 28  ? 14.824 15.742  32.837  1.00 49.69 ? 1027 ARG B NH2 1 
ATOM   1104 N N   . ASP B 1 29  ? 12.581 8.694   33.272  1.00 36.56 ? 1028 ASP B N   1 
ATOM   1105 C CA  . ASP B 1 29  ? 11.195 8.257   33.197  1.00 38.81 ? 1028 ASP B CA  1 
ATOM   1106 C C   . ASP B 1 29  ? 10.971 7.078   32.284  1.00 36.91 ? 1028 ASP B C   1 
ATOM   1107 O O   . ASP B 1 29  ? 9.830  6.746   31.984  1.00 35.70 ? 1028 ASP B O   1 
ATOM   1108 C CB  . ASP B 1 29  ? 10.287 9.403   32.758  1.00 46.29 ? 1028 ASP B CB  1 
ATOM   1109 C CG  . ASP B 1 29  ? 10.077 10.438  33.847  1.00 53.95 ? 1028 ASP B CG  1 
ATOM   1110 O OD1 . ASP B 1 29  ? 10.393 10.165  35.029  1.00 57.66 ? 1028 ASP B OD1 1 
ATOM   1111 O OD2 . ASP B 1 29  ? 9.607  11.546  33.508  1.00 60.27 ? 1028 ASP B OD2 1 
ATOM   1112 N N   . THR B 1 30  ? 12.049 6.355   31.998  1.00 36.33 ? 1029 THR B N   1 
ATOM   1113 C CA  . THR B 1 30  ? 12.006 5.191   31.127  1.00 36.08 ? 1029 THR B CA  1 
ATOM   1114 C C   . THR B 1 30  ? 11.849 3.869   31.896  1.00 36.56 ? 1029 THR B C   1 
ATOM   1115 O O   . THR B 1 30  ? 12.177 3.788   33.076  1.00 35.92 ? 1029 THR B O   1 
ATOM   1116 C CB  . THR B 1 30  ? 13.279 5.119   30.278  1.00 36.24 ? 1029 THR B CB  1 
ATOM   1117 O OG1 . THR B 1 30  ? 14.409 4.936   31.135  1.00 37.73 ? 1029 THR B OG1 1 
ATOM   1118 C CG2 . THR B 1 30  ? 13.458 6.405   29.467  1.00 34.42 ? 1029 THR B CG2 1 
ATOM   1119 N N   . ALA B 1 31  ? 11.385 2.827   31.207  1.00 36.04 ? 1030 ALA B N   1 
ATOM   1120 C CA  . ALA B 1 31  ? 11.233 1.501   31.808  1.00 33.79 ? 1030 ALA B CA  1 
ATOM   1121 C C   . ALA B 1 31  ? 12.555 0.888   32.247  1.00 35.07 ? 1030 ALA B C   1 
ATOM   1122 O O   . ALA B 1 31  ? 13.633 1.269   31.767  1.00 33.49 ? 1030 ALA B O   1 
ATOM   1123 C CB  . ALA B 1 31  ? 10.550 0.569   30.842  1.00 31.11 ? 1030 ALA B CB  1 
ATOM   1124 N N   . ASP B 1 32  ? 12.455 -0.118  33.113  1.00 36.62 ? 1031 ASP B N   1 
ATOM   1125 C CA  . ASP B 1 32  ? 13.617 -0.921  33.521  1.00 34.26 ? 1031 ASP B CA  1 
ATOM   1126 C C   . ASP B 1 32  ? 14.108 -1.736  32.320  1.00 30.58 ? 1031 ASP B C   1 
ATOM   1127 O O   . ASP B 1 32  ? 13.291 -2.222  31.523  1.00 29.53 ? 1031 ASP B O   1 
ATOM   1128 C CB  . ASP B 1 32  ? 13.224 -1.870  34.672  1.00 36.75 ? 1031 ASP B CB  1 
ATOM   1129 C CG  . ASP B 1 32  ? 13.139 -1.167  36.041  1.00 36.88 ? 1031 ASP B CG  1 
ATOM   1130 O OD1 . ASP B 1 32  ? 13.303 0.074   36.151  1.00 32.28 ? 1031 ASP B OD1 1 
ATOM   1131 O OD2 . ASP B 1 32  ? 12.915 -1.895  37.026  1.00 40.25 ? 1031 ASP B OD2 1 
ATOM   1132 N N   . GLY B 1 33  ? 15.423 -1.783  32.132  1.00 26.91 ? 1032 GLY B N   1 
ATOM   1133 C CA  . GLY B 1 33  ? 15.984 -2.475  30.981  1.00 24.57 ? 1032 GLY B CA  1 
ATOM   1134 C C   . GLY B 1 33  ? 16.456 -1.531  29.877  1.00 22.43 ? 1032 GLY B C   1 
ATOM   1135 O O   . GLY B 1 33  ? 17.168 -1.952  28.945  1.00 18.09 ? 1032 GLY B O   1 
ATOM   1136 N N   . THR B 1 34  ? 16.064 -0.260  29.986  1.00 19.86 ? 1033 THR B N   1 
ATOM   1137 C CA  . THR B 1 34  ? 16.525 0.769   29.068  1.00 21.22 ? 1033 THR B CA  1 
ATOM   1138 C C   . THR B 1 34  ? 18.003 1.070   29.356  1.00 23.17 ? 1033 THR B C   1 
ATOM   1139 O O   . THR B 1 34  ? 18.432 1.064   30.495  1.00 26.34 ? 1033 THR B O   1 
ATOM   1140 C CB  . THR B 1 34  ? 15.694 2.058   29.236  1.00 22.84 ? 1033 THR B CB  1 
ATOM   1141 O OG1 . THR B 1 34  ? 14.294 1.774   29.090  1.00 20.23 ? 1033 THR B OG1 1 
ATOM   1142 C CG2 . THR B 1 34  ? 16.109 3.119   28.218  1.00 20.26 ? 1033 THR B CG2 1 
ATOM   1143 N N   . PHE B 1 35  ? 18.804 1.213   28.314  1.00 24.05 ? 1034 PHE B N   1 
ATOM   1144 C CA  . PHE B 1 35  ? 20.244 1.333   28.508  1.00 22.38 ? 1034 PHE B CA  1 
ATOM   1145 C C   . PHE B 1 35  ? 20.909 2.079   27.362  1.00 22.23 ? 1034 PHE B C   1 
ATOM   1146 O O   . PHE B 1 35  ? 20.411 2.056   26.225  1.00 23.74 ? 1034 PHE B O   1 
ATOM   1147 C CB  . PHE B 1 35  ? 20.871 -0.064  28.636  1.00 21.07 ? 1034 PHE B CB  1 
ATOM   1148 C CG  . PHE B 1 35  ? 20.958 -0.826  27.329  1.00 21.99 ? 1034 PHE B CG  1 
ATOM   1149 C CD1 . PHE B 1 35  ? 22.135 -0.845  26.585  1.00 20.69 ? 1034 PHE B CD1 1 
ATOM   1150 C CD2 . PHE B 1 35  ? 19.855 -1.506  26.833  1.00 22.85 ? 1034 PHE B CD2 1 
ATOM   1151 C CE1 . PHE B 1 35  ? 22.212 -1.519  25.371  1.00 16.85 ? 1034 PHE B CE1 1 
ATOM   1152 C CE2 . PHE B 1 35  ? 19.922 -2.195  25.616  1.00 19.44 ? 1034 PHE B CE2 1 
ATOM   1153 C CZ  . PHE B 1 35  ? 21.098 -2.201  24.890  1.00 16.68 ? 1034 PHE B CZ  1 
ATOM   1154 N N   . LEU B 1 36  ? 22.071 2.664   27.637  1.00 19.66 ? 1035 LEU B N   1 
ATOM   1155 C CA  . LEU B 1 36  ? 22.967 3.085   26.569  1.00 22.93 ? 1035 LEU B CA  1 
ATOM   1156 C C   . LEU B 1 36  ? 24.413 2.929   26.995  1.00 22.37 ? 1035 LEU B C   1 
ATOM   1157 O O   . LEU B 1 36  ? 24.686 2.590   28.140  1.00 22.86 ? 1035 LEU B O   1 
ATOM   1158 C CB  . LEU B 1 36  ? 22.682 4.539   26.163  1.00 25.03 ? 1035 LEU B CB  1 
ATOM   1159 C CG  . LEU B 1 36  ? 22.802 5.677   27.181  1.00 24.61 ? 1035 LEU B CG  1 
ATOM   1160 C CD1 . LEU B 1 36  ? 24.230 6.219   27.193  1.00 23.30 ? 1035 LEU B CD1 1 
ATOM   1161 C CD2 . LEU B 1 36  ? 21.798 6.777   26.801  1.00 25.27 ? 1035 LEU B CD2 1 
ATOM   1162 N N   . VAL B 1 37  ? 25.337 3.111   26.059  1.00 23.39 ? 1036 VAL B N   1 
ATOM   1163 C CA  . VAL B 1 37  ? 26.772 3.038   26.356  1.00 23.07 ? 1036 VAL B CA  1 
ATOM   1164 C C   . VAL B 1 37  ? 27.518 4.322   25.915  1.00 25.83 ? 1036 VAL B C   1 
ATOM   1165 O O   . VAL B 1 37  ? 27.345 4.815   24.789  1.00 23.84 ? 1036 VAL B O   1 
ATOM   1166 C CB  . VAL B 1 37  ? 27.409 1.765   25.700  1.00 16.69 ? 1036 VAL B CB  1 
ATOM   1167 C CG1 . VAL B 1 37  ? 28.848 1.605   26.106  1.00 11.58 ? 1036 VAL B CG1 1 
ATOM   1168 C CG2 . VAL B 1 37  ? 26.617 0.526   26.101  1.00 14.11 ? 1036 VAL B CG2 1 
ATOM   1169 N N   . ARG B 1 38  ? 28.252 4.922   26.849  1.00 27.78 ? 1037 ARG B N   1 
ATOM   1170 C CA  . ARG B 1 38  ? 29.096 6.080   26.536  1.00 29.19 ? 1037 ARG B CA  1 
ATOM   1171 C C   . ARG B 1 38  ? 30.554 5.786   26.856  1.00 30.79 ? 1037 ARG B C   1 
ATOM   1172 O O   . ARG B 1 38  ? 30.890 4.730   27.381  1.00 30.05 ? 1037 ARG B O   1 
ATOM   1173 C CB  . ARG B 1 38  ? 28.641 7.315   27.326  1.00 32.64 ? 1037 ARG B CB  1 
ATOM   1174 C CG  . ARG B 1 38  ? 28.728 7.179   28.847  1.00 32.35 ? 1037 ARG B CG  1 
ATOM   1175 C CD  . ARG B 1 38  ? 28.380 8.485   29.549  1.00 31.94 ? 1037 ARG B CD  1 
ATOM   1176 N NE  . ARG B 1 38  ? 28.344 8.350   31.004  1.00 32.06 ? 1037 ARG B NE  1 
ATOM   1177 C CZ  . ARG B 1 38  ? 29.410 8.113   31.764  1.00 31.41 ? 1037 ARG B CZ  1 
ATOM   1178 N NH1 . ARG B 1 38  ? 29.268 7.949   33.079  1.00 28.93 ? 1037 ARG B NH1 1 
ATOM   1179 N NH2 . ARG B 1 38  ? 30.624 8.073   31.221  1.00 28.37 ? 1037 ARG B NH2 1 
ATOM   1180 N N   . ASP B 1 39  ? 31.428 6.709   26.503  1.00 33.56 ? 1038 ASP B N   1 
ATOM   1181 C CA  . ASP B 1 39  ? 32.823 6.576   26.879  1.00 37.81 ? 1038 ASP B CA  1 
ATOM   1182 C C   . ASP B 1 39  ? 32.977 6.780   28.380  1.00 38.44 ? 1038 ASP B C   1 
ATOM   1183 O O   . ASP B 1 39  ? 32.238 7.553   28.976  1.00 39.59 ? 1038 ASP B O   1 
ATOM   1184 C CB  . ASP B 1 39  ? 33.676 7.596   26.113  1.00 38.81 ? 1038 ASP B CB  1 
ATOM   1185 C CG  . ASP B 1 39  ? 33.512 7.485   24.619  1.00 38.25 ? 1038 ASP B CG  1 
ATOM   1186 O OD1 . ASP B 1 39  ? 33.465 6.350   24.112  1.00 41.11 ? 1038 ASP B OD1 1 
ATOM   1187 O OD2 . ASP B 1 39  ? 33.445 8.534   23.943  1.00 37.97 ? 1038 ASP B OD2 1 
ATOM   1188 N N   . ALA B 1 40  ? 33.905 6.053   28.991  1.00 39.59 ? 1039 ALA B N   1 
ATOM   1189 C CA  . ALA B 1 40  ? 34.242 6.273   30.391  1.00 42.74 ? 1039 ALA B CA  1 
ATOM   1190 C C   . ALA B 1 40  ? 34.783 7.687   30.600  1.00 45.12 ? 1039 ALA B C   1 
ATOM   1191 O O   . ALA B 1 40  ? 35.418 8.247   29.707  1.00 45.96 ? 1039 ALA B O   1 
ATOM   1192 C CB  . ALA B 1 40  ? 35.258 5.262   30.841  1.00 43.75 ? 1039 ALA B CB  1 
ATOM   1193 N N   . SER B 1 41  ? 34.522 8.259   31.776  1.00 47.74 ? 1040 SER B N   1 
ATOM   1194 C CA  . SER B 1 41  ? 35.011 9.595   32.114  1.00 49.38 ? 1040 SER B CA  1 
ATOM   1195 C C   . SER B 1 41  ? 36.531 9.616   32.204  1.00 50.53 ? 1040 SER B C   1 
ATOM   1196 O O   . SER B 1 41  ? 37.143 10.684  32.179  1.00 50.56 ? 1040 SER B O   1 
ATOM   1197 C CB  . SER B 1 41  ? 34.400 10.079  33.442  1.00 51.14 ? 1040 SER B CB  1 
ATOM   1198 O OG  . SER B 1 41  ? 34.822 9.301   34.556  1.00 50.55 ? 1040 SER B OG  1 
ATOM   1199 N N   . THR B 1 42  ? 37.129 8.427   32.263  1.00 52.15 ? 1041 THR B N   1 
ATOM   1200 C CA  . THR B 1 42  ? 38.586 8.268   32.244  1.00 56.67 ? 1041 THR B CA  1 
ATOM   1201 C C   . THR B 1 42  ? 39.221 8.791   30.949  1.00 61.39 ? 1041 THR B C   1 
ATOM   1202 O O   . THR B 1 42  ? 38.540 8.979   29.942  1.00 64.07 ? 1041 THR B O   1 
ATOM   1203 C CB  . THR B 1 42  ? 39.000 6.780   32.395  1.00 55.07 ? 1041 THR B CB  1 
ATOM   1204 O OG1 . THR B 1 42  ? 39.084 6.158   31.100  1.00 52.96 ? 1041 THR B OG1 1 
ATOM   1205 C CG2 . THR B 1 42  ? 37.996 6.021   33.256  1.00 51.99 ? 1041 THR B CG2 1 
ATOM   1206 N N   . LYS B 1 43  ? 40.543 8.928   30.940  1.00 65.59 ? 1042 LYS B N   1 
ATOM   1207 C CA  . LYS B 1 43  ? 41.254 9.199   29.691  1.00 68.98 ? 1042 LYS B CA  1 
ATOM   1208 C C   . LYS B 1 43  ? 41.536 7.918   28.898  1.00 70.27 ? 1042 LYS B C   1 
ATOM   1209 O O   . LYS B 1 43  ? 42.344 7.085   29.319  1.00 70.63 ? 1042 LYS B O   1 
ATOM   1210 C CB  . LYS B 1 43  ? 42.568 9.946   29.960  1.00 71.07 ? 1042 LYS B CB  1 
ATOM   1211 C CG  . LYS B 1 43  ? 42.438 11.466  29.973  1.00 74.73 ? 1042 LYS B CG  1 
ATOM   1212 C CD  . LYS B 1 43  ? 41.532 11.985  28.841  1.00 76.81 ? 1042 LYS B CD  1 
ATOM   1213 C CE  . LYS B 1 43  ? 42.100 11.683  27.451  1.00 77.79 ? 1042 LYS B CE  1 
ATOM   1214 N NZ  . LYS B 1 43  ? 41.216 12.169  26.349  1.00 75.43 ? 1042 LYS B NZ  1 
ATOM   1215 N N   . MET B 1 44  ? 40.724 7.695   27.867  1.00 71.09 ? 1043 MET B N   1 
ATOM   1216 C CA  . MET B 1 44  ? 40.936 6.650   26.858  1.00 72.35 ? 1043 MET B CA  1 
ATOM   1217 C C   . MET B 1 44  ? 41.784 5.447   27.291  1.00 74.08 ? 1043 MET B C   1 
ATOM   1218 O O   . MET B 1 44  ? 42.819 5.142   26.685  1.00 76.67 ? 1043 MET B O   1 
ATOM   1219 C CB  . MET B 1 44  ? 41.516 7.276   25.574  1.00 72.29 ? 1043 MET B CB  1 
ATOM   1220 C CG  . MET B 1 44  ? 41.627 6.331   24.378  1.00 69.94 ? 1043 MET B CG  1 
ATOM   1221 S SD  . MET B 1 44  ? 40.541 4.922   24.555  1.00 68.54 ? 1043 MET B SD  1 
ATOM   1222 C CE  . MET B 1 44  ? 40.100 4.587   22.846  1.00 71.04 ? 1043 MET B CE  1 
ATOM   1223 N N   . HIS B 1 45  ? 41.316 4.734   28.313  1.00 73.61 ? 1044 HIS B N   1 
ATOM   1224 C CA  . HIS B 1 45  ? 41.803 3.375   28.560  1.00 71.96 ? 1044 HIS B CA  1 
ATOM   1225 C C   . HIS B 1 45  ? 40.989 2.405   27.696  1.00 70.18 ? 1044 HIS B C   1 
ATOM   1226 O O   . HIS B 1 45  ? 40.990 1.187   27.924  1.00 70.25 ? 1044 HIS B O   1 
ATOM   1227 C CB  . HIS B 1 45  ? 41.661 3.011   30.041  1.00 72.81 ? 1044 HIS B CB  1 
ATOM   1228 C CG  . HIS B 1 45  ? 42.587 1.925   30.493  1.00 74.14 ? 1044 HIS B CG  1 
ATOM   1229 N ND1 . HIS B 1 45  ? 43.007 0.907   29.663  1.00 77.17 ? 1044 HIS B ND1 1 
ATOM   1230 C CD2 . HIS B 1 45  ? 43.142 1.674   31.702  1.00 75.82 ? 1044 HIS B CD2 1 
ATOM   1231 C CE1 . HIS B 1 45  ? 43.775 0.076   30.341  1.00 78.24 ? 1044 HIS B CE1 1 
ATOM   1232 N NE2 . HIS B 1 45  ? 43.872 0.513   31.583  1.00 77.88 ? 1044 HIS B NE2 1 
ATOM   1233 N N   . GLY B 1 46  ? 40.420 2.941   26.618  1.00 66.59 ? 1045 GLY B N   1 
ATOM   1234 C CA  . GLY B 1 46  ? 39.476 2.185   25.820  1.00 62.73 ? 1045 GLY B CA  1 
ATOM   1235 C C   . GLY B 1 46  ? 38.324 1.734   26.686  1.00 59.52 ? 1045 GLY B C   1 
ATOM   1236 O O   . GLY B 1 46  ? 37.820 0.615   26.555  1.00 61.84 ? 1045 GLY B O   1 
ATOM   1237 N N   . ASP B 1 47  ? 37.980 2.575   27.648  1.00 53.14 ? 1046 ASP B N   1 
ATOM   1238 C CA  . ASP B 1 47  ? 37.016 2.196   28.665  1.00 47.98 ? 1046 ASP B CA  1 
ATOM   1239 C C   . ASP B 1 47  ? 35.668 2.836   28.361  1.00 43.57 ? 1046 ASP B C   1 
ATOM   1240 O O   . ASP B 1 47  ? 35.601 3.982   27.889  1.00 41.51 ? 1046 ASP B O   1 
ATOM   1241 C CB  . ASP B 1 47  ? 37.523 2.634   30.047  1.00 50.51 ? 1046 ASP B CB  1 
ATOM   1242 C CG  . ASP B 1 47  ? 37.805 1.454   30.974  1.00 50.74 ? 1046 ASP B CG  1 
ATOM   1243 O OD1 . ASP B 1 47  ? 36.896 1.092   31.750  1.00 51.73 ? 1046 ASP B OD1 1 
ATOM   1244 O OD2 . ASP B 1 47  ? 38.946 0.929   30.957  1.00 48.04 ? 1046 ASP B OD2 1 
ATOM   1245 N N   . TYR B 1 48  ? 34.604 2.074   28.591  1.00 37.87 ? 1047 TYR B N   1 
ATOM   1246 C CA  . TYR B 1 48  ? 33.249 2.557   28.345  1.00 33.67 ? 1047 TYR B CA  1 
ATOM   1247 C C   . TYR B 1 48  ? 32.372 2.376   29.594  1.00 30.79 ? 1047 TYR B C   1 
ATOM   1248 O O   . TYR B 1 48  ? 32.708 1.612   30.494  1.00 34.06 ? 1047 TYR B O   1 
ATOM   1249 C CB  . TYR B 1 48  ? 32.634 1.816   27.144  1.00 31.06 ? 1047 TYR B CB  1 
ATOM   1250 C CG  . TYR B 1 48  ? 33.453 1.901   25.881  1.00 29.38 ? 1047 TYR B CG  1 
ATOM   1251 C CD1 . TYR B 1 48  ? 34.388 0.917   25.574  1.00 28.53 ? 1047 TYR B CD1 1 
ATOM   1252 C CD2 . TYR B 1 48  ? 33.340 2.996   25.026  1.00 30.27 ? 1047 TYR B CD2 1 
ATOM   1253 C CE1 . TYR B 1 48  ? 35.187 1.013   24.436  1.00 29.22 ? 1047 TYR B CE1 1 
ATOM   1254 C CE2 . TYR B 1 48  ? 34.140 3.101   23.874  1.00 31.22 ? 1047 TYR B CE2 1 
ATOM   1255 C CZ  . TYR B 1 48  ? 35.046 2.091   23.581  1.00 30.96 ? 1047 TYR B CZ  1 
ATOM   1256 O OH  . TYR B 1 48  ? 35.710 2.095   22.372  1.00 29.83 ? 1047 TYR B OH  1 
ATOM   1257 N N   . THR B 1 49  ? 31.264 3.101   29.634  1.00 24.41 ? 1048 THR B N   1 
ATOM   1258 C CA  . THR B 1 49  ? 30.320 2.996   30.711  1.00 19.62 ? 1048 THR B CA  1 
ATOM   1259 C C   . THR B 1 49  ? 28.945 2.615   30.184  1.00 19.77 ? 1048 THR B C   1 
ATOM   1260 O O   . THR B 1 49  ? 28.338 3.339   29.368  1.00 17.32 ? 1048 THR B O   1 
ATOM   1261 C CB  . THR B 1 49  ? 30.260 4.361   31.511  1.00 20.29 ? 1048 THR B CB  1 
ATOM   1262 O OG1 . THR B 1 49  ? 31.568 4.652   32.023  1.00 22.10 ? 1048 THR B OG1 1 
ATOM   1263 C CG2 . THR B 1 49  ? 29.282 4.286   32.703  1.00 15.27 ? 1048 THR B CG2 1 
ATOM   1264 N N   . LEU B 1 50  ? 28.432 1.500   30.684  1.00 18.51 ? 1049 LEU B N   1 
ATOM   1265 C CA  . LEU B 1 50  ? 27.027 1.167   30.503  1.00 17.52 ? 1049 LEU B CA  1 
ATOM   1266 C C   . LEU B 1 50  ? 26.193 1.896   31.556  1.00 20.38 ? 1049 LEU B C   1 
ATOM   1267 O O   . LEU B 1 50  ? 26.539 1.910   32.742  1.00 22.18 ? 1049 LEU B O   1 
ATOM   1268 C CB  . LEU B 1 50  ? 26.831 -0.355  30.635  1.00 14.49 ? 1049 LEU B CB  1 
ATOM   1269 C CG  . LEU B 1 50  ? 25.436 -1.003  30.729  1.00 12.80 ? 1049 LEU B CG  1 
ATOM   1270 C CD1 . LEU B 1 50  ? 24.692 -0.867  29.422  1.00 12.81 ? 1049 LEU B CD1 1 
ATOM   1271 C CD2 . LEU B 1 50  ? 25.602 -2.473  31.096  1.00 11.28 ? 1049 LEU B CD2 1 
ATOM   1272 N N   . THR B 1 51  ? 25.111 2.525   31.123  1.00 20.55 ? 1050 THR B N   1 
ATOM   1273 C CA  . THR B 1 51  ? 24.152 3.066   32.062  1.00 20.48 ? 1050 THR B CA  1 
ATOM   1274 C C   . THR B 1 51  ? 22.822 2.374   31.846  1.00 21.10 ? 1050 THR B C   1 
ATOM   1275 O O   . THR B 1 51  ? 22.314 2.350   30.725  1.00 24.81 ? 1050 THR B O   1 
ATOM   1276 C CB  . THR B 1 51  ? 23.958 4.577   31.868  1.00 21.15 ? 1050 THR B CB  1 
ATOM   1277 O OG1 . THR B 1 51  ? 25.207 5.251   32.075  1.00 21.09 ? 1050 THR B OG1 1 
ATOM   1278 C CG2 . THR B 1 51  ? 22.950 5.117   32.869  1.00 23.62 ? 1050 THR B CG2 1 
ATOM   1279 N N   . LEU B 1 52  ? 22.227 1.886   32.930  1.00 19.75 ? 1051 LEU B N   1 
ATOM   1280 C CA  . LEU B 1 52  ? 21.065 0.986   32.851  1.00 21.72 ? 1051 LEU B CA  1 
ATOM   1281 C C   . LEU B 1 52  ? 19.942 1.433   33.773  1.00 22.22 ? 1051 LEU B C   1 
ATOM   1282 O O   . LEU B 1 52  ? 20.164 1.770   34.935  1.00 24.37 ? 1051 LEU B O   1 
ATOM   1283 C CB  . LEU B 1 52  ? 21.490 -0.432  33.227  1.00 21.35 ? 1051 LEU B CB  1 
ATOM   1284 C CG  . LEU B 1 52  ? 20.462 -1.510  33.508  1.00 19.62 ? 1051 LEU B CG  1 
ATOM   1285 C CD1 . LEU B 1 52  ? 19.815 -1.986  32.229  1.00 20.71 ? 1051 LEU B CD1 1 
ATOM   1286 C CD2 . LEU B 1 52  ? 21.165 -2.675  34.162  1.00 20.49 ? 1051 LEU B CD2 1 
ATOM   1287 N N   . ARG B 1 53  ? 18.729 1.396   33.251  1.00 22.44 ? 1052 ARG B N   1 
ATOM   1288 C CA  . ARG B 1 53  ? 17.562 1.822   34.003  1.00 25.99 ? 1052 ARG B CA  1 
ATOM   1289 C C   . ARG B 1 53  ? 17.001 0.643   34.823  1.00 27.27 ? 1052 ARG B C   1 
ATOM   1290 O O   . ARG B 1 53  ? 16.648 -0.420  34.253  1.00 22.72 ? 1052 ARG B O   1 
ATOM   1291 C CB  . ARG B 1 53  ? 16.508 2.367   33.026  1.00 24.54 ? 1052 ARG B CB  1 
ATOM   1292 C CG  . ARG B 1 53  ? 15.348 3.072   33.652  1.00 28.23 ? 1052 ARG B CG  1 
ATOM   1293 C CD  . ARG B 1 53  ? 15.697 4.486   34.118  1.00 29.93 ? 1052 ARG B CD  1 
ATOM   1294 N NE  . ARG B 1 53  ? 14.488 5.180   34.594  1.00 35.94 ? 1052 ARG B NE  1 
ATOM   1295 C CZ  . ARG B 1 53  ? 14.481 6.225   35.411  1.00 32.23 ? 1052 ARG B CZ  1 
ATOM   1296 N NH1 . ARG B 1 53  ? 13.323 6.740   35.792  1.00 34.51 ? 1052 ARG B NH1 1 
ATOM   1297 N NH2 . ARG B 1 53  ? 15.620 6.765   35.833  1.00 32.74 ? 1052 ARG B NH2 1 
ATOM   1298 N N   . LYS B 1 54  ? 16.997 0.800   36.154  1.00 27.07 ? 1053 LYS B N   1 
ATOM   1299 C CA  . LYS B 1 54  ? 16.623 -0.290  37.061  1.00 27.59 ? 1053 LYS B CA  1 
ATOM   1300 C C   . LYS B 1 54  ? 16.115 0.216   38.419  1.00 28.96 ? 1053 LYS B C   1 
ATOM   1301 O O   . LYS B 1 54  ? 16.818 0.914   39.153  1.00 27.29 ? 1053 LYS B O   1 
ATOM   1302 C CB  . LYS B 1 54  ? 17.822 -1.225  37.261  1.00 29.64 ? 1053 LYS B CB  1 
ATOM   1303 C CG  . LYS B 1 54  ? 17.588 -2.393  38.195  1.00 29.57 ? 1053 LYS B CG  1 
ATOM   1304 C CD  . LYS B 1 54  ? 16.446 -3.255  37.731  1.00 33.11 ? 1053 LYS B CD  1 
ATOM   1305 C CE  . LYS B 1 54  ? 16.376 -4.521  38.548  1.00 38.81 ? 1053 LYS B CE  1 
ATOM   1306 N NZ  . LYS B 1 54  ? 15.003 -4.758  39.094  1.00 43.59 ? 1053 LYS B NZ  1 
ATOM   1307 N N   . GLY B 1 55  ? 14.850 -0.078  38.706  1.00 30.69 ? 1054 GLY B N   1 
ATOM   1308 C CA  . GLY B 1 55  ? 14.214 0.381   39.931  1.00 29.77 ? 1054 GLY B CA  1 
ATOM   1309 C C   . GLY B 1 55  ? 13.996 1.886   40.035  1.00 29.45 ? 1054 GLY B C   1 
ATOM   1310 O O   . GLY B 1 55  ? 13.973 2.437   41.137  1.00 31.39 ? 1054 GLY B O   1 
ATOM   1311 N N   . GLY B 1 56  ? 13.850 2.558   38.896  1.00 27.37 ? 1055 GLY B N   1 
ATOM   1312 C CA  . GLY B 1 56  ? 13.642 3.996   38.902  1.00 26.89 ? 1055 GLY B CA  1 
ATOM   1313 C C   . GLY B 1 56  ? 14.895 4.859   38.924  1.00 27.10 ? 1055 GLY B C   1 
ATOM   1314 O O   . GLY B 1 56  ? 14.805 6.084   38.956  1.00 32.00 ? 1055 GLY B O   1 
ATOM   1315 N N   . ASN B 1 57  ? 16.070 4.242   38.943  1.00 26.79 ? 1056 ASN B N   1 
ATOM   1316 C CA  . ASN B 1 57  ? 17.294 5.017   38.842  1.00 26.23 ? 1056 ASN B CA  1 
ATOM   1317 C C   . ASN B 1 57  ? 18.257 4.440   37.811  1.00 24.04 ? 1056 ASN B C   1 
ATOM   1318 O O   . ASN B 1 57  ? 17.983 3.406   37.217  1.00 23.28 ? 1056 ASN B O   1 
ATOM   1319 C CB  . ASN B 1 57  ? 17.971 5.173   40.224  1.00 28.21 ? 1056 ASN B CB  1 
ATOM   1320 C CG  . ASN B 1 57  ? 18.102 3.864   40.992  1.00 25.17 ? 1056 ASN B CG  1 
ATOM   1321 O OD1 . ASN B 1 57  ? 19.199 3.482   41.376  1.00 26.72 ? 1056 ASN B OD1 1 
ATOM   1322 N ND2 . ASN B 1 57  ? 16.979 3.309   41.413  1.00 26.96 ? 1056 ASN B ND2 1 
ATOM   1323 N N   . ASN B 1 58  ? 19.310 5.194   37.516  1.00 24.80 ? 1057 ASN B N   1 
ATOM   1324 C CA  . ASN B 1 58  ? 20.283 4.818   36.506  1.00 23.83 ? 1057 ASN B CA  1 
ATOM   1325 C C   . ASN B 1 58  ? 21.488 4.159   37.157  1.00 25.84 ? 1057 ASN B C   1 
ATOM   1326 O O   . ASN B 1 58  ? 22.275 4.825   37.834  1.00 30.09 ? 1057 ASN B O   1 
ATOM   1327 C CB  . ASN B 1 58  ? 20.767 6.053   35.715  1.00 24.77 ? 1057 ASN B CB  1 
ATOM   1328 C CG  . ASN B 1 58  ? 19.637 6.942   35.231  1.00 23.75 ? 1057 ASN B CG  1 
ATOM   1329 O OD1 . ASN B 1 58  ? 18.511 6.494   35.023  1.00 25.72 ? 1057 ASN B OD1 1 
ATOM   1330 N ND2 . ASN B 1 58  ? 19.930 8.222   35.071  1.00 21.30 ? 1057 ASN B ND2 1 
ATOM   1331 N N   . LYS B 1 59  ? 21.681 2.878   36.860  1.00 25.07 ? 1058 LYS B N   1 
ATOM   1332 C CA  . LYS B 1 59  ? 22.868 2.141   37.289  1.00 26.28 ? 1058 LYS B CA  1 
ATOM   1333 C C   . LYS B 1 59  ? 24.083 2.365   36.395  1.00 26.12 ? 1058 LYS B C   1 
ATOM   1334 O O   . LYS B 1 59  ? 24.070 2.002   35.219  1.00 26.81 ? 1058 LYS B O   1 
ATOM   1335 C CB  . LYS B 1 59  ? 22.563 0.650   37.334  1.00 27.08 ? 1058 LYS B CB  1 
ATOM   1336 C CG  . LYS B 1 59  ? 21.280 0.320   38.066  1.00 29.84 ? 1058 LYS B CG  1 
ATOM   1337 C CD  . LYS B 1 59  ? 21.353 0.739   39.513  1.00 25.51 ? 1058 LYS B CD  1 
ATOM   1338 C CE  . LYS B 1 59  ? 20.074 0.370   40.212  1.00 26.33 ? 1058 LYS B CE  1 
ATOM   1339 N NZ  . LYS B 1 59  ? 20.036 0.917   41.588  1.00 28.79 ? 1058 LYS B NZ  1 
ATOM   1340 N N   . LEU B 1 60  ? 25.168 2.837   37.005  1.00 26.37 ? 1059 LEU B N   1 
ATOM   1341 C CA  . LEU B 1 60  ? 26.438 3.034   36.326  1.00 23.14 ? 1059 LEU B CA  1 
ATOM   1342 C C   . LEU B 1 60  ? 27.308 1.779   36.433  1.00 23.55 ? 1059 LEU B C   1 
ATOM   1343 O O   . LEU B 1 60  ? 27.807 1.441   37.495  1.00 25.68 ? 1059 LEU B O   1 
ATOM   1344 C CB  . LEU B 1 60  ? 27.172 4.228   36.933  1.00 23.56 ? 1059 LEU B CB  1 
ATOM   1345 C CG  . LEU B 1 60  ? 26.756 5.643   36.542  1.00 22.04 ? 1059 LEU B CG  1 
ATOM   1346 C CD1 . LEU B 1 60  ? 26.930 5.837   35.059  1.00 27.92 ? 1059 LEU B CD1 1 
ATOM   1347 C CD2 . LEU B 1 60  ? 25.309 5.881   36.899  1.00 28.23 ? 1059 LEU B CD2 1 
ATOM   1348 N N   . ILE B 1 61  ? 27.475 1.091   35.314  1.00 25.65 ? 1060 ILE B N   1 
ATOM   1349 C CA  . ILE B 1 61  ? 28.247 -0.147  35.248  1.00 24.17 ? 1060 ILE B CA  1 
ATOM   1350 C C   . ILE B 1 61  ? 29.424 0.106   34.331  1.00 23.66 ? 1060 ILE B C   1 
ATOM   1351 O O   . ILE B 1 61  ? 29.250 0.565   33.214  1.00 24.50 ? 1060 ILE B O   1 
ATOM   1352 C CB  . ILE B 1 61  ? 27.418 -1.306  34.634  1.00 23.57 ? 1060 ILE B CB  1 
ATOM   1353 C CG1 . ILE B 1 61  ? 26.109 -1.525  35.419  1.00 19.32 ? 1060 ILE B CG1 1 
ATOM   1354 C CG2 . ILE B 1 61  ? 28.239 -2.569  34.619  1.00 21.19 ? 1060 ILE B CG2 1 
ATOM   1355 C CD1 . ILE B 1 61  ? 25.133 -2.449  34.710  1.00 19.10 ? 1060 ILE B CD1 1 
ATOM   1356 N N   . LYS B 1 62  ? 30.614 -0.225  34.807  1.00 25.33 ? 1061 LYS B N   1 
ATOM   1357 C CA  . LYS B 1 62  ? 31.853 0.041   34.090  1.00 25.77 ? 1061 LYS B CA  1 
ATOM   1358 C C   . LYS B 1 62  ? 32.230 -1.134  33.202  1.00 27.55 ? 1061 LYS B C   1 
ATOM   1359 O O   . LYS B 1 62  ? 32.202 -2.295  33.637  1.00 25.15 ? 1061 LYS B O   1 
ATOM   1360 C CB  . LYS B 1 62  ? 32.981 0.324   35.092  1.00 28.62 ? 1061 LYS B CB  1 
ATOM   1361 C CG  . LYS B 1 62  ? 34.375 0.441   34.490  1.00 34.07 ? 1061 LYS B CG  1 
ATOM   1362 C CD  . LYS B 1 62  ? 34.911 1.874   34.580  1.00 40.54 ? 1061 LYS B CD  1 
ATOM   1363 C CE  . LYS B 1 62  ? 34.655 2.673   33.294  1.00 40.73 ? 1061 LYS B CE  1 
ATOM   1364 N NZ  . LYS B 1 62  ? 33.296 3.286   33.246  1.00 39.92 ? 1061 LYS B NZ  1 
ATOM   1365 N N   . ILE B 1 63  ? 32.544 -0.837  31.944  1.00 27.02 ? 1062 ILE B N   1 
ATOM   1366 C CA  . ILE B 1 63  ? 33.014 -1.866  31.022  1.00 25.63 ? 1062 ILE B CA  1 
ATOM   1367 C C   . ILE B 1 63  ? 34.524 -1.794  30.892  1.00 26.58 ? 1062 ILE B C   1 
ATOM   1368 O O   . ILE B 1 63  ? 35.062 -0.900  30.237  1.00 27.74 ? 1062 ILE B O   1 
ATOM   1369 C CB  . ILE B 1 63  ? 32.361 -1.751  29.618  1.00 22.09 ? 1062 ILE B CB  1 
ATOM   1370 C CG1 . ILE B 1 63  ? 30.862 -2.017  29.718  1.00 16.19 ? 1062 ILE B CG1 1 
ATOM   1371 C CG2 . ILE B 1 63  ? 32.970 -2.785  28.666  1.00 20.52 ? 1062 ILE B CG2 1 
ATOM   1372 C CD1 . ILE B 1 63  ? 30.073 -1.420  28.578  1.00 15.43 ? 1062 ILE B CD1 1 
ATOM   1373 N N   . PHE B 1 64  ? 35.198 -2.686  31.610  1.00 27.49 ? 1063 PHE B N   1 
ATOM   1374 C CA  . PHE B 1 64  ? 36.649 -2.715  31.633  1.00 30.49 ? 1063 PHE B CA  1 
ATOM   1375 C C   . PHE B 1 64  ? 37.201 -3.208  30.304  1.00 34.29 ? 1063 PHE B C   1 
ATOM   1376 O O   . PHE B 1 64  ? 36.599 -4.050  29.640  1.00 31.70 ? 1063 PHE B O   1 
ATOM   1377 C CB  . PHE B 1 64  ? 37.161 -3.620  32.767  1.00 32.87 ? 1063 PHE B CB  1 
ATOM   1378 C CG  . PHE B 1 64  ? 36.726 -3.192  34.139  1.00 33.46 ? 1063 PHE B CG  1 
ATOM   1379 C CD1 . PHE B 1 64  ? 35.641 -3.803  34.767  1.00 33.00 ? 1063 PHE B CD1 1 
ATOM   1380 C CD2 . PHE B 1 64  ? 37.372 -2.141  34.791  1.00 32.37 ? 1063 PHE B CD2 1 
ATOM   1381 C CE1 . PHE B 1 64  ? 35.190 -3.363  36.015  1.00 31.87 ? 1063 PHE B CE1 1 
ATOM   1382 C CE2 . PHE B 1 64  ? 36.925 -1.693  36.044  1.00 32.96 ? 1063 PHE B CE2 1 
ATOM   1383 C CZ  . PHE B 1 64  ? 35.831 -2.302  36.653  1.00 30.73 ? 1063 PHE B CZ  1 
ATOM   1384 N N   . HIS B 1 65  ? 38.447 -2.822  30.046  1.00 38.96 ? 1064 HIS B N   1 
ATOM   1385 C CA  . HIS B 1 65  ? 39.151 -3.094  28.804  1.00 40.73 ? 1064 HIS B CA  1 
ATOM   1386 C C   . HIS B 1 65  ? 40.613 -3.374  29.162  1.00 41.98 ? 1064 HIS B C   1 
ATOM   1387 O O   . HIS B 1 65  ? 41.365 -2.459  29.489  1.00 42.75 ? 1064 HIS B O   1 
ATOM   1388 C CB  . HIS B 1 65  ? 39.059 -1.866  27.890  1.00 43.01 ? 1064 HIS B CB  1 
ATOM   1389 C CG  . HIS B 1 65  ? 39.757 -2.026  26.572  1.00 45.46 ? 1064 HIS B CG  1 
ATOM   1390 N ND1 . HIS B 1 65  ? 39.886 -3.241  25.935  1.00 47.04 ? 1064 HIS B ND1 1 
ATOM   1391 C CD2 . HIS B 1 65  ? 40.393 -1.125  25.788  1.00 45.93 ? 1064 HIS B CD2 1 
ATOM   1392 C CE1 . HIS B 1 65  ? 40.583 -3.085  24.824  1.00 46.51 ? 1064 HIS B CE1 1 
ATOM   1393 N NE2 . HIS B 1 65  ? 40.895 -1.808  24.706  1.00 48.16 ? 1064 HIS B NE2 1 
ATOM   1394 N N   . ARG B 1 66  ? 40.995 -4.642  29.164  1.00 43.12 ? 1065 ARG B N   1 
ATOM   1395 C CA  . ARG B 1 66  ? 42.359 -5.024  29.498  1.00 47.12 ? 1065 ARG B CA  1 
ATOM   1396 C C   . ARG B 1 66  ? 42.770 -6.191  28.622  1.00 47.20 ? 1065 ARG B C   1 
ATOM   1397 O O   . ARG B 1 66  ? 41.929 -6.985  28.227  1.00 49.15 ? 1065 ARG B O   1 
ATOM   1398 C CB  . ARG B 1 66  ? 42.458 -5.432  30.971  1.00 50.96 ? 1065 ARG B CB  1 
ATOM   1399 C CG  . ARG B 1 66  ? 42.737 -4.288  31.929  1.00 52.85 ? 1065 ARG B CG  1 
ATOM   1400 C CD  . ARG B 1 66  ? 41.476 -3.847  32.641  1.00 55.93 ? 1065 ARG B CD  1 
ATOM   1401 N NE  . ARG B 1 66  ? 41.734 -2.755  33.571  1.00 57.73 ? 1065 ARG B NE  1 
ATOM   1402 C CZ  . ARG B 1 66  ? 41.475 -1.477  33.318  1.00 57.83 ? 1065 ARG B CZ  1 
ATOM   1403 N NH1 . ARG B 1 66  ? 41.687 -0.563  34.252  1.00 60.42 ? 1065 ARG B NH1 1 
ATOM   1404 N NH2 . ARG B 1 66  ? 41.012 -1.106  32.133  1.00 57.89 ? 1065 ARG B NH2 1 
ATOM   1405 N N   . ASP B 1 67  ? 44.074 -6.366  28.432  1.00 49.53 ? 1066 ASP B N   1 
ATOM   1406 C CA  . ASP B 1 67  ? 44.594 -7.176  27.325  1.00 52.12 ? 1066 ASP B CA  1 
ATOM   1407 C C   . ASP B 1 67  ? 43.925 -6.709  26.015  1.00 51.28 ? 1066 ASP B C   1 
ATOM   1408 O O   . ASP B 1 67  ? 43.948 -5.514  25.692  1.00 51.27 ? 1066 ASP B O   1 
ATOM   1409 C CB  . ASP B 1 67  ? 44.332 -8.673  27.581  1.00 55.71 ? 1066 ASP B CB  1 
ATOM   1410 C CG  . ASP B 1 67  ? 45.211 -9.254  28.688  1.00 58.84 ? 1066 ASP B CG  1 
ATOM   1411 O OD1 . ASP B 1 67  ? 44.675 -9.582  29.773  1.00 60.69 ? 1066 ASP B OD1 1 
ATOM   1412 O OD2 . ASP B 1 67  ? 46.432 -9.427  28.461  1.00 60.25 ? 1066 ASP B OD2 1 
ATOM   1413 N N   . GLY B 1 68  ? 43.219 -7.605  25.335  1.00 48.95 ? 1067 GLY B N   1 
ATOM   1414 C CA  . GLY B 1 68  ? 42.394 -7.165  24.226  1.00 47.53 ? 1067 GLY B CA  1 
ATOM   1415 C C   . GLY B 1 68  ? 40.923 -7.485  24.430  1.00 46.56 ? 1067 GLY B C   1 
ATOM   1416 O O   . GLY B 1 68  ? 40.164 -7.629  23.473  1.00 50.48 ? 1067 GLY B O   1 
ATOM   1417 N N   . LYS B 1 69  ? 40.518 -7.620  25.684  1.00 43.41 ? 1068 LYS B N   1 
ATOM   1418 C CA  . LYS B 1 69  ? 39.201 -8.141  25.992  1.00 39.56 ? 1068 LYS B CA  1 
ATOM   1419 C C   . LYS B 1 69  ? 38.332 -7.108  26.700  1.00 38.95 ? 1068 LYS B C   1 
ATOM   1420 O O   . LYS B 1 69  ? 38.821 -6.072  27.159  1.00 37.65 ? 1068 LYS B O   1 
ATOM   1421 C CB  . LYS B 1 69  ? 39.332 -9.400  26.853  1.00 39.20 ? 1068 LYS B CB  1 
ATOM   1422 C CG  . LYS B 1 69  ? 40.163 -10.499 26.226  1.00 39.79 ? 1068 LYS B CG  1 
ATOM   1423 C CD  . LYS B 1 69  ? 39.524 -11.006 24.937  1.00 45.10 ? 1068 LYS B CD  1 
ATOM   1424 C CE  . LYS B 1 69  ? 39.523 -12.533 24.875  1.00 47.28 ? 1068 LYS B CE  1 
ATOM   1425 N NZ  . LYS B 1 69  ? 38.594 -13.066 23.828  1.00 49.61 ? 1068 LYS B NZ  1 
ATOM   1426 N N   . TYR B 1 70  ? 37.044 -7.426  26.802  1.00 36.46 ? 1069 TYR B N   1 
ATOM   1427 C CA  . TYR B 1 70  ? 36.062 -6.586  27.473  1.00 33.04 ? 1069 TYR B CA  1 
ATOM   1428 C C   . TYR B 1 70  ? 35.237 -7.395  28.467  1.00 32.31 ? 1069 TYR B C   1 
ATOM   1429 O O   . TYR B 1 70  ? 35.027 -8.590  28.284  1.00 32.23 ? 1069 TYR B O   1 
ATOM   1430 C CB  . TYR B 1 70  ? 35.135 -5.942  26.443  1.00 32.12 ? 1069 TYR B CB  1 
ATOM   1431 C CG  . TYR B 1 70  ? 35.837 -4.964  25.542  1.00 33.28 ? 1069 TYR B CG  1 
ATOM   1432 C CD1 . TYR B 1 70  ? 36.486 -5.400  24.386  1.00 33.52 ? 1069 TYR B CD1 1 
ATOM   1433 C CD2 . TYR B 1 70  ? 35.914 -3.607  25.879  1.00 31.87 ? 1069 TYR B CD2 1 
ATOM   1434 C CE1 . TYR B 1 70  ? 37.200 -4.518  23.589  1.00 33.32 ? 1069 TYR B CE1 1 
ATOM   1435 C CE2 . TYR B 1 70  ? 36.619 -2.716  25.081  1.00 30.84 ? 1069 TYR B CE2 1 
ATOM   1436 C CZ  . TYR B 1 70  ? 37.262 -3.186  23.938  1.00 32.41 ? 1069 TYR B CZ  1 
ATOM   1437 O OH  . TYR B 1 70  ? 37.989 -2.330  23.150  1.00 36.73 ? 1069 TYR B OH  1 
ATOM   1438 N N   . GLY B 1 71  ? 34.785 -6.732  29.525  1.00 31.50 ? 1070 GLY B N   1 
ATOM   1439 C CA  . GLY B 1 71  ? 33.923 -7.382  30.499  1.00 28.61 ? 1070 GLY B CA  1 
ATOM   1440 C C   . GLY B 1 71  ? 33.646 -6.510  31.704  1.00 27.65 ? 1070 GLY B C   1 
ATOM   1441 O O   . GLY B 1 71  ? 34.293 -5.472  31.880  1.00 25.76 ? 1070 GLY B O   1 
ATOM   1442 N N   . PHE B 1 72  ? 32.696 -6.933  32.536  1.00 26.71 ? 1071 PHE B N   1 
ATOM   1443 C CA  . PHE B 1 72  ? 32.311 -6.182  33.736  1.00 26.35 ? 1071 PHE B CA  1 
ATOM   1444 C C   . PHE B 1 72  ? 33.233 -6.448  34.939  1.00 25.80 ? 1071 PHE B C   1 
ATOM   1445 O O   . PHE B 1 72  ? 33.330 -5.627  35.845  1.00 26.86 ? 1071 PHE B O   1 
ATOM   1446 C CB  . PHE B 1 72  ? 30.862 -6.505  34.134  1.00 21.80 ? 1071 PHE B CB  1 
ATOM   1447 C CG  . PHE B 1 72  ? 29.840 -6.175  33.072  1.00 22.18 ? 1071 PHE B CG  1 
ATOM   1448 C CD1 . PHE B 1 72  ? 28.818 -7.079  32.757  1.00 16.38 ? 1071 PHE B CD1 1 
ATOM   1449 C CD2 . PHE B 1 72  ? 29.882 -4.955  32.401  1.00 23.16 ? 1071 PHE B CD2 1 
ATOM   1450 C CE1 . PHE B 1 72  ? 27.861 -6.772  31.800  1.00 16.76 ? 1071 PHE B CE1 1 
ATOM   1451 C CE2 . PHE B 1 72  ? 28.919 -4.650  31.432  1.00 22.71 ? 1071 PHE B CE2 1 
ATOM   1452 C CZ  . PHE B 1 72  ? 27.908 -5.557  31.133  1.00 19.60 ? 1071 PHE B CZ  1 
ATOM   1453 N N   . SER B 1 73  ? 33.919 -7.584  34.933  1.00 26.96 ? 1072 SER B N   1 
ATOM   1454 C CA  . SER B 1 73  ? 34.745 -8.008  36.064  1.00 24.76 ? 1072 SER B CA  1 
ATOM   1455 C C   . SER B 1 73  ? 35.693 -9.113  35.651  1.00 25.09 ? 1072 SER B C   1 
ATOM   1456 O O   . SER B 1 73  ? 35.631 -9.607  34.531  1.00 25.47 ? 1072 SER B O   1 
ATOM   1457 C CB  . SER B 1 73  ? 33.872 -8.531  37.193  1.00 22.25 ? 1072 SER B CB  1 
ATOM   1458 O OG  . SER B 1 73  ? 33.276 -9.753  36.836  1.00 19.09 ? 1072 SER B OG  1 
ATOM   1459 N N   . ASP B 1 74  ? 36.536 -9.536  36.584  1.00 29.04 ? 1073 ASP B N   1 
ATOM   1460 C CA  . ASP B 1 74  ? 37.510 -10.608 36.352  1.00 32.84 ? 1073 ASP B CA  1 
ATOM   1461 C C   . ASP B 1 74  ? 36.795 -11.964 36.231  1.00 32.38 ? 1073 ASP B C   1 
ATOM   1462 O O   . ASP B 1 74  ? 36.045 -12.335 37.130  1.00 32.25 ? 1073 ASP B O   1 
ATOM   1463 C CB  . ASP B 1 74  ? 38.495 -10.654 37.522  1.00 34.65 ? 1073 ASP B CB  1 
ATOM   1464 C CG  . ASP B 1 74  ? 39.919 -10.969 37.093  1.00 39.16 ? 1073 ASP B CG  1 
ATOM   1465 O OD1 . ASP B 1 74  ? 40.137 -11.522 35.991  1.00 40.72 ? 1073 ASP B OD1 1 
ATOM   1466 O OD2 . ASP B 1 74  ? 40.833 -10.684 37.895  1.00 46.72 ? 1073 ASP B OD2 1 
ATOM   1467 N N   . PRO B 1 75  ? 36.964 -12.676 35.101  1.00 30.57 ? 1074 PRO B N   1 
ATOM   1468 C CA  . PRO B 1 75  ? 37.814 -12.389 33.944  1.00 28.71 ? 1074 PRO B CA  1 
ATOM   1469 C C   . PRO B 1 75  ? 37.112 -11.618 32.826  1.00 28.70 ? 1074 PRO B C   1 
ATOM   1470 O O   . PRO B 1 75  ? 35.879 -11.701 32.662  1.00 26.06 ? 1074 PRO B O   1 
ATOM   1471 C CB  . PRO B 1 75  ? 38.234 -13.769 33.472  1.00 30.14 ? 1074 PRO B CB  1 
ATOM   1472 C CG  . PRO B 1 75  ? 36.987 -14.592 33.721  1.00 30.63 ? 1074 PRO B CG  1 
ATOM   1473 C CD  . PRO B 1 75  ? 36.323 -14.001 34.960  1.00 30.53 ? 1074 PRO B CD  1 
ATOM   1474 N N   . LEU B 1 76  ? 37.906 -10.903 32.034  1.00 28.64 ? 1075 LEU B N   1 
ATOM   1475 C CA  . LEU B 1 76  ? 37.414 -10.229 30.829  1.00 29.26 ? 1075 LEU B CA  1 
ATOM   1476 C C   . LEU B 1 76  ? 37.472 -11.196 29.644  1.00 32.34 ? 1075 LEU B C   1 
ATOM   1477 O O   . LEU B 1 76  ? 38.550 -11.656 29.269  1.00 34.56 ? 1075 LEU B O   1 
ATOM   1478 C CB  . LEU B 1 76  ? 38.287 -9.021  30.532  1.00 25.01 ? 1075 LEU B CB  1 
ATOM   1479 C CG  . LEU B 1 76  ? 38.486 -8.051  31.683  1.00 19.03 ? 1075 LEU B CG  1 
ATOM   1480 C CD1 . LEU B 1 76  ? 39.303 -6.884  31.168  1.00 18.82 ? 1075 LEU B CD1 1 
ATOM   1481 C CD2 . LEU B 1 76  ? 37.138 -7.577  32.221  1.00 17.91 ? 1075 LEU B CD2 1 
ATOM   1482 N N   . THR B 1 77  ? 36.316 -11.546 29.096  1.00 32.83 ? 1076 THR B N   1 
ATOM   1483 C CA  . THR B 1 77  ? 36.257 -12.610 28.113  1.00 33.45 ? 1076 THR B CA  1 
ATOM   1484 C C   . THR B 1 77  ? 35.609 -12.246 26.785  1.00 34.12 ? 1076 THR B C   1 
ATOM   1485 O O   . THR B 1 77  ? 35.692 -13.007 25.825  1.00 36.93 ? 1076 THR B O   1 
ATOM   1486 C CB  . THR B 1 77  ? 35.564 -13.862 28.690  1.00 34.92 ? 1076 THR B CB  1 
ATOM   1487 O OG1 . THR B 1 77  ? 34.190 -13.580 28.978  1.00 36.74 ? 1076 THR B OG1 1 
ATOM   1488 C CG2 . THR B 1 77  ? 36.240 -14.292 29.968  1.00 35.34 ? 1076 THR B CG2 1 
ATOM   1489 N N   . PHE B 1 78  ? 35.024 -11.061 26.692  1.00 32.43 ? 1077 PHE B N   1 
ATOM   1490 C CA  . PHE B 1 78  ? 34.371 -10.666 25.445  1.00 33.92 ? 1077 PHE B CA  1 
ATOM   1491 C C   . PHE B 1 78  ? 35.337 -9.917  24.537  1.00 35.35 ? 1077 PHE B C   1 
ATOM   1492 O O   . PHE B 1 78  ? 36.099 -9.069  25.004  1.00 36.06 ? 1077 PHE B O   1 
ATOM   1493 C CB  . PHE B 1 78  ? 33.131 -9.807  25.729  1.00 30.54 ? 1077 PHE B CB  1 
ATOM   1494 C CG  . PHE B 1 78  ? 32.042 -10.537 26.472  1.00 26.36 ? 1077 PHE B CG  1 
ATOM   1495 C CD1 . PHE B 1 78  ? 32.093 -10.674 27.853  1.00 29.88 ? 1077 PHE B CD1 1 
ATOM   1496 C CD2 . PHE B 1 78  ? 30.948 -11.057 25.793  1.00 29.91 ? 1077 PHE B CD2 1 
ATOM   1497 C CE1 . PHE B 1 78  ? 31.063 -11.317 28.551  1.00 32.72 ? 1077 PHE B CE1 1 
ATOM   1498 C CE2 . PHE B 1 78  ? 29.913 -11.693 26.484  1.00 34.26 ? 1077 PHE B CE2 1 
ATOM   1499 C CZ  . PHE B 1 78  ? 29.970 -11.822 27.862  1.00 32.98 ? 1077 PHE B CZ  1 
ATOM   1500 N N   . SER B 1 79  ? 35.329 -10.248 23.247  1.00 37.82 ? 1078 SER B N   1 
ATOM   1501 C CA  . SER B 1 79  ? 36.258 -9.617  22.292  1.00 37.41 ? 1078 SER B CA  1 
ATOM   1502 C C   . SER B 1 79  ? 35.844 -8.230  21.792  1.00 37.06 ? 1078 SER B C   1 
ATOM   1503 O O   . SER B 1 79  ? 36.688 -7.459  21.344  1.00 36.81 ? 1078 SER B O   1 
ATOM   1504 C CB  . SER B 1 79  ? 36.488 -10.544 21.109  1.00 33.16 ? 1078 SER B CB  1 
ATOM   1505 O OG  . SER B 1 79  ? 36.932 -11.802 21.586  1.00 40.64 ? 1078 SER B OG  1 
ATOM   1506 N N   . SER B 1 80  ? 34.566 -7.891  21.956  1.00 35.30 ? 1079 SER B N   1 
ATOM   1507 C CA  . SER B 1 80  ? 34.078 -6.543  21.674  1.00 33.58 ? 1079 SER B CA  1 
ATOM   1508 C C   . SER B 1 80  ? 32.965 -6.084  22.643  1.00 33.21 ? 1079 SER B C   1 
ATOM   1509 O O   . SER B 1 80  ? 32.238 -6.917  23.211  1.00 32.88 ? 1079 SER B O   1 
ATOM   1510 C CB  . SER B 1 80  ? 33.541 -6.470  20.251  1.00 34.60 ? 1079 SER B CB  1 
ATOM   1511 O OG  . SER B 1 80  ? 32.390 -7.281  20.112  1.00 33.59 ? 1079 SER B OG  1 
ATOM   1512 N N   . VAL B 1 81  ? 32.744 -4.769  22.723  1.00 29.08 ? 1080 VAL B N   1 
ATOM   1513 C CA  . VAL B 1 81  ? 31.637 -4.226  23.508  1.00 24.39 ? 1080 VAL B CA  1 
ATOM   1514 C C   . VAL B 1 81  ? 30.268 -4.627  22.957  1.00 26.21 ? 1080 VAL B C   1 
ATOM   1515 O O   . VAL B 1 81  ? 29.308 -4.786  23.750  1.00 26.35 ? 1080 VAL B O   1 
ATOM   1516 C CB  . VAL B 1 81  ? 31.697 -2.696  23.576  1.00 22.25 ? 1080 VAL B CB  1 
ATOM   1517 C CG1 . VAL B 1 81  ? 30.628 -2.148  24.513  1.00 17.28 ? 1080 VAL B CG1 1 
ATOM   1518 C CG2 . VAL B 1 81  ? 33.059 -2.265  24.021  1.00 24.70 ? 1080 VAL B CG2 1 
ATOM   1519 N N   . VAL B 1 82  ? 30.161 -4.777  21.625  1.00 26.58 ? 1081 VAL B N   1 
ATOM   1520 C CA  . VAL B 1 82  ? 28.887 -5.182  20.987  1.00 27.46 ? 1081 VAL B CA  1 
ATOM   1521 C C   . VAL B 1 82  ? 28.581 -6.649  21.259  1.00 26.27 ? 1081 VAL B C   1 
ATOM   1522 O O   . VAL B 1 82  ? 27.439 -7.034  21.504  1.00 23.97 ? 1081 VAL B O   1 
ATOM   1523 C CB  . VAL B 1 82  ? 28.877 -4.966  19.411  1.00 28.70 ? 1081 VAL B CB  1 
ATOM   1524 C CG1 . VAL B 1 82  ? 29.280 -3.544  19.048  1.00 30.11 ? 1081 VAL B CG1 1 
ATOM   1525 C CG2 . VAL B 1 82  ? 29.794 -5.951  18.719  1.00 34.03 ? 1081 VAL B CG2 1 
ATOM   1526 N N   . GLU B 1 83  ? 29.640 -7.437  21.322  1.00 27.73 ? 1082 GLU B N   1 
ATOM   1527 C CA  . GLU B 1 83  ? 29.551 -8.836  21.724  1.00 32.51 ? 1082 GLU B CA  1 
ATOM   1528 C C   . GLU B 1 83  ? 29.043 -8.981  23.160  1.00 32.02 ? 1082 GLU B C   1 
ATOM   1529 O O   . GLU B 1 83  ? 28.216 -9.831  23.437  1.00 33.64 ? 1082 GLU B O   1 
ATOM   1530 C CB  . GLU B 1 83  ? 30.934 -9.466  21.610  1.00 36.24 ? 1082 GLU B CB  1 
ATOM   1531 C CG  . GLU B 1 83  ? 30.980 -10.953 21.825  1.00 41.78 ? 1082 GLU B CG  1 
ATOM   1532 C CD  . GLU B 1 83  ? 32.403 -11.466 21.800  1.00 46.22 ? 1082 GLU B CD  1 
ATOM   1533 O OE1 . GLU B 1 83  ? 33.189 -10.964 20.957  1.00 45.68 ? 1082 GLU B OE1 1 
ATOM   1534 O OE2 . GLU B 1 83  ? 32.750 -12.317 22.656  1.00 46.47 ? 1082 GLU B OE2 1 
ATOM   1535 N N   . LEU B 1 84  ? 29.573 -8.142  24.053  1.00 31.15 ? 1083 LEU B N   1 
ATOM   1536 C CA  . LEU B 1 84  ? 29.221 -8.097  25.473  1.00 26.23 ? 1083 LEU B CA  1 
ATOM   1537 C C   . LEU B 1 84  ? 27.783 -7.659  25.650  1.00 26.33 ? 1083 LEU B C   1 
ATOM   1538 O O   . LEU B 1 84  ? 26.960 -8.407  26.188  1.00 29.79 ? 1083 LEU B O   1 
ATOM   1539 C CB  . LEU B 1 84  ? 30.172 -7.136  26.211  1.00 28.22 ? 1083 LEU B CB  1 
ATOM   1540 C CG  . LEU B 1 84  ? 30.075 -6.711  27.690  1.00 26.34 ? 1083 LEU B CG  1 
ATOM   1541 C CD1 . LEU B 1 84  ? 29.918 -7.893  28.608  1.00 29.31 ? 1083 LEU B CD1 1 
ATOM   1542 C CD2 . LEU B 1 84  ? 31.346 -5.996  28.046  1.00 24.29 ? 1083 LEU B CD2 1 
ATOM   1543 N N   . ILE B 1 85  ? 27.438 -6.515  25.068  1.00 25.57 ? 1084 ILE B N   1 
ATOM   1544 C CA  . ILE B 1 85  ? 26.079 -5.977  25.206  1.00 25.75 ? 1084 ILE B CA  1 
ATOM   1545 C C   . ILE B 1 85  ? 25.042 -6.928  24.638  1.00 26.02 ? 1084 ILE B C   1 
ATOM   1546 O O   . ILE B 1 85  ? 24.010 -7.186  25.255  1.00 27.77 ? 1084 ILE B O   1 
ATOM   1547 C CB  . ILE B 1 85  ? 25.950 -4.611  24.505  1.00 26.16 ? 1084 ILE B CB  1 
ATOM   1548 C CG1 . ILE B 1 85  ? 26.788 -3.566  25.253  1.00 24.93 ? 1084 ILE B CG1 1 
ATOM   1549 C CG2 . ILE B 1 85  ? 24.487 -4.176  24.435  1.00 27.47 ? 1084 ILE B CG2 1 
ATOM   1550 C CD1 . ILE B 1 85  ? 26.402 -3.435  26.700  1.00 26.38 ? 1084 ILE B CD1 1 
ATOM   1551 N N   . ASN B 1 86  ? 25.358 -7.498  23.479  1.00 26.77 ? 1085 ASN B N   1 
ATOM   1552 C CA  . ASN B 1 86  ? 24.434 -8.392  22.800  1.00 25.87 ? 1085 ASN B CA  1 
ATOM   1553 C C   . ASN B 1 86  ? 24.150 -9.604  23.642  1.00 28.32 ? 1085 ASN B C   1 
ATOM   1554 O O   . ASN B 1 86  ? 23.017 -10.053 23.739  1.00 30.51 ? 1085 ASN B O   1 
ATOM   1555 C CB  . ASN B 1 86  ? 25.001 -8.826  21.474  1.00 25.90 ? 1085 ASN B CB  1 
ATOM   1556 C CG  . ASN B 1 86  ? 24.699 -7.841  20.374  1.00 27.34 ? 1085 ASN B CG  1 
ATOM   1557 O OD1 . ASN B 1 86  ? 23.811 -6.989  20.502  1.00 30.43 ? 1085 ASN B OD1 1 
ATOM   1558 N ND2 . ASN B 1 86  ? 25.429 -7.954  19.270  1.00 27.91 ? 1085 ASN B ND2 1 
ATOM   1559 N N   . HIS B 1 87  ? 25.177 -10.096 24.318  1.00 28.36 ? 1086 HIS B N   1 
ATOM   1560 C CA  . HIS B 1 87  ? 24.971 -11.209 25.215  1.00 27.38 ? 1086 HIS B CA  1 
ATOM   1561 C C   . HIS B 1 87  ? 23.920 -10.866 26.244  1.00 27.19 ? 1086 HIS B C   1 
ATOM   1562 O O   . HIS B 1 87  ? 22.880 -11.536 26.324  1.00 28.27 ? 1086 HIS B O   1 
ATOM   1563 C CB  . HIS B 1 87  ? 26.240 -11.590 25.938  1.00 27.13 ? 1086 HIS B CB  1 
ATOM   1564 C CG  . HIS B 1 87  ? 26.096 -12.830 26.748  1.00 27.15 ? 1086 HIS B CG  1 
ATOM   1565 N ND1 . HIS B 1 87  ? 26.291 -14.083 26.219  1.00 29.55 ? 1086 HIS B ND1 1 
ATOM   1566 C CD2 . HIS B 1 87  ? 25.791 -13.013 28.053  1.00 24.70 ? 1086 HIS B CD2 1 
ATOM   1567 C CE1 . HIS B 1 87  ? 26.140 -14.987 27.164  1.00 32.45 ? 1086 HIS B CE1 1 
ATOM   1568 N NE2 . HIS B 1 87  ? 25.841 -14.364 28.290  1.00 28.55 ? 1086 HIS B NE2 1 
ATOM   1569 N N   . TYR B 1 88  ? 24.163 -9.803  27.004  1.00 25.60 ? 1087 TYR B N   1 
ATOM   1570 C CA  . TYR B 1 88  ? 23.273 -9.488  28.115  1.00 23.38 ? 1087 TYR B CA  1 
ATOM   1571 C C   . TYR B 1 88  ? 21.950 -8.850  27.716  1.00 23.90 ? 1087 TYR B C   1 
ATOM   1572 O O   . TYR B 1 88  ? 21.105 -8.583  28.563  1.00 23.69 ? 1087 TYR B O   1 
ATOM   1573 C CB  . TYR B 1 88  ? 24.022 -8.649  29.137  1.00 21.60 ? 1087 TYR B CB  1 
ATOM   1574 C CG  . TYR B 1 88  ? 25.055 -9.473  29.850  1.00 19.76 ? 1087 TYR B CG  1 
ATOM   1575 C CD1 . TYR B 1 88  ? 26.403 -9.374  29.514  1.00 18.16 ? 1087 TYR B CD1 1 
ATOM   1576 C CD2 . TYR B 1 88  ? 24.674 -10.447 30.768  1.00 17.51 ? 1087 TYR B CD2 1 
ATOM   1577 C CE1 . TYR B 1 88  ? 27.350 -10.225 30.087  1.00 15.08 ? 1087 TYR B CE1 1 
ATOM   1578 C CE2 . TYR B 1 88  ? 25.607 -11.296 31.344  1.00 17.57 ? 1087 TYR B CE2 1 
ATOM   1579 C CZ  . TYR B 1 88  ? 26.944 -11.169 31.011  1.00 15.94 ? 1087 TYR B CZ  1 
ATOM   1580 O OH  . TYR B 1 88  ? 27.871 -11.934 31.688  1.00 17.55 ? 1087 TYR B OH  1 
ATOM   1581 N N   . ARG B 1 89  ? 21.700 -8.798  26.412  1.00 24.11 ? 1088 ARG B N   1 
ATOM   1582 C CA  . ARG B 1 89  ? 20.348 -8.590  25.924  1.00 26.18 ? 1088 ARG B CA  1 
ATOM   1583 C C   . ARG B 1 89  ? 19.513 -9.853  26.164  1.00 26.76 ? 1088 ARG B C   1 
ATOM   1584 O O   . ARG B 1 89  ? 18.306 -9.775  26.395  1.00 30.04 ? 1088 ARG B O   1 
ATOM   1585 C CB  . ARG B 1 89  ? 20.344 -8.237  24.428  1.00 27.38 ? 1088 ARG B CB  1 
ATOM   1586 C CG  . ARG B 1 89  ? 21.202 -7.026  24.032  1.00 28.80 ? 1088 ARG B CG  1 
ATOM   1587 C CD  . ARG B 1 89  ? 20.430 -5.707  23.974  1.00 31.01 ? 1088 ARG B CD  1 
ATOM   1588 N NE  . ARG B 1 89  ? 19.066 -5.845  23.454  1.00 38.15 ? 1088 ARG B NE  1 
ATOM   1589 C CZ  . ARG B 1 89  ? 18.577 -5.135  22.429  1.00 41.78 ? 1088 ARG B CZ  1 
ATOM   1590 N NH1 . ARG B 1 89  ? 17.311 -5.280  22.059  1.00 40.99 ? 1088 ARG B NH1 1 
ATOM   1591 N NH2 . ARG B 1 89  ? 19.372 -4.348  21.700  1.00 41.52 ? 1088 ARG B NH2 1 
ATOM   1592 N N   . ASN B 1 90  ? 20.165 -11.006 26.221  1.00 27.75 ? 1089 ASN B N   1 
ATOM   1593 C CA  . ASN B 1 90  ? 19.437 -12.267 26.380  1.00 31.46 ? 1089 ASN B CA  1 
ATOM   1594 C C   . ASN B 1 90  ? 19.619 -12.988 27.721  1.00 34.68 ? 1089 ASN B C   1 
ATOM   1595 O O   . ASN B 1 90  ? 19.198 -14.153 27.885  1.00 36.88 ? 1089 ASN B O   1 
ATOM   1596 C CB  . ASN B 1 90  ? 19.813 -13.204 25.244  1.00 28.28 ? 1089 ASN B CB  1 
ATOM   1597 C CG  . ASN B 1 90  ? 19.032 -12.917 24.010  1.00 29.35 ? 1089 ASN B CG  1 
ATOM   1598 O OD1 . ASN B 1 90  ? 17.795 -12.967 24.024  1.00 27.60 ? 1089 ASN B OD1 1 
ATOM   1599 N ND2 . ASN B 1 90  ? 19.719 -12.499 22.965  1.00 25.41 ? 1089 ASN B ND2 1 
ATOM   1600 N N   . GLU B 1 91  ? 20.308 -12.324 28.643  1.00 33.15 ? 1090 GLU B N   1 
ATOM   1601 C CA  . GLU B 1 91  ? 20.657 -12.936 29.909  1.00 28.91 ? 1090 GLU B CA  1 
ATOM   1602 C C   . GLU B 1 91  ? 20.744 -11.816 30.921  1.00 26.79 ? 1090 GLU B C   1 
ATOM   1603 O O   . GLU B 1 91  ? 21.349 -10.782 30.655  1.00 27.77 ? 1090 GLU B O   1 
ATOM   1604 C CB  . GLU B 1 91  ? 22.007 -13.640 29.805  1.00 26.56 ? 1090 GLU B CB  1 
ATOM   1605 C CG  . GLU B 1 91  ? 22.108 -14.853 30.705  1.00 32.46 ? 1090 GLU B CG  1 
ATOM   1606 C CD  . GLU B 1 91  ? 23.535 -15.161 31.114  1.00 39.49 ? 1090 GLU B CD  1 
ATOM   1607 O OE1 . GLU B 1 91  ? 23.832 -15.167 32.328  1.00 42.11 ? 1090 GLU B OE1 1 
ATOM   1608 O OE2 . GLU B 1 91  ? 24.357 -15.421 30.217  1.00 40.48 ? 1090 GLU B OE2 1 
ATOM   1609 N N   . SER B 1 92  ? 20.056 -11.989 32.040  1.00 26.54 ? 1091 SER B N   1 
ATOM   1610 C CA  . SER B 1 92  ? 20.065 -11.012 33.128  1.00 24.24 ? 1091 SER B CA  1 
ATOM   1611 C C   . SER B 1 92  ? 21.438 -10.820 33.735  1.00 23.76 ? 1091 SER B C   1 
ATOM   1612 O O   . SER B 1 92  ? 22.282 -11.727 33.698  1.00 23.36 ? 1091 SER B O   1 
ATOM   1613 C CB  . SER B 1 92  ? 19.095 -11.437 34.224  1.00 22.83 ? 1091 SER B CB  1 
ATOM   1614 O OG  . SER B 1 92  ? 19.738 -12.291 35.138  1.00 23.31 ? 1091 SER B OG  1 
ATOM   1615 N N   . LEU B 1 93  ? 21.657 -9.664  34.343  1.00 24.89 ? 1092 LEU B N   1 
ATOM   1616 C CA  . LEU B 1 93  ? 22.962 -9.379  34.946  1.00 29.52 ? 1092 LEU B CA  1 
ATOM   1617 C C   . LEU B 1 93  ? 23.048 -9.772  36.444  1.00 29.54 ? 1092 LEU B C   1 
ATOM   1618 O O   . LEU B 1 93  ? 23.995 -9.381  37.151  1.00 30.42 ? 1092 LEU B O   1 
ATOM   1619 C CB  . LEU B 1 93  ? 23.279 -7.895  34.772  1.00 31.29 ? 1092 LEU B CB  1 
ATOM   1620 C CG  . LEU B 1 93  ? 23.352 -7.404  33.331  1.00 28.26 ? 1092 LEU B CG  1 
ATOM   1621 C CD1 . LEU B 1 93  ? 22.664 -6.047  33.215  1.00 31.14 ? 1092 LEU B CD1 1 
ATOM   1622 C CD2 . LEU B 1 93  ? 24.793 -7.315  32.916  1.00 23.74 ? 1092 LEU B CD2 1 
ATOM   1623 N N   . ALA B 1 94  ? 22.142 -10.652 36.871  1.00 26.62 ? 1093 ALA B N   1 
ATOM   1624 C CA  . ALA B 1 94  ? 22.001 -10.991 38.279  1.00 26.66 ? 1093 ALA B CA  1 
ATOM   1625 C C   . ALA B 1 94  ? 23.243 -11.610 38.881  1.00 28.05 ? 1093 ALA B C   1 
ATOM   1626 O O   . ALA B 1 94  ? 23.573 -11.323 40.023  1.00 30.92 ? 1093 ALA B O   1 
ATOM   1627 C CB  . ALA B 1 94  ? 20.820 -11.917 38.490  1.00 27.04 ? 1093 ALA B CB  1 
ATOM   1628 N N   . GLN B 1 95  ? 23.958 -12.425 38.110  1.00 30.02 ? 1094 GLN B N   1 
ATOM   1629 C CA  . GLN B 1 95  ? 25.127 -13.126 38.645  1.00 30.96 ? 1094 GLN B CA  1 
ATOM   1630 C C   . GLN B 1 95  ? 26.287 -12.191 38.958  1.00 32.23 ? 1094 GLN B C   1 
ATOM   1631 O O   . GLN B 1 95  ? 27.309 -12.621 39.486  1.00 34.14 ? 1094 GLN B O   1 
ATOM   1632 C CB  . GLN B 1 95  ? 25.594 -14.226 37.686  1.00 37.18 ? 1094 GLN B CB  1 
ATOM   1633 C CG  . GLN B 1 95  ? 24.560 -15.326 37.425  1.00 49.57 ? 1094 GLN B CG  1 
ATOM   1634 C CD  . GLN B 1 95  ? 24.042 -15.959 38.706  1.00 57.69 ? 1094 GLN B CD  1 
ATOM   1635 O OE1 . GLN B 1 95  ? 22.869 -15.801 39.072  1.00 62.20 ? 1094 GLN B OE1 1 
ATOM   1636 N NE2 . GLN B 1 95  ? 24.941 -16.582 39.453  1.00 59.93 ? 1094 GLN B NE2 1 
ATOM   1637 N N   . TYR B 1 96  ? 26.176 -10.935 38.534  1.00 32.12 ? 1095 TYR B N   1 
ATOM   1638 C CA  . TYR B 1 96  ? 27.166 -9.920  38.901  1.00 30.07 ? 1095 TYR B CA  1 
ATOM   1639 C C   . TYR B 1 96  ? 26.747 -9.174  40.172  1.00 27.62 ? 1095 TYR B C   1 
ATOM   1640 O O   . TYR B 1 96  ? 27.567 -8.707  40.952  1.00 27.31 ? 1095 TYR B O   1 
ATOM   1641 C CB  . TYR B 1 96  ? 27.359 -8.921  37.754  1.00 26.65 ? 1095 TYR B CB  1 
ATOM   1642 C CG  . TYR B 1 96  ? 28.013 -9.499  36.532  1.00 24.02 ? 1095 TYR B CG  1 
ATOM   1643 C CD1 . TYR B 1 96  ? 27.257 -9.881  35.429  1.00 21.00 ? 1095 TYR B CD1 1 
ATOM   1644 C CD2 . TYR B 1 96  ? 29.400 -9.653  36.471  1.00 21.73 ? 1095 TYR B CD2 1 
ATOM   1645 C CE1 . TYR B 1 96  ? 27.866 -10.402 34.290  1.00 21.48 ? 1095 TYR B CE1 1 
ATOM   1646 C CE2 . TYR B 1 96  ? 30.017 -10.183 35.335  1.00 23.20 ? 1095 TYR B CE2 1 
ATOM   1647 C CZ  . TYR B 1 96  ? 29.234 -10.549 34.248  1.00 21.00 ? 1095 TYR B CZ  1 
ATOM   1648 O OH  . TYR B 1 96  ? 29.839 -10.989 33.099  1.00 24.83 ? 1095 TYR B OH  1 
ATOM   1649 N N   . ASN B 1 97  ? 25.448 -9.061  40.351  1.00 26.69 ? 1096 ASN B N   1 
ATOM   1650 C CA  . ASN B 1 97  ? 24.894 -8.273  41.435  1.00 28.53 ? 1096 ASN B CA  1 
ATOM   1651 C C   . ASN B 1 97  ? 23.412 -8.607  41.569  1.00 29.78 ? 1096 ASN B C   1 
ATOM   1652 O O   . ASN B 1 97  ? 22.644 -8.482  40.613  1.00 27.92 ? 1096 ASN B O   1 
ATOM   1653 C CB  . ASN B 1 97  ? 25.085 -6.781  41.135  1.00 30.00 ? 1096 ASN B CB  1 
ATOM   1654 C CG  . ASN B 1 97  ? 24.818 -5.895  42.339  1.00 33.63 ? 1096 ASN B CG  1 
ATOM   1655 O OD1 . ASN B 1 97  ? 23.749 -5.955  42.960  1.00 30.43 ? 1096 ASN B OD1 1 
ATOM   1656 N ND2 . ASN B 1 97  ? 25.769 -5.048  42.653  1.00 30.51 ? 1096 ASN B ND2 1 
ATOM   1657 N N   . PRO B 1 98  ? 23.000 -9.102  42.748  1.00 31.20 ? 1097 PRO B N   1 
ATOM   1658 C CA  . PRO B 1 98  ? 21.618 -9.557  42.977  1.00 30.83 ? 1097 PRO B CA  1 
ATOM   1659 C C   . PRO B 1 98  ? 20.576 -8.476  42.755  1.00 30.80 ? 1097 PRO B C   1 
ATOM   1660 O O   . PRO B 1 98  ? 19.393 -8.768  42.601  1.00 32.95 ? 1097 PRO B O   1 
ATOM   1661 C CB  . PRO B 1 98  ? 21.622 -10.034 44.436  1.00 32.25 ? 1097 PRO B CB  1 
ATOM   1662 C CG  . PRO B 1 98  ? 22.923 -9.498  45.030  1.00 33.45 ? 1097 PRO B CG  1 
ATOM   1663 C CD  . PRO B 1 98  ? 23.878 -9.460  43.878  1.00 33.14 ? 1097 PRO B CD  1 
ATOM   1664 N N   . LYS B 1 99  ? 21.027 -7.226  42.806  1.00 29.78 ? 1098 LYS B N   1 
ATOM   1665 C CA  . LYS B 1 99  ? 20.186 -6.072  42.495  1.00 31.77 ? 1098 LYS B CA  1 
ATOM   1666 C C   . LYS B 1 99  ? 19.895 -5.916  40.999  1.00 31.50 ? 1098 LYS B C   1 
ATOM   1667 O O   . LYS B 1 99  ? 19.002 -5.165  40.611  1.00 30.18 ? 1098 LYS B O   1 
ATOM   1668 C CB  . LYS B 1 99  ? 20.850 -4.789  42.986  1.00 33.68 ? 1098 LYS B CB  1 
ATOM   1669 C CG  . LYS B 1 99  ? 20.553 -4.462  44.437  1.00 37.88 ? 1098 LYS B CG  1 
ATOM   1670 C CD  . LYS B 1 99  ? 19.601 -3.271  44.597  1.00 36.01 ? 1098 LYS B CD  1 
ATOM   1671 C CE  . LYS B 1 99  ? 19.943 -2.467  45.850  1.00 31.95 ? 1098 LYS B CE  1 
ATOM   1672 N NZ  . LYS B 1 99  ? 21.420 -2.416  46.077  1.00 30.64 ? 1098 LYS B NZ  1 
ATOM   1673 N N   . LEU B 1 100 ? 20.725 -6.543  40.169  1.00 31.24 ? 1099 LEU B N   1 
ATOM   1674 C CA  . LEU B 1 100 ? 20.615 -6.423  38.719  1.00 30.06 ? 1099 LEU B CA  1 
ATOM   1675 C C   . LEU B 1 100 ? 19.935 -7.630  38.081  1.00 31.49 ? 1099 LEU B C   1 
ATOM   1676 O O   . LEU B 1 100 ? 20.441 -8.202  37.123  1.00 31.52 ? 1099 LEU B O   1 
ATOM   1677 C CB  . LEU B 1 100 ? 21.998 -6.196  38.104  1.00 25.94 ? 1099 LEU B CB  1 
ATOM   1678 C CG  . LEU B 1 100 ? 22.641 -4.877  38.567  1.00 28.53 ? 1099 LEU B CG  1 
ATOM   1679 C CD1 . LEU B 1 100 ? 24.064 -4.763  38.065  1.00 27.36 ? 1099 LEU B CD1 1 
ATOM   1680 C CD2 . LEU B 1 100 ? 21.813 -3.710  38.085  1.00 25.73 ? 1099 LEU B CD2 1 
ATOM   1681 N N   . ASP B 1 101 ? 18.708 -7.907  38.506  1.00 32.47 ? 1100 ASP B N   1 
ATOM   1682 C CA  . ASP B 1 101 ? 17.903 -8.912  37.832  1.00 34.61 ? 1100 ASP B CA  1 
ATOM   1683 C C   . ASP B 1 101 ? 17.159 -8.310  36.636  1.00 33.98 ? 1100 ASP B C   1 
ATOM   1684 O O   . ASP B 1 101 ? 15.930 -8.225  36.610  1.00 34.57 ? 1100 ASP B O   1 
ATOM   1685 C CB  . ASP B 1 101 ? 16.922 -9.553  38.806  1.00 41.08 ? 1100 ASP B CB  1 
ATOM   1686 C CG  . ASP B 1 101 ? 16.072 -8.533  39.520  1.00 47.78 ? 1100 ASP B CG  1 
ATOM   1687 O OD1 . ASP B 1 101 ? 14.835 -8.550  39.313  1.00 53.19 ? 1100 ASP B OD1 1 
ATOM   1688 O OD2 . ASP B 1 101 ? 16.634 -7.689  40.251  1.00 49.89 ? 1100 ASP B OD2 1 
ATOM   1689 N N   . VAL B 1 102 ? 17.931 -7.848  35.660  1.00 32.23 ? 1101 VAL B N   1 
ATOM   1690 C CA  . VAL B 1 102 ? 17.392 -7.364  34.392  1.00 29.84 ? 1101 VAL B CA  1 
ATOM   1691 C C   . VAL B 1 102 ? 18.278 -7.824  33.263  1.00 28.05 ? 1101 VAL B C   1 
ATOM   1692 O O   . VAL B 1 102 ? 19.458 -8.127  33.467  1.00 25.73 ? 1101 VAL B O   1 
ATOM   1693 C CB  . VAL B 1 102 ? 17.353 -5.793  34.297  1.00 30.46 ? 1101 VAL B CB  1 
ATOM   1694 C CG1 . VAL B 1 102 ? 16.034 -5.256  34.804  1.00 32.81 ? 1101 VAL B CG1 1 
ATOM   1695 C CG2 . VAL B 1 102 ? 18.538 -5.180  35.011  1.00 26.63 ? 1101 VAL B CG2 1 
ATOM   1696 N N   . LYS B 1 103 ? 17.711 -7.803  32.062  1.00 29.50 ? 1102 LYS B N   1 
ATOM   1697 C CA  . LYS B 1 103 ? 18.480 -7.824  30.827  1.00 31.38 ? 1102 LYS B CA  1 
ATOM   1698 C C   . LYS B 1 103 ? 18.529 -6.434  30.213  1.00 31.05 ? 1102 LYS B C   1 
ATOM   1699 O O   . LYS B 1 103 ? 17.725 -5.552  30.550  1.00 31.37 ? 1102 LYS B O   1 
ATOM   1700 C CB  . LYS B 1 103 ? 17.859 -8.776  29.809  1.00 32.82 ? 1102 LYS B CB  1 
ATOM   1701 C CG  . LYS B 1 103 ? 17.581 -10.170 30.322  1.00 36.55 ? 1102 LYS B CG  1 
ATOM   1702 C CD  . LYS B 1 103 ? 16.814 -10.969 29.297  1.00 39.69 ? 1102 LYS B CD  1 
ATOM   1703 C CE  . LYS B 1 103 ? 16.300 -12.259 29.877  1.00 41.49 ? 1102 LYS B CE  1 
ATOM   1704 N NZ  . LYS B 1 103 ? 15.126 -12.730 29.101  1.00 44.43 ? 1102 LYS B NZ  1 
ATOM   1705 N N   . LEU B 1 104 ? 19.449 -6.247  29.279  1.00 30.92 ? 1103 LEU B N   1 
ATOM   1706 C CA  . LEU B 1 104 ? 19.455 -5.035  28.484  1.00 29.33 ? 1103 LEU B CA  1 
ATOM   1707 C C   . LEU B 1 104 ? 18.310 -5.137  27.464  1.00 28.32 ? 1103 LEU B C   1 
ATOM   1708 O O   . LEU B 1 104 ? 18.469 -5.725  26.394  1.00 24.76 ? 1103 LEU B O   1 
ATOM   1709 C CB  . LEU B 1 104 ? 20.818 -4.899  27.799  1.00 28.42 ? 1103 LEU B CB  1 
ATOM   1710 C CG  . LEU B 1 104 ? 22.006 -5.083  28.753  1.00 27.27 ? 1103 LEU B CG  1 
ATOM   1711 C CD1 . LEU B 1 104 ? 23.305 -4.830  28.019  1.00 22.21 ? 1103 LEU B CD1 1 
ATOM   1712 C CD2 . LEU B 1 104 ? 21.861 -4.140  29.942  1.00 27.22 ? 1103 LEU B CD2 1 
ATOM   1713 N N   . LEU B 1 105 ? 17.118 -4.698  27.867  1.00 30.32 ? 1104 LEU B N   1 
ATOM   1714 C CA  . LEU B 1 105 ? 15.927 -4.834  27.024  1.00 31.60 ? 1104 LEU B CA  1 
ATOM   1715 C C   . LEU B 1 105 ? 15.757 -3.747  25.961  1.00 34.26 ? 1104 LEU B C   1 
ATOM   1716 O O   . LEU B 1 105 ? 15.574 -4.067  24.777  1.00 35.73 ? 1104 LEU B O   1 
ATOM   1717 C CB  . LEU B 1 105 ? 14.666 -4.874  27.878  1.00 32.17 ? 1104 LEU B CB  1 
ATOM   1718 C CG  . LEU B 1 105 ? 14.562 -6.009  28.886  1.00 31.60 ? 1104 LEU B CG  1 
ATOM   1719 C CD1 . LEU B 1 105 ? 13.194 -5.986  29.519  1.00 32.56 ? 1104 LEU B CD1 1 
ATOM   1720 C CD2 . LEU B 1 105 ? 14.817 -7.327  28.188  1.00 32.01 ? 1104 LEU B CD2 1 
ATOM   1721 N N   . TYR B 1 106 ? 15.754 -2.477  26.386  1.00 33.99 ? 1105 TYR B N   1 
ATOM   1722 C CA  . TYR B 1 106 ? 15.409 -1.367  25.497  1.00 33.55 ? 1105 TYR B CA  1 
ATOM   1723 C C   . TYR B 1 106 ? 16.580 -0.414  25.257  1.00 34.12 ? 1105 TYR B C   1 
ATOM   1724 O O   . TYR B 1 106 ? 16.978 0.343   26.142  1.00 36.04 ? 1105 TYR B O   1 
ATOM   1725 C CB  . TYR B 1 106 ? 14.220 -0.568  26.041  1.00 31.91 ? 1105 TYR B CB  1 
ATOM   1726 C CG  . TYR B 1 106 ? 13.101 -1.402  26.622  1.00 32.70 ? 1105 TYR B CG  1 
ATOM   1727 C CD1 . TYR B 1 106 ? 12.354 -2.253  25.822  1.00 34.21 ? 1105 TYR B CD1 1 
ATOM   1728 C CD2 . TYR B 1 106 ? 12.877 -1.430  27.997  1.00 31.50 ? 1105 TYR B CD2 1 
ATOM   1729 C CE1 . TYR B 1 106 ? 11.413 -3.128  26.379  1.00 36.60 ? 1105 TYR B CE1 1 
ATOM   1730 C CE2 . TYR B 1 106 ? 11.959 -2.290  28.563  1.00 30.73 ? 1105 TYR B CE2 1 
ATOM   1731 C CZ  . TYR B 1 106 ? 11.223 -3.132  27.757  1.00 34.41 ? 1105 TYR B CZ  1 
ATOM   1732 O OH  . TYR B 1 106 ? 10.248 -3.923  28.313  1.00 36.62 ? 1105 TYR B OH  1 
ATOM   1733 N N   . PRO B 1 107 ? 17.141 -0.430  24.038  1.00 33.08 ? 1106 PRO B N   1 
ATOM   1734 C CA  . PRO B 1 107 ? 18.250 0.464   23.680  1.00 35.19 ? 1106 PRO B CA  1 
ATOM   1735 C C   . PRO B 1 107 ? 17.807 1.903   23.416  1.00 35.60 ? 1106 PRO B C   1 
ATOM   1736 O O   . PRO B 1 107 ? 16.876 2.150   22.640  1.00 38.16 ? 1106 PRO B O   1 
ATOM   1737 C CB  . PRO B 1 107 ? 18.830 -0.176  22.409  1.00 36.93 ? 1106 PRO B CB  1 
ATOM   1738 C CG  . PRO B 1 107 ? 18.204 -1.558  22.332  1.00 34.26 ? 1106 PRO B CG  1 
ATOM   1739 C CD  . PRO B 1 107 ? 16.879 -1.420  22.985  1.00 34.18 ? 1106 PRO B CD  1 
ATOM   1740 N N   . VAL B 1 108 ? 18.514 2.862   23.998  1.00 34.47 ? 1107 VAL B N   1 
ATOM   1741 C CA  . VAL B 1 108 ? 18.292 4.260   23.640  1.00 33.81 ? 1107 VAL B CA  1 
ATOM   1742 C C   . VAL B 1 108 ? 19.040 4.518   22.332  1.00 35.03 ? 1107 VAL B C   1 
ATOM   1743 O O   . VAL B 1 108 ? 20.276 4.542   22.305  1.00 33.58 ? 1107 VAL B O   1 
ATOM   1744 C CB  . VAL B 1 108 ? 18.788 5.239   24.749  1.00 34.03 ? 1107 VAL B CB  1 
ATOM   1745 C CG1 . VAL B 1 108 ? 18.458 6.665   24.372  1.00 31.20 ? 1107 VAL B CG1 1 
ATOM   1746 C CG2 . VAL B 1 108 ? 18.133 4.910   26.083  1.00 35.05 ? 1107 VAL B CG2 1 
ATOM   1747 N N   . SER B 1 109 ? 18.278 4.601   21.241  1.00 34.94 ? 1108 SER B N   1 
ATOM   1748 C CA  . SER B 1 109 ? 18.811 4.617   19.877  1.00 34.88 ? 1108 SER B CA  1 
ATOM   1749 C C   . SER B 1 109 ? 19.105 6.027   19.398  1.00 35.24 ? 1108 SER B C   1 
ATOM   1750 O O   . SER B 1 109 ? 18.209 6.866   19.326  1.00 36.64 ? 1108 SER B O   1 
ATOM   1751 C CB  . SER B 1 109 ? 17.813 3.970   18.911  1.00 36.81 ? 1108 SER B CB  1 
ATOM   1752 O OG  . SER B 1 109 ? 18.288 3.990   17.570  1.00 36.35 ? 1108 SER B OG  1 
ATOM   1753 N N   . LYS B 1 110 ? 20.353 6.272   19.023  1.00 34.20 ? 1109 LYS B N   1 
ATOM   1754 C CA  . LYS B 1 110 ? 20.732 7.559   18.463  1.00 35.86 ? 1109 LYS B CA  1 
ATOM   1755 C C   . LYS B 1 110 ? 20.116 7.814   17.090  1.00 40.05 ? 1109 LYS B C   1 
ATOM   1756 O O   . LYS B 1 110 ? 20.229 8.918   16.565  1.00 42.76 ? 1109 LYS B O   1 
ATOM   1757 C CB  . LYS B 1 110 ? 22.254 7.674   18.365  1.00 34.21 ? 1109 LYS B CB  1 
ATOM   1758 C CG  . LYS B 1 110 ? 22.918 6.649   17.469  1.00 30.99 ? 1109 LYS B CG  1 
ATOM   1759 C CD  . LYS B 1 110 ? 24.412 6.652   17.710  1.00 31.31 ? 1109 LYS B CD  1 
ATOM   1760 C CE  . LYS B 1 110 ? 25.139 5.575   16.930  1.00 31.56 ? 1109 LYS B CE  1 
ATOM   1761 N NZ  . LYS B 1 110 ? 26.574 5.462   17.354  1.00 29.24 ? 1109 LYS B NZ  1 
ATOM   1762 N N   . TYR B 1 111 ? 19.538 6.787   16.465  1.00 41.58 ? 1110 TYR B N   1 
ATOM   1763 C CA  . TYR B 1 111 ? 18.896 6.962   15.156  1.00 41.40 ? 1110 TYR B CA  1 
ATOM   1764 C C   . TYR B 1 111 ? 17.434 7.381   15.308  1.00 43.28 ? 1110 TYR B C   1 
ATOM   1765 O O   . TYR B 1 111 ? 16.675 7.381   14.340  1.00 45.97 ? 1110 TYR B O   1 
ATOM   1766 C CB  . TYR B 1 111 ? 18.986 5.676   14.303  1.00 31.98 ? 1110 TYR B CB  1 
ATOM   1767 C CG  . TYR B 1 111 ? 20.391 5.207   14.011  1.00 23.80 ? 1110 TYR B CG  1 
ATOM   1768 C CD1 . TYR B 1 111 ? 20.805 3.946   14.393  1.00 23.03 ? 1110 TYR B CD1 1 
ATOM   1769 C CD2 . TYR B 1 111 ? 21.335 6.065   13.449  1.00 18.58 ? 1110 TYR B CD2 1 
ATOM   1770 C CE1 . TYR B 1 111 ? 22.130 3.548   14.260  1.00 21.62 ? 1110 TYR B CE1 1 
ATOM   1771 C CE2 . TYR B 1 111 ? 22.662 5.677   13.295  1.00 18.00 ? 1110 TYR B CE2 1 
ATOM   1772 C CZ  . TYR B 1 111 ? 23.052 4.409   13.723  1.00 21.71 ? 1110 TYR B CZ  1 
ATOM   1773 O OH  . TYR B 1 111 ? 24.370 4.030   13.657  1.00 27.06 ? 1110 TYR B OH  1 
ATOM   1774 N N   . GLN B 1 112 ? 17.027 7.655   16.537  1.00 44.56 ? 1111 GLN B N   1 
ATOM   1775 C CA  . GLN B 1 112 ? 15.768 8.357   16.773  1.00 50.29 ? 1111 GLN B CA  1 
ATOM   1776 C C   . GLN B 1 112 ? 15.936 9.397   17.873  1.00 52.12 ? 1111 GLN B C   1 
ATOM   1777 O O   . GLN B 1 112 ? 17.021 9.974   18.026  1.00 54.79 ? 1111 GLN B O   1 
ATOM   1778 C CB  . GLN B 1 112 ? 14.652 7.381   17.146  1.00 52.16 ? 1111 GLN B CB  1 
ATOM   1779 C CG  . GLN B 1 112 ? 13.693 7.077   16.004  1.00 59.71 ? 1111 GLN B CG  1 
ATOM   1780 C CD  . GLN B 1 112 ? 14.191 5.967   15.087  1.00 65.23 ? 1111 GLN B CD  1 
ATOM   1781 O OE1 . GLN B 1 112 ? 14.794 4.989   15.546  1.00 66.54 ? 1111 GLN B OE1 1 
ATOM   1782 N NE2 . GLN B 1 112 ? 13.946 6.113   13.785  1.00 65.62 ? 1111 GLN B NE2 1 
ATOM   1783 N N   . SER C 2 1   ? 20.982 9.526   -13.214 1.00 42.78 ? 201  SER C N   1 
ATOM   1784 C CA  . SER C 2 1   ? 21.814 8.482   -13.891 1.00 42.84 ? 201  SER C CA  1 
ATOM   1785 C C   . SER C 2 1   ? 20.954 7.654   -14.843 1.00 44.06 ? 201  SER C C   1 
ATOM   1786 O O   . SER C 2 1   ? 19.736 7.823   -14.878 1.00 44.29 ? 201  SER C O   1 
ATOM   1787 C CB  . SER C 2 1   ? 22.413 7.553   -12.855 1.00 40.96 ? 201  SER C CB  1 
ATOM   1788 O OG  . SER C 2 1   ? 21.386 7.084   -12.016 1.00 43.56 ? 201  SER C OG  1 
ATOM   1789 N N   . ILE C 2 2   ? 21.579 6.739   -15.581 1.00 45.02 ? 202  ILE C N   1 
ATOM   1790 C CA  . ILE C 2 2   ? 20.843 5.922   -16.545 1.00 44.65 ? 202  ILE C CA  1 
ATOM   1791 C C   . ILE C 2 2   ? 19.825 5.000   -15.886 1.00 43.16 ? 202  ILE C C   1 
ATOM   1792 O O   . ILE C 2 2   ? 18.631 5.133   -16.129 1.00 46.46 ? 202  ILE C O   1 
ATOM   1793 C CB  . ILE C 2 2   ? 21.787 5.115   -17.462 1.00 44.68 ? 202  ILE C CB  1 
ATOM   1794 C CG1 . ILE C 2 2   ? 22.534 6.079   -18.391 1.00 46.57 ? 202  ILE C CG1 1 
ATOM   1795 C CG2 . ILE C 2 2   ? 20.990 4.132   -18.313 1.00 44.97 ? 202  ILE C CG2 1 
ATOM   1796 C CD1 . ILE C 2 2   ? 21.630 7.110   -19.088 1.00 42.29 ? 202  ILE C CD1 1 
ATOM   1797 N N   . ASP C 2 3   ? 20.270 4.126   -14.996 1.00 40.93 ? 203  ASP C N   1 
ATOM   1798 C CA  . ASP C 2 3   ? 19.340 3.464   -14.083 1.00 40.35 ? 203  ASP C CA  1 
ATOM   1799 C C   . ASP C 2 3   ? 19.807 3.576   -12.634 1.00 36.62 ? 203  ASP C C   1 
ATOM   1800 O O   . ASP C 2 3   ? 19.541 4.567   -11.974 1.00 37.50 ? 203  ASP C O   1 
ATOM   1801 C CB  . ASP C 2 3   ? 19.154 2.000   -14.477 1.00 46.75 ? 203  ASP C CB  1 
ATOM   1802 C CG  . ASP C 2 3   ? 17.815 1.435   -14.018 1.00 54.95 ? 203  ASP C CG  1 
ATOM   1803 O OD1 . ASP C 2 3   ? 17.675 0.191   -14.004 1.00 57.20 ? 203  ASP C OD1 1 
ATOM   1804 O OD2 . ASP C 2 3   ? 16.895 2.224   -13.688 1.00 58.15 ? 203  ASP C OD2 1 
HETATM 1805 N N   . PTR C 2 4   ? 20.646 2.642   -12.204 1.00 31.96 ? 204  PTR C N   1 
HETATM 1806 C CA  . PTR C 2 4   ? 21.276 2.724   -10.892 1.00 27.22 ? 204  PTR C CA  1 
HETATM 1807 C C   . PTR C 2 4   ? 22.296 3.836   -10.796 1.00 24.38 ? 204  PTR C C   1 
HETATM 1808 O O   . PTR C 2 4   ? 23.050 4.077   -11.756 1.00 26.90 ? 204  PTR C O   1 
HETATM 1809 C CB  . PTR C 2 4   ? 21.955 1.406   -10.553 1.00 26.00 ? 204  PTR C CB  1 
HETATM 1810 C CG  . PTR C 2 4   ? 21.003 0.371   -10.043 1.00 24.74 ? 204  PTR C CG  1 
HETATM 1811 C CD1 . PTR C 2 4   ? 21.043 -0.024  -8.720  1.00 26.66 ? 204  PTR C CD1 1 
HETATM 1812 C CD2 . PTR C 2 4   ? 20.027 -0.169  -10.866 1.00 24.99 ? 204  PTR C CD2 1 
HETATM 1813 C CE1 . PTR C 2 4   ? 20.136 -0.941  -8.217  1.00 28.66 ? 204  PTR C CE1 1 
HETATM 1814 C CE2 . PTR C 2 4   ? 19.104 -1.080  -10.376 1.00 27.92 ? 204  PTR C CE2 1 
HETATM 1815 C CZ  . PTR C 2 4   ? 19.166 -1.468  -9.041  1.00 28.44 ? 204  PTR C CZ  1 
HETATM 1816 O OH  . PTR C 2 4   ? 18.205 -2.279  -8.479  1.00 30.05 ? 204  PTR C OH  1 
HETATM 1817 P P   . PTR C 2 4   ? 17.266 -3.273  -9.289  1.00 29.73 ? 204  PTR C P   1 
HETATM 1818 O O1P . PTR C 2 4   ? 16.258 -2.527  -10.015 1.00 26.01 ? 204  PTR C O1P 1 
HETATM 1819 O O2P . PTR C 2 4   ? 18.120 -4.139  -10.125 1.00 33.65 ? 204  PTR C O2P 1 
HETATM 1820 O O3P . PTR C 2 4   ? 16.503 -3.941  -8.207  1.00 27.54 ? 204  PTR C O3P 1 
ATOM   1821 N N   . VAL C 2 5   ? 22.325 4.513   -9.650  1.00 18.36 ? 205  VAL C N   1 
ATOM   1822 C CA  . VAL C 2 5   ? 23.326 5.545   -9.392  1.00 15.11 ? 205  VAL C CA  1 
ATOM   1823 C C   . VAL C 2 5   ? 24.764 4.985   -9.312  1.00 14.16 ? 205  VAL C C   1 
ATOM   1824 O O   . VAL C 2 5   ? 25.046 4.015   -8.596  1.00 15.94 ? 205  VAL C O   1 
ATOM   1825 C CB  . VAL C 2 5   ? 22.996 6.323   -8.084  1.00 13.17 ? 205  VAL C CB  1 
ATOM   1826 C CG1 . VAL C 2 5   ? 24.083 7.364   -7.802  1.00 16.14 ? 205  VAL C CG1 1 
ATOM   1827 C CG2 . VAL C 2 5   ? 21.611 7.003   -8.205  1.00 6.92  ? 205  VAL C CG2 1 
ATOM   1828 N N   . PRO C 2 6   ? 25.686 5.570   -10.081 1.00 15.02 ? 206  PRO C N   1 
ATOM   1829 C CA  . PRO C 2 6   ? 27.076 5.124   -9.967  1.00 17.42 ? 206  PRO C CA  1 
ATOM   1830 C C   . PRO C 2 6   ? 27.709 5.488   -8.622  1.00 15.29 ? 206  PRO C C   1 
ATOM   1831 O O   . PRO C 2 6   ? 27.704 6.649   -8.227  1.00 16.97 ? 206  PRO C O   1 
ATOM   1832 C CB  . PRO C 2 6   ? 27.767 5.828   -11.138 1.00 14.47 ? 206  PRO C CB  1 
ATOM   1833 C CG  . PRO C 2 6   ? 26.866 6.976   -11.488 1.00 13.85 ? 206  PRO C CG  1 
ATOM   1834 C CD  . PRO C 2 6   ? 25.491 6.487   -11.216 1.00 13.63 ? 206  PRO C CD  1 
ATOM   1835 N N   . MET C 2 7   ? 28.209 4.491   -7.901  1.00 15.26 ? 207  MET C N   1 
ATOM   1836 C CA  . MET C 2 7   ? 28.890 4.751   -6.641  1.00 16.84 ? 207  MET C CA  1 
ATOM   1837 C C   . MET C 2 7   ? 30.374 4.471   -6.789  1.00 17.83 ? 207  MET C C   1 
ATOM   1838 O O   . MET C 2 7   ? 30.743 3.339   -7.111  1.00 23.00 ? 207  MET C O   1 
ATOM   1839 C CB  . MET C 2 7   ? 28.311 3.866   -5.522  1.00 16.08 ? 207  MET C CB  1 
ATOM   1840 C CG  . MET C 2 7   ? 26.805 3.921   -5.376  1.00 18.08 ? 207  MET C CG  1 
ATOM   1841 S SD  . MET C 2 7   ? 26.275 5.533   -4.827  1.00 27.06 ? 207  MET C SD  1 
ATOM   1842 C CE  . MET C 2 7   ? 26.245 5.261   -3.048  1.00 30.62 ? 207  MET C CE  1 
ATOM   1843 N N   . LEU C 2 8   ? 31.206 5.444   -6.416  1.00 19.90 ? 208  LEU C N   1 
ATOM   1844 C CA  . LEU C 2 8   ? 32.668 5.313   -6.460  1.00 22.06 ? 208  LEU C CA  1 
ATOM   1845 C C   . LEU C 2 8   ? 33.286 4.323   -5.455  1.00 22.43 ? 208  LEU C C   1 
ATOM   1846 O O   . LEU C 2 8   ? 32.831 4.183   -4.321  1.00 20.59 ? 208  LEU C O   1 
ATOM   1847 C CB  . LEU C 2 8   ? 33.332 6.687   -6.268  1.00 23.16 ? 208  LEU C CB  1 
ATOM   1848 C CG  . LEU C 2 8   ? 33.055 7.737   -7.353  1.00 24.84 ? 208  LEU C CG  1 
ATOM   1849 C CD1 . LEU C 2 8   ? 33.798 9.029   -7.058  1.00 24.99 ? 208  LEU C CD1 1 
ATOM   1850 C CD2 . LEU C 2 8   ? 33.446 7.169   -8.712  1.00 26.99 ? 208  LEU C CD2 1 
ATOM   1851 N N   . ASP C 2 9   ? 34.323 3.627   -5.898  1.00 23.79 ? 209  ASP C N   1 
ATOM   1852 C CA  . ASP C 2 9   ? 35.081 2.758   -5.016  1.00 27.18 ? 209  ASP C CA  1 
ATOM   1853 C C   . ASP C 2 9   ? 35.939 3.597   -4.089  1.00 28.27 ? 209  ASP C C   1 
ATOM   1854 O O   . ASP C 2 9   ? 36.190 4.766   -4.358  1.00 30.11 ? 209  ASP C O   1 
ATOM   1855 C CB  . ASP C 2 9   ? 35.978 1.828   -5.829  1.00 30.80 ? 209  ASP C CB  1 
ATOM   1856 C CG  . ASP C 2 9   ? 35.245 1.176   -6.960  1.00 33.68 ? 209  ASP C CG  1 
ATOM   1857 O OD1 . ASP C 2 9   ? 35.551 1.494   -8.136  1.00 36.83 ? 209  ASP C OD1 1 
ATOM   1858 O OD2 . ASP C 2 9   ? 34.299 0.405   -6.679  1.00 34.70 ? 209  ASP C OD2 1 
ATOM   1859 N N   . MET C 2 10  ? 36.335 3.002   -2.972  1.00 30.88 ? 210  MET C N   1 
ATOM   1860 C CA  . MET C 2 10  ? 37.243 3.631   -2.019  1.00 34.07 ? 210  MET C CA  1 
ATOM   1861 C C   . MET C 2 10  ? 38.481 2.745   -1.851  1.00 36.79 ? 210  MET C C   1 
ATOM   1862 O O   . MET C 2 10  ? 38.902 2.435   -0.735  1.00 35.96 ? 210  MET C O   1 
ATOM   1863 C CB  . MET C 2 10  ? 36.549 3.814   -0.668  1.00 34.43 ? 210  MET C CB  1 
ATOM   1864 C CG  . MET C 2 10  ? 35.078 4.181   -0.752  1.00 34.22 ? 210  MET C CG  1 
ATOM   1865 S SD  . MET C 2 10  ? 34.776 5.917   -1.125  1.00 40.85 ? 210  MET C SD  1 
ATOM   1866 C CE  . MET C 2 10  ? 35.873 6.706   0.042   1.00 39.96 ? 210  MET C CE  1 
ATOM   1867 N N   . LYS C 2 11  ? 39.004 2.278   -2.978  1.00 41.69 ? 211  LYS C N   1 
ATOM   1868 C CA  . LYS C 2 11  ? 40.117 1.332   -3.002  1.00 44.61 ? 211  LYS C CA  1 
ATOM   1869 C C   . LYS C 2 11  ? 40.551 1.153   -4.454  1.00 46.50 ? 211  LYS C C   1 
ATOM   1870 O O   . LYS C 2 11  ? 41.756 1.364   -4.737  1.00 46.31 ? 211  LYS C O   1 
ATOM   1871 C CB  . LYS C 2 11  ? 39.682 -0.014  -2.414  1.00 44.22 ? 211  LYS C CB  1 
ATOM   1872 C CG  . LYS C 2 11  ? 40.501 -1.217  -2.859  1.00 47.44 ? 211  LYS C CG  1 
ATOM   1873 C CD  . LYS C 2 11  ? 39.608 -2.397  -3.195  1.00 51.27 ? 211  LYS C CD  1 
ATOM   1874 C CE  . LYS C 2 11  ? 40.321 -3.411  -4.084  1.00 55.69 ? 211  LYS C CE  1 
ATOM   1875 N NZ  . LYS C 2 11  ? 40.084 -3.172  -5.550  1.00 58.66 ? 211  LYS C NZ  1 
ATOM   1876 O OXT . LYS C 2 11  ? 39.676 0.826   -5.294  1.00 49.13 ? 211  LYS C OXT 1 
ATOM   1877 N N   . SER D 2 1   ? 24.346 2.152   45.035  1.00 46.22 ? 1201 SER D N   1 
ATOM   1878 C CA  . SER D 2 1   ? 25.794 2.079   45.384  1.00 45.65 ? 1201 SER D CA  1 
ATOM   1879 C C   . SER D 2 1   ? 26.381 3.480   45.581  1.00 46.32 ? 1201 SER D C   1 
ATOM   1880 O O   . SER D 2 1   ? 25.653 4.465   45.520  1.00 48.55 ? 1201 SER D O   1 
ATOM   1881 C CB  . SER D 2 1   ? 26.553 1.334   44.287  1.00 43.50 ? 1201 SER D CB  1 
ATOM   1882 O OG  . SER D 2 1   ? 26.136 1.765   43.008  1.00 48.35 ? 1201 SER D OG  1 
ATOM   1883 N N   . ILE D 2 2   ? 27.663 3.560   45.932  1.00 45.01 ? 1202 ILE D N   1 
ATOM   1884 C CA  . ILE D 2 2   ? 28.310 4.853   46.149  1.00 43.13 ? 1202 ILE D CA  1 
ATOM   1885 C C   . ILE D 2 2   ? 28.387 5.673   44.858  1.00 41.07 ? 1202 ILE D C   1 
ATOM   1886 O O   . ILE D 2 2   ? 27.824 6.765   44.781  1.00 44.17 ? 1202 ILE D O   1 
ATOM   1887 C CB  . ILE D 2 2   ? 29.724 4.683   46.788  1.00 41.66 ? 1202 ILE D CB  1 
ATOM   1888 C CG1 . ILE D 2 2   ? 29.582 4.259   48.257  1.00 41.06 ? 1202 ILE D CG1 1 
ATOM   1889 C CG2 . ILE D 2 2   ? 30.543 5.973   46.665  1.00 42.61 ? 1202 ILE D CG2 1 
ATOM   1890 C CD1 . ILE D 2 2   ? 28.575 5.074   49.099  1.00 36.09 ? 1202 ILE D CD1 1 
ATOM   1891 N N   . ASP D 2 3   ? 29.059 5.138   43.845  1.00 37.86 ? 1203 ASP D N   1 
ATOM   1892 C CA  . ASP D 2 3   ? 28.897 5.643   42.478  1.00 36.24 ? 1203 ASP D CA  1 
ATOM   1893 C C   . ASP D 2 3   ? 28.574 4.511   41.499  1.00 32.12 ? 1203 ASP D C   1 
ATOM   1894 O O   . ASP D 2 3   ? 27.409 4.132   41.364  1.00 28.48 ? 1203 ASP D O   1 
ATOM   1895 C CB  . ASP D 2 3   ? 30.152 6.386   42.012  1.00 38.23 ? 1203 ASP D CB  1 
ATOM   1896 C CG  . ASP D 2 3   ? 29.856 7.402   40.917  1.00 40.28 ? 1203 ASP D CG  1 
ATOM   1897 O OD1 . ASP D 2 3   ? 30.823 7.927   40.326  1.00 41.98 ? 1203 ASP D OD1 1 
ATOM   1898 O OD2 . ASP D 2 3   ? 28.666 7.714   40.682  1.00 40.85 ? 1203 ASP D OD2 1 
HETATM 1899 N N   . PTR D 2 4   ? 29.614 3.878   40.952  1.00 29.74 ? 1204 PTR D N   1 
HETATM 1900 C CA  . PTR D 2 4   ? 29.440 2.715   40.081  1.00 29.37 ? 1204 PTR D CA  1 
HETATM 1901 C C   . PTR D 2 4   ? 28.955 1.489   40.847  1.00 28.57 ? 1204 PTR D C   1 
HETATM 1902 O O   . PTR D 2 4   ? 29.290 1.319   42.011  1.00 31.41 ? 1204 PTR D O   1 
HETATM 1903 C CB  . PTR D 2 4   ? 30.746 2.388   39.374  1.00 29.39 ? 1204 PTR D CB  1 
HETATM 1904 C CG  . PTR D 2 4   ? 31.010 3.246   38.165  1.00 32.52 ? 1204 PTR D CG  1 
HETATM 1905 C CD1 . PTR D 2 4   ? 30.934 2.710   36.882  1.00 34.49 ? 1204 PTR D CD1 1 
HETATM 1906 C CD2 . PTR D 2 4   ? 31.310 4.600   38.295  1.00 31.13 ? 1204 PTR D CD2 1 
HETATM 1907 C CE1 . PTR D 2 4   ? 31.152 3.495   35.760  1.00 30.71 ? 1204 PTR D CE1 1 
HETATM 1908 C CE2 . PTR D 2 4   ? 31.528 5.394   37.181  1.00 31.15 ? 1204 PTR D CE2 1 
HETATM 1909 C CZ  . PTR D 2 4   ? 31.452 4.830   35.913  1.00 30.79 ? 1204 PTR D CZ  1 
HETATM 1910 O OH  . PTR D 2 4   ? 31.602 5.598   34.785  1.00 32.30 ? 1204 PTR D OH  1 
HETATM 1911 P P   . PTR D 2 4   ? 32.316 6.944   34.620  1.00 30.01 ? 1204 PTR D P   1 
HETATM 1912 O O1P . PTR D 2 4   ? 31.321 7.893   35.099  1.00 33.56 ? 1204 PTR D O1P 1 
HETATM 1913 O O2P . PTR D 2 4   ? 33.648 6.864   35.080  1.00 29.95 ? 1204 PTR D O2P 1 
HETATM 1914 O O3P . PTR D 2 4   ? 32.350 7.222   33.246  1.00 36.17 ? 1204 PTR D O3P 1 
ATOM   1915 N N   . VAL D 2 5   ? 28.037 0.740   40.246  1.00 26.31 ? 1205 VAL D N   1 
ATOM   1916 C CA  . VAL D 2 5   ? 27.545 -0.529  40.796  1.00 21.75 ? 1205 VAL D CA  1 
ATOM   1917 C C   . VAL D 2 5   ? 28.676 -1.557  40.890  1.00 23.69 ? 1205 VAL D C   1 
ATOM   1918 O O   . VAL D 2 5   ? 29.343 -1.850  39.884  1.00 20.48 ? 1205 VAL D O   1 
ATOM   1919 C CB  . VAL D 2 5   ? 26.471 -1.120  39.876  1.00 18.93 ? 1205 VAL D CB  1 
ATOM   1920 C CG1 . VAL D 2 5   ? 25.989 -2.456  40.418  1.00 18.68 ? 1205 VAL D CG1 1 
ATOM   1921 C CG2 . VAL D 2 5   ? 25.333 -0.133  39.713  1.00 15.40 ? 1205 VAL D CG2 1 
ATOM   1922 N N   . PRO D 2 6   ? 28.911 -2.125  42.093  1.00 24.45 ? 1206 PRO D N   1 
ATOM   1923 C CA  . PRO D 2 6   ? 29.896 -3.210  42.215  1.00 23.75 ? 1206 PRO D CA  1 
ATOM   1924 C C   . PRO D 2 6   ? 29.456 -4.458  41.448  1.00 23.32 ? 1206 PRO D C   1 
ATOM   1925 O O   . PRO D 2 6   ? 28.287 -4.849  41.507  1.00 19.07 ? 1206 PRO D O   1 
ATOM   1926 C CB  . PRO D 2 6   ? 29.974 -3.455  43.730  1.00 21.58 ? 1206 PRO D CB  1 
ATOM   1927 C CG  . PRO D 2 6   ? 28.724 -2.886  44.290  1.00 23.33 ? 1206 PRO D CG  1 
ATOM   1928 C CD  . PRO D 2 6   ? 28.374 -1.722  43.402  1.00 24.48 ? 1206 PRO D CD  1 
ATOM   1929 N N   . MET D 2 7   ? 30.356 -4.981  40.614  1.00 24.17 ? 1207 MET D N   1 
ATOM   1930 C CA  . MET D 2 7   ? 30.085 -6.193  39.838  1.00 23.27 ? 1207 MET D CA  1 
ATOM   1931 C C   . MET D 2 7   ? 31.049 -7.283  40.266  1.00 21.14 ? 1207 MET D C   1 
ATOM   1932 O O   . MET D 2 7   ? 32.260 -7.107  40.193  1.00 20.82 ? 1207 MET D O   1 
ATOM   1933 C CB  . MET D 2 7   ? 30.265 -5.924  38.334  1.00 23.80 ? 1207 MET D CB  1 
ATOM   1934 C CG  . MET D 2 7   ? 29.364 -4.841  37.740  1.00 23.14 ? 1207 MET D CG  1 
ATOM   1935 S SD  . MET D 2 7   ? 27.591 -5.173  37.803  1.00 22.66 ? 1207 MET D SD  1 
ATOM   1936 C CE  . MET D 2 7   ? 27.315 -5.890  36.208  1.00 20.59 ? 1207 MET D CE  1 
ATOM   1937 N N   . LEU D 2 8   ? 30.501 -8.405  40.711  1.00 19.87 ? 1208 LEU D N   1 
ATOM   1938 C CA  . LEU D 2 8   ? 31.296 -9.519  41.215  1.00 20.85 ? 1208 LEU D CA  1 
ATOM   1939 C C   . LEU D 2 8   ? 32.121 -10.234 40.134  1.00 24.02 ? 1208 LEU D C   1 
ATOM   1940 O O   . LEU D 2 8   ? 31.654 -10.414 39.009  1.00 25.27 ? 1208 LEU D O   1 
ATOM   1941 C CB  . LEU D 2 8   ? 30.371 -10.536 41.912  1.00 20.25 ? 1208 LEU D CB  1 
ATOM   1942 C CG  . LEU D 2 8   ? 29.712 -10.150 43.237  1.00 17.24 ? 1208 LEU D CG  1 
ATOM   1943 C CD1 . LEU D 2 8   ? 28.972 -11.341 43.779  1.00 15.68 ? 1208 LEU D CD1 1 
ATOM   1944 C CD2 . LEU D 2 8   ? 30.746 -9.668  44.250  1.00 13.27 ? 1208 LEU D CD2 1 
ATOM   1945 N N   . ASP D 2 9   ? 33.328 -10.672 40.497  1.00 28.90 ? 1209 ASP D N   1 
ATOM   1946 C CA  . ASP D 2 9   ? 34.148 -11.511 39.619  1.00 34.16 ? 1209 ASP D CA  1 
ATOM   1947 C C   . ASP D 2 9   ? 33.572 -12.917 39.495  1.00 37.29 ? 1209 ASP D C   1 
ATOM   1948 O O   . ASP D 2 9   ? 32.803 -13.355 40.353  1.00 39.52 ? 1209 ASP D O   1 
ATOM   1949 C CB  . ASP D 2 9   ? 35.570 -11.631 40.149  1.00 34.94 ? 1209 ASP D CB  1 
ATOM   1950 C CG  . ASP D 2 9   ? 36.127 -10.319 40.606  1.00 38.84 ? 1209 ASP D CG  1 
ATOM   1951 O OD1 . ASP D 2 9   ? 36.270 -10.127 41.837  1.00 45.67 ? 1209 ASP D OD1 1 
ATOM   1952 O OD2 . ASP D 2 9   ? 36.408 -9.472  39.742  1.00 40.18 ? 1209 ASP D OD2 1 
ATOM   1953 N N   . MET D 2 10  ? 33.909 -13.601 38.407  1.00 40.08 ? 1210 MET D N   1 
ATOM   1954 C CA  . MET D 2 10  ? 33.499 -14.984 38.214  1.00 45.28 ? 1210 MET D CA  1 
ATOM   1955 C C   . MET D 2 10  ? 34.742 -15.872 38.107  1.00 47.11 ? 1210 MET D C   1 
ATOM   1956 O O   . MET D 2 10  ? 34.851 -16.696 37.201  1.00 49.99 ? 1210 MET D O   1 
ATOM   1957 C CB  . MET D 2 10  ? 32.666 -15.105 36.942  1.00 47.28 ? 1210 MET D CB  1 
ATOM   1958 C CG  . MET D 2 10  ? 31.724 -13.954 36.691  1.00 55.02 ? 1210 MET D CG  1 
ATOM   1959 S SD  . MET D 2 10  ? 30.340 -13.932 37.837  1.00 65.17 ? 1210 MET D SD  1 
ATOM   1960 C CE  . MET D 2 10  ? 29.618 -15.592 37.518  1.00 65.38 ? 1210 MET D CE  1 
ATOM   1961 N N   . LYS D 2 11  ? 35.717 -15.619 38.974  1.00 49.45 ? 1211 LYS D N   1 
ATOM   1962 C CA  . LYS D 2 11  ? 37.041 -16.235 38.889  1.00 52.10 ? 1211 LYS D CA  1 
ATOM   1963 C C   . LYS D 2 11  ? 37.862 -15.825 40.115  1.00 53.41 ? 1211 LYS D C   1 
ATOM   1964 O O   . LYS D 2 11  ? 38.230 -16.717 40.913  1.00 54.51 ? 1211 LYS D O   1 
ATOM   1965 C CB  . LYS D 2 11  ? 37.768 -15.782 37.609  1.00 51.97 ? 1211 LYS D CB  1 
ATOM   1966 C CG  . LYS D 2 11  ? 39.286 -15.902 37.666  1.00 53.98 ? 1211 LYS D CG  1 
ATOM   1967 C CD  . LYS D 2 11  ? 39.955 -14.612 37.204  1.00 56.17 ? 1211 LYS D CD  1 
ATOM   1968 C CE  . LYS D 2 11  ? 41.406 -14.505 37.668  1.00 53.73 ? 1211 LYS D CE  1 
ATOM   1969 N NZ  . LYS D 2 11  ? 41.525 -13.658 38.888  1.00 49.18 ? 1211 LYS D NZ  1 
ATOM   1970 O OXT . LYS D 2 11  ? 38.133 -14.608 40.258  1.00 52.57 ? 1211 LYS D OXT 1 
HETATM 1971 O O   . HOH E 3 .   ? 16.116 -3.424  12.508  1.00 57.25 ? 2001 HOH A O   1 
HETATM 1972 O O   . HOH E 3 .   ? 21.116 -6.697  8.456   1.00 39.60 ? 2002 HOH A O   1 
HETATM 1973 O O   . HOH E 3 .   ? 14.102 -12.569 0.463   1.00 50.42 ? 2003 HOH A O   1 
HETATM 1974 O O   . HOH E 3 .   ? 4.176  -4.867  0.896   1.00 57.23 ? 2004 HOH A O   1 
HETATM 1975 O O   . HOH E 3 .   ? -0.881 -3.736  1.659   1.00 61.16 ? 2005 HOH A O   1 
HETATM 1976 O O   . HOH E 3 .   ? 14.272 -11.226 3.812   1.00 37.23 ? 2006 HOH A O   1 
HETATM 1977 O O   . HOH E 3 .   ? 12.138 -11.087 1.667   1.00 38.43 ? 2007 HOH A O   1 
HETATM 1978 O O   . HOH E 3 .   ? 5.610  -7.250  -4.567  1.00 34.53 ? 2008 HOH A O   1 
HETATM 1979 O O   . HOH E 3 .   ? 7.277  -7.269  -6.895  1.00 52.60 ? 2009 HOH A O   1 
HETATM 1980 O O   . HOH E 3 .   ? 12.850 3.216   -12.760 1.00 55.46 ? 2010 HOH A O   1 
HETATM 1981 O O   . HOH E 3 .   ? 3.309  -2.694  -0.357  1.00 23.81 ? 2011 HOH A O   1 
HETATM 1982 O O   . HOH E 3 .   ? 7.170  2.904   -11.726 1.00 48.25 ? 2012 HOH A O   1 
HETATM 1983 O O   . HOH E 3 .   ? 11.608 2.982   -8.102  1.00 36.98 ? 2013 HOH A O   1 
HETATM 1984 O O   . HOH E 3 .   ? 2.026  8.949   -1.373  1.00 41.16 ? 2014 HOH A O   1 
HETATM 1985 O O   . HOH E 3 .   ? -1.987 6.739   -6.809  1.00 47.69 ? 2015 HOH A O   1 
HETATM 1986 O O   . HOH E 3 .   ? 5.849  7.900   2.029   1.00 33.54 ? 2016 HOH A O   1 
HETATM 1987 O O   . HOH E 3 .   ? 4.195  10.324  -0.288  1.00 39.22 ? 2017 HOH A O   1 
HETATM 1988 O O   . HOH E 3 .   ? 0.411  15.472  -4.447  1.00 38.81 ? 2018 HOH A O   1 
HETATM 1989 O O   . HOH E 3 .   ? 1.773  12.376  -2.916  1.00 37.21 ? 2019 HOH A O   1 
HETATM 1990 O O   . HOH E 3 .   ? 12.446 15.150  -2.971  1.00 31.72 ? 2020 HOH A O   1 
HETATM 1991 O O   . HOH E 3 .   ? 19.879 12.533  11.002  1.00 32.10 ? 2021 HOH A O   1 
HETATM 1992 O O   . HOH E 3 .   ? 9.477  11.910  4.279   1.00 38.92 ? 2022 HOH A O   1 
HETATM 1993 O O   . HOH E 3 .   ? 18.170 17.434  3.705   1.00 40.93 ? 2023 HOH A O   1 
HETATM 1994 O O   . HOH E 3 .   ? 16.005 19.476  6.842   1.00 29.92 ? 2024 HOH A O   1 
HETATM 1995 O O   . HOH E 3 .   ? 13.645 -10.062 -6.819  1.00 66.88 ? 2025 HOH A O   1 
HETATM 1996 O O   . HOH E 3 .   ? 17.385 -11.287 -5.049  1.00 49.63 ? 2026 HOH A O   1 
HETATM 1997 O O   . HOH E 3 .   ? 20.894 19.861  -3.049  1.00 47.31 ? 2027 HOH A O   1 
HETATM 1998 O O   . HOH E 3 .   ? 9.249  12.335  -8.748  1.00 46.12 ? 2028 HOH A O   1 
HETATM 1999 O O   . HOH E 3 .   ? 14.937 9.027   -11.277 1.00 55.68 ? 2029 HOH A O   1 
HETATM 2000 O O   . HOH E 3 .   ? 8.141  9.313   -7.866  1.00 45.80 ? 2030 HOH A O   1 
HETATM 2001 O O   . HOH E 3 .   ? 21.999 11.197  -9.312  1.00 34.42 ? 2031 HOH A O   1 
HETATM 2002 O O   . HOH E 3 .   ? 24.459 1.548   -7.016  1.00 22.20 ? 2032 HOH A O   1 
HETATM 2003 O O   . HOH E 3 .   ? 21.933 -13.633 2.937   1.00 66.80 ? 2033 HOH A O   1 
HETATM 2004 O O   . HOH E 3 .   ? 29.887 0.759   0.861   1.00 20.74 ? 2034 HOH A O   1 
HETATM 2005 O O   . HOH E 3 .   ? 29.841 0.300   -7.269  1.00 27.49 ? 2035 HOH A O   1 
HETATM 2006 O O   . HOH E 3 .   ? 26.203 0.820   -5.260  1.00 16.91 ? 2036 HOH A O   1 
HETATM 2007 O O   . HOH E 3 .   ? 33.400 1.480   -0.186  1.00 47.52 ? 2037 HOH A O   1 
HETATM 2008 O O   . HOH E 3 .   ? 35.084 -6.046  -2.796  1.00 54.30 ? 2038 HOH A O   1 
HETATM 2009 O O   . HOH E 3 .   ? 31.628 -1.276  2.114   1.00 31.19 ? 2039 HOH A O   1 
HETATM 2010 O O   . HOH E 3 .   ? 31.274 7.295   2.973   1.00 29.14 ? 2040 HOH A O   1 
HETATM 2011 O O   . HOH E 3 .   ? 18.038 3.838   11.527  1.00 40.78 ? 2041 HOH A O   1 
HETATM 2012 O O   . HOH E 3 .   ? 18.125 9.829   10.134  1.00 28.23 ? 2042 HOH A O   1 
HETATM 2013 O O   . HOH E 3 .   ? 22.094 13.265  14.632  1.00 59.69 ? 2043 HOH A O   1 
HETATM 2014 O O   . HOH E 3 .   ? 28.141 13.635  6.926   1.00 35.51 ? 2044 HOH A O   1 
HETATM 2015 O O   . HOH E 3 .   ? 29.912 9.277   1.499   1.00 38.82 ? 2045 HOH A O   1 
HETATM 2016 O O   . HOH E 3 .   ? 31.323 13.471  2.020   1.00 31.91 ? 2046 HOH A O   1 
HETATM 2017 O O   . HOH E 3 .   ? 35.758 8.355   -2.836  1.00 38.26 ? 2047 HOH A O   1 
HETATM 2018 O O   . HOH E 3 .   ? 25.560 18.434  -6.055  1.00 41.63 ? 2048 HOH A O   1 
HETATM 2019 O O   . HOH E 3 .   ? 28.615 17.142  -3.020  1.00 25.92 ? 2049 HOH A O   1 
HETATM 2020 O O   . HOH E 3 .   ? 21.215 19.599  0.109   1.00 60.73 ? 2050 HOH A O   1 
HETATM 2021 O O   . HOH E 3 .   ? 13.091 18.881  4.790   1.00 42.56 ? 2051 HOH A O   1 
HETATM 2022 O O   . HOH E 3 .   ? 15.455 16.976  4.435   1.00 31.71 ? 2052 HOH A O   1 
HETATM 2023 O O   . HOH E 3 .   ? 10.540 8.341   9.032   1.00 48.60 ? 2053 HOH A O   1 
HETATM 2024 O O   . HOH E 3 .   ? 9.574  -5.663  14.653  1.00 52.99 ? 2054 HOH A O   1 
HETATM 2025 O O   . HOH E 3 .   ? 5.579  5.652   6.527   1.00 39.01 ? 2055 HOH A O   1 
HETATM 2026 O O   . HOH F 3 .   ? 33.901 -2.933  17.243  1.00 38.81 ? 2001 HOH B O   1 
HETATM 2027 O O   . HOH F 3 .   ? 31.925 9.562   13.064  1.00 64.10 ? 2002 HOH B O   1 
HETATM 2028 O O   . HOH F 3 .   ? 23.614 -0.558  13.725  1.00 26.36 ? 2003 HOH B O   1 
HETATM 2029 O O   . HOH F 3 .   ? 28.968 5.570   12.747  1.00 36.89 ? 2004 HOH B O   1 
HETATM 2030 O O   . HOH F 3 .   ? 22.650 -1.150  16.654  1.00 50.37 ? 2005 HOH B O   1 
HETATM 2031 O O   . HOH F 3 .   ? 23.889 -4.143  17.815  1.00 29.92 ? 2006 HOH B O   1 
HETATM 2032 O O   . HOH F 3 .   ? 34.994 4.706   21.529  1.00 45.27 ? 2007 HOH B O   1 
HETATM 2033 O O   . HOH F 3 .   ? 33.567 8.464   20.661  1.00 26.60 ? 2008 HOH B O   1 
HETATM 2034 O O   . HOH F 3 .   ? 26.298 11.415  20.721  1.00 40.60 ? 2009 HOH B O   1 
HETATM 2035 O O   . HOH F 3 .   ? 33.534 13.991  27.881  1.00 47.71 ? 2010 HOH B O   1 
HETATM 2036 O O   . HOH F 3 .   ? 31.334 10.565  19.886  1.00 47.41 ? 2011 HOH B O   1 
HETATM 2037 O O   . HOH F 3 .   ? 30.401 12.553  31.813  1.00 59.32 ? 2012 HOH B O   1 
HETATM 2038 O O   . HOH F 3 .   ? 24.145 9.173   33.651  1.00 45.07 ? 2013 HOH B O   1 
HETATM 2039 O O   . HOH F 3 .   ? 13.406 11.356  28.309  1.00 59.06 ? 2014 HOH B O   1 
HETATM 2040 O O   . HOH F 3 .   ? 33.586 9.110   37.388  1.00 51.23 ? 2015 HOH B O   1 
HETATM 2041 O O   . HOH F 3 .   ? 37.077 4.551   24.814  1.00 50.81 ? 2016 HOH B O   1 
HETATM 2042 O O   . HOH F 3 .   ? 35.738 -0.284  21.005  1.00 33.84 ? 2017 HOH B O   1 
HETATM 2043 O O   . HOH F 3 .   ? 26.202 7.654   32.866  1.00 13.11 ? 2018 HOH B O   1 
HETATM 2044 O O   . HOH F 3 .   ? 13.160 2.373   43.461  1.00 44.47 ? 2019 HOH B O   1 
HETATM 2045 O O   . HOH F 3 .   ? 21.918 3.716   41.451  1.00 43.76 ? 2020 HOH B O   1 
HETATM 2046 O O   . HOH F 3 .   ? 25.134 3.518   39.748  1.00 9.93  ? 2021 HOH B O   1 
HETATM 2047 O O   . HOH F 3 .   ? 39.301 0.057   21.159  1.00 55.46 ? 2022 HOH B O   1 
HETATM 2048 O O   . HOH F 3 .   ? 31.865 -3.499  36.061  1.00 9.71  ? 2023 HOH B O   1 
HETATM 2049 O O   . HOH F 3 .   ? 41.812 -8.705  36.084  1.00 61.20 ? 2024 HOH B O   1 
HETATM 2050 O O   . HOH F 3 .   ? 33.437 -11.718 34.128  1.00 61.08 ? 2025 HOH B O   1 
HETATM 2051 O O   . HOH F 3 .   ? 41.168 -11.783 29.960  1.00 58.39 ? 2026 HOH B O   1 
HETATM 2052 O O   . HOH F 3 .   ? 34.884 -3.230  20.696  1.00 30.22 ? 2027 HOH B O   1 
HETATM 2053 O O   . HOH F 3 .   ? 32.295 -3.607  19.722  1.00 26.66 ? 2028 HOH B O   1 
HETATM 2054 O O   . HOH F 3 .   ? 26.924 -12.173 22.467  1.00 79.44 ? 2029 HOH B O   1 
HETATM 2055 O O   . HOH F 3 .   ? 26.739 -14.239 32.742  1.00 22.18 ? 2030 HOH B O   1 
HETATM 2056 O O   . HOH F 3 .   ? 15.730 -3.619  20.413  1.00 51.22 ? 2031 HOH B O   1 
HETATM 2057 O O   . HOH F 3 .   ? 15.899 -10.677 26.478  1.00 71.49 ? 2032 HOH B O   1 
HETATM 2058 O O   . HOH F 3 .   ? 20.720 -16.517 27.494  1.00 40.56 ? 2033 HOH B O   1 
HETATM 2059 O O   . HOH F 3 .   ? 21.314 -16.897 33.190  1.00 46.58 ? 2034 HOH B O   1 
HETATM 2060 O O   . HOH F 3 .   ? 19.268 -15.132 32.972  1.00 39.62 ? 2035 HOH B O   1 
HETATM 2061 O O   . HOH F 3 .   ? 22.095 -14.379 34.532  1.00 47.30 ? 2036 HOH B O   1 
HETATM 2062 O O   . HOH F 3 .   ? 21.217 -12.289 41.846  1.00 56.47 ? 2037 HOH B O   1 
HETATM 2063 O O   . HOH F 3 .   ? 31.990 -9.564  32.144  1.00 26.19 ? 2038 HOH B O   1 
HETATM 2064 O O   . HOH F 3 .   ? 13.889 0.046   21.981  1.00 49.34 ? 2039 HOH B O   1 
HETATM 2065 O O   . HOH F 3 .   ? 17.239 2.619   15.382  1.00 29.81 ? 2040 HOH B O   1 
HETATM 2066 O O   . HOH F 3 .   ? 15.518 4.740   21.632  1.00 42.16 ? 2041 HOH B O   1 
HETATM 2067 O O   . HOH G 3 .   ? 25.740 -1.067  -9.596  1.00 43.41 ? 2001 HOH C O   1 
HETATM 2068 O O   . HOH G 3 .   ? 21.813 12.172  -13.110 1.00 38.81 ? 2002 HOH C O   1 
HETATM 2069 O O   . HOH G 3 .   ? 17.027 7.694   -17.007 1.00 40.70 ? 2003 HOH C O   1 
HETATM 2070 O O   . HOH G 3 .   ? 24.395 6.647   -15.256 1.00 22.12 ? 2004 HOH C O   1 
HETATM 2071 O O   . HOH G 3 .   ? 20.601 -0.529  -14.971 1.00 59.33 ? 2005 HOH C O   1 
HETATM 2072 O O   . HOH G 3 .   ? 18.311 6.028   -10.207 1.00 27.36 ? 2006 HOH C O   1 
HETATM 2073 O O   . HOH G 3 .   ? 23.278 4.142   -14.994 1.00 36.26 ? 2007 HOH C O   1 
HETATM 2074 O O   . HOH G 3 .   ? 25.100 2.861   -12.509 1.00 37.88 ? 2008 HOH C O   1 
HETATM 2075 O O   . HOH G 3 .   ? 19.135 -4.499  -12.759 1.00 78.52 ? 2009 HOH C O   1 
HETATM 2076 O O   . HOH G 3 .   ? 28.034 1.391   -9.155  1.00 47.56 ? 2010 HOH C O   1 
HETATM 2077 O O   . HOH G 3 .   ? 35.965 4.114   -8.597  1.00 29.94 ? 2011 HOH C O   1 
HETATM 2078 O O   . HOH G 3 .   ? 42.651 -0.377  -6.644  1.00 53.00 ? 2012 HOH C O   1 
HETATM 2079 O O   . HOH G 3 .   ? 43.400 1.699   -2.332  1.00 37.23 ? 2013 HOH C O   1 
HETATM 2080 O O   . HOH H 3 .   ? 23.884 4.109   43.467  1.00 55.46 ? 2001 HOH D O   1 
HETATM 2081 O O   . HOH H 3 .   ? 23.380 1.024   42.597  1.00 37.11 ? 2002 HOH D O   1 
HETATM 2082 O O   . HOH H 3 .   ? 29.146 1.192   46.470  1.00 13.87 ? 2003 HOH D O   1 
HETATM 2083 O O   . HOH H 3 .   ? 31.257 10.511  41.396  1.00 49.95 ? 2004 HOH D O   1 
HETATM 2084 O O   . HOH H 3 .   ? 30.199 2.253   44.269  1.00 30.27 ? 2005 HOH D O   1 
HETATM 2085 O O   . HOH H 3 .   ? 30.766 -1.317  37.686  1.00 11.39 ? 2006 HOH D O   1 
HETATM 2086 O O   . HOH H 3 .   ? 32.376 -3.295  40.049  1.00 32.06 ? 2007 HOH D O   1 
HETATM 2087 O O   . HOH H 3 .   ? 34.209 -5.523  38.781  1.00 22.87 ? 2008 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0    ?    ?   ?   A . n 
A 1 2   MET 2   1    ?    ?   ?   A . n 
A 1 3   ASN 3   2    ?    ?   ?   A . n 
A 1 4   ASN 4   3    ?    ?   ?   A . n 
A 1 5   ASN 5   4    ?    ?   ?   A . n 
A 1 6   MET 6   5    5    MET MET A . n 
A 1 7   SER 7   6    6    SER SER A . n 
A 1 8   LEU 8   7    7    LEU LEU A . n 
A 1 9   GLN 9   8    8    GLN GLN A . n 
A 1 10  ASN 10  9    9    ASN ASN A . n 
A 1 11  ALA 11  10   10   ALA ALA A . n 
A 1 12  GLU 12  11   11   GLU GLU A . n 
A 1 13  TRP 13  12   12   TRP TRP A . n 
A 1 14  TYR 14  13   13   TYR TYR A . n 
A 1 15  TRP 15  14   14   TRP TRP A . n 
A 1 16  GLY 16  15   15   GLY GLY A . n 
A 1 17  ASP 17  16   16   ASP ASP A . n 
A 1 18  ILE 18  17   17   ILE ILE A . n 
A 1 19  SER 19  18   18   SER SER A . n 
A 1 20  ARG 20  19   19   ARG ARG A . n 
A 1 21  GLU 21  20   20   GLU GLU A . n 
A 1 22  GLU 22  21   21   GLU GLU A . n 
A 1 23  VAL 23  22   22   VAL VAL A . n 
A 1 24  ASN 24  23   23   ASN ASN A . n 
A 1 25  GLU 25  24   24   GLU GLU A . n 
A 1 26  LYS 26  25   25   LYS LYS A . n 
A 1 27  LEU 27  26   26   LEU LEU A . n 
A 1 28  ARG 28  27   27   ARG ARG A . n 
A 1 29  ASP 29  28   28   ASP ASP A . n 
A 1 30  THR 30  29   29   THR THR A . n 
A 1 31  ALA 31  30   30   ALA ALA A . n 
A 1 32  ASP 32  31   31   ASP ASP A . n 
A 1 33  GLY 33  32   32   GLY GLY A . n 
A 1 34  THR 34  33   33   THR THR A . n 
A 1 35  PHE 35  34   34   PHE PHE A . n 
A 1 36  LEU 36  35   35   LEU LEU A . n 
A 1 37  VAL 37  36   36   VAL VAL A . n 
A 1 38  ARG 38  37   37   ARG ARG A . n 
A 1 39  ASP 39  38   38   ASP ASP A . n 
A 1 40  ALA 40  39   39   ALA ALA A . n 
A 1 41  SER 41  40   40   SER SER A . n 
A 1 42  THR 42  41   41   THR THR A . n 
A 1 43  LYS 43  42   42   LYS LYS A . n 
A 1 44  MET 44  43   43   MET MET A . n 
A 1 45  HIS 45  44   44   HIS HIS A . n 
A 1 46  GLY 46  45   45   GLY GLY A . n 
A 1 47  ASP 47  46   46   ASP ASP A . n 
A 1 48  TYR 48  47   47   TYR TYR A . n 
A 1 49  THR 49  48   48   THR THR A . n 
A 1 50  LEU 50  49   49   LEU LEU A . n 
A 1 51  THR 51  50   50   THR THR A . n 
A 1 52  LEU 52  51   51   LEU LEU A . n 
A 1 53  ARG 53  52   52   ARG ARG A . n 
A 1 54  LYS 54  53   53   LYS LYS A . n 
A 1 55  GLY 55  54   54   GLY GLY A . n 
A 1 56  GLY 56  55   55   GLY GLY A . n 
A 1 57  ASN 57  56   56   ASN ASN A . n 
A 1 58  ASN 58  57   57   ASN ASN A . n 
A 1 59  LYS 59  58   58   LYS LYS A . n 
A 1 60  LEU 60  59   59   LEU LEU A . n 
A 1 61  ILE 61  60   60   ILE ILE A . n 
A 1 62  LYS 62  61   61   LYS LYS A . n 
A 1 63  ILE 63  62   62   ILE ILE A . n 
A 1 64  PHE 64  63   63   PHE PHE A . n 
A 1 65  HIS 65  64   64   HIS HIS A . n 
A 1 66  ARG 66  65   65   ARG ARG A . n 
A 1 67  ASP 67  66   66   ASP ASP A . n 
A 1 68  GLY 68  67   67   GLY GLY A . n 
A 1 69  LYS 69  68   68   LYS LYS A . n 
A 1 70  TYR 70  69   69   TYR TYR A . n 
A 1 71  GLY 71  70   70   GLY GLY A . n 
A 1 72  PHE 72  71   71   PHE PHE A . n 
A 1 73  SER 73  72   72   SER SER A . n 
A 1 74  ASP 74  73   73   ASP ASP A . n 
A 1 75  PRO 75  74   74   PRO PRO A . n 
A 1 76  LEU 76  75   75   LEU LEU A . n 
A 1 77  THR 77  76   76   THR THR A . n 
A 1 78  PHE 78  77   77   PHE PHE A . n 
A 1 79  SER 79  78   78   SER SER A . n 
A 1 80  SER 80  79   79   SER SER A . n 
A 1 81  VAL 81  80   80   VAL VAL A . n 
A 1 82  VAL 82  81   81   VAL VAL A . n 
A 1 83  GLU 83  82   82   GLU GLU A . n 
A 1 84  LEU 84  83   83   LEU LEU A . n 
A 1 85  ILE 85  84   84   ILE ILE A . n 
A 1 86  ASN 86  85   85   ASN ASN A . n 
A 1 87  HIS 87  86   86   HIS HIS A . n 
A 1 88  TYR 88  87   87   TYR TYR A . n 
A 1 89  ARG 89  88   88   ARG ARG A . n 
A 1 90  ASN 90  89   89   ASN ASN A . n 
A 1 91  GLU 91  90   90   GLU GLU A . n 
A 1 92  SER 92  91   91   SER SER A . n 
A 1 93  LEU 93  92   92   LEU LEU A . n 
A 1 94  ALA 94  93   93   ALA ALA A . n 
A 1 95  GLN 95  94   94   GLN GLN A . n 
A 1 96  TYR 96  95   95   TYR TYR A . n 
A 1 97  ASN 97  96   96   ASN ASN A . n 
A 1 98  PRO 98  97   97   PRO PRO A . n 
A 1 99  LYS 99  98   98   LYS LYS A . n 
A 1 100 LEU 100 99   99   LEU LEU A . n 
A 1 101 ASP 101 100  100  ASP ASP A . n 
A 1 102 VAL 102 101  101  VAL VAL A . n 
A 1 103 LYS 103 102  102  LYS LYS A . n 
A 1 104 LEU 104 103  103  LEU LEU A . n 
A 1 105 LEU 105 104  104  LEU LEU A . n 
A 1 106 TYR 106 105  105  TYR TYR A . n 
A 1 107 PRO 107 106  106  PRO PRO A . n 
A 1 108 VAL 108 107  107  VAL VAL A . n 
A 1 109 SER 109 108  108  SER SER A . n 
A 1 110 LYS 110 109  109  LYS LYS A . n 
A 1 111 TYR 111 110  110  TYR TYR A . n 
A 1 112 GLN 112 111  111  GLN GLN A . n 
A 1 113 GLN 113 112  ?    ?   ?   A . n 
A 1 114 ASP 114 113  ?    ?   ?   A . n 
A 1 115 GLN 115 114  ?    ?   ?   A . n 
A 1 116 VAL 116 115  ?    ?   ?   A . n 
A 1 117 VAL 117 116  ?    ?   ?   A . n 
A 1 118 LYS 118 117  ?    ?   ?   A . n 
A 1 119 GLU 119 118  ?    ?   ?   A . n 
A 1 120 ASP 120 119  ?    ?   ?   A . n 
B 1 1   GLY 1   1000 ?    ?   ?   B . n 
B 1 2   MET 2   1001 ?    ?   ?   B . n 
B 1 3   ASN 3   1002 1002 ASN ASN B . n 
B 1 4   ASN 4   1003 1003 ASN ASN B . n 
B 1 5   ASN 5   1004 1004 ASN ASN B . n 
B 1 6   MET 6   1005 1005 MET MET B . n 
B 1 7   SER 7   1006 1006 SER SER B . n 
B 1 8   LEU 8   1007 1007 LEU LEU B . n 
B 1 9   GLN 9   1008 1008 GLN GLN B . n 
B 1 10  ASN 10  1009 1009 ASN ASN B . n 
B 1 11  ALA 11  1010 1010 ALA ALA B . n 
B 1 12  GLU 12  1011 1011 GLU GLU B . n 
B 1 13  TRP 13  1012 1012 TRP TRP B . n 
B 1 14  TYR 14  1013 1013 TYR TYR B . n 
B 1 15  TRP 15  1014 1014 TRP TRP B . n 
B 1 16  GLY 16  1015 1015 GLY GLY B . n 
B 1 17  ASP 17  1016 1016 ASP ASP B . n 
B 1 18  ILE 18  1017 1017 ILE ILE B . n 
B 1 19  SER 19  1018 1018 SER SER B . n 
B 1 20  ARG 20  1019 1019 ARG ARG B . n 
B 1 21  GLU 21  1020 1020 GLU GLU B . n 
B 1 22  GLU 22  1021 1021 GLU GLU B . n 
B 1 23  VAL 23  1022 1022 VAL VAL B . n 
B 1 24  ASN 24  1023 1023 ASN ASN B . n 
B 1 25  GLU 25  1024 1024 GLU GLU B . n 
B 1 26  LYS 26  1025 1025 LYS LYS B . n 
B 1 27  LEU 27  1026 1026 LEU LEU B . n 
B 1 28  ARG 28  1027 1027 ARG ARG B . n 
B 1 29  ASP 29  1028 1028 ASP ASP B . n 
B 1 30  THR 30  1029 1029 THR THR B . n 
B 1 31  ALA 31  1030 1030 ALA ALA B . n 
B 1 32  ASP 32  1031 1031 ASP ASP B . n 
B 1 33  GLY 33  1032 1032 GLY GLY B . n 
B 1 34  THR 34  1033 1033 THR THR B . n 
B 1 35  PHE 35  1034 1034 PHE PHE B . n 
B 1 36  LEU 36  1035 1035 LEU LEU B . n 
B 1 37  VAL 37  1036 1036 VAL VAL B . n 
B 1 38  ARG 38  1037 1037 ARG ARG B . n 
B 1 39  ASP 39  1038 1038 ASP ASP B . n 
B 1 40  ALA 40  1039 1039 ALA ALA B . n 
B 1 41  SER 41  1040 1040 SER SER B . n 
B 1 42  THR 42  1041 1041 THR THR B . n 
B 1 43  LYS 43  1042 1042 LYS LYS B . n 
B 1 44  MET 44  1043 1043 MET MET B . n 
B 1 45  HIS 45  1044 1044 HIS HIS B . n 
B 1 46  GLY 46  1045 1045 GLY GLY B . n 
B 1 47  ASP 47  1046 1046 ASP ASP B . n 
B 1 48  TYR 48  1047 1047 TYR TYR B . n 
B 1 49  THR 49  1048 1048 THR THR B . n 
B 1 50  LEU 50  1049 1049 LEU LEU B . n 
B 1 51  THR 51  1050 1050 THR THR B . n 
B 1 52  LEU 52  1051 1051 LEU LEU B . n 
B 1 53  ARG 53  1052 1052 ARG ARG B . n 
B 1 54  LYS 54  1053 1053 LYS LYS B . n 
B 1 55  GLY 55  1054 1054 GLY GLY B . n 
B 1 56  GLY 56  1055 1055 GLY GLY B . n 
B 1 57  ASN 57  1056 1056 ASN ASN B . n 
B 1 58  ASN 58  1057 1057 ASN ASN B . n 
B 1 59  LYS 59  1058 1058 LYS LYS B . n 
B 1 60  LEU 60  1059 1059 LEU LEU B . n 
B 1 61  ILE 61  1060 1060 ILE ILE B . n 
B 1 62  LYS 62  1061 1061 LYS LYS B . n 
B 1 63  ILE 63  1062 1062 ILE ILE B . n 
B 1 64  PHE 64  1063 1063 PHE PHE B . n 
B 1 65  HIS 65  1064 1064 HIS HIS B . n 
B 1 66  ARG 66  1065 1065 ARG ARG B . n 
B 1 67  ASP 67  1066 1066 ASP ASP B . n 
B 1 68  GLY 68  1067 1067 GLY GLY B . n 
B 1 69  LYS 69  1068 1068 LYS LYS B . n 
B 1 70  TYR 70  1069 1069 TYR TYR B . n 
B 1 71  GLY 71  1070 1070 GLY GLY B . n 
B 1 72  PHE 72  1071 1071 PHE PHE B . n 
B 1 73  SER 73  1072 1072 SER SER B . n 
B 1 74  ASP 74  1073 1073 ASP ASP B . n 
B 1 75  PRO 75  1074 1074 PRO PRO B . n 
B 1 76  LEU 76  1075 1075 LEU LEU B . n 
B 1 77  THR 77  1076 1076 THR THR B . n 
B 1 78  PHE 78  1077 1077 PHE PHE B . n 
B 1 79  SER 79  1078 1078 SER SER B . n 
B 1 80  SER 80  1079 1079 SER SER B . n 
B 1 81  VAL 81  1080 1080 VAL VAL B . n 
B 1 82  VAL 82  1081 1081 VAL VAL B . n 
B 1 83  GLU 83  1082 1082 GLU GLU B . n 
B 1 84  LEU 84  1083 1083 LEU LEU B . n 
B 1 85  ILE 85  1084 1084 ILE ILE B . n 
B 1 86  ASN 86  1085 1085 ASN ASN B . n 
B 1 87  HIS 87  1086 1086 HIS HIS B . n 
B 1 88  TYR 88  1087 1087 TYR TYR B . n 
B 1 89  ARG 89  1088 1088 ARG ARG B . n 
B 1 90  ASN 90  1089 1089 ASN ASN B . n 
B 1 91  GLU 91  1090 1090 GLU GLU B . n 
B 1 92  SER 92  1091 1091 SER SER B . n 
B 1 93  LEU 93  1092 1092 LEU LEU B . n 
B 1 94  ALA 94  1093 1093 ALA ALA B . n 
B 1 95  GLN 95  1094 1094 GLN GLN B . n 
B 1 96  TYR 96  1095 1095 TYR TYR B . n 
B 1 97  ASN 97  1096 1096 ASN ASN B . n 
B 1 98  PRO 98  1097 1097 PRO PRO B . n 
B 1 99  LYS 99  1098 1098 LYS LYS B . n 
B 1 100 LEU 100 1099 1099 LEU LEU B . n 
B 1 101 ASP 101 1100 1100 ASP ASP B . n 
B 1 102 VAL 102 1101 1101 VAL VAL B . n 
B 1 103 LYS 103 1102 1102 LYS LYS B . n 
B 1 104 LEU 104 1103 1103 LEU LEU B . n 
B 1 105 LEU 105 1104 1104 LEU LEU B . n 
B 1 106 TYR 106 1105 1105 TYR TYR B . n 
B 1 107 PRO 107 1106 1106 PRO PRO B . n 
B 1 108 VAL 108 1107 1107 VAL VAL B . n 
B 1 109 SER 109 1108 1108 SER SER B . n 
B 1 110 LYS 110 1109 1109 LYS LYS B . n 
B 1 111 TYR 111 1110 1110 TYR TYR B . n 
B 1 112 GLN 112 1111 1111 GLN GLN B . n 
B 1 113 GLN 113 1112 ?    ?   ?   B . n 
B 1 114 ASP 114 1113 ?    ?   ?   B . n 
B 1 115 GLN 115 1114 ?    ?   ?   B . n 
B 1 116 VAL 116 1115 ?    ?   ?   B . n 
B 1 117 VAL 117 1116 ?    ?   ?   B . n 
B 1 118 LYS 118 1117 ?    ?   ?   B . n 
B 1 119 GLU 119 1118 ?    ?   ?   B . n 
B 1 120 ASP 120 1119 ?    ?   ?   B . n 
C 2 1   SER 1   201  201  SER SER C . n 
C 2 2   ILE 2   202  202  ILE ILE C . n 
C 2 3   ASP 3   203  203  ASP ASP C . n 
C 2 4   PTR 4   204  204  PTR PTR C . n 
C 2 5   VAL 5   205  205  VAL VAL C . n 
C 2 6   PRO 6   206  206  PRO PRO C . n 
C 2 7   MET 7   207  207  MET MET C . n 
C 2 8   LEU 8   208  208  LEU LEU C . n 
C 2 9   ASP 9   209  209  ASP ASP C . n 
C 2 10  MET 10  210  210  MET MET C . n 
C 2 11  LYS 11  211  211  LYS LYS C . n 
D 2 1   SER 1   1201 1201 SER SER D . n 
D 2 2   ILE 2   1202 1202 ILE ILE D . n 
D 2 3   ASP 3   1203 1203 ASP ASP D . n 
D 2 4   PTR 4   1204 1204 PTR PTR D . n 
D 2 5   VAL 5   1205 1205 VAL VAL D . n 
D 2 6   PRO 6   1206 1206 PRO PRO D . n 
D 2 7   MET 7   1207 1207 MET MET D . n 
D 2 8   LEU 8   1208 1208 LEU LEU D . n 
D 2 9   ASP 9   1209 1209 ASP ASP D . n 
D 2 10  MET 10  1210 1210 MET MET D . n 
D 2 11  LYS 11  1211 1211 LYS LYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  2001 2001 HOH HOH A . 
E 3 HOH 2  2002 2002 HOH HOH A . 
E 3 HOH 3  2003 2003 HOH HOH A . 
E 3 HOH 4  2004 2004 HOH HOH A . 
E 3 HOH 5  2005 2005 HOH HOH A . 
E 3 HOH 6  2006 2006 HOH HOH A . 
E 3 HOH 7  2007 2007 HOH HOH A . 
E 3 HOH 8  2008 2008 HOH HOH A . 
E 3 HOH 9  2009 2009 HOH HOH A . 
E 3 HOH 10 2010 2010 HOH HOH A . 
E 3 HOH 11 2011 2011 HOH HOH A . 
E 3 HOH 12 2012 2012 HOH HOH A . 
E 3 HOH 13 2013 2013 HOH HOH A . 
E 3 HOH 14 2014 2014 HOH HOH A . 
E 3 HOH 15 2015 2015 HOH HOH A . 
E 3 HOH 16 2016 2016 HOH HOH A . 
E 3 HOH 17 2017 2017 HOH HOH A . 
E 3 HOH 18 2018 2018 HOH HOH A . 
E 3 HOH 19 2019 2019 HOH HOH A . 
E 3 HOH 20 2020 2020 HOH HOH A . 
E 3 HOH 21 2021 2021 HOH HOH A . 
E 3 HOH 22 2022 2022 HOH HOH A . 
E 3 HOH 23 2023 2023 HOH HOH A . 
E 3 HOH 24 2024 2024 HOH HOH A . 
E 3 HOH 25 2025 2025 HOH HOH A . 
E 3 HOH 26 2026 2026 HOH HOH A . 
E 3 HOH 27 2027 2027 HOH HOH A . 
E 3 HOH 28 2028 2028 HOH HOH A . 
E 3 HOH 29 2029 2029 HOH HOH A . 
E 3 HOH 30 2030 2030 HOH HOH A . 
E 3 HOH 31 2031 2031 HOH HOH A . 
E 3 HOH 32 2032 2032 HOH HOH A . 
E 3 HOH 33 2033 2033 HOH HOH A . 
E 3 HOH 34 2034 2034 HOH HOH A . 
E 3 HOH 35 2035 2035 HOH HOH A . 
E 3 HOH 36 2036 2036 HOH HOH A . 
E 3 HOH 37 2037 2037 HOH HOH A . 
E 3 HOH 38 2038 2038 HOH HOH A . 
E 3 HOH 39 2039 2039 HOH HOH A . 
E 3 HOH 40 2040 2040 HOH HOH A . 
E 3 HOH 41 2041 2041 HOH HOH A . 
E 3 HOH 42 2042 2042 HOH HOH A . 
E 3 HOH 43 2043 2043 HOH HOH A . 
E 3 HOH 44 2044 2044 HOH HOH A . 
E 3 HOH 45 2045 2045 HOH HOH A . 
E 3 HOH 46 2046 2046 HOH HOH A . 
E 3 HOH 47 2047 2047 HOH HOH A . 
E 3 HOH 48 2048 2048 HOH HOH A . 
E 3 HOH 49 2049 2049 HOH HOH A . 
E 3 HOH 50 2050 2050 HOH HOH A . 
E 3 HOH 51 2051 2051 HOH HOH A . 
E 3 HOH 52 2052 2052 HOH HOH A . 
E 3 HOH 53 2053 2053 HOH HOH A . 
E 3 HOH 54 2054 2054 HOH HOH A . 
E 3 HOH 55 2055 2055 HOH HOH A . 
F 3 HOH 1  2001 2001 HOH HOH B . 
F 3 HOH 2  2002 2002 HOH HOH B . 
F 3 HOH 3  2003 2003 HOH HOH B . 
F 3 HOH 4  2004 2004 HOH HOH B . 
F 3 HOH 5  2005 2005 HOH HOH B . 
F 3 HOH 6  2006 2006 HOH HOH B . 
F 3 HOH 7  2007 2007 HOH HOH B . 
F 3 HOH 8  2008 2008 HOH HOH B . 
F 3 HOH 9  2009 2009 HOH HOH B . 
F 3 HOH 10 2010 2010 HOH HOH B . 
F 3 HOH 11 2011 2011 HOH HOH B . 
F 3 HOH 12 2012 2012 HOH HOH B . 
F 3 HOH 13 2013 2013 HOH HOH B . 
F 3 HOH 14 2014 2014 HOH HOH B . 
F 3 HOH 15 2015 2015 HOH HOH B . 
F 3 HOH 16 2016 2016 HOH HOH B . 
F 3 HOH 17 2017 2017 HOH HOH B . 
F 3 HOH 18 2018 2018 HOH HOH B . 
F 3 HOH 19 2019 2019 HOH HOH B . 
F 3 HOH 20 2020 2020 HOH HOH B . 
F 3 HOH 21 2021 2021 HOH HOH B . 
F 3 HOH 22 2022 2022 HOH HOH B . 
F 3 HOH 23 2023 2023 HOH HOH B . 
F 3 HOH 24 2024 2024 HOH HOH B . 
F 3 HOH 25 2025 2025 HOH HOH B . 
F 3 HOH 26 2026 2026 HOH HOH B . 
F 3 HOH 27 2027 2027 HOH HOH B . 
F 3 HOH 28 2028 2028 HOH HOH B . 
F 3 HOH 29 2029 2029 HOH HOH B . 
F 3 HOH 30 2030 2030 HOH HOH B . 
F 3 HOH 31 2031 2031 HOH HOH B . 
F 3 HOH 32 2032 2032 HOH HOH B . 
F 3 HOH 33 2033 2033 HOH HOH B . 
F 3 HOH 34 2034 2034 HOH HOH B . 
F 3 HOH 35 2035 2035 HOH HOH B . 
F 3 HOH 36 2036 2036 HOH HOH B . 
F 3 HOH 37 2037 2037 HOH HOH B . 
F 3 HOH 38 2038 2038 HOH HOH B . 
F 3 HOH 39 2039 2039 HOH HOH B . 
F 3 HOH 40 2040 2040 HOH HOH B . 
F 3 HOH 41 2041 2041 HOH HOH B . 
G 3 HOH 1  2001 2001 HOH HOH C . 
G 3 HOH 2  2002 2002 HOH HOH C . 
G 3 HOH 3  2003 2003 HOH HOH C . 
G 3 HOH 4  2004 2004 HOH HOH C . 
G 3 HOH 5  2005 2005 HOH HOH C . 
G 3 HOH 6  2006 2006 HOH HOH C . 
G 3 HOH 7  2007 2007 HOH HOH C . 
G 3 HOH 8  2008 2008 HOH HOH C . 
G 3 HOH 9  2009 2009 HOH HOH C . 
G 3 HOH 10 2010 2010 HOH HOH C . 
G 3 HOH 11 2011 2011 HOH HOH C . 
G 3 HOH 12 2012 2012 HOH HOH C . 
G 3 HOH 13 2013 2013 HOH HOH C . 
H 3 HOH 1  2001 2001 HOH HOH D . 
H 3 HOH 2  2002 2002 HOH HOH D . 
H 3 HOH 3  2003 2003 HOH HOH D . 
H 3 HOH 4  2004 2004 HOH HOH D . 
H 3 HOH 5  2005 2005 HOH HOH D . 
H 3 HOH 6  2006 2006 HOH HOH D . 
H 3 HOH 7  2007 2007 HOH HOH D . 
H 3 HOH 8  2008 2008 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C PTR 4 C PTR 204  ? TYR 'modified residue' 
2 D PTR 4 D PTR 1204 ? TYR 'modified residue' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-06 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Source and taxonomy'       
5 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity              
2 4 'Structure model' entity_name_com     
3 4 'Structure model' entity_src_gen      
4 4 'Structure model' pdbx_entity_src_syn 
5 4 'Structure model' struct_ref          
6 4 'Structure model' struct_ref_seq      
7 4 'Structure model' struct_ref_seq_dif  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_entity.pdbx_description'             
2  4 'Structure model' '_entity.pdbx_ec'                      
3  4 'Structure model' '_entity.src_method'                   
4  4 'Structure model' '_struct_ref.db_code'                  
5  4 'Structure model' '_struct_ref.db_name'                  
6  4 'Structure model' '_struct_ref.pdbx_align_begin'         
7  4 'Structure model' '_struct_ref.pdbx_db_accession'        
8  4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 
9  4 'Structure model' '_struct_ref_seq.db_align_beg'         
10 4 'Structure model' '_struct_ref_seq.db_align_end'         
11 4 'Structure model' '_struct_ref_seq.pdbx_db_accession'    
# 
_software.name             X-PLOR 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 16   ? ? -94.30  57.87   
2  1 ASP A 28   ? ? 80.70   9.62    
3  1 MET A 43   ? ? 21.73   59.73   
4  1 ASP A 66   ? ? 54.63   -117.89 
5  1 ASN A 96   ? ? -174.87 114.57  
6  1 LEU A 99   ? ? -103.06 50.33   
7  1 MET B 1043 ? ? 24.31   60.67   
8  1 ASP B 1066 ? ? 50.41   -120.21 
9  1 LEU B 1099 ? ? -101.12 58.22   
10 1 ASP C 203  ? ? -129.21 -86.89  
11 1 ASP D 1203 ? ? -127.96 -87.87  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2005 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.82 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0    ? A GLY 1   
2  1 Y 1 A MET 1    ? A MET 2   
3  1 Y 1 A ASN 2    ? A ASN 3   
4  1 Y 1 A ASN 3    ? A ASN 4   
5  1 Y 1 A ASN 4    ? A ASN 5   
6  1 Y 1 A GLN 112  ? A GLN 113 
7  1 Y 1 A ASP 113  ? A ASP 114 
8  1 Y 1 A GLN 114  ? A GLN 115 
9  1 Y 1 A VAL 115  ? A VAL 116 
10 1 Y 1 A VAL 116  ? A VAL 117 
11 1 Y 1 A LYS 117  ? A LYS 118 
12 1 Y 1 A GLU 118  ? A GLU 119 
13 1 Y 1 A ASP 119  ? A ASP 120 
14 1 Y 1 B GLY 1000 ? B GLY 1   
15 1 Y 1 B MET 1001 ? B MET 2   
16 1 Y 1 B GLN 1112 ? B GLN 113 
17 1 Y 1 B ASP 1113 ? B ASP 114 
18 1 Y 1 B GLN 1114 ? B GLN 115 
19 1 Y 1 B VAL 1115 ? B VAL 116 
20 1 Y 1 B VAL 1116 ? B VAL 117 
21 1 Y 1 B LYS 1117 ? B LYS 118 
22 1 Y 1 B GLU 1118 ? B GLU 119 
23 1 Y 1 B ASP 1119 ? B ASP 120 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#