data_2IZV
# 
_entry.id   2IZV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2IZV         
PDBE  EBI-29506    
WWPDB D_1290029506 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1LM8 unspecified 'STRUCTURE OF A HIF-1A-PVHL-ELONGINB- ELONGINC COMPLEX'                                                 
PDB 1LQB unspecified 'CRYSTAL STRUCTURE OF A HYDROXYLATED HIF-1 ALPHA PEPTIDEBOUND TO THE PVHL/ELONGIN-C/ ELONGIN-B COMPLEX' 
PDB 1VCB unspecified 'THE VHL-ELONGINC-ELONGINB STRUCTURE'                                                                   
PDB 2C9W unspecified 'CRYSTAL STRUCTURE OF SOCS-2 IN COMPLEX WITH ELONGIN-B AND ELONGIN-C AT 1.9A RESOLUTION'                
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2IZV 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-07-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Debreczeni, J.E.'  1  ? 
'Bullock, A.'       2  ? 
'Papagrigoriou, E.' 3  ? 
'Turnbull, A.'      4  ? 
'Pike, A.C.W.'      5  ? 
'Gorrec, F.'        6  ? 
'von Delft, F.'     7  ? 
'Sundstrom, M.'     8  ? 
'Arrowsmith, C.'    9  ? 
'Weigelt, J.'       10 ? 
'Edwards, A.'       11 ? 
'Knapp, S.'         12 ? 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            15 
_citation.page_first                1493 
_citation.page_last                 1504 
_citation.year                      2007 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17997974 
_citation.pdbx_database_id_DOI      10.1016/j.str.2007.09.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bullock, A.N.'    1 ? 
primary 'Rodriguez, M.C.'  2 ? 
primary 'Debreczeni, J.E.' 3 ? 
primary 'Songyang, Z.'     4 ? 
primary 'Knapp, S.'        5 ? 
# 
_cell.entry_id           2IZV 
_cell.length_a           154.770 
_cell.length_b           154.770 
_cell.length_c           67.909 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2IZV 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SUPPRESSOR OF CYTOKINE SIGNALING 4'              21736.711 1   ? ? 'RESIDUES 274-437' ? 
2 polymer     man 'TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2' 13147.781 1   ? ? ?                  ? 
3 polymer     man 'TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 1' 10974.616 1   ? ? 'RESIDUES 17-112'  ? 
4 non-polymer syn 'SODIUM ION'                                      22.990    1   ? ? ?                  ? 
5 non-polymer syn 1,2-ETHANEDIOL                                    62.068    1   ? ? ?                  ? 
6 non-polymer syn 'CHLORIDE ION'                                    35.453    1   ? ? ?                  ? 
7 water       nat water                                             18.015    113 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SOCS-4 ELONGIN B, C COMPLEX, SOCS-4, SOCS-7, SUPPRESSOR OF CYTOKINE SIGNALING 7'                          
2 'RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT B, SIII P18, ELONGIN B, ELOB, ELONGIN 18 KDA SUBUNIT' 
3 'RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT C, SIII P15, ELONGIN-C, ELOC, ELONGIN 15 KDA SUBUNIT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MHHHHHHSSGVDLGTENLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRS
LHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALP
IPSSMKLYLKEYHYKSKVRVLRIDAPE
;
;MHHHHHHSSGVDLGTENLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRS
LHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALP
IPSSMKLYLKEYHYKSKVRVLRIDAPE
;
A ? 
2 'polypeptide(L)' no no 
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
;MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR
ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
;
B ? 
3 'polypeptide(L)' no no 
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
;MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  LEU n 
1 25  VAL n 
1 26  PRO n 
1 27  ASP n 
1 28  LEU n 
1 29  LEU n 
1 30  GLN n 
1 31  ILE n 
1 32  ASN n 
1 33  ASN n 
1 34  ASN n 
1 35  PRO n 
1 36  CYS n 
1 37  TYR n 
1 38  TRP n 
1 39  GLY n 
1 40  VAL n 
1 41  MET n 
1 42  ASP n 
1 43  LYS n 
1 44  TYR n 
1 45  ALA n 
1 46  ALA n 
1 47  GLU n 
1 48  ALA n 
1 49  LEU n 
1 50  LEU n 
1 51  GLU n 
1 52  GLY n 
1 53  LYS n 
1 54  PRO n 
1 55  GLU n 
1 56  GLY n 
1 57  THR n 
1 58  PHE n 
1 59  LEU n 
1 60  LEU n 
1 61  ARG n 
1 62  ASP n 
1 63  SER n 
1 64  ALA n 
1 65  GLN n 
1 66  GLU n 
1 67  ASP n 
1 68  TYR n 
1 69  LEU n 
1 70  PHE n 
1 71  SER n 
1 72  VAL n 
1 73  SER n 
1 74  PHE n 
1 75  ARG n 
1 76  ARG n 
1 77  TYR n 
1 78  SER n 
1 79  ARG n 
1 80  SER n 
1 81  LEU n 
1 82  HIS n 
1 83  ALA n 
1 84  ARG n 
1 85  ILE n 
1 86  GLU n 
1 87  GLN n 
1 88  TRP n 
1 89  ASN n 
1 90  HIS n 
1 91  ASN n 
1 92  PHE n 
1 93  SER n 
1 94  PHE n 
1 95  ASP n 
1 96  ALA n 
1 97  HIS n 
1 98  ASP n 
1 99  PRO n 
1 100 CYS n 
1 101 VAL n 
1 102 PHE n 
1 103 HIS n 
1 104 SER n 
1 105 PRO n 
1 106 ASP n 
1 107 ILE n 
1 108 THR n 
1 109 GLY n 
1 110 LEU n 
1 111 LEU n 
1 112 GLU n 
1 113 HIS n 
1 114 TYR n 
1 115 LYS n 
1 116 ASP n 
1 117 PRO n 
1 118 SER n 
1 119 ALA n 
1 120 CYS n 
1 121 MET n 
1 122 PHE n 
1 123 PHE n 
1 124 GLU n 
1 125 PRO n 
1 126 LEU n 
1 127 LEU n 
1 128 SER n 
1 129 THR n 
1 130 PRO n 
1 131 LEU n 
1 132 ILE n 
1 133 ARG n 
1 134 THR n 
1 135 PHE n 
1 136 PRO n 
1 137 PHE n 
1 138 SER n 
1 139 LEU n 
1 140 GLN n 
1 141 HIS n 
1 142 ILE n 
1 143 CYS n 
1 144 ARG n 
1 145 THR n 
1 146 VAL n 
1 147 ILE n 
1 148 CYS n 
1 149 ASN n 
1 150 CYS n 
1 151 THR n 
1 152 THR n 
1 153 TYR n 
1 154 ASP n 
1 155 GLY n 
1 156 ILE n 
1 157 ASP n 
1 158 ALA n 
1 159 LEU n 
1 160 PRO n 
1 161 ILE n 
1 162 PRO n 
1 163 SER n 
1 164 SER n 
1 165 MET n 
1 166 LYS n 
1 167 LEU n 
1 168 TYR n 
1 169 LEU n 
1 170 LYS n 
1 171 GLU n 
1 172 TYR n 
1 173 HIS n 
1 174 TYR n 
1 175 LYS n 
1 176 SER n 
1 177 LYS n 
1 178 VAL n 
1 179 ARG n 
1 180 VAL n 
1 181 LEU n 
1 182 ARG n 
1 183 ILE n 
1 184 ASP n 
1 185 ALA n 
1 186 PRO n 
1 187 GLU n 
2 1   MET n 
2 2   ASP n 
2 3   VAL n 
2 4   PHE n 
2 5   LEU n 
2 6   MET n 
2 7   ILE n 
2 8   ARG n 
2 9   ARG n 
2 10  HIS n 
2 11  LYS n 
2 12  THR n 
2 13  THR n 
2 14  ILE n 
2 15  PHE n 
2 16  THR n 
2 17  ASP n 
2 18  ALA n 
2 19  LYS n 
2 20  GLU n 
2 21  SER n 
2 22  SER n 
2 23  THR n 
2 24  VAL n 
2 25  PHE n 
2 26  GLU n 
2 27  LEU n 
2 28  LYS n 
2 29  ARG n 
2 30  ILE n 
2 31  VAL n 
2 32  GLU n 
2 33  GLY n 
2 34  ILE n 
2 35  LEU n 
2 36  LYS n 
2 37  ARG n 
2 38  PRO n 
2 39  PRO n 
2 40  ASP n 
2 41  GLU n 
2 42  GLN n 
2 43  ARG n 
2 44  LEU n 
2 45  TYR n 
2 46  LYS n 
2 47  ASP n 
2 48  ASP n 
2 49  GLN n 
2 50  LEU n 
2 51  LEU n 
2 52  ASP n 
2 53  ASP n 
2 54  GLY n 
2 55  LYS n 
2 56  THR n 
2 57  LEU n 
2 58  GLY n 
2 59  GLU n 
2 60  CYS n 
2 61  GLY n 
2 62  PHE n 
2 63  THR n 
2 64  SER n 
2 65  GLN n 
2 66  THR n 
2 67  ALA n 
2 68  ARG n 
2 69  PRO n 
2 70  GLN n 
2 71  ALA n 
2 72  PRO n 
2 73  ALA n 
2 74  THR n 
2 75  VAL n 
2 76  GLY n 
2 77  LEU n 
2 78  ALA n 
2 79  PHE n 
2 80  ARG n 
2 81  ALA n 
2 82  ASP n 
2 83  ASP n 
2 84  THR n 
2 85  PHE n 
2 86  GLU n 
2 87  ALA n 
2 88  LEU n 
2 89  CYS n 
2 90  ILE n 
2 91  GLU n 
2 92  PRO n 
2 93  PHE n 
2 94  SER n 
2 95  SER n 
2 96  PRO n 
2 97  PRO n 
2 98  GLU n 
2 99  LEU n 
2 100 PRO n 
2 101 ASP n 
2 102 VAL n 
2 103 MET n 
2 104 LYS n 
2 105 PRO n 
2 106 GLN n 
2 107 ASP n 
2 108 SER n 
2 109 GLY n 
2 110 SER n 
2 111 SER n 
2 112 ALA n 
2 113 ASN n 
2 114 GLU n 
2 115 GLN n 
2 116 ALA n 
2 117 VAL n 
2 118 GLN n 
3 1   MET n 
3 2   MET n 
3 3   TYR n 
3 4   VAL n 
3 5   LYS n 
3 6   LEU n 
3 7   ILE n 
3 8   SER n 
3 9   SER n 
3 10  ASP n 
3 11  GLY n 
3 12  HIS n 
3 13  GLU n 
3 14  PHE n 
3 15  ILE n 
3 16  VAL n 
3 17  LYS n 
3 18  ARG n 
3 19  GLU n 
3 20  HIS n 
3 21  ALA n 
3 22  LEU n 
3 23  THR n 
3 24  SER n 
3 25  GLY n 
3 26  THR n 
3 27  ILE n 
3 28  LYS n 
3 29  ALA n 
3 30  MET n 
3 31  LEU n 
3 32  SER n 
3 33  GLY n 
3 34  PRO n 
3 35  GLY n 
3 36  GLN n 
3 37  PHE n 
3 38  ALA n 
3 39  GLU n 
3 40  ASN n 
3 41  GLU n 
3 42  THR n 
3 43  ASN n 
3 44  GLU n 
3 45  VAL n 
3 46  ASN n 
3 47  PHE n 
3 48  ARG n 
3 49  GLU n 
3 50  ILE n 
3 51  PRO n 
3 52  SER n 
3 53  HIS n 
3 54  VAL n 
3 55  LEU n 
3 56  SER n 
3 57  LYS n 
3 58  VAL n 
3 59  CYS n 
3 60  MET n 
3 61  TYR n 
3 62  PHE n 
3 63  THR n 
3 64  TYR n 
3 65  LYS n 
3 66  VAL n 
3 67  ARG n 
3 68  TYR n 
3 69  THR n 
3 70  ASN n 
3 71  SER n 
3 72  SER n 
3 73  THR n 
3 74  GLU n 
3 75  ILE n 
3 76  PRO n 
3 77  GLU n 
3 78  PHE n 
3 79  PRO n 
3 80  ILE n 
3 81  ALA n 
3 82  PRO n 
3 83  GLU n 
3 84  ILE n 
3 85  ALA n 
3 86  LEU n 
3 87  GLU n 
3 88  LEU n 
3 89  LEU n 
3 90  MET n 
3 91  ALA n 
3 92  ALA n 
3 93  ASN n 
3 94  PHE n 
3 95  LEU n 
3 96  ASP n 
3 97  CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? R3 ? 
? ? ? ? ? ? P11 ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? R3 ? 
? ? ? ? ? ? P11 ? ? ? ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? R3 ? 
? ? ? ? ? ? P11 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2IZV        1 ? ? 2IZV   ? 
2 UNP SOCS4_HUMAN 1 ? ? Q8WXH5 ? 
3 UNP ELOB_HUMAN  2 ? ? Q15370 ? 
4 PDB 2IZV        3 ? ? 2IZV   ? 
5 UNP ELOC_HUMAN  3 ? ? Q15369 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2IZV A 1  ? 23  ? 2IZV   251 ? 273 ? 251 273 
2 2 2IZV A 24 ? 187 ? Q8WXH5 274 ? 437 ? 274 437 
3 3 2IZV B 1  ? 118 ? Q15370 1   ? 118 ? 1   118 
4 4 2IZV C 1  ? 1   ? 2IZV   16  ? 16  ? 16  16  
5 5 2IZV C 2  ? 97  ? Q15369 17  ? 112 ? 17  112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ?                 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2IZV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.98 
_exptl_crystal.density_percent_sol   69 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '150 UL SITTING DROP 2M NACL 10% PEK6K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-06-16 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.8984 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2IZV 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             44.680 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   19724 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.13000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.1400 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.710 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.65 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.36000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.980 
_reflns_shell.pdbx_redundancy        1.72 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2IZV 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     18723 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             77.38 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.175 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.172 
_refine.ls_R_factor_R_free                       0.223 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               25.83 
_refine.aniso_B[1][1]                            -1.22000 
_refine.aniso_B[2][2]                            -1.22000 
_refine.aniso_B[3][3]                            1.83000 
_refine.aniso_B[1][2]                            -0.61000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2C9W' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.288 
_refine.pdbx_overall_ESU_R_Free                  0.229 
_refine.overall_SU_ML                            0.152 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.503 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2806 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               2925 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        77.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 2882 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1966 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.438  1.971  ? 3910 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.006  3.000  ? 4791 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.553  5.000  ? 349  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.785 23.465 ? 127  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.155 15.000 ? 476  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.092 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.144  0.200  ? 436  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 3158 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 596  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.200  0.200  ? 535  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.190  0.200  ? 1935 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.188  0.200  ? 1397 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.089  0.200  ? 1487 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.159  0.200  ? 95   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.162  0.200  ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.217  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.135  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.518  5.000  ? 1774 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.295  7.000  ? 2881 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.002  9.000  ? 1131 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.759  11.000 ? 1029 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.62 
_refine_ls_shell.number_reflns_R_work             1358 
_refine_ls_shell.R_factor_R_work                  0.2740 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3080 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             69 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2IZV 
_struct.title                     'CRYSTAL STRUCTURE OF SOCS-4 IN COMPLEX WITH ELONGIN-B AND ELONGIN-C AT 2.55A RESOLUTION' 
_struct.pdbx_descriptor           
;SUPPRESSOR OF CYTOKINE SIGNALING 4, TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2, TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2IZV 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;SIGNAL TRANSDUCTION INHIBITOR, GROWTH REGULATION, SIGNAL TRANSDUCTION, SH2 DOMAIN, TRANSCRIPTION, NUCLEAR PROTEIN, UBL CONJUGATION PATHWAY, TRANSCRIPTION REGULATION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 27  ? ASN A 34  ? ASP A 277 ASN A 284 1 ? 8  
HELX_P HELX_P2  2  ASP A 42  ? GLU A 51  ? ASP A 292 GLU A 301 1 ? 10 
HELX_P HELX_P3  3  ASP A 106 ? TYR A 114 ? ASP A 356 TYR A 364 1 ? 9  
HELX_P HELX_P4  4  ASP A 116 ? CYS A 120 ? ASP A 366 CYS A 370 5 ? 5  
HELX_P HELX_P5  5  SER A 138 ? THR A 151 ? SER A 388 THR A 401 1 ? 14 
HELX_P HELX_P6  6  THR A 152 ? ALA A 158 ? THR A 402 ALA A 408 1 ? 7  
HELX_P HELX_P7  7  PRO A 162 ? LYS A 170 ? PRO A 412 LYS A 420 1 ? 9  
HELX_P HELX_P8  8  THR B 23  ? LYS B 36  ? THR B 23  LYS B 36  1 ? 14 
HELX_P HELX_P9  9  PRO B 38  ? ASP B 40  ? PRO B 38  ASP B 40  5 ? 3  
HELX_P HELX_P10 10 PRO B 100 ? LYS B 104 ? PRO B 100 LYS B 104 5 ? 5  
HELX_P HELX_P11 11 ARG C 18  ? LEU C 22  ? ARG C 33  LEU C 37  1 ? 5  
HELX_P HELX_P12 12 SER C 24  ? MET C 30  ? SER C 39  MET C 45  1 ? 7  
HELX_P HELX_P13 13 PRO C 51  ? TYR C 68  ? PRO C 66  TYR C 83  1 ? 18 
HELX_P HELX_P14 14 ALA C 81  ? ASP C 96  ? ALA C 96  ASP C 111 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D NA . NA ? ? ? 1_555 A SER 63 O  ? ? A NA 1430 A SER 313  1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc2 metalc ? ? D NA . NA ? ? ? 1_555 A GLN 65 O  ? ? A NA 1430 A GLN 315  1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc3 metalc ? ? D NA . NA ? ? ? 1_555 A TYR 68 O  ? ? A NA 1430 A TYR 318  1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc4 metalc ? ? D NA . NA ? ? ? 1_555 G HOH .  O  ? ? A NA 1430 A HOH 2022 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc5 metalc ? ? D NA . NA ? ? ? 1_555 G HOH .  O  ? ? A NA 1430 A HOH 2023 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc6 metalc ? ? D NA . NA ? ? ? 1_555 E EDO .  O2 ? ? A NA 1430 A EDO 1431 1_555 ? ? ? ? ? ? ? 2.503 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 2 ? 
BA ? 8 ? 
BB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BA 4 5 ? anti-parallel 
BA 5 6 ? parallel      
BA 6 7 ? anti-parallel 
BA 7 8 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLN A 21  ? LEU A 24  ? GLN A 271 LEU A 274 
AA 2 HIS A 173 ? SER A 176 ? HIS A 423 SER A 426 
AB 1 TYR A 37  ? VAL A 40  ? TYR A 287 VAL A 290 
AB 2 THR A 57  ? ASP A 62  ? THR A 307 ASP A 312 
AB 3 THR A 129 ? PRO A 130 ? THR A 379 PRO A 380 
AC 1 TYR A 37  ? VAL A 40  ? TYR A 287 VAL A 290 
AC 2 THR A 57  ? ASP A 62  ? THR A 307 ASP A 312 
AC 3 PHE A 70  ? ARG A 76  ? PHE A 320 ARG A 326 
AC 4 ARG A 79  ? ARG A 84  ? ARG A 329 ARG A 334 
AD 1 GLU A 86  ? TRP A 88  ? GLU A 336 TRP A 338 
AD 2 ASN A 91  ? SER A 93  ? ASN A 341 SER A 343 
BA 1 GLN B 49  ? LEU B 50  ? GLN B 49  LEU B 50  
BA 2 GLN B 42  ? LYS B 46  ? GLN B 42  LYS B 46  
BA 3 ALA B 73  ? ALA B 81  ? ALA B 73  ALA B 81  
BA 4 ASP B 2   ? ARG B 9   ? ASP B 2   ARG B 9   
BA 5 THR B 12  ? LYS B 19  ? THR B 12  LYS B 19  
BA 6 GLU C 13  ? LYS C 17  ? GLU C 28  LYS C 32  
BA 7 TYR C 3   ? ILE C 7   ? TYR C 18  ILE C 22  
BA 8 GLU C 44  ? ASN C 46  ? GLU C 59  ASN C 61  
BB 1 GLN B 49  ? LEU B 50  ? GLN B 49  LEU B 50  
BB 2 GLN B 42  ? LYS B 46  ? GLN B 42  LYS B 46  
BB 3 ALA B 73  ? ALA B 81  ? ALA B 73  ALA B 81  
BB 4 THR B 84  ? PHE B 85  ? THR B 84  PHE B 85  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 23 ? N MET A 273 O TYR A 174 ? O TYR A 424 
AB 1 2 N TRP A 38 ? N TRP A 288 O LEU A 60  ? O LEU A 310 
AB 2 3 N PHE A 58 ? N PHE A 308 O THR A 129 ? O THR A 379 
AC 1 2 N TRP A 38 ? N TRP A 288 O LEU A 60  ? O LEU A 310 
AC 2 3 N ARG A 61 ? N ARG A 311 O SER A 71  ? O SER A 321 
AC 3 4 N ARG A 76 ? N ARG A 326 O ARG A 79  ? O ARG A 329 
AD 1 2 N TRP A 88 ? N TRP A 338 O ASN A 91  ? O ASN A 341 
BA 1 2 N GLN B 49 ? N GLN B 49  O LYS B 46  ? O LYS B 46  
BA 2 3 N TYR B 45 ? N TYR B 45  O GLY B 76  ? O GLY B 76  
BA 3 4 N ALA B 73 ? N ALA B 73  O PHE B 4   ? O PHE B 4   
BA 4 5 N ARG B 9  ? N ARG B 9   O THR B 12  ? O THR B 12  
BA 5 6 N THR B 13 ? N THR B 13  O GLU C 13  ? O GLU C 28  
BA 6 7 N VAL C 16 ? N VAL C 31  O VAL C 4   ? O VAL C 19  
BA 7 8 N ILE C 7  ? N ILE C 22  O VAL C 45  ? O VAL C 60  
BB 1 2 N GLN B 49 ? N GLN B 49  O LYS B 46  ? O LYS B 46  
BB 2 3 N TYR B 45 ? N TYR B 45  O GLY B 76  ? O GLY B 76  
BB 3 4 N ALA B 81 ? N ALA B 81  O THR B 84  ? O THR B 84  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A1430'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A1431' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 63  ? SER A 313  . ? 1_555 ? 
2  AC1 6 GLN A 65  ? GLN A 315  . ? 1_555 ? 
3  AC1 6 TYR A 68  ? TYR A 318  . ? 1_555 ? 
4  AC1 6 EDO E .   ? EDO A 1431 . ? 1_555 ? 
5  AC1 6 HOH G .   ? HOH A 2022 . ? 1_555 ? 
6  AC1 6 HOH G .   ? HOH A 2023 . ? 1_555 ? 
7  AC2 7 ASP A 62  ? ASP A 312  . ? 1_555 ? 
8  AC2 7 SER A 63  ? SER A 313  . ? 1_555 ? 
9  AC2 7 TYR A 68  ? TYR A 318  . ? 1_555 ? 
10 AC2 7 LEU A 69  ? LEU A 319  . ? 1_555 ? 
11 AC2 7 GLU A 171 ? GLU A 421  . ? 1_555 ? 
12 AC2 7 NA  D .   ? NA  A 1430 . ? 1_555 ? 
13 AC2 7 HOH G .   ? HOH A 2020 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2IZV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2IZV 
_atom_sites.fract_transf_matrix[1][1]   0.006461 
_atom_sites.fract_transf_matrix[1][2]   0.003730 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007461 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014726 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 17  ? 15.223  5.496   72.002 1.00 23.39 ? 267  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 17  ? 15.167  6.390   70.799 1.00 29.08 ? 267  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 17  ? 13.934  7.035   70.196 1.00 25.78 ? 267  ASN A C   1 
ATOM   4    O  O   . ASN A 1 17  ? 12.906  6.409   70.108 1.00 31.76 ? 267  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 17  ? 16.455  6.743   70.014 1.00 33.82 ? 267  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 17  ? 17.710  6.028   70.482 1.00 35.84 ? 267  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 17  ? 18.321  6.432   71.473 1.00 43.90 ? 267  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 17  ? 18.177  5.062   69.697 1.00 28.08 ? 267  ASN A ND2 1 
ATOM   9    N  N   . LEU A 1 18  ? 14.046  8.302   69.806 1.00 26.02 ? 268  LEU A N   1 
ATOM   10   C  CA  . LEU A 1 18  ? 13.021  8.978   69.006 1.00 28.32 ? 268  LEU A CA  1 
ATOM   11   C  C   . LEU A 1 18  ? 13.384  8.974   67.514 1.00 26.93 ? 268  LEU A C   1 
ATOM   12   O  O   . LEU A 1 18  ? 12.976  9.847   66.755 1.00 30.36 ? 268  LEU A O   1 
ATOM   13   C  CB  . LEU A 1 18  ? 12.860  10.423  69.472 1.00 29.36 ? 268  LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 18  ? 12.410  10.652  70.908 1.00 27.21 ? 268  LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 18  ? 12.024  12.107  71.007 1.00 14.58 ? 268  LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 18  ? 11.262  9.722   71.327 1.00 13.81 ? 268  LEU A CD2 1 
ATOM   17   N  N   . TYR A 1 19  ? 14.174  7.997   67.105 1.00 23.88 ? 269  TYR A N   1 
ATOM   18   C  CA  . TYR A 1 19  ? 14.546  7.852   65.723 1.00 23.26 ? 269  TYR A CA  1 
ATOM   19   C  C   . TYR A 1 19  ? 14.894  6.409   65.527 1.00 21.46 ? 269  TYR A C   1 
ATOM   20   O  O   . TYR A 1 19  ? 14.901  5.642   66.491 1.00 23.28 ? 269  TYR A O   1 
ATOM   21   C  CB  . TYR A 1 19  ? 15.722  8.753   65.379 1.00 22.31 ? 269  TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 19  ? 16.907  8.590   66.291 1.00 17.53 ? 269  TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 19  ? 17.130  9.484   67.321 1.00 13.83 ? 269  TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 19  ? 17.820  7.561   66.103 1.00 20.08 ? 269  TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 19  ? 18.199  9.355   68.148 1.00 15.22 ? 269  TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 19  ? 18.905  7.418   66.938 1.00 26.46 ? 269  TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 19  ? 19.084  8.315   67.962 1.00 17.74 ? 269  TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 19  ? 20.160  8.203   68.790 1.00 23.51 ? 269  TYR A OH  1 
ATOM   29   N  N   . PHE A 1 20  ? 15.141  6.005   64.292 1.00 22.34 ? 270  PHE A N   1 
ATOM   30   C  CA  . PHE A 1 20  ? 15.516  4.622   64.081 1.00 23.40 ? 270  PHE A CA  1 
ATOM   31   C  C   . PHE A 1 20  ? 16.650  4.464   63.141 1.00 21.77 ? 270  PHE A C   1 
ATOM   32   O  O   . PHE A 1 20  ? 16.846  5.296   62.259 1.00 23.63 ? 270  PHE A O   1 
ATOM   33   C  CB  . PHE A 1 20  ? 14.327  3.781   63.632 1.00 31.01 ? 270  PHE A CB  1 
ATOM   34   C  CG  . PHE A 1 20  ? 13.877  4.017   62.213 1.00 24.08 ? 270  PHE A CG  1 
ATOM   35   C  CD1 . PHE A 1 20  ? 12.721  4.740   61.959 1.00 24.61 ? 270  PHE A CD1 1 
ATOM   36   C  CD2 . PHE A 1 20  ? 14.557  3.447   61.148 1.00 18.92 ? 270  PHE A CD2 1 
ATOM   37   C  CE1 . PHE A 1 20  ? 12.278  4.932   60.660 1.00 23.37 ? 270  PHE A CE1 1 
ATOM   38   C  CE2 . PHE A 1 20  ? 14.113  3.637   59.840 1.00 21.00 ? 270  PHE A CE2 1 
ATOM   39   C  CZ  . PHE A 1 20  ? 12.968  4.377   59.600 1.00 11.96 ? 270  PHE A CZ  1 
ATOM   40   N  N   . GLN A 1 21  ? 17.372  3.364   63.338 1.00 21.43 ? 271  GLN A N   1 
ATOM   41   C  CA  . GLN A 1 21  ? 18.542  3.020   62.544 1.00 24.24 ? 271  GLN A CA  1 
ATOM   42   C  C   . GLN A 1 21  ? 18.205  1.794   61.728 1.00 22.69 ? 271  GLN A C   1 
ATOM   43   O  O   . GLN A 1 21  ? 17.672  0.820   62.232 1.00 23.78 ? 271  GLN A O   1 
ATOM   44   C  CB  . GLN A 1 21  ? 19.763  2.733   63.432 1.00 23.91 ? 271  GLN A CB  1 
ATOM   45   C  CG  . GLN A 1 21  ? 21.056  2.666   62.633 1.00 33.90 ? 271  GLN A CG  1 
ATOM   46   C  CD  . GLN A 1 21  ? 22.285  2.286   63.456 1.00 37.12 ? 271  GLN A CD  1 
ATOM   47   O  OE1 . GLN A 1 21  ? 22.326  2.488   64.668 1.00 34.91 ? 271  GLN A OE1 1 
ATOM   48   N  NE2 . GLN A 1 21  ? 23.307  1.753   62.778 1.00 32.82 ? 271  GLN A NE2 1 
ATOM   49   N  N   . SER A 1 22  ? 18.521  1.845   60.455 1.00 25.46 ? 272  SER A N   1 
ATOM   50   C  CA  . SER A 1 22  ? 18.238  0.741   59.594 1.00 24.54 ? 272  SER A CA  1 
ATOM   51   C  C   . SER A 1 22  ? 19.414  -0.194  59.650 1.00 28.32 ? 272  SER A C   1 
ATOM   52   O  O   . SER A 1 22  ? 20.569  0.247   59.708 1.00 20.16 ? 272  SER A O   1 
ATOM   53   C  CB  . SER A 1 22  ? 17.992  1.240   58.183 1.00 27.06 ? 272  SER A CB  1 
ATOM   54   O  OG  . SER A 1 22  ? 16.941  2.183   58.231 1.00 29.59 ? 272  SER A OG  1 
ATOM   55   N  N   . MET A 1 23  ? 19.094  -1.485  59.590 1.00 28.83 ? 273  MET A N   1 
ATOM   56   C  CA  . MET A 1 23  ? 19.989  -2.556  59.953 1.00 26.27 ? 273  MET A CA  1 
ATOM   57   C  C   . MET A 1 23  ? 19.646  -3.754  59.107 1.00 26.01 ? 273  MET A C   1 
ATOM   58   O  O   . MET A 1 23  ? 18.480  -4.125  59.059 1.00 23.20 ? 273  MET A O   1 
ATOM   59   C  CB  . MET A 1 23  ? 19.689  -2.925  61.391 1.00 28.83 ? 273  MET A CB  1 
ATOM   60   C  CG  . MET A 1 23  ? 20.878  -3.151  62.228 1.00 44.03 ? 273  MET A CG  1 
ATOM   61   S  SD  . MET A 1 23  ? 21.237  -1.718  63.196 1.00 44.37 ? 273  MET A SD  1 
ATOM   62   C  CE  . MET A 1 23  ? 22.650  -2.352  64.090 1.00 34.67 ? 273  MET A CE  1 
ATOM   63   N  N   . LEU A 1 24  ? 20.633  -4.381  58.468 1.00 26.29 ? 274  LEU A N   1 
ATOM   64   C  CA  . LEU A 1 24  ? 20.356  -5.578  57.671 1.00 22.33 ? 274  LEU A CA  1 
ATOM   65   C  C   . LEU A 1 24  ? 19.997  -6.782  58.567 1.00 19.04 ? 274  LEU A C   1 
ATOM   66   O  O   . LEU A 1 24  ? 20.636  -7.001  59.573 1.00 22.90 ? 274  LEU A O   1 
ATOM   67   C  CB  . LEU A 1 24  ? 21.546  -5.918  56.791 1.00 18.45 ? 274  LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 24  ? 21.788  -5.030  55.560 1.00 28.40 ? 274  LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 24  ? 23.121  -5.424  54.967 1.00 13.58 ? 274  LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 24  ? 20.690  -5.134  54.474 1.00 12.15 ? 274  LEU A CD2 1 
ATOM   71   N  N   . VAL A 1 25  ? 18.947  -7.528  58.218 1.00 27.11 ? 275  VAL A N   1 
ATOM   72   C  CA  . VAL A 1 25  ? 18.662  -8.831  58.851 1.00 31.92 ? 275  VAL A CA  1 
ATOM   73   C  C   . VAL A 1 25  ? 19.976  -9.615  58.848 1.00 34.39 ? 275  VAL A C   1 
ATOM   74   O  O   . VAL A 1 25  ? 20.562  -9.823  57.786 1.00 34.47 ? 275  VAL A O   1 
ATOM   75   C  CB  . VAL A 1 25  ? 17.561  -9.634  58.081 1.00 29.92 ? 275  VAL A CB  1 
ATOM   76   C  CG1 . VAL A 1 25  ? 17.404  -11.004 58.645 1.00 31.33 ? 275  VAL A CG1 1 
ATOM   77   C  CG2 . VAL A 1 25  ? 16.225  -8.918  58.163 1.00 28.71 ? 275  VAL A CG2 1 
ATOM   78   N  N   . PRO A 1 26  ? 20.477  -10.010 60.030 1.00 30.83 ? 276  PRO A N   1 
ATOM   79   C  CA  . PRO A 1 26  ? 21.861  -10.528 60.107 1.00 33.71 ? 276  PRO A CA  1 
ATOM   80   C  C   . PRO A 1 26  ? 22.016  -11.910 59.447 1.00 35.96 ? 276  PRO A C   1 
ATOM   81   O  O   . PRO A 1 26  ? 23.059  -12.268 58.947 1.00 37.21 ? 276  PRO A O   1 
ATOM   82   C  CB  . PRO A 1 26  ? 22.098  -10.625 61.617 1.00 32.27 ? 276  PRO A CB  1 
ATOM   83   C  CG  . PRO A 1 26  ? 20.682  -10.871 62.200 1.00 28.97 ? 276  PRO A CG  1 
ATOM   84   C  CD  . PRO A 1 26  ? 19.790  -10.029 61.334 1.00 29.07 ? 276  PRO A CD  1 
ATOM   85   N  N   . ASP A 1 27  ? 20.903  -12.612 59.397 1.00 40.44 ? 277  ASP A N   1 
ATOM   86   C  CA  . ASP A 1 27  ? 20.783  -14.005 59.097 1.00 37.96 ? 277  ASP A CA  1 
ATOM   87   C  C   . ASP A 1 27  ? 20.442  -14.250 57.610 1.00 34.44 ? 277  ASP A C   1 
ATOM   88   O  O   . ASP A 1 27  ? 20.196  -15.387 57.209 1.00 33.03 ? 277  ASP A O   1 
ATOM   89   C  CB  . ASP A 1 27  ? 19.579  -14.426 59.967 1.00 45.84 ? 277  ASP A CB  1 
ATOM   90   C  CG  . ASP A 1 27  ? 19.439  -15.893 60.119 1.00 55.07 ? 277  ASP A CG  1 
ATOM   91   O  OD1 . ASP A 1 27  ? 20.460  -16.611 60.003 1.00 83.98 ? 277  ASP A OD1 1 
ATOM   92   O  OD2 . ASP A 1 27  ? 18.297  -16.322 60.390 1.00 59.83 ? 277  ASP A OD2 1 
ATOM   93   N  N   . LEU A 1 28  ? 20.419  -13.189 56.799 1.00 26.17 ? 278  LEU A N   1 
ATOM   94   C  CA  . LEU A 1 28  ? 19.732  -13.189 55.490 1.00 21.45 ? 278  LEU A CA  1 
ATOM   95   C  C   . LEU A 1 28  ? 20.165  -14.276 54.500 1.00 19.90 ? 278  LEU A C   1 
ATOM   96   O  O   . LEU A 1 28  ? 19.326  -14.834 53.778 1.00 20.26 ? 278  LEU A O   1 
ATOM   97   C  CB  . LEU A 1 28  ? 19.843  -11.815 54.815 1.00 21.43 ? 278  LEU A CB  1 
ATOM   98   C  CG  . LEU A 1 28  ? 19.044  -11.619 53.512 1.00 30.78 ? 278  LEU A CG  1 
ATOM   99   C  CD1 . LEU A 1 28  ? 17.557  -11.489 53.831 1.00 23.91 ? 278  LEU A CD1 1 
ATOM   100  C  CD2 . LEU A 1 28  ? 19.544  -10.428 52.682 1.00 30.65 ? 278  LEU A CD2 1 
ATOM   101  N  N   . LEU A 1 29  ? 21.459  -14.567 54.450 1.00 23.04 ? 279  LEU A N   1 
ATOM   102  C  CA  . LEU A 1 29  ? 21.963  -15.606 53.550 1.00 28.15 ? 279  LEU A CA  1 
ATOM   103  C  C   . LEU A 1 29  ? 21.570  -16.995 54.075 1.00 25.64 ? 279  LEU A C   1 
ATOM   104  O  O   . LEU A 1 29  ? 21.080  -17.801 53.309 1.00 33.80 ? 279  LEU A O   1 
ATOM   105  C  CB  . LEU A 1 29  ? 23.478  -15.458 53.323 1.00 24.72 ? 279  LEU A CB  1 
ATOM   106  C  CG  . LEU A 1 29  ? 24.213  -16.425 52.367 1.00 24.03 ? 279  LEU A CG  1 
ATOM   107  C  CD1 . LEU A 1 29  ? 23.623  -16.493 50.985 1.00 13.75 ? 279  LEU A CD1 1 
ATOM   108  C  CD2 . LEU A 1 29  ? 25.677  -16.015 52.248 1.00 21.56 ? 279  LEU A CD2 1 
ATOM   109  N  N   . GLN A 1 30  ? 21.751  -17.268 55.369 1.00 26.03 ? 280  GLN A N   1 
ATOM   110  C  CA  . GLN A 1 30  ? 21.240  -18.518 55.949 1.00 25.61 ? 280  GLN A CA  1 
ATOM   111  C  C   . GLN A 1 30  ? 19.762  -18.734 55.619 1.00 19.65 ? 280  GLN A C   1 
ATOM   112  O  O   . GLN A 1 30  ? 19.376  -19.791 55.189 1.00 29.50 ? 280  GLN A O   1 
ATOM   113  C  CB  . GLN A 1 30  ? 21.336  -18.499 57.465 1.00 31.60 ? 280  GLN A CB  1 
ATOM   114  C  CG  . GLN A 1 30  ? 22.646  -18.862 58.088 1.00 42.87 ? 280  GLN A CG  1 
ATOM   115  C  CD  . GLN A 1 30  ? 22.480  -19.104 59.596 1.00 48.11 ? 280  GLN A CD  1 
ATOM   116  O  OE1 . GLN A 1 30  ? 22.072  -20.186 60.017 1.00 43.84 ? 280  GLN A OE1 1 
ATOM   117  N  NE2 . GLN A 1 30  ? 22.777  -18.083 60.403 1.00 44.20 ? 280  GLN A NE2 1 
ATOM   118  N  N   . ILE A 1 31  ? 18.932  -17.739 55.877 1.00 17.29 ? 281  ILE A N   1 
ATOM   119  C  CA  . ILE A 1 31  ? 17.500  -17.829 55.562 1.00 20.61 ? 281  ILE A CA  1 
ATOM   120  C  C   . ILE A 1 31  ? 17.262  -18.208 54.118 1.00 19.11 ? 281  ILE A C   1 
ATOM   121  O  O   . ILE A 1 31  ? 16.447  -19.069 53.842 1.00 22.92 ? 281  ILE A O   1 
ATOM   122  C  CB  . ILE A 1 31  ? 16.778  -16.505 55.841 1.00 24.24 ? 281  ILE A CB  1 
ATOM   123  C  CG1 . ILE A 1 31  ? 16.670  -16.268 57.345 1.00 29.65 ? 281  ILE A CG1 1 
ATOM   124  C  CG2 . ILE A 1 31  ? 15.383  -16.488 55.250 1.00 20.22 ? 281  ILE A CG2 1 
ATOM   125  C  CD1 . ILE A 1 31  ? 16.727  -14.785 57.685 1.00 34.54 ? 281  ILE A CD1 1 
ATOM   126  N  N   . ASN A 1 32  ? 17.980  -17.563 53.200 1.00 22.74 ? 282  ASN A N   1 
ATOM   127  C  CA  . ASN A 1 32  ? 17.828  -17.843 51.772 1.00 20.41 ? 282  ASN A CA  1 
ATOM   128  C  C   . ASN A 1 32  ? 18.434  -19.202 51.342 1.00 28.03 ? 282  ASN A C   1 
ATOM   129  O  O   . ASN A 1 32  ? 18.066  -19.747 50.306 1.00 33.32 ? 282  ASN A O   1 
ATOM   130  C  CB  . ASN A 1 32  ? 18.357  -16.683 50.910 1.00 17.88 ? 282  ASN A CB  1 
ATOM   131  C  CG  . ASN A 1 32  ? 17.315  -15.583 50.699 1.00 17.32 ? 282  ASN A CG  1 
ATOM   132  O  OD1 . ASN A 1 32  ? 16.547  -15.632 49.753 1.00 29.48 ? 282  ASN A OD1 1 
ATOM   133  N  ND2 . ASN A 1 32  ? 17.284  -14.589 51.598 1.00 16.90 ? 282  ASN A ND2 1 
ATOM   134  N  N   . ASN A 1 33  ? 19.332  -19.754 52.145 1.00 26.69 ? 283  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 33  ? 19.790  -21.135 51.960 1.00 28.61 ? 283  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 33  ? 18.885  -22.164 52.654 1.00 27.52 ? 283  ASN A C   1 
ATOM   137  O  O   . ASN A 1 33  ? 19.111  -23.374 52.535 1.00 20.84 ? 283  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 33  ? 21.218  -21.298 52.495 1.00 28.87 ? 283  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 33  ? 22.234  -20.489 51.711 1.00 31.74 ? 283  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 33  ? 21.986  -20.097 50.565 1.00 33.93 ? 283  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 33  ? 23.396  -20.245 52.323 1.00 26.05 ? 283  ASN A ND2 1 
ATOM   142  N  N   . ASN A 1 34  ? 17.873  -21.690 53.383 1.00 27.03 ? 284  ASN A N   1 
ATOM   143  C  CA  . ASN A 1 34  ? 16.968  -22.582 54.084 1.00 27.00 ? 284  ASN A CA  1 
ATOM   144  C  C   . ASN A 1 34  ? 15.791  -22.926 53.177 1.00 24.84 ? 284  ASN A C   1 
ATOM   145  O  O   . ASN A 1 34  ? 15.067  -22.054 52.793 1.00 18.84 ? 284  ASN A O   1 
ATOM   146  C  CB  . ASN A 1 34  ? 16.462  -21.944 55.365 1.00 23.39 ? 284  ASN A CB  1 
ATOM   147  C  CG  . ASN A 1 34  ? 15.713  -22.927 56.241 1.00 28.14 ? 284  ASN A CG  1 
ATOM   148  O  OD1 . ASN A 1 34  ? 14.963  -23.809 55.758 1.00 21.92 ? 284  ASN A OD1 1 
ATOM   149  N  ND2 . ASN A 1 34  ? 15.892  -22.778 57.535 1.00 26.46 ? 284  ASN A ND2 1 
ATOM   150  N  N   . PRO A 1 35  ? 15.595  -24.211 52.860 1.00 28.80 ? 285  PRO A N   1 
ATOM   151  C  CA  . PRO A 1 35  ? 14.607  -24.567 51.859 1.00 24.73 ? 285  PRO A CA  1 
ATOM   152  C  C   . PRO A 1 35  ? 13.167  -24.384 52.327 1.00 26.57 ? 285  PRO A C   1 
ATOM   153  O  O   . PRO A 1 35  ? 12.262  -24.461 51.508 1.00 24.62 ? 285  PRO A O   1 
ATOM   154  C  CB  . PRO A 1 35  ? 14.888  -26.039 51.623 1.00 30.65 ? 285  PRO A CB  1 
ATOM   155  C  CG  . PRO A 1 35  ? 15.348  -26.530 52.998 1.00 32.06 ? 285  PRO A CG  1 
ATOM   156  C  CD  . PRO A 1 35  ? 16.251  -25.410 53.427 1.00 28.89 ? 285  PRO A CD  1 
ATOM   157  N  N   . CYS A 1 36  ? 12.949  -24.137 53.617 1.00 24.21 ? 286  CYS A N   1 
ATOM   158  C  CA  . CYS A 1 36  ? 11.610  -23.857 54.091 1.00 25.56 ? 286  CYS A CA  1 
ATOM   159  C  C   . CYS A 1 36  ? 11.149  -22.417 53.738 1.00 28.12 ? 286  CYS A C   1 
ATOM   160  O  O   . CYS A 1 36  ? 9.991   -22.065 53.966 1.00 27.83 ? 286  CYS A O   1 
ATOM   161  C  CB  . CYS A 1 36  ? 11.539  -24.078 55.602 1.00 28.76 ? 286  CYS A CB  1 
ATOM   162  S  SG  . CYS A 1 36  ? 12.172  -22.683 56.657 1.00 33.95 ? 286  CYS A SG  1 
ATOM   163  N  N   . TYR A 1 37  ? 12.049  -21.590 53.196 1.00 26.31 ? 287  TYR A N   1 
ATOM   164  C  CA  . TYR A 1 37  ? 11.750  -20.181 52.891 1.00 24.29 ? 287  TYR A CA  1 
ATOM   165  C  C   . TYR A 1 37  ? 11.330  -19.982 51.440 1.00 27.29 ? 287  TYR A C   1 
ATOM   166  O  O   . TYR A 1 37  ? 12.078  -20.358 50.536 1.00 20.40 ? 287  TYR A O   1 
ATOM   167  C  CB  . TYR A 1 37  ? 12.976  -19.327 53.156 1.00 17.82 ? 287  TYR A CB  1 
ATOM   168  C  CG  . TYR A 1 37  ? 12.857  -17.896 52.709 1.00 18.86 ? 287  TYR A CG  1 
ATOM   169  C  CD1 . TYR A 1 37  ? 11.916  -17.044 53.273 1.00 26.58 ? 287  TYR A CD1 1 
ATOM   170  C  CD2 . TYR A 1 37  ? 13.702  -17.381 51.739 1.00 23.81 ? 287  TYR A CD2 1 
ATOM   171  C  CE1 . TYR A 1 37  ? 11.838  -15.698 52.888 1.00 20.98 ? 287  TYR A CE1 1 
ATOM   172  C  CE2 . TYR A 1 37  ? 13.621  -16.059 51.331 1.00 17.92 ? 287  TYR A CE2 1 
ATOM   173  C  CZ  . TYR A 1 37  ? 12.697  -15.221 51.914 1.00 22.35 ? 287  TYR A CZ  1 
ATOM   174  O  OH  . TYR A 1 37  ? 12.627  -13.910 51.514 1.00 13.27 ? 287  TYR A OH  1 
ATOM   175  N  N   . TRP A 1 38  ? 10.159  -19.368 51.237 1.00 22.66 ? 288  TRP A N   1 
ATOM   176  C  CA  . TRP A 1 38  ? 9.541   -19.222 49.899 1.00 22.87 ? 288  TRP A CA  1 
ATOM   177  C  C   . TRP A 1 38  ? 9.549   -17.815 49.296 1.00 16.84 ? 288  TRP A C   1 
ATOM   178  O  O   . TRP A 1 38  ? 9.089   -17.618 48.193 1.00 17.37 ? 288  TRP A O   1 
ATOM   179  C  CB  . TRP A 1 38  ? 8.104   -19.715 49.931 1.00 16.94 ? 288  TRP A CB  1 
ATOM   180  C  CG  . TRP A 1 38  ? 7.994   -21.183 50.087 1.00 23.12 ? 288  TRP A CG  1 
ATOM   181  C  CD1 . TRP A 1 38  ? 8.273   -21.893 51.193 1.00 18.82 ? 288  TRP A CD1 1 
ATOM   182  C  CD2 . TRP A 1 38  ? 7.562   -22.127 49.098 1.00 11.47 ? 288  TRP A CD2 1 
ATOM   183  N  NE1 . TRP A 1 38  ? 8.042   -23.223 50.973 1.00 26.62 ? 288  TRP A NE1 1 
ATOM   184  C  CE2 . TRP A 1 38  ? 7.589   -23.388 49.694 1.00 15.34 ? 288  TRP A CE2 1 
ATOM   185  C  CE3 . TRP A 1 38  ? 7.133   -22.015 47.777 1.00 18.53 ? 288  TRP A CE3 1 
ATOM   186  C  CZ2 . TRP A 1 38  ? 7.227   -24.535 49.016 1.00 21.85 ? 288  TRP A CZ2 1 
ATOM   187  C  CZ3 . TRP A 1 38  ? 6.785   -23.149 47.097 1.00 15.54 ? 288  TRP A CZ3 1 
ATOM   188  C  CH2 . TRP A 1 38  ? 6.814   -24.393 47.716 1.00 18.21 ? 288  TRP A CH2 1 
ATOM   189  N  N   . GLY A 1 39  ? 10.102  -16.841 49.999 1.00 23.22 ? 289  GLY A N   1 
ATOM   190  C  CA  . GLY A 1 39  ? 10.190  -15.501 49.452 1.00 19.55 ? 289  GLY A CA  1 
ATOM   191  C  C   . GLY A 1 39  ? 8.842   -14.802 49.400 1.00 22.68 ? 289  GLY A C   1 
ATOM   192  O  O   . GLY A 1 39  ? 8.008   -15.003 50.277 1.00 24.46 ? 289  GLY A O   1 
ATOM   193  N  N   . VAL A 1 40  ? 8.652   -13.957 48.380 1.00 25.46 ? 290  VAL A N   1 
ATOM   194  C  CA  . VAL A 1 40  ? 7.484   -13.104 48.288 1.00 20.89 ? 290  VAL A CA  1 
ATOM   195  C  C   . VAL A 1 40  ? 6.303   -14.010 48.022 1.00 24.53 ? 290  VAL A C   1 
ATOM   196  O  O   . VAL A 1 40  ? 6.254   -14.690 47.001 1.00 24.72 ? 290  VAL A O   1 
ATOM   197  C  CB  . VAL A 1 40  ? 7.602   -12.042 47.137 1.00 26.69 ? 290  VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 40  ? 6.306   -11.232 46.980 1.00 15.81 ? 290  VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 40  ? 8.751   -11.077 47.407 1.00 11.44 ? 290  VAL A CG2 1 
ATOM   200  N  N   . MET A 1 41  ? 5.374   -14.026 48.966 1.00 21.57 ? 291  MET A N   1 
ATOM   201  C  CA  . MET A 1 41  ? 4.179   -14.856 48.892 1.00 26.23 ? 291  MET A CA  1 
ATOM   202  C  C   . MET A 1 41  ? 3.166   -14.301 49.899 1.00 23.97 ? 291  MET A C   1 
ATOM   203  O  O   . MET A 1 41  ? 3.548   -13.958 51.024 1.00 19.95 ? 291  MET A O   1 
ATOM   204  C  CB  . MET A 1 41  ? 4.539   -16.296 49.237 1.00 24.97 ? 291  MET A CB  1 
ATOM   205  C  CG  . MET A 1 41  ? 3.351   -17.239 49.367 1.00 27.03 ? 291  MET A CG  1 
ATOM   206  S  SD  . MET A 1 41  ? 3.866   -18.788 50.137 1.00 28.85 ? 291  MET A SD  1 
ATOM   207  C  CE  . MET A 1 41  ? 4.725   -19.476 48.709 1.00 27.04 ? 291  MET A CE  1 
ATOM   208  N  N   . ASP A 1 42  ? 1.898   -14.201 49.508 1.00 17.15 ? 292  ASP A N   1 
ATOM   209  C  CA  . ASP A 1 42  ? 0.867   -13.739 50.455 1.00 28.85 ? 292  ASP A CA  1 
ATOM   210  C  C   . ASP A 1 42  ? 0.246   -14.902 51.252 1.00 24.54 ? 292  ASP A C   1 
ATOM   211  O  O   . ASP A 1 42  ? 0.543   -16.089 51.015 1.00 23.20 ? 292  ASP A O   1 
ATOM   212  C  CB  . ASP A 1 42  ? -0.198  -12.830 49.782 1.00 24.61 ? 292  ASP A CB  1 
ATOM   213  C  CG  . ASP A 1 42  ? -1.038  -13.549 48.722 1.00 28.88 ? 292  ASP A CG  1 
ATOM   214  O  OD1 . ASP A 1 42  ? -1.270  -14.771 48.802 1.00 36.42 ? 292  ASP A OD1 1 
ATOM   215  O  OD2 . ASP A 1 42  ? -1.501  -12.867 47.793 1.00 39.64 ? 292  ASP A OD2 1 
ATOM   216  N  N   . LYS A 1 43  ? -0.604  -14.563 52.215 1.00 27.69 ? 293  LYS A N   1 
ATOM   217  C  CA  . LYS A 1 43  ? -1.142  -15.585 53.125 1.00 26.81 ? 293  LYS A CA  1 
ATOM   218  C  C   . LYS A 1 43  ? -2.101  -16.539 52.424 1.00 23.84 ? 293  LYS A C   1 
ATOM   219  O  O   . LYS A 1 43  ? -2.266  -17.664 52.851 1.00 25.27 ? 293  LYS A O   1 
ATOM   220  C  CB  . LYS A 1 43  ? -1.815  -14.944 54.337 1.00 17.68 ? 293  LYS A CB  1 
ATOM   221  C  CG  . LYS A 1 43  ? -3.157  -14.305 54.071 1.00 25.25 ? 293  LYS A CG  1 
ATOM   222  C  CD  . LYS A 1 43  ? -3.565  -13.458 55.284 1.00 35.95 ? 293  LYS A CD  1 
ATOM   223  C  CE  . LYS A 1 43  ? -5.007  -13.677 55.682 1.00 39.44 ? 293  LYS A CE  1 
ATOM   224  N  NZ  . LYS A 1 43  ? -5.327  -15.082 56.085 1.00 22.60 ? 293  LYS A NZ  1 
ATOM   225  N  N   . TYR A 1 44  ? -2.713  -16.079 51.343 1.00 24.69 ? 294  TYR A N   1 
ATOM   226  C  CA  . TYR A 1 44  ? -3.634  -16.908 50.560 1.00 27.06 ? 294  TYR A CA  1 
ATOM   227  C  C   . TYR A 1 44  ? -2.904  -18.001 49.812 1.00 25.29 ? 294  TYR A C   1 
ATOM   228  O  O   . TYR A 1 44  ? -3.399  -19.117 49.714 1.00 31.49 ? 294  TYR A O   1 
ATOM   229  C  CB  . TYR A 1 44  ? -4.415  -16.047 49.576 1.00 21.75 ? 294  TYR A CB  1 
ATOM   230  C  CG  . TYR A 1 44  ? -5.073  -14.868 50.232 1.00 15.03 ? 294  TYR A CG  1 
ATOM   231  C  CD1 . TYR A 1 44  ? -4.615  -13.566 50.015 1.00 23.14 ? 294  TYR A CD1 1 
ATOM   232  C  CD2 . TYR A 1 44  ? -6.151  -15.047 51.089 1.00 26.12 ? 294  TYR A CD2 1 
ATOM   233  C  CE1 . TYR A 1 44  ? -5.227  -12.471 50.639 1.00 12.71 ? 294  TYR A CE1 1 
ATOM   234  C  CE2 . TYR A 1 44  ? -6.768  -13.976 51.697 1.00 20.51 ? 294  TYR A CE2 1 
ATOM   235  C  CZ  . TYR A 1 44  ? -6.307  -12.698 51.469 1.00 19.04 ? 294  TYR A CZ  1 
ATOM   236  O  OH  . TYR A 1 44  ? -6.951  -11.662 52.068 1.00 29.42 ? 294  TYR A OH  1 
ATOM   237  N  N   . ALA A 1 45  ? -1.727  -17.663 49.286 1.00 28.07 ? 295  ALA A N   1 
ATOM   238  C  CA  . ALA A 1 45  ? -0.862  -18.619 48.578 1.00 24.08 ? 295  ALA A CA  1 
ATOM   239  C  C   . ALA A 1 45  ? -0.228  -19.637 49.549 1.00 21.32 ? 295  ALA A C   1 
ATOM   240  O  O   . ALA A 1 45  ? -0.074  -20.817 49.218 1.00 22.73 ? 295  ALA A O   1 
ATOM   241  C  CB  . ALA A 1 45  ? 0.214   -17.866 47.781 1.00 13.72 ? 295  ALA A CB  1 
ATOM   242  N  N   . ALA A 1 46  ? 0.125   -19.179 50.747 1.00 21.54 ? 296  ALA A N   1 
ATOM   243  C  CA  . ALA A 1 46  ? 0.579   -20.084 51.810 1.00 18.86 ? 296  ALA A CA  1 
ATOM   244  C  C   . ALA A 1 46  ? -0.508  -21.081 52.200 1.00 25.33 ? 296  ALA A C   1 
ATOM   245  O  O   . ALA A 1 46  ? -0.247  -22.275 52.415 1.00 24.95 ? 296  ALA A O   1 
ATOM   246  C  CB  . ALA A 1 46  ? 0.978   -19.301 53.009 1.00 17.14 ? 296  ALA A CB  1 
ATOM   247  N  N   . GLU A 1 47  ? -1.727  -20.570 52.293 1.00 25.81 ? 297  GLU A N   1 
ATOM   248  C  CA  . GLU A 1 47  ? -2.882  -21.373 52.656 1.00 28.16 ? 297  GLU A CA  1 
ATOM   249  C  C   . GLU A 1 47  ? -3.175  -22.429 51.597 1.00 26.98 ? 297  GLU A C   1 
ATOM   250  O  O   . GLU A 1 47  ? -3.593  -23.532 51.932 1.00 26.76 ? 297  GLU A O   1 
ATOM   251  C  CB  . GLU A 1 47  ? -4.103  -20.470 52.911 1.00 21.76 ? 297  GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 47  ? -3.940  -19.693 54.211 1.00 14.61 ? 297  GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 47  ? -4.874  -18.504 54.371 1.00 26.72 ? 297  GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 47  ? -5.830  -18.344 53.568 1.00 17.16 ? 297  GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 47  ? -4.637  -17.743 55.340 1.00 27.26 ? 297  GLU A OE2 1 
ATOM   256  N  N   . ALA A 1 48  ? -2.945  -22.088 50.336 1.00 21.85 ? 298  ALA A N   1 
ATOM   257  C  CA  . ALA A 1 48  ? -3.115  -23.033 49.243 1.00 25.07 ? 298  ALA A CA  1 
ATOM   258  C  C   . ALA A 1 48  ? -2.058  -24.146 49.373 1.00 27.78 ? 298  ALA A C   1 
ATOM   259  O  O   . ALA A 1 48  ? -2.382  -25.328 49.297 1.00 30.95 ? 298  ALA A O   1 
ATOM   260  C  CB  . ALA A 1 48  ? -3.017  -22.309 47.867 1.00 14.34 ? 298  ALA A CB  1 
ATOM   261  N  N   . LEU A 1 49  ? -0.799  -23.774 49.603 1.00 27.43 ? 299  LEU A N   1 
ATOM   262  C  CA  . LEU A 1 49  ? 0.260   -24.778 49.773 1.00 22.24 ? 299  LEU A CA  1 
ATOM   263  C  C   . LEU A 1 49  ? 0.016   -25.690 50.960 1.00 16.99 ? 299  LEU A C   1 
ATOM   264  O  O   . LEU A 1 49  ? 0.243   -26.890 50.872 1.00 28.70 ? 299  LEU A O   1 
ATOM   265  C  CB  . LEU A 1 49  ? 1.631   -24.116 49.898 1.00 22.47 ? 299  LEU A CB  1 
ATOM   266  C  CG  . LEU A 1 49  ? 2.131   -23.450 48.600 1.00 29.74 ? 299  LEU A CG  1 
ATOM   267  C  CD1 . LEU A 1 49  ? 3.368   -22.588 48.858 1.00 27.40 ? 299  LEU A CD1 1 
ATOM   268  C  CD2 . LEU A 1 49  ? 2.414   -24.473 47.508 1.00 19.38 ? 299  LEU A CD2 1 
ATOM   269  N  N   . LEU A 1 50  ? -0.467  -25.117 52.056 1.00 18.99 ? 300  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 50  ? -0.665  -25.832 53.316 1.00 20.98 ? 300  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 50  ? -1.990  -26.555 53.477 1.00 23.20 ? 300  LEU A C   1 
ATOM   272  O  O   . LEU A 1 50  ? -2.174  -27.337 54.420 1.00 28.21 ? 300  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 50  ? -0.534  -24.844 54.465 1.00 26.35 ? 300  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 50  ? 0.881   -24.373 54.758 1.00 24.72 ? 300  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 50  ? 0.829   -23.268 55.802 1.00 26.02 ? 300  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 50  ? 1.688   -25.582 55.245 1.00 30.31 ? 300  LEU A CD2 1 
ATOM   277  N  N   . GLU A 1 51  ? -2.917  -26.292 52.571 1.00 30.74 ? 301  GLU A N   1 
ATOM   278  C  CA  . GLU A 1 51  ? -4.252  -26.916 52.566 1.00 30.86 ? 301  GLU A CA  1 
ATOM   279  C  C   . GLU A 1 51  ? -4.214  -28.429 52.896 1.00 25.59 ? 301  GLU A C   1 
ATOM   280  O  O   . GLU A 1 51  ? -3.463  -29.196 52.302 1.00 20.84 ? 301  GLU A O   1 
ATOM   281  C  CB  . GLU A 1 51  ? -4.885  -26.616 51.198 1.00 34.82 ? 301  GLU A CB  1 
ATOM   282  C  CG  . GLU A 1 51  ? -6.180  -27.306 50.796 1.00 49.24 ? 301  GLU A CG  1 
ATOM   283  C  CD  . GLU A 1 51  ? -6.426  -27.184 49.267 1.00 65.78 ? 301  GLU A CD  1 
ATOM   284  O  OE1 . GLU A 1 51  ? -5.898  -26.229 48.619 1.00 61.78 ? 301  GLU A OE1 1 
ATOM   285  O  OE2 . GLU A 1 51  ? -7.136  -28.059 48.720 1.00 62.44 ? 301  GLU A OE2 1 
ATOM   286  N  N   . GLY A 1 52  ? -4.995  -28.825 53.895 1.00 26.39 ? 302  GLY A N   1 
ATOM   287  C  CA  . GLY A 1 52  ? -5.142  -30.226 54.268 1.00 22.30 ? 302  GLY A CA  1 
ATOM   288  C  C   . GLY A 1 52  ? -3.983  -30.840 55.035 1.00 28.02 ? 302  GLY A C   1 
ATOM   289  O  O   . GLY A 1 52  ? -4.048  -31.988 55.442 1.00 26.44 ? 302  GLY A O   1 
ATOM   290  N  N   . LYS A 1 53  ? -2.908  -30.098 55.261 1.00 35.10 ? 303  LYS A N   1 
ATOM   291  C  CA  . LYS A 1 53  ? -1.672  -30.761 55.662 1.00 30.23 ? 303  LYS A CA  1 
ATOM   292  C  C   . LYS A 1 53  ? -1.569  -30.989 57.168 1.00 27.26 ? 303  LYS A C   1 
ATOM   293  O  O   . LYS A 1 53  ? -2.268  -30.358 57.957 1.00 20.57 ? 303  LYS A O   1 
ATOM   294  C  CB  . LYS A 1 53  ? -0.467  -30.042 55.053 1.00 27.17 ? 303  LYS A CB  1 
ATOM   295  C  CG  . LYS A 1 53  ? -0.545  -30.114 53.518 1.00 27.99 ? 303  LYS A CG  1 
ATOM   296  C  CD  . LYS A 1 53  ? 0.806   -30.223 52.849 1.00 30.33 ? 303  LYS A CD  1 
ATOM   297  C  CE  . LYS A 1 53  ? 0.703   -30.457 51.339 1.00 23.37 ? 303  LYS A CE  1 
ATOM   298  N  NZ  . LYS A 1 53  ? -0.357  -29.650 50.649 1.00 46.00 ? 303  LYS A NZ  1 
ATOM   299  N  N   . PRO A 1 54  ? -0.762  -31.967 57.563 1.00 20.86 ? 304  PRO A N   1 
ATOM   300  C  CA  . PRO A 1 54  ? -0.686  -32.380 58.949 1.00 23.74 ? 304  PRO A CA  1 
ATOM   301  C  C   . PRO A 1 54  ? -0.081  -31.368 59.896 1.00 28.46 ? 304  PRO A C   1 
ATOM   302  O  O   . PRO A 1 54  ? 0.762   -30.582 59.502 1.00 28.07 ? 304  PRO A O   1 
ATOM   303  C  CB  . PRO A 1 54  ? 0.211   -33.614 58.895 1.00 23.62 ? 304  PRO A CB  1 
ATOM   304  C  CG  . PRO A 1 54  ? 0.144   -34.044 57.507 1.00 23.09 ? 304  PRO A CG  1 
ATOM   305  C  CD  . PRO A 1 54  ? 0.060   -32.815 56.708 1.00 16.16 ? 304  PRO A CD  1 
ATOM   306  N  N   . GLU A 1 55  ? -0.545  -31.429 61.145 1.00 35.56 ? 305  GLU A N   1 
ATOM   307  C  CA  . GLU A 1 55  ? -0.125  -30.577 62.248 1.00 32.23 ? 305  GLU A CA  1 
ATOM   308  C  C   . GLU A 1 55  ? 1.365   -30.314 62.163 1.00 23.86 ? 305  GLU A C   1 
ATOM   309  O  O   . GLU A 1 55  ? 2.146   -31.234 62.093 1.00 23.93 ? 305  GLU A O   1 
ATOM   310  C  CB  . GLU A 1 55  ? -0.492  -31.280 63.575 1.00 35.47 ? 305  GLU A CB  1 
ATOM   311  C  CG  . GLU A 1 55  ? -0.165  -30.501 64.854 1.00 52.01 ? 305  GLU A CG  1 
ATOM   312  C  CD  . GLU A 1 55  ? -1.328  -30.409 65.890 1.00 64.29 ? 305  GLU A CD  1 
ATOM   313  O  OE1 . GLU A 1 55  ? -1.015  -30.300 67.103 1.00 67.13 ? 305  GLU A OE1 1 
ATOM   314  O  OE2 . GLU A 1 55  ? -2.532  -30.395 65.511 1.00 59.55 ? 305  GLU A OE2 1 
ATOM   315  N  N   . GLY A 1 56  ? 1.753   -29.051 62.109 1.00 26.07 ? 306  GLY A N   1 
ATOM   316  C  CA  . GLY A 1 56  ? 3.168   -28.673 62.215 1.00 25.06 ? 306  GLY A CA  1 
ATOM   317  C  C   . GLY A 1 56  ? 3.898   -28.458 60.901 1.00 23.48 ? 306  GLY A C   1 
ATOM   318  O  O   . GLY A 1 56  ? 5.072   -28.074 60.897 1.00 19.36 ? 306  GLY A O   1 
ATOM   319  N  N   . THR A 1 57  ? 3.220   -28.741 59.788 1.00 17.94 ? 307  THR A N   1 
ATOM   320  C  CA  . THR A 1 57  ? 3.747   -28.457 58.469 1.00 18.18 ? 307  THR A CA  1 
ATOM   321  C  C   . THR A 1 57  ? 3.819   -26.929 58.340 1.00 20.88 ? 307  THR A C   1 
ATOM   322  O  O   . THR A 1 57  ? 2.844   -26.256 58.625 1.00 27.48 ? 307  THR A O   1 
ATOM   323  C  CB  . THR A 1 57  ? 2.816   -29.027 57.397 1.00 16.99 ? 307  THR A CB  1 
ATOM   324  O  OG1 . THR A 1 57  ? 2.705   -30.448 57.558 1.00 21.45 ? 307  THR A OG1 1 
ATOM   325  C  CG2 . THR A 1 57  ? 3.319   -28.700 55.988 1.00 14.11 ? 307  THR A CG2 1 
ATOM   326  N  N   . PHE A 1 58  ? 4.957   -26.382 57.929 1.00 21.08 ? 308  PHE A N   1 
ATOM   327  C  CA  . PHE A 1 58  ? 5.148   -24.933 57.939 1.00 20.76 ? 308  PHE A CA  1 
ATOM   328  C  C   . PHE A 1 58  ? 6.009   -24.398 56.793 1.00 23.22 ? 308  PHE A C   1 
ATOM   329  O  O   . PHE A 1 58  ? 6.680   -25.168 56.104 1.00 27.70 ? 308  PHE A O   1 
ATOM   330  C  CB  . PHE A 1 58  ? 5.763   -24.527 59.262 1.00 22.57 ? 308  PHE A CB  1 
ATOM   331  C  CG  . PHE A 1 58  ? 7.265   -24.585 59.286 1.00 23.16 ? 308  PHE A CG  1 
ATOM   332  C  CD1 . PHE A 1 58  ? 7.919   -25.733 59.682 1.00 23.50 ? 308  PHE A CD1 1 
ATOM   333  C  CD2 . PHE A 1 58  ? 8.020   -23.477 58.935 1.00 21.77 ? 308  PHE A CD2 1 
ATOM   334  C  CE1 . PHE A 1 58  ? 9.299   -25.788 59.701 1.00 24.52 ? 308  PHE A CE1 1 
ATOM   335  C  CE2 . PHE A 1 58  ? 9.379   -23.514 58.978 1.00 18.66 ? 308  PHE A CE2 1 
ATOM   336  C  CZ  . PHE A 1 58  ? 10.031  -24.681 59.347 1.00 27.03 ? 308  PHE A CZ  1 
ATOM   337  N  N   . LEU A 1 59  ? 5.947   -23.080 56.589 1.00 18.65 ? 309  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 59  ? 6.886   -22.337 55.726 1.00 23.16 ? 309  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 59  ? 7.212   -20.923 56.271 1.00 23.23 ? 309  LEU A C   1 
ATOM   340  O  O   . LEU A 1 59  ? 6.465   -20.351 57.059 1.00 20.71 ? 309  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 59  ? 6.397   -22.251 54.268 1.00 25.72 ? 309  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 59  ? 4.982   -21.718 53.941 1.00 27.49 ? 309  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 59  ? 4.907   -20.233 54.017 1.00 14.32 ? 309  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 59  ? 4.558   -22.144 52.555 1.00 21.00 ? 309  LEU A CD2 1 
ATOM   345  N  N   . LEU A 1 60  ? 8.366   -20.404 55.871 1.00 23.44 ? 310  LEU A N   1 
ATOM   346  C  CA  . LEU A 1 60  ? 8.752   -19.023 56.102 1.00 23.32 ? 310  LEU A CA  1 
ATOM   347  C  C   . LEU A 1 60  ? 8.549   -18.288 54.786 1.00 22.81 ? 310  LEU A C   1 
ATOM   348  O  O   . LEU A 1 60  ? 8.874   -18.815 53.730 1.00 26.47 ? 310  LEU A O   1 
ATOM   349  C  CB  . LEU A 1 60  ? 10.233  -18.917 56.510 1.00 21.09 ? 310  LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 60  ? 10.712  -17.507 56.892 1.00 20.27 ? 310  LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 60  ? 9.944   -16.983 58.103 1.00 24.27 ? 310  LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 60  ? 12.196  -17.503 57.193 1.00 23.53 ? 310  LEU A CD2 1 
ATOM   353  N  N   . ARG A 1 61  ? 8.027   -17.074 54.856 1.00 20.69 ? 311  ARG A N   1 
ATOM   354  C  CA  . ARG A 1 61  ? 7.856   -16.263 53.682 1.00 21.39 ? 311  ARG A CA  1 
ATOM   355  C  C   . ARG A 1 61  ? 7.980   -14.806 54.021 1.00 18.08 ? 311  ARG A C   1 
ATOM   356  O  O   . ARG A 1 61  ? 8.032   -14.431 55.179 1.00 30.01 ? 311  ARG A O   1 
ATOM   357  C  CB  . ARG A 1 61  ? 6.485   -16.535 53.110 1.00 27.24 ? 311  ARG A CB  1 
ATOM   358  C  CG  . ARG A 1 61  ? 5.362   -16.157 54.042 1.00 26.89 ? 311  ARG A CG  1 
ATOM   359  C  CD  . ARG A 1 61  ? 4.008   -16.596 53.482 1.00 18.36 ? 311  ARG A CD  1 
ATOM   360  N  NE  . ARG A 1 61  ? 2.979   -16.402 54.495 1.00 21.46 ? 311  ARG A NE  1 
ATOM   361  C  CZ  . ARG A 1 61  ? 2.430   -15.230 54.786 1.00 28.77 ? 311  ARG A CZ  1 
ATOM   362  N  NH1 . ARG A 1 61  ? 2.813   -14.140 54.142 1.00 32.05 ? 311  ARG A NH1 1 
ATOM   363  N  NH2 . ARG A 1 61  ? 1.505   -15.151 55.735 1.00 27.96 ? 311  ARG A NH2 1 
ATOM   364  N  N   . ASP A 1 62  ? 8.013   -13.961 53.018 1.00 21.68 ? 312  ASP A N   1 
ATOM   365  C  CA  . ASP A 1 62  ? 7.928   -12.534 53.289 1.00 27.68 ? 312  ASP A CA  1 
ATOM   366  C  C   . ASP A 1 62  ? 6.486   -12.151 53.695 1.00 24.27 ? 312  ASP A C   1 
ATOM   367  O  O   . ASP A 1 62  ? 5.533   -12.569 53.070 1.00 22.24 ? 312  ASP A O   1 
ATOM   368  C  CB  . ASP A 1 62  ? 8.325   -11.727 52.046 1.00 28.49 ? 312  ASP A CB  1 
ATOM   369  C  CG  . ASP A 1 62  ? 9.808   -11.834 51.702 1.00 35.97 ? 312  ASP A CG  1 
ATOM   370  O  OD1 . ASP A 1 62  ? 10.475  -12.757 52.218 1.00 30.30 ? 312  ASP A OD1 1 
ATOM   371  O  OD2 . ASP A 1 62  ? 10.301  -10.975 50.908 1.00 34.83 ? 312  ASP A OD2 1 
ATOM   372  N  N   . SER A 1 63  ? 6.330   -11.336 54.726 1.00 26.91 ? 313  SER A N   1 
ATOM   373  C  CA  . SER A 1 63  ? 5.025   -10.779 55.067 1.00 20.06 ? 313  SER A CA  1 
ATOM   374  C  C   . SER A 1 63  ? 4.682   -9.658  54.111 1.00 22.22 ? 313  SER A C   1 
ATOM   375  O  O   . SER A 1 63  ? 5.535   -8.836  53.764 1.00 28.17 ? 313  SER A O   1 
ATOM   376  C  CB  . SER A 1 63  ? 5.027   -10.254 56.501 1.00 19.40 ? 313  SER A CB  1 
ATOM   377  O  OG  . SER A 1 63  ? 3.772   -9.686  56.858 1.00 29.45 ? 313  SER A OG  1 
ATOM   378  N  N   . ALA A 1 64  ? 3.432   -9.641  53.675 1.00 23.94 ? 314  ALA A N   1 
ATOM   379  C  CA  . ALA A 1 64  ? 2.916   -8.595  52.798 1.00 23.72 ? 314  ALA A CA  1 
ATOM   380  C  C   . ALA A 1 64  ? 2.615   -7.307  53.579 1.00 25.04 ? 314  ALA A C   1 
ATOM   381  O  O   . ALA A 1 64  ? 2.385   -6.275  52.968 1.00 30.31 ? 314  ALA A O   1 
ATOM   382  C  CB  . ALA A 1 64  ? 1.636   -9.081  52.059 1.00 13.22 ? 314  ALA A CB  1 
ATOM   383  N  N   . GLN A 1 65  ? 2.587   -7.374  54.912 1.00 26.18 ? 315  GLN A N   1 
ATOM   384  C  CA  . GLN A 1 65  ? 2.487   -6.173  55.757 1.00 30.96 ? 315  GLN A CA  1 
ATOM   385  C  C   . GLN A 1 65  ? 3.795   -5.362  55.624 1.00 35.97 ? 315  GLN A C   1 
ATOM   386  O  O   . GLN A 1 65  ? 4.903   -5.937  55.545 1.00 37.50 ? 315  GLN A O   1 
ATOM   387  C  CB  . GLN A 1 65  ? 2.235   -6.527  57.245 1.00 31.82 ? 315  GLN A CB  1 
ATOM   388  C  CG  . GLN A 1 65  ? 1.079   -7.538  57.530 1.00 40.17 ? 315  GLN A CG  1 
ATOM   389  C  CD  . GLN A 1 65  ? 0.804   -7.752  59.045 1.00 52.60 ? 315  GLN A CD  1 
ATOM   390  O  OE1 . GLN A 1 65  ? 0.658   -6.782  59.791 1.00 67.77 ? 315  GLN A OE1 1 
ATOM   391  N  NE2 . GLN A 1 65  ? 0.714   -9.021  59.487 1.00 44.30 ? 315  GLN A NE2 1 
ATOM   392  N  N   . GLU A 1 66  ? 3.651   -4.032  55.609 1.00 38.56 ? 316  GLU A N   1 
ATOM   393  C  CA  . GLU A 1 66  ? 4.744   -3.089  55.347 1.00 35.43 ? 316  GLU A CA  1 
ATOM   394  C  C   . GLU A 1 66  ? 5.775   -3.059  56.466 1.00 34.02 ? 316  GLU A C   1 
ATOM   395  O  O   . GLU A 1 66  ? 6.967   -2.918  56.201 1.00 28.77 ? 316  GLU A O   1 
ATOM   396  C  CB  . GLU A 1 66  ? 4.180   -1.674  55.106 1.00 37.55 ? 316  GLU A CB  1 
ATOM   397  N  N   . ASP A 1 67  ? 5.328   -3.227  57.708 1.00 30.79 ? 317  ASP A N   1 
ATOM   398  C  CA  . ASP A 1 67  ? 6.239   -3.134  58.852 1.00 33.99 ? 317  ASP A CA  1 
ATOM   399  C  C   . ASP A 1 67  ? 6.899   -4.436  59.282 1.00 30.92 ? 317  ASP A C   1 
ATOM   400  O  O   . ASP A 1 67  ? 7.607   -4.471  60.307 1.00 22.02 ? 317  ASP A O   1 
ATOM   401  C  CB  . ASP A 1 67  ? 5.495   -2.541  60.052 1.00 40.60 ? 317  ASP A CB  1 
ATOM   402  C  CG  . ASP A 1 67  ? 5.046   -1.102  59.808 1.00 47.06 ? 317  ASP A CG  1 
ATOM   403  O  OD1 . ASP A 1 67  ? 4.056   -0.688  60.440 1.00 49.69 ? 317  ASP A OD1 1 
ATOM   404  O  OD2 . ASP A 1 67  ? 5.671   -0.388  58.987 1.00 54.44 ? 317  ASP A OD2 1 
ATOM   405  N  N   . TYR A 1 68  ? 6.672   -5.513  58.542 1.00 25.17 ? 318  TYR A N   1 
ATOM   406  C  CA  . TYR A 1 68  ? 7.296   -6.780  58.910 1.00 23.98 ? 318  TYR A CA  1 
ATOM   407  C  C   . TYR A 1 68  ? 7.899   -7.399  57.687 1.00 22.80 ? 318  TYR A C   1 
ATOM   408  O  O   . TYR A 1 68  ? 7.349   -7.319  56.604 1.00 23.26 ? 318  TYR A O   1 
ATOM   409  C  CB  . TYR A 1 68  ? 6.306   -7.715  59.602 1.00 27.06 ? 318  TYR A CB  1 
ATOM   410  C  CG  . TYR A 1 68  ? 5.627   -7.024  60.763 1.00 28.85 ? 318  TYR A CG  1 
ATOM   411  C  CD1 . TYR A 1 68  ? 4.431   -6.318  60.576 1.00 34.17 ? 318  TYR A CD1 1 
ATOM   412  C  CD2 . TYR A 1 68  ? 6.200   -7.018  62.027 1.00 22.06 ? 318  TYR A CD2 1 
ATOM   413  C  CE1 . TYR A 1 68  ? 3.816   -5.641  61.630 1.00 36.71 ? 318  TYR A CE1 1 
ATOM   414  C  CE2 . TYR A 1 68  ? 5.584   -6.352  63.093 1.00 37.14 ? 318  TYR A CE2 1 
ATOM   415  C  CZ  . TYR A 1 68  ? 4.396   -5.670  62.882 1.00 30.67 ? 318  TYR A CZ  1 
ATOM   416  O  OH  . TYR A 1 68  ? 3.801   -5.003  63.908 1.00 40.68 ? 318  TYR A OH  1 
ATOM   417  N  N   . LEU A 1 69  ? 9.088   -7.945  57.861 1.00 26.29 ? 319  LEU A N   1 
ATOM   418  C  CA  . LEU A 1 69  ? 9.783   -8.592  56.776 1.00 26.16 ? 319  LEU A CA  1 
ATOM   419  C  C   . LEU A 1 69  ? 9.238   -9.991  56.506 1.00 25.58 ? 319  LEU A C   1 
ATOM   420  O  O   . LEU A 1 69  ? 9.043   -10.358 55.340 1.00 25.64 ? 319  LEU A O   1 
ATOM   421  C  CB  . LEU A 1 69  ? 11.283  -8.677  57.080 1.00 24.61 ? 319  LEU A CB  1 
ATOM   422  C  CG  . LEU A 1 69  ? 12.070  -7.386  56.884 1.00 27.27 ? 319  LEU A CG  1 
ATOM   423  C  CD1 . LEU A 1 69  ? 13.532  -7.642  57.103 1.00 24.28 ? 319  LEU A CD1 1 
ATOM   424  C  CD2 . LEU A 1 69  ? 11.843  -6.777  55.502 1.00 20.93 ? 319  LEU A CD2 1 
ATOM   425  N  N   . PHE A 1 70  ? 8.994   -10.759 57.572 1.00 21.85 ? 320  PHE A N   1 
ATOM   426  C  CA  . PHE A 1 70  ? 8.757   -12.183 57.436 1.00 19.60 ? 320  PHE A CA  1 
ATOM   427  C  C   . PHE A 1 70  ? 7.582   -12.665 58.229 1.00 19.65 ? 320  PHE A C   1 
ATOM   428  O  O   . PHE A 1 70  ? 7.274   -12.092 59.265 1.00 25.74 ? 320  PHE A O   1 
ATOM   429  C  CB  . PHE A 1 70  ? 9.957   -12.950 57.953 1.00 20.78 ? 320  PHE A CB  1 
ATOM   430  C  CG  . PHE A 1 70  ? 11.253  -12.616 57.265 1.00 22.55 ? 320  PHE A CG  1 
ATOM   431  C  CD1 . PHE A 1 70  ? 12.337  -12.136 57.995 1.00 23.23 ? 320  PHE A CD1 1 
ATOM   432  C  CD2 . PHE A 1 70  ? 11.418  -12.859 55.917 1.00 16.70 ? 320  PHE A CD2 1 
ATOM   433  C  CE1 . PHE A 1 70  ? 13.523  -11.847 57.376 1.00 15.49 ? 320  PHE A CE1 1 
ATOM   434  C  CE2 . PHE A 1 70  ? 12.619  -12.573 55.287 1.00 23.46 ? 320  PHE A CE2 1 
ATOM   435  C  CZ  . PHE A 1 70  ? 13.659  -12.055 56.007 1.00 19.29 ? 320  PHE A CZ  1 
ATOM   436  N  N   . SER A 1 71  ? 6.939   -13.740 57.751 1.00 24.67 ? 321  SER A N   1 
ATOM   437  C  CA  . SER A 1 71  ? 5.936   -14.476 58.536 1.00 20.77 ? 321  SER A CA  1 
ATOM   438  C  C   . SER A 1 71  ? 6.153   -15.948 58.383 1.00 23.29 ? 321  SER A C   1 
ATOM   439  O  O   . SER A 1 71  ? 6.706   -16.393 57.365 1.00 18.85 ? 321  SER A O   1 
ATOM   440  C  CB  . SER A 1 71  ? 4.515   -14.194 58.050 1.00 23.67 ? 321  SER A CB  1 
ATOM   441  O  OG  . SER A 1 71  ? 4.157   -12.829 58.197 1.00 40.43 ? 321  SER A OG  1 
ATOM   442  N  N   . VAL A 1 72  ? 5.695   -16.713 59.377 1.00 23.58 ? 322  VAL A N   1 
ATOM   443  C  CA  . VAL A 1 72  ? 5.535   -18.153 59.190 1.00 22.32 ? 322  VAL A CA  1 
ATOM   444  C  C   . VAL A 1 72  ? 4.082   -18.505 58.966 1.00 26.17 ? 322  VAL A C   1 
ATOM   445  O  O   . VAL A 1 72  ? 3.182   -17.864 59.497 1.00 29.34 ? 322  VAL A O   1 
ATOM   446  C  CB  . VAL A 1 72  ? 6.045   -19.002 60.367 1.00 21.61 ? 322  VAL A CB  1 
ATOM   447  C  CG1 . VAL A 1 72  ? 7.513   -18.759 60.569 1.00 18.62 ? 322  VAL A CG1 1 
ATOM   448  C  CG2 . VAL A 1 72  ? 5.217   -18.738 61.625 1.00 18.67 ? 322  VAL A CG2 1 
ATOM   449  N  N   . SER A 1 73  ? 3.865   -19.530 58.158 1.00 27.92 ? 323  SER A N   1 
ATOM   450  C  CA  . SER A 1 73  ? 2.545   -20.072 57.966 1.00 26.28 ? 323  SER A CA  1 
ATOM   451  C  C   . SER A 1 73  ? 2.636   -21.515 58.334 1.00 17.78 ? 323  SER A C   1 
ATOM   452  O  O   . SER A 1 73  ? 3.547   -22.210 57.911 1.00 22.12 ? 323  SER A O   1 
ATOM   453  C  CB  . SER A 1 73  ? 2.129   -19.914 56.523 1.00 26.30 ? 323  SER A CB  1 
ATOM   454  O  OG  . SER A 1 73  ? 1.896   -18.556 56.288 1.00 33.85 ? 323  SER A OG  1 
ATOM   455  N  N   . PHE A 1 74  ? 1.716   -21.976 59.151 1.00 21.20 ? 324  PHE A N   1 
ATOM   456  C  CA  . PHE A 1 74  ? 1.834   -23.328 59.673 1.00 19.70 ? 324  PHE A CA  1 
ATOM   457  C  C   . PHE A 1 74  ? 0.467   -23.938 59.976 1.00 18.50 ? 324  PHE A C   1 
ATOM   458  O  O   . PHE A 1 74  ? -0.587  -23.274 59.951 1.00 25.31 ? 324  PHE A O   1 
ATOM   459  C  CB  . PHE A 1 74  ? 2.741   -23.328 60.902 1.00 15.94 ? 324  PHE A CB  1 
ATOM   460  C  CG  . PHE A 1 74  ? 2.156   -22.600 62.050 1.00 13.58 ? 324  PHE A CG  1 
ATOM   461  C  CD1 . PHE A 1 74  ? 2.285   -21.238 62.152 1.00 20.83 ? 324  PHE A CD1 1 
ATOM   462  C  CD2 . PHE A 1 74  ? 1.411   -23.270 62.998 1.00 14.53 ? 324  PHE A CD2 1 
ATOM   463  C  CE1 . PHE A 1 74  ? 1.715   -20.538 63.230 1.00 16.58 ? 324  PHE A CE1 1 
ATOM   464  C  CE2 . PHE A 1 74  ? 0.820   -22.582 64.052 1.00 19.59 ? 324  PHE A CE2 1 
ATOM   465  C  CZ  . PHE A 1 74  ? 0.976   -21.212 64.163 1.00 15.32 ? 324  PHE A CZ  1 
ATOM   466  N  N   . ARG A 1 75  ? 0.504   -25.221 60.253 1.00 18.98 ? 325  ARG A N   1 
ATOM   467  C  CA  . ARG A 1 75  ? -0.681  -26.013 60.431 1.00 18.52 ? 325  ARG A CA  1 
ATOM   468  C  C   . ARG A 1 75  ? -0.816  -26.425 61.884 1.00 17.19 ? 325  ARG A C   1 
ATOM   469  O  O   . ARG A 1 75  ? 0.143   -26.856 62.505 1.00 18.20 ? 325  ARG A O   1 
ATOM   470  C  CB  . ARG A 1 75  ? -0.579  -27.206 59.496 1.00 23.65 ? 325  ARG A CB  1 
ATOM   471  C  CG  . ARG A 1 75  ? -1.351  -26.989 58.204 1.00 22.22 ? 325  ARG A CG  1 
ATOM   472  C  CD  . ARG A 1 75  ? -2.744  -27.464 58.491 1.00 25.32 ? 325  ARG A CD  1 
ATOM   473  N  NE  . ARG A 1 75  ? -3.766  -26.940 57.613 1.00 32.57 ? 325  ARG A NE  1 
ATOM   474  C  CZ  . ARG A 1 75  ? -4.988  -27.441 57.535 1.00 26.51 ? 325  ARG A CZ  1 
ATOM   475  N  NH1 . ARG A 1 75  ? -5.327  -28.481 58.277 1.00 29.00 ? 325  ARG A NH1 1 
ATOM   476  N  NH2 . ARG A 1 75  ? -5.880  -26.893 56.729 1.00 48.76 ? 325  ARG A NH2 1 
ATOM   477  N  N   . ARG A 1 76  ? -2.005  -26.239 62.434 1.00 20.76 ? 326  ARG A N   1 
ATOM   478  C  CA  . ARG A 1 76  ? -2.316  -26.653 63.791 1.00 18.64 ? 326  ARG A CA  1 
ATOM   479  C  C   . ARG A 1 76  ? -3.821  -26.579 64.048 1.00 17.20 ? 326  ARG A C   1 
ATOM   480  O  O   . ARG A 1 76  ? -4.501  -25.683 63.551 1.00 19.99 ? 326  ARG A O   1 
ATOM   481  C  CB  . ARG A 1 76  ? -1.568  -25.787 64.810 1.00 19.61 ? 326  ARG A CB  1 
ATOM   482  C  CG  . ARG A 1 76  ? -1.405  -26.490 66.146 1.00 22.66 ? 326  ARG A CG  1 
ATOM   483  C  CD  . ARG A 1 76  ? -0.429  -25.813 67.066 1.00 28.36 ? 326  ARG A CD  1 
ATOM   484  N  NE  . ARG A 1 76  ? -0.171  -26.626 68.250 1.00 36.48 ? 326  ARG A NE  1 
ATOM   485  C  CZ  . ARG A 1 76  ? 0.624   -26.266 69.249 1.00 34.67 ? 326  ARG A CZ  1 
ATOM   486  N  NH1 . ARG A 1 76  ? 0.794   -27.070 70.287 1.00 39.31 ? 326  ARG A NH1 1 
ATOM   487  N  NH2 . ARG A 1 76  ? 1.249   -25.107 69.213 1.00 35.19 ? 326  ARG A NH2 1 
ATOM   488  N  N   . TYR A 1 77  ? -4.340  -27.534 64.814 1.00 24.55 ? 327  TYR A N   1 
ATOM   489  C  CA  . TYR A 1 77  ? -5.784  -27.643 65.104 1.00 20.85 ? 327  TYR A CA  1 
ATOM   490  C  C   . TYR A 1 77  ? -6.633  -27.738 63.826 1.00 23.22 ? 327  TYR A C   1 
ATOM   491  O  O   . TYR A 1 77  ? -7.783  -27.307 63.809 1.00 30.79 ? 327  TYR A O   1 
ATOM   492  C  CB  . TYR A 1 77  ? -6.248  -26.480 66.001 1.00 23.22 ? 327  TYR A CB  1 
ATOM   493  C  CG  . TYR A 1 77  ? -5.353  -26.257 67.205 1.00 22.94 ? 327  TYR A CG  1 
ATOM   494  C  CD1 . TYR A 1 77  ? -4.611  -25.087 67.349 1.00 35.05 ? 327  TYR A CD1 1 
ATOM   495  C  CD2 . TYR A 1 77  ? -5.218  -27.231 68.181 1.00 31.58 ? 327  TYR A CD2 1 
ATOM   496  C  CE1 . TYR A 1 77  ? -3.772  -24.885 68.456 1.00 29.48 ? 327  TYR A CE1 1 
ATOM   497  C  CE2 . TYR A 1 77  ? -4.381  -27.043 69.280 1.00 38.25 ? 327  TYR A CE2 1 
ATOM   498  C  CZ  . TYR A 1 77  ? -3.660  -25.868 69.408 1.00 33.54 ? 327  TYR A CZ  1 
ATOM   499  O  OH  . TYR A 1 77  ? -2.837  -25.694 70.493 1.00 34.45 ? 327  TYR A OH  1 
ATOM   500  N  N   . SER A 1 78  ? -6.060  -28.316 62.771 1.00 21.58 ? 328  SER A N   1 
ATOM   501  C  CA  . SER A 1 78  ? -6.702  -28.380 61.455 1.00 28.79 ? 328  SER A CA  1 
ATOM   502  C  C   . SER A 1 78  ? -6.995  -27.010 60.827 1.00 28.82 ? 328  SER A C   1 
ATOM   503  O  O   . SER A 1 78  ? -7.976  -26.862 60.105 1.00 28.39 ? 328  SER A O   1 
ATOM   504  C  CB  . SER A 1 78  ? -8.005  -29.183 61.542 1.00 31.26 ? 328  SER A CB  1 
ATOM   505  O  OG  . SER A 1 78  ? -7.819  -30.332 62.340 1.00 41.13 ? 328  SER A OG  1 
ATOM   506  N  N   . ARG A 1 79  ? -6.148  -26.018 61.099 1.00 26.54 ? 329  ARG A N   1 
ATOM   507  C  CA  . ARG A 1 79  ? -6.299  -24.681 60.513 1.00 24.51 ? 329  ARG A CA  1 
ATOM   508  C  C   . ARG A 1 79  ? -4.967  -24.189 59.986 1.00 17.56 ? 329  ARG A C   1 
ATOM   509  O  O   . ARG A 1 79  ? -3.927  -24.563 60.493 1.00 15.45 ? 329  ARG A O   1 
ATOM   510  C  CB  . ARG A 1 79  ? -6.839  -23.693 61.560 1.00 24.58 ? 329  ARG A CB  1 
ATOM   511  C  CG  . ARG A 1 79  ? -8.183  -24.110 62.170 1.00 31.62 ? 329  ARG A CG  1 
ATOM   512  C  CD  . ARG A 1 79  ? -9.359  -23.988 61.163 1.00 43.35 ? 329  ARG A CD  1 
ATOM   513  N  NE  . ARG A 1 79  ? -10.626 -24.480 61.720 1.00 41.10 ? 329  ARG A NE  1 
ATOM   514  C  CZ  . ARG A 1 79  ? -11.322 -25.533 61.284 1.00 42.34 ? 329  ARG A CZ  1 
ATOM   515  N  NH1 . ARG A 1 79  ? -10.939 -26.263 60.239 1.00 53.30 ? 329  ARG A NH1 1 
ATOM   516  N  NH2 . ARG A 1 79  ? -12.442 -25.855 61.903 1.00 47.03 ? 329  ARG A NH2 1 
ATOM   517  N  N   . SER A 1 80  ? -5.001  -23.362 58.952 1.00 24.50 ? 330  SER A N   1 
ATOM   518  C  CA  . SER A 1 80  ? -3.796  -22.746 58.412 1.00 21.69 ? 330  SER A CA  1 
ATOM   519  C  C   . SER A 1 80  ? -3.679  -21.436 59.126 1.00 25.45 ? 330  SER A C   1 
ATOM   520  O  O   . SER A 1 80  ? -4.544  -20.587 58.957 1.00 21.57 ? 330  SER A O   1 
ATOM   521  C  CB  . SER A 1 80  ? -3.925  -22.501 56.919 1.00 19.50 ? 330  SER A CB  1 
ATOM   522  O  OG  . SER A 1 80  ? -4.000  -23.737 56.215 1.00 25.43 ? 330  SER A OG  1 
ATOM   523  N  N   . LEU A 1 81  ? -2.630  -21.302 59.944 1.00 23.81 ? 331  LEU A N   1 
ATOM   524  C  CA  . LEU A 1 81  ? -2.442  -20.162 60.847 1.00 23.03 ? 331  LEU A CA  1 
ATOM   525  C  C   . LEU A 1 81  ? -1.171  -19.380 60.457 1.00 24.34 ? 331  LEU A C   1 
ATOM   526  O  O   . LEU A 1 81  ? -0.284  -19.924 59.822 1.00 23.15 ? 331  LEU A O   1 
ATOM   527  C  CB  . LEU A 1 81  ? -2.286  -20.667 62.291 1.00 16.62 ? 331  LEU A CB  1 
ATOM   528  C  CG  . LEU A 1 81  ? -3.410  -21.519 62.855 1.00 11.98 ? 331  LEU A CG  1 
ATOM   529  C  CD1 . LEU A 1 81  ? -2.907  -22.385 64.004 1.00 10.16 ? 331  LEU A CD1 1 
ATOM   530  C  CD2 . LEU A 1 81  ? -4.531  -20.603 63.306 1.00 15.09 ? 331  LEU A CD2 1 
ATOM   531  N  N   . HIS A 1 82  ? -1.064  -18.118 60.865 1.00 21.14 ? 332  HIS A N   1 
ATOM   532  C  CA  . HIS A 1 82  ? 0.075   -17.307 60.480 1.00 13.69 ? 332  HIS A CA  1 
ATOM   533  C  C   . HIS A 1 82  ? 0.648   -16.596 61.688 1.00 16.44 ? 332  HIS A C   1 
ATOM   534  O  O   . HIS A 1 82  ? -0.027  -16.377 62.680 1.00 24.40 ? 332  HIS A O   1 
ATOM   535  C  CB  . HIS A 1 82  ? -0.344  -16.299 59.425 1.00 21.18 ? 332  HIS A CB  1 
ATOM   536  C  CG  . HIS A 1 82  ? -1.041  -16.899 58.240 1.00 18.03 ? 332  HIS A CG  1 
ATOM   537  N  ND1 . HIS A 1 82  ? -0.363  -17.342 57.123 1.00 18.11 ? 332  HIS A ND1 1 
ATOM   538  C  CD2 . HIS A 1 82  ? -2.356  -17.108 57.989 1.00 21.34 ? 332  HIS A CD2 1 
ATOM   539  C  CE1 . HIS A 1 82  ? -1.230  -17.814 56.244 1.00 22.91 ? 332  HIS A CE1 1 
ATOM   540  N  NE2 . HIS A 1 82  ? -2.448  -17.681 56.742 1.00 24.21 ? 332  HIS A NE2 1 
ATOM   541  N  N   . ALA A 1 83  ? 1.918   -16.253 61.615 1.00 24.70 ? 333  ALA A N   1 
ATOM   542  C  CA  . ALA A 1 83  ? 2.599   -15.581 62.717 1.00 21.62 ? 333  ALA A CA  1 
ATOM   543  C  C   . ALA A 1 83  ? 3.662   -14.644 62.148 1.00 20.77 ? 333  ALA A C   1 
ATOM   544  O  O   . ALA A 1 83  ? 4.669   -15.084 61.569 1.00 20.39 ? 333  ALA A O   1 
ATOM   545  C  CB  . ALA A 1 83  ? 3.227   -16.612 63.676 1.00 15.39 ? 333  ALA A CB  1 
ATOM   546  N  N   . ARG A 1 84  ? 3.439   -13.349 62.310 1.00 22.93 ? 334  ARG A N   1 
ATOM   547  C  CA  . ARG A 1 84  ? 4.424   -12.393 61.875 1.00 29.10 ? 334  ARG A CA  1 
ATOM   548  C  C   . ARG A 1 84  ? 5.611   -12.365 62.851 1.00 28.65 ? 334  ARG A C   1 
ATOM   549  O  O   . ARG A 1 84  ? 5.447   -12.443 64.077 1.00 33.87 ? 334  ARG A O   1 
ATOM   550  C  CB  . ARG A 1 84  ? 3.794   -11.010 61.691 1.00 33.06 ? 334  ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 84  ? 3.577   -10.235 62.969 1.00 50.07 ? 334  ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 84  ? 2.555   -9.127  62.799 1.00 59.05 ? 334  ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 84  ? 2.200   -8.521  64.085 1.00 63.13 ? 334  ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 84  ? 1.402   -7.459  64.224 1.00 63.08 ? 334  ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 84  ? 0.860   -6.864  63.156 1.00 48.89 ? 334  ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 84  ? 1.145   -6.982  65.442 1.00 60.97 ? 334  ARG A NH2 1 
ATOM   557  N  N   . ILE A 1 85  ? 6.803   -12.267 62.283 1.00 27.74 ? 335  ILE A N   1 
ATOM   558  C  CA  . ILE A 1 85  ? 8.000   -12.086 63.052 1.00 29.12 ? 335  ILE A CA  1 
ATOM   559  C  C   . ILE A 1 85  ? 8.268   -10.606 63.328 1.00 28.23 ? 335  ILE A C   1 
ATOM   560  O  O   . ILE A 1 85  ? 8.360   -9.794  62.391 1.00 36.08 ? 335  ILE A O   1 
ATOM   561  C  CB  . ILE A 1 85  ? 9.215   -12.712 62.361 1.00 22.77 ? 335  ILE A CB  1 
ATOM   562  C  CG1 . ILE A 1 85  ? 8.975   -14.204 62.162 1.00 14.64 ? 335  ILE A CG1 1 
ATOM   563  C  CG2 . ILE A 1 85  ? 10.466  -12.516 63.251 1.00 26.36 ? 335  ILE A CG2 1 
ATOM   564  C  CD1 . ILE A 1 85  ? 10.022  -14.872 61.349 1.00 27.25 ? 335  ILE A CD1 1 
ATOM   565  N  N   . GLU A 1 86  ? 8.422   -10.295 64.618 1.00 22.67 ? 336  GLU A N   1 
ATOM   566  C  CA  . GLU A 1 86  ? 8.664   -8.956  65.134 1.00 20.32 ? 336  GLU A CA  1 
ATOM   567  C  C   . GLU A 1 86  ? 10.131  -8.843  65.538 1.00 25.26 ? 336  GLU A C   1 
ATOM   568  O  O   . GLU A 1 86  ? 10.801  -9.854  65.743 1.00 31.67 ? 336  GLU A O   1 
ATOM   569  C  CB  . GLU A 1 86  ? 7.745   -8.685  66.352 1.00 24.98 ? 336  GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 86  ? 6.223   -8.720  66.010 1.00 26.73 ? 336  GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 86  ? 5.249   -8.405  67.170 1.00 33.69 ? 336  GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 86  ? 5.631   -8.328  68.368 1.00 32.77 ? 336  GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 86  ? 4.050   -8.229  66.851 1.00 41.47 ? 336  GLU A OE2 1 
ATOM   574  N  N   . GLN A 1 87  ? 10.646  -7.623  65.644 1.00 26.08 ? 337  GLN A N   1 
ATOM   575  C  CA  . GLN A 1 87  ? 11.965  -7.439  66.228 1.00 26.88 ? 337  GLN A CA  1 
ATOM   576  C  C   . GLN A 1 87  ? 11.955  -6.355  67.284 1.00 28.24 ? 337  GLN A C   1 
ATOM   577  O  O   . GLN A 1 87  ? 11.114  -5.471  67.276 1.00 25.27 ? 337  GLN A O   1 
ATOM   578  C  CB  . GLN A 1 87  ? 13.031  -7.183  65.148 1.00 31.88 ? 337  GLN A CB  1 
ATOM   579  C  CG  . GLN A 1 87  ? 13.379  -5.748  64.886 1.00 40.78 ? 337  GLN A CG  1 
ATOM   580  C  CD  . GLN A 1 87  ? 14.464  -5.225  65.813 1.00 39.14 ? 337  GLN A CD  1 
ATOM   581  O  OE1 . GLN A 1 87  ? 15.420  -5.924  66.134 1.00 37.00 ? 337  GLN A OE1 1 
ATOM   582  N  NE2 . GLN A 1 87  ? 14.322  -3.982  66.226 1.00 29.53 ? 337  GLN A NE2 1 
ATOM   583  N  N   . TRP A 1 88  ? 12.881  -6.480  68.225 1.00 34.80 ? 338  TRP A N   1 
ATOM   584  C  CA  . TRP A 1 88  ? 13.161  -5.443  69.195 1.00 33.09 ? 338  TRP A CA  1 
ATOM   585  C  C   . TRP A 1 88  ? 14.461  -5.763  69.922 1.00 29.74 ? 338  TRP A C   1 
ATOM   586  O  O   . TRP A 1 88  ? 14.705  -6.904  70.314 1.00 28.58 ? 338  TRP A O   1 
ATOM   587  C  CB  . TRP A 1 88  ? 12.015  -5.295  70.184 1.00 43.19 ? 338  TRP A CB  1 
ATOM   588  C  CG  . TRP A 1 88  ? 12.270  -4.223  71.188 1.00 48.72 ? 338  TRP A CG  1 
ATOM   589  C  CD1 . TRP A 1 88  ? 12.152  -2.873  71.003 1.00 54.48 ? 338  TRP A CD1 1 
ATOM   590  C  CD2 . TRP A 1 88  ? 12.708  -4.410  72.529 1.00 52.91 ? 338  TRP A CD2 1 
ATOM   591  N  NE1 . TRP A 1 88  ? 12.487  -2.208  72.150 1.00 56.98 ? 338  TRP A NE1 1 
ATOM   592  C  CE2 . TRP A 1 88  ? 12.830  -3.125  73.108 1.00 55.57 ? 338  TRP A CE2 1 
ATOM   593  C  CE3 . TRP A 1 88  ? 13.011  -5.543  73.302 1.00 56.98 ? 338  TRP A CE3 1 
ATOM   594  C  CZ2 . TRP A 1 88  ? 13.234  -2.935  74.425 1.00 57.20 ? 338  TRP A CZ2 1 
ATOM   595  C  CZ3 . TRP A 1 88  ? 13.415  -5.361  74.622 1.00 64.01 ? 338  TRP A CZ3 1 
ATOM   596  C  CH2 . TRP A 1 88  ? 13.522  -4.059  75.173 1.00 63.78 ? 338  TRP A CH2 1 
ATOM   597  N  N   . ASN A 1 89  ? 15.302  -4.743  70.073 1.00 32.94 ? 339  ASN A N   1 
ATOM   598  C  CA  . ASN A 1 89  ? 16.624  -4.874  70.704 1.00 29.26 ? 339  ASN A CA  1 
ATOM   599  C  C   . ASN A 1 89  ? 17.509  -5.917  70.006 1.00 30.07 ? 339  ASN A C   1 
ATOM   600  O  O   . ASN A 1 89  ? 18.273  -6.655  70.640 1.00 27.69 ? 339  ASN A O   1 
ATOM   601  C  CB  . ASN A 1 89  ? 16.496  -5.160  72.211 1.00 30.16 ? 339  ASN A CB  1 
ATOM   602  C  CG  . ASN A 1 89  ? 17.789  -4.865  72.980 1.00 36.71 ? 339  ASN A CG  1 
ATOM   603  O  OD1 . ASN A 1 89  ? 18.507  -3.902  72.689 1.00 36.50 ? 339  ASN A OD1 1 
ATOM   604  N  ND2 . ASN A 1 89  ? 18.088  -5.702  73.958 1.00 35.54 ? 339  ASN A ND2 1 
ATOM   605  N  N   . HIS A 1 90  ? 17.388  -5.960  68.684 1.00 30.95 ? 340  HIS A N   1 
ATOM   606  C  CA  . HIS A 1 90  ? 18.224  -6.801  67.830 1.00 32.10 ? 340  HIS A CA  1 
ATOM   607  C  C   . HIS A 1 90  ? 17.897  -8.263  67.939 1.00 28.56 ? 340  HIS A C   1 
ATOM   608  O  O   . HIS A 1 90  ? 18.659  -9.087  67.438 1.00 31.91 ? 340  HIS A O   1 
ATOM   609  C  CB  . HIS A 1 90  ? 19.727  -6.558  68.074 1.00 24.76 ? 340  HIS A CB  1 
ATOM   610  C  CG  . HIS A 1 90  ? 20.131  -5.132  67.874 1.00 32.70 ? 340  HIS A CG  1 
ATOM   611  N  ND1 . HIS A 1 90  ? 20.185  -4.546  66.625 1.00 38.83 ? 340  HIS A ND1 1 
ATOM   612  C  CD2 . HIS A 1 90  ? 20.461  -4.163  68.760 1.00 36.11 ? 340  HIS A CD2 1 
ATOM   613  C  CE1 . HIS A 1 90  ? 20.547  -3.281  66.751 1.00 43.90 ? 340  HIS A CE1 1 
ATOM   614  N  NE2 . HIS A 1 90  ? 20.718  -3.022  68.035 1.00 38.22 ? 340  HIS A NE2 1 
ATOM   615  N  N   . ASN A 1 91  ? 16.768  -8.582  68.576 1.00 28.55 ? 341  ASN A N   1 
ATOM   616  C  CA  . ASN A 1 91  ? 16.284  -9.955  68.626 1.00 29.56 ? 341  ASN A CA  1 
ATOM   617  C  C   . ASN A 1 91  ? 14.988  -10.054 67.837 1.00 30.56 ? 341  ASN A C   1 
ATOM   618  O  O   . ASN A 1 91  ? 14.311  -9.061  67.635 1.00 19.75 ? 341  ASN A O   1 
ATOM   619  C  CB  . ASN A 1 91  ? 16.044  -10.411 70.058 1.00 25.18 ? 341  ASN A CB  1 
ATOM   620  C  CG  . ASN A 1 91  ? 17.284  -10.317 70.918 1.00 36.23 ? 341  ASN A CG  1 
ATOM   621  O  OD1 . ASN A 1 91  ? 18.316  -10.902 70.597 1.00 39.33 ? 341  ASN A OD1 1 
ATOM   622  N  ND2 . ASN A 1 91  ? 17.189  -9.578  72.023 1.00 23.92 ? 341  ASN A ND2 1 
ATOM   623  N  N   . PHE A 1 92  ? 14.656  -11.270 67.413 1.00 34.28 ? 342  PHE A N   1 
ATOM   624  C  CA  . PHE A 1 92  ? 13.411  -11.549 66.721 1.00 29.15 ? 342  PHE A CA  1 
ATOM   625  C  C   . PHE A 1 92  ? 12.536  -12.497 67.531 1.00 25.81 ? 342  PHE A C   1 
ATOM   626  O  O   . PHE A 1 92  ? 13.031  -13.395 68.192 1.00 19.86 ? 342  PHE A O   1 
ATOM   627  C  CB  . PHE A 1 92  ? 13.727  -12.124 65.352 1.00 31.71 ? 342  PHE A CB  1 
ATOM   628  C  CG  . PHE A 1 92  ? 14.636  -11.247 64.566 1.00 31.58 ? 342  PHE A CG  1 
ATOM   629  C  CD1 . PHE A 1 92  ? 16.000  -11.304 64.757 1.00 28.83 ? 342  PHE A CD1 1 
ATOM   630  C  CD2 . PHE A 1 92  ? 14.129  -10.312 63.703 1.00 30.13 ? 342  PHE A CD2 1 
ATOM   631  C  CE1 . PHE A 1 92  ? 16.841  -10.477 64.061 1.00 31.50 ? 342  PHE A CE1 1 
ATOM   632  C  CE2 . PHE A 1 92  ? 14.964  -9.477  63.000 1.00 42.26 ? 342  PHE A CE2 1 
ATOM   633  C  CZ  . PHE A 1 92  ? 16.330  -9.556  63.183 1.00 34.16 ? 342  PHE A CZ  1 
ATOM   634  N  N   . SER A 1 93  ? 11.232  -12.256 67.492 1.00 23.16 ? 343  SER A N   1 
ATOM   635  C  CA  . SER A 1 93  ? 10.269  -13.131 68.126 1.00 27.63 ? 343  SER A CA  1 
ATOM   636  C  C   . SER A 1 93  ? 8.886   -12.901 67.548 1.00 26.16 ? 343  SER A C   1 
ATOM   637  O  O   . SER A 1 93  ? 8.678   -12.015 66.724 1.00 18.47 ? 343  SER A O   1 
ATOM   638  C  CB  . SER A 1 93  ? 10.225  -12.905 69.645 1.00 31.05 ? 343  SER A CB  1 
ATOM   639  O  OG  . SER A 1 93  ? 9.530   -11.727 69.994 1.00 30.69 ? 343  SER A OG  1 
ATOM   640  N  N   . PHE A 1 94  ? 7.942   -13.713 68.000 1.00 29.41 ? 344  PHE A N   1 
ATOM   641  C  CA  . PHE A 1 94  ? 6.541   -13.543 67.639 1.00 28.75 ? 344  PHE A CA  1 
ATOM   642  C  C   . PHE A 1 94  ? 5.787   -12.592 68.596 1.00 29.72 ? 344  PHE A C   1 
ATOM   643  O  O   . PHE A 1 94  ? 4.654   -12.228 68.314 1.00 31.16 ? 344  PHE A O   1 
ATOM   644  C  CB  . PHE A 1 94  ? 5.873   -14.905 67.556 1.00 27.07 ? 344  PHE A CB  1 
ATOM   645  C  CG  . PHE A 1 94  ? 6.481   -15.828 66.517 1.00 23.76 ? 344  PHE A CG  1 
ATOM   646  C  CD1 . PHE A 1 94  ? 7.108   -16.996 66.889 1.00 18.19 ? 344  PHE A CD1 1 
ATOM   647  C  CD2 . PHE A 1 94  ? 6.391   -15.534 65.159 1.00 25.45 ? 344  PHE A CD2 1 
ATOM   648  C  CE1 . PHE A 1 94  ? 7.650   -17.853 65.941 1.00 23.57 ? 344  PHE A CE1 1 
ATOM   649  C  CE2 . PHE A 1 94  ? 6.938   -16.398 64.196 1.00 20.45 ? 344  PHE A CE2 1 
ATOM   650  C  CZ  . PHE A 1 94  ? 7.563   -17.560 64.590 1.00 18.75 ? 344  PHE A CZ  1 
ATOM   651  N  N   . ASP A 1 95  ? 6.415   -12.207 69.719 1.00 35.01 ? 345  ASP A N   1 
ATOM   652  C  CA  . ASP A 1 95  ? 6.027   -10.995 70.494 1.00 33.80 ? 345  ASP A CA  1 
ATOM   653  C  C   . ASP A 1 95  ? 7.259   -10.237 71.025 1.00 39.15 ? 345  ASP A C   1 
ATOM   654  O  O   . ASP A 1 95  ? 7.872   -10.607 72.051 1.00 34.03 ? 345  ASP A O   1 
ATOM   655  C  CB  . ASP A 1 95  ? 5.075   -11.307 71.648 1.00 37.26 ? 345  ASP A CB  1 
ATOM   656  C  CG  . ASP A 1 95  ? 4.352   -10.061 72.171 1.00 42.01 ? 345  ASP A CG  1 
ATOM   657  O  OD1 . ASP A 1 95  ? 4.691   -8.929  71.735 1.00 57.59 ? 345  ASP A OD1 1 
ATOM   658  O  OD2 . ASP A 1 95  ? 3.437   -10.216 73.012 1.00 41.40 ? 345  ASP A OD2 1 
ATOM   659  N  N   . ALA A 1 96  ? 7.604   -9.163  70.319 1.00 38.62 ? 346  ALA A N   1 
ATOM   660  C  CA  . ALA A 1 96  ? 8.855   -8.473  70.552 1.00 38.98 ? 346  ALA A CA  1 
ATOM   661  C  C   . ALA A 1 96  ? 8.835   -7.713  71.861 1.00 42.70 ? 346  ALA A C   1 
ATOM   662  O  O   . ALA A 1 96  ? 9.882   -7.573  72.501 1.00 34.80 ? 346  ALA A O   1 
ATOM   663  C  CB  . ALA A 1 96  ? 9.142   -7.534  69.417 1.00 44.13 ? 346  ALA A CB  1 
ATOM   664  N  N   . HIS A 1 97  ? 7.648   -7.243  72.260 1.00 46.55 ? 347  HIS A N   1 
ATOM   665  C  CA  . HIS A 1 97  ? 7.513   -6.388  73.437 1.00 49.75 ? 347  HIS A CA  1 
ATOM   666  C  C   . HIS A 1 97  ? 7.156   -7.133  74.723 1.00 52.53 ? 347  HIS A C   1 
ATOM   667  O  O   . HIS A 1 97  ? 7.020   -6.523  75.780 1.00 58.18 ? 347  HIS A O   1 
ATOM   668  C  CB  . HIS A 1 97  ? 6.497   -5.278  73.161 1.00 51.89 ? 347  HIS A CB  1 
ATOM   669  C  CG  . HIS A 1 97  ? 6.895   -4.370  72.037 1.00 62.01 ? 347  HIS A CG  1 
ATOM   670  N  ND1 . HIS A 1 97  ? 6.004   -3.937  71.075 1.00 71.90 ? 347  HIS A ND1 1 
ATOM   671  C  CD2 . HIS A 1 97  ? 8.096   -3.831  71.709 1.00 59.62 ? 347  HIS A CD2 1 
ATOM   672  C  CE1 . HIS A 1 97  ? 6.636   -3.161  70.210 1.00 69.36 ? 347  HIS A CE1 1 
ATOM   673  N  NE2 . HIS A 1 97  ? 7.907   -3.087  70.567 1.00 64.19 ? 347  HIS A NE2 1 
ATOM   674  N  N   . ASP A 1 98  ? 7.005   -8.449  74.644 1.00 56.32 ? 348  ASP A N   1 
ATOM   675  C  CA  . ASP A 1 98  ? 6.802   -9.267  75.838 1.00 54.15 ? 348  ASP A CA  1 
ATOM   676  C  C   . ASP A 1 98  ? 8.063   -10.117 76.038 1.00 54.87 ? 348  ASP A C   1 
ATOM   677  O  O   . ASP A 1 98  ? 8.281   -11.089 75.318 1.00 51.42 ? 348  ASP A O   1 
ATOM   678  C  CB  . ASP A 1 98  ? 5.549   -10.136 75.687 1.00 51.94 ? 348  ASP A CB  1 
ATOM   679  C  CG  . ASP A 1 98  ? 5.252   -10.971 76.925 1.00 55.28 ? 348  ASP A CG  1 
ATOM   680  O  OD1 . ASP A 1 98  ? 5.968   -10.832 77.945 1.00 59.89 ? 348  ASP A OD1 1 
ATOM   681  O  OD2 . ASP A 1 98  ? 4.302   -11.782 76.872 1.00 46.47 ? 348  ASP A OD2 1 
ATOM   682  N  N   . PRO A 1 99  ? 8.897   -9.758  77.027 1.00 57.33 ? 349  PRO A N   1 
ATOM   683  C  CA  . PRO A 1 99  ? 10.185  -10.443 77.147 1.00 56.52 ? 349  PRO A CA  1 
ATOM   684  C  C   . PRO A 1 99  ? 10.107  -11.827 77.807 1.00 51.74 ? 349  PRO A C   1 
ATOM   685  O  O   . PRO A 1 99  ? 11.120  -12.507 77.881 1.00 52.96 ? 349  PRO A O   1 
ATOM   686  C  CB  . PRO A 1 99  ? 11.032  -9.467  77.964 1.00 57.92 ? 349  PRO A CB  1 
ATOM   687  C  CG  . PRO A 1 99  ? 10.043  -8.642  78.744 1.00 61.82 ? 349  PRO A CG  1 
ATOM   688  C  CD  . PRO A 1 99  ? 8.694   -8.752  78.086 1.00 58.54 ? 349  PRO A CD  1 
ATOM   689  N  N   . CYS A 1 100 ? 8.924   -12.243 78.260 1.00 48.03 ? 350  CYS A N   1 
ATOM   690  C  CA  . CYS A 1 100 ? 8.684   -13.641 78.642 1.00 48.67 ? 350  CYS A CA  1 
ATOM   691  C  C   . CYS A 1 100 ? 8.711   -14.556 77.445 1.00 47.26 ? 350  CYS A C   1 
ATOM   692  O  O   . CYS A 1 100 ? 9.124   -15.711 77.543 1.00 52.26 ? 350  CYS A O   1 
ATOM   693  C  CB  . CYS A 1 100 ? 7.309   -13.803 79.265 1.00 51.71 ? 350  CYS A CB  1 
ATOM   694  S  SG  . CYS A 1 100 ? 7.130   -12.929 80.785 1.00 60.10 ? 350  CYS A SG  1 
ATOM   695  N  N   . VAL A 1 101 ? 8.213   -14.052 76.324 1.00 41.57 ? 351  VAL A N   1 
ATOM   696  C  CA  . VAL A 1 101 ? 8.182   -14.822 75.096 1.00 35.89 ? 351  VAL A CA  1 
ATOM   697  C  C   . VAL A 1 101 ? 9.605   -14.943 74.560 1.00 32.74 ? 351  VAL A C   1 
ATOM   698  O  O   . VAL A 1 101 ? 10.375  -13.984 74.600 1.00 33.19 ? 351  VAL A O   1 
ATOM   699  C  CB  . VAL A 1 101 ? 7.271   -14.151 74.041 1.00 34.08 ? 351  VAL A CB  1 
ATOM   700  C  CG1 . VAL A 1 101 ? 7.325   -14.915 72.751 1.00 25.29 ? 351  VAL A CG1 1 
ATOM   701  C  CG2 . VAL A 1 101 ? 5.831   -14.072 74.553 1.00 32.98 ? 351  VAL A CG2 1 
ATOM   702  N  N   . PHE A 1 102 ? 9.934   -16.130 74.064 1.00 28.21 ? 352  PHE A N   1 
ATOM   703  C  CA  . PHE A 1 102 ? 11.266  -16.446 73.554 1.00 28.29 ? 352  PHE A CA  1 
ATOM   704  C  C   . PHE A 1 102 ? 11.690  -15.611 72.357 1.00 25.99 ? 352  PHE A C   1 
ATOM   705  O  O   . PHE A 1 102 ? 10.922  -15.444 71.434 1.00 30.29 ? 352  PHE A O   1 
ATOM   706  C  CB  . PHE A 1 102 ? 11.310  -17.919 73.154 1.00 25.22 ? 352  PHE A CB  1 
ATOM   707  C  CG  . PHE A 1 102 ? 12.584  -18.330 72.466 1.00 31.94 ? 352  PHE A CG  1 
ATOM   708  C  CD1 . PHE A 1 102 ? 13.670  -18.787 73.205 1.00 36.11 ? 352  PHE A CD1 1 
ATOM   709  C  CD2 . PHE A 1 102 ? 12.692  -18.281 71.081 1.00 32.15 ? 352  PHE A CD2 1 
ATOM   710  C  CE1 . PHE A 1 102 ? 14.838  -19.184 72.584 1.00 29.30 ? 352  PHE A CE1 1 
ATOM   711  C  CE2 . PHE A 1 102 ? 13.858  -18.671 70.455 1.00 28.25 ? 352  PHE A CE2 1 
ATOM   712  C  CZ  . PHE A 1 102 ? 14.933  -19.127 71.209 1.00 37.91 ? 352  PHE A CZ  1 
ATOM   713  N  N   . HIS A 1 103 ? 12.939  -15.143 72.369 1.00 28.68 ? 353  HIS A N   1 
ATOM   714  C  CA  . HIS A 1 103 ? 13.526  -14.381 71.261 1.00 31.05 ? 353  HIS A CA  1 
ATOM   715  C  C   . HIS A 1 103 ? 14.944  -14.858 70.912 1.00 31.48 ? 353  HIS A C   1 
ATOM   716  O  O   . HIS A 1 103 ? 15.580  -15.569 71.684 1.00 35.64 ? 353  HIS A O   1 
ATOM   717  C  CB  . HIS A 1 103 ? 13.522  -12.870 71.555 1.00 29.23 ? 353  HIS A CB  1 
ATOM   718  C  CG  . HIS A 1 103 ? 14.234  -12.492 72.811 1.00 39.70 ? 353  HIS A CG  1 
ATOM   719  N  ND1 . HIS A 1 103 ? 15.607  -12.549 72.935 1.00 45.00 ? 353  HIS A ND1 1 
ATOM   720  C  CD2 . HIS A 1 103 ? 13.762  -12.057 74.005 1.00 42.46 ? 353  HIS A CD2 1 
ATOM   721  C  CE1 . HIS A 1 103 ? 15.950  -12.170 74.153 1.00 33.57 ? 353  HIS A CE1 1 
ATOM   722  N  NE2 . HIS A 1 103 ? 14.850  -11.865 74.821 1.00 32.62 ? 353  HIS A NE2 1 
ATOM   723  N  N   . SER A 1 104 ? 15.419  -14.451 69.739 1.00 31.59 ? 354  SER A N   1 
ATOM   724  C  CA  . SER A 1 104 ? 16.687  -14.921 69.194 1.00 31.57 ? 354  SER A CA  1 
ATOM   725  C  C   . SER A 1 104 ? 17.335  -13.798 68.413 1.00 30.21 ? 354  SER A C   1 
ATOM   726  O  O   . SER A 1 104 ? 16.642  -12.961 67.845 1.00 29.28 ? 354  SER A O   1 
ATOM   727  C  CB  . SER A 1 104 ? 16.439  -16.109 68.265 1.00 31.76 ? 354  SER A CB  1 
ATOM   728  O  OG  . SER A 1 104 ? 17.538  -16.345 67.418 1.00 32.29 ? 354  SER A OG  1 
ATOM   729  N  N   . PRO A 1 105 ? 18.667  -13.763 68.385 1.00 29.33 ? 355  PRO A N   1 
ATOM   730  C  CA  . PRO A 1 105 ? 19.339  -12.735 67.603 1.00 31.93 ? 355  PRO A CA  1 
ATOM   731  C  C   . PRO A 1 105 ? 19.253  -13.002 66.102 1.00 36.13 ? 355  PRO A C   1 
ATOM   732  O  O   . PRO A 1 105 ? 19.666  -12.160 65.294 1.00 30.73 ? 355  PRO A O   1 
ATOM   733  C  CB  . PRO A 1 105 ? 20.788  -12.804 68.104 1.00 27.88 ? 355  PRO A CB  1 
ATOM   734  C  CG  . PRO A 1 105 ? 20.952  -14.163 68.613 1.00 29.13 ? 355  PRO A CG  1 
ATOM   735  C  CD  . PRO A 1 105 ? 19.615  -14.626 69.105 1.00 29.90 ? 355  PRO A CD  1 
ATOM   736  N  N   . ASP A 1 106 ? 18.672  -14.155 65.767 1.00 41.86 ? 356  ASP A N   1 
ATOM   737  C  CA  . ASP A 1 106 ? 18.588  -14.718 64.416 1.00 41.67 ? 356  ASP A CA  1 
ATOM   738  C  C   . ASP A 1 106 ? 17.146  -15.080 64.080 1.00 37.29 ? 356  ASP A C   1 
ATOM   739  O  O   . ASP A 1 106 ? 16.381  -15.479 64.953 1.00 43.21 ? 356  ASP A O   1 
ATOM   740  C  CB  . ASP A 1 106 ? 19.323  -16.071 64.422 1.00 47.66 ? 356  ASP A CB  1 
ATOM   741  C  CG  . ASP A 1 106 ? 20.661  -16.027 63.769 1.00 56.56 ? 356  ASP A CG  1 
ATOM   742  O  OD1 . ASP A 1 106 ? 21.103  -14.926 63.380 1.00 78.63 ? 356  ASP A OD1 1 
ATOM   743  O  OD2 . ASP A 1 106 ? 21.269  -17.117 63.640 1.00 69.13 ? 356  ASP A OD2 1 
ATOM   744  N  N   . ILE A 1 107 ? 16.781  -15.018 62.813 1.00 35.96 ? 357  ILE A N   1 
ATOM   745  C  CA  . ILE A 1 107 ? 15.531  -15.634 62.387 1.00 29.14 ? 357  ILE A CA  1 
ATOM   746  C  C   . ILE A 1 107 ? 15.654  -17.157 62.475 1.00 28.84 ? 357  ILE A C   1 
ATOM   747  O  O   . ILE A 1 107 ? 14.711  -17.840 62.880 1.00 34.69 ? 357  ILE A O   1 
ATOM   748  C  CB  . ILE A 1 107 ? 15.164  -15.259 60.943 1.00 30.03 ? 357  ILE A CB  1 
ATOM   749  C  CG1 . ILE A 1 107 ? 14.957  -13.736 60.813 1.00 29.51 ? 357  ILE A CG1 1 
ATOM   750  C  CG2 . ILE A 1 107 ? 13.962  -16.064 60.496 1.00 16.03 ? 357  ILE A CG2 1 
ATOM   751  C  CD1 . ILE A 1 107 ? 13.833  -13.179 61.634 1.00 35.30 ? 357  ILE A CD1 1 
ATOM   752  N  N   . THR A 1 108 ? 16.807  -17.693 62.093 1.00 23.72 ? 358  THR A N   1 
ATOM   753  C  CA  . THR A 1 108 ? 16.990  -19.139 62.067 1.00 27.26 ? 358  THR A CA  1 
ATOM   754  C  C   . THR A 1 108 ? 16.774  -19.750 63.448 1.00 26.20 ? 358  THR A C   1 
ATOM   755  O  O   . THR A 1 108 ? 16.068  -20.732 63.582 1.00 30.37 ? 358  THR A O   1 
ATOM   756  C  CB  . THR A 1 108 ? 18.377  -19.525 61.534 1.00 33.67 ? 358  THR A CB  1 
ATOM   757  O  OG1 . THR A 1 108 ? 18.376  -19.420 60.107 1.00 36.56 ? 358  THR A OG1 1 
ATOM   758  C  CG2 . THR A 1 108 ? 18.753  -20.967 61.950 1.00 31.89 ? 358  THR A CG2 1 
ATOM   759  N  N   . GLY A 1 109 ? 17.357  -19.149 64.476 1.00 31.78 ? 359  GLY A N   1 
ATOM   760  C  CA  . GLY A 1 109 ? 17.195  -19.637 65.855 1.00 36.33 ? 359  GLY A CA  1 
ATOM   761  C  C   . GLY A 1 109 ? 15.776  -19.540 66.414 1.00 35.34 ? 359  GLY A C   1 
ATOM   762  O  O   . GLY A 1 109 ? 15.408  -20.256 67.348 1.00 41.96 ? 359  GLY A O   1 
ATOM   763  N  N   . LEU A 1 110 ? 14.978  -18.642 65.856 1.00 34.29 ? 360  LEU A N   1 
ATOM   764  C  CA  . LEU A 1 110 ? 13.595  -18.480 66.287 1.00 28.28 ? 360  LEU A CA  1 
ATOM   765  C  C   . LEU A 1 110 ? 12.757  -19.605 65.720 1.00 26.21 ? 360  LEU A C   1 
ATOM   766  O  O   . LEU A 1 110 ? 11.883  -20.110 66.390 1.00 32.46 ? 360  LEU A O   1 
ATOM   767  C  CB  . LEU A 1 110 ? 13.054  -17.125 65.846 1.00 19.70 ? 360  LEU A CB  1 
ATOM   768  C  CG  . LEU A 1 110 ? 11.629  -16.832 66.282 1.00 26.55 ? 360  LEU A CG  1 
ATOM   769  C  CD1 . LEU A 1 110 ? 11.525  -16.721 67.794 1.00 13.40 ? 360  LEU A CD1 1 
ATOM   770  C  CD2 . LEU A 1 110 ? 11.174  -15.564 65.577 1.00 20.83 ? 360  LEU A CD2 1 
ATOM   771  N  N   . LEU A 1 111 ? 13.026  -20.002 64.484 1.00 32.18 ? 361  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 111 ? 12.370  -21.178 63.924 1.00 34.16 ? 361  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 111 ? 12.827  -22.430 64.692 1.00 36.92 ? 361  LEU A C   1 
ATOM   774  O  O   . LEU A 1 111 ? 11.991  -23.219 65.149 1.00 40.56 ? 361  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 111 ? 12.655  -21.315 62.417 1.00 31.71 ? 361  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 111 ? 12.235  -20.130 61.551 1.00 32.10 ? 361  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 111 ? 12.350  -20.475 60.065 1.00 29.04 ? 361  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 111 ? 10.834  -19.673 61.900 1.00 25.63 ? 361  LEU A CD2 1 
ATOM   779  N  N   . GLU A 1 112 ? 14.143  -22.589 64.857 1.00 34.09 ? 362  GLU A N   1 
ATOM   780  C  CA  . GLU A 1 112 ? 14.700  -23.743 65.560 1.00 34.36 ? 362  GLU A CA  1 
ATOM   781  C  C   . GLU A 1 112 ? 14.089  -23.960 66.944 1.00 30.06 ? 362  GLU A C   1 
ATOM   782  O  O   . GLU A 1 112 ? 13.938  -25.099 67.380 1.00 34.54 ? 362  GLU A O   1 
ATOM   783  C  CB  . GLU A 1 112 ? 16.227  -23.642 65.665 1.00 40.77 ? 362  GLU A CB  1 
ATOM   784  C  CG  . GLU A 1 112 ? 16.955  -23.961 64.346 1.00 51.01 ? 362  GLU A CG  1 
ATOM   785  C  CD  . GLU A 1 112 ? 18.471  -23.714 64.401 1.00 62.36 ? 362  GLU A CD  1 
ATOM   786  O  OE1 . GLU A 1 112 ? 18.979  -23.112 65.378 1.00 64.16 ? 362  GLU A OE1 1 
ATOM   787  O  OE2 . GLU A 1 112 ? 19.161  -24.132 63.444 1.00 73.62 ? 362  GLU A OE2 1 
ATOM   788  N  N   . HIS A 1 113 ? 13.711  -22.888 67.629 1.00 24.42 ? 363  HIS A N   1 
ATOM   789  C  CA  . HIS A 1 113 ? 13.100  -23.037 68.951 1.00 26.85 ? 363  HIS A CA  1 
ATOM   790  C  C   . HIS A 1 113 ? 11.740  -23.706 68.928 1.00 29.51 ? 363  HIS A C   1 
ATOM   791  O  O   . HIS A 1 113 ? 11.372  -24.353 69.872 1.00 35.15 ? 363  HIS A O   1 
ATOM   792  C  CB  . HIS A 1 113 ? 12.962  -21.682 69.616 1.00 29.30 ? 363  HIS A CB  1 
ATOM   793  C  CG  . HIS A 1 113 ? 12.343  -21.731 70.978 1.00 34.04 ? 363  HIS A CG  1 
ATOM   794  N  ND1 . HIS A 1 113 ? 13.045  -22.119 72.100 1.00 30.95 ? 363  HIS A ND1 1 
ATOM   795  C  CD2 . HIS A 1 113 ? 11.095  -21.413 71.402 1.00 33.97 ? 363  HIS A CD2 1 
ATOM   796  C  CE1 . HIS A 1 113 ? 12.251  -22.045 73.155 1.00 39.32 ? 363  HIS A CE1 1 
ATOM   797  N  NE2 . HIS A 1 113 ? 11.064  -21.615 72.760 1.00 36.23 ? 363  HIS A NE2 1 
ATOM   798  N  N   . TYR A 1 114 ? 10.993  -23.545 67.845 1.00 37.49 ? 364  TYR A N   1 
ATOM   799  C  CA  . TYR A 1 114 ? 9.641   -24.059 67.776 1.00 31.66 ? 364  TYR A CA  1 
ATOM   800  C  C   . TYR A 1 114 ? 9.569   -25.346 66.938 1.00 33.89 ? 364  TYR A C   1 
ATOM   801  O  O   . TYR A 1 114 ? 8.533   -25.675 66.370 1.00 38.22 ? 364  TYR A O   1 
ATOM   802  C  CB  . TYR A 1 114 ? 8.748   -22.959 67.217 1.00 34.30 ? 364  TYR A CB  1 
ATOM   803  C  CG  . TYR A 1 114 ? 8.548   -21.815 68.179 1.00 29.49 ? 364  TYR A CG  1 
ATOM   804  C  CD1 . TYR A 1 114 ? 9.205   -20.606 68.013 1.00 22.85 ? 364  TYR A CD1 1 
ATOM   805  C  CD2 . TYR A 1 114 ? 7.693   -21.944 69.264 1.00 31.03 ? 364  TYR A CD2 1 
ATOM   806  C  CE1 . TYR A 1 114 ? 8.999   -19.540 68.908 1.00 28.94 ? 364  TYR A CE1 1 
ATOM   807  C  CE2 . TYR A 1 114 ? 7.496   -20.895 70.165 1.00 33.14 ? 364  TYR A CE2 1 
ATOM   808  C  CZ  . TYR A 1 114 ? 8.152   -19.704 69.985 1.00 29.44 ? 364  TYR A CZ  1 
ATOM   809  O  OH  . TYR A 1 114 ? 7.950   -18.705 70.902 1.00 37.33 ? 364  TYR A OH  1 
ATOM   810  N  N   . LYS A 1 115 ? 10.679  -26.075 66.890 1.00 39.93 ? 365  LYS A N   1 
ATOM   811  C  CA  . LYS A 1 115 ? 10.801  -27.296 66.088 1.00 46.07 ? 365  LYS A CA  1 
ATOM   812  C  C   . LYS A 1 115 ? 10.164  -28.501 66.766 1.00 41.96 ? 365  LYS A C   1 
ATOM   813  O  O   . LYS A 1 115 ? 9.664   -29.370 66.068 1.00 38.74 ? 365  LYS A O   1 
ATOM   814  C  CB  . LYS A 1 115 ? 12.291  -27.605 65.813 1.00 53.29 ? 365  LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 115 ? 12.605  -28.517 64.587 1.00 58.88 ? 365  LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 115 ? 14.146  -28.592 64.285 1.00 69.42 ? 365  LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 115 ? 14.912  -29.720 65.053 1.00 71.18 ? 365  LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 115 ? 15.247  -29.446 66.499 1.00 65.81 ? 365  LYS A NZ  1 
ATOM   819  N  N   . ASP A 1 116 ? 10.185  -28.546 68.108 1.00 44.95 ? 366  ASP A N   1 
ATOM   820  C  CA  . ASP A 1 116 ? 9.823   -29.749 68.888 1.00 48.43 ? 366  ASP A CA  1 
ATOM   821  C  C   . ASP A 1 116 ? 8.359   -29.725 69.379 1.00 51.08 ? 366  ASP A C   1 
ATOM   822  O  O   . ASP A 1 116 ? 8.038   -28.990 70.311 1.00 45.20 ? 366  ASP A O   1 
ATOM   823  C  CB  . ASP A 1 116 ? 10.789  -29.904 70.084 1.00 52.42 ? 366  ASP A CB  1 
ATOM   824  C  CG  . ASP A 1 116 ? 10.545  -31.194 70.901 1.00 60.08 ? 366  ASP A CG  1 
ATOM   825  O  OD1 . ASP A 1 116 ? 10.121  -32.216 70.324 1.00 63.48 ? 366  ASP A OD1 1 
ATOM   826  O  OD2 . ASP A 1 116 ? 10.790  -31.189 72.130 1.00 68.29 ? 366  ASP A OD2 1 
ATOM   827  N  N   . PRO A 1 117 ? 7.475   -30.561 68.775 1.00 57.42 ? 367  PRO A N   1 
ATOM   828  C  CA  . PRO A 1 117 ? 6.024   -30.496 69.038 1.00 59.11 ? 367  PRO A CA  1 
ATOM   829  C  C   . PRO A 1 117 ? 5.590   -30.745 70.477 1.00 63.07 ? 367  PRO A C   1 
ATOM   830  O  O   . PRO A 1 117 ? 4.725   -30.025 70.979 1.00 63.61 ? 367  PRO A O   1 
ATOM   831  C  CB  . PRO A 1 117 ? 5.429   -31.566 68.102 1.00 57.89 ? 367  PRO A CB  1 
ATOM   832  C  CG  . PRO A 1 117 ? 6.543   -32.456 67.749 1.00 61.90 ? 367  PRO A CG  1 
ATOM   833  C  CD  . PRO A 1 117 ? 7.795   -31.612 67.787 1.00 61.45 ? 367  PRO A CD  1 
ATOM   834  N  N   . SER A 1 118 ? 6.167   -31.746 71.134 1.00 65.76 ? 368  SER A N   1 
ATOM   835  C  CA  . SER A 1 118 ? 5.829   -32.021 72.534 1.00 68.30 ? 368  SER A CA  1 
ATOM   836  C  C   . SER A 1 118 ? 6.384   -30.951 73.501 1.00 69.82 ? 368  SER A C   1 
ATOM   837  O  O   . SER A 1 118 ? 6.095   -30.997 74.700 1.00 70.99 ? 368  SER A O   1 
ATOM   838  C  CB  . SER A 1 118 ? 6.285   -33.430 72.942 1.00 67.29 ? 368  SER A CB  1 
ATOM   839  O  OG  . SER A 1 118 ? 7.580   -33.720 72.446 1.00 68.59 ? 368  SER A OG  1 
ATOM   840  N  N   . ALA A 1 119 ? 7.167   -29.998 72.975 1.00 69.84 ? 369  ALA A N   1 
ATOM   841  C  CA  . ALA A 1 119 ? 7.629   -28.824 73.733 1.00 67.52 ? 369  ALA A CA  1 
ATOM   842  C  C   . ALA A 1 119 ? 7.139   -27.495 73.124 1.00 67.74 ? 369  ALA A C   1 
ATOM   843  O  O   . ALA A 1 119 ? 7.831   -26.471 73.221 1.00 67.15 ? 369  ALA A O   1 
ATOM   844  C  CB  . ALA A 1 119 ? 9.145   -28.831 73.830 1.00 67.18 ? 369  ALA A CB  1 
ATOM   845  N  N   . CYS A 1 120 ? 5.955   -27.530 72.491 1.00 68.46 ? 370  CYS A N   1 
ATOM   846  C  CA  . CYS A 1 120 ? 5.223   -26.323 72.011 1.00 65.05 ? 370  CYS A CA  1 
ATOM   847  C  C   . CYS A 1 120 ? 3.905   -26.154 72.778 1.00 60.41 ? 370  CYS A C   1 
ATOM   848  O  O   . CYS A 1 120 ? 3.113   -27.096 72.882 1.00 60.21 ? 370  CYS A O   1 
ATOM   849  C  CB  . CYS A 1 120 ? 4.901   -26.401 70.504 1.00 61.83 ? 370  CYS A CB  1 
ATOM   850  S  SG  . CYS A 1 120 ? 6.269   -25.967 69.408 1.00 55.84 ? 370  CYS A SG  1 
ATOM   851  N  N   . MET A 1 121 ? 3.658   -24.948 73.280 1.00 52.31 ? 371  MET A N   1 
ATOM   852  C  CA  . MET A 1 121 ? 2.455   -24.671 74.053 1.00 44.91 ? 371  MET A CA  1 
ATOM   853  C  C   . MET A 1 121 ? 1.355   -24.285 73.068 1.00 41.11 ? 371  MET A C   1 
ATOM   854  O  O   . MET A 1 121 ? 1.639   -23.841 71.950 1.00 32.89 ? 371  MET A O   1 
ATOM   855  C  CB  . MET A 1 121 ? 2.694   -23.529 75.037 1.00 47.18 ? 371  MET A CB  1 
ATOM   856  C  CG  . MET A 1 121 ? 4.043   -23.560 75.785 1.00 55.46 ? 371  MET A CG  1 
ATOM   857  S  SD  . MET A 1 121 ? 3.943   -24.115 77.496 1.00 61.90 ? 371  MET A SD  1 
ATOM   858  C  CE  . MET A 1 121 ? 5.099   -22.986 78.319 1.00 62.43 ? 371  MET A CE  1 
ATOM   859  N  N   . PHE A 1 122 ? 0.105   -24.440 73.486 1.00 34.19 ? 372  PHE A N   1 
ATOM   860  C  CA  . PHE A 1 122 ? -1.035  -24.211 72.592 1.00 35.46 ? 372  PHE A CA  1 
ATOM   861  C  C   . PHE A 1 122 ? -1.033  -22.839 71.896 1.00 29.99 ? 372  PHE A C   1 
ATOM   862  O  O   . PHE A 1 122 ? -1.437  -22.729 70.741 1.00 27.10 ? 372  PHE A O   1 
ATOM   863  C  CB  . PHE A 1 122 ? -2.362  -24.441 73.328 1.00 36.75 ? 372  PHE A CB  1 
ATOM   864  C  CG  . PHE A 1 122 ? -2.514  -23.625 74.584 1.00 49.27 ? 372  PHE A CG  1 
ATOM   865  C  CD1 . PHE A 1 122 ? -2.137  -24.151 75.823 1.00 49.36 ? 372  PHE A CD1 1 
ATOM   866  C  CD2 . PHE A 1 122 ? -3.039  -22.334 74.534 1.00 52.67 ? 372  PHE A CD2 1 
ATOM   867  C  CE1 . PHE A 1 122 ? -2.271  -23.408 76.984 1.00 52.11 ? 372  PHE A CE1 1 
ATOM   868  C  CE2 . PHE A 1 122 ? -3.180  -21.575 75.697 1.00 52.67 ? 372  PHE A CE2 1 
ATOM   869  C  CZ  . PHE A 1 122 ? -2.793  -22.113 76.923 1.00 57.82 ? 372  PHE A CZ  1 
ATOM   870  N  N   . PHE A 1 123 ? -0.556  -21.810 72.582 1.00 24.93 ? 373  PHE A N   1 
ATOM   871  C  CA  . PHE A 1 123 ? -0.519  -20.449 72.017 1.00 27.70 ? 373  PHE A CA  1 
ATOM   872  C  C   . PHE A 1 123 ? 0.738   -20.110 71.205 1.00 23.76 ? 373  PHE A C   1 
ATOM   873  O  O   . PHE A 1 123 ? 0.940   -18.963 70.835 1.00 21.53 ? 373  PHE A O   1 
ATOM   874  C  CB  . PHE A 1 123 ? -0.651  -19.421 73.147 1.00 32.65 ? 373  PHE A CB  1 
ATOM   875  C  CG  . PHE A 1 123 ? 0.465   -19.473 74.163 1.00 31.81 ? 373  PHE A CG  1 
ATOM   876  C  CD1 . PHE A 1 123 ? 1.564   -18.627 74.054 1.00 44.78 ? 373  PHE A CD1 1 
ATOM   877  C  CD2 . PHE A 1 123 ? 0.403   -20.344 75.246 1.00 38.47 ? 373  PHE A CD2 1 
ATOM   878  C  CE1 . PHE A 1 123 ? 2.590   -18.658 75.002 1.00 40.14 ? 373  PHE A CE1 1 
ATOM   879  C  CE2 . PHE A 1 123 ? 1.417   -20.379 76.191 1.00 36.83 ? 373  PHE A CE2 1 
ATOM   880  C  CZ  . PHE A 1 123 ? 2.515   -19.535 76.064 1.00 32.10 ? 373  PHE A CZ  1 
ATOM   881  N  N   . GLU A 1 124 ? 1.594   -21.098 70.977 1.00 28.09 ? 374  GLU A N   1 
ATOM   882  C  CA  . GLU A 1 124 ? 2.840   -20.931 70.253 1.00 26.43 ? 374  GLU A CA  1 
ATOM   883  C  C   . GLU A 1 124 ? 2.730   -21.615 68.897 1.00 27.49 ? 374  GLU A C   1 
ATOM   884  O  O   . GLU A 1 124 ? 2.019   -22.598 68.774 1.00 27.79 ? 374  GLU A O   1 
ATOM   885  C  CB  . GLU A 1 124 ? 3.958   -21.609 71.021 1.00 30.02 ? 374  GLU A CB  1 
ATOM   886  C  CG  . GLU A 1 124 ? 4.336   -20.942 72.334 1.00 40.49 ? 374  GLU A CG  1 
ATOM   887  C  CD  . GLU A 1 124 ? 5.375   -21.743 73.130 1.00 48.99 ? 374  GLU A CD  1 
ATOM   888  O  OE1 . GLU A 1 124 ? 5.514   -22.976 72.900 1.00 53.18 ? 374  GLU A OE1 1 
ATOM   889  O  OE2 . GLU A 1 124 ? 6.047   -21.135 73.993 1.00 52.48 ? 374  GLU A OE2 1 
ATOM   890  N  N   . PRO A 1 125 ? 3.424   -21.097 67.867 1.00 24.93 ? 375  PRO A N   1 
ATOM   891  C  CA  . PRO A 1 125 ? 3.520   -21.780 66.594 1.00 22.00 ? 375  PRO A CA  1 
ATOM   892  C  C   . PRO A 1 125 ? 4.147   -23.140 66.734 1.00 25.42 ? 375  PRO A C   1 
ATOM   893  O  O   . PRO A 1 125 ? 4.878   -23.373 67.682 1.00 26.35 ? 375  PRO A O   1 
ATOM   894  C  CB  . PRO A 1 125 ? 4.443   -20.885 65.780 1.00 27.45 ? 375  PRO A CB  1 
ATOM   895  C  CG  . PRO A 1 125 ? 4.303   -19.575 66.373 1.00 26.92 ? 375  PRO A CG  1 
ATOM   896  C  CD  . PRO A 1 125 ? 4.109   -19.807 67.831 1.00 24.44 ? 375  PRO A CD  1 
ATOM   897  N  N   . LEU A 1 126 ? 3.850   -24.029 65.794 1.00 29.25 ? 376  LEU A N   1 
ATOM   898  C  CA  . LEU A 1 126 ? 4.440   -25.369 65.759 1.00 29.30 ? 376  LEU A CA  1 
ATOM   899  C  C   . LEU A 1 126 ? 5.050   -25.560 64.381 1.00 29.72 ? 376  LEU A C   1 
ATOM   900  O  O   . LEU A 1 126 ? 4.302   -25.665 63.378 1.00 23.88 ? 376  LEU A O   1 
ATOM   901  C  CB  . LEU A 1 126 ? 3.359   -26.426 65.999 1.00 35.97 ? 376  LEU A CB  1 
ATOM   902  C  CG  . LEU A 1 126 ? 3.782   -27.895 65.985 1.00 34.57 ? 376  LEU A CG  1 
ATOM   903  C  CD1 . LEU A 1 126 ? 4.947   -28.108 66.930 1.00 31.45 ? 376  LEU A CD1 1 
ATOM   904  C  CD2 . LEU A 1 126 ? 2.608   -28.769 66.358 1.00 29.41 ? 376  LEU A CD2 1 
ATOM   905  N  N   . LEU A 1 127 ? 6.390   -25.589 64.331 1.00 23.68 ? 377  LEU A N   1 
ATOM   906  C  CA  . LEU A 1 127 ? 7.114   -25.540 63.064 1.00 24.78 ? 377  LEU A CA  1 
ATOM   907  C  C   . LEU A 1 127 ? 8.015   -26.739 62.915 1.00 24.35 ? 377  LEU A C   1 
ATOM   908  O  O   . LEU A 1 127 ? 9.235   -26.608 62.905 1.00 27.87 ? 377  LEU A O   1 
ATOM   909  C  CB  . LEU A 1 127 ? 7.935   -24.261 62.981 1.00 23.06 ? 377  LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 127 ? 7.173   -23.003 63.385 1.00 24.36 ? 377  LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 127 ? 8.155   -21.835 63.466 1.00 14.50 ? 377  LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 127 ? 6.019   -22.735 62.430 1.00 18.45 ? 377  LEU A CD2 1 
ATOM   913  N  N   . SER A 1 128 ? 7.399   -27.904 62.776 1.00 27.66 ? 378  SER A N   1 
ATOM   914  C  CA  . SER A 1 128 ? 8.101   -29.191 62.843 1.00 28.11 ? 378  SER A CA  1 
ATOM   915  C  C   . SER A 1 128 ? 8.386   -29.889 61.501 1.00 28.30 ? 378  SER A C   1 
ATOM   916  O  O   . SER A 1 128 ? 9.235   -30.749 61.454 1.00 31.28 ? 378  SER A O   1 
ATOM   917  C  CB  . SER A 1 128 ? 7.273   -30.128 63.711 1.00 28.38 ? 378  SER A CB  1 
ATOM   918  O  OG  . SER A 1 128 ? 5.985   -30.295 63.148 1.00 41.07 ? 378  SER A OG  1 
ATOM   919  N  N   . THR A 1 129 ? 7.666   -29.563 60.426 1.00 30.10 ? 379  THR A N   1 
ATOM   920  C  CA  . THR A 1 129 ? 7.918   -30.197 59.114 1.00 24.49 ? 379  THR A CA  1 
ATOM   921  C  C   . THR A 1 129 ? 7.912   -29.123 58.023 1.00 21.85 ? 379  THR A C   1 
ATOM   922  O  O   . THR A 1 129 ? 6.861   -28.648 57.644 1.00 23.53 ? 379  THR A O   1 
ATOM   923  C  CB  . THR A 1 129 ? 6.862   -31.287 58.754 1.00 23.78 ? 379  THR A CB  1 
ATOM   924  O  OG1 . THR A 1 129 ? 6.653   -32.153 59.867 1.00 31.90 ? 379  THR A OG1 1 
ATOM   925  C  CG2 . THR A 1 129 ? 7.296   -32.109 57.579 1.00 19.92 ? 379  THR A CG2 1 
ATOM   926  N  N   . PRO A 1 130 ? 9.093   -28.729 57.528 1.00 18.49 ? 380  PRO A N   1 
ATOM   927  C  CA  . PRO A 1 130 ? 9.165   -27.672 56.561 1.00 12.96 ? 380  PRO A CA  1 
ATOM   928  C  C   . PRO A 1 130 ? 8.619   -28.091 55.201 1.00 17.66 ? 380  PRO A C   1 
ATOM   929  O  O   . PRO A 1 130 ? 8.876   -29.197 54.780 1.00 22.43 ? 380  PRO A O   1 
ATOM   930  C  CB  . PRO A 1 130 ? 10.673  -27.405 56.466 1.00 17.61 ? 380  PRO A CB  1 
ATOM   931  C  CG  . PRO A 1 130 ? 11.309  -28.644 56.826 1.00 15.14 ? 380  PRO A CG  1 
ATOM   932  C  CD  . PRO A 1 130 ? 10.433  -29.241 57.870 1.00 19.28 ? 380  PRO A CD  1 
ATOM   933  N  N   . LEU A 1 131 ? 7.850   -27.215 54.554 1.00 15.45 ? 381  LEU A N   1 
ATOM   934  C  CA  . LEU A 1 131 ? 7.419   -27.400 53.176 1.00 16.44 ? 381  LEU A CA  1 
ATOM   935  C  C   . LEU A 1 131 ? 8.518   -26.813 52.312 1.00 25.31 ? 381  LEU A C   1 
ATOM   936  O  O   . LEU A 1 131 ? 8.939   -25.669 52.526 1.00 23.81 ? 381  LEU A O   1 
ATOM   937  C  CB  . LEU A 1 131 ? 6.124   -26.657 52.914 1.00 18.91 ? 381  LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 131 ? 5.147   -27.342 51.986 1.00 27.44 ? 381  LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 131 ? 4.612   -28.657 52.603 1.00 20.29 ? 381  LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 131 ? 4.011   -26.373 51.687 1.00 37.83 ? 381  LEU A CD2 1 
ATOM   941  N  N   . ILE A 1 132 ? 8.990   -27.592 51.340 1.00 24.21 ? 382  ILE A N   1 
ATOM   942  C  CA  . ILE A 1 132 ? 10.248  -27.292 50.670 1.00 17.18 ? 382  ILE A CA  1 
ATOM   943  C  C   . ILE A 1 132 ? 10.022  -26.521 49.349 1.00 19.74 ? 382  ILE A C   1 
ATOM   944  O  O   . ILE A 1 132 ? 9.276   -26.954 48.488 1.00 21.17 ? 382  ILE A O   1 
ATOM   945  C  CB  . ILE A 1 132 ? 11.002  -28.616 50.432 1.00 18.40 ? 382  ILE A CB  1 
ATOM   946  C  CG1 . ILE A 1 132 ? 11.304  -29.325 51.763 1.00 19.98 ? 382  ILE A CG1 1 
ATOM   947  C  CG2 . ILE A 1 132 ? 12.259  -28.398 49.634 1.00 11.47 ? 382  ILE A CG2 1 
ATOM   948  C  CD1 . ILE A 1 132 ? 12.143  -28.557 52.760 1.00 10.23 ? 382  ILE A CD1 1 
ATOM   949  N  N   . ARG A 1 133 ? 10.681  -25.378 49.194 1.00 23.10 ? 383  ARG A N   1 
ATOM   950  C  CA  . ARG A 1 133 ? 10.557  -24.574 47.976 1.00 23.72 ? 383  ARG A CA  1 
ATOM   951  C  C   . ARG A 1 133 ? 10.991  -25.336 46.725 1.00 21.30 ? 383  ARG A C   1 
ATOM   952  O  O   . ARG A 1 133 ? 12.058  -25.891 46.677 1.00 19.91 ? 383  ARG A O   1 
ATOM   953  C  CB  . ARG A 1 133 ? 11.383  -23.289 48.062 1.00 25.75 ? 383  ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 133 ? 10.983  -22.256 47.004 1.00 30.33 ? 383  ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 133 ? 12.023  -21.199 46.742 1.00 23.28 ? 383  ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 133 ? 12.941  -21.098 47.856 1.00 23.49 ? 383  ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 133 ? 14.263  -21.215 47.778 1.00 30.70 ? 383  ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 133 ? 14.870  -21.417 46.619 1.00 29.36 ? 383  ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 133 ? 14.991  -21.109 48.887 1.00 38.55 ? 383  ARG A NH2 1 
ATOM   960  N  N   . THR A 1 134 ? 10.157  -25.301 45.702 1.00 19.56 ? 384  THR A N   1 
ATOM   961  C  CA  . THR A 1 134 ? 10.340  -26.098 44.518 1.00 18.19 ? 384  THR A CA  1 
ATOM   962  C  C   . THR A 1 134 ? 10.795  -25.300 43.284 1.00 18.12 ? 384  THR A C   1 
ATOM   963  O  O   . THR A 1 134 ? 10.883  -25.853 42.187 1.00 20.49 ? 384  THR A O   1 
ATOM   964  C  CB  . THR A 1 134 ? 9.047   -26.806 44.225 1.00 24.17 ? 384  THR A CB  1 
ATOM   965  O  OG1 . THR A 1 134 ? 7.989   -25.845 44.236 1.00 38.28 ? 384  THR A OG1 1 
ATOM   966  C  CG2 . THR A 1 134 ? 8.768   -27.849 45.308 1.00 23.79 ? 384  THR A CG2 1 
ATOM   967  N  N   . PHE A 1 135 ? 11.141  -24.029 43.467 1.00 14.57 ? 385  PHE A N   1 
ATOM   968  C  CA  . PHE A 1 135 ? 11.726  -23.229 42.403 1.00 17.68 ? 385  PHE A CA  1 
ATOM   969  C  C   . PHE A 1 135 ? 12.898  -22.403 42.894 1.00 22.69 ? 385  PHE A C   1 
ATOM   970  O  O   . PHE A 1 135 ? 12.987  -22.051 44.072 1.00 26.85 ? 385  PHE A O   1 
ATOM   971  C  CB  . PHE A 1 135 ? 10.698  -22.287 41.819 1.00 20.32 ? 385  PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 135 ? 10.146  -21.365 42.811 1.00 18.69 ? 385  PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 135 ? 9.042   -21.744 43.574 1.00 22.34 ? 385  PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 135 ? 10.726  -20.134 43.016 1.00 16.83 ? 385  PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 135 ? 8.527   -20.905 44.510 1.00 17.85 ? 385  PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 135 ? 10.223  -19.277 43.952 1.00 21.13 ? 385  PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 135 ? 9.118   -19.663 44.711 1.00 27.16 ? 385  PHE A CZ  1 
ATOM   978  N  N   . PRO A 1 136 ? 13.790  -22.036 41.973 1.00 23.96 ? 386  PRO A N   1 
ATOM   979  C  CA  . PRO A 1 136 ? 14.952  -21.278 42.365 1.00 25.80 ? 386  PRO A CA  1 
ATOM   980  C  C   . PRO A 1 136 ? 14.683  -19.784 42.307 1.00 19.50 ? 386  PRO A C   1 
ATOM   981  O  O   . PRO A 1 136 ? 13.901  -19.330 41.510 1.00 24.80 ? 386  PRO A O   1 
ATOM   982  C  CB  . PRO A 1 136 ? 15.973  -21.687 41.318 1.00 28.80 ? 386  PRO A CB  1 
ATOM   983  C  CG  . PRO A 1 136 ? 15.177  -22.184 40.166 1.00 28.26 ? 386  PRO A CG  1 
ATOM   984  C  CD  . PRO A 1 136 ? 13.759  -22.247 40.522 1.00 23.78 ? 386  PRO A CD  1 
ATOM   985  N  N   . PHE A 1 137 ? 15.308  -19.012 43.161 1.00 20.92 ? 387  PHE A N   1 
ATOM   986  C  CA  . PHE A 1 137 ? 15.123  -17.581 43.076 1.00 19.23 ? 387  PHE A CA  1 
ATOM   987  C  C   . PHE A 1 137 ? 15.885  -16.997 41.889 1.00 20.18 ? 387  PHE A C   1 
ATOM   988  O  O   . PHE A 1 137 ? 16.652  -17.682 41.212 1.00 21.50 ? 387  PHE A O   1 
ATOM   989  C  CB  . PHE A 1 137 ? 15.630  -16.920 44.342 1.00 23.95 ? 387  PHE A CB  1 
ATOM   990  C  CG  . PHE A 1 137 ? 14.846  -17.254 45.578 1.00 21.68 ? 387  PHE A CG  1 
ATOM   991  C  CD1 . PHE A 1 137 ? 15.497  -17.477 46.774 1.00 26.94 ? 387  PHE A CD1 1 
ATOM   992  C  CD2 . PHE A 1 137 ? 13.474  -17.273 45.569 1.00 21.88 ? 387  PHE A CD2 1 
ATOM   993  C  CE1 . PHE A 1 137 ? 14.791  -17.748 47.919 1.00 27.78 ? 387  PHE A CE1 1 
ATOM   994  C  CE2 . PHE A 1 137 ? 12.769  -17.530 46.720 1.00 23.66 ? 387  PHE A CE2 1 
ATOM   995  C  CZ  . PHE A 1 137 ? 13.434  -17.772 47.892 1.00 27.36 ? 387  PHE A CZ  1 
ATOM   996  N  N   . SER A 1 138 ? 15.678  -15.707 41.665 1.00 17.05 ? 388  SER A N   1 
ATOM   997  C  CA  . SER A 1 138 ? 16.374  -14.976 40.625 1.00 22.50 ? 388  SER A CA  1 
ATOM   998  C  C   . SER A 1 138 ? 17.862  -14.766 40.948 1.00 19.87 ? 388  SER A C   1 
ATOM   999  O  O   . SER A 1 138 ? 18.268  -14.606 42.106 1.00 19.34 ? 388  SER A O   1 
ATOM   1000 C  CB  . SER A 1 138 ? 15.700  -13.618 40.380 1.00 21.55 ? 388  SER A CB  1 
ATOM   1001 O  OG  . SER A 1 138 ? 15.901  -12.746 41.473 1.00 30.17 ? 388  SER A OG  1 
ATOM   1002 N  N   . LEU A 1 139 ? 18.662  -14.743 39.895 1.00 20.29 ? 389  LEU A N   1 
ATOM   1003 C  CA  . LEU A 1 139 ? 20.087  -14.472 40.028 1.00 22.11 ? 389  LEU A CA  1 
ATOM   1004 C  C   . LEU A 1 139 ? 20.303  -13.133 40.743 1.00 18.16 ? 389  LEU A C   1 
ATOM   1005 O  O   . LEU A 1 139 ? 21.199  -13.010 41.573 1.00 23.08 ? 389  LEU A O   1 
ATOM   1006 C  CB  . LEU A 1 139 ? 20.794  -14.507 38.657 1.00 16.24 ? 389  LEU A CB  1 
ATOM   1007 C  CG  . LEU A 1 139 ? 22.299  -14.234 38.647 1.00 15.49 ? 389  LEU A CG  1 
ATOM   1008 C  CD1 . LEU A 1 139 ? 22.917  -15.115 39.700 1.00 12.52 ? 389  LEU A CD1 1 
ATOM   1009 C  CD2 . LEU A 1 139 ? 22.926  -14.458 37.284 1.00 8.98  ? 389  LEU A CD2 1 
ATOM   1010 N  N   . GLN A 1 140 ? 19.474  -12.142 40.460 1.00 17.65 ? 390  GLN A N   1 
ATOM   1011 C  CA  . GLN A 1 140 ? 19.646  -10.841 41.125 1.00 18.71 ? 390  GLN A CA  1 
ATOM   1012 C  C   . GLN A 1 140 ? 19.463  -10.981 42.613 1.00 18.12 ? 390  GLN A C   1 
ATOM   1013 O  O   . GLN A 1 140 ? 20.283  -10.505 43.393 1.00 22.95 ? 390  GLN A O   1 
ATOM   1014 C  CB  . GLN A 1 140 ? 18.652  -9.830  40.617 1.00 18.33 ? 390  GLN A CB  1 
ATOM   1015 C  CG  . GLN A 1 140 ? 19.042  -8.397  40.865 1.00 25.94 ? 390  GLN A CG  1 
ATOM   1016 C  CD  . GLN A 1 140 ? 18.067  -7.468  40.221 1.00 26.02 ? 390  GLN A CD  1 
ATOM   1017 O  OE1 . GLN A 1 140 ? 17.549  -7.780  39.135 1.00 25.29 ? 390  GLN A OE1 1 
ATOM   1018 N  NE2 . GLN A 1 140 ? 17.780  -6.326  40.880 1.00 13.39 ? 390  GLN A NE2 1 
ATOM   1019 N  N   . HIS A 1 141 ? 18.391  -11.657 43.013 1.00 21.84 ? 391  HIS A N   1 
ATOM   1020 C  CA  . HIS A 1 141 ? 18.170  -11.869 44.424 1.00 22.62 ? 391  HIS A CA  1 
ATOM   1021 C  C   . HIS A 1 141 ? 19.319  -12.636 45.071 1.00 24.14 ? 391  HIS A C   1 
ATOM   1022 O  O   . HIS A 1 141 ? 19.716  -12.327 46.181 1.00 25.25 ? 391  HIS A O   1 
ATOM   1023 C  CB  . HIS A 1 141 ? 16.872  -12.594 44.702 1.00 21.53 ? 391  HIS A CB  1 
ATOM   1024 C  CG  . HIS A 1 141 ? 16.645  -12.810 46.161 1.00 13.60 ? 391  HIS A CG  1 
ATOM   1025 N  ND1 . HIS A 1 141 ? 16.263  -11.793 47.003 1.00 23.31 ? 391  HIS A ND1 1 
ATOM   1026 C  CD2 . HIS A 1 141 ? 16.780  -13.907 46.937 1.00 26.64 ? 391  HIS A CD2 1 
ATOM   1027 C  CE1 . HIS A 1 141 ? 16.170  -12.249 48.238 1.00 31.73 ? 391  HIS A CE1 1 
ATOM   1028 N  NE2 . HIS A 1 141 ? 16.458  -13.537 48.222 1.00 24.06 ? 391  HIS A NE2 1 
ATOM   1029 N  N   . ILE A 1 142 ? 19.869  -13.624 44.380 1.00 21.99 ? 392  ILE A N   1 
ATOM   1030 C  CA  . ILE A 1 142 ? 20.903  -14.442 45.002 1.00 23.11 ? 392  ILE A CA  1 
ATOM   1031 C  C   . ILE A 1 142 ? 22.187  -13.638 45.267 1.00 19.40 ? 392  ILE A C   1 
ATOM   1032 O  O   . ILE A 1 142 ? 22.816  -13.788 46.299 1.00 27.80 ? 392  ILE A O   1 
ATOM   1033 C  CB  . ILE A 1 142 ? 21.197  -15.736 44.177 1.00 24.34 ? 392  ILE A CB  1 
ATOM   1034 C  CG1 . ILE A 1 142 ? 19.943  -16.598 44.074 1.00 26.17 ? 392  ILE A CG1 1 
ATOM   1035 C  CG2 . ILE A 1 142 ? 22.267  -16.563 44.857 1.00 15.42 ? 392  ILE A CG2 1 
ATOM   1036 C  CD1 . ILE A 1 142 ? 20.093  -17.844 43.243 1.00 15.09 ? 392  ILE A CD1 1 
ATOM   1037 N  N   . CYS A 1 143 ? 22.577  -12.800 44.320 1.00 21.77 ? 393  CYS A N   1 
ATOM   1038 C  CA  . CYS A 1 143 ? 23.677  -11.867 44.521 1.00 25.36 ? 393  CYS A CA  1 
ATOM   1039 C  C   . CYS A 1 143 ? 23.444  -10.938 45.701 1.00 19.28 ? 393  CYS A C   1 
ATOM   1040 O  O   . CYS A 1 143 ? 24.315  -10.707 46.502 1.00 31.91 ? 393  CYS A O   1 
ATOM   1041 C  CB  . CYS A 1 143 ? 23.863  -11.010 43.276 1.00 28.66 ? 393  CYS A CB  1 
ATOM   1042 S  SG  . CYS A 1 143 ? 24.472  -11.919 41.888 1.00 34.52 ? 393  CYS A SG  1 
ATOM   1043 N  N   . ARG A 1 144 ? 22.258  -10.391 45.787 1.00 19.05 ? 394  ARG A N   1 
ATOM   1044 C  CA  . ARG A 1 144 ? 21.908  -9.537  46.900 1.00 23.09 ? 394  ARG A CA  1 
ATOM   1045 C  C   . ARG A 1 144 ? 22.199  -10.216 48.225 1.00 20.23 ? 394  ARG A C   1 
ATOM   1046 O  O   . ARG A 1 144 ? 22.779  -9.611  49.110 1.00 18.80 ? 394  ARG A O   1 
ATOM   1047 C  CB  . ARG A 1 144 ? 20.441  -9.212  46.786 1.00 20.93 ? 394  ARG A CB  1 
ATOM   1048 C  CG  . ARG A 1 144 ? 19.796  -8.404  47.901 1.00 27.49 ? 394  ARG A CG  1 
ATOM   1049 C  CD  . ARG A 1 144 ? 18.350  -8.843  47.950 1.00 24.76 ? 394  ARG A CD  1 
ATOM   1050 N  NE  . ARG A 1 144 ? 17.413  -7.759  47.851 1.00 31.43 ? 394  ARG A NE  1 
ATOM   1051 C  CZ  . ARG A 1 144 ? 16.184  -7.881  47.370 1.00 29.89 ? 394  ARG A CZ  1 
ATOM   1052 N  NH1 . ARG A 1 144 ? 15.736  -9.037  46.924 1.00 16.79 ? 394  ARG A NH1 1 
ATOM   1053 N  NH2 . ARG A 1 144 ? 15.382  -6.835  47.333 1.00 42.01 ? 394  ARG A NH2 1 
ATOM   1054 N  N   . THR A 1 145 ? 21.811  -11.476 48.355 1.00 20.04 ? 395  THR A N   1 
ATOM   1055 C  CA  . THR A 1 145 ? 21.908  -12.151 49.639 1.00 20.77 ? 395  THR A CA  1 
ATOM   1056 C  C   . THR A 1 145 ? 23.372  -12.286 50.007 1.00 24.96 ? 395  THR A C   1 
ATOM   1057 O  O   . THR A 1 145 ? 23.740  -12.076 51.159 1.00 30.70 ? 395  THR A O   1 
ATOM   1058 C  CB  . THR A 1 145 ? 21.265  -13.522 49.609 1.00 23.46 ? 395  THR A CB  1 
ATOM   1059 O  OG1 . THR A 1 145 ? 21.923  -14.345 48.644 1.00 30.42 ? 395  THR A OG1 1 
ATOM   1060 C  CG2 . THR A 1 145 ? 19.817  -13.418 49.234 1.00 16.77 ? 395  THR A CG2 1 
ATOM   1061 N  N   . VAL A 1 146 ? 24.206  -12.600 49.012 1.00 23.83 ? 396  VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 146 ? 25.659  -12.682 49.199 1.00 23.92 ? 396  VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 146 ? 26.317  -11.349 49.551 1.00 23.50 ? 396  VAL A C   1 
ATOM   1064 O  O   . VAL A 1 146 ? 27.191  -11.302 50.402 1.00 26.48 ? 396  VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 146 ? 26.385  -13.230 47.924 1.00 26.59 ? 396  VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 146 ? 27.905  -13.068 48.068 1.00 13.86 ? 396  VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 146 ? 26.019  -14.695 47.674 1.00 12.81 ? 396  VAL A CG2 1 
ATOM   1068 N  N   . ILE A 1 147 ? 25.926  -10.281 48.861 1.00 23.43 ? 397  ILE A N   1 
ATOM   1069 C  CA  . ILE A 1 147 ? 26.481  -8.943  49.109 1.00 21.46 ? 397  ILE A CA  1 
ATOM   1070 C  C   . ILE A 1 147 ? 26.111  -8.438  50.489 1.00 22.54 ? 397  ILE A C   1 
ATOM   1071 O  O   . ILE A 1 147 ? 26.961  -7.951  51.248 1.00 27.94 ? 397  ILE A O   1 
ATOM   1072 C  CB  . ILE A 1 147 ? 25.997  -7.932  48.069 1.00 21.47 ? 397  ILE A CB  1 
ATOM   1073 C  CG1 . ILE A 1 147 ? 26.605  -8.238  46.687 1.00 18.30 ? 397  ILE A CG1 1 
ATOM   1074 C  CG2 . ILE A 1 147 ? 26.396  -6.532  48.476 1.00 14.87 ? 397  ILE A CG2 1 
ATOM   1075 C  CD1 . ILE A 1 147 ? 25.949  -7.482  45.540 1.00 21.11 ? 397  ILE A CD1 1 
ATOM   1076 N  N   . CYS A 1 148 ? 24.833  -8.562  50.818 1.00 22.56 ? 398  CYS A N   1 
ATOM   1077 C  CA  . CYS A 1 148 ? 24.349  -8.169  52.139 1.00 26.26 ? 398  CYS A CA  1 
ATOM   1078 C  C   . CYS A 1 148 ? 25.057  -8.901  53.271 1.00 28.11 ? 398  CYS A C   1 
ATOM   1079 O  O   . CYS A 1 148 ? 25.214  -8.356  54.361 1.00 33.33 ? 398  CYS A O   1 
ATOM   1080 C  CB  . CYS A 1 148 ? 22.847  -8.410  52.252 1.00 30.96 ? 398  CYS A CB  1 
ATOM   1081 S  SG  . CYS A 1 148 ? 21.842  -7.268  51.303 1.00 30.05 ? 398  CYS A SG  1 
ATOM   1082 N  N   . ASN A 1 149 ? 25.470  -10.139 53.007 1.00 29.20 ? 399  ASN A N   1 
ATOM   1083 C  CA  . ASN A 1 149 ? 26.129  -10.959 54.004 1.00 26.45 ? 399  ASN A CA  1 
ATOM   1084 C  C   . ASN A 1 149 ? 27.539  -10.447 54.322 1.00 26.65 ? 399  ASN A C   1 
ATOM   1085 O  O   . ASN A 1 149 ? 28.018  -10.651 55.434 1.00 32.07 ? 399  ASN A O   1 
ATOM   1086 C  CB  . ASN A 1 149 ? 26.165  -12.407 53.510 1.00 28.81 ? 399  ASN A CB  1 
ATOM   1087 C  CG  . ASN A 1 149 ? 26.700  -13.383 54.559 1.00 34.86 ? 399  ASN A CG  1 
ATOM   1088 O  OD1 . ASN A 1 149 ? 26.216  -13.429 55.694 1.00 27.60 ? 399  ASN A OD1 1 
ATOM   1089 N  ND2 . ASN A 1 149 ? 27.696  -14.181 54.168 1.00 19.92 ? 399  ASN A ND2 1 
ATOM   1090 N  N   . CYS A 1 150 ? 28.186  -9.774  53.359 1.00 31.81 ? 400  CYS A N   1 
ATOM   1091 C  CA  . CYS A 1 150 ? 29.556  -9.215  53.512 1.00 33.20 ? 400  CYS A CA  1 
ATOM   1092 C  C   . CYS A 1 150 ? 29.600  -7.815  54.099 1.00 31.95 ? 400  CYS A C   1 
ATOM   1093 O  O   . CYS A 1 150 ? 30.651  -7.378  54.592 1.00 36.27 ? 400  CYS A O   1 
ATOM   1094 C  CB  . CYS A 1 150 ? 30.242  -9.034  52.158 1.00 32.62 ? 400  CYS A CB  1 
ATOM   1095 S  SG  . CYS A 1 150 ? 30.240  -10.392 51.096 1.00 46.57 ? 400  CYS A SG  1 
ATOM   1096 N  N   . THR A 1 151 ? 28.495  -7.097  53.958 1.00 30.19 ? 401  THR A N   1 
ATOM   1097 C  CA  . THR A 1 151 ? 28.453  -5.654  54.160 1.00 33.39 ? 401  THR A CA  1 
ATOM   1098 C  C   . THR A 1 151 ? 27.479  -5.333  55.294 1.00 31.03 ? 401  THR A C   1 
ATOM   1099 O  O   . THR A 1 151 ? 26.835  -6.221  55.851 1.00 38.43 ? 401  THR A O   1 
ATOM   1100 C  CB  . THR A 1 151 ? 27.992  -4.959  52.836 1.00 35.70 ? 401  THR A CB  1 
ATOM   1101 O  OG1 . THR A 1 151 ? 28.698  -3.739  52.639 1.00 36.86 ? 401  THR A OG1 1 
ATOM   1102 C  CG2 . THR A 1 151 ? 26.524  -4.658  52.856 1.00 41.86 ? 401  THR A CG2 1 
ATOM   1103 N  N   . THR A 1 152 ? 27.374  -4.063  55.636 1.00 28.04 ? 402  THR A N   1 
ATOM   1104 C  CA  . THR A 1 152 ? 26.388  -3.600  56.589 1.00 26.64 ? 402  THR A CA  1 
ATOM   1105 C  C   . THR A 1 152 ? 25.536  -2.597  55.843 1.00 28.90 ? 402  THR A C   1 
ATOM   1106 O  O   . THR A 1 152 ? 25.848  -2.253  54.685 1.00 29.23 ? 402  THR A O   1 
ATOM   1107 C  CB  . THR A 1 152 ? 27.015  -2.874  57.808 1.00 29.81 ? 402  THR A CB  1 
ATOM   1108 O  OG1 . THR A 1 152 ? 27.625  -1.659  57.362 1.00 21.40 ? 402  THR A OG1 1 
ATOM   1109 C  CG2 . THR A 1 152 ? 28.047  -3.742  58.539 1.00 11.94 ? 402  THR A CG2 1 
ATOM   1110 N  N   . TYR A 1 153 ? 24.475  -2.128  56.507 1.00 27.06 ? 403  TYR A N   1 
ATOM   1111 C  CA  . TYR A 1 153 ? 23.525  -1.204  55.883 1.00 27.13 ? 403  TYR A CA  1 
ATOM   1112 C  C   . TYR A 1 153 ? 24.244  0.071   55.493 1.00 20.98 ? 403  TYR A C   1 
ATOM   1113 O  O   . TYR A 1 153 ? 24.138  0.488   54.341 1.00 25.38 ? 403  TYR A O   1 
ATOM   1114 C  CB  . TYR A 1 153 ? 22.312  -0.924  56.785 1.00 24.97 ? 403  TYR A CB  1 
ATOM   1115 C  CG  . TYR A 1 153 ? 21.150  -0.243  56.098 1.00 23.15 ? 403  TYR A CG  1 
ATOM   1116 C  CD1 . TYR A 1 153 ? 20.104  -0.970  55.561 1.00 24.31 ? 403  TYR A CD1 1 
ATOM   1117 C  CD2 . TYR A 1 153 ? 21.091  1.137   56.007 1.00 24.15 ? 403  TYR A CD2 1 
ATOM   1118 C  CE1 . TYR A 1 153 ? 19.053  -0.334  54.930 1.00 22.34 ? 403  TYR A CE1 1 
ATOM   1119 C  CE2 . TYR A 1 153 ? 20.056  1.779   55.379 1.00 18.73 ? 403  TYR A CE2 1 
ATOM   1120 C  CZ  . TYR A 1 153 ? 19.036  1.051   54.837 1.00 25.17 ? 403  TYR A CZ  1 
ATOM   1121 O  OH  . TYR A 1 153 ? 17.987  1.728   54.224 1.00 23.82 ? 403  TYR A OH  1 
ATOM   1122 N  N   . ASP A 1 154 ? 25.002  0.679   56.401 1.00 22.57 ? 404  ASP A N   1 
ATOM   1123 C  CA  . ASP A 1 154 ? 25.705  1.926   56.016 1.00 29.46 ? 404  ASP A CA  1 
ATOM   1124 C  C   . ASP A 1 154 ? 26.737  1.629   54.912 1.00 27.53 ? 404  ASP A C   1 
ATOM   1125 O  O   . ASP A 1 154 ? 26.934  2.433   54.016 1.00 35.04 ? 404  ASP A O   1 
ATOM   1126 C  CB  . ASP A 1 154 ? 26.330  2.702   57.211 1.00 29.32 ? 404  ASP A CB  1 
ATOM   1127 C  CG  . ASP A 1 154 ? 25.881  4.236   57.254 1.00 48.83 ? 404  ASP A CG  1 
ATOM   1128 O  OD1 . ASP A 1 154 ? 26.755  5.123   57.036 1.00 36.25 ? 404  ASP A OD1 1 
ATOM   1129 O  OD2 . ASP A 1 154 ? 24.656  4.548   57.498 1.00 49.30 ? 404  ASP A OD2 1 
ATOM   1130 N  N   . GLY A 1 155 ? 27.356  0.458   54.956 1.00 20.40 ? 405  GLY A N   1 
ATOM   1131 C  CA  . GLY A 1 155 ? 28.301  0.058   53.929 1.00 20.22 ? 405  GLY A CA  1 
ATOM   1132 C  C   . GLY A 1 155 ? 27.747  0.050   52.513 1.00 22.56 ? 405  GLY A C   1 
ATOM   1133 O  O   . GLY A 1 155 ? 28.492  0.269   51.553 1.00 23.98 ? 405  GLY A O   1 
ATOM   1134 N  N   . ILE A 1 156 ? 26.444  -0.199  52.370 1.00 24.03 ? 406  ILE A N   1 
ATOM   1135 C  CA  . ILE A 1 156 ? 25.830  -0.263  51.043 1.00 23.29 ? 406  ILE A CA  1 
ATOM   1136 C  C   . ILE A 1 156 ? 26.015  1.065   50.298 1.00 27.63 ? 406  ILE A C   1 
ATOM   1137 O  O   . ILE A 1 156 ? 26.219  1.061   49.081 1.00 26.84 ? 406  ILE A O   1 
ATOM   1138 C  CB  . ILE A 1 156 ? 24.343  -0.716  51.107 1.00 20.70 ? 406  ILE A CB  1 
ATOM   1139 C  CG1 . ILE A 1 156 ? 24.263  -2.195  51.485 1.00 27.18 ? 406  ILE A CG1 1 
ATOM   1140 C  CG2 . ILE A 1 156 ? 23.652  -0.575  49.779 1.00 22.28 ? 406  ILE A CG2 1 
ATOM   1141 C  CD1 . ILE A 1 156 ? 22.882  -2.670  51.882 1.00 19.40 ? 406  ILE A CD1 1 
ATOM   1142 N  N   . ASP A 1 157 ? 26.002  2.183   51.027 1.00 29.25 ? 407  ASP A N   1 
ATOM   1143 C  CA  . ASP A 1 157 ? 26.107  3.515   50.407 1.00 30.90 ? 407  ASP A CA  1 
ATOM   1144 C  C   . ASP A 1 157 ? 27.443  3.746   49.709 1.00 30.00 ? 407  ASP A C   1 
ATOM   1145 O  O   . ASP A 1 157 ? 27.499  4.418   48.679 1.00 31.41 ? 407  ASP A O   1 
ATOM   1146 C  CB  . ASP A 1 157 ? 25.870  4.621   51.439 1.00 34.54 ? 407  ASP A CB  1 
ATOM   1147 C  CG  . ASP A 1 157 ? 24.378  4.857   51.742 1.00 39.75 ? 407  ASP A CG  1 
ATOM   1148 O  OD1 . ASP A 1 157 ? 23.537  4.887   50.794 1.00 44.97 ? 407  ASP A OD1 1 
ATOM   1149 O  OD2 . ASP A 1 157 ? 24.074  5.051   52.940 1.00 34.69 ? 407  ASP A OD2 1 
ATOM   1150 N  N   . ALA A 1 158 ? 28.511  3.162   50.239 1.00 30.93 ? 408  ALA A N   1 
ATOM   1151 C  CA  . ALA A 1 158 ? 29.843  3.295   49.627 1.00 29.09 ? 408  ALA A CA  1 
ATOM   1152 C  C   . ALA A 1 158 ? 30.099  2.354   48.424 1.00 30.20 ? 408  ALA A C   1 
ATOM   1153 O  O   . ALA A 1 158 ? 31.204  2.347   47.878 1.00 33.49 ? 408  ALA A O   1 
ATOM   1154 C  CB  . ALA A 1 158 ? 30.944  3.103   50.707 1.00 19.86 ? 408  ALA A CB  1 
ATOM   1155 N  N   . LEU A 1 159 ? 29.119  1.550   48.011 1.00 27.84 ? 409  LEU A N   1 
ATOM   1156 C  CA  . LEU A 1 159 ? 29.326  0.645   46.859 1.00 29.69 ? 409  LEU A CA  1 
ATOM   1157 C  C   . LEU A 1 159 ? 29.276  1.384   45.508 1.00 29.51 ? 409  LEU A C   1 
ATOM   1158 O  O   . LEU A 1 159 ? 28.528  2.355   45.350 1.00 27.37 ? 409  LEU A O   1 
ATOM   1159 C  CB  . LEU A 1 159 ? 28.283  -0.456  46.832 1.00 25.00 ? 409  LEU A CB  1 
ATOM   1160 C  CG  . LEU A 1 159 ? 28.201  -1.372  48.044 1.00 29.23 ? 409  LEU A CG  1 
ATOM   1161 C  CD1 . LEU A 1 159 ? 26.923  -2.245  47.968 1.00 25.16 ? 409  LEU A CD1 1 
ATOM   1162 C  CD2 . LEU A 1 159 ? 29.427  -2.224  48.096 1.00 20.94 ? 409  LEU A CD2 1 
ATOM   1163 N  N   . PRO A 1 160 ? 30.048  0.904   44.516 1.00 30.05 ? 410  PRO A N   1 
ATOM   1164 C  CA  . PRO A 1 160 ? 30.066  1.553   43.212 1.00 30.94 ? 410  PRO A CA  1 
ATOM   1165 C  C   . PRO A 1 160 ? 28.944  1.087   42.273 1.00 32.28 ? 410  PRO A C   1 
ATOM   1166 O  O   . PRO A 1 160 ? 29.226  0.586   41.184 1.00 33.42 ? 410  PRO A O   1 
ATOM   1167 C  CB  . PRO A 1 160 ? 31.443  1.155   42.663 1.00 29.37 ? 410  PRO A CB  1 
ATOM   1168 C  CG  . PRO A 1 160 ? 31.663  -0.205  43.196 1.00 24.54 ? 410  PRO A CG  1 
ATOM   1169 C  CD  . PRO A 1 160 ? 30.966  -0.250  44.553 1.00 27.87 ? 410  PRO A CD  1 
ATOM   1170 N  N   . ILE A 1 161 ? 27.692  1.279   42.684 1.00 31.24 ? 411  ILE A N   1 
ATOM   1171 C  CA  . ILE A 1 161 ? 26.512  0.850   41.901 1.00 29.29 ? 411  ILE A CA  1 
ATOM   1172 C  C   . ILE A 1 161 ? 25.506  1.997   41.896 1.00 27.16 ? 411  ILE A C   1 
ATOM   1173 O  O   . ILE A 1 161 ? 25.626  2.881   42.718 1.00 29.54 ? 411  ILE A O   1 
ATOM   1174 C  CB  . ILE A 1 161 ? 25.843  -0.420  42.508 1.00 28.80 ? 411  ILE A CB  1 
ATOM   1175 C  CG1 . ILE A 1 161 ? 25.531  -0.232  43.997 1.00 25.37 ? 411  ILE A CG1 1 
ATOM   1176 C  CG2 . ILE A 1 161 ? 26.715  -1.651  42.312 1.00 22.15 ? 411  ILE A CG2 1 
ATOM   1177 C  CD1 . ILE A 1 161 ? 24.847  -1.429  44.612 1.00 22.64 ? 411  ILE A CD1 1 
ATOM   1178 N  N   . PRO A 1 162 ? 24.509  1.994   40.986 1.00 30.76 ? 412  PRO A N   1 
ATOM   1179 C  CA  . PRO A 1 162 ? 23.535  3.109   41.027 1.00 28.61 ? 412  PRO A CA  1 
ATOM   1180 C  C   . PRO A 1 162 ? 22.704  3.055   42.299 1.00 31.12 ? 412  PRO A C   1 
ATOM   1181 O  O   . PRO A 1 162 ? 22.714  2.043   42.997 1.00 32.75 ? 412  PRO A O   1 
ATOM   1182 C  CB  . PRO A 1 162 ? 22.646  2.870   39.803 1.00 33.00 ? 412  PRO A CB  1 
ATOM   1183 C  CG  . PRO A 1 162 ? 23.362  1.823   38.966 1.00 29.97 ? 412  PRO A CG  1 
ATOM   1184 C  CD  . PRO A 1 162 ? 24.203  1.028   39.917 1.00 29.29 ? 412  PRO A CD  1 
ATOM   1185 N  N   . SER A 1 163 ? 21.990  4.117   42.620 1.00 31.90 ? 413  SER A N   1 
ATOM   1186 C  CA  . SER A 1 163 ? 21.215  4.090   43.859 1.00 33.81 ? 413  SER A CA  1 
ATOM   1187 C  C   . SER A 1 163 ? 19.914  3.284   43.724 1.00 32.36 ? 413  SER A C   1 
ATOM   1188 O  O   . SER A 1 163 ? 19.405  2.747   44.715 1.00 25.82 ? 413  SER A O   1 
ATOM   1189 C  CB  . SER A 1 163 ? 20.969  5.495   44.404 1.00 30.40 ? 413  SER A CB  1 
ATOM   1190 O  OG  . SER A 1 163 ? 21.015  6.411   43.369 1.00 33.78 ? 413  SER A OG  1 
ATOM   1191 N  N   . SER A 1 164 ? 19.403  3.144   42.507 1.00 31.40 ? 414  SER A N   1 
ATOM   1192 C  CA  . SER A 1 164 ? 18.355  2.150   42.292 1.00 33.37 ? 414  SER A CA  1 
ATOM   1193 C  C   . SER A 1 164 ? 18.790  0.778   42.872 1.00 28.51 ? 414  SER A C   1 
ATOM   1194 O  O   . SER A 1 164 ? 17.985  0.072   43.456 1.00 22.67 ? 414  SER A O   1 
ATOM   1195 C  CB  . SER A 1 164 ? 17.985  2.031   40.807 1.00 35.35 ? 414  SER A CB  1 
ATOM   1196 O  OG  . SER A 1 164 ? 19.048  1.473   40.050 1.00 37.54 ? 414  SER A OG  1 
ATOM   1197 N  N   . MET A 1 165 ? 20.069  0.428   42.757 1.00 27.29 ? 415  MET A N   1 
ATOM   1198 C  CA  . MET A 1 165 ? 20.537  -0.864  43.250 1.00 28.63 ? 415  MET A CA  1 
ATOM   1199 C  C   . MET A 1 165 ? 20.846  -0.831  44.724 1.00 27.50 ? 415  MET A C   1 
ATOM   1200 O  O   . MET A 1 165 ? 20.717  -1.840  45.422 1.00 31.68 ? 415  MET A O   1 
ATOM   1201 C  CB  . MET A 1 165 ? 21.762  -1.348  42.483 1.00 28.96 ? 415  MET A CB  1 
ATOM   1202 C  CG  . MET A 1 165 ? 21.395  -2.114  41.245 1.00 41.85 ? 415  MET A CG  1 
ATOM   1203 S  SD  . MET A 1 165 ? 20.541  -3.651  41.616 1.00 42.84 ? 415  MET A SD  1 
ATOM   1204 C  CE  . MET A 1 165 ? 19.535  -3.790  40.149 1.00 48.54 ? 415  MET A CE  1 
ATOM   1205 N  N   . LYS A 1 166 ? 21.263  0.319   45.208 1.00 19.73 ? 416  LYS A N   1 
ATOM   1206 C  CA  . LYS A 1 166 ? 21.421  0.459   46.619 1.00 19.46 ? 416  LYS A CA  1 
ATOM   1207 C  C   . LYS A 1 166 ? 20.067  0.261   47.266 1.00 23.43 ? 416  LYS A C   1 
ATOM   1208 O  O   . LYS A 1 166 ? 19.957  -0.471  48.254 1.00 26.78 ? 416  LYS A O   1 
ATOM   1209 C  CB  . LYS A 1 166 ? 22.027  1.812   46.947 1.00 23.52 ? 416  LYS A CB  1 
ATOM   1210 C  CG  . LYS A 1 166 ? 23.496  1.876   46.578 1.00 14.89 ? 416  LYS A CG  1 
ATOM   1211 C  CD  . LYS A 1 166 ? 23.999  3.295   46.454 1.00 19.33 ? 416  LYS A CD  1 
ATOM   1212 C  CE  . LYS A 1 166 ? 25.526  3.349   46.382 1.00 29.30 ? 416  LYS A CE  1 
ATOM   1213 N  NZ  . LYS A 1 166 ? 26.062  4.735   46.150 1.00 25.08 ? 416  LYS A NZ  1 
ATOM   1214 N  N   . LEU A 1 167 ? 19.032  0.871   46.683 1.00 24.55 ? 417  LEU A N   1 
ATOM   1215 C  CA  . LEU A 1 167 ? 17.643  0.682   47.149 1.00 25.86 ? 417  LEU A CA  1 
ATOM   1216 C  C   . LEU A 1 167 ? 17.270  -0.817  47.283 1.00 26.14 ? 417  LEU A C   1 
ATOM   1217 O  O   . LEU A 1 167 ? 16.630  -1.253  48.252 1.00 25.65 ? 417  LEU A O   1 
ATOM   1218 C  CB  . LEU A 1 167 ? 16.678  1.387   46.191 1.00 22.22 ? 417  LEU A CB  1 
ATOM   1219 C  CG  . LEU A 1 167 ? 15.178  1.350   46.510 1.00 28.21 ? 417  LEU A CG  1 
ATOM   1220 C  CD1 . LEU A 1 167 ? 14.468  2.618   45.979 1.00 26.32 ? 417  LEU A CD1 1 
ATOM   1221 C  CD2 . LEU A 1 167 ? 14.525  0.079   45.956 1.00 25.78 ? 417  LEU A CD2 1 
ATOM   1222 N  N   . TYR A 1 168 ? 17.705  -1.596  46.302 1.00 26.24 ? 418  TYR A N   1 
ATOM   1223 C  CA  . TYR A 1 168 ? 17.381  -3.000  46.228 1.00 22.57 ? 418  TYR A CA  1 
ATOM   1224 C  C   . TYR A 1 168 ? 18.141  -3.770  47.296 1.00 21.64 ? 418  TYR A C   1 
ATOM   1225 O  O   . TYR A 1 168 ? 17.555  -4.624  47.976 1.00 20.10 ? 418  TYR A O   1 
ATOM   1226 C  CB  . TYR A 1 168 ? 17.720  -3.522  44.837 1.00 22.99 ? 418  TYR A CB  1 
ATOM   1227 C  CG  . TYR A 1 168 ? 17.435  -4.982  44.584 1.00 22.35 ? 418  TYR A CG  1 
ATOM   1228 C  CD1 . TYR A 1 168 ? 16.126  -5.440  44.317 1.00 17.55 ? 418  TYR A CD1 1 
ATOM   1229 C  CD2 . TYR A 1 168 ? 18.463  -5.897  44.558 1.00 13.58 ? 418  TYR A CD2 1 
ATOM   1230 C  CE1 . TYR A 1 168 ? 15.863  -6.779  44.057 1.00 10.48 ? 418  TYR A CE1 1 
ATOM   1231 C  CE2 . TYR A 1 168 ? 18.208  -7.248  44.291 1.00 25.01 ? 418  TYR A CE2 1 
ATOM   1232 C  CZ  . TYR A 1 168 ? 16.912  -7.680  44.039 1.00 26.15 ? 418  TYR A CZ  1 
ATOM   1233 O  OH  . TYR A 1 168 ? 16.690  -9.010  43.760 1.00 25.87 ? 418  TYR A OH  1 
ATOM   1234 N  N   . LEU A 1 169 ? 19.432  -3.484  47.464 1.00 15.08 ? 419  LEU A N   1 
ATOM   1235 C  CA  . LEU A 1 169 ? 20.215  -4.214  48.486 1.00 14.52 ? 419  LEU A CA  1 
ATOM   1236 C  C   . LEU A 1 169 ? 19.718  -3.923  49.890 1.00 14.90 ? 419  LEU A C   1 
ATOM   1237 O  O   . LEU A 1 169 ? 19.913  -4.733  50.778 1.00 22.38 ? 419  LEU A O   1 
ATOM   1238 C  CB  . LEU A 1 169 ? 21.708  -3.894  48.414 1.00 14.50 ? 419  LEU A CB  1 
ATOM   1239 C  CG  . LEU A 1 169 ? 22.381  -4.292  47.100 1.00 22.18 ? 419  LEU A CG  1 
ATOM   1240 C  CD1 . LEU A 1 169 ? 23.769  -3.685  46.983 1.00 19.40 ? 419  LEU A CD1 1 
ATOM   1241 C  CD2 . LEU A 1 169 ? 22.439  -5.774  46.934 1.00 15.45 ? 419  LEU A CD2 1 
ATOM   1242 N  N   . LYS A 1 170 ? 19.057  -2.773  50.090 1.00 18.55 ? 420  LYS A N   1 
ATOM   1243 C  CA  . LYS A 1 170 ? 18.678  -2.341  51.423 1.00 17.12 ? 420  LYS A CA  1 
ATOM   1244 C  C   . LYS A 1 170 ? 17.321  -2.870  51.843 1.00 22.85 ? 420  LYS A C   1 
ATOM   1245 O  O   . LYS A 1 170 ? 16.887  -2.616  52.967 1.00 25.64 ? 420  LYS A O   1 
ATOM   1246 C  CB  . LYS A 1 170 ? 18.649  -0.822  51.479 1.00 21.01 ? 420  LYS A CB  1 
ATOM   1247 C  CG  . LYS A 1 170 ? 20.023  -0.148  51.469 1.00 25.83 ? 420  LYS A CG  1 
ATOM   1248 C  CD  . LYS A 1 170 ? 19.867  1.379   51.329 1.00 25.53 ? 420  LYS A CD  1 
ATOM   1249 C  CE  . LYS A 1 170 ? 21.135  2.135   51.690 1.00 25.40 ? 420  LYS A CE  1 
ATOM   1250 N  NZ  . LYS A 1 170 ? 20.875  3.552   52.066 1.00 25.69 ? 420  LYS A NZ  1 
ATOM   1251 N  N   . GLU A 1 171 ? 16.640  -3.584  50.949 1.00 21.47 ? 421  GLU A N   1 
ATOM   1252 C  CA  . GLU A 1 171 ? 15.266  -4.032  51.207 1.00 23.29 ? 421  GLU A CA  1 
ATOM   1253 C  C   . GLU A 1 171 ? 15.074  -4.810  52.517 1.00 24.28 ? 421  GLU A C   1 
ATOM   1254 O  O   . GLU A 1 171 ? 14.117  -4.539  53.242 1.00 19.77 ? 421  GLU A O   1 
ATOM   1255 C  CB  . GLU A 1 171 ? 14.712  -4.869  50.034 1.00 20.13 ? 421  GLU A CB  1 
ATOM   1256 C  CG  . GLU A 1 171 ? 13.295  -5.392  50.291 1.00 32.05 ? 421  GLU A CG  1 
ATOM   1257 C  CD  . GLU A 1 171 ? 12.436  -5.606  49.044 1.00 39.66 ? 421  GLU A CD  1 
ATOM   1258 O  OE1 . GLU A 1 171 ? 12.975  -5.690  47.909 1.00 40.61 ? 421  GLU A OE1 1 
ATOM   1259 O  OE2 . GLU A 1 171 ? 11.193  -5.687  49.224 1.00 47.56 ? 421  GLU A OE2 1 
ATOM   1260 N  N   . TYR A 1 172 ? 15.947  -5.789  52.799 1.00 22.27 ? 422  TYR A N   1 
ATOM   1261 C  CA  . TYR A 1 172 ? 15.751  -6.673  53.957 1.00 20.51 ? 422  TYR A CA  1 
ATOM   1262 C  C   . TYR A 1 172 ? 16.420  -6.125  55.206 1.00 23.32 ? 422  TYR A C   1 
ATOM   1263 O  O   . TYR A 1 172 ? 17.404  -6.661  55.726 1.00 23.63 ? 422  TYR A O   1 
ATOM   1264 C  CB  . TYR A 1 172 ? 16.146  -8.141  53.645 1.00 22.90 ? 422  TYR A CB  1 
ATOM   1265 C  CG  . TYR A 1 172 ? 15.180  -8.759  52.653 1.00 24.50 ? 422  TYR A CG  1 
ATOM   1266 C  CD1 . TYR A 1 172 ? 15.387  -8.636  51.279 1.00 22.39 ? 422  TYR A CD1 1 
ATOM   1267 C  CD2 . TYR A 1 172 ? 14.022  -9.383  53.079 1.00 23.57 ? 422  TYR A CD2 1 
ATOM   1268 C  CE1 . TYR A 1 172 ? 14.497  -9.176  50.382 1.00 22.63 ? 422  TYR A CE1 1 
ATOM   1269 C  CE2 . TYR A 1 172 ? 13.108  -9.926  52.170 1.00 24.65 ? 422  TYR A CE2 1 
ATOM   1270 C  CZ  . TYR A 1 172 ? 13.347  -9.812  50.829 1.00 15.70 ? 422  TYR A CZ  1 
ATOM   1271 O  OH  . TYR A 1 172 ? 12.450  -10.308 49.914 1.00 26.99 ? 422  TYR A OH  1 
ATOM   1272 N  N   . HIS A 1 173 ? 15.847  -5.033  55.694 1.00 25.20 ? 423  HIS A N   1 
ATOM   1273 C  CA  . HIS A 1 173 ? 16.338  -4.413  56.901 1.00 22.43 ? 423  HIS A CA  1 
ATOM   1274 C  C   . HIS A 1 173 ? 15.229  -4.299  57.921 1.00 23.42 ? 423  HIS A C   1 
ATOM   1275 O  O   . HIS A 1 173 ? 14.039  -4.399  57.598 1.00 24.05 ? 423  HIS A O   1 
ATOM   1276 C  CB  . HIS A 1 173 ? 16.913  -3.026  56.584 1.00 22.99 ? 423  HIS A CB  1 
ATOM   1277 C  CG  . HIS A 1 173 ? 15.873  -2.013  56.264 1.00 20.70 ? 423  HIS A CG  1 
ATOM   1278 N  ND1 . HIS A 1 173 ? 15.278  -1.926  55.025 1.00 23.08 ? 423  HIS A ND1 1 
ATOM   1279 C  CD2 . HIS A 1 173 ? 15.293  -1.063  57.030 1.00 22.39 ? 423  HIS A CD2 1 
ATOM   1280 C  CE1 . HIS A 1 173 ? 14.374  -0.962  55.040 1.00 19.70 ? 423  HIS A CE1 1 
ATOM   1281 N  NE2 . HIS A 1 173 ? 14.357  -0.428  56.247 1.00 23.31 ? 423  HIS A NE2 1 
ATOM   1282 N  N   . TYR A 1 174 ? 15.633  -4.072  59.159 1.00 20.97 ? 424  TYR A N   1 
ATOM   1283 C  CA  . TYR A 1 174 ? 14.694  -3.776  60.210 1.00 23.85 ? 424  TYR A CA  1 
ATOM   1284 C  C   . TYR A 1 174 ? 15.058  -2.429  60.809 1.00 21.64 ? 424  TYR A C   1 
ATOM   1285 O  O   . TYR A 1 174 ? 16.118  -1.899  60.529 1.00 26.54 ? 424  TYR A O   1 
ATOM   1286 C  CB  . TYR A 1 174 ? 14.662  -4.893  61.256 1.00 23.42 ? 424  TYR A CB  1 
ATOM   1287 C  CG  . TYR A 1 174 ? 15.936  -5.067  62.038 1.00 17.48 ? 424  TYR A CG  1 
ATOM   1288 C  CD1 . TYR A 1 174 ? 16.165  -4.316  63.181 1.00 23.24 ? 424  TYR A CD1 1 
ATOM   1289 C  CD2 . TYR A 1 174 ? 16.901  -5.988  61.651 1.00 17.57 ? 424  TYR A CD2 1 
ATOM   1290 C  CE1 . TYR A 1 174 ? 17.341  -4.461  63.921 1.00 24.07 ? 424  TYR A CE1 1 
ATOM   1291 C  CE2 . TYR A 1 174 ? 18.086  -6.146  62.383 1.00 21.84 ? 424  TYR A CE2 1 
ATOM   1292 C  CZ  . TYR A 1 174 ? 18.297  -5.372  63.522 1.00 18.41 ? 424  TYR A CZ  1 
ATOM   1293 O  OH  . TYR A 1 174 ? 19.432  -5.497  64.294 1.00 24.32 ? 424  TYR A OH  1 
ATOM   1294 N  N   . LYS A 1 175 ? 14.162  -1.889  61.620 1.00 22.54 ? 425  LYS A N   1 
ATOM   1295 C  CA  . LYS A 1 175 ? 14.260  -0.523  62.120 1.00 25.84 ? 425  LYS A CA  1 
ATOM   1296 C  C   . LYS A 1 175 ? 14.637  -0.608  63.600 1.00 21.92 ? 425  LYS A C   1 
ATOM   1297 O  O   . LYS A 1 175 ? 13.881  -1.125  64.396 1.00 26.67 ? 425  LYS A O   1 
ATOM   1298 C  CB  . LYS A 1 175 ? 12.915  0.218   61.904 1.00 25.09 ? 425  LYS A CB  1 
ATOM   1299 C  CG  . LYS A 1 175 ? 12.632  0.652   60.431 1.00 17.99 ? 425  LYS A CG  1 
ATOM   1300 N  N   . SER A 1 176 ? 15.818  -0.139  63.970 1.00 26.22 ? 426  SER A N   1 
ATOM   1301 C  CA  . SER A 1 176 ? 16.278  -0.245  65.370 1.00 29.98 ? 426  SER A CA  1 
ATOM   1302 C  C   . SER A 1 176 ? 16.061  1.069   66.124 1.00 27.51 ? 426  SER A C   1 
ATOM   1303 O  O   . SER A 1 176 ? 16.613  2.087   65.727 1.00 29.04 ? 426  SER A O   1 
ATOM   1304 C  CB  . SER A 1 176 ? 17.762  -0.634  65.417 1.00 29.01 ? 426  SER A CB  1 
ATOM   1305 O  OG  . SER A 1 176 ? 18.129  -1.047  66.720 1.00 28.45 ? 426  SER A OG  1 
ATOM   1306 N  N   . LYS A 1 177 ? 15.266  1.035   67.199 1.00 30.63 ? 427  LYS A N   1 
ATOM   1307 C  CA  . LYS A 1 177 ? 14.882  2.245   67.947 1.00 34.25 ? 427  LYS A CA  1 
ATOM   1308 C  C   . LYS A 1 177 ? 15.606  2.277   69.307 1.00 41.07 ? 427  LYS A C   1 
ATOM   1309 O  O   . LYS A 1 177 ? 15.252  3.049   70.208 1.00 45.00 ? 427  LYS A O   1 
ATOM   1310 C  CB  . LYS A 1 177 ? 13.346  2.330   68.136 1.00 34.16 ? 427  LYS A CB  1 
ATOM   1311 C  CG  . LYS A 1 177 ? 12.498  2.660   66.871 1.00 35.33 ? 427  LYS A CG  1 
ATOM   1312 N  N   . VAL A 1 178 ? 16.656  1.475   69.433 1.00 45.74 ? 428  VAL A N   1 
ATOM   1313 C  CA  . VAL A 1 178 ? 17.282  1.219   70.723 1.00 47.47 ? 428  VAL A CA  1 
ATOM   1314 C  C   . VAL A 1 178 ? 18.785  1.581   70.653 1.00 54.70 ? 428  VAL A C   1 
ATOM   1315 O  O   . VAL A 1 178 ? 19.393  1.526   69.567 1.00 54.37 ? 428  VAL A O   1 
ATOM   1316 C  CB  . VAL A 1 178 ? 17.060  -0.295  71.091 1.00 47.11 ? 428  VAL A CB  1 
ATOM   1317 C  CG1 . VAL A 1 178 ? 18.290  -1.154  70.704 1.00 24.31 ? 428  VAL A CG1 1 
ATOM   1318 C  CG2 . VAL A 1 178 ? 16.672  -0.469  72.558 1.00 38.92 ? 428  VAL A CG2 1 
ATOM   1319 N  N   . ARG A 1 179 ? 19.354  1.990   71.797 1.00 61.76 ? 429  ARG A N   1 
ATOM   1320 C  CA  . ARG A 1 179 ? 20.833  1.987   72.052 1.00 61.03 ? 429  ARG A CA  1 
ATOM   1321 C  C   . ARG A 1 179 ? 21.072  2.146   73.545 1.00 60.33 ? 429  ARG A C   1 
ATOM   1322 O  O   . ARG A 1 179 ? 20.111  2.269   74.298 1.00 56.67 ? 429  ARG A O   1 
ATOM   1323 C  CB  . ARG A 1 179 ? 21.605  3.077   71.275 1.00 58.93 ? 429  ARG A CB  1 
ATOM   1324 C  CG  . ARG A 1 179 ? 22.526  2.528   70.164 1.00 54.85 ? 429  ARG A CG  1 
ATOM   1325 C  CD  . ARG A 1 179 ? 22.890  3.613   69.122 1.00 54.45 ? 429  ARG A CD  1 
ATOM   1326 N  N   . MET B 2 1   ? 21.191  -40.085 35.191 1.00 46.81 ? 1    MET B N   1 
ATOM   1327 C  CA  . MET B 2 1   ? 22.015  -39.112 35.964 1.00 50.81 ? 1    MET B CA  1 
ATOM   1328 C  C   . MET B 2 1   ? 22.624  -38.193 34.917 1.00 48.48 ? 1    MET B C   1 
ATOM   1329 O  O   . MET B 2 1   ? 23.450  -38.623 34.096 1.00 48.28 ? 1    MET B O   1 
ATOM   1330 C  CB  . MET B 2 1   ? 23.104  -39.798 36.825 1.00 43.31 ? 1    MET B CB  1 
ATOM   1331 N  N   . ASP B 2 2   ? 22.172  -36.944 34.905 1.00 41.49 ? 2    ASP B N   1 
ATOM   1332 C  CA  . ASP B 2 2   ? 22.743  -35.974 34.008 1.00 38.79 ? 2    ASP B CA  1 
ATOM   1333 C  C   . ASP B 2 2   ? 23.974  -35.359 34.654 1.00 33.47 ? 2    ASP B C   1 
ATOM   1334 O  O   . ASP B 2 2   ? 24.006  -35.108 35.859 1.00 34.22 ? 2    ASP B O   1 
ATOM   1335 C  CB  . ASP B 2 2   ? 21.715  -34.907 33.625 1.00 40.74 ? 2    ASP B CB  1 
ATOM   1336 C  CG  . ASP B 2 2   ? 20.663  -35.432 32.655 1.00 46.72 ? 2    ASP B CG  1 
ATOM   1337 O  OD1 . ASP B 2 2   ? 21.001  -35.771 31.487 1.00 39.44 ? 2    ASP B OD1 1 
ATOM   1338 O  OD2 . ASP B 2 2   ? 19.493  -35.510 33.079 1.00 53.79 ? 2    ASP B OD2 1 
ATOM   1339 N  N   . VAL B 2 3   ? 25.000  -35.140 33.848 1.00 27.53 ? 3    VAL B N   1 
ATOM   1340 C  CA  . VAL B 2 3   ? 26.160  -34.377 34.296 1.00 29.06 ? 3    VAL B CA  1 
ATOM   1341 C  C   . VAL B 2 3   ? 26.337  -33.148 33.414 1.00 28.01 ? 3    VAL B C   1 
ATOM   1342 O  O   . VAL B 2 3   ? 26.048  -33.173 32.214 1.00 27.73 ? 3    VAL B O   1 
ATOM   1343 C  CB  . VAL B 2 3   ? 27.448  -35.228 34.314 1.00 28.22 ? 3    VAL B CB  1 
ATOM   1344 C  CG1 . VAL B 2 3   ? 27.250  -36.418 35.252 1.00 19.97 ? 3    VAL B CG1 1 
ATOM   1345 C  CG2 . VAL B 2 3   ? 27.827  -35.670 32.897 1.00 15.69 ? 3    VAL B CG2 1 
ATOM   1346 N  N   . PHE B 2 4   ? 26.853  -32.091 34.019 1.00 27.96 ? 4    PHE B N   1 
ATOM   1347 C  CA  . PHE B 2 4   ? 26.886  -30.782 33.408 1.00 24.25 ? 4    PHE B CA  1 
ATOM   1348 C  C   . PHE B 2 4   ? 28.308  -30.343 33.216 1.00 27.95 ? 4    PHE B C   1 
ATOM   1349 O  O   . PHE B 2 4   ? 29.124  -30.437 34.137 1.00 31.29 ? 4    PHE B O   1 
ATOM   1350 C  CB  . PHE B 2 4   ? 26.085  -29.832 34.283 1.00 22.31 ? 4    PHE B CB  1 
ATOM   1351 C  CG  . PHE B 2 4   ? 24.656  -30.250 34.389 1.00 23.22 ? 4    PHE B CG  1 
ATOM   1352 C  CD1 . PHE B 2 4   ? 23.732  -29.826 33.438 1.00 21.92 ? 4    PHE B CD1 1 
ATOM   1353 C  CD2 . PHE B 2 4   ? 24.258  -31.151 35.365 1.00 20.12 ? 4    PHE B CD2 1 
ATOM   1354 C  CE1 . PHE B 2 4   ? 22.441  -30.247 33.479 1.00 15.47 ? 4    PHE B CE1 1 
ATOM   1355 C  CE2 . PHE B 2 4   ? 22.938  -31.588 35.434 1.00 26.65 ? 4    PHE B CE2 1 
ATOM   1356 C  CZ  . PHE B 2 4   ? 22.022  -31.134 34.489 1.00 29.74 ? 4    PHE B CZ  1 
ATOM   1357 N  N   . LEU B 2 5   ? 28.596  -29.872 32.003 1.00 27.72 ? 5    LEU B N   1 
ATOM   1358 C  CA  . LEU B 2 5   ? 29.961  -29.689 31.534 1.00 26.94 ? 5    LEU B CA  1 
ATOM   1359 C  C   . LEU B 2 5   ? 30.158  -28.355 30.883 1.00 27.02 ? 5    LEU B C   1 
ATOM   1360 O  O   . LEU B 2 5   ? 29.216  -27.768 30.397 1.00 27.78 ? 5    LEU B O   1 
ATOM   1361 C  CB  . LEU B 2 5   ? 30.288  -30.758 30.484 1.00 30.98 ? 5    LEU B CB  1 
ATOM   1362 C  CG  . LEU B 2 5   ? 30.142  -32.204 30.965 1.00 33.90 ? 5    LEU B CG  1 
ATOM   1363 C  CD1 . LEU B 2 5   ? 30.360  -33.161 29.833 1.00 28.54 ? 5    LEU B CD1 1 
ATOM   1364 C  CD2 . LEU B 2 5   ? 31.111  -32.487 32.135 1.00 25.66 ? 5    LEU B CD2 1 
ATOM   1365 N  N   . MET B 2 6   ? 31.404  -27.896 30.879 1.00 35.21 ? 6    MET B N   1 
ATOM   1366 C  CA  . MET B 2 6   ? 31.858  -26.783 30.061 1.00 37.09 ? 6    MET B CA  1 
ATOM   1367 C  C   . MET B 2 6   ? 32.955  -27.358 29.180 1.00 35.95 ? 6    MET B C   1 
ATOM   1368 O  O   . MET B 2 6   ? 33.997  -27.755 29.698 1.00 33.84 ? 6    MET B O   1 
ATOM   1369 C  CB  . MET B 2 6   ? 32.480  -25.681 30.921 1.00 39.94 ? 6    MET B CB  1 
ATOM   1370 C  CG  . MET B 2 6   ? 31.514  -24.681 31.525 1.00 42.28 ? 6    MET B CG  1 
ATOM   1371 S  SD  . MET B 2 6   ? 32.355  -23.406 32.512 1.00 48.02 ? 6    MET B SD  1 
ATOM   1372 C  CE  . MET B 2 6   ? 33.417  -24.321 33.611 1.00 18.37 ? 6    MET B CE  1 
ATOM   1373 N  N   . ILE B 2 7   ? 32.740  -27.413 27.868 1.00 30.50 ? 7    ILE B N   1 
ATOM   1374 C  CA  . ILE B 2 7   ? 33.783  -27.886 26.960 1.00 28.06 ? 7    ILE B CA  1 
ATOM   1375 C  C   . ILE B 2 7   ? 34.503  -26.672 26.454 1.00 30.58 ? 7    ILE B C   1 
ATOM   1376 O  O   . ILE B 2 7   ? 33.874  -25.778 25.900 1.00 29.71 ? 7    ILE B O   1 
ATOM   1377 C  CB  . ILE B 2 7   ? 33.241  -28.686 25.759 1.00 29.00 ? 7    ILE B CB  1 
ATOM   1378 C  CG1 . ILE B 2 7   ? 32.256  -29.770 26.220 1.00 24.59 ? 7    ILE B CG1 1 
ATOM   1379 C  CG2 . ILE B 2 7   ? 34.405  -29.308 24.987 1.00 28.38 ? 7    ILE B CG2 1 
ATOM   1380 C  CD1 . ILE B 2 7   ? 31.888  -30.764 25.180 1.00 25.63 ? 7    ILE B CD1 1 
ATOM   1381 N  N   . ARG B 2 8   ? 35.825  -26.643 26.607 1.00 33.17 ? 8    ARG B N   1 
ATOM   1382 C  CA  . ARG B 2 8   ? 36.560  -25.417 26.345 1.00 28.82 ? 8    ARG B CA  1 
ATOM   1383 C  C   . ARG B 2 8   ? 37.759  -25.584 25.435 1.00 26.66 ? 8    ARG B C   1 
ATOM   1384 O  O   . ARG B 2 8   ? 38.548  -26.504 25.594 1.00 25.71 ? 8    ARG B O   1 
ATOM   1385 C  CB  . ARG B 2 8   ? 36.990  -24.796 27.669 1.00 27.16 ? 8    ARG B CB  1 
ATOM   1386 C  CG  . ARG B 2 8   ? 35.830  -24.644 28.661 1.00 33.49 ? 8    ARG B CG  1 
ATOM   1387 C  CD  . ARG B 2 8   ? 36.224  -23.796 29.855 1.00 32.34 ? 8    ARG B CD  1 
ATOM   1388 N  NE  . ARG B 2 8   ? 36.798  -22.556 29.366 1.00 35.96 ? 8    ARG B NE  1 
ATOM   1389 C  CZ  . ARG B 2 8   ? 37.532  -21.715 30.072 1.00 29.08 ? 8    ARG B CZ  1 
ATOM   1390 N  NH1 . ARG B 2 8   ? 37.786  -21.933 31.350 1.00 31.33 ? 8    ARG B NH1 1 
ATOM   1391 N  NH2 . ARG B 2 8   ? 38.004  -20.628 29.487 1.00 32.50 ? 8    ARG B NH2 1 
ATOM   1392 N  N   . ARG B 2 9   ? 37.879  -24.631 24.514 1.00 24.84 ? 9    ARG B N   1 
ATOM   1393 C  CA  . ARG B 2 9   ? 38.946  -24.520 23.544 1.00 23.68 ? 9    ARG B CA  1 
ATOM   1394 C  C   . ARG B 2 9   ? 39.129  -23.051 23.143 1.00 29.78 ? 9    ARG B C   1 
ATOM   1395 O  O   . ARG B 2 9   ? 38.182  -22.418 22.695 1.00 38.00 ? 9    ARG B O   1 
ATOM   1396 C  CB  . ARG B 2 9   ? 38.587  -25.280 22.283 1.00 22.31 ? 9    ARG B CB  1 
ATOM   1397 C  CG  . ARG B 2 9   ? 39.473  -24.895 21.094 1.00 28.69 ? 9    ARG B CG  1 
ATOM   1398 C  CD  . ARG B 2 9   ? 39.279  -25.836 19.936 1.00 29.26 ? 9    ARG B CD  1 
ATOM   1399 N  NE  . ARG B 2 9   ? 40.285  -25.632 18.912 1.00 32.46 ? 9    ARG B NE  1 
ATOM   1400 C  CZ  . ARG B 2 9   ? 40.286  -24.621 18.046 1.00 31.91 ? 9    ARG B CZ  1 
ATOM   1401 N  NH1 . ARG B 2 9   ? 39.320  -23.711 18.055 1.00 28.35 ? 9    ARG B NH1 1 
ATOM   1402 N  NH2 . ARG B 2 9   ? 41.261  -24.536 17.145 1.00 30.59 ? 9    ARG B NH2 1 
ATOM   1403 N  N   . HIS B 2 10  ? 40.348  -22.536 23.277 1.00 31.22 ? 10   HIS B N   1 
ATOM   1404 C  CA  . HIS B 2 10  ? 40.682  -21.137 22.991 1.00 33.49 ? 10   HIS B CA  1 
ATOM   1405 C  C   . HIS B 2 10  ? 39.715  -20.211 23.737 1.00 33.24 ? 10   HIS B C   1 
ATOM   1406 O  O   . HIS B 2 10  ? 39.674  -20.264 24.966 1.00 32.94 ? 10   HIS B O   1 
ATOM   1407 C  CB  . HIS B 2 10  ? 40.741  -20.856 21.473 1.00 31.75 ? 10   HIS B CB  1 
ATOM   1408 C  CG  . HIS B 2 10  ? 41.756  -21.675 20.744 1.00 31.67 ? 10   HIS B CG  1 
ATOM   1409 N  ND1 . HIS B 2 10  ? 42.165  -21.375 19.461 1.00 38.15 ? 10   HIS B ND1 1 
ATOM   1410 C  CD2 . HIS B 2 10  ? 42.447  -22.785 21.111 1.00 30.88 ? 10   HIS B CD2 1 
ATOM   1411 C  CE1 . HIS B 2 10  ? 43.055  -22.270 19.068 1.00 35.78 ? 10   HIS B CE1 1 
ATOM   1412 N  NE2 . HIS B 2 10  ? 43.251  -23.131 20.054 1.00 29.80 ? 10   HIS B NE2 1 
ATOM   1413 N  N   . LYS B 2 11  ? 38.952  -19.383 23.010 1.00 33.63 ? 11   LYS B N   1 
ATOM   1414 C  CA  . LYS B 2 11  ? 37.996  -18.465 23.623 1.00 32.88 ? 11   LYS B CA  1 
ATOM   1415 C  C   . LYS B 2 11  ? 36.550  -18.934 23.435 1.00 32.29 ? 11   LYS B C   1 
ATOM   1416 O  O   . LYS B 2 11  ? 35.627  -18.129 23.331 1.00 33.86 ? 11   LYS B O   1 
ATOM   1417 C  CB  . LYS B 2 11  ? 38.194  -17.057 23.073 1.00 31.40 ? 11   LYS B CB  1 
ATOM   1418 C  CG  . LYS B 2 11  ? 39.384  -16.329 23.662 1.00 29.46 ? 11   LYS B CG  1 
ATOM   1419 C  CD  . LYS B 2 11  ? 39.469  -14.884 23.148 1.00 31.11 ? 11   LYS B CD  1 
ATOM   1420 C  CE  . LYS B 2 11  ? 39.989  -13.909 24.214 1.00 25.59 ? 11   LYS B CE  1 
ATOM   1421 N  NZ  . LYS B 2 11  ? 39.948  -12.531 23.675 1.00 20.41 ? 11   LYS B NZ  1 
ATOM   1422 N  N   . THR B 2 12  ? 36.369  -20.249 23.461 1.00 33.22 ? 12   THR B N   1 
ATOM   1423 C  CA  . THR B 2 12  ? 35.071  -20.886 23.269 1.00 33.68 ? 12   THR B CA  1 
ATOM   1424 C  C   . THR B 2 12  ? 34.753  -21.775 24.474 1.00 31.63 ? 12   THR B C   1 
ATOM   1425 O  O   . THR B 2 12  ? 35.595  -22.537 24.933 1.00 34.90 ? 12   THR B O   1 
ATOM   1426 C  CB  . THR B 2 12  ? 35.073  -21.769 21.986 1.00 34.68 ? 12   THR B CB  1 
ATOM   1427 O  OG1 . THR B 2 12  ? 35.228  -20.939 20.821 1.00 29.73 ? 12   THR B OG1 1 
ATOM   1428 C  CG2 . THR B 2 12  ? 33.787  -22.583 21.882 1.00 33.27 ? 12   THR B CG2 1 
ATOM   1429 N  N   . THR B 2 13  ? 33.537  -21.657 24.978 1.00 27.76 ? 13   THR B N   1 
ATOM   1430 C  CA  . THR B 2 13  ? 33.021  -22.554 25.981 1.00 28.68 ? 13   THR B CA  1 
ATOM   1431 C  C   . THR B 2 13  ? 31.618  -23.025 25.607 1.00 25.94 ? 13   THR B C   1 
ATOM   1432 O  O   . THR B 2 13  ? 30.742  -22.207 25.318 1.00 27.33 ? 13   THR B O   1 
ATOM   1433 C  CB  . THR B 2 13  ? 32.936  -21.860 27.333 1.00 31.11 ? 13   THR B CB  1 
ATOM   1434 O  OG1 . THR B 2 13  ? 34.205  -21.272 27.632 1.00 24.84 ? 13   THR B OG1 1 
ATOM   1435 C  CG2 . THR B 2 13  ? 32.535  -22.855 28.406 1.00 25.84 ? 13   THR B CG2 1 
ATOM   1436 N  N   . ILE B 2 14  ? 31.429  -24.343 25.612 1.00 23.08 ? 14   ILE B N   1 
ATOM   1437 C  CA  . ILE B 2 14  ? 30.137  -24.970 25.402 1.00 22.67 ? 14   ILE B CA  1 
ATOM   1438 C  C   . ILE B 2 14  ? 29.570  -25.453 26.721 1.00 24.78 ? 14   ILE B C   1 
ATOM   1439 O  O   . ILE B 2 14  ? 30.184  -26.234 27.421 1.00 27.50 ? 14   ILE B O   1 
ATOM   1440 C  CB  . ILE B 2 14  ? 30.230  -26.177 24.491 1.00 27.85 ? 14   ILE B CB  1 
ATOM   1441 C  CG1 . ILE B 2 14  ? 30.848  -25.765 23.143 1.00 36.76 ? 14   ILE B CG1 1 
ATOM   1442 C  CG2 . ILE B 2 14  ? 28.818  -26.791 24.310 1.00 28.56 ? 14   ILE B CG2 1 
ATOM   1443 C  CD1 . ILE B 2 14  ? 31.089  -26.899 22.161 1.00 26.42 ? 14   ILE B CD1 1 
ATOM   1444 N  N   . PHE B 2 15  ? 28.388  -24.971 27.051 1.00 29.55 ? 15   PHE B N   1 
ATOM   1445 C  CA  . PHE B 2 15  ? 27.635  -25.473 28.176 1.00 33.84 ? 15   PHE B CA  1 
ATOM   1446 C  C   . PHE B 2 15  ? 26.704  -26.553 27.662 1.00 30.92 ? 15   PHE B C   1 
ATOM   1447 O  O   . PHE B 2 15  ? 25.837  -26.313 26.827 1.00 36.25 ? 15   PHE B O   1 
ATOM   1448 C  CB  . PHE B 2 15  ? 26.839  -24.348 28.850 1.00 36.20 ? 15   PHE B CB  1 
ATOM   1449 C  CG  . PHE B 2 15  ? 27.691  -23.450 29.672 1.00 31.96 ? 15   PHE B CG  1 
ATOM   1450 C  CD1 . PHE B 2 15  ? 27.834  -23.661 31.011 1.00 39.76 ? 15   PHE B CD1 1 
ATOM   1451 C  CD2 . PHE B 2 15  ? 28.365  -22.418 29.101 1.00 31.59 ? 15   PHE B CD2 1 
ATOM   1452 C  CE1 . PHE B 2 15  ? 28.624  -22.841 31.764 1.00 42.16 ? 15   PHE B CE1 1 
ATOM   1453 C  CE2 . PHE B 2 15  ? 29.159  -21.607 29.857 1.00 39.43 ? 15   PHE B CE2 1 
ATOM   1454 C  CZ  . PHE B 2 15  ? 29.285  -21.815 31.182 1.00 36.29 ? 15   PHE B CZ  1 
ATOM   1455 N  N   . THR B 2 16  ? 26.910  -27.758 28.144 1.00 32.20 ? 16   THR B N   1 
ATOM   1456 C  CA  . THR B 2 16  ? 26.068  -28.840 27.737 1.00 31.78 ? 16   THR B CA  1 
ATOM   1457 C  C   . THR B 2 16  ? 26.056  -29.887 28.809 1.00 30.77 ? 16   THR B C   1 
ATOM   1458 O  O   . THR B 2 16  ? 26.834  -29.831 29.747 1.00 26.06 ? 16   THR B O   1 
ATOM   1459 C  CB  . THR B 2 16  ? 26.554  -29.459 26.442 1.00 31.90 ? 16   THR B CB  1 
ATOM   1460 O  OG1 . THR B 2 16  ? 25.467  -30.150 25.811 1.00 30.71 ? 16   THR B OG1 1 
ATOM   1461 C  CG2 . THR B 2 16  ? 27.704  -30.391 26.721 1.00 20.29 ? 16   THR B CG2 1 
ATOM   1462 N  N   . ASP B 2 17  ? 25.141  -30.829 28.645 1.00 35.62 ? 17   ASP B N   1 
ATOM   1463 C  CA  . ASP B 2 17  ? 24.963  -31.915 29.570 1.00 37.25 ? 17   ASP B CA  1 
ATOM   1464 C  C   . ASP B 2 17  ? 24.841  -33.227 28.788 1.00 34.85 ? 17   ASP B C   1 
ATOM   1465 O  O   . ASP B 2 17  ? 24.497  -33.229 27.598 1.00 28.30 ? 17   ASP B O   1 
ATOM   1466 C  CB  . ASP B 2 17  ? 23.729  -31.673 30.445 1.00 35.75 ? 17   ASP B CB  1 
ATOM   1467 C  CG  . ASP B 2 17  ? 22.538  -31.186 29.651 1.00 51.78 ? 17   ASP B CG  1 
ATOM   1468 O  OD1 . ASP B 2 17  ? 22.401  -29.939 29.477 1.00 62.55 ? 17   ASP B OD1 1 
ATOM   1469 O  OD2 . ASP B 2 17  ? 21.738  -32.050 29.214 1.00 45.20 ? 17   ASP B OD2 1 
ATOM   1470 N  N   . ALA B 2 18  ? 25.148  -34.324 29.475 1.00 31.19 ? 18   ALA B N   1 
ATOM   1471 C  CA  . ALA B 2 18  ? 25.013  -35.670 28.933 1.00 32.58 ? 18   ALA B CA  1 
ATOM   1472 C  C   . ALA B 2 18  ? 24.791  -36.670 30.095 1.00 33.35 ? 18   ALA B C   1 
ATOM   1473 O  O   . ALA B 2 18  ? 24.921  -36.308 31.270 1.00 29.50 ? 18   ALA B O   1 
ATOM   1474 C  CB  . ALA B 2 18  ? 26.238  -36.017 28.127 1.00 26.61 ? 18   ALA B CB  1 
ATOM   1475 N  N   . LYS B 2 19  ? 24.427  -37.914 29.794 1.00 35.48 ? 19   LYS B N   1 
ATOM   1476 C  CA  . LYS B 2 19  ? 24.195  -38.859 30.881 1.00 35.00 ? 19   LYS B CA  1 
ATOM   1477 C  C   . LYS B 2 19  ? 25.561  -39.301 31.398 1.00 33.62 ? 19   LYS B C   1 
ATOM   1478 O  O   . LYS B 2 19  ? 26.544  -39.316 30.641 1.00 28.30 ? 19   LYS B O   1 
ATOM   1479 C  CB  . LYS B 2 19  ? 23.342  -40.067 30.435 1.00 38.75 ? 19   LYS B CB  1 
ATOM   1480 C  CG  . LYS B 2 19  ? 21.919  -39.753 29.923 1.00 39.71 ? 19   LYS B CG  1 
ATOM   1481 C  CD  . LYS B 2 19  ? 21.016  -39.090 30.985 1.00 50.78 ? 19   LYS B CD  1 
ATOM   1482 N  N   . GLU B 2 20  ? 25.626  -39.650 32.683 1.00 32.43 ? 20   GLU B N   1 
ATOM   1483 C  CA  . GLU B 2 20  ? 26.829  -40.287 33.273 1.00 34.61 ? 20   GLU B CA  1 
ATOM   1484 C  C   . GLU B 2 20  ? 27.309  -41.556 32.522 1.00 31.14 ? 20   GLU B C   1 
ATOM   1485 O  O   . GLU B 2 20  ? 28.506  -41.864 32.476 1.00 31.50 ? 20   GLU B O   1 
ATOM   1486 C  CB  . GLU B 2 20  ? 26.557  -40.632 34.741 1.00 33.04 ? 20   GLU B CB  1 
ATOM   1487 C  CG  . GLU B 2 20  ? 27.807  -40.835 35.594 1.00 41.72 ? 20   GLU B CG  1 
ATOM   1488 C  CD  . GLU B 2 20  ? 27.509  -40.785 37.096 1.00 41.39 ? 20   GLU B CD  1 
ATOM   1489 O  OE1 . GLU B 2 20  ? 27.028  -39.745 37.558 1.00 56.31 ? 20   GLU B OE1 1 
ATOM   1490 O  OE2 . GLU B 2 20  ? 27.754  -41.775 37.822 1.00 47.31 ? 20   GLU B OE2 1 
ATOM   1491 N  N   . SER B 2 21  ? 26.358  -42.276 31.936 1.00 29.97 ? 21   SER B N   1 
ATOM   1492 C  CA  . SER B 2 21  ? 26.604  -43.546 31.260 1.00 29.72 ? 21   SER B CA  1 
ATOM   1493 C  C   . SER B 2 21  ? 26.944  -43.395 29.776 1.00 27.31 ? 21   SER B C   1 
ATOM   1494 O  O   . SER B 2 21  ? 27.259  -44.373 29.099 1.00 28.20 ? 21   SER B O   1 
ATOM   1495 C  CB  . SER B 2 21  ? 25.356  -44.408 31.392 1.00 26.19 ? 21   SER B CB  1 
ATOM   1496 O  OG  . SER B 2 21  ? 24.253  -43.705 30.850 1.00 34.06 ? 21   SER B OG  1 
ATOM   1497 N  N   . SER B 2 22  ? 26.847  -42.180 29.265 1.00 27.88 ? 22   SER B N   1 
ATOM   1498 C  CA  . SER B 2 22  ? 27.266  -41.892 27.907 1.00 28.90 ? 22   SER B CA  1 
ATOM   1499 C  C   . SER B 2 22  ? 28.792  -41.911 27.819 1.00 28.80 ? 22   SER B C   1 
ATOM   1500 O  O   . SER B 2 22  ? 29.479  -41.699 28.815 1.00 25.45 ? 22   SER B O   1 
ATOM   1501 C  CB  . SER B 2 22  ? 26.725  -40.534 27.465 1.00 30.00 ? 22   SER B CB  1 
ATOM   1502 O  OG  . SER B 2 22  ? 27.220  -39.492 28.283 1.00 26.43 ? 22   SER B OG  1 
ATOM   1503 N  N   . THR B 2 23  ? 29.300  -42.167 26.619 1.00 26.14 ? 23   THR B N   1 
ATOM   1504 C  CA  . THR B 2 23  ? 30.716  -42.320 26.391 1.00 25.96 ? 23   THR B CA  1 
ATOM   1505 C  C   . THR B 2 23  ? 31.371  -40.996 25.998 1.00 29.12 ? 23   THR B C   1 
ATOM   1506 O  O   . THR B 2 23  ? 30.695  -40.037 25.609 1.00 32.53 ? 23   THR B O   1 
ATOM   1507 C  CB  . THR B 2 23  ? 30.983  -43.375 25.281 1.00 30.97 ? 23   THR B CB  1 
ATOM   1508 O  OG1 . THR B 2 23  ? 30.585  -42.854 24.012 1.00 35.27 ? 23   THR B OG1 1 
ATOM   1509 C  CG2 . THR B 2 23  ? 30.211  -44.673 25.548 1.00 15.85 ? 23   THR B CG2 1 
ATOM   1510 N  N   . VAL B 2 24  ? 32.695  -40.951 26.107 1.00 23.31 ? 24   VAL B N   1 
ATOM   1511 C  CA  . VAL B 2 24  ? 33.460  -39.799 25.681 1.00 19.35 ? 24   VAL B CA  1 
ATOM   1512 C  C   . VAL B 2 24  ? 33.275  -39.558 24.181 1.00 22.74 ? 24   VAL B C   1 
ATOM   1513 O  O   . VAL B 2 24  ? 33.291  -38.429 23.708 1.00 27.94 ? 24   VAL B O   1 
ATOM   1514 C  CB  . VAL B 2 24  ? 34.945  -39.973 26.012 1.00 22.29 ? 24   VAL B CB  1 
ATOM   1515 C  CG1 . VAL B 2 24  ? 35.779  -38.828 25.431 1.00 16.78 ? 24   VAL B CG1 1 
ATOM   1516 C  CG2 . VAL B 2 24  ? 35.145  -40.087 27.532 1.00 23.64 ? 24   VAL B CG2 1 
ATOM   1517 N  N   . PHE B 2 25  ? 33.066  -40.627 23.436 1.00 24.84 ? 25   PHE B N   1 
ATOM   1518 C  CA  . PHE B 2 25  ? 32.880  -40.541 22.001 1.00 26.70 ? 25   PHE B CA  1 
ATOM   1519 C  C   . PHE B 2 25  ? 31.549  -39.856 21.699 1.00 29.81 ? 25   PHE B C   1 
ATOM   1520 O  O   . PHE B 2 25  ? 31.459  -38.975 20.848 1.00 30.12 ? 25   PHE B O   1 
ATOM   1521 C  CB  . PHE B 2 25  ? 32.914  -41.961 21.411 1.00 30.21 ? 25   PHE B CB  1 
ATOM   1522 C  CG  . PHE B 2 25  ? 32.867  -41.982 19.938 1.00 33.47 ? 25   PHE B CG  1 
ATOM   1523 C  CD1 . PHE B 2 25  ? 34.014  -41.761 19.198 1.00 37.63 ? 25   PHE B CD1 1 
ATOM   1524 C  CD2 . PHE B 2 25  ? 31.665  -42.176 19.277 1.00 37.39 ? 25   PHE B CD2 1 
ATOM   1525 C  CE1 . PHE B 2 25  ? 33.971  -41.743 17.801 1.00 36.98 ? 25   PHE B CE1 1 
ATOM   1526 C  CE2 . PHE B 2 25  ? 31.613  -42.168 17.893 1.00 34.85 ? 25   PHE B CE2 1 
ATOM   1527 C  CZ  . PHE B 2 25  ? 32.770  -41.941 17.154 1.00 30.99 ? 25   PHE B CZ  1 
ATOM   1528 N  N   . GLU B 2 26  ? 30.514  -40.261 22.426 1.00 29.36 ? 26   GLU B N   1 
ATOM   1529 C  CA  . GLU B 2 26  ? 29.197  -39.669 22.282 1.00 28.77 ? 26   GLU B CA  1 
ATOM   1530 C  C   . GLU B 2 26  ? 29.247  -38.179 22.590 1.00 29.79 ? 26   GLU B C   1 
ATOM   1531 O  O   . GLU B 2 26  ? 28.487  -37.403 22.013 1.00 35.19 ? 26   GLU B O   1 
ATOM   1532 C  CB  . GLU B 2 26  ? 28.172  -40.383 23.187 1.00 30.52 ? 26   GLU B CB  1 
ATOM   1533 C  CG  . GLU B 2 26  ? 27.754  -41.809 22.705 1.00 32.92 ? 26   GLU B CG  1 
ATOM   1534 C  CD  . GLU B 2 26  ? 26.953  -42.620 23.761 1.00 38.53 ? 26   GLU B CD  1 
ATOM   1535 O  OE1 . GLU B 2 26  ? 26.821  -43.853 23.619 1.00 37.68 ? 26   GLU B OE1 1 
ATOM   1536 O  OE2 . GLU B 2 26  ? 26.436  -42.033 24.733 1.00 50.57 ? 26   GLU B OE2 1 
ATOM   1537 N  N   . LEU B 2 27  ? 30.125  -37.777 23.503 1.00 30.77 ? 27   LEU B N   1 
ATOM   1538 C  CA  . LEU B 2 27  ? 30.310  -36.354 23.797 1.00 28.62 ? 27   LEU B CA  1 
ATOM   1539 C  C   . LEU B 2 27  ? 30.982  -35.659 22.610 1.00 30.03 ? 27   LEU B C   1 
ATOM   1540 O  O   . LEU B 2 27  ? 30.632  -34.532 22.272 1.00 29.44 ? 27   LEU B O   1 
ATOM   1541 C  CB  . LEU B 2 27  ? 31.145  -36.171 25.052 1.00 26.69 ? 27   LEU B CB  1 
ATOM   1542 C  CG  . LEU B 2 27  ? 31.219  -34.759 25.651 1.00 30.23 ? 27   LEU B CG  1 
ATOM   1543 C  CD1 . LEU B 2 27  ? 29.840  -34.229 26.036 1.00 25.06 ? 27   LEU B CD1 1 
ATOM   1544 C  CD2 . LEU B 2 27  ? 32.144  -34.774 26.864 1.00 26.48 ? 27   LEU B CD2 1 
ATOM   1545 N  N   . LYS B 2 28  ? 31.918  -36.353 21.960 1.00 30.65 ? 28   LYS B N   1 
ATOM   1546 C  CA  . LYS B 2 28  ? 32.530  -35.840 20.736 1.00 30.45 ? 28   LYS B CA  1 
ATOM   1547 C  C   . LYS B 2 28  ? 31.495  -35.682 19.627 1.00 31.85 ? 28   LYS B C   1 
ATOM   1548 O  O   . LYS B 2 28  ? 31.648  -34.805 18.765 1.00 29.67 ? 28   LYS B O   1 
ATOM   1549 C  CB  . LYS B 2 28  ? 33.685  -36.720 20.241 1.00 25.06 ? 28   LYS B CB  1 
ATOM   1550 C  CG  . LYS B 2 28  ? 34.912  -36.684 21.122 1.00 25.44 ? 28   LYS B CG  1 
ATOM   1551 C  CD  . LYS B 2 28  ? 36.056  -37.483 20.496 1.00 30.46 ? 28   LYS B CD  1 
ATOM   1552 C  CE  . LYS B 2 28  ? 37.290  -37.468 21.365 1.00 28.17 ? 28   LYS B CE  1 
ATOM   1553 N  NZ  . LYS B 2 28  ? 38.385  -38.289 20.797 1.00 36.12 ? 28   LYS B NZ  1 
ATOM   1554 N  N   . ARG B 2 29  ? 30.454  -36.515 19.640 1.00 29.01 ? 29   ARG B N   1 
ATOM   1555 C  CA  . ARG B 2 29  ? 29.363  -36.354 18.676 1.00 32.34 ? 29   ARG B CA  1 
ATOM   1556 C  C   . ARG B 2 29  ? 28.523  -35.114 18.991 1.00 30.55 ? 29   ARG B C   1 
ATOM   1557 O  O   . ARG B 2 29  ? 28.072  -34.425 18.072 1.00 31.00 ? 29   ARG B O   1 
ATOM   1558 C  CB  . ARG B 2 29  ? 28.483  -37.603 18.577 1.00 30.55 ? 29   ARG B CB  1 
ATOM   1559 C  CG  . ARG B 2 29  ? 29.178  -38.785 17.920 1.00 41.33 ? 29   ARG B CG  1 
ATOM   1560 C  CD  . ARG B 2 29  ? 28.196  -39.792 17.302 1.00 51.78 ? 29   ARG B CD  1 
ATOM   1561 N  NE  . ARG B 2 29  ? 27.846  -39.398 15.936 1.00 62.91 ? 29   ARG B NE  1 
ATOM   1562 C  CZ  . ARG B 2 29  ? 28.547  -39.695 14.836 1.00 65.94 ? 29   ARG B CZ  1 
ATOM   1563 N  NH1 . ARG B 2 29  ? 29.659  -40.428 14.890 1.00 63.02 ? 29   ARG B NH1 1 
ATOM   1564 N  NH2 . ARG B 2 29  ? 28.121  -39.258 13.654 1.00 68.02 ? 29   ARG B NH2 1 
ATOM   1565 N  N   . ILE B 2 30  ? 28.331  -34.812 20.274 1.00 32.19 ? 30   ILE B N   1 
ATOM   1566 C  CA  . ILE B 2 30  ? 27.628  -33.580 20.656 1.00 33.46 ? 30   ILE B CA  1 
ATOM   1567 C  C   . ILE B 2 30  ? 28.405  -32.403 20.082 1.00 34.47 ? 30   ILE B C   1 
ATOM   1568 O  O   . ILE B 2 30  ? 27.821  -31.536 19.442 1.00 34.91 ? 30   ILE B O   1 
ATOM   1569 C  CB  . ILE B 2 30  ? 27.494  -33.391 22.204 1.00 35.61 ? 30   ILE B CB  1 
ATOM   1570 C  CG1 . ILE B 2 30  ? 26.607  -34.474 22.825 1.00 41.64 ? 30   ILE B CG1 1 
ATOM   1571 C  CG2 . ILE B 2 30  ? 26.925  -32.010 22.539 1.00 28.35 ? 30   ILE B CG2 1 
ATOM   1572 C  CD1 . ILE B 2 30  ? 25.148  -34.496 22.319 1.00 42.36 ? 30   ILE B CD1 1 
ATOM   1573 N  N   . VAL B 2 31  ? 29.727  -32.403 20.302 1.00 35.09 ? 31   VAL B N   1 
ATOM   1574 C  CA  . VAL B 2 31  ? 30.620  -31.312 19.871 1.00 30.66 ? 31   VAL B CA  1 
ATOM   1575 C  C   . VAL B 2 31  ? 30.663  -31.186 18.346 1.00 29.20 ? 31   VAL B C   1 
ATOM   1576 O  O   . VAL B 2 31  ? 30.834  -30.092 17.821 1.00 30.44 ? 31   VAL B O   1 
ATOM   1577 C  CB  . VAL B 2 31  ? 32.059  -31.500 20.421 1.00 29.45 ? 31   VAL B CB  1 
ATOM   1578 C  CG1 . VAL B 2 31  ? 32.975  -30.401 19.958 1.00 29.19 ? 31   VAL B CG1 1 
ATOM   1579 C  CG2 . VAL B 2 31  ? 32.048  -31.526 21.917 1.00 21.47 ? 31   VAL B CG2 1 
ATOM   1580 N  N   . GLU B 2 32  ? 30.486  -32.298 17.642 1.00 31.77 ? 32   GLU B N   1 
ATOM   1581 C  CA  . GLU B 2 32  ? 30.504  -32.304 16.170 1.00 32.34 ? 32   GLU B CA  1 
ATOM   1582 C  C   . GLU B 2 32  ? 29.320  -31.537 15.599 1.00 28.25 ? 32   GLU B C   1 
ATOM   1583 O  O   . GLU B 2 32  ? 29.429  -30.879 14.561 1.00 32.47 ? 32   GLU B O   1 
ATOM   1584 C  CB  . GLU B 2 32  ? 30.499  -33.747 15.651 1.00 34.07 ? 32   GLU B CB  1 
ATOM   1585 C  CG  . GLU B 2 32  ? 30.334  -33.929 14.134 1.00 36.21 ? 32   GLU B CG  1 
ATOM   1586 C  CD  . GLU B 2 32  ? 30.253  -35.404 13.729 1.00 44.69 ? 32   GLU B CD  1 
ATOM   1587 O  OE1 . GLU B 2 32  ? 29.767  -36.230 14.547 1.00 46.17 ? 32   GLU B OE1 1 
ATOM   1588 O  OE2 . GLU B 2 32  ? 30.667  -35.738 12.592 1.00 35.58 ? 32   GLU B OE2 1 
ATOM   1589 N  N   . GLY B 2 33  ? 28.186  -31.626 16.276 1.00 27.01 ? 33   GLY B N   1 
ATOM   1590 C  CA  . GLY B 2 33  ? 26.970  -30.928 15.828 1.00 29.57 ? 33   GLY B CA  1 
ATOM   1591 C  C   . GLY B 2 33  ? 27.074  -29.429 16.006 1.00 27.68 ? 33   GLY B C   1 
ATOM   1592 O  O   . GLY B 2 33  ? 26.595  -28.657 15.185 1.00 25.44 ? 33   GLY B O   1 
ATOM   1593 N  N   . ILE B 2 34  ? 27.725  -29.032 17.088 1.00 28.16 ? 34   ILE B N   1 
ATOM   1594 C  CA  . ILE B 2 34  ? 27.987  -27.635 17.370 1.00 29.23 ? 34   ILE B CA  1 
ATOM   1595 C  C   . ILE B 2 34  ? 29.143  -27.080 16.521 1.00 28.13 ? 34   ILE B C   1 
ATOM   1596 O  O   . ILE B 2 34  ? 28.955  -26.129 15.783 1.00 28.86 ? 34   ILE B O   1 
ATOM   1597 C  CB  . ILE B 2 34  ? 28.281  -27.424 18.892 1.00 29.57 ? 34   ILE B CB  1 
ATOM   1598 C  CG1 . ILE B 2 34  ? 27.051  -27.842 19.719 1.00 28.09 ? 34   ILE B CG1 1 
ATOM   1599 C  CG2 . ILE B 2 34  ? 28.674  -25.983 19.153 1.00 24.85 ? 34   ILE B CG2 1 
ATOM   1600 C  CD1 . ILE B 2 34  ? 27.276  -27.916 21.173 1.00 23.78 ? 34   ILE B CD1 1 
ATOM   1601 N  N   . LEU B 2 35  ? 30.327  -27.674 16.618 1.00 28.44 ? 35   LEU B N   1 
ATOM   1602 C  CA  . LEU B 2 35  ? 31.530  -27.033 16.101 1.00 27.80 ? 35   LEU B CA  1 
ATOM   1603 C  C   . LEU B 2 35  ? 31.946  -27.527 14.719 1.00 30.72 ? 35   LEU B C   1 
ATOM   1604 O  O   . LEU B 2 35  ? 32.838  -26.945 14.096 1.00 33.35 ? 35   LEU B O   1 
ATOM   1605 C  CB  . LEU B 2 35  ? 32.677  -27.173 17.111 1.00 27.53 ? 35   LEU B CB  1 
ATOM   1606 C  CG  . LEU B 2 35  ? 32.595  -26.267 18.345 1.00 28.32 ? 35   LEU B CG  1 
ATOM   1607 C  CD1 . LEU B 2 35  ? 33.807  -26.478 19.220 1.00 21.00 ? 35   LEU B CD1 1 
ATOM   1608 C  CD2 . LEU B 2 35  ? 32.495  -24.799 17.967 1.00 19.50 ? 35   LEU B CD2 1 
ATOM   1609 N  N   . LYS B 2 36  ? 31.297  -28.589 14.240 1.00 32.09 ? 36   LYS B N   1 
ATOM   1610 C  CA  . LYS B 2 36  ? 31.462  -29.062 12.858 1.00 30.18 ? 36   LYS B CA  1 
ATOM   1611 C  C   . LYS B 2 36  ? 32.833  -29.680 12.572 1.00 32.89 ? 36   LYS B C   1 
ATOM   1612 O  O   . LYS B 2 36  ? 33.381  -29.524 11.491 1.00 34.59 ? 36   LYS B O   1 
ATOM   1613 C  CB  . LYS B 2 36  ? 31.144  -27.942 11.869 1.00 27.51 ? 36   LYS B CB  1 
ATOM   1614 C  CG  . LYS B 2 36  ? 29.745  -28.010 11.309 1.00 34.95 ? 36   LYS B CG  1 
ATOM   1615 C  CD  . LYS B 2 36  ? 28.621  -27.859 12.341 1.00 32.51 ? 36   LYS B CD  1 
ATOM   1616 C  CE  . LYS B 2 36  ? 27.341  -28.540 11.813 1.00 35.90 ? 36   LYS B CE  1 
ATOM   1617 N  NZ  . LYS B 2 36  ? 26.064  -27.983 12.344 1.00 36.32 ? 36   LYS B NZ  1 
ATOM   1618 N  N   . ARG B 2 37  ? 33.363  -30.404 13.554 1.00 34.56 ? 37   ARG B N   1 
ATOM   1619 C  CA  . ARG B 2 37  ? 34.576  -31.206 13.390 1.00 32.63 ? 37   ARG B CA  1 
ATOM   1620 C  C   . ARG B 2 37  ? 34.327  -32.644 13.872 1.00 26.74 ? 37   ARG B C   1 
ATOM   1621 O  O   . ARG B 2 37  ? 33.854  -32.860 14.983 1.00 29.36 ? 37   ARG B O   1 
ATOM   1622 C  CB  . ARG B 2 37  ? 35.724  -30.576 14.183 1.00 35.42 ? 37   ARG B CB  1 
ATOM   1623 C  CG  . ARG B 2 37  ? 36.055  -29.156 13.760 1.00 40.61 ? 37   ARG B CG  1 
ATOM   1624 C  CD  . ARG B 2 37  ? 36.809  -29.096 12.433 1.00 44.72 ? 37   ARG B CD  1 
ATOM   1625 N  NE  . ARG B 2 37  ? 38.164  -28.564 12.602 1.00 47.31 ? 37   ARG B NE  1 
ATOM   1626 C  CZ  . ARG B 2 37  ? 39.282  -29.284 12.593 1.00 48.04 ? 37   ARG B CZ  1 
ATOM   1627 N  NH1 . ARG B 2 37  ? 39.251  -30.590 12.394 1.00 39.55 ? 37   ARG B NH1 1 
ATOM   1628 N  NH2 . ARG B 2 37  ? 40.450  -28.674 12.767 1.00 54.14 ? 37   ARG B NH2 1 
ATOM   1629 N  N   . PRO B 2 38  ? 34.609  -33.638 13.031 1.00 28.59 ? 38   PRO B N   1 
ATOM   1630 C  CA  . PRO B 2 38  ? 34.349  -35.013 13.475 1.00 27.60 ? 38   PRO B CA  1 
ATOM   1631 C  C   . PRO B 2 38  ? 35.179  -35.491 14.681 1.00 28.31 ? 38   PRO B C   1 
ATOM   1632 O  O   . PRO B 2 38  ? 36.240  -34.920 14.979 1.00 26.48 ? 38   PRO B O   1 
ATOM   1633 C  CB  . PRO B 2 38  ? 34.687  -35.855 12.234 1.00 27.31 ? 38   PRO B CB  1 
ATOM   1634 C  CG  . PRO B 2 38  ? 35.555  -34.997 11.400 1.00 30.50 ? 38   PRO B CG  1 
ATOM   1635 C  CD  . PRO B 2 38  ? 35.099  -33.589 11.640 1.00 31.08 ? 38   PRO B CD  1 
ATOM   1636 N  N   . PRO B 2 39  ? 34.689  -36.528 15.378 1.00 27.20 ? 39   PRO B N   1 
ATOM   1637 C  CA  . PRO B 2 39  ? 35.311  -37.165 16.549 1.00 30.88 ? 39   PRO B CA  1 
ATOM   1638 C  C   . PRO B 2 39  ? 36.783  -37.526 16.417 1.00 34.34 ? 39   PRO B C   1 
ATOM   1639 O  O   . PRO B 2 39  ? 37.564  -37.260 17.349 1.00 36.88 ? 39   PRO B O   1 
ATOM   1640 C  CB  . PRO B 2 39  ? 34.483  -38.429 16.728 1.00 27.50 ? 39   PRO B CB  1 
ATOM   1641 C  CG  . PRO B 2 39  ? 33.121  -37.995 16.294 1.00 30.69 ? 39   PRO B CG  1 
ATOM   1642 C  CD  . PRO B 2 39  ? 33.380  -37.132 15.086 1.00 25.43 ? 39   PRO B CD  1 
ATOM   1643 N  N   . ASP B 2 40  ? 37.151  -38.115 15.279 1.00 38.17 ? 40   ASP B N   1 
ATOM   1644 C  CA  . ASP B 2 40  ? 38.562  -38.418 14.969 1.00 41.96 ? 40   ASP B CA  1 
ATOM   1645 C  C   . ASP B 2 40  ? 39.445  -37.151 14.890 1.00 39.40 ? 40   ASP B C   1 
ATOM   1646 O  O   . ASP B 2 40  ? 40.666  -37.260 14.959 1.00 38.26 ? 40   ASP B O   1 
ATOM   1647 C  CB  . ASP B 2 40  ? 38.687  -39.230 13.662 1.00 45.19 ? 40   ASP B CB  1 
ATOM   1648 C  CG  . ASP B 2 40  ? 38.038  -38.527 12.457 1.00 59.27 ? 40   ASP B CG  1 
ATOM   1649 O  OD1 . ASP B 2 40  ? 36.786  -38.451 12.403 1.00 70.22 ? 40   ASP B OD1 1 
ATOM   1650 O  OD2 . ASP B 2 40  ? 38.775  -38.052 11.559 1.00 70.12 ? 40   ASP B OD2 1 
ATOM   1651 N  N   . GLU B 2 41  ? 38.821  -35.973 14.747 1.00 33.16 ? 41   GLU B N   1 
ATOM   1652 C  CA  . GLU B 2 41  ? 39.530  -34.709 14.667 1.00 34.06 ? 41   GLU B CA  1 
ATOM   1653 C  C   . GLU B 2 41  ? 39.477  -33.949 15.983 1.00 31.12 ? 41   GLU B C   1 
ATOM   1654 O  O   . GLU B 2 41  ? 39.769  -32.762 16.016 1.00 29.02 ? 41   GLU B O   1 
ATOM   1655 C  CB  . GLU B 2 41  ? 38.990  -33.852 13.493 1.00 36.93 ? 41   GLU B CB  1 
ATOM   1656 C  CG  . GLU B 2 41  ? 39.745  -34.146 12.169 1.00 42.14 ? 41   GLU B CG  1 
ATOM   1657 C  CD  . GLU B 2 41  ? 39.066  -33.663 10.869 1.00 37.72 ? 41   GLU B CD  1 
ATOM   1658 O  OE1 . GLU B 2 41  ? 38.588  -32.510 10.774 1.00 31.50 ? 41   GLU B OE1 1 
ATOM   1659 O  OE2 . GLU B 2 41  ? 39.062  -34.453 9.901  1.00 46.84 ? 41   GLU B OE2 1 
ATOM   1660 N  N   . GLN B 2 42  ? 39.134  -34.638 17.066 1.00 29.14 ? 42   GLN B N   1 
ATOM   1661 C  CA  . GLN B 2 42  ? 39.110  -34.031 18.396 1.00 27.21 ? 42   GLN B CA  1 
ATOM   1662 C  C   . GLN B 2 42  ? 39.828  -34.825 19.448 1.00 25.41 ? 42   GLN B C   1 
ATOM   1663 O  O   . GLN B 2 42  ? 39.733  -36.048 19.493 1.00 30.59 ? 42   GLN B O   1 
ATOM   1664 C  CB  . GLN B 2 42  ? 37.689  -33.923 18.913 1.00 25.20 ? 42   GLN B CB  1 
ATOM   1665 C  CG  . GLN B 2 42  ? 36.722  -33.247 18.019 1.00 23.66 ? 42   GLN B CG  1 
ATOM   1666 C  CD  . GLN B 2 42  ? 35.325  -33.462 18.499 1.00 20.50 ? 42   GLN B CD  1 
ATOM   1667 O  OE1 . GLN B 2 42  ? 35.104  -33.686 19.685 1.00 22.16 ? 42   GLN B OE1 1 
ATOM   1668 N  NE2 . GLN B 2 42  ? 34.367  -33.433 17.580 1.00 26.11 ? 42   GLN B NE2 1 
ATOM   1669 N  N   . ARG B 2 43  ? 40.483  -34.112 20.348 1.00 30.90 ? 43   ARG B N   1 
ATOM   1670 C  CA  . ARG B 2 43  ? 40.927  -34.691 21.602 1.00 29.53 ? 43   ARG B CA  1 
ATOM   1671 C  C   . ARG B 2 43  ? 40.165  -34.048 22.742 1.00 33.30 ? 43   ARG B C   1 
ATOM   1672 O  O   . ARG B 2 43  ? 40.066  -32.827 22.806 1.00 31.16 ? 43   ARG B O   1 
ATOM   1673 C  CB  . ARG B 2 43  ? 42.411  -34.450 21.770 1.00 29.01 ? 43   ARG B CB  1 
ATOM   1674 C  CG  . ARG B 2 43  ? 43.233  -35.357 20.891 1.00 21.97 ? 43   ARG B CG  1 
ATOM   1675 C  CD  . ARG B 2 43  ? 44.665  -35.057 21.081 1.00 26.48 ? 43   ARG B CD  1 
ATOM   1676 N  NE  . ARG B 2 43  ? 45.545  -36.001 20.388 1.00 28.60 ? 43   ARG B NE  1 
ATOM   1677 C  CZ  . ARG B 2 43  ? 46.865  -35.829 20.329 1.00 29.12 ? 43   ARG B CZ  1 
ATOM   1678 N  NH1 . ARG B 2 43  ? 47.420  -34.770 20.912 1.00 31.62 ? 43   ARG B NH1 1 
ATOM   1679 N  NH2 . ARG B 2 43  ? 47.635  -36.691 19.683 1.00 31.72 ? 43   ARG B NH2 1 
ATOM   1680 N  N   . LEU B 2 44  ? 39.604  -34.874 23.620 1.00 33.99 ? 44   LEU B N   1 
ATOM   1681 C  CA  . LEU B 2 44  ? 38.965  -34.382 24.822 1.00 31.37 ? 44   LEU B CA  1 
ATOM   1682 C  C   . LEU B 2 44  ? 39.829  -34.678 26.055 1.00 27.89 ? 44   LEU B C   1 
ATOM   1683 O  O   . LEU B 2 44  ? 40.411  -35.755 26.186 1.00 26.48 ? 44   LEU B O   1 
ATOM   1684 C  CB  . LEU B 2 44  ? 37.565  -34.979 24.957 1.00 31.16 ? 44   LEU B CB  1 
ATOM   1685 C  CG  . LEU B 2 44  ? 36.521  -34.454 23.960 1.00 35.72 ? 44   LEU B CG  1 
ATOM   1686 C  CD1 . LEU B 2 44  ? 35.153  -35.098 24.216 1.00 14.38 ? 44   LEU B CD1 1 
ATOM   1687 C  CD2 . LEU B 2 44  ? 36.412  -32.916 24.007 1.00 29.14 ? 44   LEU B CD2 1 
ATOM   1688 N  N   . TYR B 2 45  ? 39.881  -33.713 26.964 1.00 25.72 ? 45   TYR B N   1 
ATOM   1689 C  CA  . TYR B 2 45  ? 40.803  -33.739 28.083 1.00 24.61 ? 45   TYR B CA  1 
ATOM   1690 C  C   . TYR B 2 45  ? 40.125  -33.469 29.411 1.00 24.28 ? 45   TYR B C   1 
ATOM   1691 O  O   . TYR B 2 45  ? 39.258  -32.621 29.510 1.00 27.47 ? 45   TYR B O   1 
ATOM   1692 C  CB  . TYR B 2 45  ? 41.842  -32.660 27.892 1.00 27.13 ? 45   TYR B CB  1 
ATOM   1693 C  CG  . TYR B 2 45  ? 42.875  -32.904 26.824 1.00 23.69 ? 45   TYR B CG  1 
ATOM   1694 C  CD1 . TYR B 2 45  ? 44.073  -33.543 27.121 1.00 32.35 ? 45   TYR B CD1 1 
ATOM   1695 C  CD2 . TYR B 2 45  ? 42.693  -32.428 25.538 1.00 27.34 ? 45   TYR B CD2 1 
ATOM   1696 C  CE1 . TYR B 2 45  ? 45.077  -33.724 26.137 1.00 20.53 ? 45   TYR B CE1 1 
ATOM   1697 C  CE2 . TYR B 2 45  ? 43.672  -32.613 24.547 1.00 27.88 ? 45   TYR B CE2 1 
ATOM   1698 C  CZ  . TYR B 2 45  ? 44.869  -33.265 24.860 1.00 27.99 ? 45   TYR B CZ  1 
ATOM   1699 O  OH  . TYR B 2 45  ? 45.841  -33.449 23.890 1.00 27.71 ? 45   TYR B OH  1 
ATOM   1700 N  N   . LYS B 2 46  ? 40.520  -34.196 30.445 1.00 32.12 ? 46   LYS B N   1 
ATOM   1701 C  CA  . LYS B 2 46  ? 40.144  -33.838 31.809 1.00 32.25 ? 46   LYS B CA  1 
ATOM   1702 C  C   . LYS B 2 46  ? 41.432  -33.363 32.483 1.00 32.66 ? 46   LYS B C   1 
ATOM   1703 O  O   . LYS B 2 46  ? 42.312  -34.161 32.794 1.00 26.74 ? 46   LYS B O   1 
ATOM   1704 C  CB  . LYS B 2 46  ? 39.514  -35.018 32.547 1.00 34.45 ? 46   LYS B CB  1 
ATOM   1705 C  CG  . LYS B 2 46  ? 39.201  -34.750 34.025 1.00 40.09 ? 46   LYS B CG  1 
ATOM   1706 C  CD  . LYS B 2 46  ? 38.353  -35.875 34.651 1.00 47.62 ? 46   LYS B CD  1 
ATOM   1707 C  CE  . LYS B 2 46  ? 38.626  -36.072 36.170 1.00 53.92 ? 46   LYS B CE  1 
ATOM   1708 N  NZ  . LYS B 2 46  ? 38.451  -34.845 37.041 1.00 41.05 ? 46   LYS B NZ  1 
ATOM   1709 N  N   . ASP B 2 47  ? 41.516  -32.052 32.700 1.00 36.23 ? 47   ASP B N   1 
ATOM   1710 C  CA  . ASP B 2 47  ? 42.761  -31.380 33.034 1.00 37.22 ? 47   ASP B CA  1 
ATOM   1711 C  C   . ASP B 2 47  ? 43.659  -31.629 31.841 1.00 35.03 ? 47   ASP B C   1 
ATOM   1712 O  O   . ASP B 2 47  ? 43.229  -31.367 30.729 1.00 30.93 ? 47   ASP B O   1 
ATOM   1713 C  CB  . ASP B 2 47  ? 43.354  -31.874 34.359 1.00 40.85 ? 47   ASP B CB  1 
ATOM   1714 C  CG  . ASP B 2 47  ? 42.439  -31.610 35.542 1.00 42.66 ? 47   ASP B CG  1 
ATOM   1715 O  OD1 . ASP B 2 47  ? 41.881  -30.506 35.611 1.00 35.06 ? 47   ASP B OD1 1 
ATOM   1716 O  OD2 . ASP B 2 47  ? 42.295  -32.499 36.410 1.00 59.79 ? 47   ASP B OD2 1 
ATOM   1717 N  N   . ASP B 2 48  ? 44.866  -32.155 32.044 1.00 32.11 ? 48   ASP B N   1 
ATOM   1718 C  CA  . ASP B 2 48  ? 45.739  -32.460 30.927 1.00 36.05 ? 48   ASP B CA  1 
ATOM   1719 C  C   . ASP B 2 48  ? 45.745  -33.933 30.495 1.00 32.29 ? 48   ASP B C   1 
ATOM   1720 O  O   . ASP B 2 48  ? 46.570  -34.354 29.693 1.00 29.75 ? 48   ASP B O   1 
ATOM   1721 C  CB  . ASP B 2 48  ? 47.124  -31.937 31.250 1.00 39.99 ? 48   ASP B CB  1 
ATOM   1722 C  CG  . ASP B 2 48  ? 47.163  -30.413 31.222 1.00 51.46 ? 48   ASP B CG  1 
ATOM   1723 O  OD1 . ASP B 2 48  ? 47.225  -29.831 30.107 1.00 47.76 ? 48   ASP B OD1 1 
ATOM   1724 O  OD2 . ASP B 2 48  ? 47.097  -29.802 32.312 1.00 52.68 ? 48   ASP B OD2 1 
ATOM   1725 N  N   . GLN B 2 49  ? 44.796  -34.705 31.001 1.00 28.44 ? 49   GLN B N   1 
ATOM   1726 C  CA  . GLN B 2 49  ? 44.724  -36.124 30.682 1.00 26.56 ? 49   GLN B CA  1 
ATOM   1727 C  C   . GLN B 2 49  ? 43.805  -36.332 29.505 1.00 24.77 ? 49   GLN B C   1 
ATOM   1728 O  O   . GLN B 2 49  ? 42.619  -36.052 29.596 1.00 27.14 ? 49   GLN B O   1 
ATOM   1729 C  CB  . GLN B 2 49  ? 44.183  -36.895 31.868 1.00 24.59 ? 49   GLN B CB  1 
ATOM   1730 C  CG  . GLN B 2 49  ? 43.870  -38.338 31.566 1.00 27.41 ? 49   GLN B CG  1 
ATOM   1731 C  CD  . GLN B 2 49  ? 43.486  -39.111 32.796 1.00 32.20 ? 49   GLN B CD  1 
ATOM   1732 O  OE1 . GLN B 2 49  ? 43.528  -38.583 33.896 1.00 25.48 ? 49   GLN B OE1 1 
ATOM   1733 N  NE2 . GLN B 2 49  ? 43.129  -40.374 32.620 1.00 23.41 ? 49   GLN B NE2 1 
ATOM   1734 N  N   . LEU B 2 50  ? 44.357  -36.817 28.405 1.00 23.34 ? 50   LEU B N   1 
ATOM   1735 C  CA  . LEU B 2 50  ? 43.568  -37.151 27.226 1.00 22.63 ? 50   LEU B CA  1 
ATOM   1736 C  C   . LEU B 2 50  ? 42.621  -38.277 27.608 1.00 24.00 ? 50   LEU B C   1 
ATOM   1737 O  O   . LEU B 2 50  ? 43.034  -39.243 28.236 1.00 19.20 ? 50   LEU B O   1 
ATOM   1738 C  CB  . LEU B 2 50  ? 44.506  -37.601 26.096 1.00 18.59 ? 50   LEU B CB  1 
ATOM   1739 C  CG  . LEU B 2 50  ? 43.908  -38.019 24.757 1.00 25.23 ? 50   LEU B CG  1 
ATOM   1740 C  CD1 . LEU B 2 50  ? 43.181  -36.864 24.111 1.00 23.74 ? 50   LEU B CD1 1 
ATOM   1741 C  CD2 . LEU B 2 50  ? 44.982  -38.601 23.811 1.00 18.23 ? 50   LEU B CD2 1 
ATOM   1742 N  N   . LEU B 2 51  ? 41.355  -38.162 27.229 1.00 27.63 ? 51   LEU B N   1 
ATOM   1743 C  CA  . LEU B 2 51  ? 40.355  -39.152 27.620 1.00 22.70 ? 51   LEU B CA  1 
ATOM   1744 C  C   . LEU B 2 51  ? 40.196  -40.286 26.593 1.00 24.41 ? 51   LEU B C   1 
ATOM   1745 O  O   . LEU B 2 51  ? 40.495  -40.130 25.411 1.00 30.05 ? 51   LEU B O   1 
ATOM   1746 C  CB  . LEU B 2 51  ? 39.018  -38.452 27.847 1.00 21.79 ? 51   LEU B CB  1 
ATOM   1747 C  CG  . LEU B 2 51  ? 38.964  -37.424 28.986 1.00 16.62 ? 51   LEU B CG  1 
ATOM   1748 C  CD1 . LEU B 2 51  ? 37.649  -36.770 28.975 1.00 19.14 ? 51   LEU B CD1 1 
ATOM   1749 C  CD2 . LEU B 2 51  ? 39.195  -38.022 30.376 1.00 22.11 ? 51   LEU B CD2 1 
ATOM   1750 N  N   . ASP B 2 52  ? 39.696  -41.416 27.069 1.00 21.49 ? 52   ASP B N   1 
ATOM   1751 C  CA  . ASP B 2 52  ? 39.415  -42.614 26.267 1.00 25.76 ? 52   ASP B CA  1 
ATOM   1752 C  C   . ASP B 2 52  ? 37.975  -42.567 25.701 1.00 24.14 ? 52   ASP B C   1 
ATOM   1753 O  O   . ASP B 2 52  ? 36.985  -42.620 26.454 1.00 18.62 ? 52   ASP B O   1 
ATOM   1754 C  CB  . ASP B 2 52  ? 39.592  -43.859 27.191 1.00 32.64 ? 52   ASP B CB  1 
ATOM   1755 C  CG  . ASP B 2 52  ? 39.426  -45.210 26.464 1.00 42.34 ? 52   ASP B CG  1 
ATOM   1756 O  OD1 . ASP B 2 52  ? 39.770  -46.260 27.070 1.00 53.50 ? 52   ASP B OD1 1 
ATOM   1757 O  OD2 . ASP B 2 52  ? 38.954  -45.233 25.307 1.00 48.67 ? 52   ASP B OD2 1 
ATOM   1758 N  N   . ASP B 2 53  ? 37.879  -42.458 24.381 1.00 22.46 ? 53   ASP B N   1 
ATOM   1759 C  CA  . ASP B 2 53  ? 36.609  -42.491 23.635 1.00 27.84 ? 53   ASP B CA  1 
ATOM   1760 C  C   . ASP B 2 53  ? 35.564  -43.497 24.127 1.00 29.14 ? 53   ASP B C   1 
ATOM   1761 O  O   . ASP B 2 53  ? 34.379  -43.202 24.145 1.00 28.32 ? 53   ASP B O   1 
ATOM   1762 C  CB  . ASP B 2 53  ? 36.912  -42.847 22.166 1.00 32.75 ? 53   ASP B CB  1 
ATOM   1763 C  CG  . ASP B 2 53  ? 37.372  -41.642 21.329 1.00 39.37 ? 53   ASP B CG  1 
ATOM   1764 O  OD1 . ASP B 2 53  ? 37.349  -40.489 21.834 1.00 51.60 ? 53   ASP B OD1 1 
ATOM   1765 O  OD2 . ASP B 2 53  ? 37.746  -41.864 20.148 1.00 53.23 ? 53   ASP B OD2 1 
ATOM   1766 N  N   . GLY B 2 54  ? 36.007  -44.701 24.484 1.00 28.67 ? 54   GLY B N   1 
ATOM   1767 C  CA  . GLY B 2 54  ? 35.111  -45.768 24.880 1.00 27.64 ? 54   GLY B CA  1 
ATOM   1768 C  C   . GLY B 2 54  ? 34.715  -45.790 26.345 1.00 26.98 ? 54   GLY B C   1 
ATOM   1769 O  O   . GLY B 2 54  ? 33.892  -46.603 26.738 1.00 35.04 ? 54   GLY B O   1 
ATOM   1770 N  N   . LYS B 2 55  ? 35.293  -44.931 27.168 1.00 25.36 ? 55   LYS B N   1 
ATOM   1771 C  CA  . LYS B 2 55  ? 34.912  -44.879 28.578 1.00 29.51 ? 55   LYS B CA  1 
ATOM   1772 C  C   . LYS B 2 55  ? 33.678  -43.983 28.809 1.00 27.69 ? 55   LYS B C   1 
ATOM   1773 O  O   . LYS B 2 55  ? 33.437  -43.026 28.076 1.00 31.01 ? 55   LYS B O   1 
ATOM   1774 C  CB  . LYS B 2 55  ? 36.106  -44.457 29.442 1.00 29.10 ? 55   LYS B CB  1 
ATOM   1775 C  CG  . LYS B 2 55  ? 36.882  -45.690 29.941 1.00 46.41 ? 55   LYS B CG  1 
ATOM   1776 C  CD  . LYS B 2 55  ? 38.343  -45.435 30.318 1.00 55.15 ? 55   LYS B CD  1 
ATOM   1777 C  CE  . LYS B 2 55  ? 38.511  -44.403 31.421 1.00 57.99 ? 55   LYS B CE  1 
ATOM   1778 N  NZ  . LYS B 2 55  ? 39.964  -44.207 31.725 1.00 64.67 ? 55   LYS B NZ  1 
ATOM   1779 N  N   . THR B 2 56  ? 32.901  -44.303 29.828 1.00 22.97 ? 56   THR B N   1 
ATOM   1780 C  CA  . THR B 2 56  ? 31.780  -43.463 30.206 1.00 29.66 ? 56   THR B CA  1 
ATOM   1781 C  C   . THR B 2 56  ? 32.308  -42.230 30.934 1.00 31.03 ? 56   THR B C   1 
ATOM   1782 O  O   . THR B 2 56  ? 33.401  -42.231 31.489 1.00 32.24 ? 56   THR B O   1 
ATOM   1783 C  CB  . THR B 2 56  ? 30.808  -44.175 31.162 1.00 32.09 ? 56   THR B CB  1 
ATOM   1784 O  OG1 . THR B 2 56  ? 31.414  -44.269 32.457 1.00 39.10 ? 56   THR B OG1 1 
ATOM   1785 C  CG2 . THR B 2 56  ? 30.445  -45.592 30.666 1.00 30.84 ? 56   THR B CG2 1 
ATOM   1786 N  N   . LEU B 2 57  ? 31.500  -41.190 30.966 1.00 32.68 ? 57   LEU B N   1 
ATOM   1787 C  CA  . LEU B 2 57  ? 31.873  -39.967 31.644 1.00 31.75 ? 57   LEU B CA  1 
ATOM   1788 C  C   . LEU B 2 57  ? 32.006  -40.170 33.147 1.00 31.60 ? 57   LEU B C   1 
ATOM   1789 O  O   . LEU B 2 57  ? 32.871  -39.569 33.778 1.00 31.20 ? 57   LEU B O   1 
ATOM   1790 C  CB  . LEU B 2 57  ? 30.860  -38.865 31.339 1.00 30.22 ? 57   LEU B CB  1 
ATOM   1791 C  CG  . LEU B 2 57  ? 30.657  -38.610 29.838 1.00 36.48 ? 57   LEU B CG  1 
ATOM   1792 C  CD1 . LEU B 2 57  ? 29.633  -37.515 29.603 1.00 26.14 ? 57   LEU B CD1 1 
ATOM   1793 C  CD2 . LEU B 2 57  ? 31.982  -38.309 29.130 1.00 29.16 ? 57   LEU B CD2 1 
ATOM   1794 N  N   . GLY B 2 58  ? 31.153  -41.011 33.723 1.00 33.22 ? 58   GLY B N   1 
ATOM   1795 C  CA  . GLY B 2 58  ? 31.281  -41.371 35.138 1.00 33.84 ? 58   GLY B CA  1 
ATOM   1796 C  C   . GLY B 2 58  ? 32.582  -42.100 35.449 1.00 34.68 ? 58   GLY B C   1 
ATOM   1797 O  O   . GLY B 2 58  ? 33.222  -41.816 36.454 1.00 38.76 ? 58   GLY B O   1 
ATOM   1798 N  N   . GLU B 2 59  ? 32.965  -43.034 34.580 1.00 34.51 ? 59   GLU B N   1 
ATOM   1799 C  CA  . GLU B 2 59  ? 34.285  -43.678 34.634 1.00 38.21 ? 59   GLU B CA  1 
ATOM   1800 C  C   . GLU B 2 59  ? 35.464  -42.690 34.512 1.00 37.75 ? 59   GLU B C   1 
ATOM   1801 O  O   . GLU B 2 59  ? 36.518  -42.936 35.086 1.00 40.31 ? 59   GLU B O   1 
ATOM   1802 C  CB  . GLU B 2 59  ? 34.408  -44.749 33.539 1.00 39.57 ? 59   GLU B CB  1 
ATOM   1803 C  CG  . GLU B 2 59  ? 33.864  -46.116 33.919 1.00 39.52 ? 59   GLU B CG  1 
ATOM   1804 C  CD  . GLU B 2 59  ? 33.308  -46.915 32.725 1.00 47.33 ? 59   GLU B CD  1 
ATOM   1805 O  OE1 . GLU B 2 59  ? 33.786  -46.773 31.571 1.00 39.90 ? 59   GLU B OE1 1 
ATOM   1806 O  OE2 . GLU B 2 59  ? 32.371  -47.704 32.957 1.00 51.48 ? 59   GLU B OE2 1 
ATOM   1807 N  N   . CYS B 2 60  ? 35.300  -41.598 33.766 1.00 37.70 ? 60   CYS B N   1 
ATOM   1808 C  CA  . CYS B 2 60  ? 36.320  -40.516 33.743 1.00 37.40 ? 60   CYS B CA  1 
ATOM   1809 C  C   . CYS B 2 60  ? 36.249  -39.564 34.937 1.00 36.38 ? 60   CYS B C   1 
ATOM   1810 O  O   . CYS B 2 60  ? 37.047  -38.639 35.009 1.00 33.50 ? 60   CYS B O   1 
ATOM   1811 C  CB  . CYS B 2 60  ? 36.196  -39.638 32.503 1.00 33.40 ? 60   CYS B CB  1 
ATOM   1812 S  SG  . CYS B 2 60  ? 36.060  -40.493 30.975 1.00 36.43 ? 60   CYS B SG  1 
ATOM   1813 N  N   . GLY B 2 61  ? 35.291  -39.759 35.843 1.00 38.70 ? 61   GLY B N   1 
ATOM   1814 C  CA  . GLY B 2 61  ? 35.195  -38.953 37.060 1.00 42.06 ? 61   GLY B CA  1 
ATOM   1815 C  C   . GLY B 2 61  ? 34.155  -37.832 37.033 1.00 45.00 ? 61   GLY B C   1 
ATOM   1816 O  O   . GLY B 2 61  ? 34.013  -37.082 38.010 1.00 43.48 ? 61   GLY B O   1 
ATOM   1817 N  N   . PHE B 2 62  ? 33.423  -37.709 35.929 1.00 44.18 ? 62   PHE B N   1 
ATOM   1818 C  CA  . PHE B 2 62  ? 32.311  -36.753 35.851 1.00 44.72 ? 62   PHE B CA  1 
ATOM   1819 C  C   . PHE B 2 62  ? 31.004  -37.317 36.484 1.00 40.41 ? 62   PHE B C   1 
ATOM   1820 O  O   . PHE B 2 62  ? 30.387  -38.205 35.925 1.00 48.91 ? 62   PHE B O   1 
ATOM   1821 C  CB  . PHE B 2 62  ? 32.068  -36.357 34.391 1.00 45.49 ? 62   PHE B CB  1 
ATOM   1822 C  CG  . PHE B 2 62  ? 33.272  -35.742 33.707 1.00 42.09 ? 62   PHE B CG  1 
ATOM   1823 C  CD1 . PHE B 2 62  ? 33.819  -34.557 34.169 1.00 37.27 ? 62   PHE B CD1 1 
ATOM   1824 C  CD2 . PHE B 2 62  ? 33.834  -36.338 32.589 1.00 39.80 ? 62   PHE B CD2 1 
ATOM   1825 C  CE1 . PHE B 2 62  ? 34.915  -33.979 33.539 1.00 41.25 ? 62   PHE B CE1 1 
ATOM   1826 C  CE2 . PHE B 2 62  ? 34.942  -35.759 31.947 1.00 49.76 ? 62   PHE B CE2 1 
ATOM   1827 C  CZ  . PHE B 2 62  ? 35.478  -34.575 32.426 1.00 43.18 ? 62   PHE B CZ  1 
ATOM   1828 N  N   . THR B 2 63  ? 30.583  -36.784 37.632 1.00 34.78 ? 63   THR B N   1 
ATOM   1829 C  CA  . THR B 2 63  ? 29.431  -37.292 38.367 1.00 30.56 ? 63   THR B CA  1 
ATOM   1830 C  C   . THR B 2 63  ? 28.562  -36.183 38.961 1.00 30.48 ? 63   THR B C   1 
ATOM   1831 O  O   . THR B 2 63  ? 28.888  -35.016 38.841 1.00 35.78 ? 63   THR B O   1 
ATOM   1832 C  CB  . THR B 2 63  ? 29.903  -38.161 39.535 1.00 31.89 ? 63   THR B CB  1 
ATOM   1833 O  OG1 . THR B 2 63  ? 30.444  -37.313 40.552 1.00 35.10 ? 63   THR B OG1 1 
ATOM   1834 C  CG2 . THR B 2 63  ? 30.957  -39.136 39.088 1.00 23.37 ? 63   THR B CG2 1 
ATOM   1835 N  N   . SER B 2 64  ? 27.469  -36.571 39.611 1.00 28.49 ? 64   SER B N   1 
ATOM   1836 C  CA  . SER B 2 64  ? 26.583  -35.669 40.362 1.00 32.87 ? 64   SER B CA  1 
ATOM   1837 C  C   . SER B 2 64  ? 27.256  -34.694 41.286 1.00 31.44 ? 64   SER B C   1 
ATOM   1838 O  O   . SER B 2 64  ? 26.740  -33.613 41.515 1.00 47.13 ? 64   SER B O   1 
ATOM   1839 C  CB  . SER B 2 64  ? 25.646  -36.476 41.299 1.00 33.50 ? 64   SER B CB  1 
ATOM   1840 O  OG  . SER B 2 64  ? 24.954  -37.500 40.615 1.00 54.19 ? 64   SER B OG  1 
ATOM   1841 N  N   . GLN B 2 65  ? 28.319  -35.123 41.936 1.00 36.08 ? 65   GLN B N   1 
ATOM   1842 C  CA  . GLN B 2 65  ? 28.959  -34.316 42.965 1.00 37.77 ? 65   GLN B CA  1 
ATOM   1843 C  C   . GLN B 2 65  ? 30.003  -33.382 42.310 1.00 39.11 ? 65   GLN B C   1 
ATOM   1844 O  O   . GLN B 2 65  ? 30.333  -32.319 42.839 1.00 39.92 ? 65   GLN B O   1 
ATOM   1845 C  CB  . GLN B 2 65  ? 29.571  -35.235 44.036 1.00 38.27 ? 65   GLN B CB  1 
ATOM   1846 C  CG  . GLN B 2 65  ? 28.533  -36.146 44.746 1.00 36.21 ? 65   GLN B CG  1 
ATOM   1847 N  N   . THR B 2 66  ? 30.412  -33.761 41.106 1.00 36.72 ? 66   THR B N   1 
ATOM   1848 C  CA  . THR B 2 66  ? 31.564  -33.215 40.380 1.00 37.37 ? 66   THR B CA  1 
ATOM   1849 C  C   . THR B 2 66  ? 31.192  -32.328 39.192 1.00 32.84 ? 66   THR B C   1 
ATOM   1850 O  O   . THR B 2 66  ? 31.972  -31.495 38.777 1.00 33.96 ? 66   THR B O   1 
ATOM   1851 C  CB  . THR B 2 66  ? 32.392  -34.435 39.863 1.00 37.13 ? 66   THR B CB  1 
ATOM   1852 O  OG1 . THR B 2 66  ? 33.089  -35.013 40.971 1.00 34.53 ? 66   THR B OG1 1 
ATOM   1853 C  CG2 . THR B 2 66  ? 33.378  -34.087 38.754 1.00 38.97 ? 66   THR B CG2 1 
ATOM   1854 N  N   . ALA B 2 67  ? 30.000  -32.525 38.634 1.00 38.16 ? 67   ALA B N   1 
ATOM   1855 C  CA  . ALA B 2 67  ? 29.586  -31.863 37.400 1.00 30.12 ? 67   ALA B CA  1 
ATOM   1856 C  C   . ALA B 2 67  ? 28.117  -31.430 37.525 1.00 28.92 ? 67   ALA B C   1 
ATOM   1857 O  O   . ALA B 2 67  ? 27.222  -32.035 36.928 1.00 25.33 ? 67   ALA B O   1 
ATOM   1858 C  CB  . ALA B 2 67  ? 29.781  -32.800 36.236 1.00 32.18 ? 67   ALA B CB  1 
ATOM   1859 N  N   . ARG B 2 68  ? 27.907  -30.372 38.305 1.00 24.39 ? 68   ARG B N   1 
ATOM   1860 C  CA  . ARG B 2 68  ? 26.586  -29.896 38.712 1.00 29.69 ? 68   ARG B CA  1 
ATOM   1861 C  C   . ARG B 2 68  ? 26.164  -28.727 37.842 1.00 27.89 ? 68   ARG B C   1 
ATOM   1862 O  O   . ARG B 2 68  ? 27.003  -28.020 37.313 1.00 27.87 ? 68   ARG B O   1 
ATOM   1863 C  CB  . ARG B 2 68  ? 26.609  -29.455 40.196 1.00 30.13 ? 68   ARG B CB  1 
ATOM   1864 C  CG  . ARG B 2 68  ? 26.687  -30.607 41.234 1.00 33.02 ? 68   ARG B CG  1 
ATOM   1865 C  CD  . ARG B 2 68  ? 27.710  -30.366 42.382 1.00 42.61 ? 68   ARG B CD  1 
ATOM   1866 N  NE  . ARG B 2 68  ? 27.575  -29.040 42.999 1.00 61.55 ? 68   ARG B NE  1 
ATOM   1867 C  CZ  . ARG B 2 68  ? 28.578  -28.279 43.460 1.00 64.23 ? 68   ARG B CZ  1 
ATOM   1868 N  NH1 . ARG B 2 68  ? 28.313  -27.068 43.970 1.00 62.62 ? 68   ARG B NH1 1 
ATOM   1869 N  NH2 . ARG B 2 68  ? 29.840  -28.695 43.403 1.00 61.40 ? 68   ARG B NH2 1 
ATOM   1870 N  N   . PRO B 2 69  ? 24.852  -28.504 37.703 1.00 33.93 ? 69   PRO B N   1 
ATOM   1871 C  CA  . PRO B 2 69  ? 24.408  -27.406 36.850 1.00 32.80 ? 69   PRO B CA  1 
ATOM   1872 C  C   . PRO B 2 69  ? 25.019  -26.073 37.238 1.00 37.18 ? 69   PRO B C   1 
ATOM   1873 O  O   . PRO B 2 69  ? 25.455  -25.294 36.355 1.00 39.20 ? 69   PRO B O   1 
ATOM   1874 C  CB  . PRO B 2 69  ? 22.895  -27.372 37.077 1.00 34.38 ? 69   PRO B CB  1 
ATOM   1875 C  CG  . PRO B 2 69  ? 22.518  -28.733 37.509 1.00 28.77 ? 69   PRO B CG  1 
ATOM   1876 C  CD  . PRO B 2 69  ? 23.717  -29.243 38.293 1.00 36.09 ? 69   PRO B CD  1 
ATOM   1877 N  N   . GLN B 2 70  ? 25.054  -25.812 38.547 1.00 34.02 ? 70   GLN B N   1 
ATOM   1878 C  CA  . GLN B 2 70  ? 25.604  -24.551 39.069 1.00 29.15 ? 70   GLN B CA  1 
ATOM   1879 C  C   . GLN B 2 70  ? 27.135  -24.507 39.151 1.00 29.54 ? 70   GLN B C   1 
ATOM   1880 O  O   . GLN B 2 70  ? 27.700  -23.449 39.436 1.00 34.99 ? 70   GLN B O   1 
ATOM   1881 C  CB  . GLN B 2 70  ? 24.997  -24.225 40.444 1.00 30.27 ? 70   GLN B CB  1 
ATOM   1882 C  CG  . GLN B 2 70  ? 25.392  -25.148 41.610 1.00 29.27 ? 70   GLN B CG  1 
ATOM   1883 C  CD  . GLN B 2 70  ? 24.617  -26.442 41.645 1.00 37.55 ? 70   GLN B CD  1 
ATOM   1884 O  OE1 . GLN B 2 70  ? 23.918  -26.815 40.671 1.00 27.01 ? 70   GLN B OE1 1 
ATOM   1885 N  NE2 . GLN B 2 70  ? 24.737  -27.154 42.771 1.00 27.18 ? 70   GLN B NE2 1 
ATOM   1886 N  N   . ALA B 2 71  ? 27.796  -25.653 38.940 1.00 30.99 ? 71   ALA B N   1 
ATOM   1887 C  CA  . ALA B 2 71  ? 29.278  -25.772 39.015 1.00 29.60 ? 71   ALA B CA  1 
ATOM   1888 C  C   . ALA B 2 71  ? 29.747  -26.919 38.112 1.00 29.98 ? 71   ALA B C   1 
ATOM   1889 O  O   . ALA B 2 71  ? 30.182  -27.978 38.586 1.00 28.22 ? 71   ALA B O   1 
ATOM   1890 C  CB  . ALA B 2 71  ? 29.752  -25.977 40.457 1.00 25.11 ? 71   ALA B CB  1 
ATOM   1891 N  N   . PRO B 2 72  ? 29.614  -26.720 36.798 1.00 29.32 ? 72   PRO B N   1 
ATOM   1892 C  CA  . PRO B 2 72  ? 29.939  -27.730 35.808 1.00 27.23 ? 72   PRO B CA  1 
ATOM   1893 C  C   . PRO B 2 72  ? 31.411  -28.067 35.763 1.00 27.24 ? 72   PRO B C   1 
ATOM   1894 O  O   . PRO B 2 72  ? 32.219  -27.246 36.152 1.00 28.47 ? 72   PRO B O   1 
ATOM   1895 C  CB  . PRO B 2 72  ? 29.512  -27.080 34.489 1.00 31.69 ? 72   PRO B CB  1 
ATOM   1896 C  CG  . PRO B 2 72  ? 29.491  -25.634 34.758 1.00 33.34 ? 72   PRO B CG  1 
ATOM   1897 C  CD  . PRO B 2 72  ? 29.089  -25.491 36.173 1.00 28.00 ? 72   PRO B CD  1 
ATOM   1898 N  N   . ALA B 2 73  ? 31.730  -29.277 35.299 1.00 20.97 ? 73   ALA B N   1 
ATOM   1899 C  CA  . ALA B 2 73  ? 33.099  -29.735 35.170 1.00 21.27 ? 73   ALA B CA  1 
ATOM   1900 C  C   . ALA B 2 73  ? 33.615  -29.288 33.823 1.00 22.51 ? 73   ALA B C   1 
ATOM   1901 O  O   . ALA B 2 73  ? 32.888  -29.306 32.840 1.00 30.60 ? 73   ALA B O   1 
ATOM   1902 C  CB  . ALA B 2 73  ? 33.187  -31.266 35.280 1.00 15.13 ? 73   ALA B CB  1 
ATOM   1903 N  N   . THR B 2 74  ? 34.870  -28.882 33.778 1.00 29.40 ? 74   THR B N   1 
ATOM   1904 C  CA  . THR B 2 74  ? 35.505  -28.485 32.529 1.00 31.77 ? 74   THR B CA  1 
ATOM   1905 C  C   . THR B 2 74  ? 36.106  -29.699 31.806 1.00 31.19 ? 74   THR B C   1 
ATOM   1906 O  O   . THR B 2 74  ? 36.784  -30.526 32.424 1.00 32.12 ? 74   THR B O   1 
ATOM   1907 C  CB  . THR B 2 74  ? 36.602  -27.460 32.796 1.00 34.94 ? 74   THR B CB  1 
ATOM   1908 O  OG1 . THR B 2 74  ? 36.005  -26.230 33.242 1.00 34.93 ? 74   THR B OG1 1 
ATOM   1909 C  CG2 . THR B 2 74  ? 37.428  -27.222 31.543 1.00 32.04 ? 74   THR B CG2 1 
ATOM   1910 N  N   . VAL B 2 75  ? 35.810  -29.799 30.511 1.00 31.37 ? 75   VAL B N   1 
ATOM   1911 C  CA  . VAL B 2 75  ? 36.439  -30.740 29.582 1.00 31.19 ? 75   VAL B CA  1 
ATOM   1912 C  C   . VAL B 2 75  ? 37.225  -29.913 28.551 1.00 31.58 ? 75   VAL B C   1 
ATOM   1913 O  O   . VAL B 2 75  ? 36.642  -29.072 27.843 1.00 30.73 ? 75   VAL B O   1 
ATOM   1914 C  CB  . VAL B 2 75  ? 35.365  -31.572 28.847 1.00 29.49 ? 75   VAL B CB  1 
ATOM   1915 C  CG1 . VAL B 2 75  ? 36.010  -32.615 27.936 1.00 24.17 ? 75   VAL B CG1 1 
ATOM   1916 C  CG2 . VAL B 2 75  ? 34.451  -32.233 29.861 1.00 34.25 ? 75   VAL B CG2 1 
ATOM   1917 N  N   . GLY B 2 76  ? 38.540  -30.118 28.478 1.00 27.63 ? 76   GLY B N   1 
ATOM   1918 C  CA  . GLY B 2 76  ? 39.354  -29.466 27.448 1.00 23.11 ? 76   GLY B CA  1 
ATOM   1919 C  C   . GLY B 2 76  ? 39.115  -30.050 26.066 1.00 27.13 ? 76   GLY B C   1 
ATOM   1920 O  O   . GLY B 2 76  ? 38.686  -31.207 25.938 1.00 29.40 ? 76   GLY B O   1 
ATOM   1921 N  N   . LEU B 2 77  ? 39.389  -29.259 25.031 1.00 24.35 ? 77   LEU B N   1 
ATOM   1922 C  CA  . LEU B 2 77  ? 39.260  -29.729 23.665 1.00 25.36 ? 77   LEU B CA  1 
ATOM   1923 C  C   . LEU B 2 77  ? 40.337  -29.147 22.762 1.00 27.52 ? 77   LEU B C   1 
ATOM   1924 O  O   . LEU B 2 77  ? 40.597  -27.940 22.794 1.00 30.41 ? 77   LEU B O   1 
ATOM   1925 C  CB  . LEU B 2 77  ? 37.893  -29.353 23.137 1.00 28.12 ? 77   LEU B CB  1 
ATOM   1926 C  CG  . LEU B 2 77  ? 37.612  -29.432 21.637 1.00 26.51 ? 77   LEU B CG  1 
ATOM   1927 C  CD1 . LEU B 2 77  ? 37.525  -30.879 21.192 1.00 19.92 ? 77   LEU B CD1 1 
ATOM   1928 C  CD2 . LEU B 2 77  ? 36.320  -28.694 21.348 1.00 21.65 ? 77   LEU B CD2 1 
ATOM   1929 N  N   . ALA B 2 78  ? 40.939  -30.029 21.961 1.00 26.03 ? 78   ALA B N   1 
ATOM   1930 C  CA  . ALA B 2 78  ? 41.924  -29.686 20.931 1.00 25.78 ? 78   ALA B CA  1 
ATOM   1931 C  C   . ALA B 2 78  ? 41.510  -30.297 19.572 1.00 26.53 ? 78   ALA B C   1 
ATOM   1932 O  O   . ALA B 2 78  ? 41.065  -31.448 19.519 1.00 25.01 ? 78   ALA B O   1 
ATOM   1933 C  CB  . ALA B 2 78  ? 43.339  -30.221 21.351 1.00 18.50 ? 78   ALA B CB  1 
ATOM   1934 N  N   . PHE B 2 79  ? 41.663  -29.533 18.486 1.00 26.89 ? 79   PHE B N   1 
ATOM   1935 C  CA  . PHE B 2 79  ? 41.442  -30.059 17.130 1.00 28.86 ? 79   PHE B CA  1 
ATOM   1936 C  C   . PHE B 2 79  ? 42.712  -30.498 16.411 1.00 28.70 ? 79   PHE B C   1 
ATOM   1937 O  O   . PHE B 2 79  ? 43.824  -30.056 16.715 1.00 25.55 ? 79   PHE B O   1 
ATOM   1938 C  CB  . PHE B 2 79  ? 40.733  -29.047 16.226 1.00 30.28 ? 79   PHE B CB  1 
ATOM   1939 C  CG  . PHE B 2 79  ? 39.334  -28.681 16.666 1.00 32.52 ? 79   PHE B CG  1 
ATOM   1940 C  CD1 . PHE B 2 79  ? 38.449  -29.644 17.141 1.00 30.73 ? 79   PHE B CD1 1 
ATOM   1941 C  CD2 . PHE B 2 79  ? 38.890  -27.367 16.547 1.00 29.16 ? 79   PHE B CD2 1 
ATOM   1942 C  CE1 . PHE B 2 79  ? 37.167  -29.304 17.516 1.00 28.73 ? 79   PHE B CE1 1 
ATOM   1943 C  CE2 . PHE B 2 79  ? 37.593  -27.014 16.921 1.00 27.07 ? 79   PHE B CE2 1 
ATOM   1944 C  CZ  . PHE B 2 79  ? 36.731  -27.982 17.400 1.00 29.19 ? 79   PHE B CZ  1 
ATOM   1945 N  N   . ARG B 2 80  ? 42.522  -31.383 15.441 1.00 33.21 ? 80   ARG B N   1 
ATOM   1946 C  CA  . ARG B 2 80  ? 43.596  -31.834 14.590 1.00 33.49 ? 80   ARG B CA  1 
ATOM   1947 C  C   . ARG B 2 80  ? 43.874  -30.803 13.494 1.00 39.69 ? 80   ARG B C   1 
ATOM   1948 O  O   . ARG B 2 80  ? 42.966  -30.443 12.742 1.00 38.12 ? 80   ARG B O   1 
ATOM   1949 C  CB  . ARG B 2 80  ? 43.226  -33.178 13.990 1.00 34.03 ? 80   ARG B CB  1 
ATOM   1950 C  CG  . ARG B 2 80  ? 44.334  -33.851 13.203 1.00 32.77 ? 80   ARG B CG  1 
ATOM   1951 C  CD  . ARG B 2 80  ? 43.881  -35.230 12.694 1.00 38.12 ? 80   ARG B CD  1 
ATOM   1952 N  NE  . ARG B 2 80  ? 44.044  -36.282 13.705 1.00 54.80 ? 80   ARG B NE  1 
ATOM   1953 C  CZ  . ARG B 2 80  ? 43.494  -37.496 13.626 1.00 59.84 ? 80   ARG B CZ  1 
ATOM   1954 N  NH1 . ARG B 2 80  ? 43.681  -38.395 14.590 1.00 46.72 ? 80   ARG B NH1 1 
ATOM   1955 N  NH2 . ARG B 2 80  ? 42.743  -37.821 12.576 1.00 74.93 ? 80   ARG B NH2 1 
ATOM   1956 N  N   . ALA B 2 81  ? 45.130  -30.336 13.437 1.00 49.06 ? 81   ALA B N   1 
ATOM   1957 C  CA  . ALA B 2 81  ? 45.657  -29.469 12.369 1.00 54.07 ? 81   ALA B CA  1 
ATOM   1958 C  C   . ALA B 2 81  ? 46.503  -30.273 11.348 1.00 60.71 ? 81   ALA B C   1 
ATOM   1959 O  O   . ALA B 2 81  ? 47.713  -30.507 11.570 1.00 64.95 ? 81   ALA B O   1 
ATOM   1960 C  CB  . ALA B 2 81  ? 46.499  -28.343 12.985 1.00 50.10 ? 81   ALA B CB  1 
ATOM   1961 N  N   . ASP B 2 82  ? 45.876  -30.666 10.230 1.00 60.54 ? 82   ASP B N   1 
ATOM   1962 C  CA  . ASP B 2 82  ? 46.514  -31.531 9.195  1.00 63.21 ? 82   ASP B CA  1 
ATOM   1963 C  C   . ASP B 2 82  ? 46.711  -32.959 9.747  1.00 61.23 ? 82   ASP B C   1 
ATOM   1964 O  O   . ASP B 2 82  ? 45.737  -33.588 10.136 1.00 62.76 ? 82   ASP B O   1 
ATOM   1965 C  CB  . ASP B 2 82  ? 47.822  -30.931 8.643  1.00 61.67 ? 82   ASP B CB  1 
ATOM   1966 N  N   . ASP B 2 83  ? 47.934  -33.480 9.796  1.00 58.77 ? 83   ASP B N   1 
ATOM   1967 C  CA  . ASP B 2 83  ? 48.148  -34.821 10.385 1.00 56.91 ? 83   ASP B CA  1 
ATOM   1968 C  C   . ASP B 2 83  ? 48.225  -34.769 11.935 1.00 52.75 ? 83   ASP B C   1 
ATOM   1969 O  O   . ASP B 2 83  ? 47.742  -35.662 12.642 1.00 52.81 ? 83   ASP B O   1 
ATOM   1970 C  CB  . ASP B 2 83  ? 49.405  -35.475 9.782  1.00 55.92 ? 83   ASP B CB  1 
ATOM   1971 N  N   . THR B 2 84  ? 48.808  -33.690 12.444 1.00 50.06 ? 84   THR B N   1 
ATOM   1972 C  CA  . THR B 2 84  ? 49.105  -33.507 13.861 1.00 44.76 ? 84   THR B CA  1 
ATOM   1973 C  C   . THR B 2 84  ? 47.975  -32.764 14.624 1.00 42.98 ? 84   THR B C   1 
ATOM   1974 O  O   . THR B 2 84  ? 47.257  -31.961 14.030 1.00 40.14 ? 84   THR B O   1 
ATOM   1975 C  CB  . THR B 2 84  ? 50.425  -32.700 13.948 1.00 44.89 ? 84   THR B CB  1 
ATOM   1976 O  OG1 . THR B 2 84  ? 50.950  -32.763 15.271 1.00 56.51 ? 84   THR B OG1 1 
ATOM   1977 C  CG2 . THR B 2 84  ? 50.232  -31.225 13.524 1.00 39.96 ? 84   THR B CG2 1 
ATOM   1978 N  N   . PHE B 2 85  ? 47.815  -33.024 15.928 1.00 39.01 ? 85   PHE B N   1 
ATOM   1979 C  CA  . PHE B 2 85  ? 46.892  -32.225 16.787 1.00 35.46 ? 85   PHE B CA  1 
ATOM   1980 C  C   . PHE B 2 85  ? 47.517  -30.942 17.321 1.00 33.93 ? 85   PHE B C   1 
ATOM   1981 O  O   . PHE B 2 85  ? 48.697  -30.914 17.652 1.00 36.27 ? 85   PHE B O   1 
ATOM   1982 C  CB  . PHE B 2 85  ? 46.407  -33.036 18.000 1.00 35.22 ? 85   PHE B CB  1 
ATOM   1983 C  CG  . PHE B 2 85  ? 45.225  -33.919 17.706 1.00 34.25 ? 85   PHE B CG  1 
ATOM   1984 C  CD1 . PHE B 2 85  ? 45.406  -35.215 17.261 1.00 24.81 ? 85   PHE B CD1 1 
ATOM   1985 C  CD2 . PHE B 2 85  ? 43.932  -33.444 17.859 1.00 25.98 ? 85   PHE B CD2 1 
ATOM   1986 C  CE1 . PHE B 2 85  ? 44.321  -36.027 16.984 1.00 36.86 ? 85   PHE B CE1 1 
ATOM   1987 C  CE2 . PHE B 2 85  ? 42.831  -34.251 17.563 1.00 37.74 ? 85   PHE B CE2 1 
ATOM   1988 C  CZ  . PHE B 2 85  ? 43.030  -35.547 17.135 1.00 27.36 ? 85   PHE B CZ  1 
ATOM   1989 N  N   . GLU B 2 86  ? 46.719  -29.887 17.444 1.00 32.38 ? 86   GLU B N   1 
ATOM   1990 C  CA  . GLU B 2 86  ? 47.166  -28.642 18.106 1.00 29.89 ? 86   GLU B CA  1 
ATOM   1991 C  C   . GLU B 2 86  ? 47.323  -28.875 19.613 1.00 29.12 ? 86   GLU B C   1 
ATOM   1992 O  O   . GLU B 2 86  ? 46.657  -29.747 20.186 1.00 28.04 ? 86   GLU B O   1 
ATOM   1993 C  CB  . GLU B 2 86  ? 46.135  -27.526 17.885 1.00 30.39 ? 86   GLU B CB  1 
ATOM   1994 C  CG  . GLU B 2 86  ? 44.837  -27.734 18.711 1.00 30.42 ? 86   GLU B CG  1 
ATOM   1995 C  CD  . GLU B 2 86  ? 43.759  -26.684 18.478 1.00 35.13 ? 86   GLU B CD  1 
ATOM   1996 O  OE1 . GLU B 2 86  ? 43.884  -25.909 17.527 1.00 35.94 ? 86   GLU B OE1 1 
ATOM   1997 O  OE2 . GLU B 2 86  ? 42.778  -26.636 19.258 1.00 38.11 ? 86   GLU B OE2 1 
ATOM   1998 N  N   . ALA B 2 87  ? 48.168  -28.089 20.272 1.00 32.06 ? 87   ALA B N   1 
ATOM   1999 C  CA  . ALA B 2 87  ? 48.291  -28.186 21.737 1.00 32.65 ? 87   ALA B CA  1 
ATOM   2000 C  C   . ALA B 2 87  ? 46.970  -27.794 22.412 1.00 32.09 ? 87   ALA B C   1 
ATOM   2001 O  O   . ALA B 2 87  ? 46.293  -26.862 21.976 1.00 31.38 ? 87   ALA B O   1 
ATOM   2002 C  CB  . ALA B 2 87  ? 49.412  -27.292 22.234 1.00 30.88 ? 87   ALA B CB  1 
ATOM   2003 N  N   . LEU B 2 88  ? 46.591  -28.510 23.463 1.00 31.89 ? 88   LEU B N   1 
ATOM   2004 C  CA  . LEU B 2 88  ? 45.467  -28.069 24.291 1.00 33.10 ? 88   LEU B CA  1 
ATOM   2005 C  C   . LEU B 2 88  ? 45.784  -26.661 24.783 1.00 36.15 ? 88   LEU B C   1 
ATOM   2006 O  O   . LEU B 2 88  ? 46.822  -26.436 25.427 1.00 34.28 ? 88   LEU B O   1 
ATOM   2007 C  CB  . LEU B 2 88  ? 45.218  -28.988 25.501 1.00 30.13 ? 88   LEU B CB  1 
ATOM   2008 C  CG  . LEU B 2 88  ? 44.275  -28.453 26.604 1.00 37.19 ? 88   LEU B CG  1 
ATOM   2009 C  CD1 . LEU B 2 88  ? 42.912  -28.181 25.989 1.00 28.10 ? 88   LEU B CD1 1 
ATOM   2010 C  CD2 . LEU B 2 88  ? 44.127  -29.390 27.833 1.00 29.13 ? 88   LEU B CD2 1 
ATOM   2011 N  N   . CYS B 2 89  ? 44.890  -25.726 24.468 1.00 33.17 ? 89   CYS B N   1 
ATOM   2012 C  CA  . CYS B 2 89  ? 45.015  -24.360 24.920 1.00 33.90 ? 89   CYS B CA  1 
ATOM   2013 C  C   . CYS B 2 89  ? 43.662  -23.809 25.320 1.00 40.36 ? 89   CYS B C   1 
ATOM   2014 O  O   . CYS B 2 89  ? 42.731  -23.813 24.509 1.00 46.17 ? 89   CYS B O   1 
ATOM   2015 C  CB  . CYS B 2 89  ? 45.574  -23.503 23.792 1.00 37.09 ? 89   CYS B CB  1 
ATOM   2016 S  SG  . CYS B 2 89  ? 45.863  -21.855 24.336 1.00 41.62 ? 89   CYS B SG  1 
ATOM   2017 N  N   . ILE B 2 90  ? 43.540  -23.333 26.556 1.00 35.39 ? 90   ILE B N   1 
ATOM   2018 C  CA  . ILE B 2 90  ? 42.293  -22.722 27.009 1.00 31.34 ? 90   ILE B CA  1 
ATOM   2019 C  C   . ILE B 2 90  ? 42.583  -21.326 27.527 1.00 32.14 ? 90   ILE B C   1 
ATOM   2020 O  O   . ILE B 2 90  ? 43.220  -21.165 28.556 1.00 32.28 ? 90   ILE B O   1 
ATOM   2021 C  CB  . ILE B 2 90  ? 41.624  -23.553 28.129 1.00 30.38 ? 90   ILE B CB  1 
ATOM   2022 C  CG1 . ILE B 2 90  ? 41.129  -24.894 27.579 1.00 33.08 ? 90   ILE B CG1 1 
ATOM   2023 C  CG2 . ILE B 2 90  ? 40.457  -22.794 28.748 1.00 26.55 ? 90   ILE B CG2 1 
ATOM   2024 C  CD1 . ILE B 2 90  ? 40.670  -25.874 28.644 1.00 25.07 ? 90   ILE B CD1 1 
ATOM   2025 N  N   . GLU B 2 91  ? 42.099  -20.317 26.821 1.00 34.73 ? 91   GLU B N   1 
ATOM   2026 C  CA  . GLU B 2 91  ? 42.285  -18.932 27.237 1.00 36.48 ? 91   GLU B CA  1 
ATOM   2027 C  C   . GLU B 2 91  ? 41.462  -18.682 28.509 1.00 31.74 ? 91   GLU B C   1 
ATOM   2028 O  O   . GLU B 2 91  ? 40.282  -18.921 28.497 1.00 35.89 ? 91   GLU B O   1 
ATOM   2029 C  CB  . GLU B 2 91  ? 41.827  -18.013 26.108 1.00 38.44 ? 91   GLU B CB  1 
ATOM   2030 C  CG  . GLU B 2 91  ? 41.877  -16.522 26.422 1.00 54.40 ? 91   GLU B CG  1 
ATOM   2031 C  CD  . GLU B 2 91  ? 43.282  -15.967 26.453 1.00 60.27 ? 91   GLU B CD  1 
ATOM   2032 O  OE1 . GLU B 2 91  ? 44.228  -16.718 26.095 1.00 59.45 ? 91   GLU B OE1 1 
ATOM   2033 O  OE2 . GLU B 2 91  ? 43.417  -14.776 26.832 1.00 46.89 ? 91   GLU B OE2 1 
ATOM   2034 N  N   . PRO B 2 92  ? 42.078  -18.197 29.603 1.00 31.24 ? 92   PRO B N   1 
ATOM   2035 C  CA  . PRO B 2 92  ? 41.318  -18.038 30.857 1.00 35.05 ? 92   PRO B CA  1 
ATOM   2036 C  C   . PRO B 2 92  ? 40.301  -16.906 30.796 1.00 35.64 ? 92   PRO B C   1 
ATOM   2037 O  O   . PRO B 2 92  ? 40.351  -16.085 29.886 1.00 38.61 ? 92   PRO B O   1 
ATOM   2038 C  CB  . PRO B 2 92  ? 42.401  -17.695 31.890 1.00 35.10 ? 92   PRO B CB  1 
ATOM   2039 C  CG  . PRO B 2 92  ? 43.484  -17.055 31.089 1.00 32.62 ? 92   PRO B CG  1 
ATOM   2040 C  CD  . PRO B 2 92  ? 43.475  -17.748 29.747 1.00 29.59 ? 92   PRO B CD  1 
ATOM   2041 N  N   . PHE B 2 93  ? 39.385  -16.868 31.756 1.00 35.02 ? 93   PHE B N   1 
ATOM   2042 C  CA  . PHE B 2 93  ? 38.420  -15.772 31.838 1.00 35.21 ? 93   PHE B CA  1 
ATOM   2043 C  C   . PHE B 2 93  ? 39.086  -14.550 32.428 1.00 33.10 ? 93   PHE B C   1 
ATOM   2044 O  O   . PHE B 2 93  ? 40.187  -14.639 32.942 1.00 34.75 ? 93   PHE B O   1 
ATOM   2045 C  CB  . PHE B 2 93  ? 37.205  -16.149 32.697 1.00 35.49 ? 93   PHE B CB  1 
ATOM   2046 C  CG  . PHE B 2 93  ? 36.435  -17.351 32.185 1.00 33.87 ? 93   PHE B CG  1 
ATOM   2047 C  CD1 . PHE B 2 93  ? 36.156  -17.501 30.831 1.00 25.72 ? 93   PHE B CD1 1 
ATOM   2048 C  CD2 . PHE B 2 93  ? 35.958  -18.310 33.072 1.00 35.67 ? 93   PHE B CD2 1 
ATOM   2049 C  CE1 . PHE B 2 93  ? 35.454  -18.598 30.370 1.00 23.85 ? 93   PHE B CE1 1 
ATOM   2050 C  CE2 . PHE B 2 93  ? 35.258  -19.407 32.609 1.00 30.87 ? 93   PHE B CE2 1 
ATOM   2051 C  CZ  . PHE B 2 93  ? 35.003  -19.542 31.252 1.00 30.03 ? 93   PHE B CZ  1 
ATOM   2052 N  N   . SER B 2 94  ? 38.404  -13.410 32.341 1.00 33.64 ? 94   SER B N   1 
ATOM   2053 C  CA  . SER B 2 94  ? 38.872  -12.155 32.904 1.00 29.53 ? 94   SER B CA  1 
ATOM   2054 C  C   . SER B 2 94  ? 38.962  -12.258 34.424 1.00 33.26 ? 94   SER B C   1 
ATOM   2055 O  O   . SER B 2 94  ? 38.408  -13.187 35.023 1.00 38.23 ? 94   SER B O   1 
ATOM   2056 C  CB  . SER B 2 94  ? 37.918  -11.029 32.493 1.00 29.61 ? 94   SER B CB  1 
ATOM   2057 O  OG  . SER B 2 94  ? 36.554  -11.398 32.700 1.00 30.03 ? 94   SER B OG  1 
ATOM   2058 N  N   . SER B 2 95  ? 39.673  -11.321 35.046 1.00 40.83 ? 95   SER B N   1 
ATOM   2059 C  CA  . SER B 2 95  ? 39.806  -11.306 36.505 1.00 44.51 ? 95   SER B CA  1 
ATOM   2060 C  C   . SER B 2 95  ? 38.906  -10.273 37.151 1.00 43.56 ? 95   SER B C   1 
ATOM   2061 O  O   . SER B 2 95  ? 38.796  -9.167  36.655 1.00 33.37 ? 95   SER B O   1 
ATOM   2062 C  CB  . SER B 2 95  ? 41.247  -11.057 36.935 1.00 45.49 ? 95   SER B CB  1 
ATOM   2063 O  OG  . SER B 2 95  ? 41.843  -12.289 37.286 1.00 55.16 ? 95   SER B OG  1 
ATOM   2064 N  N   . PRO B 2 96  ? 38.266  -10.635 38.279 1.00 48.91 ? 96   PRO B N   1 
ATOM   2065 C  CA  . PRO B 2 96  ? 37.468  -9.628  38.960 1.00 46.77 ? 96   PRO B CA  1 
ATOM   2066 C  C   . PRO B 2 96  ? 38.391  -8.646  39.631 1.00 45.32 ? 96   PRO B C   1 
ATOM   2067 O  O   . PRO B 2 96  ? 39.569  -8.972  39.838 1.00 41.80 ? 96   PRO B O   1 
ATOM   2068 C  CB  . PRO B 2 96  ? 36.705  -10.409 40.029 1.00 48.01 ? 96   PRO B CB  1 
ATOM   2069 C  CG  . PRO B 2 96  ? 37.077  -11.862 39.852 1.00 48.15 ? 96   PRO B CG  1 
ATOM   2070 C  CD  . PRO B 2 96  ? 38.266  -11.933 38.983 1.00 50.85 ? 96   PRO B CD  1 
ATOM   2071 N  N   . PRO B 2 97  ? 37.853  -7.473  40.006 1.00 43.02 ? 97   PRO B N   1 
ATOM   2072 C  CA  . PRO B 2 97  ? 38.620  -6.415  40.642 1.00 39.79 ? 97   PRO B CA  1 
ATOM   2073 C  C   . PRO B 2 97  ? 38.763  -6.636  42.132 1.00 35.02 ? 97   PRO B C   1 
ATOM   2074 O  O   . PRO B 2 97  ? 38.158  -7.544  42.675 1.00 37.51 ? 97   PRO B O   1 
ATOM   2075 C  CB  . PRO B 2 97  ? 37.777  -5.160  40.380 1.00 40.75 ? 97   PRO B CB  1 
ATOM   2076 C  CG  . PRO B 2 97  ? 36.496  -5.632  39.734 1.00 40.48 ? 97   PRO B CG  1 
ATOM   2077 C  CD  . PRO B 2 97  ? 36.434  -7.101  39.882 1.00 42.49 ? 97   PRO B CD  1 
ATOM   2078 N  N   . GLU B 2 98  ? 39.564  -5.806  42.786 1.00 36.87 ? 98   GLU B N   1 
ATOM   2079 C  CA  . GLU B 2 98  ? 39.661  -5.874  44.236 1.00 38.38 ? 98   GLU B CA  1 
ATOM   2080 C  C   . GLU B 2 98  ? 38.249  -5.702  44.857 1.00 38.26 ? 98   GLU B C   1 
ATOM   2081 O  O   . GLU B 2 98  ? 37.415  -4.897  44.410 1.00 29.91 ? 98   GLU B O   1 
ATOM   2082 C  CB  . GLU B 2 98  ? 40.663  -4.843  44.797 1.00 27.93 ? 98   GLU B CB  1 
ATOM   2083 N  N   . LEU B 2 99  ? 37.992  -6.509  45.875 1.00 40.75 ? 99   LEU B N   1 
ATOM   2084 C  CA  . LEU B 2 99  ? 36.799  -6.390  46.696 1.00 39.14 ? 99   LEU B CA  1 
ATOM   2085 C  C   . LEU B 2 99  ? 36.797  -4.997  47.381 1.00 36.87 ? 99   LEU B C   1 
ATOM   2086 O  O   . LEU B 2 99  ? 37.820  -4.584  47.917 1.00 36.86 ? 99   LEU B O   1 
ATOM   2087 C  CB  . LEU B 2 99  ? 36.822  -7.519  47.729 1.00 36.01 ? 99   LEU B CB  1 
ATOM   2088 C  CG  . LEU B 2 99  ? 35.532  -8.016  48.349 1.00 43.80 ? 99   LEU B CG  1 
ATOM   2089 C  CD1 . LEU B 2 99  ? 34.632  -8.591  47.269 1.00 29.13 ? 99   LEU B CD1 1 
ATOM   2090 C  CD2 . LEU B 2 99  ? 35.847  -9.036  49.454 1.00 35.67 ? 99   LEU B CD2 1 
ATOM   2091 N  N   . PRO B 2 100 ? 35.664  -4.256  47.319 1.00 35.90 ? 100  PRO B N   1 
ATOM   2092 C  CA  . PRO B 2 100 ? 35.504  -3.001  48.067 1.00 33.59 ? 100  PRO B CA  1 
ATOM   2093 C  C   . PRO B 2 100 ? 35.673  -3.219  49.550 1.00 36.19 ? 100  PRO B C   1 
ATOM   2094 O  O   . PRO B 2 100 ? 35.312  -4.277  50.067 1.00 37.61 ? 100  PRO B O   1 
ATOM   2095 C  CB  . PRO B 2 100 ? 34.060  -2.577  47.802 1.00 35.42 ? 100  PRO B CB  1 
ATOM   2096 C  CG  . PRO B 2 100 ? 33.587  -3.398  46.658 1.00 39.72 ? 100  PRO B CG  1 
ATOM   2097 C  CD  . PRO B 2 100 ? 34.473  -4.590  46.514 1.00 37.39 ? 100  PRO B CD  1 
ATOM   2098 N  N   . ASP B 2 101 ? 36.194  -2.208  50.231 1.00 37.61 ? 101  ASP B N   1 
ATOM   2099 C  CA  . ASP B 2 101 ? 36.585  -2.348  51.629 1.00 38.48 ? 101  ASP B CA  1 
ATOM   2100 C  C   . ASP B 2 101 ? 35.367  -2.641  52.477 1.00 36.25 ? 101  ASP B C   1 
ATOM   2101 O  O   . ASP B 2 101 ? 35.463  -3.403  53.432 1.00 36.03 ? 101  ASP B O   1 
ATOM   2102 C  CB  . ASP B 2 101 ? 37.284  -1.088  52.154 1.00 42.94 ? 101  ASP B CB  1 
ATOM   2103 C  CG  . ASP B 2 101 ? 38.157  -0.409  51.100 1.00 48.82 ? 101  ASP B CG  1 
ATOM   2104 O  OD1 . ASP B 2 101 ? 37.914  -0.645  49.880 1.00 33.07 ? 101  ASP B OD1 1 
ATOM   2105 O  OD2 . ASP B 2 101 ? 39.048  0.383   51.503 1.00 41.14 ? 101  ASP B OD2 1 
ATOM   2106 N  N   . VAL B 2 102 ? 34.222  -2.047  52.131 1.00 34.67 ? 102  VAL B N   1 
ATOM   2107 C  CA  . VAL B 2 102 ? 32.989  -2.335  52.869 1.00 32.19 ? 102  VAL B CA  1 
ATOM   2108 C  C   . VAL B 2 102 ? 32.558  -3.807  52.765 1.00 32.41 ? 102  VAL B C   1 
ATOM   2109 O  O   . VAL B 2 102 ? 31.761  -4.267  53.585 1.00 29.30 ? 102  VAL B O   1 
ATOM   2110 C  CB  . VAL B 2 102 ? 31.797  -1.446  52.449 1.00 35.16 ? 102  VAL B CB  1 
ATOM   2111 C  CG1 . VAL B 2 102 ? 32.005  -0.007  52.929 1.00 16.97 ? 102  VAL B CG1 1 
ATOM   2112 C  CG2 . VAL B 2 102 ? 31.520  -1.553  50.926 1.00 22.57 ? 102  VAL B CG2 1 
ATOM   2113 N  N   . MET B 2 103 ? 33.088  -4.533  51.772 1.00 33.00 ? 103  MET B N   1 
ATOM   2114 C  CA  . MET B 2 103 ? 32.778  -5.950  51.577 1.00 27.37 ? 103  MET B CA  1 
ATOM   2115 C  C   . MET B 2 103 ? 33.848  -6.914  52.111 1.00 28.38 ? 103  MET B C   1 
ATOM   2116 O  O   . MET B 2 103 ? 33.745  -8.115  51.901 1.00 33.63 ? 103  MET B O   1 
ATOM   2117 C  CB  . MET B 2 103 ? 32.522  -6.229  50.093 1.00 29.86 ? 103  MET B CB  1 
ATOM   2118 C  CG  . MET B 2 103 ? 31.107  -5.968  49.653 1.00 25.13 ? 103  MET B CG  1 
ATOM   2119 S  SD  . MET B 2 103 ? 30.937  -6.180  47.879 1.00 36.43 ? 103  MET B SD  1 
ATOM   2120 C  CE  . MET B 2 103 ? 30.547  -7.920  47.767 1.00 30.45 ? 103  MET B CE  1 
ATOM   2121 N  N   . LYS B 2 104 ? 34.852  -6.417  52.820 1.00 34.36 ? 104  LYS B N   1 
ATOM   2122 C  CA  . LYS B 2 104 ? 35.890  -7.290  53.375 1.00 41.10 ? 104  LYS B CA  1 
ATOM   2123 C  C   . LYS B 2 104 ? 35.565  -7.690  54.838 1.00 49.87 ? 104  LYS B C   1 
ATOM   2124 O  O   . LYS B 2 104 ? 34.859  -6.957  55.544 1.00 47.60 ? 104  LYS B O   1 
ATOM   2125 C  CB  . LYS B 2 104 ? 37.276  -6.606  53.290 1.00 38.49 ? 104  LYS B CB  1 
ATOM   2126 C  CG  . LYS B 2 104 ? 37.858  -6.472  51.860 1.00 37.87 ? 104  LYS B CG  1 
ATOM   2127 C  CD  . LYS B 2 104 ? 39.172  -5.658  51.811 1.00 23.96 ? 104  LYS B CD  1 
ATOM   2128 N  N   . PRO B 2 105 ? 36.068  -8.870  55.291 1.00 63.29 ? 105  PRO B N   1 
ATOM   2129 C  CA  . PRO B 2 105 ? 36.130  -9.164  56.748 1.00 66.34 ? 105  PRO B CA  1 
ATOM   2130 C  C   . PRO B 2 105 ? 37.105  -8.238  57.504 1.00 65.08 ? 105  PRO B C   1 
ATOM   2131 O  O   . PRO B 2 105 ? 36.704  -7.555  58.450 1.00 65.34 ? 105  PRO B O   1 
ATOM   2132 C  CB  . PRO B 2 105 ? 36.621  -10.627 56.811 1.00 67.07 ? 105  PRO B CB  1 
ATOM   2133 C  CG  . PRO B 2 105 ? 36.555  -11.166 55.400 1.00 62.91 ? 105  PRO B CG  1 
ATOM   2134 C  CD  . PRO B 2 105 ? 36.574  -9.992  54.466 1.00 60.40 ? 105  PRO B CD  1 
ATOM   2135 N  N   . MET C 3 2   ? 18.605  -24.584 18.590 1.00 29.42 ? 17   MET C N   1 
ATOM   2136 C  CA  . MET C 3 2   ? 19.067  -25.492 19.704 1.00 37.16 ? 17   MET C CA  1 
ATOM   2137 C  C   . MET C 3 2   ? 20.119  -24.771 20.583 1.00 33.99 ? 17   MET C C   1 
ATOM   2138 O  O   . MET C 3 2   ? 20.000  -24.737 21.800 1.00 32.36 ? 17   MET C O   1 
ATOM   2139 C  CB  . MET C 3 2   ? 19.640  -26.817 19.165 1.00 37.09 ? 17   MET C CB  1 
ATOM   2140 C  CG  . MET C 3 2   ? 19.020  -28.102 19.789 1.00 52.13 ? 17   MET C CG  1 
ATOM   2141 S  SD  . MET C 3 2   ? 19.306  -28.426 21.574 1.00 75.45 ? 17   MET C SD  1 
ATOM   2142 C  CE  . MET C 3 2   ? 18.011  -29.598 21.998 1.00 70.90 ? 17   MET C CE  1 
ATOM   2143 N  N   . TYR C 3 3   ? 21.126  -24.178 19.957 1.00 28.02 ? 18   TYR C N   1 
ATOM   2144 C  CA  . TYR C 3 3   ? 22.188  -23.484 20.673 1.00 27.37 ? 18   TYR C CA  1 
ATOM   2145 C  C   . TYR C 3 3   ? 22.279  -22.040 20.216 1.00 27.89 ? 18   TYR C C   1 
ATOM   2146 O  O   . TYR C 3 3   ? 21.943  -21.726 19.085 1.00 26.66 ? 18   TYR C O   1 
ATOM   2147 C  CB  . TYR C 3 3   ? 23.537  -24.184 20.438 1.00 29.49 ? 18   TYR C CB  1 
ATOM   2148 C  CG  . TYR C 3 3   ? 23.665  -25.484 21.185 1.00 19.10 ? 18   TYR C CG  1 
ATOM   2149 C  CD1 . TYR C 3 3   ? 24.148  -25.498 22.482 1.00 19.29 ? 18   TYR C CD1 1 
ATOM   2150 C  CD2 . TYR C 3 3   ? 23.301  -26.701 20.599 1.00 15.94 ? 18   TYR C CD2 1 
ATOM   2151 C  CE1 . TYR C 3 3   ? 24.264  -26.700 23.210 1.00 24.64 ? 18   TYR C CE1 1 
ATOM   2152 C  CE2 . TYR C 3 3   ? 23.402  -27.914 21.318 1.00 22.89 ? 18   TYR C CE2 1 
ATOM   2153 C  CZ  . TYR C 3 3   ? 23.880  -27.898 22.628 1.00 23.00 ? 18   TYR C CZ  1 
ATOM   2154 O  OH  . TYR C 3 3   ? 24.011  -29.059 23.371 1.00 32.57 ? 18   TYR C OH  1 
ATOM   2155 N  N   . VAL C 3 4   ? 22.724  -21.162 21.107 1.00 29.74 ? 19   VAL C N   1 
ATOM   2156 C  CA  . VAL C 3 4   ? 22.987  -19.770 20.756 1.00 31.68 ? 19   VAL C CA  1 
ATOM   2157 C  C   . VAL C 3 4   ? 24.340  -19.372 21.315 1.00 31.40 ? 19   VAL C C   1 
ATOM   2158 O  O   . VAL C 3 4   ? 24.849  -20.031 22.235 1.00 27.73 ? 19   VAL C O   1 
ATOM   2159 C  CB  . VAL C 3 4   ? 21.890  -18.820 21.269 1.00 34.73 ? 19   VAL C CB  1 
ATOM   2160 C  CG1 . VAL C 3 4   ? 20.645  -19.009 20.449 1.00 46.86 ? 19   VAL C CG1 1 
ATOM   2161 C  CG2 . VAL C 3 4   ? 21.581  -19.053 22.726 1.00 33.65 ? 19   VAL C CG2 1 
ATOM   2162 N  N   . LYS C 3 5   ? 24.932  -18.325 20.737 1.00 28.09 ? 20   LYS C N   1 
ATOM   2163 C  CA  . LYS C 3 5   ? 26.264  -17.876 21.132 1.00 28.90 ? 20   LYS C CA  1 
ATOM   2164 C  C   . LYS C 3 5   ? 26.186  -16.522 21.812 1.00 29.74 ? 20   LYS C C   1 
ATOM   2165 O  O   . LYS C 3 5   ? 25.699  -15.574 21.222 1.00 33.68 ? 20   LYS C O   1 
ATOM   2166 C  CB  . LYS C 3 5   ? 27.187  -17.791 19.922 1.00 28.59 ? 20   LYS C CB  1 
ATOM   2167 C  CG  . LYS C 3 5   ? 28.614  -17.378 20.283 1.00 31.99 ? 20   LYS C CG  1 
ATOM   2168 C  CD  . LYS C 3 5   ? 29.483  -17.151 19.054 1.00 28.12 ? 20   LYS C CD  1 
ATOM   2169 C  CE  . LYS C 3 5   ? 29.885  -18.465 18.399 1.00 27.05 ? 20   LYS C CE  1 
ATOM   2170 N  NZ  . LYS C 3 5   ? 30.769  -18.183 17.258 1.00 20.99 ? 20   LYS C NZ  1 
ATOM   2171 N  N   . LEU C 3 6   ? 26.663  -16.434 23.048 1.00 30.09 ? 21   LEU C N   1 
ATOM   2172 C  CA  . LEU C 3 6   ? 26.686  -15.167 23.779 1.00 28.23 ? 21   LEU C CA  1 
ATOM   2173 C  C   . LEU C 3 6   ? 28.138  -14.765 23.957 1.00 27.41 ? 21   LEU C C   1 
ATOM   2174 O  O   . LEU C 3 6   ? 28.893  -15.495 24.568 1.00 29.70 ? 21   LEU C O   1 
ATOM   2175 C  CB  . LEU C 3 6   ? 26.022  -15.316 25.140 1.00 25.15 ? 21   LEU C CB  1 
ATOM   2176 C  CG  . LEU C 3 6   ? 24.690  -16.049 25.193 1.00 29.77 ? 21   LEU C CG  1 
ATOM   2177 C  CD1 . LEU C 3 6   ? 24.367  -16.371 26.634 1.00 33.46 ? 21   LEU C CD1 1 
ATOM   2178 C  CD2 . LEU C 3 6   ? 23.577  -15.248 24.565 1.00 28.49 ? 21   LEU C CD2 1 
ATOM   2179 N  N   . ILE C 3 7   ? 28.523  -13.616 23.408 1.00 31.24 ? 22   ILE C N   1 
ATOM   2180 C  CA  . ILE C 3 7   ? 29.922  -13.193 23.368 1.00 27.99 ? 22   ILE C CA  1 
ATOM   2181 C  C   . ILE C 3 7   ? 30.142  -12.094 24.405 1.00 26.03 ? 22   ILE C C   1 
ATOM   2182 O  O   . ILE C 3 7   ? 29.418  -11.102 24.438 1.00 22.74 ? 22   ILE C O   1 
ATOM   2183 C  CB  . ILE C 3 7   ? 30.343  -12.692 21.944 1.00 31.31 ? 22   ILE C CB  1 
ATOM   2184 C  CG1 . ILE C 3 7   ? 29.968  -13.712 20.854 1.00 30.00 ? 22   ILE C CG1 1 
ATOM   2185 C  CG2 . ILE C 3 7   ? 31.849  -12.405 21.888 1.00 19.95 ? 22   ILE C CG2 1 
ATOM   2186 C  CD1 . ILE C 3 7   ? 30.434  -13.307 19.395 1.00 33.13 ? 22   ILE C CD1 1 
ATOM   2187 N  N   . SER C 3 8   ? 31.137  -12.289 25.263 1.00 26.73 ? 23   SER C N   1 
ATOM   2188 C  CA  . SER C 3 8   ? 31.425  -11.347 26.338 1.00 28.82 ? 23   SER C CA  1 
ATOM   2189 C  C   . SER C 3 8   ? 32.246  -10.179 25.810 1.00 29.25 ? 23   SER C C   1 
ATOM   2190 O  O   . SER C 3 8   ? 32.711  -10.203 24.675 1.00 26.65 ? 23   SER C O   1 
ATOM   2191 C  CB  . SER C 3 8   ? 32.182  -12.047 27.473 1.00 27.20 ? 23   SER C CB  1 
ATOM   2192 O  OG  . SER C 3 8   ? 33.484  -12.446 27.068 1.00 25.49 ? 23   SER C OG  1 
ATOM   2193 N  N   . SER C 3 9   ? 32.451  -9.176  26.656 1.00 35.24 ? 24   SER C N   1 
ATOM   2194 C  CA  . SER C 3 9   ? 33.213  -7.973  26.263 1.00 34.22 ? 24   SER C CA  1 
ATOM   2195 C  C   . SER C 3 9   ? 34.657  -8.281  25.910 1.00 29.18 ? 24   SER C C   1 
ATOM   2196 O  O   . SER C 3 9   ? 35.200  -7.642  25.022 1.00 28.50 ? 24   SER C O   1 
ATOM   2197 C  CB  . SER C 3 9   ? 33.194  -6.921  27.378 1.00 32.41 ? 24   SER C CB  1 
ATOM   2198 O  OG  . SER C 3 9   ? 33.761  -7.439  28.571 1.00 30.45 ? 24   SER C OG  1 
ATOM   2199 N  N   . ASP C 3 10  ? 35.273  -9.244  26.601 1.00 27.98 ? 25   ASP C N   1 
ATOM   2200 C  CA  . ASP C 3 10  ? 36.669  -9.630  26.303 1.00 29.81 ? 25   ASP C CA  1 
ATOM   2201 C  C   . ASP C 3 10  ? 36.819  -10.665 25.168 1.00 29.85 ? 25   ASP C C   1 
ATOM   2202 O  O   . ASP C 3 10  ? 37.912  -11.157 24.934 1.00 32.45 ? 25   ASP C O   1 
ATOM   2203 C  CB  . ASP C 3 10  ? 37.476  -10.037 27.573 1.00 28.89 ? 25   ASP C CB  1 
ATOM   2204 C  CG  . ASP C 3 10  ? 36.855  -11.197 28.377 1.00 35.72 ? 25   ASP C CG  1 
ATOM   2205 O  OD1 . ASP C 3 10  ? 35.649  -11.171 28.693 1.00 39.41 ? 25   ASP C OD1 1 
ATOM   2206 O  OD2 . ASP C 3 10  ? 37.609  -12.120 28.752 1.00 39.21 ? 25   ASP C OD2 1 
ATOM   2207 N  N   . GLY C 3 11  ? 35.733  -10.970 24.455 1.00 28.81 ? 26   GLY C N   1 
ATOM   2208 C  CA  . GLY C 3 11  ? 35.793  -11.818 23.258 1.00 26.74 ? 26   GLY C CA  1 
ATOM   2209 C  C   . GLY C 3 11  ? 35.552  -13.306 23.474 1.00 23.99 ? 26   GLY C C   1 
ATOM   2210 O  O   . GLY C 3 11  ? 35.662  -14.116 22.539 1.00 27.02 ? 26   GLY C O   1 
ATOM   2211 N  N   . HIS C 3 12  ? 35.237  -13.686 24.702 1.00 21.39 ? 27   HIS C N   1 
ATOM   2212 C  CA  . HIS C 3 12  ? 34.960  -15.090 24.984 1.00 24.95 ? 27   HIS C CA  1 
ATOM   2213 C  C   . HIS C 3 12  ? 33.591  -15.426 24.414 1.00 22.33 ? 27   HIS C C   1 
ATOM   2214 O  O   . HIS C 3 12  ? 32.696  -14.600 24.491 1.00 21.25 ? 27   HIS C O   1 
ATOM   2215 C  CB  . HIS C 3 12  ? 35.009  -15.371 26.477 1.00 25.20 ? 27   HIS C CB  1 
ATOM   2216 C  CG  . HIS C 3 12  ? 36.337  -15.861 26.959 1.00 30.06 ? 27   HIS C CG  1 
ATOM   2217 N  ND1 . HIS C 3 12  ? 36.596  -17.198 27.174 1.00 39.93 ? 27   HIS C ND1 1 
ATOM   2218 C  CD2 . HIS C 3 12  ? 37.474  -15.198 27.282 1.00 31.33 ? 27   HIS C CD2 1 
ATOM   2219 C  CE1 . HIS C 3 12  ? 37.830  -17.336 27.621 1.00 34.50 ? 27   HIS C CE1 1 
ATOM   2220 N  NE2 . HIS C 3 12  ? 38.384  -16.137 27.699 1.00 24.25 ? 27   HIS C NE2 1 
ATOM   2221 N  N   . GLU C 3 13  ? 33.457  -16.607 23.804 1.00 18.20 ? 28   GLU C N   1 
ATOM   2222 C  CA  . GLU C 3 13  ? 32.220  -17.013 23.157 1.00 21.75 ? 28   GLU C CA  1 
ATOM   2223 C  C   . GLU C 3 13  ? 31.606  -18.162 23.925 1.00 25.42 ? 28   GLU C C   1 
ATOM   2224 O  O   . GLU C 3 13  ? 32.237  -19.205 24.095 1.00 32.94 ? 28   GLU C O   1 
ATOM   2225 C  CB  . GLU C 3 13  ? 32.507  -17.427 21.712 1.00 26.34 ? 28   GLU C CB  1 
ATOM   2226 C  CG  . GLU C 3 13  ? 33.122  -16.299 20.866 1.00 33.26 ? 28   GLU C CG  1 
ATOM   2227 C  CD  . GLU C 3 13  ? 33.257  -16.623 19.369 1.00 32.72 ? 28   GLU C CD  1 
ATOM   2228 O  OE1 . GLU C 3 13  ? 33.188  -17.809 19.001 1.00 32.98 ? 28   GLU C OE1 1 
ATOM   2229 O  OE2 . GLU C 3 13  ? 33.432  -15.675 18.566 1.00 29.62 ? 28   GLU C OE2 1 
ATOM   2230 N  N   . PHE C 3 14  ? 30.392  -17.974 24.429 1.00 28.55 ? 29   PHE C N   1 
ATOM   2231 C  CA  . PHE C 3 14  ? 29.725  -19.039 25.193 1.00 28.92 ? 29   PHE C CA  1 
ATOM   2232 C  C   . PHE C 3 14  ? 28.555  -19.634 24.414 1.00 28.86 ? 29   PHE C C   1 
ATOM   2233 O  O   . PHE C 3 14  ? 27.565  -18.954 24.132 1.00 28.79 ? 29   PHE C O   1 
ATOM   2234 C  CB  . PHE C 3 14  ? 29.224  -18.512 26.527 1.00 26.17 ? 29   PHE C CB  1 
ATOM   2235 C  CG  . PHE C 3 14  ? 30.298  -17.949 27.387 1.00 24.80 ? 29   PHE C CG  1 
ATOM   2236 C  CD1 . PHE C 3 14  ? 30.945  -18.742 28.306 1.00 27.14 ? 29   PHE C CD1 1 
ATOM   2237 C  CD2 . PHE C 3 14  ? 30.679  -16.621 27.259 1.00 23.27 ? 29   PHE C CD2 1 
ATOM   2238 C  CE1 . PHE C 3 14  ? 31.951  -18.233 29.101 1.00 31.54 ? 29   PHE C CE1 1 
ATOM   2239 C  CE2 . PHE C 3 14  ? 31.660  -16.109 28.045 1.00 30.24 ? 29   PHE C CE2 1 
ATOM   2240 C  CZ  . PHE C 3 14  ? 32.299  -16.922 28.991 1.00 30.08 ? 29   PHE C CZ  1 
ATOM   2241 N  N   . ILE C 3 15  ? 28.679  -20.904 24.070 1.00 30.03 ? 30   ILE C N   1 
ATOM   2242 C  CA  . ILE C 3 15  ? 27.606  -21.617 23.396 1.00 29.83 ? 30   ILE C CA  1 
ATOM   2243 C  C   . ILE C 3 15  ? 26.728  -22.272 24.461 1.00 33.37 ? 30   ILE C C   1 
ATOM   2244 O  O   . ILE C 3 15  ? 27.190  -23.133 25.223 1.00 33.87 ? 30   ILE C O   1 
ATOM   2245 C  CB  . ILE C 3 15  ? 28.183  -22.629 22.428 1.00 25.88 ? 30   ILE C CB  1 
ATOM   2246 C  CG1 . ILE C 3 15  ? 28.948  -21.869 21.339 1.00 29.15 ? 30   ILE C CG1 1 
ATOM   2247 C  CG2 . ILE C 3 15  ? 27.103  -23.480 21.820 1.00 24.73 ? 30   ILE C CG2 1 
ATOM   2248 C  CD1 . ILE C 3 15  ? 29.678  -22.755 20.387 1.00 33.93 ? 30   ILE C CD1 1 
ATOM   2249 N  N   . VAL C 3 16  ? 25.480  -21.817 24.541 1.00 29.82 ? 31   VAL C N   1 
ATOM   2250 C  CA  . VAL C 3 16  ? 24.499  -22.380 25.467 1.00 32.63 ? 31   VAL C CA  1 
ATOM   2251 C  C   . VAL C 3 16  ? 23.213  -22.754 24.715 1.00 31.24 ? 31   VAL C C   1 
ATOM   2252 O  O   . VAL C 3 16  ? 22.965  -22.251 23.615 1.00 22.40 ? 31   VAL C O   1 
ATOM   2253 C  CB  . VAL C 3 16  ? 24.170  -21.389 26.626 1.00 33.78 ? 31   VAL C CB  1 
ATOM   2254 C  CG1 . VAL C 3 16  ? 25.452  -20.812 27.214 1.00 34.46 ? 31   VAL C CG1 1 
ATOM   2255 C  CG2 . VAL C 3 16  ? 23.252  -20.272 26.148 1.00 32.08 ? 31   VAL C CG2 1 
ATOM   2256 N  N   . LYS C 3 17  ? 22.391  -23.623 25.308 1.00 30.81 ? 32   LYS C N   1 
ATOM   2257 C  CA  . LYS C 3 17  ? 21.141  -24.010 24.665 1.00 28.36 ? 32   LYS C CA  1 
ATOM   2258 C  C   . LYS C 3 17  ? 20.196  -22.812 24.617 1.00 24.90 ? 32   LYS C C   1 
ATOM   2259 O  O   . LYS C 3 17  ? 20.150  -22.019 25.548 1.00 26.09 ? 32   LYS C O   1 
ATOM   2260 C  CB  . LYS C 3 17  ? 20.452  -25.172 25.387 1.00 31.03 ? 32   LYS C CB  1 
ATOM   2261 C  CG  . LYS C 3 17  ? 21.268  -26.425 25.594 1.00 34.83 ? 32   LYS C CG  1 
ATOM   2262 C  CD  . LYS C 3 17  ? 20.339  -27.609 25.918 1.00 42.87 ? 32   LYS C CD  1 
ATOM   2263 C  CE  . LYS C 3 17  ? 21.042  -28.753 26.677 1.00 48.04 ? 32   LYS C CE  1 
ATOM   2264 N  NZ  . LYS C 3 17  ? 21.998  -29.543 25.841 1.00 47.50 ? 32   LYS C NZ  1 
ATOM   2265 N  N   . ARG C 3 18  ? 19.442  -22.681 23.536 1.00 23.35 ? 33   ARG C N   1 
ATOM   2266 C  CA  . ARG C 3 18  ? 18.508  -21.558 23.412 1.00 26.09 ? 33   ARG C CA  1 
ATOM   2267 C  C   . ARG C 3 18  ? 17.496  -21.566 24.568 1.00 26.69 ? 33   ARG C C   1 
ATOM   2268 O  O   . ARG C 3 18  ? 17.279  -20.543 25.198 1.00 31.73 ? 33   ARG C O   1 
ATOM   2269 C  CB  . ARG C 3 18  ? 17.774  -21.617 22.071 1.00 25.93 ? 33   ARG C CB  1 
ATOM   2270 C  CG  . ARG C 3 18  ? 17.299  -20.283 21.513 1.00 34.54 ? 33   ARG C CG  1 
ATOM   2271 C  CD  . ARG C 3 18  ? 16.466  -20.463 20.223 1.00 32.25 ? 33   ARG C CD  1 
ATOM   2272 N  NE  . ARG C 3 18  ? 16.373  -19.210 19.464 1.00 46.02 ? 33   ARG C NE  1 
ATOM   2273 C  CZ  . ARG C 3 18  ? 17.272  -18.763 18.574 1.00 51.11 ? 33   ARG C CZ  1 
ATOM   2274 N  NH1 . ARG C 3 18  ? 18.377  -19.454 18.279 1.00 52.65 ? 33   ARG C NH1 1 
ATOM   2275 N  NH2 . ARG C 3 18  ? 17.067  -17.597 17.968 1.00 44.60 ? 33   ARG C NH2 1 
ATOM   2276 N  N   . GLU C 3 19  ? 16.903  -22.722 24.861 1.00 28.02 ? 34   GLU C N   1 
ATOM   2277 C  CA  . GLU C 3 19  ? 15.922  -22.831 25.937 1.00 32.48 ? 34   GLU C CA  1 
ATOM   2278 C  C   . GLU C 3 19  ? 16.442  -22.231 27.255 1.00 32.37 ? 34   GLU C C   1 
ATOM   2279 O  O   . GLU C 3 19  ? 15.673  -21.637 28.000 1.00 35.28 ? 34   GLU C O   1 
ATOM   2280 C  CB  . GLU C 3 19  ? 15.510  -24.297 26.143 1.00 40.51 ? 34   GLU C CB  1 
ATOM   2281 C  CG  . GLU C 3 19  ? 14.389  -24.549 27.203 1.00 53.48 ? 34   GLU C CG  1 
ATOM   2282 C  CD  . GLU C 3 19  ? 14.531  -25.902 27.983 1.00 66.53 ? 34   GLU C CD  1 
ATOM   2283 O  OE1 . GLU C 3 19  ? 15.297  -26.811 27.554 1.00 65.06 ? 34   GLU C OE1 1 
ATOM   2284 O  OE2 . GLU C 3 19  ? 13.865  -26.044 29.044 1.00 65.36 ? 34   GLU C OE2 1 
ATOM   2285 N  N   . HIS C 3 20  ? 17.736  -22.389 27.531 1.00 28.37 ? 35   HIS C N   1 
ATOM   2286 C  CA  . HIS C 3 20  ? 18.335  -21.940 28.788 1.00 28.41 ? 35   HIS C CA  1 
ATOM   2287 C  C   . HIS C 3 20  ? 18.607  -20.458 28.740 1.00 28.49 ? 35   HIS C C   1 
ATOM   2288 O  O   . HIS C 3 20  ? 18.415  -19.750 29.732 1.00 34.81 ? 35   HIS C O   1 
ATOM   2289 C  CB  . HIS C 3 20  ? 19.650  -22.684 29.057 1.00 33.40 ? 35   HIS C CB  1 
ATOM   2290 C  CG  . HIS C 3 20  ? 19.483  -24.161 29.276 1.00 35.88 ? 35   HIS C CG  1 
ATOM   2291 N  ND1 . HIS C 3 20  ? 18.377  -24.861 28.838 1.00 32.24 ? 35   HIS C ND1 1 
ATOM   2292 C  CD2 . HIS C 3 20  ? 20.290  -25.070 29.874 1.00 32.59 ? 35   HIS C CD2 1 
ATOM   2293 C  CE1 . HIS C 3 20  ? 18.499  -26.132 29.182 1.00 37.99 ? 35   HIS C CE1 1 
ATOM   2294 N  NE2 . HIS C 3 20  ? 19.652  -26.284 29.806 1.00 35.95 ? 35   HIS C NE2 1 
ATOM   2295 N  N   . ALA C 3 21  ? 19.049  -19.981 27.582 1.00 25.11 ? 36   ALA C N   1 
ATOM   2296 C  CA  . ALA C 3 21  ? 19.269  -18.550 27.386 1.00 24.01 ? 36   ALA C CA  1 
ATOM   2297 C  C   . ALA C 3 21  ? 17.975  -17.766 27.457 1.00 25.03 ? 36   ALA C C   1 
ATOM   2298 O  O   . ALA C 3 21  ? 17.992  -16.599 27.813 1.00 25.02 ? 36   ALA C O   1 
ATOM   2299 C  CB  . ALA C 3 21  ? 19.945  -18.290 26.073 1.00 17.21 ? 36   ALA C CB  1 
ATOM   2300 N  N   . LEU C 3 22  ? 16.848  -18.384 27.110 1.00 30.91 ? 37   LEU C N   1 
ATOM   2301 C  CA  . LEU C 3 22  ? 15.543  -17.686 27.208 1.00 30.59 ? 37   LEU C CA  1 
ATOM   2302 C  C   . LEU C 3 22  ? 15.117  -17.434 28.666 1.00 32.58 ? 37   LEU C C   1 
ATOM   2303 O  O   . LEU C 3 22  ? 14.209  -16.658 28.900 1.00 36.12 ? 37   LEU C O   1 
ATOM   2304 C  CB  . LEU C 3 22  ? 14.456  -18.427 26.417 1.00 26.26 ? 37   LEU C CB  1 
ATOM   2305 C  CG  . LEU C 3 22  ? 14.770  -18.466 24.912 1.00 34.72 ? 37   LEU C CG  1 
ATOM   2306 C  CD1 . LEU C 3 22  ? 13.635  -19.074 24.076 1.00 25.60 ? 37   LEU C CD1 1 
ATOM   2307 C  CD2 . LEU C 3 22  ? 15.124  -17.063 24.392 1.00 30.12 ? 37   LEU C CD2 1 
ATOM   2308 N  N   . THR C 3 23  ? 15.789  -18.071 29.629 1.00 29.79 ? 38   THR C N   1 
ATOM   2309 C  CA  . THR C 3 23  ? 15.737  -17.672 31.034 1.00 30.51 ? 38   THR C CA  1 
ATOM   2310 C  C   . THR C 3 23  ? 15.970  -16.163 31.265 1.00 34.78 ? 38   THR C C   1 
ATOM   2311 O  O   . THR C 3 23  ? 15.437  -15.583 32.206 1.00 38.01 ? 38   THR C O   1 
ATOM   2312 C  CB  . THR C 3 23  ? 16.790  -18.467 31.803 1.00 35.45 ? 38   THR C CB  1 
ATOM   2313 O  OG1 . THR C 3 23  ? 16.367  -19.837 31.876 1.00 36.06 ? 38   THR C OG1 1 
ATOM   2314 C  CG2 . THR C 3 23  ? 17.036  -17.892 33.220 1.00 41.58 ? 38   THR C CG2 1 
ATOM   2315 N  N   . SER C 3 24  ? 16.772  -15.530 30.416 1.00 32.61 ? 39   SER C N   1 
ATOM   2316 C  CA  . SER C 3 24  ? 16.931  -14.078 30.453 1.00 29.60 ? 39   SER C CA  1 
ATOM   2317 C  C   . SER C 3 24  ? 15.857  -13.405 29.624 1.00 29.29 ? 39   SER C C   1 
ATOM   2318 O  O   . SER C 3 24  ? 15.711  -13.672 28.432 1.00 26.84 ? 39   SER C O   1 
ATOM   2319 C  CB  . SER C 3 24  ? 18.323  -13.656 29.947 1.00 28.26 ? 39   SER C CB  1 
ATOM   2320 O  OG  . SER C 3 24  ? 18.328  -12.332 29.433 1.00 27.79 ? 39   SER C OG  1 
ATOM   2321 N  N   . GLY C 3 25  ? 15.124  -12.499 30.253 1.00 30.49 ? 40   GLY C N   1 
ATOM   2322 C  CA  . GLY C 3 25  ? 14.106  -11.745 29.560 1.00 30.36 ? 40   GLY C CA  1 
ATOM   2323 C  C   . GLY C 3 25  ? 14.696  -10.811 28.534 1.00 30.30 ? 40   GLY C C   1 
ATOM   2324 O  O   . GLY C 3 25  ? 14.067  -10.530 27.512 1.00 30.84 ? 40   GLY C O   1 
ATOM   2325 N  N   . THR C 3 26  ? 15.895  -10.301 28.804 1.00 32.06 ? 41   THR C N   1 
ATOM   2326 C  CA  . THR C 3 26  ? 16.529  -9.377  27.871 1.00 30.79 ? 41   THR C CA  1 
ATOM   2327 C  C   . THR C 3 26  ? 16.897  -10.155 26.637 1.00 36.21 ? 41   THR C C   1 
ATOM   2328 O  O   . THR C 3 26  ? 16.656  -9.683  25.520 1.00 42.53 ? 41   THR C O   1 
ATOM   2329 C  CB  . THR C 3 26  ? 17.799  -8.718  28.442 1.00 32.54 ? 41   THR C CB  1 
ATOM   2330 O  OG1 . THR C 3 26  ? 17.470  -8.018  29.647 1.00 27.89 ? 41   THR C OG1 1 
ATOM   2331 C  CG2 . THR C 3 26  ? 18.396  -7.737  27.414 1.00 19.80 ? 41   THR C CG2 1 
ATOM   2332 N  N   . ILE C 3 27  ? 17.461  -11.351 26.839 1.00 33.31 ? 42   ILE C N   1 
ATOM   2333 C  CA  . ILE C 3 27  ? 17.865  -12.201 25.719 1.00 34.00 ? 42   ILE C CA  1 
ATOM   2334 C  C   . ILE C 3 27  ? 16.652  -12.733 24.954 1.00 37.88 ? 42   ILE C C   1 
ATOM   2335 O  O   . ILE C 3 27  ? 16.639  -12.717 23.725 1.00 37.18 ? 42   ILE C O   1 
ATOM   2336 C  CB  . ILE C 3 27  ? 18.767  -13.351 26.179 1.00 32.97 ? 42   ILE C CB  1 
ATOM   2337 C  CG1 . ILE C 3 27  ? 20.103  -12.801 26.673 1.00 35.41 ? 42   ILE C CG1 1 
ATOM   2338 C  CG2 . ILE C 3 27  ? 19.048  -14.303 25.049 1.00 31.85 ? 42   ILE C CG2 1 
ATOM   2339 C  CD1 . ILE C 3 27  ? 20.949  -13.794 27.426 1.00 18.91 ? 42   ILE C CD1 1 
ATOM   2340 N  N   . LYS C 3 28  ? 15.638  -13.199 25.682 1.00 43.85 ? 43   LYS C N   1 
ATOM   2341 C  CA  . LYS C 3 28  ? 14.376  -13.661 25.074 1.00 46.92 ? 43   LYS C CA  1 
ATOM   2342 C  C   . LYS C 3 28  ? 13.790  -12.593 24.165 1.00 47.66 ? 43   LYS C C   1 
ATOM   2343 O  O   . LYS C 3 28  ? 13.288  -12.908 23.094 1.00 46.70 ? 43   LYS C O   1 
ATOM   2344 C  CB  . LYS C 3 28  ? 13.349  -14.040 26.160 1.00 50.14 ? 43   LYS C CB  1 
ATOM   2345 C  CG  . LYS C 3 28  ? 11.974  -14.566 25.665 1.00 47.97 ? 43   LYS C CG  1 
ATOM   2346 C  CD  . LYS C 3 28  ? 11.124  -15.078 26.848 1.00 51.22 ? 43   LYS C CD  1 
ATOM   2347 C  CE  . LYS C 3 28  ? 9.739   -15.557 26.419 1.00 53.62 ? 43   LYS C CE  1 
ATOM   2348 N  N   . ALA C 3 29  ? 13.865  -11.336 24.602 1.00 51.31 ? 44   ALA C N   1 
ATOM   2349 C  CA  . ALA C 3 29  ? 13.312  -10.211 23.847 1.00 51.53 ? 44   ALA C CA  1 
ATOM   2350 C  C   . ALA C 3 29  ? 14.152  -9.882  22.621 1.00 52.77 ? 44   ALA C C   1 
ATOM   2351 O  O   . ALA C 3 29  ? 13.593  -9.492  21.591 1.00 54.19 ? 44   ALA C O   1 
ATOM   2352 C  CB  . ALA C 3 29  ? 13.174  -8.987  24.728 1.00 48.09 ? 44   ALA C CB  1 
ATOM   2353 N  N   . MET C 3 30  ? 15.477  -10.044 22.714 1.00 53.04 ? 45   MET C N   1 
ATOM   2354 C  CA  . MET C 3 30  ? 16.355  -9.681  21.591 1.00 54.42 ? 45   MET C CA  1 
ATOM   2355 C  C   . MET C 3 30  ? 16.697  -10.832 20.623 1.00 56.95 ? 45   MET C C   1 
ATOM   2356 O  O   . MET C 3 30  ? 17.604  -10.678 19.793 1.00 55.42 ? 45   MET C O   1 
ATOM   2357 C  CB  . MET C 3 30  ? 17.614  -8.938  22.073 1.00 54.69 ? 45   MET C CB  1 
ATOM   2358 C  CG  . MET C 3 30  ? 18.718  -9.762  22.696 1.00 55.87 ? 45   MET C CG  1 
ATOM   2359 S  SD  . MET C 3 30  ? 20.092  -8.734  23.328 1.00 60.32 ? 45   MET C SD  1 
ATOM   2360 C  CE  . MET C 3 30  ? 20.479  -7.755  21.858 1.00 64.07 ? 45   MET C CE  1 
ATOM   2361 N  N   . LEU C 3 31  ? 15.945  -11.945 20.704 1.00 59.10 ? 46   LEU C N   1 
ATOM   2362 C  CA  . LEU C 3 31  ? 16.025  -13.060 19.723 1.00 57.42 ? 46   LEU C CA  1 
ATOM   2363 C  C   . LEU C 3 31  ? 14.780  -13.195 18.802 1.00 56.39 ? 46   LEU C C   1 
ATOM   2364 O  O   . LEU C 3 31  ? 13.656  -12.816 19.157 1.00 55.27 ? 46   LEU C O   1 
ATOM   2365 C  CB  . LEU C 3 31  ? 16.297  -14.390 20.440 1.00 51.02 ? 46   LEU C CB  1 
ATOM   2366 C  CG  . LEU C 3 31  ? 17.700  -14.585 21.055 1.00 50.68 ? 46   LEU C CG  1 
ATOM   2367 C  CD1 . LEU C 3 31  ? 17.697  -15.743 22.011 1.00 38.66 ? 46   LEU C CD1 1 
ATOM   2368 C  CD2 . LEU C 3 31  ? 18.795  -14.806 20.022 1.00 41.16 ? 46   LEU C CD2 1 
ATOM   2369 N  N   . ASN C 3 43  ? 21.012  -16.272 16.314 1.00 36.94 ? 58   ASN C N   1 
ATOM   2370 C  CA  . ASN C 3 43  ? 22.147  -17.152 16.608 1.00 40.29 ? 58   ASN C CA  1 
ATOM   2371 C  C   . ASN C 3 43  ? 23.181  -16.550 17.586 1.00 43.59 ? 58   ASN C C   1 
ATOM   2372 O  O   . ASN C 3 43  ? 23.655  -17.257 18.473 1.00 45.96 ? 58   ASN C O   1 
ATOM   2373 C  CB  . ASN C 3 43  ? 22.847  -17.603 15.312 1.00 37.54 ? 58   ASN C CB  1 
ATOM   2374 N  N   . GLU C 3 44  ? 23.536  -15.268 17.424 1.00 45.49 ? 59   GLU C N   1 
ATOM   2375 C  CA  . GLU C 3 44  ? 24.614  -14.622 18.216 1.00 44.94 ? 59   GLU C CA  1 
ATOM   2376 C  C   . GLU C 3 44  ? 24.137  -13.361 18.932 1.00 42.26 ? 59   GLU C C   1 
ATOM   2377 O  O   . GLU C 3 44  ? 23.356  -12.597 18.389 1.00 43.78 ? 59   GLU C O   1 
ATOM   2378 C  CB  . GLU C 3 44  ? 25.823  -14.238 17.334 1.00 45.87 ? 59   GLU C CB  1 
ATOM   2379 C  CG  . GLU C 3 44  ? 26.502  -15.403 16.583 1.00 56.99 ? 59   GLU C CG  1 
ATOM   2380 C  CD  . GLU C 3 44  ? 27.916  -15.069 16.068 1.00 62.34 ? 59   GLU C CD  1 
ATOM   2381 O  OE1 . GLU C 3 44  ? 28.204  -13.871 15.846 1.00 64.43 ? 59   GLU C OE1 1 
ATOM   2382 O  OE2 . GLU C 3 44  ? 28.734  -16.010 15.879 1.00 60.56 ? 59   GLU C OE2 1 
ATOM   2383 N  N   . VAL C 3 45  ? 24.632  -13.147 20.149 1.00 41.03 ? 60   VAL C N   1 
ATOM   2384 C  CA  . VAL C 3 45  ? 24.396  -11.919 20.903 1.00 35.35 ? 60   VAL C CA  1 
ATOM   2385 C  C   . VAL C 3 45  ? 25.720  -11.424 21.497 1.00 35.45 ? 60   VAL C C   1 
ATOM   2386 O  O   . VAL C 3 45  ? 26.438  -12.201 22.157 1.00 26.39 ? 60   VAL C O   1 
ATOM   2387 C  CB  . VAL C 3 45  ? 23.380  -12.139 22.032 1.00 37.82 ? 60   VAL C CB  1 
ATOM   2388 C  CG1 . VAL C 3 45  ? 23.352  -10.927 22.986 1.00 24.79 ? 60   VAL C CG1 1 
ATOM   2389 C  CG2 . VAL C 3 45  ? 22.011  -12.422 21.439 1.00 33.17 ? 60   VAL C CG2 1 
ATOM   2390 N  N   . ASN C 3 46  ? 26.032  -10.140 21.258 1.00 33.70 ? 61   ASN C N   1 
ATOM   2391 C  CA  . ASN C 3 46  ? 27.258  -9.512  21.770 1.00 36.49 ? 61   ASN C CA  1 
ATOM   2392 C  C   . ASN C 3 46  ? 26.967  -8.669  22.998 1.00 36.02 ? 61   ASN C C   1 
ATOM   2393 O  O   . ASN C 3 46  ? 26.023  -7.893  22.994 1.00 36.93 ? 61   ASN C O   1 
ATOM   2394 C  CB  . ASN C 3 46  ? 27.950  -8.672  20.687 1.00 37.81 ? 61   ASN C CB  1 
ATOM   2395 C  CG  . ASN C 3 46  ? 29.430  -9.009  20.561 1.00 49.13 ? 61   ASN C CG  1 
ATOM   2396 O  OD1 . ASN C 3 46  ? 30.203  -8.852  21.513 1.00 58.25 ? 61   ASN C OD1 1 
ATOM   2397 N  ND2 . ASN C 3 46  ? 29.820  -9.523  19.401 1.00 49.81 ? 61   ASN C ND2 1 
ATOM   2398 N  N   . PHE C 3 47  ? 27.764  -8.838  24.050 1.00 36.39 ? 62   PHE C N   1 
ATOM   2399 C  CA  . PHE C 3 47  ? 27.567  -8.115  25.301 1.00 35.49 ? 62   PHE C CA  1 
ATOM   2400 C  C   . PHE C 3 47  ? 28.783  -7.251  25.562 1.00 39.50 ? 62   PHE C C   1 
ATOM   2401 O  O   . PHE C 3 47  ? 29.732  -7.689  26.199 1.00 46.69 ? 62   PHE C O   1 
ATOM   2402 C  CB  . PHE C 3 47  ? 27.385  -9.096  26.465 1.00 37.03 ? 62   PHE C CB  1 
ATOM   2403 C  CG  . PHE C 3 47  ? 26.111  -9.859  26.417 1.00 36.30 ? 62   PHE C CG  1 
ATOM   2404 C  CD1 . PHE C 3 47  ? 24.906  -9.219  26.636 1.00 37.59 ? 62   PHE C CD1 1 
ATOM   2405 C  CD2 . PHE C 3 47  ? 26.103  -11.215 26.142 1.00 39.51 ? 62   PHE C CD2 1 
ATOM   2406 C  CE1 . PHE C 3 47  ? 23.712  -9.911  26.583 1.00 29.41 ? 62   PHE C CE1 1 
ATOM   2407 C  CE2 . PHE C 3 47  ? 24.913  -11.906 26.094 1.00 35.02 ? 62   PHE C CE2 1 
ATOM   2408 C  CZ  . PHE C 3 47  ? 23.713  -11.248 26.318 1.00 30.73 ? 62   PHE C CZ  1 
ATOM   2409 N  N   . ARG C 3 48  ? 28.774  -6.016  25.087 1.00 42.57 ? 63   ARG C N   1 
ATOM   2410 C  CA  . ARG C 3 48  ? 30.001  -5.222  25.114 1.00 41.14 ? 63   ARG C CA  1 
ATOM   2411 C  C   . ARG C 3 48  ? 30.340  -4.715  26.525 1.00 39.42 ? 63   ARG C C   1 
ATOM   2412 O  O   . ARG C 3 48  ? 31.432  -4.215  26.756 1.00 41.44 ? 63   ARG C O   1 
ATOM   2413 C  CB  . ARG C 3 48  ? 29.947  -4.093  24.059 1.00 43.69 ? 63   ARG C CB  1 
ATOM   2414 C  CG  . ARG C 3 48  ? 30.131  -4.576  22.578 1.00 36.43 ? 63   ARG C CG  1 
ATOM   2415 N  N   . GLU C 3 49  ? 29.435  -4.899  27.482 1.00 39.43 ? 64   GLU C N   1 
ATOM   2416 C  CA  . GLU C 3 49  ? 29.664  -4.425  28.847 1.00 43.01 ? 64   GLU C CA  1 
ATOM   2417 C  C   . GLU C 3 49  ? 29.759  -5.536  29.898 1.00 38.19 ? 64   GLU C C   1 
ATOM   2418 O  O   . GLU C 3 49  ? 29.986  -5.239  31.069 1.00 36.30 ? 64   GLU C O   1 
ATOM   2419 C  CB  . GLU C 3 49  ? 28.562  -3.421  29.250 1.00 49.29 ? 64   GLU C CB  1 
ATOM   2420 C  CG  . GLU C 3 49  ? 28.656  -2.038  28.569 1.00 58.95 ? 64   GLU C CG  1 
ATOM   2421 C  CD  . GLU C 3 49  ? 29.636  -1.077  29.266 1.00 72.44 ? 64   GLU C CD  1 
ATOM   2422 O  OE1 . GLU C 3 49  ? 29.211  -0.309  30.164 1.00 73.69 ? 64   GLU C OE1 1 
ATOM   2423 O  OE2 . GLU C 3 49  ? 30.835  -1.080  28.902 1.00 79.30 ? 64   GLU C OE2 1 
ATOM   2424 N  N   . ILE C 3 50  ? 29.571  -6.796  29.503 1.00 33.70 ? 65   ILE C N   1 
ATOM   2425 C  CA  . ILE C 3 50  ? 29.697  -7.924  30.442 1.00 33.36 ? 65   ILE C CA  1 
ATOM   2426 C  C   . ILE C 3 50  ? 30.928  -8.753  30.113 1.00 28.18 ? 65   ILE C C   1 
ATOM   2427 O  O   . ILE C 3 50  ? 31.009  -9.305  29.010 1.00 31.37 ? 65   ILE C O   1 
ATOM   2428 C  CB  . ILE C 3 50  ? 28.484  -8.894  30.438 1.00 31.18 ? 65   ILE C CB  1 
ATOM   2429 C  CG1 . ILE C 3 50  ? 27.156  -8.156  30.671 1.00 37.10 ? 65   ILE C CG1 1 
ATOM   2430 C  CG2 . ILE C 3 50  ? 28.685  -9.915  31.528 1.00 29.12 ? 65   ILE C CG2 1 
ATOM   2431 C  CD1 . ILE C 3 50  ? 25.886  -9.048  30.516 1.00 32.01 ? 65   ILE C CD1 1 
ATOM   2432 N  N   . PRO C 3 51  ? 31.880  -8.856  31.065 1.00 26.05 ? 66   PRO C N   1 
ATOM   2433 C  CA  . PRO C 3 51  ? 33.126  -9.605  30.823 1.00 25.96 ? 66   PRO C CA  1 
ATOM   2434 C  C   . PRO C 3 51  ? 33.000  -11.105 31.114 1.00 21.31 ? 66   PRO C C   1 
ATOM   2435 O  O   . PRO C 3 51  ? 32.053  -11.524 31.763 1.00 30.30 ? 66   PRO C O   1 
ATOM   2436 C  CB  . PRO C 3 51  ? 34.129  -8.942  31.784 1.00 22.20 ? 66   PRO C CB  1 
ATOM   2437 C  CG  . PRO C 3 51  ? 33.312  -8.539  32.972 1.00 18.13 ? 66   PRO C CG  1 
ATOM   2438 C  CD  . PRO C 3 51  ? 31.865  -8.275  32.429 1.00 27.15 ? 66   PRO C CD  1 
ATOM   2439 N  N   . SER C 3 52  ? 33.978  -11.890 30.672 1.00 26.17 ? 67   SER C N   1 
ATOM   2440 C  CA  . SER C 3 52  ? 33.841  -13.348 30.663 1.00 28.66 ? 67   SER C CA  1 
ATOM   2441 C  C   . SER C 3 52  ? 33.668  -13.976 32.058 1.00 28.16 ? 67   SER C C   1 
ATOM   2442 O  O   . SER C 3 52  ? 32.919  -14.935 32.203 1.00 29.74 ? 67   SER C O   1 
ATOM   2443 C  CB  . SER C 3 52  ? 34.987  -14.012 29.884 1.00 29.89 ? 67   SER C CB  1 
ATOM   2444 O  OG  . SER C 3 52  ? 36.258  -13.602 30.349 1.00 25.41 ? 67   SER C OG  1 
ATOM   2445 N  N   . HIS C 3 53  ? 34.312  -13.431 33.088 1.00 28.26 ? 68   HIS C N   1 
ATOM   2446 C  CA  . HIS C 3 53  ? 34.169  -14.026 34.426 1.00 28.31 ? 68   HIS C CA  1 
ATOM   2447 C  C   . HIS C 3 53  ? 32.762  -13.867 34.977 1.00 31.22 ? 68   HIS C C   1 
ATOM   2448 O  O   . HIS C 3 53  ? 32.372  -14.571 35.906 1.00 37.16 ? 68   HIS C O   1 
ATOM   2449 C  CB  . HIS C 3 53  ? 35.198  -13.477 35.420 1.00 24.27 ? 68   HIS C CB  1 
ATOM   2450 C  CG  . HIS C 3 53  ? 34.979  -12.057 35.835 1.00 19.31 ? 68   HIS C CG  1 
ATOM   2451 N  ND1 . HIS C 3 53  ? 35.533  -10.988 35.165 1.00 28.06 ? 68   HIS C ND1 1 
ATOM   2452 C  CD2 . HIS C 3 53  ? 34.329  -11.533 36.902 1.00 31.87 ? 68   HIS C CD2 1 
ATOM   2453 C  CE1 . HIS C 3 53  ? 35.205  -9.864  35.783 1.00 28.58 ? 68   HIS C CE1 1 
ATOM   2454 N  NE2 . HIS C 3 53  ? 34.474  -10.167 36.842 1.00 22.93 ? 68   HIS C NE2 1 
ATOM   2455 N  N   . VAL C 3 54  ? 32.008  -12.943 34.404 1.00 27.61 ? 69   VAL C N   1 
ATOM   2456 C  CA  . VAL C 3 54  ? 30.639  -12.735 34.804 1.00 24.21 ? 69   VAL C CA  1 
ATOM   2457 C  C   . VAL C 3 54  ? 29.684  -13.530 33.910 1.00 25.92 ? 69   VAL C C   1 
ATOM   2458 O  O   . VAL C 3 54  ? 28.728  -14.106 34.412 1.00 28.16 ? 69   VAL C O   1 
ATOM   2459 C  CB  . VAL C 3 54  ? 30.334  -11.247 34.783 1.00 25.02 ? 69   VAL C CB  1 
ATOM   2460 C  CG1 . VAL C 3 54  ? 28.853  -10.998 34.984 1.00 23.28 ? 69   VAL C CG1 1 
ATOM   2461 C  CG2 . VAL C 3 54  ? 31.179  -10.543 35.848 1.00 19.15 ? 69   VAL C CG2 1 
ATOM   2462 N  N   . LEU C 3 55  ? 29.951  -13.591 32.601 1.00 28.45 ? 70   LEU C N   1 
ATOM   2463 C  CA  . LEU C 3 55  ? 29.019  -14.229 31.647 1.00 25.50 ? 70   LEU C CA  1 
ATOM   2464 C  C   . LEU C 3 55  ? 29.048  -15.728 31.788 1.00 23.48 ? 70   LEU C C   1 
ATOM   2465 O  O   . LEU C 3 55  ? 28.052  -16.419 31.567 1.00 33.71 ? 70   LEU C O   1 
ATOM   2466 C  CB  . LEU C 3 55  ? 29.365  -13.849 30.211 1.00 23.85 ? 70   LEU C CB  1 
ATOM   2467 C  CG  . LEU C 3 55  ? 28.302  -14.038 29.127 1.00 31.65 ? 70   LEU C CG  1 
ATOM   2468 C  CD1 . LEU C 3 55  ? 26.874  -13.566 29.549 1.00 28.11 ? 70   LEU C CD1 1 
ATOM   2469 C  CD2 . LEU C 3 55  ? 28.767  -13.290 27.868 1.00 23.74 ? 70   LEU C CD2 1 
ATOM   2470 N  N   . SER C 3 56  ? 30.197  -16.257 32.162 1.00 25.16 ? 71   SER C N   1 
ATOM   2471 C  CA  . SER C 3 56  ? 30.312  -17.691 32.336 1.00 28.32 ? 71   SER C CA  1 
ATOM   2472 C  C   . SER C 3 56  ? 29.392  -18.096 33.454 1.00 29.97 ? 71   SER C C   1 
ATOM   2473 O  O   . SER C 3 56  ? 28.727  -19.124 33.379 1.00 32.30 ? 71   SER C O   1 
ATOM   2474 C  CB  . SER C 3 56  ? 31.739  -18.062 32.701 1.00 28.61 ? 71   SER C CB  1 
ATOM   2475 O  OG  . SER C 3 56  ? 32.163  -17.290 33.813 1.00 39.42 ? 71   SER C OG  1 
ATOM   2476 N  N   . LYS C 3 57  ? 29.375  -17.259 34.489 1.00 30.14 ? 72   LYS C N   1 
ATOM   2477 C  CA  . LYS C 3 57  ? 28.598  -17.497 35.692 1.00 27.39 ? 72   LYS C CA  1 
ATOM   2478 C  C   . LYS C 3 57  ? 27.120  -17.377 35.431 1.00 24.84 ? 72   LYS C C   1 
ATOM   2479 O  O   . LYS C 3 57  ? 26.338  -18.123 35.997 1.00 29.91 ? 72   LYS C O   1 
ATOM   2480 C  CB  . LYS C 3 57  ? 29.013  -16.537 36.802 1.00 26.29 ? 72   LYS C CB  1 
ATOM   2481 C  CG  . LYS C 3 57  ? 28.644  -17.033 38.200 1.00 34.52 ? 72   LYS C CG  1 
ATOM   2482 C  CD  . LYS C 3 57  ? 29.646  -18.060 38.680 1.00 43.16 ? 72   LYS C CD  1 
ATOM   2483 C  CE  . LYS C 3 57  ? 29.131  -18.790 39.887 1.00 38.65 ? 72   LYS C CE  1 
ATOM   2484 N  NZ  . LYS C 3 57  ? 30.274  -19.445 40.558 1.00 39.44 ? 72   LYS C NZ  1 
ATOM   2485 N  N   . VAL C 3 58  ? 26.741  -16.436 34.579 1.00 30.42 ? 73   VAL C N   1 
ATOM   2486 C  CA  . VAL C 3 58  ? 25.334  -16.263 34.181 1.00 29.80 ? 73   VAL C CA  1 
ATOM   2487 C  C   . VAL C 3 58  ? 24.862  -17.523 33.479 1.00 29.46 ? 73   VAL C C   1 
ATOM   2488 O  O   . VAL C 3 58  ? 23.788  -18.052 33.768 1.00 24.95 ? 73   VAL C O   1 
ATOM   2489 C  CB  . VAL C 3 58  ? 25.171  -15.035 33.245 1.00 29.90 ? 73   VAL C CB  1 
ATOM   2490 C  CG1 . VAL C 3 58  ? 23.809  -15.015 32.600 1.00 28.40 ? 73   VAL C CG1 1 
ATOM   2491 C  CG2 . VAL C 3 58  ? 25.399  -13.754 34.029 1.00 21.99 ? 73   VAL C CG2 1 
ATOM   2492 N  N   . CYS C 3 59  ? 25.695  -18.036 32.586 1.00 26.13 ? 74   CYS C N   1 
ATOM   2493 C  CA  . CYS C 3 59  ? 25.366  -19.283 31.910 1.00 26.06 ? 74   CYS C CA  1 
ATOM   2494 C  C   . CYS C 3 59  ? 25.107  -20.440 32.870 1.00 26.49 ? 74   CYS C C   1 
ATOM   2495 O  O   . CYS C 3 59  ? 24.167  -21.204 32.690 1.00 29.39 ? 74   CYS C O   1 
ATOM   2496 C  CB  . CYS C 3 59  ? 26.463  -19.632 30.944 1.00 29.14 ? 74   CYS C CB  1 
ATOM   2497 S  SG  . CYS C 3 59  ? 26.556  -18.467 29.571 1.00 32.30 ? 74   CYS C SG  1 
ATOM   2498 N  N   . MET C 3 60  ? 25.942  -20.551 33.897 1.00 25.40 ? 75   MET C N   1 
ATOM   2499 C  CA  . MET C 3 60  ? 25.756  -21.540 34.918 1.00 24.48 ? 75   MET C CA  1 
ATOM   2500 C  C   . MET C 3 60  ? 24.386  -21.338 35.606 1.00 32.39 ? 75   MET C C   1 
ATOM   2501 O  O   . MET C 3 60  ? 23.682  -22.318 35.888 1.00 36.05 ? 75   MET C O   1 
ATOM   2502 C  CB  . MET C 3 60  ? 26.887  -21.461 35.939 1.00 23.81 ? 75   MET C CB  1 
ATOM   2503 C  CG  . MET C 3 60  ? 28.235  -21.888 35.406 1.00 26.78 ? 75   MET C CG  1 
ATOM   2504 S  SD  . MET C 3 60  ? 29.606  -21.596 36.570 1.00 29.12 ? 75   MET C SD  1 
ATOM   2505 C  CE  . MET C 3 60  ? 31.033  -21.523 35.489 1.00 29.37 ? 75   MET C CE  1 
ATOM   2506 N  N   . TYR C 3 61  ? 23.987  -20.089 35.845 1.00 24.22 ? 76   TYR C N   1 
ATOM   2507 C  CA  . TYR C 3 61  ? 22.666  -19.832 36.416 1.00 26.83 ? 76   TYR C CA  1 
ATOM   2508 C  C   . TYR C 3 61  ? 21.513  -20.335 35.518 1.00 29.20 ? 76   TYR C C   1 
ATOM   2509 O  O   . TYR C 3 61  ? 20.531  -20.916 35.996 1.00 31.43 ? 76   TYR C O   1 
ATOM   2510 C  CB  . TYR C 3 61  ? 22.467  -18.341 36.763 1.00 23.58 ? 76   TYR C CB  1 
ATOM   2511 C  CG  . TYR C 3 61  ? 21.111  -18.095 37.343 1.00 25.16 ? 76   TYR C CG  1 
ATOM   2512 C  CD1 . TYR C 3 61  ? 20.837  -18.395 38.679 1.00 23.92 ? 76   TYR C CD1 1 
ATOM   2513 C  CD2 . TYR C 3 61  ? 20.067  -17.648 36.545 1.00 23.01 ? 76   TYR C CD2 1 
ATOM   2514 C  CE1 . TYR C 3 61  ? 19.566  -18.183 39.220 1.00 18.82 ? 76   TYR C CE1 1 
ATOM   2515 C  CE2 . TYR C 3 61  ? 18.792  -17.451 37.072 1.00 18.61 ? 76   TYR C CE2 1 
ATOM   2516 C  CZ  . TYR C 3 61  ? 18.547  -17.726 38.406 1.00 19.44 ? 76   TYR C CZ  1 
ATOM   2517 O  OH  . TYR C 3 61  ? 17.275  -17.555 38.907 1.00 21.51 ? 76   TYR C OH  1 
ATOM   2518 N  N   . PHE C 3 62  ? 21.628  -20.107 34.222 1.00 31.04 ? 77   PHE C N   1 
ATOM   2519 C  CA  . PHE C 3 62  ? 20.604  -20.555 33.281 1.00 27.16 ? 77   PHE C CA  1 
ATOM   2520 C  C   . PHE C 3 62  ? 20.385  -22.069 33.352 1.00 30.90 ? 77   PHE C C   1 
ATOM   2521 O  O   . PHE C 3 62  ? 19.264  -22.555 33.183 1.00 33.01 ? 77   PHE C O   1 
ATOM   2522 C  CB  . PHE C 3 62  ? 21.028  -20.263 31.850 1.00 28.78 ? 77   PHE C CB  1 
ATOM   2523 C  CG  . PHE C 3 62  ? 21.150  -18.819 31.503 1.00 29.04 ? 77   PHE C CG  1 
ATOM   2524 C  CD1 . PHE C 3 62  ? 20.498  -17.840 32.213 1.00 23.12 ? 77   PHE C CD1 1 
ATOM   2525 C  CD2 . PHE C 3 62  ? 21.892  -18.448 30.388 1.00 28.63 ? 77   PHE C CD2 1 
ATOM   2526 C  CE1 . PHE C 3 62  ? 20.608  -16.506 31.837 1.00 25.60 ? 77   PHE C CE1 1 
ATOM   2527 C  CE2 . PHE C 3 62  ? 21.992  -17.116 30.015 1.00 28.74 ? 77   PHE C CE2 1 
ATOM   2528 C  CZ  . PHE C 3 62  ? 21.354  -16.154 30.741 1.00 22.03 ? 77   PHE C CZ  1 
ATOM   2529 N  N   . THR C 3 63  ? 21.462  -22.820 33.536 1.00 25.19 ? 78   THR C N   1 
ATOM   2530 C  CA  . THR C 3 63  ? 21.348  -24.262 33.695 1.00 26.27 ? 78   THR C CA  1 
ATOM   2531 C  C   . THR C 3 63  ? 20.716  -24.647 35.036 1.00 26.64 ? 78   THR C C   1 
ATOM   2532 O  O   . THR C 3 63  ? 19.877  -25.544 35.105 1.00 28.86 ? 78   THR C O   1 
ATOM   2533 C  CB  . THR C 3 63  ? 22.720  -24.895 33.609 1.00 26.63 ? 78   THR C CB  1 
ATOM   2534 O  OG1 . THR C 3 63  ? 23.446  -24.241 32.571 1.00 30.64 ? 78   THR C OG1 1 
ATOM   2535 C  CG2 . THR C 3 63  ? 22.598  -26.369 33.308 1.00 21.45 ? 78   THR C CG2 1 
ATOM   2536 N  N   . TYR C 3 64  ? 21.141  -23.965 36.096 1.00 26.82 ? 79   TYR C N   1 
ATOM   2537 C  CA  . TYR C 3 64  ? 20.561  -24.128 37.429 1.00 23.96 ? 79   TYR C CA  1 
ATOM   2538 C  C   . TYR C 3 64  ? 19.080  -23.765 37.391 1.00 25.80 ? 79   TYR C C   1 
ATOM   2539 O  O   . TYR C 3 64  ? 18.232  -24.546 37.859 1.00 28.10 ? 79   TYR C O   1 
ATOM   2540 C  CB  . TYR C 3 64  ? 21.362  -23.282 38.406 1.00 21.46 ? 79   TYR C CB  1 
ATOM   2541 C  CG  . TYR C 3 64  ? 20.848  -23.092 39.814 1.00 20.16 ? 79   TYR C CG  1 
ATOM   2542 C  CD1 . TYR C 3 64  ? 21.214  -23.938 40.834 1.00 27.84 ? 79   TYR C CD1 1 
ATOM   2543 C  CD2 . TYR C 3 64  ? 20.085  -21.996 40.137 1.00 23.09 ? 79   TYR C CD2 1 
ATOM   2544 C  CE1 . TYR C 3 64  ? 20.795  -23.711 42.143 1.00 23.49 ? 79   TYR C CE1 1 
ATOM   2545 C  CE2 . TYR C 3 64  ? 19.657  -21.772 41.404 1.00 20.32 ? 79   TYR C CE2 1 
ATOM   2546 C  CZ  . TYR C 3 64  ? 20.022  -22.617 42.417 1.00 25.11 ? 79   TYR C CZ  1 
ATOM   2547 O  OH  . TYR C 3 64  ? 19.578  -22.350 43.702 1.00 26.34 ? 79   TYR C OH  1 
ATOM   2548 N  N   . LYS C 3 65  ? 18.747  -22.648 36.752 1.00 26.32 ? 80   LYS C N   1 
ATOM   2549 C  CA  . LYS C 3 65  ? 17.349  -22.184 36.749 1.00 29.46 ? 80   LYS C CA  1 
ATOM   2550 C  C   . LYS C 3 65  ? 16.443  -23.170 36.074 1.00 26.48 ? 80   LYS C C   1 
ATOM   2551 O  O   . LYS C 3 65  ? 15.399  -23.533 36.613 1.00 35.24 ? 80   LYS C O   1 
ATOM   2552 C  CB  . LYS C 3 65  ? 17.181  -20.821 36.089 1.00 31.14 ? 80   LYS C CB  1 
ATOM   2553 C  CG  . LYS C 3 65  ? 15.993  -20.019 36.634 1.00 42.75 ? 80   LYS C CG  1 
ATOM   2554 C  CD  . LYS C 3 65  ? 14.826  -19.929 35.664 1.00 52.61 ? 80   LYS C CD  1 
ATOM   2555 C  CE  . LYS C 3 65  ? 13.705  -19.005 36.196 1.00 53.83 ? 80   LYS C CE  1 
ATOM   2556 N  NZ  . LYS C 3 65  ? 12.860  -19.679 37.250 1.00 52.23 ? 80   LYS C NZ  1 
ATOM   2557 N  N   . VAL C 3 66  ? 16.863  -23.634 34.909 1.00 30.21 ? 81   VAL C N   1 
ATOM   2558 C  CA  . VAL C 3 66  ? 16.060  -24.551 34.125 1.00 26.22 ? 81   VAL C CA  1 
ATOM   2559 C  C   . VAL C 3 66  ? 15.988  -25.912 34.792 1.00 25.83 ? 81   VAL C C   1 
ATOM   2560 O  O   . VAL C 3 66  ? 14.914  -26.514 34.825 1.00 28.58 ? 81   VAL C O   1 
ATOM   2561 C  CB  . VAL C 3 66  ? 16.573  -24.673 32.675 1.00 28.66 ? 81   VAL C CB  1 
ATOM   2562 C  CG1 . VAL C 3 66  ? 15.885  -25.815 31.947 1.00 20.98 ? 81   VAL C CG1 1 
ATOM   2563 C  CG2 . VAL C 3 66  ? 16.332  -23.346 31.925 1.00 27.65 ? 81   VAL C CG2 1 
ATOM   2564 N  N   . ARG C 3 67  ? 17.097  -26.396 35.347 1.00 24.19 ? 82   ARG C N   1 
ATOM   2565 C  CA  . ARG C 3 67  ? 17.116  -27.761 35.900 1.00 23.47 ? 82   ARG C CA  1 
ATOM   2566 C  C   . ARG C 3 67  ? 16.342  -27.854 37.215 1.00 23.62 ? 82   ARG C C   1 
ATOM   2567 O  O   . ARG C 3 67  ? 15.714  -28.873 37.489 1.00 21.57 ? 82   ARG C O   1 
ATOM   2568 C  CB  . ARG C 3 67  ? 18.559  -28.278 36.052 1.00 32.74 ? 82   ARG C CB  1 
ATOM   2569 C  CG  . ARG C 3 67  ? 18.789  -29.430 37.085 1.00 43.27 ? 82   ARG C CG  1 
ATOM   2570 C  CD  . ARG C 3 67  ? 18.668  -30.886 36.550 1.00 43.09 ? 82   ARG C CD  1 
ATOM   2571 N  NE  . ARG C 3 67  ? 18.844  -31.860 37.646 1.00 60.30 ? 82   ARG C NE  1 
ATOM   2572 C  CZ  . ARG C 3 67  ? 17.897  -32.222 38.538 1.00 73.15 ? 82   ARG C CZ  1 
ATOM   2573 N  NH1 . ARG C 3 67  ? 16.650  -31.734 38.494 1.00 76.02 ? 82   ARG C NH1 1 
ATOM   2574 N  NH2 . ARG C 3 67  ? 18.188  -33.100 39.496 1.00 72.39 ? 82   ARG C NH2 1 
ATOM   2575 N  N   . TYR C 3 68  ? 16.381  -26.798 38.021 1.00 23.88 ? 83   TYR C N   1 
ATOM   2576 C  CA  . TYR C 3 68  ? 15.691  -26.799 39.306 1.00 24.23 ? 83   TYR C CA  1 
ATOM   2577 C  C   . TYR C 3 68  ? 14.301  -26.122 39.303 1.00 29.41 ? 83   TYR C C   1 
ATOM   2578 O  O   . TYR C 3 68  ? 13.660  -25.961 40.354 1.00 27.30 ? 83   TYR C O   1 
ATOM   2579 C  CB  . TYR C 3 68  ? 16.623  -26.210 40.362 1.00 23.20 ? 83   TYR C CB  1 
ATOM   2580 C  CG  . TYR C 3 68  ? 17.755  -27.172 40.650 1.00 19.62 ? 83   TYR C CG  1 
ATOM   2581 C  CD1 . TYR C 3 68  ? 17.494  -28.427 41.196 1.00 17.58 ? 83   TYR C CD1 1 
ATOM   2582 C  CD2 . TYR C 3 68  ? 19.057  -26.868 40.332 1.00 20.69 ? 83   TYR C CD2 1 
ATOM   2583 C  CE1 . TYR C 3 68  ? 18.501  -29.336 41.442 1.00 19.64 ? 83   TYR C CE1 1 
ATOM   2584 C  CE2 . TYR C 3 68  ? 20.087  -27.786 40.585 1.00 20.82 ? 83   TYR C CE2 1 
ATOM   2585 C  CZ  . TYR C 3 68  ? 19.795  -29.011 41.136 1.00 12.71 ? 83   TYR C CZ  1 
ATOM   2586 O  OH  . TYR C 3 68  ? 20.791  -29.922 41.394 1.00 22.93 ? 83   TYR C OH  1 
ATOM   2587 N  N   . THR C 3 69  ? 13.843  -25.747 38.111 1.00 25.82 ? 84   THR C N   1 
ATOM   2588 C  CA  . THR C 3 69  ? 12.488  -25.303 37.914 1.00 26.74 ? 84   THR C CA  1 
ATOM   2589 C  C   . THR C 3 69  ? 11.615  -26.556 37.927 1.00 26.77 ? 84   THR C C   1 
ATOM   2590 O  O   . THR C 3 69  ? 11.966  -27.542 37.304 1.00 33.09 ? 84   THR C O   1 
ATOM   2591 C  CB  . THR C 3 69  ? 12.367  -24.512 36.582 1.00 29.26 ? 84   THR C CB  1 
ATOM   2592 O  OG1 . THR C 3 69  ? 12.960  -23.215 36.747 1.00 25.21 ? 84   THR C OG1 1 
ATOM   2593 C  CG2 . THR C 3 69  ? 10.924  -24.342 36.177 1.00 24.13 ? 84   THR C CG2 1 
ATOM   2594 N  N   . ASN C 3 70  ? 10.492  -26.518 38.645 1.00 30.82 ? 85   ASN C N   1 
ATOM   2595 C  CA  . ASN C 3 70  ? 9.684   -27.722 38.921 1.00 30.62 ? 85   ASN C CA  1 
ATOM   2596 C  C   . ASN C 3 70  ? 10.576  -28.842 39.464 1.00 25.95 ? 85   ASN C C   1 
ATOM   2597 O  O   . ASN C 3 70  ? 10.658  -29.918 38.881 1.00 26.84 ? 85   ASN C O   1 
ATOM   2598 C  CB  . ASN C 3 70  ? 8.936   -28.202 37.661 1.00 33.85 ? 85   ASN C CB  1 
ATOM   2599 C  CG  . ASN C 3 70  ? 7.830   -27.266 37.244 1.00 32.39 ? 85   ASN C CG  1 
ATOM   2600 O  OD1 . ASN C 3 70  ? 6.913   -27.005 38.017 1.00 40.88 ? 85   ASN C OD1 1 
ATOM   2601 N  ND2 . ASN C 3 70  ? 7.901   -26.761 36.016 1.00 30.52 ? 85   ASN C ND2 1 
ATOM   2602 N  N   . SER C 3 71  ? 11.260  -28.576 40.572 1.00 23.97 ? 86   SER C N   1 
ATOM   2603 C  CA  . SER C 3 71  ? 12.293  -29.481 41.029 1.00 18.51 ? 86   SER C CA  1 
ATOM   2604 C  C   . SER C 3 71  ? 11.725  -30.791 41.582 1.00 17.33 ? 86   SER C C   1 
ATOM   2605 O  O   . SER C 3 71  ? 10.677  -30.824 42.226 1.00 20.96 ? 86   SER C O   1 
ATOM   2606 C  CB  . SER C 3 71  ? 13.183  -28.822 42.063 1.00 18.26 ? 86   SER C CB  1 
ATOM   2607 O  OG  . SER C 3 71  ? 14.406  -29.541 42.171 1.00 22.30 ? 86   SER C OG  1 
ATOM   2608 N  N   . SER C 3 72  ? 12.437  -31.865 41.283 1.00 15.54 ? 87   SER C N   1 
ATOM   2609 C  CA  . SER C 3 72  ? 12.201  -33.183 41.832 1.00 17.77 ? 87   SER C CA  1 
ATOM   2610 C  C   . SER C 3 72  ? 12.887  -33.338 43.192 1.00 15.88 ? 87   SER C C   1 
ATOM   2611 O  O   . SER C 3 72  ? 12.720  -34.355 43.870 1.00 15.67 ? 87   SER C O   1 
ATOM   2612 C  CB  . SER C 3 72  ? 12.801  -34.216 40.876 1.00 22.48 ? 87   SER C CB  1 
ATOM   2613 O  OG  . SER C 3 72  ? 14.206  -33.982 40.711 1.00 16.99 ? 87   SER C OG  1 
ATOM   2614 N  N   . THR C 3 73  ? 13.689  -32.348 43.563 1.00 15.91 ? 88   THR C N   1 
ATOM   2615 C  CA  . THR C 3 73  ? 14.502  -32.421 44.774 1.00 18.57 ? 88   THR C CA  1 
ATOM   2616 C  C   . THR C 3 73  ? 14.596  -31.062 45.456 1.00 14.54 ? 88   THR C C   1 
ATOM   2617 O  O   . THR C 3 73  ? 14.254  -30.055 44.881 1.00 14.40 ? 88   THR C O   1 
ATOM   2618 C  CB  . THR C 3 73  ? 15.946  -32.926 44.449 1.00 18.95 ? 88   THR C CB  1 
ATOM   2619 O  OG1 . THR C 3 73  ? 16.771  -32.816 45.612 1.00 21.53 ? 88   THR C OG1 1 
ATOM   2620 C  CG2 . THR C 3 73  ? 16.593  -32.125 43.319 1.00 11.70 ? 88   THR C CG2 1 
ATOM   2621 N  N   . GLU C 3 74  ? 15.067  -31.071 46.692 1.00 19.07 ? 89   GLU C N   1 
ATOM   2622 C  CA  . GLU C 3 74  ? 15.459  -29.877 47.395 1.00 17.39 ? 89   GLU C CA  1 
ATOM   2623 C  C   . GLU C 3 74  ? 16.542  -29.241 46.593 1.00 20.63 ? 89   GLU C C   1 
ATOM   2624 O  O   . GLU C 3 74  ? 17.440  -29.941 46.123 1.00 24.03 ? 89   GLU C O   1 
ATOM   2625 C  CB  . GLU C 3 74  ? 16.019  -30.220 48.759 1.00 17.23 ? 89   GLU C CB  1 
ATOM   2626 C  CG  . GLU C 3 74  ? 16.282  -29.016 49.626 1.00 25.99 ? 89   GLU C CG  1 
ATOM   2627 C  CD  . GLU C 3 74  ? 16.944  -29.376 50.942 1.00 26.66 ? 89   GLU C CD  1 
ATOM   2628 O  OE1 . GLU C 3 74  ? 16.402  -30.227 51.705 1.00 24.14 ? 89   GLU C OE1 1 
ATOM   2629 O  OE2 . GLU C 3 74  ? 18.009  -28.783 51.208 1.00 29.65 ? 89   GLU C OE2 1 
ATOM   2630 N  N   . ILE C 3 75  ? 16.461  -27.916 46.464 1.00 22.20 ? 90   ILE C N   1 
ATOM   2631 C  CA  . ILE C 3 75  ? 17.290  -27.164 45.542 1.00 25.86 ? 90   ILE C CA  1 
ATOM   2632 C  C   . ILE C 3 75  ? 18.568  -26.691 46.224 1.00 26.64 ? 90   ILE C C   1 
ATOM   2633 O  O   . ILE C 3 75  ? 18.513  -26.168 47.319 1.00 30.22 ? 90   ILE C O   1 
ATOM   2634 C  CB  . ILE C 3 75  ? 16.528  -25.949 45.004 1.00 23.12 ? 90   ILE C CB  1 
ATOM   2635 C  CG1 . ILE C 3 75  ? 15.258  -26.404 44.304 1.00 24.09 ? 90   ILE C CG1 1 
ATOM   2636 C  CG2 . ILE C 3 75  ? 17.336  -25.229 43.977 1.00 17.85 ? 90   ILE C CG2 1 
ATOM   2637 C  CD1 . ILE C 3 75  ? 14.269  -25.304 44.082 1.00 18.23 ? 90   ILE C CD1 1 
ATOM   2638 N  N   . PRO C 3 76  ? 19.725  -26.903 45.590 1.00 28.60 ? 91   PRO C N   1 
ATOM   2639 C  CA  . PRO C 3 76  ? 20.974  -26.519 46.231 1.00 30.39 ? 91   PRO C CA  1 
ATOM   2640 C  C   . PRO C 3 76  ? 21.273  -25.043 46.057 1.00 28.79 ? 91   PRO C C   1 
ATOM   2641 O  O   . PRO C 3 76  ? 20.553  -24.347 45.343 1.00 30.84 ? 91   PRO C O   1 
ATOM   2642 C  CB  . PRO C 3 76  ? 22.025  -27.366 45.484 1.00 27.94 ? 91   PRO C CB  1 
ATOM   2643 C  CG  . PRO C 3 76  ? 21.490  -27.544 44.155 1.00 23.83 ? 91   PRO C CG  1 
ATOM   2644 C  CD  . PRO C 3 76  ? 19.964  -27.519 44.274 1.00 26.33 ? 91   PRO C CD  1 
ATOM   2645 N  N   . GLU C 3 77  ? 22.343  -24.589 46.703 1.00 31.49 ? 92   GLU C N   1 
ATOM   2646 C  CA  . GLU C 3 77  ? 22.785  -23.203 46.617 1.00 32.08 ? 92   GLU C CA  1 
ATOM   2647 C  C   . GLU C 3 77  ? 23.428  -22.944 45.297 1.00 29.93 ? 92   GLU C C   1 
ATOM   2648 O  O   . GLU C 3 77  ? 24.097  -23.822 44.742 1.00 35.13 ? 92   GLU C O   1 
ATOM   2649 C  CB  . GLU C 3 77  ? 23.860  -22.881 47.635 1.00 33.83 ? 92   GLU C CB  1 
ATOM   2650 C  CG  . GLU C 3 77  ? 23.472  -23.062 49.063 1.00 48.77 ? 92   GLU C CG  1 
ATOM   2651 C  CD  . GLU C 3 77  ? 24.666  -22.803 49.986 1.00 56.39 ? 92   GLU C CD  1 
ATOM   2652 O  OE1 . GLU C 3 77  ? 25.644  -22.184 49.501 1.00 52.71 ? 92   GLU C OE1 1 
ATOM   2653 O  OE2 . GLU C 3 77  ? 24.617  -23.206 51.181 1.00 49.89 ? 92   GLU C OE2 1 
ATOM   2654 N  N   . PHE C 3 78  ? 23.249  -21.725 44.808 1.00 29.87 ? 93   PHE C N   1 
ATOM   2655 C  CA  . PHE C 3 78  ? 24.025  -21.247 43.680 1.00 33.95 ? 93   PHE C CA  1 
ATOM   2656 C  C   . PHE C 3 78  ? 25.245  -20.544 44.289 1.00 35.63 ? 93   PHE C C   1 
ATOM   2657 O  O   . PHE C 3 78  ? 25.102  -19.523 44.965 1.00 37.02 ? 93   PHE C O   1 
ATOM   2658 C  CB  . PHE C 3 78  ? 23.191  -20.314 42.806 1.00 30.14 ? 93   PHE C CB  1 
ATOM   2659 C  CG  . PHE C 3 78  ? 23.833  -19.993 41.499 1.00 37.05 ? 93   PHE C CG  1 
ATOM   2660 C  CD1 . PHE C 3 78  ? 23.922  -20.957 40.510 1.00 26.13 ? 93   PHE C CD1 1 
ATOM   2661 C  CD2 . PHE C 3 78  ? 24.362  -18.734 41.254 1.00 29.04 ? 93   PHE C CD2 1 
ATOM   2662 C  CE1 . PHE C 3 78  ? 24.534  -20.670 39.300 1.00 34.02 ? 93   PHE C CE1 1 
ATOM   2663 C  CE2 . PHE C 3 78  ? 24.964  -18.457 40.052 1.00 38.03 ? 93   PHE C CE2 1 
ATOM   2664 C  CZ  . PHE C 3 78  ? 25.047  -19.437 39.069 1.00 33.52 ? 93   PHE C CZ  1 
ATOM   2665 N  N   . PRO C 3 79  ? 26.443  -21.128 44.120 1.00 39.54 ? 94   PRO C N   1 
ATOM   2666 C  CA  . PRO C 3 79  ? 27.590  -20.504 44.796 1.00 39.87 ? 94   PRO C CA  1 
ATOM   2667 C  C   . PRO C 3 79  ? 28.048  -19.272 44.031 1.00 37.08 ? 94   PRO C C   1 
ATOM   2668 O  O   . PRO C 3 79  ? 28.293  -19.379 42.823 1.00 35.12 ? 94   PRO C O   1 
ATOM   2669 C  CB  . PRO C 3 79  ? 28.668  -21.598 44.767 1.00 37.54 ? 94   PRO C CB  1 
ATOM   2670 C  CG  . PRO C 3 79  ? 28.295  -22.481 43.618 1.00 34.82 ? 94   PRO C CG  1 
ATOM   2671 C  CD  . PRO C 3 79  ? 26.824  -22.331 43.354 1.00 33.78 ? 94   PRO C CD  1 
ATOM   2672 N  N   . ILE C 3 80  ? 28.121  -18.130 44.725 1.00 31.59 ? 95   ILE C N   1 
ATOM   2673 C  CA  . ILE C 3 80  ? 28.710  -16.900 44.180 1.00 31.73 ? 95   ILE C CA  1 
ATOM   2674 C  C   . ILE C 3 80  ? 29.799  -16.364 45.121 1.00 31.64 ? 95   ILE C C   1 
ATOM   2675 O  O   . ILE C 3 80  ? 29.569  -16.155 46.329 1.00 33.84 ? 95   ILE C O   1 
ATOM   2676 C  CB  . ILE C 3 80  ? 27.655  -15.784 43.946 1.00 32.28 ? 95   ILE C CB  1 
ATOM   2677 C  CG1 . ILE C 3 80  ? 26.482  -16.301 43.100 1.00 28.62 ? 95   ILE C CG1 1 
ATOM   2678 C  CG2 . ILE C 3 80  ? 28.304  -14.560 43.259 1.00 19.95 ? 95   ILE C CG2 1 
ATOM   2679 C  CD1 . ILE C 3 80  ? 25.222  -15.362 43.137 1.00 28.96 ? 95   ILE C CD1 1 
ATOM   2680 N  N   . ALA C 3 81  ? 30.986  -16.131 44.568 1.00 28.55 ? 96   ALA C N   1 
ATOM   2681 C  CA  . ALA C 3 81  ? 32.089  -15.565 45.357 1.00 29.92 ? 96   ALA C CA  1 
ATOM   2682 C  C   . ALA C 3 81  ? 31.853  -14.056 45.517 1.00 31.51 ? 96   ALA C C   1 
ATOM   2683 O  O   . ALA C 3 81  ? 31.402  -13.414 44.579 1.00 38.97 ? 96   ALA C O   1 
ATOM   2684 C  CB  . ALA C 3 81  ? 33.413  -15.839 44.684 1.00 21.02 ? 96   ALA C CB  1 
ATOM   2685 N  N   . PRO C 3 82  ? 32.152  -13.487 46.700 1.00 28.58 ? 97   PRO C N   1 
ATOM   2686 C  CA  . PRO C 3 82  ? 31.932  -12.044 46.903 1.00 27.20 ? 97   PRO C CA  1 
ATOM   2687 C  C   . PRO C 3 82  ? 32.623  -11.143 45.864 1.00 27.57 ? 97   PRO C C   1 
ATOM   2688 O  O   . PRO C 3 82  ? 32.142  -10.048 45.550 1.00 29.06 ? 97   PRO C O   1 
ATOM   2689 C  CB  . PRO C 3 82  ? 32.498  -11.789 48.313 1.00 28.94 ? 97   PRO C CB  1 
ATOM   2690 C  CG  . PRO C 3 82  ? 32.481  -13.146 49.009 1.00 26.61 ? 97   PRO C CG  1 
ATOM   2691 C  CD  . PRO C 3 82  ? 32.683  -14.159 47.907 1.00 31.28 ? 97   PRO C CD  1 
ATOM   2692 N  N   . GLU C 3 83  ? 33.732  -11.619 45.334 1.00 26.85 ? 98   GLU C N   1 
ATOM   2693 C  CA  . GLU C 3 83  ? 34.578  -10.876 44.405 1.00 30.93 ? 98   GLU C CA  1 
ATOM   2694 C  C   . GLU C 3 83  ? 33.879  -10.555 43.054 1.00 33.02 ? 98   GLU C C   1 
ATOM   2695 O  O   . GLU C 3 83  ? 34.182  -9.543  42.423 1.00 36.13 ? 98   GLU C O   1 
ATOM   2696 C  CB  . GLU C 3 83  ? 35.883  -11.692 44.181 1.00 37.62 ? 98   GLU C CB  1 
ATOM   2697 C  CG  . GLU C 3 83  ? 36.851  -11.837 45.458 1.00 50.04 ? 98   GLU C CG  1 
ATOM   2698 C  CD  . GLU C 3 83  ? 36.406  -12.849 46.617 1.00 60.22 ? 98   GLU C CD  1 
ATOM   2699 O  OE1 . GLU C 3 83  ? 35.442  -13.644 46.470 1.00 46.50 ? 98   GLU C OE1 1 
ATOM   2700 O  OE2 . GLU C 3 83  ? 37.056  -12.850 47.701 1.00 61.88 ? 98   GLU C OE2 1 
ATOM   2701 N  N   . ILE C 3 84  ? 32.944  -11.397 42.605 1.00 33.42 ? 99   ILE C N   1 
ATOM   2702 C  CA  . ILE C 3 84  ? 32.178  -11.101 41.366 1.00 32.06 ? 99   ILE C CA  1 
ATOM   2703 C  C   . ILE C 3 84  ? 30.738  -10.653 41.644 1.00 29.90 ? 99   ILE C C   1 
ATOM   2704 O  O   . ILE C 3 84  ? 29.988  -10.336 40.718 1.00 27.81 ? 99   ILE C O   1 
ATOM   2705 C  CB  . ILE C 3 84  ? 32.114  -12.308 40.383 1.00 28.77 ? 99   ILE C CB  1 
ATOM   2706 C  CG1 . ILE C 3 84  ? 31.486  -13.521 41.052 1.00 30.22 ? 99   ILE C CG1 1 
ATOM   2707 C  CG2 . ILE C 3 84  ? 33.478  -12.681 39.916 1.00 27.89 ? 99   ILE C CG2 1 
ATOM   2708 C  CD1 . ILE C 3 84  ? 30.943  -14.526 40.045 1.00 37.39 ? 99   ILE C CD1 1 
ATOM   2709 N  N   . ALA C 3 85  ? 30.362  -10.609 42.919 1.00 29.16 ? 100  ALA C N   1 
ATOM   2710 C  CA  . ALA C 3 85  ? 28.962  -10.405 43.291 1.00 29.37 ? 100  ALA C CA  1 
ATOM   2711 C  C   . ALA C 3 85  ? 28.348  -9.108  42.724 1.00 28.05 ? 100  ALA C C   1 
ATOM   2712 O  O   . ALA C 3 85  ? 27.245  -9.142  42.191 1.00 35.85 ? 100  ALA C O   1 
ATOM   2713 C  CB  . ALA C 3 85  ? 28.778  -10.507 44.820 1.00 18.08 ? 100  ALA C CB  1 
ATOM   2714 N  N   . LEU C 3 86  ? 29.055  -7.988  42.800 1.00 24.33 ? 101  LEU C N   1 
ATOM   2715 C  CA  . LEU C 3 86  ? 28.492  -6.728  42.332 1.00 23.37 ? 101  LEU C CA  1 
ATOM   2716 C  C   . LEU C 3 86  ? 28.342  -6.655  40.828 1.00 27.57 ? 101  LEU C C   1 
ATOM   2717 O  O   . LEU C 3 86  ? 27.335  -6.128  40.341 1.00 29.19 ? 101  LEU C O   1 
ATOM   2718 C  CB  . LEU C 3 86  ? 29.320  -5.557  42.772 1.00 19.04 ? 101  LEU C CB  1 
ATOM   2719 C  CG  . LEU C 3 86  ? 29.262  -5.217  44.240 1.00 28.98 ? 101  LEU C CG  1 
ATOM   2720 C  CD1 . LEU C 3 86  ? 30.277  -4.083  44.474 1.00 27.89 ? 101  LEU C CD1 1 
ATOM   2721 C  CD2 . LEU C 3 86  ? 27.860  -4.842  44.671 1.00 17.91 ? 101  LEU C CD2 1 
ATOM   2722 N  N   . GLU C 3 87  ? 29.330  -7.130  40.075 1.00 26.72 ? 102  GLU C N   1 
ATOM   2723 C  CA  . GLU C 3 87  ? 29.171  -7.181  38.611 1.00 25.23 ? 102  GLU C CA  1 
ATOM   2724 C  C   . GLU C 3 87  ? 28.043  -8.142  38.243 1.00 28.12 ? 102  GLU C C   1 
ATOM   2725 O  O   . GLU C 3 87  ? 27.288  -7.910  37.290 1.00 27.65 ? 102  GLU C O   1 
ATOM   2726 C  CB  . GLU C 3 87  ? 30.441  -7.667  37.948 1.00 31.07 ? 102  GLU C CB  1 
ATOM   2727 C  CG  . GLU C 3 87  ? 31.604  -6.695  37.961 1.00 31.64 ? 102  GLU C CG  1 
ATOM   2728 C  CD  . GLU C 3 87  ? 32.937  -7.416  37.731 1.00 39.00 ? 102  GLU C CD  1 
ATOM   2729 O  OE1 . GLU C 3 87  ? 33.279  -8.308  38.546 1.00 36.16 ? 102  GLU C OE1 1 
ATOM   2730 O  OE2 . GLU C 3 87  ? 33.631  -7.106  36.732 1.00 36.39 ? 102  GLU C OE2 1 
ATOM   2731 N  N   . LEU C 3 88  ? 27.929  -9.228  39.004 1.00 27.94 ? 103  LEU C N   1 
ATOM   2732 C  CA  . LEU C 3 88  ? 26.912  -10.246 38.708 1.00 31.25 ? 103  LEU C CA  1 
ATOM   2733 C  C   . LEU C 3 88  ? 25.517  -9.719  39.015 1.00 24.25 ? 103  LEU C C   1 
ATOM   2734 O  O   . LEU C 3 88  ? 24.584  -10.054 38.317 1.00 21.32 ? 103  LEU C O   1 
ATOM   2735 C  CB  . LEU C 3 88  ? 27.190  -11.567 39.442 1.00 29.99 ? 103  LEU C CB  1 
ATOM   2736 C  CG  . LEU C 3 88  ? 26.576  -12.856 38.881 1.00 31.69 ? 103  LEU C CG  1 
ATOM   2737 C  CD1 . LEU C 3 88  ? 26.943  -13.102 37.424 1.00 27.21 ? 103  LEU C CD1 1 
ATOM   2738 C  CD2 . LEU C 3 88  ? 27.039  -14.043 39.730 1.00 25.94 ? 103  LEU C CD2 1 
ATOM   2739 N  N   . LEU C 3 89  ? 25.408  -8.878  40.042 1.00 22.37 ? 104  LEU C N   1 
ATOM   2740 C  CA  . LEU C 3 89  ? 24.165  -8.198  40.413 1.00 22.69 ? 104  LEU C CA  1 
ATOM   2741 C  C   . LEU C 3 89  ? 23.646  -7.310  39.273 1.00 24.34 ? 104  LEU C C   1 
ATOM   2742 O  O   . LEU C 3 89  ? 22.476  -7.396  38.885 1.00 26.94 ? 104  LEU C O   1 
ATOM   2743 C  CB  . LEU C 3 89  ? 24.398  -7.345  41.665 1.00 21.04 ? 104  LEU C CB  1 
ATOM   2744 C  CG  . LEU C 3 89  ? 23.219  -6.542  42.213 1.00 24.38 ? 104  LEU C CG  1 
ATOM   2745 C  CD1 . LEU C 3 89  ? 22.110  -7.456  42.726 1.00 17.09 ? 104  LEU C CD1 1 
ATOM   2746 C  CD2 . LEU C 3 89  ? 23.723  -5.657  43.319 1.00 22.37 ? 104  LEU C CD2 1 
ATOM   2747 N  N   . MET C 3 90  ? 24.536  -6.472  38.750 1.00 25.91 ? 105  MET C N   1 
ATOM   2748 C  CA  . MET C 3 90  ? 24.255  -5.589  37.622 1.00 26.37 ? 105  MET C CA  1 
ATOM   2749 C  C   . MET C 3 90  ? 24.017  -6.352  36.290 1.00 25.26 ? 105  MET C C   1 
ATOM   2750 O  O   . MET C 3 90  ? 23.210  -5.938  35.466 1.00 27.47 ? 105  MET C O   1 
ATOM   2751 C  CB  . MET C 3 90  ? 25.428  -4.626  37.415 1.00 29.72 ? 105  MET C CB  1 
ATOM   2752 C  CG  . MET C 3 90  ? 25.799  -3.709  38.581 1.00 27.95 ? 105  MET C CG  1 
ATOM   2753 S  SD  . MET C 3 90  ? 24.378  -2.961  39.357 1.00 38.75 ? 105  MET C SD  1 
ATOM   2754 C  CE  . MET C 3 90  ? 23.749  -1.843  38.052 1.00 13.37 ? 105  MET C CE  1 
ATOM   2755 N  N   . ALA C 3 91  ? 24.703  -7.455  36.059 1.00 25.58 ? 106  ALA C N   1 
ATOM   2756 C  CA  . ALA C 3 91  ? 24.424  -8.209  34.837 1.00 29.06 ? 106  ALA C CA  1 
ATOM   2757 C  C   . ALA C 3 91  ? 23.093  -8.958  34.979 1.00 29.23 ? 106  ALA C C   1 
ATOM   2758 O  O   . ALA C 3 91  ? 22.338  -9.090  34.021 1.00 34.83 ? 106  ALA C O   1 
ATOM   2759 C  CB  . ALA C 3 91  ? 25.550  -9.142  34.513 1.00 23.30 ? 106  ALA C CB  1 
ATOM   2760 N  N   . ALA C 3 92  ? 22.789  -9.420  36.184 1.00 32.93 ? 107  ALA C N   1 
ATOM   2761 C  CA  . ALA C 3 92  ? 21.536  -10.122 36.407 1.00 31.70 ? 107  ALA C CA  1 
ATOM   2762 C  C   . ALA C 3 92  ? 20.440  -9.128  36.209 1.00 28.00 ? 107  ALA C C   1 
ATOM   2763 O  O   . ALA C 3 92  ? 19.501  -9.390  35.483 1.00 34.63 ? 107  ALA C O   1 
ATOM   2764 C  CB  . ALA C 3 92  ? 21.457  -10.742 37.801 1.00 34.54 ? 107  ALA C CB  1 
ATOM   2765 N  N   . ASN C 3 93  ? 20.569  -7.970  36.827 1.00 28.91 ? 108  ASN C N   1 
ATOM   2766 C  CA  . ASN C 3 93  ? 19.562  -6.930  36.634 1.00 28.24 ? 108  ASN C CA  1 
ATOM   2767 C  C   . ASN C 3 93  ? 19.408  -6.480  35.189 1.00 27.87 ? 108  ASN C C   1 
ATOM   2768 O  O   . ASN C 3 93  ? 18.291  -6.267  34.724 1.00 31.54 ? 108  ASN C O   1 
ATOM   2769 C  CB  . ASN C 3 93  ? 19.878  -5.708  37.467 1.00 26.44 ? 108  ASN C CB  1 
ATOM   2770 C  CG  . ASN C 3 93  ? 18.875  -4.609  37.254 1.00 25.99 ? 108  ASN C CG  1 
ATOM   2771 O  OD1 . ASN C 3 93  ? 19.211  -3.531  36.779 1.00 22.74 ? 108  ASN C OD1 1 
ATOM   2772 N  ND2 . ASN C 3 93  ? 17.629  -4.885  37.588 1.00 23.74 ? 108  ASN C ND2 1 
ATOM   2773 N  N   . PHE C 3 94  ? 20.527  -6.328  34.486 1.00 28.83 ? 109  PHE C N   1 
ATOM   2774 C  CA  . PHE C 3 94  ? 20.496  -5.963  33.066 1.00 29.78 ? 109  PHE C CA  1 
ATOM   2775 C  C   . PHE C 3 94  ? 19.902  -7.075  32.188 1.00 27.78 ? 109  PHE C C   1 
ATOM   2776 O  O   . PHE C 3 94  ? 19.200  -6.782  31.225 1.00 21.82 ? 109  PHE C O   1 
ATOM   2777 C  CB  . PHE C 3 94  ? 21.900  -5.607  32.564 1.00 31.15 ? 109  PHE C CB  1 
ATOM   2778 C  CG  . PHE C 3 94  ? 21.980  -5.415  31.078 1.00 30.38 ? 109  PHE C CG  1 
ATOM   2779 C  CD1 . PHE C 3 94  ? 21.726  -4.177  30.511 1.00 43.01 ? 109  PHE C CD1 1 
ATOM   2780 C  CD2 . PHE C 3 94  ? 22.305  -6.473  30.246 1.00 27.14 ? 109  PHE C CD2 1 
ATOM   2781 C  CE1 . PHE C 3 94  ? 21.801  -3.991  29.118 1.00 45.27 ? 109  PHE C CE1 1 
ATOM   2782 C  CE2 . PHE C 3 94  ? 22.377  -6.310  28.869 1.00 37.84 ? 109  PHE C CE2 1 
ATOM   2783 C  CZ  . PHE C 3 94  ? 22.128  -5.068  28.301 1.00 43.92 ? 109  PHE C CZ  1 
ATOM   2784 N  N   . LEU C 3 95  ? 20.219  -8.336  32.495 1.00 28.63 ? 110  LEU C N   1 
ATOM   2785 C  CA  . LEU C 3 95  ? 19.660  -9.476  31.751 1.00 28.31 ? 110  LEU C CA  1 
ATOM   2786 C  C   . LEU C 3 95  ? 18.230  -9.886  32.157 1.00 26.87 ? 110  LEU C C   1 
ATOM   2787 O  O   . LEU C 3 95  ? 17.628  -10.689 31.463 1.00 24.67 ? 110  LEU C O   1 
ATOM   2788 C  CB  . LEU C 3 95  ? 20.594  -10.686 31.840 1.00 29.91 ? 110  LEU C CB  1 
ATOM   2789 C  CG  . LEU C 3 95  ? 21.948  -10.533 31.132 1.00 33.03 ? 110  LEU C CG  1 
ATOM   2790 C  CD1 . LEU C 3 95  ? 22.894  -11.684 31.458 1.00 27.28 ? 110  LEU C CD1 1 
ATOM   2791 C  CD2 . LEU C 3 95  ? 21.752  -10.412 29.636 1.00 32.26 ? 110  LEU C CD2 1 
ATOM   2792 N  N   . ASP C 3 96  ? 17.691  -9.339  33.249 1.00 34.63 ? 111  ASP C N   1 
ATOM   2793 C  CA  . ASP C 3 96  ? 16.308  -9.632  33.718 1.00 38.37 ? 111  ASP C CA  1 
ATOM   2794 C  C   . ASP C 3 96  ? 16.179  -11.120 34.010 1.00 39.46 ? 111  ASP C C   1 
ATOM   2795 O  O   . ASP C 3 96  ? 15.408  -11.861 33.376 1.00 39.10 ? 111  ASP C O   1 
ATOM   2796 C  CB  . ASP C 3 96  ? 15.249  -9.134  32.702 1.00 43.26 ? 111  ASP C CB  1 
ATOM   2797 C  CG  . ASP C 3 96  ? 13.780  -9.335  33.163 1.00 45.62 ? 111  ASP C CG  1 
ATOM   2798 O  OD1 . ASP C 3 96  ? 13.513  -9.458  34.375 1.00 44.25 ? 111  ASP C OD1 1 
ATOM   2799 O  OD2 . ASP C 3 96  ? 12.884  -9.350  32.280 1.00 44.75 ? 111  ASP C OD2 1 
ATOM   2800 N  N   . CYS C 3 97  ? 16.976  -11.553 34.972 1.00 42.40 ? 112  CYS C N   1 
ATOM   2801 C  CA  . CYS C 3 97  ? 16.880  -12.905 35.486 1.00 41.95 ? 112  CYS C CA  1 
ATOM   2802 C  C   . CYS C 3 97  ? 17.483  -13.062 36.901 1.00 42.42 ? 112  CYS C C   1 
ATOM   2803 O  O   . CYS C 3 97  ? 17.986  -12.111 37.541 1.00 28.56 ? 112  CYS C O   1 
ATOM   2804 C  CB  . CYS C 3 97  ? 17.590  -13.814 34.532 1.00 38.79 ? 112  CYS C CB  1 
ATOM   2805 S  SG  . CYS C 3 97  ? 19.310  -13.519 34.645 1.00 47.36 ? 112  CYS C SG  1 
ATOM   2806 O  OXT . CYS C 3 97  ? 17.455  -14.191 37.430 1.00 43.59 ? 112  CYS C OXT 1 
HETATM 2807 NA NA  . NA  D 4 .   ? 6.817   -6.904  54.255 1.00 33.37 ? 1430 NA  A NA  1 
HETATM 2808 C  C1  . EDO E 5 .   ? 9.505   -7.506  51.356 1.00 33.16 ? 1431 EDO A C1  1 
HETATM 2809 O  O1  . EDO E 5 .   ? 8.975   -8.545  50.478 1.00 26.42 ? 1431 EDO A O1  1 
HETATM 2810 C  C2  . EDO E 5 .   ? 9.812   -7.966  52.789 1.00 24.29 ? 1431 EDO A C2  1 
HETATM 2811 O  O2  . EDO E 5 .   ? 8.633   -8.445  53.486 1.00 23.06 ? 1431 EDO A O2  1 
HETATM 2812 CL CL  . CL  F 6 .   ? 12.609  -13.145 47.182 1.00 53.72 ? 1432 CL  A CL  1 
HETATM 2813 O  O   . HOH G 7 .   ? 23.025  1.195   60.020 1.00 29.29 ? 2001 HOH A O   1 
HETATM 2814 O  O   . HOH G 7 .   ? 23.607  -3.670  59.286 1.00 2.00  ? 2002 HOH A O   1 
HETATM 2815 O  O   . HOH G 7 .   ? 22.500  -9.775  56.085 1.00 27.29 ? 2003 HOH A O   1 
HETATM 2816 O  O   . HOH G 7 .   ? 23.553  -15.519 57.239 1.00 26.38 ? 2004 HOH A O   1 
HETATM 2817 O  O   . HOH G 7 .   ? 15.228  -12.884 51.249 1.00 20.46 ? 2005 HOH A O   1 
HETATM 2818 O  O   . HOH G 7 .   ? 14.112  -26.065 56.598 1.00 34.08 ? 2006 HOH A O   1 
HETATM 2819 O  O   . HOH G 7 .   ? 7.718   -16.872 46.219 1.00 33.42 ? 2007 HOH A O   1 
HETATM 2820 O  O   . HOH G 7 .   ? 9.535   -15.126 45.039 1.00 29.58 ? 2008 HOH A O   1 
HETATM 2821 O  O   . HOH G 7 .   ? 2.625   -11.977 46.708 1.00 29.81 ? 2009 HOH A O   1 
HETATM 2822 O  O   . HOH G 7 .   ? 1.305   -14.502 46.808 1.00 13.91 ? 2010 HOH A O   1 
HETATM 2823 O  O   . HOH G 7 .   ? 2.987   -10.821 48.993 1.00 26.09 ? 2011 HOH A O   1 
HETATM 2824 O  O   . HOH G 7 .   ? -1.213  -11.433 52.876 1.00 6.60  ? 2012 HOH A O   1 
HETATM 2825 O  O   . HOH G 7 .   ? -6.202  -19.674 49.434 1.00 26.82 ? 2013 HOH A O   1 
HETATM 2826 O  O   . HOH G 7 .   ? -3.181  -17.787 46.084 1.00 20.82 ? 2014 HOH A O   1 
HETATM 2827 O  O   . HOH G 7 .   ? -4.152  -30.690 59.835 1.00 27.92 ? 2015 HOH A O   1 
HETATM 2828 O  O   . HOH G 7 .   ? 3.285   -31.632 49.772 1.00 34.16 ? 2016 HOH A O   1 
HETATM 2829 O  O   . HOH G 7 .   ? -2.041  -33.887 61.658 1.00 26.31 ? 2017 HOH A O   1 
HETATM 2830 O  O   . HOH G 7 .   ? 3.901   -32.946 57.487 1.00 27.46 ? 2018 HOH A O   1 
HETATM 2831 O  O   . HOH G 7 .   ? 5.225   -11.370 50.855 1.00 21.53 ? 2019 HOH A O   1 
HETATM 2832 O  O   . HOH G 7 .   ? 6.230   -9.063  51.154 1.00 18.21 ? 2020 HOH A O   1 
HETATM 2833 O  O   . HOH G 7 .   ? 1.282   -11.546 54.213 1.00 17.73 ? 2021 HOH A O   1 
HETATM 2834 O  O   . HOH G 7 .   ? 5.815   -5.452  52.362 1.00 32.19 ? 2022 HOH A O   1 
HETATM 2835 O  O   . HOH G 7 .   ? 8.347   -5.140  54.844 1.00 17.47 ? 2023 HOH A O   1 
HETATM 2836 O  O   . HOH G 7 .   ? 10.842  -7.698  60.809 0.50 2.00  ? 2024 HOH A O   1 
HETATM 2837 O  O   . HOH G 7 .   ? 1.328   -12.340 57.834 1.00 16.22 ? 2025 HOH A O   1 
HETATM 2838 O  O   . HOH G 7 .   ? -3.560  -29.727 62.213 1.00 13.24 ? 2026 HOH A O   1 
HETATM 2839 O  O   . HOH G 7 .   ? -5.268  -23.666 53.946 1.00 20.06 ? 2027 HOH A O   1 
HETATM 2840 O  O   . HOH G 7 .   ? 10.617  -9.872  60.480 0.50 2.00  ? 2028 HOH A O   1 
HETATM 2841 O  O   . HOH G 7 .   ? 8.728   -5.619  64.688 1.00 25.85 ? 2029 HOH A O   1 
HETATM 2842 O  O   . HOH G 7 .   ? 14.554  -1.982  68.375 1.00 5.77  ? 2030 HOH A O   1 
HETATM 2843 O  O   . HOH G 7 .   ? 10.140  -11.643 73.021 1.00 39.24 ? 2031 HOH A O   1 
HETATM 2844 O  O   . HOH G 7 .   ? 6.703   -5.061  67.935 1.00 38.93 ? 2032 HOH A O   1 
HETATM 2845 O  O   . HOH G 7 .   ? 8.836   -16.020 69.850 1.00 35.05 ? 2033 HOH A O   1 
HETATM 2846 O  O   . HOH G 7 .   ? 18.008  -17.232 71.653 1.00 29.36 ? 2034 HOH A O   1 
HETATM 2847 O  O   . HOH G 7 .   ? 14.954  -15.785 75.074 1.00 23.50 ? 2035 HOH A O   1 
HETATM 2848 O  O   . HOH G 7 .   ? 18.776  -18.584 69.431 1.00 31.14 ? 2036 HOH A O   1 
HETATM 2849 O  O   . HOH G 7 .   ? 20.505  -10.215 66.350 1.00 40.60 ? 2037 HOH A O   1 
HETATM 2850 O  O   . HOH G 7 .   ? 23.147  -15.824 66.448 1.00 43.19 ? 2038 HOH A O   1 
HETATM 2851 O  O   . HOH G 7 .   ? 22.031  -19.729 63.582 1.00 40.04 ? 2039 HOH A O   1 
HETATM 2852 O  O   . HOH G 7 .   ? 11.545  -24.745 63.119 1.00 30.11 ? 2040 HOH A O   1 
HETATM 2853 O  O   . HOH G 7 .   ? 13.152  -26.646 59.289 1.00 27.22 ? 2041 HOH A O   1 
HETATM 2854 O  O   . HOH G 7 .   ? 0.272   -26.310 76.075 1.00 37.16 ? 2042 HOH A O   1 
HETATM 2855 O  O   . HOH G 7 .   ? 7.474   -28.824 48.639 1.00 21.55 ? 2043 HOH A O   1 
HETATM 2856 O  O   . HOH G 7 .   ? 14.511  -26.236 47.981 1.00 17.57 ? 2044 HOH A O   1 
HETATM 2857 O  O   . HOH G 7 .   ? 7.531   -25.027 41.603 1.00 29.21 ? 2045 HOH A O   1 
HETATM 2858 O  O   . HOH G 7 .   ? 13.414  -14.225 43.110 1.00 14.05 ? 2046 HOH A O   1 
HETATM 2859 O  O   . HOH G 7 .   ? 16.145  -4.228  40.404 1.00 24.28 ? 2047 HOH A O   1 
HETATM 2860 O  O   . HOH G 7 .   ? 16.369  -9.825  37.971 1.00 34.45 ? 2048 HOH A O   1 
HETATM 2861 O  O   . HOH G 7 .   ? 28.822  -13.573 51.402 1.00 29.96 ? 2049 HOH A O   1 
HETATM 2862 O  O   . HOH G 7 .   ? 23.664  -12.626 55.872 1.00 22.75 ? 2050 HOH A O   1 
HETATM 2863 O  O   . HOH G 7 .   ? 4.965   -27.768 48.325 1.00 18.05 ? 2051 HOH A O   1 
HETATM 2864 O  O   . HOH G 7 .   ? 22.446  4.486   54.765 1.00 25.71 ? 2052 HOH A O   1 
HETATM 2865 O  O   . HOH G 7 .   ? 19.061  4.366   47.021 1.00 20.80 ? 2053 HOH A O   1 
HETATM 2866 O  O   . HOH G 7 .   ? 22.808  6.613   40.813 1.00 33.52 ? 2054 HOH A O   1 
HETATM 2867 O  O   . HOH G 7 .   ? 19.626  4.570   39.764 1.00 33.65 ? 2055 HOH A O   1 
HETATM 2868 O  O   . HOH G 7 .   ? 13.432  -2.797  44.474 0.50 2.00  ? 2056 HOH A O   1 
HETATM 2869 O  O   . HOH G 7 .   ? 14.040  -1.748  49.003 1.00 36.15 ? 2057 HOH A O   1 
HETATM 2870 O  O   . HOH G 7 .   ? 14.297  -9.585  42.784 1.00 23.75 ? 2058 HOH A O   1 
HETATM 2871 O  O   . HOH G 7 .   ? 18.395  -6.796  51.427 1.00 18.15 ? 2059 HOH A O   1 
HETATM 2872 O  O   . HOH G 7 .   ? 11.700  -3.358  53.611 1.00 27.80 ? 2060 HOH A O   1 
HETATM 2873 O  O   . HOH G 7 .   ? 12.010  -8.427  46.888 1.00 34.80 ? 2061 HOH A O   1 
HETATM 2874 O  O   . HOH G 7 .   ? 13.545  -3.592  46.532 0.50 3.95  ? 2062 HOH A O   1 
HETATM 2875 O  O   . HOH G 7 .   ? 11.195  -2.865  57.746 1.00 34.80 ? 2063 HOH A O   1 
HETATM 2876 O  O   . HOH G 7 .   ? 11.400  -3.406  61.812 1.00 10.66 ? 2064 HOH A O   1 
HETATM 2877 O  O   . HOH H 7 .   ? 18.947  -32.473 33.909 1.00 41.43 ? 2001 HOH B O   1 
HETATM 2878 O  O   . HOH H 7 .   ? 26.541  -27.137 31.826 1.00 23.24 ? 2002 HOH B O   1 
HETATM 2879 O  O   . HOH H 7 .   ? 37.491  -21.158 26.703 1.00 32.57 ? 2003 HOH B O   1 
HETATM 2880 O  O   . HOH H 7 .   ? 37.802  -19.172 20.116 1.00 31.86 ? 2004 HOH B O   1 
HETATM 2881 O  O   . HOH H 7 .   ? 34.867  -19.146 26.008 1.00 30.26 ? 2005 HOH B O   1 
HETATM 2882 O  O   . HOH H 7 .   ? 23.633  -25.120 27.766 1.00 25.42 ? 2006 HOH B O   1 
HETATM 2883 O  O   . HOH H 7 .   ? 24.299  -27.489 30.192 1.00 31.05 ? 2007 HOH B O   1 
HETATM 2884 O  O   . HOH H 7 .   ? 23.098  -42.336 33.281 1.00 21.29 ? 2008 HOH B O   1 
HETATM 2885 O  O   . HOH H 7 .   ? 28.500  -38.197 26.137 1.00 38.23 ? 2009 HOH B O   1 
HETATM 2886 O  O   . HOH H 7 .   ? 26.611  -45.214 26.147 1.00 38.68 ? 2010 HOH B O   1 
HETATM 2887 O  O   . HOH H 7 .   ? 25.189  -31.063 18.985 1.00 29.59 ? 2011 HOH B O   1 
HETATM 2888 O  O   . HOH H 7 .   ? 37.852  -25.669 13.564 1.00 29.17 ? 2012 HOH B O   1 
HETATM 2889 O  O   . HOH H 7 .   ? 41.310  -29.613 30.116 1.00 36.07 ? 2013 HOH B O   1 
HETATM 2890 O  O   . HOH H 7 .   ? 47.154  -36.539 28.210 1.00 20.07 ? 2014 HOH B O   1 
HETATM 2891 O  O   . HOH H 7 .   ? 42.363  -41.054 29.996 1.00 18.11 ? 2015 HOH B O   1 
HETATM 2892 O  O   . HOH H 7 .   ? 40.098  -41.507 30.170 1.00 32.92 ? 2016 HOH B O   1 
HETATM 2893 O  O   . HOH H 7 .   ? 29.603  -44.814 34.790 1.00 30.78 ? 2017 HOH B O   1 
HETATM 2894 O  O   . HOH H 7 .   ? 26.022  -25.223 33.599 1.00 17.98 ? 2018 HOH B O   1 
HETATM 2895 O  O   . HOH H 7 .   ? 30.684  -29.309 40.589 1.00 41.21 ? 2019 HOH B O   1 
HETATM 2896 O  O   . HOH H 7 .   ? 32.056  -25.354 37.600 1.00 35.32 ? 2020 HOH B O   1 
HETATM 2897 O  O   . HOH H 7 .   ? 37.299  -31.227 35.341 1.00 33.41 ? 2021 HOH B O   1 
HETATM 2898 O  O   . HOH H 7 .   ? 34.788  -26.095 35.748 1.00 22.95 ? 2022 HOH B O   1 
HETATM 2899 O  O   . HOH H 7 .   ? 39.339  -30.152 32.327 1.00 32.73 ? 2023 HOH B O   1 
HETATM 2900 O  O   . HOH H 7 .   ? 42.990  -26.576 22.401 1.00 27.60 ? 2024 HOH B O   1 
HETATM 2901 O  O   . HOH H 7 .   ? 50.464  -29.146 16.307 1.00 37.73 ? 2025 HOH B O   1 
HETATM 2902 O  O   . HOH H 7 .   ? 46.429  -31.908 21.469 1.00 25.12 ? 2026 HOH B O   1 
HETATM 2903 O  O   . HOH H 7 .   ? 49.713  -25.658 18.595 1.00 32.90 ? 2027 HOH B O   1 
HETATM 2904 O  O   . HOH H 7 .   ? 43.841  -18.852 23.719 1.00 30.68 ? 2028 HOH B O   1 
HETATM 2905 O  O   . HOH H 7 .   ? 39.505  -19.276 33.630 1.00 20.06 ? 2029 HOH B O   1 
HETATM 2906 O  O   . HOH H 7 .   ? 18.132  -30.175 33.471 1.00 31.87 ? 2030 HOH B O   1 
HETATM 2907 O  O   . HOH H 7 .   ? 23.859  -28.993 17.730 1.00 39.54 ? 2031 HOH B O   1 
HETATM 2908 O  O   . HOH I 7 .   ? 32.989  -5.492  30.319 1.00 31.41 ? 2001 HOH C O   1 
HETATM 2909 O  O   . HOH I 7 .   ? 34.694  -13.678 19.831 1.00 34.38 ? 2002 HOH C O   1 
HETATM 2910 O  O   . HOH I 7 .   ? 33.891  -3.251  28.254 1.00 37.10 ? 2003 HOH C O   1 
HETATM 2911 O  O   . HOH I 7 .   ? 26.458  -5.591  27.652 1.00 21.69 ? 2004 HOH C O   1 
HETATM 2912 O  O   . HOH I 7 .   ? 30.051  -22.189 40.404 1.00 25.65 ? 2005 HOH C O   1 
HETATM 2913 O  O   . HOH I 7 .   ? 31.635  -17.233 41.912 1.00 20.77 ? 2006 HOH C O   1 
HETATM 2914 O  O   . HOH I 7 .   ? 17.591  -20.568 44.703 1.00 27.04 ? 2007 HOH C O   1 
HETATM 2915 O  O   . HOH I 7 .   ? 23.479  -29.650 42.249 1.00 30.69 ? 2008 HOH C O   1 
HETATM 2916 O  O   . HOH I 7 .   ? 6.218   -28.825 39.950 0.50 6.68  ? 2009 HOH C O   1 
HETATM 2917 O  O   . HOH I 7 .   ? 6.403   -27.022 41.030 0.50 4.69  ? 2010 HOH C O   1 
HETATM 2918 O  O   . HOH I 7 .   ? 13.103  -35.922 46.123 1.00 32.22 ? 2011 HOH C O   1 
HETATM 2919 O  O   . HOH I 7 .   ? 16.433  -24.567 48.895 1.00 20.77 ? 2012 HOH C O   1 
HETATM 2920 O  O   . HOH I 7 .   ? 25.441  -25.985 45.386 1.00 29.89 ? 2013 HOH C O   1 
HETATM 2921 O  O   . HOH I 7 .   ? 23.341  -26.583 48.551 1.00 22.27 ? 2014 HOH C O   1 
HETATM 2922 O  O   . HOH I 7 .   ? 24.930  -18.599 47.428 1.00 19.45 ? 2015 HOH C O   1 
HETATM 2923 O  O   . HOH I 7 .   ? 32.119  -5.710  34.892 1.00 30.90 ? 2016 HOH C O   1 
HETATM 2924 O  O   . HOH I 7 .   ? 32.358  -7.585  41.012 1.00 22.59 ? 2017 HOH C O   1 
HETATM 2925 O  O   . HOH I 7 .   ? 15.499  -15.691 36.765 1.00 28.64 ? 2018 HOH C O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'ASN A  267  C-ALPHA IS PLANAR' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   251 ?   ?   ?   A . n 
A 1 2   HIS 2   252 ?   ?   ?   A . n 
A 1 3   HIS 3   253 ?   ?   ?   A . n 
A 1 4   HIS 4   254 ?   ?   ?   A . n 
A 1 5   HIS 5   255 ?   ?   ?   A . n 
A 1 6   HIS 6   256 ?   ?   ?   A . n 
A 1 7   HIS 7   257 ?   ?   ?   A . n 
A 1 8   SER 8   258 ?   ?   ?   A . n 
A 1 9   SER 9   259 ?   ?   ?   A . n 
A 1 10  GLY 10  260 ?   ?   ?   A . n 
A 1 11  VAL 11  261 ?   ?   ?   A . n 
A 1 12  ASP 12  262 ?   ?   ?   A . n 
A 1 13  LEU 13  263 ?   ?   ?   A . n 
A 1 14  GLY 14  264 ?   ?   ?   A . n 
A 1 15  THR 15  265 ?   ?   ?   A . n 
A 1 16  GLU 16  266 ?   ?   ?   A . n 
A 1 17  ASN 17  267 267 ASN ASN A . n 
A 1 18  LEU 18  268 268 LEU LEU A . n 
A 1 19  TYR 19  269 269 TYR TYR A . n 
A 1 20  PHE 20  270 270 PHE PHE A . n 
A 1 21  GLN 21  271 271 GLN GLN A . n 
A 1 22  SER 22  272 272 SER SER A . n 
A 1 23  MET 23  273 273 MET MET A . n 
A 1 24  LEU 24  274 274 LEU LEU A . n 
A 1 25  VAL 25  275 275 VAL VAL A . n 
A 1 26  PRO 26  276 276 PRO PRO A . n 
A 1 27  ASP 27  277 277 ASP ASP A . n 
A 1 28  LEU 28  278 278 LEU LEU A . n 
A 1 29  LEU 29  279 279 LEU LEU A . n 
A 1 30  GLN 30  280 280 GLN GLN A . n 
A 1 31  ILE 31  281 281 ILE ILE A . n 
A 1 32  ASN 32  282 282 ASN ASN A . n 
A 1 33  ASN 33  283 283 ASN ASN A . n 
A 1 34  ASN 34  284 284 ASN ASN A . n 
A 1 35  PRO 35  285 285 PRO PRO A . n 
A 1 36  CYS 36  286 286 CYS CYS A . n 
A 1 37  TYR 37  287 287 TYR TYR A . n 
A 1 38  TRP 38  288 288 TRP TRP A . n 
A 1 39  GLY 39  289 289 GLY GLY A . n 
A 1 40  VAL 40  290 290 VAL VAL A . n 
A 1 41  MET 41  291 291 MET MET A . n 
A 1 42  ASP 42  292 292 ASP ASP A . n 
A 1 43  LYS 43  293 293 LYS LYS A . n 
A 1 44  TYR 44  294 294 TYR TYR A . n 
A 1 45  ALA 45  295 295 ALA ALA A . n 
A 1 46  ALA 46  296 296 ALA ALA A . n 
A 1 47  GLU 47  297 297 GLU GLU A . n 
A 1 48  ALA 48  298 298 ALA ALA A . n 
A 1 49  LEU 49  299 299 LEU LEU A . n 
A 1 50  LEU 50  300 300 LEU LEU A . n 
A 1 51  GLU 51  301 301 GLU GLU A . n 
A 1 52  GLY 52  302 302 GLY GLY A . n 
A 1 53  LYS 53  303 303 LYS LYS A . n 
A 1 54  PRO 54  304 304 PRO PRO A . n 
A 1 55  GLU 55  305 305 GLU GLU A . n 
A 1 56  GLY 56  306 306 GLY GLY A . n 
A 1 57  THR 57  307 307 THR THR A . n 
A 1 58  PHE 58  308 308 PHE PHE A . n 
A 1 59  LEU 59  309 309 LEU LEU A . n 
A 1 60  LEU 60  310 310 LEU LEU A . n 
A 1 61  ARG 61  311 311 ARG ARG A . n 
A 1 62  ASP 62  312 312 ASP ASP A . n 
A 1 63  SER 63  313 313 SER SER A . n 
A 1 64  ALA 64  314 314 ALA ALA A . n 
A 1 65  GLN 65  315 315 GLN GLN A . n 
A 1 66  GLU 66  316 316 GLU GLU A . n 
A 1 67  ASP 67  317 317 ASP ASP A . n 
A 1 68  TYR 68  318 318 TYR TYR A . n 
A 1 69  LEU 69  319 319 LEU LEU A . n 
A 1 70  PHE 70  320 320 PHE PHE A . n 
A 1 71  SER 71  321 321 SER SER A . n 
A 1 72  VAL 72  322 322 VAL VAL A . n 
A 1 73  SER 73  323 323 SER SER A . n 
A 1 74  PHE 74  324 324 PHE PHE A . n 
A 1 75  ARG 75  325 325 ARG ARG A . n 
A 1 76  ARG 76  326 326 ARG ARG A . n 
A 1 77  TYR 77  327 327 TYR TYR A . n 
A 1 78  SER 78  328 328 SER SER A . n 
A 1 79  ARG 79  329 329 ARG ARG A . n 
A 1 80  SER 80  330 330 SER SER A . n 
A 1 81  LEU 81  331 331 LEU LEU A . n 
A 1 82  HIS 82  332 332 HIS HIS A . n 
A 1 83  ALA 83  333 333 ALA ALA A . n 
A 1 84  ARG 84  334 334 ARG ARG A . n 
A 1 85  ILE 85  335 335 ILE ILE A . n 
A 1 86  GLU 86  336 336 GLU GLU A . n 
A 1 87  GLN 87  337 337 GLN GLN A . n 
A 1 88  TRP 88  338 338 TRP TRP A . n 
A 1 89  ASN 89  339 339 ASN ASN A . n 
A 1 90  HIS 90  340 340 HIS HIS A . n 
A 1 91  ASN 91  341 341 ASN ASN A . n 
A 1 92  PHE 92  342 342 PHE PHE A . n 
A 1 93  SER 93  343 343 SER SER A . n 
A 1 94  PHE 94  344 344 PHE PHE A . n 
A 1 95  ASP 95  345 345 ASP ASP A . n 
A 1 96  ALA 96  346 346 ALA ALA A . n 
A 1 97  HIS 97  347 347 HIS HIS A . n 
A 1 98  ASP 98  348 348 ASP ASP A . n 
A 1 99  PRO 99  349 349 PRO PRO A . n 
A 1 100 CYS 100 350 350 CYS CYS A . n 
A 1 101 VAL 101 351 351 VAL VAL A . n 
A 1 102 PHE 102 352 352 PHE PHE A . n 
A 1 103 HIS 103 353 353 HIS HIS A . n 
A 1 104 SER 104 354 354 SER SER A . n 
A 1 105 PRO 105 355 355 PRO PRO A . n 
A 1 106 ASP 106 356 356 ASP ASP A . n 
A 1 107 ILE 107 357 357 ILE ILE A . n 
A 1 108 THR 108 358 358 THR THR A . n 
A 1 109 GLY 109 359 359 GLY GLY A . n 
A 1 110 LEU 110 360 360 LEU LEU A . n 
A 1 111 LEU 111 361 361 LEU LEU A . n 
A 1 112 GLU 112 362 362 GLU GLU A . n 
A 1 113 HIS 113 363 363 HIS HIS A . n 
A 1 114 TYR 114 364 364 TYR TYR A . n 
A 1 115 LYS 115 365 365 LYS LYS A . n 
A 1 116 ASP 116 366 366 ASP ASP A . n 
A 1 117 PRO 117 367 367 PRO PRO A . n 
A 1 118 SER 118 368 368 SER SER A . n 
A 1 119 ALA 119 369 369 ALA ALA A . n 
A 1 120 CYS 120 370 370 CYS CYS A . n 
A 1 121 MET 121 371 371 MET MET A . n 
A 1 122 PHE 122 372 372 PHE PHE A . n 
A 1 123 PHE 123 373 373 PHE PHE A . n 
A 1 124 GLU 124 374 374 GLU GLU A . n 
A 1 125 PRO 125 375 375 PRO PRO A . n 
A 1 126 LEU 126 376 376 LEU LEU A . n 
A 1 127 LEU 127 377 377 LEU LEU A . n 
A 1 128 SER 128 378 378 SER SER A . n 
A 1 129 THR 129 379 379 THR THR A . n 
A 1 130 PRO 130 380 380 PRO PRO A . n 
A 1 131 LEU 131 381 381 LEU LEU A . n 
A 1 132 ILE 132 382 382 ILE ILE A . n 
A 1 133 ARG 133 383 383 ARG ARG A . n 
A 1 134 THR 134 384 384 THR THR A . n 
A 1 135 PHE 135 385 385 PHE PHE A . n 
A 1 136 PRO 136 386 386 PRO PRO A . n 
A 1 137 PHE 137 387 387 PHE PHE A . n 
A 1 138 SER 138 388 388 SER SER A . n 
A 1 139 LEU 139 389 389 LEU LEU A . n 
A 1 140 GLN 140 390 390 GLN GLN A . n 
A 1 141 HIS 141 391 391 HIS HIS A . n 
A 1 142 ILE 142 392 392 ILE ILE A . n 
A 1 143 CYS 143 393 393 CYS CYS A . n 
A 1 144 ARG 144 394 394 ARG ARG A . n 
A 1 145 THR 145 395 395 THR THR A . n 
A 1 146 VAL 146 396 396 VAL VAL A . n 
A 1 147 ILE 147 397 397 ILE ILE A . n 
A 1 148 CYS 148 398 398 CYS CYS A . n 
A 1 149 ASN 149 399 399 ASN ASN A . n 
A 1 150 CYS 150 400 400 CYS CYS A . n 
A 1 151 THR 151 401 401 THR THR A . n 
A 1 152 THR 152 402 402 THR THR A . n 
A 1 153 TYR 153 403 403 TYR TYR A . n 
A 1 154 ASP 154 404 404 ASP ASP A . n 
A 1 155 GLY 155 405 405 GLY GLY A . n 
A 1 156 ILE 156 406 406 ILE ILE A . n 
A 1 157 ASP 157 407 407 ASP ASP A . n 
A 1 158 ALA 158 408 408 ALA ALA A . n 
A 1 159 LEU 159 409 409 LEU LEU A . n 
A 1 160 PRO 160 410 410 PRO PRO A . n 
A 1 161 ILE 161 411 411 ILE ILE A . n 
A 1 162 PRO 162 412 412 PRO PRO A . n 
A 1 163 SER 163 413 413 SER SER A . n 
A 1 164 SER 164 414 414 SER SER A . n 
A 1 165 MET 165 415 415 MET MET A . n 
A 1 166 LYS 166 416 416 LYS LYS A . n 
A 1 167 LEU 167 417 417 LEU LEU A . n 
A 1 168 TYR 168 418 418 TYR TYR A . n 
A 1 169 LEU 169 419 419 LEU LEU A . n 
A 1 170 LYS 170 420 420 LYS LYS A . n 
A 1 171 GLU 171 421 421 GLU GLU A . n 
A 1 172 TYR 172 422 422 TYR TYR A . n 
A 1 173 HIS 173 423 423 HIS HIS A . n 
A 1 174 TYR 174 424 424 TYR TYR A . n 
A 1 175 LYS 175 425 425 LYS LYS A . n 
A 1 176 SER 176 426 426 SER SER A . n 
A 1 177 LYS 177 427 427 LYS LYS A . n 
A 1 178 VAL 178 428 428 VAL VAL A . n 
A 1 179 ARG 179 429 429 ARG ARG A . n 
A 1 180 VAL 180 430 ?   ?   ?   A . n 
A 1 181 LEU 181 431 ?   ?   ?   A . n 
A 1 182 ARG 182 432 ?   ?   ?   A . n 
A 1 183 ILE 183 433 ?   ?   ?   A . n 
A 1 184 ASP 184 434 ?   ?   ?   A . n 
A 1 185 ALA 185 435 ?   ?   ?   A . n 
A 1 186 PRO 186 436 ?   ?   ?   A . n 
A 1 187 GLU 187 437 ?   ?   ?   A . n 
B 2 1   MET 1   1   1   MET MET B . n 
B 2 2   ASP 2   2   2   ASP ASP B . n 
B 2 3   VAL 3   3   3   VAL VAL B . n 
B 2 4   PHE 4   4   4   PHE PHE B . n 
B 2 5   LEU 5   5   5   LEU LEU B . n 
B 2 6   MET 6   6   6   MET MET B . n 
B 2 7   ILE 7   7   7   ILE ILE B . n 
B 2 8   ARG 8   8   8   ARG ARG B . n 
B 2 9   ARG 9   9   9   ARG ARG B . n 
B 2 10  HIS 10  10  10  HIS HIS B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  THR 12  12  12  THR THR B . n 
B 2 13  THR 13  13  13  THR THR B . n 
B 2 14  ILE 14  14  14  ILE ILE B . n 
B 2 15  PHE 15  15  15  PHE PHE B . n 
B 2 16  THR 16  16  16  THR THR B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  ALA 18  18  18  ALA ALA B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  GLU 20  20  20  GLU GLU B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  SER 22  22  22  SER SER B . n 
B 2 23  THR 23  23  23  THR THR B . n 
B 2 24  VAL 24  24  24  VAL VAL B . n 
B 2 25  PHE 25  25  25  PHE PHE B . n 
B 2 26  GLU 26  26  26  GLU GLU B . n 
B 2 27  LEU 27  27  27  LEU LEU B . n 
B 2 28  LYS 28  28  28  LYS LYS B . n 
B 2 29  ARG 29  29  29  ARG ARG B . n 
B 2 30  ILE 30  30  30  ILE ILE B . n 
B 2 31  VAL 31  31  31  VAL VAL B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  GLY 33  33  33  GLY GLY B . n 
B 2 34  ILE 34  34  34  ILE ILE B . n 
B 2 35  LEU 35  35  35  LEU LEU B . n 
B 2 36  LYS 36  36  36  LYS LYS B . n 
B 2 37  ARG 37  37  37  ARG ARG B . n 
B 2 38  PRO 38  38  38  PRO PRO B . n 
B 2 39  PRO 39  39  39  PRO PRO B . n 
B 2 40  ASP 40  40  40  ASP ASP B . n 
B 2 41  GLU 41  41  41  GLU GLU B . n 
B 2 42  GLN 42  42  42  GLN GLN B . n 
B 2 43  ARG 43  43  43  ARG ARG B . n 
B 2 44  LEU 44  44  44  LEU LEU B . n 
B 2 45  TYR 45  45  45  TYR TYR B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ASP 47  47  47  ASP ASP B . n 
B 2 48  ASP 48  48  48  ASP ASP B . n 
B 2 49  GLN 49  49  49  GLN GLN B . n 
B 2 50  LEU 50  50  50  LEU LEU B . n 
B 2 51  LEU 51  51  51  LEU LEU B . n 
B 2 52  ASP 52  52  52  ASP ASP B . n 
B 2 53  ASP 53  53  53  ASP ASP B . n 
B 2 54  GLY 54  54  54  GLY GLY B . n 
B 2 55  LYS 55  55  55  LYS LYS B . n 
B 2 56  THR 56  56  56  THR THR B . n 
B 2 57  LEU 57  57  57  LEU LEU B . n 
B 2 58  GLY 58  58  58  GLY GLY B . n 
B 2 59  GLU 59  59  59  GLU GLU B . n 
B 2 60  CYS 60  60  60  CYS CYS B . n 
B 2 61  GLY 61  61  61  GLY GLY B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  THR 63  63  63  THR THR B . n 
B 2 64  SER 64  64  64  SER SER B . n 
B 2 65  GLN 65  65  65  GLN GLN B . n 
B 2 66  THR 66  66  66  THR THR B . n 
B 2 67  ALA 67  67  67  ALA ALA B . n 
B 2 68  ARG 68  68  68  ARG ARG B . n 
B 2 69  PRO 69  69  69  PRO PRO B . n 
B 2 70  GLN 70  70  70  GLN GLN B . n 
B 2 71  ALA 71  71  71  ALA ALA B . n 
B 2 72  PRO 72  72  72  PRO PRO B . n 
B 2 73  ALA 73  73  73  ALA ALA B . n 
B 2 74  THR 74  74  74  THR THR B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  GLY 76  76  76  GLY GLY B . n 
B 2 77  LEU 77  77  77  LEU LEU B . n 
B 2 78  ALA 78  78  78  ALA ALA B . n 
B 2 79  PHE 79  79  79  PHE PHE B . n 
B 2 80  ARG 80  80  80  ARG ARG B . n 
B 2 81  ALA 81  81  81  ALA ALA B . n 
B 2 82  ASP 82  82  82  ASP ASP B . n 
B 2 83  ASP 83  83  83  ASP ASP B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  PHE 85  85  85  PHE PHE B . n 
B 2 86  GLU 86  86  86  GLU GLU B . n 
B 2 87  ALA 87  87  87  ALA ALA B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  CYS 89  89  89  CYS CYS B . n 
B 2 90  ILE 90  90  90  ILE ILE B . n 
B 2 91  GLU 91  91  91  GLU GLU B . n 
B 2 92  PRO 92  92  92  PRO PRO B . n 
B 2 93  PHE 93  93  93  PHE PHE B . n 
B 2 94  SER 94  94  94  SER SER B . n 
B 2 95  SER 95  95  95  SER SER B . n 
B 2 96  PRO 96  96  96  PRO PRO B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  GLU 98  98  98  GLU GLU B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 ASP 101 101 101 ASP ASP B . n 
B 2 102 VAL 102 102 102 VAL VAL B . n 
B 2 103 MET 103 103 103 MET MET B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 PRO 105 105 105 PRO PRO B . n 
B 2 106 GLN 106 106 ?   ?   ?   B . n 
B 2 107 ASP 107 107 ?   ?   ?   B . n 
B 2 108 SER 108 108 ?   ?   ?   B . n 
B 2 109 GLY 109 109 ?   ?   ?   B . n 
B 2 110 SER 110 110 ?   ?   ?   B . n 
B 2 111 SER 111 111 ?   ?   ?   B . n 
B 2 112 ALA 112 112 ?   ?   ?   B . n 
B 2 113 ASN 113 113 ?   ?   ?   B . n 
B 2 114 GLU 114 114 ?   ?   ?   B . n 
B 2 115 GLN 115 115 ?   ?   ?   B . n 
B 2 116 ALA 116 116 ?   ?   ?   B . n 
B 2 117 VAL 117 117 ?   ?   ?   B . n 
B 2 118 GLN 118 118 ?   ?   ?   B . n 
C 3 1   MET 1   16  ?   ?   ?   C . n 
C 3 2   MET 2   17  17  MET MET C . n 
C 3 3   TYR 3   18  18  TYR TYR C . n 
C 3 4   VAL 4   19  19  VAL VAL C . n 
C 3 5   LYS 5   20  20  LYS LYS C . n 
C 3 6   LEU 6   21  21  LEU LEU C . n 
C 3 7   ILE 7   22  22  ILE ILE C . n 
C 3 8   SER 8   23  23  SER SER C . n 
C 3 9   SER 9   24  24  SER SER C . n 
C 3 10  ASP 10  25  25  ASP ASP C . n 
C 3 11  GLY 11  26  26  GLY GLY C . n 
C 3 12  HIS 12  27  27  HIS HIS C . n 
C 3 13  GLU 13  28  28  GLU GLU C . n 
C 3 14  PHE 14  29  29  PHE PHE C . n 
C 3 15  ILE 15  30  30  ILE ILE C . n 
C 3 16  VAL 16  31  31  VAL VAL C . n 
C 3 17  LYS 17  32  32  LYS LYS C . n 
C 3 18  ARG 18  33  33  ARG ARG C . n 
C 3 19  GLU 19  34  34  GLU GLU C . n 
C 3 20  HIS 20  35  35  HIS HIS C . n 
C 3 21  ALA 21  36  36  ALA ALA C . n 
C 3 22  LEU 22  37  37  LEU LEU C . n 
C 3 23  THR 23  38  38  THR THR C . n 
C 3 24  SER 24  39  39  SER SER C . n 
C 3 25  GLY 25  40  40  GLY GLY C . n 
C 3 26  THR 26  41  41  THR THR C . n 
C 3 27  ILE 27  42  42  ILE ILE C . n 
C 3 28  LYS 28  43  43  LYS LYS C . n 
C 3 29  ALA 29  44  44  ALA ALA C . n 
C 3 30  MET 30  45  45  MET MET C . n 
C 3 31  LEU 31  46  46  LEU LEU C . n 
C 3 32  SER 32  47  ?   ?   ?   C . n 
C 3 33  GLY 33  48  ?   ?   ?   C . n 
C 3 34  PRO 34  49  ?   ?   ?   C . n 
C 3 35  GLY 35  50  ?   ?   ?   C . n 
C 3 36  GLN 36  51  ?   ?   ?   C . n 
C 3 37  PHE 37  52  ?   ?   ?   C . n 
C 3 38  ALA 38  53  ?   ?   ?   C . n 
C 3 39  GLU 39  54  ?   ?   ?   C . n 
C 3 40  ASN 40  55  ?   ?   ?   C . n 
C 3 41  GLU 41  56  ?   ?   ?   C . n 
C 3 42  THR 42  57  ?   ?   ?   C . n 
C 3 43  ASN 43  58  58  ASN ASN C . n 
C 3 44  GLU 44  59  59  GLU GLU C . n 
C 3 45  VAL 45  60  60  VAL VAL C . n 
C 3 46  ASN 46  61  61  ASN ASN C . n 
C 3 47  PHE 47  62  62  PHE PHE C . n 
C 3 48  ARG 48  63  63  ARG ARG C . n 
C 3 49  GLU 49  64  64  GLU GLU C . n 
C 3 50  ILE 50  65  65  ILE ILE C . n 
C 3 51  PRO 51  66  66  PRO PRO C . n 
C 3 52  SER 52  67  67  SER SER C . n 
C 3 53  HIS 53  68  68  HIS HIS C . n 
C 3 54  VAL 54  69  69  VAL VAL C . n 
C 3 55  LEU 55  70  70  LEU LEU C . n 
C 3 56  SER 56  71  71  SER SER C . n 
C 3 57  LYS 57  72  72  LYS LYS C . n 
C 3 58  VAL 58  73  73  VAL VAL C . n 
C 3 59  CYS 59  74  74  CYS CYS C . n 
C 3 60  MET 60  75  75  MET MET C . n 
C 3 61  TYR 61  76  76  TYR TYR C . n 
C 3 62  PHE 62  77  77  PHE PHE C . n 
C 3 63  THR 63  78  78  THR THR C . n 
C 3 64  TYR 64  79  79  TYR TYR C . n 
C 3 65  LYS 65  80  80  LYS LYS C . n 
C 3 66  VAL 66  81  81  VAL VAL C . n 
C 3 67  ARG 67  82  82  ARG ARG C . n 
C 3 68  TYR 68  83  83  TYR TYR C . n 
C 3 69  THR 69  84  84  THR THR C . n 
C 3 70  ASN 70  85  85  ASN ASN C . n 
C 3 71  SER 71  86  86  SER SER C . n 
C 3 72  SER 72  87  87  SER SER C . n 
C 3 73  THR 73  88  88  THR THR C . n 
C 3 74  GLU 74  89  89  GLU GLU C . n 
C 3 75  ILE 75  90  90  ILE ILE C . n 
C 3 76  PRO 76  91  91  PRO PRO C . n 
C 3 77  GLU 77  92  92  GLU GLU C . n 
C 3 78  PHE 78  93  93  PHE PHE C . n 
C 3 79  PRO 79  94  94  PRO PRO C . n 
C 3 80  ILE 80  95  95  ILE ILE C . n 
C 3 81  ALA 81  96  96  ALA ALA C . n 
C 3 82  PRO 82  97  97  PRO PRO C . n 
C 3 83  GLU 83  98  98  GLU GLU C . n 
C 3 84  ILE 84  99  99  ILE ILE C . n 
C 3 85  ALA 85  100 100 ALA ALA C . n 
C 3 86  LEU 86  101 101 LEU LEU C . n 
C 3 87  GLU 87  102 102 GLU GLU C . n 
C 3 88  LEU 88  103 103 LEU LEU C . n 
C 3 89  LEU 89  104 104 LEU LEU C . n 
C 3 90  MET 90  105 105 MET MET C . n 
C 3 91  ALA 91  106 106 ALA ALA C . n 
C 3 92  ALA 92  107 107 ALA ALA C . n 
C 3 93  ASN 93  108 108 ASN ASN C . n 
C 3 94  PHE 94  109 109 PHE PHE C . n 
C 3 95  LEU 95  110 110 LEU LEU C . n 
C 3 96  ASP 96  111 111 ASP ASP C . n 
C 3 97  CYS 97  112 112 CYS CYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1  1430 1430 NA  NA  A . 
E 5 EDO 1  1431 1431 EDO EDO A . 
F 6 CL  1  1432 1432 CL  CL  A . 
G 7 HOH 1  2001 2001 HOH HOH A . 
G 7 HOH 2  2002 2002 HOH HOH A . 
G 7 HOH 3  2003 2003 HOH HOH A . 
G 7 HOH 4  2004 2004 HOH HOH A . 
G 7 HOH 5  2005 2005 HOH HOH A . 
G 7 HOH 6  2006 2006 HOH HOH A . 
G 7 HOH 7  2007 2007 HOH HOH A . 
G 7 HOH 8  2008 2008 HOH HOH A . 
G 7 HOH 9  2009 2009 HOH HOH A . 
G 7 HOH 10 2010 2010 HOH HOH A . 
G 7 HOH 11 2011 2011 HOH HOH A . 
G 7 HOH 12 2012 2012 HOH HOH A . 
G 7 HOH 13 2013 2013 HOH HOH A . 
G 7 HOH 14 2014 2014 HOH HOH A . 
G 7 HOH 15 2015 2015 HOH HOH A . 
G 7 HOH 16 2016 2016 HOH HOH A . 
G 7 HOH 17 2017 2017 HOH HOH A . 
G 7 HOH 18 2018 2018 HOH HOH A . 
G 7 HOH 19 2019 2019 HOH HOH A . 
G 7 HOH 20 2020 2020 HOH HOH A . 
G 7 HOH 21 2021 2021 HOH HOH A . 
G 7 HOH 22 2022 2022 HOH HOH A . 
G 7 HOH 23 2023 2023 HOH HOH A . 
G 7 HOH 24 2024 2024 HOH HOH A . 
G 7 HOH 25 2025 2025 HOH HOH A . 
G 7 HOH 26 2026 2026 HOH HOH A . 
G 7 HOH 27 2027 2027 HOH HOH A . 
G 7 HOH 28 2028 2028 HOH HOH A . 
G 7 HOH 29 2029 2029 HOH HOH A . 
G 7 HOH 30 2030 2030 HOH HOH A . 
G 7 HOH 31 2031 2031 HOH HOH A . 
G 7 HOH 32 2032 2032 HOH HOH A . 
G 7 HOH 33 2033 2033 HOH HOH A . 
G 7 HOH 34 2034 2034 HOH HOH A . 
G 7 HOH 35 2035 2035 HOH HOH A . 
G 7 HOH 36 2036 2036 HOH HOH A . 
G 7 HOH 37 2037 2037 HOH HOH A . 
G 7 HOH 38 2038 2038 HOH HOH A . 
G 7 HOH 39 2039 2039 HOH HOH A . 
G 7 HOH 40 2040 2040 HOH HOH A . 
G 7 HOH 41 2041 2041 HOH HOH A . 
G 7 HOH 42 2042 2042 HOH HOH A . 
G 7 HOH 43 2043 2043 HOH HOH A . 
G 7 HOH 44 2044 2044 HOH HOH A . 
G 7 HOH 45 2045 2045 HOH HOH A . 
G 7 HOH 46 2046 2046 HOH HOH A . 
G 7 HOH 47 2047 2047 HOH HOH A . 
G 7 HOH 48 2048 2048 HOH HOH A . 
G 7 HOH 49 2049 2049 HOH HOH A . 
G 7 HOH 50 2050 2050 HOH HOH A . 
G 7 HOH 51 2051 2051 HOH HOH A . 
G 7 HOH 52 2052 2052 HOH HOH A . 
G 7 HOH 53 2053 2053 HOH HOH A . 
G 7 HOH 54 2054 2054 HOH HOH A . 
G 7 HOH 55 2055 2055 HOH HOH A . 
G 7 HOH 56 2056 2056 HOH HOH A . 
G 7 HOH 57 2057 2057 HOH HOH A . 
G 7 HOH 58 2058 2058 HOH HOH A . 
G 7 HOH 59 2059 2059 HOH HOH A . 
G 7 HOH 60 2060 2060 HOH HOH A . 
G 7 HOH 61 2061 2061 HOH HOH A . 
G 7 HOH 62 2062 2062 HOH HOH A . 
G 7 HOH 63 2063 2063 HOH HOH A . 
G 7 HOH 64 2064 2064 HOH HOH A . 
H 7 HOH 1  2001 2001 HOH HOH B . 
H 7 HOH 2  2002 2002 HOH HOH B . 
H 7 HOH 3  2003 2003 HOH HOH B . 
H 7 HOH 4  2004 2004 HOH HOH B . 
H 7 HOH 5  2005 2005 HOH HOH B . 
H 7 HOH 6  2006 2006 HOH HOH B . 
H 7 HOH 7  2007 2007 HOH HOH B . 
H 7 HOH 8  2008 2008 HOH HOH B . 
H 7 HOH 9  2009 2009 HOH HOH B . 
H 7 HOH 10 2010 2010 HOH HOH B . 
H 7 HOH 11 2011 2011 HOH HOH B . 
H 7 HOH 12 2012 2012 HOH HOH B . 
H 7 HOH 13 2013 2013 HOH HOH B . 
H 7 HOH 14 2014 2014 HOH HOH B . 
H 7 HOH 15 2015 2015 HOH HOH B . 
H 7 HOH 16 2016 2016 HOH HOH B . 
H 7 HOH 17 2017 2017 HOH HOH B . 
H 7 HOH 18 2018 2018 HOH HOH B . 
H 7 HOH 19 2019 2019 HOH HOH B . 
H 7 HOH 20 2020 2020 HOH HOH B . 
H 7 HOH 21 2021 2021 HOH HOH B . 
H 7 HOH 22 2022 2022 HOH HOH B . 
H 7 HOH 23 2023 2023 HOH HOH B . 
H 7 HOH 24 2024 2024 HOH HOH B . 
H 7 HOH 25 2025 2025 HOH HOH B . 
H 7 HOH 26 2026 2026 HOH HOH B . 
H 7 HOH 27 2027 2027 HOH HOH B . 
H 7 HOH 28 2028 2028 HOH HOH B . 
H 7 HOH 29 2029 2029 HOH HOH B . 
H 7 HOH 30 2030 2030 HOH HOH B . 
H 7 HOH 31 2031 2031 HOH HOH B . 
I 7 HOH 1  2001 2001 HOH HOH C . 
I 7 HOH 2  2002 2002 HOH HOH C . 
I 7 HOH 3  2003 2003 HOH HOH C . 
I 7 HOH 4  2004 2004 HOH HOH C . 
I 7 HOH 5  2005 2005 HOH HOH C . 
I 7 HOH 6  2006 2006 HOH HOH C . 
I 7 HOH 7  2007 2007 HOH HOH C . 
I 7 HOH 8  2008 2008 HOH HOH C . 
I 7 HOH 9  2009 2009 HOH HOH C . 
I 7 HOH 10 2010 2010 HOH HOH C . 
I 7 HOH 11 2011 2011 HOH HOH C . 
I 7 HOH 12 2012 2012 HOH HOH C . 
I 7 HOH 13 2013 2013 HOH HOH C . 
I 7 HOH 14 2014 2014 HOH HOH C . 
I 7 HOH 15 2015 2015 HOH HOH C . 
I 7 HOH 16 2016 2016 HOH HOH C . 
I 7 HOH 17 2017 2017 HOH HOH C . 
I 7 HOH 18 2018 2018 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A SER 63 ? A SER 313  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? A GLN 65 ? A GLN 315  ? 1_555 90.5  ? 
2  O ? A SER 63 ? A SER 313  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? A TYR 68 ? A TYR 318  ? 1_555 100.3 ? 
3  O ? A GLN 65 ? A GLN 315  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? A TYR 68 ? A TYR 318  ? 1_555 74.7  ? 
4  O ? A SER 63 ? A SER 313  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2022 ? 1_555 95.5  ? 
5  O ? A GLN 65 ? A GLN 315  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2022 ? 1_555 82.2  ? 
6  O ? A TYR 68 ? A TYR 318  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2022 ? 1_555 152.0 ? 
7  O ? A SER 63 ? A SER 313  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2023 ? 1_555 172.5 ? 
8  O ? A GLN 65 ? A GLN 315  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2023 ? 1_555 94.4  ? 
9  O ? A TYR 68 ? A TYR 318  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2023 ? 1_555 75.6  ? 
10 O ? G HOH .  ? A HOH 2022 ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O  ? G HOH .  ? A HOH 2023 ? 1_555 90.8  ? 
11 O ? A SER 63 ? A SER 313  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O2 ? E EDO .  ? A EDO 1431 ? 1_555 80.0  ? 
12 O ? A GLN 65 ? A GLN 315  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O2 ? E EDO .  ? A EDO 1431 ? 1_555 162.0 ? 
13 O ? A TYR 68 ? A TYR 318  ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O2 ? E EDO .  ? A EDO 1431 ? 1_555 91.9  ? 
14 O ? G HOH .  ? A HOH 2022 ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O2 ? E EDO .  ? A EDO 1431 ? 1_555 113.7 ? 
15 O ? G HOH .  ? A HOH 2023 ? 1_555 NA ? D NA . ? A NA 1430 ? 1_555 O2 ? E EDO .  ? A EDO 1431 ? 1_555 93.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
4 'Structure model' 1 3 2018-02-28 
5 'Structure model' 1 4 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Structure summary'         
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Source and taxonomy'       
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author       
2 4 'Structure model' citation           
3 4 'Structure model' entity_src_gen     
4 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'                             
2 4 'Structure model' '_citation.page_last'                            
3 4 'Structure model' '_citation.pdbx_database_id_DOI'                 
4 4 'Structure model' '_citation.title'                                
5 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'        
6 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
7 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
8 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
9 5 'Structure model' '_exptl_crystal_grow.method'                     
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 8.5008  -16.1138 61.5944 -0.0127 -0.0086 -0.0535 0.0407 -0.0385 0.0516  0.9031 2.6757 1.0306 
0.8146  0.1039  0.0303 0.0394 -0.2001 -0.1057 0.2938  -0.0036 -0.0199 0.0146  -0.0199 -0.0358 
'X-RAY DIFFRACTION' 2 ? refined 21.2349 -6.5275  47.1676 -0.0457 -0.0571 0.0138  0.0241 -0.0087 -0.0249 0.5906 3.7599 1.6225 
-0.2030 -0.9701 0.6611 0.1165 -0.1975 0.1240  -0.2094 0.0110  -0.3413 -0.1042 0.0249  -0.1274 
'X-RAY DIFFRACTION' 3 ? refined 35.1863 -29.7591 27.7502 -0.0854 -0.0974 -0.0403 0.0275 0.0156  0.0214  2.3090 3.0440 1.8646 
-1.6996 -1.6951 1.9404 0.0512 0.1284  -0.1869 -0.2321 -0.1623 0.0169  -0.0674 -0.1062 0.1111  
'X-RAY DIFFRACTION' 4 ? refined 23.6390 -16.8591 32.2935 -0.0323 -0.1156 -0.0492 0.0621 -0.0006 0.0204  2.5625 1.8708 2.2259 
-0.4579 -0.2497 0.1585 0.1076 0.0854  0.1179  -0.3384 -0.1158 0.0085  -0.0863 -0.0893 0.0082  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 267 ? ? A 383 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 422 ? ? A 429 ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 384 ? ? A 421 ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 B 2   ? ? B 104 ? ? ? ? 
'X-RAY DIFFRACTION' 5 4 C 17  ? ? C 112 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 305 ? ? -37.95  123.09  
2 1 HIS B 10  ? ? 51.70   -119.33 
3 1 ASP B 47  ? ? 61.23   -126.76 
4 1 ALA B 71  ? ? -152.79 68.76   
5 1 ASP B 82  ? ? 69.53   -121.38 
6 1 ASP C 111 ? ? 60.09   62.20   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ASN 
_pdbx_validate_chiral.auth_seq_id     267 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 316 ? CG  ? A GLU 66  CG  
2  1 Y 1 A GLU 316 ? CD  ? A GLU 66  CD  
3  1 Y 1 A GLU 316 ? OE1 ? A GLU 66  OE1 
4  1 Y 1 A GLU 316 ? OE2 ? A GLU 66  OE2 
5  1 Y 1 A LYS 425 ? CD  ? A LYS 175 CD  
6  1 Y 1 A LYS 425 ? CE  ? A LYS 175 CE  
7  1 Y 1 A LYS 425 ? NZ  ? A LYS 175 NZ  
8  1 Y 1 A LYS 427 ? CD  ? A LYS 177 CD  
9  1 Y 1 A LYS 427 ? CE  ? A LYS 177 CE  
10 1 Y 1 A LYS 427 ? NZ  ? A LYS 177 NZ  
11 1 Y 1 A ARG 429 ? NE  ? A ARG 179 NE  
12 1 Y 1 A ARG 429 ? CZ  ? A ARG 179 CZ  
13 1 Y 1 A ARG 429 ? NH1 ? A ARG 179 NH1 
14 1 Y 1 A ARG 429 ? NH2 ? A ARG 179 NH2 
15 1 Y 1 B MET 1   ? CG  ? B MET 1   CG  
16 1 Y 1 B MET 1   ? SD  ? B MET 1   SD  
17 1 Y 1 B MET 1   ? CE  ? B MET 1   CE  
18 1 Y 1 B LYS 19  ? CE  ? B LYS 19  CE  
19 1 Y 1 B LYS 19  ? NZ  ? B LYS 19  NZ  
20 1 Y 1 B GLN 65  ? CD  ? B GLN 65  CD  
21 1 Y 1 B GLN 65  ? OE1 ? B GLN 65  OE1 
22 1 Y 1 B GLN 65  ? NE2 ? B GLN 65  NE2 
23 1 Y 1 B ASP 82  ? CG  ? B ASP 82  CG  
24 1 Y 1 B ASP 82  ? OD1 ? B ASP 82  OD1 
25 1 Y 1 B ASP 82  ? OD2 ? B ASP 82  OD2 
26 1 Y 1 B ASP 83  ? CG  ? B ASP 83  CG  
27 1 Y 1 B ASP 83  ? OD1 ? B ASP 83  OD1 
28 1 Y 1 B ASP 83  ? OD2 ? B ASP 83  OD2 
29 1 Y 1 B GLU 98  ? CG  ? B GLU 98  CG  
30 1 Y 1 B GLU 98  ? CD  ? B GLU 98  CD  
31 1 Y 1 B GLU 98  ? OE1 ? B GLU 98  OE1 
32 1 Y 1 B GLU 98  ? OE2 ? B GLU 98  OE2 
33 1 Y 1 B LYS 104 ? CE  ? B LYS 104 CE  
34 1 Y 1 B LYS 104 ? NZ  ? B LYS 104 NZ  
35 1 Y 1 C LYS 43  ? NZ  ? C LYS 28  NZ  
36 1 Y 1 C ASN 58  ? CG  ? C ASN 43  CG  
37 1 Y 1 C ASN 58  ? OD1 ? C ASN 43  OD1 
38 1 Y 1 C ASN 58  ? ND2 ? C ASN 43  ND2 
39 1 Y 1 C ARG 63  ? CD  ? C ARG 48  CD  
40 1 Y 1 C ARG 63  ? NE  ? C ARG 48  NE  
41 1 Y 1 C ARG 63  ? CZ  ? C ARG 48  CZ  
42 1 Y 1 C ARG 63  ? NH1 ? C ARG 48  NH1 
43 1 Y 1 C ARG 63  ? NH2 ? C ARG 48  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 251 ? A MET 1   
2  1 Y 1 A HIS 252 ? A HIS 2   
3  1 Y 1 A HIS 253 ? A HIS 3   
4  1 Y 1 A HIS 254 ? A HIS 4   
5  1 Y 1 A HIS 255 ? A HIS 5   
6  1 Y 1 A HIS 256 ? A HIS 6   
7  1 Y 1 A HIS 257 ? A HIS 7   
8  1 Y 1 A SER 258 ? A SER 8   
9  1 Y 1 A SER 259 ? A SER 9   
10 1 Y 1 A GLY 260 ? A GLY 10  
11 1 Y 1 A VAL 261 ? A VAL 11  
12 1 Y 1 A ASP 262 ? A ASP 12  
13 1 Y 1 A LEU 263 ? A LEU 13  
14 1 Y 1 A GLY 264 ? A GLY 14  
15 1 Y 1 A THR 265 ? A THR 15  
16 1 Y 1 A GLU 266 ? A GLU 16  
17 1 Y 1 A VAL 430 ? A VAL 180 
18 1 Y 1 A LEU 431 ? A LEU 181 
19 1 Y 1 A ARG 432 ? A ARG 182 
20 1 Y 1 A ILE 433 ? A ILE 183 
21 1 Y 1 A ASP 434 ? A ASP 184 
22 1 Y 1 A ALA 435 ? A ALA 185 
23 1 Y 1 A PRO 436 ? A PRO 186 
24 1 Y 1 A GLU 437 ? A GLU 187 
25 1 Y 1 B GLN 106 ? B GLN 106 
26 1 Y 1 B ASP 107 ? B ASP 107 
27 1 Y 1 B SER 108 ? B SER 108 
28 1 Y 1 B GLY 109 ? B GLY 109 
29 1 Y 1 B SER 110 ? B SER 110 
30 1 Y 1 B SER 111 ? B SER 111 
31 1 Y 1 B ALA 112 ? B ALA 112 
32 1 Y 1 B ASN 113 ? B ASN 113 
33 1 Y 1 B GLU 114 ? B GLU 114 
34 1 Y 1 B GLN 115 ? B GLN 115 
35 1 Y 1 B ALA 116 ? B ALA 116 
36 1 Y 1 B VAL 117 ? B VAL 117 
37 1 Y 1 B GLN 118 ? B GLN 118 
38 1 Y 1 C MET 16  ? C MET 1   
39 1 Y 1 C SER 47  ? C SER 32  
40 1 Y 1 C GLY 48  ? C GLY 33  
41 1 Y 1 C PRO 49  ? C PRO 34  
42 1 Y 1 C GLY 50  ? C GLY 35  
43 1 Y 1 C GLN 51  ? C GLN 36  
44 1 Y 1 C PHE 52  ? C PHE 37  
45 1 Y 1 C ALA 53  ? C ALA 38  
46 1 Y 1 C GLU 54  ? C GLU 39  
47 1 Y 1 C ASN 55  ? C ASN 40  
48 1 Y 1 C GLU 56  ? C GLU 41  
49 1 Y 1 C THR 57  ? C THR 42  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'   NA  
5 1,2-ETHANEDIOL EDO 
6 'CHLORIDE ION' CL  
7 water          HOH 
#