data_2J2C
# 
_entry.id   2J2C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2J2C         
PDBE  EBI-29709    
WWPDB D_1290029709 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2J2C 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wallden, K.'            1  
'Stenmark, P.'           2  
'Arrowsmith, C.'         3  
'Berglund, H.'           4  
'Busam, R.'              5  
'Collins, R.'            6  
'Edwards, A.'            7  
'Ehn, M.'                8  
'Flodin, S.'             9  
'Flores, A.'             10 
'Graslund, S.'           11 
'Hammarstrom, M.'        12 
'Hallberg, B.M.'         13 
'Holmberg Schiavone, L.' 14 
'Hogbom, M.'             15 
'Karlberg, T.'           16 
'Kotenyova, T.'          17 
'Loppnau, P.'            18 
'Magnusdottir, A.'       19 
'Nilsson-Ehle, P.'       20 
'Nyman, T.'              21 
'Ogg, D.'                22 
'Persson, C.'            23 
'Sagemark, J.'           24 
'Sundstrom, M.'          25 
'Uppenberg, J.'          26 
'Thorsell, A.G.'         27 
'Van Den Berg, S.'       28 
'Weigelt, J.'            29 
'Welin, M.'              30 
'Nordlund, P.'           31 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Human Cytosolic 5'- Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                17828 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17405878 
_citation.pdbx_database_id_DOI      10.1074/JBC.M700917200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wallden, K.'  1 
primary 'Stenmark, P.' 2 
primary 'Nyman, T.'    3 
primary 'Flodin, S.'   4 
primary 'Graslund, S.' 5 
primary 'Loppnau, P.'  6 
primary 'Bianchi, V.'  7 
primary 'Nordlund, P.' 8 
# 
_cell.entry_id           2J2C 
_cell.length_a           91.465 
_cell.length_b           128.034 
_cell.length_c           130.415 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2J2C 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
64088.930 1   3.1.3.5 ? 'RESIDUES 1-536' ? 
2 non-polymer syn GLYCEROL                           92.094    1   ?       ? ?                ? 
3 non-polymer syn 'SULFATE ION'                      96.063    6   ?       ? ?                ? 
4 non-polymer syn 'MAGNESIUM ION'                    24.305    1   ?       ? ?                ? 
5 water       nat water                              18.015    445 ?       ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;5'-NUCLEOTIDASE CYTOSOLIC II, CYTOSOLIC PURINE 5'-NUCLEOTIDASE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYK
SPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKF
IQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVEN
LEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTV
LRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHV
WTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLY
AASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSMSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYK
SPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNKF
IQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVEN
LEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGTV
LRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDHIFGDILKSKKRQGWRTFLVIPELAQELHV
WTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLY
AASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  MET n 
1 21  SER n 
1 22  THR n 
1 23  SER n 
1 24  TRP n 
1 25  SER n 
1 26  ASP n 
1 27  ARG n 
1 28  LEU n 
1 29  GLN n 
1 30  ASN n 
1 31  ALA n 
1 32  ALA n 
1 33  ASP n 
1 34  MET n 
1 35  PRO n 
1 36  ALA n 
1 37  ASN n 
1 38  MET n 
1 39  ASP n 
1 40  LYS n 
1 41  HIS n 
1 42  ALA n 
1 43  LEU n 
1 44  LYS n 
1 45  LYS n 
1 46  TYR n 
1 47  ARG n 
1 48  ARG n 
1 49  GLU n 
1 50  ALA n 
1 51  TYR n 
1 52  HIS n 
1 53  ARG n 
1 54  VAL n 
1 55  PHE n 
1 56  VAL n 
1 57  ASN n 
1 58  ARG n 
1 59  SER n 
1 60  LEU n 
1 61  ALA n 
1 62  MET n 
1 63  GLU n 
1 64  LYS n 
1 65  ILE n 
1 66  LYS n 
1 67  CYS n 
1 68  PHE n 
1 69  GLY n 
1 70  PHE n 
1 71  ASP n 
1 72  MET n 
1 73  ASP n 
1 74  TYR n 
1 75  THR n 
1 76  LEU n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LYS n 
1 81  SER n 
1 82  PRO n 
1 83  GLU n 
1 84  TYR n 
1 85  GLU n 
1 86  SER n 
1 87  LEU n 
1 88  GLY n 
1 89  PHE n 
1 90  GLU n 
1 91  LEU n 
1 92  THR n 
1 93  VAL n 
1 94  GLU n 
1 95  ARG n 
1 96  LEU n 
1 97  VAL n 
1 98  SER n 
1 99  ILE n 
1 100 GLY n 
1 101 TYR n 
1 102 PRO n 
1 103 GLN n 
1 104 GLU n 
1 105 LEU n 
1 106 LEU n 
1 107 SER n 
1 108 PHE n 
1 109 ALA n 
1 110 TYR n 
1 111 ASP n 
1 112 SER n 
1 113 THR n 
1 114 PHE n 
1 115 PRO n 
1 116 THR n 
1 117 ARG n 
1 118 GLY n 
1 119 LEU n 
1 120 VAL n 
1 121 PHE n 
1 122 ASP n 
1 123 THR n 
1 124 LEU n 
1 125 TYR n 
1 126 GLY n 
1 127 ASN n 
1 128 LEU n 
1 129 LEU n 
1 130 LYS n 
1 131 VAL n 
1 132 ASP n 
1 133 ALA n 
1 134 TYR n 
1 135 GLY n 
1 136 ASN n 
1 137 LEU n 
1 138 LEU n 
1 139 VAL n 
1 140 CYS n 
1 141 ALA n 
1 142 HIS n 
1 143 GLY n 
1 144 PHE n 
1 145 ASN n 
1 146 PHE n 
1 147 ILE n 
1 148 ARG n 
1 149 GLY n 
1 150 PRO n 
1 151 GLU n 
1 152 THR n 
1 153 ARG n 
1 154 GLU n 
1 155 GLN n 
1 156 TYR n 
1 157 PRO n 
1 158 ASN n 
1 159 LYS n 
1 160 PHE n 
1 161 ILE n 
1 162 GLN n 
1 163 ARG n 
1 164 ASP n 
1 165 ASP n 
1 166 THR n 
1 167 GLU n 
1 168 ARG n 
1 169 PHE n 
1 170 TYR n 
1 171 ILE n 
1 172 LEU n 
1 173 ASN n 
1 174 THR n 
1 175 LEU n 
1 176 PHE n 
1 177 ASN n 
1 178 LEU n 
1 179 PRO n 
1 180 GLU n 
1 181 THR n 
1 182 TYR n 
1 183 LEU n 
1 184 LEU n 
1 185 ALA n 
1 186 CYS n 
1 187 LEU n 
1 188 VAL n 
1 189 ASP n 
1 190 PHE n 
1 191 PHE n 
1 192 THR n 
1 193 ASN n 
1 194 CYS n 
1 195 PRO n 
1 196 ARG n 
1 197 TYR n 
1 198 THR n 
1 199 SER n 
1 200 CYS n 
1 201 GLU n 
1 202 THR n 
1 203 GLY n 
1 204 PHE n 
1 205 LYS n 
1 206 ASP n 
1 207 GLY n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 MET n 
1 212 SER n 
1 213 TYR n 
1 214 ARG n 
1 215 SER n 
1 216 MET n 
1 217 PHE n 
1 218 GLN n 
1 219 ASP n 
1 220 VAL n 
1 221 ARG n 
1 222 ASP n 
1 223 ALA n 
1 224 VAL n 
1 225 ASP n 
1 226 TRP n 
1 227 VAL n 
1 228 HIS n 
1 229 TYR n 
1 230 LYS n 
1 231 GLY n 
1 232 SER n 
1 233 LEU n 
1 234 LYS n 
1 235 GLU n 
1 236 LYS n 
1 237 THR n 
1 238 VAL n 
1 239 GLU n 
1 240 ASN n 
1 241 LEU n 
1 242 GLU n 
1 243 LYS n 
1 244 TYR n 
1 245 VAL n 
1 246 VAL n 
1 247 LYS n 
1 248 ASP n 
1 249 GLY n 
1 250 LYS n 
1 251 LEU n 
1 252 PRO n 
1 253 LEU n 
1 254 LEU n 
1 255 LEU n 
1 256 SER n 
1 257 ARG n 
1 258 MET n 
1 259 LYS n 
1 260 GLU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 VAL n 
1 265 PHE n 
1 266 LEU n 
1 267 ALA n 
1 268 THR n 
1 269 ASN n 
1 270 SER n 
1 271 ASP n 
1 272 TYR n 
1 273 LYS n 
1 274 TYR n 
1 275 THR n 
1 276 ASP n 
1 277 LYS n 
1 278 ILE n 
1 279 MET n 
1 280 THR n 
1 281 TYR n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 PHE n 
1 286 PRO n 
1 287 HIS n 
1 288 GLY n 
1 289 PRO n 
1 290 LYS n 
1 291 PRO n 
1 292 GLY n 
1 293 SER n 
1 294 SER n 
1 295 HIS n 
1 296 ARG n 
1 297 PRO n 
1 298 TRP n 
1 299 GLN n 
1 300 SER n 
1 301 TYR n 
1 302 PHE n 
1 303 ASP n 
1 304 LEU n 
1 305 ILE n 
1 306 LEU n 
1 307 VAL n 
1 308 ASP n 
1 309 ALA n 
1 310 ARG n 
1 311 LYS n 
1 312 PRO n 
1 313 LEU n 
1 314 PHE n 
1 315 PHE n 
1 316 GLY n 
1 317 GLU n 
1 318 GLY n 
1 319 THR n 
1 320 VAL n 
1 321 LEU n 
1 322 ARG n 
1 323 GLN n 
1 324 VAL n 
1 325 ASP n 
1 326 THR n 
1 327 LYS n 
1 328 THR n 
1 329 GLY n 
1 330 LYS n 
1 331 LEU n 
1 332 LYS n 
1 333 ILE n 
1 334 GLY n 
1 335 THR n 
1 336 TYR n 
1 337 THR n 
1 338 GLY n 
1 339 PRO n 
1 340 LEU n 
1 341 GLN n 
1 342 HIS n 
1 343 GLY n 
1 344 ILE n 
1 345 VAL n 
1 346 TYR n 
1 347 SER n 
1 348 GLY n 
1 349 GLY n 
1 350 SER n 
1 351 SER n 
1 352 ASP n 
1 353 THR n 
1 354 ILE n 
1 355 CYS n 
1 356 ASP n 
1 357 LEU n 
1 358 LEU n 
1 359 GLY n 
1 360 ALA n 
1 361 LYS n 
1 362 GLY n 
1 363 LYS n 
1 364 ASP n 
1 365 ILE n 
1 366 LEU n 
1 367 TYR n 
1 368 ILE n 
1 369 GLY n 
1 370 ASP n 
1 371 HIS n 
1 372 ILE n 
1 373 PHE n 
1 374 GLY n 
1 375 ASP n 
1 376 ILE n 
1 377 LEU n 
1 378 LYS n 
1 379 SER n 
1 380 LYS n 
1 381 LYS n 
1 382 ARG n 
1 383 GLN n 
1 384 GLY n 
1 385 TRP n 
1 386 ARG n 
1 387 THR n 
1 388 PHE n 
1 389 LEU n 
1 390 VAL n 
1 391 ILE n 
1 392 PRO n 
1 393 GLU n 
1 394 LEU n 
1 395 ALA n 
1 396 GLN n 
1 397 GLU n 
1 398 LEU n 
1 399 HIS n 
1 400 VAL n 
1 401 TRP n 
1 402 THR n 
1 403 ASP n 
1 404 LYS n 
1 405 SER n 
1 406 SER n 
1 407 LEU n 
1 408 PHE n 
1 409 GLU n 
1 410 GLU n 
1 411 LEU n 
1 412 GLN n 
1 413 SER n 
1 414 LEU n 
1 415 ASP n 
1 416 ILE n 
1 417 PHE n 
1 418 LEU n 
1 419 ALA n 
1 420 GLU n 
1 421 LEU n 
1 422 TYR n 
1 423 LYS n 
1 424 HIS n 
1 425 LEU n 
1 426 ASP n 
1 427 SER n 
1 428 SER n 
1 429 SER n 
1 430 ASN n 
1 431 GLU n 
1 432 ARG n 
1 433 PRO n 
1 434 ASP n 
1 435 ILE n 
1 436 SER n 
1 437 SER n 
1 438 ILE n 
1 439 GLN n 
1 440 ARG n 
1 441 ARG n 
1 442 ILE n 
1 443 LYS n 
1 444 LYS n 
1 445 VAL n 
1 446 THR n 
1 447 HIS n 
1 448 ASP n 
1 449 MET n 
1 450 ASP n 
1 451 MET n 
1 452 CYS n 
1 453 TYR n 
1 454 GLY n 
1 455 MET n 
1 456 MET n 
1 457 GLY n 
1 458 SER n 
1 459 LEU n 
1 460 PHE n 
1 461 ARG n 
1 462 SER n 
1 463 GLY n 
1 464 SER n 
1 465 ARG n 
1 466 GLN n 
1 467 THR n 
1 468 LEU n 
1 469 PHE n 
1 470 ALA n 
1 471 SER n 
1 472 GLN n 
1 473 VAL n 
1 474 MET n 
1 475 ARG n 
1 476 TYR n 
1 477 ALA n 
1 478 ASP n 
1 479 LEU n 
1 480 TYR n 
1 481 ALA n 
1 482 ALA n 
1 483 SER n 
1 484 PHE n 
1 485 ILE n 
1 486 ASN n 
1 487 LEU n 
1 488 LEU n 
1 489 TYR n 
1 490 TYR n 
1 491 PRO n 
1 492 PHE n 
1 493 SER n 
1 494 TYR n 
1 495 LEU n 
1 496 PHE n 
1 497 ARG n 
1 498 ALA n 
1 499 ALA n 
1 500 HIS n 
1 501 VAL n 
1 502 LEU n 
1 503 MET n 
1 504 PRO n 
1 505 HIS n 
1 506 GLU n 
1 507 SER n 
1 508 THR n 
1 509 VAL n 
1 510 GLU n 
1 511 HIS n 
1 512 THR n 
1 513 HIS n 
1 514 VAL n 
1 515 ASP n 
1 516 ILE n 
1 517 ASN n 
1 518 GLU n 
1 519 MET n 
1 520 GLU n 
1 521 SER n 
1 522 PRO n 
1 523 LEU n 
1 524 ALA n 
1 525 THR n 
1 526 ARG n 
1 527 ASN n 
1 528 ARG n 
1 529 THR n 
1 530 SER n 
1 531 VAL n 
1 532 ASP n 
1 533 PHE n 
1 534 LYS n 
1 535 ASP n 
1 536 THR n 
1 537 ASP n 
1 538 TYR n 
1 539 LYS n 
1 540 ARG n 
1 541 HIS n 
1 542 GLN n 
1 543 LEU n 
1 544 THR n 
1 545 ARG n 
1 546 SER n 
1 547 ILE n 
1 548 SER n 
1 549 GLU n 
1 550 ILE n 
1 551 LYS n 
1 552 PRO n 
1 553 PRO n 
1 554 ASN n 
1 555 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'ROSETTA2(DE)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P28A-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2J2C       1 ? ? 2J2C   ? 
2 UNP 5NTC_HUMAN 1 ? ? P49902 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2J2C A 1  ? 19  ? 2J2C   -18 ? 0   ? -18 0   
2 2 2J2C A 20 ? 555 ? P49902 1   ? 536 ? 1   536 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2J2C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.17 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1.8 M MG2SO4 0.1 M TRIS PH 8.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2006-04-22 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9196 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.9196 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2J2C 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             91.290 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   39212 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.5000 
_reflns.B_iso_Wilson_estimate        23.50 
_reflns.pdbx_redundancy              6.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.15000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    11.500 
_reflns_shell.pdbx_redundancy        6.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2J2C 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     37234 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.154 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.152 
_refine.ls_R_factor_R_free                       0.184 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1967 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               7.85 
_refine.aniso_B[1][1]                            -0.25000 
_refine.aniso_B[2][2]                            -0.04000 
_refine.aniso_B[3][3]                            0.29000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES 3-400 AND 417-488 OUT OF 536 RESIDUES ARE MODELLED' 
_refine.pdbx_starting_model                      'PDB ENTRY 2BDE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.161 
_refine.pdbx_overall_ESU_R_Free                  0.142 
_refine.overall_SU_ML                            0.085 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.989 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3828 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             445 
_refine_hist.number_atoms_total               4310 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 4058 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.428  1.970  ? 5501 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.958  5.000  ? 494  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.779 23.265 ? 196  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.102 15.000 ? 707  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.438 15.000 ? 27   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.101  0.200  ? 578  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 3101 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.193  0.200  ? 1794 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.303  0.200  ? 2744 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.139  0.200  ? 391  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.192  0.200  ? 57   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.173  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.772  1.500  ? 2487 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.206  2.000  ? 3873 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.105  3.000  ? 1832 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.171  4.500  ? 1621 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             2730 
_refine_ls_shell.R_factor_R_work                  0.1490 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2080 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             135 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2J2C 
_struct.title                     
;Crystal structure of Human Cytosolic 5'-Nucleotidase II (NT5C2, cN-II)
;
_struct.pdbx_descriptor           
;CYTOSOLIC PURINE 5'-NUCLEOTIDASE (E.C.3.1.3.5)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2J2C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;CYTOSOLIC 5-PRIME NUCLEOTIDASE II, ALLOSTERIC ENZYME, GMP- IMP SPECIFIC NUCLEOTIDASE, HIGH KM 5-PRIME NUCLEOTIDASE, CN- II, NT5C2, HYDROLASE, CYTOSOLIC PURINE 5- PRIME NUCLEOTIDASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23  ? ASP A 33  ? SER A 4   ASP A 14  1 ? 11  
HELX_P HELX_P2  2  ASP A 39  ? GLU A 49  ? ASP A 20  GLU A 30  1 ? 11  
HELX_P HELX_P3  3  ALA A 50  ? ARG A 53  ? ALA A 31  ARG A 34  5 ? 4   
HELX_P HELX_P4  4  GLU A 63  ? ILE A 65  ? GLU A 44  ILE A 46  5 ? 3   
HELX_P HELX_P5  5  PRO A 82  ? ILE A 99  ? PRO A 63  ILE A 80  1 ? 18  
HELX_P HELX_P6  6  PRO A 102 ? PHE A 108 ? PRO A 83  PHE A 89  5 ? 7   
HELX_P HELX_P7  7  ARG A 148 ? ARG A 153 ? ARG A 129 ARG A 134 1 ? 6   
HELX_P HELX_P8  8  THR A 174 ? PHE A 176 ? THR A 155 PHE A 157 5 ? 3   
HELX_P HELX_P9  9  ASN A 177 ? CYS A 194 ? ASN A 158 CYS A 175 1 ? 18  
HELX_P HELX_P10 10 TYR A 213 ? LYS A 230 ? TYR A 194 LYS A 211 1 ? 18  
HELX_P HELX_P11 11 SER A 232 ? GLU A 239 ? SER A 213 GLU A 220 1 ? 8   
HELX_P HELX_P12 12 ASN A 240 ? VAL A 245 ? ASN A 221 VAL A 226 1 ? 6   
HELX_P HELX_P13 13 GLY A 249 ? GLY A 262 ? GLY A 230 GLY A 243 1 ? 14  
HELX_P HELX_P14 14 ASP A 271 ? PHE A 283 ? ASP A 252 PHE A 264 1 ? 13  
HELX_P HELX_P15 15 PRO A 297 ? PHE A 302 ? PRO A 278 PHE A 283 5 ? 6   
HELX_P HELX_P16 16 PRO A 312 ? GLY A 316 ? PRO A 293 GLY A 297 5 ? 5   
HELX_P HELX_P17 17 SER A 350 ? GLY A 359 ? SER A 331 GLY A 340 1 ? 10  
HELX_P HELX_P18 18 LYS A 361 ? LYS A 363 ? LYS A 342 LYS A 344 5 ? 3   
HELX_P HELX_P19 19 THR A 22  ? ASP A 375 ? THR A 3   ASP A 356 5 ? 354 
HELX_P HELX_P20 20 ILE A 376 ? GLY A 384 ? ILE A 357 GLY A 365 1 ? 9   
HELX_P HELX_P21 21 GLU A 393 ? LYS A 404 ? GLU A 374 LYS A 385 1 ? 12  
HELX_P HELX_P22 22 LYS A 404 ? ALA A 419 ? LYS A 385 ALA A 400 1 ? 16  
HELX_P HELX_P23 23 SER A 436 ? CYS A 452 ? SER A 417 CYS A 433 1 ? 17  
HELX_P HELX_P24 24 THR A 467 ? ALA A 477 ? THR A 448 ALA A 458 1 ? 11  
HELX_P HELX_P25 25 SER A 483 ? TYR A 490 ? SER A 464 TYR A 471 5 ? 8   
HELX_P HELX_P26 26 MET A 503 ? SER A 507 ? MET A 484 SER A 488 5 ? 5   
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? I MG . MG ? ? ? 1_555 J HOH .   O   ? ? A MG 1496 A HOH 2365 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc2 metalc ? ? I MG . MG ? ? ? 1_555 J HOH .   O   ? ? A MG 1496 A HOH 2443 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc3 metalc ? ? I MG . MG ? ? ? 1_555 A ASP 71  OD2 ? ? A MG 1496 A ASP 52   1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc4 metalc ? ? I MG . MG ? ? ? 1_555 A ASP 73  O   ? ? A MG 1496 A ASP 54   1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc5 metalc ? ? I MG . MG ? ? ? 1_555 A ASP 370 OD1 ? ? A MG 1496 A ASP 351  1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc6 metalc ? ? I MG . MG ? ? ? 1_555 J HOH .   O   ? ? A MG 1496 A HOH 2369 1_555 ? ? ? ? ? ? ? 2.155 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 81  A . ? SER 62  A PRO 82  A ? PRO 63  A 1 1.65 
2 LYS 311 A . ? LYS 292 A PRO 312 A ? PRO 293 A 1 2.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 3 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
AA 8 9 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 55  ? VAL A 56  ? PHE A 36  VAL A 37  
AA 2 LEU A 479 ? ALA A 481 ? LEU A 460 ALA A 462 
AA 3 ARG A 386 ? VAL A 390 ? ARG A 367 VAL A 371 
AA 4 ILE A 365 ? GLY A 369 ? ILE A 346 GLY A 350 
AA 5 CYS A 67  ? PHE A 70  ? CYS A 48  PHE A 51  
AA 6 LYS A 263 ? ALA A 267 ? LYS A 244 ALA A 248 
AA 7 LEU A 304 ? VAL A 307 ? LEU A 285 VAL A 288 
AA 8 TYR A 346 ? GLY A 348 ? TYR A 327 GLY A 329 
AA 9 LEU A 321 ? GLN A 323 ? LEU A 302 GLN A 304 
AB 1 LEU A 60  ? ALA A 61  ? LEU A 41  ALA A 42  
AB 2 LEU A 495 ? PHE A 496 ? LEU A 476 PHE A 477 
AC 1 ASN A 145 ? PHE A 146 ? ASN A 126 PHE A 127 
AC 2 LEU A 137 ? HIS A 142 ? LEU A 118 HIS A 123 
AC 3 ASN A 127 ? VAL A 131 ? ASN A 108 VAL A 112 
AC 4 VAL A 120 ? ASP A 122 ? VAL A 101 ASP A 103 
AC 5 PHE A 169 ? ILE A 171 ? PHE A 150 ILE A 152 
AD 1 THR A 198 ? SER A 199 ? THR A 179 SER A 180 
AD 2 GLY A 203 ? ASP A 206 ? GLY A 184 ASP A 187 
AD 3 LEU A 209 ? SER A 212 ? LEU A 190 SER A 193 
AE 1 ARG A 461 ? SER A 462 ? ARG A 442 SER A 443 
AE 2 ARG A 465 ? GLN A 466 ? ARG A 446 GLN A 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N PHE A 55  ? N PHE A 36  O TYR A 480 ? O TYR A 461 
AA 2 3 N LEU A 479 ? N LEU A 460 O THR A 387 ? O THR A 368 
AA 3 4 N ARG A 386 ? N ARG A 367 O ILE A 365 ? O ILE A 346 
AA 4 5 N LEU A 366 ? N LEU A 347 O CYS A 67  ? O CYS A 48  
AA 5 6 N PHE A 68  ? N PHE A 49  O LYS A 263 ? O LYS A 244 
AA 6 7 N LEU A 266 ? N LEU A 247 O LEU A 304 ? O LEU A 285 
AA 7 8 N VAL A 307 ? N VAL A 288 O TYR A 346 ? O TYR A 327 
AA 8 9 N SER A 347 ? N SER A 328 O ARG A 322 ? O ARG A 303 
AB 1 2 N LEU A 60  ? N LEU A 41  O PHE A 496 ? O PHE A 477 
AC 1 2 N ASN A 145 ? N ASN A 126 O HIS A 142 ? O HIS A 123 
AC 2 3 N ALA A 141 ? N ALA A 122 O LEU A 128 ? O LEU A 109 
AC 3 4 N LEU A 129 ? N LEU A 110 O VAL A 120 ? O VAL A 101 
AC 4 5 N PHE A 121 ? N PHE A 102 O TYR A 170 ? O TYR A 151 
AD 1 2 N THR A 198 ? N THR A 179 O LYS A 205 ? O LYS A 186 
AD 2 3 N ASP A 206 ? N ASP A 187 O LEU A 209 ? O LEU A 190 
AE 1 2 N SER A 462 ? N SER A 443 O ARG A 465 ? O ARG A 446 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A1490' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 A1491' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A1492' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A1493' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A1494' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A1495' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A1496'  
AC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A1489' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ARG A 163 ? ARG A 144  . ? 1_555 ? 
2  AC1 7 GLN A 472 ? GLN A 453  . ? 1_555 ? 
3  AC1 7 ARG A 475 ? ARG A 456  . ? 1_555 ? 
4  AC1 7 TYR A 476 ? TYR A 457  . ? 1_555 ? 
5  AC1 7 HOH J .   ? HOH A 2376 . ? 1_555 ? 
6  AC1 7 HOH J .   ? HOH A 2438 . ? 1_555 ? 
7  AC1 7 HOH J .   ? HOH A 2439 . ? 1_555 ? 
8  AC2 9 ASN A 269 ? ASN A 250  . ? 1_555 ? 
9  AC2 9 HOH J .   ? HOH A 2064 . ? 1_555 ? 
10 AC2 9 HOH J .   ? HOH A 2365 . ? 1_555 ? 
11 AC2 9 HOH J .   ? HOH A 2369 . ? 1_555 ? 
12 AC2 9 HOH J .   ? HOH A 2440 . ? 1_555 ? 
13 AC2 9 HOH J .   ? HOH A 2441 . ? 1_555 ? 
14 AC2 9 HOH J .   ? HOH A 2442 . ? 1_555 ? 
15 AC2 9 HOH J .   ? HOH A 2443 . ? 1_555 ? 
16 AC2 9 HOH J .   ? HOH A 2444 . ? 1_555 ? 
17 AC3 5 LYS A 44  ? LYS A 25   . ? 1_555 ? 
18 AC3 5 ARG A 47  ? ARG A 28   . ? 1_555 ? 
19 AC3 5 ARG A 48  ? ARG A 29   . ? 1_555 ? 
20 AC3 5 TYR A 494 ? TYR A 475  . ? 1_555 ? 
21 AC3 5 ARG A 497 ? ARG A 478  . ? 1_555 ? 
22 AC4 3 ASN A 136 ? ASN A 117  . ? 1_555 ? 
23 AC4 3 LYS A 363 ? LYS A 344  . ? 1_555 ? 
24 AC4 3 ARG A 465 ? ARG A 446  . ? 1_555 ? 
25 AC5 4 GLY A 149 ? GLY A 130  . ? 1_555 ? 
26 AC5 4 PRO A 150 ? PRO A 131  . ? 1_555 ? 
27 AC5 4 ARG A 153 ? ARG A 134  . ? 1_555 ? 
28 AC5 4 LYS A 159 ? LYS A 140  . ? 1_555 ? 
29 AC6 2 ARG A 95  ? ARG A 76   . ? 1_555 ? 
30 AC6 2 TRP A 226 ? TRP A 207  . ? 1_555 ? 
31 AC7 6 ASP A 71  ? ASP A 52   . ? 1_555 ? 
32 AC7 6 ASP A 73  ? ASP A 54   . ? 1_555 ? 
33 AC7 6 ASP A 370 ? ASP A 351  . ? 1_555 ? 
34 AC7 6 HOH J .   ? HOH A 2365 . ? 1_555 ? 
35 AC7 6 HOH J .   ? HOH A 2369 . ? 1_555 ? 
36 AC7 6 HOH J .   ? HOH A 2443 . ? 1_555 ? 
37 AC8 8 PRO A 115 ? PRO A 96   . ? 1_555 ? 
38 AC8 8 GLU A 393 ? GLU A 374  . ? 1_555 ? 
39 AC8 8 GLU A 397 ? GLU A 378  . ? 1_555 ? 
40 AC8 8 TYR A 453 ? TYR A 434  . ? 1_555 ? 
41 AC8 8 HOH J .   ? HOH A 2384 . ? 1_555 ? 
42 AC8 8 HOH J .   ? HOH A 2435 . ? 1_555 ? 
43 AC8 8 HOH J .   ? HOH A 2436 . ? 1_555 ? 
44 AC8 8 HOH J .   ? HOH A 2437 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2J2C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2J2C 
_atom_sites.fract_transf_matrix[1][1]   0.010933 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007810 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007668 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 22  ? -8.708  37.396 32.829 1.00 15.05 ? 3    THR A N   1 
ATOM   2    C  CA  . THR A 1 22  ? -7.284  37.455 33.312 1.00 14.87 ? 3    THR A CA  1 
ATOM   3    C  C   . THR A 1 22  ? -7.020  36.544 34.529 1.00 14.17 ? 3    THR A C   1 
ATOM   4    O  O   . THR A 1 22  ? -7.324  36.903 35.685 1.00 15.63 ? 3    THR A O   1 
ATOM   5    C  CB  . THR A 1 22  ? -6.852  38.882 33.714 1.00 15.08 ? 3    THR A CB  1 
ATOM   6    O  OG1 . THR A 1 22  ? -7.209  39.819 32.686 1.00 17.54 ? 3    THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 22  ? -5.358  38.932 33.928 1.00 15.15 ? 3    THR A CG2 1 
ATOM   8    N  N   . SER A 1 23  ? -6.401  35.397 34.294 1.00 11.56 ? 4    SER A N   1 
ATOM   9    C  CA  . SER A 1 23  ? -6.107  34.508 35.391 1.00 9.17  ? 4    SER A CA  1 
ATOM   10   C  C   . SER A 1 23  ? -4.765  34.840 36.064 1.00 8.37  ? 4    SER A C   1 
ATOM   11   O  O   . SER A 1 23  ? -3.962  35.628 35.548 1.00 8.29  ? 4    SER A O   1 
ATOM   12   C  CB  . SER A 1 23  ? -6.097  33.091 34.876 1.00 8.59  ? 4    SER A CB  1 
ATOM   13   O  OG  . SER A 1 23  ? -4.895  32.873 34.178 1.00 6.56  ? 4    SER A OG  1 
ATOM   14   N  N   . TRP A 1 24  ? -4.502  34.206 37.201 1.00 7.15  ? 5    TRP A N   1 
ATOM   15   C  CA  . TRP A 1 24  ? -3.230  34.393 37.901 1.00 6.14  ? 5    TRP A CA  1 
ATOM   16   C  C   . TRP A 1 24  ? -2.034  33.971 37.045 1.00 6.21  ? 5    TRP A C   1 
ATOM   17   O  O   . TRP A 1 24  ? -0.966  34.572 37.133 1.00 5.26  ? 5    TRP A O   1 
ATOM   18   C  CB  . TRP A 1 24  ? -3.229  33.666 39.264 1.00 5.62  ? 5    TRP A CB  1 
ATOM   19   C  CG  . TRP A 1 24  ? -3.800  32.241 39.260 1.00 4.99  ? 5    TRP A CG  1 
ATOM   20   C  CD1 . TRP A 1 24  ? -5.068  31.870 39.595 1.00 4.21  ? 5    TRP A CD1 1 
ATOM   21   C  CD2 . TRP A 1 24  ? -3.097  31.026 38.950 1.00 3.09  ? 5    TRP A CD2 1 
ATOM   22   N  NE1 . TRP A 1 24  ? -5.206  30.511 39.502 1.00 2.78  ? 5    TRP A NE1 1 
ATOM   23   C  CE2 . TRP A 1 24  ? -4.013  29.967 39.104 1.00 3.76  ? 5    TRP A CE2 1 
ATOM   24   C  CE3 . TRP A 1 24  ? -1.774  30.734 38.563 1.00 4.63  ? 5    TRP A CE3 1 
ATOM   25   C  CZ2 . TRP A 1 24  ? -3.656  28.615 38.898 1.00 4.62  ? 5    TRP A CZ2 1 
ATOM   26   C  CZ3 . TRP A 1 24  ? -1.417  29.395 38.349 1.00 3.93  ? 5    TRP A CZ3 1 
ATOM   27   C  CH2 . TRP A 1 24  ? -2.368  28.357 38.498 1.00 4.44  ? 5    TRP A CH2 1 
ATOM   28   N  N   . SER A 1 25  ? -2.219  32.974 36.175 1.00 6.04  ? 6    SER A N   1 
ATOM   29   C  CA  . SER A 1 25  ? -1.109  32.570 35.298 1.00 5.61  ? 6    SER A CA  1 
ATOM   30   C  C   . SER A 1 25  ? -0.845  33.602 34.187 1.00 6.29  ? 6    SER A C   1 
ATOM   31   O  O   . SER A 1 25  ? 0.309   33.737 33.724 1.00 5.84  ? 6    SER A O   1 
ATOM   32   C  CB  . SER A 1 25  ? -1.312  31.137 34.746 1.00 4.75  ? 6    SER A CB  1 
ATOM   33   O  OG  . SER A 1 25  ? -2.286  31.113 33.731 1.00 3.36  ? 6    SER A OG  1 
ATOM   34   N  N   . ASP A 1 26  ? -1.908  34.306 33.760 1.00 6.36  ? 7    ASP A N   1 
ATOM   35   C  CA  . ASP A 1 26  ? -1.793  35.391 32.782 1.00 7.28  ? 7    ASP A CA  1 
ATOM   36   C  C   . ASP A 1 26  ? -0.921  36.492 33.369 1.00 7.48  ? 7    ASP A C   1 
ATOM   37   O  O   . ASP A 1 26  ? 0.007   36.965 32.717 1.00 7.95  ? 7    ASP A O   1 
ATOM   38   C  CB  . ASP A 1 26  ? -3.164  35.976 32.392 1.00 6.87  ? 7    ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 26  ? -3.992  35.034 31.509 1.00 9.64  ? 7    ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 26  ? -3.423  34.118 30.884 1.00 11.48 ? 7    ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 26  ? -5.225  35.229 31.404 1.00 10.28 ? 7    ASP A OD2 1 
ATOM   42   N  N   . ARG A 1 27  ? -1.218  36.887 34.606 1.00 7.98  ? 8    ARG A N   1 
ATOM   43   C  CA  . ARG A 1 27  ? -0.376  37.839 35.349 1.00 9.05  ? 8    ARG A CA  1 
ATOM   44   C  C   . ARG A 1 27  ? 1.075   37.354 35.443 1.00 8.93  ? 8    ARG A C   1 
ATOM   45   O  O   . ARG A 1 27  ? 2.006   38.114 35.200 1.00 9.26  ? 8    ARG A O   1 
ATOM   46   C  CB  . ARG A 1 27  ? -0.916  38.037 36.772 1.00 9.58  ? 8    ARG A CB  1 
ATOM   47   C  CG  . ARG A 1 27  ? -2.355  38.459 36.832 1.00 10.12 ? 8    ARG A CG  1 
ATOM   48   C  CD  . ARG A 1 27  ? -2.463  39.902 36.434 1.00 14.29 ? 8    ARG A CD  1 
ATOM   49   N  NE  . ARG A 1 27  ? -3.821  40.408 36.632 1.00 16.35 ? 8    ARG A NE  1 
ATOM   50   C  CZ  . ARG A 1 27  ? -4.253  41.593 36.219 1.00 17.92 ? 8    ARG A CZ  1 
ATOM   51   N  NH1 . ARG A 1 27  ? -3.444  42.422 35.561 1.00 17.47 ? 8    ARG A NH1 1 
ATOM   52   N  NH2 . ARG A 1 27  ? -5.513  41.937 36.448 1.00 19.11 ? 8    ARG A NH2 1 
ATOM   53   N  N   . LEU A 1 28  ? 1.257   36.085 35.804 1.00 8.29  ? 9    LEU A N   1 
ATOM   54   C  CA  . LEU A 1 28  ? 2.601   35.540 35.939 1.00 8.02  ? 9    LEU A CA  1 
ATOM   55   C  C   . LEU A 1 28  ? 3.351   35.552 34.603 1.00 7.14  ? 9    LEU A C   1 
ATOM   56   O  O   . LEU A 1 28  ? 4.529   35.908 34.561 1.00 7.56  ? 9    LEU A O   1 
ATOM   57   C  CB  . LEU A 1 28  ? 2.574   34.124 36.535 1.00 7.38  ? 9    LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 28  ? 2.199   34.013 38.035 1.00 9.91  ? 9    LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 28  ? 1.983   32.569 38.451 1.00 5.31  ? 9    LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 28  ? 3.255   34.655 38.948 1.00 9.00  ? 9    LEU A CD2 1 
ATOM   61   N  N   . GLN A 1 29  ? 2.671   35.181 33.521 1.00 6.83  ? 10   GLN A N   1 
ATOM   62   C  CA  . GLN A 1 29  ? 3.289   35.170 32.189 1.00 7.55  ? 10   GLN A CA  1 
ATOM   63   C  C   . GLN A 1 29  ? 3.608   36.591 31.690 1.00 7.80  ? 10   GLN A C   1 
ATOM   64   O  O   . GLN A 1 29  ? 4.626   36.782 31.016 1.00 7.40  ? 10   GLN A O   1 
ATOM   65   C  CB  . GLN A 1 29  ? 2.445   34.419 31.155 1.00 7.27  ? 10   GLN A CB  1 
ATOM   66   C  CG  . GLN A 1 29  ? 3.164   34.252 29.772 1.00 9.00  ? 10   GLN A CG  1 
ATOM   67   C  CD  . GLN A 1 29  ? 4.458   33.410 29.879 1.00 11.77 ? 10   GLN A CD  1 
ATOM   68   O  OE1 . GLN A 1 29  ? 4.427   32.244 30.292 1.00 11.98 ? 10   GLN A OE1 1 
ATOM   69   N  NE2 . GLN A 1 29  ? 5.588   34.005 29.508 1.00 11.09 ? 10   GLN A NE2 1 
ATOM   70   N  N   . ASN A 1 30  ? 2.751   37.565 32.014 1.00 8.14  ? 11   ASN A N   1 
ATOM   71   C  CA  . ASN A 1 30  ? 3.000   38.961 31.619 1.00 9.54  ? 11   ASN A CA  1 
ATOM   72   C  C   . ASN A 1 30  ? 4.288   39.456 32.277 1.00 9.33  ? 11   ASN A C   1 
ATOM   73   O  O   . ASN A 1 30  ? 5.127   40.070 31.632 1.00 9.56  ? 11   ASN A O   1 
ATOM   74   C  CB  . ASN A 1 30  ? 1.815   39.886 31.957 1.00 9.75  ? 11   ASN A CB  1 
ATOM   75   C  CG  . ASN A 1 30  ? 0.568   39.619 31.078 1.00 13.21 ? 11   ASN A CG  1 
ATOM   76   O  OD1 . ASN A 1 30  ? 0.641   38.965 30.030 1.00 14.62 ? 11   ASN A OD1 1 
ATOM   77   N  ND2 . ASN A 1 30  ? -0.585  40.146 31.514 1.00 15.65 ? 11   ASN A ND2 1 
ATOM   78   N  N   . ALA A 1 31  ? 4.464   39.128 33.548 1.00 9.51  ? 12   ALA A N   1 
ATOM   79   C  CA  . ALA A 1 31  ? 5.691   39.496 34.250 1.00 10.03 ? 12   ALA A CA  1 
ATOM   80   C  C   . ALA A 1 31  ? 6.920   38.697 33.756 1.00 10.55 ? 12   ALA A C   1 
ATOM   81   O  O   . ALA A 1 31  ? 8.047   39.247 33.682 1.00 10.53 ? 12   ALA A O   1 
ATOM   82   C  CB  . ALA A 1 31  ? 5.514   39.352 35.757 1.00 9.46  ? 12   ALA A CB  1 
ATOM   83   N  N   . ALA A 1 32  ? 6.705   37.410 33.443 1.00 9.96  ? 13   ALA A N   1 
ATOM   84   C  CA  . ALA A 1 32  ? 7.763   36.545 32.922 1.00 10.18 ? 13   ALA A CA  1 
ATOM   85   C  C   . ALA A 1 32  ? 8.305   37.081 31.588 1.00 10.49 ? 13   ALA A C   1 
ATOM   86   O  O   . ALA A 1 32  ? 9.484   36.938 31.278 1.00 10.93 ? 13   ALA A O   1 
ATOM   87   C  CB  . ALA A 1 32  ? 7.256   35.110 32.760 1.00 9.39  ? 13   ALA A CB  1 
ATOM   88   N  N   . ASP A 1 33  ? 7.433   37.688 30.793 1.00 10.76 ? 14   ASP A N   1 
ATOM   89   C  CA  . ASP A 1 33  ? 7.813   38.226 29.485 1.00 11.43 ? 14   ASP A CA  1 
ATOM   90   C  C   . ASP A 1 33  ? 8.770   39.421 29.555 1.00 11.78 ? 14   ASP A C   1 
ATOM   91   O  O   . ASP A 1 33  ? 9.429   39.761 28.561 1.00 11.58 ? 14   ASP A O   1 
ATOM   92   C  CB  . ASP A 1 33  ? 6.564   38.661 28.718 1.00 11.84 ? 14   ASP A CB  1 
ATOM   93   C  CG  . ASP A 1 33  ? 5.743   37.486 28.194 1.00 12.74 ? 14   ASP A CG  1 
ATOM   94   O  OD1 . ASP A 1 33  ? 6.213   36.321 28.211 1.00 11.91 ? 14   ASP A OD1 1 
ATOM   95   O  OD2 . ASP A 1 33  ? 4.609   37.751 27.741 1.00 16.27 ? 14   ASP A OD2 1 
ATOM   96   N  N   A MET A 1 34  ? 8.847   40.057 30.717 0.50 11.78 ? 15   MET A N   1 
ATOM   97   N  N   B MET A 1 34  ? 8.831   40.064 30.721 0.50 11.67 ? 15   MET A N   1 
ATOM   98   C  CA  A MET A 1 34  ? 9.679   41.243 30.856 0.50 12.36 ? 15   MET A CA  1 
ATOM   99   C  CA  B MET A 1 34  ? 9.664   41.255 30.906 0.50 11.95 ? 15   MET A CA  1 
ATOM   100  C  C   A MET A 1 34  ? 11.138  40.893 31.146 0.50 11.89 ? 15   MET A C   1 
ATOM   101  C  C   B MET A 1 34  ? 11.137  40.886 31.150 0.50 11.77 ? 15   MET A C   1 
ATOM   102  O  O   A MET A 1 34  ? 11.420  40.017 31.972 0.50 11.32 ? 15   MET A O   1 
ATOM   103  O  O   B MET A 1 34  ? 11.429  39.987 31.947 0.50 11.15 ? 15   MET A O   1 
ATOM   104  C  CB  A MET A 1 34  ? 9.129   42.149 31.943 0.50 12.28 ? 15   MET A CB  1 
ATOM   105  C  CB  B MET A 1 34  ? 9.140   42.109 32.067 0.50 12.29 ? 15   MET A CB  1 
ATOM   106  C  CG  A MET A 1 34  ? 7.763   42.696 31.621 0.50 12.77 ? 15   MET A CG  1 
ATOM   107  C  CG  B MET A 1 34  ? 7.686   42.577 31.926 0.50 13.82 ? 15   MET A CG  1 
ATOM   108  S  SD  A MET A 1 34  ? 7.004   43.256 33.134 0.50 14.83 ? 15   MET A SD  1 
ATOM   109  S  SD  B MET A 1 34  ? 7.326   43.578 30.469 0.50 18.35 ? 15   MET A SD  1 
ATOM   110  C  CE  A MET A 1 34  ? 7.749   44.894 33.303 0.50 15.73 ? 15   MET A CE  1 
ATOM   111  C  CE  B MET A 1 34  ? 8.188   45.110 30.851 0.50 18.38 ? 15   MET A CE  1 
ATOM   112  N  N   . PRO A 1 35  ? 12.070  41.572 30.457 1.00 11.41 ? 16   PRO A N   1 
ATOM   113  C  CA  . PRO A 1 35  ? 13.492  41.367 30.756 1.00 11.31 ? 16   PRO A CA  1 
ATOM   114  C  C   . PRO A 1 35  ? 13.852  41.964 32.116 1.00 11.05 ? 16   PRO A C   1 
ATOM   115  O  O   . PRO A 1 35  ? 13.188  42.883 32.600 1.00 11.13 ? 16   PRO A O   1 
ATOM   116  C  CB  . PRO A 1 35  ? 14.223  42.101 29.615 1.00 11.51 ? 16   PRO A CB  1 
ATOM   117  C  CG  . PRO A 1 35  ? 13.243  43.124 29.113 1.00 12.16 ? 16   PRO A CG  1 
ATOM   118  C  CD  . PRO A 1 35  ? 11.855  42.541 29.357 1.00 12.31 ? 16   PRO A CD  1 
ATOM   119  N  N   . ALA A 1 36  ? 14.874  41.411 32.748 1.00 10.82 ? 17   ALA A N   1 
ATOM   120  C  CA  . ALA A 1 36  ? 15.381  41.957 34.002 1.00 9.85  ? 17   ALA A CA  1 
ATOM   121  C  C   . ALA A 1 36  ? 16.176  43.251 33.758 1.00 9.23  ? 17   ALA A C   1 
ATOM   122  O  O   . ALA A 1 36  ? 17.162  43.242 33.041 1.00 8.82  ? 17   ALA A O   1 
ATOM   123  C  CB  . ALA A 1 36  ? 16.259  40.920 34.679 1.00 9.70  ? 17   ALA A CB  1 
ATOM   124  N  N   . ASN A 1 37  ? 15.737  44.349 34.376 1.00 8.76  ? 18   ASN A N   1 
ATOM   125  C  CA  . ASN A 1 37  ? 16.550  45.558 34.505 1.00 7.78  ? 18   ASN A CA  1 
ATOM   126  C  C   . ASN A 1 37  ? 17.204  45.483 35.885 1.00 7.16  ? 18   ASN A C   1 
ATOM   127  O  O   . ASN A 1 37  ? 16.531  45.695 36.898 1.00 7.63  ? 18   ASN A O   1 
ATOM   128  C  CB  . ASN A 1 37  ? 15.691  46.837 34.320 1.00 6.97  ? 18   ASN A CB  1 
ATOM   129  C  CG  . ASN A 1 37  ? 16.492  48.135 34.471 1.00 8.59  ? 18   ASN A CG  1 
ATOM   130  O  OD1 . ASN A 1 37  ? 17.702  48.121 34.734 1.00 8.65  ? 18   ASN A OD1 1 
ATOM   131  N  ND2 . ASN A 1 37  ? 15.812  49.274 34.291 1.00 5.86  ? 18   ASN A ND2 1 
ATOM   132  N  N   . MET A 1 38  ? 18.507  45.195 35.918 1.00 6.15  ? 19   MET A N   1 
ATOM   133  C  CA  . MET A 1 38  ? 19.235  45.009 37.182 1.00 5.67  ? 19   MET A CA  1 
ATOM   134  C  C   . MET A 1 38  ? 19.840  46.289 37.792 1.00 5.45  ? 19   MET A C   1 
ATOM   135  O  O   . MET A 1 38  ? 20.584  46.237 38.788 1.00 5.29  ? 19   MET A O   1 
ATOM   136  C  CB  . MET A 1 38  ? 20.281  43.876 37.062 1.00 5.85  ? 19   MET A CB  1 
ATOM   137  C  CG  . MET A 1 38  ? 19.702  42.482 36.698 1.00 4.25  ? 19   MET A CG  1 
ATOM   138  S  SD  . MET A 1 38  ? 18.516  41.864 37.914 1.00 6.72  ? 19   MET A SD  1 
ATOM   139  C  CE  . MET A 1 38  ? 19.622  41.397 39.256 1.00 6.04  ? 19   MET A CE  1 
ATOM   140  N  N   . ASP A 1 39  ? 19.503  47.432 37.210 1.00 5.16  ? 20   ASP A N   1 
ATOM   141  C  CA  . ASP A 1 39  ? 19.848  48.719 37.784 1.00 5.57  ? 20   ASP A CA  1 
ATOM   142  C  C   . ASP A 1 39  ? 19.258  48.741 39.174 1.00 6.22  ? 20   ASP A C   1 
ATOM   143  O  O   . ASP A 1 39  ? 18.088  48.412 39.358 1.00 5.51  ? 20   ASP A O   1 
ATOM   144  C  CB  . ASP A 1 39  ? 19.280  49.865 36.942 1.00 5.42  ? 20   ASP A CB  1 
ATOM   145  C  CG  . ASP A 1 39  ? 19.492  51.232 37.598 1.00 5.48  ? 20   ASP A CG  1 
ATOM   146  O  OD1 . ASP A 1 39  ? 20.541  51.859 37.364 1.00 5.15  ? 20   ASP A OD1 1 
ATOM   147  O  OD2 . ASP A 1 39  ? 18.607  51.690 38.353 1.00 8.62  ? 20   ASP A OD2 1 
ATOM   148  N  N   . LYS A 1 40  ? 20.079  49.097 40.159 1.00 7.60  ? 21   LYS A N   1 
ATOM   149  C  CA  . LYS A 1 40  ? 19.711  48.893 41.546 1.00 9.51  ? 21   LYS A CA  1 
ATOM   150  C  C   . LYS A 1 40  ? 18.496  49.742 41.969 1.00 9.01  ? 21   LYS A C   1 
ATOM   151  O  O   . LYS A 1 40  ? 17.692  49.319 42.800 1.00 8.31  ? 21   LYS A O   1 
ATOM   152  C  CB  . LYS A 1 40  ? 20.923  49.107 42.464 1.00 10.42 ? 21   LYS A CB  1 
ATOM   153  C  CG  . LYS A 1 40  ? 22.005  47.994 42.302 1.00 12.22 ? 21   LYS A CG  1 
ATOM   154  C  CD  . LYS A 1 40  ? 22.927  47.924 43.537 1.00 12.94 ? 21   LYS A CD  1 
ATOM   155  C  CE  . LYS A 1 40  ? 24.314  47.336 43.213 1.00 17.67 ? 21   LYS A CE  1 
ATOM   156  N  NZ  . LYS A 1 40  ? 24.243  46.078 42.395 1.00 16.96 ? 21   LYS A NZ  1 
ATOM   157  N  N   . HIS A 1 41  ? 18.348  50.909 41.351 1.00 8.76  ? 22   HIS A N   1 
ATOM   158  C  CA  . HIS A 1 41  ? 17.188  51.761 41.596 1.00 9.13  ? 22   HIS A CA  1 
ATOM   159  C  C   . HIS A 1 41  ? 15.937  51.212 40.939 1.00 7.94  ? 22   HIS A C   1 
ATOM   160  O  O   . HIS A 1 41  ? 14.851  51.283 41.521 1.00 7.62  ? 22   HIS A O   1 
ATOM   161  C  CB  . HIS A 1 41  ? 17.450  53.197 41.143 1.00 9.47  ? 22   HIS A CB  1 
ATOM   162  C  CG  . HIS A 1 41  ? 18.498  53.885 41.945 1.00 13.36 ? 22   HIS A CG  1 
ATOM   163  N  ND1 . HIS A 1 41  ? 19.537  54.581 41.368 1.00 18.04 ? 22   HIS A ND1 1 
ATOM   164  C  CD2 . HIS A 1 41  ? 18.673  53.986 43.285 1.00 17.09 ? 22   HIS A CD2 1 
ATOM   165  C  CE1 . HIS A 1 41  ? 20.298  55.098 42.319 1.00 20.32 ? 22   HIS A CE1 1 
ATOM   166  N  NE2 . HIS A 1 41  ? 19.800  54.745 43.491 1.00 19.25 ? 22   HIS A NE2 1 
ATOM   167  N  N   . ALA A 1 42  ? 16.092  50.668 39.735 1.00 7.12  ? 23   ALA A N   1 
ATOM   168  C  CA  . ALA A 1 42  ? 14.995  49.997 39.057 1.00 7.39  ? 23   ALA A CA  1 
ATOM   169  C  C   . ALA A 1 42  ? 14.495  48.824 39.903 1.00 7.48  ? 23   ALA A C   1 
ATOM   170  O  O   . ALA A 1 42  ? 13.284  48.607 40.021 1.00 8.00  ? 23   ALA A O   1 
ATOM   171  C  CB  . ALA A 1 42  ? 15.422  49.523 37.660 1.00 6.85  ? 23   ALA A CB  1 
ATOM   172  N  N   . LEU A 1 43  ? 15.425  48.089 40.504 1.00 7.28  ? 24   LEU A N   1 
ATOM   173  C  CA  . LEU A 1 43  ? 15.076  46.923 41.324 1.00 7.84  ? 24   LEU A CA  1 
ATOM   174  C  C   . LEU A 1 43  ? 14.271  47.294 42.567 1.00 8.62  ? 24   LEU A C   1 
ATOM   175  O  O   . LEU A 1 43  ? 13.281  46.622 42.901 1.00 8.29  ? 24   LEU A O   1 
ATOM   176  C  CB  . LEU A 1 43  ? 16.330  46.118 41.731 1.00 7.06  ? 24   LEU A CB  1 
ATOM   177  C  CG  . LEU A 1 43  ? 17.067  45.366 40.620 1.00 5.94  ? 24   LEU A CG  1 
ATOM   178  C  CD1 . LEU A 1 43  ? 18.333  44.728 41.168 1.00 4.90  ? 24   LEU A CD1 1 
ATOM   179  C  CD2 . LEU A 1 43  ? 16.178  44.309 39.956 1.00 3.45  ? 24   LEU A CD2 1 
ATOM   180  N  N   . LYS A 1 44  ? 14.714  48.348 43.250 1.00 9.46  ? 25   LYS A N   1 
ATOM   181  C  CA  . LYS A 1 44  ? 14.061  48.785 44.467 1.00 11.24 ? 25   LYS A CA  1 
ATOM   182  C  C   . LYS A 1 44  ? 12.622  49.209 44.167 1.00 11.50 ? 25   LYS A C   1 
ATOM   183  O  O   . LYS A 1 44  ? 11.685  48.838 44.894 1.00 11.77 ? 25   LYS A O   1 
ATOM   184  C  CB  . LYS A 1 44  ? 14.831  49.919 45.123 1.00 10.98 ? 25   LYS A CB  1 
ATOM   185  C  CG  . LYS A 1 44  ? 14.275  50.309 46.471 1.00 13.28 ? 25   LYS A CG  1 
ATOM   186  C  CD  . LYS A 1 44  ? 15.246  51.225 47.196 1.00 17.97 ? 25   LYS A CD  1 
ATOM   187  C  CE  . LYS A 1 44  ? 15.310  50.890 48.686 1.00 21.98 ? 25   LYS A CE  1 
ATOM   188  N  NZ  . LYS A 1 44  ? 16.316  51.734 49.431 1.00 24.74 ? 25   LYS A NZ  1 
ATOM   189  N  N   . LYS A 1 45  ? 12.453  49.955 43.083 1.00 11.32 ? 26   LYS A N   1 
ATOM   190  C  CA  . LYS A 1 45  ? 11.132  50.432 42.694 1.00 12.04 ? 26   LYS A CA  1 
ATOM   191  C  C   . LYS A 1 45  ? 10.203  49.257 42.331 1.00 11.53 ? 26   LYS A C   1 
ATOM   192  O  O   . LYS A 1 45  ? 9.045   49.224 42.744 1.00 11.44 ? 26   LYS A O   1 
ATOM   193  C  CB  . LYS A 1 45  ? 11.265  51.450 41.560 1.00 12.36 ? 26   LYS A CB  1 
ATOM   194  C  CG  . LYS A 1 45  ? 9.964   52.073 41.110 1.00 15.82 ? 26   LYS A CG  1 
ATOM   195  C  CD  . LYS A 1 45  ? 10.220  53.264 40.183 1.00 20.02 ? 26   LYS A CD  1 
ATOM   196  C  CE  . LYS A 1 45  ? 9.078   53.438 39.176 1.00 22.98 ? 26   LYS A CE  1 
ATOM   197  N  NZ  . LYS A 1 45  ? 9.271   54.659 38.315 1.00 23.73 ? 26   LYS A NZ  1 
ATOM   198  N  N   . TYR A 1 46  ? 10.729  48.284 41.594 1.00 11.06 ? 27   TYR A N   1 
ATOM   199  C  CA  . TYR A 1 46  ? 9.933   47.153 41.130 1.00 11.79 ? 27   TYR A CA  1 
ATOM   200  C  C   . TYR A 1 46  ? 9.387   46.310 42.320 1.00 11.79 ? 27   TYR A C   1 
ATOM   201  O  O   . TYR A 1 46  ? 8.203   46.008 42.367 1.00 11.81 ? 27   TYR A O   1 
ATOM   202  C  CB  . TYR A 1 46  ? 10.756  46.300 40.140 1.00 11.67 ? 27   TYR A CB  1 
ATOM   203  C  CG  . TYR A 1 46  ? 9.948   45.477 39.150 1.00 12.30 ? 27   TYR A CG  1 
ATOM   204  C  CD1 . TYR A 1 46  ? 9.151   46.098 38.173 1.00 13.63 ? 27   TYR A CD1 1 
ATOM   205  C  CD2 . TYR A 1 46  ? 10.026  44.080 39.151 1.00 13.06 ? 27   TYR A CD2 1 
ATOM   206  C  CE1 . TYR A 1 46  ? 8.437   45.360 37.256 1.00 12.77 ? 27   TYR A CE1 1 
ATOM   207  C  CE2 . TYR A 1 46  ? 9.313   43.317 38.234 1.00 13.57 ? 27   TYR A CE2 1 
ATOM   208  C  CZ  . TYR A 1 46  ? 8.514   43.962 37.294 1.00 14.39 ? 27   TYR A CZ  1 
ATOM   209  O  OH  . TYR A 1 46  ? 7.788   43.213 36.387 1.00 14.40 ? 27   TYR A OH  1 
ATOM   210  N  N   . ARG A 1 47  ? 10.245  45.998 43.288 1.00 12.00 ? 28   ARG A N   1 
ATOM   211  C  CA  . ARG A 1 47  ? 9.888   45.152 44.435 1.00 12.42 ? 28   ARG A CA  1 
ATOM   212  C  C   . ARG A 1 47  ? 8.974   45.834 45.460 1.00 14.31 ? 28   ARG A C   1 
ATOM   213  O  O   . ARG A 1 47  ? 8.477   45.166 46.379 1.00 14.98 ? 28   ARG A O   1 
ATOM   214  C  CB  . ARG A 1 47  ? 11.149  44.617 45.134 1.00 12.65 ? 28   ARG A CB  1 
ATOM   215  C  CG  . ARG A 1 47  ? 11.928  45.641 46.013 1.00 9.74  ? 28   ARG A CG  1 
ATOM   216  C  CD  . ARG A 1 47  ? 13.250  45.053 46.505 1.00 10.03 ? 28   ARG A CD  1 
ATOM   217  N  NE  . ARG A 1 47  ? 13.993  45.968 47.369 1.00 6.03  ? 28   ARG A NE  1 
ATOM   218  C  CZ  . ARG A 1 47  ? 15.243  46.403 47.159 1.00 8.81  ? 28   ARG A CZ  1 
ATOM   219  N  NH1 . ARG A 1 47  ? 15.979  45.996 46.108 1.00 6.90  ? 28   ARG A NH1 1 
ATOM   220  N  NH2 . ARG A 1 47  ? 15.777  47.258 48.023 1.00 6.49  ? 28   ARG A NH2 1 
ATOM   221  N  N   . ARG A 1 48  ? 8.763   47.145 45.308 1.00 14.92 ? 29   ARG A N   1 
ATOM   222  C  CA  . ARG A 1 48  ? 7.797   47.861 46.123 1.00 16.26 ? 29   ARG A CA  1 
ATOM   223  C  C   . ARG A 1 48  ? 6.368   47.575 45.676 1.00 15.72 ? 29   ARG A C   1 
ATOM   224  O  O   . ARG A 1 48  ? 5.428   47.726 46.469 1.00 15.95 ? 29   ARG A O   1 
ATOM   225  C  CB  . ARG A 1 48  ? 8.030   49.384 46.095 1.00 17.20 ? 29   ARG A CB  1 
ATOM   226  C  CG  . ARG A 1 48  ? 9.444   49.875 46.433 1.00 21.23 ? 29   ARG A CG  1 
ATOM   227  C  CD  . ARG A 1 48  ? 9.856   49.713 47.893 1.00 24.51 ? 29   ARG A CD  1 
ATOM   228  N  NE  . ARG A 1 48  ? 11.094  50.454 48.160 1.00 27.59 ? 29   ARG A NE  1 
ATOM   229  C  CZ  . ARG A 1 48  ? 11.176  51.562 48.902 1.00 32.77 ? 29   ARG A CZ  1 
ATOM   230  N  NH1 . ARG A 1 48  ? 10.089  52.068 49.498 1.00 34.49 ? 29   ARG A NH1 1 
ATOM   231  N  NH2 . ARG A 1 48  ? 12.356  52.163 49.080 1.00 32.67 ? 29   ARG A NH2 1 
ATOM   232  N  N   . GLU A 1 49  ? 6.198   47.206 44.406 1.00 14.79 ? 30   GLU A N   1 
ATOM   233  C  CA  . GLU A 1 49  ? 4.899   46.765 43.912 1.00 15.19 ? 30   GLU A CA  1 
ATOM   234  C  C   . GLU A 1 49  ? 4.595   45.385 44.500 1.00 12.74 ? 30   GLU A C   1 
ATOM   235  O  O   . GLU A 1 49  ? 5.429   44.495 44.425 1.00 11.52 ? 30   GLU A O   1 
ATOM   236  C  CB  . GLU A 1 49  ? 4.897   46.688 42.392 1.00 14.59 ? 30   GLU A CB  1 
ATOM   237  C  CG  . GLU A 1 49  ? 5.015   48.035 41.692 1.00 19.45 ? 30   GLU A CG  1 
ATOM   238  C  CD  . GLU A 1 49  ? 5.035   47.904 40.161 1.00 20.17 ? 30   GLU A CD  1 
ATOM   239  O  OE1 . GLU A 1 49  ? 4.112   47.255 39.583 1.00 26.36 ? 30   GLU A OE1 1 
ATOM   240  O  OE2 . GLU A 1 49  ? 5.977   48.466 39.542 1.00 27.74 ? 30   GLU A OE2 1 
ATOM   241  N  N   . ALA A 1 50  ? 3.401   45.232 45.075 1.00 11.41 ? 31   ALA A N   1 
ATOM   242  C  CA  . ALA A 1 50  ? 2.989   43.999 45.758 1.00 9.89  ? 31   ALA A CA  1 
ATOM   243  C  C   . ALA A 1 50  ? 3.265   42.770 44.901 1.00 9.48  ? 31   ALA A C   1 
ATOM   244  O  O   . ALA A 1 50  ? 3.795   41.768 45.414 1.00 8.09  ? 31   ALA A O   1 
ATOM   245  C  CB  . ALA A 1 50  ? 1.512   44.073 46.177 1.00 9.12  ? 31   ALA A CB  1 
ATOM   246  N  N   . TYR A 1 51  ? 2.991   42.894 43.586 1.00 9.24  ? 32   TYR A N   1 
ATOM   247  C  CA  . TYR A 1 51  ? 3.155   41.814 42.581 1.00 8.80  ? 32   TYR A CA  1 
ATOM   248  C  C   . TYR A 1 51  ? 4.564   41.233 42.543 1.00 7.93  ? 32   TYR A C   1 
ATOM   249  O  O   . TYR A 1 51  ? 4.741   40.031 42.277 1.00 8.40  ? 32   TYR A O   1 
ATOM   250  C  CB  . TYR A 1 51  ? 2.659   42.264 41.159 1.00 10.47 ? 32   TYR A CB  1 
ATOM   251  C  CG  . TYR A 1 51  ? 1.425   43.127 41.284 1.00 13.06 ? 32   TYR A CG  1 
ATOM   252  C  CD1 . TYR A 1 51  ? 0.187   42.554 41.628 1.00 16.91 ? 32   TYR A CD1 1 
ATOM   253  C  CD2 . TYR A 1 51  ? 1.500   44.526 41.194 1.00 15.69 ? 32   TYR A CD2 1 
ATOM   254  C  CE1 . TYR A 1 51  ? -0.961  43.351 41.831 1.00 15.34 ? 32   TYR A CE1 1 
ATOM   255  C  CE2 . TYR A 1 51  ? 0.345   45.337 41.389 1.00 16.27 ? 32   TYR A CE2 1 
ATOM   256  C  CZ  . TYR A 1 51  ? -0.881  44.731 41.709 1.00 15.53 ? 32   TYR A CZ  1 
ATOM   257  O  OH  . TYR A 1 51  ? -2.039  45.494 41.915 1.00 16.12 ? 32   TYR A OH  1 
ATOM   258  N  N   . HIS A 1 52  ? 5.555   42.070 42.854 1.00 6.23  ? 33   HIS A N   1 
ATOM   259  C  CA  . HIS A 1 52  ? 6.963   41.712 42.698 1.00 5.05  ? 33   HIS A CA  1 
ATOM   260  C  C   . HIS A 1 52  ? 7.683   41.674 44.029 1.00 4.13  ? 33   HIS A C   1 
ATOM   261  O  O   . HIS A 1 52  ? 8.907   41.573 44.088 1.00 3.78  ? 33   HIS A O   1 
ATOM   262  C  CB  . HIS A 1 52  ? 7.600   42.725 41.750 1.00 5.80  ? 33   HIS A CB  1 
ATOM   263  C  CG  . HIS A 1 52  ? 6.836   42.864 40.472 1.00 5.53  ? 33   HIS A CG  1 
ATOM   264  N  ND1 . HIS A 1 52  ? 6.331   44.068 40.027 1.00 8.50  ? 33   HIS A ND1 1 
ATOM   265  C  CD2 . HIS A 1 52  ? 6.432   41.932 39.582 1.00 3.92  ? 33   HIS A CD2 1 
ATOM   266  C  CE1 . HIS A 1 52  ? 5.700   43.877 38.883 1.00 4.82  ? 33   HIS A CE1 1 
ATOM   267  N  NE2 . HIS A 1 52  ? 5.727   42.586 38.605 1.00 7.91  ? 33   HIS A NE2 1 
ATOM   268  N  N   . ARG A 1 53  ? 6.892   41.707 45.094 1.00 2.43  ? 34   ARG A N   1 
ATOM   269  C  CA  . ARG A 1 53  ? 7.378   41.745 46.436 1.00 2.35  ? 34   ARG A CA  1 
ATOM   270  C  C   . ARG A 1 53  ? 7.512   40.328 47.020 1.00 2.00  ? 34   ARG A C   1 
ATOM   271  O  O   . ARG A 1 53  ? 6.786   39.409 46.630 1.00 2.00  ? 34   ARG A O   1 
ATOM   272  C  CB  . ARG A 1 53  ? 6.389   42.558 47.252 1.00 2.57  ? 34   ARG A CB  1 
ATOM   273  C  CG  . ARG A 1 53  ? 6.871   42.937 48.615 1.00 5.37  ? 34   ARG A CG  1 
ATOM   274  C  CD  . ARG A 1 53  ? 6.288   44.259 49.049 1.00 6.92  ? 34   ARG A CD  1 
ATOM   275  N  NE  . ARG A 1 53  ? 6.494   44.392 50.489 1.00 11.42 ? 34   ARG A NE  1 
ATOM   276  C  CZ  . ARG A 1 53  ? 5.609   44.918 51.335 1.00 12.30 ? 34   ARG A CZ  1 
ATOM   277  N  NH1 . ARG A 1 53  ? 4.452   45.381 50.876 1.00 11.52 ? 34   ARG A NH1 1 
ATOM   278  N  NH2 . ARG A 1 53  ? 5.885   44.989 52.636 1.00 11.00 ? 34   ARG A NH2 1 
ATOM   279  N  N   . VAL A 1 54  ? 8.473   40.179 47.924 1.00 2.00  ? 35   VAL A N   1 
ATOM   280  C  CA  . VAL A 1 54  ? 8.582   39.008 48.793 1.00 2.00  ? 35   VAL A CA  1 
ATOM   281  C  C   . VAL A 1 54  ? 8.036   39.417 50.189 1.00 2.56  ? 35   VAL A C   1 
ATOM   282  O  O   . VAL A 1 54  ? 8.540   40.367 50.819 1.00 2.00  ? 35   VAL A O   1 
ATOM   283  C  CB  . VAL A 1 54  ? 10.030  38.498 48.885 1.00 2.13  ? 35   VAL A CB  1 
ATOM   284  C  CG1 . VAL A 1 54  ? 10.179  37.461 50.037 1.00 2.00  ? 35   VAL A CG1 1 
ATOM   285  C  CG2 . VAL A 1 54  ? 10.492  37.916 47.524 1.00 2.00  ? 35   VAL A CG2 1 
ATOM   286  N  N   . PHE A 1 55  ? 6.998   38.700 50.635 1.00 2.00  ? 36   PHE A N   1 
ATOM   287  C  CA  . PHE A 1 55  ? 6.327   39.002 51.896 1.00 2.28  ? 36   PHE A CA  1 
ATOM   288  C  C   . PHE A 1 55  ? 6.969   38.194 53.030 1.00 2.39  ? 36   PHE A C   1 
ATOM   289  O  O   . PHE A 1 55  ? 7.496   37.095 52.806 1.00 2.00  ? 36   PHE A O   1 
ATOM   290  C  CB  . PHE A 1 55  ? 4.810   38.782 51.741 1.00 2.00  ? 36   PHE A CB  1 
ATOM   291  C  CG  . PHE A 1 55  ? 4.179   39.783 50.797 1.00 2.13  ? 36   PHE A CG  1 
ATOM   292  C  CD1 . PHE A 1 55  ? 4.014   41.102 51.195 1.00 2.00  ? 36   PHE A CD1 1 
ATOM   293  C  CD2 . PHE A 1 55  ? 3.822   39.418 49.487 1.00 2.00  ? 36   PHE A CD2 1 
ATOM   294  C  CE1 . PHE A 1 55  ? 3.467   42.045 50.324 1.00 2.00  ? 36   PHE A CE1 1 
ATOM   295  C  CE2 . PHE A 1 55  ? 3.279   40.382 48.597 1.00 2.56  ? 36   PHE A CE2 1 
ATOM   296  C  CZ  . PHE A 1 55  ? 3.101   41.689 49.027 1.00 2.00  ? 36   PHE A CZ  1 
ATOM   297  N  N   . VAL A 1 56  ? 6.982   38.788 54.224 1.00 2.47  ? 37   VAL A N   1 
ATOM   298  C  CA  . VAL A 1 56  ? 7.814   38.301 55.338 1.00 2.01  ? 37   VAL A CA  1 
ATOM   299  C  C   . VAL A 1 56  ? 6.938   38.012 56.569 1.00 2.58  ? 37   VAL A C   1 
ATOM   300  O  O   . VAL A 1 56  ? 6.334   38.926 57.128 1.00 2.00  ? 37   VAL A O   1 
ATOM   301  C  CB  . VAL A 1 56  ? 8.916   39.334 55.724 1.00 2.15  ? 37   VAL A CB  1 
ATOM   302  C  CG1 . VAL A 1 56  ? 9.858   38.776 56.813 1.00 2.00  ? 37   VAL A CG1 1 
ATOM   303  C  CG2 . VAL A 1 56  ? 9.687   39.783 54.464 1.00 2.00  ? 37   VAL A CG2 1 
ATOM   304  N  N   . ASN A 1 57  ? 6.896   36.732 56.964 1.00 2.00  ? 38   ASN A N   1 
ATOM   305  C  CA  . ASN A 1 57  ? 6.272   36.320 58.222 1.00 2.27  ? 38   ASN A CA  1 
ATOM   306  C  C   . ASN A 1 57  ? 7.236   36.301 59.399 1.00 2.32  ? 38   ASN A C   1 
ATOM   307  O  O   . ASN A 1 57  ? 6.837   36.625 60.524 1.00 2.00  ? 38   ASN A O   1 
ATOM   308  C  CB  . ASN A 1 57  ? 5.593   34.938 58.092 1.00 2.00  ? 38   ASN A CB  1 
ATOM   309  C  CG  . ASN A 1 57  ? 4.425   34.963 57.122 1.00 2.61  ? 38   ASN A CG  1 
ATOM   310  O  OD1 . ASN A 1 57  ? 4.349   34.137 56.192 1.00 2.95  ? 38   ASN A OD1 1 
ATOM   311  N  ND2 . ASN A 1 57  ? 3.510   35.896 57.330 1.00 2.00  ? 38   ASN A ND2 1 
ATOM   312  N  N   . ARG A 1 58  ? 8.478   35.881 59.136 1.00 2.01  ? 39   ARG A N   1 
ATOM   313  C  CA  . ARG A 1 58  ? 9.537   35.922 60.144 1.00 2.29  ? 39   ARG A CA  1 
ATOM   314  C  C   . ARG A 1 58  ? 10.790  36.448 59.487 1.00 2.52  ? 39   ARG A C   1 
ATOM   315  O  O   . ARG A 1 58  ? 11.076  36.099 58.337 1.00 2.91  ? 39   ARG A O   1 
ATOM   316  C  CB  . ARG A 1 58  ? 9.793   34.523 60.784 1.00 2.00  ? 39   ARG A CB  1 
ATOM   317  C  CG  . ARG A 1 58  ? 8.790   34.144 61.907 1.00 2.00  ? 39   ARG A CG  1 
ATOM   318  C  CD  . ARG A 1 58  ? 8.710   32.594 62.143 1.00 2.18  ? 39   ARG A CD  1 
ATOM   319  N  NE  . ARG A 1 58  ? 8.349   31.899 60.903 1.00 3.07  ? 39   ARG A NE  1 
ATOM   320  C  CZ  . ARG A 1 58  ? 7.131   31.894 60.363 1.00 3.47  ? 39   ARG A CZ  1 
ATOM   321  N  NH1 . ARG A 1 58  ? 6.099   32.504 60.969 1.00 3.14  ? 39   ARG A NH1 1 
ATOM   322  N  NH2 . ARG A 1 58  ? 6.931   31.251 59.221 1.00 6.14  ? 39   ARG A NH2 1 
ATOM   323  N  N   . SER A 1 59  ? 11.537  37.264 60.233 1.00 2.93  ? 40   SER A N   1 
ATOM   324  C  CA  . SER A 1 59  ? 12.760  37.886 59.751 1.00 3.38  ? 40   SER A CA  1 
ATOM   325  C  C   . SER A 1 59  ? 13.736  36.824 59.247 1.00 3.21  ? 40   SER A C   1 
ATOM   326  O  O   . SER A 1 59  ? 13.837  35.752 59.832 1.00 3.08  ? 40   SER A O   1 
ATOM   327  C  CB  . SER A 1 59  ? 13.421  38.719 60.862 1.00 3.06  ? 40   SER A CB  1 
ATOM   328  O  OG  . SER A 1 59  ? 12.632  39.868 61.118 1.00 5.69  ? 40   SER A OG  1 
ATOM   329  N  N   . LEU A 1 60  ? 14.442  37.144 58.168 1.00 2.92  ? 41   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 60  ? 15.364  36.208 57.547 1.00 3.14  ? 41   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 60  ? 16.493  37.031 56.925 1.00 3.31  ? 41   LEU A C   1 
ATOM   332  O  O   . LEU A 1 60  ? 16.260  37.876 56.053 1.00 2.76  ? 41   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 60  ? 14.643  35.315 56.515 1.00 2.83  ? 41   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 60  ? 15.361  34.120 55.855 1.00 3.45  ? 41   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 60  ? 14.384  33.012 55.435 1.00 2.00  ? 41   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 60  ? 16.204  34.527 54.650 1.00 2.00  ? 41   LEU A CD2 1 
ATOM   337  N  N   . ALA A 1 61  ? 17.713  36.773 57.408 1.00 3.62  ? 42   ALA A N   1 
ATOM   338  C  CA  . ALA A 1 61  ? 18.922  37.413 56.925 1.00 4.04  ? 42   ALA A CA  1 
ATOM   339  C  C   . ALA A 1 61  ? 19.438  36.586 55.752 1.00 4.53  ? 42   ALA A C   1 
ATOM   340  O  O   . ALA A 1 61  ? 19.936  35.483 55.946 1.00 3.99  ? 42   ALA A O   1 
ATOM   341  C  CB  . ALA A 1 61  ? 19.980  37.506 58.074 1.00 3.45  ? 42   ALA A CB  1 
ATOM   342  N  N   . MET A 1 62  ? 19.287  37.101 54.526 1.00 5.46  ? 43   MET A N   1 
ATOM   343  C  CA  . MET A 1 62  ? 19.722  36.354 53.320 1.00 6.24  ? 43   MET A CA  1 
ATOM   344  C  C   . MET A 1 62  ? 21.201  35.959 53.302 1.00 6.46  ? 43   MET A C   1 
ATOM   345  O  O   . MET A 1 62  ? 21.566  34.943 52.697 1.00 5.32  ? 43   MET A O   1 
ATOM   346  C  CB  . MET A 1 62  ? 19.325  37.081 52.037 1.00 5.88  ? 43   MET A CB  1 
ATOM   347  C  CG  . MET A 1 62  ? 17.866  36.928 51.740 1.00 9.62  ? 43   MET A CG  1 
ATOM   348  S  SD  . MET A 1 62  ? 17.444  35.282 51.041 1.00 14.63 ? 43   MET A SD  1 
ATOM   349  C  CE  . MET A 1 62  ? 18.056  35.479 49.385 1.00 12.20 ? 43   MET A CE  1 
ATOM   350  N  N   A GLU A 1 63  ? 22.038  36.751 53.978 0.50 6.95  ? 44   GLU A N   1 
ATOM   351  N  N   B GLU A 1 63  ? 22.037  36.753 53.973 0.50 6.74  ? 44   GLU A N   1 
ATOM   352  C  CA  A GLU A 1 63  ? 23.477  36.483 54.058 0.50 8.22  ? 44   GLU A CA  1 
ATOM   353  C  CA  B GLU A 1 63  ? 23.469  36.476 54.068 0.50 7.62  ? 44   GLU A CA  1 
ATOM   354  C  C   A GLU A 1 63  ? 23.793  35.165 54.783 0.50 7.85  ? 44   GLU A C   1 
ATOM   355  C  C   B GLU A 1 63  ? 23.755  35.126 54.722 0.50 7.60  ? 44   GLU A C   1 
ATOM   356  O  O   A GLU A 1 63  ? 24.854  34.574 54.587 0.50 8.19  ? 44   GLU A O   1 
ATOM   357  O  O   B GLU A 1 63  ? 24.760  34.479 54.424 0.50 7.87  ? 44   GLU A O   1 
ATOM   358  C  CB  A GLU A 1 63  ? 24.210  37.671 54.707 0.50 8.38  ? 44   GLU A CB  1 
ATOM   359  C  CB  B GLU A 1 63  ? 24.165  37.587 54.854 0.50 8.13  ? 44   GLU A CB  1 
ATOM   360  C  CG  A GLU A 1 63  ? 24.058  37.791 56.217 0.50 9.68  ? 44   GLU A CG  1 
ATOM   361  C  CG  B GLU A 1 63  ? 25.685  37.545 54.756 0.50 10.32 ? 44   GLU A CG  1 
ATOM   362  C  CD  A GLU A 1 63  ? 24.602  39.103 56.766 0.50 10.86 ? 44   GLU A CD  1 
ATOM   363  C  CD  B GLU A 1 63  ? 26.335  38.858 55.129 0.50 13.37 ? 44   GLU A CD  1 
ATOM   364  O  OE1 A GLU A 1 63  ? 23.848  40.113 56.775 0.50 13.25 ? 44   GLU A OE1 1 
ATOM   365  O  OE1 B GLU A 1 63  ? 25.597  39.867 55.294 0.50 13.15 ? 44   GLU A OE1 1 
ATOM   366  O  OE2 A GLU A 1 63  ? 25.783  39.115 57.200 0.50 13.32 ? 44   GLU A OE2 1 
ATOM   367  O  OE2 B GLU A 1 63  ? 27.587  38.874 55.253 0.50 14.72 ? 44   GLU A OE2 1 
ATOM   368  N  N   . LYS A 1 64  ? 22.852  34.700 55.600 1.00 7.75  ? 45   LYS A N   1 
ATOM   369  C  CA  . LYS A 1 64  ? 23.002  33.445 56.337 1.00 7.78  ? 45   LYS A CA  1 
ATOM   370  C  C   . LYS A 1 64  ? 22.545  32.213 55.526 1.00 6.00  ? 45   LYS A C   1 
ATOM   371  O  O   . LYS A 1 64  ? 22.725  31.081 55.963 1.00 4.65  ? 45   LYS A O   1 
ATOM   372  C  CB  . LYS A 1 64  ? 22.194  33.516 57.652 1.00 8.30  ? 45   LYS A CB  1 
ATOM   373  C  CG  . LYS A 1 64  ? 22.766  34.480 58.720 1.00 12.69 ? 45   LYS A CG  1 
ATOM   374  C  CD  . LYS A 1 64  ? 22.198  34.093 60.084 1.00 18.34 ? 45   LYS A CD  1 
ATOM   375  C  CE  . LYS A 1 64  ? 22.662  34.991 61.211 1.00 26.00 ? 45   LYS A CE  1 
ATOM   376  N  NZ  . LYS A 1 64  ? 21.611  35.984 61.621 1.00 29.38 ? 45   LYS A NZ  1 
ATOM   377  N  N   . ILE A 1 65  ? 21.913  32.433 54.376 1.00 4.87  ? 46   ILE A N   1 
ATOM   378  C  CA  . ILE A 1 65  ? 21.465  31.311 53.564 1.00 3.64  ? 46   ILE A CA  1 
ATOM   379  C  C   . ILE A 1 65  ? 22.634  30.793 52.727 1.00 4.09  ? 46   ILE A C   1 
ATOM   380  O  O   . ILE A 1 65  ? 23.238  31.544 51.940 1.00 3.76  ? 46   ILE A O   1 
ATOM   381  C  CB  . ILE A 1 65  ? 20.254  31.681 52.685 1.00 4.28  ? 46   ILE A CB  1 
ATOM   382  C  CG1 . ILE A 1 65  ? 19.044  32.119 53.555 1.00 3.30  ? 46   ILE A CG1 1 
ATOM   383  C  CG2 . ILE A 1 65  ? 19.893  30.524 51.724 1.00 2.42  ? 46   ILE A CG2 1 
ATOM   384  C  CD1 . ILE A 1 65  ? 18.574  31.098 54.639 1.00 2.28  ? 46   ILE A CD1 1 
ATOM   385  N  N   . LYS A 1 66  ? 22.984  29.523 52.934 1.00 3.18  ? 47   LYS A N   1 
ATOM   386  C  CA  . LYS A 1 66  ? 24.062  28.922 52.173 1.00 4.36  ? 47   LYS A CA  1 
ATOM   387  C  C   . LYS A 1 66  ? 23.576  28.039 51.013 1.00 3.32  ? 47   LYS A C   1 
ATOM   388  O  O   . LYS A 1 66  ? 24.337  27.824 50.089 1.00 3.46  ? 47   LYS A O   1 
ATOM   389  C  CB  . LYS A 1 66  ? 24.994  28.119 53.086 1.00 5.09  ? 47   LYS A CB  1 
ATOM   390  C  CG  . LYS A 1 66  ? 25.319  28.785 54.429 1.00 10.37 ? 47   LYS A CG  1 
ATOM   391  C  CD  . LYS A 1 66  ? 26.574  29.631 54.369 1.00 17.90 ? 47   LYS A CD  1 
ATOM   392  C  CE  . LYS A 1 66  ? 26.273  31.089 54.068 1.00 21.37 ? 47   LYS A CE  1 
ATOM   393  N  NZ  . LYS A 1 66  ? 26.951  31.992 55.056 1.00 22.11 ? 47   LYS A NZ  1 
ATOM   394  N  N   . CYS A 1 67  ? 22.339  27.523 51.083 1.00 2.28  ? 48   CYS A N   1 
ATOM   395  C  CA  . CYS A 1 67  ? 21.797  26.635 50.059 1.00 2.63  ? 48   CYS A CA  1 
ATOM   396  C  C   . CYS A 1 67  ? 20.396  27.067 49.729 1.00 2.36  ? 48   CYS A C   1 
ATOM   397  O  O   . CYS A 1 67  ? 19.582  27.288 50.620 1.00 2.99  ? 48   CYS A O   1 
ATOM   398  C  CB  . CYS A 1 67  ? 21.752  25.147 50.511 1.00 2.11  ? 48   CYS A CB  1 
ATOM   399  S  SG  . CYS A 1 67  ? 23.322  24.441 51.058 1.00 5.06  ? 48   CYS A SG  1 
ATOM   400  N  N   . PHE A 1 68  ? 20.111  27.147 48.442 1.00 2.00  ? 49   PHE A N   1 
ATOM   401  C  CA  . PHE A 1 68  ? 18.802  27.449 47.952 1.00 2.21  ? 49   PHE A CA  1 
ATOM   402  C  C   . PHE A 1 68  ? 18.265  26.154 47.306 1.00 2.28  ? 49   PHE A C   1 
ATOM   403  O  O   . PHE A 1 68  ? 18.858  25.648 46.353 1.00 2.01  ? 49   PHE A O   1 
ATOM   404  C  CB  . PHE A 1 68  ? 18.903  28.574 46.917 1.00 2.00  ? 49   PHE A CB  1 
ATOM   405  C  CG  . PHE A 1 68  ? 19.504  29.875 47.467 1.00 2.68  ? 49   PHE A CG  1 
ATOM   406  C  CD1 . PHE A 1 68  ? 18.684  30.839 48.076 1.00 3.61  ? 49   PHE A CD1 1 
ATOM   407  C  CD2 . PHE A 1 68  ? 20.868  30.126 47.370 1.00 2.33  ? 49   PHE A CD2 1 
ATOM   408  C  CE1 . PHE A 1 68  ? 19.224  32.045 48.584 1.00 2.82  ? 49   PHE A CE1 1 
ATOM   409  C  CE2 . PHE A 1 68  ? 21.427  31.324 47.859 1.00 3.07  ? 49   PHE A CE2 1 
ATOM   410  C  CZ  . PHE A 1 68  ? 20.586  32.298 48.459 1.00 2.47  ? 49   PHE A CZ  1 
ATOM   411  N  N   . GLY A 1 69  ? 17.163  25.625 47.843 1.00 2.00  ? 50   GLY A N   1 
ATOM   412  C  CA  . GLY A 1 69  ? 16.542  24.385 47.332 1.00 2.00  ? 50   GLY A CA  1 
ATOM   413  C  C   . GLY A 1 69  ? 15.195  24.680 46.680 1.00 2.00  ? 50   GLY A C   1 
ATOM   414  O  O   . GLY A 1 69  ? 14.456  25.559 47.146 1.00 2.00  ? 50   GLY A O   1 
ATOM   415  N  N   . PHE A 1 70  ? 14.877  23.942 45.627 1.00 2.00  ? 51   PHE A N   1 
ATOM   416  C  CA  . PHE A 1 70  ? 13.619  24.132 44.887 1.00 2.00  ? 51   PHE A CA  1 
ATOM   417  C  C   . PHE A 1 70  ? 12.816  22.859 44.706 1.00 2.00  ? 51   PHE A C   1 
ATOM   418  O  O   . PHE A 1 70  ? 13.367  21.768 44.490 1.00 2.00  ? 51   PHE A O   1 
ATOM   419  C  CB  . PHE A 1 70  ? 13.864  24.674 43.442 1.00 2.00  ? 51   PHE A CB  1 
ATOM   420  C  CG  . PHE A 1 70  ? 14.398  26.076 43.386 1.00 2.00  ? 51   PHE A CG  1 
ATOM   421  C  CD1 . PHE A 1 70  ? 13.542  27.146 43.147 1.00 2.00  ? 51   PHE A CD1 1 
ATOM   422  C  CD2 . PHE A 1 70  ? 15.775  26.323 43.579 1.00 2.00  ? 51   PHE A CD2 1 
ATOM   423  C  CE1 . PHE A 1 70  ? 14.044  28.467 43.094 1.00 2.00  ? 51   PHE A CE1 1 
ATOM   424  C  CE2 . PHE A 1 70  ? 16.284  27.619 43.522 1.00 2.01  ? 51   PHE A CE2 1 
ATOM   425  C  CZ  . PHE A 1 70  ? 15.400  28.700 43.275 1.00 2.14  ? 51   PHE A CZ  1 
ATOM   426  N  N   . ASP A 1 71  ? 11.501  23.057 44.755 1.00 2.00  ? 52   ASP A N   1 
ATOM   427  C  CA  . ASP A 1 71  ? 10.525  22.165 44.189 1.00 2.00  ? 52   ASP A CA  1 
ATOM   428  C  C   . ASP A 1 71  ? 10.380  22.506 42.704 1.00 2.00  ? 52   ASP A C   1 
ATOM   429  O  O   . ASP A 1 71  ? 10.784  23.598 42.257 1.00 2.00  ? 52   ASP A O   1 
ATOM   430  C  CB  . ASP A 1 71  ? 9.192   22.365 44.908 1.00 2.00  ? 52   ASP A CB  1 
ATOM   431  C  CG  . ASP A 1 71  ? 8.105   21.512 44.330 1.00 4.20  ? 52   ASP A CG  1 
ATOM   432  O  OD1 . ASP A 1 71  ? 8.325   20.286 44.151 1.00 3.31  ? 52   ASP A OD1 1 
ATOM   433  O  OD2 . ASP A 1 71  ? 7.027   22.070 44.016 1.00 8.35  ? 52   ASP A OD2 1 
ATOM   434  N  N   . MET A 1 72  ? 9.816   21.588 41.934 1.00 2.00  ? 53   MET A N   1 
ATOM   435  C  CA  . MET A 1 72  ? 9.558   21.862 40.512 1.00 2.00  ? 53   MET A CA  1 
ATOM   436  C  C   . MET A 1 72  ? 8.127   22.291 40.229 1.00 2.03  ? 53   MET A C   1 
ATOM   437  O  O   . MET A 1 72  ? 7.900   23.439 39.916 1.00 2.46  ? 53   MET A O   1 
ATOM   438  C  CB  . MET A 1 72  ? 9.946   20.697 39.586 1.00 2.00  ? 53   MET A CB  1 
ATOM   439  C  CG  . MET A 1 72  ? 9.951   21.089 38.086 1.00 2.00  ? 53   MET A CG  1 
ATOM   440  S  SD  . MET A 1 72  ? 10.295  19.665 37.011 1.00 2.00  ? 53   MET A SD  1 
ATOM   441  C  CE  . MET A 1 72  ? 8.763   18.746 37.083 1.00 2.00  ? 53   MET A CE  1 
ATOM   442  N  N   . ASP A 1 73  ? 7.176   21.368 40.295 1.00 2.30  ? 54   ASP A N   1 
ATOM   443  C  CA  . ASP A 1 73  ? 5.804   21.644 39.806 1.00 3.00  ? 54   ASP A CA  1 
ATOM   444  C  C   . ASP A 1 73  ? 5.065   22.666 40.644 1.00 2.60  ? 54   ASP A C   1 
ATOM   445  O  O   . ASP A 1 73  ? 5.024   22.534 41.844 1.00 3.23  ? 54   ASP A O   1 
ATOM   446  C  CB  . ASP A 1 73  ? 4.988   20.362 39.698 1.00 3.16  ? 54   ASP A CB  1 
ATOM   447  C  CG  . ASP A 1 73  ? 5.330   19.557 38.433 1.00 4.03  ? 54   ASP A CG  1 
ATOM   448  O  OD1 . ASP A 1 73  ? 5.830   20.145 37.462 1.00 6.58  ? 54   ASP A OD1 1 
ATOM   449  O  OD2 . ASP A 1 73  ? 5.116   18.341 38.424 1.00 6.94  ? 54   ASP A OD2 1 
ATOM   450  N  N   . TYR A 1 74  ? 4.507   23.681 39.986 1.00 2.31  ? 55   TYR A N   1 
ATOM   451  C  CA  . TYR A 1 74  ? 3.887   24.846 40.629 1.00 2.79  ? 55   TYR A CA  1 
ATOM   452  C  C   . TYR A 1 74  ? 4.841   25.696 41.466 1.00 2.93  ? 55   TYR A C   1 
ATOM   453  O  O   . TYR A 1 74  ? 4.399   26.548 42.250 1.00 2.17  ? 55   TYR A O   1 
ATOM   454  C  CB  . TYR A 1 74  ? 2.600   24.493 41.402 1.00 2.44  ? 55   TYR A CB  1 
ATOM   455  C  CG  . TYR A 1 74  ? 1.423   24.202 40.478 1.00 2.76  ? 55   TYR A CG  1 
ATOM   456  C  CD1 . TYR A 1 74  ? 0.879   25.225 39.680 1.00 2.00  ? 55   TYR A CD1 1 
ATOM   457  C  CD2 . TYR A 1 74  ? 0.899   22.892 40.349 1.00 2.00  ? 55   TYR A CD2 1 
ATOM   458  C  CE1 . TYR A 1 74  ? -0.215  24.984 38.819 1.00 2.00  ? 55   TYR A CE1 1 
ATOM   459  C  CE2 . TYR A 1 74  ? -0.196  22.635 39.466 1.00 2.00  ? 55   TYR A CE2 1 
ATOM   460  C  CZ  . TYR A 1 74  ? -0.745  23.706 38.727 1.00 2.00  ? 55   TYR A CZ  1 
ATOM   461  O  OH  . TYR A 1 74  ? -1.831  23.508 37.894 1.00 3.74  ? 55   TYR A OH  1 
ATOM   462  N  N   . THR A 1 75  ? 6.140   25.462 41.265 1.00 3.11  ? 56   THR A N   1 
ATOM   463  C  CA  . THR A 1 75  ? 7.195   26.295 41.863 1.00 2.79  ? 56   THR A CA  1 
ATOM   464  C  C   . THR A 1 75  ? 8.054   26.841 40.719 1.00 2.56  ? 56   THR A C   1 
ATOM   465  O  O   . THR A 1 75  ? 7.857   27.977 40.315 1.00 2.47  ? 56   THR A O   1 
ATOM   466  C  CB  . THR A 1 75  ? 8.001   25.515 42.944 1.00 2.80  ? 56   THR A CB  1 
ATOM   467  O  OG1 . THR A 1 75  ? 7.109   25.099 43.980 1.00 2.82  ? 56   THR A OG1 1 
ATOM   468  C  CG2 . THR A 1 75  ? 9.116   26.390 43.566 1.00 2.72  ? 56   THR A CG2 1 
ATOM   469  N  N   . LEU A 1 76  ? 8.946   26.019 40.167 1.00 2.00  ? 57   LEU A N   1 
ATOM   470  C  CA  . LEU A 1 76  ? 9.672   26.364 38.945 1.00 2.32  ? 57   LEU A CA  1 
ATOM   471  C  C   . LEU A 1 76  ? 8.773   26.282 37.685 1.00 2.33  ? 57   LEU A C   1 
ATOM   472  O  O   . LEU A 1 76  ? 8.860   27.136 36.781 1.00 2.58  ? 57   LEU A O   1 
ATOM   473  C  CB  . LEU A 1 76  ? 10.886  25.425 38.769 1.00 2.04  ? 57   LEU A CB  1 
ATOM   474  C  CG  . LEU A 1 76  ? 12.054  25.640 39.746 1.00 2.13  ? 57   LEU A CG  1 
ATOM   475  C  CD1 . LEU A 1 76  ? 13.110  24.506 39.638 1.00 2.00  ? 57   LEU A CD1 1 
ATOM   476  C  CD2 . LEU A 1 76  ? 12.692  27.045 39.611 1.00 2.45  ? 57   LEU A CD2 1 
ATOM   477  N  N   . ALA A 1 77  ? 7.924   25.257 37.633 1.00 2.00  ? 58   ALA A N   1 
ATOM   478  C  CA  . ALA A 1 77  ? 7.074   25.010 36.475 1.00 2.00  ? 58   ALA A CA  1 
ATOM   479  C  C   . ALA A 1 77  ? 5.642   25.299 36.888 1.00 2.15  ? 58   ALA A C   1 
ATOM   480  O  O   . ALA A 1 77  ? 4.974   24.463 37.474 1.00 2.00  ? 58   ALA A O   1 
ATOM   481  C  CB  . ALA A 1 77  ? 7.213   23.554 35.988 1.00 2.00  ? 58   ALA A CB  1 
ATOM   482  N  N   . VAL A 1 78  ? 5.193   26.522 36.625 1.00 2.77  ? 59   VAL A N   1 
ATOM   483  C  CA  . VAL A 1 78  ? 3.832   26.916 37.000 1.00 2.33  ? 59   VAL A CA  1 
ATOM   484  C  C   . VAL A 1 78  ? 2.924   26.641 35.811 1.00 2.25  ? 59   VAL A C   1 
ATOM   485  O  O   . VAL A 1 78  ? 3.128   27.193 34.744 1.00 2.00  ? 59   VAL A O   1 
ATOM   486  C  CB  . VAL A 1 78  ? 3.723   28.408 37.395 1.00 2.34  ? 59   VAL A CB  1 
ATOM   487  C  CG1 . VAL A 1 78  ? 2.224   28.820 37.544 1.00 2.00  ? 59   VAL A CG1 1 
ATOM   488  C  CG2 . VAL A 1 78  ? 4.519   28.679 38.702 1.00 2.00  ? 59   VAL A CG2 1 
ATOM   489  N  N   . TYR A 1 79  ? 1.916   25.796 35.999 1.00 2.00  ? 60   TYR A N   1 
ATOM   490  C  CA  . TYR A 1 79  ? 1.080   25.439 34.848 1.00 2.10  ? 60   TYR A CA  1 
ATOM   491  C  C   . TYR A 1 79  ? 0.014   26.498 34.601 1.00 2.48  ? 60   TYR A C   1 
ATOM   492  O  O   . TYR A 1 79  ? -0.581  27.049 35.556 1.00 2.12  ? 60   TYR A O   1 
ATOM   493  C  CB  . TYR A 1 79  ? 0.447   24.048 35.059 1.00 2.00  ? 60   TYR A CB  1 
ATOM   494  C  CG  . TYR A 1 79  ? 1.519   22.980 35.159 1.00 2.65  ? 60   TYR A CG  1 
ATOM   495  C  CD1 . TYR A 1 79  ? 2.065   22.418 33.998 1.00 2.90  ? 60   TYR A CD1 1 
ATOM   496  C  CD2 . TYR A 1 79  ? 2.038   22.582 36.404 1.00 2.91  ? 60   TYR A CD2 1 
ATOM   497  C  CE1 . TYR A 1 79  ? 3.077   21.463 34.054 1.00 2.00  ? 60   TYR A CE1 1 
ATOM   498  C  CE2 . TYR A 1 79  ? 3.037   21.607 36.475 1.00 3.80  ? 60   TYR A CE2 1 
ATOM   499  C  CZ  . TYR A 1 79  ? 3.565   21.067 35.277 1.00 3.30  ? 60   TYR A CZ  1 
ATOM   500  O  OH  . TYR A 1 79  ? 4.583   20.142 35.291 1.00 2.70  ? 60   TYR A OH  1 
ATOM   501  N  N   . LYS A 1 80  ? -0.246  26.755 33.326 1.00 2.39  ? 61   LYS A N   1 
ATOM   502  C  CA  . LYS A 1 80  ? -1.177  27.836 32.927 1.00 3.22  ? 61   LYS A CA  1 
ATOM   503  C  C   . LYS A 1 80  ? -2.639  27.503 33.214 1.00 3.50  ? 61   LYS A C   1 
ATOM   504  O  O   . LYS A 1 80  ? -3.087  26.365 33.006 1.00 3.42  ? 61   LYS A O   1 
ATOM   505  C  CB  . LYS A 1 80  ? -1.005  28.204 31.454 1.00 2.53  ? 61   LYS A CB  1 
ATOM   506  C  CG  . LYS A 1 80  ? 0.362   28.772 31.150 1.00 3.70  ? 61   LYS A CG  1 
ATOM   507  C  CD  . LYS A 1 80  ? 0.464   29.231 29.665 1.00 2.45  ? 61   LYS A CD  1 
ATOM   508  C  CE  . LYS A 1 80  ? 1.771   29.965 29.424 1.00 4.06  ? 61   LYS A CE  1 
ATOM   509  N  NZ  . LYS A 1 80  ? 2.074   30.263 27.950 1.00 6.85  ? 61   LYS A NZ  1 
ATOM   510  N  N   . SER A 1 81  ? -3.360  28.523 33.678 1.00 3.18  ? 62   SER A N   1 
ATOM   511  C  CA  . SER A 1 81  ? -4.720  28.407 34.165 1.00 3.31  ? 62   SER A CA  1 
ATOM   512  C  C   . SER A 1 81  ? -5.638  29.245 33.271 1.00 3.38  ? 62   SER A C   1 
ATOM   513  O  O   . SER A 1 81  ? -5.277  30.378 32.938 1.00 2.93  ? 62   SER A O   1 
ATOM   514  C  CB  . SER A 1 81  ? -4.768  28.961 35.599 1.00 3.20  ? 62   SER A CB  1 
ATOM   515  O  OG  . SER A 1 81  ? -6.055  28.812 36.167 1.00 2.81  ? 62   SER A OG  1 
ATOM   516  N  N   . PRO A 1 82  ? -6.844  28.727 32.929 1.00 3.35  ? 63   PRO A N   1 
ATOM   517  C  CA  . PRO A 1 82  ? -7.424  27.426 33.347 1.00 3.56  ? 63   PRO A CA  1 
ATOM   518  C  C   . PRO A 1 82  ? -7.118  26.210 32.466 1.00 2.96  ? 63   PRO A C   1 
ATOM   519  O  O   . PRO A 1 82  ? -7.704  25.143 32.701 1.00 2.56  ? 63   PRO A O   1 
ATOM   520  C  CB  . PRO A 1 82  ? -8.930  27.709 33.291 1.00 3.74  ? 63   PRO A CB  1 
ATOM   521  C  CG  . PRO A 1 82  ? -9.057  28.634 32.076 1.00 3.70  ? 63   PRO A CG  1 
ATOM   522  C  CD  . PRO A 1 82  ? -7.803  29.513 32.118 1.00 3.36  ? 63   PRO A CD  1 
ATOM   523  N  N   . GLU A 1 83  ? -6.236  26.356 31.469 1.00 2.38  ? 64   GLU A N   1 
ATOM   524  C  CA  . GLU A 1 83  ? -5.992  25.301 30.477 1.00 2.62  ? 64   GLU A CA  1 
ATOM   525  C  C   . GLU A 1 83  ? -5.520  23.986 31.108 1.00 2.48  ? 64   GLU A C   1 
ATOM   526  O  O   . GLU A 1 83  ? -5.972  22.904 30.734 1.00 2.19  ? 64   GLU A O   1 
ATOM   527  C  CB  . GLU A 1 83  ? -4.943  25.746 29.435 1.00 2.75  ? 64   GLU A CB  1 
ATOM   528  C  CG  . GLU A 1 83  ? -5.471  26.681 28.343 1.00 3.70  ? 64   GLU A CG  1 
ATOM   529  C  CD  . GLU A 1 83  ? -5.639  28.150 28.834 1.00 8.58  ? 64   GLU A CD  1 
ATOM   530  O  OE1 . GLU A 1 83  ? -5.200  28.498 29.955 1.00 8.24  ? 64   GLU A OE1 1 
ATOM   531  O  OE2 . GLU A 1 83  ? -6.200  28.967 28.073 1.00 11.93 ? 64   GLU A OE2 1 
ATOM   532  N  N   . TYR A 1 84  ? -4.590  24.080 32.048 1.00 2.00  ? 65   TYR A N   1 
ATOM   533  C  CA  . TYR A 1 84  ? -4.027  22.880 32.642 1.00 2.12  ? 65   TYR A CA  1 
ATOM   534  C  C   . TYR A 1 84  ? -5.060  22.187 33.546 1.00 2.11  ? 65   TYR A C   1 
ATOM   535  O  O   . TYR A 1 84  ? -5.244  20.978 33.465 1.00 2.00  ? 65   TYR A O   1 
ATOM   536  C  CB  . TYR A 1 84  ? -2.742  23.210 33.385 1.00 2.00  ? 65   TYR A CB  1 
ATOM   537  C  CG  . TYR A 1 84  ? -1.998  21.977 33.884 1.00 2.00  ? 65   TYR A CG  1 
ATOM   538  C  CD1 . TYR A 1 84  ? -1.342  21.105 32.981 1.00 2.00  ? 65   TYR A CD1 1 
ATOM   539  C  CD2 . TYR A 1 84  ? -1.970  21.671 35.237 1.00 2.00  ? 65   TYR A CD2 1 
ATOM   540  C  CE1 . TYR A 1 84  ? -0.665  19.990 33.442 1.00 2.00  ? 65   TYR A CE1 1 
ATOM   541  C  CE2 . TYR A 1 84  ? -1.287  20.527 35.721 1.00 2.00  ? 65   TYR A CE2 1 
ATOM   542  C  CZ  . TYR A 1 84  ? -0.647  19.700 34.812 1.00 2.00  ? 65   TYR A CZ  1 
ATOM   543  O  OH  . TYR A 1 84  ? 0.041   18.605 35.283 1.00 2.00  ? 65   TYR A OH  1 
ATOM   544  N  N   . GLU A 1 85  ? -5.764  22.968 34.363 1.00 2.27  ? 66   GLU A N   1 
ATOM   545  C  CA  . GLU A 1 85  ? -6.855  22.416 35.179 1.00 2.82  ? 66   GLU A CA  1 
ATOM   546  C  C   . GLU A 1 85  ? -7.933  21.767 34.312 1.00 2.80  ? 66   GLU A C   1 
ATOM   547  O  O   . GLU A 1 85  ? -8.439  20.702 34.671 1.00 2.18  ? 66   GLU A O   1 
ATOM   548  C  CB  . GLU A 1 85  ? -7.517  23.472 36.102 1.00 2.74  ? 66   GLU A CB  1 
ATOM   549  C  CG  . GLU A 1 85  ? -6.606  24.169 37.123 1.00 2.00  ? 66   GLU A CG  1 
ATOM   550  C  CD  . GLU A 1 85  ? -6.098  25.492 36.587 1.00 2.69  ? 66   GLU A CD  1 
ATOM   551  O  OE1 . GLU A 1 85  ? -5.388  25.465 35.580 1.00 2.00  ? 66   GLU A OE1 1 
ATOM   552  O  OE2 . GLU A 1 85  ? -6.408  26.562 37.170 1.00 3.72  ? 66   GLU A OE2 1 
ATOM   553  N  N   A SER A 1 86  ? -8.278  22.417 33.198 0.50 2.61  ? 67   SER A N   1 
ATOM   554  N  N   B SER A 1 86  ? -8.286  22.409 33.194 0.50 2.78  ? 67   SER A N   1 
ATOM   555  C  CA  A SER A 1 86  ? -9.280  21.879 32.278 0.50 3.23  ? 67   SER A CA  1 
ATOM   556  C  CA  B SER A 1 86  ? -9.292  21.855 32.274 0.50 3.61  ? 67   SER A CA  1 
ATOM   557  C  C   A SER A 1 86  ? -8.869  20.540 31.671 0.50 3.52  ? 67   SER A C   1 
ATOM   558  C  C   B SER A 1 86  ? -8.870  20.525 31.671 0.50 3.72  ? 67   SER A C   1 
ATOM   559  O  O   A SER A 1 86  ? -9.691  19.637 31.552 0.50 3.78  ? 67   SER A O   1 
ATOM   560  O  O   B SER A 1 86  ? -9.682  19.612 31.552 0.50 3.99  ? 67   SER A O   1 
ATOM   561  C  CB  A SER A 1 86  ? -9.609  22.871 31.164 0.50 3.09  ? 67   SER A CB  1 
ATOM   562  C  CB  B SER A 1 86  ? -9.640  22.837 31.155 0.50 3.51  ? 67   SER A CB  1 
ATOM   563  O  OG  A SER A 1 86  ? -10.727 22.422 30.437 0.50 2.45  ? 67   SER A OG  1 
ATOM   564  O  OG  B SER A 1 86  ? -10.001 24.085 31.705 0.50 4.39  ? 67   SER A OG  1 
ATOM   565  N  N   . LEU A 1 87  ? -7.600  20.430 31.289 1.00 4.32  ? 68   LEU A N   1 
ATOM   566  C  CA  . LEU A 1 87  ? -7.025  19.178 30.786 1.00 5.13  ? 68   LEU A CA  1 
ATOM   567  C  C   . LEU A 1 87  ? -7.091  18.087 31.857 1.00 4.85  ? 68   LEU A C   1 
ATOM   568  O  O   . LEU A 1 87  ? -7.561  16.993 31.577 1.00 5.86  ? 68   LEU A O   1 
ATOM   569  C  CB  . LEU A 1 87  ? -5.586  19.383 30.250 1.00 4.98  ? 68   LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 87  ? -4.846  18.108 29.742 1.00 5.73  ? 68   LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 87  ? -5.438  17.530 28.466 1.00 5.55  ? 68   LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 87  ? -3.343  18.329 29.549 1.00 5.95  ? 68   LEU A CD2 1 
ATOM   573  N  N   . GLY A 1 88  ? -6.662  18.381 33.082 1.00 4.81  ? 69   GLY A N   1 
ATOM   574  C  CA  . GLY A 1 88  ? -6.749  17.399 34.168 1.00 3.95  ? 69   GLY A CA  1 
ATOM   575  C  C   . GLY A 1 88  ? -8.168  16.929 34.425 1.00 4.28  ? 69   GLY A C   1 
ATOM   576  O  O   . GLY A 1 88  ? -8.436  15.724 34.573 1.00 4.43  ? 69   GLY A O   1 
ATOM   577  N  N   . PHE A 1 89  ? -9.082  17.889 34.447 1.00 4.14  ? 70   PHE A N   1 
ATOM   578  C  CA  . PHE A 1 89  ? -10.523 17.635 34.613 1.00 3.61  ? 70   PHE A CA  1 
ATOM   579  C  C   . PHE A 1 89  ? -11.092 16.697 33.518 1.00 3.27  ? 70   PHE A C   1 
ATOM   580  O  O   . PHE A 1 89  ? -11.717 15.659 33.826 1.00 2.09  ? 70   PHE A O   1 
ATOM   581  C  CB  . PHE A 1 89  ? -11.278 18.976 34.653 1.00 2.83  ? 70   PHE A CB  1 
ATOM   582  C  CG  . PHE A 1 89  ? -12.763 18.850 34.886 1.00 2.00  ? 70   PHE A CG  1 
ATOM   583  C  CD1 . PHE A 1 89  ? -13.281 18.862 36.169 1.00 2.00  ? 70   PHE A CD1 1 
ATOM   584  C  CD2 . PHE A 1 89  ? -13.643 18.740 33.807 1.00 2.00  ? 70   PHE A CD2 1 
ATOM   585  C  CE1 . PHE A 1 89  ? -14.657 18.740 36.392 1.00 2.00  ? 70   PHE A CE1 1 
ATOM   586  C  CE2 . PHE A 1 89  ? -15.013 18.619 34.014 1.00 2.00  ? 70   PHE A CE2 1 
ATOM   587  C  CZ  . PHE A 1 89  ? -15.521 18.638 35.320 1.00 2.00  ? 70   PHE A CZ  1 
ATOM   588  N  N   . GLU A 1 90  ? -10.871 17.075 32.259 1.00 3.32  ? 71   GLU A N   1 
ATOM   589  C  CA  A GLU A 1 90  ? -11.343 16.298 31.116 0.50 3.57  ? 71   GLU A CA  1 
ATOM   590  C  CA  B GLU A 1 90  ? -11.365 16.285 31.129 0.50 3.70  ? 71   GLU A CA  1 
ATOM   591  C  C   . GLU A 1 90  ? -10.825 14.861 31.165 1.00 2.89  ? 71   GLU A C   1 
ATOM   592  O  O   . GLU A 1 90  ? -11.573 13.917 30.967 1.00 2.43  ? 71   GLU A O   1 
ATOM   593  C  CB  A GLU A 1 90  ? -10.927 16.971 29.812 0.50 3.19  ? 71   GLU A CB  1 
ATOM   594  C  CB  B GLU A 1 90  ? -11.040 16.946 29.791 0.50 3.90  ? 71   GLU A CB  1 
ATOM   595  C  CG  A GLU A 1 90  ? -11.614 16.421 28.580 0.50 4.39  ? 71   GLU A CG  1 
ATOM   596  C  CG  B GLU A 1 90  ? -11.715 18.294 29.581 0.50 7.73  ? 71   GLU A CG  1 
ATOM   597  C  CD  A GLU A 1 90  ? -11.248 17.183 27.302 0.50 5.52  ? 71   GLU A CD  1 
ATOM   598  C  CD  B GLU A 1 90  ? -13.111 18.205 28.970 0.50 13.97 ? 71   GLU A CD  1 
ATOM   599  O  OE1 A GLU A 1 90  ? -11.231 18.436 27.327 0.50 8.93  ? 71   GLU A OE1 1 
ATOM   600  O  OE1 B GLU A 1 90  ? -13.337 17.337 28.085 0.50 18.35 ? 71   GLU A OE1 1 
ATOM   601  O  OE2 A GLU A 1 90  ? -10.983 16.521 26.272 0.50 8.84  ? 71   GLU A OE2 1 
ATOM   602  O  OE2 B GLU A 1 90  ? -13.985 19.016 29.352 0.50 13.91 ? 71   GLU A OE2 1 
ATOM   603  N  N   . LEU A 1 91  ? -9.536  14.703 31.437 1.00 2.43  ? 72   LEU A N   1 
ATOM   604  C  CA  . LEU A 1 91  ? -8.954  13.354 31.505 1.00 2.33  ? 72   LEU A CA  1 
ATOM   605  C  C   . LEU A 1 91  ? -9.432  12.544 32.707 1.00 2.55  ? 72   LEU A C   1 
ATOM   606  O  O   . LEU A 1 91  ? -9.595  11.316 32.611 1.00 2.00  ? 72   LEU A O   1 
ATOM   607  C  CB  . LEU A 1 91  ? -7.431  13.408 31.449 1.00 2.06  ? 72   LEU A CB  1 
ATOM   608  C  CG  . LEU A 1 91  ? -6.844  14.017 30.158 1.00 2.72  ? 72   LEU A CG  1 
ATOM   609  C  CD1 . LEU A 1 91  ? -5.343  14.135 30.303 1.00 2.17  ? 72   LEU A CD1 1 
ATOM   610  C  CD2 . LEU A 1 91  ? -7.210  13.226 28.899 1.00 2.00  ? 72   LEU A CD2 1 
ATOM   611  N  N   . THR A 1 92  ? -9.638  13.230 33.840 1.00 2.20  ? 73   THR A N   1 
ATOM   612  C  CA  . THR A 1 92  ? -10.181 12.568 35.039 1.00 2.44  ? 73   THR A CA  1 
ATOM   613  C  C   . THR A 1 92  ? -11.622 12.094 34.812 1.00 2.44  ? 73   THR A C   1 
ATOM   614  O  O   . THR A 1 92  ? -11.989 10.979 35.178 1.00 3.35  ? 73   THR A O   1 
ATOM   615  C  CB  . THR A 1 92  ? -10.091 13.492 36.254 1.00 2.00  ? 73   THR A CB  1 
ATOM   616  O  OG1 . THR A 1 92  ? -8.715  13.806 36.444 1.00 2.63  ? 73   THR A OG1 1 
ATOM   617  C  CG2 . THR A 1 92  ? -10.631 12.810 37.513 1.00 2.00  ? 73   THR A CG2 1 
ATOM   618  N  N   . VAL A 1 93  ? -12.425 12.944 34.202 1.00 2.62  ? 74   VAL A N   1 
ATOM   619  C  CA  . VAL A 1 93  ? -13.790 12.583 33.837 1.00 2.59  ? 74   VAL A CA  1 
ATOM   620  C  C   . VAL A 1 93  ? -13.795 11.367 32.888 1.00 2.73  ? 74   VAL A C   1 
ATOM   621  O  O   . VAL A 1 93  ? -14.559 10.414 33.101 1.00 3.00  ? 74   VAL A O   1 
ATOM   622  C  CB  . VAL A 1 93  ? -14.534 13.801 33.208 1.00 2.63  ? 74   VAL A CB  1 
ATOM   623  C  CG1 . VAL A 1 93  ? -15.750 13.354 32.333 1.00 2.00  ? 74   VAL A CG1 1 
ATOM   624  C  CG2 . VAL A 1 93  ? -14.967 14.757 34.312 1.00 2.00  ? 74   VAL A CG2 1 
ATOM   625  N  N   A GLU A 1 94  ? -12.950 11.404 31.862 0.50 2.29  ? 75   GLU A N   1 
ATOM   626  N  N   B GLU A 1 94  ? -12.957 11.427 31.855 0.50 2.50  ? 75   GLU A N   1 
ATOM   627  C  CA  A GLU A 1 94  ? -12.868 10.311 30.889 0.50 2.30  ? 75   GLU A CA  1 
ATOM   628  C  CA  B GLU A 1 94  ? -12.805 10.345 30.878 0.50 2.79  ? 75   GLU A CA  1 
ATOM   629  C  C   A GLU A 1 94  ? -12.441 8.995  31.551 0.50 2.00  ? 75   GLU A C   1 
ATOM   630  C  C   B GLU A 1 94  ? -12.464 9.020  31.574 0.50 2.13  ? 75   GLU A C   1 
ATOM   631  O  O   A GLU A 1 94  ? -12.960 7.935  31.215 0.50 2.00  ? 75   GLU A O   1 
ATOM   632  O  O   B GLU A 1 94  ? -13.058 7.986  31.281 0.50 2.01  ? 75   GLU A O   1 
ATOM   633  C  CB  A GLU A 1 94  ? -11.956 10.690 29.706 0.50 2.00  ? 75   GLU A CB  1 
ATOM   634  C  CB  B GLU A 1 94  ? -11.750 10.726 29.816 0.50 2.27  ? 75   GLU A CB  1 
ATOM   635  C  CG  A GLU A 1 94  ? -12.586 11.756 28.797 0.50 2.22  ? 75   GLU A CG  1 
ATOM   636  C  CG  B GLU A 1 94  ? -11.031 9.556  29.173 0.50 4.05  ? 75   GLU A CG  1 
ATOM   637  C  CD  A GLU A 1 94  ? -11.682 12.228 27.681 0.50 2.83  ? 75   GLU A CD  1 
ATOM   638  C  CD  B GLU A 1 94  ? -10.124 9.958  28.007 0.50 3.76  ? 75   GLU A CD  1 
ATOM   639  O  OE1 A GLU A 1 94  ? -10.476 11.910 27.680 0.50 3.62  ? 75   GLU A OE1 1 
ATOM   640  O  OE1 B GLU A 1 94  ? -8.897  10.055 28.192 0.50 2.00  ? 75   GLU A OE1 1 
ATOM   641  O  OE2 A GLU A 1 94  ? -12.190 12.929 26.789 0.50 5.68  ? 75   GLU A OE2 1 
ATOM   642  O  OE2 B GLU A 1 94  ? -10.666 10.163 26.898 0.50 7.31  ? 75   GLU A OE2 1 
ATOM   643  N  N   . ARG A 1 95  ? -11.521 9.076  32.506 1.00 2.01  ? 76   ARG A N   1 
ATOM   644  C  CA  . ARG A 1 95  ? -11.120 7.897  33.300 1.00 2.18  ? 76   ARG A CA  1 
ATOM   645  C  C   . ARG A 1 95  ? -12.308 7.355  34.120 1.00 2.11  ? 76   ARG A C   1 
ATOM   646  O  O   . ARG A 1 95  ? -12.549 6.152  34.143 1.00 2.12  ? 76   ARG A O   1 
ATOM   647  C  CB  . ARG A 1 95  ? -9.917  8.232  34.205 1.00 2.07  ? 76   ARG A CB  1 
ATOM   648  C  CG  . ARG A 1 95  ? -9.470  7.107  35.183 1.00 2.45  ? 76   ARG A CG  1 
ATOM   649  C  CD  . ARG A 1 95  ? -9.134  5.770  34.456 1.00 2.00  ? 76   ARG A CD  1 
ATOM   650  N  NE  . ARG A 1 95  ? -8.747  4.761  35.444 1.00 2.01  ? 76   ARG A NE  1 
ATOM   651  C  CZ  . ARG A 1 95  ? -8.455  3.486  35.189 1.00 4.84  ? 76   ARG A CZ  1 
ATOM   652  N  NH1 . ARG A 1 95  ? -8.505  3.008  33.933 1.00 4.70  ? 76   ARG A NH1 1 
ATOM   653  N  NH2 . ARG A 1 95  ? -8.104  2.686  36.203 1.00 2.33  ? 76   ARG A NH2 1 
ATOM   654  N  N   . LEU A 1 96  ? -13.060 8.243  34.771 1.00 2.00  ? 77   LEU A N   1 
ATOM   655  C  CA  . LEU A 1 96  ? -14.232 7.793  35.542 1.00 2.31  ? 77   LEU A CA  1 
ATOM   656  C  C   . LEU A 1 96  ? -15.300 7.137  34.660 1.00 2.19  ? 77   LEU A C   1 
ATOM   657  O  O   . LEU A 1 96  ? -15.883 6.123  35.042 1.00 2.39  ? 77   LEU A O   1 
ATOM   658  C  CB  . LEU A 1 96  ? -14.853 8.949  36.325 1.00 2.00  ? 77   LEU A CB  1 
ATOM   659  C  CG  . LEU A 1 96  ? -14.073 9.470  37.543 1.00 2.39  ? 77   LEU A CG  1 
ATOM   660  C  CD1 . LEU A 1 96  ? -14.768 10.735 38.067 1.00 2.00  ? 77   LEU A CD1 1 
ATOM   661  C  CD2 . LEU A 1 96  ? -13.913 8.368  38.628 1.00 2.00  ? 77   LEU A CD2 1 
ATOM   662  N  N   . VAL A 1 97  ? -15.558 7.728  33.497 1.00 2.00  ? 78   VAL A N   1 
ATOM   663  C  CA  . VAL A 1 97  ? -16.497 7.130  32.542 1.00 2.07  ? 78   VAL A CA  1 
ATOM   664  C  C   . VAL A 1 97  ? -15.995 5.774  32.063 1.00 2.55  ? 78   VAL A C   1 
ATOM   665  O  O   . VAL A 1 97  ? -16.751 4.834  31.937 1.00 2.00  ? 78   VAL A O   1 
ATOM   666  C  CB  . VAL A 1 97  ? -16.840 8.059  31.328 1.00 2.00  ? 78   VAL A CB  1 
ATOM   667  C  CG1 . VAL A 1 97  ? -17.748 7.331  30.317 1.00 2.00  ? 78   VAL A CG1 1 
ATOM   668  C  CG2 . VAL A 1 97  ? -17.559 9.312  31.835 1.00 2.00  ? 78   VAL A CG2 1 
ATOM   669  N  N   . SER A 1 98  ? -14.697 5.672  31.840 1.00 3.34  ? 79   SER A N   1 
ATOM   670  C  CA  . SER A 1 98  ? -14.175 4.445  31.325 1.00 4.58  ? 79   SER A CA  1 
ATOM   671  C  C   . SER A 1 98  ? -14.283 3.296  32.359 1.00 4.17  ? 79   SER A C   1 
ATOM   672  O  O   . SER A 1 98  ? -14.422 2.153  31.965 1.00 4.05  ? 79   SER A O   1 
ATOM   673  C  CB  . SER A 1 98  ? -12.775 4.669  30.760 1.00 4.88  ? 79   SER A CB  1 
ATOM   674  O  OG  . SER A 1 98  ? -11.788 4.051  31.521 1.00 9.28  ? 79   SER A OG  1 
ATOM   675  N  N   . ILE A 1 99  ? -14.286 3.610  33.659 1.00 4.42  ? 80   ILE A N   1 
ATOM   676  C  CA  . ILE A 1 99  ? -14.496 2.577  34.686 1.00 5.16  ? 80   ILE A CA  1 
ATOM   677  C  C   . ILE A 1 99  ? -15.988 2.365  35.018 1.00 4.97  ? 80   ILE A C   1 
ATOM   678  O  O   . ILE A 1 99  ? -16.315 1.509  35.822 1.00 4.47  ? 80   ILE A O   1 
ATOM   679  C  CB  . ILE A 1 99  ? -13.644 2.801  35.999 1.00 6.04  ? 80   ILE A CB  1 
ATOM   680  C  CG1 . ILE A 1 99  ? -14.104 4.036  36.774 1.00 5.43  ? 80   ILE A CG1 1 
ATOM   681  C  CG2 . ILE A 1 99  ? -12.118 2.852  35.670 1.00 6.98  ? 80   ILE A CG2 1 
ATOM   682  C  CD1 . ILE A 1 99  ? -13.909 3.945  38.226 1.00 7.78  ? 80   ILE A CD1 1 
ATOM   683  N  N   . GLY A 1 100 ? -16.880 3.150  34.409 1.00 3.98  ? 81   GLY A N   1 
ATOM   684  C  CA  . GLY A 1 100 ? -18.302 2.855  34.504 1.00 3.73  ? 81   GLY A CA  1 
ATOM   685  C  C   . GLY A 1 100 ? -19.201 3.912  35.106 1.00 3.61  ? 81   GLY A C   1 
ATOM   686  O  O   . GLY A 1 100 ? -20.399 3.670  35.268 1.00 3.12  ? 81   GLY A O   1 
ATOM   687  N  N   . TYR A 1 101 ? -18.637 5.084  35.420 1.00 3.43  ? 82   TYR A N   1 
ATOM   688  C  CA  . TYR A 1 101 ? -19.440 6.261  35.787 1.00 3.68  ? 82   TYR A CA  1 
ATOM   689  C  C   . TYR A 1 101 ? -20.322 6.682  34.610 1.00 4.43  ? 82   TYR A C   1 
ATOM   690  O  O   . TYR A 1 101 ? -19.961 6.461  33.441 1.00 4.60  ? 82   TYR A O   1 
ATOM   691  C  CB  . TYR A 1 101 ? -18.543 7.428  36.272 1.00 2.95  ? 82   TYR A CB  1 
ATOM   692  C  CG  . TYR A 1 101 ? -18.242 7.304  37.754 1.00 3.17  ? 82   TYR A CG  1 
ATOM   693  C  CD1 . TYR A 1 101 ? -17.374 6.306  38.227 1.00 2.00  ? 82   TYR A CD1 1 
ATOM   694  C  CD2 . TYR A 1 101 ? -18.848 8.150  38.684 1.00 2.69  ? 82   TYR A CD2 1 
ATOM   695  C  CE1 . TYR A 1 101 ? -17.116 6.170  39.590 1.00 2.05  ? 82   TYR A CE1 1 
ATOM   696  C  CE2 . TYR A 1 101 ? -18.585 8.021  40.063 1.00 2.71  ? 82   TYR A CE2 1 
ATOM   697  C  CZ  . TYR A 1 101 ? -17.730 7.033  40.499 1.00 2.51  ? 82   TYR A CZ  1 
ATOM   698  O  OH  . TYR A 1 101 ? -17.467 6.892  41.843 1.00 3.74  ? 82   TYR A OH  1 
ATOM   699  N  N   . PRO A 1 102 ? -21.500 7.254  34.912 1.00 5.21  ? 83   PRO A N   1 
ATOM   700  C  CA  . PRO A 1 102 ? -22.472 7.527  33.833 1.00 5.41  ? 83   PRO A CA  1 
ATOM   701  C  C   . PRO A 1 102 ? -21.971 8.503  32.753 1.00 5.41  ? 83   PRO A C   1 
ATOM   702  O  O   . PRO A 1 102 ? -21.114 9.349  33.016 1.00 4.70  ? 83   PRO A O   1 
ATOM   703  C  CB  . PRO A 1 102 ? -23.681 8.121  34.564 1.00 5.07  ? 83   PRO A CB  1 
ATOM   704  C  CG  . PRO A 1 102 ? -23.266 8.338  35.972 1.00 6.51  ? 83   PRO A CG  1 
ATOM   705  C  CD  . PRO A 1 102 ? -22.016 7.588  36.255 1.00 4.06  ? 83   PRO A CD  1 
ATOM   706  N  N   . GLN A 1 103 ? -22.508 8.339  31.545 1.00 5.94  ? 84   GLN A N   1 
ATOM   707  C  CA  . GLN A 1 103 ? -22.133 9.122  30.366 1.00 6.75  ? 84   GLN A CA  1 
ATOM   708  C  C   . GLN A 1 103 ? -22.342 10.630 30.520 1.00 6.14  ? 84   GLN A C   1 
ATOM   709  O  O   . GLN A 1 103 ? -21.641 11.406 29.869 1.00 6.14  ? 84   GLN A O   1 
ATOM   710  C  CB  . GLN A 1 103 ? -22.951 8.636  29.167 1.00 7.66  ? 84   GLN A CB  1 
ATOM   711  C  CG  . GLN A 1 103 ? -22.674 7.175  28.772 1.00 13.29 ? 84   GLN A CG  1 
ATOM   712  C  CD  . GLN A 1 103 ? -21.264 6.936  28.228 1.00 18.32 ? 84   GLN A CD  1 
ATOM   713  O  OE1 . GLN A 1 103 ? -20.824 7.615  27.294 1.00 21.41 ? 84   GLN A OE1 1 
ATOM   714  N  NE2 . GLN A 1 103 ? -20.570 5.932  28.781 1.00 19.95 ? 84   GLN A NE2 1 
ATOM   715  N  N   . GLU A 1 104 ? -23.296 11.040 31.370 1.00 5.09  ? 85   GLU A N   1 
ATOM   716  C  CA  . GLU A 1 104 ? -23.586 12.457 31.601 1.00 5.52  ? 85   GLU A CA  1 
ATOM   717  C  C   . GLU A 1 104 ? -22.386 13.243 32.114 1.00 5.07  ? 85   GLU A C   1 
ATOM   718  O  O   . GLU A 1 104 ? -22.338 14.468 31.928 1.00 6.29  ? 85   GLU A O   1 
ATOM   719  C  CB  . GLU A 1 104 ? -24.749 12.666 32.591 1.00 5.32  ? 85   GLU A CB  1 
ATOM   720  C  CG  . GLU A 1 104 ? -26.108 12.299 32.047 1.00 6.41  ? 85   GLU A CG  1 
ATOM   721  C  CD  . GLU A 1 104 ? -26.493 10.839 32.362 1.00 8.34  ? 85   GLU A CD  1 
ATOM   722  O  OE1 . GLU A 1 104 ? -25.601 9.990  32.630 1.00 7.24  ? 85   GLU A OE1 1 
ATOM   723  O  OE2 . GLU A 1 104 ? -27.703 10.556 32.324 1.00 8.78  ? 85   GLU A OE2 1 
ATOM   724  N  N   . LEU A 1 105 ? -21.436 12.561 32.762 1.00 3.98  ? 86   LEU A N   1 
ATOM   725  C  CA  . LEU A 1 105 ? -20.158 13.184 33.156 1.00 3.07  ? 86   LEU A CA  1 
ATOM   726  C  C   . LEU A 1 105 ? -19.431 13.875 31.989 1.00 3.13  ? 86   LEU A C   1 
ATOM   727  O  O   . LEU A 1 105 ? -18.770 14.895 32.201 1.00 3.14  ? 86   LEU A O   1 
ATOM   728  C  CB  . LEU A 1 105 ? -19.213 12.163 33.778 1.00 2.30  ? 86   LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 105 ? -19.243 11.941 35.298 1.00 4.37  ? 86   LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 105 ? -20.543 11.285 35.771 1.00 2.94  ? 86   LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 105 ? -18.033 11.087 35.716 1.00 2.94  ? 86   LEU A CD2 1 
ATOM   732  N  N   . LEU A 1 106 ? -19.542 13.304 30.785 1.00 2.76  ? 87   LEU A N   1 
ATOM   733  C  CA  . LEU A 1 106 ? -18.927 13.861 29.568 1.00 3.32  ? 87   LEU A CA  1 
ATOM   734  C  C   . LEU A 1 106 ? -19.484 15.227 29.184 1.00 3.84  ? 87   LEU A C   1 
ATOM   735  O  O   . LEU A 1 106 ? -18.871 15.924 28.390 1.00 3.63  ? 87   LEU A O   1 
ATOM   736  C  CB  . LEU A 1 106 ? -19.035 12.897 28.359 1.00 2.70  ? 87   LEU A CB  1 
ATOM   737  C  CG  . LEU A 1 106 ? -18.424 11.473 28.517 1.00 3.50  ? 87   LEU A CG  1 
ATOM   738  C  CD1 . LEU A 1 106 ? -18.688 10.610 27.224 1.00 5.18  ? 87   LEU A CD1 1 
ATOM   739  C  CD2 . LEU A 1 106 ? -16.927 11.475 28.883 1.00 2.00  ? 87   LEU A CD2 1 
ATOM   740  N  N   . SER A 1 107 ? -20.621 15.614 29.760 1.00 4.58  ? 88   SER A N   1 
ATOM   741  C  CA  . SER A 1 107 ? -21.194 16.923 29.478 1.00 5.13  ? 88   SER A CA  1 
ATOM   742  C  C   . SER A 1 107 ? -20.718 17.989 30.480 1.00 5.29  ? 88   SER A C   1 
ATOM   743  O  O   . SER A 1 107 ? -21.036 19.176 30.315 1.00 6.11  ? 88   SER A O   1 
ATOM   744  C  CB  . SER A 1 107 ? -22.717 16.836 29.446 1.00 5.07  ? 88   SER A CB  1 
ATOM   745  O  OG  . SER A 1 107 ? -23.204 16.676 30.778 1.00 8.69  ? 88   SER A OG  1 
ATOM   746  N  N   . PHE A 1 108 ? -19.959 17.579 31.508 1.00 4.65  ? 89   PHE A N   1 
ATOM   747  C  CA  . PHE A 1 108 ? -19.344 18.523 32.481 1.00 3.86  ? 89   PHE A CA  1 
ATOM   748  C  C   . PHE A 1 108 ? -18.231 19.304 31.737 1.00 3.94  ? 89   PHE A C   1 
ATOM   749  O  O   . PHE A 1 108 ? -17.597 18.759 30.822 1.00 3.77  ? 89   PHE A O   1 
ATOM   750  C  CB  . PHE A 1 108 ? -18.661 17.810 33.657 1.00 2.75  ? 89   PHE A CB  1 
ATOM   751  C  CG  . PHE A 1 108 ? -19.582 16.986 34.575 1.00 3.84  ? 89   PHE A CG  1 
ATOM   752  C  CD1 . PHE A 1 108 ? -20.979 17.053 34.504 1.00 4.87  ? 89   PHE A CD1 1 
ATOM   753  C  CD2 . PHE A 1 108 ? -19.011 16.159 35.553 1.00 2.27  ? 89   PHE A CD2 1 
ATOM   754  C  CE1 . PHE A 1 108 ? -21.805 16.260 35.374 1.00 2.83  ? 89   PHE A CE1 1 
ATOM   755  C  CE2 . PHE A 1 108 ? -19.815 15.387 36.440 1.00 3.59  ? 89   PHE A CE2 1 
ATOM   756  C  CZ  . PHE A 1 108 ? -21.216 15.444 36.343 1.00 3.23  ? 89   PHE A CZ  1 
ATOM   757  N  N   . ALA A 1 109 ? -17.973 20.549 32.131 1.00 3.28  ? 90   ALA A N   1 
ATOM   758  C  CA  . ALA A 1 109 ? -16.846 21.296 31.571 1.00 3.25  ? 90   ALA A CA  1 
ATOM   759  C  C   . ALA A 1 109 ? -16.226 22.045 32.723 1.00 2.65  ? 90   ALA A C   1 
ATOM   760  O  O   . ALA A 1 109 ? -16.953 22.580 33.545 1.00 3.06  ? 90   ALA A O   1 
ATOM   761  C  CB  . ALA A 1 109 ? -17.313 22.285 30.445 1.00 2.93  ? 90   ALA A CB  1 
ATOM   762  N  N   . TYR A 1 110 ? -14.901 22.042 32.812 1.00 2.34  ? 91   TYR A N   1 
ATOM   763  C  CA  . TYR A 1 110 ? -14.220 22.709 33.910 1.00 3.32  ? 91   TYR A CA  1 
ATOM   764  C  C   . TYR A 1 110 ? -14.610 24.183 34.010 1.00 3.18  ? 91   TYR A C   1 
ATOM   765  O  O   . TYR A 1 110 ? -14.672 24.902 32.998 1.00 3.25  ? 91   TYR A O   1 
ATOM   766  C  CB  . TYR A 1 110 ? -12.707 22.582 33.814 1.00 3.26  ? 91   TYR A CB  1 
ATOM   767  C  CG  . TYR A 1 110 ? -12.015 23.203 35.028 1.00 3.63  ? 91   TYR A CG  1 
ATOM   768  C  CD1 . TYR A 1 110 ? -12.014 22.556 36.270 1.00 3.13  ? 91   TYR A CD1 1 
ATOM   769  C  CD2 . TYR A 1 110 ? -11.361 24.422 34.918 1.00 2.55  ? 91   TYR A CD2 1 
ATOM   770  C  CE1 . TYR A 1 110 ? -11.377 23.139 37.384 1.00 5.42  ? 91   TYR A CE1 1 
ATOM   771  C  CE2 . TYR A 1 110 ? -10.712 24.998 36.003 1.00 4.05  ? 91   TYR A CE2 1 
ATOM   772  C  CZ  . TYR A 1 110 ? -10.729 24.369 37.240 1.00 5.21  ? 91   TYR A CZ  1 
ATOM   773  O  OH  . TYR A 1 110 ? -10.067 24.974 38.319 1.00 3.25  ? 91   TYR A OH  1 
ATOM   774  N  N   . ASP A 1 111 ? -14.882 24.616 35.228 1.00 2.99  ? 92   ASP A N   1 
ATOM   775  C  CA  . ASP A 1 111 ? -15.243 26.011 35.486 1.00 4.55  ? 92   ASP A CA  1 
ATOM   776  C  C   . ASP A 1 111 ? -14.333 26.618 36.573 1.00 3.97  ? 92   ASP A C   1 
ATOM   777  O  O   . ASP A 1 111 ? -14.488 26.333 37.762 1.00 2.99  ? 92   ASP A O   1 
ATOM   778  C  CB  . ASP A 1 111 ? -16.698 26.058 35.913 1.00 5.47  ? 92   ASP A CB  1 
ATOM   779  C  CG  . ASP A 1 111 ? -17.176 27.463 36.306 1.00 9.95  ? 92   ASP A CG  1 
ATOM   780  O  OD1 . ASP A 1 111 ? -16.509 28.483 36.038 1.00 7.91  ? 92   ASP A OD1 1 
ATOM   781  O  OD2 . ASP A 1 111 ? -18.275 27.507 36.913 1.00 17.26 ? 92   ASP A OD2 1 
ATOM   782  N  N   . SER A 1 112 ? -13.412 27.474 36.147 1.00 3.36  ? 93   SER A N   1 
ATOM   783  C  CA  . SER A 1 112 ? -12.417 28.065 37.045 1.00 3.69  ? 93   SER A CA  1 
ATOM   784  C  C   . SER A 1 112 ? -13.002 28.979 38.125 1.00 3.44  ? 93   SER A C   1 
ATOM   785  O  O   . SER A 1 112 ? -12.384 29.159 39.184 1.00 4.13  ? 93   SER A O   1 
ATOM   786  C  CB  . SER A 1 112 ? -11.327 28.783 36.228 1.00 3.38  ? 93   SER A CB  1 
ATOM   787  O  OG  . SER A 1 112 ? -11.833 29.970 35.625 1.00 5.48  ? 93   SER A OG  1 
ATOM   788  N  N   . THR A 1 113 ? -14.201 29.520 37.887 1.00 2.86  ? 94   THR A N   1 
ATOM   789  C  CA  . THR A 1 113 ? -14.834 30.427 38.838 1.00 2.16  ? 94   THR A CA  1 
ATOM   790  C  C   . THR A 1 113 ? -15.371 29.715 40.084 1.00 2.62  ? 94   THR A C   1 
ATOM   791  O  O   . THR A 1 113 ? -15.654 30.366 41.073 1.00 2.36  ? 94   THR A O   1 
ATOM   792  C  CB  . THR A 1 113 ? -15.946 31.325 38.212 1.00 2.02  ? 94   THR A CB  1 
ATOM   793  O  OG1 . THR A 1 113 ? -17.111 30.553 37.865 1.00 2.22  ? 94   THR A OG1 1 
ATOM   794  C  CG2 . THR A 1 113 ? -15.429 32.105 37.001 1.00 2.00  ? 94   THR A CG2 1 
ATOM   795  N  N   . PHE A 1 114 ? -15.487 28.384 40.039 1.00 2.02  ? 95   PHE A N   1 
ATOM   796  C  CA  . PHE A 1 114 ? -15.983 27.670 41.207 1.00 2.24  ? 95   PHE A CA  1 
ATOM   797  C  C   . PHE A 1 114 ? -14.938 27.391 42.296 1.00 2.30  ? 95   PHE A C   1 
ATOM   798  O  O   . PHE A 1 114 ? -15.139 27.845 43.426 1.00 2.85  ? 95   PHE A O   1 
ATOM   799  C  CB  . PHE A 1 114 ? -16.765 26.391 40.874 1.00 2.00  ? 95   PHE A CB  1 
ATOM   800  C  CG  . PHE A 1 114 ? -17.252 25.647 42.119 1.00 2.00  ? 95   PHE A CG  1 
ATOM   801  C  CD1 . PHE A 1 114 ? -18.459 25.967 42.711 1.00 2.00  ? 95   PHE A CD1 1 
ATOM   802  C  CD2 . PHE A 1 114 ? -16.479 24.643 42.707 1.00 2.00  ? 95   PHE A CD2 1 
ATOM   803  C  CE1 . PHE A 1 114 ? -18.904 25.282 43.867 1.00 2.27  ? 95   PHE A CE1 1 
ATOM   804  C  CE2 . PHE A 1 114 ? -16.927 23.944 43.850 1.00 2.00  ? 95   PHE A CE2 1 
ATOM   805  C  CZ  . PHE A 1 114 ? -18.136 24.263 44.425 1.00 2.00  ? 95   PHE A CZ  1 
ATOM   806  N  N   . PRO A 1 115 ? -13.855 26.641 41.982 1.00 2.51  ? 96   PRO A N   1 
ATOM   807  C  CA  . PRO A 1 115 ? -13.047 26.170 43.109 1.00 2.79  ? 96   PRO A CA  1 
ATOM   808  C  C   . PRO A 1 115 ? -12.041 27.182 43.604 1.00 2.91  ? 96   PRO A C   1 
ATOM   809  O  O   . PRO A 1 115 ? -11.485 27.952 42.808 1.00 3.57  ? 96   PRO A O   1 
ATOM   810  C  CB  . PRO A 1 115 ? -12.310 24.942 42.530 1.00 2.00  ? 96   PRO A CB  1 
ATOM   811  C  CG  . PRO A 1 115 ? -12.101 25.277 41.092 1.00 3.20  ? 96   PRO A CG  1 
ATOM   812  C  CD  . PRO A 1 115 ? -13.321 26.136 40.689 1.00 2.72  ? 96   PRO A CD  1 
ATOM   813  N  N   . THR A 1 116 ? -11.846 27.198 44.925 1.00 3.25  ? 97   THR A N   1 
ATOM   814  C  CA  . THR A 1 116 ? -10.726 27.896 45.548 1.00 2.87  ? 97   THR A CA  1 
ATOM   815  C  C   . THR A 1 116 ? -9.860  26.790 46.178 1.00 2.75  ? 97   THR A C   1 
ATOM   816  O  O   . THR A 1 116 ? -10.375 25.759 46.594 1.00 2.00  ? 97   THR A O   1 
ATOM   817  C  CB  . THR A 1 116 ? -11.209 28.913 46.586 1.00 3.39  ? 97   THR A CB  1 
ATOM   818  O  OG1 . THR A 1 116 ? -11.890 29.970 45.899 1.00 4.50  ? 97   THR A OG1 1 
ATOM   819  C  CG2 . THR A 1 116 ? -10.024 29.563 47.384 1.00 2.10  ? 97   THR A CG2 1 
ATOM   820  N  N   . ARG A 1 117 ? -8.553  26.990 46.197 1.00 2.62  ? 98   ARG A N   1 
ATOM   821  C  CA  . ARG A 1 117 ? -7.671  25.987 46.793 1.00 3.50  ? 98   ARG A CA  1 
ATOM   822  C  C   . ARG A 1 117 ? -7.805  25.950 48.321 1.00 2.80  ? 98   ARG A C   1 
ATOM   823  O  O   . ARG A 1 117 ? -8.122  26.959 48.955 1.00 2.40  ? 98   ARG A O   1 
ATOM   824  C  CB  . ARG A 1 117 ? -6.224  26.257 46.387 1.00 3.56  ? 98   ARG A CB  1 
ATOM   825  C  CG  . ARG A 1 117 ? -5.232  25.214 46.889 1.00 5.17  ? 98   ARG A CG  1 
ATOM   826  C  CD  . ARG A 1 117 ? -3.968  25.240 46.002 1.00 3.52  ? 98   ARG A CD  1 
ATOM   827  N  NE  . ARG A 1 117 ? -3.287  26.553 45.946 1.00 2.93  ? 98   ARG A NE  1 
ATOM   828  C  CZ  . ARG A 1 117 ? -2.122  26.830 46.527 1.00 2.63  ? 98   ARG A CZ  1 
ATOM   829  N  NH1 . ARG A 1 117 ? -1.503  25.899 47.260 1.00 2.68  ? 98   ARG A NH1 1 
ATOM   830  N  NH2 . ARG A 1 117 ? -1.547  28.022 46.335 1.00 2.69  ? 98   ARG A NH2 1 
ATOM   831  N  N   . GLY A 1 118 ? -7.521  24.781 48.886 1.00 3.36  ? 99   GLY A N   1 
ATOM   832  C  CA  . GLY A 1 118 ? -7.455  24.571 50.331 1.00 2.73  ? 99   GLY A CA  1 
ATOM   833  C  C   . GLY A 1 118 ? -8.791  24.178 50.953 1.00 3.11  ? 99   GLY A C   1 
ATOM   834  O  O   . GLY A 1 118 ? -8.903  24.126 52.156 1.00 2.70  ? 99   GLY A O   1 
ATOM   835  N  N   . LEU A 1 119 ? -9.811  23.908 50.132 1.00 2.99  ? 100  LEU A N   1 
ATOM   836  C  CA  . LEU A 1 119 ? -11.102 23.433 50.657 1.00 2.51  ? 100  LEU A CA  1 
ATOM   837  C  C   . LEU A 1 119 ? -10.964 22.011 51.229 1.00 2.26  ? 100  LEU A C   1 
ATOM   838  O  O   . LEU A 1 119 ? -10.021 21.270 50.900 1.00 2.00  ? 100  LEU A O   1 
ATOM   839  C  CB  . LEU A 1 119 ? -12.203 23.489 49.571 1.00 2.00  ? 100  LEU A CB  1 
ATOM   840  C  CG  . LEU A 1 119 ? -12.525 24.877 48.962 1.00 3.40  ? 100  LEU A CG  1 
ATOM   841  C  CD1 . LEU A 1 119 ? -13.514 24.774 47.763 1.00 2.00  ? 100  LEU A CD1 1 
ATOM   842  C  CD2 . LEU A 1 119 ? -13.011 25.922 50.005 1.00 2.00  ? 100  LEU A CD2 1 
ATOM   843  N  N   . VAL A 1 120 ? -11.915 21.656 52.087 1.00 2.41  ? 101  VAL A N   1 
ATOM   844  C  CA  . VAL A 1 120 ? -11.938 20.372 52.760 1.00 2.84  ? 101  VAL A CA  1 
ATOM   845  C  C   . VAL A 1 120 ? -13.149 19.591 52.217 1.00 3.39  ? 101  VAL A C   1 
ATOM   846  O  O   . VAL A 1 120 ? -14.286 20.109 52.244 1.00 3.04  ? 101  VAL A O   1 
ATOM   847  C  CB  . VAL A 1 120 ? -12.035 20.532 54.327 1.00 2.49  ? 101  VAL A CB  1 
ATOM   848  C  CG1 . VAL A 1 120 ? -12.014 19.175 55.026 1.00 3.72  ? 101  VAL A CG1 1 
ATOM   849  C  CG2 . VAL A 1 120 ? -10.899 21.404 54.877 1.00 2.00  ? 101  VAL A CG2 1 
ATOM   850  N  N   . PHE A 1 121 ? -12.911 18.371 51.697 1.00 2.84  ? 102  PHE A N   1 
ATOM   851  C  CA  . PHE A 1 121 ? -14.034 17.527 51.333 1.00 2.08  ? 102  PHE A CA  1 
ATOM   852  C  C   . PHE A 1 121 ? -14.408 16.647 52.502 1.00 2.60  ? 102  PHE A C   1 
ATOM   853  O  O   . PHE A 1 121 ? -13.563 15.901 53.039 1.00 2.01  ? 102  PHE A O   1 
ATOM   854  C  CB  . PHE A 1 121 ? -13.769 16.671 50.088 1.00 2.73  ? 102  PHE A CB  1 
ATOM   855  C  CG  . PHE A 1 121 ? -15.031 16.033 49.527 1.00 2.54  ? 102  PHE A CG  1 
ATOM   856  C  CD1 . PHE A 1 121 ? -16.010 16.836 48.908 1.00 2.00  ? 102  PHE A CD1 1 
ATOM   857  C  CD2 . PHE A 1 121 ? -15.249 14.668 49.644 1.00 2.00  ? 102  PHE A CD2 1 
ATOM   858  C  CE1 . PHE A 1 121 ? -17.199 16.270 48.398 1.00 2.00  ? 102  PHE A CE1 1 
ATOM   859  C  CE2 . PHE A 1 121 ? -16.424 14.087 49.161 1.00 2.00  ? 102  PHE A CE2 1 
ATOM   860  C  CZ  . PHE A 1 121 ? -17.408 14.918 48.506 1.00 2.00  ? 102  PHE A CZ  1 
ATOM   861  N  N   . ASP A 1 122 ? -15.674 16.748 52.909 1.00 2.39  ? 103  ASP A N   1 
ATOM   862  C  CA  . ASP A 1 122 ? -16.184 15.914 53.977 1.00 2.84  ? 103  ASP A CA  1 
ATOM   863  C  C   . ASP A 1 122 ? -16.707 14.647 53.332 1.00 3.03  ? 103  ASP A C   1 
ATOM   864  O  O   . ASP A 1 122 ? -17.764 14.677 52.720 1.00 2.73  ? 103  ASP A O   1 
ATOM   865  C  CB  . ASP A 1 122 ? -17.292 16.648 54.777 1.00 3.00  ? 103  ASP A CB  1 
ATOM   866  C  CG  . ASP A 1 122 ? -17.875 15.785 55.906 1.00 4.03  ? 103  ASP A CG  1 
ATOM   867  O  OD1 . ASP A 1 122 ? -17.542 14.585 56.021 1.00 4.48  ? 103  ASP A OD1 1 
ATOM   868  O  OD2 . ASP A 1 122 ? -18.677 16.303 56.690 1.00 5.43  ? 103  ASP A OD2 1 
ATOM   869  N  N   . THR A 1 123 ? -15.980 13.528 53.471 1.00 3.18  ? 104  THR A N   1 
ATOM   870  C  CA  . THR A 1 123 ? -16.403 12.279 52.791 1.00 3.51  ? 104  THR A CA  1 
ATOM   871  C  C   . THR A 1 123 ? -17.646 11.617 53.419 1.00 4.14  ? 104  THR A C   1 
ATOM   872  O  O   . THR A 1 123 ? -18.253 10.737 52.807 1.00 4.61  ? 104  THR A O   1 
ATOM   873  C  CB  . THR A 1 123 ? -15.269 11.213 52.747 1.00 2.88  ? 104  THR A CB  1 
ATOM   874  O  OG1 . THR A 1 123 ? -14.965 10.805 54.083 1.00 2.60  ? 104  THR A OG1 1 
ATOM   875  C  CG2 . THR A 1 123 ? -14.002 11.738 52.045 1.00 2.00  ? 104  THR A CG2 1 
ATOM   876  N  N   . LEU A 1 124 ? -18.026 12.016 54.635 1.00 3.37  ? 105  LEU A N   1 
ATOM   877  C  CA  . LEU A 1 124 ? -19.233 11.434 55.233 1.00 3.55  ? 105  LEU A CA  1 
ATOM   878  C  C   . LEU A 1 124 ? -20.480 12.038 54.589 1.00 3.17  ? 105  LEU A C   1 
ATOM   879  O  O   . LEU A 1 124 ? -21.395 11.318 54.210 1.00 4.25  ? 105  LEU A O   1 
ATOM   880  C  CB  . LEU A 1 124 ? -19.266 11.634 56.776 1.00 3.17  ? 105  LEU A CB  1 
ATOM   881  C  CG  . LEU A 1 124 ? -20.429 11.024 57.586 1.00 3.63  ? 105  LEU A CG  1 
ATOM   882  C  CD1 . LEU A 1 124 ? -20.526 9.451  57.481 1.00 2.07  ? 105  LEU A CD1 1 
ATOM   883  C  CD2 . LEU A 1 124 ? -20.255 11.449 59.063 1.00 2.78  ? 105  LEU A CD2 1 
ATOM   884  N  N   . TYR A 1 125 ? -20.504 13.360 54.470 1.00 3.28  ? 106  TYR A N   1 
ATOM   885  C  CA  . TYR A 1 125 ? -21.709 14.085 54.046 1.00 3.01  ? 106  TYR A CA  1 
ATOM   886  C  C   . TYR A 1 125 ? -21.652 14.652 52.619 1.00 3.21  ? 106  TYR A C   1 
ATOM   887  O  O   . TYR A 1 125 ? -22.651 15.187 52.121 1.00 2.90  ? 106  TYR A O   1 
ATOM   888  C  CB  . TYR A 1 125 ? -22.083 15.164 55.091 1.00 2.96  ? 106  TYR A CB  1 
ATOM   889  C  CG  . TYR A 1 125 ? -22.498 14.592 56.460 1.00 2.56  ? 106  TYR A CG  1 
ATOM   890  C  CD1 . TYR A 1 125 ? -23.430 13.536 56.574 1.00 3.76  ? 106  TYR A CD1 1 
ATOM   891  C  CD2 . TYR A 1 125 ? -21.972 15.123 57.623 1.00 3.53  ? 106  TYR A CD2 1 
ATOM   892  C  CE1 . TYR A 1 125 ? -23.809 13.028 57.840 1.00 4.62  ? 106  TYR A CE1 1 
ATOM   893  C  CE2 . TYR A 1 125 ? -22.341 14.660 58.857 1.00 4.10  ? 106  TYR A CE2 1 
ATOM   894  C  CZ  . TYR A 1 125 ? -23.245 13.617 58.980 1.00 5.73  ? 106  TYR A CZ  1 
ATOM   895  O  OH  . TYR A 1 125 ? -23.546 13.190 60.260 1.00 5.61  ? 106  TYR A OH  1 
ATOM   896  N  N   . GLY A 1 126 ? -20.500 14.514 51.952 1.00 3.26  ? 107  GLY A N   1 
ATOM   897  C  CA  . GLY A 1 126 ? -20.354 15.004 50.581 1.00 2.38  ? 107  GLY A CA  1 
ATOM   898  C  C   . GLY A 1 126 ? -20.296 16.514 50.404 1.00 2.68  ? 107  GLY A C   1 
ATOM   899  O  O   . GLY A 1 126 ? -20.658 17.028 49.342 1.00 2.99  ? 107  GLY A O   1 
ATOM   900  N  N   . ASN A 1 127 ? -19.799 17.233 51.403 1.00 2.05  ? 108  ASN A N   1 
ATOM   901  C  CA  . ASN A 1 127 ? -19.765 18.719 51.358 1.00 2.45  ? 108  ASN A CA  1 
ATOM   902  C  C   . ASN A 1 127 ? -18.331 19.206 51.076 1.00 2.25  ? 108  ASN A C   1 
ATOM   903  O  O   . ASN A 1 127 ? -17.379 18.592 51.563 1.00 2.00  ? 108  ASN A O   1 
ATOM   904  C  CB  . ASN A 1 127 ? -20.265 19.312 52.706 1.00 2.53  ? 108  ASN A CB  1 
ATOM   905  C  CG  . ASN A 1 127 ? -21.713 18.962 52.985 1.00 3.39  ? 108  ASN A CG  1 
ATOM   906  O  OD1 . ASN A 1 127 ? -22.540 18.994 52.065 1.00 3.37  ? 108  ASN A OD1 1 
ATOM   907  N  ND2 . ASN A 1 127 ? -22.023 18.565 54.221 1.00 2.00  ? 108  ASN A ND2 1 
ATOM   908  N  N   . LEU A 1 128 ? -18.184 20.280 50.294 1.00 2.00  ? 109  LEU A N   1 
ATOM   909  C  CA  . LEU A 1 128 ? -16.930 21.056 50.303 1.00 2.50  ? 109  LEU A CA  1 
ATOM   910  C  C   . LEU A 1 128 ? -16.995 22.119 51.378 1.00 2.40  ? 109  LEU A C   1 
ATOM   911  O  O   . LEU A 1 128 ? -17.946 22.909 51.434 1.00 2.66  ? 109  LEU A O   1 
ATOM   912  C  CB  . LEU A 1 128 ? -16.621 21.735 48.945 1.00 2.63  ? 109  LEU A CB  1 
ATOM   913  C  CG  . LEU A 1 128 ? -16.072 20.801 47.862 1.00 3.72  ? 109  LEU A CG  1 
ATOM   914  C  CD1 . LEU A 1 128 ? -16.161 21.535 46.507 1.00 3.26  ? 109  LEU A CD1 1 
ATOM   915  C  CD2 . LEU A 1 128 ? -14.627 20.282 48.174 1.00 2.00  ? 109  LEU A CD2 1 
ATOM   916  N  N   . LEU A 1 129 ? -15.968 22.160 52.219 1.00 2.57  ? 110  LEU A N   1 
ATOM   917  C  CA  . LEU A 1 129 ? -15.945 23.130 53.319 1.00 2.22  ? 110  LEU A CA  1 
ATOM   918  C  C   . LEU A 1 129 ? -14.756 24.076 53.217 1.00 2.13  ? 110  LEU A C   1 
ATOM   919  O  O   . LEU A 1 129 ? -13.631 23.651 52.941 1.00 2.00  ? 110  LEU A O   1 
ATOM   920  C  CB  . LEU A 1 129 ? -15.926 22.416 54.690 1.00 2.18  ? 110  LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 129 ? -16.976 21.288 54.888 1.00 2.94  ? 110  LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 129 ? -16.611 20.451 56.132 1.00 2.00  ? 110  LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 129 ? -18.414 21.812 54.934 1.00 2.00  ? 110  LEU A CD2 1 
ATOM   924  N  N   . LYS A 1 130 ? -15.016 25.349 53.487 1.00 2.00  ? 111  LYS A N   1 
ATOM   925  C  CA  . LYS A 1 130 ? -13.962 26.325 53.676 1.00 2.00  ? 111  LYS A CA  1 
ATOM   926  C  C   . LYS A 1 130 ? -13.952 26.601 55.166 1.00 2.00  ? 111  LYS A C   1 
ATOM   927  O  O   . LYS A 1 130 ? -14.979 26.984 55.735 1.00 2.00  ? 111  LYS A O   1 
ATOM   928  C  CB  . LYS A 1 130 ? -14.246 27.614 52.915 1.00 2.00  ? 111  LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 130 ? -13.021 28.547 52.771 1.00 2.21  ? 111  LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 130 ? -13.505 29.865 52.144 1.00 2.00  ? 111  LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 130 ? -12.412 30.746 51.641 1.00 2.00  ? 111  LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 130 ? -12.971 31.937 50.882 1.00 2.00  ? 111  LYS A NZ  1 
ATOM   933  N  N   . VAL A 1 131 ? -12.804 26.361 55.801 1.00 2.17  ? 112  VAL A N   1 
ATOM   934  C  CA  . VAL A 1 131 ? -12.723 26.440 57.271 1.00 2.18  ? 112  VAL A CA  1 
ATOM   935  C  C   . VAL A 1 131 ? -11.628 27.404 57.682 1.00 2.27  ? 112  VAL A C   1 
ATOM   936  O  O   . VAL A 1 131 ? -10.730 27.721 56.875 1.00 2.00  ? 112  VAL A O   1 
ATOM   937  C  CB  . VAL A 1 131 ? -12.503 25.032 57.951 1.00 2.00  ? 112  VAL A CB  1 
ATOM   938  C  CG1 . VAL A 1 131 ? -13.615 24.051 57.548 1.00 2.00  ? 112  VAL A CG1 1 
ATOM   939  C  CG2 . VAL A 1 131 ? -11.092 24.449 57.643 1.00 2.00  ? 112  VAL A CG2 1 
ATOM   940  N  N   . ASP A 1 132 ? -11.710 27.869 58.926 1.00 2.00  ? 113  ASP A N   1 
ATOM   941  C  CA  . ASP A 1 132 ? -10.620 28.664 59.492 1.00 2.61  ? 113  ASP A CA  1 
ATOM   942  C  C   . ASP A 1 132 ? -9.605  27.725 60.189 1.00 2.91  ? 113  ASP A C   1 
ATOM   943  O  O   . ASP A 1 132 ? -9.723  26.470 60.080 1.00 2.21  ? 113  ASP A O   1 
ATOM   944  C  CB  . ASP A 1 132 ? -11.161 29.793 60.420 1.00 2.60  ? 113  ASP A CB  1 
ATOM   945  C  CG  . ASP A 1 132 ? -11.735 29.285 61.748 1.00 3.32  ? 113  ASP A CG  1 
ATOM   946  O  OD1 . ASP A 1 132 ? -11.611 28.069 62.105 1.00 3.17  ? 113  ASP A OD1 1 
ATOM   947  O  OD2 . ASP A 1 132 ? -12.317 30.141 62.467 1.00 4.84  ? 113  ASP A OD2 1 
ATOM   948  N  N   . ALA A 1 133 ? -8.640  28.305 60.907 1.00 2.88  ? 114  ALA A N   1 
ATOM   949  C  CA  . ALA A 1 133 ? -7.547  27.498 61.526 1.00 4.27  ? 114  ALA A CA  1 
ATOM   950  C  C   . ALA A 1 133 ? -8.015  26.624 62.666 1.00 4.05  ? 114  ALA A C   1 
ATOM   951  O  O   . ALA A 1 133 ? -7.272  25.765 63.116 1.00 5.69  ? 114  ALA A O   1 
ATOM   952  C  CB  . ALA A 1 133 ? -6.423  28.424 62.049 1.00 4.36  ? 114  ALA A CB  1 
ATOM   953  N  N   . TYR A 1 134 ? -9.228  26.871 63.146 1.00 3.54  ? 115  TYR A N   1 
ATOM   954  C  CA  . TYR A 1 134 ? -9.820  26.162 64.291 1.00 3.37  ? 115  TYR A CA  1 
ATOM   955  C  C   . TYR A 1 134 ? -10.889 25.156 63.851 1.00 3.71  ? 115  TYR A C   1 
ATOM   956  O  O   . TYR A 1 134 ? -11.559 24.575 64.670 1.00 4.91  ? 115  TYR A O   1 
ATOM   957  C  CB  . TYR A 1 134 ? -10.369 27.203 65.288 1.00 2.90  ? 115  TYR A CB  1 
ATOM   958  C  CG  . TYR A 1 134 ? -9.239  28.066 65.810 1.00 2.18  ? 115  TYR A CG  1 
ATOM   959  C  CD1 . TYR A 1 134 ? -8.368  27.566 66.797 1.00 2.98  ? 115  TYR A CD1 1 
ATOM   960  C  CD2 . TYR A 1 134 ? -8.970  29.326 65.260 1.00 3.05  ? 115  TYR A CD2 1 
ATOM   961  C  CE1 . TYR A 1 134 ? -7.302  28.315 67.259 1.00 2.92  ? 115  TYR A CE1 1 
ATOM   962  C  CE2 . TYR A 1 134 ? -7.890  30.091 65.703 1.00 2.42  ? 115  TYR A CE2 1 
ATOM   963  C  CZ  . TYR A 1 134 ? -7.057  29.563 66.706 1.00 3.35  ? 115  TYR A CZ  1 
ATOM   964  O  OH  . TYR A 1 134 ? -5.980  30.284 67.191 1.00 4.30  ? 115  TYR A OH  1 
ATOM   965  N  N   . GLY A 1 135 ? -11.052 24.954 62.547 1.00 3.68  ? 116  GLY A N   1 
ATOM   966  C  CA  . GLY A 1 135 ? -12.077 24.026 62.041 1.00 2.98  ? 116  GLY A CA  1 
ATOM   967  C  C   . GLY A 1 135 ? -13.485 24.620 61.972 1.00 2.55  ? 116  GLY A C   1 
ATOM   968  O  O   . GLY A 1 135 ? -14.439 23.895 61.661 1.00 2.69  ? 116  GLY A O   1 
ATOM   969  N  N   . ASN A 1 136 ? -13.622 25.922 62.244 1.00 2.00  ? 117  ASN A N   1 
ATOM   970  C  CA  . ASN A 1 136 ? -14.920 26.602 62.082 1.00 2.21  ? 117  ASN A CA  1 
ATOM   971  C  C   . ASN A 1 136 ? -15.311 26.774 60.624 1.00 2.37  ? 117  ASN A C   1 
ATOM   972  O  O   . ASN A 1 136 ? -14.492 27.135 59.789 1.00 2.00  ? 117  ASN A O   1 
ATOM   973  C  CB  . ASN A 1 136 ? -14.939 27.963 62.762 1.00 2.00  ? 117  ASN A CB  1 
ATOM   974  C  CG  . ASN A 1 136 ? -14.514 27.884 64.211 1.00 3.08  ? 117  ASN A CG  1 
ATOM   975  O  OD1 . ASN A 1 136 ? -14.952 26.983 64.946 1.00 2.85  ? 117  ASN A OD1 1 
ATOM   976  N  ND2 . ASN A 1 136 ? -13.631 28.793 64.627 1.00 2.00  ? 117  ASN A ND2 1 
ATOM   977  N  N   . LEU A 1 137 ? -16.579 26.497 60.347 1.00 3.13  ? 118  LEU A N   1 
ATOM   978  C  CA  . LEU A 1 137 ? -17.130 26.543 58.993 1.00 3.85  ? 118  LEU A CA  1 
ATOM   979  C  C   . LEU A 1 137 ? -17.299 27.974 58.526 1.00 3.52  ? 118  LEU A C   1 
ATOM   980  O  O   . LEU A 1 137 ? -17.956 28.773 59.188 1.00 2.67  ? 118  LEU A O   1 
ATOM   981  C  CB  . LEU A 1 137 ? -18.484 25.845 58.990 1.00 4.60  ? 118  LEU A CB  1 
ATOM   982  C  CG  . LEU A 1 137 ? -18.456 24.381 58.544 1.00 9.86  ? 118  LEU A CG  1 
ATOM   983  C  CD1 . LEU A 1 137 ? -17.384 23.562 59.249 1.00 10.60 ? 118  LEU A CD1 1 
ATOM   984  C  CD2 . LEU A 1 137 ? -19.850 23.776 58.718 1.00 11.36 ? 118  LEU A CD2 1 
ATOM   985  N  N   . LEU A 1 138 ? -16.668 28.297 57.401 1.00 3.13  ? 119  LEU A N   1 
ATOM   986  C  CA  . LEU A 1 138 ? -16.855 29.582 56.752 1.00 2.84  ? 119  LEU A CA  1 
ATOM   987  C  C   . LEU A 1 138 ? -17.801 29.431 55.578 1.00 3.51  ? 119  LEU A C   1 
ATOM   988  O  O   . LEU A 1 138 ? -18.610 30.304 55.324 1.00 3.91  ? 119  LEU A O   1 
ATOM   989  C  CB  . LEU A 1 138 ? -15.508 30.135 56.265 1.00 2.29  ? 119  LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 138 ? -14.410 30.302 57.338 1.00 2.37  ? 119  LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 138 ? -13.091 30.829 56.714 1.00 2.00  ? 119  LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 138 ? -14.900 31.196 58.544 1.00 2.00  ? 119  LEU A CD2 1 
ATOM   993  N  N   . VAL A 1 139 ? -17.675 28.337 54.833 1.00 3.70  ? 120  VAL A N   1 
ATOM   994  C  CA  . VAL A 1 139 ? -18.545 28.105 53.687 1.00 3.96  ? 120  VAL A CA  1 
ATOM   995  C  C   . VAL A 1 139 ? -18.802 26.604 53.667 1.00 4.55  ? 120  VAL A C   1 
ATOM   996  O  O   . VAL A 1 139 ? -17.923 25.832 54.005 1.00 3.83  ? 120  VAL A O   1 
ATOM   997  C  CB  . VAL A 1 139 ? -17.864 28.493 52.319 1.00 3.54  ? 120  VAL A CB  1 
ATOM   998  C  CG1 . VAL A 1 139 ? -18.810 28.227 51.143 1.00 2.77  ? 120  VAL A CG1 1 
ATOM   999  C  CG2 . VAL A 1 139 ? -17.331 29.919 52.298 1.00 2.94  ? 120  VAL A CG2 1 
ATOM   1000 N  N   . CYS A 1 140 ? -20.010 26.208 53.270 1.00 5.30  ? 121  CYS A N   1 
ATOM   1001 C  CA  . CYS A 1 140 ? -20.358 24.806 53.094 1.00 5.58  ? 121  CYS A CA  1 
ATOM   1002 C  C   . CYS A 1 140 ? -21.178 24.687 51.826 1.00 5.20  ? 121  CYS A C   1 
ATOM   1003 O  O   . CYS A 1 140 ? -22.265 25.249 51.748 1.00 5.74  ? 121  CYS A O   1 
ATOM   1004 C  CB  . CYS A 1 140 ? -21.188 24.333 54.287 1.00 5.59  ? 121  CYS A CB  1 
ATOM   1005 S  SG  . CYS A 1 140 ? -21.791 22.580 54.187 1.00 7.30  ? 121  CYS A SG  1 
ATOM   1006 N  N   . ALA A 1 141 ? -20.673 23.957 50.837 1.00 4.62  ? 122  ALA A N   1 
ATOM   1007 C  CA  . ALA A 1 141 ? -21.452 23.691 49.629 1.00 4.10  ? 122  ALA A CA  1 
ATOM   1008 C  C   . ALA A 1 141 ? -21.685 22.189 49.431 1.00 3.83  ? 122  ALA A C   1 
ATOM   1009 O  O   . ALA A 1 141 ? -20.753 21.396 49.479 1.00 3.74  ? 122  ALA A O   1 
ATOM   1010 C  CB  . ALA A 1 141 ? -20.766 24.272 48.404 1.00 2.88  ? 122  ALA A CB  1 
ATOM   1011 N  N   . HIS A 1 142 ? -22.931 21.825 49.162 1.00 3.43  ? 123  HIS A N   1 
ATOM   1012 C  CA  . HIS A 1 142 ? -23.276 20.465 48.801 1.00 3.74  ? 123  HIS A CA  1 
ATOM   1013 C  C   . HIS A 1 142 ? -23.604 20.553 47.304 1.00 3.63  ? 123  HIS A C   1 
ATOM   1014 O  O   . HIS A 1 142 ? -24.608 21.162 46.928 1.00 3.84  ? 123  HIS A O   1 
ATOM   1015 C  CB  . HIS A 1 142 ? -24.498 19.998 49.619 1.00 3.60  ? 123  HIS A CB  1 
ATOM   1016 C  CG  . HIS A 1 142 ? -24.823 18.554 49.424 1.00 4.60  ? 123  HIS A CG  1 
ATOM   1017 N  ND1 . HIS A 1 142 ? -24.094 17.545 50.017 1.00 5.96  ? 123  HIS A ND1 1 
ATOM   1018 C  CD2 . HIS A 1 142 ? -25.759 17.945 48.659 1.00 4.25  ? 123  HIS A CD2 1 
ATOM   1019 C  CE1 . HIS A 1 142 ? -24.582 16.372 49.644 1.00 4.08  ? 123  HIS A CE1 1 
ATOM   1020 N  NE2 . HIS A 1 142 ? -25.595 16.587 48.826 1.00 7.10  ? 123  HIS A NE2 1 
ATOM   1021 N  N   . GLY A 1 143 ? -22.743 19.997 46.452 1.00 3.18  ? 124  GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 143 ? -22.813 20.272 45.011 1.00 2.89  ? 124  GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 143 ? -22.605 21.769 44.807 1.00 3.31  ? 124  GLY A C   1 
ATOM   1024 O  O   . GLY A 1 143 ? -21.631 22.347 45.300 1.00 2.91  ? 124  GLY A O   1 
ATOM   1025 N  N   . PHE A 1 144 ? -23.559 22.406 44.129 1.00 3.94  ? 125  PHE A N   1 
ATOM   1026 C  CA  . PHE A 1 144 ? -23.542 23.866 43.935 1.00 3.98  ? 125  PHE A CA  1 
ATOM   1027 C  C   . PHE A 1 144 ? -24.561 24.598 44.839 1.00 4.59  ? 125  PHE A C   1 
ATOM   1028 O  O   . PHE A 1 144 ? -24.876 25.792 44.633 1.00 5.29  ? 125  PHE A O   1 
ATOM   1029 C  CB  . PHE A 1 144 ? -23.784 24.177 42.456 1.00 3.56  ? 125  PHE A CB  1 
ATOM   1030 C  CG  . PHE A 1 144 ? -22.871 23.405 41.507 1.00 2.00  ? 125  PHE A CG  1 
ATOM   1031 C  CD1 . PHE A 1 144 ? -21.487 23.470 41.644 1.00 2.11  ? 125  PHE A CD1 1 
ATOM   1032 C  CD2 . PHE A 1 144 ? -23.401 22.667 40.458 1.00 2.00  ? 125  PHE A CD2 1 
ATOM   1033 C  CE1 . PHE A 1 144 ? -20.635 22.779 40.754 1.00 2.00  ? 125  PHE A CE1 1 
ATOM   1034 C  CE2 . PHE A 1 144 ? -22.575 21.999 39.552 1.00 2.00  ? 125  PHE A CE2 1 
ATOM   1035 C  CZ  . PHE A 1 144 ? -21.182 22.067 39.718 1.00 2.00  ? 125  PHE A CZ  1 
ATOM   1036 N  N   . ASN A 1 145 ? -25.054 23.882 45.835 1.00 3.75  ? 126  ASN A N   1 
ATOM   1037 C  CA  . ASN A 1 145 ? -25.931 24.440 46.847 1.00 4.72  ? 126  ASN A CA  1 
ATOM   1038 C  C   . ASN A 1 145 ? -25.133 24.919 48.065 1.00 3.80  ? 126  ASN A C   1 
ATOM   1039 O  O   . ASN A 1 145 ? -24.595 24.112 48.821 1.00 2.93  ? 126  ASN A O   1 
ATOM   1040 C  CB  . ASN A 1 145 ? -26.990 23.387 47.262 1.00 5.15  ? 126  ASN A CB  1 
ATOM   1041 C  CG  . ASN A 1 145 ? -28.046 23.941 48.241 1.00 8.87  ? 126  ASN A CG  1 
ATOM   1042 O  OD1 . ASN A 1 145 ? -28.375 25.148 48.237 1.00 11.70 ? 126  ASN A OD1 1 
ATOM   1043 N  ND2 . ASN A 1 145 ? -28.606 23.047 49.068 1.00 11.36 ? 126  ASN A ND2 1 
ATOM   1044 N  N   . PHE A 1 146 ? -25.062 26.241 48.245 1.00 4.08  ? 127  PHE A N   1 
ATOM   1045 C  CA  . PHE A 1 146 ? -24.382 26.836 49.398 1.00 4.16  ? 127  PHE A CA  1 
ATOM   1046 C  C   . PHE A 1 146 ? -25.335 26.921 50.583 1.00 4.40  ? 127  PHE A C   1 
ATOM   1047 O  O   . PHE A 1 146 ? -26.373 27.572 50.536 1.00 4.31  ? 127  PHE A O   1 
ATOM   1048 C  CB  . PHE A 1 146 ? -23.741 28.197 49.058 1.00 4.85  ? 127  PHE A CB  1 
ATOM   1049 C  CG  . PHE A 1 146 ? -22.565 28.085 48.113 1.00 5.46  ? 127  PHE A CG  1 
ATOM   1050 C  CD1 . PHE A 1 146 ? -22.761 27.736 46.773 1.00 6.24  ? 127  PHE A CD1 1 
ATOM   1051 C  CD2 . PHE A 1 146 ? -21.272 28.299 48.566 1.00 3.72  ? 127  PHE A CD2 1 
ATOM   1052 C  CE1 . PHE A 1 146 ? -21.681 27.619 45.869 1.00 7.91  ? 127  PHE A CE1 1 
ATOM   1053 C  CE2 . PHE A 1 146 ? -20.190 28.189 47.699 1.00 6.74  ? 127  PHE A CE2 1 
ATOM   1054 C  CZ  . PHE A 1 146 ? -20.393 27.846 46.336 1.00 7.62  ? 127  PHE A CZ  1 
ATOM   1055 N  N   . ILE A 1 147 ? -24.951 26.212 51.626 1.00 4.62  ? 128  ILE A N   1 
ATOM   1056 C  CA  . ILE A 1 147 ? -25.761 25.964 52.789 1.00 5.95  ? 128  ILE A CA  1 
ATOM   1057 C  C   . ILE A 1 147 ? -25.428 27.102 53.758 1.00 6.82  ? 128  ILE A C   1 
ATOM   1058 O  O   . ILE A 1 147 ? -24.251 27.334 54.070 1.00 6.26  ? 128  ILE A O   1 
ATOM   1059 C  CB  . ILE A 1 147 ? -25.391 24.563 53.417 1.00 5.68  ? 128  ILE A CB  1 
ATOM   1060 C  CG1 . ILE A 1 147 ? -25.289 23.456 52.348 1.00 6.07  ? 128  ILE A CG1 1 
ATOM   1061 C  CG2 . ILE A 1 147 ? -26.345 24.164 54.544 1.00 6.34  ? 128  ILE A CG2 1 
ATOM   1062 C  CD1 . ILE A 1 147 ? -26.505 23.250 51.486 1.00 3.53  ? 128  ILE A CD1 1 
ATOM   1063 N  N   . ARG A 1 148 ? -26.448 27.827 54.207 1.00 8.54  ? 129  ARG A N   1 
ATOM   1064 C  CA  . ARG A 1 148 ? -26.220 28.927 55.142 1.00 10.87 ? 129  ARG A CA  1 
ATOM   1065 C  C   . ARG A 1 148 ? -26.178 28.408 56.567 1.00 11.22 ? 129  ARG A C   1 
ATOM   1066 O  O   . ARG A 1 148 ? -26.553 27.265 56.832 1.00 11.22 ? 129  ARG A O   1 
ATOM   1067 C  CB  . ARG A 1 148 ? -27.289 29.992 55.029 1.00 11.16 ? 129  ARG A CB  1 
ATOM   1068 C  CG  . ARG A 1 148 ? -27.449 30.573 53.650 1.00 15.42 ? 129  ARG A CG  1 
ATOM   1069 C  CD  . ARG A 1 148 ? -28.524 31.641 53.711 1.00 21.22 ? 129  ARG A CD  1 
ATOM   1070 N  NE  . ARG A 1 148 ? -29.033 31.949 52.387 1.00 26.77 ? 129  ARG A NE  1 
ATOM   1071 C  CZ  . ARG A 1 148 ? -29.992 32.838 52.142 1.00 29.07 ? 129  ARG A CZ  1 
ATOM   1072 N  NH1 . ARG A 1 148 ? -30.550 33.513 53.145 1.00 30.47 ? 129  ARG A NH1 1 
ATOM   1073 N  NH2 . ARG A 1 148 ? -30.393 33.048 50.892 1.00 29.59 ? 129  ARG A NH2 1 
ATOM   1074 N  N   . GLY A 1 149 ? -25.731 29.269 57.476 1.00 11.79 ? 130  GLY A N   1 
ATOM   1075 C  CA  . GLY A 1 149 ? -25.483 28.889 58.862 1.00 12.11 ? 130  GLY A CA  1 
ATOM   1076 C  C   . GLY A 1 149 ? -26.479 27.955 59.541 1.00 12.18 ? 130  GLY A C   1 
ATOM   1077 O  O   . GLY A 1 149 ? -26.099 26.859 59.967 1.00 12.41 ? 130  GLY A O   1 
ATOM   1078 N  N   . PRO A 1 150 ? -27.741 28.397 59.710 1.00 12.25 ? 131  PRO A N   1 
ATOM   1079 C  CA  . PRO A 1 150 ? -28.705 27.528 60.428 1.00 12.17 ? 131  PRO A CA  1 
ATOM   1080 C  C   . PRO A 1 150 ? -28.865 26.111 59.858 1.00 11.80 ? 131  PRO A C   1 
ATOM   1081 O  O   . PRO A 1 150 ? -28.881 25.145 60.628 1.00 10.51 ? 131  PRO A O   1 
ATOM   1082 C  CB  . PRO A 1 150 ? -30.015 28.337 60.381 1.00 12.39 ? 131  PRO A CB  1 
ATOM   1083 C  CG  . PRO A 1 150 ? -29.544 29.771 60.279 1.00 12.05 ? 131  PRO A CG  1 
ATOM   1084 C  CD  . PRO A 1 150 ? -28.338 29.700 59.360 1.00 11.99 ? 131  PRO A CD  1 
ATOM   1085 N  N   . GLU A 1 151 ? -28.940 25.985 58.527 1.00 12.20 ? 132  GLU A N   1 
ATOM   1086 C  CA  . GLU A 1 151 ? -29.003 24.662 57.888 1.00 12.09 ? 132  GLU A CA  1 
ATOM   1087 C  C   . GLU A 1 151 ? -27.717 23.803 58.072 1.00 11.25 ? 132  GLU A C   1 
ATOM   1088 O  O   . GLU A 1 151 ? -27.807 22.571 58.076 1.00 10.47 ? 132  GLU A O   1 
ATOM   1089 C  CB  . GLU A 1 151 ? -29.430 24.759 56.407 1.00 12.32 ? 132  GLU A CB  1 
ATOM   1090 C  CG  . GLU A 1 151 ? -29.769 23.390 55.730 1.00 13.56 ? 132  GLU A CG  1 
ATOM   1091 C  CD  . GLU A 1 151 ? -30.034 23.469 54.204 1.00 15.33 ? 132  GLU A CD  1 
ATOM   1092 O  OE1 . GLU A 1 151 ? -30.341 24.580 53.678 1.00 18.40 ? 132  GLU A OE1 1 
ATOM   1093 O  OE2 . GLU A 1 151 ? -29.931 22.407 53.524 1.00 18.89 ? 132  GLU A OE2 1 
ATOM   1094 N  N   . THR A 1 152 ? -26.542 24.418 58.261 1.00 10.21 ? 133  THR A N   1 
ATOM   1095 C  CA  . THR A 1 152 ? -25.311 23.605 58.452 1.00 10.36 ? 133  THR A CA  1 
ATOM   1096 C  C   . THR A 1 152 ? -25.285 22.879 59.802 1.00 9.75  ? 133  THR A C   1 
ATOM   1097 O  O   . THR A 1 152 ? -24.569 21.884 59.953 1.00 8.59  ? 133  THR A O   1 
ATOM   1098 C  CB  . THR A 1 152 ? -23.987 24.412 58.342 1.00 10.47 ? 133  THR A CB  1 
ATOM   1099 O  OG1 . THR A 1 152 ? -23.973 25.391 59.376 1.00 12.13 ? 133  THR A OG1 1 
ATOM   1100 C  CG2 . THR A 1 152 ? -23.849 25.099 56.975 1.00 9.19  ? 133  THR A CG2 1 
ATOM   1101 N  N   . ARG A 1 153 ? -26.070 23.386 60.761 1.00 9.13  ? 134  ARG A N   1 
ATOM   1102 C  CA  . ARG A 1 153 ? -26.121 22.847 62.119 1.00 9.53  ? 134  ARG A CA  1 
ATOM   1103 C  C   . ARG A 1 153 ? -26.667 21.419 62.231 1.00 9.65  ? 134  ARG A C   1 
ATOM   1104 O  O   . ARG A 1 153 ? -26.308 20.693 63.156 1.00 8.96  ? 134  ARG A O   1 
ATOM   1105 C  CB  . ARG A 1 153 ? -26.866 23.811 63.081 1.00 9.72  ? 134  ARG A CB  1 
ATOM   1106 C  CG  . ARG A 1 153 ? -26.051 25.059 63.421 1.00 9.04  ? 134  ARG A CG  1 
ATOM   1107 C  CD  . ARG A 1 153 ? -26.516 25.656 64.708 1.00 12.56 ? 134  ARG A CD  1 
ATOM   1108 N  NE  . ARG A 1 153 ? -25.902 26.956 64.960 1.00 12.01 ? 134  ARG A NE  1 
ATOM   1109 C  CZ  . ARG A 1 153 ? -24.759 27.136 65.627 1.00 11.47 ? 134  ARG A CZ  1 
ATOM   1110 N  NH1 . ARG A 1 153 ? -24.073 26.091 66.118 1.00 7.66  ? 134  ARG A NH1 1 
ATOM   1111 N  NH2 . ARG A 1 153 ? -24.308 28.371 65.804 1.00 8.89  ? 134  ARG A NH2 1 
ATOM   1112 N  N   . GLU A 1 154 ? -27.517 21.019 61.293 1.00 9.73  ? 135  GLU A N   1 
ATOM   1113 C  CA  . GLU A 1 154 ? -28.005 19.624 61.216 1.00 11.33 ? 135  GLU A CA  1 
ATOM   1114 C  C   . GLU A 1 154 ? -26.817 18.647 61.136 1.00 9.43  ? 135  GLU A C   1 
ATOM   1115 O  O   . GLU A 1 154 ? -26.737 17.713 61.928 1.00 10.35 ? 135  GLU A O   1 
ATOM   1116 C  CB  . GLU A 1 154 ? -28.967 19.440 60.019 1.00 11.14 ? 135  GLU A CB  1 
ATOM   1117 C  CG  . GLU A 1 154 ? -30.198 20.398 60.068 1.00 14.05 ? 135  GLU A CG  1 
ATOM   1118 C  CD  . GLU A 1 154 ? -31.041 20.437 58.769 1.00 16.11 ? 135  GLU A CD  1 
ATOM   1119 O  OE1 . GLU A 1 154 ? -30.910 19.534 57.895 1.00 22.14 ? 135  GLU A OE1 1 
ATOM   1120 O  OE2 . GLU A 1 154 ? -31.868 21.383 58.632 1.00 22.56 ? 135  GLU A OE2 1 
ATOM   1121 N  N   . GLN A 1 155 ? -25.870 18.918 60.242 1.00 7.28  ? 136  GLN A N   1 
ATOM   1122 C  CA  . GLN A 1 155 ? -24.718 18.039 60.022 1.00 5.92  ? 136  GLN A CA  1 
ATOM   1123 C  C   . GLN A 1 155 ? -23.487 18.405 60.855 1.00 5.69  ? 136  GLN A C   1 
ATOM   1124 O  O   . GLN A 1 155 ? -22.652 17.521 61.147 1.00 6.47  ? 136  GLN A O   1 
ATOM   1125 C  CB  . GLN A 1 155 ? -24.366 17.982 58.529 1.00 5.03  ? 136  GLN A CB  1 
ATOM   1126 C  CG  . GLN A 1 155 ? -25.414 17.214 57.719 1.00 4.02  ? 136  GLN A CG  1 
ATOM   1127 C  CD  . GLN A 1 155 ? -25.077 17.087 56.244 1.00 5.52  ? 136  GLN A CD  1 
ATOM   1128 O  OE1 . GLN A 1 155 ? -24.270 17.845 55.699 1.00 3.24  ? 136  GLN A OE1 1 
ATOM   1129 N  NE2 . GLN A 1 155 ? -25.730 16.141 55.579 1.00 3.60  ? 136  GLN A NE2 1 
ATOM   1130 N  N   . TYR A 1 156 ? -23.394 19.688 61.233 1.00 3.97  ? 137  TYR A N   1 
ATOM   1131 C  CA  . TYR A 1 156 ? -22.278 20.251 62.013 1.00 3.34  ? 137  TYR A CA  1 
ATOM   1132 C  C   . TYR A 1 156 ? -22.881 21.067 63.132 1.00 3.07  ? 137  TYR A C   1 
ATOM   1133 O  O   . TYR A 1 156 ? -23.008 22.303 63.007 1.00 3.08  ? 137  TYR A O   1 
ATOM   1134 C  CB  . TYR A 1 156 ? -21.362 21.150 61.143 1.00 3.13  ? 137  TYR A CB  1 
ATOM   1135 C  CG  . TYR A 1 156 ? -20.961 20.493 59.839 1.00 3.38  ? 137  TYR A CG  1 
ATOM   1136 C  CD1 . TYR A 1 156 ? -19.842 19.658 59.776 1.00 2.88  ? 137  TYR A CD1 1 
ATOM   1137 C  CD2 . TYR A 1 156 ? -21.725 20.676 58.668 1.00 2.00  ? 137  TYR A CD2 1 
ATOM   1138 C  CE1 . TYR A 1 156 ? -19.483 19.020 58.564 1.00 3.47  ? 137  TYR A CE1 1 
ATOM   1139 C  CE2 . TYR A 1 156 ? -21.374 20.033 57.466 1.00 2.46  ? 137  TYR A CE2 1 
ATOM   1140 C  CZ  . TYR A 1 156 ? -20.242 19.224 57.429 1.00 2.35  ? 137  TYR A CZ  1 
ATOM   1141 O  OH  . TYR A 1 156 ? -19.871 18.608 56.252 1.00 2.77  ? 137  TYR A OH  1 
ATOM   1142 N  N   . PRO A 1 157 ? -23.288 20.387 64.232 1.00 3.21  ? 138  PRO A N   1 
ATOM   1143 C  CA  . PRO A 1 157 ? -23.978 21.005 65.366 1.00 2.84  ? 138  PRO A CA  1 
ATOM   1144 C  C   . PRO A 1 157 ? -23.200 22.148 66.035 1.00 2.79  ? 138  PRO A C   1 
ATOM   1145 O  O   . PRO A 1 157 ? -23.803 23.015 66.685 1.00 2.62  ? 138  PRO A O   1 
ATOM   1146 C  CB  . PRO A 1 157 ? -24.153 19.831 66.344 1.00 2.94  ? 138  PRO A CB  1 
ATOM   1147 C  CG  . PRO A 1 157 ? -24.200 18.640 65.475 1.00 4.15  ? 138  PRO A CG  1 
ATOM   1148 C  CD  . PRO A 1 157 ? -23.156 18.927 64.418 1.00 3.47  ? 138  PRO A CD  1 
ATOM   1149 N  N   . ASN A 1 158 ? -21.874 22.122 65.923 1.00 2.37  ? 139  ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 158 ? -21.052 23.174 66.492 1.00 2.33  ? 139  ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 158 ? -20.404 24.000 65.382 1.00 2.07  ? 139  ASN A C   1 
ATOM   1152 O  O   . ASN A 1 158 ? -19.503 24.774 65.645 1.00 2.00  ? 139  ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 158 ? -20.002 22.582 67.453 1.00 2.00  ? 139  ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 158 ? -19.334 23.634 68.323 1.00 2.00  ? 139  ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 158 ? -19.972 24.596 68.817 1.00 2.00  ? 139  ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 158 ? -18.025 23.454 68.534 1.00 2.00  ? 139  ASN A ND2 1 
ATOM   1157 N  N   . LYS A 1 159 ? -20.890 23.841 64.154 1.00 2.19  ? 140  LYS A N   1 
ATOM   1158 C  CA  . LYS A 1 159 ? -20.321 24.539 62.969 1.00 4.67  ? 140  LYS A CA  1 
ATOM   1159 C  C   . LYS A 1 159 ? -18.779 24.418 62.926 1.00 3.17  ? 140  LYS A C   1 
ATOM   1160 O  O   . LYS A 1 159 ? -18.057 25.404 62.746 1.00 2.72  ? 140  LYS A O   1 
ATOM   1161 C  CB  . LYS A 1 159 ? -20.810 26.005 62.943 1.00 4.98  ? 140  LYS A CB  1 
ATOM   1162 C  CG  . LYS A 1 159 ? -22.075 26.186 62.044 1.00 9.86  ? 140  LYS A CG  1 
ATOM   1163 C  CD  . LYS A 1 159 ? -22.914 27.400 62.404 1.00 9.75  ? 140  LYS A CD  1 
ATOM   1164 C  CE  . LYS A 1 159 ? -22.278 28.712 62.001 1.00 16.92 ? 140  LYS A CE  1 
ATOM   1165 N  NZ  . LYS A 1 159 ? -23.372 29.727 61.755 1.00 21.67 ? 140  LYS A NZ  1 
ATOM   1166 N  N   . PHE A 1 160 ? -18.317 23.182 63.083 1.00 2.79  ? 141  PHE A N   1 
ATOM   1167 C  CA  . PHE A 1 160 ? -16.932 22.859 63.427 1.00 3.17  ? 141  PHE A CA  1 
ATOM   1168 C  C   . PHE A 1 160 ? -16.640 21.470 62.912 1.00 2.68  ? 141  PHE A C   1 
ATOM   1169 O  O   . PHE A 1 160 ? -17.469 20.551 63.011 1.00 2.83  ? 141  PHE A O   1 
ATOM   1170 C  CB  . PHE A 1 160 ? -16.725 22.945 64.979 1.00 3.49  ? 141  PHE A CB  1 
ATOM   1171 C  CG  . PHE A 1 160 ? -15.537 22.163 65.517 1.00 3.30  ? 141  PHE A CG  1 
ATOM   1172 C  CD1 . PHE A 1 160 ? -14.284 22.750 65.580 1.00 3.58  ? 141  PHE A CD1 1 
ATOM   1173 C  CD2 . PHE A 1 160 ? -15.682 20.854 65.975 1.00 5.52  ? 141  PHE A CD2 1 
ATOM   1174 C  CE1 . PHE A 1 160 ? -13.182 22.041 66.080 1.00 4.22  ? 141  PHE A CE1 1 
ATOM   1175 C  CE2 . PHE A 1 160 ? -14.584 20.125 66.476 1.00 3.95  ? 141  PHE A CE2 1 
ATOM   1176 C  CZ  . PHE A 1 160 ? -13.332 20.740 66.542 1.00 2.00  ? 141  PHE A CZ  1 
ATOM   1177 N  N   . ILE A 1 161 ? -15.459 21.311 62.349 1.00 2.88  ? 142  ILE A N   1 
ATOM   1178 C  CA  . ILE A 1 161 ? -14.961 19.976 62.059 1.00 2.91  ? 142  ILE A CA  1 
ATOM   1179 C  C   . ILE A 1 161 ? -13.631 19.770 62.780 1.00 3.81  ? 142  ILE A C   1 
ATOM   1180 O  O   . ILE A 1 161 ? -12.870 20.745 63.045 1.00 3.37  ? 142  ILE A O   1 
ATOM   1181 C  CB  . ILE A 1 161 ? -14.778 19.756 60.528 1.00 2.63  ? 142  ILE A CB  1 
ATOM   1182 C  CG1 . ILE A 1 161 ? -13.774 20.772 59.933 1.00 3.60  ? 142  ILE A CG1 1 
ATOM   1183 C  CG2 . ILE A 1 161 ? -16.103 19.877 59.827 1.00 2.00  ? 142  ILE A CG2 1 
ATOM   1184 C  CD1 . ILE A 1 161 ? -13.038 20.292 58.669 1.00 2.00  ? 142  ILE A CD1 1 
ATOM   1185 N  N   . GLN A 1 162 ? -13.378 18.505 63.092 1.00 4.69  ? 143  GLN A N   1 
ATOM   1186 C  CA  A GLN A 1 162 ? -12.095 18.041 63.636 0.50 5.10  ? 143  GLN A CA  1 
ATOM   1187 C  CA  B GLN A 1 162 ? -12.097 18.080 63.622 0.50 5.65  ? 143  GLN A CA  1 
ATOM   1188 C  C   . GLN A 1 162 ? -11.205 17.728 62.435 1.00 6.09  ? 143  GLN A C   1 
ATOM   1189 O  O   . GLN A 1 162 ? -11.240 16.612 61.925 1.00 4.80  ? 143  GLN A O   1 
ATOM   1190 C  CB  A GLN A 1 162 ? -12.269 16.754 64.478 0.50 4.88  ? 143  GLN A CB  1 
ATOM   1191 C  CB  B GLN A 1 162 ? -12.310 16.870 64.524 0.50 5.40  ? 143  GLN A CB  1 
ATOM   1192 C  CG  A GLN A 1 162 ? -13.407 16.731 65.530 0.50 4.07  ? 143  GLN A CG  1 
ATOM   1193 C  CG  B GLN A 1 162 ? -11.401 16.834 65.720 0.50 6.13  ? 143  GLN A CG  1 
ATOM   1194 C  CD  A GLN A 1 162 ? -13.484 15.423 66.366 0.50 3.87  ? 143  GLN A CD  1 
ATOM   1195 C  CD  B GLN A 1 162 ? -9.981  16.456 65.367 0.50 5.82  ? 143  GLN A CD  1 
ATOM   1196 O  OE1 A GLN A 1 162 ? -13.807 15.458 67.560 0.50 2.00  ? 143  GLN A OE1 1 
ATOM   1197 O  OE1 B GLN A 1 162 ? -9.094  17.308 65.416 0.50 8.15  ? 143  GLN A OE1 1 
ATOM   1198 N  NE2 A GLN A 1 162 ? -13.187 14.279 65.737 0.50 2.00  ? 143  GLN A NE2 1 
ATOM   1199 N  NE2 B GLN A 1 162 ? -9.753  15.180 65.007 0.50 2.21  ? 143  GLN A NE2 1 
ATOM   1200 N  N   . ARG A 1 163 ? -10.388 18.678 61.974 1.00 8.37  ? 144  ARG A N   1 
ATOM   1201 C  CA  . ARG A 1 163 ? -9.732  18.454 60.650 1.00 11.89 ? 144  ARG A CA  1 
ATOM   1202 C  C   . ARG A 1 163 ? -8.655  17.355 60.522 1.00 12.78 ? 144  ARG A C   1 
ATOM   1203 O  O   . ARG A 1 163 ? -8.307  16.949 59.387 1.00 15.58 ? 144  ARG A O   1 
ATOM   1204 C  CB  . ARG A 1 163 ? -9.176  19.741 60.063 1.00 12.42 ? 144  ARG A CB  1 
ATOM   1205 C  CG  . ARG A 1 163 ? -7.930  20.230 60.765 1.00 13.65 ? 144  ARG A CG  1 
ATOM   1206 C  CD  . ARG A 1 163 ? -7.608  21.622 60.225 1.00 13.12 ? 144  ARG A CD  1 
ATOM   1207 N  NE  . ARG A 1 163 ? -6.999  22.427 61.259 1.00 10.10 ? 144  ARG A NE  1 
ATOM   1208 C  CZ  . ARG A 1 163 ? -5.699  22.517 61.428 1.00 9.54  ? 144  ARG A CZ  1 
ATOM   1209 N  NH1 . ARG A 1 163 ? -4.876  21.845 60.608 1.00 11.76 ? 144  ARG A NH1 1 
ATOM   1210 N  NH2 . ARG A 1 163 ? -5.227  23.279 62.406 1.00 4.03  ? 144  ARG A NH2 1 
ATOM   1211 N  N   . ASP A 1 164 ? -8.103  16.942 61.645 1.00 11.73 ? 145  ASP A N   1 
ATOM   1212 C  CA  A ASP A 1 164 ? -7.107  15.883 61.747 0.50 12.01 ? 145  ASP A CA  1 
ATOM   1213 C  CA  B ASP A 1 164 ? -7.105  15.902 61.614 0.50 12.08 ? 145  ASP A CA  1 
ATOM   1214 C  C   . ASP A 1 164 ? -7.756  14.502 61.741 1.00 11.72 ? 145  ASP A C   1 
ATOM   1215 O  O   . ASP A 1 164 ? -7.061  13.490 61.838 1.00 11.82 ? 145  ASP A O   1 
ATOM   1216 C  CB  A ASP A 1 164 ? -6.455  15.993 63.108 0.50 12.14 ? 145  ASP A CB  1 
ATOM   1217 C  CB  B ASP A 1 164 ? -6.000  16.194 62.650 0.50 12.69 ? 145  ASP A CB  1 
ATOM   1218 C  CG  A ASP A 1 164 ? -7.466  15.873 64.193 0.50 12.38 ? 145  ASP A CG  1 
ATOM   1219 C  CG  B ASP A 1 164 ? -5.200  17.463 62.306 0.50 12.81 ? 145  ASP A CG  1 
ATOM   1220 O  OD1 A ASP A 1 164 ? -8.489  16.603 64.070 0.50 10.04 ? 145  ASP A OD1 1 
ATOM   1221 O  OD1 B ASP A 1 164 ? -4.536  17.485 61.249 0.50 13.11 ? 145  ASP A OD1 1 
ATOM   1222 O  OD2 A ASP A 1 164 ? -7.268  15.047 65.121 0.50 13.51 ? 145  ASP A OD2 1 
ATOM   1223 O  OD2 B ASP A 1 164 ? -5.242  18.443 63.080 0.50 14.19 ? 145  ASP A OD2 1 
ATOM   1224 N  N   . ASP A 1 165 ? -9.096  14.462 61.700 1.00 9.59  ? 146  ASP A N   1 
ATOM   1225 C  CA  . ASP A 1 165 ? -9.808  13.234 61.449 1.00 7.53  ? 146  ASP A CA  1 
ATOM   1226 C  C   . ASP A 1 165 ? -9.615  13.025 59.942 1.00 7.35  ? 146  ASP A C   1 
ATOM   1227 O  O   . ASP A 1 165 ? -10.495 13.334 59.115 1.00 5.29  ? 146  ASP A O   1 
ATOM   1228 C  CB  . ASP A 1 165 ? -11.277 13.358 61.865 1.00 6.64  ? 146  ASP A CB  1 
ATOM   1229 C  CG  . ASP A 1 165 ? -12.103 12.109 61.528 1.00 6.96  ? 146  ASP A CG  1 
ATOM   1230 O  OD1 . ASP A 1 165 ? -11.540 11.115 61.042 1.00 7.10  ? 146  ASP A OD1 1 
ATOM   1231 O  OD2 . ASP A 1 165 ? -13.328 12.115 61.767 1.00 7.07  ? 146  ASP A OD2 1 
ATOM   1232 N  N   . THR A 1 166 ? -8.446  12.490 59.598 1.00 7.94  ? 147  THR A N   1 
ATOM   1233 C  CA  . THR A 1 166 ? -8.021  12.375 58.190 1.00 9.62  ? 147  THR A CA  1 
ATOM   1234 C  C   . THR A 1 166 ? -8.723  11.269 57.430 1.00 9.89  ? 147  THR A C   1 
ATOM   1235 O  O   . THR A 1 166 ? -8.758  11.280 56.214 1.00 11.80 ? 147  THR A O   1 
ATOM   1236 C  CB  . THR A 1 166 ? -6.497  12.209 58.063 1.00 9.67  ? 147  THR A CB  1 
ATOM   1237 O  OG1 . THR A 1 166 ? -6.072  11.119 58.891 1.00 10.64 ? 147  THR A OG1 1 
ATOM   1238 C  CG2 . THR A 1 166 ? -5.805  13.476 58.521 1.00 10.18 ? 147  THR A CG2 1 
ATOM   1239 N  N   . GLU A 1 167 ? -9.301  10.312 58.131 1.00 10.12 ? 148  GLU A N   1 
ATOM   1240 C  CA  A GLU A 1 167 ? -10.130 9.288  57.507 0.50 10.08 ? 148  GLU A CA  1 
ATOM   1241 C  CA  B GLU A 1 167 ? -10.102 9.312  57.449 0.50 10.06 ? 148  GLU A CA  1 
ATOM   1242 C  C   . GLU A 1 167 ? -11.423 9.911  56.950 1.00 9.49  ? 148  GLU A C   1 
ATOM   1243 O  O   . GLU A 1 167 ? -11.967 9.443  55.950 1.00 10.54 ? 148  GLU A O   1 
ATOM   1244 C  CB  A GLU A 1 167 ? -10.433 8.175  58.517 0.50 10.18 ? 148  GLU A CB  1 
ATOM   1245 C  CB  B GLU A 1 167 ? -10.318 8.085  58.329 0.50 10.62 ? 148  GLU A CB  1 
ATOM   1246 C  CG  A GLU A 1 167 ? -9.169  7.425  59.006 0.50 11.48 ? 148  GLU A CG  1 
ATOM   1247 C  CG  B GLU A 1 167 ? -9.015  7.333  58.672 0.50 13.56 ? 148  GLU A CG  1 
ATOM   1248 C  CD  A GLU A 1 167 ? -9.387  6.530  60.227 0.50 11.81 ? 148  GLU A CD  1 
ATOM   1249 C  CD  B GLU A 1 167 ? -8.338  6.727  57.447 0.50 17.68 ? 148  GLU A CD  1 
ATOM   1250 O  OE1 A GLU A 1 167 ? -9.836  7.026  61.294 0.50 13.93 ? 148  GLU A OE1 1 
ATOM   1251 O  OE1 B GLU A 1 167 ? -8.708  5.590  57.073 0.50 19.22 ? 148  GLU A OE1 1 
ATOM   1252 O  OE2 A GLU A 1 167 ? -9.054  5.325  60.137 0.50 14.42 ? 148  GLU A OE2 1 
ATOM   1253 O  OE2 B GLU A 1 167 ? -7.439  7.385  56.861 0.50 18.41 ? 148  GLU A OE2 1 
ATOM   1254 N  N   . ARG A 1 168 ? -11.928 10.961 57.611 1.00 6.84  ? 149  ARG A N   1 
ATOM   1255 C  CA  . ARG A 1 168 ? -13.140 11.633 57.145 1.00 4.16  ? 149  ARG A CA  1 
ATOM   1256 C  C   . ARG A 1 168 ? -12.908 12.842 56.212 1.00 3.73  ? 149  ARG A C   1 
ATOM   1257 O  O   . ARG A 1 168 ? -13.617 13.023 55.223 1.00 3.08  ? 149  ARG A O   1 
ATOM   1258 C  CB  . ARG A 1 168 ? -14.014 12.060 58.334 1.00 4.81  ? 149  ARG A CB  1 
ATOM   1259 C  CG  . ARG A 1 168 ? -15.277 12.816 57.947 1.00 3.60  ? 149  ARG A CG  1 
ATOM   1260 C  CD  . ARG A 1 168 ? -16.207 13.006 59.146 1.00 3.28  ? 149  ARG A CD  1 
ATOM   1261 N  NE  . ARG A 1 168 ? -17.253 13.984 58.835 1.00 2.00  ? 149  ARG A NE  1 
ATOM   1262 C  CZ  . ARG A 1 168 ? -18.079 14.507 59.742 1.00 3.69  ? 149  ARG A CZ  1 
ATOM   1263 N  NH1 . ARG A 1 168 ? -18.001 14.123 61.030 1.00 2.02  ? 149  ARG A NH1 1 
ATOM   1264 N  NH2 . ARG A 1 168 ? -18.984 15.412 59.367 1.00 2.27  ? 149  ARG A NH2 1 
ATOM   1265 N  N   . PHE A 1 169 ? -11.926 13.673 56.526 1.00 2.50  ? 150  PHE A N   1 
ATOM   1266 C  CA  . PHE A 1 169 ? -11.778 14.958 55.852 1.00 2.49  ? 150  PHE A CA  1 
ATOM   1267 C  C   . PHE A 1 169 ? -10.528 14.931 54.970 1.00 2.85  ? 150  PHE A C   1 
ATOM   1268 O  O   . PHE A 1 169 ? -9.456  14.544 55.415 1.00 2.29  ? 150  PHE A O   1 
ATOM   1269 C  CB  . PHE A 1 169 ? -11.693 16.121 56.888 1.00 2.14  ? 150  PHE A CB  1 
ATOM   1270 C  CG  . PHE A 1 169 ? -12.916 16.244 57.786 1.00 2.00  ? 150  PHE A CG  1 
ATOM   1271 C  CD1 . PHE A 1 169 ? -14.150 16.703 57.271 1.00 2.00  ? 150  PHE A CD1 1 
ATOM   1272 C  CD2 . PHE A 1 169 ? -12.841 15.879 59.130 1.00 2.00  ? 150  PHE A CD2 1 
ATOM   1273 C  CE1 . PHE A 1 169 ? -15.290 16.810 58.085 1.00 2.00  ? 150  PHE A CE1 1 
ATOM   1274 C  CE2 . PHE A 1 169 ? -13.972 15.990 59.964 1.00 2.00  ? 150  PHE A CE2 1 
ATOM   1275 C  CZ  . PHE A 1 169 ? -15.205 16.438 59.426 1.00 2.00  ? 150  PHE A CZ  1 
ATOM   1276 N  N   . TYR A 1 170 ? -10.671 15.362 53.723 1.00 2.86  ? 151  TYR A N   1 
ATOM   1277 C  CA  . TYR A 1 170 ? -9.513  15.526 52.848 1.00 2.83  ? 151  TYR A CA  1 
ATOM   1278 C  C   . TYR A 1 170 ? -9.283  17.011 52.448 1.00 2.00  ? 151  TYR A C   1 
ATOM   1279 O  O   . TYR A 1 170 ? -10.147 17.655 51.868 1.00 2.00  ? 151  TYR A O   1 
ATOM   1280 C  CB  . TYR A 1 170 ? -9.681  14.655 51.591 1.00 3.38  ? 151  TYR A CB  1 
ATOM   1281 C  CG  . TYR A 1 170 ? -8.416  14.553 50.769 1.00 4.76  ? 151  TYR A CG  1 
ATOM   1282 C  CD1 . TYR A 1 170 ? -7.483  13.558 51.038 1.00 6.24  ? 151  TYR A CD1 1 
ATOM   1283 C  CD2 . TYR A 1 170 ? -8.150  15.446 49.737 1.00 3.22  ? 151  TYR A CD2 1 
ATOM   1284 C  CE1 . TYR A 1 170 ? -6.311  13.441 50.274 1.00 7.15  ? 151  TYR A CE1 1 
ATOM   1285 C  CE2 . TYR A 1 170 ? -6.972  15.347 48.974 1.00 5.60  ? 151  TYR A CE2 1 
ATOM   1286 C  CZ  . TYR A 1 170 ? -6.060  14.351 49.275 1.00 6.65  ? 151  TYR A CZ  1 
ATOM   1287 O  OH  . TYR A 1 170 ? -4.903  14.214 48.548 1.00 9.89  ? 151  TYR A OH  1 
ATOM   1288 N  N   . ILE A 1 171 ? -8.103  17.522 52.736 1.00 2.00  ? 152  ILE A N   1 
ATOM   1289 C  CA  . ILE A 1 171 ? -7.781  18.924 52.443 1.00 2.49  ? 152  ILE A CA  1 
ATOM   1290 C  C   . ILE A 1 171 ? -7.135  19.003 51.074 1.00 2.36  ? 152  ILE A C   1 
ATOM   1291 O  O   . ILE A 1 171 ? -6.127  18.346 50.806 1.00 2.01  ? 152  ILE A O   1 
ATOM   1292 C  CB  . ILE A 1 171 ? -6.907  19.595 53.542 1.00 2.60  ? 152  ILE A CB  1 
ATOM   1293 C  CG1 . ILE A 1 171 ? -7.609  19.452 54.905 1.00 3.16  ? 152  ILE A CG1 1 
ATOM   1294 C  CG2 . ILE A 1 171 ? -6.603  21.105 53.179 1.00 2.00  ? 152  ILE A CG2 1 
ATOM   1295 C  CD1 . ILE A 1 171 ? -6.751  19.833 56.110 1.00 4.20  ? 152  ILE A CD1 1 
ATOM   1296 N  N   . LEU A 1 172 ? -7.769  19.782 50.204 1.00 2.32  ? 153  LEU A N   1 
ATOM   1297 C  CA  . LEU A 1 172 ? -7.392  19.903 48.800 1.00 2.87  ? 153  LEU A CA  1 
ATOM   1298 C  C   . LEU A 1 172 ? -6.395  21.058 48.679 1.00 3.03  ? 153  LEU A C   1 
ATOM   1299 O  O   . LEU A 1 172 ? -6.730  22.157 48.238 1.00 3.48  ? 153  LEU A O   1 
ATOM   1300 C  CB  . LEU A 1 172 ? -8.645  20.144 47.953 1.00 2.36  ? 153  LEU A CB  1 
ATOM   1301 C  CG  . LEU A 1 172 ? -9.627  18.954 48.057 1.00 5.07  ? 153  LEU A CG  1 
ATOM   1302 C  CD1 . LEU A 1 172 ? -11.118 19.387 47.967 1.00 3.06  ? 153  LEU A CD1 1 
ATOM   1303 C  CD2 . LEU A 1 172 ? -9.285  17.878 46.975 1.00 3.58  ? 153  LEU A CD2 1 
ATOM   1304 N  N   . ASN A 1 173 ? -5.160  20.746 49.041 1.00 2.54  ? 154  ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 173 ? -4.091  21.697 49.334 1.00 2.57  ? 154  ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 173 ? -3.258  22.238 48.161 1.00 2.00  ? 154  ASN A C   1 
ATOM   1307 O  O   . ASN A 1 173 ? -2.584  23.272 48.296 1.00 2.00  ? 154  ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 173 ? -3.120  20.984 50.313 1.00 2.38  ? 154  ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 173 ? -3.227  21.534 51.687 1.00 4.78  ? 154  ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 173 ? -3.648  22.683 51.854 1.00 6.57  ? 154  ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 173 ? -2.862  20.748 52.685 1.00 2.75  ? 154  ASN A ND2 1 
ATOM   1312 N  N   . THR A 1 174 ? -3.253  21.528 47.040 1.00 2.00  ? 155  THR A N   1 
ATOM   1313 C  CA  . THR A 1 174 ? -2.400  21.937 45.915 1.00 2.00  ? 155  THR A CA  1 
ATOM   1314 C  C   . THR A 1 174 ? -3.212  22.368 44.707 1.00 2.00  ? 155  THR A C   1 
ATOM   1315 O  O   . THR A 1 174 ? -4.397  22.050 44.584 1.00 2.00  ? 155  THR A O   1 
ATOM   1316 C  CB  . THR A 1 174 ? -1.436  20.819 45.465 1.00 2.00  ? 155  THR A CB  1 
ATOM   1317 O  OG1 . THR A 1 174 ? -2.174  19.868 44.689 1.00 3.97  ? 155  THR A OG1 1 
ATOM   1318 C  CG2 . THR A 1 174 ? -0.814  20.102 46.698 1.00 3.43  ? 155  THR A CG2 1 
ATOM   1319 N  N   . LEU A 1 175 ? -2.549  23.079 43.801 1.00 2.00  ? 156  LEU A N   1 
ATOM   1320 C  CA  . LEU A 1 175 ? -3.180  23.463 42.529 1.00 2.00  ? 156  LEU A CA  1 
ATOM   1321 C  C   . LEU A 1 175 ? -3.525  22.238 41.652 1.00 2.00  ? 156  LEU A C   1 
ATOM   1322 O  O   . LEU A 1 175 ? -4.391  22.335 40.786 1.00 2.00  ? 156  LEU A O   1 
ATOM   1323 C  CB  . LEU A 1 175 ? -2.341  24.507 41.790 1.00 2.00  ? 156  LEU A CB  1 
ATOM   1324 C  CG  . LEU A 1 175 ? -2.329  25.907 42.467 1.00 2.31  ? 156  LEU A CG  1 
ATOM   1325 C  CD1 . LEU A 1 175 ? -1.193  26.753 41.988 1.00 2.25  ? 156  LEU A CD1 1 
ATOM   1326 C  CD2 . LEU A 1 175 ? -3.646  26.641 42.184 1.00 4.45  ? 156  LEU A CD2 1 
ATOM   1327 N  N   . PHE A 1 176 ? -2.882  21.091 41.902 1.00 2.00  ? 157  PHE A N   1 
ATOM   1328 C  CA  . PHE A 1 176 ? -3.266  19.832 41.234 1.00 2.00  ? 157  PHE A CA  1 
ATOM   1329 C  C   . PHE A 1 176 ? -4.665  19.377 41.637 1.00 2.17  ? 157  PHE A C   1 
ATOM   1330 O  O   . PHE A 1 176 ? -5.302  18.650 40.896 1.00 3.19  ? 157  PHE A O   1 
ATOM   1331 C  CB  . PHE A 1 176 ? -2.269  18.704 41.534 1.00 2.00  ? 157  PHE A CB  1 
ATOM   1332 C  CG  . PHE A 1 176 ? -0.931  18.850 40.840 1.00 2.00  ? 157  PHE A CG  1 
ATOM   1333 C  CD1 . PHE A 1 176 ? -0.828  18.796 39.430 1.00 2.00  ? 157  PHE A CD1 1 
ATOM   1334 C  CD2 . PHE A 1 176 ? 0.244   19.017 41.599 1.00 2.00  ? 157  PHE A CD2 1 
ATOM   1335 C  CE1 . PHE A 1 176 ? 0.433   18.922 38.785 1.00 2.00  ? 157  PHE A CE1 1 
ATOM   1336 C  CE2 . PHE A 1 176 ? 1.505   19.134 40.963 1.00 2.00  ? 157  PHE A CE2 1 
ATOM   1337 C  CZ  . PHE A 1 176 ? 1.591   19.077 39.541 1.00 2.00  ? 157  PHE A CZ  1 
ATOM   1338 N  N   . ASN A 1 177 ? -5.130  19.805 42.817 1.00 2.41  ? 158  ASN A N   1 
ATOM   1339 C  CA  . ASN A 1 177 ? -6.456  19.440 43.349 1.00 2.54  ? 158  ASN A CA  1 
ATOM   1340 C  C   . ASN A 1 177 ? -7.592  20.350 42.890 1.00 2.11  ? 158  ASN A C   1 
ATOM   1341 O  O   . ASN A 1 177 ? -8.734  20.080 43.229 1.00 2.15  ? 158  ASN A O   1 
ATOM   1342 C  CB  . ASN A 1 177 ? -6.484  19.457 44.886 1.00 2.00  ? 158  ASN A CB  1 
ATOM   1343 C  CG  . ASN A 1 177 ? -5.499  18.477 45.523 1.00 3.06  ? 158  ASN A CG  1 
ATOM   1344 O  OD1 . ASN A 1 177 ? -4.750  18.875 46.415 1.00 4.48  ? 158  ASN A OD1 1 
ATOM   1345 N  ND2 . ASN A 1 177 ? -5.507  17.202 45.090 1.00 2.00  ? 158  ASN A ND2 1 
ATOM   1346 N  N   . LEU A 1 178 ? -7.294  21.421 42.154 1.00 2.00  ? 159  LEU A N   1 
ATOM   1347 C  CA  . LEU A 1 178 ? -8.382  22.267 41.629 1.00 2.41  ? 159  LEU A CA  1 
ATOM   1348 C  C   . LEU A 1 178 ? -9.392  21.516 40.733 1.00 2.71  ? 159  LEU A C   1 
ATOM   1349 O  O   . LEU A 1 178 ? -10.597 21.655 40.932 1.00 3.39  ? 159  LEU A O   1 
ATOM   1350 C  CB  . LEU A 1 178 ? -7.847  23.509 40.934 1.00 2.00  ? 159  LEU A CB  1 
ATOM   1351 C  CG  . LEU A 1 178 ? -7.286  24.612 41.862 1.00 3.17  ? 159  LEU A CG  1 
ATOM   1352 C  CD1 . LEU A 1 178 ? -6.790  25.796 41.007 1.00 3.76  ? 159  LEU A CD1 1 
ATOM   1353 C  CD2 . LEU A 1 178 ? -8.315  25.077 42.913 1.00 2.00  ? 159  LEU A CD2 1 
ATOM   1354 N  N   . PRO A 1 179 ? -8.914  20.753 39.728 1.00 2.88  ? 160  PRO A N   1 
ATOM   1355 C  CA  . PRO A 1 179 ? -9.882  19.989 38.932 1.00 2.86  ? 160  PRO A CA  1 
ATOM   1356 C  C   . PRO A 1 179 ? -10.836 19.080 39.766 1.00 3.30  ? 160  PRO A C   1 
ATOM   1357 O  O   . PRO A 1 179 ? -12.060 19.069 39.511 1.00 2.77  ? 160  PRO A O   1 
ATOM   1358 C  CB  . PRO A 1 179 ? -9.006  19.129 38.020 1.00 2.13  ? 160  PRO A CB  1 
ATOM   1359 C  CG  . PRO A 1 179 ? -7.709  19.766 37.993 1.00 2.98  ? 160  PRO A CG  1 
ATOM   1360 C  CD  . PRO A 1 179 ? -7.536  20.607 39.220 1.00 2.44  ? 160  PRO A CD  1 
ATOM   1361 N  N   . GLU A 1 180 ? -10.288 18.312 40.708 1.00 3.27  ? 161  GLU A N   1 
ATOM   1362 C  CA  . GLU A 1 180 ? -11.120 17.402 41.510 1.00 4.33  ? 161  GLU A CA  1 
ATOM   1363 C  C   . GLU A 1 180 ? -12.020 18.143 42.505 1.00 3.90  ? 161  GLU A C   1 
ATOM   1364 O  O   . GLU A 1 180 ? -13.101 17.654 42.803 1.00 4.01  ? 161  GLU A O   1 
ATOM   1365 C  CB  . GLU A 1 180 ? -10.292 16.322 42.213 1.00 4.70  ? 161  GLU A CB  1 
ATOM   1366 C  CG  . GLU A 1 180 ? -9.559  16.769 43.474 1.00 4.58  ? 161  GLU A CG  1 
ATOM   1367 C  CD  . GLU A 1 180 ? -8.466  15.781 43.873 1.00 5.79  ? 161  GLU A CD  1 
ATOM   1368 O  OE1 . GLU A 1 180 ? -8.750  14.917 44.743 1.00 6.64  ? 161  GLU A OE1 1 
ATOM   1369 O  OE2 . GLU A 1 180 ? -7.336  15.868 43.291 1.00 3.40  ? 161  GLU A OE2 1 
ATOM   1370 N  N   . THR A 1 181 ? -11.588 19.320 42.998 1.00 3.28  ? 162  THR A N   1 
ATOM   1371 C  CA  . THR A 1 181 ? -12.469 20.180 43.803 1.00 2.53  ? 162  THR A CA  1 
ATOM   1372 C  C   . THR A 1 181 ? -13.793 20.468 43.017 1.00 2.82  ? 162  THR A C   1 
ATOM   1373 O  O   . THR A 1 181 ? -14.907 20.330 43.538 1.00 2.68  ? 162  THR A O   1 
ATOM   1374 C  CB  . THR A 1 181 ? -11.771 21.534 44.145 1.00 2.08  ? 162  THR A CB  1 
ATOM   1375 O  OG1 . THR A 1 181 ? -10.561 21.305 44.875 1.00 2.00  ? 162  THR A OG1 1 
ATOM   1376 C  CG2 . THR A 1 181 ? -12.670 22.452 44.949 1.00 2.00  ? 162  THR A CG2 1 
ATOM   1377 N  N   . TYR A 1 182 ? -13.651 20.915 41.780 1.00 2.00  ? 163  TYR A N   1 
ATOM   1378 C  CA  . TYR A 1 182 ? -14.808 21.215 40.967 1.00 2.08  ? 163  TYR A CA  1 
ATOM   1379 C  C   . TYR A 1 182 ? -15.591 19.927 40.613 1.00 2.13  ? 163  TYR A C   1 
ATOM   1380 O  O   . TYR A 1 182 ? -16.824 19.915 40.668 1.00 2.12  ? 163  TYR A O   1 
ATOM   1381 C  CB  . TYR A 1 182 ? -14.383 21.989 39.693 1.00 2.00  ? 163  TYR A CB  1 
ATOM   1382 C  CG  . TYR A 1 182 ? -15.549 22.342 38.798 1.00 2.05  ? 163  TYR A CG  1 
ATOM   1383 C  CD1 . TYR A 1 182 ? -16.574 23.178 39.267 1.00 2.00  ? 163  TYR A CD1 1 
ATOM   1384 C  CD2 . TYR A 1 182 ? -15.651 21.820 37.494 1.00 2.00  ? 163  TYR A CD2 1 
ATOM   1385 C  CE1 . TYR A 1 182 ? -17.660 23.476 38.487 1.00 2.00  ? 163  TYR A CE1 1 
ATOM   1386 C  CE2 . TYR A 1 182 ? -16.748 22.122 36.678 1.00 2.00  ? 163  TYR A CE2 1 
ATOM   1387 C  CZ  . TYR A 1 182 ? -17.749 22.958 37.184 1.00 2.00  ? 163  TYR A CZ  1 
ATOM   1388 O  OH  . TYR A 1 182 ? -18.853 23.284 36.419 1.00 2.00  ? 163  TYR A OH  1 
ATOM   1389 N  N   . LEU A 1 183 ? -14.860 18.863 40.279 1.00 2.00  ? 164  LEU A N   1 
ATOM   1390 C  CA  . LEU A 1 183 ? -15.448 17.600 39.869 1.00 2.02  ? 164  LEU A CA  1 
ATOM   1391 C  C   . LEU A 1 183 ? -16.293 16.969 41.003 1.00 2.00  ? 164  LEU A C   1 
ATOM   1392 O  O   . LEU A 1 183 ? -17.392 16.471 40.768 1.00 2.00  ? 164  LEU A O   1 
ATOM   1393 C  CB  . LEU A 1 183 ? -14.352 16.616 39.383 1.00 2.00  ? 164  LEU A CB  1 
ATOM   1394 C  CG  . LEU A 1 183 ? -14.849 15.251 38.884 1.00 2.00  ? 164  LEU A CG  1 
ATOM   1395 C  CD1 . LEU A 1 183 ? -15.934 15.382 37.777 1.00 2.00  ? 164  LEU A CD1 1 
ATOM   1396 C  CD2 . LEU A 1 183 ? -13.694 14.396 38.384 1.00 2.00  ? 164  LEU A CD2 1 
ATOM   1397 N  N   . LEU A 1 184 ? -15.773 16.994 42.223 1.00 2.00  ? 165  LEU A N   1 
ATOM   1398 C  CA  . LEU A 1 184 ? -16.553 16.535 43.388 1.00 2.66  ? 165  LEU A CA  1 
ATOM   1399 C  C   . LEU A 1 184 ? -17.909 17.259 43.477 1.00 2.67  ? 165  LEU A C   1 
ATOM   1400 O  O   . LEU A 1 184 ? -18.944 16.605 43.588 1.00 3.27  ? 165  LEU A O   1 
ATOM   1401 C  CB  . LEU A 1 184 ? -15.737 16.696 44.706 1.00 2.01  ? 165  LEU A CB  1 
ATOM   1402 C  CG  . LEU A 1 184 ? -14.539 15.726 44.824 1.00 2.00  ? 165  LEU A CG  1 
ATOM   1403 C  CD1 . LEU A 1 184 ? -13.516 16.242 45.888 1.00 2.00  ? 165  LEU A CD1 1 
ATOM   1404 C  CD2 . LEU A 1 184 ? -14.991 14.256 45.113 1.00 2.49  ? 165  LEU A CD2 1 
ATOM   1405 N  N   . ALA A 1 185 ? -17.893 18.592 43.402 1.00 2.00  ? 166  ALA A N   1 
ATOM   1406 C  CA  . ALA A 1 185 ? -19.114 19.384 43.366 1.00 2.24  ? 166  ALA A CA  1 
ATOM   1407 C  C   . ALA A 1 185 ? -20.056 19.014 42.175 1.00 2.31  ? 166  ALA A C   1 
ATOM   1408 O  O   . ALA A 1 185 ? -21.261 18.829 42.374 1.00 2.43  ? 166  ALA A O   1 
ATOM   1409 C  CB  . ALA A 1 185 ? -18.779 20.877 43.343 1.00 2.00  ? 166  ALA A CB  1 
ATOM   1410 N  N   . CYS A 1 186 ? -19.497 18.888 40.973 1.00 2.00  ? 167  CYS A N   1 
ATOM   1411 C  CA  . CYS A 1 186 ? -20.254 18.439 39.783 1.00 2.09  ? 167  CYS A CA  1 
ATOM   1412 C  C   . CYS A 1 186 ? -20.961 17.104 40.026 1.00 2.00  ? 167  CYS A C   1 
ATOM   1413 O  O   . CYS A 1 186 ? -22.146 16.945 39.677 1.00 2.00  ? 167  CYS A O   1 
ATOM   1414 C  CB  . CYS A 1 186 ? -19.328 18.249 38.561 1.00 2.00  ? 167  CYS A CB  1 
ATOM   1415 S  SG  . CYS A 1 186 ? -18.693 19.751 37.819 1.00 2.83  ? 167  CYS A SG  1 
ATOM   1416 N  N   . LEU A 1 187 ? -20.213 16.145 40.574 1.00 2.00  ? 168  LEU A N   1 
ATOM   1417 C  CA  . LEU A 1 187 ? -20.729 14.803 40.833 1.00 2.41  ? 168  LEU A CA  1 
ATOM   1418 C  C   . LEU A 1 187 ? -21.856 14.814 41.864 1.00 2.55  ? 168  LEU A C   1 
ATOM   1419 O  O   . LEU A 1 187 ? -22.915 14.249 41.630 1.00 2.84  ? 168  LEU A O   1 
ATOM   1420 C  CB  . LEU A 1 187 ? -19.607 13.842 41.273 1.00 2.52  ? 168  LEU A CB  1 
ATOM   1421 C  CG  . LEU A 1 187 ? -18.549 13.483 40.210 1.00 2.44  ? 168  LEU A CG  1 
ATOM   1422 C  CD1 . LEU A 1 187 ? -17.359 12.785 40.865 1.00 2.00  ? 168  LEU A CD1 1 
ATOM   1423 C  CD2 . LEU A 1 187 ? -19.163 12.617 39.097 1.00 2.00  ? 168  LEU A CD2 1 
ATOM   1424 N  N   . VAL A 1 188 ? -21.633 15.463 42.997 1.00 2.59  ? 169  VAL A N   1 
ATOM   1425 C  CA  . VAL A 1 188 ? -22.693 15.580 44.005 1.00 2.10  ? 169  VAL A CA  1 
ATOM   1426 C  C   . VAL A 1 188 ? -23.951 16.237 43.412 1.00 2.15  ? 169  VAL A C   1 
ATOM   1427 O  O   . VAL A 1 188 ? -25.068 15.725 43.572 1.00 2.07  ? 169  VAL A O   1 
ATOM   1428 C  CB  . VAL A 1 188 ? -22.183 16.285 45.282 1.00 2.00  ? 169  VAL A CB  1 
ATOM   1429 C  CG1 . VAL A 1 188 ? -23.341 16.568 46.224 1.00 2.00  ? 169  VAL A CG1 1 
ATOM   1430 C  CG2 . VAL A 1 188 ? -21.133 15.365 45.974 1.00 2.11  ? 169  VAL A CG2 1 
ATOM   1431 N  N   . ASP A 1 189 ? -23.755 17.347 42.692 1.00 2.00  ? 170  ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 189 ? -24.850 17.981 41.987 1.00 2.00  ? 170  ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 189 ? -25.554 17.010 41.010 1.00 2.00  ? 170  ASP A C   1 
ATOM   1434 O  O   . ASP A 1 189 ? -26.795 16.948 40.964 1.00 2.00  ? 170  ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 189 ? -24.367 19.213 41.228 1.00 2.00  ? 170  ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 189 ? -25.463 19.804 40.360 1.00 3.54  ? 170  ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 189 ? -26.431 20.371 40.928 1.00 3.16  ? 170  ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 189 ? -25.358 19.706 39.114 1.00 3.50  ? 170  ASP A OD2 1 
ATOM   1439 N  N   . PHE A 1 190 ? -24.757 16.250 40.255 1.00 2.00  ? 171  PHE A N   1 
ATOM   1440 C  CA  . PHE A 1 190 ? -25.317 15.376 39.233 1.00 2.00  ? 171  PHE A CA  1 
ATOM   1441 C  C   . PHE A 1 190 ? -26.196 14.275 39.844 1.00 2.00  ? 171  PHE A C   1 
ATOM   1442 O  O   . PHE A 1 190 ? -27.346 14.128 39.456 1.00 2.00  ? 171  PHE A O   1 
ATOM   1443 C  CB  . PHE A 1 190 ? -24.262 14.731 38.313 1.00 2.00  ? 171  PHE A CB  1 
ATOM   1444 C  CG  . PHE A 1 190 ? -24.850 13.628 37.467 1.00 2.63  ? 171  PHE A CG  1 
ATOM   1445 C  CD1 . PHE A 1 190 ? -25.632 13.937 36.349 1.00 2.00  ? 171  PHE A CD1 1 
ATOM   1446 C  CD2 . PHE A 1 190 ? -24.698 12.282 37.827 1.00 2.40  ? 171  PHE A CD2 1 
ATOM   1447 C  CE1 . PHE A 1 190 ? -26.240 12.913 35.590 1.00 2.57  ? 171  PHE A CE1 1 
ATOM   1448 C  CE2 . PHE A 1 190 ? -25.306 11.264 37.058 1.00 2.77  ? 171  PHE A CE2 1 
ATOM   1449 C  CZ  . PHE A 1 190 ? -26.069 11.585 35.949 1.00 2.00  ? 171  PHE A CZ  1 
ATOM   1450 N  N   . PHE A 1 191 ? -25.634 13.510 40.788 1.00 2.00  ? 172  PHE A N   1 
ATOM   1451 C  CA  . PHE A 1 191 ? -26.351 12.410 41.425 1.00 2.00  ? 172  PHE A CA  1 
ATOM   1452 C  C   . PHE A 1 191 ? -27.584 12.891 42.192 1.00 2.00  ? 172  PHE A C   1 
ATOM   1453 O  O   . PHE A 1 191 ? -28.635 12.243 42.146 1.00 2.01  ? 172  PHE A O   1 
ATOM   1454 C  CB  . PHE A 1 191 ? -25.413 11.555 42.317 1.00 2.00  ? 172  PHE A CB  1 
ATOM   1455 C  CG  . PHE A 1 191 ? -24.358 10.787 41.533 1.00 2.00  ? 172  PHE A CG  1 
ATOM   1456 C  CD1 . PHE A 1 191 ? -24.719 9.749  40.693 1.00 2.31  ? 172  PHE A CD1 1 
ATOM   1457 C  CD2 . PHE A 1 191 ? -23.004 11.118 41.639 1.00 2.46  ? 172  PHE A CD2 1 
ATOM   1458 C  CE1 . PHE A 1 191 ? -23.724 9.022  39.925 1.00 3.04  ? 172  PHE A CE1 1 
ATOM   1459 C  CE2 . PHE A 1 191 ? -22.014 10.440 40.865 1.00 2.33  ? 172  PHE A CE2 1 
ATOM   1460 C  CZ  . PHE A 1 191 ? -22.368 9.394  40.040 1.00 3.17  ? 172  PHE A CZ  1 
ATOM   1461 N  N   . THR A 1 192 ? -27.459 14.034 42.855 1.00 2.00  ? 173  THR A N   1 
ATOM   1462 C  CA  . THR A 1 192 ? -28.558 14.638 43.627 1.00 2.45  ? 173  THR A CA  1 
ATOM   1463 C  C   . THR A 1 192 ? -29.759 14.935 42.753 1.00 2.29  ? 173  THR A C   1 
ATOM   1464 O  O   . THR A 1 192 ? -30.917 14.755 43.177 1.00 2.00  ? 173  THR A O   1 
ATOM   1465 C  CB  . THR A 1 192 ? -28.112 15.946 44.305 1.00 2.26  ? 173  THR A CB  1 
ATOM   1466 O  OG1 . THR A 1 192 ? -27.075 15.636 45.249 1.00 4.12  ? 173  THR A OG1 1 
ATOM   1467 C  CG2 . THR A 1 192 ? -29.309 16.639 45.033 1.00 3.86  ? 173  THR A CG2 1 
ATOM   1468 N  N   . ASN A 1 193 ? -29.481 15.397 41.537 1.00 2.60  ? 174  ASN A N   1 
ATOM   1469 C  CA  . ASN A 1 193 ? -30.534 15.848 40.644 1.00 3.69  ? 174  ASN A CA  1 
ATOM   1470 C  C   . ASN A 1 193 ? -30.915 14.865 39.539 1.00 3.20  ? 174  ASN A C   1 
ATOM   1471 O  O   . ASN A 1 193 ? -31.807 15.157 38.751 1.00 2.93  ? 174  ASN A O   1 
ATOM   1472 C  CB  . ASN A 1 193 ? -30.195 17.242 40.070 1.00 4.52  ? 174  ASN A CB  1 
ATOM   1473 C  CG  . ASN A 1 193 ? -30.161 18.318 41.160 1.00 6.35  ? 174  ASN A CG  1 
ATOM   1474 O  OD1 . ASN A 1 193 ? -29.125 18.957 41.406 1.00 9.97  ? 174  ASN A OD1 1 
ATOM   1475 N  ND2 . ASN A 1 193 ? -31.284 18.501 41.834 1.00 6.67  ? 174  ASN A ND2 1 
ATOM   1476 N  N   . CYS A 1 194 ? -30.256 13.704 39.486 1.00 2.80  ? 175  CYS A N   1 
ATOM   1477 C  CA  . CYS A 1 194 ? -30.602 12.690 38.489 1.00 2.19  ? 175  CYS A CA  1 
ATOM   1478 C  C   . CYS A 1 194 ? -31.603 11.713 39.111 1.00 2.36  ? 175  CYS A C   1 
ATOM   1479 O  O   . CYS A 1 194 ? -31.292 11.073 40.131 1.00 2.00  ? 175  CYS A O   1 
ATOM   1480 C  CB  . CYS A 1 194 ? -29.355 11.962 37.974 1.00 2.71  ? 175  CYS A CB  1 
ATOM   1481 S  SG  . CYS A 1 194 ? -29.727 10.585 36.866 1.00 2.31  ? 175  CYS A SG  1 
ATOM   1482 N  N   . PRO A 1 195 ? -32.819 11.614 38.516 1.00 2.17  ? 176  PRO A N   1 
ATOM   1483 C  CA  . PRO A 1 195 ? -33.882 10.788 39.091 1.00 2.11  ? 176  PRO A CA  1 
ATOM   1484 C  C   . PRO A 1 195 ? -33.617 9.270  39.083 1.00 2.09  ? 176  PRO A C   1 
ATOM   1485 O  O   . PRO A 1 195 ? -34.390 8.525  39.679 1.00 2.00  ? 176  PRO A O   1 
ATOM   1486 C  CB  . PRO A 1 195 ? -35.135 11.151 38.270 1.00 2.31  ? 176  PRO A CB  1 
ATOM   1487 C  CG  . PRO A 1 195 ? -34.637 11.822 37.024 1.00 3.01  ? 176  PRO A CG  1 
ATOM   1488 C  CD  . PRO A 1 195 ? -33.231 12.312 37.277 1.00 2.28  ? 176  PRO A CD  1 
ATOM   1489 N  N   . ARG A 1 196 ? -32.540 8.817  38.449 1.00 2.67  ? 177  ARG A N   1 
ATOM   1490 C  CA  . ARG A 1 196 ? -32.111 7.393  38.576 1.00 3.46  ? 177  ARG A CA  1 
ATOM   1491 C  C   . ARG A 1 196 ? -31.640 7.034  40.004 1.00 3.52  ? 177  ARG A C   1 
ATOM   1492 O  O   . ARG A 1 196 ? -31.711 5.869  40.407 1.00 3.46  ? 177  ARG A O   1 
ATOM   1493 C  CB  . ARG A 1 196 ? -31.012 7.033  37.561 1.00 3.26  ? 177  ARG A CB  1 
ATOM   1494 C  CG  . ARG A 1 196 ? -31.435 7.242  36.083 1.00 4.93  ? 177  ARG A CG  1 
ATOM   1495 C  CD  . ARG A 1 196 ? -30.519 6.558  35.023 1.00 4.92  ? 177  ARG A CD  1 
ATOM   1496 N  NE  . ARG A 1 196 ? -29.084 6.862  35.187 1.00 8.38  ? 177  ARG A NE  1 
ATOM   1497 C  CZ  . ARG A 1 196 ? -28.432 7.849  34.554 1.00 8.59  ? 177  ARG A CZ  1 
ATOM   1498 N  NH1 . ARG A 1 196 ? -29.071 8.662  33.720 1.00 4.81  ? 177  ARG A NH1 1 
ATOM   1499 N  NH2 . ARG A 1 196 ? -27.128 8.021  34.756 1.00 7.74  ? 177  ARG A NH2 1 
ATOM   1500 N  N   . TYR A 1 197 ? -31.187 8.045  40.762 1.00 3.02  ? 178  TYR A N   1 
ATOM   1501 C  CA  . TYR A 1 197 ? -30.562 7.845  42.065 1.00 3.20  ? 178  TYR A CA  1 
ATOM   1502 C  C   . TYR A 1 197 ? -31.413 8.418  43.197 1.00 4.04  ? 178  TYR A C   1 
ATOM   1503 O  O   . TYR A 1 197 ? -32.063 9.450  43.034 1.00 3.73  ? 178  TYR A O   1 
ATOM   1504 C  CB  . TYR A 1 197 ? -29.181 8.537  42.084 1.00 4.19  ? 178  TYR A CB  1 
ATOM   1505 C  CG  . TYR A 1 197 ? -28.255 8.049  40.976 1.00 4.40  ? 178  TYR A CG  1 
ATOM   1506 C  CD1 . TYR A 1 197 ? -27.350 7.005  41.203 1.00 4.25  ? 178  TYR A CD1 1 
ATOM   1507 C  CD2 . TYR A 1 197 ? -28.300 8.616  39.706 1.00 3.49  ? 178  TYR A CD2 1 
ATOM   1508 C  CE1 . TYR A 1 197 ? -26.512 6.543  40.169 1.00 6.60  ? 178  TYR A CE1 1 
ATOM   1509 C  CE2 . TYR A 1 197 ? -27.473 8.167  38.679 1.00 5.49  ? 178  TYR A CE2 1 
ATOM   1510 C  CZ  . TYR A 1 197 ? -26.583 7.140  38.911 1.00 6.32  ? 178  TYR A CZ  1 
ATOM   1511 O  OH  . TYR A 1 197 ? -25.777 6.694  37.875 1.00 9.41  ? 178  TYR A OH  1 
ATOM   1512 N  N   . THR A 1 198 ? -31.383 7.760  44.353 1.00 4.32  ? 179  THR A N   1 
ATOM   1513 C  CA  . THR A 1 198 ? -32.021 8.271  45.559 1.00 5.12  ? 179  THR A CA  1 
ATOM   1514 C  C   . THR A 1 198 ? -30.942 8.806  46.515 1.00 5.57  ? 179  THR A C   1 
ATOM   1515 O  O   . THR A 1 198 ? -30.000 8.084  46.861 1.00 6.03  ? 179  THR A O   1 
ATOM   1516 C  CB  . THR A 1 198 ? -32.840 7.147  46.241 1.00 4.62  ? 179  THR A CB  1 
ATOM   1517 O  OG1 . THR A 1 198 ? -33.789 6.654  45.301 1.00 6.77  ? 179  THR A OG1 1 
ATOM   1518 C  CG2 . THR A 1 198 ? -33.582 7.643  47.503 1.00 4.78  ? 179  THR A CG2 1 
ATOM   1519 N  N   . SER A 1 199 ? -31.089 10.053 46.946 1.00 6.09  ? 180  SER A N   1 
ATOM   1520 C  CA  . SER A 1 199 ? -30.128 10.672 47.855 1.00 7.08  ? 180  SER A CA  1 
ATOM   1521 C  C   . SER A 1 199 ? -30.350 10.228 49.287 1.00 7.50  ? 180  SER A C   1 
ATOM   1522 O  O   . SER A 1 199 ? -31.483 10.240 49.789 1.00 7.86  ? 180  SER A O   1 
ATOM   1523 C  CB  . SER A 1 199 ? -30.242 12.190 47.773 1.00 8.24  ? 180  SER A CB  1 
ATOM   1524 O  OG  . SER A 1 199 ? -29.888 12.647 46.482 1.00 10.16 ? 180  SER A OG  1 
ATOM   1525 N  N   . CYS A 1 200 ? -29.275 9.803  49.940 1.00 7.48  ? 181  CYS A N   1 
ATOM   1526 C  CA  . CYS A 1 200 ? -29.310 9.440  51.356 1.00 7.44  ? 181  CYS A CA  1 
ATOM   1527 C  C   . CYS A 1 200 ? -28.338 10.398 52.050 1.00 5.85  ? 181  CYS A C   1 
ATOM   1528 O  O   . CYS A 1 200 ? -27.657 11.174 51.382 1.00 3.94  ? 181  CYS A O   1 
ATOM   1529 C  CB  . CYS A 1 200 ? -28.904 7.955  51.545 1.00 7.69  ? 181  CYS A CB  1 
ATOM   1530 S  SG  . CYS A 1 200 ? -29.837 6.791  50.391 1.00 16.64 ? 181  CYS A SG  1 
ATOM   1531 N  N   . GLU A 1 201 ? -28.237 10.306 53.380 1.00 5.14  ? 182  GLU A N   1 
ATOM   1532 C  CA  A GLU A 1 201 ? -27.381 11.167 54.206 0.50 4.82  ? 182  GLU A CA  1 
ATOM   1533 C  CA  B GLU A 1 201 ? -27.401 11.268 54.101 0.50 4.60  ? 182  GLU A CA  1 
ATOM   1534 C  C   . GLU A 1 201 ? -25.917 11.091 53.748 1.00 3.99  ? 182  GLU A C   1 
ATOM   1535 O  O   . GLU A 1 201 ? -25.180 12.101 53.660 1.00 3.30  ? 182  GLU A O   1 
ATOM   1536 C  CB  A GLU A 1 201 ? -27.492 10.685 55.674 0.50 5.09  ? 182  GLU A CB  1 
ATOM   1537 C  CB  B GLU A 1 201 ? -27.651 11.213 55.624 0.50 5.17  ? 182  GLU A CB  1 
ATOM   1538 C  CG  A GLU A 1 201 ? -27.465 11.782 56.733 0.50 5.39  ? 182  GLU A CG  1 
ATOM   1539 C  CG  B GLU A 1 201 ? -27.064 12.390 56.425 0.50 5.50  ? 182  GLU A CG  1 
ATOM   1540 C  CD  A GLU A 1 201 ? -27.340 11.255 58.170 0.50 5.73  ? 182  GLU A CD  1 
ATOM   1541 C  CD  B GLU A 1 201 ? -27.936 13.654 56.446 0.50 6.70  ? 182  GLU A CD  1 
ATOM   1542 O  OE1 A GLU A 1 201 ? -27.133 10.031 58.389 0.50 7.46  ? 182  GLU A OE1 1 
ATOM   1543 O  OE1 B GLU A 1 201 ? -27.730 14.499 57.357 0.50 4.37  ? 182  GLU A OE1 1 
ATOM   1544 O  OE2 A GLU A 1 201 ? -27.444 12.087 59.091 0.50 6.87  ? 182  GLU A OE2 1 
ATOM   1545 O  OE2 B GLU A 1 201 ? -28.820 13.813 55.568 0.50 7.36  ? 182  GLU A OE2 1 
ATOM   1546 N  N   . THR A 1 202 ? -25.496 9.852  53.474 1.00 3.03  ? 183  THR A N   1 
ATOM   1547 C  CA  . THR A 1 202 ? -24.082 9.541  53.226 1.00 2.82  ? 183  THR A CA  1 
ATOM   1548 C  C   . THR A 1 202 ? -23.697 9.092  51.798 1.00 2.43  ? 183  THR A C   1 
ATOM   1549 O  O   . THR A 1 202 ? -22.544 8.726  51.545 1.00 2.68  ? 183  THR A O   1 
ATOM   1550 C  CB  . THR A 1 202 ? -23.554 8.505  54.243 1.00 2.84  ? 183  THR A CB  1 
ATOM   1551 O  OG1 . THR A 1 202 ? -24.111 7.216  53.959 1.00 2.77  ? 183  THR A OG1 1 
ATOM   1552 C  CG2 . THR A 1 202 ? -23.875 8.936  55.709 1.00 2.53  ? 183  THR A CG2 1 
ATOM   1553 N  N   . GLY A 1 203 ? -24.650 9.127  50.881 1.00 2.14  ? 184  GLY A N   1 
ATOM   1554 C  CA  . GLY A 1 203 ? -24.383 8.850  49.470 1.00 2.42  ? 184  GLY A CA  1 
ATOM   1555 C  C   . GLY A 1 203 ? -25.658 8.647  48.674 1.00 2.80  ? 184  GLY A C   1 
ATOM   1556 O  O   . GLY A 1 203 ? -26.704 9.209  49.023 1.00 2.74  ? 184  GLY A O   1 
ATOM   1557 N  N   . PHE A 1 204 ? -25.577 7.821  47.630 1.00 2.80  ? 185  PHE A N   1 
ATOM   1558 C  CA  . PHE A 1 204 ? -26.661 7.658  46.651 1.00 3.27  ? 185  PHE A CA  1 
ATOM   1559 C  C   . PHE A 1 204 ? -26.977 6.203  46.419 1.00 3.78  ? 185  PHE A C   1 
ATOM   1560 O  O   . PHE A 1 204 ? -26.069 5.379  46.262 1.00 3.48  ? 185  PHE A O   1 
ATOM   1561 C  CB  . PHE A 1 204 ? -26.288 8.296  45.304 1.00 2.71  ? 185  PHE A CB  1 
ATOM   1562 C  CG  . PHE A 1 204 ? -25.994 9.754  45.414 1.00 4.56  ? 185  PHE A CG  1 
ATOM   1563 C  CD1 . PHE A 1 204 ? -27.042 10.682 45.505 1.00 3.71  ? 185  PHE A CD1 1 
ATOM   1564 C  CD2 . PHE A 1 204 ? -24.677 10.211 45.494 1.00 5.66  ? 185  PHE A CD2 1 
ATOM   1565 C  CE1 . PHE A 1 204 ? -26.795 12.048 45.646 1.00 2.39  ? 185  PHE A CE1 1 
ATOM   1566 C  CE2 . PHE A 1 204 ? -24.413 11.602 45.625 1.00 4.41  ? 185  PHE A CE2 1 
ATOM   1567 C  CZ  . PHE A 1 204 ? -25.481 12.518 45.700 1.00 2.60  ? 185  PHE A CZ  1 
ATOM   1568 N  N   . LYS A 1 205 ? -28.268 5.905  46.370 1.00 4.08  ? 186  LYS A N   1 
ATOM   1569 C  CA  . LYS A 1 205 ? -28.735 4.557  46.077 1.00 6.37  ? 186  LYS A CA  1 
ATOM   1570 C  C   . LYS A 1 205 ? -29.169 4.493  44.606 1.00 5.87  ? 186  LYS A C   1 
ATOM   1571 O  O   . LYS A 1 205 ? -29.840 5.414  44.081 1.00 5.30  ? 186  LYS A O   1 
ATOM   1572 C  CB  . LYS A 1 205 ? -29.884 4.206  47.030 1.00 6.55  ? 186  LYS A CB  1 
ATOM   1573 C  CG  . LYS A 1 205 ? -30.462 2.812  46.895 1.00 9.67  ? 186  LYS A CG  1 
ATOM   1574 C  CD  . LYS A 1 205 ? -31.600 2.601  47.934 1.00 9.59  ? 186  LYS A CD  1 
ATOM   1575 C  CE  . LYS A 1 205 ? -32.104 1.102  47.984 1.00 13.60 ? 186  LYS A CE  1 
ATOM   1576 N  NZ  . LYS A 1 205 ? -32.755 0.632  46.707 1.00 14.34 ? 186  LYS A NZ  1 
ATOM   1577 N  N   . ASP A 1 206 ? -28.754 3.429  43.939 1.00 5.94  ? 187  ASP A N   1 
ATOM   1578 C  CA  . ASP A 1 206 ? -29.180 3.157  42.573 1.00 6.72  ? 187  ASP A CA  1 
ATOM   1579 C  C   . ASP A 1 206 ? -29.603 1.684  42.526 1.00 6.19  ? 187  ASP A C   1 
ATOM   1580 O  O   . ASP A 1 206 ? -28.821 0.793  42.182 1.00 5.64  ? 187  ASP A O   1 
ATOM   1581 C  CB  . ASP A 1 206 ? -28.045 3.511  41.584 1.00 7.15  ? 187  ASP A CB  1 
ATOM   1582 C  CG  . ASP A 1 206 ? -28.246 2.925  40.183 1.00 11.43 ? 187  ASP A CG  1 
ATOM   1583 O  OD1 . ASP A 1 206 ? -29.415 2.655  39.785 1.00 11.14 ? 187  ASP A OD1 1 
ATOM   1584 O  OD2 . ASP A 1 206 ? -27.195 2.729  39.490 1.00 17.51 ? 187  ASP A OD2 1 
ATOM   1585 N  N   . GLY A 1 207 ? -30.846 1.441  42.909 1.00 5.89  ? 188  GLY A N   1 
ATOM   1586 C  CA  . GLY A 1 207 ? -31.363 0.081  43.023 1.00 5.33  ? 188  GLY A CA  1 
ATOM   1587 C  C   . GLY A 1 207 ? -30.625 -0.671 44.116 1.00 4.52  ? 188  GLY A C   1 
ATOM   1588 O  O   . GLY A 1 207 ? -30.584 -0.238 45.263 1.00 3.60  ? 188  GLY A O   1 
ATOM   1589 N  N   . ASP A 1 208 ? -30.009 -1.787 43.735 1.00 4.34  ? 189  ASP A N   1 
ATOM   1590 C  CA  . ASP A 1 208 ? -29.215 -2.612 44.665 1.00 3.76  ? 189  ASP A CA  1 
ATOM   1591 C  C   . ASP A 1 208 ? -27.738 -2.178 44.793 1.00 3.03  ? 189  ASP A C   1 
ATOM   1592 O  O   . ASP A 1 208 ? -26.914 -2.924 45.344 1.00 3.29  ? 189  ASP A O   1 
ATOM   1593 C  CB  . ASP A 1 208 ? -29.299 -4.079 44.231 1.00 3.65  ? 189  ASP A CB  1 
ATOM   1594 C  CG  . ASP A 1 208 ? -30.662 -4.665 44.467 1.00 4.78  ? 189  ASP A CG  1 
ATOM   1595 O  OD1 . ASP A 1 208 ? -31.298 -4.273 45.470 1.00 6.20  ? 189  ASP A OD1 1 
ATOM   1596 O  OD2 . ASP A 1 208 ? -31.087 -5.519 43.664 1.00 6.43  ? 189  ASP A OD2 1 
ATOM   1597 N  N   . LEU A 1 209 ? -27.409 -1.001 44.270 1.00 2.00  ? 190  LEU A N   1 
ATOM   1598 C  CA  . LEU A 1 209 ? -26.062 -0.464 44.391 1.00 2.05  ? 190  LEU A CA  1 
ATOM   1599 C  C   . LEU A 1 209 ? -26.066 0.799  45.249 1.00 2.43  ? 190  LEU A C   1 
ATOM   1600 O  O   . LEU A 1 209 ? -26.860 1.734  44.981 1.00 2.32  ? 190  LEU A O   1 
ATOM   1601 C  CB  . LEU A 1 209 ? -25.460 -0.176 43.014 1.00 2.00  ? 190  LEU A CB  1 
ATOM   1602 C  CG  . LEU A 1 209 ? -25.293 -1.399 42.097 1.00 2.82  ? 190  LEU A CG  1 
ATOM   1603 C  CD1 . LEU A 1 209 ? -25.076 -0.947 40.616 1.00 2.43  ? 190  LEU A CD1 1 
ATOM   1604 C  CD2 . LEU A 1 209 ? -24.135 -2.245 42.591 1.00 2.00  ? 190  LEU A CD2 1 
ATOM   1605 N  N   . PHE A 1 210 ? -25.204 0.825  46.274 1.00 2.06  ? 191  PHE A N   1 
ATOM   1606 C  CA  . PHE A 1 210 ? -25.048 2.026  47.116 1.00 2.46  ? 191  PHE A CA  1 
ATOM   1607 C  C   . PHE A 1 210 ? -23.670 2.668  46.919 1.00 3.45  ? 191  PHE A C   1 
ATOM   1608 O  O   . PHE A 1 210 ? -22.642 2.026  47.152 1.00 3.15  ? 191  PHE A O   1 
ATOM   1609 C  CB  . PHE A 1 210 ? -25.264 1.739  48.605 1.00 2.00  ? 191  PHE A CB  1 
ATOM   1610 C  CG  . PHE A 1 210 ? -25.177 2.983  49.457 1.00 2.37  ? 191  PHE A CG  1 
ATOM   1611 C  CD1 . PHE A 1 210 ? -26.204 3.936  49.419 1.00 3.26  ? 191  PHE A CD1 1 
ATOM   1612 C  CD2 . PHE A 1 210 ? -24.060 3.223  50.260 1.00 2.94  ? 191  PHE A CD2 1 
ATOM   1613 C  CE1 . PHE A 1 210 ? -26.113 5.127  50.157 1.00 3.48  ? 191  PHE A CE1 1 
ATOM   1614 C  CE2 . PHE A 1 210 ? -23.949 4.391  50.992 1.00 4.94  ? 191  PHE A CE2 1 
ATOM   1615 C  CZ  . PHE A 1 210 ? -24.990 5.350  50.950 1.00 4.42  ? 191  PHE A CZ  1 
ATOM   1616 N  N   . MET A 1 211 ? -23.655 3.930  46.511 1.00 3.40  ? 192  MET A N   1 
ATOM   1617 C  CA  . MET A 1 211 ? -22.405 4.667  46.369 1.00 6.06  ? 192  MET A CA  1 
ATOM   1618 C  C   . MET A 1 211 ? -22.306 5.756  47.439 1.00 4.07  ? 192  MET A C   1 
ATOM   1619 O  O   . MET A 1 211 ? -23.034 6.750  47.389 1.00 3.78  ? 192  MET A O   1 
ATOM   1620 C  CB  . MET A 1 211 ? -22.292 5.278  44.967 1.00 5.00  ? 192  MET A CB  1 
ATOM   1621 C  CG  . MET A 1 211 ? -20.995 6.069  44.758 1.00 9.71  ? 192  MET A CG  1 
ATOM   1622 S  SD  . MET A 1 211 ? -21.017 7.079  43.242 1.00 14.80 ? 192  MET A SD  1 
ATOM   1623 C  CE  . MET A 1 211 ? -22.361 8.236  43.598 1.00 13.54 ? 192  MET A CE  1 
ATOM   1624 N  N   . SER A 1 212 ? -21.431 5.544  48.431 1.00 3.35  ? 193  SER A N   1 
ATOM   1625 C  CA  . SER A 1 212 ? -21.184 6.516  49.485 1.00 2.00  ? 193  SER A CA  1 
ATOM   1626 C  C   . SER A 1 212 ? -20.370 7.668  48.916 1.00 2.00  ? 193  SER A C   1 
ATOM   1627 O  O   . SER A 1 212 ? -19.680 7.503  47.909 1.00 2.00  ? 193  SER A O   1 
ATOM   1628 C  CB  . SER A 1 212 ? -20.470 5.838  50.663 1.00 2.00  ? 193  SER A CB  1 
ATOM   1629 O  OG  . SER A 1 212 ? -19.163 5.432  50.313 1.00 2.58  ? 193  SER A OG  1 
ATOM   1630 N  N   . TYR A 1 213 ? -20.496 8.861  49.514 1.00 2.00  ? 194  TYR A N   1 
ATOM   1631 C  CA  . TYR A 1 213 ? -19.639 9.968  49.143 1.00 2.14  ? 194  TYR A CA  1 
ATOM   1632 C  C   . TYR A 1 213 ? -18.151 9.627  49.309 1.00 2.37  ? 194  TYR A C   1 
ATOM   1633 O  O   . TYR A 1 213 ? -17.324 10.149 48.567 1.00 2.00  ? 194  TYR A O   1 
ATOM   1634 C  CB  . TYR A 1 213 ? -19.968 11.196 49.976 1.00 2.56  ? 194  TYR A CB  1 
ATOM   1635 C  CG  . TYR A 1 213 ? -21.332 11.764 49.719 1.00 2.00  ? 194  TYR A CG  1 
ATOM   1636 C  CD1 . TYR A 1 213 ? -21.654 12.273 48.459 1.00 2.85  ? 194  TYR A CD1 1 
ATOM   1637 C  CD2 . TYR A 1 213 ? -22.278 11.853 50.736 1.00 2.00  ? 194  TYR A CD2 1 
ATOM   1638 C  CE1 . TYR A 1 213 ? -22.902 12.842 48.209 1.00 3.67  ? 194  TYR A CE1 1 
ATOM   1639 C  CE2 . TYR A 1 213 ? -23.542 12.412 50.498 1.00 2.00  ? 194  TYR A CE2 1 
ATOM   1640 C  CZ  . TYR A 1 213 ? -23.831 12.907 49.222 1.00 3.23  ? 194  TYR A CZ  1 
ATOM   1641 O  OH  . TYR A 1 213 ? -25.042 13.448 48.922 1.00 5.07  ? 194  TYR A OH  1 
ATOM   1642 N  N   . ARG A 1 214 ? -17.822 8.773  50.290 1.00 2.00  ? 195  ARG A N   1 
ATOM   1643 C  CA  . ARG A 1 214 ? -16.446 8.371  50.527 1.00 3.13  ? 195  ARG A CA  1 
ATOM   1644 C  C   . ARG A 1 214 ? -15.899 7.516  49.371 1.00 2.34  ? 195  ARG A C   1 
ATOM   1645 O  O   . ARG A 1 214 ? -14.775 7.737  48.936 1.00 2.00  ? 195  ARG A O   1 
ATOM   1646 C  CB  . ARG A 1 214 ? -16.267 7.633  51.874 1.00 2.89  ? 195  ARG A CB  1 
ATOM   1647 C  CG  . ARG A 1 214 ? -14.774 7.597  52.359 1.00 5.44  ? 195  ARG A CG  1 
ATOM   1648 C  CD  . ARG A 1 214 ? -14.636 6.624  53.526 1.00 7.17  ? 195  ARG A CD  1 
ATOM   1649 N  NE  . ARG A 1 214 ? -13.380 6.583  54.322 1.00 15.39 ? 195  ARG A NE  1 
ATOM   1650 C  CZ  . ARG A 1 214 ? -12.119 6.826  53.919 1.00 20.71 ? 195  ARG A CZ  1 
ATOM   1651 N  NH1 . ARG A 1 214 ? -11.810 7.200  52.654 1.00 21.16 ? 195  ARG A NH1 1 
ATOM   1652 N  NH2 . ARG A 1 214 ? -11.139 6.680  54.824 1.00 19.89 ? 195  ARG A NH2 1 
ATOM   1653 N  N   . SER A 1 215 ? -16.681 6.526  48.904 1.00 2.51  ? 196  SER A N   1 
ATOM   1654 C  CA  . SER A 1 215 ? -16.213 5.661  47.836 1.00 2.88  ? 196  SER A CA  1 
ATOM   1655 C  C   . SER A 1 215 ? -16.168 6.451  46.529 1.00 2.69  ? 196  SER A C   1 
ATOM   1656 O  O   . SER A 1 215 ? -15.264 6.251  45.718 1.00 2.79  ? 196  SER A O   1 
ATOM   1657 C  CB  . SER A 1 215 ? -17.091 4.396  47.698 1.00 3.05  ? 196  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 215 ? -18.318 4.767  47.079 1.00 6.80  ? 196  SER A OG  1 
ATOM   1659 N  N   . MET A 1 216 ? -17.120 7.366  46.339 1.00 2.42  ? 197  MET A N   1 
ATOM   1660 C  CA  . MET A 1 216 ? -17.081 8.318  45.215 1.00 3.52  ? 197  MET A CA  1 
ATOM   1661 C  C   . MET A 1 216 ? -15.800 9.190  45.224 1.00 2.88  ? 197  MET A C   1 
ATOM   1662 O  O   . MET A 1 216 ? -15.100 9.301  44.205 1.00 3.47  ? 197  MET A O   1 
ATOM   1663 C  CB  . MET A 1 216 ? -18.314 9.229  45.243 1.00 2.29  ? 197  MET A CB  1 
ATOM   1664 C  CG  . MET A 1 216 ? -18.498 10.061 43.980 1.00 5.40  ? 197  MET A CG  1 
ATOM   1665 S  SD  . MET A 1 216 ? -19.765 11.338 44.116 1.00 8.04  ? 197  MET A SD  1 
ATOM   1666 C  CE  . MET A 1 216 ? -18.855 12.577 45.021 1.00 6.45  ? 197  MET A CE  1 
ATOM   1667 N  N   . PHE A 1 217 ? -15.524 9.818  46.365 1.00 2.40  ? 198  PHE A N   1 
ATOM   1668 C  CA  . PHE A 1 217 ? -14.301 10.602 46.578 1.00 2.43  ? 198  PHE A CA  1 
ATOM   1669 C  C   . PHE A 1 217 ? -13.034 9.782  46.270 1.00 2.60  ? 198  PHE A C   1 
ATOM   1670 O  O   . PHE A 1 217 ? -12.113 10.272 45.596 1.00 2.09  ? 198  PHE A O   1 
ATOM   1671 C  CB  . PHE A 1 217 ? -14.217 11.126 48.023 1.00 2.00  ? 198  PHE A CB  1 
ATOM   1672 C  CG  . PHE A 1 217 ? -12.848 11.687 48.375 1.00 2.00  ? 198  PHE A CG  1 
ATOM   1673 C  CD1 . PHE A 1 217 ? -12.488 12.974 47.981 1.00 2.00  ? 198  PHE A CD1 1 
ATOM   1674 C  CD2 . PHE A 1 217 ? -11.914 10.906 49.058 1.00 2.00  ? 198  PHE A CD2 1 
ATOM   1675 C  CE1 . PHE A 1 217 ? -11.228 13.482 48.248 1.00 2.00  ? 198  PHE A CE1 1 
ATOM   1676 C  CE2 . PHE A 1 217 ? -10.654 11.411 49.366 1.00 2.00  ? 198  PHE A CE2 1 
ATOM   1677 C  CZ  . PHE A 1 217 ? -10.304 12.697 48.953 1.00 2.00  ? 198  PHE A CZ  1 
ATOM   1678 N  N   . GLN A 1 218 ? -12.990 8.550  46.787 1.00 2.21  ? 199  GLN A N   1 
ATOM   1679 C  CA  . GLN A 1 218 ? -11.870 7.643  46.510 1.00 3.58  ? 199  GLN A CA  1 
ATOM   1680 C  C   . GLN A 1 218 ? -11.714 7.353  45.008 1.00 2.84  ? 199  GLN A C   1 
ATOM   1681 O  O   . GLN A 1 218 ? -10.611 7.408  44.508 1.00 3.23  ? 199  GLN A O   1 
ATOM   1682 C  CB  . GLN A 1 218 ? -11.945 6.332  47.320 1.00 3.48  ? 199  GLN A CB  1 
ATOM   1683 C  CG  . GLN A 1 218 ? -10.577 5.573  47.342 1.00 8.18  ? 199  GLN A CG  1 
ATOM   1684 C  CD  . GLN A 1 218 ? -9.453  6.438  47.980 1.00 12.53 ? 199  GLN A CD  1 
ATOM   1685 O  OE1 . GLN A 1 218 ? -9.587  6.869  49.123 1.00 12.96 ? 199  GLN A OE1 1 
ATOM   1686 N  NE2 . GLN A 1 218 ? -8.376  6.715  47.225 1.00 10.73 ? 199  GLN A NE2 1 
ATOM   1687 N  N   . ASP A 1 219 ? -12.811 7.085  44.305 1.00 2.34  ? 200  ASP A N   1 
ATOM   1688 C  CA  . ASP A 1 219 ? -12.772 6.956  42.843 1.00 2.87  ? 200  ASP A CA  1 
ATOM   1689 C  C   . ASP A 1 219 ? -12.186 8.200  42.138 1.00 2.90  ? 200  ASP A C   1 
ATOM   1690 O  O   . ASP A 1 219 ? -11.405 8.054  41.208 1.00 2.77  ? 200  ASP A O   1 
ATOM   1691 C  CB  . ASP A 1 219 ? -14.163 6.685  42.255 1.00 2.42  ? 200  ASP A CB  1 
ATOM   1692 C  CG  . ASP A 1 219 ? -14.658 5.279  42.538 1.00 2.27  ? 200  ASP A CG  1 
ATOM   1693 O  OD1 . ASP A 1 219 ? -13.838 4.399  42.801 1.00 3.67  ? 200  ASP A OD1 1 
ATOM   1694 O  OD2 . ASP A 1 219 ? -15.874 5.043  42.453 1.00 3.05  ? 200  ASP A OD2 1 
ATOM   1695 N  N   . VAL A 1 220 ? -12.590 9.399  42.561 1.00 2.70  ? 201  VAL A N   1 
ATOM   1696 C  CA  . VAL A 1 220 ? -12.060 10.637 42.000 1.00 2.75  ? 201  VAL A CA  1 
ATOM   1697 C  C   . VAL A 1 220 ? -10.554 10.761 42.266 1.00 3.49  ? 201  VAL A C   1 
ATOM   1698 O  O   . VAL A 1 220 ? -9.765  11.068 41.361 1.00 3.80  ? 201  VAL A O   1 
ATOM   1699 C  CB  . VAL A 1 220 ? -12.785 11.891 42.572 1.00 2.35  ? 201  VAL A CB  1 
ATOM   1700 C  CG1 . VAL A 1 220 ? -12.122 13.186 42.090 1.00 2.00  ? 201  VAL A CG1 1 
ATOM   1701 C  CG2 . VAL A 1 220 ? -14.230 11.880 42.145 1.00 2.90  ? 201  VAL A CG2 1 
ATOM   1702 N  N   . ARG A 1 221 ? -10.176 10.556 43.519 1.00 2.93  ? 202  ARG A N   1 
ATOM   1703 C  CA  . ARG A 1 221 ? -8.794  10.615 43.926 1.00 3.58  ? 202  ARG A CA  1 
ATOM   1704 C  C   . ARG A 1 221 ? -7.954  9.592  43.091 1.00 3.26  ? 202  ARG A C   1 
ATOM   1705 O  O   . ARG A 1 221 ? -6.900  9.941  42.537 1.00 2.50  ? 202  ARG A O   1 
ATOM   1706 C  CB  . ARG A 1 221 ? -8.769  10.349 45.448 1.00 4.10  ? 202  ARG A CB  1 
ATOM   1707 C  CG  . ARG A 1 221 ? -7.581  10.805 46.238 1.00 9.14  ? 202  ARG A CG  1 
ATOM   1708 C  CD  . ARG A 1 221 ? -7.569  12.297 46.610 1.00 7.15  ? 202  ARG A CD  1 
ATOM   1709 N  NE  . ARG A 1 221 ? -7.128  13.088 45.469 1.00 8.83  ? 202  ARG A NE  1 
ATOM   1710 C  CZ  . ARG A 1 221 ? -5.991  12.883 44.800 1.00 6.44  ? 202  ARG A CZ  1 
ATOM   1711 N  NH1 . ARG A 1 221 ? -5.145  11.923 45.172 1.00 5.27  ? 202  ARG A NH1 1 
ATOM   1712 N  NH2 . ARG A 1 221 ? -5.699  13.649 43.763 1.00 4.36  ? 202  ARG A NH2 1 
ATOM   1713 N  N   . ASP A 1 222 ? -8.443  8.350  42.971 1.00 2.49  ? 203  ASP A N   1 
ATOM   1714 C  CA  . ASP A 1 222 ? -7.756  7.312  42.211 1.00 2.34  ? 203  ASP A CA  1 
ATOM   1715 C  C   . ASP A 1 222 ? -7.609  7.693  40.742 1.00 2.25  ? 203  ASP A C   1 
ATOM   1716 O  O   . ASP A 1 222 ? -6.557  7.469  40.164 1.00 2.00  ? 203  ASP A O   1 
ATOM   1717 C  CB  . ASP A 1 222 ? -8.511  5.975  42.293 1.00 2.31  ? 203  ASP A CB  1 
ATOM   1718 C  CG  . ASP A 1 222 ? -8.383  5.294  43.665 1.00 3.82  ? 203  ASP A CG  1 
ATOM   1719 O  OD1 . ASP A 1 222 ? -7.539  5.709  44.489 1.00 7.78  ? 203  ASP A OD1 1 
ATOM   1720 O  OD2 . ASP A 1 222 ? -9.140  4.339  43.917 1.00 5.78  ? 203  ASP A OD2 1 
ATOM   1721 N  N   . ALA A 1 223 ? -8.674  8.235  40.143 1.00 2.14  ? 204  ALA A N   1 
ATOM   1722 C  CA  . ALA A 1 223 ? -8.685  8.645  38.720 1.00 2.16  ? 204  ALA A CA  1 
ATOM   1723 C  C   . ALA A 1 223 ? -7.707  9.809  38.459 1.00 2.39  ? 204  ALA A C   1 
ATOM   1724 O  O   . ALA A 1 223 ? -7.004  9.822  37.440 1.00 2.00  ? 204  ALA A O   1 
ATOM   1725 C  CB  . ALA A 1 223 ? -10.118 9.025  38.271 1.00 2.00  ? 204  ALA A CB  1 
ATOM   1726 N  N   . VAL A 1 224 ? -7.647  10.762 39.394 1.00 2.44  ? 205  VAL A N   1 
ATOM   1727 C  CA  . VAL A 1 224 ? -6.633  11.840 39.329 1.00 3.50  ? 205  VAL A CA  1 
ATOM   1728 C  C   . VAL A 1 224 ? -5.189  11.281 39.362 1.00 3.06  ? 205  VAL A C   1 
ATOM   1729 O  O   . VAL A 1 224 ? -4.365  11.589 38.493 1.00 3.01  ? 205  VAL A O   1 
ATOM   1730 C  CB  . VAL A 1 224 ? -6.829  12.928 40.447 1.00 3.81  ? 205  VAL A CB  1 
ATOM   1731 C  CG1 . VAL A 1 224 ? -5.686  13.972 40.380 1.00 5.17  ? 205  VAL A CG1 1 
ATOM   1732 C  CG2 . VAL A 1 224 ? -8.193  13.629 40.314 1.00 2.22  ? 205  VAL A CG2 1 
ATOM   1733 N  N   . ASP A 1 225 ? -4.884  10.452 40.352 1.00 3.10  ? 206  ASP A N   1 
ATOM   1734 C  CA  . ASP A 1 225 ? -3.578  9.830  40.406 1.00 3.12  ? 206  ASP A CA  1 
ATOM   1735 C  C   . ASP A 1 225 ? -3.280  9.085  39.065 1.00 3.13  ? 206  ASP A C   1 
ATOM   1736 O  O   . ASP A 1 225 ? -2.195  9.215  38.512 1.00 2.77  ? 206  ASP A O   1 
ATOM   1737 C  CB  . ASP A 1 225 ? -3.475  8.839  41.592 1.00 3.83  ? 206  ASP A CB  1 
ATOM   1738 C  CG  . ASP A 1 225 ? -3.453  9.537  42.985 1.00 6.73  ? 206  ASP A CG  1 
ATOM   1739 O  OD1 . ASP A 1 225 ? -3.239  10.783 43.101 1.00 7.75  ? 206  ASP A OD1 1 
ATOM   1740 O  OD2 . ASP A 1 225 ? -3.660  8.814  43.981 1.00 10.60 ? 206  ASP A OD2 1 
ATOM   1741 N  N   . TRP A 1 226 ? -4.232  8.276  38.608 1.00 2.28  ? 207  TRP A N   1 
ATOM   1742 C  CA  . TRP A 1 226 ? -4.103  7.462  37.403 1.00 2.38  ? 207  TRP A CA  1 
ATOM   1743 C  C   . TRP A 1 226 ? -3.798  8.335  36.169 1.00 2.40  ? 207  TRP A C   1 
ATOM   1744 O  O   . TRP A 1 226 ? -2.936  8.008  35.367 1.00 2.27  ? 207  TRP A O   1 
ATOM   1745 C  CB  . TRP A 1 226 ? -5.382  6.627  37.173 1.00 2.00  ? 207  TRP A CB  1 
ATOM   1746 C  CG  . TRP A 1 226 ? -5.314  5.685  35.983 1.00 2.00  ? 207  TRP A CG  1 
ATOM   1747 C  CD1 . TRP A 1 226 ? -4.978  4.351  36.005 1.00 2.56  ? 207  TRP A CD1 1 
ATOM   1748 C  CD2 . TRP A 1 226 ? -5.568  6.008  34.608 1.00 2.00  ? 207  TRP A CD2 1 
ATOM   1749 N  NE1 . TRP A 1 226 ? -5.008  3.835  34.734 1.00 2.00  ? 207  TRP A NE1 1 
ATOM   1750 C  CE2 . TRP A 1 226 ? -5.374  4.823  33.858 1.00 2.00  ? 207  TRP A CE2 1 
ATOM   1751 C  CE3 . TRP A 1 226 ? -5.971  7.181  33.938 1.00 2.00  ? 207  TRP A CE3 1 
ATOM   1752 C  CZ2 . TRP A 1 226 ? -5.554  4.774  32.458 1.00 2.54  ? 207  TRP A CZ2 1 
ATOM   1753 C  CZ3 . TRP A 1 226 ? -6.144  7.131  32.553 1.00 2.00  ? 207  TRP A CZ3 1 
ATOM   1754 C  CH2 . TRP A 1 226 ? -5.935  5.937  31.830 1.00 2.00  ? 207  TRP A CH2 1 
ATOM   1755 N  N   . VAL A 1 227 ? -4.534  9.417  36.004 1.00 2.00  ? 208  VAL A N   1 
ATOM   1756 C  CA  . VAL A 1 227 ? -4.333  10.284 34.854 1.00 3.37  ? 208  VAL A CA  1 
ATOM   1757 C  C   . VAL A 1 227 ? -2.876  10.828 34.817 1.00 3.37  ? 208  VAL A C   1 
ATOM   1758 O  O   . VAL A 1 227 ? -2.241  10.875 33.762 1.00 3.09  ? 208  VAL A O   1 
ATOM   1759 C  CB  . VAL A 1 227 ? -5.441  11.398 34.857 1.00 4.12  ? 208  VAL A CB  1 
ATOM   1760 C  CG1 . VAL A 1 227 ? -4.959  12.676 34.278 1.00 7.52  ? 208  VAL A CG1 1 
ATOM   1761 C  CG2 . VAL A 1 227 ? -6.690  10.909 34.169 1.00 2.31  ? 208  VAL A CG2 1 
ATOM   1762 N  N   . HIS A 1 228 ? -2.349  11.200 35.985 1.00 4.72  ? 209  HIS A N   1 
ATOM   1763 C  CA  . HIS A 1 228 ? -0.969  11.658 36.126 1.00 5.61  ? 209  HIS A CA  1 
ATOM   1764 C  C   . HIS A 1 228 ? 0.072   10.541 35.978 1.00 6.49  ? 209  HIS A C   1 
ATOM   1765 O  O   . HIS A 1 228 ? 1.177   10.769 35.468 1.00 6.37  ? 209  HIS A O   1 
ATOM   1766 C  CB  . HIS A 1 228 ? -0.784  12.329 37.487 1.00 6.06  ? 209  HIS A CB  1 
ATOM   1767 C  CG  . HIS A 1 228 ? -1.228  13.757 37.514 1.00 8.41  ? 209  HIS A CG  1 
ATOM   1768 N  ND1 . HIS A 1 228 ? -2.491  14.137 37.921 1.00 8.43  ? 209  HIS A ND1 1 
ATOM   1769 C  CD2 . HIS A 1 228 ? -0.583  14.895 37.162 1.00 6.26  ? 209  HIS A CD2 1 
ATOM   1770 C  CE1 . HIS A 1 228 ? -2.593  15.454 37.848 1.00 7.35  ? 209  HIS A CE1 1 
ATOM   1771 N  NE2 . HIS A 1 228 ? -1.447  15.934 37.392 1.00 10.84 ? 209  HIS A NE2 1 
ATOM   1772 N  N   . TYR A 1 229 ? -0.276  9.334  36.402 1.00 7.13  ? 210  TYR A N   1 
ATOM   1773 C  CA  . TYR A 1 229 ? 0.716   8.287  36.474 1.00 9.53  ? 210  TYR A CA  1 
ATOM   1774 C  C   . TYR A 1 229 ? 0.617   7.313  35.313 1.00 9.49  ? 210  TYR A C   1 
ATOM   1775 O  O   . TYR A 1 229 ? 1.633   6.936  34.751 1.00 9.37  ? 210  TYR A O   1 
ATOM   1776 C  CB  . TYR A 1 229 ? 0.641   7.555  37.813 1.00 10.96 ? 210  TYR A CB  1 
ATOM   1777 C  CG  . TYR A 1 229 ? 1.624   6.407  37.964 1.00 15.73 ? 210  TYR A CG  1 
ATOM   1778 C  CD1 . TYR A 1 229 ? 3.012   6.626  37.902 1.00 19.36 ? 210  TYR A CD1 1 
ATOM   1779 C  CD2 . TYR A 1 229 ? 1.174   5.100  38.203 1.00 18.79 ? 210  TYR A CD2 1 
ATOM   1780 C  CE1 . TYR A 1 229 ? 3.923   5.563  38.047 1.00 20.13 ? 210  TYR A CE1 1 
ATOM   1781 C  CE2 . TYR A 1 229 ? 2.080   4.027  38.348 1.00 20.04 ? 210  TYR A CE2 1 
ATOM   1782 C  CZ  . TYR A 1 229 ? 3.451   4.276  38.269 1.00 18.59 ? 210  TYR A CZ  1 
ATOM   1783 O  OH  . TYR A 1 229 ? 4.351   3.230  38.421 1.00 19.95 ? 210  TYR A OH  1 
ATOM   1784 N  N   . LYS A 1 230 ? -0.603  6.915  34.961 1.00 8.93  ? 211  LYS A N   1 
ATOM   1785 C  CA  . LYS A 1 230 ? -0.821  5.876  33.963 1.00 9.68  ? 211  LYS A CA  1 
ATOM   1786 C  C   . LYS A 1 230 ? -1.528  6.395  32.704 1.00 8.05  ? 211  LYS A C   1 
ATOM   1787 O  O   . LYS A 1 230 ? -1.519  5.727  31.695 1.00 8.34  ? 211  LYS A O   1 
ATOM   1788 C  CB  . LYS A 1 230 ? -1.619  4.716  34.577 1.00 9.59  ? 211  LYS A CB  1 
ATOM   1789 C  CG  . LYS A 1 230 ? -0.849  3.941  35.660 1.00 12.16 ? 211  LYS A CG  1 
ATOM   1790 C  CD  . LYS A 1 230 ? -1.701  2.849  36.301 1.00 13.81 ? 211  LYS A CD  1 
ATOM   1791 C  CE  . LYS A 1 230 ? -0.858  1.631  36.720 1.00 20.13 ? 211  LYS A CE  1 
ATOM   1792 N  NZ  . LYS A 1 230 ? -1.712  0.447  37.135 1.00 22.37 ? 211  LYS A NZ  1 
ATOM   1793 N  N   . GLY A 1 231 ? -2.126  7.581  32.772 1.00 6.96  ? 212  GLY A N   1 
ATOM   1794 C  CA  . GLY A 1 231 ? -2.890  8.127  31.657 1.00 5.66  ? 212  GLY A CA  1 
ATOM   1795 C  C   . GLY A 1 231 ? -2.045  8.999  30.754 1.00 5.36  ? 212  GLY A C   1 
ATOM   1796 O  O   . GLY A 1 231 ? -0.818  8.860  30.711 1.00 5.10  ? 212  GLY A O   1 
ATOM   1797 N  N   . SER A 1 232 ? -2.707  9.925  30.063 1.00 4.55  ? 213  SER A N   1 
ATOM   1798 C  CA  . SER A 1 232 ? -2.105  10.695 28.971 1.00 3.84  ? 213  SER A CA  1 
ATOM   1799 C  C   . SER A 1 232 ? -1.809  12.159 29.327 1.00 3.81  ? 213  SER A C   1 
ATOM   1800 O  O   . SER A 1 232 ? -1.415  12.919 28.457 1.00 4.56  ? 213  SER A O   1 
ATOM   1801 C  CB  . SER A 1 232 ? -3.029  10.641 27.739 1.00 3.72  ? 213  SER A CB  1 
ATOM   1802 O  OG  . SER A 1 232 ? -4.249  11.331 28.008 1.00 3.14  ? 213  SER A OG  1 
ATOM   1803 N  N   . LEU A 1 233 ? -2.019  12.552 30.587 1.00 3.83  ? 214  LEU A N   1 
ATOM   1804 C  CA  . LEU A 1 233 ? -1.804  13.941 31.014 1.00 4.21  ? 214  LEU A CA  1 
ATOM   1805 C  C   . LEU A 1 233 ? -0.393  14.502 30.748 1.00 3.33  ? 214  LEU A C   1 
ATOM   1806 O  O   . LEU A 1 233 ? -0.264  15.600 30.199 1.00 2.70  ? 214  LEU A O   1 
ATOM   1807 C  CB  . LEU A 1 233 ? -2.195  14.162 32.491 1.00 3.42  ? 214  LEU A CB  1 
ATOM   1808 C  CG  . LEU A 1 233 ? -2.006  15.561 33.124 1.00 5.71  ? 214  LEU A CG  1 
ATOM   1809 C  CD1 . LEU A 1 233 ? -2.419  16.697 32.220 1.00 6.80  ? 214  LEU A CD1 1 
ATOM   1810 C  CD2 . LEU A 1 233 ? -2.844  15.636 34.364 1.00 9.01  ? 214  LEU A CD2 1 
ATOM   1811 N  N   . LYS A 1 234 ? 0.627   13.756 31.172 1.00 2.81  ? 215  LYS A N   1 
ATOM   1812 C  CA  . LYS A 1 234 ? 2.026   14.155 30.993 1.00 2.66  ? 215  LYS A CA  1 
ATOM   1813 C  C   . LYS A 1 234 ? 2.380   14.280 29.510 1.00 2.69  ? 215  LYS A C   1 
ATOM   1814 O  O   . LYS A 1 234 ? 2.980   15.272 29.082 1.00 2.29  ? 215  LYS A O   1 
ATOM   1815 C  CB  . LYS A 1 234 ? 2.968   13.160 31.698 1.00 2.29  ? 215  LYS A CB  1 
ATOM   1816 C  CG  . LYS A 1 234 ? 3.150   13.474 33.190 1.00 2.00  ? 215  LYS A CG  1 
ATOM   1817 C  CD  . LYS A 1 234 ? 4.021   12.397 33.866 1.00 2.10  ? 215  LYS A CD  1 
ATOM   1818 C  CE  . LYS A 1 234 ? 4.321   12.763 35.330 1.00 2.00  ? 215  LYS A CE  1 
ATOM   1819 N  NZ  . LYS A 1 234 ? 3.044   13.015 36.123 1.00 2.00  ? 215  LYS A NZ  1 
ATOM   1820 N  N   . GLU A 1 235 ? 1.993   13.275 28.741 1.00 2.50  ? 216  GLU A N   1 
ATOM   1821 C  CA  . GLU A 1 235 ? 2.207   13.271 27.289 1.00 3.71  ? 216  GLU A CA  1 
ATOM   1822 C  C   . GLU A 1 235 ? 1.588   14.505 26.582 1.00 3.31  ? 216  GLU A C   1 
ATOM   1823 O  O   . GLU A 1 235 ? 2.255   15.175 25.792 1.00 2.56  ? 216  GLU A O   1 
ATOM   1824 C  CB  . GLU A 1 235 ? 1.666   11.957 26.714 1.00 4.07  ? 216  GLU A CB  1 
ATOM   1825 C  CG  . GLU A 1 235 ? 1.475   11.956 25.225 1.00 7.66  ? 216  GLU A CG  1 
ATOM   1826 C  CD  . GLU A 1 235 ? 1.072   10.595 24.705 1.00 14.89 ? 216  GLU A CD  1 
ATOM   1827 O  OE1 . GLU A 1 235 ? 0.019   10.058 25.134 1.00 18.41 ? 216  GLU A OE1 1 
ATOM   1828 O  OE2 . GLU A 1 235 ? 1.815   10.067 23.862 1.00 17.20 ? 216  GLU A OE2 1 
ATOM   1829 N  N   . LYS A 1 236 ? 0.318   14.791 26.882 1.00 3.54  ? 217  LYS A N   1 
ATOM   1830 C  CA  . LYS A 1 236 ? -0.377  16.007 26.400 1.00 4.34  ? 217  LYS A CA  1 
ATOM   1831 C  C   . LYS A 1 236 ? 0.227   17.330 26.897 1.00 4.41  ? 217  LYS A C   1 
ATOM   1832 O  O   . LYS A 1 236 ? 0.287   18.312 26.165 1.00 4.65  ? 217  LYS A O   1 
ATOM   1833 C  CB  . LYS A 1 236 ? -1.883  15.915 26.718 1.00 4.78  ? 217  LYS A CB  1 
ATOM   1834 C  CG  . LYS A 1 236 ? -2.621  14.868 25.823 1.00 7.17  ? 217  LYS A CG  1 
ATOM   1835 C  CD  . LYS A 1 236 ? -3.967  14.511 26.446 1.00 11.41 ? 217  LYS A CD  1 
ATOM   1836 C  CE  . LYS A 1 236 ? -4.740  13.482 25.611 1.00 11.93 ? 217  LYS A CE  1 
ATOM   1837 N  NZ  . LYS A 1 236 ? -4.933  13.999 24.247 1.00 17.08 ? 217  LYS A NZ  1 
ATOM   1838 N  N   . THR A 1 237 ? 0.716   17.350 28.133 1.00 4.82  ? 218  THR A N   1 
ATOM   1839 C  CA  . THR A 1 237 ? 1.426   18.524 28.641 1.00 4.31  ? 218  THR A CA  1 
ATOM   1840 C  C   . THR A 1 237 ? 2.671   18.819 27.782 1.00 4.82  ? 218  THR A C   1 
ATOM   1841 O  O   . THR A 1 237 ? 2.852   19.932 27.270 1.00 5.18  ? 218  THR A O   1 
ATOM   1842 C  CB  . THR A 1 237 ? 1.828   18.334 30.128 1.00 4.43  ? 218  THR A CB  1 
ATOM   1843 O  OG1 . THR A 1 237 ? 0.656   17.980 30.893 1.00 3.65  ? 218  THR A OG1 1 
ATOM   1844 C  CG2 . THR A 1 237 ? 2.489   19.647 30.709 1.00 2.37  ? 218  THR A CG2 1 
ATOM   1845 N  N   . VAL A 1 238 ? 3.519   17.812 27.652 1.00 4.67  ? 219  VAL A N   1 
ATOM   1846 C  CA  . VAL A 1 238 ? 4.836   17.922 27.050 1.00 6.35  ? 219  VAL A CA  1 
ATOM   1847 C  C   . VAL A 1 238 ? 4.742   18.139 25.521 1.00 6.97  ? 219  VAL A C   1 
ATOM   1848 O  O   . VAL A 1 238 ? 5.637   18.756 24.914 1.00 7.50  ? 219  VAL A O   1 
ATOM   1849 C  CB  . VAL A 1 238 ? 5.640   16.638 27.427 1.00 7.31  ? 219  VAL A CB  1 
ATOM   1850 C  CG1 . VAL A 1 238 ? 6.788   16.359 26.469 1.00 9.70  ? 219  VAL A CG1 1 
ATOM   1851 C  CG2 . VAL A 1 238 ? 6.110   16.708 28.896 1.00 5.92  ? 219  VAL A CG2 1 
ATOM   1852 N  N   . GLU A 1 239 ? 3.664   17.660 24.900 1.00 6.68  ? 220  GLU A N   1 
ATOM   1853 C  CA  . GLU A 1 239 ? 3.476   17.931 23.484 1.00 8.99  ? 220  GLU A CA  1 
ATOM   1854 C  C   . GLU A 1 239 ? 3.065   19.371 23.175 1.00 7.23  ? 220  GLU A C   1 
ATOM   1855 O  O   . GLU A 1 239 ? 3.085   19.762 22.037 1.00 7.03  ? 220  GLU A O   1 
ATOM   1856 C  CB  . GLU A 1 239 ? 2.548   16.915 22.804 1.00 8.73  ? 220  GLU A CB  1 
ATOM   1857 C  CG  . GLU A 1 239 ? 1.113   16.962 23.248 1.00 13.28 ? 220  GLU A CG  1 
ATOM   1858 C  CD  . GLU A 1 239 ? 0.238   15.917 22.526 1.00 13.72 ? 220  GLU A CD  1 
ATOM   1859 O  OE1 . GLU A 1 239 ? 0.804   14.891 22.052 1.00 18.86 ? 220  GLU A OE1 1 
ATOM   1860 O  OE2 . GLU A 1 239 ? -1.004  16.140 22.429 1.00 17.22 ? 220  GLU A OE2 1 
ATOM   1861 N  N   . ASN A 1 240 ? 2.721   20.164 24.189 1.00 6.93  ? 221  ASN A N   1 
ATOM   1862 C  CA  . ASN A 1 240 ? 2.373   21.571 23.956 1.00 5.99  ? 221  ASN A CA  1 
ATOM   1863 C  C   . ASN A 1 240 ? 2.707   22.401 25.174 1.00 5.02  ? 221  ASN A C   1 
ATOM   1864 O  O   . ASN A 1 240 ? 1.826   22.904 25.848 1.00 4.60  ? 221  ASN A O   1 
ATOM   1865 C  CB  . ASN A 1 240 ? 0.891   21.730 23.608 1.00 6.27  ? 221  ASN A CB  1 
ATOM   1866 C  CG  . ASN A 1 240 ? 0.588   23.059 22.908 1.00 7.49  ? 221  ASN A CG  1 
ATOM   1867 O  OD1 . ASN A 1 240 ? 1.410   24.003 22.900 1.00 8.18  ? 221  ASN A OD1 1 
ATOM   1868 N  ND2 . ASN A 1 240 ? -0.598  23.141 22.328 1.00 6.46  ? 221  ASN A ND2 1 
ATOM   1869 N  N   . LEU A 1 241 ? 3.998   22.532 25.436 1.00 4.22  ? 222  LEU A N   1 
ATOM   1870 C  CA  . LEU A 1 241 ? 4.485   23.128 26.652 1.00 4.82  ? 222  LEU A CA  1 
ATOM   1871 C  C   . LEU A 1 241 ? 4.173   24.616 26.727 1.00 4.90  ? 222  LEU A C   1 
ATOM   1872 O  O   . LEU A 1 241 ? 3.943   25.156 27.813 1.00 3.57  ? 222  LEU A O   1 
ATOM   1873 C  CB  . LEU A 1 241 ? 5.982   22.832 26.790 1.00 5.31  ? 222  LEU A CB  1 
ATOM   1874 C  CG  . LEU A 1 241 ? 6.285   21.398 27.270 1.00 7.51  ? 222  LEU A CG  1 
ATOM   1875 C  CD1 . LEU A 1 241 ? 7.724   21.014 27.029 1.00 9.83  ? 222  LEU A CD1 1 
ATOM   1876 C  CD2 . LEU A 1 241 ? 5.945   21.251 28.740 1.00 7.92  ? 222  LEU A CD2 1 
ATOM   1877 N  N   . GLU A 1 242 ? 4.124   25.269 25.564 1.00 4.62  ? 223  GLU A N   1 
ATOM   1878 C  CA  . GLU A 1 242 ? 3.826   26.701 25.507 1.00 4.96  ? 223  GLU A CA  1 
ATOM   1879 C  C   . GLU A 1 242 ? 2.387   26.981 25.962 1.00 3.88  ? 223  GLU A C   1 
ATOM   1880 O  O   . GLU A 1 242 ? 2.122   27.994 26.617 1.00 3.36  ? 223  GLU A O   1 
ATOM   1881 C  CB  . GLU A 1 242 ? 4.036   27.225 24.084 1.00 5.89  ? 223  GLU A CB  1 
ATOM   1882 C  CG  . GLU A 1 242 ? 5.504   27.115 23.563 1.00 12.64 ? 223  GLU A CG  1 
ATOM   1883 C  CD  . GLU A 1 242 ? 5.918   25.692 23.087 1.00 19.21 ? 223  GLU A CD  1 
ATOM   1884 O  OE1 . GLU A 1 242 ? 5.033   24.813 22.845 1.00 18.61 ? 223  GLU A OE1 1 
ATOM   1885 O  OE2 . GLU A 1 242 ? 7.155   25.470 22.963 1.00 22.17 ? 223  GLU A OE2 1 
ATOM   1886 N  N   . LYS A 1 243 ? 1.464   26.087 25.604 1.00 2.49  ? 224  LYS A N   1 
ATOM   1887 C  CA  . LYS A 1 243 ? 0.079   26.187 26.061 1.00 2.69  ? 224  LYS A CA  1 
ATOM   1888 C  C   . LYS A 1 243 ? -0.101  25.953 27.579 1.00 2.54  ? 224  LYS A C   1 
ATOM   1889 O  O   . LYS A 1 243 ? -1.021  26.499 28.185 1.00 3.05  ? 224  LYS A O   1 
ATOM   1890 C  CB  . LYS A 1 243 ? -0.809  25.216 25.269 1.00 2.72  ? 224  LYS A CB  1 
ATOM   1891 C  CG  . LYS A 1 243 ? -2.232  25.003 25.781 1.00 2.97  ? 224  LYS A CG  1 
ATOM   1892 C  CD  . LYS A 1 243 ? -3.039  24.142 24.826 1.00 2.97  ? 224  LYS A CD  1 
ATOM   1893 C  CE  . LYS A 1 243 ? -4.490  24.030 25.284 1.00 5.93  ? 224  LYS A CE  1 
ATOM   1894 N  NZ  . LYS A 1 243 ? -5.273  23.210 24.317 1.00 8.91  ? 224  LYS A NZ  1 
ATOM   1895 N  N   . TYR A 1 244 ? 0.744   25.113 28.165 1.00 2.29  ? 225  TYR A N   1 
ATOM   1896 C  CA  . TYR A 1 244 ? 0.524   24.596 29.514 1.00 2.16  ? 225  TYR A CA  1 
ATOM   1897 C  C   . TYR A 1 244 ? 1.480   25.094 30.589 1.00 2.47  ? 225  TYR A C   1 
ATOM   1898 O  O   . TYR A 1 244 ? 1.181   24.910 31.764 1.00 2.69  ? 225  TYR A O   1 
ATOM   1899 C  CB  . TYR A 1 244 ? 0.507   23.042 29.523 1.00 2.00  ? 225  TYR A CB  1 
ATOM   1900 C  CG  . TYR A 1 244 ? -0.717  22.482 28.816 1.00 2.58  ? 225  TYR A CG  1 
ATOM   1901 C  CD1 . TYR A 1 244 ? -2.020  22.738 29.307 1.00 2.19  ? 225  TYR A CD1 1 
ATOM   1902 C  CD2 . TYR A 1 244 ? -0.585  21.719 27.657 1.00 2.00  ? 225  TYR A CD2 1 
ATOM   1903 C  CE1 . TYR A 1 244 ? -3.155  22.251 28.648 1.00 2.00  ? 225  TYR A CE1 1 
ATOM   1904 C  CE2 . TYR A 1 244 ? -1.707  21.234 26.989 1.00 2.00  ? 225  TYR A CE2 1 
ATOM   1905 C  CZ  . TYR A 1 244 ? -2.982  21.506 27.501 1.00 2.00  ? 225  TYR A CZ  1 
ATOM   1906 O  OH  . TYR A 1 244 ? -4.066  21.007 26.849 1.00 5.37  ? 225  TYR A OH  1 
ATOM   1907 N  N   . VAL A 1 245 ? 2.614   25.700 30.223 1.00 2.35  ? 226  VAL A N   1 
ATOM   1908 C  CA  . VAL A 1 245 ? 3.649   25.988 31.245 1.00 2.79  ? 226  VAL A CA  1 
ATOM   1909 C  C   . VAL A 1 245 ? 4.174   27.405 31.086 1.00 2.84  ? 226  VAL A C   1 
ATOM   1910 O  O   . VAL A 1 245 ? 4.505   27.800 29.982 1.00 2.35  ? 226  VAL A O   1 
ATOM   1911 C  CB  . VAL A 1 245 ? 4.834   24.972 31.218 1.00 2.46  ? 226  VAL A CB  1 
ATOM   1912 C  CG1 . VAL A 1 245 ? 5.795   25.205 32.425 1.00 2.55  ? 226  VAL A CG1 1 
ATOM   1913 C  CG2 . VAL A 1 245 ? 4.320   23.538 31.254 1.00 4.81  ? 226  VAL A CG2 1 
ATOM   1914 N  N   . VAL A 1 246 ? 4.216   28.159 32.191 1.00 2.92  ? 227  VAL A N   1 
ATOM   1915 C  CA  . VAL A 1 246 ? 4.801   29.520 32.206 1.00 2.98  ? 227  VAL A CA  1 
ATOM   1916 C  C   . VAL A 1 246 ? 6.318   29.371 32.047 1.00 3.51  ? 227  VAL A C   1 
ATOM   1917 O  O   . VAL A 1 246 ? 6.943   28.507 32.689 1.00 4.22  ? 227  VAL A O   1 
ATOM   1918 C  CB  . VAL A 1 246 ? 4.451   30.307 33.522 1.00 2.73  ? 227  VAL A CB  1 
ATOM   1919 C  CG1 . VAL A 1 246 ? 5.207   31.655 33.633 1.00 2.56  ? 227  VAL A CG1 1 
ATOM   1920 C  CG2 . VAL A 1 246 ? 2.940   30.531 33.658 1.00 2.00  ? 227  VAL A CG2 1 
ATOM   1921 N  N   . LYS A 1 247 ? 6.899   30.222 31.212 1.00 3.32  ? 228  LYS A N   1 
ATOM   1922 C  CA  . LYS A 1 247 ? 8.322   30.212 30.929 1.00 3.46  ? 228  LYS A CA  1 
ATOM   1923 C  C   . LYS A 1 247 ? 8.880   31.630 31.136 1.00 2.41  ? 228  LYS A C   1 
ATOM   1924 O  O   . LYS A 1 247 ? 8.252   32.587 30.754 1.00 2.18  ? 228  LYS A O   1 
ATOM   1925 C  CB  . LYS A 1 247 ? 8.494   29.787 29.465 1.00 4.39  ? 228  LYS A CB  1 
ATOM   1926 C  CG  . LYS A 1 247 ? 9.898   29.474 29.063 1.00 5.99  ? 228  LYS A CG  1 
ATOM   1927 C  CD  . LYS A 1 247 ? 9.872   28.871 27.708 1.00 8.69  ? 228  LYS A CD  1 
ATOM   1928 C  CE  . LYS A 1 247 ? 11.249  28.577 27.230 1.00 10.60 ? 228  LYS A CE  1 
ATOM   1929 N  NZ  . LYS A 1 247 ? 11.140  27.942 25.891 1.00 12.78 ? 228  LYS A NZ  1 
ATOM   1930 N  N   . ASP A 1 248 ? 10.085  31.765 31.672 1.00 2.20  ? 229  ASP A N   1 
ATOM   1931 C  CA  . ASP A 1 248 ? 10.595  33.084 32.096 1.00 2.53  ? 229  ASP A CA  1 
ATOM   1932 C  C   . ASP A 1 248 ? 12.097  33.146 31.877 1.00 2.96  ? 229  ASP A C   1 
ATOM   1933 O  O   . ASP A 1 248 ? 12.829  32.425 32.519 1.00 4.14  ? 229  ASP A O   1 
ATOM   1934 C  CB  . ASP A 1 248 ? 10.269  33.314 33.609 1.00 2.00  ? 229  ASP A CB  1 
ATOM   1935 C  CG  . ASP A 1 248 ? 10.673  34.724 34.119 1.00 2.85  ? 229  ASP A CG  1 
ATOM   1936 O  OD1 . ASP A 1 248 ? 11.348  35.502 33.400 1.00 2.00  ? 229  ASP A OD1 1 
ATOM   1937 O  OD2 . ASP A 1 248 ? 10.299  35.061 35.266 1.00 2.00  ? 229  ASP A OD2 1 
ATOM   1938 N  N   . GLY A 1 249 ? 12.563  34.031 31.007 1.00 4.61  ? 230  GLY A N   1 
ATOM   1939 C  CA  . GLY A 1 249 ? 14.005  34.198 30.739 1.00 4.17  ? 230  GLY A CA  1 
ATOM   1940 C  C   . GLY A 1 249 ? 14.816  34.615 31.962 1.00 4.68  ? 230  GLY A C   1 
ATOM   1941 O  O   . GLY A 1 249 ? 16.032  34.399 31.989 1.00 4.62  ? 230  GLY A O   1 
ATOM   1942 N  N   . LYS A 1 250 ? 14.149  35.185 32.973 1.00 3.86  ? 231  LYS A N   1 
ATOM   1943 C  CA  . LYS A 1 250 ? 14.815  35.564 34.240 1.00 4.01  ? 231  LYS A CA  1 
ATOM   1944 C  C   . LYS A 1 250 ? 15.175  34.427 35.187 1.00 4.72  ? 231  LYS A C   1 
ATOM   1945 O  O   . LYS A 1 250 ? 16.010  34.613 36.080 1.00 5.00  ? 231  LYS A O   1 
ATOM   1946 C  CB  . LYS A 1 250 ? 14.029  36.654 34.981 1.00 4.47  ? 231  LYS A CB  1 
ATOM   1947 C  CG  . LYS A 1 250 ? 13.892  37.962 34.141 1.00 2.00  ? 231  LYS A CG  1 
ATOM   1948 C  CD  . LYS A 1 250 ? 12.985  38.980 34.805 1.00 2.98  ? 231  LYS A CD  1 
ATOM   1949 C  CE  . LYS A 1 250 ? 11.584  38.436 35.078 1.00 2.42  ? 231  LYS A CE  1 
ATOM   1950 N  NZ  . LYS A 1 250 ? 10.749  38.139 33.843 1.00 2.00  ? 231  LYS A NZ  1 
ATOM   1951 N  N   . LEU A 1 251 ? 14.588  33.238 34.994 1.00 5.18  ? 232  LEU A N   1 
ATOM   1952 C  CA  . LEU A 1 251 ? 14.931  32.085 35.847 1.00 4.93  ? 232  LEU A CA  1 
ATOM   1953 C  C   . LEU A 1 251 ? 16.437  31.741 35.873 1.00 4.28  ? 232  LEU A C   1 
ATOM   1954 O  O   . LEU A 1 251 ? 17.008  31.635 36.962 1.00 2.90  ? 232  LEU A O   1 
ATOM   1955 C  CB  . LEU A 1 251 ? 14.067  30.845 35.528 1.00 5.32  ? 232  LEU A CB  1 
ATOM   1956 C  CG  . LEU A 1 251 ? 14.560  29.508 36.123 1.00 6.54  ? 232  LEU A CG  1 
ATOM   1957 C  CD1 . LEU A 1 251 ? 14.444  29.510 37.649 1.00 7.29  ? 232  LEU A CD1 1 
ATOM   1958 C  CD2 . LEU A 1 251 ? 13.804  28.300 35.564 1.00 7.36  ? 232  LEU A CD2 1 
ATOM   1959 N  N   . PRO A 1 252 ? 17.087  31.521 34.687 1.00 4.16  ? 233  PRO A N   1 
ATOM   1960 C  CA  . PRO A 1 252 ? 18.539  31.257 34.802 1.00 3.84  ? 233  PRO A CA  1 
ATOM   1961 C  C   . PRO A 1 252 ? 19.362  32.381 35.409 1.00 3.75  ? 233  PRO A C   1 
ATOM   1962 O  O   . PRO A 1 252 ? 20.387  32.105 36.028 1.00 3.54  ? 233  PRO A O   1 
ATOM   1963 C  CB  . PRO A 1 252 ? 18.999  30.966 33.362 1.00 4.02  ? 233  PRO A CB  1 
ATOM   1964 C  CG  . PRO A 1 252 ? 17.770  31.100 32.462 1.00 4.54  ? 233  PRO A CG  1 
ATOM   1965 C  CD  . PRO A 1 252 ? 16.560  31.305 33.317 1.00 4.36  ? 233  PRO A CD  1 
ATOM   1966 N  N   . LEU A 1 253 ? 18.948  33.637 35.206 1.00 3.26  ? 234  LEU A N   1 
ATOM   1967 C  CA  . LEU A 1 253 ? 19.605  34.751 35.878 1.00 3.15  ? 234  LEU A CA  1 
ATOM   1968 C  C   . LEU A 1 253 ? 19.577  34.594 37.409 1.00 2.70  ? 234  LEU A C   1 
ATOM   1969 O  O   . LEU A 1 253 ? 20.621  34.645 38.052 1.00 3.17  ? 234  LEU A O   1 
ATOM   1970 C  CB  . LEU A 1 253 ? 19.022  36.119 35.424 1.00 3.26  ? 234  LEU A CB  1 
ATOM   1971 C  CG  . LEU A 1 253 ? 19.670  37.401 35.976 1.00 3.52  ? 234  LEU A CG  1 
ATOM   1972 C  CD1 . LEU A 1 253 ? 21.153  37.499 35.556 1.00 3.55  ? 234  LEU A CD1 1 
ATOM   1973 C  CD2 . LEU A 1 253 ? 18.885  38.667 35.536 1.00 2.75  ? 234  LEU A CD2 1 
ATOM   1974 N  N   . LEU A 1 254 ? 18.396  34.381 37.982 1.00 2.41  ? 235  LEU A N   1 
ATOM   1975 C  CA  . LEU A 1 254 ? 18.276  34.222 39.437 1.00 3.07  ? 235  LEU A CA  1 
ATOM   1976 C  C   . LEU A 1 254 ? 19.102  33.036 39.956 1.00 3.04  ? 235  LEU A C   1 
ATOM   1977 O  O   . LEU A 1 254 ? 19.865  33.186 40.910 1.00 2.25  ? 235  LEU A O   1 
ATOM   1978 C  CB  . LEU A 1 254 ? 16.811  34.067 39.871 1.00 3.27  ? 235  LEU A CB  1 
ATOM   1979 C  CG  . LEU A 1 254 ? 16.591  33.914 41.398 1.00 4.21  ? 235  LEU A CG  1 
ATOM   1980 C  CD1 . LEU A 1 254 ? 17.113  35.160 42.177 1.00 2.00  ? 235  LEU A CD1 1 
ATOM   1981 C  CD2 . LEU A 1 254 ? 15.110  33.719 41.683 1.00 3.06  ? 235  LEU A CD2 1 
ATOM   1982 N  N   . LEU A 1 255 ? 18.963  31.872 39.310 1.00 3.02  ? 236  LEU A N   1 
ATOM   1983 C  CA  . LEU A 1 255 ? 19.714  30.684 39.718 1.00 4.04  ? 236  LEU A CA  1 
ATOM   1984 C  C   . LEU A 1 255 ? 21.217  30.886 39.633 1.00 3.85  ? 236  LEU A C   1 
ATOM   1985 O  O   . LEU A 1 255 ? 21.954  30.410 40.502 1.00 3.19  ? 236  LEU A O   1 
ATOM   1986 C  CB  . LEU A 1 255 ? 19.310  29.431 38.909 1.00 4.18  ? 236  LEU A CB  1 
ATOM   1987 C  CG  . LEU A 1 255 ? 17.932  28.816 39.159 1.00 7.81  ? 236  LEU A CG  1 
ATOM   1988 C  CD1 . LEU A 1 255 ? 17.867  27.371 38.735 1.00 9.16  ? 236  LEU A CD1 1 
ATOM   1989 C  CD2 . LEU A 1 255 ? 17.541  28.894 40.581 1.00 6.71  ? 236  LEU A CD2 1 
ATOM   1990 N  N   . SER A 1 256 ? 21.681  31.576 38.588 1.00 3.90  ? 237  SER A N   1 
ATOM   1991 C  CA  . SER A 1 256 ? 23.110  31.812 38.464 1.00 4.62  ? 237  SER A CA  1 
ATOM   1992 C  C   . SER A 1 256 ? 23.596  32.774 39.557 1.00 4.29  ? 237  SER A C   1 
ATOM   1993 O  O   . SER A 1 256 ? 24.693  32.597 40.098 1.00 4.65  ? 237  SER A O   1 
ATOM   1994 C  CB  . SER A 1 256 ? 23.500  32.278 37.044 1.00 4.56  ? 237  SER A CB  1 
ATOM   1995 O  OG  . SER A 1 256 ? 22.953  33.556 36.764 1.00 9.08  ? 237  SER A OG  1 
ATOM   1996 N  N   . ARG A 1 257 ? 22.777  33.765 39.926 1.00 3.85  ? 238  ARG A N   1 
ATOM   1997 C  CA  . ARG A 1 257 ? 23.138  34.644 41.047 1.00 3.12  ? 238  ARG A CA  1 
ATOM   1998 C  C   . ARG A 1 257 ? 23.166  33.912 42.400 1.00 3.83  ? 238  ARG A C   1 
ATOM   1999 O  O   . ARG A 1 257 ? 24.079  34.131 43.228 1.00 2.20  ? 238  ARG A O   1 
ATOM   2000 C  CB  . ARG A 1 257 ? 22.239  35.876 41.101 1.00 3.21  ? 238  ARG A CB  1 
ATOM   2001 C  CG  . ARG A 1 257 ? 22.442  36.824 39.875 1.00 4.94  ? 238  ARG A CG  1 
ATOM   2002 C  CD  . ARG A 1 257 ? 21.332  37.855 39.801 1.00 9.66  ? 238  ARG A CD  1 
ATOM   2003 N  NE  . ARG A 1 257 ? 21.226  38.583 41.066 1.00 14.14 ? 238  ARG A NE  1 
ATOM   2004 C  CZ  . ARG A 1 257 ? 21.952  39.659 41.365 1.00 16.46 ? 238  ARG A CZ  1 
ATOM   2005 N  NH1 . ARG A 1 257 ? 22.810  40.143 40.470 1.00 15.28 ? 238  ARG A NH1 1 
ATOM   2006 N  NH2 . ARG A 1 257 ? 21.809  40.245 42.550 1.00 17.43 ? 238  ARG A NH2 1 
ATOM   2007 N  N   . MET A 1 258 ? 22.179  33.036 42.613 1.00 3.47  ? 239  MET A N   1 
ATOM   2008 C  CA  . MET A 1 258 ? 22.177  32.215 43.811 1.00 5.19  ? 239  MET A CA  1 
ATOM   2009 C  C   . MET A 1 258 ? 23.457  31.384 43.869 1.00 6.27  ? 239  MET A C   1 
ATOM   2010 O  O   . MET A 1 258 ? 24.048  31.254 44.920 1.00 4.79  ? 239  MET A O   1 
ATOM   2011 C  CB  . MET A 1 258 ? 20.953  31.300 43.848 1.00 4.50  ? 239  MET A CB  1 
ATOM   2012 C  CG  . MET A 1 258 ? 19.651  32.046 44.088 1.00 4.16  ? 239  MET A CG  1 
ATOM   2013 S  SD  . MET A 1 258 ? 18.280  30.888 43.910 1.00 4.11  ? 239  MET A SD  1 
ATOM   2014 C  CE  . MET A 1 258 ? 17.036  31.809 44.803 1.00 3.05  ? 239  MET A CE  1 
ATOM   2015 N  N   . LYS A 1 259 ? 23.884  30.839 42.721 1.00 8.03  ? 240  LYS A N   1 
ATOM   2016 C  CA  . LYS A 1 259 ? 25.066  29.969 42.698 1.00 10.36 ? 240  LYS A CA  1 
ATOM   2017 C  C   . LYS A 1 259 ? 26.389  30.720 42.950 1.00 10.93 ? 240  LYS A C   1 
ATOM   2018 O  O   . LYS A 1 259 ? 27.384  30.107 43.333 1.00 11.87 ? 240  LYS A O   1 
ATOM   2019 C  CB  . LYS A 1 259 ? 25.086  29.064 41.445 1.00 11.04 ? 240  LYS A CB  1 
ATOM   2020 C  CG  . LYS A 1 259 ? 25.882  27.756 41.643 1.00 16.34 ? 240  LYS A CG  1 
ATOM   2021 C  CD  . LYS A 1 259 ? 25.246  26.496 40.999 1.00 19.67 ? 240  LYS A CD  1 
ATOM   2022 C  CE  . LYS A 1 259 ? 26.026  26.078 39.761 1.00 22.64 ? 240  LYS A CE  1 
ATOM   2023 N  NZ  . LYS A 1 259 ? 26.867  24.883 40.046 1.00 24.88 ? 240  LYS A NZ  1 
ATOM   2024 N  N   . GLU A 1 260 ? 26.375  32.049 42.809 1.00 11.43 ? 241  GLU A N   1 
ATOM   2025 C  CA  . GLU A 1 260 ? 27.519  32.906 43.127 1.00 11.81 ? 241  GLU A CA  1 
ATOM   2026 C  C   . GLU A 1 260 ? 27.738  33.063 44.630 1.00 10.87 ? 241  GLU A C   1 
ATOM   2027 O  O   . GLU A 1 260 ? 28.856  33.316 45.083 1.00 11.03 ? 241  GLU A O   1 
ATOM   2028 C  CB  . GLU A 1 260 ? 27.352  34.309 42.496 1.00 11.83 ? 241  GLU A CB  1 
ATOM   2029 C  CG  . GLU A 1 260 ? 27.288  34.315 40.963 1.00 13.27 ? 241  GLU A CG  1 
ATOM   2030 C  CD  . GLU A 1 260 ? 26.843  35.676 40.343 1.00 15.40 ? 241  GLU A CD  1 
ATOM   2031 O  OE1 . GLU A 1 260 ? 26.894  36.746 41.023 1.00 18.38 ? 241  GLU A OE1 1 
ATOM   2032 O  OE2 . GLU A 1 260 ? 26.428  35.662 39.148 1.00 22.19 ? 241  GLU A OE2 1 
ATOM   2033 N  N   . VAL A 1 261 ? 26.672  32.951 45.414 1.00 10.11 ? 242  VAL A N   1 
ATOM   2034 C  CA  . VAL A 1 261 ? 26.800  33.110 46.877 1.00 8.53  ? 242  VAL A CA  1 
ATOM   2035 C  C   . VAL A 1 261 ? 26.522  31.830 47.647 1.00 7.58  ? 242  VAL A C   1 
ATOM   2036 O  O   . VAL A 1 261 ? 26.693  31.798 48.839 1.00 8.21  ? 242  VAL A O   1 
ATOM   2037 C  CB  . VAL A 1 261 ? 25.897  34.250 47.437 1.00 8.87  ? 242  VAL A CB  1 
ATOM   2038 C  CG1 . VAL A 1 261 ? 26.338  35.598 46.835 1.00 8.68  ? 242  VAL A CG1 1 
ATOM   2039 C  CG2 . VAL A 1 261 ? 24.377  33.956 47.181 1.00 6.22  ? 242  VAL A CG2 1 
ATOM   2040 N  N   . GLY A 1 262 ? 26.059  30.781 46.986 1.00 6.43  ? 243  GLY A N   1 
ATOM   2041 C  CA  . GLY A 1 262 ? 25.746  29.570 47.714 1.00 5.44  ? 243  GLY A CA  1 
ATOM   2042 C  C   . GLY A 1 262 ? 25.544  28.403 46.808 1.00 5.24  ? 243  GLY A C   1 
ATOM   2043 O  O   . GLY A 1 262 ? 25.894  28.459 45.636 1.00 5.75  ? 243  GLY A O   1 
ATOM   2044 N  N   . LYS A 1 263 ? 24.984  27.336 47.360 1.00 4.37  ? 244  LYS A N   1 
ATOM   2045 C  CA  . LYS A 1 263 ? 24.676  26.151 46.596 1.00 4.78  ? 244  LYS A CA  1 
ATOM   2046 C  C   . LYS A 1 263 ? 23.197  26.136 46.243 1.00 4.44  ? 244  LYS A C   1 
ATOM   2047 O  O   . LYS A 1 263 ? 22.370  26.756 46.932 1.00 4.56  ? 244  LYS A O   1 
ATOM   2048 C  CB  . LYS A 1 263 ? 25.100  24.900 47.382 1.00 5.59  ? 244  LYS A CB  1 
ATOM   2049 C  CG  . LYS A 1 263 ? 26.642  24.858 47.463 1.00 7.02  ? 244  LYS A CG  1 
ATOM   2050 C  CD  . LYS A 1 263 ? 27.085  23.786 48.337 1.00 10.90 ? 244  LYS A CD  1 
ATOM   2051 C  CE  . LYS A 1 263 ? 28.591  23.847 48.531 1.00 12.73 ? 244  LYS A CE  1 
ATOM   2052 N  NZ  . LYS A 1 263 ? 28.911  22.845 49.600 1.00 15.15 ? 244  LYS A NZ  1 
ATOM   2053 N  N   . VAL A 1 264 ? 22.891  25.469 45.139 1.00 3.89  ? 245  VAL A N   1 
ATOM   2054 C  CA  . VAL A 1 264 ? 21.544  25.402 44.592 1.00 3.22  ? 245  VAL A CA  1 
ATOM   2055 C  C   . VAL A 1 264 ? 21.181  23.944 44.401 1.00 2.50  ? 245  VAL A C   1 
ATOM   2056 O  O   . VAL A 1 264 ? 21.939  23.213 43.806 1.00 2.89  ? 245  VAL A O   1 
ATOM   2057 C  CB  . VAL A 1 264 ? 21.403  26.207 43.269 1.00 3.50  ? 245  VAL A CB  1 
ATOM   2058 C  CG1 . VAL A 1 264 ? 19.946  26.115 42.706 1.00 2.88  ? 245  VAL A CG1 1 
ATOM   2059 C  CG2 . VAL A 1 264 ? 21.807  27.688 43.503 1.00 2.52  ? 245  VAL A CG2 1 
ATOM   2060 N  N   . PHE A 1 265 ? 20.029  23.525 44.924 1.00 2.00  ? 246  PHE A N   1 
ATOM   2061 C  CA  . PHE A 1 265 ? 19.570  22.153 44.681 1.00 2.00  ? 246  PHE A CA  1 
ATOM   2062 C  C   . PHE A 1 265 ? 18.092  22.049 44.242 1.00 2.00  ? 246  PHE A C   1 
ATOM   2063 O  O   . PHE A 1 265 ? 17.291  22.963 44.464 1.00 2.00  ? 246  PHE A O   1 
ATOM   2064 C  CB  . PHE A 1 265 ? 19.869  21.234 45.880 1.00 2.00  ? 246  PHE A CB  1 
ATOM   2065 C  CG  . PHE A 1 265 ? 19.052  21.543 47.137 1.00 2.00  ? 246  PHE A CG  1 
ATOM   2066 C  CD1 . PHE A 1 265 ? 17.853  20.873 47.383 1.00 2.00  ? 246  PHE A CD1 1 
ATOM   2067 C  CD2 . PHE A 1 265 ? 19.508  22.483 48.076 1.00 2.00  ? 246  PHE A CD2 1 
ATOM   2068 C  CE1 . PHE A 1 265 ? 17.089  21.110 48.570 1.00 2.00  ? 246  PHE A CE1 1 
ATOM   2069 C  CE2 . PHE A 1 265 ? 18.776  22.731 49.278 1.00 2.00  ? 246  PHE A CE2 1 
ATOM   2070 C  CZ  . PHE A 1 265 ? 17.566  22.041 49.517 1.00 2.00  ? 246  PHE A CZ  1 
ATOM   2071 N  N   . LEU A 1 266 ? 17.786  20.921 43.613 1.00 2.00  ? 247  LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 266 ? 16.456  20.524 43.245 1.00 2.07  ? 247  LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 266 ? 16.089  19.286 44.065 1.00 2.51  ? 247  LEU A C   1 
ATOM   2074 O  O   . LEU A 1 266 ? 16.845  18.314 44.100 1.00 2.87  ? 247  LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 266 ? 16.391  20.187 41.727 1.00 2.00  ? 247  LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 266 ? 14.992  19.924 41.149 1.00 3.02  ? 247  LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 266 ? 14.109  21.200 41.170 1.00 2.78  ? 247  LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 266 ? 15.053  19.383 39.694 1.00 2.65  ? 247  LEU A CD2 1 
ATOM   2079 N  N   . ALA A 1 267 ? 14.934  19.333 44.728 1.00 2.09  ? 248  ALA A N   1 
ATOM   2080 C  CA  . ALA A 1 267 ? 14.390  18.175 45.411 1.00 3.14  ? 248  ALA A CA  1 
ATOM   2081 C  C   . ALA A 1 267 ? 12.907  18.108 45.037 1.00 3.11  ? 248  ALA A C   1 
ATOM   2082 O  O   . ALA A 1 267 ? 12.090  18.928 45.491 1.00 3.63  ? 248  ALA A O   1 
ATOM   2083 C  CB  . ALA A 1 267 ? 14.572  18.284 46.962 1.00 2.00  ? 248  ALA A CB  1 
ATOM   2084 N  N   . THR A 1 268 ? 12.568  17.162 44.173 1.00 2.71  ? 249  THR A N   1 
ATOM   2085 C  CA  . THR A 1 268 ? 11.232  17.159 43.557 1.00 2.25  ? 249  THR A CA  1 
ATOM   2086 C  C   . THR A 1 268 ? 10.602  15.771 43.645 1.00 2.00  ? 249  THR A C   1 
ATOM   2087 O  O   . THR A 1 268 ? 11.304  14.756 43.578 1.00 2.00  ? 249  THR A O   1 
ATOM   2088 C  CB  . THR A 1 268 ? 11.270  17.641 42.070 1.00 2.00  ? 249  THR A CB  1 
ATOM   2089 O  OG1 . THR A 1 268 ? 9.963   17.540 41.481 1.00 3.17  ? 249  THR A OG1 1 
ATOM   2090 C  CG2 . THR A 1 268 ? 12.258  16.820 41.204 1.00 2.00  ? 249  THR A CG2 1 
ATOM   2091 N  N   . ASN A 1 269 ? 9.280   15.723 43.741 1.00 2.00  ? 250  ASN A N   1 
ATOM   2092 C  CA  . ASN A 1 269 ? 8.597   14.426 43.779 1.00 2.14  ? 250  ASN A CA  1 
ATOM   2093 C  C   . ASN A 1 269 ? 8.491   13.813 42.399 1.00 2.31  ? 250  ASN A C   1 
ATOM   2094 O  O   . ASN A 1 269 ? 8.321   12.611 42.294 1.00 2.56  ? 250  ASN A O   1 
ATOM   2095 C  CB  . ASN A 1 269 ? 7.191   14.550 44.388 1.00 2.00  ? 250  ASN A CB  1 
ATOM   2096 C  CG  . ASN A 1 269 ? 7.217   14.697 45.907 1.00 2.82  ? 250  ASN A CG  1 
ATOM   2097 O  OD1 . ASN A 1 269 ? 8.264   14.555 46.539 1.00 2.42  ? 250  ASN A OD1 1 
ATOM   2098 N  ND2 . ASN A 1 269 ? 6.046   14.949 46.496 1.00 2.00  ? 250  ASN A ND2 1 
ATOM   2099 N  N   . SER A 1 270 ? 8.542   14.641 41.349 1.00 2.06  ? 251  SER A N   1 
ATOM   2100 C  CA  . SER A 1 270 ? 8.539   14.135 39.959 1.00 2.11  ? 251  SER A CA  1 
ATOM   2101 C  C   . SER A 1 270 ? 9.725   13.197 39.657 1.00 2.47  ? 251  SER A C   1 
ATOM   2102 O  O   . SER A 1 270 ? 10.773  13.264 40.327 1.00 2.09  ? 251  SER A O   1 
ATOM   2103 C  CB  . SER A 1 270 ? 8.541   15.307 38.972 1.00 2.45  ? 251  SER A CB  1 
ATOM   2104 O  OG  . SER A 1 270 ? 9.657   16.148 39.223 1.00 2.33  ? 251  SER A OG  1 
ATOM   2105 N  N   . ASP A 1 271 ? 9.537   12.306 38.679 1.00 2.04  ? 252  ASP A N   1 
ATOM   2106 C  CA  . ASP A 1 271 ? 10.587  11.397 38.254 1.00 2.44  ? 252  ASP A CA  1 
ATOM   2107 C  C   . ASP A 1 271 ? 11.577  12.046 37.274 1.00 2.00  ? 252  ASP A C   1 
ATOM   2108 O  O   . ASP A 1 271 ? 11.362  13.174 36.794 1.00 2.00  ? 252  ASP A O   1 
ATOM   2109 C  CB  . ASP A 1 271 ? 10.010  10.047 37.710 1.00 3.09  ? 252  ASP A CB  1 
ATOM   2110 C  CG  . ASP A 1 271 ? 9.341   10.160 36.304 1.00 7.20  ? 252  ASP A CG  1 
ATOM   2111 O  OD1 . ASP A 1 271 ? 9.616   11.076 35.507 1.00 8.65  ? 252  ASP A OD1 1 
ATOM   2112 O  OD2 . ASP A 1 271 ? 8.523   9.266  35.968 1.00 14.09 ? 252  ASP A OD2 1 
ATOM   2113 N  N   . TYR A 1 272 ? 12.676  11.348 36.998 1.00 2.00  ? 253  TYR A N   1 
ATOM   2114 C  CA  . TYR A 1 272 ? 13.710  11.959 36.170 1.00 2.02  ? 253  TYR A CA  1 
ATOM   2115 C  C   . TYR A 1 272 ? 13.259  12.378 34.766 1.00 2.00  ? 253  TYR A C   1 
ATOM   2116 O  O   . TYR A 1 272 ? 13.578  13.466 34.330 1.00 2.35  ? 253  TYR A O   1 
ATOM   2117 C  CB  . TYR A 1 272 ? 14.997  11.130 36.084 1.00 2.08  ? 253  TYR A CB  1 
ATOM   2118 C  CG  . TYR A 1 272 ? 16.063  11.929 35.357 1.00 2.00  ? 253  TYR A CG  1 
ATOM   2119 C  CD1 . TYR A 1 272 ? 16.675  13.029 35.972 1.00 3.32  ? 253  TYR A CD1 1 
ATOM   2120 C  CD2 . TYR A 1 272 ? 16.411  11.626 34.031 1.00 2.00  ? 253  TYR A CD2 1 
ATOM   2121 C  CE1 . TYR A 1 272 ? 17.637  13.797 35.291 1.00 2.35  ? 253  TYR A CE1 1 
ATOM   2122 C  CE2 . TYR A 1 272 ? 17.380  12.381 33.342 1.00 2.50  ? 253  TYR A CE2 1 
ATOM   2123 C  CZ  . TYR A 1 272 ? 17.983  13.462 33.990 1.00 3.20  ? 253  TYR A CZ  1 
ATOM   2124 O  OH  . TYR A 1 272 ? 18.921  14.221 33.315 1.00 4.06  ? 253  TYR A OH  1 
ATOM   2125 N  N   . LYS A 1 273 ? 12.545  11.511 34.055 1.00 2.22  ? 254  LYS A N   1 
ATOM   2126 C  CA  . LYS A 1 273 ? 12.179  11.774 32.634 1.00 3.16  ? 254  LYS A CA  1 
ATOM   2127 C  C   . LYS A 1 273 ? 11.277  12.988 32.494 1.00 2.34  ? 254  LYS A C   1 
ATOM   2128 O  O   . LYS A 1 273 ? 11.524  13.839 31.649 1.00 2.42  ? 254  LYS A O   1 
ATOM   2129 C  CB  . LYS A 1 273 ? 11.514  10.556 31.979 1.00 2.63  ? 254  LYS A CB  1 
ATOM   2130 C  CG  . LYS A 1 273 ? 12.531  9.610  31.394 1.00 8.63  ? 254  LYS A CG  1 
ATOM   2131 C  CD  . LYS A 1 273 ? 11.966  8.233  31.164 1.00 16.62 ? 254  LYS A CD  1 
ATOM   2132 C  CE  . LYS A 1 273 ? 12.792  7.468  30.144 1.00 19.30 ? 254  LYS A CE  1 
ATOM   2133 N  NZ  . LYS A 1 273 ? 12.161  6.100  29.984 1.00 23.84 ? 254  LYS A NZ  1 
ATOM   2134 N  N   . TYR A 1 274 ? 10.266  13.072 33.352 1.00 2.00  ? 255  TYR A N   1 
ATOM   2135 C  CA  . TYR A 1 274 ? 9.371   14.228 33.386 1.00 2.43  ? 255  TYR A CA  1 
ATOM   2136 C  C   . TYR A 1 274 ? 10.064  15.524 33.849 1.00 2.17  ? 255  TYR A C   1 
ATOM   2137 O  O   . TYR A 1 274 ? 9.882   16.605 33.262 1.00 2.10  ? 255  TYR A O   1 
ATOM   2138 C  CB  . TYR A 1 274 ? 8.146   13.928 34.270 1.00 2.00  ? 255  TYR A CB  1 
ATOM   2139 C  CG  . TYR A 1 274 ? 7.099   15.036 34.161 1.00 2.41  ? 255  TYR A CG  1 
ATOM   2140 C  CD1 . TYR A 1 274 ? 6.372   15.214 32.965 1.00 2.00  ? 255  TYR A CD1 1 
ATOM   2141 C  CD2 . TYR A 1 274 ? 6.863   15.923 35.229 1.00 2.00  ? 255  TYR A CD2 1 
ATOM   2142 C  CE1 . TYR A 1 274 ? 5.415   16.215 32.844 1.00 2.00  ? 255  TYR A CE1 1 
ATOM   2143 C  CE2 . TYR A 1 274 ? 5.886   16.932 35.119 1.00 2.00  ? 255  TYR A CE2 1 
ATOM   2144 C  CZ  . TYR A 1 274 ? 5.177   17.068 33.912 1.00 2.00  ? 255  TYR A CZ  1 
ATOM   2145 O  OH  . TYR A 1 274 ? 4.216   18.059 33.758 1.00 2.33  ? 255  TYR A OH  1 
ATOM   2146 N  N   . THR A 1 275 ? 10.868  15.412 34.903 1.00 2.64  ? 256  THR A N   1 
ATOM   2147 C  CA  . THR A 1 275 ? 11.694  16.546 35.365 1.00 2.92  ? 256  THR A CA  1 
ATOM   2148 C  C   . THR A 1 275 ? 12.604  17.070 34.221 1.00 2.93  ? 256  THR A C   1 
ATOM   2149 O  O   . THR A 1 275 ? 12.706  18.275 33.992 1.00 2.85  ? 256  THR A O   1 
ATOM   2150 C  CB  . THR A 1 275 ? 12.586  16.145 36.578 1.00 2.53  ? 256  THR A CB  1 
ATOM   2151 O  OG1 . THR A 1 275 ? 11.791  15.553 37.613 1.00 3.74  ? 256  THR A OG1 1 
ATOM   2152 C  CG2 . THR A 1 275 ? 13.355  17.343 37.125 1.00 2.53  ? 256  THR A CG2 1 
ATOM   2153 N  N   . ASP A 1 276 ? 13.292  16.152 33.538 1.00 2.56  ? 257  ASP A N   1 
ATOM   2154 C  CA  . ASP A 1 276 ? 14.165  16.536 32.412 1.00 2.60  ? 257  ASP A CA  1 
ATOM   2155 C  C   . ASP A 1 276 ? 13.388  17.285 31.280 1.00 3.12  ? 257  ASP A C   1 
ATOM   2156 O  O   . ASP A 1 276 ? 13.838  18.357 30.825 1.00 3.00  ? 257  ASP A O   1 
ATOM   2157 C  CB  . ASP A 1 276 ? 14.916  15.299 31.890 1.00 2.00  ? 257  ASP A CB  1 
ATOM   2158 C  CG  . ASP A 1 276 ? 16.015  15.640 30.866 1.00 2.93  ? 257  ASP A CG  1 
ATOM   2159 O  OD1 . ASP A 1 276 ? 16.529  16.777 30.827 1.00 3.11  ? 257  ASP A OD1 1 
ATOM   2160 O  OD2 . ASP A 1 276 ? 16.401  14.724 30.101 1.00 6.99  ? 257  ASP A OD2 1 
ATOM   2161 N  N   . LYS A 1 277 ? 12.224  16.757 30.872 1.00 2.54  ? 258  LYS A N   1 
ATOM   2162 C  CA  . LYS A 1 277 ? 11.380  17.443 29.861 1.00 3.61  ? 258  LYS A CA  1 
ATOM   2163 C  C   . LYS A 1 277 ? 10.933  18.841 30.271 1.00 2.71  ? 258  LYS A C   1 
ATOM   2164 O  O   . LYS A 1 277 ? 11.059  19.784 29.495 1.00 2.68  ? 258  LYS A O   1 
ATOM   2165 C  CB  . LYS A 1 277 ? 10.150  16.613 29.485 1.00 3.53  ? 258  LYS A CB  1 
ATOM   2166 C  CG  . LYS A 1 277 ? 10.548  15.304 28.848 1.00 10.33 ? 258  LYS A CG  1 
ATOM   2167 C  CD  . LYS A 1 277 ? 9.551   14.806 27.823 1.00 19.24 ? 258  LYS A CD  1 
ATOM   2168 C  CE  . LYS A 1 277 ? 8.738   13.637 28.377 1.00 24.46 ? 258  LYS A CE  1 
ATOM   2169 N  NZ  . LYS A 1 277 ? 9.543   12.348 28.557 1.00 27.27 ? 258  LYS A NZ  1 
ATOM   2170 N  N   . ILE A 1 278 ? 10.399  18.960 31.487 1.00 2.48  ? 259  ILE A N   1 
ATOM   2171 C  CA  . ILE A 1 278 ? 9.925   20.253 32.000 1.00 2.06  ? 259  ILE A CA  1 
ATOM   2172 C  C   . ILE A 1 278 ? 11.063  21.235 32.172 1.00 2.11  ? 259  ILE A C   1 
ATOM   2173 O  O   . ILE A 1 278 ? 10.979  22.362 31.687 1.00 2.14  ? 259  ILE A O   1 
ATOM   2174 C  CB  . ILE A 1 278 ? 9.147   20.101 33.332 1.00 2.00  ? 259  ILE A CB  1 
ATOM   2175 C  CG1 . ILE A 1 278 ? 7.874   19.269 33.106 1.00 2.00  ? 259  ILE A CG1 1 
ATOM   2176 C  CG2 . ILE A 1 278 ? 8.788   21.500 33.916 1.00 2.00  ? 259  ILE A CG2 1 
ATOM   2177 C  CD1 . ILE A 1 278 ? 6.975   19.759 31.944 1.00 2.00  ? 259  ILE A CD1 1 
ATOM   2178 N  N   . MET A 1 279 ? 12.109  20.800 32.881 1.00 2.00  ? 260  MET A N   1 
ATOM   2179 C  CA  . MET A 1 279 ? 13.270  21.629 33.114 1.00 2.00  ? 260  MET A CA  1 
ATOM   2180 C  C   . MET A 1 279 ? 13.981  22.073 31.835 1.00 2.54  ? 260  MET A C   1 
ATOM   2181 O  O   . MET A 1 279 ? 14.391  23.231 31.732 1.00 3.28  ? 260  MET A O   1 
ATOM   2182 C  CB  . MET A 1 279 ? 14.230  20.956 34.093 1.00 2.00  ? 260  MET A CB  1 
ATOM   2183 C  CG  . MET A 1 279 ? 13.670  20.781 35.511 1.00 2.06  ? 260  MET A CG  1 
ATOM   2184 S  SD  . MET A 1 279 ? 13.345  22.295 36.443 1.00 3.71  ? 260  MET A SD  1 
ATOM   2185 C  CE  . MET A 1 279 ? 15.016  22.889 36.822 1.00 2.00  ? 260  MET A CE  1 
ATOM   2186 N  N   . THR A 1 280 ? 14.107  21.187 30.843 1.00 2.88  ? 261  THR A N   1 
ATOM   2187 C  CA  . THR A 1 280 ? 14.682  21.608 29.549 1.00 2.19  ? 261  THR A CA  1 
ATOM   2188 C  C   . THR A 1 280 ? 13.905  22.763 28.941 1.00 2.57  ? 261  THR A C   1 
ATOM   2189 O  O   . THR A 1 280 ? 14.494  23.745 28.469 1.00 2.85  ? 261  THR A O   1 
ATOM   2190 C  CB  . THR A 1 280 ? 14.727  20.430 28.588 1.00 2.00  ? 261  THR A CB  1 
ATOM   2191 O  OG1 . THR A 1 280 ? 15.497  19.396 29.207 1.00 2.00  ? 261  THR A OG1 1 
ATOM   2192 C  CG2 . THR A 1 280 ? 15.337  20.820 27.184 1.00 2.00  ? 261  THR A CG2 1 
ATOM   2193 N  N   . TYR A 1 281 ? 12.578  22.641 28.956 1.00 2.99  ? 262  TYR A N   1 
ATOM   2194 C  CA  . TYR A 1 281 ? 11.696  23.678 28.457 1.00 3.26  ? 262  TYR A CA  1 
ATOM   2195 C  C   . TYR A 1 281 ? 11.861  24.981 29.245 1.00 3.65  ? 262  TYR A C   1 
ATOM   2196 O  O   . TYR A 1 281 ? 11.927  26.050 28.654 1.00 3.45  ? 262  TYR A O   1 
ATOM   2197 C  CB  . TYR A 1 281 ? 10.231  23.216 28.491 1.00 3.64  ? 262  TYR A CB  1 
ATOM   2198 C  CG  . TYR A 1 281 ? 9.221   24.326 28.199 1.00 3.44  ? 262  TYR A CG  1 
ATOM   2199 C  CD1 . TYR A 1 281 ? 8.951   24.757 26.884 1.00 3.38  ? 262  TYR A CD1 1 
ATOM   2200 C  CD2 . TYR A 1 281 ? 8.563   24.961 29.252 1.00 3.12  ? 262  TYR A CD2 1 
ATOM   2201 C  CE1 . TYR A 1 281 ? 8.018   25.803 26.642 1.00 3.78  ? 262  TYR A CE1 1 
ATOM   2202 C  CE2 . TYR A 1 281 ? 7.645   25.981 29.021 1.00 2.58  ? 262  TYR A CE2 1 
ATOM   2203 C  CZ  . TYR A 1 281 ? 7.372   26.377 27.746 1.00 4.14  ? 262  TYR A CZ  1 
ATOM   2204 O  OH  . TYR A 1 281 ? 6.456   27.385 27.617 1.00 8.70  ? 262  TYR A OH  1 
ATOM   2205 N  N   . LEU A 1 282 ? 11.926  24.894 30.570 1.00 3.50  ? 263  LEU A N   1 
ATOM   2206 C  CA  . LEU A 1 282 ? 12.095  26.101 31.394 1.00 3.11  ? 263  LEU A CA  1 
ATOM   2207 C  C   . LEU A 1 282 ? 13.381  26.864 31.101 1.00 2.89  ? 263  LEU A C   1 
ATOM   2208 O  O   . LEU A 1 282 ? 13.441  28.061 31.330 1.00 3.80  ? 263  LEU A O   1 
ATOM   2209 C  CB  . LEU A 1 282 ? 12.037  25.758 32.879 1.00 2.64  ? 263  LEU A CB  1 
ATOM   2210 C  CG  . LEU A 1 282 ? 10.655  25.307 33.381 1.00 3.58  ? 263  LEU A CG  1 
ATOM   2211 C  CD1 . LEU A 1 282 ? 10.786  24.943 34.856 1.00 3.18  ? 263  LEU A CD1 1 
ATOM   2212 C  CD2 . LEU A 1 282 ? 9.603   26.397 33.174 1.00 2.98  ? 263  LEU A CD2 1 
ATOM   2213 N  N   . PHE A 1 283 ? 14.402  26.176 30.606 1.00 2.40  ? 264  PHE A N   1 
ATOM   2214 C  CA  . PHE A 1 283 ? 15.663  26.828 30.263 1.00 2.91  ? 264  PHE A CA  1 
ATOM   2215 C  C   . PHE A 1 283 ? 15.867  27.049 28.760 1.00 3.27  ? 264  PHE A C   1 
ATOM   2216 O  O   . PHE A 1 283 ? 16.962  27.444 28.330 1.00 2.64  ? 264  PHE A O   1 
ATOM   2217 C  CB  . PHE A 1 283 ? 16.849  26.061 30.866 1.00 2.30  ? 264  PHE A CB  1 
ATOM   2218 C  CG  . PHE A 1 283 ? 16.968  26.233 32.367 1.00 2.96  ? 264  PHE A CG  1 
ATOM   2219 C  CD1 . PHE A 1 283 ? 17.937  27.074 32.901 1.00 2.00  ? 264  PHE A CD1 1 
ATOM   2220 C  CD2 . PHE A 1 283 ? 16.084  25.568 33.239 1.00 2.00  ? 264  PHE A CD2 1 
ATOM   2221 C  CE1 . PHE A 1 283 ? 18.042  27.253 34.295 1.00 2.00  ? 264  PHE A CE1 1 
ATOM   2222 C  CE2 . PHE A 1 283 ? 16.198  25.717 34.622 1.00 3.27  ? 264  PHE A CE2 1 
ATOM   2223 C  CZ  . PHE A 1 283 ? 17.189  26.578 35.148 1.00 2.61  ? 264  PHE A CZ  1 
ATOM   2224 N  N   . ASP A 1 284 ? 14.819  26.796 27.970 1.00 3.17  ? 265  ASP A N   1 
ATOM   2225 C  CA  . ASP A 1 284 ? 14.990  26.780 26.527 1.00 4.14  ? 265  ASP A CA  1 
ATOM   2226 C  C   . ASP A 1 284 ? 14.851  28.189 25.959 1.00 4.25  ? 265  ASP A C   1 
ATOM   2227 O  O   . ASP A 1 284 ? 13.760  28.615 25.547 1.00 3.73  ? 265  ASP A O   1 
ATOM   2228 C  CB  . ASP A 1 284 ? 14.037  25.780 25.865 1.00 4.40  ? 265  ASP A CB  1 
ATOM   2229 C  CG  . ASP A 1 284 ? 14.075  25.835 24.309 1.00 8.33  ? 265  ASP A CG  1 
ATOM   2230 O  OD1 . ASP A 1 284 ? 15.151  26.085 23.689 1.00 9.15  ? 265  ASP A OD1 1 
ATOM   2231 O  OD2 . ASP A 1 284 ? 12.994  25.604 23.720 1.00 13.41 ? 265  ASP A OD2 1 
ATOM   2232 N  N   . PHE A 1 285 ? 15.979  28.892 25.967 1.00 3.45  ? 266  PHE A N   1 
ATOM   2233 C  CA  . PHE A 1 285 ? 16.114  30.245 25.440 1.00 3.50  ? 266  PHE A CA  1 
ATOM   2234 C  C   . PHE A 1 285 ? 17.390  30.217 24.609 1.00 3.74  ? 266  PHE A C   1 
ATOM   2235 O  O   . PHE A 1 285 ? 18.206  29.317 24.788 1.00 2.70  ? 266  PHE A O   1 
ATOM   2236 C  CB  . PHE A 1 285 ? 16.269  31.275 26.578 1.00 2.95  ? 266  PHE A CB  1 
ATOM   2237 C  CG  . PHE A 1 285 ? 15.046  31.360 27.473 1.00 4.86  ? 266  PHE A CG  1 
ATOM   2238 C  CD1 . PHE A 1 285 ? 13.954  32.142 27.104 1.00 4.57  ? 266  PHE A CD1 1 
ATOM   2239 C  CD2 . PHE A 1 285 ? 14.977  30.634 28.647 1.00 3.44  ? 266  PHE A CD2 1 
ATOM   2240 C  CE1 . PHE A 1 285 ? 12.830  32.168 27.883 1.00 2.91  ? 266  PHE A CE1 1 
ATOM   2241 C  CE2 . PHE A 1 285 ? 13.843  30.681 29.439 1.00 2.98  ? 266  PHE A CE2 1 
ATOM   2242 C  CZ  . PHE A 1 285 ? 12.781  31.437 29.047 1.00 2.00  ? 266  PHE A CZ  1 
ATOM   2243 N  N   . PRO A 1 286 ? 17.560  31.196 23.691 1.00 4.12  ? 267  PRO A N   1 
ATOM   2244 C  CA  . PRO A 1 286 ? 18.807  31.179 22.926 1.00 5.03  ? 267  PRO A CA  1 
ATOM   2245 C  C   . PRO A 1 286 ? 19.987  31.758 23.719 1.00 6.08  ? 267  PRO A C   1 
ATOM   2246 O  O   . PRO A 1 286 ? 20.934  32.260 23.121 1.00 9.46  ? 267  PRO A O   1 
ATOM   2247 C  CB  . PRO A 1 286 ? 18.482  32.034 21.683 1.00 5.08  ? 267  PRO A CB  1 
ATOM   2248 C  CG  . PRO A 1 286 ? 17.240  32.825 22.014 1.00 4.38  ? 267  PRO A CG  1 
ATOM   2249 C  CD  . PRO A 1 286 ? 16.654  32.302 23.310 1.00 3.22  ? 267  PRO A CD  1 
ATOM   2250 N  N   . HIS A 1 287 ? 19.920  31.737 25.038 1.00 5.46  ? 268  HIS A N   1 
ATOM   2251 C  CA  . HIS A 1 287 ? 20.952  32.348 25.874 1.00 5.15  ? 268  HIS A CA  1 
ATOM   2252 C  C   . HIS A 1 287 ? 20.953  31.593 27.176 1.00 4.10  ? 268  HIS A C   1 
ATOM   2253 O  O   . HIS A 1 287 ? 20.044  30.798 27.426 1.00 3.73  ? 268  HIS A O   1 
ATOM   2254 C  CB  . HIS A 1 287 ? 20.697  33.865 26.104 1.00 4.78  ? 268  HIS A CB  1 
ATOM   2255 C  CG  . HIS A 1 287 ? 19.376  34.180 26.752 1.00 5.86  ? 268  HIS A CG  1 
ATOM   2256 N  ND1 . HIS A 1 287 ? 19.112  33.916 28.081 1.00 9.63  ? 268  HIS A ND1 1 
ATOM   2257 C  CD2 . HIS A 1 287 ? 18.252  34.751 26.256 1.00 7.28  ? 268  HIS A CD2 1 
ATOM   2258 C  CE1 . HIS A 1 287 ? 17.882  34.302 28.378 1.00 9.23  ? 268  HIS A CE1 1 
ATOM   2259 N  NE2 . HIS A 1 287 ? 17.339  34.812 27.287 1.00 8.82  ? 268  HIS A NE2 1 
ATOM   2260 N  N   . GLY A 1 288 ? 21.963  31.844 28.009 1.00 4.34  ? 269  GLY A N   1 
ATOM   2261 C  CA  . GLY A 1 288 ? 22.028  31.262 29.344 1.00 3.82  ? 269  GLY A CA  1 
ATOM   2262 C  C   . GLY A 1 288 ? 21.438  32.267 30.324 1.00 4.70  ? 269  GLY A C   1 
ATOM   2263 O  O   . GLY A 1 288 ? 20.357  32.804 30.066 1.00 5.18  ? 269  GLY A O   1 
ATOM   2264 N  N   . PRO A 1 289 ? 22.182  32.614 31.394 1.00 4.64  ? 270  PRO A N   1 
ATOM   2265 C  CA  . PRO A 1 289 ? 21.642  33.490 32.460 1.00 4.66  ? 270  PRO A CA  1 
ATOM   2266 C  C   . PRO A 1 289 ? 21.103  34.793 31.927 1.00 5.51  ? 270  PRO A C   1 
ATOM   2267 O  O   . PRO A 1 289 ? 20.035  35.225 32.343 1.00 6.59  ? 270  PRO A O   1 
ATOM   2268 C  CB  . PRO A 1 289 ? 22.837  33.734 33.383 1.00 3.35  ? 270  PRO A CB  1 
ATOM   2269 C  CG  . PRO A 1 289 ? 23.665  32.545 33.254 1.00 6.12  ? 270  PRO A CG  1 
ATOM   2270 C  CD  . PRO A 1 289 ? 23.562  32.198 31.692 1.00 4.98  ? 270  PRO A CD  1 
ATOM   2271 N  N   . LYS A 1 290 ? 21.825  35.423 31.008 1.00 5.84  ? 271  LYS A N   1 
ATOM   2272 C  CA  . LYS A 1 290 ? 21.345  36.672 30.419 1.00 6.24  ? 271  LYS A CA  1 
ATOM   2273 C  C   . LYS A 1 290 ? 21.463  36.663 28.917 1.00 4.64  ? 271  LYS A C   1 
ATOM   2274 O  O   . LYS A 1 290 ? 22.258  35.887 28.363 1.00 4.17  ? 271  LYS A O   1 
ATOM   2275 C  CB  . LYS A 1 290 ? 22.069  37.877 31.019 1.00 7.19  ? 271  LYS A CB  1 
ATOM   2276 C  CG  . LYS A 1 290 ? 23.559  37.835 30.882 1.00 12.03 ? 271  LYS A CG  1 
ATOM   2277 C  CD  . LYS A 1 290 ? 24.243  38.881 31.798 1.00 17.78 ? 271  LYS A CD  1 
ATOM   2278 C  CE  . LYS A 1 290 ? 25.768  38.903 31.443 1.00 19.48 ? 271  LYS A CE  1 
ATOM   2279 N  NZ  . LYS A 1 290 ? 26.589  39.893 32.231 1.00 15.07 ? 271  LYS A NZ  1 
ATOM   2280 N  N   . PRO A 1 291 ? 20.647  37.495 28.234 1.00 4.25  ? 272  PRO A N   1 
ATOM   2281 C  CA  . PRO A 1 291 ? 20.805  37.623 26.791 1.00 2.85  ? 272  PRO A CA  1 
ATOM   2282 C  C   . PRO A 1 291 ? 22.269  37.894 26.386 1.00 2.49  ? 272  PRO A C   1 
ATOM   2283 O  O   . PRO A 1 291 ? 22.980  38.677 27.062 1.00 2.02  ? 272  PRO A O   1 
ATOM   2284 C  CB  . PRO A 1 291 ? 19.872  38.789 26.433 1.00 2.92  ? 272  PRO A CB  1 
ATOM   2285 C  CG  . PRO A 1 291 ? 18.835  38.795 27.493 1.00 3.06  ? 272  PRO A CG  1 
ATOM   2286 C  CD  . PRO A 1 291 ? 19.515  38.309 28.743 1.00 4.33  ? 272  PRO A CD  1 
ATOM   2287 N  N   . GLY A 1 292 ? 22.710  37.225 25.315 1.00 2.00  ? 273  GLY A N   1 
ATOM   2288 C  CA  . GLY A 1 292 ? 24.116  37.290 24.879 1.00 2.00  ? 273  GLY A CA  1 
ATOM   2289 C  C   . GLY A 1 292 ? 25.059  36.207 25.410 1.00 2.00  ? 273  GLY A C   1 
ATOM   2290 O  O   . GLY A 1 292 ? 26.134  35.972 24.842 1.00 2.00  ? 273  GLY A O   1 
ATOM   2291 N  N   . SER A 1 293 ? 24.662  35.533 26.486 1.00 2.00  ? 274  SER A N   1 
ATOM   2292 C  CA  . SER A 1 293 ? 25.483  34.465 27.085 1.00 2.00  ? 274  SER A CA  1 
ATOM   2293 C  C   . SER A 1 293 ? 25.138  33.104 26.479 1.00 2.00  ? 274  SER A C   1 
ATOM   2294 O  O   . SER A 1 293 ? 23.992  32.892 26.094 1.00 2.00  ? 274  SER A O   1 
ATOM   2295 C  CB  . SER A 1 293 ? 25.312  34.440 28.619 1.00 2.00  ? 274  SER A CB  1 
ATOM   2296 O  OG  . SER A 1 293 ? 24.017  33.958 28.950 1.00 2.00  ? 274  SER A OG  1 
ATOM   2297 N  N   . SER A 1 294 ? 26.112  32.192 26.382 1.00 2.00  ? 275  SER A N   1 
ATOM   2298 C  CA  . SER A 1 294 ? 25.826  30.841 25.871 1.00 2.00  ? 275  SER A CA  1 
ATOM   2299 C  C   . SER A 1 294 ? 24.761  30.127 26.721 1.00 2.00  ? 275  SER A C   1 
ATOM   2300 O  O   . SER A 1 294 ? 24.773  30.201 27.959 1.00 2.00  ? 275  SER A O   1 
ATOM   2301 C  CB  . SER A 1 294 ? 27.089  29.962 25.843 1.00 2.00  ? 275  SER A CB  1 
ATOM   2302 O  OG  . SER A 1 294 ? 28.115  30.539 25.076 1.00 2.00  ? 275  SER A OG  1 
ATOM   2303 N  N   . HIS A 1 295 ? 23.833  29.461 26.043 1.00 2.00  ? 276  HIS A N   1 
ATOM   2304 C  CA  . HIS A 1 295 ? 22.906  28.572 26.694 1.00 2.00  ? 276  HIS A CA  1 
ATOM   2305 C  C   . HIS A 1 295 ? 23.705  27.460 27.423 1.00 2.46  ? 276  HIS A C   1 
ATOM   2306 O  O   . HIS A 1 295 ? 24.722  26.940 26.899 1.00 2.61  ? 276  HIS A O   1 
ATOM   2307 C  CB  . HIS A 1 295 ? 21.955  27.950 25.655 1.00 2.48  ? 276  HIS A CB  1 
ATOM   2308 C  CG  . HIS A 1 295 ? 20.963  26.994 26.255 1.00 2.04  ? 276  HIS A CG  1 
ATOM   2309 N  ND1 . HIS A 1 295 ? 21.228  25.654 26.413 1.00 2.53  ? 276  HIS A ND1 1 
ATOM   2310 C  CD2 . HIS A 1 295 ? 19.720  27.195 26.758 1.00 2.00  ? 276  HIS A CD2 1 
ATOM   2311 C  CE1 . HIS A 1 295 ? 20.195  25.070 27.007 1.00 6.32  ? 276  HIS A CE1 1 
ATOM   2312 N  NE2 . HIS A 1 295 ? 19.254  25.981 27.200 1.00 3.53  ? 276  HIS A NE2 1 
ATOM   2313 N  N   . ARG A 1 296 ? 23.249  27.110 28.623 1.00 2.76  ? 277  ARG A N   1 
ATOM   2314 C  CA  . ARG A 1 296 ? 23.760  25.941 29.364 1.00 3.64  ? 277  ARG A CA  1 
ATOM   2315 C  C   . ARG A 1 296 ? 22.591  25.018 29.746 1.00 3.57  ? 277  ARG A C   1 
ATOM   2316 O  O   . ARG A 1 296 ? 21.474  25.508 30.013 1.00 2.73  ? 277  ARG A O   1 
ATOM   2317 C  CB  . ARG A 1 296 ? 24.390  26.345 30.708 1.00 4.21  ? 277  ARG A CB  1 
ATOM   2318 C  CG  . ARG A 1 296 ? 24.849  27.756 30.907 1.00 7.54  ? 277  ARG A CG  1 
ATOM   2319 C  CD  . ARG A 1 296 ? 25.916  27.745 31.949 1.00 10.34 ? 277  ARG A CD  1 
ATOM   2320 N  NE  . ARG A 1 296 ? 25.776  28.821 32.904 1.00 14.43 ? 277  ARG A NE  1 
ATOM   2321 C  CZ  . ARG A 1 296 ? 25.407  28.666 34.181 1.00 18.12 ? 277  ARG A CZ  1 
ATOM   2322 N  NH1 . ARG A 1 296 ? 25.108  27.452 34.714 1.00 14.68 ? 277  ARG A NH1 1 
ATOM   2323 N  NH2 . ARG A 1 296 ? 25.348  29.762 34.940 1.00 16.69 ? 277  ARG A NH2 1 
ATOM   2324 N  N   . PRO A 1 297 ? 22.862  23.704 29.861 1.00 3.60  ? 278  PRO A N   1 
ATOM   2325 C  CA  . PRO A 1 297 ? 21.827  22.740 30.269 1.00 3.83  ? 278  PRO A CA  1 
ATOM   2326 C  C   . PRO A 1 297 ? 21.294  23.084 31.651 1.00 3.23  ? 278  PRO A C   1 
ATOM   2327 O  O   . PRO A 1 297 ? 22.040  23.582 32.521 1.00 3.33  ? 278  PRO A O   1 
ATOM   2328 C  CB  . PRO A 1 297 ? 22.570  21.397 30.319 1.00 3.28  ? 278  PRO A CB  1 
ATOM   2329 C  CG  . PRO A 1 297 ? 23.790  21.573 29.548 1.00 5.25  ? 278  PRO A CG  1 
ATOM   2330 C  CD  . PRO A 1 297 ? 24.158  23.049 29.602 1.00 4.72  ? 278  PRO A CD  1 
ATOM   2331 N  N   . TRP A 1 298 ? 20.014  22.823 31.853 1.00 3.28  ? 279  TRP A N   1 
ATOM   2332 C  CA  . TRP A 1 298 ? 19.389  23.057 33.128 1.00 2.58  ? 279  TRP A CA  1 
ATOM   2333 C  C   . TRP A 1 298 ? 20.156  22.427 34.288 1.00 2.72  ? 279  TRP A C   1 
ATOM   2334 O  O   . TRP A 1 298 ? 20.243  23.033 35.350 1.00 2.47  ? 279  TRP A O   1 
ATOM   2335 C  CB  . TRP A 1 298 ? 17.918  22.637 33.129 1.00 2.56  ? 279  TRP A CB  1 
ATOM   2336 C  CG  . TRP A 1 298 ? 17.624  21.157 33.157 1.00 2.05  ? 279  TRP A CG  1 
ATOM   2337 C  CD1 . TRP A 1 298 ? 17.340  20.376 32.086 1.00 2.00  ? 279  TRP A CD1 1 
ATOM   2338 C  CD2 . TRP A 1 298 ? 17.545  20.292 34.321 1.00 2.67  ? 279  TRP A CD2 1 
ATOM   2339 N  NE1 . TRP A 1 298 ? 17.098  19.079 32.487 1.00 2.04  ? 279  TRP A NE1 1 
ATOM   2340 C  CE2 . TRP A 1 298 ? 17.196  19.001 33.851 1.00 2.00  ? 279  TRP A CE2 1 
ATOM   2341 C  CE3 . TRP A 1 298 ? 17.706  20.497 35.710 1.00 2.00  ? 279  TRP A CE3 1 
ATOM   2342 C  CZ2 . TRP A 1 298 ? 17.031  17.892 34.711 1.00 2.00  ? 279  TRP A CZ2 1 
ATOM   2343 C  CZ3 . TRP A 1 298 ? 17.531  19.419 36.568 1.00 2.37  ? 279  TRP A CZ3 1 
ATOM   2344 C  CH2 . TRP A 1 298 ? 17.213  18.111 36.063 1.00 3.23  ? 279  TRP A CH2 1 
ATOM   2345 N  N   . GLN A 1 299 ? 20.750  21.244 34.077 1.00 2.90  ? 280  GLN A N   1 
ATOM   2346 C  CA  . GLN A 1 299 ? 21.456  20.549 35.171 1.00 2.66  ? 280  GLN A CA  1 
ATOM   2347 C  C   . GLN A 1 299 ? 22.636  21.345 35.716 1.00 2.72  ? 280  GLN A C   1 
ATOM   2348 O  O   . GLN A 1 299 ? 22.957  21.226 36.890 1.00 2.89  ? 280  GLN A O   1 
ATOM   2349 C  CB  . GLN A 1 299 ? 21.918  19.149 34.762 1.00 2.46  ? 280  GLN A CB  1 
ATOM   2350 C  CG  . GLN A 1 299 ? 20.785  18.159 34.422 1.00 2.53  ? 280  GLN A CG  1 
ATOM   2351 C  CD  . GLN A 1 299 ? 20.443  18.151 32.930 1.00 4.06  ? 280  GLN A CD  1 
ATOM   2352 O  OE1 . GLN A 1 299 ? 20.610  19.158 32.227 1.00 4.28  ? 280  GLN A OE1 1 
ATOM   2353 N  NE2 . GLN A 1 299 ? 19.960  17.013 32.442 1.00 3.82  ? 280  GLN A NE2 1 
ATOM   2354 N  N   . SER A 1 300 ? 23.279  22.158 34.876 1.00 2.48  ? 281  SER A N   1 
ATOM   2355 C  CA  . SER A 1 300 ? 24.469  22.917 35.294 1.00 2.00  ? 281  SER A CA  1 
ATOM   2356 C  C   . SER A 1 300 ? 24.171  24.002 36.344 1.00 2.00  ? 281  SER A C   1 
ATOM   2357 O  O   . SER A 1 300 ? 25.077  24.531 36.995 1.00 2.00  ? 281  SER A O   1 
ATOM   2358 C  CB  . SER A 1 300 ? 25.172  23.546 34.067 1.00 2.00  ? 281  SER A CB  1 
ATOM   2359 O  OG  . SER A 1 300 ? 24.355  24.611 33.541 1.00 2.09  ? 281  SER A OG  1 
ATOM   2360 N  N   . TYR A 1 301 ? 22.900  24.326 36.532 1.00 2.00  ? 282  TYR A N   1 
ATOM   2361 C  CA  . TYR A 1 301 ? 22.523  25.358 37.514 1.00 2.29  ? 282  TYR A CA  1 
ATOM   2362 C  C   . TYR A 1 301 ? 22.387  24.774 38.935 1.00 2.76  ? 282  TYR A C   1 
ATOM   2363 O  O   . TYR A 1 301 ? 22.182  25.523 39.891 1.00 3.00  ? 282  TYR A O   1 
ATOM   2364 C  CB  . TYR A 1 301 ? 21.192  25.993 37.090 1.00 2.23  ? 282  TYR A CB  1 
ATOM   2365 C  CG  . TYR A 1 301 ? 21.345  26.869 35.868 1.00 2.45  ? 282  TYR A CG  1 
ATOM   2366 C  CD1 . TYR A 1 301 ? 21.582  28.241 36.003 1.00 2.00  ? 282  TYR A CD1 1 
ATOM   2367 C  CD2 . TYR A 1 301 ? 21.294  26.316 34.578 1.00 2.00  ? 282  TYR A CD2 1 
ATOM   2368 C  CE1 . TYR A 1 301 ? 21.752  29.046 34.878 1.00 2.00  ? 282  TYR A CE1 1 
ATOM   2369 C  CE2 . TYR A 1 301 ? 21.439  27.113 33.438 1.00 2.00  ? 282  TYR A CE2 1 
ATOM   2370 C  CZ  . TYR A 1 301 ? 21.666  28.453 33.585 1.00 2.00  ? 282  TYR A CZ  1 
ATOM   2371 O  OH  . TYR A 1 301 ? 21.816  29.218 32.472 1.00 2.00  ? 282  TYR A OH  1 
ATOM   2372 N  N   . PHE A 1 302 ? 22.527  23.453 39.069 1.00 2.00  ? 283  PHE A N   1 
ATOM   2373 C  CA  . PHE A 1 302 ? 22.292  22.770 40.363 1.00 2.00  ? 283  PHE A CA  1 
ATOM   2374 C  C   . PHE A 1 302 ? 23.550  22.034 40.837 1.00 2.48  ? 283  PHE A C   1 
ATOM   2375 O  O   . PHE A 1 302 ? 24.178  21.291 40.072 1.00 2.48  ? 283  PHE A O   1 
ATOM   2376 C  CB  . PHE A 1 302 ? 21.108  21.799 40.263 1.00 2.00  ? 283  PHE A CB  1 
ATOM   2377 C  CG  . PHE A 1 302 ? 19.823  22.485 39.935 1.00 2.77  ? 283  PHE A CG  1 
ATOM   2378 C  CD1 . PHE A 1 302 ? 19.014  22.989 40.953 1.00 2.30  ? 283  PHE A CD1 1 
ATOM   2379 C  CD2 . PHE A 1 302 ? 19.460  22.726 38.593 1.00 2.71  ? 283  PHE A CD2 1 
ATOM   2380 C  CE1 . PHE A 1 302 ? 17.845  23.661 40.657 1.00 3.01  ? 283  PHE A CE1 1 
ATOM   2381 C  CE2 . PHE A 1 302 ? 18.280  23.414 38.287 1.00 2.90  ? 283  PHE A CE2 1 
ATOM   2382 C  CZ  . PHE A 1 302 ? 17.473  23.866 39.308 1.00 3.03  ? 283  PHE A CZ  1 
ATOM   2383 N  N   . ASP A 1 303 ? 23.917  22.274 42.092 1.00 2.39  ? 284  ASP A N   1 
ATOM   2384 C  CA  . ASP A 1 303 ? 24.941  21.474 42.773 1.00 2.89  ? 284  ASP A CA  1 
ATOM   2385 C  C   . ASP A 1 303 ? 24.461  20.071 43.131 1.00 2.69  ? 284  ASP A C   1 
ATOM   2386 O  O   . ASP A 1 303 ? 25.256  19.157 43.342 1.00 2.91  ? 284  ASP A O   1 
ATOM   2387 C  CB  . ASP A 1 303 ? 25.380  22.214 44.031 1.00 2.41  ? 284  ASP A CB  1 
ATOM   2388 C  CG  . ASP A 1 303 ? 26.031  23.549 43.686 1.00 4.45  ? 284  ASP A CG  1 
ATOM   2389 O  OD1 . ASP A 1 303 ? 27.170  23.518 43.191 1.00 6.13  ? 284  ASP A OD1 1 
ATOM   2390 O  OD2 . ASP A 1 303 ? 25.398  24.613 43.832 1.00 3.74  ? 284  ASP A OD2 1 
ATOM   2391 N  N   . LEU A 1 304 ? 23.153  19.914 43.273 1.00 3.28  ? 285  LEU A N   1 
ATOM   2392 C  CA  . LEU A 1 304 ? 22.599  18.606 43.631 1.00 2.38  ? 285  LEU A CA  1 
ATOM   2393 C  C   . LEU A 1 304 ? 21.201  18.523 43.061 1.00 2.18  ? 285  LEU A C   1 
ATOM   2394 O  O   . LEU A 1 304 ? 20.404  19.461 43.177 1.00 2.00  ? 285  LEU A O   1 
ATOM   2395 C  CB  . LEU A 1 304 ? 22.621  18.409 45.158 1.00 2.00  ? 285  LEU A CB  1 
ATOM   2396 C  CG  . LEU A 1 304 ? 22.150  17.097 45.828 1.00 3.44  ? 285  LEU A CG  1 
ATOM   2397 C  CD1 . LEU A 1 304 ? 22.637  16.992 47.315 1.00 3.99  ? 285  LEU A CD1 1 
ATOM   2398 C  CD2 . LEU A 1 304 ? 20.611  16.997 45.795 1.00 5.03  ? 285  LEU A CD2 1 
ATOM   2399 N  N   . ILE A 1 305 ? 20.908  17.395 42.427 1.00 2.09  ? 286  ILE A N   1 
ATOM   2400 C  CA  . ILE A 1 305 ? 19.618  17.182 41.789 1.00 2.00  ? 286  ILE A CA  1 
ATOM   2401 C  C   . ILE A 1 305 ? 19.045  15.900 42.365 1.00 2.60  ? 286  ILE A C   1 
ATOM   2402 O  O   . ILE A 1 305 ? 19.687  14.825 42.301 1.00 2.69  ? 286  ILE A O   1 
ATOM   2403 C  CB  . ILE A 1 305 ? 19.754  17.027 40.255 1.00 2.00  ? 286  ILE A CB  1 
ATOM   2404 C  CG1 . ILE A 1 305 ? 20.355  18.302 39.631 1.00 2.14  ? 286  ILE A CG1 1 
ATOM   2405 C  CG2 . ILE A 1 305 ? 18.369  16.665 39.622 1.00 2.00  ? 286  ILE A CG2 1 
ATOM   2406 C  CD1 . ILE A 1 305 ? 20.741  18.165 38.127 1.00 2.00  ? 286  ILE A CD1 1 
ATOM   2407 N  N   . LEU A 1 306 ? 17.856  16.004 42.951 1.00 2.91  ? 287  LEU A N   1 
ATOM   2408 C  CA  . LEU A 1 306 ? 17.229  14.835 43.569 1.00 2.50  ? 287  LEU A CA  1 
ATOM   2409 C  C   . LEU A 1 306 ? 15.770  14.728 43.118 1.00 2.78  ? 287  LEU A C   1 
ATOM   2410 O  O   . LEU A 1 306 ? 15.000  15.678 43.258 1.00 3.93  ? 287  LEU A O   1 
ATOM   2411 C  CB  . LEU A 1 306 ? 17.372  14.894 45.091 1.00 2.42  ? 287  LEU A CB  1 
ATOM   2412 C  CG  . LEU A 1 306 ? 16.940  13.685 45.942 1.00 3.24  ? 287  LEU A CG  1 
ATOM   2413 C  CD1 . LEU A 1 306 ? 17.818  13.550 47.203 1.00 2.00  ? 287  LEU A CD1 1 
ATOM   2414 C  CD2 . LEU A 1 306 ? 15.450  13.827 46.315 1.00 3.92  ? 287  LEU A CD2 1 
ATOM   2415 N  N   . VAL A 1 307 ? 15.422  13.573 42.545 1.00 2.40  ? 288  VAL A N   1 
ATOM   2416 C  CA  . VAL A 1 307 ? 14.087  13.267 42.038 1.00 2.00  ? 288  VAL A CA  1 
ATOM   2417 C  C   . VAL A 1 307 ? 13.448  12.145 42.868 1.00 2.00  ? 288  VAL A C   1 
ATOM   2418 O  O   . VAL A 1 307 ? 14.077  11.590 43.767 1.00 2.00  ? 288  VAL A O   1 
ATOM   2419 C  CB  . VAL A 1 307 ? 14.093  12.923 40.469 1.00 2.10  ? 288  VAL A CB  1 
ATOM   2420 C  CG1 . VAL A 1 307 ? 14.627  14.103 39.664 1.00 2.00  ? 288  VAL A CG1 1 
ATOM   2421 C  CG2 . VAL A 1 307 ? 14.935  11.658 40.163 1.00 2.00  ? 288  VAL A CG2 1 
ATOM   2422 N  N   . ASP A 1 308 ? 12.184  11.837 42.587 1.00 2.00  ? 289  ASP A N   1 
ATOM   2423 C  CA  . ASP A 1 308 ? 11.426  10.836 43.361 1.00 2.02  ? 289  ASP A CA  1 
ATOM   2424 C  C   . ASP A 1 308 ? 11.587  11.108 44.870 1.00 2.29  ? 289  ASP A C   1 
ATOM   2425 O  O   . ASP A 1 308 ? 11.785  10.174 45.659 1.00 2.52  ? 289  ASP A O   1 
ATOM   2426 C  CB  . ASP A 1 308 ? 11.867  9.400  43.012 1.00 2.00  ? 289  ASP A CB  1 
ATOM   2427 C  CG  . ASP A 1 308 ? 11.931  9.142  41.513 1.00 3.05  ? 289  ASP A CG  1 
ATOM   2428 O  OD1 . ASP A 1 308 ? 10.882  9.285  40.825 1.00 3.36  ? 289  ASP A OD1 1 
ATOM   2429 O  OD2 . ASP A 1 308 ? 13.027  8.752  41.016 1.00 3.51  ? 289  ASP A OD2 1 
ATOM   2430 N  N   . ALA A 1 309 ? 11.483  12.377 45.275 1.00 2.07  ? 290  ALA A N   1 
ATOM   2431 C  CA  . ALA A 1 309 ? 11.796  12.740 46.663 1.00 2.50  ? 290  ALA A CA  1 
ATOM   2432 C  C   . ALA A 1 309 ? 10.848  12.158 47.701 1.00 2.57  ? 290  ALA A C   1 
ATOM   2433 O  O   . ALA A 1 309 ? 11.254  11.945 48.853 1.00 2.59  ? 290  ALA A O   1 
ATOM   2434 C  CB  . ALA A 1 309 ? 11.907  14.264 46.830 1.00 2.00  ? 290  ALA A CB  1 
ATOM   2435 N  N   . ARG A 1 310 ? 9.600   11.892 47.304 1.00 2.78  ? 291  ARG A N   1 
ATOM   2436 C  CA  . ARG A 1 310 ? 8.562   11.432 48.250 1.00 3.44  ? 291  ARG A CA  1 
ATOM   2437 C  C   . ARG A 1 310 ? 8.425   12.339 49.476 1.00 2.95  ? 291  ARG A C   1 
ATOM   2438 O  O   . ARG A 1 310 ? 8.407   11.850 50.618 1.00 3.62  ? 291  ARG A O   1 
ATOM   2439 C  CB  . ARG A 1 310 ? 8.794   9.971  48.723 1.00 3.32  ? 291  ARG A CB  1 
ATOM   2440 C  CG  . ARG A 1 310 ? 8.674   8.885  47.674 1.00 6.47  ? 291  ARG A CG  1 
ATOM   2441 C  CD  . ARG A 1 310 ? 7.268   8.270  47.591 1.00 16.52 ? 291  ARG A CD  1 
ATOM   2442 N  NE  . ARG A 1 310 ? 6.731   7.705  48.854 1.00 20.05 ? 291  ARG A NE  1 
ATOM   2443 C  CZ  . ARG A 1 310 ? 6.898   6.446  49.280 1.00 20.80 ? 291  ARG A CZ  1 
ATOM   2444 N  NH1 . ARG A 1 310 ? 7.612   5.562  48.596 1.00 19.97 ? 291  ARG A NH1 1 
ATOM   2445 N  NH2 . ARG A 1 310 ? 6.352   6.068  50.426 1.00 23.31 ? 291  ARG A NH2 1 
ATOM   2446 N  N   . LYS A 1 311 ? 8.340   13.643 49.256 1.00 3.13  ? 292  LYS A N   1 
ATOM   2447 C  CA  . LYS A 1 311 ? 8.022   14.571 50.349 1.00 3.16  ? 292  LYS A CA  1 
ATOM   2448 C  C   . LYS A 1 311 ? 6.548   14.326 50.692 1.00 3.40  ? 292  LYS A C   1 
ATOM   2449 O  O   . LYS A 1 311 ? 5.776   14.064 49.784 1.00 4.21  ? 292  LYS A O   1 
ATOM   2450 C  CB  . LYS A 1 311 ? 8.227   16.019 49.900 1.00 2.24  ? 292  LYS A CB  1 
ATOM   2451 C  CG  . LYS A 1 311 ? 9.651   16.362 49.533 1.00 2.00  ? 292  LYS A CG  1 
ATOM   2452 C  CD  . LYS A 1 311 ? 9.726   17.760 48.911 1.00 2.00  ? 292  LYS A CD  1 
ATOM   2453 C  CE  . LYS A 1 311 ? 9.221   17.738 47.447 1.00 2.00  ? 292  LYS A CE  1 
ATOM   2454 N  NZ  . LYS A 1 311 ? 8.987   19.115 46.934 1.00 2.67  ? 292  LYS A NZ  1 
ATOM   2455 N  N   . PRO A 1 312 ? 6.143   14.439 51.985 1.00 3.37  ? 293  PRO A N   1 
ATOM   2456 C  CA  . PRO A 1 312 ? 6.945   14.820 53.139 1.00 3.15  ? 293  PRO A CA  1 
ATOM   2457 C  C   . PRO A 1 312 ? 7.750   13.713 53.820 1.00 2.66  ? 293  PRO A C   1 
ATOM   2458 O  O   . PRO A 1 312 ? 8.594   14.034 54.653 1.00 2.85  ? 293  PRO A O   1 
ATOM   2459 C  CB  . PRO A 1 312 ? 5.899   15.384 54.109 1.00 4.15  ? 293  PRO A CB  1 
ATOM   2460 C  CG  . PRO A 1 312 ? 4.711   14.482 53.870 1.00 3.25  ? 293  PRO A CG  1 
ATOM   2461 C  CD  . PRO A 1 312 ? 4.726   14.220 52.362 1.00 3.30  ? 293  PRO A CD  1 
ATOM   2462 N  N   . LEU A 1 313 ? 7.530   12.447 53.474 1.00 2.62  ? 294  LEU A N   1 
ATOM   2463 C  CA  . LEU A 1 313 ? 8.349   11.341 54.031 1.00 3.29  ? 294  LEU A CA  1 
ATOM   2464 C  C   . LEU A 1 313 ? 9.868   11.631 53.936 1.00 2.92  ? 294  LEU A C   1 
ATOM   2465 O  O   . LEU A 1 313 ? 10.620  11.326 54.845 1.00 3.55  ? 294  LEU A O   1 
ATOM   2466 C  CB  . LEU A 1 313 ? 7.983   9.987  53.361 1.00 3.31  ? 294  LEU A CB  1 
ATOM   2467 C  CG  . LEU A 1 313 ? 8.834   8.747  53.607 1.00 3.51  ? 294  LEU A CG  1 
ATOM   2468 C  CD1 . LEU A 1 313 ? 8.648   8.282  55.068 1.00 3.47  ? 294  LEU A CD1 1 
ATOM   2469 C  CD2 . LEU A 1 313 ? 8.494   7.596  52.627 1.00 4.55  ? 294  LEU A CD2 1 
ATOM   2470 N  N   . PHE A 1 314 ? 10.281  12.252 52.840 1.00 2.55  ? 295  PHE A N   1 
ATOM   2471 C  CA  . PHE A 1 314 ? 11.627  12.790 52.630 1.00 2.37  ? 295  PHE A CA  1 
ATOM   2472 C  C   . PHE A 1 314 ? 12.223  13.512 53.829 1.00 3.48  ? 295  PHE A C   1 
ATOM   2473 O  O   . PHE A 1 314 ? 13.432  13.391 54.083 1.00 3.25  ? 295  PHE A O   1 
ATOM   2474 C  CB  . PHE A 1 314 ? 11.541  13.773 51.477 1.00 2.00  ? 295  PHE A CB  1 
ATOM   2475 C  CG  . PHE A 1 314 ? 12.866  14.333 51.027 1.00 2.37  ? 295  PHE A CG  1 
ATOM   2476 C  CD1 . PHE A 1 314 ? 13.773  13.536 50.306 1.00 2.00  ? 295  PHE A CD1 1 
ATOM   2477 C  CD2 . PHE A 1 314 ? 13.188  15.677 51.267 1.00 2.02  ? 295  PHE A CD2 1 
ATOM   2478 C  CE1 . PHE A 1 314 ? 14.985  14.064 49.860 1.00 2.00  ? 295  PHE A CE1 1 
ATOM   2479 C  CE2 . PHE A 1 314 ? 14.416  16.208 50.824 1.00 2.67  ? 295  PHE A CE2 1 
ATOM   2480 C  CZ  . PHE A 1 314 ? 15.309  15.399 50.123 1.00 2.00  ? 295  PHE A CZ  1 
ATOM   2481 N  N   . PHE A 1 315 ? 11.383  14.270 54.549 1.00 3.22  ? 296  PHE A N   1 
ATOM   2482 C  CA  . PHE A 1 315 ? 11.832  15.049 55.713 1.00 4.30  ? 296  PHE A CA  1 
ATOM   2483 C  C   . PHE A 1 315 ? 11.878  14.283 57.031 1.00 4.56  ? 296  PHE A C   1 
ATOM   2484 O  O   . PHE A 1 315 ? 12.228  14.879 58.047 1.00 5.14  ? 296  PHE A O   1 
ATOM   2485 C  CB  . PHE A 1 315 ? 11.007  16.354 55.893 1.00 3.69  ? 296  PHE A CB  1 
ATOM   2486 C  CG  . PHE A 1 315 ? 11.111  17.289 54.725 1.00 2.64  ? 296  PHE A CG  1 
ATOM   2487 C  CD1 . PHE A 1 315 ? 12.296  17.993 54.494 1.00 2.00  ? 296  PHE A CD1 1 
ATOM   2488 C  CD2 . PHE A 1 315 ? 10.028  17.485 53.867 1.00 2.00  ? 296  PHE A CD2 1 
ATOM   2489 C  CE1 . PHE A 1 315 ? 12.441  18.823 53.434 1.00 2.00  ? 296  PHE A CE1 1 
ATOM   2490 C  CE2 . PHE A 1 315 ? 10.142  18.353 52.792 1.00 3.47  ? 296  PHE A CE2 1 
ATOM   2491 C  CZ  . PHE A 1 315 ? 11.358  19.026 52.562 1.00 3.77  ? 296  PHE A CZ  1 
ATOM   2492 N  N   . GLY A 1 316 ? 11.532  12.979 57.008 1.00 5.11  ? 297  GLY A N   1 
ATOM   2493 C  CA  . GLY A 1 316 ? 11.759  12.058 58.141 1.00 4.43  ? 297  GLY A CA  1 
ATOM   2494 C  C   . GLY A 1 316 ? 12.730  10.972 57.673 1.00 4.92  ? 297  GLY A C   1 
ATOM   2495 O  O   . GLY A 1 316 ? 13.840  11.292 57.239 1.00 3.76  ? 297  GLY A O   1 
ATOM   2496 N  N   . GLU A 1 317 ? 12.312  9.699  57.719 1.00 5.19  ? 298  GLU A N   1 
ATOM   2497 C  CA  A GLU A 1 317 ? 13.152  8.550  57.322 0.50 5.81  ? 298  GLU A CA  1 
ATOM   2498 C  CA  B GLU A 1 317 ? 13.219  8.601  57.332 0.50 5.64  ? 298  GLU A CA  1 
ATOM   2499 C  C   . GLU A 1 317 ? 13.510  8.566  55.834 1.00 5.10  ? 298  GLU A C   1 
ATOM   2500 O  O   . GLU A 1 317 ? 14.534  8.029  55.420 1.00 4.61  ? 298  GLU A O   1 
ATOM   2501 C  CB  A GLU A 1 317 ? 12.456  7.210  57.691 0.50 6.02  ? 298  GLU A CB  1 
ATOM   2502 C  CB  B GLU A 1 317 ? 12.730  7.218  57.826 0.50 6.52  ? 298  GLU A CB  1 
ATOM   2503 C  CG  A GLU A 1 317 ? 11.016  7.092  57.174 0.50 6.92  ? 298  GLU A CG  1 
ATOM   2504 C  CG  B GLU A 1 317 ? 12.792  7.005  59.353 0.50 9.50  ? 298  GLU A CG  1 
ATOM   2505 C  CD  A GLU A 1 317 ? 10.187  6.002  57.838 0.50 8.56  ? 298  GLU A CD  1 
ATOM   2506 C  CD  B GLU A 1 317 ? 14.219  6.927  59.932 0.50 13.63 ? 298  GLU A CD  1 
ATOM   2507 O  OE1 A GLU A 1 317 ? 10.655  4.827  57.875 0.50 10.81 ? 298  GLU A OE1 1 
ATOM   2508 O  OE1 B GLU A 1 317 ? 14.468  6.019  60.756 0.50 14.86 ? 298  GLU A OE1 1 
ATOM   2509 O  OE2 A GLU A 1 317 ? 9.051   6.324  58.296 0.50 10.28 ? 298  GLU A OE2 1 
ATOM   2510 O  OE2 B GLU A 1 317 ? 15.079  7.788  59.605 0.50 15.35 ? 298  GLU A OE2 1 
ATOM   2511 N  N   . GLY A 1 318 ? 12.633  9.170  55.029 1.00 4.47  ? 299  GLY A N   1 
ATOM   2512 C  CA  . GLY A 1 318 ? 12.797  9.191  53.582 1.00 3.99  ? 299  GLY A CA  1 
ATOM   2513 C  C   . GLY A 1 318 ? 12.787  7.770  53.033 1.00 3.23  ? 299  GLY A C   1 
ATOM   2514 O  O   . GLY A 1 318 ? 12.158  6.890  53.609 1.00 3.30  ? 299  GLY A O   1 
ATOM   2515 N  N   . THR A 1 319 ? 13.509  7.552  51.941 1.00 3.06  ? 300  THR A N   1 
ATOM   2516 C  CA  . THR A 1 319 ? 13.610  6.236  51.294 1.00 4.50  ? 300  THR A CA  1 
ATOM   2517 C  C   . THR A 1 319 ? 15.061  5.933  50.972 1.00 4.45  ? 300  THR A C   1 
ATOM   2518 O  O   . THR A 1 319 ? 15.932  6.770  51.147 1.00 5.56  ? 300  THR A O   1 
ATOM   2519 C  CB  . THR A 1 319 ? 12.738  6.158  49.978 1.00 4.53  ? 300  THR A CB  1 
ATOM   2520 O  OG1 . THR A 1 319 ? 13.100  7.223  49.059 1.00 6.28  ? 300  THR A OG1 1 
ATOM   2521 C  CG2 . THR A 1 319 ? 11.254  6.294  50.320 1.00 3.80  ? 300  THR A CG2 1 
ATOM   2522 N  N   . VAL A 1 320 ? 15.323  4.741  50.477 1.00 4.82  ? 301  VAL A N   1 
ATOM   2523 C  CA  . VAL A 1 320 ? 16.666  4.349  50.063 1.00 4.13  ? 301  VAL A CA  1 
ATOM   2524 C  C   . VAL A 1 320 ? 17.159  5.329  48.967 1.00 3.15  ? 301  VAL A C   1 
ATOM   2525 O  O   . VAL A 1 320 ? 16.430  5.651  48.020 1.00 2.28  ? 301  VAL A O   1 
ATOM   2526 C  CB  . VAL A 1 320 ? 16.614  2.838  49.641 1.00 4.94  ? 301  VAL A CB  1 
ATOM   2527 C  CG1 . VAL A 1 320 ? 17.707  2.429  48.714 1.00 5.84  ? 301  VAL A CG1 1 
ATOM   2528 C  CG2 . VAL A 1 320 ? 16.558  1.911  50.935 1.00 5.91  ? 301  VAL A CG2 1 
ATOM   2529 N  N   . LEU A 1 321 ? 18.382  5.825  49.149 1.00 2.89  ? 302  LEU A N   1 
ATOM   2530 C  CA  . LEU A 1 321 ? 19.081  6.629  48.163 1.00 2.60  ? 302  LEU A CA  1 
ATOM   2531 C  C   . LEU A 1 321 ? 19.491  5.776  46.935 1.00 3.26  ? 302  LEU A C   1 
ATOM   2532 O  O   . LEU A 1 321 ? 20.181  4.755  47.057 1.00 2.98  ? 302  LEU A O   1 
ATOM   2533 C  CB  . LEU A 1 321 ? 20.302  7.274  48.782 1.00 2.17  ? 302  LEU A CB  1 
ATOM   2534 C  CG  . LEU A 1 321 ? 20.941  8.318  47.859 1.00 3.48  ? 302  LEU A CG  1 
ATOM   2535 C  CD1 . LEU A 1 321 ? 19.956  9.497  47.591 1.00 2.00  ? 302  LEU A CD1 1 
ATOM   2536 C  CD2 . LEU A 1 321 ? 22.301  8.798  48.407 1.00 2.75  ? 302  LEU A CD2 1 
ATOM   2537 N  N   . ARG A 1 322 ? 18.997  6.199  45.773 1.00 2.74  ? 303  ARG A N   1 
ATOM   2538 C  CA  . ARG A 1 322 ? 19.246  5.542  44.502 1.00 2.15  ? 303  ARG A CA  1 
ATOM   2539 C  C   . ARG A 1 322 ? 19.953  6.544  43.587 1.00 2.08  ? 303  ARG A C   1 
ATOM   2540 O  O   . ARG A 1 322 ? 19.927  7.766  43.836 1.00 2.00  ? 303  ARG A O   1 
ATOM   2541 C  CB  . ARG A 1 322 ? 17.923  5.115  43.861 1.00 2.00  ? 303  ARG A CB  1 
ATOM   2542 C  CG  . ARG A 1 322 ? 17.028  4.186  44.745 1.00 2.64  ? 303  ARG A CG  1 
ATOM   2543 C  CD  . ARG A 1 322 ? 17.578  2.745  44.903 1.00 2.00  ? 303  ARG A CD  1 
ATOM   2544 N  NE  . ARG A 1 322 ? 17.676  2.019  43.635 1.00 2.00  ? 303  ARG A NE  1 
ATOM   2545 C  CZ  . ARG A 1 322 ? 16.660  1.392  43.034 1.00 2.16  ? 303  ARG A CZ  1 
ATOM   2546 N  NH1 . ARG A 1 322 ? 15.430  1.403  43.574 1.00 2.00  ? 303  ARG A NH1 1 
ATOM   2547 N  NH2 . ARG A 1 322 ? 16.868  0.754  41.883 1.00 2.00  ? 303  ARG A NH2 1 
ATOM   2548 N  N   . GLN A 1 323 ? 20.560  6.009  42.529 1.00 2.00  ? 304  GLN A N   1 
ATOM   2549 C  CA  . GLN A 1 323 ? 21.201  6.792  41.491 1.00 2.00  ? 304  GLN A CA  1 
ATOM   2550 C  C   . GLN A 1 323 ? 20.434  6.588  40.177 1.00 2.05  ? 304  GLN A C   1 
ATOM   2551 O  O   . GLN A 1 323 ? 20.181  5.463  39.763 1.00 2.07  ? 304  GLN A O   1 
ATOM   2552 C  CB  . GLN A 1 323 ? 22.664  6.352  41.312 1.00 2.00  ? 304  GLN A CB  1 
ATOM   2553 C  CG  . GLN A 1 323 ? 23.409  7.167  40.236 1.00 2.20  ? 304  GLN A CG  1 
ATOM   2554 C  CD  . GLN A 1 323 ? 24.827  6.707  39.969 1.00 2.02  ? 304  GLN A CD  1 
ATOM   2555 O  OE1 . GLN A 1 323 ? 25.291  5.737  40.530 1.00 5.54  ? 304  GLN A OE1 1 
ATOM   2556 N  NE2 . GLN A 1 323 ? 25.513  7.406  39.088 1.00 2.46  ? 304  GLN A NE2 1 
ATOM   2557 N  N   . VAL A 1 324 ? 20.071  7.696  39.539 1.00 2.00  ? 305  VAL A N   1 
ATOM   2558 C  CA  . VAL A 1 324 ? 19.480  7.692  38.206 1.00 2.00  ? 305  VAL A CA  1 
ATOM   2559 C  C   . VAL A 1 324 ? 20.548  7.473  37.117 1.00 2.68  ? 305  VAL A C   1 
ATOM   2560 O  O   . VAL A 1 324 ? 21.601  8.127  37.111 1.00 2.46  ? 305  VAL A O   1 
ATOM   2561 C  CB  . VAL A 1 324 ? 18.707  9.050  37.932 1.00 2.00  ? 305  VAL A CB  1 
ATOM   2562 C  CG1 . VAL A 1 324 ? 18.084  9.079  36.520 1.00 2.00  ? 305  VAL A CG1 1 
ATOM   2563 C  CG2 . VAL A 1 324 ? 17.613  9.296  39.030 1.00 2.00  ? 305  VAL A CG2 1 
ATOM   2564 N  N   . ASP A 1 325 ? 20.272  6.525  36.220 1.00 2.95  ? 306  ASP A N   1 
ATOM   2565 C  CA  . ASP A 1 325 ? 21.009  6.415  34.971 1.00 4.10  ? 306  ASP A CA  1 
ATOM   2566 C  C   . ASP A 1 325 ? 20.361  7.413  34.007 1.00 4.89  ? 306  ASP A C   1 
ATOM   2567 O  O   . ASP A 1 325 ? 19.304  7.143  33.450 1.00 4.00  ? 306  ASP A O   1 
ATOM   2568 C  CB  . ASP A 1 325 ? 20.905  4.990  34.414 1.00 3.85  ? 306  ASP A CB  1 
ATOM   2569 C  CG  . ASP A 1 325 ? 21.636  4.819  33.069 1.00 6.63  ? 306  ASP A CG  1 
ATOM   2570 O  OD1 . ASP A 1 325 ? 21.904  5.831  32.383 1.00 5.31  ? 306  ASP A OD1 1 
ATOM   2571 O  OD2 . ASP A 1 325 ? 21.920  3.659  32.691 1.00 7.03  ? 306  ASP A OD2 1 
ATOM   2572 N  N   . THR A 1 326 ? 21.008  8.566  33.812 1.00 6.06  ? 307  THR A N   1 
ATOM   2573 C  CA  . THR A 1 326 ? 20.388  9.700  33.112 1.00 7.09  ? 307  THR A CA  1 
ATOM   2574 C  C   . THR A 1 326 ? 20.260  9.471  31.601 1.00 8.34  ? 307  THR A C   1 
ATOM   2575 O  O   . THR A 1 326 ? 19.494  10.163 30.914 1.00 9.52  ? 307  THR A O   1 
ATOM   2576 C  CB  . THR A 1 326 ? 21.118  11.040 33.422 1.00 7.16  ? 307  THR A CB  1 
ATOM   2577 O  OG1 . THR A 1 326 ? 22.482  10.957 32.992 1.00 6.74  ? 307  THR A OG1 1 
ATOM   2578 C  CG2 . THR A 1 326 ? 21.069  11.336 34.921 1.00 5.98  ? 307  THR A CG2 1 
ATOM   2579 N  N   . LYS A 1 327 ? 20.987  8.481  31.101 1.00 9.00  ? 308  LYS A N   1 
ATOM   2580 C  CA  . LYS A 1 327 ? 20.883  8.051  29.722 1.00 10.40 ? 308  LYS A CA  1 
ATOM   2581 C  C   . LYS A 1 327 ? 19.565  7.335  29.405 1.00 8.94  ? 308  LYS A C   1 
ATOM   2582 O  O   . LYS A 1 327 ? 18.973  7.547  28.350 1.00 9.03  ? 308  LYS A O   1 
ATOM   2583 C  CB  . LYS A 1 327 ? 22.067  7.142  29.369 1.00 10.61 ? 308  LYS A CB  1 
ATOM   2584 C  CG  . LYS A 1 327 ? 23.407  7.868  29.368 1.00 13.69 ? 308  LYS A CG  1 
ATOM   2585 C  CD  . LYS A 1 327 ? 24.510  7.041  28.652 1.00 14.32 ? 308  LYS A CD  1 
ATOM   2586 C  CE  . LYS A 1 327 ? 25.574  7.998  28.029 1.00 21.94 ? 308  LYS A CE  1 
ATOM   2587 N  NZ  . LYS A 1 327 ? 26.319  7.365  26.858 1.00 23.72 ? 308  LYS A NZ  1 
ATOM   2588 N  N   . THR A 1 328 ? 19.117  6.470  30.310 1.00 8.32  ? 309  THR A N   1 
ATOM   2589 C  CA  . THR A 1 328 ? 17.914  5.680  30.083 1.00 6.80  ? 309  THR A CA  1 
ATOM   2590 C  C   . THR A 1 328 ? 16.726  6.205  30.854 1.00 6.77  ? 309  THR A C   1 
ATOM   2591 O  O   . THR A 1 328 ? 15.589  5.877  30.515 1.00 7.42  ? 309  THR A O   1 
ATOM   2592 C  CB  . THR A 1 328 ? 18.134  4.238  30.479 1.00 7.11  ? 309  THR A CB  1 
ATOM   2593 O  OG1 . THR A 1 328 ? 18.474  4.170  31.875 1.00 6.46  ? 309  THR A OG1 1 
ATOM   2594 C  CG2 . THR A 1 328 ? 19.263  3.635  29.637 1.00 5.77  ? 309  THR A CG2 1 
ATOM   2595 N  N   . GLY A 1 329 ? 16.989  6.989  31.902 1.00 5.29  ? 310  GLY A N   1 
ATOM   2596 C  CA  . GLY A 1 329 ? 15.942  7.445  32.803 1.00 4.81  ? 310  GLY A CA  1 
ATOM   2597 C  C   . GLY A 1 329 ? 15.482  6.428  33.841 1.00 4.99  ? 310  GLY A C   1 
ATOM   2598 O  O   . GLY A 1 329 ? 14.560  6.712  34.636 1.00 5.56  ? 310  GLY A O   1 
ATOM   2599 N  N   . LYS A 1 330 ? 16.133  5.268  33.850 1.00 3.27  ? 311  LYS A N   1 
ATOM   2600 C  CA  . LYS A 1 330 ? 15.904  4.204  34.825 1.00 3.46  ? 311  LYS A CA  1 
ATOM   2601 C  C   . LYS A 1 330 ? 16.854  4.375  36.032 1.00 2.86  ? 311  LYS A C   1 
ATOM   2602 O  O   . LYS A 1 330 ? 17.936  4.954  35.914 1.00 3.11  ? 311  LYS A O   1 
ATOM   2603 C  CB  . LYS A 1 330 ? 16.166  2.835  34.165 1.00 2.98  ? 311  LYS A CB  1 
ATOM   2604 C  CG  . LYS A 1 330 ? 15.316  2.554  32.937 1.00 3.13  ? 311  LYS A CG  1 
ATOM   2605 C  CD  . LYS A 1 330 ? 15.634  1.156  32.299 1.00 4.80  ? 311  LYS A CD  1 
ATOM   2606 C  CE  . LYS A 1 330 ? 14.819  0.978  30.987 1.00 5.59  ? 311  LYS A CE  1 
ATOM   2607 N  NZ  . LYS A 1 330 ? 15.255  -0.238 30.182 1.00 8.44  ? 311  LYS A NZ  1 
ATOM   2608 N  N   . LEU A 1 331 ? 16.456  3.843  37.180 1.00 2.39  ? 312  LEU A N   1 
ATOM   2609 C  CA  . LEU A 1 331 ? 17.339  3.764  38.341 1.00 2.41  ? 312  LEU A CA  1 
ATOM   2610 C  C   . LEU A 1 331 ? 18.350  2.653  38.156 1.00 2.20  ? 312  LEU A C   1 
ATOM   2611 O  O   . LEU A 1 331 ? 18.012  1.579  37.634 1.00 2.00  ? 312  LEU A O   1 
ATOM   2612 C  CB  . LEU A 1 331 ? 16.524  3.516  39.618 1.00 2.35  ? 312  LEU A CB  1 
ATOM   2613 C  CG  . LEU A 1 331 ? 15.484  4.618  39.875 1.00 2.86  ? 312  LEU A CG  1 
ATOM   2614 C  CD1 . LEU A 1 331 ? 14.732  4.367  41.173 1.00 3.23  ? 312  LEU A CD1 1 
ATOM   2615 C  CD2 . LEU A 1 331 ? 16.121  5.998  39.854 1.00 2.00  ? 312  LEU A CD2 1 
ATOM   2616 N  N   . LYS A 1 332 ? 19.589  2.915  38.565 1.00 2.00  ? 313  LYS A N   1 
ATOM   2617 C  CA  . LYS A 1 332 ? 20.598  1.852  38.641 1.00 2.05  ? 313  LYS A CA  1 
ATOM   2618 C  C   . LYS A 1 332 ? 20.178  0.895  39.727 1.00 2.00  ? 313  LYS A C   1 
ATOM   2619 O  O   . LYS A 1 332 ? 19.460  1.293  40.643 1.00 2.68  ? 313  LYS A O   1 
ATOM   2620 C  CB  . LYS A 1 332 ? 21.979  2.416  38.957 1.00 2.00  ? 313  LYS A CB  1 
ATOM   2621 C  CG  . LYS A 1 332 ? 22.468  3.380  37.879 1.00 4.67  ? 313  LYS A CG  1 
ATOM   2622 C  CD  . LYS A 1 332 ? 23.923  3.638  38.019 1.00 8.84  ? 313  LYS A CD  1 
ATOM   2623 C  CE  . LYS A 1 332 ? 24.339  4.750  37.110 1.00 12.40 ? 313  LYS A CE  1 
ATOM   2624 N  NZ  . LYS A 1 332 ? 25.589  4.366  36.436 1.00 16.95 ? 313  LYS A NZ  1 
ATOM   2625 N  N   . ILE A 1 333 ? 20.593  -0.361 39.630 1.00 2.00  ? 314  ILE A N   1 
ATOM   2626 C  CA  . ILE A 1 333 ? 20.186  -1.348 40.614 1.00 2.16  ? 314  ILE A CA  1 
ATOM   2627 C  C   . ILE A 1 333 ? 21.055  -1.206 41.880 1.00 2.38  ? 314  ILE A C   1 
ATOM   2628 O  O   . ILE A 1 333 ? 22.278  -1.175 41.793 1.00 2.22  ? 314  ILE A O   1 
ATOM   2629 C  CB  . ILE A 1 333 ? 20.244  -2.788 40.047 1.00 2.25  ? 314  ILE A CB  1 
ATOM   2630 C  CG1 . ILE A 1 333 ? 19.347  -2.912 38.786 1.00 2.18  ? 314  ILE A CG1 1 
ATOM   2631 C  CG2 . ILE A 1 333 ? 19.856  -3.833 41.164 1.00 2.00  ? 314  ILE A CG2 1 
ATOM   2632 C  CD1 . ILE A 1 333 ? 17.895  -2.484 38.954 1.00 2.00  ? 314  ILE A CD1 1 
ATOM   2633 N  N   . GLY A 1 334 ? 20.415  -1.101 43.038 1.00 2.12  ? 315  GLY A N   1 
ATOM   2634 C  CA  . GLY A 1 334 ? 21.155  -1.008 44.285 1.00 3.08  ? 315  GLY A CA  1 
ATOM   2635 C  C   . GLY A 1 334 ? 21.042  0.362  44.957 1.00 3.02  ? 315  GLY A C   1 
ATOM   2636 O  O   . GLY A 1 334 ? 20.622  1.332  44.336 1.00 2.58  ? 315  GLY A O   1 
ATOM   2637 N  N   . THR A 1 335 ? 21.399  0.406  46.235 1.00 3.08  ? 316  THR A N   1 
ATOM   2638 C  CA  . THR A 1 335 ? 21.543  1.666  46.988 1.00 3.96  ? 316  THR A CA  1 
ATOM   2639 C  C   . THR A 1 335 ? 22.857  2.351  46.616 1.00 3.27  ? 316  THR A C   1 
ATOM   2640 O  O   . THR A 1 335 ? 23.916  1.708  46.580 1.00 2.08  ? 316  THR A O   1 
ATOM   2641 C  CB  . THR A 1 335 ? 21.525  1.389  48.517 1.00 4.04  ? 316  THR A CB  1 
ATOM   2642 O  OG1 . THR A 1 335 ? 20.298  0.743  48.831 1.00 6.95  ? 316  THR A OG1 1 
ATOM   2643 C  CG2 . THR A 1 335 ? 21.608  2.683  49.352 1.00 4.11  ? 316  THR A CG2 1 
ATOM   2644 N  N   . TYR A 1 336 ? 22.776  3.651  46.335 1.00 3.29  ? 317  TYR A N   1 
ATOM   2645 C  CA  . TYR A 1 336 ? 23.972  4.414  46.018 1.00 4.57  ? 317  TYR A CA  1 
ATOM   2646 C  C   . TYR A 1 336 ? 24.705  4.776  47.318 1.00 5.07  ? 317  TYR A C   1 
ATOM   2647 O  O   . TYR A 1 336 ? 24.133  5.433  48.187 1.00 4.95  ? 317  TYR A O   1 
ATOM   2648 C  CB  . TYR A 1 336 ? 23.631  5.690  45.218 1.00 4.90  ? 317  TYR A CB  1 
ATOM   2649 C  CG  . TYR A 1 336 ? 24.865  6.489  44.906 1.00 3.85  ? 317  TYR A CG  1 
ATOM   2650 C  CD1 . TYR A 1 336 ? 25.741  6.059  43.930 1.00 2.50  ? 317  TYR A CD1 1 
ATOM   2651 C  CD2 . TYR A 1 336 ? 25.164  7.662  45.603 1.00 4.33  ? 317  TYR A CD2 1 
ATOM   2652 C  CE1 . TYR A 1 336 ? 26.882  6.751  43.631 1.00 5.47  ? 317  TYR A CE1 1 
ATOM   2653 C  CE2 . TYR A 1 336 ? 26.323  8.393  45.300 1.00 5.84  ? 317  TYR A CE2 1 
ATOM   2654 C  CZ  . TYR A 1 336 ? 27.177  7.913  44.319 1.00 6.55  ? 317  TYR A CZ  1 
ATOM   2655 O  OH  . TYR A 1 336 ? 28.324  8.577  43.975 1.00 8.27  ? 317  TYR A OH  1 
ATOM   2656 N  N   . THR A 1 337 ? 25.969  4.378  47.430 1.00 6.30  ? 318  THR A N   1 
ATOM   2657 C  CA  . THR A 1 337 ? 26.742  4.564  48.669 1.00 7.44  ? 318  THR A CA  1 
ATOM   2658 C  C   . THR A 1 337 ? 27.931  5.501  48.432 1.00 8.51  ? 318  THR A C   1 
ATOM   2659 O  O   . THR A 1 337 ? 28.763  5.681  49.324 1.00 9.29  ? 318  THR A O   1 
ATOM   2660 C  CB  . THR A 1 337 ? 27.348  3.240  49.172 1.00 7.96  ? 318  THR A CB  1 
ATOM   2661 O  OG1 . THR A 1 337 ? 28.216  2.722  48.155 1.00 8.76  ? 318  THR A OG1 1 
ATOM   2662 C  CG2 . THR A 1 337 ? 26.240  2.188  49.545 1.00 5.77  ? 318  THR A CG2 1 
ATOM   2663 N  N   . GLY A 1 338 ? 28.021  6.062  47.230 1.00 8.28  ? 319  GLY A N   1 
ATOM   2664 C  CA  . GLY A 1 338 ? 29.178  6.852  46.830 1.00 8.60  ? 319  GLY A CA  1 
ATOM   2665 C  C   . GLY A 1 338 ? 29.059  8.325  47.202 1.00 9.13  ? 319  GLY A C   1 
ATOM   2666 O  O   . GLY A 1 338 ? 28.135  8.732  47.927 1.00 8.70  ? 319  GLY A O   1 
ATOM   2667 N  N   . PRO A 1 339 ? 30.010  9.139  46.724 1.00 9.41  ? 320  PRO A N   1 
ATOM   2668 C  CA  . PRO A 1 339 ? 30.007  10.554 47.068 1.00 9.70  ? 320  PRO A CA  1 
ATOM   2669 C  C   . PRO A 1 339 ? 29.177  11.426 46.098 1.00 10.18 ? 320  PRO A C   1 
ATOM   2670 O  O   . PRO A 1 339 ? 28.669  10.946 45.072 1.00 10.04 ? 320  PRO A O   1 
ATOM   2671 C  CB  . PRO A 1 339 ? 31.498  10.915 47.003 1.00 9.24  ? 320  PRO A CB  1 
ATOM   2672 C  CG  . PRO A 1 339 ? 32.025  10.055 45.888 1.00 9.69  ? 320  PRO A CG  1 
ATOM   2673 C  CD  . PRO A 1 339 ? 31.170  8.770  45.885 1.00 9.63  ? 320  PRO A CD  1 
ATOM   2674 N  N   . LEU A 1 340 ? 29.036  12.699 46.431 1.00 10.12 ? 321  LEU A N   1 
ATOM   2675 C  CA  . LEU A 1 340 ? 28.496  13.663 45.487 1.00 11.18 ? 321  LEU A CA  1 
ATOM   2676 C  C   . LEU A 1 340 ? 29.524  13.835 44.385 1.00 12.28 ? 321  LEU A C   1 
ATOM   2677 O  O   . LEU A 1 340 ? 30.663  14.192 44.678 1.00 13.09 ? 321  LEU A O   1 
ATOM   2678 C  CB  . LEU A 1 340 ? 28.248  15.005 46.187 1.00 10.72 ? 321  LEU A CB  1 
ATOM   2679 C  CG  . LEU A 1 340 ? 27.668  16.155 45.369 1.00 11.34 ? 321  LEU A CG  1 
ATOM   2680 C  CD1 . LEU A 1 340 ? 26.216  15.915 45.009 1.00 11.20 ? 321  LEU A CD1 1 
ATOM   2681 C  CD2 . LEU A 1 340 ? 27.816  17.466 46.128 1.00 11.35 ? 321  LEU A CD2 1 
ATOM   2682 N  N   . GLN A 1 341 ? 29.146  13.538 43.139 1.00 12.74 ? 322  GLN A N   1 
ATOM   2683 C  CA  . GLN A 1 341 ? 30.024  13.748 41.987 1.00 13.97 ? 322  GLN A CA  1 
ATOM   2684 C  C   . GLN A 1 341 ? 29.290  14.578 40.966 1.00 13.30 ? 322  GLN A C   1 
ATOM   2685 O  O   . GLN A 1 341 ? 28.058  14.564 40.902 1.00 12.81 ? 322  GLN A O   1 
ATOM   2686 C  CB  . GLN A 1 341 ? 30.441  12.443 41.277 1.00 13.83 ? 322  GLN A CB  1 
ATOM   2687 C  CG  . GLN A 1 341 ? 30.426  11.158 42.093 1.00 15.93 ? 322  GLN A CG  1 
ATOM   2688 C  CD  . GLN A 1 341 ? 30.669  9.923  41.221 1.00 16.29 ? 322  GLN A CD  1 
ATOM   2689 O  OE1 . GLN A 1 341 ? 31.327  10.008 40.181 1.00 19.49 ? 322  GLN A OE1 1 
ATOM   2690 N  NE2 . GLN A 1 341 ? 30.127  8.767  41.639 1.00 19.80 ? 322  GLN A NE2 1 
ATOM   2691 N  N   . HIS A 1 342 ? 30.064  15.265 40.142 1.00 13.35 ? 323  HIS A N   1 
ATOM   2692 C  CA  . HIS A 1 342 ? 29.516  16.081 39.064 1.00 13.87 ? 323  HIS A CA  1 
ATOM   2693 C  C   . HIS A 1 342 ? 28.704  15.226 38.086 1.00 12.44 ? 323  HIS A C   1 
ATOM   2694 O  O   . HIS A 1 342 ? 29.181  14.191 37.604 1.00 12.61 ? 323  HIS A O   1 
ATOM   2695 C  CB  . HIS A 1 342 ? 30.645  16.809 38.310 1.00 14.55 ? 323  HIS A CB  1 
ATOM   2696 C  CG  . HIS A 1 342 ? 30.162  17.562 37.107 1.00 18.34 ? 323  HIS A CG  1 
ATOM   2697 N  ND1 . HIS A 1 342 ? 29.485  18.763 37.203 1.00 20.54 ? 323  HIS A ND1 1 
ATOM   2698 C  CD2 . HIS A 1 342 ? 30.221  17.265 35.785 1.00 21.81 ? 323  HIS A CD2 1 
ATOM   2699 C  CE1 . HIS A 1 342 ? 29.164  19.180 35.990 1.00 22.70 ? 323  HIS A CE1 1 
ATOM   2700 N  NE2 . HIS A 1 342 ? 29.595  18.288 35.112 1.00 23.62 ? 323  HIS A NE2 1 
ATOM   2701 N  N   . GLY A 1 343 ? 27.484  15.657 37.791 1.00 10.90 ? 324  GLY A N   1 
ATOM   2702 C  CA  . GLY A 1 343 ? 26.667  14.938 36.815 1.00 9.58  ? 324  GLY A CA  1 
ATOM   2703 C  C   . GLY A 1 343 ? 25.768  13.865 37.420 1.00 8.88  ? 324  GLY A C   1 
ATOM   2704 O  O   . GLY A 1 343 ? 24.842  13.407 36.765 1.00 9.34  ? 324  GLY A O   1 
ATOM   2705 N  N   . ILE A 1 344 ? 26.011  13.479 38.668 1.00 7.29  ? 325  ILE A N   1 
ATOM   2706 C  CA  . ILE A 1 344 ? 25.162  12.490 39.329 1.00 7.23  ? 325  ILE A CA  1 
ATOM   2707 C  C   . ILE A 1 344 ? 23.738  13.007 39.600 1.00 6.33  ? 325  ILE A C   1 
ATOM   2708 O  O   . ILE A 1 344 ? 23.527  14.167 39.977 1.00 6.39  ? 325  ILE A O   1 
ATOM   2709 C  CB  . ILE A 1 344 ? 25.782  11.994 40.660 1.00 6.76  ? 325  ILE A CB  1 
ATOM   2710 C  CG1 . ILE A 1 344 ? 25.085  10.729 41.143 1.00 8.24  ? 325  ILE A CG1 1 
ATOM   2711 C  CG2 . ILE A 1 344 ? 25.688  13.111 41.739 1.00 9.09  ? 325  ILE A CG2 1 
ATOM   2712 C  CD1 . ILE A 1 344 ? 25.843  9.994  42.219 1.00 10.49 ? 325  ILE A CD1 1 
ATOM   2713 N  N   . VAL A 1 345 ? 22.759  12.131 39.419 1.00 5.31  ? 326  VAL A N   1 
ATOM   2714 C  CA  . VAL A 1 345 ? 21.396  12.467 39.764 1.00 4.13  ? 326  VAL A CA  1 
ATOM   2715 C  C   . VAL A 1 345 ? 20.870  11.431 40.737 1.00 3.69  ? 326  VAL A C   1 
ATOM   2716 O  O   . VAL A 1 345 ? 20.926  10.209 40.479 1.00 3.53  ? 326  VAL A O   1 
ATOM   2717 C  CB  . VAL A 1 345 ? 20.473  12.638 38.528 1.00 3.95  ? 326  VAL A CB  1 
ATOM   2718 C  CG1 . VAL A 1 345 ? 19.001  12.823 38.964 1.00 2.70  ? 326  VAL A CG1 1 
ATOM   2719 C  CG2 . VAL A 1 345 ? 20.939  13.828 37.684 1.00 4.30  ? 326  VAL A CG2 1 
ATOM   2720 N  N   . TYR A 1 346 ? 20.348  11.942 41.842 1.00 2.94  ? 327  TYR A N   1 
ATOM   2721 C  CA  . TYR A 1 346 ? 19.813  11.125 42.920 1.00 3.22  ? 327  TYR A CA  1 
ATOM   2722 C  C   . TYR A 1 346 ? 18.309  10.905 42.817 1.00 2.83  ? 327  TYR A C   1 
ATOM   2723 O  O   . TYR A 1 346 ? 17.577  11.729 42.239 1.00 2.81  ? 327  TYR A O   1 
ATOM   2724 C  CB  . TYR A 1 346 ? 20.083  11.813 44.250 1.00 3.97  ? 327  TYR A CB  1 
ATOM   2725 C  CG  . TYR A 1 346 ? 21.538  11.947 44.557 1.00 5.31  ? 327  TYR A CG  1 
ATOM   2726 C  CD1 . TYR A 1 346 ? 22.314  10.818 44.893 1.00 3.55  ? 327  TYR A CD1 1 
ATOM   2727 C  CD2 . TYR A 1 346 ? 22.145  13.191 44.539 1.00 6.51  ? 327  TYR A CD2 1 
ATOM   2728 C  CE1 . TYR A 1 346 ? 23.664  10.938 45.199 1.00 5.69  ? 327  TYR A CE1 1 
ATOM   2729 C  CE2 . TYR A 1 346 ? 23.520  13.330 44.851 1.00 9.89  ? 327  TYR A CE2 1 
ATOM   2730 C  CZ  . TYR A 1 346 ? 24.265  12.200 45.180 1.00 8.29  ? 327  TYR A CZ  1 
ATOM   2731 O  OH  . TYR A 1 346 ? 25.603  12.338 45.481 1.00 8.29  ? 327  TYR A OH  1 
ATOM   2732 N  N   . SER A 1 347 ? 17.872  9.812  43.437 1.00 2.14  ? 328  SER A N   1 
ATOM   2733 C  CA  . SER A 1 347 ? 16.471  9.434  43.536 1.00 2.00  ? 328  SER A CA  1 
ATOM   2734 C  C   . SER A 1 347 ? 16.201  8.922  44.935 1.00 2.00  ? 328  SER A C   1 
ATOM   2735 O  O   . SER A 1 347 ? 16.950  8.076  45.435 1.00 2.00  ? 328  SER A O   1 
ATOM   2736 C  CB  . SER A 1 347 ? 16.164  8.328  42.525 1.00 2.00  ? 328  SER A CB  1 
ATOM   2737 O  OG  . SER A 1 347 ? 14.852  7.843  42.713 1.00 2.00  ? 328  SER A OG  1 
ATOM   2738 N  N   . GLY A 1 348 ? 15.139  9.451  45.558 1.00 2.03  ? 329  GLY A N   1 
ATOM   2739 C  CA  . GLY A 1 348 ? 14.721  9.074  46.884 1.00 2.00  ? 329  GLY A CA  1 
ATOM   2740 C  C   . GLY A 1 348 ? 15.586  9.744  47.927 1.00 3.16  ? 329  GLY A C   1 
ATOM   2741 O  O   . GLY A 1 348 ? 15.759  10.968 47.910 1.00 3.14  ? 329  GLY A O   1 
ATOM   2742 N  N   . GLY A 1 349 ? 16.139  8.951  48.854 1.00 3.20  ? 330  GLY A N   1 
ATOM   2743 C  CA  . GLY A 1 349 ? 16.902  9.507  49.979 1.00 2.75  ? 330  GLY A CA  1 
ATOM   2744 C  C   . GLY A 1 349 ? 16.048  10.252 51.009 1.00 2.82  ? 330  GLY A C   1 
ATOM   2745 O  O   . GLY A 1 349 ? 14.857  9.960  51.205 1.00 2.09  ? 330  GLY A O   1 
ATOM   2746 N  N   . SER A 1 350 ? 16.673  11.219 51.676 1.00 2.86  ? 331  SER A N   1 
ATOM   2747 C  CA  . SER A 1 350 ? 16.021  12.016 52.728 1.00 2.96  ? 331  SER A CA  1 
ATOM   2748 C  C   . SER A 1 350 ? 16.595  13.405 52.743 1.00 2.63  ? 331  SER A C   1 
ATOM   2749 O  O   . SER A 1 350 ? 17.620  13.672 52.086 1.00 3.39  ? 331  SER A O   1 
ATOM   2750 C  CB  . SER A 1 350 ? 16.216  11.371 54.112 1.00 3.16  ? 331  SER A CB  1 
ATOM   2751 O  OG  . SER A 1 350 ? 17.567  11.456 54.568 1.00 3.54  ? 331  SER A OG  1 
ATOM   2752 N  N   . SER A 1 351 ? 15.981  14.305 53.506 1.00 2.55  ? 332  SER A N   1 
ATOM   2753 C  CA  . SER A 1 351 ? 16.557  15.650 53.624 1.00 2.97  ? 332  SER A CA  1 
ATOM   2754 C  C   . SER A 1 351 ? 17.995  15.620 54.203 1.00 3.25  ? 332  SER A C   1 
ATOM   2755 O  O   . SER A 1 351 ? 18.807  16.503 53.899 1.00 2.96  ? 332  SER A O   1 
ATOM   2756 C  CB  . SER A 1 351 ? 15.616  16.568 54.413 1.00 3.18  ? 332  SER A CB  1 
ATOM   2757 O  OG  . SER A 1 351 ? 15.498  16.102 55.744 1.00 3.30  ? 332  SER A OG  1 
ATOM   2758 N  N   . ASP A 1 352 ? 18.311  14.605 55.012 1.00 3.37  ? 333  ASP A N   1 
ATOM   2759 C  CA  . ASP A 1 352 ? 19.671  14.423 55.522 1.00 5.25  ? 333  ASP A CA  1 
ATOM   2760 C  C   . ASP A 1 352 ? 20.733  14.168 54.436 1.00 4.95  ? 333  ASP A C   1 
ATOM   2761 O  O   . ASP A 1 352 ? 21.891  14.538 54.604 1.00 4.67  ? 333  ASP A O   1 
ATOM   2762 C  CB  . ASP A 1 352 ? 19.725  13.295 56.557 1.00 6.24  ? 333  ASP A CB  1 
ATOM   2763 C  CG  . ASP A 1 352 ? 19.153  13.714 57.910 1.00 10.88 ? 333  ASP A CG  1 
ATOM   2764 O  OD1 . ASP A 1 352 ? 18.961  14.936 58.186 1.00 14.00 ? 333  ASP A OD1 1 
ATOM   2765 O  OD2 . ASP A 1 352 ? 18.886  12.797 58.692 1.00 15.69 ? 333  ASP A OD2 1 
ATOM   2766 N  N   . THR A 1 353 ? 20.320  13.557 53.330 1.00 5.48  ? 334  THR A N   1 
ATOM   2767 C  CA  . THR A 1 353 ? 21.165  13.385 52.168 1.00 6.35  ? 334  THR A CA  1 
ATOM   2768 C  C   . THR A 1 353 ? 21.639  14.755 51.691 1.00 6.04  ? 334  THR A C   1 
ATOM   2769 O  O   . THR A 1 353 ? 22.814  14.956 51.419 1.00 6.23  ? 334  THR A O   1 
ATOM   2770 C  CB  . THR A 1 353 ? 20.384  12.691 51.019 1.00 6.56  ? 334  THR A CB  1 
ATOM   2771 O  OG1 . THR A 1 353 ? 19.968  11.383 51.444 1.00 7.62  ? 334  THR A OG1 1 
ATOM   2772 C  CG2 . THR A 1 353 ? 21.260  12.562 49.764 1.00 7.94  ? 334  THR A CG2 1 
ATOM   2773 N  N   . ILE A 1 354 ? 20.714  15.703 51.614 1.00 6.04  ? 335  ILE A N   1 
ATOM   2774 C  CA  . ILE A 1 354 ? 21.031  17.046 51.164 1.00 6.29  ? 335  ILE A CA  1 
ATOM   2775 C  C   . ILE A 1 354 ? 21.966  17.769 52.125 1.00 5.82  ? 335  ILE A C   1 
ATOM   2776 O  O   . ILE A 1 354 ? 22.981  18.292 51.693 1.00 4.56  ? 335  ILE A O   1 
ATOM   2777 C  CB  . ILE A 1 354 ? 19.707  17.825 50.856 1.00 8.22  ? 335  ILE A CB  1 
ATOM   2778 C  CG1 . ILE A 1 354 ? 19.059  17.110 49.654 1.00 7.24  ? 335  ILE A CG1 1 
ATOM   2779 C  CG2 . ILE A 1 354 ? 19.993  19.319 50.648 1.00 7.40  ? 335  ILE A CG2 1 
ATOM   2780 C  CD1 . ILE A 1 354 ? 17.808  17.669 49.098 1.00 13.19 ? 335  ILE A CD1 1 
ATOM   2781 N  N   . CYS A 1 355 ? 21.657  17.736 53.432 1.00 4.87  ? 336  CYS A N   1 
ATOM   2782 C  CA  . CYS A 1 355 ? 22.498  18.367 54.427 1.00 5.42  ? 336  CYS A CA  1 
ATOM   2783 C  C   . CYS A 1 355 ? 23.912  17.798 54.458 1.00 4.60  ? 336  CYS A C   1 
ATOM   2784 O  O   . CYS A 1 355 ? 24.878  18.546 54.558 1.00 4.28  ? 336  CYS A O   1 
ATOM   2785 C  CB  . CYS A 1 355 ? 21.876  18.245 55.828 1.00 5.20  ? 336  CYS A CB  1 
ATOM   2786 S  SG  . CYS A 1 355 ? 20.350  19.141 55.960 1.00 11.25 ? 336  CYS A SG  1 
ATOM   2787 N  N   A ASP A 1 356 ? 24.020  16.476 54.358 0.50 4.17  ? 337  ASP A N   1 
ATOM   2788 N  N   B ASP A 1 356 ? 24.031  16.477 54.403 0.50 4.55  ? 337  ASP A N   1 
ATOM   2789 C  CA  A ASP A 1 356 ? 25.311  15.788 54.402 0.50 4.21  ? 337  ASP A CA  1 
ATOM   2790 C  CA  B ASP A 1 356 ? 25.347  15.862 54.413 0.50 4.94  ? 337  ASP A CA  1 
ATOM   2791 C  C   A ASP A 1 356 ? 26.177  16.041 53.162 0.50 4.06  ? 337  ASP A C   1 
ATOM   2792 C  C   B ASP A 1 356 ? 26.122  16.294 53.165 0.50 4.42  ? 337  ASP A C   1 
ATOM   2793 O  O   A ASP A 1 356 ? 27.393  16.200 53.268 0.50 4.15  ? 337  ASP A O   1 
ATOM   2794 O  O   B ASP A 1 356 ? 27.201  16.886 53.275 0.50 4.59  ? 337  ASP A O   1 
ATOM   2795 C  CB  A ASP A 1 356 ? 25.099  14.280 54.547 0.50 4.30  ? 337  ASP A CB  1 
ATOM   2796 C  CB  B ASP A 1 356 ? 25.244  14.333 54.498 0.50 5.48  ? 337  ASP A CB  1 
ATOM   2797 C  CG  A ASP A 1 356 ? 24.549  13.884 55.901 0.50 4.47  ? 337  ASP A CG  1 
ATOM   2798 C  CG  B ASP A 1 356 ? 26.608  13.650 54.508 0.50 7.61  ? 337  ASP A CG  1 
ATOM   2799 O  OD1 A ASP A 1 356 ? 24.461  14.728 56.817 0.50 5.86  ? 337  ASP A OD1 1 
ATOM   2800 O  OD1 B ASP A 1 356 ? 27.391  13.850 55.470 0.50 12.44 ? 337  ASP A OD1 1 
ATOM   2801 O  OD2 A ASP A 1 356 ? 24.218  12.692 56.049 0.50 6.46  ? 337  ASP A OD2 1 
ATOM   2802 O  OD2 B ASP A 1 356 ? 26.899  12.894 53.560 0.50 9.69  ? 337  ASP A OD2 1 
ATOM   2803 N  N   . LEU A 1 357 ? 25.554  16.030 51.992 1.00 3.50  ? 338  LEU A N   1 
ATOM   2804 C  CA  . LEU A 1 357 ? 26.279  16.244 50.721 1.00 4.22  ? 338  LEU A CA  1 
ATOM   2805 C  C   . LEU A 1 357 ? 26.613  17.718 50.456 1.00 3.81  ? 338  LEU A C   1 
ATOM   2806 O  O   . LEU A 1 357 ? 27.658  18.027 49.894 1.00 4.50  ? 338  LEU A O   1 
ATOM   2807 C  CB  . LEU A 1 357 ? 25.522  15.610 49.549 1.00 3.78  ? 338  LEU A CB  1 
ATOM   2808 C  CG  . LEU A 1 357 ? 25.375  14.069 49.631 1.00 4.92  ? 338  LEU A CG  1 
ATOM   2809 C  CD1 . LEU A 1 357 ? 24.524  13.558 48.459 1.00 4.00  ? 338  LEU A CD1 1 
ATOM   2810 C  CD2 . LEU A 1 357 ? 26.737  13.328 49.652 1.00 4.59  ? 338  LEU A CD2 1 
ATOM   2811 N  N   . LEU A 1 358 ? 25.769  18.636 50.925 1.00 3.42  ? 339  LEU A N   1 
ATOM   2812 C  CA  . LEU A 1 358 ? 26.079  20.037 50.749 1.00 3.08  ? 339  LEU A CA  1 
ATOM   2813 C  C   . LEU A 1 358 ? 26.774  20.673 51.943 1.00 3.49  ? 339  LEU A C   1 
ATOM   2814 O  O   . LEU A 1 358 ? 27.115  21.860 51.884 1.00 3.36  ? 339  LEU A O   1 
ATOM   2815 C  CB  . LEU A 1 358 ? 24.829  20.825 50.351 1.00 3.26  ? 339  LEU A CB  1 
ATOM   2816 C  CG  . LEU A 1 358 ? 24.076  20.356 49.107 1.00 2.35  ? 339  LEU A CG  1 
ATOM   2817 C  CD1 . LEU A 1 358 ? 22.825  21.244 48.888 1.00 2.00  ? 339  LEU A CD1 1 
ATOM   2818 C  CD2 . LEU A 1 358 ? 24.972  20.351 47.858 1.00 2.00  ? 339  LEU A CD2 1 
ATOM   2819 N  N   . GLY A 1 359 ? 26.994  19.915 53.023 1.00 3.44  ? 340  GLY A N   1 
ATOM   2820 C  CA  . GLY A 1 359 ? 27.661  20.486 54.210 1.00 3.27  ? 340  GLY A CA  1 
ATOM   2821 C  C   . GLY A 1 359 ? 26.805  21.557 54.870 1.00 4.17  ? 340  GLY A C   1 
ATOM   2822 O  O   . GLY A 1 359 ? 27.311  22.599 55.314 1.00 4.90  ? 340  GLY A O   1 
ATOM   2823 N  N   . ALA A 1 360 ? 25.501  21.321 54.924 1.00 4.12  ? 341  ALA A N   1 
ATOM   2824 C  CA  . ALA A 1 360 ? 24.547  22.326 55.416 1.00 4.40  ? 341  ALA A CA  1 
ATOM   2825 C  C   . ALA A 1 360 ? 23.784  21.848 56.665 1.00 4.31  ? 341  ALA A C   1 
ATOM   2826 O  O   . ALA A 1 360 ? 23.579  20.662 56.864 1.00 4.00  ? 341  ALA A O   1 
ATOM   2827 C  CB  . ALA A 1 360 ? 23.540  22.665 54.331 1.00 3.30  ? 341  ALA A CB  1 
ATOM   2828 N  N   . LYS A 1 361 ? 23.386  22.813 57.478 1.00 4.56  ? 342  LYS A N   1 
ATOM   2829 C  CA  . LYS A 1 361 ? 22.431  22.658 58.558 1.00 6.35  ? 342  LYS A CA  1 
ATOM   2830 C  C   . LYS A 1 361 ? 21.113  23.277 58.075 1.00 6.14  ? 342  LYS A C   1 
ATOM   2831 O  O   . LYS A 1 361 ? 21.117  24.149 57.168 1.00 7.66  ? 342  LYS A O   1 
ATOM   2832 C  CB  . LYS A 1 361 ? 22.929  23.471 59.741 1.00 6.34  ? 342  LYS A CB  1 
ATOM   2833 C  CG  . LYS A 1 361 ? 23.815  22.719 60.687 1.00 10.96 ? 342  LYS A CG  1 
ATOM   2834 C  CD  . LYS A 1 361 ? 25.124  22.328 60.118 1.00 17.72 ? 342  LYS A CD  1 
ATOM   2835 C  CE  . LYS A 1 361 ? 25.454  20.877 60.500 1.00 21.19 ? 342  LYS A CE  1 
ATOM   2836 N  NZ  . LYS A 1 361 ? 26.866  20.547 60.154 1.00 23.76 ? 342  LYS A NZ  1 
ATOM   2837 N  N   . GLY A 1 362 ? 20.007  22.913 58.711 1.00 5.44  ? 343  GLY A N   1 
ATOM   2838 C  CA  . GLY A 1 362 ? 18.688  23.382 58.270 1.00 3.49  ? 343  GLY A CA  1 
ATOM   2839 C  C   . GLY A 1 362 ? 18.541  24.884 58.093 1.00 3.50  ? 343  GLY A C   1 
ATOM   2840 O  O   . GLY A 1 362 ? 17.947  25.351 57.121 1.00 2.81  ? 343  GLY A O   1 
ATOM   2841 N  N   . LYS A 1 363 ? 19.064  25.659 59.037 1.00 3.00  ? 344  LYS A N   1 
ATOM   2842 C  CA  . LYS A 1 363 ? 18.838  27.100 59.002 1.00 2.62  ? 344  LYS A CA  1 
ATOM   2843 C  C   . LYS A 1 363 ? 19.700  27.853 57.964 1.00 2.71  ? 344  LYS A C   1 
ATOM   2844 O  O   . LYS A 1 363 ? 19.498  29.053 57.762 1.00 3.23  ? 344  LYS A O   1 
ATOM   2845 C  CB  . LYS A 1 363 ? 19.000  27.701 60.395 1.00 2.30  ? 344  LYS A CB  1 
ATOM   2846 C  CG  . LYS A 1 363 ? 17.843  27.391 61.361 1.00 2.00  ? 344  LYS A CG  1 
ATOM   2847 C  CD  . LYS A 1 363 ? 18.247  27.757 62.803 1.00 2.80  ? 344  LYS A CD  1 
ATOM   2848 C  CE  . LYS A 1 363 ? 17.322  27.100 63.780 1.00 3.26  ? 344  LYS A CE  1 
ATOM   2849 N  NZ  . LYS A 1 363 ? 17.904  26.921 65.120 1.00 3.18  ? 344  LYS A NZ  1 
ATOM   2850 N  N   . ASP A 1 364 ? 20.651  27.145 57.345 1.00 3.03  ? 345  ASP A N   1 
ATOM   2851 C  CA  . ASP A 1 364 ? 21.464  27.593 56.207 1.00 3.63  ? 345  ASP A CA  1 
ATOM   2852 C  C   . ASP A 1 364 ? 20.706  27.334 54.903 1.00 3.21  ? 345  ASP A C   1 
ATOM   2853 O  O   . ASP A 1 364 ? 21.203  27.684 53.826 1.00 2.34  ? 345  ASP A O   1 
ATOM   2854 C  CB  . ASP A 1 364 ? 22.680  26.660 56.006 1.00 4.80  ? 345  ASP A CB  1 
ATOM   2855 C  CG  . ASP A 1 364 ? 23.637  26.611 57.150 1.00 8.12  ? 345  ASP A CG  1 
ATOM   2856 O  OD1 . ASP A 1 364 ? 23.831  27.619 57.893 1.00 9.63  ? 345  ASP A OD1 1 
ATOM   2857 O  OD2 . ASP A 1 364 ? 24.262  25.522 57.261 1.00 11.84 ? 345  ASP A OD2 1 
ATOM   2858 N  N   . ILE A 1 365 ? 19.571  26.637 54.977 1.00 2.44  ? 346  ILE A N   1 
ATOM   2859 C  CA  . ILE A 1 365 ? 18.831  26.261 53.773 1.00 2.00  ? 346  ILE A CA  1 
ATOM   2860 C  C   . ILE A 1 365 ? 17.546  27.070 53.648 1.00 2.55  ? 346  ILE A C   1 
ATOM   2861 O  O   . ILE A 1 365 ? 16.733  27.098 54.599 1.00 2.18  ? 346  ILE A O   1 
ATOM   2862 C  CB  . ILE A 1 365 ? 18.465  24.732 53.773 1.00 2.35  ? 346  ILE A CB  1 
ATOM   2863 C  CG1 . ILE A 1 365 ? 19.740  23.847 53.837 1.00 2.26  ? 346  ILE A CG1 1 
ATOM   2864 C  CG2 . ILE A 1 365 ? 17.479  24.369 52.613 1.00 2.00  ? 346  ILE A CG2 1 
ATOM   2865 C  CD1 . ILE A 1 365 ? 19.468  22.334 54.170 1.00 2.00  ? 346  ILE A CD1 1 
ATOM   2866 N  N   . LEU A 1 366 ? 17.350  27.684 52.473 1.00 2.00  ? 347  LEU A N   1 
ATOM   2867 C  CA  . LEU A 1 366 ? 16.053  28.213 52.084 1.00 2.13  ? 347  LEU A CA  1 
ATOM   2868 C  C   . LEU A 1 366 ? 15.399  27.275 51.052 1.00 2.17  ? 347  LEU A C   1 
ATOM   2869 O  O   . LEU A 1 366 ? 15.882  27.171 49.944 1.00 2.06  ? 347  LEU A O   1 
ATOM   2870 C  CB  . LEU A 1 366 ? 16.150  29.635 51.495 1.00 2.00  ? 347  LEU A CB  1 
ATOM   2871 C  CG  . LEU A 1 366 ? 14.781  30.291 51.179 1.00 2.98  ? 347  LEU A CG  1 
ATOM   2872 C  CD1 . LEU A 1 366 ? 13.950  30.470 52.448 1.00 2.00  ? 347  LEU A CD1 1 
ATOM   2873 C  CD2 . LEU A 1 366 ? 14.987  31.641 50.468 1.00 2.55  ? 347  LEU A CD2 1 
ATOM   2874 N  N   . TYR A 1 367 ? 14.319  26.602 51.448 1.00 2.03  ? 348  TYR A N   1 
ATOM   2875 C  CA  . TYR A 1 367 ? 13.584  25.708 50.578 1.00 2.00  ? 348  TYR A CA  1 
ATOM   2876 C  C   . TYR A 1 367 ? 12.333  26.405 50.035 1.00 2.22  ? 348  TYR A C   1 
ATOM   2877 O  O   . TYR A 1 367 ? 11.527  26.987 50.786 1.00 2.15  ? 348  TYR A O   1 
ATOM   2878 C  CB  . TYR A 1 367 ? 13.216  24.375 51.259 1.00 2.00  ? 348  TYR A CB  1 
ATOM   2879 C  CG  . TYR A 1 367 ? 12.730  23.353 50.236 1.00 2.40  ? 348  TYR A CG  1 
ATOM   2880 C  CD1 . TYR A 1 367 ? 13.569  22.936 49.185 1.00 2.00  ? 348  TYR A CD1 1 
ATOM   2881 C  CD2 . TYR A 1 367 ? 11.424  22.879 50.272 1.00 2.00  ? 348  TYR A CD2 1 
ATOM   2882 C  CE1 . TYR A 1 367 ? 13.120  22.041 48.220 1.00 2.00  ? 348  TYR A CE1 1 
ATOM   2883 C  CE2 . TYR A 1 367 ? 10.953  21.983 49.297 1.00 2.69  ? 348  TYR A CE2 1 
ATOM   2884 C  CZ  . TYR A 1 367 ? 11.805  21.553 48.290 1.00 2.36  ? 348  TYR A CZ  1 
ATOM   2885 O  OH  . TYR A 1 367 ? 11.327  20.670 47.333 1.00 2.93  ? 348  TYR A OH  1 
ATOM   2886 N  N   . ILE A 1 368 ? 12.211  26.330 48.710 1.00 2.30  ? 349  ILE A N   1 
ATOM   2887 C  CA  . ILE A 1 368 ? 11.251  27.081 47.911 1.00 2.11  ? 349  ILE A CA  1 
ATOM   2888 C  C   . ILE A 1 368 ? 10.270  26.097 47.273 1.00 2.39  ? 349  ILE A C   1 
ATOM   2889 O  O   . ILE A 1 368 ? 10.659  25.296 46.390 1.00 2.16  ? 349  ILE A O   1 
ATOM   2890 C  CB  . ILE A 1 368 ? 12.008  27.907 46.837 1.00 2.71  ? 349  ILE A CB  1 
ATOM   2891 C  CG1 . ILE A 1 368 ? 13.017  28.854 47.528 1.00 3.29  ? 349  ILE A CG1 1 
ATOM   2892 C  CG2 . ILE A 1 368 ? 11.031  28.689 45.932 1.00 2.00  ? 349  ILE A CG2 1 
ATOM   2893 C  CD1 . ILE A 1 368 ? 14.104  29.400 46.592 1.00 3.04  ? 349  ILE A CD1 1 
ATOM   2894 N  N   . GLY A 1 369 ? 9.009   26.154 47.711 1.00 2.00  ? 350  GLY A N   1 
ATOM   2895 C  CA  . GLY A 1 369 ? 7.960   25.282 47.164 1.00 2.56  ? 350  GLY A CA  1 
ATOM   2896 C  C   . GLY A 1 369 ? 6.561   25.853 47.310 1.00 2.77  ? 350  GLY A C   1 
ATOM   2897 O  O   . GLY A 1 369 ? 6.367   26.907 47.910 1.00 3.33  ? 350  GLY A O   1 
ATOM   2898 N  N   . ASP A 1 370 ? 5.578   25.130 46.784 1.00 3.47  ? 351  ASP A N   1 
ATOM   2899 C  CA  . ASP A 1 370 ? 4.170   25.576 46.746 1.00 2.72  ? 351  ASP A CA  1 
ATOM   2900 C  C   . ASP A 1 370 ? 3.299   24.681 47.624 1.00 2.59  ? 351  ASP A C   1 
ATOM   2901 O  O   . ASP A 1 370 ? 2.108   24.973 47.789 1.00 2.63  ? 351  ASP A O   1 
ATOM   2902 C  CB  . ASP A 1 370 ? 3.623   25.472 45.293 1.00 2.17  ? 351  ASP A CB  1 
ATOM   2903 C  CG  . ASP A 1 370 ? 3.587   24.037 44.799 1.00 2.26  ? 351  ASP A CG  1 
ATOM   2904 O  OD1 . ASP A 1 370 ? 4.672   23.425 44.603 1.00 3.01  ? 351  ASP A OD1 1 
ATOM   2905 O  OD2 . ASP A 1 370 ? 2.482   23.478 44.635 1.00 3.53  ? 351  ASP A OD2 1 
ATOM   2906 N  N   . HIS A 1 371 ? 3.840   23.564 48.134 1.00 2.05  ? 352  HIS A N   1 
ATOM   2907 C  CA  . HIS A 1 371 ? 2.989   22.630 48.912 1.00 2.06  ? 352  HIS A CA  1 
ATOM   2908 C  C   . HIS A 1 371 ? 3.059   23.027 50.385 1.00 2.44  ? 352  HIS A C   1 
ATOM   2909 O  O   . HIS A 1 371 ? 4.058   22.733 51.071 1.00 2.00  ? 352  HIS A O   1 
ATOM   2910 C  CB  . HIS A 1 371 ? 3.339   21.126 48.737 1.00 2.00  ? 352  HIS A CB  1 
ATOM   2911 C  CG  . HIS A 1 371 ? 2.244   20.202 49.211 1.00 2.00  ? 352  HIS A CG  1 
ATOM   2912 N  ND1 . HIS A 1 371 ? 1.881   19.064 48.524 1.00 2.11  ? 352  HIS A ND1 1 
ATOM   2913 C  CD2 . HIS A 1 371 ? 1.372   20.304 50.242 1.00 2.00  ? 352  HIS A CD2 1 
ATOM   2914 C  CE1 . HIS A 1 371 ? 0.877   18.465 49.146 1.00 2.00  ? 352  HIS A CE1 1 
ATOM   2915 N  NE2 . HIS A 1 371 ? 0.532   19.213 50.180 1.00 2.30  ? 352  HIS A NE2 1 
ATOM   2916 N  N   . ILE A 1 372 ? 1.996   23.680 50.872 1.00 2.52  ? 353  ILE A N   1 
ATOM   2917 C  CA  . ILE A 1 372 ? 2.002   24.218 52.223 1.00 2.92  ? 353  ILE A CA  1 
ATOM   2918 C  C   . ILE A 1 372 ? 2.296   23.137 53.275 1.00 3.70  ? 353  ILE A C   1 
ATOM   2919 O  O   . ILE A 1 372 ? 2.928   23.414 54.308 1.00 4.03  ? 353  ILE A O   1 
ATOM   2920 C  CB  . ILE A 1 372 ? 0.669   24.947 52.567 1.00 3.48  ? 353  ILE A CB  1 
ATOM   2921 C  CG1 . ILE A 1 372 ? 0.781   25.638 53.939 1.00 4.12  ? 353  ILE A CG1 1 
ATOM   2922 C  CG2 . ILE A 1 372 ? -0.524  23.950 52.576 1.00 2.00  ? 353  ILE A CG2 1 
ATOM   2923 C  CD1 . ILE A 1 372 ? 1.815   26.794 53.973 1.00 3.11  ? 353  ILE A CD1 1 
ATOM   2924 N  N   . PHE A 1 373 ? 1.805   21.916 53.036 1.00 3.41  ? 354  PHE A N   1 
ATOM   2925 C  CA  . PHE A 1 373 ? 2.032   20.806 53.963 1.00 3.06  ? 354  PHE A CA  1 
ATOM   2926 C  C   . PHE A 1 373 ? 3.364   20.117 53.663 1.00 2.88  ? 354  PHE A C   1 
ATOM   2927 O  O   . PHE A 1 373 ? 4.261   20.069 54.532 1.00 3.11  ? 354  PHE A O   1 
ATOM   2928 C  CB  . PHE A 1 373 ? 0.864   19.806 53.925 1.00 3.23  ? 354  PHE A CB  1 
ATOM   2929 C  CG  . PHE A 1 373 ? 0.980   18.686 54.928 1.00 3.92  ? 354  PHE A CG  1 
ATOM   2930 C  CD1 . PHE A 1 373 ? 0.643   18.891 56.267 1.00 5.77  ? 354  PHE A CD1 1 
ATOM   2931 C  CD2 . PHE A 1 373 ? 1.432   17.435 54.547 1.00 4.32  ? 354  PHE A CD2 1 
ATOM   2932 C  CE1 . PHE A 1 373 ? 0.753   17.848 57.222 1.00 5.90  ? 354  PHE A CE1 1 
ATOM   2933 C  CE2 . PHE A 1 373 ? 1.539   16.386 55.496 1.00 6.51  ? 354  PHE A CE2 1 
ATOM   2934 C  CZ  . PHE A 1 373 ? 1.202   16.607 56.829 1.00 5.88  ? 354  PHE A CZ  1 
ATOM   2935 N  N   . GLY A 1 374 ? 3.492   19.587 52.446 1.00 2.05  ? 355  GLY A N   1 
ATOM   2936 C  CA  . GLY A 1 374 ? 4.568   18.663 52.107 1.00 2.00  ? 355  GLY A CA  1 
ATOM   2937 C  C   . GLY A 1 374 ? 5.911   19.310 51.878 1.00 3.04  ? 355  GLY A C   1 
ATOM   2938 O  O   . GLY A 1 374 ? 6.952   18.665 52.086 1.00 3.52  ? 355  GLY A O   1 
ATOM   2939 N  N   . ASP A 1 375 ? 5.902   20.571 51.433 1.00 2.39  ? 356  ASP A N   1 
ATOM   2940 C  CA  . ASP A 1 375 ? 7.134   21.331 51.232 1.00 3.15  ? 356  ASP A CA  1 
ATOM   2941 C  C   . ASP A 1 375 ? 7.509   22.198 52.430 1.00 3.51  ? 356  ASP A C   1 
ATOM   2942 O  O   . ASP A 1 375 ? 8.695   22.306 52.790 1.00 4.38  ? 356  ASP A O   1 
ATOM   2943 C  CB  . ASP A 1 375 ? 7.059   22.269 49.992 1.00 2.15  ? 356  ASP A CB  1 
ATOM   2944 C  CG  . ASP A 1 375 ? 6.950   21.515 48.677 1.00 3.12  ? 356  ASP A CG  1 
ATOM   2945 O  OD1 . ASP A 1 375 ? 7.369   20.335 48.609 1.00 2.84  ? 356  ASP A OD1 1 
ATOM   2946 O  OD2 . ASP A 1 375 ? 6.433   22.100 47.690 1.00 2.81  ? 356  ASP A OD2 1 
ATOM   2947 N  N   . ILE A 1 376 ? 6.511   22.864 53.018 1.00 3.22  ? 357  ILE A N   1 
ATOM   2948 C  CA  . ILE A 1 376 ? 6.783   24.001 53.898 1.00 2.37  ? 357  ILE A CA  1 
ATOM   2949 C  C   . ILE A 1 376 ? 6.606   23.656 55.380 1.00 2.08  ? 357  ILE A C   1 
ATOM   2950 O  O   . ILE A 1 376 ? 7.557   23.722 56.149 1.00 2.00  ? 357  ILE A O   1 
ATOM   2951 C  CB  . ILE A 1 376 ? 5.953   25.282 53.432 1.00 2.67  ? 357  ILE A CB  1 
ATOM   2952 C  CG1 . ILE A 1 376 ? 6.355   25.699 51.976 1.00 2.23  ? 357  ILE A CG1 1 
ATOM   2953 C  CG2 . ILE A 1 376 ? 6.042   26.432 54.473 1.00 2.00  ? 357  ILE A CG2 1 
ATOM   2954 C  CD1 . ILE A 1 376 ? 7.847   26.001 51.711 1.00 2.00  ? 357  ILE A CD1 1 
ATOM   2955 N  N   . LEU A 1 377 ? 5.405   23.229 55.764 1.00 2.00  ? 358  LEU A N   1 
ATOM   2956 C  CA  . LEU A 1 377 ? 5.142   22.849 57.132 1.00 2.03  ? 358  LEU A CA  1 
ATOM   2957 C  C   . LEU A 1 377 ? 6.110   21.741 57.586 1.00 2.67  ? 358  LEU A C   1 
ATOM   2958 O  O   . LEU A 1 377 ? 6.694   21.828 58.681 1.00 2.07  ? 358  LEU A O   1 
ATOM   2959 C  CB  . LEU A 1 377 ? 3.682   22.395 57.265 1.00 2.04  ? 358  LEU A CB  1 
ATOM   2960 C  CG  . LEU A 1 377 ? 3.121   22.034 58.629 1.00 2.80  ? 358  LEU A CG  1 
ATOM   2961 C  CD1 . LEU A 1 377 ? 1.601   22.202 58.607 1.00 2.38  ? 358  LEU A CD1 1 
ATOM   2962 C  CD2 . LEU A 1 377 ? 3.517   20.563 59.062 1.00 2.00  ? 358  LEU A CD2 1 
ATOM   2963 N  N   . LYS A 1 378 ? 6.280   20.724 56.737 1.00 2.32  ? 359  LYS A N   1 
ATOM   2964 C  CA  . LYS A 1 378 ? 7.091   19.574 57.114 1.00 3.51  ? 359  LYS A CA  1 
ATOM   2965 C  C   . LYS A 1 378 ? 8.605   19.855 57.183 1.00 3.16  ? 359  LYS A C   1 
ATOM   2966 O  O   . LYS A 1 378 ? 9.258   19.385 58.112 1.00 2.93  ? 359  LYS A O   1 
ATOM   2967 C  CB  . LYS A 1 378 ? 6.764   18.316 56.249 1.00 2.59  ? 359  LYS A CB  1 
ATOM   2968 C  CG  . LYS A 1 378 ? 5.405   17.657 56.647 1.00 2.42  ? 359  LYS A CG  1 
ATOM   2969 C  CD  . LYS A 1 378 ? 5.523   16.937 57.962 1.00 8.32  ? 359  LYS A CD  1 
ATOM   2970 C  CE  . LYS A 1 378 ? 4.202   16.370 58.440 1.00 10.97 ? 359  LYS A CE  1 
ATOM   2971 N  NZ  . LYS A 1 378 ? 4.373   15.577 59.694 1.00 12.79 ? 359  LYS A NZ  1 
ATOM   2972 N  N   . SER A 1 379 ? 9.149   20.617 56.242 1.00 2.42  ? 360  SER A N   1 
ATOM   2973 C  CA  . SER A 1 379 ? 10.581  20.954 56.325 1.00 2.69  ? 360  SER A CA  1 
ATOM   2974 C  C   . SER A 1 379 ? 10.836  21.871 57.543 1.00 2.64  ? 360  SER A C   1 
ATOM   2975 O  O   . SER A 1 379 ? 11.844  21.722 58.227 1.00 3.22  ? 360  SER A O   1 
ATOM   2976 C  CB  . SER A 1 379 ? 11.085  21.611 55.042 1.00 2.40  ? 360  SER A CB  1 
ATOM   2977 O  OG  . SER A 1 379 ? 10.480  22.876 54.859 1.00 2.23  ? 360  SER A OG  1 
ATOM   2978 N  N   . LYS A 1 380 ? 9.921   22.804 57.797 1.00 2.90  ? 361  LYS A N   1 
ATOM   2979 C  CA  . LYS A 1 380 ? 9.976   23.645 58.996 1.00 2.53  ? 361  LYS A CA  1 
ATOM   2980 C  C   . LYS A 1 380 ? 9.881   22.831 60.298 1.00 2.56  ? 361  LYS A C   1 
ATOM   2981 O  O   . LYS A 1 380 ? 10.778  22.891 61.140 1.00 2.00  ? 361  LYS A O   1 
ATOM   2982 C  CB  . LYS A 1 380 ? 8.889   24.727 58.977 1.00 2.61  ? 361  LYS A CB  1 
ATOM   2983 C  CG  . LYS A 1 380 ? 8.799   25.560 60.304 1.00 2.00  ? 361  LYS A CG  1 
ATOM   2984 C  CD  . LYS A 1 380 ? 10.070  26.437 60.518 1.00 2.00  ? 361  LYS A CD  1 
ATOM   2985 C  CE  . LYS A 1 380 ? 10.337  27.474 59.382 1.00 2.00  ? 361  LYS A CE  1 
ATOM   2986 N  NZ  . LYS A 1 380 ? 11.510  28.425 59.684 1.00 2.00  ? 361  LYS A NZ  1 
ATOM   2987 N  N   . LYS A 1 381 ? 8.817   22.043 60.453 1.00 2.96  ? 362  LYS A N   1 
ATOM   2988 C  CA  . LYS A 1 381 ? 8.627   21.339 61.727 1.00 4.58  ? 362  LYS A CA  1 
ATOM   2989 C  C   . LYS A 1 381 ? 9.627   20.204 61.960 1.00 3.65  ? 362  LYS A C   1 
ATOM   2990 O  O   . LYS A 1 381 ? 10.043  19.976 63.094 1.00 2.06  ? 362  LYS A O   1 
ATOM   2991 C  CB  . LYS A 1 381 ? 7.205   20.771 61.863 1.00 4.85  ? 362  LYS A CB  1 
ATOM   2992 C  CG  . LYS A 1 381 ? 6.129   21.867 61.912 1.00 8.34  ? 362  LYS A CG  1 
ATOM   2993 C  CD  . LYS A 1 381 ? 4.752   21.312 62.283 1.00 7.23  ? 362  LYS A CD  1 
ATOM   2994 C  CE  . LYS A 1 381 ? 4.663   21.038 63.740 1.00 14.33 ? 362  LYS A CE  1 
ATOM   2995 N  NZ  . LYS A 1 381 ? 3.222   20.862 64.131 1.00 17.96 ? 362  LYS A NZ  1 
ATOM   2996 N  N   . ARG A 1 382 ? 9.973   19.467 60.902 1.00 2.53  ? 363  ARG A N   1 
ATOM   2997 C  CA  . ARG A 1 382 ? 10.777  18.261 61.100 1.00 3.05  ? 363  ARG A CA  1 
ATOM   2998 C  C   . ARG A 1 382 ? 12.259  18.595 61.114 1.00 2.63  ? 363  ARG A C   1 
ATOM   2999 O  O   . ARG A 1 382 ? 13.037  17.905 61.730 1.00 2.00  ? 363  ARG A O   1 
ATOM   3000 C  CB  . ARG A 1 382 ? 10.512  17.257 59.989 1.00 3.50  ? 363  ARG A CB  1 
ATOM   3001 C  CG  . ARG A 1 382 ? 9.052   16.850 59.864 1.00 8.12  ? 363  ARG A CG  1 
ATOM   3002 C  CD  . ARG A 1 382 ? 8.704   15.924 60.986 1.00 15.82 ? 363  ARG A CD  1 
ATOM   3003 N  NE  . ARG A 1 382 ? 9.577   14.756 60.927 1.00 25.30 ? 363  ARG A NE  1 
ATOM   3004 C  CZ  . ARG A 1 382 ? 9.543   13.752 61.797 1.00 30.65 ? 363  ARG A CZ  1 
ATOM   3005 N  NH1 . ARG A 1 382 ? 8.668   13.771 62.804 1.00 31.30 ? 363  ARG A NH1 1 
ATOM   3006 N  NH2 . ARG A 1 382 ? 10.375  12.723 61.646 1.00 32.92 ? 363  ARG A NH2 1 
ATOM   3007 N  N   . GLN A 1 383 ? 12.640  19.643 60.389 1.00 2.52  ? 364  GLN A N   1 
ATOM   3008 C  CA  . GLN A 1 383 ? 14.062  19.902 60.124 1.00 2.34  ? 364  GLN A CA  1 
ATOM   3009 C  C   . GLN A 1 383 ? 14.565  21.296 60.478 1.00 2.09  ? 364  GLN A C   1 
ATOM   3010 O  O   . GLN A 1 383 ? 15.769  21.516 60.464 1.00 2.52  ? 364  GLN A O   1 
ATOM   3011 C  CB  . GLN A 1 383 ? 14.403  19.577 58.649 1.00 2.17  ? 364  GLN A CB  1 
ATOM   3012 C  CG  . GLN A 1 383 ? 14.250  18.038 58.274 1.00 2.09  ? 364  GLN A CG  1 
ATOM   3013 C  CD  . GLN A 1 383 ? 15.085  17.090 59.184 1.00 6.38  ? 364  GLN A CD  1 
ATOM   3014 O  OE1 . GLN A 1 383 ? 16.085  17.515 59.757 1.00 4.81  ? 364  GLN A OE1 1 
ATOM   3015 N  NE2 . GLN A 1 383 ? 14.647  15.810 59.333 1.00 2.26  ? 364  GLN A NE2 1 
ATOM   3016 N  N   . GLY A 1 384 ? 13.671  22.241 60.757 1.00 2.00  ? 365  GLY A N   1 
ATOM   3017 C  CA  . GLY A 1 384 ? 14.098  23.631 61.034 1.00 2.00  ? 365  GLY A CA  1 
ATOM   3018 C  C   . GLY A 1 384 ? 14.718  24.328 59.810 1.00 2.16  ? 365  GLY A C   1 
ATOM   3019 O  O   . GLY A 1 384 ? 15.580  25.218 59.956 1.00 2.00  ? 365  GLY A O   1 
ATOM   3020 N  N   . TRP A 1 385 ? 14.296  23.923 58.605 1.00 2.00  ? 366  TRP A N   1 
ATOM   3021 C  CA  . TRP A 1 385 ? 14.720  24.619 57.359 1.00 2.15  ? 366  TRP A CA  1 
ATOM   3022 C  C   . TRP A 1 385 ? 14.051  25.978 57.309 1.00 2.00  ? 366  TRP A C   1 
ATOM   3023 O  O   . TRP A 1 385 ? 12.985  26.146 57.883 1.00 2.53  ? 366  TRP A O   1 
ATOM   3024 C  CB  . TRP A 1 385 ? 14.323  23.801 56.114 1.00 2.00  ? 366  TRP A CB  1 
ATOM   3025 C  CG  . TRP A 1 385 ? 15.174  22.579 55.885 1.00 2.00  ? 366  TRP A CG  1 
ATOM   3026 C  CD1 . TRP A 1 385 ? 15.978  21.961 56.787 1.00 2.00  ? 366  TRP A CD1 1 
ATOM   3027 C  CD2 . TRP A 1 385 ? 15.314  21.843 54.646 1.00 2.00  ? 366  TRP A CD2 1 
ATOM   3028 N  NE1 . TRP A 1 385 ? 16.635  20.906 56.195 1.00 2.05  ? 366  TRP A NE1 1 
ATOM   3029 C  CE2 . TRP A 1 385 ? 16.238  20.799 54.884 1.00 2.66  ? 366  TRP A CE2 1 
ATOM   3030 C  CE3 . TRP A 1 385 ? 14.754  21.978 53.364 1.00 2.00  ? 366  TRP A CE3 1 
ATOM   3031 C  CZ2 . TRP A 1 385 ? 16.634  19.888 53.872 1.00 2.04  ? 366  TRP A CZ2 1 
ATOM   3032 C  CZ3 . TRP A 1 385 ? 15.134  21.077 52.357 1.00 2.00  ? 366  TRP A CZ3 1 
ATOM   3033 C  CH2 . TRP A 1 385 ? 16.073  20.048 52.621 1.00 2.29  ? 366  TRP A CH2 1 
ATOM   3034 N  N   . ARG A 1 386 ? 14.673  26.946 56.636 1.00 2.00  ? 367  ARG A N   1 
ATOM   3035 C  CA  . ARG A 1 386 ? 13.980  28.182 56.276 1.00 2.00  ? 367  ARG A CA  1 
ATOM   3036 C  C   . ARG A 1 386 ? 13.108  27.922 55.038 1.00 2.00  ? 367  ARG A C   1 
ATOM   3037 O  O   . ARG A 1 386 ? 13.413  27.081 54.180 1.00 2.00  ? 367  ARG A O   1 
ATOM   3038 C  CB  . ARG A 1 386 ? 14.945  29.362 56.027 1.00 2.00  ? 367  ARG A CB  1 
ATOM   3039 C  CG  . ARG A 1 386 ? 15.957  29.624 57.171 1.00 2.00  ? 367  ARG A CG  1 
ATOM   3040 C  CD  . ARG A 1 386 ? 15.298  29.773 58.536 1.00 4.27  ? 367  ARG A CD  1 
ATOM   3041 N  NE  . ARG A 1 386 ? 14.304  30.872 58.685 1.00 4.80  ? 367  ARG A NE  1 
ATOM   3042 C  CZ  . ARG A 1 386 ? 14.601  32.122 59.073 1.00 6.14  ? 367  ARG A CZ  1 
ATOM   3043 N  NH1 . ARG A 1 386 ? 15.876  32.491 59.305 1.00 2.30  ? 367  ARG A NH1 1 
ATOM   3044 N  NH2 . ARG A 1 386 ? 13.622  33.023 59.224 1.00 6.93  ? 367  ARG A NH2 1 
ATOM   3045 N  N   . THR A 1 387 ? 11.999  28.635 54.980 1.00 2.00  ? 368  THR A N   1 
ATOM   3046 C  CA  . THR A 1 387 ? 10.964  28.326 54.028 1.00 2.07  ? 368  THR A CA  1 
ATOM   3047 C  C   . THR A 1 387 ? 10.520  29.565 53.238 1.00 2.13  ? 368  THR A C   1 
ATOM   3048 O  O   . THR A 1 387 ? 10.388  30.688 53.772 1.00 2.00  ? 368  THR A O   1 
ATOM   3049 C  CB  . THR A 1 387 ? 9.748   27.695 54.724 1.00 2.02  ? 368  THR A CB  1 
ATOM   3050 O  OG1 . THR A 1 387 ? 9.315   28.565 55.783 1.00 2.77  ? 368  THR A OG1 1 
ATOM   3051 C  CG2 . THR A 1 387 ? 10.089  26.296 55.312 1.00 2.00  ? 368  THR A CG2 1 
ATOM   3052 N  N   . PHE A 1 388 ? 10.256  29.297 51.966 1.00 2.24  ? 369  PHE A N   1 
ATOM   3053 C  CA  . PHE A 1 388 ? 9.688   30.267 51.036 1.00 2.28  ? 369  PHE A CA  1 
ATOM   3054 C  C   . PHE A 1 388 ? 8.514   29.581 50.291 1.00 2.35  ? 369  PHE A C   1 
ATOM   3055 O  O   . PHE A 1 388 ? 8.711   28.636 49.507 1.00 2.00  ? 369  PHE A O   1 
ATOM   3056 C  CB  . PHE A 1 388 ? 10.774  30.737 50.052 1.00 2.00  ? 369  PHE A CB  1 
ATOM   3057 C  CG  . PHE A 1 388 ? 10.330  31.852 49.107 1.00 3.15  ? 369  PHE A CG  1 
ATOM   3058 C  CD1 . PHE A 1 388 ? 10.952  33.098 49.147 1.00 3.94  ? 369  PHE A CD1 1 
ATOM   3059 C  CD2 . PHE A 1 388 ? 9.323   31.639 48.151 1.00 3.51  ? 369  PHE A CD2 1 
ATOM   3060 C  CE1 . PHE A 1 388 ? 10.584  34.135 48.251 1.00 3.84  ? 369  PHE A CE1 1 
ATOM   3061 C  CE2 . PHE A 1 388 ? 8.915   32.674 47.263 1.00 2.20  ? 369  PHE A CE2 1 
ATOM   3062 C  CZ  . PHE A 1 388 ? 9.561   33.912 47.302 1.00 3.17  ? 369  PHE A CZ  1 
ATOM   3063 N  N   . LEU A 1 389 ? 7.304   30.085 50.524 1.00 2.00  ? 370  LEU A N   1 
ATOM   3064 C  CA  . LEU A 1 389 ? 6.142   29.552 49.883 1.00 2.00  ? 370  LEU A CA  1 
ATOM   3065 C  C   . LEU A 1 389 ? 5.762   30.358 48.658 1.00 2.20  ? 370  LEU A C   1 
ATOM   3066 O  O   . LEU A 1 389 ? 5.528   31.560 48.739 1.00 2.00  ? 370  LEU A O   1 
ATOM   3067 C  CB  . LEU A 1 389 ? 4.955   29.481 50.840 1.00 2.00  ? 370  LEU A CB  1 
ATOM   3068 C  CG  . LEU A 1 389 ? 3.683   28.838 50.268 1.00 2.00  ? 370  LEU A CG  1 
ATOM   3069 C  CD1 . LEU A 1 389 ? 3.785   27.271 50.139 1.00 2.00  ? 370  LEU A CD1 1 
ATOM   3070 C  CD2 . LEU A 1 389 ? 2.508   29.255 51.191 1.00 2.00  ? 370  LEU A CD2 1 
ATOM   3071 N  N   . VAL A 1 390 ? 5.649   29.649 47.540 1.00 2.00  ? 371  VAL A N   1 
ATOM   3072 C  CA  . VAL A 1 390 ? 5.200   30.211 46.311 1.00 2.40  ? 371  VAL A CA  1 
ATOM   3073 C  C   . VAL A 1 390 ? 3.701   30.025 46.311 1.00 2.14  ? 371  VAL A C   1 
ATOM   3074 O  O   . VAL A 1 390 ? 3.205   28.913 46.528 1.00 2.00  ? 371  VAL A O   1 
ATOM   3075 C  CB  . VAL A 1 390 ? 5.863   29.456 45.080 1.00 2.85  ? 371  VAL A CB  1 
ATOM   3076 C  CG1 . VAL A 1 390 ? 5.124   29.779 43.781 1.00 4.31  ? 371  VAL A CG1 1 
ATOM   3077 C  CG2 . VAL A 1 390 ? 7.349   29.792 44.958 1.00 2.19  ? 371  VAL A CG2 1 
ATOM   3078 N  N   . ILE A 1 391 ? 2.972   31.114 46.073 1.00 2.00  ? 372  ILE A N   1 
ATOM   3079 C  CA  . ILE A 1 391 ? 1.508   31.047 45.981 1.00 2.00  ? 372  ILE A CA  1 
ATOM   3080 C  C   . ILE A 1 391 ? 1.087   31.628 44.639 1.00 2.70  ? 372  ILE A C   1 
ATOM   3081 O  O   . ILE A 1 391 ? 0.895   32.856 44.549 1.00 2.78  ? 372  ILE A O   1 
ATOM   3082 C  CB  . ILE A 1 391 ? 0.810   31.866 47.115 1.00 2.00  ? 372  ILE A CB  1 
ATOM   3083 C  CG1 . ILE A 1 391 ? 1.442   31.531 48.480 1.00 2.28  ? 372  ILE A CG1 1 
ATOM   3084 C  CG2 . ILE A 1 391 ? -0.709  31.621 47.103 1.00 2.00  ? 372  ILE A CG2 1 
ATOM   3085 C  CD1 . ILE A 1 391 ? 0.838   32.304 49.716 1.00 2.00  ? 372  ILE A CD1 1 
ATOM   3086 N  N   . PRO A 1 392 ? 0.968   30.763 43.584 1.00 2.40  ? 373  PRO A N   1 
ATOM   3087 C  CA  . PRO A 1 392 ? 0.723   31.321 42.246 1.00 2.24  ? 373  PRO A CA  1 
ATOM   3088 C  C   . PRO A 1 392 ? -0.528  32.197 42.118 1.00 2.42  ? 373  PRO A C   1 
ATOM   3089 O  O   . PRO A 1 392 ? -0.475  33.199 41.430 1.00 2.13  ? 373  PRO A O   1 
ATOM   3090 C  CB  . PRO A 1 392 ? 0.680   30.074 41.327 1.00 2.00  ? 373  PRO A CB  1 
ATOM   3091 C  CG  . PRO A 1 392 ? 1.569   29.073 42.080 1.00 2.94  ? 373  PRO A CG  1 
ATOM   3092 C  CD  . PRO A 1 392 ? 1.142   29.293 43.533 1.00 2.00  ? 373  PRO A CD  1 
ATOM   3093 N  N   . GLU A 1 393 ? -1.616  31.843 42.802 1.00 2.95  ? 374  GLU A N   1 
ATOM   3094 C  CA  . GLU A 1 393 ? -2.867  32.643 42.744 1.00 2.94  ? 374  GLU A CA  1 
ATOM   3095 C  C   . GLU A 1 393 ? -2.717  34.020 43.331 1.00 3.16  ? 374  GLU A C   1 
ATOM   3096 O  O   . GLU A 1 393 ? -3.566  34.880 43.081 1.00 2.40  ? 374  GLU A O   1 
ATOM   3097 C  CB  . GLU A 1 393 ? -4.041  31.953 43.465 1.00 2.94  ? 374  GLU A CB  1 
ATOM   3098 C  CG  . GLU A 1 393 ? -4.230  30.483 43.120 1.00 3.45  ? 374  GLU A CG  1 
ATOM   3099 C  CD  . GLU A 1 393 ? -3.663  29.559 44.170 1.00 4.50  ? 374  GLU A CD  1 
ATOM   3100 O  OE1 . GLU A 1 393 ? -2.453  29.662 44.425 1.00 2.66  ? 374  GLU A OE1 1 
ATOM   3101 O  OE2 . GLU A 1 393 ? -4.439  28.718 44.724 1.00 3.76  ? 374  GLU A OE2 1 
ATOM   3102 N  N   . LEU A 1 394 ? -1.678  34.232 44.151 1.00 3.49  ? 375  LEU A N   1 
ATOM   3103 C  CA  . LEU A 1 394 ? -1.463  35.542 44.742 1.00 5.01  ? 375  LEU A CA  1 
ATOM   3104 C  C   . LEU A 1 394 ? -1.329  36.612 43.654 1.00 6.72  ? 375  LEU A C   1 
ATOM   3105 O  O   . LEU A 1 394 ? -1.771  37.732 43.858 1.00 7.93  ? 375  LEU A O   1 
ATOM   3106 C  CB  . LEU A 1 394 ? -0.243  35.544 45.670 1.00 5.23  ? 375  LEU A CB  1 
ATOM   3107 C  CG  . LEU A 1 394 ? -0.024  36.755 46.596 1.00 6.25  ? 375  LEU A CG  1 
ATOM   3108 C  CD1 . LEU A 1 394 ? -1.229  37.069 47.541 1.00 2.00  ? 375  LEU A CD1 1 
ATOM   3109 C  CD2 . LEU A 1 394 ? 1.315   36.614 47.352 1.00 4.70  ? 375  LEU A CD2 1 
ATOM   3110 N  N   . ALA A 1 395 ? -0.761  36.232 42.502 1.00 7.29  ? 376  ALA A N   1 
ATOM   3111 C  CA  . ALA A 1 395 ? -0.597  37.107 41.339 1.00 9.19  ? 376  ALA A CA  1 
ATOM   3112 C  C   . ALA A 1 395 ? -1.875  37.819 40.953 1.00 9.56  ? 376  ALA A C   1 
ATOM   3113 O  O   . ALA A 1 395 ? -1.795  38.948 40.520 1.00 11.60 ? 376  ALA A O   1 
ATOM   3114 C  CB  . ALA A 1 395 ? -0.029  36.324 40.114 1.00 8.14  ? 376  ALA A CB  1 
ATOM   3115 N  N   . GLN A 1 396 ? -3.031  37.157 41.094 1.00 9.03  ? 377  GLN A N   1 
ATOM   3116 C  CA  . GLN A 1 396 ? -4.340  37.753 40.817 1.00 8.02  ? 377  GLN A CA  1 
ATOM   3117 C  C   . GLN A 1 396 ? -5.141  38.161 42.085 1.00 7.48  ? 377  GLN A C   1 
ATOM   3118 O  O   . GLN A 1 396 ? -5.859  39.162 42.063 1.00 6.93  ? 377  GLN A O   1 
ATOM   3119 C  CB  . GLN A 1 396 ? -5.171  36.847 39.865 1.00 8.69  ? 377  GLN A CB  1 
ATOM   3120 C  CG  . GLN A 1 396 ? -6.532  37.429 39.326 1.00 9.78  ? 377  GLN A CG  1 
ATOM   3121 C  CD  . GLN A 1 396 ? -6.440  38.833 38.691 1.00 12.70 ? 377  GLN A CD  1 
ATOM   3122 O  OE1 . GLN A 1 396 ? -5.376  39.287 38.251 1.00 14.06 ? 377  GLN A OE1 1 
ATOM   3123 N  NE2 . GLN A 1 396 ? -7.574  39.520 38.642 1.00 14.38 ? 377  GLN A NE2 1 
ATOM   3124 N  N   . GLU A 1 397 ? -5.015  37.414 43.182 1.00 5.95  ? 378  GLU A N   1 
ATOM   3125 C  CA  . GLU A 1 397 ? -5.611  37.851 44.454 1.00 6.38  ? 378  GLU A CA  1 
ATOM   3126 C  C   . GLU A 1 397 ? -5.149  39.262 44.896 1.00 6.15  ? 378  GLU A C   1 
ATOM   3127 O  O   . GLU A 1 397 ? -5.920  39.985 45.513 1.00 5.96  ? 378  GLU A O   1 
ATOM   3128 C  CB  . GLU A 1 397 ? -5.347  36.849 45.586 1.00 5.05  ? 378  GLU A CB  1 
ATOM   3129 C  CG  . GLU A 1 397 ? -6.007  35.470 45.348 1.00 6.96  ? 378  GLU A CG  1 
ATOM   3130 C  CD  . GLU A 1 397 ? -6.932  35.064 46.497 1.00 4.20  ? 378  GLU A CD  1 
ATOM   3131 O  OE1 . GLU A 1 397 ? -6.992  35.793 47.506 1.00 3.39  ? 378  GLU A OE1 1 
ATOM   3132 O  OE2 . GLU A 1 397 ? -7.634  34.049 46.371 1.00 4.12  ? 378  GLU A OE2 1 
ATOM   3133 N  N   . LEU A 1 398 ? -3.892  39.609 44.624 1.00 5.74  ? 379  LEU A N   1 
ATOM   3134 C  CA  . LEU A 1 398 ? -3.377  40.954 44.887 1.00 7.02  ? 379  LEU A CA  1 
ATOM   3135 C  C   . LEU A 1 398 ? -4.141  41.991 44.076 1.00 7.33  ? 379  LEU A C   1 
ATOM   3136 O  O   . LEU A 1 398 ? -4.487  43.038 44.610 1.00 7.79  ? 379  LEU A O   1 
ATOM   3137 C  CB  . LEU A 1 398 ? -1.868  41.052 44.590 1.00 6.24  ? 379  LEU A CB  1 
ATOM   3138 C  CG  . LEU A 1 398 ? -0.974  40.401 45.651 1.00 7.57  ? 379  LEU A CG  1 
ATOM   3139 C  CD1 . LEU A 1 398 ? 0.481   40.251 45.172 1.00 5.43  ? 379  LEU A CD1 1 
ATOM   3140 C  CD2 . LEU A 1 398 ? -1.073  41.161 46.987 1.00 6.69  ? 379  LEU A CD2 1 
ATOM   3141 N  N   . HIS A 1 399 ? -4.431  41.695 42.807 1.00 7.31  ? 380  HIS A N   1 
ATOM   3142 C  CA  . HIS A 1 399 ? -5.218  42.627 42.017 1.00 8.65  ? 380  HIS A CA  1 
ATOM   3143 C  C   . HIS A 1 399 ? -6.610  42.859 42.609 1.00 7.95  ? 380  HIS A C   1 
ATOM   3144 O  O   . HIS A 1 399 ? -7.013  44.001 42.773 1.00 7.20  ? 380  HIS A O   1 
ATOM   3145 C  CB  . HIS A 1 399 ? -5.262  42.251 40.522 1.00 9.60  ? 380  HIS A CB  1 
ATOM   3146 C  CG  . HIS A 1 399 ? -3.978  42.556 39.791 1.00 14.48 ? 380  HIS A CG  1 
ATOM   3147 N  ND1 . HIS A 1 399 ? -3.696  43.800 39.251 1.00 17.88 ? 380  HIS A ND1 1 
ATOM   3148 C  CD2 . HIS A 1 399 ? -2.898  41.775 39.515 1.00 16.16 ? 380  HIS A CD2 1 
ATOM   3149 C  CE1 . HIS A 1 399 ? -2.504  43.768 38.676 1.00 18.78 ? 380  HIS A CE1 1 
ATOM   3150 N  NE2 . HIS A 1 399 ? -1.995  42.554 38.830 1.00 15.39 ? 380  HIS A NE2 1 
ATOM   3151 N  N   . VAL A 1 400 ? -7.324  41.787 42.949 1.00 7.60  ? 381  VAL A N   1 
ATOM   3152 C  CA  . VAL A 1 400 ? -8.658  41.905 43.576 1.00 7.85  ? 381  VAL A CA  1 
ATOM   3153 C  C   . VAL A 1 400 ? -8.583  42.637 44.911 1.00 8.35  ? 381  VAL A C   1 
ATOM   3154 O  O   . VAL A 1 400 ? -9.428  43.468 45.216 1.00 8.24  ? 381  VAL A O   1 
ATOM   3155 C  CB  . VAL A 1 400 ? -9.370  40.519 43.775 1.00 7.45  ? 381  VAL A CB  1 
ATOM   3156 C  CG1 . VAL A 1 400 ? -10.758 40.717 44.369 1.00 5.27  ? 381  VAL A CG1 1 
ATOM   3157 C  CG2 . VAL A 1 400 ? -9.461  39.733 42.445 1.00 6.44  ? 381  VAL A CG2 1 
ATOM   3158 N  N   . TRP A 1 401 ? -7.570  42.307 45.710 1.00 9.79  ? 382  TRP A N   1 
ATOM   3159 C  CA  . TRP A 1 401 ? -7.385  42.893 47.043 1.00 10.65 ? 382  TRP A CA  1 
ATOM   3160 C  C   . TRP A 1 401 ? -7.288  44.407 46.993 1.00 11.90 ? 382  TRP A C   1 
ATOM   3161 O  O   . TRP A 1 401 ? -7.952  45.102 47.772 1.00 12.30 ? 382  TRP A O   1 
ATOM   3162 C  CB  . TRP A 1 401 ? -6.150  42.313 47.740 1.00 10.07 ? 382  TRP A CB  1 
ATOM   3163 C  CG  . TRP A 1 401 ? -5.904  42.945 49.092 1.00 10.31 ? 382  TRP A CG  1 
ATOM   3164 C  CD1 . TRP A 1 401 ? -5.001  43.937 49.396 1.00 9.60  ? 382  TRP A CD1 1 
ATOM   3165 C  CD2 . TRP A 1 401 ? -6.578  42.636 50.314 1.00 10.61 ? 382  TRP A CD2 1 
ATOM   3166 N  NE1 . TRP A 1 401 ? -5.066  44.248 50.725 1.00 8.54  ? 382  TRP A NE1 1 
ATOM   3167 C  CE2 . TRP A 1 401 ? -6.023  43.470 51.321 1.00 8.96  ? 382  TRP A CE2 1 
ATOM   3168 C  CE3 . TRP A 1 401 ? -7.580  41.716 50.668 1.00 12.35 ? 382  TRP A CE3 1 
ATOM   3169 C  CZ2 . TRP A 1 401 ? -6.460  43.441 52.649 1.00 8.33  ? 382  TRP A CZ2 1 
ATOM   3170 C  CZ3 . TRP A 1 401 ? -8.010  41.688 52.019 1.00 11.50 ? 382  TRP A CZ3 1 
ATOM   3171 C  CH2 . TRP A 1 401 ? -7.444  42.540 52.977 1.00 9.67  ? 382  TRP A CH2 1 
ATOM   3172 N  N   . THR A 1 402 ? -6.459  44.914 46.084 1.00 13.38 ? 383  THR A N   1 
ATOM   3173 C  CA  . THR A 1 402 ? -6.323  46.351 45.881 1.00 15.14 ? 383  THR A CA  1 
ATOM   3174 C  C   . THR A 1 402 ? -7.557  46.953 45.174 1.00 16.19 ? 383  THR A C   1 
ATOM   3175 O  O   . THR A 1 402 ? -8.099  47.949 45.634 1.00 16.10 ? 383  THR A O   1 
ATOM   3176 C  CB  . THR A 1 402 ? -4.956  46.743 45.213 1.00 15.28 ? 383  THR A CB  1 
ATOM   3177 O  OG1 . THR A 1 402 ? -4.819  48.168 45.167 1.00 14.93 ? 383  THR A OG1 1 
ATOM   3178 C  CG2 . THR A 1 402 ? -4.812  46.209 43.798 1.00 16.84 ? 383  THR A CG2 1 
ATOM   3179 N  N   . ASP A 1 403 ? -8.032  46.320 44.103 1.00 17.52 ? 384  ASP A N   1 
ATOM   3180 C  CA  . ASP A 1 403 ? -9.203  46.816 43.369 1.00 19.51 ? 384  ASP A CA  1 
ATOM   3181 C  C   . ASP A 1 403 ? -10.495 46.877 44.205 1.00 20.08 ? 384  ASP A C   1 
ATOM   3182 O  O   . ASP A 1 403 ? -11.339 47.738 43.980 1.00 20.18 ? 384  ASP A O   1 
ATOM   3183 C  CB  . ASP A 1 403 ? -9.424  46.014 42.081 1.00 20.00 ? 384  ASP A CB  1 
ATOM   3184 C  CG  . ASP A 1 403 ? -10.474 46.642 41.162 1.00 23.39 ? 384  ASP A CG  1 
ATOM   3185 O  OD1 . ASP A 1 403 ? -10.395 47.872 40.874 1.00 25.87 ? 384  ASP A OD1 1 
ATOM   3186 O  OD2 . ASP A 1 403 ? -11.377 45.893 40.708 1.00 26.48 ? 384  ASP A OD2 1 
ATOM   3187 N  N   . LYS A 1 404 ? -10.636 45.983 45.179 1.00 21.13 ? 385  LYS A N   1 
ATOM   3188 C  CA  . LYS A 1 404 ? -11.856 45.918 45.984 1.00 21.99 ? 385  LYS A CA  1 
ATOM   3189 C  C   . LYS A 1 404 ? -11.614 46.303 47.436 1.00 22.73 ? 385  LYS A C   1 
ATOM   3190 O  O   . LYS A 1 404 ? -12.433 46.005 48.299 1.00 23.88 ? 385  LYS A O   1 
ATOM   3191 C  CB  . LYS A 1 404 ? -12.498 44.515 45.893 1.00 22.17 ? 385  LYS A CB  1 
ATOM   3192 C  CG  . LYS A 1 404 ? -12.840 44.060 44.472 1.00 20.87 ? 385  LYS A CG  1 
ATOM   3193 C  CD  . LYS A 1 404 ? -13.838 44.993 43.789 1.00 22.26 ? 385  LYS A CD  1 
ATOM   3194 C  CE  . LYS A 1 404 ? -14.100 44.551 42.349 1.00 23.06 ? 385  LYS A CE  1 
ATOM   3195 N  NZ  . LYS A 1 404 ? -15.146 45.382 41.657 1.00 23.66 ? 385  LYS A NZ  1 
ATOM   3196 N  N   . SER A 1 405 ? -10.497 46.982 47.688 1.00 23.23 ? 386  SER A N   1 
ATOM   3197 C  CA  A SER A 1 405 ? -10.108 47.393 49.037 0.50 23.07 ? 386  SER A CA  1 
ATOM   3198 C  CA  B SER A 1 405 ? -10.099 47.402 49.032 0.50 23.45 ? 386  SER A CA  1 
ATOM   3199 C  C   . SER A 1 405 ? -11.227 48.135 49.771 1.00 23.71 ? 386  SER A C   1 
ATOM   3200 O  O   . SER A 1 405 ? -11.353 48.024 51.002 1.00 23.73 ? 386  SER A O   1 
ATOM   3201 C  CB  A SER A 1 405 ? -8.838  48.256 48.987 0.50 23.16 ? 386  SER A CB  1 
ATOM   3202 C  CB  B SER A 1 405 ? -8.850  48.294 48.943 0.50 23.61 ? 386  SER A CB  1 
ATOM   3203 O  OG  A SER A 1 405 ? -9.029  49.417 48.192 0.50 21.34 ? 386  SER A OG  1 
ATOM   3204 O  OG  B SER A 1 405 ? -8.067  48.236 50.124 0.50 24.10 ? 386  SER A OG  1 
ATOM   3205 N  N   . SER A 1 406 ? -12.044 48.889 49.021 1.00 23.93 ? 387  SER A N   1 
ATOM   3206 C  CA  . SER A 1 406 ? -13.146 49.650 49.615 1.00 24.41 ? 387  SER A CA  1 
ATOM   3207 C  C   . SER A 1 406 ? -14.181 48.758 50.314 1.00 24.39 ? 387  SER A C   1 
ATOM   3208 O  O   . SER A 1 406 ? -14.744 49.149 51.333 1.00 24.11 ? 387  SER A O   1 
ATOM   3209 C  CB  . SER A 1 406 ? -13.800 50.609 48.596 1.00 24.82 ? 387  SER A CB  1 
ATOM   3210 O  OG  . SER A 1 406 ? -14.779 49.956 47.806 1.00 25.93 ? 387  SER A OG  1 
ATOM   3211 N  N   . LEU A 1 407 ? -14.399 47.553 49.781 1.00 24.47 ? 388  LEU A N   1 
ATOM   3212 C  CA  . LEU A 1 407 ? -15.296 46.570 50.405 1.00 24.74 ? 388  LEU A CA  1 
ATOM   3213 C  C   . LEU A 1 407 ? -14.733 45.990 51.710 1.00 24.55 ? 388  LEU A C   1 
ATOM   3214 O  O   . LEU A 1 407 ? -15.459 45.864 52.706 1.00 24.56 ? 388  LEU A O   1 
ATOM   3215 C  CB  . LEU A 1 407 ? -15.652 45.438 49.424 1.00 25.05 ? 388  LEU A CB  1 
ATOM   3216 C  CG  . LEU A 1 407 ? -16.906 45.650 48.563 1.00 25.95 ? 388  LEU A CG  1 
ATOM   3217 C  CD1 . LEU A 1 407 ? -16.689 46.738 47.509 1.00 28.23 ? 388  LEU A CD1 1 
ATOM   3218 C  CD2 . LEU A 1 407 ? -17.281 44.353 47.884 1.00 26.84 ? 388  LEU A CD2 1 
ATOM   3219 N  N   . PHE A 1 408 ? -13.447 45.640 51.702 1.00 23.89 ? 389  PHE A N   1 
ATOM   3220 C  CA  . PHE A 1 408 ? -12.786 45.210 52.925 1.00 23.70 ? 389  PHE A CA  1 
ATOM   3221 C  C   . PHE A 1 408 ? -12.757 46.310 54.000 1.00 24.07 ? 389  PHE A C   1 
ATOM   3222 O  O   . PHE A 1 408 ? -13.004 46.029 55.179 1.00 23.88 ? 389  PHE A O   1 
ATOM   3223 C  CB  . PHE A 1 408 ? -11.375 44.679 52.659 1.00 22.79 ? 389  PHE A CB  1 
ATOM   3224 C  CG  . PHE A 1 408 ? -10.746 44.036 53.865 1.00 22.10 ? 389  PHE A CG  1 
ATOM   3225 C  CD1 . PHE A 1 408 ? -11.120 42.754 54.260 1.00 21.17 ? 389  PHE A CD1 1 
ATOM   3226 C  CD2 . PHE A 1 408 ? -9.800  44.722 54.625 1.00 21.18 ? 389  PHE A CD2 1 
ATOM   3227 C  CE1 . PHE A 1 408 ? -10.551 42.165 55.378 1.00 20.06 ? 389  PHE A CE1 1 
ATOM   3228 C  CE2 . PHE A 1 408 ? -9.216  44.134 55.743 1.00 19.42 ? 389  PHE A CE2 1 
ATOM   3229 C  CZ  . PHE A 1 408 ? -9.600  42.859 56.123 1.00 21.07 ? 389  PHE A CZ  1 
ATOM   3230 N  N   . GLU A 1 409 ? -12.431 47.540 53.594 1.00 24.24 ? 390  GLU A N   1 
ATOM   3231 C  CA  . GLU A 1 409 ? -12.416 48.668 54.513 1.00 25.59 ? 390  GLU A CA  1 
ATOM   3232 C  C   . GLU A 1 409 ? -13.810 48.832 55.129 1.00 25.33 ? 390  GLU A C   1 
ATOM   3233 O  O   . GLU A 1 409 ? -13.934 48.953 56.350 1.00 25.45 ? 390  GLU A O   1 
ATOM   3234 C  CB  . GLU A 1 409 ? -11.990 49.968 53.807 1.00 25.49 ? 390  GLU A CB  1 
ATOM   3235 C  CG  . GLU A 1 409 ? -10.532 50.009 53.326 1.00 27.09 ? 390  GLU A CG  1 
ATOM   3236 C  CD  . GLU A 1 409 ? -10.297 51.033 52.196 1.00 27.79 ? 390  GLU A CD  1 
ATOM   3237 O  OE1 . GLU A 1 409 ? -11.008 52.061 52.145 1.00 30.45 ? 390  GLU A OE1 1 
ATOM   3238 O  OE2 . GLU A 1 409 ? -9.400  50.808 51.348 1.00 31.54 ? 390  GLU A OE2 1 
ATOM   3239 N  N   . GLU A 1 410 ? -14.852 48.806 54.293 1.00 24.73 ? 391  GLU A N   1 
ATOM   3240 C  CA  . GLU A 1 410 ? -16.222 48.901 54.794 1.00 24.64 ? 391  GLU A CA  1 
ATOM   3241 C  C   . GLU A 1 410 ? -16.495 47.848 55.867 1.00 24.47 ? 391  GLU A C   1 
ATOM   3242 O  O   . GLU A 1 410 ? -17.006 48.165 56.938 1.00 23.99 ? 391  GLU A O   1 
ATOM   3243 C  CB  . GLU A 1 410 ? -17.264 48.828 53.666 1.00 24.42 ? 391  GLU A CB  1 
ATOM   3244 C  CG  . GLU A 1 410 ? -18.697 48.818 54.192 1.00 24.62 ? 391  GLU A CG  1 
ATOM   3245 C  CD  . GLU A 1 410 ? -19.764 48.990 53.129 1.00 25.51 ? 391  GLU A CD  1 
ATOM   3246 O  OE1 . GLU A 1 410 ? -19.461 48.844 51.918 1.00 27.17 ? 391  GLU A OE1 1 
ATOM   3247 O  OE2 . GLU A 1 410 ? -20.925 49.265 53.519 1.00 25.26 ? 391  GLU A OE2 1 
ATOM   3248 N  N   . LEU A 1 411 ? -16.137 46.600 55.573 1.00 24.60 ? 392  LEU A N   1 
ATOM   3249 C  CA  . LEU A 1 411 ? -16.304 45.504 56.515 1.00 24.93 ? 392  LEU A CA  1 
ATOM   3250 C  C   . LEU A 1 411 ? -15.550 45.754 57.841 1.00 25.04 ? 392  LEU A C   1 
ATOM   3251 O  O   . LEU A 1 411 ? -16.103 45.575 58.931 1.00 24.59 ? 392  LEU A O   1 
ATOM   3252 C  CB  . LEU A 1 411 ? -15.882 44.191 55.840 1.00 25.14 ? 392  LEU A CB  1 
ATOM   3253 C  CG  . LEU A 1 411 ? -15.868 42.868 56.598 1.00 26.21 ? 392  LEU A CG  1 
ATOM   3254 C  CD1 . LEU A 1 411 ? -17.249 42.527 57.181 1.00 27.07 ? 392  LEU A CD1 1 
ATOM   3255 C  CD2 . LEU A 1 411 ? -15.392 41.771 55.653 1.00 24.51 ? 392  LEU A CD2 1 
ATOM   3256 N  N   . GLN A 1 412 ? -14.297 46.190 57.739 1.00 25.28 ? 393  GLN A N   1 
ATOM   3257 C  CA  . GLN A 1 412 ? -13.523 46.591 58.913 1.00 25.94 ? 393  GLN A CA  1 
ATOM   3258 C  C   . GLN A 1 412 ? -14.202 47.700 59.739 1.00 25.89 ? 393  GLN A C   1 
ATOM   3259 O  O   . GLN A 1 412 ? -14.116 47.686 60.970 1.00 26.49 ? 393  GLN A O   1 
ATOM   3260 C  CB  . GLN A 1 412 ? -12.085 46.985 58.530 1.00 25.63 ? 393  GLN A CB  1 
ATOM   3261 C  CG  . GLN A 1 412 ? -11.174 45.781 58.222 1.00 26.80 ? 393  GLN A CG  1 
ATOM   3262 C  CD  . GLN A 1 412 ? -9.678  46.061 58.468 1.00 27.64 ? 393  GLN A CD  1 
ATOM   3263 O  OE1 . GLN A 1 412 ? -9.114  47.010 57.911 1.00 28.36 ? 393  GLN A OE1 1 
ATOM   3264 N  NE2 . GLN A 1 412 ? -9.031  45.218 59.302 1.00 28.83 ? 393  GLN A NE2 1 
ATOM   3265 N  N   . SER A 1 413 ? -14.874 48.648 59.079 1.00 25.22 ? 394  SER A N   1 
ATOM   3266 C  CA  . SER A 1 413 ? -15.568 49.738 59.789 1.00 25.03 ? 394  SER A CA  1 
ATOM   3267 C  C   . SER A 1 413 ? -16.838 49.265 60.473 1.00 24.46 ? 394  SER A C   1 
ATOM   3268 O  O   . SER A 1 413 ? -17.143 49.698 61.568 1.00 24.26 ? 394  SER A O   1 
ATOM   3269 C  CB  . SER A 1 413 ? -15.910 50.885 58.842 1.00 24.99 ? 394  SER A CB  1 
ATOM   3270 O  OG  . SER A 1 413 ? -14.762 51.265 58.115 1.00 26.36 ? 394  SER A OG  1 
ATOM   3271 N  N   . LEU A 1 414 ? -17.569 48.376 59.809 1.00 24.62 ? 395  LEU A N   1 
ATOM   3272 C  CA  . LEU A 1 414 ? -18.786 47.776 60.347 1.00 24.80 ? 395  LEU A CA  1 
ATOM   3273 C  C   . LEU A 1 414 ? -18.499 46.924 61.580 1.00 24.78 ? 395  LEU A C   1 
ATOM   3274 O  O   . LEU A 1 414 ? -19.195 47.044 62.584 1.00 24.05 ? 395  LEU A O   1 
ATOM   3275 C  CB  . LEU A 1 414 ? -19.472 46.916 59.281 1.00 24.82 ? 395  LEU A CB  1 
ATOM   3276 C  CG  . LEU A 1 414 ? -20.092 47.655 58.092 1.00 24.80 ? 395  LEU A CG  1 
ATOM   3277 C  CD1 . LEU A 1 414 ? -20.251 46.687 56.932 1.00 24.61 ? 395  LEU A CD1 1 
ATOM   3278 C  CD2 . LEU A 1 414 ? -21.422 48.328 58.455 1.00 24.01 ? 395  LEU A CD2 1 
ATOM   3279 N  N   . ASP A 1 415 ? -17.475 46.067 61.488 1.00 25.46 ? 396  ASP A N   1 
ATOM   3280 C  CA  . ASP A 1 415 ? -17.056 45.192 62.599 1.00 26.18 ? 396  ASP A CA  1 
ATOM   3281 C  C   . ASP A 1 415 ? -16.772 46.028 63.865 1.00 26.09 ? 396  ASP A C   1 
ATOM   3282 O  O   . ASP A 1 415 ? -17.180 45.662 64.969 1.00 25.99 ? 396  ASP A O   1 
ATOM   3283 C  CB  . ASP A 1 415 ? -15.827 44.331 62.206 1.00 26.19 ? 396  ASP A CB  1 
ATOM   3284 C  CG  . ASP A 1 415 ? -16.168 43.203 61.209 1.00 28.10 ? 396  ASP A CG  1 
ATOM   3285 O  OD1 . ASP A 1 415 ? -17.342 42.792 61.135 1.00 30.33 ? 396  ASP A OD1 1 
ATOM   3286 O  OD2 . ASP A 1 415 ? -15.253 42.710 60.502 1.00 28.59 ? 396  ASP A OD2 1 
ATOM   3287 N  N   . ILE A 1 416 ? -16.091 47.155 63.669 1.00 26.30 ? 397  ILE A N   1 
ATOM   3288 C  CA  . ILE A 1 416 ? -15.744 48.102 64.736 1.00 26.92 ? 397  ILE A CA  1 
ATOM   3289 C  C   . ILE A 1 416 ? -16.964 48.862 65.270 1.00 26.84 ? 397  ILE A C   1 
ATOM   3290 O  O   . ILE A 1 416 ? -17.074 49.113 66.485 1.00 27.23 ? 397  ILE A O   1 
ATOM   3291 C  CB  . ILE A 1 416 ? -14.612 49.069 64.260 1.00 27.06 ? 397  ILE A CB  1 
ATOM   3292 C  CG1 . ILE A 1 416 ? -13.317 48.266 64.012 1.00 27.51 ? 397  ILE A CG1 1 
ATOM   3293 C  CG2 . ILE A 1 416 ? -14.381 50.218 65.247 1.00 26.77 ? 397  ILE A CG2 1 
ATOM   3294 C  CD1 . ILE A 1 416 ? -12.155 49.071 63.443 1.00 27.54 ? 397  ILE A CD1 1 
ATOM   3295 N  N   . PHE A 1 417 ? -17.880 49.218 64.369 1.00 26.72 ? 398  PHE A N   1 
ATOM   3296 C  CA  . PHE A 1 417 ? -19.130 49.897 64.740 1.00 26.34 ? 398  PHE A CA  1 
ATOM   3297 C  C   . PHE A 1 417 ? -20.057 48.976 65.549 1.00 26.12 ? 398  PHE A C   1 
ATOM   3298 O  O   . PHE A 1 417 ? -20.585 49.383 66.585 1.00 25.46 ? 398  PHE A O   1 
ATOM   3299 C  CB  . PHE A 1 417 ? -19.836 50.451 63.488 1.00 26.57 ? 398  PHE A CB  1 
ATOM   3300 C  CG  . PHE A 1 417 ? -21.084 51.251 63.783 1.00 27.12 ? 398  PHE A CG  1 
ATOM   3301 C  CD1 . PHE A 1 417 ? -21.029 52.393 64.580 1.00 27.52 ? 398  PHE A CD1 1 
ATOM   3302 C  CD2 . PHE A 1 417 ? -22.312 50.869 63.248 1.00 27.63 ? 398  PHE A CD2 1 
ATOM   3303 C  CE1 . PHE A 1 417 ? -22.181 53.134 64.856 1.00 27.75 ? 398  PHE A CE1 1 
ATOM   3304 C  CE2 . PHE A 1 417 ? -23.468 51.608 63.511 1.00 27.61 ? 398  PHE A CE2 1 
ATOM   3305 C  CZ  . PHE A 1 417 ? -23.401 52.740 64.317 1.00 27.63 ? 398  PHE A CZ  1 
ATOM   3306 N  N   . LEU A 1 418 ? -20.232 47.735 65.079 1.00 26.06 ? 399  LEU A N   1 
ATOM   3307 C  CA  . LEU A 1 418 ? -20.980 46.701 65.821 1.00 26.14 ? 399  LEU A CA  1 
ATOM   3308 C  C   . LEU A 1 418 ? -20.469 46.512 67.277 1.00 26.26 ? 399  LEU A C   1 
ATOM   3309 O  O   . LEU A 1 418 ? -21.270 46.366 68.206 1.00 25.55 ? 399  LEU A O   1 
ATOM   3310 C  CB  . LEU A 1 418 ? -20.992 45.367 65.054 1.00 26.09 ? 399  LEU A CB  1 
ATOM   3311 C  CG  . LEU A 1 418 ? -21.691 44.134 65.662 1.00 26.53 ? 399  LEU A CG  1 
ATOM   3312 C  CD1 . LEU A 1 418 ? -23.217 44.327 65.790 1.00 27.08 ? 399  LEU A CD1 1 
ATOM   3313 C  CD2 . LEU A 1 418 ? -21.366 42.858 64.879 1.00 25.92 ? 399  LEU A CD2 1 
ATOM   3314 N  N   . ALA A 1 419 ? -19.145 46.524 67.457 1.00 26.26 ? 400  ALA A N   1 
ATOM   3315 C  CA  . ALA A 1 419 ? -18.533 46.567 68.790 1.00 26.56 ? 400  ALA A CA  1 
ATOM   3316 C  C   . ALA A 1 419 ? -18.423 48.003 69.327 1.00 26.46 ? 400  ALA A C   1 
ATOM   3317 O  O   . ALA A 1 419 ? -19.430 48.679 69.583 1.00 26.81 ? 400  ALA A O   1 
ATOM   3318 C  CB  . ALA A 1 419 ? -17.161 45.901 68.757 1.00 26.29 ? 400  ALA A CB  1 
ATOM   3319 N  N   . SER A 1 436 ? -30.059 43.013 64.131 1.00 27.19 ? 417  SER A N   1 
ATOM   3320 C  CA  . SER A 1 436 ? -29.646 44.363 63.763 1.00 27.07 ? 417  SER A CA  1 
ATOM   3321 C  C   . SER A 1 436 ? -29.364 44.473 62.258 1.00 26.99 ? 417  SER A C   1 
ATOM   3322 O  O   . SER A 1 436 ? -28.974 43.487 61.608 1.00 26.75 ? 417  SER A O   1 
ATOM   3323 C  CB  . SER A 1 436 ? -28.423 44.796 64.585 1.00 27.12 ? 417  SER A CB  1 
ATOM   3324 O  OG  . SER A 1 436 ? -27.258 44.094 64.180 1.00 27.24 ? 417  SER A OG  1 
ATOM   3325 N  N   . SER A 1 437 ? -29.565 45.675 61.715 1.00 26.77 ? 418  SER A N   1 
ATOM   3326 C  CA  . SER A 1 437 ? -29.305 45.944 60.292 1.00 26.51 ? 418  SER A CA  1 
ATOM   3327 C  C   . SER A 1 437 ? -27.807 45.958 59.953 1.00 26.07 ? 418  SER A C   1 
ATOM   3328 O  O   . SER A 1 437 ? -27.426 45.820 58.780 1.00 25.89 ? 418  SER A O   1 
ATOM   3329 C  CB  . SER A 1 437 ? -29.988 47.245 59.832 1.00 26.70 ? 418  SER A CB  1 
ATOM   3330 O  OG  . SER A 1 437 ? -29.256 48.391 60.231 1.00 27.13 ? 418  SER A OG  1 
ATOM   3331 N  N   . ILE A 1 438 ? -26.974 46.133 60.982 1.00 25.44 ? 419  ILE A N   1 
ATOM   3332 C  CA  . ILE A 1 438 ? -25.515 46.073 60.843 1.00 24.83 ? 419  ILE A CA  1 
ATOM   3333 C  C   . ILE A 1 438 ? -25.043 44.632 60.573 1.00 24.49 ? 419  ILE A C   1 
ATOM   3334 O  O   . ILE A 1 438 ? -24.218 44.404 59.686 1.00 24.45 ? 419  ILE A O   1 
ATOM   3335 C  CB  . ILE A 1 438 ? -24.790 46.708 62.077 1.00 24.72 ? 419  ILE A CB  1 
ATOM   3336 C  CG1 . ILE A 1 438 ? -25.118 48.204 62.185 1.00 25.02 ? 419  ILE A CG1 1 
ATOM   3337 C  CG2 . ILE A 1 438 ? -23.268 46.491 62.030 1.00 24.24 ? 419  ILE A CG2 1 
ATOM   3338 C  CD1 . ILE A 1 438 ? -24.747 49.044 60.952 1.00 25.77 ? 419  ILE A CD1 1 
ATOM   3339 N  N   . GLN A 1 439 ? -25.591 43.672 61.320 1.00 23.88 ? 420  GLN A N   1 
ATOM   3340 C  CA  . GLN A 1 439 ? -25.259 42.253 61.160 1.00 23.66 ? 420  GLN A CA  1 
ATOM   3341 C  C   . GLN A 1 439 ? -25.561 41.721 59.741 1.00 22.90 ? 420  GLN A C   1 
ATOM   3342 O  O   . GLN A 1 439 ? -24.764 40.971 59.169 1.00 22.79 ? 420  GLN A O   1 
ATOM   3343 C  CB  . GLN A 1 439 ? -26.002 41.431 62.214 1.00 23.68 ? 420  GLN A CB  1 
ATOM   3344 C  CG  . GLN A 1 439 ? -25.143 40.378 62.903 1.00 24.48 ? 420  GLN A CG  1 
ATOM   3345 C  CD  . GLN A 1 439 ? -25.907 39.590 63.973 1.00 24.99 ? 420  GLN A CD  1 
ATOM   3346 O  OE1 . GLN A 1 439 ? -26.529 40.165 64.886 1.00 23.83 ? 420  GLN A OE1 1 
ATOM   3347 N  NE2 . GLN A 1 439 ? -25.856 38.256 63.863 1.00 26.54 ? 420  GLN A NE2 1 
ATOM   3348 N  N   . ARG A 1 440 ? -26.715 42.123 59.199 1.00 22.00 ? 421  ARG A N   1 
ATOM   3349 C  CA  . ARG A 1 440 ? -27.156 41.789 57.842 1.00 20.99 ? 421  ARG A CA  1 
ATOM   3350 C  C   . ARG A 1 440 ? -26.295 42.479 56.792 1.00 20.06 ? 421  ARG A C   1 
ATOM   3351 O  O   . ARG A 1 440 ? -26.036 41.915 55.720 1.00 19.38 ? 421  ARG A O   1 
ATOM   3352 C  CB  . ARG A 1 440 ? -28.615 42.215 57.635 1.00 21.04 ? 421  ARG A CB  1 
ATOM   3353 C  CG  . ARG A 1 440 ? -29.651 41.223 58.132 1.00 21.41 ? 421  ARG A CG  1 
ATOM   3354 C  CD  . ARG A 1 440 ? -31.076 41.720 57.880 1.00 21.29 ? 421  ARG A CD  1 
ATOM   3355 N  NE  . ARG A 1 440 ? -31.534 42.632 58.933 1.00 22.58 ? 421  ARG A NE  1 
ATOM   3356 C  CZ  . ARG A 1 440 ? -32.105 43.822 58.730 1.00 22.76 ? 421  ARG A CZ  1 
ATOM   3357 N  NH1 . ARG A 1 440 ? -32.323 44.277 57.498 1.00 22.90 ? 421  ARG A NH1 1 
ATOM   3358 N  NH2 . ARG A 1 440 ? -32.476 44.558 59.770 1.00 22.07 ? 421  ARG A NH2 1 
ATOM   3359 N  N   . ARG A 1 441 ? -25.885 43.710 57.100 1.00 19.13 ? 422  ARG A N   1 
ATOM   3360 C  CA  . ARG A 1 441 ? -24.981 44.475 56.243 1.00 18.54 ? 422  ARG A CA  1 
ATOM   3361 C  C   . ARG A 1 441 ? -23.605 43.802 56.168 1.00 17.56 ? 422  ARG A C   1 
ATOM   3362 O  O   . ARG A 1 441 ? -23.028 43.691 55.080 1.00 17.18 ? 422  ARG A O   1 
ATOM   3363 C  CB  . ARG A 1 441 ? -24.864 45.935 56.725 1.00 18.82 ? 422  ARG A CB  1 
ATOM   3364 C  CG  . ARG A 1 441 ? -23.922 46.826 55.890 1.00 20.04 ? 422  ARG A CG  1 
ATOM   3365 C  CD  . ARG A 1 441 ? -24.550 47.235 54.557 1.00 21.80 ? 422  ARG A CD  1 
ATOM   3366 N  NE  . ARG A 1 441 ? -23.545 47.620 53.565 1.00 22.29 ? 422  ARG A NE  1 
ATOM   3367 C  CZ  . ARG A 1 441 ? -23.770 47.709 52.253 1.00 22.76 ? 422  ARG A CZ  1 
ATOM   3368 N  NH1 . ARG A 1 441 ? -24.975 47.449 51.756 1.00 24.07 ? 422  ARG A NH1 1 
ATOM   3369 N  NH2 . ARG A 1 441 ? -22.789 48.062 51.430 1.00 21.42 ? 422  ARG A NH2 1 
ATOM   3370 N  N   . ILE A 1 442 ? -23.106 43.360 57.330 1.00 16.54 ? 423  ILE A N   1 
ATOM   3371 C  CA  . ILE A 1 442 ? -21.861 42.594 57.451 1.00 15.74 ? 423  ILE A CA  1 
ATOM   3372 C  C   . ILE A 1 442 ? -21.900 41.313 56.608 1.00 15.25 ? 423  ILE A C   1 
ATOM   3373 O  O   . ILE A 1 442 ? -20.936 41.020 55.907 1.00 15.01 ? 423  ILE A O   1 
ATOM   3374 C  CB  . ILE A 1 442 ? -21.506 42.285 58.935 1.00 15.61 ? 423  ILE A CB  1 
ATOM   3375 C  CG1 . ILE A 1 442 ? -20.977 43.554 59.629 1.00 17.01 ? 423  ILE A CG1 1 
ATOM   3376 C  CG2 . ILE A 1 442 ? -20.478 41.155 59.054 1.00 15.97 ? 423  ILE A CG2 1 
ATOM   3377 C  CD1 . ILE A 1 442 ? -20.758 43.429 61.160 1.00 15.45 ? 423  ILE A CD1 1 
ATOM   3378 N  N   . LYS A 1 443 ? -23.004 40.566 56.663 1.00 14.72 ? 424  LYS A N   1 
ATOM   3379 C  CA  . LYS A 1 443 ? -23.153 39.357 55.838 1.00 14.49 ? 424  LYS A CA  1 
ATOM   3380 C  C   . LYS A 1 443 ? -23.192 39.661 54.337 1.00 14.09 ? 424  LYS A C   1 
ATOM   3381 O  O   . LYS A 1 443 ? -22.642 38.900 53.525 1.00 12.82 ? 424  LYS A O   1 
ATOM   3382 C  CB  . LYS A 1 443 ? -24.380 38.546 56.250 1.00 14.64 ? 424  LYS A CB  1 
ATOM   3383 C  CG  . LYS A 1 443 ? -24.194 37.755 57.541 1.00 16.14 ? 424  LYS A CG  1 
ATOM   3384 C  CD  . LYS A 1 443 ? -25.319 36.750 57.734 1.00 18.07 ? 424  LYS A CD  1 
ATOM   3385 C  CE  . LYS A 1 443 ? -25.072 35.863 58.948 1.00 19.43 ? 424  LYS A CE  1 
ATOM   3386 N  NZ  . LYS A 1 443 ? -25.545 36.496 60.222 1.00 20.54 ? 424  LYS A NZ  1 
ATOM   3387 N  N   . LYS A 1 444 ? -23.825 40.785 53.985 1.00 14.10 ? 425  LYS A N   1 
ATOM   3388 C  CA  . LYS A 1 444 ? -23.972 41.185 52.582 1.00 13.78 ? 425  LYS A CA  1 
ATOM   3389 C  C   . LYS A 1 444 ? -22.647 41.673 51.986 1.00 12.74 ? 425  LYS A C   1 
ATOM   3390 O  O   . LYS A 1 444 ? -22.305 41.311 50.850 1.00 13.00 ? 425  LYS A O   1 
ATOM   3391 C  CB  . LYS A 1 444 ? -25.100 42.201 52.411 1.00 13.82 ? 425  LYS A CB  1 
ATOM   3392 C  CG  . LYS A 1 444 ? -25.522 42.461 50.971 1.00 16.64 ? 425  LYS A CG  1 
ATOM   3393 C  CD  . LYS A 1 444 ? -24.936 43.789 50.472 1.00 21.13 ? 425  LYS A CD  1 
ATOM   3394 C  CE  . LYS A 1 444 ? -25.926 44.571 49.591 1.00 23.15 ? 425  LYS A CE  1 
ATOM   3395 N  NZ  . LYS A 1 444 ? -25.983 44.048 48.192 1.00 24.84 ? 425  LYS A NZ  1 
ATOM   3396 N  N   . VAL A 1 445 ? -21.912 42.493 52.744 1.00 11.16 ? 426  VAL A N   1 
ATOM   3397 C  CA  . VAL A 1 445 ? -20.599 42.971 52.313 1.00 9.25  ? 426  VAL A CA  1 
ATOM   3398 C  C   . VAL A 1 445 ? -19.590 41.802 52.209 1.00 8.27  ? 426  VAL A C   1 
ATOM   3399 O  O   . VAL A 1 445 ? -18.821 41.738 51.239 1.00 7.10  ? 426  VAL A O   1 
ATOM   3400 C  CB  . VAL A 1 445 ? -20.082 44.103 53.223 1.00 9.60  ? 426  VAL A CB  1 
ATOM   3401 C  CG1 . VAL A 1 445 ? -18.653 44.511 52.869 1.00 9.42  ? 426  VAL A CG1 1 
ATOM   3402 C  CG2 . VAL A 1 445 ? -21.002 45.316 53.120 1.00 10.15 ? 426  VAL A CG2 1 
ATOM   3403 N  N   . THR A 1 446 ? -19.606 40.902 53.200 1.00 6.95  ? 427  THR A N   1 
ATOM   3404 C  CA  . THR A 1 446 ? -18.785 39.676 53.206 1.00 7.57  ? 427  THR A CA  1 
ATOM   3405 C  C   . THR A 1 446 ? -19.032 38.872 51.903 1.00 7.47  ? 427  THR A C   1 
ATOM   3406 O  O   . THR A 1 446 ? -18.086 38.470 51.226 1.00 6.52  ? 427  THR A O   1 
ATOM   3407 C  CB  . THR A 1 446 ? -19.060 38.800 54.495 1.00 8.12  ? 427  THR A CB  1 
ATOM   3408 O  OG1 . THR A 1 446 ? -18.684 39.531 55.679 1.00 8.73  ? 427  THR A OG1 1 
ATOM   3409 C  CG2 . THR A 1 446 ? -18.326 37.417 54.485 1.00 5.93  ? 427  THR A CG2 1 
ATOM   3410 N  N   . HIS A 1 447 ? -20.308 38.689 51.553 1.00 7.52  ? 428  HIS A N   1 
ATOM   3411 C  CA  . HIS A 1 447 ? -20.682 37.980 50.341 1.00 8.09  ? 428  HIS A CA  1 
ATOM   3412 C  C   . HIS A 1 447 ? -20.192 38.668 49.074 1.00 7.91  ? 428  HIS A C   1 
ATOM   3413 O  O   . HIS A 1 447 ? -19.561 38.036 48.237 1.00 7.38  ? 428  HIS A O   1 
ATOM   3414 C  CB  . HIS A 1 447 ? -22.188 37.752 50.260 1.00 8.47  ? 428  HIS A CB  1 
ATOM   3415 C  CG  . HIS A 1 447 ? -22.581 36.845 49.132 1.00 10.24 ? 428  HIS A CG  1 
ATOM   3416 N  ND1 . HIS A 1 447 ? -23.169 37.311 47.973 1.00 10.96 ? 428  HIS A ND1 1 
ATOM   3417 C  CD2 . HIS A 1 447 ? -22.404 35.513 48.959 1.00 10.34 ? 428  HIS A CD2 1 
ATOM   3418 C  CE1 . HIS A 1 447 ? -23.376 36.298 47.152 1.00 10.56 ? 428  HIS A CE1 1 
ATOM   3419 N  NE2 . HIS A 1 447 ? -22.926 35.196 47.728 1.00 11.90 ? 428  HIS A NE2 1 
ATOM   3420 N  N   . ASP A 1 448 ? -20.466 39.965 48.955 1.00 8.17  ? 429  ASP A N   1 
ATOM   3421 C  CA  . ASP A 1 448 ? -20.002 40.759 47.811 1.00 8.78  ? 429  ASP A CA  1 
ATOM   3422 C  C   . ASP A 1 448 ? -18.478 40.739 47.644 1.00 8.39  ? 429  ASP A C   1 
ATOM   3423 O  O   . ASP A 1 448 ? -17.968 40.584 46.523 1.00 7.74  ? 429  ASP A O   1 
ATOM   3424 C  CB  . ASP A 1 448 ? -20.509 42.205 47.905 1.00 9.05  ? 429  ASP A CB  1 
ATOM   3425 C  CG  . ASP A 1 448 ? -22.015 42.319 47.688 1.00 11.56 ? 429  ASP A CG  1 
ATOM   3426 O  OD1 . ASP A 1 448 ? -22.622 41.376 47.106 1.00 15.17 ? 429  ASP A OD1 1 
ATOM   3427 O  OD2 . ASP A 1 448 ? -22.584 43.367 48.087 1.00 14.03 ? 429  ASP A OD2 1 
ATOM   3428 N  N   . MET A 1 449 ? -17.764 40.888 48.758 1.00 7.58  ? 430  MET A N   1 
ATOM   3429 C  CA  . MET A 1 449 ? -16.316 40.831 48.746 1.00 8.42  ? 430  MET A CA  1 
ATOM   3430 C  C   . MET A 1 449 ? -15.870 39.452 48.264 1.00 6.28  ? 430  MET A C   1 
ATOM   3431 O  O   . MET A 1 449 ? -15.063 39.350 47.341 1.00 5.34  ? 430  MET A O   1 
ATOM   3432 C  CB  . MET A 1 449 ? -15.755 41.164 50.143 1.00 8.69  ? 430  MET A CB  1 
ATOM   3433 C  CG  . MET A 1 449 ? -14.233 41.077 50.249 1.00 11.30 ? 430  MET A CG  1 
ATOM   3434 S  SD  . MET A 1 449 ? -13.636 41.138 51.950 1.00 14.84 ? 430  MET A SD  1 
ATOM   3435 C  CE  . MET A 1 449 ? -12.544 39.731 51.994 1.00 12.18 ? 430  MET A CE  1 
ATOM   3436 N  N   . ASP A 1 450 ? -16.399 38.390 48.880 1.00 5.28  ? 431  ASP A N   1 
ATOM   3437 C  CA  . ASP A 1 450 ? -15.963 37.023 48.558 1.00 4.82  ? 431  ASP A CA  1 
ATOM   3438 C  C   . ASP A 1 450 ? -16.204 36.684 47.067 1.00 4.10  ? 431  ASP A C   1 
ATOM   3439 O  O   . ASP A 1 450 ? -15.336 36.085 46.428 1.00 3.57  ? 431  ASP A O   1 
ATOM   3440 C  CB  . ASP A 1 450 ? -16.651 35.985 49.449 1.00 4.61  ? 431  ASP A CB  1 
ATOM   3441 C  CG  . ASP A 1 450 ? -16.190 36.037 50.914 1.00 6.10  ? 431  ASP A CG  1 
ATOM   3442 O  OD1 . ASP A 1 450 ? -15.278 36.841 51.308 1.00 5.75  ? 431  ASP A OD1 1 
ATOM   3443 O  OD2 . ASP A 1 450 ? -16.789 35.258 51.686 1.00 5.31  ? 431  ASP A OD2 1 
ATOM   3444 N  N   . MET A 1 451 ? -17.347 37.119 46.526 1.00 2.93  ? 432  MET A N   1 
ATOM   3445 C  CA  . MET A 1 451 ? -17.745 36.789 45.156 1.00 3.57  ? 432  MET A CA  1 
ATOM   3446 C  C   . MET A 1 451 ? -16.816 37.375 44.098 1.00 4.22  ? 432  MET A C   1 
ATOM   3447 O  O   . MET A 1 451 ? -16.794 36.882 42.958 1.00 4.01  ? 432  MET A O   1 
ATOM   3448 C  CB  . MET A 1 451 ? -19.199 37.221 44.867 1.00 3.28  ? 432  MET A CB  1 
ATOM   3449 C  CG  . MET A 1 451 ? -20.277 36.348 45.542 1.00 4.42  ? 432  MET A CG  1 
ATOM   3450 S  SD  . MET A 1 451 ? -20.045 34.533 45.378 1.00 4.79  ? 432  MET A SD  1 
ATOM   3451 C  CE  . MET A 1 451 ? -18.943 34.103 46.763 1.00 4.21  ? 432  MET A CE  1 
ATOM   3452 N  N   . CYS A 1 452 ? -16.094 38.442 44.463 1.00 4.29  ? 433  CYS A N   1 
ATOM   3453 C  CA  . CYS A 1 452 ? -15.081 39.065 43.600 1.00 5.31  ? 433  CYS A CA  1 
ATOM   3454 C  C   . CYS A 1 452 ? -13.934 38.094 43.280 1.00 5.11  ? 433  CYS A C   1 
ATOM   3455 O  O   . CYS A 1 452 ? -13.256 38.251 42.252 1.00 5.24  ? 433  CYS A O   1 
ATOM   3456 C  CB  . CYS A 1 452 ? -14.478 40.304 44.270 1.00 5.40  ? 433  CYS A CB  1 
ATOM   3457 S  SG  . CYS A 1 452 ? -15.584 41.691 44.425 1.00 9.83  ? 433  CYS A SG  1 
ATOM   3458 N  N   . TYR A 1 453 ? -13.714 37.114 44.163 1.00 4.78  ? 434  TYR A N   1 
ATOM   3459 C  CA  . TYR A 1 453 ? -12.644 36.127 44.006 1.00 4.90  ? 434  TYR A CA  1 
ATOM   3460 C  C   . TYR A 1 453 ? -13.109 34.877 43.258 1.00 5.04  ? 434  TYR A C   1 
ATOM   3461 O  O   . TYR A 1 453 ? -12.311 34.215 42.594 1.00 6.50  ? 434  TYR A O   1 
ATOM   3462 C  CB  . TYR A 1 453 ? -12.069 35.715 45.378 1.00 4.84  ? 434  TYR A CB  1 
ATOM   3463 C  CG  . TYR A 1 453 ? -11.378 36.827 46.096 1.00 5.06  ? 434  TYR A CG  1 
ATOM   3464 C  CD1 . TYR A 1 453 ? -10.016 37.088 45.873 1.00 6.34  ? 434  TYR A CD1 1 
ATOM   3465 C  CD2 . TYR A 1 453 ? -12.078 37.648 46.974 1.00 4.81  ? 434  TYR A CD2 1 
ATOM   3466 C  CE1 . TYR A 1 453 ? -9.364  38.110 46.527 1.00 4.46  ? 434  TYR A CE1 1 
ATOM   3467 C  CE2 . TYR A 1 453 ? -11.435 38.683 47.647 1.00 6.54  ? 434  TYR A CE2 1 
ATOM   3468 C  CZ  . TYR A 1 453 ? -10.083 38.904 47.419 1.00 6.28  ? 434  TYR A CZ  1 
ATOM   3469 O  OH  . TYR A 1 453 ? -9.467  39.931 48.079 1.00 7.68  ? 434  TYR A OH  1 
ATOM   3470 N  N   . GLY A 1 454 ? -14.397 34.563 43.372 1.00 4.34  ? 435  GLY A N   1 
ATOM   3471 C  CA  . GLY A 1 454 ? -14.968 33.330 42.846 1.00 2.96  ? 435  GLY A CA  1 
ATOM   3472 C  C   . GLY A 1 454 ? -16.022 32.835 43.832 1.00 3.05  ? 435  GLY A C   1 
ATOM   3473 O  O   . GLY A 1 454 ? -16.213 33.420 44.922 1.00 2.31  ? 435  GLY A O   1 
ATOM   3474 N  N   . MET A 1 455 ? -16.666 31.732 43.466 1.00 2.00  ? 436  MET A N   1 
ATOM   3475 C  CA  . MET A 1 455 ? -17.766 31.175 44.227 1.00 2.00  ? 436  MET A CA  1 
ATOM   3476 C  C   . MET A 1 455 ? -17.376 30.672 45.643 1.00 2.00  ? 436  MET A C   1 
ATOM   3477 O  O   . MET A 1 455 ? -18.203 30.671 46.576 1.00 2.00  ? 436  MET A O   1 
ATOM   3478 C  CB  . MET A 1 455 ? -18.430 30.085 43.378 1.00 2.00  ? 436  MET A CB  1 
ATOM   3479 C  CG  . MET A 1 455 ? -19.169 30.678 42.154 1.00 2.00  ? 436  MET A CG  1 
ATOM   3480 S  SD  . MET A 1 455 ? -20.582 31.726 42.621 1.00 2.08  ? 436  MET A SD  1 
ATOM   3481 C  CE  . MET A 1 455 ? -21.944 30.544 42.601 1.00 2.47  ? 436  MET A CE  1 
ATOM   3482 N  N   . MET A 1 456 ? -16.115 30.253 45.767 1.00 2.00  ? 437  MET A N   1 
ATOM   3483 C  CA  . MET A 1 456 ? -15.533 29.795 47.038 1.00 2.03  ? 437  MET A CA  1 
ATOM   3484 C  C   . MET A 1 456 ? -14.617 30.858 47.678 1.00 2.32  ? 437  MET A C   1 
ATOM   3485 O  O   . MET A 1 456 ? -13.892 30.556 48.623 1.00 2.67  ? 437  MET A O   1 
ATOM   3486 C  CB  . MET A 1 456 ? -14.793 28.462 46.821 1.00 2.38  ? 437  MET A CB  1 
ATOM   3487 C  CG  . MET A 1 456 ? -15.738 27.250 46.674 1.00 2.64  ? 437  MET A CG  1 
ATOM   3488 S  SD  . MET A 1 456 ? -16.585 27.012 48.278 1.00 9.53  ? 437  MET A SD  1 
ATOM   3489 C  CE  . MET A 1 456 ? -17.593 25.599 47.867 1.00 5.61  ? 437  MET A CE  1 
ATOM   3490 N  N   . GLY A 1 457 ? -14.667 32.101 47.174 1.00 2.00  ? 438  GLY A N   1 
ATOM   3491 C  CA  . GLY A 1 457 ? -13.979 33.242 47.787 1.00 2.00  ? 438  GLY A CA  1 
ATOM   3492 C  C   . GLY A 1 457 ? -12.452 33.225 47.698 1.00 2.00  ? 438  GLY A C   1 
ATOM   3493 O  O   . GLY A 1 457 ? -11.868 32.416 47.001 1.00 2.00  ? 438  GLY A O   1 
ATOM   3494 N  N   . SER A 1 458 ? -11.810 34.136 48.419 1.00 2.00  ? 439  SER A N   1 
ATOM   3495 C  CA  . SER A 1 458 ? -10.360 34.209 48.509 1.00 2.00  ? 439  SER A CA  1 
ATOM   3496 C  C   . SER A 1 458 ? -9.734  32.947 49.143 1.00 2.48  ? 439  SER A C   1 
ATOM   3497 O  O   . SER A 1 458 ? -10.301 32.345 50.071 1.00 2.13  ? 439  SER A O   1 
ATOM   3498 C  CB  . SER A 1 458 ? -9.985  35.443 49.349 1.00 2.00  ? 439  SER A CB  1 
ATOM   3499 O  OG  . SER A 1 458 ? -8.591  35.546 49.530 1.00 2.00  ? 439  SER A OG  1 
ATOM   3500 N  N   . LEU A 1 459 ? -8.581  32.547 48.611 1.00 2.04  ? 440  LEU A N   1 
ATOM   3501 C  CA  . LEU A 1 459 ? -7.735  31.574 49.235 1.00 2.91  ? 440  LEU A CA  1 
ATOM   3502 C  C   . LEU A 1 459 ? -7.481  31.886 50.741 1.00 2.17  ? 440  LEU A C   1 
ATOM   3503 O  O   . LEU A 1 459 ? -7.322  30.959 51.563 1.00 2.00  ? 440  LEU A O   1 
ATOM   3504 C  CB  . LEU A 1 459 ? -6.409  31.579 48.464 1.00 3.28  ? 440  LEU A CB  1 
ATOM   3505 C  CG  . LEU A 1 459 ? -5.252  30.663 48.866 1.00 5.01  ? 440  LEU A CG  1 
ATOM   3506 C  CD1 . LEU A 1 459 ? -5.637  29.155 48.891 1.00 4.06  ? 440  LEU A CD1 1 
ATOM   3507 C  CD2 . LEU A 1 459 ? -4.136  30.922 47.847 1.00 5.42  ? 440  LEU A CD2 1 
ATOM   3508 N  N   . PHE A 1 460 ? -7.486  33.185 51.083 1.00 2.00  ? 441  PHE A N   1 
ATOM   3509 C  CA  . PHE A 1 460 ? -6.964  33.670 52.381 1.00 2.47  ? 441  PHE A CA  1 
ATOM   3510 C  C   . PHE A 1 460 ? -7.987  34.029 53.419 1.00 2.31  ? 441  PHE A C   1 
ATOM   3511 O  O   . PHE A 1 460 ? -7.636  34.187 54.595 1.00 3.48  ? 441  PHE A O   1 
ATOM   3512 C  CB  . PHE A 1 460 ? -6.053  34.894 52.184 1.00 2.00  ? 441  PHE A CB  1 
ATOM   3513 C  CG  . PHE A 1 460 ? -4.900  34.617 51.269 1.00 3.39  ? 441  PHE A CG  1 
ATOM   3514 C  CD1 . PHE A 1 460 ? -3.900  33.718 51.665 1.00 3.12  ? 441  PHE A CD1 1 
ATOM   3515 C  CD2 . PHE A 1 460 ? -4.841  35.194 50.002 1.00 2.00  ? 441  PHE A CD2 1 
ATOM   3516 C  CE1 . PHE A 1 460 ? -2.820  33.428 50.830 1.00 3.76  ? 441  PHE A CE1 1 
ATOM   3517 C  CE2 . PHE A 1 460 ? -3.749  34.927 49.167 1.00 4.99  ? 441  PHE A CE2 1 
ATOM   3518 C  CZ  . PHE A 1 460 ? -2.731  34.035 49.595 1.00 2.55  ? 441  PHE A CZ  1 
ATOM   3519 N  N   . ARG A 1 461 ? -9.225  34.207 52.992 1.00 2.27  ? 442  ARG A N   1 
ATOM   3520 C  CA  . ARG A 1 461 ? -10.285 34.642 53.894 1.00 2.99  ? 442  ARG A CA  1 
ATOM   3521 C  C   . ARG A 1 461 ? -11.696 34.489 53.335 1.00 3.36  ? 442  ARG A C   1 
ATOM   3522 O  O   . ARG A 1 461 ? -11.906 34.283 52.143 1.00 4.06  ? 442  ARG A O   1 
ATOM   3523 C  CB  . ARG A 1 461 ? -10.067 36.092 54.355 1.00 2.55  ? 442  ARG A CB  1 
ATOM   3524 C  CG  . ARG A 1 461 ? -9.786  37.093 53.228 1.00 2.81  ? 442  ARG A CG  1 
ATOM   3525 C  CD  . ARG A 1 461 ? -9.631  38.524 53.749 1.00 2.56  ? 442  ARG A CD  1 
ATOM   3526 N  NE  . ARG A 1 461 ? -8.506  38.688 54.679 1.00 5.07  ? 442  ARG A NE  1 
ATOM   3527 C  CZ  . ARG A 1 461 ? -8.621  38.844 56.001 1.00 4.74  ? 442  ARG A CZ  1 
ATOM   3528 N  NH1 . ARG A 1 461 ? -7.530  39.004 56.743 1.00 4.43  ? 442  ARG A NH1 1 
ATOM   3529 N  NH2 . ARG A 1 461 ? -9.815  38.809 56.588 1.00 4.75  ? 442  ARG A NH2 1 
ATOM   3530 N  N   . SER A 1 462 ? -12.652 34.547 54.246 1.00 3.64  ? 443  SER A N   1 
ATOM   3531 C  CA  . SER A 1 462 ? -14.033 34.742 53.919 1.00 3.77  ? 443  SER A CA  1 
ATOM   3532 C  C   . SER A 1 462 ? -14.409 35.961 54.778 1.00 3.24  ? 443  SER A C   1 
ATOM   3533 O  O   . SER A 1 462 ? -14.444 35.896 56.016 1.00 2.79  ? 443  SER A O   1 
ATOM   3534 C  CB  . SER A 1 462 ? -14.845 33.466 54.245 1.00 4.13  ? 443  SER A CB  1 
ATOM   3535 O  OG  . SER A 1 462 ? -16.240 33.740 54.161 1.00 8.72  ? 443  SER A OG  1 
ATOM   3536 N  N   . GLY A 1 463 ? -14.605 37.103 54.127 1.00 3.05  ? 444  GLY A N   1 
ATOM   3537 C  CA  . GLY A 1 463 ? -14.833 38.352 54.852 1.00 3.04  ? 444  GLY A CA  1 
ATOM   3538 C  C   . GLY A 1 463 ? -13.694 38.650 55.813 1.00 3.63  ? 444  GLY A C   1 
ATOM   3539 O  O   . GLY A 1 463 ? -12.523 38.619 55.431 1.00 4.09  ? 444  GLY A O   1 
ATOM   3540 N  N   . SER A 1 464 ? -14.026 38.887 57.072 1.00 3.56  ? 445  SER A N   1 
ATOM   3541 C  CA  . SER A 1 464 ? -13.007 39.190 58.050 1.00 4.90  ? 445  SER A CA  1 
ATOM   3542 C  C   . SER A 1 464 ? -12.392 37.964 58.719 1.00 4.65  ? 445  SER A C   1 
ATOM   3543 O  O   . SER A 1 464 ? -11.569 38.109 59.621 1.00 5.37  ? 445  SER A O   1 
ATOM   3544 C  CB  . SER A 1 464 ? -13.571 40.153 59.104 1.00 5.23  ? 445  SER A CB  1 
ATOM   3545 O  OG  . SER A 1 464 ? -14.514 39.459 59.914 1.00 9.69  ? 445  SER A OG  1 
ATOM   3546 N  N   . ARG A 1 465 ? -12.768 36.763 58.282 1.00 4.11  ? 446  ARG A N   1 
ATOM   3547 C  CA  . ARG A 1 465 ? -12.236 35.541 58.886 1.00 4.19  ? 446  ARG A CA  1 
ATOM   3548 C  C   . ARG A 1 465 ? -11.210 34.878 57.993 1.00 3.37  ? 446  ARG A C   1 
ATOM   3549 O  O   . ARG A 1 465 ? -11.528 34.522 56.870 1.00 3.87  ? 446  ARG A O   1 
ATOM   3550 C  CB  . ARG A 1 465 ? -13.376 34.563 59.224 1.00 4.13  ? 446  ARG A CB  1 
ATOM   3551 C  CG  . ARG A 1 465 ? -14.394 35.239 60.154 1.00 8.77  ? 446  ARG A CG  1 
ATOM   3552 C  CD  . ARG A 1 465 ? -15.485 34.342 60.613 1.00 14.23 ? 446  ARG A CD  1 
ATOM   3553 N  NE  . ARG A 1 465 ? -14.960 33.323 61.528 1.00 19.48 ? 446  ARG A NE  1 
ATOM   3554 C  CZ  . ARG A 1 465 ? -15.703 32.384 62.104 1.00 19.87 ? 446  ARG A CZ  1 
ATOM   3555 N  NH1 . ARG A 1 465 ? -17.020 32.327 61.880 1.00 19.72 ? 446  ARG A NH1 1 
ATOM   3556 N  NH2 . ARG A 1 465 ? -15.121 31.498 62.891 1.00 19.55 ? 446  ARG A NH2 1 
ATOM   3557 N  N   . GLN A 1 466 ? -10.001 34.691 58.515 1.00 2.46  ? 447  GLN A N   1 
ATOM   3558 C  CA  . GLN A 1 466 ? -8.912  34.023 57.808 1.00 2.76  ? 447  GLN A CA  1 
ATOM   3559 C  C   . GLN A 1 466 ? -9.124  32.518 57.671 1.00 2.18  ? 447  GLN A C   1 
ATOM   3560 O  O   . GLN A 1 466 ? -9.669  31.875 58.585 1.00 2.00  ? 447  GLN A O   1 
ATOM   3561 C  CB  . GLN A 1 466 ? -7.598  34.273 58.549 1.00 2.69  ? 447  GLN A CB  1 
ATOM   3562 C  CG  . GLN A 1 466 ? -7.199  35.755 58.598 1.00 6.75  ? 447  GLN A CG  1 
ATOM   3563 C  CD  . GLN A 1 466 ? -5.774  35.919 59.101 1.00 11.03 ? 447  GLN A CD  1 
ATOM   3564 O  OE1 . GLN A 1 466 ? -5.516  35.680 60.269 1.00 11.61 ? 447  GLN A OE1 1 
ATOM   3565 N  NE2 . GLN A 1 466 ? -4.829  36.251 58.201 1.00 10.93 ? 447  GLN A NE2 1 
ATOM   3566 N  N   . THR A 1 467 ? -8.682  31.956 56.543 1.00 2.00  ? 448  THR A N   1 
ATOM   3567 C  CA  . THR A 1 467 ? -8.831  30.528 56.301 1.00 2.00  ? 448  THR A CA  1 
ATOM   3568 C  C   . THR A 1 467 ? -7.699  29.764 57.036 1.00 2.20  ? 448  THR A C   1 
ATOM   3569 O  O   . THR A 1 467 ? -6.680  30.349 57.453 1.00 2.00  ? 448  THR A O   1 
ATOM   3570 C  CB  . THR A 1 467 ? -8.721  30.191 54.796 1.00 2.65  ? 448  THR A CB  1 
ATOM   3571 O  OG1 . THR A 1 467 ? -7.510  30.758 54.297 1.00 2.02  ? 448  THR A OG1 1 
ATOM   3572 C  CG2 . THR A 1 467 ? -9.948  30.715 53.955 1.00 2.00  ? 448  THR A CG2 1 
ATOM   3573 N  N   . LEU A 1 468 ? -7.890  28.456 57.177 1.00 2.00  ? 449  LEU A N   1 
ATOM   3574 C  CA  . LEU A 1 468 ? -6.817  27.561 57.582 1.00 2.00  ? 449  LEU A CA  1 
ATOM   3575 C  C   . LEU A 1 468 ? -5.562  27.793 56.735 1.00 2.18  ? 449  LEU A C   1 
ATOM   3576 O  O   . LEU A 1 468 ? -4.454  27.839 57.261 1.00 2.53  ? 449  LEU A O   1 
ATOM   3577 C  CB  . LEU A 1 468 ? -7.276  26.115 57.432 1.00 2.00  ? 449  LEU A CB  1 
ATOM   3578 C  CG  . LEU A 1 468 ? -6.237  25.006 57.653 1.00 3.03  ? 449  LEU A CG  1 
ATOM   3579 C  CD1 . LEU A 1 468 ? -5.680  25.062 59.141 1.00 2.00  ? 449  LEU A CD1 1 
ATOM   3580 C  CD2 . LEU A 1 468 ? -6.874  23.617 57.295 1.00 2.00  ? 449  LEU A CD2 1 
ATOM   3581 N  N   . PHE A 1 469 ? -5.722  27.925 55.414 1.00 2.35  ? 450  PHE A N   1 
ATOM   3582 C  CA  . PHE A 1 469 ? -4.555  28.069 54.564 1.00 2.00  ? 450  PHE A CA  1 
ATOM   3583 C  C   . PHE A 1 469 ? -3.743  29.324 54.927 1.00 3.03  ? 450  PHE A C   1 
ATOM   3584 O  O   . PHE A 1 469 ? -2.512  29.246 55.030 1.00 3.32  ? 450  PHE A O   1 
ATOM   3585 C  CB  . PHE A 1 469 ? -4.977  28.061 53.088 1.00 2.00  ? 450  PHE A CB  1 
ATOM   3586 C  CG  . PHE A 1 469 ? -3.834  28.125 52.128 1.00 2.00  ? 450  PHE A CG  1 
ATOM   3587 C  CD1 . PHE A 1 469 ? -3.241  26.955 51.653 1.00 3.09  ? 450  PHE A CD1 1 
ATOM   3588 C  CD2 . PHE A 1 469 ? -3.336  29.361 51.697 1.00 2.00  ? 450  PHE A CD2 1 
ATOM   3589 C  CE1 . PHE A 1 469 ? -2.167  27.016 50.732 1.00 4.73  ? 450  PHE A CE1 1 
ATOM   3590 C  CE2 . PHE A 1 469 ? -2.254  29.425 50.796 1.00 2.14  ? 450  PHE A CE2 1 
ATOM   3591 C  CZ  . PHE A 1 469 ? -1.667  28.244 50.321 1.00 2.00  ? 450  PHE A CZ  1 
ATOM   3592 N  N   . ALA A 1 470 ? -4.423  30.478 55.064 1.00 2.34  ? 451  ALA A N   1 
ATOM   3593 C  CA  . ALA A 1 470 ? -3.794  31.726 55.464 1.00 2.53  ? 451  ALA A CA  1 
ATOM   3594 C  C   . ALA A 1 470 ? -3.010  31.581 56.790 1.00 3.03  ? 451  ALA A C   1 
ATOM   3595 O  O   . ALA A 1 470 ? -1.877  32.078 56.918 1.00 2.19  ? 451  ALA A O   1 
ATOM   3596 C  CB  . ALA A 1 470 ? -4.860  32.869 55.594 1.00 2.00  ? 451  ALA A CB  1 
ATOM   3597 N  N   . SER A 1 471 ? -3.629  30.922 57.776 1.00 3.95  ? 452  SER A N   1 
ATOM   3598 C  CA  . SER A 1 471 ? -2.996  30.751 59.076 1.00 5.12  ? 452  SER A CA  1 
ATOM   3599 C  C   . SER A 1 471 ? -1.732  29.865 58.983 1.00 3.79  ? 452  SER A C   1 
ATOM   3600 O  O   . SER A 1 471 ? -0.732  30.142 59.642 1.00 3.32  ? 452  SER A O   1 
ATOM   3601 C  CB  . SER A 1 471 ? -3.995  30.242 60.138 1.00 5.76  ? 452  SER A CB  1 
ATOM   3602 O  OG  . SER A 1 471 ? -4.252  28.847 59.958 1.00 13.30 ? 452  SER A OG  1 
ATOM   3603 N  N   . GLN A 1 472 ? -1.782  28.829 58.140 1.00 3.25  ? 453  GLN A N   1 
ATOM   3604 C  CA  . GLN A 1 472 ? -0.625  27.976 57.887 1.00 3.25  ? 453  GLN A CA  1 
ATOM   3605 C  C   . GLN A 1 472 ? 0.485   28.718 57.140 1.00 2.79  ? 453  GLN A C   1 
ATOM   3606 O  O   . GLN A 1 472 ? 1.656   28.576 57.476 1.00 3.13  ? 453  GLN A O   1 
ATOM   3607 C  CB  . GLN A 1 472 ? -1.029  26.677 57.161 1.00 3.25  ? 453  GLN A CB  1 
ATOM   3608 C  CG  . GLN A 1 472 ? -1.951  25.739 57.975 1.00 2.63  ? 453  GLN A CG  1 
ATOM   3609 C  CD  . GLN A 1 472 ? -2.296  24.484 57.196 1.00 4.65  ? 453  GLN A CD  1 
ATOM   3610 O  OE1 . GLN A 1 472 ? -2.555  24.544 56.001 1.00 9.55  ? 453  GLN A OE1 1 
ATOM   3611 N  NE2 . GLN A 1 472 ? -2.299  23.355 57.860 1.00 3.29  ? 453  GLN A NE2 1 
ATOM   3612 N  N   . VAL A 1 473 ? 0.125   29.509 56.140 1.00 3.06  ? 454  VAL A N   1 
ATOM   3613 C  CA  . VAL A 1 473 ? 1.090   30.411 55.532 1.00 2.92  ? 454  VAL A CA  1 
ATOM   3614 C  C   . VAL A 1 473 ? 1.839   31.251 56.572 1.00 3.25  ? 454  VAL A C   1 
ATOM   3615 O  O   . VAL A 1 473 ? 3.074   31.220 56.612 1.00 2.82  ? 454  VAL A O   1 
ATOM   3616 C  CB  . VAL A 1 473 ? 0.470   31.319 54.453 1.00 3.34  ? 454  VAL A CB  1 
ATOM   3617 C  CG1 . VAL A 1 473 ? 1.545   32.304 53.883 1.00 2.69  ? 454  VAL A CG1 1 
ATOM   3618 C  CG2 . VAL A 1 473 ? -0.118  30.486 53.313 1.00 2.00  ? 454  VAL A CG2 1 
ATOM   3619 N  N   . MET A 1 474 ? 1.107   31.958 57.433 1.00 3.08  ? 455  MET A N   1 
ATOM   3620 C  CA  . MET A 1 474 ? 1.734   32.844 58.393 1.00 4.74  ? 455  MET A CA  1 
ATOM   3621 C  C   . MET A 1 474 ? 2.635   32.088 59.376 1.00 3.33  ? 455  MET A C   1 
ATOM   3622 O  O   . MET A 1 474 ? 3.721   32.588 59.721 1.00 2.96  ? 455  MET A O   1 
ATOM   3623 C  CB  . MET A 1 474 ? 0.689   33.658 59.170 1.00 4.69  ? 455  MET A CB  1 
ATOM   3624 C  CG  . MET A 1 474 ? -0.080  34.681 58.341 1.00 7.26  ? 455  MET A CG  1 
ATOM   3625 S  SD  . MET A 1 474 ? -1.404  35.447 59.323 1.00 9.92  ? 455  MET A SD  1 
ATOM   3626 C  CE  . MET A 1 474 ? -0.496  36.518 60.403 1.00 12.87 ? 455  MET A CE  1 
ATOM   3627 N  N   A ARG A 1 475 ? 2.201   30.901 59.826 0.50 2.91  ? 456  ARG A N   1 
ATOM   3628 N  N   B ARG A 1 475 ? 2.175   30.895 59.764 0.50 2.84  ? 456  ARG A N   1 
ATOM   3629 C  CA  A ARG A 1 475 ? 2.951   30.125 60.836 0.50 2.87  ? 456  ARG A CA  1 
ATOM   3630 C  CA  B ARG A 1 475 ? 2.790   30.031 60.769 0.50 2.74  ? 456  ARG A CA  1 
ATOM   3631 C  C   A ARG A 1 475 ? 4.174   29.376 60.273 0.50 2.81  ? 456  ARG A C   1 
ATOM   3632 C  C   B ARG A 1 475 ? 4.080   29.338 60.290 0.50 2.81  ? 456  ARG A C   1 
ATOM   3633 O  O   A ARG A 1 475 ? 5.184   29.241 60.959 0.50 2.53  ? 456  ARG A O   1 
ATOM   3634 O  O   B ARG A 1 475 ? 5.039   29.215 61.048 0.50 2.57  ? 456  ARG A O   1 
ATOM   3635 C  CB  A ARG A 1 475 ? 2.035   29.141 61.605 0.50 2.54  ? 456  ARG A CB  1 
ATOM   3636 C  CB  B ARG A 1 475 ? 1.749   28.974 61.178 0.50 2.35  ? 456  ARG A CB  1 
ATOM   3637 C  CG  A ARG A 1 475 ? 2.627   28.656 62.962 0.50 3.78  ? 456  ARG A CG  1 
ATOM   3638 C  CG  B ARG A 1 475 ? 2.085   28.113 62.352 0.50 3.05  ? 456  ARG A CG  1 
ATOM   3639 C  CD  A ARG A 1 475 ? 1.691   27.736 63.792 0.50 3.14  ? 456  ARG A CD  1 
ATOM   3640 C  CD  B ARG A 1 475 ? 0.843   27.374 62.831 0.50 2.36  ? 456  ARG A CD  1 
ATOM   3641 N  NE  A ARG A 1 475 ? 0.320   28.250 63.853 0.50 5.64  ? 456  ARG A NE  1 
ATOM   3642 N  NE  B ARG A 1 475 ? 1.106   26.468 63.945 0.50 2.06  ? 456  ARG A NE  1 
ATOM   3643 C  CZ  A ARG A 1 475 ? -0.083  29.315 64.547 0.50 6.22  ? 456  ARG A CZ  1 
ATOM   3644 C  CZ  B ARG A 1 475 ? 0.152   25.790 64.594 0.50 3.85  ? 456  ARG A CZ  1 
ATOM   3645 N  NH1 A ARG A 1 475 ? 0.769   30.032 65.277 0.50 6.48  ? 456  ARG A NH1 1 
ATOM   3646 N  NH1 B ARG A 1 475 ? -1.141  25.940 64.273 0.50 2.00  ? 456  ARG A NH1 1 
ATOM   3647 N  NH2 A ARG A 1 475 ? -1.357  29.679 64.488 0.50 6.71  ? 456  ARG A NH2 1 
ATOM   3648 N  NH2 B ARG A 1 475 ? 0.477   24.980 65.595 0.50 4.16  ? 456  ARG A NH2 1 
ATOM   3649 N  N   . TYR A 1 476 ? 4.091   28.880 59.040 1.00 2.36  ? 457  TYR A N   1 
ATOM   3650 C  CA  . TYR A 1 476 ? 5.175   28.010 58.561 1.00 2.51  ? 457  TYR A CA  1 
ATOM   3651 C  C   . TYR A 1 476 ? 6.048   28.554 57.437 1.00 2.00  ? 457  TYR A C   1 
ATOM   3652 O  O   . TYR A 1 476 ? 7.162   28.052 57.261 1.00 2.00  ? 457  TYR A O   1 
ATOM   3653 C  CB  . TYR A 1 476 ? 4.641   26.623 58.179 1.00 2.50  ? 457  TYR A CB  1 
ATOM   3654 C  CG  . TYR A 1 476 ? 3.946   25.943 59.332 1.00 2.76  ? 457  TYR A CG  1 
ATOM   3655 C  CD1 . TYR A 1 476 ? 4.669   25.463 60.424 1.00 3.06  ? 457  TYR A CD1 1 
ATOM   3656 C  CD2 . TYR A 1 476 ? 2.566   25.780 59.323 1.00 3.41  ? 457  TYR A CD2 1 
ATOM   3657 C  CE1 . TYR A 1 476 ? 4.023   24.855 61.510 1.00 5.17  ? 457  TYR A CE1 1 
ATOM   3658 C  CE2 . TYR A 1 476 ? 1.906   25.152 60.371 1.00 3.37  ? 457  TYR A CE2 1 
ATOM   3659 C  CZ  . TYR A 1 476 ? 2.637   24.703 61.450 1.00 4.97  ? 457  TYR A CZ  1 
ATOM   3660 O  OH  . TYR A 1 476 ? 1.976   24.093 62.452 1.00 5.43  ? 457  TYR A OH  1 
ATOM   3661 N  N   . ALA A 1 477 ? 5.530   29.514 56.663 1.00 2.00  ? 458  ALA A N   1 
ATOM   3662 C  CA  . ALA A 1 477 ? 6.293   30.066 55.543 1.00 2.00  ? 458  ALA A CA  1 
ATOM   3663 C  C   . ALA A 1 477 ? 7.006   31.335 56.024 1.00 2.00  ? 458  ALA A C   1 
ATOM   3664 O  O   . ALA A 1 477 ? 6.358   32.347 56.343 1.00 2.48  ? 458  ALA A O   1 
ATOM   3665 C  CB  . ALA A 1 477 ? 5.388   30.350 54.319 1.00 2.00  ? 458  ALA A CB  1 
ATOM   3666 N  N   . ASP A 1 478 ? 8.328   31.288 56.103 1.00 2.00  ? 459  ASP A N   1 
ATOM   3667 C  CA  . ASP A 1 478 ? 9.078   32.453 56.606 1.00 2.00  ? 459  ASP A CA  1 
ATOM   3668 C  C   . ASP A 1 478 ? 8.895   33.601 55.625 1.00 2.00  ? 459  ASP A C   1 
ATOM   3669 O  O   . ASP A 1 478 ? 8.713   34.739 56.041 1.00 2.00  ? 459  ASP A O   1 
ATOM   3670 C  CB  . ASP A 1 478 ? 10.564  32.145 56.787 1.00 2.00  ? 459  ASP A CB  1 
ATOM   3671 C  CG  . ASP A 1 478 ? 10.817  31.036 57.799 1.00 2.00  ? 459  ASP A CG  1 
ATOM   3672 O  OD1 . ASP A 1 478 ? 10.060  30.908 58.770 1.00 4.97  ? 459  ASP A OD1 1 
ATOM   3673 O  OD2 . ASP A 1 478 ? 11.776  30.280 57.655 1.00 2.00  ? 459  ASP A OD2 1 
ATOM   3674 N  N   . LEU A 1 479 ? 8.957   33.273 54.325 1.00 2.20  ? 460  LEU A N   1 
ATOM   3675 C  CA  . LEU A 1 479 ? 8.772   34.210 53.215 1.00 2.73  ? 460  LEU A CA  1 
ATOM   3676 C  C   . LEU A 1 479 ? 7.710   33.612 52.301 1.00 2.95  ? 460  LEU A C   1 
ATOM   3677 O  O   . LEU A 1 479 ? 7.543   32.391 52.252 1.00 2.46  ? 460  LEU A O   1 
ATOM   3678 C  CB  . LEU A 1 479 ? 10.070  34.357 52.382 1.00 2.95  ? 460  LEU A CB  1 
ATOM   3679 C  CG  . LEU A 1 479 ? 11.369  34.755 53.130 1.00 3.51  ? 460  LEU A CG  1 
ATOM   3680 C  CD1 . LEU A 1 479 ? 12.553  34.828 52.118 1.00 2.00  ? 460  LEU A CD1 1 
ATOM   3681 C  CD2 . LEU A 1 479 ? 11.211  36.069 53.893 1.00 2.00  ? 460  LEU A CD2 1 
ATOM   3682 N  N   . TYR A 1 480 ? 6.974   34.475 51.602 1.00 2.58  ? 461  TYR A N   1 
ATOM   3683 C  CA  . TYR A 1 480 ? 6.069   33.994 50.578 1.00 2.30  ? 461  TYR A CA  1 
ATOM   3684 C  C   . TYR A 1 480 ? 5.904   35.041 49.490 1.00 2.21  ? 461  TYR A C   1 
ATOM   3685 O  O   . TYR A 1 480 ? 6.184   36.232 49.702 1.00 2.00  ? 461  TYR A O   1 
ATOM   3686 C  CB  . TYR A 1 480 ? 4.717   33.571 51.180 1.00 2.00  ? 461  TYR A CB  1 
ATOM   3687 C  CG  . TYR A 1 480 ? 3.800   34.693 51.653 1.00 2.71  ? 461  TYR A CG  1 
ATOM   3688 C  CD1 . TYR A 1 480 ? 2.835   35.236 50.800 1.00 2.00  ? 461  TYR A CD1 1 
ATOM   3689 C  CD2 . TYR A 1 480 ? 3.862   35.171 52.985 1.00 2.75  ? 461  TYR A CD2 1 
ATOM   3690 C  CE1 . TYR A 1 480 ? 1.953   36.233 51.227 1.00 2.00  ? 461  TYR A CE1 1 
ATOM   3691 C  CE2 . TYR A 1 480 ? 2.979   36.184 53.432 1.00 2.23  ? 461  TYR A CE2 1 
ATOM   3692 C  CZ  . TYR A 1 480 ? 2.030   36.700 52.542 1.00 2.52  ? 461  TYR A CZ  1 
ATOM   3693 O  OH  . TYR A 1 480 ? 1.144   37.653 52.967 1.00 2.70  ? 461  TYR A OH  1 
ATOM   3694 N  N   . ALA A 1 481 ? 5.472   34.592 48.307 1.00 2.56  ? 462  ALA A N   1 
ATOM   3695 C  CA  . ALA A 1 481 ? 5.340   35.516 47.173 1.00 3.20  ? 462  ALA A CA  1 
ATOM   3696 C  C   . ALA A 1 481 ? 4.505   34.881 46.099 1.00 3.82  ? 462  ALA A C   1 
ATOM   3697 O  O   . ALA A 1 481 ? 4.325   33.649 46.110 1.00 4.73  ? 462  ALA A O   1 
ATOM   3698 C  CB  . ALA A 1 481 ? 6.739   35.889 46.609 1.00 2.82  ? 462  ALA A CB  1 
ATOM   3699 N  N   . ALA A 1 482 ? 4.050   35.693 45.139 1.00 3.10  ? 463  ALA A N   1 
ATOM   3700 C  CA  . ALA A 1 482 ? 3.356   35.161 43.949 1.00 2.81  ? 463  ALA A CA  1 
ATOM   3701 C  C   . ALA A 1 482 ? 4.268   34.235 43.099 1.00 2.75  ? 463  ALA A C   1 
ATOM   3702 O  O   . ALA A 1 482 ? 3.788   33.289 42.447 1.00 3.19  ? 463  ALA A O   1 
ATOM   3703 C  CB  . ALA A 1 482 ? 2.816   36.327 43.095 1.00 2.80  ? 463  ALA A CB  1 
ATOM   3704 N  N   . SER A 1 483 ? 5.576   34.498 43.137 1.00 2.47  ? 464  SER A N   1 
ATOM   3705 C  CA  . SER A 1 483 ? 6.584   33.752 42.375 1.00 2.65  ? 464  SER A CA  1 
ATOM   3706 C  C   . SER A 1 483 ? 7.900   33.803 43.122 1.00 2.70  ? 464  SER A C   1 
ATOM   3707 O  O   . SER A 1 483 ? 8.200   34.802 43.745 1.00 2.51  ? 464  SER A O   1 
ATOM   3708 C  CB  . SER A 1 483 ? 6.796   34.392 40.998 1.00 2.33  ? 464  SER A CB  1 
ATOM   3709 O  OG  . SER A 1 483 ? 7.839   33.714 40.306 1.00 3.40  ? 464  SER A OG  1 
ATOM   3710 N  N   . PHE A 1 484 ? 8.705   32.744 43.025 1.00 3.04  ? 465  PHE A N   1 
ATOM   3711 C  CA  . PHE A 1 484 ? 10.048  32.729 43.629 1.00 3.19  ? 465  PHE A CA  1 
ATOM   3712 C  C   . PHE A 1 484 ? 10.944  33.752 42.881 1.00 2.69  ? 465  PHE A C   1 
ATOM   3713 O  O   . PHE A 1 484 ? 11.966  34.208 43.402 1.00 2.00  ? 465  PHE A O   1 
ATOM   3714 C  CB  . PHE A 1 484 ? 10.667  31.314 43.527 1.00 3.64  ? 465  PHE A CB  1 
ATOM   3715 C  CG  . PHE A 1 484 ? 11.033  30.957 42.156 1.00 5.88  ? 465  PHE A CG  1 
ATOM   3716 C  CD1 . PHE A 1 484 ? 12.266  31.367 41.633 1.00 6.47  ? 465  PHE A CD1 1 
ATOM   3717 C  CD2 . PHE A 1 484 ? 10.113  30.302 41.324 1.00 10.52 ? 465  PHE A CD2 1 
ATOM   3718 C  CE1 . PHE A 1 484 ? 12.606  31.107 40.334 1.00 6.80  ? 465  PHE A CE1 1 
ATOM   3719 C  CE2 . PHE A 1 484 ? 10.420  30.041 39.989 1.00 12.00 ? 465  PHE A CE2 1 
ATOM   3720 C  CZ  . PHE A 1 484 ? 11.676  30.453 39.480 1.00 11.13 ? 465  PHE A CZ  1 
ATOM   3721 N  N   . ILE A 1 485 ? 10.567  34.088 41.647 1.00 2.00  ? 466  ILE A N   1 
ATOM   3722 C  CA  . ILE A 1 485 ? 11.364  35.024 40.861 1.00 2.19  ? 466  ILE A CA  1 
ATOM   3723 C  C   . ILE A 1 485 ? 11.529  36.380 41.566 1.00 2.04  ? 466  ILE A C   1 
ATOM   3724 O  O   . ILE A 1 485 ? 12.489  37.118 41.279 1.00 2.48  ? 466  ILE A O   1 
ATOM   3725 C  CB  . ILE A 1 485 ? 10.824  35.226 39.415 1.00 2.44  ? 466  ILE A CB  1 
ATOM   3726 C  CG1 . ILE A 1 485 ? 11.961  35.677 38.482 1.00 3.11  ? 466  ILE A CG1 1 
ATOM   3727 C  CG2 . ILE A 1 485 ? 9.694   36.240 39.394 1.00 2.00  ? 466  ILE A CG2 1 
ATOM   3728 C  CD1 . ILE A 1 485 ? 12.992  34.560 38.177 1.00 7.04  ? 466  ILE A CD1 1 
ATOM   3729 N  N   . ASN A 1 486 ? 10.620  36.709 42.484 1.00 2.00  ? 467  ASN A N   1 
ATOM   3730 C  CA  . ASN A 1 486 ? 10.684  38.017 43.184 1.00 2.47  ? 467  ASN A CA  1 
ATOM   3731 C  C   . ASN A 1 486 ? 11.940  38.178 44.044 1.00 2.25  ? 467  ASN A C   1 
ATOM   3732 O  O   . ASN A 1 486 ? 12.334  39.292 44.316 1.00 3.10  ? 467  ASN A O   1 
ATOM   3733 C  CB  . ASN A 1 486 ? 9.400   38.304 43.998 1.00 2.35  ? 467  ASN A CB  1 
ATOM   3734 C  CG  . ASN A 1 486 ? 8.154   38.388 43.106 1.00 2.98  ? 467  ASN A CG  1 
ATOM   3735 O  OD1 . ASN A 1 486 ? 8.267   38.407 41.883 1.00 2.03  ? 467  ASN A OD1 1 
ATOM   3736 N  ND2 . ASN A 1 486 ? 6.975   38.414 43.715 1.00 2.00  ? 467  ASN A ND2 1 
ATOM   3737 N  N   . LEU A 1 487 ? 12.599  37.072 44.396 1.00 2.35  ? 468  LEU A N   1 
ATOM   3738 C  CA  . LEU A 1 487 ? 13.940  37.106 45.024 1.00 2.73  ? 468  LEU A CA  1 
ATOM   3739 C  C   . LEU A 1 487 ? 15.017  37.797 44.189 1.00 2.53  ? 468  LEU A C   1 
ATOM   3740 O  O   . LEU A 1 487 ? 15.997  38.290 44.742 1.00 2.55  ? 468  LEU A O   1 
ATOM   3741 C  CB  . LEU A 1 487 ? 14.445  35.682 45.357 1.00 2.55  ? 468  LEU A CB  1 
ATOM   3742 C  CG  . LEU A 1 487 ? 13.707  34.984 46.502 1.00 2.83  ? 468  LEU A CG  1 
ATOM   3743 C  CD1 . LEU A 1 487 ? 14.071  33.504 46.497 1.00 2.67  ? 468  LEU A CD1 1 
ATOM   3744 C  CD2 . LEU A 1 487 ? 14.023  35.665 47.845 1.00 2.34  ? 468  LEU A CD2 1 
ATOM   3745 N  N   . LEU A 1 488 ? 14.844  37.801 42.866 1.00 2.39  ? 469  LEU A N   1 
ATOM   3746 C  CA  . LEU A 1 488 ? 15.804  38.443 41.955 1.00 2.73  ? 469  LEU A CA  1 
ATOM   3747 C  C   . LEU A 1 488 ? 15.903  39.942 42.222 1.00 2.91  ? 469  LEU A C   1 
ATOM   3748 O  O   . LEU A 1 488 ? 16.939  40.567 41.941 1.00 3.37  ? 469  LEU A O   1 
ATOM   3749 C  CB  . LEU A 1 488 ? 15.419  38.202 40.483 1.00 2.25  ? 469  LEU A CB  1 
ATOM   3750 C  CG  . LEU A 1 488 ? 16.284  38.779 39.356 1.00 2.00  ? 469  LEU A CG  1 
ATOM   3751 C  CD1 . LEU A 1 488 ? 17.714  38.203 39.352 1.00 2.00  ? 469  LEU A CD1 1 
ATOM   3752 C  CD2 . LEU A 1 488 ? 15.578  38.534 38.026 1.00 2.02  ? 469  LEU A CD2 1 
ATOM   3753 N  N   . TYR A 1 489 ? 14.837  40.508 42.788 1.00 3.34  ? 470  TYR A N   1 
ATOM   3754 C  CA  . TYR A 1 489 ? 14.749  41.970 42.929 1.00 3.33  ? 470  TYR A CA  1 
ATOM   3755 C  C   . TYR A 1 489 ? 15.323  42.487 44.230 1.00 3.33  ? 470  TYR A C   1 
ATOM   3756 O  O   . TYR A 1 489 ? 15.336  43.699 44.445 1.00 4.75  ? 470  TYR A O   1 
ATOM   3757 C  CB  . TYR A 1 489 ? 13.318  42.487 42.657 1.00 2.56  ? 470  TYR A CB  1 
ATOM   3758 C  CG  . TYR A 1 489 ? 12.754  41.866 41.400 1.00 2.88  ? 470  TYR A CG  1 
ATOM   3759 C  CD1 . TYR A 1 489 ? 13.463  41.944 40.177 1.00 2.62  ? 470  TYR A CD1 1 
ATOM   3760 C  CD2 . TYR A 1 489 ? 11.534  41.194 41.418 1.00 2.00  ? 470  TYR A CD2 1 
ATOM   3761 C  CE1 . TYR A 1 489 ? 12.980  41.341 39.027 1.00 2.00  ? 470  TYR A CE1 1 
ATOM   3762 C  CE2 . TYR A 1 489 ? 11.042  40.591 40.268 1.00 2.00  ? 470  TYR A CE2 1 
ATOM   3763 C  CZ  . TYR A 1 489 ? 11.770  40.680 39.082 1.00 2.20  ? 470  TYR A CZ  1 
ATOM   3764 O  OH  . TYR A 1 489 ? 11.285  40.083 37.964 1.00 2.52  ? 470  TYR A OH  1 
ATOM   3765 N  N   . TYR A 1 490 ? 15.833  41.581 45.060 1.00 3.37  ? 471  TYR A N   1 
ATOM   3766 C  CA  . TYR A 1 490 ? 16.463  41.913 46.355 1.00 3.47  ? 471  TYR A CA  1 
ATOM   3767 C  C   . TYR A 1 490 ? 17.960  41.635 46.301 1.00 4.53  ? 471  TYR A C   1 
ATOM   3768 O  O   . TYR A 1 490 ? 18.369  40.640 45.702 1.00 4.44  ? 471  TYR A O   1 
ATOM   3769 C  CB  . TYR A 1 490 ? 15.825  41.104 47.510 1.00 2.49  ? 471  TYR A CB  1 
ATOM   3770 C  CG  . TYR A 1 490 ? 14.376  41.459 47.731 1.00 2.00  ? 471  TYR A CG  1 
ATOM   3771 C  CD1 . TYR A 1 490 ? 14.015  42.417 48.687 1.00 2.00  ? 471  TYR A CD1 1 
ATOM   3772 C  CD2 . TYR A 1 490 ? 13.365  40.871 46.951 1.00 2.00  ? 471  TYR A CD2 1 
ATOM   3773 C  CE1 . TYR A 1 490 ? 12.694  42.761 48.876 1.00 2.00  ? 471  TYR A CE1 1 
ATOM   3774 C  CE2 . TYR A 1 490 ? 12.045  41.214 47.112 1.00 2.00  ? 471  TYR A CE2 1 
ATOM   3775 C  CZ  . TYR A 1 490 ? 11.706  42.155 48.090 1.00 2.00  ? 471  TYR A CZ  1 
ATOM   3776 O  OH  . TYR A 1 490 ? 10.383  42.493 48.283 1.00 2.20  ? 471  TYR A OH  1 
ATOM   3777 N  N   . PRO A 1 491 ? 18.787  42.499 46.940 1.00 5.79  ? 472  PRO A N   1 
ATOM   3778 C  CA  . PRO A 1 491 ? 20.238  42.257 46.881 1.00 6.88  ? 472  PRO A CA  1 
ATOM   3779 C  C   . PRO A 1 491 ? 20.661  41.054 47.702 1.00 8.17  ? 472  PRO A C   1 
ATOM   3780 O  O   . PRO A 1 491 ? 19.931  40.592 48.586 1.00 7.41  ? 472  PRO A O   1 
ATOM   3781 C  CB  . PRO A 1 491 ? 20.855  43.546 47.471 1.00 6.40  ? 472  PRO A CB  1 
ATOM   3782 C  CG  . PRO A 1 491 ? 19.807  44.033 48.419 1.00 6.29  ? 472  PRO A CG  1 
ATOM   3783 C  CD  . PRO A 1 491 ? 18.459  43.688 47.754 1.00 5.24  ? 472  PRO A CD  1 
ATOM   3784 N  N   . PHE A 1 492 ? 21.873  40.598 47.410 1.00 10.76 ? 473  PHE A N   1 
ATOM   3785 C  CA  . PHE A 1 492 ? 22.499  39.425 48.042 1.00 12.94 ? 473  PHE A CA  1 
ATOM   3786 C  C   . PHE A 1 492 ? 22.364  39.296 49.596 1.00 13.50 ? 473  PHE A C   1 
ATOM   3787 O  O   . PHE A 1 492 ? 22.062  38.212 50.140 1.00 15.16 ? 473  PHE A O   1 
ATOM   3788 C  CB  . PHE A 1 492 ? 23.981  39.370 47.581 1.00 13.52 ? 473  PHE A CB  1 
ATOM   3789 C  CG  . PHE A 1 492 ? 24.168  38.849 46.152 1.00 14.75 ? 473  PHE A CG  1 
ATOM   3790 C  CD1 . PHE A 1 492 ? 23.539  37.659 45.729 1.00 16.32 ? 473  PHE A CD1 1 
ATOM   3791 C  CD2 . PHE A 1 492 ? 24.990  39.530 45.241 1.00 16.57 ? 473  PHE A CD2 1 
ATOM   3792 C  CE1 . PHE A 1 492 ? 23.727  37.166 44.406 1.00 16.62 ? 473  PHE A CE1 1 
ATOM   3793 C  CE2 . PHE A 1 492 ? 25.192  39.046 43.922 1.00 16.36 ? 473  PHE A CE2 1 
ATOM   3794 C  CZ  . PHE A 1 492 ? 24.558  37.863 43.509 1.00 14.86 ? 473  PHE A CZ  1 
ATOM   3795 N  N   . SER A 1 493 ? 22.592  40.382 50.316 1.00 12.44 ? 474  SER A N   1 
ATOM   3796 C  CA  . SER A 1 493 ? 22.532  40.278 51.775 1.00 11.58 ? 474  SER A CA  1 
ATOM   3797 C  C   . SER A 1 493 ? 21.338  41.019 52.382 1.00 9.46  ? 474  SER A C   1 
ATOM   3798 O  O   . SER A 1 493 ? 21.400  41.443 53.533 1.00 7.91  ? 474  SER A O   1 
ATOM   3799 C  CB  . SER A 1 493 ? 23.846  40.762 52.404 1.00 12.45 ? 474  SER A CB  1 
ATOM   3800 O  OG  . SER A 1 493 ? 24.949  39.957 51.969 1.00 17.20 ? 474  SER A OG  1 
ATOM   3801 N  N   . TYR A 1 494 ? 20.249  41.134 51.614 1.00 7.13  ? 475  TYR A N   1 
ATOM   3802 C  CA  . TYR A 1 494 ? 19.027  41.738 52.115 1.00 6.47  ? 475  TYR A CA  1 
ATOM   3803 C  C   . TYR A 1 494 ? 18.561  41.110 53.461 1.00 5.97  ? 475  TYR A C   1 
ATOM   3804 O  O   . TYR A 1 494 ? 18.595  39.885 53.619 1.00 5.46  ? 475  TYR A O   1 
ATOM   3805 C  CB  . TYR A 1 494 ? 17.929  41.660 51.052 1.00 5.65  ? 475  TYR A CB  1 
ATOM   3806 C  CG  . TYR A 1 494 ? 16.735  42.521 51.381 1.00 4.68  ? 475  TYR A CG  1 
ATOM   3807 C  CD1 . TYR A 1 494 ? 16.748  43.903 51.142 1.00 3.04  ? 475  TYR A CD1 1 
ATOM   3808 C  CD2 . TYR A 1 494 ? 15.570  41.951 51.914 1.00 4.89  ? 475  TYR A CD2 1 
ATOM   3809 C  CE1 . TYR A 1 494 ? 15.624  44.700 51.446 1.00 3.27  ? 475  TYR A CE1 1 
ATOM   3810 C  CE2 . TYR A 1 494 ? 14.446  42.733 52.213 1.00 3.49  ? 475  TYR A CE2 1 
ATOM   3811 C  CZ  . TYR A 1 494 ? 14.489  44.096 51.987 1.00 5.41  ? 475  TYR A CZ  1 
ATOM   3812 O  OH  . TYR A 1 494 ? 13.376  44.846 52.294 1.00 7.52  ? 475  TYR A OH  1 
ATOM   3813 N  N   . LEU A 1 495 ? 18.164  41.939 54.429 1.00 5.57  ? 476  LEU A N   1 
ATOM   3814 C  CA  . LEU A 1 495 ? 17.476  41.426 55.634 1.00 5.80  ? 476  LEU A CA  1 
ATOM   3815 C  C   . LEU A 1 495 ? 15.951  41.586 55.514 1.00 5.80  ? 476  LEU A C   1 
ATOM   3816 O  O   . LEU A 1 495 ? 15.428  42.719 55.538 1.00 6.13  ? 476  LEU A O   1 
ATOM   3817 C  CB  . LEU A 1 495 ? 17.999  42.086 56.918 1.00 5.86  ? 476  LEU A CB  1 
ATOM   3818 C  CG  . LEU A 1 495 ? 17.317  41.704 58.269 1.00 7.35  ? 476  LEU A CG  1 
ATOM   3819 C  CD1 . LEU A 1 495 ? 17.193  40.199 58.631 1.00 4.30  ? 476  LEU A CD1 1 
ATOM   3820 C  CD2 . LEU A 1 495 ? 17.962  42.454 59.428 1.00 7.14  ? 476  LEU A CD2 1 
ATOM   3821 N  N   . PHE A 1 496 ? 15.246  40.468 55.331 1.00 3.75  ? 477  PHE A N   1 
ATOM   3822 C  CA  . PHE A 1 496 ? 13.803  40.496 55.323 1.00 3.51  ? 477  PHE A CA  1 
ATOM   3823 C  C   . PHE A 1 496 ? 13.334  40.720 56.773 1.00 3.08  ? 477  PHE A C   1 
ATOM   3824 O  O   . PHE A 1 496 ? 13.759  39.993 57.662 1.00 4.24  ? 477  PHE A O   1 
ATOM   3825 C  CB  . PHE A 1 496 ? 13.245  39.195 54.730 1.00 3.03  ? 477  PHE A CB  1 
ATOM   3826 C  CG  . PHE A 1 496 ? 13.455  39.076 53.228 1.00 2.58  ? 477  PHE A CG  1 
ATOM   3827 C  CD1 . PHE A 1 496 ? 12.642  39.783 52.345 1.00 2.02  ? 477  PHE A CD1 1 
ATOM   3828 C  CD2 . PHE A 1 496 ? 14.472  38.267 52.703 1.00 2.39  ? 477  PHE A CD2 1 
ATOM   3829 C  CE1 . PHE A 1 496 ? 12.844  39.713 50.956 1.00 3.13  ? 477  PHE A CE1 1 
ATOM   3830 C  CE2 . PHE A 1 496 ? 14.662  38.176 51.293 1.00 2.63  ? 477  PHE A CE2 1 
ATOM   3831 C  CZ  . PHE A 1 496 ? 13.845  38.900 50.437 1.00 2.27  ? 477  PHE A CZ  1 
ATOM   3832 N  N   . ARG A 1 497 ? 12.500  41.724 57.010 1.00 2.15  ? 478  ARG A N   1 
ATOM   3833 C  CA  . ARG A 1 497 ? 12.104  42.073 58.364 1.00 2.30  ? 478  ARG A CA  1 
ATOM   3834 C  C   . ARG A 1 497 ? 10.614  41.850 58.630 1.00 2.00  ? 478  ARG A C   1 
ATOM   3835 O  O   . ARG A 1 497 ? 9.765   42.188 57.811 1.00 2.00  ? 478  ARG A O   1 
ATOM   3836 C  CB  . ARG A 1 497 ? 12.443  43.544 58.646 1.00 2.12  ? 478  ARG A CB  1 
ATOM   3837 C  CG  . ARG A 1 497 ? 13.891  43.945 58.388 1.00 2.13  ? 478  ARG A CG  1 
ATOM   3838 C  CD  . ARG A 1 497 ? 14.045  45.476 58.455 1.00 5.03  ? 478  ARG A CD  1 
ATOM   3839 N  NE  . ARG A 1 497 ? 14.089  46.079 57.113 1.00 12.91 ? 478  ARG A NE  1 
ATOM   3840 C  CZ  . ARG A 1 497 ? 13.063  46.656 56.479 1.00 14.87 ? 478  ARG A CZ  1 
ATOM   3841 N  NH1 . ARG A 1 497 ? 11.864  46.737 57.059 1.00 16.89 ? 478  ARG A NH1 1 
ATOM   3842 N  NH2 . ARG A 1 497 ? 13.240  47.158 55.254 1.00 14.05 ? 478  ARG A NH2 1 
ATOM   3843 N  N   . ALA A 1 498 ? 10.313  41.288 59.792 1.00 2.00  ? 479  ALA A N   1 
ATOM   3844 C  CA  . ALA A 1 498 ? 8.957   41.214 60.282 1.00 3.14  ? 479  ALA A CA  1 
ATOM   3845 C  C   . ALA A 1 498 ? 8.978   41.742 61.717 1.00 4.42  ? 479  ALA A C   1 
ATOM   3846 O  O   . ALA A 1 498 ? 9.913   41.461 62.455 1.00 4.62  ? 479  ALA A O   1 
ATOM   3847 C  CB  . ALA A 1 498 ? 8.455   39.779 60.246 1.00 2.00  ? 479  ALA A CB  1 
ATOM   3848 N  N   . ALA A 1 499 ? 7.954   42.483 62.123 1.00 6.49  ? 480  ALA A N   1 
ATOM   3849 C  CA  . ALA A 1 499 ? 7.862   42.939 63.534 1.00 8.35  ? 480  ALA A CA  1 
ATOM   3850 C  C   . ALA A 1 499 ? 7.748   41.799 64.528 1.00 9.71  ? 480  ALA A C   1 
ATOM   3851 O  O   . ALA A 1 499 ? 7.170   40.750 64.238 1.00 9.87  ? 480  ALA A O   1 
ATOM   3852 C  CB  . ALA A 1 499 ? 6.713   43.937 63.740 1.00 8.17  ? 480  ALA A CB  1 
ATOM   3853 N  N   . HIS A 1 500 ? 8.310   42.018 65.714 1.00 11.71 ? 481  HIS A N   1 
ATOM   3854 C  CA  . HIS A 1 500 ? 8.127   41.086 66.818 1.00 13.62 ? 481  HIS A CA  1 
ATOM   3855 C  C   . HIS A 1 500 ? 6.690   41.028 67.278 1.00 13.58 ? 481  HIS A C   1 
ATOM   3856 O  O   . HIS A 1 500 ? 5.954   42.018 67.270 1.00 13.91 ? 481  HIS A O   1 
ATOM   3857 C  CB  . HIS A 1 500 ? 9.072   41.389 67.987 1.00 14.43 ? 481  HIS A CB  1 
ATOM   3858 C  CG  . HIS A 1 500 ? 10.465  40.900 67.756 1.00 16.96 ? 481  HIS A CG  1 
ATOM   3859 N  ND1 . HIS A 1 500 ? 10.832  39.585 67.964 1.00 19.01 ? 481  HIS A ND1 1 
ATOM   3860 C  CD2 . HIS A 1 500 ? 11.565  41.530 67.273 1.00 20.04 ? 481  HIS A CD2 1 
ATOM   3861 C  CE1 . HIS A 1 500 ? 12.108  39.437 67.648 1.00 21.38 ? 481  HIS A CE1 1 
ATOM   3862 N  NE2 . HIS A 1 500 ? 12.575  40.601 67.222 1.00 20.63 ? 481  HIS A NE2 1 
ATOM   3863 N  N   . VAL A 1 501 ? 6.316   39.811 67.614 1.00 13.80 ? 482  VAL A N   1 
ATOM   3864 C  CA  . VAL A 1 501 ? 5.037   39.457 68.189 1.00 13.68 ? 482  VAL A CA  1 
ATOM   3865 C  C   . VAL A 1 501 ? 5.109   39.670 69.703 1.00 12.10 ? 482  VAL A C   1 
ATOM   3866 O  O   . VAL A 1 501 ? 6.101   39.239 70.352 1.00 13.07 ? 482  VAL A O   1 
ATOM   3867 C  CB  . VAL A 1 501 ? 4.780   37.956 67.916 1.00 14.18 ? 482  VAL A CB  1 
ATOM   3868 C  CG1 . VAL A 1 501 ? 3.437   37.525 68.479 1.00 14.51 ? 482  VAL A CG1 1 
ATOM   3869 C  CG2 . VAL A 1 501 ? 4.896   37.676 66.405 1.00 14.98 ? 482  VAL A CG2 1 
ATOM   3870 N  N   . LEU A 1 502 ? 4.096   40.366 70.237 1.00 9.81  ? 483  LEU A N   1 
ATOM   3871 C  CA  . LEU A 1 502 ? 3.898   40.550 71.676 1.00 6.89  ? 483  LEU A CA  1 
ATOM   3872 C  C   . LEU A 1 502 ? 2.595   39.876 72.121 1.00 5.08  ? 483  LEU A C   1 
ATOM   3873 O  O   . LEU A 1 502 ? 1.573   39.949 71.427 1.00 4.13  ? 483  LEU A O   1 
ATOM   3874 C  CB  . LEU A 1 502 ? 3.863   42.041 72.069 1.00 6.48  ? 483  LEU A CB  1 
ATOM   3875 C  CG  . LEU A 1 502 ? 5.106   42.932 71.933 1.00 8.16  ? 483  LEU A CG  1 
ATOM   3876 C  CD1 . LEU A 1 502 ? 4.866   44.304 72.559 1.00 6.81  ? 483  LEU A CD1 1 
ATOM   3877 C  CD2 . LEU A 1 502 ? 6.356   42.287 72.529 1.00 7.41  ? 483  LEU A CD2 1 
ATOM   3878 N  N   . MET A 1 503 ? 2.629   39.240 73.283 1.00 2.79  ? 484  MET A N   1 
ATOM   3879 C  CA  . MET A 1 503 ? 1.390   38.768 73.921 1.00 2.12  ? 484  MET A CA  1 
ATOM   3880 C  C   . MET A 1 503 ? 0.540   39.952 74.363 1.00 2.01  ? 484  MET A C   1 
ATOM   3881 O  O   . MET A 1 503 ? 1.073   41.053 74.508 1.00 2.20  ? 484  MET A O   1 
ATOM   3882 C  CB  . MET A 1 503 ? 1.698   37.859 75.108 1.00 2.00  ? 484  MET A CB  1 
ATOM   3883 C  CG  . MET A 1 503 ? 2.354   36.565 74.695 1.00 2.00  ? 484  MET A CG  1 
ATOM   3884 S  SD  . MET A 1 503 ? 2.580   35.448 76.079 1.00 2.00  ? 484  MET A SD  1 
ATOM   3885 C  CE  . MET A 1 503 ? 0.878   34.927 76.306 1.00 2.00  ? 484  MET A CE  1 
ATOM   3886 N  N   . PRO A 1 504 ? -0.793  39.752 74.495 1.00 2.00  ? 485  PRO A N   1 
ATOM   3887 C  CA  . PRO A 1 504 ? -1.716  40.766 75.028 1.00 2.00  ? 485  PRO A CA  1 
ATOM   3888 C  C   . PRO A 1 504 ? -1.285  41.433 76.346 1.00 2.00  ? 485  PRO A C   1 
ATOM   3889 O  O   . PRO A 1 504 ? -1.435  42.635 76.483 1.00 2.00  ? 485  PRO A O   1 
ATOM   3890 C  CB  . PRO A 1 504 ? -3.017  39.971 75.204 1.00 2.00  ? 485  PRO A CB  1 
ATOM   3891 C  CG  . PRO A 1 504 ? -2.972  39.065 74.018 1.00 2.00  ? 485  PRO A CG  1 
ATOM   3892 C  CD  . PRO A 1 504 ? -1.543  38.556 74.063 1.00 2.00  ? 485  PRO A CD  1 
ATOM   3893 N  N   . HIS A 1 505 ? -0.751  40.662 77.290 1.00 2.00  ? 486  HIS A N   1 
ATOM   3894 C  CA  . HIS A 1 505 ? -0.286  41.254 78.570 1.00 2.49  ? 486  HIS A CA  1 
ATOM   3895 C  C   . HIS A 1 505 ? 1.059   42.014 78.447 1.00 2.65  ? 486  HIS A C   1 
ATOM   3896 O  O   . HIS A 1 505 ? 1.424   42.770 79.346 1.00 2.12  ? 486  HIS A O   1 
ATOM   3897 C  CB  . HIS A 1 505 ? -0.210  40.204 79.678 1.00 2.00  ? 486  HIS A CB  1 
ATOM   3898 C  CG  . HIS A 1 505 ? 1.011   39.346 79.602 1.00 2.60  ? 486  HIS A CG  1 
ATOM   3899 N  ND1 . HIS A 1 505 ? 1.035   38.144 78.929 1.00 2.00  ? 486  HIS A ND1 1 
ATOM   3900 C  CD2 . HIS A 1 505 ? 2.250   39.515 80.121 1.00 2.00  ? 486  HIS A CD2 1 
ATOM   3901 C  CE1 . HIS A 1 505 ? 2.234   37.612 79.038 1.00 2.00  ? 486  HIS A CE1 1 
ATOM   3902 N  NE2 . HIS A 1 505 ? 2.997   38.436 79.733 1.00 2.00  ? 486  HIS A NE2 1 
ATOM   3903 N  N   . GLU A 1 506 ? 1.767   41.806 77.336 1.00 2.03  ? 487  GLU A N   1 
ATOM   3904 C  CA  . GLU A 1 506 ? 3.026   42.471 77.074 1.00 4.07  ? 487  GLU A CA  1 
ATOM   3905 C  C   . GLU A 1 506 ? 2.829   43.813 76.323 1.00 5.92  ? 487  GLU A C   1 
ATOM   3906 O  O   . GLU A 1 506 ? 3.780   44.532 76.095 1.00 5.59  ? 487  GLU A O   1 
ATOM   3907 C  CB  . GLU A 1 506 ? 3.961   41.559 76.283 1.00 2.73  ? 487  GLU A CB  1 
ATOM   3908 C  CG  . GLU A 1 506 ? 4.282   40.274 77.022 1.00 2.00  ? 487  GLU A CG  1 
ATOM   3909 C  CD  . GLU A 1 506 ? 5.106   39.336 76.193 1.00 2.00  ? 487  GLU A CD  1 
ATOM   3910 O  OE1 . GLU A 1 506 ? 4.978   39.382 74.928 1.00 2.00  ? 487  GLU A OE1 1 
ATOM   3911 O  OE2 . GLU A 1 506 ? 5.872   38.568 76.801 1.00 2.00  ? 487  GLU A OE2 1 
ATOM   3912 N  N   . SER A 1 507 ? 1.586   44.083 75.915 1.00 8.87  ? 488  SER A N   1 
ATOM   3913 C  CA  . SER A 1 507 ? 1.176   45.318 75.232 1.00 11.14 ? 488  SER A CA  1 
ATOM   3914 C  C   . SER A 1 507 ? 0.503   46.240 76.244 1.00 12.23 ? 488  SER A C   1 
ATOM   3915 O  O   . SER A 1 507 ? 0.647   47.467 76.160 1.00 14.91 ? 488  SER A O   1 
ATOM   3916 C  CB  . SER A 1 507 ? 0.226   45.002 74.060 1.00 11.56 ? 488  SER A CB  1 
ATOM   3917 O  OG  . SER A 1 507 ? 0.624   43.813 73.344 1.00 12.19 ? 488  SER A OG  1 
HETATM 3918 C  C1  . GOL B 2 .   ? -9.456  32.080 42.464 1.00 26.86 ? 1489 GOL A C1  1 
HETATM 3919 O  O1  . GOL B 2 .   ? -10.003 30.816 42.590 1.00 27.00 ? 1489 GOL A O1  1 
HETATM 3920 C  C2  . GOL B 2 .   ? -9.666  32.735 43.807 1.00 26.53 ? 1489 GOL A C2  1 
HETATM 3921 O  O2  . GOL B 2 .   ? -9.429  34.113 43.573 1.00 26.81 ? 1489 GOL A O2  1 
HETATM 3922 C  C3  . GOL B 2 .   ? -8.702  32.100 44.824 1.00 25.94 ? 1489 GOL A C3  1 
HETATM 3923 O  O3  . GOL B 2 .   ? -7.349  32.070 44.410 1.00 17.86 ? 1489 GOL A O3  1 
HETATM 3924 S  S   . SO4 C 3 .   ? -1.530  23.342 61.857 1.00 24.89 ? 1490 SO4 A S   1 
HETATM 3925 O  O1  . SO4 C 3 .   ? -1.348  24.805 61.621 1.00 28.90 ? 1490 SO4 A O1  1 
HETATM 3926 O  O2  . SO4 C 3 .   ? -2.056  22.720 60.601 1.00 27.53 ? 1490 SO4 A O2  1 
HETATM 3927 O  O3  . SO4 C 3 .   ? -0.260  22.659 62.275 1.00 23.63 ? 1490 SO4 A O3  1 
HETATM 3928 O  O4  . SO4 C 3 .   ? -2.535  23.161 62.955 1.00 27.84 ? 1490 SO4 A O4  1 
HETATM 3929 S  S   . SO4 D 3 .   ? 3.721   17.494 44.913 1.00 13.46 ? 1491 SO4 A S   1 
HETATM 3930 O  O1  . SO4 D 3 .   ? 4.348   17.473 43.540 1.00 17.47 ? 1491 SO4 A O1  1 
HETATM 3931 O  O2  . SO4 D 3 .   ? 2.484   18.367 44.876 1.00 15.26 ? 1491 SO4 A O2  1 
HETATM 3932 O  O3  . SO4 D 3 .   ? 3.361   16.091 45.348 1.00 16.93 ? 1491 SO4 A O3  1 
HETATM 3933 O  O4  . SO4 D 3 .   ? 4.816   18.069 45.788 1.00 15.75 ? 1491 SO4 A O4  1 
HETATM 3934 S  S   . SO4 E 3 .   ? 13.163  47.952 50.653 1.00 58.40 ? 1492 SO4 A S   1 
HETATM 3935 O  O1  . SO4 E 3 .   ? 14.546  48.558 50.817 1.00 56.22 ? 1492 SO4 A O1  1 
HETATM 3936 O  O2  . SO4 E 3 .   ? 12.179  49.009 50.210 1.00 58.70 ? 1492 SO4 A O2  1 
HETATM 3937 O  O3  . SO4 E 3 .   ? 13.119  46.838 49.632 1.00 57.31 ? 1492 SO4 A O3  1 
HETATM 3938 O  O4  . SO4 E 3 .   ? 12.718  47.404 51.988 1.00 58.57 ? 1492 SO4 A O4  1 
HETATM 3939 S  S   . SO4 F 3 .   ? -18.584 30.343 64.506 0.50 12.45 ? 1493 SO4 A S   1 
HETATM 3940 O  O1  . SO4 F 3 .   ? -17.149 30.154 64.618 0.50 5.80  ? 1493 SO4 A O1  1 
HETATM 3941 O  O2  . SO4 F 3 .   ? -18.890 30.925 63.200 0.50 16.50 ? 1493 SO4 A O2  1 
HETATM 3942 O  O3  . SO4 F 3 .   ? -19.338 29.096 64.629 0.50 10.41 ? 1493 SO4 A O3  1 
HETATM 3943 O  O4  . SO4 F 3 .   ? -19.086 31.277 65.507 0.50 12.95 ? 1493 SO4 A O4  1 
HETATM 3944 S  S   . SO4 G 3 .   ? -26.662 30.061 63.288 1.00 51.17 ? 1494 SO4 A S   1 
HETATM 3945 O  O1  . SO4 G 3 .   ? -25.741 29.905 62.155 1.00 47.93 ? 1494 SO4 A O1  1 
HETATM 3946 O  O2  . SO4 G 3 .   ? -27.618 31.139 63.027 1.00 51.39 ? 1494 SO4 A O2  1 
HETATM 3947 O  O3  . SO4 G 3 .   ? -27.415 28.831 63.571 1.00 48.55 ? 1494 SO4 A O3  1 
HETATM 3948 O  O4  . SO4 G 3 .   ? -25.872 30.429 64.471 1.00 52.27 ? 1494 SO4 A O4  1 
HETATM 3949 S  S   . SO4 H 3 .   ? -5.977  0.055  34.050 0.50 36.26 ? 1495 SO4 A S   1 
HETATM 3950 O  O1  . SO4 H 3 .   ? -4.750  0.811  34.326 0.50 33.88 ? 1495 SO4 A O1  1 
HETATM 3951 O  O2  . SO4 H 3 .   ? -6.764  0.737  33.022 0.50 33.95 ? 1495 SO4 A O2  1 
HETATM 3952 O  O3  . SO4 H 3 .   ? -5.623  -1.278 33.544 0.50 35.68 ? 1495 SO4 A O3  1 
HETATM 3953 O  O4  . SO4 H 3 .   ? -6.765  -0.086 35.272 0.50 33.40 ? 1495 SO4 A O4  1 
HETATM 3954 MG MG  . MG  I 4 .   ? 5.016   21.528 43.806 1.00 6.20  ? 1496 MG  A MG  1 
HETATM 3955 O  O   . HOH J 5 .   ? -9.263  31.051 38.755 1.00 16.09 ? 2001 HOH A O   1 
HETATM 3956 O  O   . HOH J 5 .   ? -7.269  33.546 38.076 1.00 23.53 ? 2002 HOH A O   1 
HETATM 3957 O  O   . HOH J 5 .   ? 5.374   37.453 38.898 1.00 8.82  ? 2003 HOH A O   1 
HETATM 3958 O  O   . HOH J 5 .   ? -2.011  31.927 31.434 1.00 9.47  ? 2004 HOH A O   1 
HETATM 3959 O  O   . HOH J 5 .   ? -0.779  35.322 29.165 1.00 37.28 ? 2005 HOH A O   1 
HETATM 3960 O  O   . HOH J 5 .   ? -4.051  32.948 28.301 1.00 17.03 ? 2006 HOH A O   1 
HETATM 3961 O  O   . HOH J 5 .   ? 15.036  38.095 29.258 1.00 36.29 ? 2007 HOH A O   1 
HETATM 3962 O  O   . HOH J 5 .   ? 1.640   40.895 35.590 1.00 21.55 ? 2008 HOH A O   1 
HETATM 3963 O  O   . HOH J 5 .   ? 12.210  47.568 36.209 1.00 17.23 ? 2009 HOH A O   1 
HETATM 3964 O  O   . HOH J 5 .   ? 20.089  45.784 44.672 1.00 25.40 ? 2010 HOH A O   1 
HETATM 3965 O  O   . HOH J 5 .   ? 6.333   35.974 36.796 1.00 5.27  ? 2011 HOH A O   1 
HETATM 3966 O  O   . HOH J 5 .   ? -12.939 2.803  27.813 1.00 29.38 ? 2012 HOH A O   1 
HETATM 3967 O  O   . HOH J 5 .   ? -0.544  41.598 33.865 1.00 19.01 ? 2013 HOH A O   1 
HETATM 3968 O  O   . HOH J 5 .   ? -3.111  39.064 29.958 1.00 32.50 ? 2014 HOH A O   1 
HETATM 3969 O  O   . HOH J 5 .   ? 3.551   40.259 27.621 1.00 36.97 ? 2015 HOH A O   1 
HETATM 3970 O  O   . HOH J 5 .   ? 26.524  -2.881 53.647 1.00 32.48 ? 2016 HOH A O   1 
HETATM 3971 O  O   . HOH J 5 .   ? 12.650  37.724 30.064 1.00 30.01 ? 2017 HOH A O   1 
HETATM 3972 O  O   . HOH J 5 .   ? 11.166  42.599 35.142 1.00 16.59 ? 2018 HOH A O   1 
HETATM 3973 O  O   . HOH J 5 .   ? 11.628  45.100 31.991 1.00 34.15 ? 2019 HOH A O   1 
HETATM 3974 O  O   . HOH J 5 .   ? 16.550  39.088 31.352 1.00 34.98 ? 2020 HOH A O   1 
HETATM 3975 O  O   . HOH J 5 .   ? 13.701  45.857 37.497 1.00 19.54 ? 2021 HOH A O   1 
HETATM 3976 O  O   . HOH J 5 .   ? 12.830  49.062 33.861 1.00 16.02 ? 2022 HOH A O   1 
HETATM 3977 O  O   . HOH J 5 .   ? 18.960  48.209 32.252 1.00 20.89 ? 2023 HOH A O   1 
HETATM 3978 O  O   . HOH J 5 .   ? 16.522  51.904 34.639 1.00 16.29 ? 2024 HOH A O   1 
HETATM 3979 O  O   . HOH J 5 .   ? 12.914  44.041 36.059 1.00 29.35 ? 2025 HOH A O   1 
HETATM 3980 O  O   . HOH J 5 .   ? 21.717  44.616 40.764 1.00 28.60 ? 2026 HOH A O   1 
HETATM 3981 O  O   . HOH J 5 .   ? 20.422  45.094 33.832 1.00 28.10 ? 2027 HOH A O   1 
HETATM 3982 O  O   . HOH J 5 .   ? 22.881  50.633 36.951 1.00 18.30 ? 2028 HOH A O   1 
HETATM 3983 O  O   . HOH J 5 .   ? 16.829  53.077 36.899 1.00 23.97 ? 2029 HOH A O   1 
HETATM 3984 O  O   . HOH J 5 .   ? 1.643   15.343 40.252 1.00 21.49 ? 2030 HOH A O   1 
HETATM 3985 O  O   . HOH J 5 .   ? 23.143  49.378 39.417 1.00 27.52 ? 2031 HOH A O   1 
HETATM 3986 O  O   . HOH J 5 .   ? 18.209  47.595 44.711 1.00 24.44 ? 2032 HOH A O   1 
HETATM 3987 O  O   . HOH J 5 .   ? -8.988  33.014 32.239 1.00 28.41 ? 2033 HOH A O   1 
HETATM 3988 O  O   . HOH J 5 .   ? -8.536  24.535 27.823 1.00 26.98 ? 2034 HOH A O   1 
HETATM 3989 O  O   . HOH J 5 .   ? 14.191  53.285 38.429 1.00 24.08 ? 2035 HOH A O   1 
HETATM 3990 O  O   . HOH J 5 .   ? 11.365  49.345 38.156 1.00 17.43 ? 2036 HOH A O   1 
HETATM 3991 O  O   . HOH J 5 .   ? -23.904 -0.332 51.535 1.00 24.24 ? 2037 HOH A O   1 
HETATM 3992 O  O   . HOH J 5 .   ? 8.889   41.112 35.693 1.00 6.60  ? 2038 HOH A O   1 
HETATM 3993 O  O   . HOH J 5 .   ? -15.012 5.063  27.997 1.00 23.91 ? 2039 HOH A O   1 
HETATM 3994 O  O   . HOH J 5 .   ? -15.085 9.076  27.012 1.00 25.38 ? 2040 HOH A O   1 
HETATM 3995 O  O   . HOH J 5 .   ? -10.951 6.522  27.945 1.00 27.06 ? 2041 HOH A O   1 
HETATM 3996 O  O   . HOH J 5 .   ? -5.370  7.349  28.374 1.00 19.75 ? 2042 HOH A O   1 
HETATM 3997 O  O   . HOH J 5 .   ? 14.800  22.196 24.222 1.00 25.49 ? 2043 HOH A O   1 
HETATM 3998 O  O   . HOH J 5 .   ? 3.716   45.396 37.308 1.00 36.46 ? 2044 HOH A O   1 
HETATM 3999 O  O   . HOH J 5 .   ? 8.760   49.771 38.438 1.00 30.76 ? 2045 HOH A O   1 
HETATM 4000 O  O   . HOH J 5 .   ? 1.498   47.398 45.013 1.00 21.32 ? 2046 HOH A O   1 
HETATM 4001 O  O   . HOH J 5 .   ? 3.416   38.384 40.425 1.00 14.06 ? 2047 HOH A O   1 
HETATM 4002 O  O   . HOH J 5 .   ? 4.387   38.645 45.574 1.00 3.83  ? 2048 HOH A O   1 
HETATM 4003 O  O   . HOH J 5 .   ? -18.968 7.120  54.596 1.00 19.06 ? 2049 HOH A O   1 
HETATM 4004 O  O   . HOH J 5 .   ? -16.327 9.267  58.564 1.00 28.25 ? 2050 HOH A O   1 
HETATM 4005 O  O   . HOH J 5 .   ? 8.086   42.529 52.290 1.00 11.84 ? 2051 HOH A O   1 
HETATM 4006 O  O   . HOH J 5 .   ? 26.479  -0.834 51.953 1.00 25.43 ? 2052 HOH A O   1 
HETATM 4007 O  O   . HOH J 5 .   ? 6.354   41.688 54.232 1.00 2.93  ? 2053 HOH A O   1 
HETATM 4008 O  O   . HOH J 5 .   ? 2.766   37.157 59.553 1.00 6.36  ? 2054 HOH A O   1 
HETATM 4009 O  O   . HOH J 5 .   ? 5.538   33.755 63.522 1.00 11.54 ? 2055 HOH A O   1 
HETATM 4010 O  O   . HOH J 5 .   ? 13.545  34.922 62.380 1.00 13.89 ? 2056 HOH A O   1 
HETATM 4011 O  O   . HOH J 5 .   ? 10.505  37.824 63.050 1.00 10.11 ? 2057 HOH A O   1 
HETATM 4012 O  O   . HOH J 5 .   ? 18.706  33.774 57.595 1.00 17.71 ? 2058 HOH A O   1 
HETATM 4013 O  O   . HOH J 5 .   ? 22.892  34.512 50.447 1.00 17.16 ? 2059 HOH A O   1 
HETATM 4014 O  O   . HOH J 5 .   ? -21.699 30.721 68.953 1.00 26.93 ? 2060 HOH A O   1 
HETATM 4015 O  O   . HOH J 5 .   ? -16.746 16.672 65.746 1.00 30.75 ? 2061 HOH A O   1 
HETATM 4016 O  O   . HOH J 5 .   ? -19.801 18.475 66.241 1.00 27.21 ? 2062 HOH A O   1 
HETATM 4017 O  O   . HOH J 5 .   ? 27.203  26.969 50.586 1.00 30.14 ? 2063 HOH A O   1 
HETATM 4018 O  O   . HOH J 5 .   ? 7.570   17.824 44.593 1.00 2.00  ? 2064 HOH A O   1 
HETATM 4019 O  O   . HOH J 5 .   ? 3.365   16.196 37.677 1.00 9.67  ? 2065 HOH A O   1 
HETATM 4020 O  O   . HOH J 5 .   ? 5.915   16.825 40.569 1.00 17.37 ? 2066 HOH A O   1 
HETATM 4021 O  O   . HOH J 5 .   ? -22.106 20.576 35.832 1.00 28.73 ? 2067 HOH A O   1 
HETATM 4022 O  O   . HOH J 5 .   ? -2.669  25.594 36.543 1.00 2.65  ? 2068 HOH A O   1 
HETATM 4023 O  O   . HOH J 5 .   ? 7.050   30.566 41.073 1.00 7.88  ? 2069 HOH A O   1 
HETATM 4024 O  O   . HOH J 5 .   ? 10.592  29.497 36.112 1.00 25.49 ? 2070 HOH A O   1 
HETATM 4025 O  O   . HOH J 5 .   ? -25.325 17.657 35.908 1.00 28.25 ? 2071 HOH A O   1 
HETATM 4026 O  O   . HOH J 5 .   ? -29.396 15.014 35.122 1.00 19.01 ? 2072 HOH A O   1 
HETATM 4027 O  O   . HOH J 5 .   ? -33.788 1.636  40.512 1.00 27.94 ? 2073 HOH A O   1 
HETATM 4028 O  O   . HOH J 5 .   ? -0.007  32.812 29.504 1.00 21.33 ? 2074 HOH A O   1 
HETATM 4029 O  O   . HOH J 5 .   ? -6.257  32.372 31.213 1.00 14.48 ? 2075 HOH A O   1 
HETATM 4030 O  O   . HOH J 5 .   ? -7.871  30.833 36.516 1.00 12.45 ? 2076 HOH A O   1 
HETATM 4031 O  O   . HOH J 5 .   ? -6.749  31.519 28.628 1.00 19.55 ? 2077 HOH A O   1 
HETATM 4032 O  O   . HOH J 5 .   ? -6.913  22.631 28.194 1.00 15.50 ? 2078 HOH A O   1 
HETATM 4033 O  O   . HOH J 5 .   ? -3.406  30.465 29.721 1.00 18.46 ? 2079 HOH A O   1 
HETATM 4034 O  O   . HOH J 5 .   ? -4.445  28.302 25.012 1.00 29.13 ? 2080 HOH A O   1 
HETATM 4035 O  O   . HOH J 5 .   ? -22.993 5.675  41.750 1.00 38.07 ? 2081 HOH A O   1 
HETATM 4036 O  O   . HOH J 5 .   ? 1.647   17.200 33.618 1.00 5.03  ? 2082 HOH A O   1 
HETATM 4037 O  O   . HOH J 5 .   ? -4.593  19.611 36.633 1.00 4.43  ? 2083 HOH A O   1 
HETATM 4038 O  O   . HOH J 5 .   ? -20.884 1.950  51.515 1.00 25.71 ? 2084 HOH A O   1 
HETATM 4039 O  O   . HOH J 5 .   ? -11.904 26.131 31.463 1.00 24.01 ? 2085 HOH A O   1 
HETATM 4040 O  O   . HOH J 5 .   ? -9.823  26.489 29.096 1.00 29.75 ? 2086 HOH A O   1 
HETATM 4041 O  O   . HOH J 5 .   ? -1.756  15.219 42.076 1.00 26.57 ? 2087 HOH A O   1 
HETATM 4042 O  O   . HOH J 5 .   ? -0.826  6.128  41.048 1.00 30.73 ? 2088 HOH A O   1 
HETATM 4043 O  O   . HOH J 5 .   ? -13.116 20.918 30.865 1.00 14.72 ? 2089 HOH A O   1 
HETATM 4044 O  O   . HOH J 5 .   ? -15.348 15.441 28.314 1.00 35.12 ? 2090 HOH A O   1 
HETATM 4045 O  O   . HOH J 5 .   ? -8.920  20.741 27.717 1.00 32.41 ? 2091 HOH A O   1 
HETATM 4046 O  O   . HOH J 5 .   ? 4.010   10.024 30.163 1.00 25.35 ? 2092 HOH A O   1 
HETATM 4047 O  O   . HOH J 5 .   ? -8.201  9.719  30.850 1.00 4.20  ? 2093 HOH A O   1 
HETATM 4048 O  O   . HOH J 5 .   ? 5.593   12.240 26.116 1.00 29.89 ? 2094 HOH A O   1 
HETATM 4049 O  O   . HOH J 5 .   ? -6.567  10.281 26.618 1.00 28.86 ? 2095 HOH A O   1 
HETATM 4050 O  O   . HOH J 5 .   ? -13.986 7.370  28.743 1.00 11.60 ? 2096 HOH A O   1 
HETATM 4051 O  O   . HOH J 5 .   ? -9.304  6.960  30.564 1.00 8.70  ? 2097 HOH A O   1 
HETATM 4052 O  O   . HOH J 5 .   ? -8.892  5.287  38.270 1.00 7.77  ? 2098 HOH A O   1 
HETATM 4053 O  O   . HOH J 5 .   ? -7.200  3.524  39.435 1.00 23.99 ? 2099 HOH A O   1 
HETATM 4054 O  O   . HOH J 5 .   ? -9.236  4.374  31.356 1.00 9.80  ? 2100 HOH A O   1 
HETATM 4055 O  O   . HOH J 5 .   ? -15.695 -0.213 37.653 1.00 7.73  ? 2101 HOH A O   1 
HETATM 4056 O  O   . HOH J 5 .   ? -21.212 0.610  35.439 1.00 25.11 ? 2102 HOH A O   1 
HETATM 4057 O  O   . HOH J 5 .   ? -22.507 4.017  36.739 1.00 27.48 ? 2103 HOH A O   1 
HETATM 4058 O  O   . HOH J 5 .   ? -20.388 4.686  31.321 1.00 25.42 ? 2104 HOH A O   1 
HETATM 4059 O  O   . HOH J 5 .   ? 8.036   8.580  43.769 1.00 7.35  ? 2105 HOH A O   1 
HETATM 4060 O  O   . HOH J 5 .   ? 5.504   11.198 45.695 1.00 10.28 ? 2106 HOH A O   1 
HETATM 4061 O  O   . HOH J 5 .   ? -24.652 6.272  31.340 1.00 18.81 ? 2107 HOH A O   1 
HETATM 4062 O  O   . HOH J 5 .   ? -22.347 9.840  25.346 1.00 34.22 ? 2108 HOH A O   1 
HETATM 4063 O  O   . HOH J 5 .   ? 19.140  19.309 28.774 1.00 30.74 ? 2109 HOH A O   1 
HETATM 4064 O  O   . HOH J 5 .   ? 13.172  17.858 25.895 1.00 17.93 ? 2110 HOH A O   1 
HETATM 4065 O  O   . HOH J 5 .   ? 11.876  22.019 25.322 1.00 20.66 ? 2111 HOH A O   1 
HETATM 4066 O  O   . HOH J 5 .   ? 17.236  23.191 25.120 1.00 16.73 ? 2112 HOH A O   1 
HETATM 4067 O  O   . HOH J 5 .   ? -17.064 19.104 27.883 1.00 33.36 ? 2113 HOH A O   1 
HETATM 4068 O  O   . HOH J 5 .   ? -15.954 16.373 30.847 1.00 34.67 ? 2114 HOH A O   1 
HETATM 4069 O  O   . HOH J 5 .   ? -8.959  27.009 38.025 1.00 3.81  ? 2115 HOH A O   1 
HETATM 4070 O  O   . HOH J 5 .   ? -13.846 24.753 30.508 1.00 21.15 ? 2116 HOH A O   1 
HETATM 4071 O  O   . HOH J 5 .   ? -16.142 30.056 33.776 1.00 24.62 ? 2117 HOH A O   1 
HETATM 4072 O  O   . HOH J 5 .   ? 27.273  32.960 31.209 1.00 17.47 ? 2118 HOH A O   1 
HETATM 4073 O  O   . HOH J 5 .   ? 28.456  28.617 29.273 1.00 22.16 ? 2119 HOH A O   1 
HETATM 4074 O  O   . HOH J 5 .   ? 25.755  23.252 26.030 1.00 29.51 ? 2120 HOH A O   1 
HETATM 4075 O  O   . HOH J 5 .   ? -12.854 27.741 33.205 1.00 13.38 ? 2121 HOH A O   1 
HETATM 4076 O  O   . HOH J 5 .   ? -9.433  31.444 34.651 1.00 19.76 ? 2122 HOH A O   1 
HETATM 4077 O  O   . HOH J 5 .   ? -11.589 32.320 37.695 1.00 15.20 ? 2123 HOH A O   1 
HETATM 4078 O  O   . HOH J 5 .   ? -9.920  28.375 40.373 1.00 21.07 ? 2124 HOH A O   1 
HETATM 4079 O  O   . HOH J 5 .   ? 24.116  18.223 31.242 1.00 30.40 ? 2125 HOH A O   1 
HETATM 4080 O  O   . HOH J 5 .   ? 25.967  19.122 35.213 1.00 25.59 ? 2126 HOH A O   1 
HETATM 4081 O  O   . HOH J 5 .   ? -9.760  23.134 47.124 1.00 2.00  ? 2127 HOH A O   1 
HETATM 4082 O  O   . HOH J 5 .   ? -13.720 30.240 43.878 1.00 3.47  ? 2128 HOH A O   1 
HETATM 4083 O  O   . HOH J 5 .   ? 12.486  6.584  37.684 1.00 25.88 ? 2129 HOH A O   1 
HETATM 4084 O  O   . HOH J 5 .   ? -6.718  24.733 53.801 1.00 2.00  ? 2130 HOH A O   1 
HETATM 4085 O  O   . HOH J 5 .   ? 22.644  7.266  52.211 1.00 26.66 ? 2131 HOH A O   1 
HETATM 4086 O  O   . HOH J 5 .   ? 14.313  0.004  47.013 1.00 29.04 ? 2132 HOH A O   1 
HETATM 4087 O  O   . HOH J 5 .   ? -16.346 9.118  55.789 1.00 17.04 ? 2133 HOH A O   1 
HETATM 4088 O  O   . HOH J 5 .   ? -19.976 8.664  52.775 1.00 2.00  ? 2134 HOH A O   1 
HETATM 4089 O  O   . HOH J 5 .   ? 16.707  -1.395 50.423 1.00 32.55 ? 2135 HOH A O   1 
HETATM 4090 O  O   . HOH J 5 .   ? -25.327 19.189 53.090 1.00 28.46 ? 2136 HOH A O   1 
HETATM 4091 O  O   . HOH J 5 .   ? 28.815  -0.876 50.069 1.00 23.15 ? 2137 HOH A O   1 
HETATM 4092 O  O   . HOH J 5 .   ? 25.291  10.056 50.258 1.00 16.91 ? 2138 HOH A O   1 
HETATM 4093 O  O   . HOH J 5 .   ? 29.947  12.146 50.630 1.00 24.13 ? 2139 HOH A O   1 
HETATM 4094 O  O   . HOH J 5 .   ? 33.143  14.106 48.055 1.00 26.28 ? 2140 HOH A O   1 
HETATM 4095 O  O   . HOH J 5 .   ? 11.730  4.603  43.364 1.00 15.25 ? 2141 HOH A O   1 
HETATM 4096 O  O   . HOH J 5 .   ? -10.543 25.728 54.041 1.00 2.75  ? 2142 HOH A O   1 
HETATM 4097 O  O   . HOH J 5 .   ? -7.572  23.495 65.495 1.00 18.48 ? 2143 HOH A O   1 
HETATM 4098 O  O   . HOH J 5 .   ? -5.304  25.002 65.289 1.00 16.73 ? 2144 HOH A O   1 
HETATM 4099 O  O   . HOH J 5 .   ? -13.588 26.321 67.037 1.00 2.91  ? 2145 HOH A O   1 
HETATM 4100 O  O   . HOH J 5 .   ? 26.855  25.426 61.280 1.00 29.45 ? 2146 HOH A O   1 
HETATM 4101 O  O   . HOH J 5 .   ? 1.381   13.799 52.559 1.00 32.38 ? 2147 HOH A O   1 
HETATM 4102 O  O   . HOH J 5 .   ? -26.644 19.406 45.358 1.00 13.90 ? 2148 HOH A O   1 
HETATM 4103 O  O   . HOH J 5 .   ? -27.707 14.947 47.958 1.00 14.56 ? 2149 HOH A O   1 
HETATM 4104 O  O   . HOH J 5 .   ? 2.417   18.104 61.857 1.00 28.63 ? 2150 HOH A O   1 
HETATM 4105 O  O   . HOH J 5 .   ? -19.595 21.306 46.742 1.00 3.10  ? 2151 HOH A O   1 
HETATM 4106 O  O   . HOH J 5 .   ? -20.284 18.742 47.106 1.00 2.23  ? 2152 HOH A O   1 
HETATM 4107 O  O   . HOH J 5 .   ? -24.188 27.831 42.986 1.00 27.62 ? 2153 HOH A O   1 
HETATM 4108 O  O   . HOH J 5 .   ? -28.195 20.444 49.192 1.00 27.32 ? 2154 HOH A O   1 
HETATM 4109 O  O   . HOH J 5 .   ? -26.670 28.313 46.584 1.00 17.08 ? 2155 HOH A O   1 
HETATM 4110 O  O   . HOH J 5 .   ? -26.650 30.360 50.103 1.00 26.28 ? 2156 HOH A O   1 
HETATM 4111 O  O   . HOH J 5 .   ? -22.119 28.244 52.885 1.00 9.47  ? 2157 HOH A O   1 
HETATM 4112 O  O   . HOH J 5 .   ? -29.308 27.042 53.646 1.00 25.71 ? 2158 HOH A O   1 
HETATM 4113 O  O   . HOH J 5 .   ? -30.437 27.989 56.698 1.00 25.59 ? 2159 HOH A O   1 
HETATM 4114 O  O   . HOH J 5 .   ? -26.702 20.494 57.530 1.00 29.36 ? 2160 HOH A O   1 
HETATM 4115 O  O   . HOH J 5 .   ? -21.617 28.901 66.833 1.00 23.95 ? 2161 HOH A O   1 
HETATM 4116 O  O   . HOH J 5 .   ? -28.783 18.647 56.196 1.00 26.64 ? 2162 HOH A O   1 
HETATM 4117 O  O   . HOH J 5 .   ? -23.708 15.199 62.219 1.00 27.77 ? 2163 HOH A O   1 
HETATM 4118 O  O   . HOH J 5 .   ? -24.742 20.783 55.868 1.00 17.22 ? 2164 HOH A O   1 
HETATM 4119 O  O   . HOH J 5 .   ? -20.267 16.626 61.683 1.00 11.50 ? 2165 HOH A O   1 
HETATM 4120 O  O   . HOH J 5 .   ? -22.115 26.211 68.158 1.00 9.52  ? 2166 HOH A O   1 
HETATM 4121 O  O   . HOH J 5 .   ? -19.816 20.399 64.491 1.00 2.50  ? 2167 HOH A O   1 
HETATM 4122 O  O   . HOH J 5 .   ? -17.975 17.798 62.494 1.00 17.32 ? 2168 HOH A O   1 
HETATM 4123 O  O   . HOH J 5 .   ? -7.295  18.872 64.798 1.00 23.56 ? 2169 HOH A O   1 
HETATM 4124 O  O   . HOH J 5 .   ? -15.482 16.509 62.944 1.00 4.13  ? 2170 HOH A O   1 
HETATM 4125 O  O   . HOH J 5 .   ? -12.519 11.658 66.223 1.00 29.62 ? 2171 HOH A O   1 
HETATM 4126 O  O   . HOH J 5 .   ? -14.086 12.457 69.306 1.00 40.20 ? 2172 HOH A O   1 
HETATM 4127 O  O   . HOH J 5 .   ? -10.206 21.212 62.766 1.00 22.90 ? 2173 HOH A O   1 
HETATM 4128 O  O   . HOH J 5 .   ? -7.675  16.150 57.005 1.00 20.78 ? 2174 HOH A O   1 
HETATM 4129 O  O   . HOH J 5 .   ? -6.175  17.283 66.662 1.00 25.87 ? 2175 HOH A O   1 
HETATM 4130 O  O   . HOH J 5 .   ? -4.432  12.905 62.537 1.00 28.39 ? 2176 HOH A O   1 
HETATM 4131 O  O   . HOH J 5 .   ? -5.058  19.240 59.185 1.00 32.49 ? 2177 HOH A O   1 
HETATM 4132 O  O   . HOH J 5 .   ? -20.094 32.048 50.235 1.00 22.06 ? 2178 HOH A O   1 
HETATM 4133 O  O   . HOH J 5 .   ? -14.662 13.888 63.281 1.00 10.95 ? 2179 HOH A O   1 
HETATM 4134 O  O   . HOH J 5 .   ? -8.954  9.887  61.383 1.00 19.69 ? 2180 HOH A O   1 
HETATM 4135 O  O   . HOH J 5 .   ? -9.842  11.174 53.268 1.00 22.27 ? 2181 HOH A O   1 
HETATM 4136 O  O   . HOH J 5 .   ? -17.073 11.577 62.131 1.00 25.23 ? 2182 HOH A O   1 
HETATM 4137 O  O   . HOH J 5 .   ? -6.868  13.242 54.589 1.00 18.47 ? 2183 HOH A O   1 
HETATM 4138 O  O   . HOH J 5 .   ? 1.219   32.798 62.876 1.00 12.09 ? 2184 HOH A O   1 
HETATM 4139 O  O   . HOH J 5 .   ? -3.696  15.210 46.383 1.00 23.53 ? 2185 HOH A O   1 
HETATM 4140 O  O   . HOH J 5 .   ? -2.824  12.621 49.358 1.00 31.19 ? 2186 HOH A O   1 
HETATM 4141 O  O   . HOH J 5 .   ? -5.958  15.729 54.051 1.00 14.14 ? 2187 HOH A O   1 
HETATM 4142 O  O   . HOH J 5 .   ? -4.456  16.697 52.001 1.00 32.18 ? 2188 HOH A O   1 
HETATM 4143 O  O   . HOH J 5 .   ? -1.984  18.087 52.513 1.00 20.31 ? 2189 HOH A O   1 
HETATM 4144 O  O   . HOH J 5 .   ? -0.180  24.069 49.073 1.00 9.25  ? 2190 HOH A O   1 
HETATM 4145 O  O   . HOH J 5 .   ? 5.707   31.981 37.807 1.00 28.73 ? 2191 HOH A O   1 
HETATM 4146 O  O   . HOH J 5 .   ? -7.103  22.820 45.171 1.00 14.45 ? 2192 HOH A O   1 
HETATM 4147 O  O   . HOH J 5 .   ? -3.930  21.815 38.297 1.00 2.00  ? 2193 HOH A O   1 
HETATM 4148 O  O   . HOH J 5 .   ? -7.536  17.198 40.940 1.00 3.40  ? 2194 HOH A O   1 
HETATM 4149 O  O   . HOH J 5 .   ? -4.601  17.557 38.381 1.00 3.18  ? 2195 HOH A O   1 
HETATM 4150 O  O   . HOH J 5 .   ? -3.431  17.852 48.517 1.00 16.46 ? 2196 HOH A O   1 
HETATM 4151 O  O   . HOH J 5 .   ? 18.545  47.040 51.721 1.00 33.09 ? 2197 HOH A O   1 
HETATM 4152 O  O   . HOH J 5 .   ? -20.099 25.346 37.279 1.00 3.39  ? 2198 HOH A O   1 
HETATM 4153 O  O   . HOH J 5 .   ? -19.682 21.463 34.472 1.00 11.62 ? 2199 HOH A O   1 
HETATM 4154 O  O   . HOH J 5 .   ? -25.921 21.823 37.348 1.00 19.09 ? 2200 HOH A O   1 
HETATM 4155 O  O   . HOH J 5 .   ? -26.225 21.144 43.558 1.00 4.05  ? 2201 HOH A O   1 
HETATM 4156 O  O   . HOH J 5 .   ? -28.007 22.365 39.905 1.00 20.71 ? 2202 HOH A O   1 
HETATM 4157 O  O   . HOH J 5 .   ? -23.227 18.674 37.726 1.00 4.37  ? 2203 HOH A O   1 
HETATM 4158 O  O   . HOH J 5 .   ? -27.395 18.289 37.497 1.00 16.40 ? 2204 HOH A O   1 
HETATM 4159 O  O   . HOH J 5 .   ? -28.419 15.665 37.436 1.00 5.90  ? 2205 HOH A O   1 
HETATM 4160 O  O   . HOH J 5 .   ? -32.530 12.631 42.210 1.00 22.18 ? 2206 HOH A O   1 
HETATM 4161 O  O   . HOH J 5 .   ? -32.320 14.245 45.507 1.00 21.93 ? 2207 HOH A O   1 
HETATM 4162 O  O   . HOH J 5 .   ? -33.966 17.286 41.513 1.00 34.16 ? 2208 HOH A O   1 
HETATM 4163 O  O   . HOH J 5 .   ? -33.250 5.471  42.659 1.00 23.24 ? 2209 HOH A O   1 
HETATM 4164 O  O   . HOH J 5 .   ? -32.239 3.349  38.917 1.00 40.38 ? 2210 HOH A O   1 
HETATM 4165 O  O   . HOH J 5 .   ? -27.787 4.503  36.430 1.00 32.43 ? 2211 HOH A O   1 
HETATM 4166 O  O   . HOH J 5 .   ? -30.578 11.526 43.908 1.00 15.65 ? 2212 HOH A O   1 
HETATM 4167 O  O   . HOH J 5 .   ? -33.417 11.578 46.076 1.00 20.79 ? 2213 HOH A O   1 
HETATM 4168 O  O   . HOH J 5 .   ? -27.184 7.479  57.165 1.00 25.69 ? 2214 HOH A O   1 
HETATM 4169 O  O   . HOH J 5 .   ? -25.240 14.786 53.055 1.00 10.70 ? 2215 HOH A O   1 
HETATM 4170 O  O   . HOH J 5 .   ? -27.020 14.110 60.552 1.00 34.52 ? 2216 HOH A O   1 
HETATM 4171 O  O   . HOH J 5 .   ? -30.628 8.748  54.594 1.00 28.53 ? 2217 HOH A O   1 
HETATM 4172 O  O   . HOH J 5 .   ? -26.865 7.215  54.574 1.00 16.43 ? 2218 HOH A O   1 
HETATM 4173 O  O   . HOH J 5 .   ? -22.549 5.300  54.483 1.00 15.47 ? 2219 HOH A O   1 
HETATM 4174 O  O   . HOH J 5 .   ? -28.710 -0.178 39.672 1.00 30.06 ? 2220 HOH A O   1 
HETATM 4175 O  O   . HOH J 5 .   ? -29.928 -6.047 41.273 1.00 38.67 ? 2221 HOH A O   1 
HETATM 4176 O  O   . HOH J 5 .   ? -33.534 -6.919 43.723 1.00 31.93 ? 2222 HOH A O   1 
HETATM 4177 O  O   . HOH J 5 .   ? -29.449 -2.542 40.812 1.00 32.53 ? 2223 HOH A O   1 
HETATM 4178 O  O   . HOH J 5 .   ? -30.906 -3.374 47.976 1.00 25.93 ? 2224 HOH A O   1 
HETATM 4179 O  O   . HOH J 5 .   ? -25.404 4.127  43.174 1.00 34.29 ? 2225 HOH A O   1 
HETATM 4180 O  O   . HOH J 5 .   ? -20.329 2.752  48.575 1.00 9.51  ? 2226 HOH A O   1 
HETATM 4181 O  O   . HOH J 5 .   ? -17.989 3.974  52.263 1.00 24.72 ? 2227 HOH A O   1 
HETATM 4182 O  O   . HOH J 5 .   ? -11.905 5.431  50.578 1.00 34.24 ? 2228 HOH A O   1 
HETATM 4183 O  O   . HOH J 5 .   ? -13.953 3.513  45.793 1.00 26.93 ? 2229 HOH A O   1 
HETATM 4184 O  O   . HOH J 5 .   ? -18.237 4.324  44.301 1.00 15.97 ? 2230 HOH A O   1 
HETATM 4185 O  O   . HOH J 5 .   ? -11.462 3.583  41.476 1.00 8.38  ? 2231 HOH A O   1 
HETATM 4186 O  O   . HOH J 5 .   ? -15.578 2.064  42.290 1.00 26.27 ? 2232 HOH A O   1 
HETATM 4187 O  O   . HOH J 5 .   ? -11.077 5.696  39.729 1.00 4.87  ? 2233 HOH A O   1 
HETATM 4188 O  O   . HOH J 5 .   ? -4.897  5.441  40.647 1.00 12.78 ? 2234 HOH A O   1 
HETATM 4189 O  O   . HOH J 5 .   ? -5.582  7.553  45.358 1.00 19.55 ? 2235 HOH A O   1 
HETATM 4190 O  O   . HOH J 5 .   ? 0.408   9.932  40.056 1.00 21.10 ? 2236 HOH A O   1 
HETATM 4191 O  O   . HOH J 5 .   ? -2.782  13.064 42.477 1.00 27.56 ? 2237 HOH A O   1 
HETATM 4192 O  O   . HOH J 5 .   ? -2.561  5.255  39.458 1.00 16.54 ? 2238 HOH A O   1 
HETATM 4193 O  O   . HOH J 5 .   ? 0.403   11.108 32.606 1.00 3.79  ? 2239 HOH A O   1 
HETATM 4194 O  O   . HOH J 5 .   ? 4.305   9.150  35.114 1.00 24.84 ? 2240 HOH A O   1 
HETATM 4195 O  O   . HOH J 5 .   ? 2.572   9.344  33.176 1.00 15.19 ? 2241 HOH A O   1 
HETATM 4196 O  O   . HOH J 5 .   ? 1.298   10.526 29.860 1.00 9.24  ? 2242 HOH A O   1 
HETATM 4197 O  O   . HOH J 5 .   ? 1.333   7.313  31.592 1.00 23.12 ? 2243 HOH A O   1 
HETATM 4198 O  O   . HOH J 5 .   ? -5.649  9.692  30.181 1.00 11.57 ? 2244 HOH A O   1 
HETATM 4199 O  O   . HOH J 5 .   ? 1.697   15.320 35.816 1.00 6.93  ? 2245 HOH A O   1 
HETATM 4200 O  O   . HOH J 5 .   ? 4.959   13.947 38.334 1.00 6.30  ? 2246 HOH A O   1 
HETATM 4201 O  O   . HOH J 5 .   ? 4.512   13.927 24.356 1.00 28.48 ? 2247 HOH A O   1 
HETATM 4202 O  O   . HOH J 5 .   ? 0.718   8.699  27.683 1.00 26.76 ? 2248 HOH A O   1 
HETATM 4203 O  O   . HOH J 5 .   ? 5.935   21.133 23.525 1.00 14.92 ? 2249 HOH A O   1 
HETATM 4204 O  O   . HOH J 5 .   ? -1.465  18.500 23.931 1.00 13.41 ? 2250 HOH A O   1 
HETATM 4205 O  O   . HOH J 5 .   ? 1.163   26.404 21.847 1.00 28.61 ? 2251 HOH A O   1 
HETATM 4206 O  O   . HOH J 5 .   ? -2.184  20.791 22.639 1.00 32.10 ? 2252 HOH A O   1 
HETATM 4207 O  O   . HOH J 5 .   ? -2.165  28.773 27.418 1.00 9.89  ? 2253 HOH A O   1 
HETATM 4208 O  O   . HOH J 5 .   ? -3.808  18.970 25.105 1.00 21.03 ? 2254 HOH A O   1 
HETATM 4209 O  O   . HOH J 5 .   ? 7.005   28.307 35.303 1.00 3.09  ? 2255 HOH A O   1 
HETATM 4210 O  O   . HOH J 5 .   ? 9.194   28.060 23.886 1.00 32.85 ? 2256 HOH A O   1 
HETATM 4211 O  O   . HOH J 5 .   ? 9.457   32.907 36.878 1.00 22.75 ? 2257 HOH A O   1 
HETATM 4212 O  O   . HOH J 5 .   ? 11.638  29.728 32.839 1.00 7.91  ? 2258 HOH A O   1 
HETATM 4213 O  O   . HOH J 5 .   ? 8.628   37.078 35.972 1.00 8.05  ? 2259 HOH A O   1 
HETATM 4214 O  O   . HOH J 5 .   ? 10.929  35.515 29.508 1.00 23.90 ? 2260 HOH A O   1 
HETATM 4215 O  O   . HOH J 5 .   ? 26.868  31.550 38.783 1.00 30.82 ? 2261 HOH A O   1 
HETATM 4216 O  O   . HOH J 5 .   ? 24.100  38.732 37.577 1.00 25.35 ? 2262 HOH A O   1 
HETATM 4217 O  O   . HOH J 5 .   ? 23.220  42.713 44.657 1.00 25.90 ? 2263 HOH A O   1 
HETATM 4218 O  O   . HOH J 5 .   ? 20.941  43.398 43.202 1.00 16.96 ? 2264 HOH A O   1 
HETATM 4219 O  O   . HOH J 5 .   ? 25.214  42.370 41.956 1.00 26.07 ? 2265 HOH A O   1 
HETATM 4220 O  O   . HOH J 5 .   ? 29.513  29.589 45.668 1.00 33.67 ? 2266 HOH A O   1 
HETATM 4221 O  O   . HOH J 5 .   ? 27.127  21.935 39.277 1.00 34.48 ? 2267 HOH A O   1 
HETATM 4222 O  O   . HOH J 5 .   ? 24.904  35.861 36.968 1.00 29.01 ? 2268 HOH A O   1 
HETATM 4223 O  O   . HOH J 5 .   ? 27.437  26.693 44.154 1.00 20.70 ? 2269 HOH A O   1 
HETATM 4224 O  O   . HOH J 5 .   ? 28.908  20.468 48.332 1.00 21.47 ? 2270 HOH A O   1 
HETATM 4225 O  O   . HOH J 5 .   ? 7.597   18.650 41.390 1.00 3.87  ? 2271 HOH A O   1 
HETATM 4226 O  O   . HOH J 5 .   ? 8.070   11.100 44.748 1.00 2.00  ? 2272 HOH A O   1 
HETATM 4227 O  O   . HOH J 5 .   ? 5.227   13.764 40.988 1.00 21.04 ? 2273 HOH A O   1 
HETATM 4228 O  O   . HOH J 5 .   ? 7.433   10.548 32.950 1.00 25.89 ? 2274 HOH A O   1 
HETATM 4229 O  O   . HOH J 5 .   ? 6.960   12.445 37.500 1.00 7.50  ? 2275 HOH A O   1 
HETATM 4230 O  O   . HOH J 5 .   ? 8.144   7.079  37.249 1.00 25.87 ? 2276 HOH A O   1 
HETATM 4231 O  O   . HOH J 5 .   ? 19.413  13.718 30.747 1.00 10.25 ? 2277 HOH A O   1 
HETATM 4232 O  O   . HOH J 5 .   ? 12.965  12.976 29.357 1.00 13.09 ? 2278 HOH A O   1 
HETATM 4233 O  O   . HOH J 5 .   ? 15.376  12.359 30.275 1.00 13.91 ? 2279 HOH A O   1 
HETATM 4234 O  O   . HOH J 5 .   ? 17.032  15.091 27.584 1.00 31.43 ? 2280 HOH A O   1 
HETATM 4235 O  O   . HOH J 5 .   ? 18.855  16.876 29.494 1.00 11.95 ? 2281 HOH A O   1 
HETATM 4236 O  O   . HOH J 5 .   ? 7.928   12.135 30.756 1.00 28.28 ? 2282 HOH A O   1 
HETATM 4237 O  O   . HOH J 5 .   ? 11.457  19.562 26.911 1.00 7.65  ? 2283 HOH A O   1 
HETATM 4238 O  O   . HOH J 5 .   ? 17.108  24.056 27.825 1.00 5.60  ? 2284 HOH A O   1 
HETATM 4239 O  O   . HOH J 5 .   ? 15.233  17.014 27.287 1.00 31.14 ? 2285 HOH A O   1 
HETATM 4240 O  O   . HOH J 5 .   ? 18.569  29.279 29.630 1.00 4.84  ? 2286 HOH A O   1 
HETATM 4241 O  O   . HOH J 5 .   ? 15.446  28.827 22.345 1.00 17.26 ? 2287 HOH A O   1 
HETATM 4242 O  O   . HOH J 5 .   ? 19.634  27.363 22.969 1.00 25.53 ? 2288 HOH A O   1 
HETATM 4243 O  O   . HOH J 5 .   ? 22.105  29.307 21.444 1.00 37.66 ? 2289 HOH A O   1 
HETATM 4244 O  O   . HOH J 5 .   ? 14.899  36.203 27.486 1.00 28.54 ? 2290 HOH A O   1 
HETATM 4245 O  O   . HOH J 5 .   ? 17.963  36.482 31.826 1.00 14.74 ? 2291 HOH A O   1 
HETATM 4246 O  O   . HOH J 5 .   ? 28.270  38.071 33.423 1.00 29.28 ? 2292 HOH A O   1 
HETATM 4247 O  O   . HOH J 5 .   ? 22.418  40.899 28.742 1.00 9.06  ? 2293 HOH A O   1 
HETATM 4248 O  O   . HOH J 5 .   ? 30.778  29.228 25.744 1.00 12.97 ? 2294 HOH A O   1 
HETATM 4249 O  O   . HOH J 5 .   ? 26.735  30.800 29.754 1.00 12.75 ? 2295 HOH A O   1 
HETATM 4250 O  O   . HOH J 5 .   ? 25.191  26.523 24.035 1.00 25.27 ? 2296 HOH A O   1 
HETATM 4251 O  O   . HOH J 5 .   ? 24.498  28.976 23.166 1.00 17.01 ? 2297 HOH A O   1 
HETATM 4252 O  O   . HOH J 5 .   ? 23.235  23.967 25.712 1.00 14.86 ? 2298 HOH A O   1 
HETATM 4253 O  O   . HOH J 5 .   ? 27.429  26.392 27.531 1.00 19.79 ? 2299 HOH A O   1 
HETATM 4254 O  O   . HOH J 5 .   ? 24.555  28.562 37.364 1.00 18.07 ? 2300 HOH A O   1 
HETATM 4255 O  O   . HOH J 5 .   ? 27.040  31.125 33.654 1.00 22.90 ? 2301 HOH A O   1 
HETATM 4256 O  O   . HOH J 5 .   ? 20.832  28.125 30.158 1.00 3.02  ? 2302 HOH A O   1 
HETATM 4257 O  O   . HOH J 5 .   ? 18.492  22.427 29.505 1.00 2.54  ? 2303 HOH A O   1 
HETATM 4258 O  O   . HOH J 5 .   ? 25.105  19.952 32.866 1.00 18.39 ? 2304 HOH A O   1 
HETATM 4259 O  O   . HOH J 5 .   ? 27.956  23.468 36.568 1.00 40.39 ? 2305 HOH A O   1 
HETATM 4260 O  O   . HOH J 5 .   ? 22.604  28.097 39.295 1.00 12.43 ? 2306 HOH A O   1 
HETATM 4261 O  O   . HOH J 5 .   ? 25.805  20.430 37.648 1.00 21.60 ? 2307 HOH A O   1 
HETATM 4262 O  O   . HOH J 5 .   ? 28.796  21.339 45.587 1.00 31.79 ? 2308 HOH A O   1 
HETATM 4263 O  O   . HOH J 5 .   ? 10.880  7.125  39.292 1.00 15.40 ? 2309 HOH A O   1 
HETATM 4264 O  O   . HOH J 5 .   ? 13.427  8.818  38.344 1.00 4.50  ? 2310 HOH A O   1 
HETATM 4265 O  O   . HOH J 5 .   ? 8.308   9.687  41.277 1.00 12.16 ? 2311 HOH A O   1 
HETATM 4266 O  O   . HOH J 5 .   ? 11.628  7.478  46.078 1.00 6.36  ? 2312 HOH A O   1 
HETATM 4267 O  O   . HOH J 5 .   ? 12.509  9.774  49.828 1.00 6.12  ? 2313 HOH A O   1 
HETATM 4268 O  O   . HOH J 5 .   ? 4.899   11.732 48.264 1.00 15.94 ? 2314 HOH A O   1 
HETATM 4269 O  O   . HOH J 5 .   ? 3.778   16.367 49.272 1.00 9.25  ? 2315 HOH A O   1 
HETATM 4270 O  O   . HOH J 5 .   ? 7.762   13.668 57.462 1.00 29.13 ? 2316 HOH A O   1 
HETATM 4271 O  O   . HOH J 5 .   ? 5.272   11.001 51.764 1.00 18.50 ? 2317 HOH A O   1 
HETATM 4272 O  O   . HOH J 5 .   ? 15.486  13.403 56.811 1.00 2.47  ? 2318 HOH A O   1 
HETATM 4273 O  O   . HOH J 5 .   ? 9.432   9.283  58.831 1.00 20.94 ? 2319 HOH A O   1 
HETATM 4274 O  O   . HOH J 5 .   ? 10.847  4.565  54.109 1.00 26.48 ? 2320 HOH A O   1 
HETATM 4275 O  O   . HOH J 5 .   ? 13.057  2.776  50.394 1.00 12.83 ? 2321 HOH A O   1 
HETATM 4276 O  O   . HOH J 5 .   ? 14.215  4.977  46.811 1.00 4.44  ? 2322 HOH A O   1 
HETATM 4277 O  O   . HOH J 5 .   ? 20.008  5.126  51.548 1.00 15.57 ? 2323 HOH A O   1 
HETATM 4278 O  O   . HOH J 5 .   ? 14.140  2.421  46.010 1.00 7.82  ? 2324 HOH A O   1 
HETATM 4279 O  O   . HOH J 5 .   ? 12.800  0.924  42.245 1.00 16.90 ? 2325 HOH A O   1 
HETATM 4280 O  O   . HOH J 5 .   ? 14.963  -0.534 40.222 1.00 15.19 ? 2326 HOH A O   1 
HETATM 4281 O  O   . HOH J 5 .   ? 27.478  4.413  40.450 1.00 19.89 ? 2327 HOH A O   1 
HETATM 4282 O  O   . HOH J 5 .   ? 23.384  9.830  37.988 1.00 4.38  ? 2328 HOH A O   1 
HETATM 4283 O  O   . HOH J 5 .   ? 23.012  3.228  30.389 1.00 23.05 ? 2329 HOH A O   1 
HETATM 4284 O  O   . HOH J 5 .   ? 16.310  10.010 30.631 1.00 23.67 ? 2330 HOH A O   1 
HETATM 4285 O  O   . HOH J 5 .   ? 24.165  8.257  34.518 1.00 23.09 ? 2331 HOH A O   1 
HETATM 4286 O  O   . HOH J 5 .   ? 19.531  1.959  32.773 1.00 13.46 ? 2332 HOH A O   1 
HETATM 4287 O  O   . HOH J 5 .   ? 12.324  8.493  35.023 1.00 7.33  ? 2333 HOH A O   1 
HETATM 4288 O  O   . HOH J 5 .   ? 14.165  2.401  37.207 1.00 13.44 ? 2334 HOH A O   1 
HETATM 4289 O  O   . HOH J 5 .   ? 19.225  0.732  35.357 1.00 13.82 ? 2335 HOH A O   1 
HETATM 4290 O  O   . HOH J 5 .   ? 22.550  -0.991 37.602 1.00 13.26 ? 2336 HOH A O   1 
HETATM 4291 O  O   . HOH J 5 .   ? 23.998  -2.979 41.179 1.00 21.70 ? 2337 HOH A O   1 
HETATM 4292 O  O   . HOH J 5 .   ? 20.633  3.172  42.409 1.00 2.77  ? 2338 HOH A O   1 
HETATM 4293 O  O   . HOH J 5 .   ? 17.842  -1.836 43.894 1.00 13.63 ? 2339 HOH A O   1 
HETATM 4294 O  O   . HOH J 5 .   ? 18.370  -0.980 47.368 1.00 26.30 ? 2340 HOH A O   1 
HETATM 4295 O  O   . HOH J 5 .   ? 23.148  5.300  50.638 1.00 18.41 ? 2341 HOH A O   1 
HETATM 4296 O  O   . HOH J 5 .   ? 28.551  -0.003 47.584 1.00 17.26 ? 2342 HOH A O   1 
HETATM 4297 O  O   . HOH J 5 .   ? 26.325  10.615 47.503 1.00 19.12 ? 2343 HOH A O   1 
HETATM 4298 O  O   . HOH J 5 .   ? 25.917  7.759  49.176 1.00 30.39 ? 2344 HOH A O   1 
HETATM 4299 O  O   . HOH J 5 .   ? 30.277  13.918 48.764 1.00 16.72 ? 2345 HOH A O   1 
HETATM 4300 O  O   . HOH J 5 .   ? 26.341  18.285 39.442 1.00 19.05 ? 2346 HOH A O   1 
HETATM 4301 O  O   . HOH J 5 .   ? 23.403  16.392 35.909 1.00 21.29 ? 2347 HOH A O   1 
HETATM 4302 O  O   . HOH J 5 .   ? 24.299  17.389 39.211 1.00 18.71 ? 2348 HOH A O   1 
HETATM 4303 O  O   . HOH J 5 .   ? 23.112  15.567 42.125 1.00 9.37  ? 2349 HOH A O   1 
HETATM 4304 O  O   . HOH J 5 .   ? 13.630  6.130  44.469 1.00 4.22  ? 2350 HOH A O   1 
HETATM 4305 O  O   . HOH J 5 .   ? 17.012  10.331 57.328 1.00 25.21 ? 2351 HOH A O   1 
HETATM 4306 O  O   . HOH J 5 .   ? 18.956  9.453  53.754 1.00 18.50 ? 2352 HOH A O   1 
HETATM 4307 O  O   . HOH J 5 .   ? 17.644  16.958 57.163 1.00 9.18  ? 2353 HOH A O   1 
HETATM 4308 O  O   . HOH J 5 .   ? 16.330  13.317 59.629 1.00 25.03 ? 2354 HOH A O   1 
HETATM 4309 O  O   . HOH J 5 .   ? 21.410  9.688  52.356 1.00 20.04 ? 2355 HOH A O   1 
HETATM 4310 O  O   . HOH J 5 .   ? 22.627  15.030 58.290 1.00 34.53 ? 2356 HOH A O   1 
HETATM 4311 O  O   . HOH J 5 .   ? 23.353  10.997 54.470 1.00 30.28 ? 2357 HOH A O   1 
HETATM 4312 O  O   . HOH J 5 .   ? 29.779  16.295 49.532 1.00 14.53 ? 2358 HOH A O   1 
HETATM 4313 O  O   . HOH J 5 .   ? 26.564  24.752 52.351 1.00 26.81 ? 2359 HOH A O   1 
HETATM 4314 O  O   . HOH J 5 .   ? 25.545  19.084 57.572 1.00 22.82 ? 2360 HOH A O   1 
HETATM 4315 O  O   . HOH J 5 .   ? 19.958  20.608 59.956 1.00 18.33 ? 2361 HOH A O   1 
HETATM 4316 O  O   . HOH J 5 .   ? 18.519  31.215 58.750 1.00 9.98  ? 2362 HOH A O   1 
HETATM 4317 O  O   . HOH J 5 .   ? 24.119  27.162 60.589 1.00 19.87 ? 2363 HOH A O   1 
HETATM 4318 O  O   . HOH J 5 .   ? -0.033  24.417 44.784 1.00 14.25 ? 2364 HOH A O   1 
HETATM 4319 O  O   . HOH J 5 .   ? 2.989   21.094 43.605 1.00 2.98  ? 2365 HOH A O   1 
HETATM 4320 O  O   . HOH J 5 .   ? -0.832  16.375 48.476 1.00 25.31 ? 2366 HOH A O   1 
HETATM 4321 O  O   . HOH J 5 .   ? 1.920   16.128 51.567 1.00 20.27 ? 2367 HOH A O   1 
HETATM 4322 O  O   . HOH J 5 .   ? -0.720  16.170 51.356 1.00 31.60 ? 2368 HOH A O   1 
HETATM 4323 O  O   . HOH J 5 .   ? 5.263   20.689 45.775 1.00 2.00  ? 2369 HOH A O   1 
HETATM 4324 O  O   . HOH J 5 .   ? 4.904   17.511 61.502 1.00 19.11 ? 2370 HOH A O   1 
HETATM 4325 O  O   . HOH J 5 .   ? 6.193   13.384 59.541 1.00 22.74 ? 2371 HOH A O   1 
HETATM 4326 O  O   . HOH J 5 .   ? 1.760   14.343 59.865 1.00 30.84 ? 2372 HOH A O   1 
HETATM 4327 O  O   . HOH J 5 .   ? 10.351  24.402 63.291 1.00 11.44 ? 2373 HOH A O   1 
HETATM 4328 O  O   . HOH J 5 .   ? 10.658  29.758 62.024 1.00 11.50 ? 2374 HOH A O   1 
HETATM 4329 O  O   . HOH J 5 .   ? 10.183  20.806 65.626 1.00 16.54 ? 2375 HOH A O   1 
HETATM 4330 O  O   . HOH J 5 .   ? 3.125   20.686 66.732 1.00 20.49 ? 2376 HOH A O   1 
HETATM 4331 O  O   . HOH J 5 .   ? 12.093  10.666 61.657 1.00 34.99 ? 2377 HOH A O   1 
HETATM 4332 O  O   . HOH J 5 .   ? 17.793  20.339 61.528 1.00 13.02 ? 2378 HOH A O   1 
HETATM 4333 O  O   . HOH J 5 .   ? 14.035  27.363 60.949 1.00 3.88  ? 2379 HOH A O   1 
HETATM 4334 O  O   . HOH J 5 .   ? 18.072  19.279 58.288 1.00 10.01 ? 2380 HOH A O   1 
HETATM 4335 O  O   . HOH J 5 .   ? 14.547  29.799 62.159 1.00 19.61 ? 2381 HOH A O   1 
HETATM 4336 O  O   . HOH J 5 .   ? 17.603  35.168 60.579 1.00 18.78 ? 2382 HOH A O   1 
HETATM 4337 O  O   . HOH J 5 .   ? 1.091   27.632 47.570 1.00 2.00  ? 2383 HOH A O   1 
HETATM 4338 O  O   . HOH J 5 .   ? -7.088  29.242 44.871 1.00 2.24  ? 2384 HOH A O   1 
HETATM 4339 O  O   . HOH J 5 .   ? 1.318   39.655 39.071 1.00 28.31 ? 2385 HOH A O   1 
HETATM 4340 O  O   . HOH J 5 .   ? 0.849   42.022 37.820 1.00 19.88 ? 2386 HOH A O   1 
HETATM 4341 O  O   . HOH J 5 .   ? -9.374  44.284 49.925 1.00 15.43 ? 2387 HOH A O   1 
HETATM 4342 O  O   . HOH J 5 .   ? -10.595 42.978 40.409 1.00 32.59 ? 2388 HOH A O   1 
HETATM 4343 O  O   . HOH J 5 .   ? -7.513  44.441 61.412 1.00 36.31 ? 2389 HOH A O   1 
HETATM 4344 O  O   . HOH J 5 .   ? -12.873 42.989 60.904 1.00 34.73 ? 2390 HOH A O   1 
HETATM 4345 O  O   . HOH J 5 .   ? -27.345 45.990 53.095 1.00 38.17 ? 2391 HOH A O   1 
HETATM 4346 O  O   . HOH J 5 .   ? -16.948 38.897 57.550 1.00 12.55 ? 2392 HOH A O   1 
HETATM 4347 O  O   . HOH J 5 .   ? -19.300 40.787 44.117 1.00 17.52 ? 2393 HOH A O   1 
HETATM 4348 O  O   . HOH J 5 .   ? -15.661 32.808 50.877 1.00 8.49  ? 2394 HOH A O   1 
HETATM 4349 O  O   . HOH J 5 .   ? -13.036 35.952 50.220 1.00 7.57  ? 2395 HOH A O   1 
HETATM 4350 O  O   . HOH J 5 .   ? -19.487 34.456 51.572 1.00 17.84 ? 2396 HOH A O   1 
HETATM 4351 O  O   . HOH J 5 .   ? -18.252 34.643 42.518 1.00 10.19 ? 2397 HOH A O   1 
HETATM 4352 O  O   . HOH J 5 .   ? -16.540 36.971 39.955 1.00 24.98 ? 2398 HOH A O   1 
HETATM 4353 O  O   . HOH J 5 .   ? -11.002 36.930 40.725 1.00 30.38 ? 2399 HOH A O   1 
HETATM 4354 O  O   . HOH J 5 .   ? -10.852 42.014 48.959 1.00 13.42 ? 2400 HOH A O   1 
HETATM 4355 O  O   . HOH J 5 .   ? -12.798 33.095 39.864 1.00 10.56 ? 2401 HOH A O   1 
HETATM 4356 O  O   . HOH J 5 .   ? -17.745 31.668 49.216 1.00 6.69  ? 2402 HOH A O   1 
HETATM 4357 O  O   . HOH J 5 .   ? -20.975 31.237 46.582 1.00 21.50 ? 2403 HOH A O   1 
HETATM 4358 O  O   . HOH J 5 .   ? -8.349  38.195 50.183 1.00 16.11 ? 2404 HOH A O   1 
HETATM 4359 O  O   . HOH J 5 .   ? -8.459  28.339 51.439 1.00 2.00  ? 2405 HOH A O   1 
HETATM 4360 O  O   . HOH J 5 .   ? -16.647 35.537 57.657 1.00 31.05 ? 2406 HOH A O   1 
HETATM 4361 O  O   . HOH J 5 .   ? -18.314 33.064 55.747 1.00 20.90 ? 2407 HOH A O   1 
HETATM 4362 O  O   . HOH J 5 .   ? -17.165 40.134 60.030 1.00 16.53 ? 2408 HOH A O   1 
HETATM 4363 O  O   . HOH J 5 .   ? -9.134  39.546 59.491 1.00 21.37 ? 2409 HOH A O   1 
HETATM 4364 O  O   . HOH J 5 .   ? -8.167  31.062 60.778 1.00 13.42 ? 2410 HOH A O   1 
HETATM 4365 O  O   . HOH J 5 .   ? -9.848  34.923 61.574 1.00 15.01 ? 2411 HOH A O   1 
HETATM 4366 O  O   . HOH J 5 .   ? -5.913  36.307 55.533 1.00 3.52  ? 2412 HOH A O   1 
HETATM 4367 O  O   . HOH J 5 .   ? -4.262  33.331 61.531 1.00 31.96 ? 2413 HOH A O   1 
HETATM 4368 O  O   . HOH J 5 .   ? -8.096  27.070 53.832 1.00 2.28  ? 2414 HOH A O   1 
HETATM 4369 O  O   . HOH J 5 .   ? -0.944  31.539 62.006 1.00 6.82  ? 2415 HOH A O   1 
HETATM 4370 O  O   . HOH J 5 .   ? -4.237  23.836 54.152 1.00 12.88 ? 2416 HOH A O   1 
HETATM 4371 O  O   . HOH J 5 .   ? -2.644  20.493 57.647 1.00 29.78 ? 2417 HOH A O   1 
HETATM 4372 O  O   . HOH J 5 .   ? -4.215  29.708 64.723 1.00 31.76 ? 2418 HOH A O   1 
HETATM 4373 O  O   . HOH J 5 .   ? -4.203  27.216 64.739 1.00 30.31 ? 2419 HOH A O   1 
HETATM 4374 O  O   . HOH J 5 .   ? 4.451   31.523 40.532 1.00 7.75  ? 2420 HOH A O   1 
HETATM 4375 O  O   . HOH J 5 .   ? 7.539   33.760 37.109 1.00 31.44 ? 2421 HOH A O   1 
HETATM 4376 O  O   . HOH J 5 .   ? 7.270   39.199 39.628 1.00 8.78  ? 2422 HOH A O   1 
HETATM 4377 O  O   . HOH J 5 .   ? 9.036   39.258 37.643 1.00 5.67  ? 2423 HOH A O   1 
HETATM 4378 O  O   . HOH J 5 .   ? 19.190  41.424 43.328 1.00 16.86 ? 2424 HOH A O   1 
HETATM 4379 O  O   . HOH J 5 .   ? 21.340  39.391 55.303 1.00 12.76 ? 2425 HOH A O   1 
HETATM 4380 O  O   . HOH J 5 .   ? 18.588  44.807 54.058 1.00 15.69 ? 2426 HOH A O   1 
HETATM 4381 O  O   . HOH J 5 .   ? 11.576  43.310 54.767 1.00 19.67 ? 2427 HOH A O   1 
HETATM 4382 O  O   . HOH J 5 .   ? 16.134  45.407 55.454 1.00 25.37 ? 2428 HOH A O   1 
HETATM 4383 O  O   . HOH J 5 .   ? 8.180   38.066 64.094 1.00 28.06 ? 2429 HOH A O   1 
HETATM 4384 O  O   . HOH J 5 .   ? 5.956   42.755 60.473 1.00 19.28 ? 2430 HOH A O   1 
HETATM 4385 O  O   . HOH J 5 .   ? 4.854   40.370 62.992 1.00 25.43 ? 2431 HOH A O   1 
HETATM 4386 O  O   . HOH J 5 .   ? 9.745   44.580 65.926 1.00 37.24 ? 2432 HOH A O   1 
HETATM 4387 O  O   . HOH J 5 .   ? -0.951  39.387 70.710 1.00 19.52 ? 2433 HOH A O   1 
HETATM 4388 O  O   . HOH J 5 .   ? 5.741   38.232 79.390 1.00 2.63  ? 2434 HOH A O   1 
HETATM 4389 O  O   . HOH J 5 .   ? -12.288 30.886 41.468 1.00 4.30  ? 2435 HOH A O   1 
HETATM 4390 O  O   . HOH J 5 .   ? -8.352  29.096 42.492 1.00 17.69 ? 2436 HOH A O   1 
HETATM 4391 O  O   . HOH J 5 .   ? -8.259  33.420 40.247 1.00 25.93 ? 2437 HOH A O   1 
HETATM 4392 O  O   . HOH J 5 .   ? -1.143  20.198 60.147 1.00 28.35 ? 2438 HOH A O   1 
HETATM 4393 O  O   . HOH J 5 .   ? -2.446  27.119 61.734 1.00 22.03 ? 2439 HOH A O   1 
HETATM 4394 O  O   . HOH J 5 .   ? 5.565   18.107 48.399 1.00 3.68  ? 2440 HOH A O   1 
HETATM 4395 O  O   . HOH J 5 .   ? -0.248  17.377 44.649 1.00 25.53 ? 2441 HOH A O   1 
HETATM 4396 O  O   . HOH J 5 .   ? 2.119   15.533 47.630 1.00 13.64 ? 2442 HOH A O   1 
HETATM 4397 O  O   . HOH J 5 .   ? 5.533   19.732 42.942 1.00 3.46  ? 2443 HOH A O   1 
HETATM 4398 O  O   . HOH J 5 .   ? 4.233   15.790 41.840 1.00 20.23 ? 2444 HOH A O   1 
HETATM 4399 O  O   . HOH J 5 .   ? -18.917 31.618 69.127 1.00 23.50 ? 2445 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -18 ?   ?   ?   A . n 
A 1 2   GLY 2   -17 ?   ?   ?   A . n 
A 1 3   SER 3   -16 ?   ?   ?   A . n 
A 1 4   SER 4   -15 ?   ?   ?   A . n 
A 1 5   HIS 5   -14 ?   ?   ?   A . n 
A 1 6   HIS 6   -13 ?   ?   ?   A . n 
A 1 7   HIS 7   -12 ?   ?   ?   A . n 
A 1 8   HIS 8   -11 ?   ?   ?   A . n 
A 1 9   HIS 9   -10 ?   ?   ?   A . n 
A 1 10  HIS 10  -9  ?   ?   ?   A . n 
A 1 11  SER 11  -8  ?   ?   ?   A . n 
A 1 12  SER 12  -7  ?   ?   ?   A . n 
A 1 13  GLY 13  -6  ?   ?   ?   A . n 
A 1 14  LEU 14  -5  ?   ?   ?   A . n 
A 1 15  VAL 15  -4  ?   ?   ?   A . n 
A 1 16  PRO 16  -3  ?   ?   ?   A . n 
A 1 17  ARG 17  -2  ?   ?   ?   A . n 
A 1 18  GLY 18  -1  ?   ?   ?   A . n 
A 1 19  SER 19  0   ?   ?   ?   A . n 
A 1 20  MET 20  1   ?   ?   ?   A . n 
A 1 21  SER 21  2   ?   ?   ?   A . n 
A 1 22  THR 22  3   3   THR THR A . n 
A 1 23  SER 23  4   4   SER SER A . n 
A 1 24  TRP 24  5   5   TRP TRP A . n 
A 1 25  SER 25  6   6   SER SER A . n 
A 1 26  ASP 26  7   7   ASP ASP A . n 
A 1 27  ARG 27  8   8   ARG ARG A . n 
A 1 28  LEU 28  9   9   LEU LEU A . n 
A 1 29  GLN 29  10  10  GLN GLN A . n 
A 1 30  ASN 30  11  11  ASN ASN A . n 
A 1 31  ALA 31  12  12  ALA ALA A . n 
A 1 32  ALA 32  13  13  ALA ALA A . n 
A 1 33  ASP 33  14  14  ASP ASP A . n 
A 1 34  MET 34  15  15  MET MET A . n 
A 1 35  PRO 35  16  16  PRO PRO A . n 
A 1 36  ALA 36  17  17  ALA ALA A . n 
A 1 37  ASN 37  18  18  ASN ASN A . n 
A 1 38  MET 38  19  19  MET MET A . n 
A 1 39  ASP 39  20  20  ASP ASP A . n 
A 1 40  LYS 40  21  21  LYS LYS A . n 
A 1 41  HIS 41  22  22  HIS HIS A . n 
A 1 42  ALA 42  23  23  ALA ALA A . n 
A 1 43  LEU 43  24  24  LEU LEU A . n 
A 1 44  LYS 44  25  25  LYS LYS A . n 
A 1 45  LYS 45  26  26  LYS LYS A . n 
A 1 46  TYR 46  27  27  TYR TYR A . n 
A 1 47  ARG 47  28  28  ARG ARG A . n 
A 1 48  ARG 48  29  29  ARG ARG A . n 
A 1 49  GLU 49  30  30  GLU GLU A . n 
A 1 50  ALA 50  31  31  ALA ALA A . n 
A 1 51  TYR 51  32  32  TYR TYR A . n 
A 1 52  HIS 52  33  33  HIS HIS A . n 
A 1 53  ARG 53  34  34  ARG ARG A . n 
A 1 54  VAL 54  35  35  VAL VAL A . n 
A 1 55  PHE 55  36  36  PHE PHE A . n 
A 1 56  VAL 56  37  37  VAL VAL A . n 
A 1 57  ASN 57  38  38  ASN ASN A . n 
A 1 58  ARG 58  39  39  ARG ARG A . n 
A 1 59  SER 59  40  40  SER SER A . n 
A 1 60  LEU 60  41  41  LEU LEU A . n 
A 1 61  ALA 61  42  42  ALA ALA A . n 
A 1 62  MET 62  43  43  MET MET A . n 
A 1 63  GLU 63  44  44  GLU GLU A . n 
A 1 64  LYS 64  45  45  LYS LYS A . n 
A 1 65  ILE 65  46  46  ILE ILE A . n 
A 1 66  LYS 66  47  47  LYS LYS A . n 
A 1 67  CYS 67  48  48  CYS CYS A . n 
A 1 68  PHE 68  49  49  PHE PHE A . n 
A 1 69  GLY 69  50  50  GLY GLY A . n 
A 1 70  PHE 70  51  51  PHE PHE A . n 
A 1 71  ASP 71  52  52  ASP ASP A . n 
A 1 72  MET 72  53  53  MET MET A . n 
A 1 73  ASP 73  54  54  ASP ASP A . n 
A 1 74  TYR 74  55  55  TYR TYR A . n 
A 1 75  THR 75  56  56  THR THR A . n 
A 1 76  LEU 76  57  57  LEU LEU A . n 
A 1 77  ALA 77  58  58  ALA ALA A . n 
A 1 78  VAL 78  59  59  VAL VAL A . n 
A 1 79  TYR 79  60  60  TYR TYR A . n 
A 1 80  LYS 80  61  61  LYS LYS A . n 
A 1 81  SER 81  62  62  SER SER A . n 
A 1 82  PRO 82  63  63  PRO PRO A . n 
A 1 83  GLU 83  64  64  GLU GLU A . n 
A 1 84  TYR 84  65  65  TYR TYR A . n 
A 1 85  GLU 85  66  66  GLU GLU A . n 
A 1 86  SER 86  67  67  SER SER A . n 
A 1 87  LEU 87  68  68  LEU LEU A . n 
A 1 88  GLY 88  69  69  GLY GLY A . n 
A 1 89  PHE 89  70  70  PHE PHE A . n 
A 1 90  GLU 90  71  71  GLU GLU A . n 
A 1 91  LEU 91  72  72  LEU LEU A . n 
A 1 92  THR 92  73  73  THR THR A . n 
A 1 93  VAL 93  74  74  VAL VAL A . n 
A 1 94  GLU 94  75  75  GLU GLU A . n 
A 1 95  ARG 95  76  76  ARG ARG A . n 
A 1 96  LEU 96  77  77  LEU LEU A . n 
A 1 97  VAL 97  78  78  VAL VAL A . n 
A 1 98  SER 98  79  79  SER SER A . n 
A 1 99  ILE 99  80  80  ILE ILE A . n 
A 1 100 GLY 100 81  81  GLY GLY A . n 
A 1 101 TYR 101 82  82  TYR TYR A . n 
A 1 102 PRO 102 83  83  PRO PRO A . n 
A 1 103 GLN 103 84  84  GLN GLN A . n 
A 1 104 GLU 104 85  85  GLU GLU A . n 
A 1 105 LEU 105 86  86  LEU LEU A . n 
A 1 106 LEU 106 87  87  LEU LEU A . n 
A 1 107 SER 107 88  88  SER SER A . n 
A 1 108 PHE 108 89  89  PHE PHE A . n 
A 1 109 ALA 109 90  90  ALA ALA A . n 
A 1 110 TYR 110 91  91  TYR TYR A . n 
A 1 111 ASP 111 92  92  ASP ASP A . n 
A 1 112 SER 112 93  93  SER SER A . n 
A 1 113 THR 113 94  94  THR THR A . n 
A 1 114 PHE 114 95  95  PHE PHE A . n 
A 1 115 PRO 115 96  96  PRO PRO A . n 
A 1 116 THR 116 97  97  THR THR A . n 
A 1 117 ARG 117 98  98  ARG ARG A . n 
A 1 118 GLY 118 99  99  GLY GLY A . n 
A 1 119 LEU 119 100 100 LEU LEU A . n 
A 1 120 VAL 120 101 101 VAL VAL A . n 
A 1 121 PHE 121 102 102 PHE PHE A . n 
A 1 122 ASP 122 103 103 ASP ASP A . n 
A 1 123 THR 123 104 104 THR THR A . n 
A 1 124 LEU 124 105 105 LEU LEU A . n 
A 1 125 TYR 125 106 106 TYR TYR A . n 
A 1 126 GLY 126 107 107 GLY GLY A . n 
A 1 127 ASN 127 108 108 ASN ASN A . n 
A 1 128 LEU 128 109 109 LEU LEU A . n 
A 1 129 LEU 129 110 110 LEU LEU A . n 
A 1 130 LYS 130 111 111 LYS LYS A . n 
A 1 131 VAL 131 112 112 VAL VAL A . n 
A 1 132 ASP 132 113 113 ASP ASP A . n 
A 1 133 ALA 133 114 114 ALA ALA A . n 
A 1 134 TYR 134 115 115 TYR TYR A . n 
A 1 135 GLY 135 116 116 GLY GLY A . n 
A 1 136 ASN 136 117 117 ASN ASN A . n 
A 1 137 LEU 137 118 118 LEU LEU A . n 
A 1 138 LEU 138 119 119 LEU LEU A . n 
A 1 139 VAL 139 120 120 VAL VAL A . n 
A 1 140 CYS 140 121 121 CYS CYS A . n 
A 1 141 ALA 141 122 122 ALA ALA A . n 
A 1 142 HIS 142 123 123 HIS HIS A . n 
A 1 143 GLY 143 124 124 GLY GLY A . n 
A 1 144 PHE 144 125 125 PHE PHE A . n 
A 1 145 ASN 145 126 126 ASN ASN A . n 
A 1 146 PHE 146 127 127 PHE PHE A . n 
A 1 147 ILE 147 128 128 ILE ILE A . n 
A 1 148 ARG 148 129 129 ARG ARG A . n 
A 1 149 GLY 149 130 130 GLY GLY A . n 
A 1 150 PRO 150 131 131 PRO PRO A . n 
A 1 151 GLU 151 132 132 GLU GLU A . n 
A 1 152 THR 152 133 133 THR THR A . n 
A 1 153 ARG 153 134 134 ARG ARG A . n 
A 1 154 GLU 154 135 135 GLU GLU A . n 
A 1 155 GLN 155 136 136 GLN GLN A . n 
A 1 156 TYR 156 137 137 TYR TYR A . n 
A 1 157 PRO 157 138 138 PRO PRO A . n 
A 1 158 ASN 158 139 139 ASN ASN A . n 
A 1 159 LYS 159 140 140 LYS LYS A . n 
A 1 160 PHE 160 141 141 PHE PHE A . n 
A 1 161 ILE 161 142 142 ILE ILE A . n 
A 1 162 GLN 162 143 143 GLN GLN A . n 
A 1 163 ARG 163 144 144 ARG ARG A . n 
A 1 164 ASP 164 145 145 ASP ASP A . n 
A 1 165 ASP 165 146 146 ASP ASP A . n 
A 1 166 THR 166 147 147 THR THR A . n 
A 1 167 GLU 167 148 148 GLU GLU A . n 
A 1 168 ARG 168 149 149 ARG ARG A . n 
A 1 169 PHE 169 150 150 PHE PHE A . n 
A 1 170 TYR 170 151 151 TYR TYR A . n 
A 1 171 ILE 171 152 152 ILE ILE A . n 
A 1 172 LEU 172 153 153 LEU LEU A . n 
A 1 173 ASN 173 154 154 ASN ASN A . n 
A 1 174 THR 174 155 155 THR THR A . n 
A 1 175 LEU 175 156 156 LEU LEU A . n 
A 1 176 PHE 176 157 157 PHE PHE A . n 
A 1 177 ASN 177 158 158 ASN ASN A . n 
A 1 178 LEU 178 159 159 LEU LEU A . n 
A 1 179 PRO 179 160 160 PRO PRO A . n 
A 1 180 GLU 180 161 161 GLU GLU A . n 
A 1 181 THR 181 162 162 THR THR A . n 
A 1 182 TYR 182 163 163 TYR TYR A . n 
A 1 183 LEU 183 164 164 LEU LEU A . n 
A 1 184 LEU 184 165 165 LEU LEU A . n 
A 1 185 ALA 185 166 166 ALA ALA A . n 
A 1 186 CYS 186 167 167 CYS CYS A . n 
A 1 187 LEU 187 168 168 LEU LEU A . n 
A 1 188 VAL 188 169 169 VAL VAL A . n 
A 1 189 ASP 189 170 170 ASP ASP A . n 
A 1 190 PHE 190 171 171 PHE PHE A . n 
A 1 191 PHE 191 172 172 PHE PHE A . n 
A 1 192 THR 192 173 173 THR THR A . n 
A 1 193 ASN 193 174 174 ASN ASN A . n 
A 1 194 CYS 194 175 175 CYS CYS A . n 
A 1 195 PRO 195 176 176 PRO PRO A . n 
A 1 196 ARG 196 177 177 ARG ARG A . n 
A 1 197 TYR 197 178 178 TYR TYR A . n 
A 1 198 THR 198 179 179 THR THR A . n 
A 1 199 SER 199 180 180 SER SER A . n 
A 1 200 CYS 200 181 181 CYS CYS A . n 
A 1 201 GLU 201 182 182 GLU GLU A . n 
A 1 202 THR 202 183 183 THR THR A . n 
A 1 203 GLY 203 184 184 GLY GLY A . n 
A 1 204 PHE 204 185 185 PHE PHE A . n 
A 1 205 LYS 205 186 186 LYS LYS A . n 
A 1 206 ASP 206 187 187 ASP ASP A . n 
A 1 207 GLY 207 188 188 GLY GLY A . n 
A 1 208 ASP 208 189 189 ASP ASP A . n 
A 1 209 LEU 209 190 190 LEU LEU A . n 
A 1 210 PHE 210 191 191 PHE PHE A . n 
A 1 211 MET 211 192 192 MET MET A . n 
A 1 212 SER 212 193 193 SER SER A . n 
A 1 213 TYR 213 194 194 TYR TYR A . n 
A 1 214 ARG 214 195 195 ARG ARG A . n 
A 1 215 SER 215 196 196 SER SER A . n 
A 1 216 MET 216 197 197 MET MET A . n 
A 1 217 PHE 217 198 198 PHE PHE A . n 
A 1 218 GLN 218 199 199 GLN GLN A . n 
A 1 219 ASP 219 200 200 ASP ASP A . n 
A 1 220 VAL 220 201 201 VAL VAL A . n 
A 1 221 ARG 221 202 202 ARG ARG A . n 
A 1 222 ASP 222 203 203 ASP ASP A . n 
A 1 223 ALA 223 204 204 ALA ALA A . n 
A 1 224 VAL 224 205 205 VAL VAL A . n 
A 1 225 ASP 225 206 206 ASP ASP A . n 
A 1 226 TRP 226 207 207 TRP TRP A . n 
A 1 227 VAL 227 208 208 VAL VAL A . n 
A 1 228 HIS 228 209 209 HIS HIS A . n 
A 1 229 TYR 229 210 210 TYR TYR A . n 
A 1 230 LYS 230 211 211 LYS LYS A . n 
A 1 231 GLY 231 212 212 GLY GLY A . n 
A 1 232 SER 232 213 213 SER SER A . n 
A 1 233 LEU 233 214 214 LEU LEU A . n 
A 1 234 LYS 234 215 215 LYS LYS A . n 
A 1 235 GLU 235 216 216 GLU GLU A . n 
A 1 236 LYS 236 217 217 LYS LYS A . n 
A 1 237 THR 237 218 218 THR THR A . n 
A 1 238 VAL 238 219 219 VAL VAL A . n 
A 1 239 GLU 239 220 220 GLU GLU A . n 
A 1 240 ASN 240 221 221 ASN ASN A . n 
A 1 241 LEU 241 222 222 LEU LEU A . n 
A 1 242 GLU 242 223 223 GLU GLU A . n 
A 1 243 LYS 243 224 224 LYS LYS A . n 
A 1 244 TYR 244 225 225 TYR TYR A . n 
A 1 245 VAL 245 226 226 VAL VAL A . n 
A 1 246 VAL 246 227 227 VAL VAL A . n 
A 1 247 LYS 247 228 228 LYS LYS A . n 
A 1 248 ASP 248 229 229 ASP ASP A . n 
A 1 249 GLY 249 230 230 GLY GLY A . n 
A 1 250 LYS 250 231 231 LYS LYS A . n 
A 1 251 LEU 251 232 232 LEU LEU A . n 
A 1 252 PRO 252 233 233 PRO PRO A . n 
A 1 253 LEU 253 234 234 LEU LEU A . n 
A 1 254 LEU 254 235 235 LEU LEU A . n 
A 1 255 LEU 255 236 236 LEU LEU A . n 
A 1 256 SER 256 237 237 SER SER A . n 
A 1 257 ARG 257 238 238 ARG ARG A . n 
A 1 258 MET 258 239 239 MET MET A . n 
A 1 259 LYS 259 240 240 LYS LYS A . n 
A 1 260 GLU 260 241 241 GLU GLU A . n 
A 1 261 VAL 261 242 242 VAL VAL A . n 
A 1 262 GLY 262 243 243 GLY GLY A . n 
A 1 263 LYS 263 244 244 LYS LYS A . n 
A 1 264 VAL 264 245 245 VAL VAL A . n 
A 1 265 PHE 265 246 246 PHE PHE A . n 
A 1 266 LEU 266 247 247 LEU LEU A . n 
A 1 267 ALA 267 248 248 ALA ALA A . n 
A 1 268 THR 268 249 249 THR THR A . n 
A 1 269 ASN 269 250 250 ASN ASN A . n 
A 1 270 SER 270 251 251 SER SER A . n 
A 1 271 ASP 271 252 252 ASP ASP A . n 
A 1 272 TYR 272 253 253 TYR TYR A . n 
A 1 273 LYS 273 254 254 LYS LYS A . n 
A 1 274 TYR 274 255 255 TYR TYR A . n 
A 1 275 THR 275 256 256 THR THR A . n 
A 1 276 ASP 276 257 257 ASP ASP A . n 
A 1 277 LYS 277 258 258 LYS LYS A . n 
A 1 278 ILE 278 259 259 ILE ILE A . n 
A 1 279 MET 279 260 260 MET MET A . n 
A 1 280 THR 280 261 261 THR THR A . n 
A 1 281 TYR 281 262 262 TYR TYR A . n 
A 1 282 LEU 282 263 263 LEU LEU A . n 
A 1 283 PHE 283 264 264 PHE PHE A . n 
A 1 284 ASP 284 265 265 ASP ASP A . n 
A 1 285 PHE 285 266 266 PHE PHE A . n 
A 1 286 PRO 286 267 267 PRO PRO A . n 
A 1 287 HIS 287 268 268 HIS HIS A . n 
A 1 288 GLY 288 269 269 GLY GLY A . n 
A 1 289 PRO 289 270 270 PRO PRO A . n 
A 1 290 LYS 290 271 271 LYS LYS A . n 
A 1 291 PRO 291 272 272 PRO PRO A . n 
A 1 292 GLY 292 273 273 GLY GLY A . n 
A 1 293 SER 293 274 274 SER SER A . n 
A 1 294 SER 294 275 275 SER SER A . n 
A 1 295 HIS 295 276 276 HIS HIS A . n 
A 1 296 ARG 296 277 277 ARG ARG A . n 
A 1 297 PRO 297 278 278 PRO PRO A . n 
A 1 298 TRP 298 279 279 TRP TRP A . n 
A 1 299 GLN 299 280 280 GLN GLN A . n 
A 1 300 SER 300 281 281 SER SER A . n 
A 1 301 TYR 301 282 282 TYR TYR A . n 
A 1 302 PHE 302 283 283 PHE PHE A . n 
A 1 303 ASP 303 284 284 ASP ASP A . n 
A 1 304 LEU 304 285 285 LEU LEU A . n 
A 1 305 ILE 305 286 286 ILE ILE A . n 
A 1 306 LEU 306 287 287 LEU LEU A . n 
A 1 307 VAL 307 288 288 VAL VAL A . n 
A 1 308 ASP 308 289 289 ASP ASP A . n 
A 1 309 ALA 309 290 290 ALA ALA A . n 
A 1 310 ARG 310 291 291 ARG ARG A . n 
A 1 311 LYS 311 292 292 LYS LYS A . n 
A 1 312 PRO 312 293 293 PRO PRO A . n 
A 1 313 LEU 313 294 294 LEU LEU A . n 
A 1 314 PHE 314 295 295 PHE PHE A . n 
A 1 315 PHE 315 296 296 PHE PHE A . n 
A 1 316 GLY 316 297 297 GLY GLY A . n 
A 1 317 GLU 317 298 298 GLU GLU A . n 
A 1 318 GLY 318 299 299 GLY GLY A . n 
A 1 319 THR 319 300 300 THR THR A . n 
A 1 320 VAL 320 301 301 VAL VAL A . n 
A 1 321 LEU 321 302 302 LEU LEU A . n 
A 1 322 ARG 322 303 303 ARG ARG A . n 
A 1 323 GLN 323 304 304 GLN GLN A . n 
A 1 324 VAL 324 305 305 VAL VAL A . n 
A 1 325 ASP 325 306 306 ASP ASP A . n 
A 1 326 THR 326 307 307 THR THR A . n 
A 1 327 LYS 327 308 308 LYS LYS A . n 
A 1 328 THR 328 309 309 THR THR A . n 
A 1 329 GLY 329 310 310 GLY GLY A . n 
A 1 330 LYS 330 311 311 LYS LYS A . n 
A 1 331 LEU 331 312 312 LEU LEU A . n 
A 1 332 LYS 332 313 313 LYS LYS A . n 
A 1 333 ILE 333 314 314 ILE ILE A . n 
A 1 334 GLY 334 315 315 GLY GLY A . n 
A 1 335 THR 335 316 316 THR THR A . n 
A 1 336 TYR 336 317 317 TYR TYR A . n 
A 1 337 THR 337 318 318 THR THR A . n 
A 1 338 GLY 338 319 319 GLY GLY A . n 
A 1 339 PRO 339 320 320 PRO PRO A . n 
A 1 340 LEU 340 321 321 LEU LEU A . n 
A 1 341 GLN 341 322 322 GLN GLN A . n 
A 1 342 HIS 342 323 323 HIS HIS A . n 
A 1 343 GLY 343 324 324 GLY GLY A . n 
A 1 344 ILE 344 325 325 ILE ILE A . n 
A 1 345 VAL 345 326 326 VAL VAL A . n 
A 1 346 TYR 346 327 327 TYR TYR A . n 
A 1 347 SER 347 328 328 SER SER A . n 
A 1 348 GLY 348 329 329 GLY GLY A . n 
A 1 349 GLY 349 330 330 GLY GLY A . n 
A 1 350 SER 350 331 331 SER SER A . n 
A 1 351 SER 351 332 332 SER SER A . n 
A 1 352 ASP 352 333 333 ASP ASP A . n 
A 1 353 THR 353 334 334 THR THR A . n 
A 1 354 ILE 354 335 335 ILE ILE A . n 
A 1 355 CYS 355 336 336 CYS CYS A . n 
A 1 356 ASP 356 337 337 ASP ASP A . n 
A 1 357 LEU 357 338 338 LEU LEU A . n 
A 1 358 LEU 358 339 339 LEU LEU A . n 
A 1 359 GLY 359 340 340 GLY GLY A . n 
A 1 360 ALA 360 341 341 ALA ALA A . n 
A 1 361 LYS 361 342 342 LYS LYS A . n 
A 1 362 GLY 362 343 343 GLY GLY A . n 
A 1 363 LYS 363 344 344 LYS LYS A . n 
A 1 364 ASP 364 345 345 ASP ASP A . n 
A 1 365 ILE 365 346 346 ILE ILE A . n 
A 1 366 LEU 366 347 347 LEU LEU A . n 
A 1 367 TYR 367 348 348 TYR TYR A . n 
A 1 368 ILE 368 349 349 ILE ILE A . n 
A 1 369 GLY 369 350 350 GLY GLY A . n 
A 1 370 ASP 370 351 351 ASP ASP A . n 
A 1 371 HIS 371 352 352 HIS HIS A . n 
A 1 372 ILE 372 353 353 ILE ILE A . n 
A 1 373 PHE 373 354 354 PHE PHE A . n 
A 1 374 GLY 374 355 355 GLY GLY A . n 
A 1 375 ASP 375 356 356 ASP ASP A . n 
A 1 376 ILE 376 357 357 ILE ILE A . n 
A 1 377 LEU 377 358 358 LEU LEU A . n 
A 1 378 LYS 378 359 359 LYS LYS A . n 
A 1 379 SER 379 360 360 SER SER A . n 
A 1 380 LYS 380 361 361 LYS LYS A . n 
A 1 381 LYS 381 362 362 LYS LYS A . n 
A 1 382 ARG 382 363 363 ARG ARG A . n 
A 1 383 GLN 383 364 364 GLN GLN A . n 
A 1 384 GLY 384 365 365 GLY GLY A . n 
A 1 385 TRP 385 366 366 TRP TRP A . n 
A 1 386 ARG 386 367 367 ARG ARG A . n 
A 1 387 THR 387 368 368 THR THR A . n 
A 1 388 PHE 388 369 369 PHE PHE A . n 
A 1 389 LEU 389 370 370 LEU LEU A . n 
A 1 390 VAL 390 371 371 VAL VAL A . n 
A 1 391 ILE 391 372 372 ILE ILE A . n 
A 1 392 PRO 392 373 373 PRO PRO A . n 
A 1 393 GLU 393 374 374 GLU GLU A . n 
A 1 394 LEU 394 375 375 LEU LEU A . n 
A 1 395 ALA 395 376 376 ALA ALA A . n 
A 1 396 GLN 396 377 377 GLN GLN A . n 
A 1 397 GLU 397 378 378 GLU GLU A . n 
A 1 398 LEU 398 379 379 LEU LEU A . n 
A 1 399 HIS 399 380 380 HIS HIS A . n 
A 1 400 VAL 400 381 381 VAL VAL A . n 
A 1 401 TRP 401 382 382 TRP TRP A . n 
A 1 402 THR 402 383 383 THR THR A . n 
A 1 403 ASP 403 384 384 ASP ASP A . n 
A 1 404 LYS 404 385 385 LYS LYS A . n 
A 1 405 SER 405 386 386 SER SER A . n 
A 1 406 SER 406 387 387 SER SER A . n 
A 1 407 LEU 407 388 388 LEU LEU A . n 
A 1 408 PHE 408 389 389 PHE PHE A . n 
A 1 409 GLU 409 390 390 GLU GLU A . n 
A 1 410 GLU 410 391 391 GLU GLU A . n 
A 1 411 LEU 411 392 392 LEU LEU A . n 
A 1 412 GLN 412 393 393 GLN GLN A . n 
A 1 413 SER 413 394 394 SER SER A . n 
A 1 414 LEU 414 395 395 LEU LEU A . n 
A 1 415 ASP 415 396 396 ASP ASP A . n 
A 1 416 ILE 416 397 397 ILE ILE A . n 
A 1 417 PHE 417 398 398 PHE PHE A . n 
A 1 418 LEU 418 399 399 LEU LEU A . n 
A 1 419 ALA 419 400 400 ALA ALA A . n 
A 1 420 GLU 420 401 ?   ?   ?   A . n 
A 1 421 LEU 421 402 ?   ?   ?   A . n 
A 1 422 TYR 422 403 ?   ?   ?   A . n 
A 1 423 LYS 423 404 ?   ?   ?   A . n 
A 1 424 HIS 424 405 ?   ?   ?   A . n 
A 1 425 LEU 425 406 ?   ?   ?   A . n 
A 1 426 ASP 426 407 ?   ?   ?   A . n 
A 1 427 SER 427 408 ?   ?   ?   A . n 
A 1 428 SER 428 409 ?   ?   ?   A . n 
A 1 429 SER 429 410 ?   ?   ?   A . n 
A 1 430 ASN 430 411 ?   ?   ?   A . n 
A 1 431 GLU 431 412 ?   ?   ?   A . n 
A 1 432 ARG 432 413 ?   ?   ?   A . n 
A 1 433 PRO 433 414 ?   ?   ?   A . n 
A 1 434 ASP 434 415 ?   ?   ?   A . n 
A 1 435 ILE 435 416 ?   ?   ?   A . n 
A 1 436 SER 436 417 417 SER SER A . n 
A 1 437 SER 437 418 418 SER SER A . n 
A 1 438 ILE 438 419 419 ILE ILE A . n 
A 1 439 GLN 439 420 420 GLN GLN A . n 
A 1 440 ARG 440 421 421 ARG ARG A . n 
A 1 441 ARG 441 422 422 ARG ARG A . n 
A 1 442 ILE 442 423 423 ILE ILE A . n 
A 1 443 LYS 443 424 424 LYS LYS A . n 
A 1 444 LYS 444 425 425 LYS LYS A . n 
A 1 445 VAL 445 426 426 VAL VAL A . n 
A 1 446 THR 446 427 427 THR THR A . n 
A 1 447 HIS 447 428 428 HIS HIS A . n 
A 1 448 ASP 448 429 429 ASP ASP A . n 
A 1 449 MET 449 430 430 MET MET A . n 
A 1 450 ASP 450 431 431 ASP ASP A . n 
A 1 451 MET 451 432 432 MET MET A . n 
A 1 452 CYS 452 433 433 CYS CYS A . n 
A 1 453 TYR 453 434 434 TYR TYR A . n 
A 1 454 GLY 454 435 435 GLY GLY A . n 
A 1 455 MET 455 436 436 MET MET A . n 
A 1 456 MET 456 437 437 MET MET A . n 
A 1 457 GLY 457 438 438 GLY GLY A . n 
A 1 458 SER 458 439 439 SER SER A . n 
A 1 459 LEU 459 440 440 LEU LEU A . n 
A 1 460 PHE 460 441 441 PHE PHE A . n 
A 1 461 ARG 461 442 442 ARG ARG A . n 
A 1 462 SER 462 443 443 SER SER A . n 
A 1 463 GLY 463 444 444 GLY GLY A . n 
A 1 464 SER 464 445 445 SER SER A . n 
A 1 465 ARG 465 446 446 ARG ARG A . n 
A 1 466 GLN 466 447 447 GLN GLN A . n 
A 1 467 THR 467 448 448 THR THR A . n 
A 1 468 LEU 468 449 449 LEU LEU A . n 
A 1 469 PHE 469 450 450 PHE PHE A . n 
A 1 470 ALA 470 451 451 ALA ALA A . n 
A 1 471 SER 471 452 452 SER SER A . n 
A 1 472 GLN 472 453 453 GLN GLN A . n 
A 1 473 VAL 473 454 454 VAL VAL A . n 
A 1 474 MET 474 455 455 MET MET A . n 
A 1 475 ARG 475 456 456 ARG ARG A . n 
A 1 476 TYR 476 457 457 TYR TYR A . n 
A 1 477 ALA 477 458 458 ALA ALA A . n 
A 1 478 ASP 478 459 459 ASP ASP A . n 
A 1 479 LEU 479 460 460 LEU LEU A . n 
A 1 480 TYR 480 461 461 TYR TYR A . n 
A 1 481 ALA 481 462 462 ALA ALA A . n 
A 1 482 ALA 482 463 463 ALA ALA A . n 
A 1 483 SER 483 464 464 SER SER A . n 
A 1 484 PHE 484 465 465 PHE PHE A . n 
A 1 485 ILE 485 466 466 ILE ILE A . n 
A 1 486 ASN 486 467 467 ASN ASN A . n 
A 1 487 LEU 487 468 468 LEU LEU A . n 
A 1 488 LEU 488 469 469 LEU LEU A . n 
A 1 489 TYR 489 470 470 TYR TYR A . n 
A 1 490 TYR 490 471 471 TYR TYR A . n 
A 1 491 PRO 491 472 472 PRO PRO A . n 
A 1 492 PHE 492 473 473 PHE PHE A . n 
A 1 493 SER 493 474 474 SER SER A . n 
A 1 494 TYR 494 475 475 TYR TYR A . n 
A 1 495 LEU 495 476 476 LEU LEU A . n 
A 1 496 PHE 496 477 477 PHE PHE A . n 
A 1 497 ARG 497 478 478 ARG ARG A . n 
A 1 498 ALA 498 479 479 ALA ALA A . n 
A 1 499 ALA 499 480 480 ALA ALA A . n 
A 1 500 HIS 500 481 481 HIS HIS A . n 
A 1 501 VAL 501 482 482 VAL VAL A . n 
A 1 502 LEU 502 483 483 LEU LEU A . n 
A 1 503 MET 503 484 484 MET MET A . n 
A 1 504 PRO 504 485 485 PRO PRO A . n 
A 1 505 HIS 505 486 486 HIS HIS A . n 
A 1 506 GLU 506 487 487 GLU GLU A . n 
A 1 507 SER 507 488 488 SER SER A . n 
A 1 508 THR 508 489 ?   ?   ?   A . n 
A 1 509 VAL 509 490 ?   ?   ?   A . n 
A 1 510 GLU 510 491 ?   ?   ?   A . n 
A 1 511 HIS 511 492 ?   ?   ?   A . n 
A 1 512 THR 512 493 ?   ?   ?   A . n 
A 1 513 HIS 513 494 ?   ?   ?   A . n 
A 1 514 VAL 514 495 ?   ?   ?   A . n 
A 1 515 ASP 515 496 ?   ?   ?   A . n 
A 1 516 ILE 516 497 ?   ?   ?   A . n 
A 1 517 ASN 517 498 ?   ?   ?   A . n 
A 1 518 GLU 518 499 ?   ?   ?   A . n 
A 1 519 MET 519 500 ?   ?   ?   A . n 
A 1 520 GLU 520 501 ?   ?   ?   A . n 
A 1 521 SER 521 502 ?   ?   ?   A . n 
A 1 522 PRO 522 503 ?   ?   ?   A . n 
A 1 523 LEU 523 504 ?   ?   ?   A . n 
A 1 524 ALA 524 505 ?   ?   ?   A . n 
A 1 525 THR 525 506 ?   ?   ?   A . n 
A 1 526 ARG 526 507 ?   ?   ?   A . n 
A 1 527 ASN 527 508 ?   ?   ?   A . n 
A 1 528 ARG 528 509 ?   ?   ?   A . n 
A 1 529 THR 529 510 ?   ?   ?   A . n 
A 1 530 SER 530 511 ?   ?   ?   A . n 
A 1 531 VAL 531 512 ?   ?   ?   A . n 
A 1 532 ASP 532 513 ?   ?   ?   A . n 
A 1 533 PHE 533 514 ?   ?   ?   A . n 
A 1 534 LYS 534 515 ?   ?   ?   A . n 
A 1 535 ASP 535 516 ?   ?   ?   A . n 
A 1 536 THR 536 517 ?   ?   ?   A . n 
A 1 537 ASP 537 518 ?   ?   ?   A . n 
A 1 538 TYR 538 519 ?   ?   ?   A . n 
A 1 539 LYS 539 520 ?   ?   ?   A . n 
A 1 540 ARG 540 521 ?   ?   ?   A . n 
A 1 541 HIS 541 522 ?   ?   ?   A . n 
A 1 542 GLN 542 523 ?   ?   ?   A . n 
A 1 543 LEU 543 524 ?   ?   ?   A . n 
A 1 544 THR 544 525 ?   ?   ?   A . n 
A 1 545 ARG 545 526 ?   ?   ?   A . n 
A 1 546 SER 546 527 ?   ?   ?   A . n 
A 1 547 ILE 547 528 ?   ?   ?   A . n 
A 1 548 SER 548 529 ?   ?   ?   A . n 
A 1 549 GLU 549 530 ?   ?   ?   A . n 
A 1 550 ILE 550 531 ?   ?   ?   A . n 
A 1 551 LYS 551 532 ?   ?   ?   A . n 
A 1 552 PRO 552 533 ?   ?   ?   A . n 
A 1 553 PRO 553 534 ?   ?   ?   A . n 
A 1 554 ASN 554 535 ?   ?   ?   A . n 
A 1 555 LEU 555 536 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   1489 1489 GOL GOL A . 
C 3 SO4 1   1490 1490 SO4 SO4 A . 
D 3 SO4 1   1491 1491 SO4 SO4 A . 
E 3 SO4 1   1492 1492 SO4 SO4 A . 
F 3 SO4 1   1493 1493 SO4 SO4 A . 
G 3 SO4 1   1494 1494 SO4 SO4 A . 
H 3 SO4 1   1495 1495 SO4 SO4 A . 
I 4 MG  1   1496 1496 MG  MG  A . 
J 5 HOH 1   2001 2001 HOH HOH A . 
J 5 HOH 2   2002 2002 HOH HOH A . 
J 5 HOH 3   2003 2003 HOH HOH A . 
J 5 HOH 4   2004 2004 HOH HOH A . 
J 5 HOH 5   2005 2005 HOH HOH A . 
J 5 HOH 6   2006 2006 HOH HOH A . 
J 5 HOH 7   2007 2007 HOH HOH A . 
J 5 HOH 8   2008 2008 HOH HOH A . 
J 5 HOH 9   2009 2009 HOH HOH A . 
J 5 HOH 10  2010 2010 HOH HOH A . 
J 5 HOH 11  2011 2011 HOH HOH A . 
J 5 HOH 12  2012 2012 HOH HOH A . 
J 5 HOH 13  2013 2013 HOH HOH A . 
J 5 HOH 14  2014 2014 HOH HOH A . 
J 5 HOH 15  2015 2015 HOH HOH A . 
J 5 HOH 16  2016 2016 HOH HOH A . 
J 5 HOH 17  2017 2017 HOH HOH A . 
J 5 HOH 18  2018 2018 HOH HOH A . 
J 5 HOH 19  2019 2019 HOH HOH A . 
J 5 HOH 20  2020 2020 HOH HOH A . 
J 5 HOH 21  2021 2021 HOH HOH A . 
J 5 HOH 22  2022 2022 HOH HOH A . 
J 5 HOH 23  2023 2023 HOH HOH A . 
J 5 HOH 24  2024 2024 HOH HOH A . 
J 5 HOH 25  2025 2025 HOH HOH A . 
J 5 HOH 26  2026 2026 HOH HOH A . 
J 5 HOH 27  2027 2027 HOH HOH A . 
J 5 HOH 28  2028 2028 HOH HOH A . 
J 5 HOH 29  2029 2029 HOH HOH A . 
J 5 HOH 30  2030 2030 HOH HOH A . 
J 5 HOH 31  2031 2031 HOH HOH A . 
J 5 HOH 32  2032 2032 HOH HOH A . 
J 5 HOH 33  2033 2033 HOH HOH A . 
J 5 HOH 34  2034 2034 HOH HOH A . 
J 5 HOH 35  2035 2035 HOH HOH A . 
J 5 HOH 36  2036 2036 HOH HOH A . 
J 5 HOH 37  2037 2037 HOH HOH A . 
J 5 HOH 38  2038 2038 HOH HOH A . 
J 5 HOH 39  2039 2039 HOH HOH A . 
J 5 HOH 40  2040 2040 HOH HOH A . 
J 5 HOH 41  2041 2041 HOH HOH A . 
J 5 HOH 42  2042 2042 HOH HOH A . 
J 5 HOH 43  2043 2043 HOH HOH A . 
J 5 HOH 44  2044 2044 HOH HOH A . 
J 5 HOH 45  2045 2045 HOH HOH A . 
J 5 HOH 46  2046 2046 HOH HOH A . 
J 5 HOH 47  2047 2047 HOH HOH A . 
J 5 HOH 48  2048 2048 HOH HOH A . 
J 5 HOH 49  2049 2049 HOH HOH A . 
J 5 HOH 50  2050 2050 HOH HOH A . 
J 5 HOH 51  2051 2051 HOH HOH A . 
J 5 HOH 52  2052 2052 HOH HOH A . 
J 5 HOH 53  2053 2053 HOH HOH A . 
J 5 HOH 54  2054 2054 HOH HOH A . 
J 5 HOH 55  2055 2055 HOH HOH A . 
J 5 HOH 56  2056 2056 HOH HOH A . 
J 5 HOH 57  2057 2057 HOH HOH A . 
J 5 HOH 58  2058 2058 HOH HOH A . 
J 5 HOH 59  2059 2059 HOH HOH A . 
J 5 HOH 60  2060 2060 HOH HOH A . 
J 5 HOH 61  2061 2061 HOH HOH A . 
J 5 HOH 62  2062 2062 HOH HOH A . 
J 5 HOH 63  2063 2063 HOH HOH A . 
J 5 HOH 64  2064 2064 HOH HOH A . 
J 5 HOH 65  2065 2065 HOH HOH A . 
J 5 HOH 66  2066 2066 HOH HOH A . 
J 5 HOH 67  2067 2067 HOH HOH A . 
J 5 HOH 68  2068 2068 HOH HOH A . 
J 5 HOH 69  2069 2069 HOH HOH A . 
J 5 HOH 70  2070 2070 HOH HOH A . 
J 5 HOH 71  2071 2071 HOH HOH A . 
J 5 HOH 72  2072 2072 HOH HOH A . 
J 5 HOH 73  2073 2073 HOH HOH A . 
J 5 HOH 74  2074 2074 HOH HOH A . 
J 5 HOH 75  2075 2075 HOH HOH A . 
J 5 HOH 76  2076 2076 HOH HOH A . 
J 5 HOH 77  2077 2077 HOH HOH A . 
J 5 HOH 78  2078 2078 HOH HOH A . 
J 5 HOH 79  2079 2079 HOH HOH A . 
J 5 HOH 80  2080 2080 HOH HOH A . 
J 5 HOH 81  2081 2081 HOH HOH A . 
J 5 HOH 82  2082 2082 HOH HOH A . 
J 5 HOH 83  2083 2083 HOH HOH A . 
J 5 HOH 84  2084 2084 HOH HOH A . 
J 5 HOH 85  2085 2085 HOH HOH A . 
J 5 HOH 86  2086 2086 HOH HOH A . 
J 5 HOH 87  2087 2087 HOH HOH A . 
J 5 HOH 88  2088 2088 HOH HOH A . 
J 5 HOH 89  2089 2089 HOH HOH A . 
J 5 HOH 90  2090 2090 HOH HOH A . 
J 5 HOH 91  2091 2091 HOH HOH A . 
J 5 HOH 92  2092 2092 HOH HOH A . 
J 5 HOH 93  2093 2093 HOH HOH A . 
J 5 HOH 94  2094 2094 HOH HOH A . 
J 5 HOH 95  2095 2095 HOH HOH A . 
J 5 HOH 96  2096 2096 HOH HOH A . 
J 5 HOH 97  2097 2097 HOH HOH A . 
J 5 HOH 98  2098 2098 HOH HOH A . 
J 5 HOH 99  2099 2099 HOH HOH A . 
J 5 HOH 100 2100 2100 HOH HOH A . 
J 5 HOH 101 2101 2101 HOH HOH A . 
J 5 HOH 102 2102 2102 HOH HOH A . 
J 5 HOH 103 2103 2103 HOH HOH A . 
J 5 HOH 104 2104 2104 HOH HOH A . 
J 5 HOH 105 2105 2105 HOH HOH A . 
J 5 HOH 106 2106 2106 HOH HOH A . 
J 5 HOH 107 2107 2107 HOH HOH A . 
J 5 HOH 108 2108 2108 HOH HOH A . 
J 5 HOH 109 2109 2109 HOH HOH A . 
J 5 HOH 110 2110 2110 HOH HOH A . 
J 5 HOH 111 2111 2111 HOH HOH A . 
J 5 HOH 112 2112 2112 HOH HOH A . 
J 5 HOH 113 2113 2113 HOH HOH A . 
J 5 HOH 114 2114 2114 HOH HOH A . 
J 5 HOH 115 2115 2115 HOH HOH A . 
J 5 HOH 116 2116 2116 HOH HOH A . 
J 5 HOH 117 2117 2117 HOH HOH A . 
J 5 HOH 118 2118 2118 HOH HOH A . 
J 5 HOH 119 2119 2119 HOH HOH A . 
J 5 HOH 120 2120 2120 HOH HOH A . 
J 5 HOH 121 2121 2121 HOH HOH A . 
J 5 HOH 122 2122 2122 HOH HOH A . 
J 5 HOH 123 2123 2123 HOH HOH A . 
J 5 HOH 124 2124 2124 HOH HOH A . 
J 5 HOH 125 2125 2125 HOH HOH A . 
J 5 HOH 126 2126 2126 HOH HOH A . 
J 5 HOH 127 2127 2127 HOH HOH A . 
J 5 HOH 128 2128 2128 HOH HOH A . 
J 5 HOH 129 2129 2129 HOH HOH A . 
J 5 HOH 130 2130 2130 HOH HOH A . 
J 5 HOH 131 2131 2131 HOH HOH A . 
J 5 HOH 132 2132 2132 HOH HOH A . 
J 5 HOH 133 2133 2133 HOH HOH A . 
J 5 HOH 134 2134 2134 HOH HOH A . 
J 5 HOH 135 2135 2135 HOH HOH A . 
J 5 HOH 136 2136 2136 HOH HOH A . 
J 5 HOH 137 2137 2137 HOH HOH A . 
J 5 HOH 138 2138 2138 HOH HOH A . 
J 5 HOH 139 2139 2139 HOH HOH A . 
J 5 HOH 140 2140 2140 HOH HOH A . 
J 5 HOH 141 2141 2141 HOH HOH A . 
J 5 HOH 142 2142 2142 HOH HOH A . 
J 5 HOH 143 2143 2143 HOH HOH A . 
J 5 HOH 144 2144 2144 HOH HOH A . 
J 5 HOH 145 2145 2145 HOH HOH A . 
J 5 HOH 146 2146 2146 HOH HOH A . 
J 5 HOH 147 2147 2147 HOH HOH A . 
J 5 HOH 148 2148 2148 HOH HOH A . 
J 5 HOH 149 2149 2149 HOH HOH A . 
J 5 HOH 150 2150 2150 HOH HOH A . 
J 5 HOH 151 2151 2151 HOH HOH A . 
J 5 HOH 152 2152 2152 HOH HOH A . 
J 5 HOH 153 2153 2153 HOH HOH A . 
J 5 HOH 154 2154 2154 HOH HOH A . 
J 5 HOH 155 2155 2155 HOH HOH A . 
J 5 HOH 156 2156 2156 HOH HOH A . 
J 5 HOH 157 2157 2157 HOH HOH A . 
J 5 HOH 158 2158 2158 HOH HOH A . 
J 5 HOH 159 2159 2159 HOH HOH A . 
J 5 HOH 160 2160 2160 HOH HOH A . 
J 5 HOH 161 2161 2161 HOH HOH A . 
J 5 HOH 162 2162 2162 HOH HOH A . 
J 5 HOH 163 2163 2163 HOH HOH A . 
J 5 HOH 164 2164 2164 HOH HOH A . 
J 5 HOH 165 2165 2165 HOH HOH A . 
J 5 HOH 166 2166 2166 HOH HOH A . 
J 5 HOH 167 2167 2167 HOH HOH A . 
J 5 HOH 168 2168 2168 HOH HOH A . 
J 5 HOH 169 2169 2169 HOH HOH A . 
J 5 HOH 170 2170 2170 HOH HOH A . 
J 5 HOH 171 2171 2171 HOH HOH A . 
J 5 HOH 172 2172 2172 HOH HOH A . 
J 5 HOH 173 2173 2173 HOH HOH A . 
J 5 HOH 174 2174 2174 HOH HOH A . 
J 5 HOH 175 2175 2175 HOH HOH A . 
J 5 HOH 176 2176 2176 HOH HOH A . 
J 5 HOH 177 2177 2177 HOH HOH A . 
J 5 HOH 178 2178 2178 HOH HOH A . 
J 5 HOH 179 2179 2179 HOH HOH A . 
J 5 HOH 180 2180 2180 HOH HOH A . 
J 5 HOH 181 2181 2181 HOH HOH A . 
J 5 HOH 182 2182 2182 HOH HOH A . 
J 5 HOH 183 2183 2183 HOH HOH A . 
J 5 HOH 184 2184 2184 HOH HOH A . 
J 5 HOH 185 2185 2185 HOH HOH A . 
J 5 HOH 186 2186 2186 HOH HOH A . 
J 5 HOH 187 2187 2187 HOH HOH A . 
J 5 HOH 188 2188 2188 HOH HOH A . 
J 5 HOH 189 2189 2189 HOH HOH A . 
J 5 HOH 190 2190 2190 HOH HOH A . 
J 5 HOH 191 2191 2191 HOH HOH A . 
J 5 HOH 192 2192 2192 HOH HOH A . 
J 5 HOH 193 2193 2193 HOH HOH A . 
J 5 HOH 194 2194 2194 HOH HOH A . 
J 5 HOH 195 2195 2195 HOH HOH A . 
J 5 HOH 196 2196 2196 HOH HOH A . 
J 5 HOH 197 2197 2197 HOH HOH A . 
J 5 HOH 198 2198 2198 HOH HOH A . 
J 5 HOH 199 2199 2199 HOH HOH A . 
J 5 HOH 200 2200 2200 HOH HOH A . 
J 5 HOH 201 2201 2201 HOH HOH A . 
J 5 HOH 202 2202 2202 HOH HOH A . 
J 5 HOH 203 2203 2203 HOH HOH A . 
J 5 HOH 204 2204 2204 HOH HOH A . 
J 5 HOH 205 2205 2205 HOH HOH A . 
J 5 HOH 206 2206 2206 HOH HOH A . 
J 5 HOH 207 2207 2207 HOH HOH A . 
J 5 HOH 208 2208 2208 HOH HOH A . 
J 5 HOH 209 2209 2209 HOH HOH A . 
J 5 HOH 210 2210 2210 HOH HOH A . 
J 5 HOH 211 2211 2211 HOH HOH A . 
J 5 HOH 212 2212 2212 HOH HOH A . 
J 5 HOH 213 2213 2213 HOH HOH A . 
J 5 HOH 214 2214 2214 HOH HOH A . 
J 5 HOH 215 2215 2215 HOH HOH A . 
J 5 HOH 216 2216 2216 HOH HOH A . 
J 5 HOH 217 2217 2217 HOH HOH A . 
J 5 HOH 218 2218 2218 HOH HOH A . 
J 5 HOH 219 2219 2219 HOH HOH A . 
J 5 HOH 220 2220 2220 HOH HOH A . 
J 5 HOH 221 2221 2221 HOH HOH A . 
J 5 HOH 222 2222 2222 HOH HOH A . 
J 5 HOH 223 2223 2223 HOH HOH A . 
J 5 HOH 224 2224 2224 HOH HOH A . 
J 5 HOH 225 2225 2225 HOH HOH A . 
J 5 HOH 226 2226 2226 HOH HOH A . 
J 5 HOH 227 2227 2227 HOH HOH A . 
J 5 HOH 228 2228 2228 HOH HOH A . 
J 5 HOH 229 2229 2229 HOH HOH A . 
J 5 HOH 230 2230 2230 HOH HOH A . 
J 5 HOH 231 2231 2231 HOH HOH A . 
J 5 HOH 232 2232 2232 HOH HOH A . 
J 5 HOH 233 2233 2233 HOH HOH A . 
J 5 HOH 234 2234 2234 HOH HOH A . 
J 5 HOH 235 2235 2235 HOH HOH A . 
J 5 HOH 236 2236 2236 HOH HOH A . 
J 5 HOH 237 2237 2237 HOH HOH A . 
J 5 HOH 238 2238 2238 HOH HOH A . 
J 5 HOH 239 2239 2239 HOH HOH A . 
J 5 HOH 240 2240 2240 HOH HOH A . 
J 5 HOH 241 2241 2241 HOH HOH A . 
J 5 HOH 242 2242 2242 HOH HOH A . 
J 5 HOH 243 2243 2243 HOH HOH A . 
J 5 HOH 244 2244 2244 HOH HOH A . 
J 5 HOH 245 2245 2245 HOH HOH A . 
J 5 HOH 246 2246 2246 HOH HOH A . 
J 5 HOH 247 2247 2247 HOH HOH A . 
J 5 HOH 248 2248 2248 HOH HOH A . 
J 5 HOH 249 2249 2249 HOH HOH A . 
J 5 HOH 250 2250 2250 HOH HOH A . 
J 5 HOH 251 2251 2251 HOH HOH A . 
J 5 HOH 252 2252 2252 HOH HOH A . 
J 5 HOH 253 2253 2253 HOH HOH A . 
J 5 HOH 254 2254 2254 HOH HOH A . 
J 5 HOH 255 2255 2255 HOH HOH A . 
J 5 HOH 256 2256 2256 HOH HOH A . 
J 5 HOH 257 2257 2257 HOH HOH A . 
J 5 HOH 258 2258 2258 HOH HOH A . 
J 5 HOH 259 2259 2259 HOH HOH A . 
J 5 HOH 260 2260 2260 HOH HOH A . 
J 5 HOH 261 2261 2261 HOH HOH A . 
J 5 HOH 262 2262 2262 HOH HOH A . 
J 5 HOH 263 2263 2263 HOH HOH A . 
J 5 HOH 264 2264 2264 HOH HOH A . 
J 5 HOH 265 2265 2265 HOH HOH A . 
J 5 HOH 266 2266 2266 HOH HOH A . 
J 5 HOH 267 2267 2267 HOH HOH A . 
J 5 HOH 268 2268 2268 HOH HOH A . 
J 5 HOH 269 2269 2269 HOH HOH A . 
J 5 HOH 270 2270 2270 HOH HOH A . 
J 5 HOH 271 2271 2271 HOH HOH A . 
J 5 HOH 272 2272 2272 HOH HOH A . 
J 5 HOH 273 2273 2273 HOH HOH A . 
J 5 HOH 274 2274 2274 HOH HOH A . 
J 5 HOH 275 2275 2275 HOH HOH A . 
J 5 HOH 276 2276 2276 HOH HOH A . 
J 5 HOH 277 2277 2277 HOH HOH A . 
J 5 HOH 278 2278 2278 HOH HOH A . 
J 5 HOH 279 2279 2279 HOH HOH A . 
J 5 HOH 280 2280 2280 HOH HOH A . 
J 5 HOH 281 2281 2281 HOH HOH A . 
J 5 HOH 282 2282 2282 HOH HOH A . 
J 5 HOH 283 2283 2283 HOH HOH A . 
J 5 HOH 284 2284 2284 HOH HOH A . 
J 5 HOH 285 2285 2285 HOH HOH A . 
J 5 HOH 286 2286 2286 HOH HOH A . 
J 5 HOH 287 2287 2287 HOH HOH A . 
J 5 HOH 288 2288 2288 HOH HOH A . 
J 5 HOH 289 2289 2289 HOH HOH A . 
J 5 HOH 290 2290 2290 HOH HOH A . 
J 5 HOH 291 2291 2291 HOH HOH A . 
J 5 HOH 292 2292 2292 HOH HOH A . 
J 5 HOH 293 2293 2293 HOH HOH A . 
J 5 HOH 294 2294 2294 HOH HOH A . 
J 5 HOH 295 2295 2295 HOH HOH A . 
J 5 HOH 296 2296 2296 HOH HOH A . 
J 5 HOH 297 2297 2297 HOH HOH A . 
J 5 HOH 298 2298 2298 HOH HOH A . 
J 5 HOH 299 2299 2299 HOH HOH A . 
J 5 HOH 300 2300 2300 HOH HOH A . 
J 5 HOH 301 2301 2301 HOH HOH A . 
J 5 HOH 302 2302 2302 HOH HOH A . 
J 5 HOH 303 2303 2303 HOH HOH A . 
J 5 HOH 304 2304 2304 HOH HOH A . 
J 5 HOH 305 2305 2305 HOH HOH A . 
J 5 HOH 306 2306 2306 HOH HOH A . 
J 5 HOH 307 2307 2307 HOH HOH A . 
J 5 HOH 308 2308 2308 HOH HOH A . 
J 5 HOH 309 2309 2309 HOH HOH A . 
J 5 HOH 310 2310 2310 HOH HOH A . 
J 5 HOH 311 2311 2311 HOH HOH A . 
J 5 HOH 312 2312 2312 HOH HOH A . 
J 5 HOH 313 2313 2313 HOH HOH A . 
J 5 HOH 314 2314 2314 HOH HOH A . 
J 5 HOH 315 2315 2315 HOH HOH A . 
J 5 HOH 316 2316 2316 HOH HOH A . 
J 5 HOH 317 2317 2317 HOH HOH A . 
J 5 HOH 318 2318 2318 HOH HOH A . 
J 5 HOH 319 2319 2319 HOH HOH A . 
J 5 HOH 320 2320 2320 HOH HOH A . 
J 5 HOH 321 2321 2321 HOH HOH A . 
J 5 HOH 322 2322 2322 HOH HOH A . 
J 5 HOH 323 2323 2323 HOH HOH A . 
J 5 HOH 324 2324 2324 HOH HOH A . 
J 5 HOH 325 2325 2325 HOH HOH A . 
J 5 HOH 326 2326 2326 HOH HOH A . 
J 5 HOH 327 2327 2327 HOH HOH A . 
J 5 HOH 328 2328 2328 HOH HOH A . 
J 5 HOH 329 2329 2329 HOH HOH A . 
J 5 HOH 330 2330 2330 HOH HOH A . 
J 5 HOH 331 2331 2331 HOH HOH A . 
J 5 HOH 332 2332 2332 HOH HOH A . 
J 5 HOH 333 2333 2333 HOH HOH A . 
J 5 HOH 334 2334 2334 HOH HOH A . 
J 5 HOH 335 2335 2335 HOH HOH A . 
J 5 HOH 336 2336 2336 HOH HOH A . 
J 5 HOH 337 2337 2337 HOH HOH A . 
J 5 HOH 338 2338 2338 HOH HOH A . 
J 5 HOH 339 2339 2339 HOH HOH A . 
J 5 HOH 340 2340 2340 HOH HOH A . 
J 5 HOH 341 2341 2341 HOH HOH A . 
J 5 HOH 342 2342 2342 HOH HOH A . 
J 5 HOH 343 2343 2343 HOH HOH A . 
J 5 HOH 344 2344 2344 HOH HOH A . 
J 5 HOH 345 2345 2345 HOH HOH A . 
J 5 HOH 346 2346 2346 HOH HOH A . 
J 5 HOH 347 2347 2347 HOH HOH A . 
J 5 HOH 348 2348 2348 HOH HOH A . 
J 5 HOH 349 2349 2349 HOH HOH A . 
J 5 HOH 350 2350 2350 HOH HOH A . 
J 5 HOH 351 2351 2351 HOH HOH A . 
J 5 HOH 352 2352 2352 HOH HOH A . 
J 5 HOH 353 2353 2353 HOH HOH A . 
J 5 HOH 354 2354 2354 HOH HOH A . 
J 5 HOH 355 2355 2355 HOH HOH A . 
J 5 HOH 356 2356 2356 HOH HOH A . 
J 5 HOH 357 2357 2357 HOH HOH A . 
J 5 HOH 358 2358 2358 HOH HOH A . 
J 5 HOH 359 2359 2359 HOH HOH A . 
J 5 HOH 360 2360 2360 HOH HOH A . 
J 5 HOH 361 2361 2361 HOH HOH A . 
J 5 HOH 362 2362 2362 HOH HOH A . 
J 5 HOH 363 2363 2363 HOH HOH A . 
J 5 HOH 364 2364 2364 HOH HOH A . 
J 5 HOH 365 2365 2365 HOH HOH A . 
J 5 HOH 366 2366 2366 HOH HOH A . 
J 5 HOH 367 2367 2367 HOH HOH A . 
J 5 HOH 368 2368 2368 HOH HOH A . 
J 5 HOH 369 2369 2369 HOH HOH A . 
J 5 HOH 370 2370 2370 HOH HOH A . 
J 5 HOH 371 2371 2371 HOH HOH A . 
J 5 HOH 372 2372 2372 HOH HOH A . 
J 5 HOH 373 2373 2373 HOH HOH A . 
J 5 HOH 374 2374 2374 HOH HOH A . 
J 5 HOH 375 2375 2375 HOH HOH A . 
J 5 HOH 376 2376 2376 HOH HOH A . 
J 5 HOH 377 2377 2377 HOH HOH A . 
J 5 HOH 378 2378 2378 HOH HOH A . 
J 5 HOH 379 2379 2379 HOH HOH A . 
J 5 HOH 380 2380 2380 HOH HOH A . 
J 5 HOH 381 2381 2381 HOH HOH A . 
J 5 HOH 382 2382 2382 HOH HOH A . 
J 5 HOH 383 2383 2383 HOH HOH A . 
J 5 HOH 384 2384 2384 HOH HOH A . 
J 5 HOH 385 2385 2385 HOH HOH A . 
J 5 HOH 386 2386 2386 HOH HOH A . 
J 5 HOH 387 2387 2387 HOH HOH A . 
J 5 HOH 388 2388 2388 HOH HOH A . 
J 5 HOH 389 2389 2389 HOH HOH A . 
J 5 HOH 390 2390 2390 HOH HOH A . 
J 5 HOH 391 2391 2391 HOH HOH A . 
J 5 HOH 392 2392 2392 HOH HOH A . 
J 5 HOH 393 2393 2393 HOH HOH A . 
J 5 HOH 394 2394 2394 HOH HOH A . 
J 5 HOH 395 2395 2395 HOH HOH A . 
J 5 HOH 396 2396 2396 HOH HOH A . 
J 5 HOH 397 2397 2397 HOH HOH A . 
J 5 HOH 398 2398 2398 HOH HOH A . 
J 5 HOH 399 2399 2399 HOH HOH A . 
J 5 HOH 400 2400 2400 HOH HOH A . 
J 5 HOH 401 2401 2401 HOH HOH A . 
J 5 HOH 402 2402 2402 HOH HOH A . 
J 5 HOH 403 2403 2403 HOH HOH A . 
J 5 HOH 404 2404 2404 HOH HOH A . 
J 5 HOH 405 2405 2405 HOH HOH A . 
J 5 HOH 406 2406 2406 HOH HOH A . 
J 5 HOH 407 2407 2407 HOH HOH A . 
J 5 HOH 408 2408 2408 HOH HOH A . 
J 5 HOH 409 2409 2409 HOH HOH A . 
J 5 HOH 410 2410 2410 HOH HOH A . 
J 5 HOH 411 2411 2411 HOH HOH A . 
J 5 HOH 412 2412 2412 HOH HOH A . 
J 5 HOH 413 2413 2413 HOH HOH A . 
J 5 HOH 414 2414 2414 HOH HOH A . 
J 5 HOH 415 2415 2415 HOH HOH A . 
J 5 HOH 416 2416 2416 HOH HOH A . 
J 5 HOH 417 2417 2417 HOH HOH A . 
J 5 HOH 418 2418 2418 HOH HOH A . 
J 5 HOH 419 2419 2419 HOH HOH A . 
J 5 HOH 420 2420 2420 HOH HOH A . 
J 5 HOH 421 2421 2421 HOH HOH A . 
J 5 HOH 422 2422 2422 HOH HOH A . 
J 5 HOH 423 2423 2423 HOH HOH A . 
J 5 HOH 424 2424 2424 HOH HOH A . 
J 5 HOH 425 2425 2425 HOH HOH A . 
J 5 HOH 426 2426 2426 HOH HOH A . 
J 5 HOH 427 2427 2427 HOH HOH A . 
J 5 HOH 428 2428 2428 HOH HOH A . 
J 5 HOH 429 2429 2429 HOH HOH A . 
J 5 HOH 430 2430 2430 HOH HOH A . 
J 5 HOH 431 2431 2431 HOH HOH A . 
J 5 HOH 432 2432 2432 HOH HOH A . 
J 5 HOH 433 2433 2433 HOH HOH A . 
J 5 HOH 434 2434 2434 HOH HOH A . 
J 5 HOH 435 2435 2435 HOH HOH A . 
J 5 HOH 436 2436 2436 HOH HOH A . 
J 5 HOH 437 2437 2437 HOH HOH A . 
J 5 HOH 438 2438 2438 HOH HOH A . 
J 5 HOH 439 2439 2439 HOH HOH A . 
J 5 HOH 440 2440 2440 HOH HOH A . 
J 5 HOH 441 2441 2441 HOH HOH A . 
J 5 HOH 442 2442 2442 HOH HOH A . 
J 5 HOH 443 2443 2443 HOH HOH A . 
J 5 HOH 444 2444 2444 HOH HOH A . 
J 5 HOH 445 2445 2445 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? J HOH .   ? A HOH 2365 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2443 ? 1_555 91.3  ? 
2  O   ? J HOH .   ? A HOH 2365 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD2 ? A ASP 71  ? A ASP 52   ? 1_555 177.0 ? 
3  O   ? J HOH .   ? A HOH 2443 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD2 ? A ASP 71  ? A ASP 52   ? 1_555 91.5  ? 
4  O   ? J HOH .   ? A HOH 2365 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? A ASP 73  ? A ASP 54   ? 1_555 90.7  ? 
5  O   ? J HOH .   ? A HOH 2443 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? A ASP 73  ? A ASP 54   ? 1_555 91.4  ? 
6  OD2 ? A ASP 71  ? A ASP 52   ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? A ASP 73  ? A ASP 54   ? 1_555 88.1  ? 
7  O   ? J HOH .   ? A HOH 2365 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD1 ? A ASP 370 ? A ASP 351  ? 1_555 93.8  ? 
8  O   ? J HOH .   ? A HOH 2443 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD1 ? A ASP 370 ? A ASP 351  ? 1_555 174.2 ? 
9  OD2 ? A ASP 71  ? A ASP 52   ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD1 ? A ASP 370 ? A ASP 351  ? 1_555 83.4  ? 
10 O   ? A ASP 73  ? A ASP 54   ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 OD1 ? A ASP 370 ? A ASP 351  ? 1_555 85.7  ? 
11 O   ? J HOH .   ? A HOH 2365 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2369 ? 1_555 96.8  ? 
12 O   ? J HOH .   ? A HOH 2443 ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2369 ? 1_555 90.9  ? 
13 OD2 ? A ASP 71  ? A ASP 52   ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2369 ? 1_555 84.2  ? 
14 O   ? A ASP 73  ? A ASP 54   ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2369 ? 1_555 172.1 ? 
15 OD1 ? A ASP 370 ? A ASP 351  ? 1_555 MG ? I MG . ? A MG 1496 ? 1_555 O   ? J HOH .   ? A HOH 2369 ? 1_555 91.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-19 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 7.7150   42.6840 38.4060 0.1753 -0.0669 -0.0548 0.0115  -0.0041 0.0587  5.9930  5.4418 1.8400  
3.7112  0.3484   1.3421  -0.0218 -0.0387 0.4494  -0.2440 0.0406  0.1084  -0.2665 -0.0127 -0.0188 
'X-RAY DIFFRACTION' 2  ? refined -6.2610  22.6660 44.0900 0.0977 -0.0489 -0.0735 0.0098  -0.0088 0.0160  0.7773  0.4417 0.5311  
0.2215  0.0569   0.0899  0.0205  0.0470  0.0031  -0.0313 -0.0002 0.0059  -0.0335 -0.0179 -0.0203 
'X-RAY DIFFRACTION' 3  ? refined -20.6760 22.2720 59.5730 0.1021 0.0284  -0.0768 0.0146  0.0059  -0.0270 0.9658  4.0688 5.6126  
1.7461  1.4363   0.8166  -0.1522 -0.1021 0.1889  0.0738  -0.1678 0.2563  -0.2406 -0.6072 0.3200  
'X-RAY DIFFRACTION' 4  ? refined -16.3190 15.7210 44.9670 0.1025 -0.0590 -0.0466 0.0310  -0.0161 0.0055  1.0263  1.6961 1.4471  
0.4045  -1.1928  -0.1647 -0.0574 0.1018  -0.0946 0.0539  0.0586  0.0631  0.0428  0.0308  -0.0012 
'X-RAY DIFFRACTION' 5  ? refined -9.7970  12.1770 39.0200 0.1121 -0.0294 -0.0675 0.0105  -0.0473 -0.0183 4.5391  2.0468 1.5007  
2.3003  -2.1588  -1.0833 -0.1334 0.1151  -0.2089 -0.0535 0.0766  -0.0585 0.1462  -0.0064 0.0567  
'X-RAY DIFFRACTION' 6  ? refined 18.0340  25.0150 35.7570 0.1028 -0.0287 -0.0418 -0.0134 0.0343  0.0155  1.1707  0.9665 1.1034  
0.6668  -0.3746  -0.5278 0.0211  0.0862  0.0374  -0.0173 -0.0297 -0.0436 -0.1277 0.0610  0.0086  
'X-RAY DIFFRACTION' 7  ? refined 13.9490  17.8830 48.7020 0.0885 -0.0270 -0.0801 -0.0214 0.0150  0.0194  1.1463  2.1864 0.4594  
-0.8343 -0.4945  0.4621  -0.0102 -0.0061 -0.0464 -0.0573 -0.0139 -0.0576 0.0698  0.0748  0.0241  
'X-RAY DIFFRACTION' 8  ? refined -17.1810 45.8190 56.0570 0.2309 -0.0505 0.0492  0.2248  -0.0670 0.0031  14.2793 4.2887 21.7034 
-2.3561 -11.0301 5.1693  0.2000  0.2102  0.6014  0.3410  -0.0778 0.1221  -1.2277 -1.3459 -0.1222 
'X-RAY DIFFRACTION' 9  ? refined -1.1720  35.4810 50.9430 0.1290 -0.0966 -0.0618 0.0063  -0.0073 0.0060  1.3374  0.9869 1.8068  
0.4471  0.2158   0.2177  -0.0265 -0.0739 0.1574  -0.0639 -0.0188 0.0942  -0.2144 0.0130  0.0453  
'X-RAY DIFFRACTION' 10 ? refined 5.1110   41.2280 70.1860 0.2724 -0.0276 0.0891  0.0075  0.0660  0.0383  5.0793  0.8546 32.1681 
1.0924  -10.7595 0.0965  0.5867  0.0285  0.3887  -0.2757 0.1601  -0.2330 -1.4912 0.2761  -0.7468 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 3   ? ? A 34  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 35  ? ? A 125 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 126 ? ? A 146 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 147 ? ? A 179 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 180 ? ? A 229 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 230 ? ? A 288 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 289 ? ? A 381 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 382 ? ? A 424 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 425 ? ? A 477 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 478 ? ? A 488 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
PHASER phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2J2C 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;OUR CONSTRUCT CONTAINS RESIDUES 1-536 OUT OF THE 561 AMINO
ACIDS. ADDITIONALLY IT CONTAINS AN N-TERMINAL HISTAG
MGSSHHHHHHSSGLVPRGS
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2257 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2421 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2173 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2375 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_556 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 53  ? ? -98.12  -72.89 
2 1 THR A 56  ? ? -122.68 -77.88 
3 1 ASN A 221 ? ? -151.13 68.08  
4 1 PRO A 267 ? ? -79.26  24.14  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2016 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   8.03 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -18 ? A MET 1   
2  1 Y 1 A GLY -17 ? A GLY 2   
3  1 Y 1 A SER -16 ? A SER 3   
4  1 Y 1 A SER -15 ? A SER 4   
5  1 Y 1 A HIS -14 ? A HIS 5   
6  1 Y 1 A HIS -13 ? A HIS 6   
7  1 Y 1 A HIS -12 ? A HIS 7   
8  1 Y 1 A HIS -11 ? A HIS 8   
9  1 Y 1 A HIS -10 ? A HIS 9   
10 1 Y 1 A HIS -9  ? A HIS 10  
11 1 Y 1 A SER -8  ? A SER 11  
12 1 Y 1 A SER -7  ? A SER 12  
13 1 Y 1 A GLY -6  ? A GLY 13  
14 1 Y 1 A LEU -5  ? A LEU 14  
15 1 Y 1 A VAL -4  ? A VAL 15  
16 1 Y 1 A PRO -3  ? A PRO 16  
17 1 Y 1 A ARG -2  ? A ARG 17  
18 1 Y 1 A GLY -1  ? A GLY 18  
19 1 Y 1 A SER 0   ? A SER 19  
20 1 Y 1 A MET 1   ? A MET 20  
21 1 Y 1 A SER 2   ? A SER 21  
22 1 Y 1 A GLU 401 ? A GLU 420 
23 1 Y 1 A LEU 402 ? A LEU 421 
24 1 Y 1 A TYR 403 ? A TYR 422 
25 1 Y 1 A LYS 404 ? A LYS 423 
26 1 Y 1 A HIS 405 ? A HIS 424 
27 1 Y 1 A LEU 406 ? A LEU 425 
28 1 Y 1 A ASP 407 ? A ASP 426 
29 1 Y 1 A SER 408 ? A SER 427 
30 1 Y 1 A SER 409 ? A SER 428 
31 1 Y 1 A SER 410 ? A SER 429 
32 1 Y 1 A ASN 411 ? A ASN 430 
33 1 Y 1 A GLU 412 ? A GLU 431 
34 1 Y 1 A ARG 413 ? A ARG 432 
35 1 Y 1 A PRO 414 ? A PRO 433 
36 1 Y 1 A ASP 415 ? A ASP 434 
37 1 Y 1 A ILE 416 ? A ILE 435 
38 1 Y 1 A THR 489 ? A THR 508 
39 1 Y 1 A VAL 490 ? A VAL 509 
40 1 Y 1 A GLU 491 ? A GLU 510 
41 1 Y 1 A HIS 492 ? A HIS 511 
42 1 Y 1 A THR 493 ? A THR 512 
43 1 Y 1 A HIS 494 ? A HIS 513 
44 1 Y 1 A VAL 495 ? A VAL 514 
45 1 Y 1 A ASP 496 ? A ASP 515 
46 1 Y 1 A ILE 497 ? A ILE 516 
47 1 Y 1 A ASN 498 ? A ASN 517 
48 1 Y 1 A GLU 499 ? A GLU 518 
49 1 Y 1 A MET 500 ? A MET 519 
50 1 Y 1 A GLU 501 ? A GLU 520 
51 1 Y 1 A SER 502 ? A SER 521 
52 1 Y 1 A PRO 503 ? A PRO 522 
53 1 Y 1 A LEU 504 ? A LEU 523 
54 1 Y 1 A ALA 505 ? A ALA 524 
55 1 Y 1 A THR 506 ? A THR 525 
56 1 Y 1 A ARG 507 ? A ARG 526 
57 1 Y 1 A ASN 508 ? A ASN 527 
58 1 Y 1 A ARG 509 ? A ARG 528 
59 1 Y 1 A THR 510 ? A THR 529 
60 1 Y 1 A SER 511 ? A SER 530 
61 1 Y 1 A VAL 512 ? A VAL 531 
62 1 Y 1 A ASP 513 ? A ASP 532 
63 1 Y 1 A PHE 514 ? A PHE 533 
64 1 Y 1 A LYS 515 ? A LYS 534 
65 1 Y 1 A ASP 516 ? A ASP 535 
66 1 Y 1 A THR 517 ? A THR 536 
67 1 Y 1 A ASP 518 ? A ASP 537 
68 1 Y 1 A TYR 519 ? A TYR 538 
69 1 Y 1 A LYS 520 ? A LYS 539 
70 1 Y 1 A ARG 521 ? A ARG 540 
71 1 Y 1 A HIS 522 ? A HIS 541 
72 1 Y 1 A GLN 523 ? A GLN 542 
73 1 Y 1 A LEU 524 ? A LEU 543 
74 1 Y 1 A THR 525 ? A THR 544 
75 1 Y 1 A ARG 526 ? A ARG 545 
76 1 Y 1 A SER 527 ? A SER 546 
77 1 Y 1 A ILE 528 ? A ILE 547 
78 1 Y 1 A SER 529 ? A SER 548 
79 1 Y 1 A GLU 530 ? A GLU 549 
80 1 Y 1 A ILE 531 ? A ILE 550 
81 1 Y 1 A LYS 532 ? A LYS 551 
82 1 Y 1 A PRO 533 ? A PRO 552 
83 1 Y 1 A PRO 534 ? A PRO 553 
84 1 Y 1 A ASN 535 ? A ASN 554 
85 1 Y 1 A LEU 536 ? A LEU 555 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL        GOL 
3 'SULFATE ION'   SO4 
4 'MAGNESIUM ION' MG  
5 water           HOH 
#