data_2J2M
# 
_entry.id   2J2M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2J2M         
PDBE  EBI-29727    
WWPDB D_1290029727 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2J2M 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hara, I.'      1 
'Ichise, N.'    2 
'Kojima, K.'    3 
'Kondo, H.'     4 
'Ohgiya, S.'    5 
'Matsuyama, H.' 6 
'Yumoto, I.'    7 
# 
_citation.id                        primary 
_citation.title                     
;Relationship between the Size of the Bottleneck 15 a from Iron in the Main Channel and the Reactivity of Catalase Corresponding to the Molecular Size of Substrates.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                11 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17198371 
_citation.pdbx_database_id_DOI      10.1021/BI061519W 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hara, I.'      1 
primary 'Ichise, N.'    2 
primary 'Kojima, K.'    3 
primary 'Kondo, H.'     4 
primary 'Ohgiya, S.'    5 
primary 'Matsuyama, H.' 6 
primary 'Yumoto, I.'    7 
# 
_cell.entry_id           2J2M 
_cell.length_a           94.267 
_cell.length_b           131.935 
_cell.length_c           110.642 
_cell.angle_alpha        90.00 
_cell.angle_beta         107.61 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2J2M 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat CATALASE                          56590.883 4   1.11.1.6 ? ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4   ?        ? ? ? 
3 water       nat water                             18.015    536 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNENEKKLTTNQGVPIGDNQNSRTAGRRGPTLLEDYQLIEKIAHFDRERVPERVVHARGFGAHGVFKVKNSMKKYTKAAF
LQEEGTEVPVFARFSTVIHGTHSPETLRDPRGFSVKFYTEEGNWDFVGNNLPVFFIRDAMKFPDMVHSLKPDPRTNIQDP
DRYWDFMTLRPESTNMLMHIFTDEGIPASYRKMRGSSVHSFKWVNAHGNTVYIKLRWVPKEGVHNLSADEATEVQGKDFN
HASNDTFQAIENGDFPEWDLFVQVLDPADVENFDFDPLDATKDWFEDVIPFQHVGTMTLNKNVDNYFAETESVGFNPGVL
VPGMLPSEDKLLQGRLFSYSDTQRHRIGPNYQQLPINCPFAQVNNYQRDGAMPFKQQTSSVNYEPNRYQDEPKQTPEYTE
DTQPLHDDIHGRLEIEKTNNFGQAGEVYRRMTEEEQMALLNNLVNDLQQVRHENTVLLAICNFYRADASLGEKLSEALNV
DIKPFLQQMQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNENEKKLTTNQGVPIGDNQNSRTAGRRGPTLLEDYQLIEKIAHFDRERVPERVVHARGFGAHGVFKVKNSMKKYTKAAF
LQEEGTEVPVFARFSTVIHGTHSPETLRDPRGFSVKFYTEEGNWDFVGNNLPVFFIRDAMKFPDMVHSLKPDPRTNIQDP
DRYWDFMTLRPESTNMLMHIFTDEGIPASYRKMRGSSVHSFKWVNAHGNTVYIKLRWVPKEGVHNLSADEATEVQGKDFN
HASNDTFQAIENGDFPEWDLFVQVLDPADVENFDFDPLDATKDWFEDVIPFQHVGTMTLNKNVDNYFAETESVGFNPGVL
VPGMLPSEDKLLQGRLFSYSDTQRHRIGPNYQQLPINCPFAQVNNYQRDGAMPFKQQTSSVNYEPNRYQDEPKQTPEYTE
DTQPLHDDIHGRLEIEKTNNFGQAGEVYRRMTEEEQMALLNNLVNDLQQVRHENTVLLAICNFYRADASLGEKLSEALNV
DIKPFLQQMQK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   GLU n 
1 4   ASN n 
1 5   GLU n 
1 6   LYS n 
1 7   LYS n 
1 8   LEU n 
1 9   THR n 
1 10  THR n 
1 11  ASN n 
1 12  GLN n 
1 13  GLY n 
1 14  VAL n 
1 15  PRO n 
1 16  ILE n 
1 17  GLY n 
1 18  ASP n 
1 19  ASN n 
1 20  GLN n 
1 21  ASN n 
1 22  SER n 
1 23  ARG n 
1 24  THR n 
1 25  ALA n 
1 26  GLY n 
1 27  ARG n 
1 28  ARG n 
1 29  GLY n 
1 30  PRO n 
1 31  THR n 
1 32  LEU n 
1 33  LEU n 
1 34  GLU n 
1 35  ASP n 
1 36  TYR n 
1 37  GLN n 
1 38  LEU n 
1 39  ILE n 
1 40  GLU n 
1 41  LYS n 
1 42  ILE n 
1 43  ALA n 
1 44  HIS n 
1 45  PHE n 
1 46  ASP n 
1 47  ARG n 
1 48  GLU n 
1 49  ARG n 
1 50  VAL n 
1 51  PRO n 
1 52  GLU n 
1 53  ARG n 
1 54  VAL n 
1 55  VAL n 
1 56  HIS n 
1 57  ALA n 
1 58  ARG n 
1 59  GLY n 
1 60  PHE n 
1 61  GLY n 
1 62  ALA n 
1 63  HIS n 
1 64  GLY n 
1 65  VAL n 
1 66  PHE n 
1 67  LYS n 
1 68  VAL n 
1 69  LYS n 
1 70  ASN n 
1 71  SER n 
1 72  MET n 
1 73  LYS n 
1 74  LYS n 
1 75  TYR n 
1 76  THR n 
1 77  LYS n 
1 78  ALA n 
1 79  ALA n 
1 80  PHE n 
1 81  LEU n 
1 82  GLN n 
1 83  GLU n 
1 84  GLU n 
1 85  GLY n 
1 86  THR n 
1 87  GLU n 
1 88  VAL n 
1 89  PRO n 
1 90  VAL n 
1 91  PHE n 
1 92  ALA n 
1 93  ARG n 
1 94  PHE n 
1 95  SER n 
1 96  THR n 
1 97  VAL n 
1 98  ILE n 
1 99  HIS n 
1 100 GLY n 
1 101 THR n 
1 102 HIS n 
1 103 SER n 
1 104 PRO n 
1 105 GLU n 
1 106 THR n 
1 107 LEU n 
1 108 ARG n 
1 109 ASP n 
1 110 PRO n 
1 111 ARG n 
1 112 GLY n 
1 113 PHE n 
1 114 SER n 
1 115 VAL n 
1 116 LYS n 
1 117 PHE n 
1 118 TYR n 
1 119 THR n 
1 120 GLU n 
1 121 GLU n 
1 122 GLY n 
1 123 ASN n 
1 124 TRP n 
1 125 ASP n 
1 126 PHE n 
1 127 VAL n 
1 128 GLY n 
1 129 ASN n 
1 130 ASN n 
1 131 LEU n 
1 132 PRO n 
1 133 VAL n 
1 134 PHE n 
1 135 PHE n 
1 136 ILE n 
1 137 ARG n 
1 138 ASP n 
1 139 ALA n 
1 140 MET n 
1 141 LYS n 
1 142 PHE n 
1 143 PRO n 
1 144 ASP n 
1 145 MET n 
1 146 VAL n 
1 147 HIS n 
1 148 SER n 
1 149 LEU n 
1 150 LYS n 
1 151 PRO n 
1 152 ASP n 
1 153 PRO n 
1 154 ARG n 
1 155 THR n 
1 156 ASN n 
1 157 ILE n 
1 158 GLN n 
1 159 ASP n 
1 160 PRO n 
1 161 ASP n 
1 162 ARG n 
1 163 TYR n 
1 164 TRP n 
1 165 ASP n 
1 166 PHE n 
1 167 MET n 
1 168 THR n 
1 169 LEU n 
1 170 ARG n 
1 171 PRO n 
1 172 GLU n 
1 173 SER n 
1 174 THR n 
1 175 ASN n 
1 176 MET n 
1 177 LEU n 
1 178 MET n 
1 179 HIS n 
1 180 ILE n 
1 181 PHE n 
1 182 THR n 
1 183 ASP n 
1 184 GLU n 
1 185 GLY n 
1 186 ILE n 
1 187 PRO n 
1 188 ALA n 
1 189 SER n 
1 190 TYR n 
1 191 ARG n 
1 192 LYS n 
1 193 MET n 
1 194 ARG n 
1 195 GLY n 
1 196 SER n 
1 197 SER n 
1 198 VAL n 
1 199 HIS n 
1 200 SER n 
1 201 PHE n 
1 202 LYS n 
1 203 TRP n 
1 204 VAL n 
1 205 ASN n 
1 206 ALA n 
1 207 HIS n 
1 208 GLY n 
1 209 ASN n 
1 210 THR n 
1 211 VAL n 
1 212 TYR n 
1 213 ILE n 
1 214 LYS n 
1 215 LEU n 
1 216 ARG n 
1 217 TRP n 
1 218 VAL n 
1 219 PRO n 
1 220 LYS n 
1 221 GLU n 
1 222 GLY n 
1 223 VAL n 
1 224 HIS n 
1 225 ASN n 
1 226 LEU n 
1 227 SER n 
1 228 ALA n 
1 229 ASP n 
1 230 GLU n 
1 231 ALA n 
1 232 THR n 
1 233 GLU n 
1 234 VAL n 
1 235 GLN n 
1 236 GLY n 
1 237 LYS n 
1 238 ASP n 
1 239 PHE n 
1 240 ASN n 
1 241 HIS n 
1 242 ALA n 
1 243 SER n 
1 244 ASN n 
1 245 ASP n 
1 246 THR n 
1 247 PHE n 
1 248 GLN n 
1 249 ALA n 
1 250 ILE n 
1 251 GLU n 
1 252 ASN n 
1 253 GLY n 
1 254 ASP n 
1 255 PHE n 
1 256 PRO n 
1 257 GLU n 
1 258 TRP n 
1 259 ASP n 
1 260 LEU n 
1 261 PHE n 
1 262 VAL n 
1 263 GLN n 
1 264 VAL n 
1 265 LEU n 
1 266 ASP n 
1 267 PRO n 
1 268 ALA n 
1 269 ASP n 
1 270 VAL n 
1 271 GLU n 
1 272 ASN n 
1 273 PHE n 
1 274 ASP n 
1 275 PHE n 
1 276 ASP n 
1 277 PRO n 
1 278 LEU n 
1 279 ASP n 
1 280 ALA n 
1 281 THR n 
1 282 LYS n 
1 283 ASP n 
1 284 TRP n 
1 285 PHE n 
1 286 GLU n 
1 287 ASP n 
1 288 VAL n 
1 289 ILE n 
1 290 PRO n 
1 291 PHE n 
1 292 GLN n 
1 293 HIS n 
1 294 VAL n 
1 295 GLY n 
1 296 THR n 
1 297 MET n 
1 298 THR n 
1 299 LEU n 
1 300 ASN n 
1 301 LYS n 
1 302 ASN n 
1 303 VAL n 
1 304 ASP n 
1 305 ASN n 
1 306 TYR n 
1 307 PHE n 
1 308 ALA n 
1 309 GLU n 
1 310 THR n 
1 311 GLU n 
1 312 SER n 
1 313 VAL n 
1 314 GLY n 
1 315 PHE n 
1 316 ASN n 
1 317 PRO n 
1 318 GLY n 
1 319 VAL n 
1 320 LEU n 
1 321 VAL n 
1 322 PRO n 
1 323 GLY n 
1 324 MET n 
1 325 LEU n 
1 326 PRO n 
1 327 SER n 
1 328 GLU n 
1 329 ASP n 
1 330 LYS n 
1 331 LEU n 
1 332 LEU n 
1 333 GLN n 
1 334 GLY n 
1 335 ARG n 
1 336 LEU n 
1 337 PHE n 
1 338 SER n 
1 339 TYR n 
1 340 SER n 
1 341 ASP n 
1 342 THR n 
1 343 GLN n 
1 344 ARG n 
1 345 HIS n 
1 346 ARG n 
1 347 ILE n 
1 348 GLY n 
1 349 PRO n 
1 350 ASN n 
1 351 TYR n 
1 352 GLN n 
1 353 GLN n 
1 354 LEU n 
1 355 PRO n 
1 356 ILE n 
1 357 ASN n 
1 358 CYS n 
1 359 PRO n 
1 360 PHE n 
1 361 ALA n 
1 362 GLN n 
1 363 VAL n 
1 364 ASN n 
1 365 ASN n 
1 366 TYR n 
1 367 GLN n 
1 368 ARG n 
1 369 ASP n 
1 370 GLY n 
1 371 ALA n 
1 372 MET n 
1 373 PRO n 
1 374 PHE n 
1 375 LYS n 
1 376 GLN n 
1 377 GLN n 
1 378 THR n 
1 379 SER n 
1 380 SER n 
1 381 VAL n 
1 382 ASN n 
1 383 TYR n 
1 384 GLU n 
1 385 PRO n 
1 386 ASN n 
1 387 ARG n 
1 388 TYR n 
1 389 GLN n 
1 390 ASP n 
1 391 GLU n 
1 392 PRO n 
1 393 LYS n 
1 394 GLN n 
1 395 THR n 
1 396 PRO n 
1 397 GLU n 
1 398 TYR n 
1 399 THR n 
1 400 GLU n 
1 401 ASP n 
1 402 THR n 
1 403 GLN n 
1 404 PRO n 
1 405 LEU n 
1 406 HIS n 
1 407 ASP n 
1 408 ASP n 
1 409 ILE n 
1 410 HIS n 
1 411 GLY n 
1 412 ARG n 
1 413 LEU n 
1 414 GLU n 
1 415 ILE n 
1 416 GLU n 
1 417 LYS n 
1 418 THR n 
1 419 ASN n 
1 420 ASN n 
1 421 PHE n 
1 422 GLY n 
1 423 GLN n 
1 424 ALA n 
1 425 GLY n 
1 426 GLU n 
1 427 VAL n 
1 428 TYR n 
1 429 ARG n 
1 430 ARG n 
1 431 MET n 
1 432 THR n 
1 433 GLU n 
1 434 GLU n 
1 435 GLU n 
1 436 GLN n 
1 437 MET n 
1 438 ALA n 
1 439 LEU n 
1 440 LEU n 
1 441 ASN n 
1 442 ASN n 
1 443 LEU n 
1 444 VAL n 
1 445 ASN n 
1 446 ASP n 
1 447 LEU n 
1 448 GLN n 
1 449 GLN n 
1 450 VAL n 
1 451 ARG n 
1 452 HIS n 
1 453 GLU n 
1 454 ASN n 
1 455 THR n 
1 456 VAL n 
1 457 LEU n 
1 458 LEU n 
1 459 ALA n 
1 460 ILE n 
1 461 CYS n 
1 462 ASN n 
1 463 PHE n 
1 464 TYR n 
1 465 ARG n 
1 466 ALA n 
1 467 ASP n 
1 468 ALA n 
1 469 SER n 
1 470 LEU n 
1 471 GLY n 
1 472 GLU n 
1 473 LYS n 
1 474 LEU n 
1 475 SER n 
1 476 GLU n 
1 477 ALA n 
1 478 LEU n 
1 479 ASN n 
1 480 VAL n 
1 481 ASP n 
1 482 ILE n 
1 483 LYS n 
1 484 PRO n 
1 485 PHE n 
1 486 LEU n 
1 487 GLN n 
1 488 GLN n 
1 489 MET n 
1 490 GLN n 
1 491 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'EXIGUOBACTERIUM OXIDOTOLERANS' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      223958 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     T-2-2T 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2J2M 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          2J2M 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2J2M A 1 ? 491 ? 2J2M 1 ? 491 ? 1 491 
2 1 2J2M B 1 ? 491 ? 2J2M 1 ? 491 ? 1 491 
3 1 2J2M C 1 ? 491 ? 2J2M 1 ? 491 ? 1 491 
4 1 2J2M D 1 ? 491 ? 2J2M 1 ? 491 ? 1 491 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2J2M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.1 
_exptl_crystal.density_percent_sol   61 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '100MM MES PH6.0, 12-13%(W/V)PEG10000, 5%(W/V)PEG400 AND 20%(W/V)GLYCEROL, pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2003-12-07 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             1.0000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2J2M 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   99632 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.05000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.6000 
_reflns.B_iso_Wilson_estimate        23.00 
_reflns.pdbx_redundancy              3.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           0.06000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.400 
_reflns_shell.pdbx_redundancy        2.70 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2J2M 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     94615 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.230 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4994 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.907 
_refine.correlation_coeff_Fo_to_Fc_free          0.881 
_refine.B_iso_mean                               15.64 
_refine.aniso_B[1][1]                            -0.60000 
_refine.aniso_B[2][2]                            -0.27000 
_refine.aniso_B[3][3]                            1.11000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.39000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 8CAT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.363 
_refine.pdbx_overall_ESU_R_Free                  0.234 
_refine.overall_SU_ML                            0.151 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.259 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15576 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             536 
_refine_hist.number_atoms_total               16284 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 16188 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.430  1.970  ? 22024 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.423  5.000  ? 1916  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.395 24.529 ? 892   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.062 15.000 ? 2620  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.705 15.000 ? 108   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 2260  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 12880 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.209  0.200  ? 7846  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 10792 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.140  0.200  ? 1052  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.144  0.200  ? 27    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.078  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.620  1.500  ? 9891  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.000  2.000  ? 15584 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.648  3.000  ? 7164  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.474  4.500  ? 6432  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.46 
_refine_ls_shell.number_reflns_R_work             6822 
_refine_ls_shell.R_factor_R_work                  0.2010 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2570 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             321 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2J2M 
_struct.title                     'Crystal Structure Analysis of Catalase from Exiguobacterium oxidotolerans' 
_struct.pdbx_descriptor           'CATALASE (E.C.1.11.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2J2M 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'FUNCTIONAL CLASS, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 35  ? ASP A 46  ? ASP A 35  ASP A 46  1 ? 12  
HELX_P HELX_P2  2  ALA A 78  ? GLN A 82  ? ALA A 78  GLN A 82  5 ? 5   
HELX_P HELX_P3  3  ASP A 138 ? MET A 140 ? ASP A 138 MET A 140 5 ? 3   
HELX_P HELX_P4  4  LYS A 141 ? LYS A 150 ? LYS A 141 LYS A 150 1 ? 10  
HELX_P HELX_P5  5  ASP A 159 ? ARG A 170 ? ASP A 159 ARG A 170 1 ? 12  
HELX_P HELX_P6  6  SER A 173 ? PHE A 181 ? SER A 173 PHE A 181 1 ? 9   
HELX_P HELX_P7  7  THR A 182 ? ILE A 186 ? THR A 182 ILE A 186 5 ? 5   
HELX_P HELX_P8  8  SER A 189 ? MET A 193 ? SER A 189 MET A 193 5 ? 5   
HELX_P HELX_P9  9  SER A 227 ? ASP A 238 ? SER A 227 ASP A 238 1 ? 12  
HELX_P HELX_P10 10 ASN A 240 ? ASN A 252 ? ASN A 240 ASN A 252 1 ? 13  
HELX_P HELX_P11 11 ASP A 266 ? PHE A 273 ? ASP A 266 PHE A 273 5 ? 8   
HELX_P HELX_P12 12 LYS A 6   ? SER A 312 ? LYS A 6   SER A 312 5 ? 307 
HELX_P HELX_P13 13 ASP A 329 ? ILE A 347 ? ASP A 329 ILE A 347 1 ? 19  
HELX_P HELX_P14 14 ASN A 350 ? LEU A 354 ? ASN A 350 LEU A 354 5 ? 5   
HELX_P HELX_P15 15 THR A 395 ? THR A 399 ? THR A 395 THR A 399 5 ? 5   
HELX_P HELX_P16 16 PHE A 421 ? MET A 431 ? PHE A 421 MET A 431 1 ? 11  
HELX_P HELX_P17 17 THR A 432 ? GLN A 448 ? THR A 432 GLN A 448 1 ? 17  
HELX_P HELX_P18 18 HIS A 452 ? ASP A 467 ? HIS A 452 ASP A 467 1 ? 16  
HELX_P HELX_P19 19 ASP A 467 ? LEU A 478 ? ASP A 467 LEU A 478 1 ? 12  
HELX_P HELX_P20 20 ASP B 35  ? ASP B 46  ? ASP B 35  ASP B 46  1 ? 12  
HELX_P HELX_P21 21 ALA B 78  ? GLN B 82  ? ALA B 78  GLN B 82  5 ? 5   
HELX_P HELX_P22 22 ASP B 138 ? MET B 140 ? ASP B 138 MET B 140 5 ? 3   
HELX_P HELX_P23 23 LYS B 141 ? LYS B 150 ? LYS B 141 LYS B 150 1 ? 10  
HELX_P HELX_P24 24 ASP B 159 ? ARG B 170 ? ASP B 159 ARG B 170 1 ? 12  
HELX_P HELX_P25 25 SER B 173 ? PHE B 181 ? SER B 173 PHE B 181 1 ? 9   
HELX_P HELX_P26 26 THR B 182 ? ILE B 186 ? THR B 182 ILE B 186 5 ? 5   
HELX_P HELX_P27 27 SER B 189 ? MET B 193 ? SER B 189 MET B 193 5 ? 5   
HELX_P HELX_P28 28 SER B 227 ? ASP B 238 ? SER B 227 ASP B 238 1 ? 12  
HELX_P HELX_P29 29 ASN B 240 ? ASN B 252 ? ASN B 240 ASN B 252 1 ? 13  
HELX_P HELX_P30 30 ASP B 266 ? PHE B 273 ? ASP B 266 PHE B 273 5 ? 8   
HELX_P HELX_P31 31 LYS A 6   ? SER B 312 ? LYS A 6   SER B 312 5 ? 307 
HELX_P HELX_P32 32 ASP B 329 ? ILE B 347 ? ASP B 329 ILE B 347 1 ? 19  
HELX_P HELX_P33 33 ASN B 350 ? LEU B 354 ? ASN B 350 LEU B 354 5 ? 5   
HELX_P HELX_P34 34 THR B 395 ? THR B 399 ? THR B 395 THR B 399 5 ? 5   
HELX_P HELX_P35 35 PHE B 421 ? MET B 431 ? PHE B 421 MET B 431 1 ? 11  
HELX_P HELX_P36 36 THR B 432 ? GLN B 448 ? THR B 432 GLN B 448 1 ? 17  
HELX_P HELX_P37 37 HIS B 452 ? ASP B 467 ? HIS B 452 ASP B 467 1 ? 16  
HELX_P HELX_P38 38 ASP B 467 ? ASN B 479 ? ASP B 467 ASN B 479 1 ? 13  
HELX_P HELX_P39 39 ASP C 35  ? ASP C 46  ? ASP C 35  ASP C 46  1 ? 12  
HELX_P HELX_P40 40 ALA C 78  ? GLN C 82  ? ALA C 78  GLN C 82  5 ? 5   
HELX_P HELX_P41 41 ASP C 138 ? MET C 140 ? ASP C 138 MET C 140 5 ? 3   
HELX_P HELX_P42 42 LYS C 141 ? LYS C 150 ? LYS C 141 LYS C 150 1 ? 10  
HELX_P HELX_P43 43 ASP C 159 ? ARG C 170 ? ASP C 159 ARG C 170 1 ? 12  
HELX_P HELX_P44 44 SER C 173 ? PHE C 181 ? SER C 173 PHE C 181 1 ? 9   
HELX_P HELX_P45 45 THR C 182 ? ILE C 186 ? THR C 182 ILE C 186 5 ? 5   
HELX_P HELX_P46 46 SER C 189 ? MET C 193 ? SER C 189 MET C 193 5 ? 5   
HELX_P HELX_P47 47 SER C 227 ? ASP C 238 ? SER C 227 ASP C 238 1 ? 12  
HELX_P HELX_P48 48 ASN C 240 ? ASN C 252 ? ASN C 240 ASN C 252 1 ? 13  
HELX_P HELX_P49 49 ASP C 266 ? VAL C 270 ? ASP C 266 VAL C 270 5 ? 5   
HELX_P HELX_P50 50 ASN C 305 ? THR C 310 ? ASN C 305 THR C 310 1 ? 6   
HELX_P HELX_P51 51 ASP C 329 ? ILE C 347 ? ASP C 329 ILE C 347 1 ? 19  
HELX_P HELX_P52 52 ASN C 350 ? LEU C 354 ? ASN C 350 LEU C 354 5 ? 5   
HELX_P HELX_P53 53 THR C 395 ? THR C 399 ? THR C 395 THR C 399 5 ? 5   
HELX_P HELX_P54 54 PHE C 421 ? MET C 431 ? PHE C 421 MET C 431 1 ? 11  
HELX_P HELX_P55 55 THR C 432 ? GLN C 448 ? THR C 432 GLN C 448 1 ? 17  
HELX_P HELX_P56 56 HIS C 452 ? ASP C 467 ? HIS C 452 ASP C 467 1 ? 16  
HELX_P HELX_P57 57 ASP C 467 ? ASN C 479 ? ASP C 467 ASN C 479 1 ? 13  
HELX_P HELX_P58 58 ASP D 35  ? ASP D 46  ? ASP D 35  ASP D 46  1 ? 12  
HELX_P HELX_P59 59 ALA D 78  ? GLN D 82  ? ALA D 78  GLN D 82  5 ? 5   
HELX_P HELX_P60 60 ASP D 138 ? MET D 140 ? ASP D 138 MET D 140 5 ? 3   
HELX_P HELX_P61 61 LYS D 141 ? LYS D 150 ? LYS D 141 LYS D 150 1 ? 10  
HELX_P HELX_P62 62 ASP D 159 ? ARG D 170 ? ASP D 159 ARG D 170 1 ? 12  
HELX_P HELX_P63 63 SER D 173 ? PHE D 181 ? SER D 173 PHE D 181 1 ? 9   
HELX_P HELX_P64 64 THR D 182 ? ILE D 186 ? THR D 182 ILE D 186 5 ? 5   
HELX_P HELX_P65 65 SER D 189 ? MET D 193 ? SER D 189 MET D 193 5 ? 5   
HELX_P HELX_P66 66 SER D 227 ? ASP D 238 ? SER D 227 ASP D 238 1 ? 12  
HELX_P HELX_P67 67 ASN D 240 ? ASN D 252 ? ASN D 240 ASN D 252 1 ? 13  
HELX_P HELX_P68 68 ASP D 266 ? VAL D 270 ? ASP D 266 VAL D 270 5 ? 5   
HELX_P HELX_P69 69 ASN D 305 ? THR D 310 ? ASN D 305 THR D 310 1 ? 6   
HELX_P HELX_P70 70 LEU D 331 ? ILE D 347 ? LEU D 331 ILE D 347 1 ? 17  
HELX_P HELX_P71 71 ASN D 350 ? LEU D 354 ? ASN D 350 LEU D 354 5 ? 5   
HELX_P HELX_P72 72 THR D 395 ? THR D 399 ? THR D 395 THR D 399 5 ? 5   
HELX_P HELX_P73 73 PHE D 421 ? MET D 431 ? PHE D 421 MET D 431 1 ? 11  
HELX_P HELX_P74 74 THR D 432 ? GLN D 448 ? THR D 432 GLN D 448 1 ? 17  
HELX_P HELX_P75 75 HIS D 452 ? ASP D 467 ? HIS D 452 ASP D 467 1 ? 16  
HELX_P HELX_P76 76 ASP D 467 ? ASN D 479 ? ASP D 467 ASN D 479 1 ? 13  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A TYR 339 OH ? ? ? 1_555 E HEM . FE ? ? A TYR 339 A HEM 501 1_555 ? ? ? ? ? ? ? 1.889 ? 
metalc2 metalc ? ? B TYR 339 OH ? ? ? 1_555 F HEM . FE ? ? B TYR 339 B HEM 501 1_555 ? ? ? ? ? ? ? 1.928 ? 
metalc3 metalc ? ? C TYR 339 OH ? ? ? 1_555 G HEM . FE ? ? C TYR 339 C HEM 501 1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc4 metalc ? ? D TYR 339 OH ? ? ? 1_555 H HEM . FE ? ? D TYR 339 D HEM 501 1_555 ? ? ? ? ? ? ? 1.766 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 384 A . ? GLU 384 A PRO 385 A ? PRO 385 A 1 -3.17  
2 GLU 384 B . ? GLU 384 B PRO 385 B ? PRO 385 B 1 1.57   
3 LEU 478 B . ? LEU 478 B ASN 479 B ? ASN 479 B 1 -14.24 
4 GLU 384 C . ? GLU 384 C PRO 385 C ? PRO 385 C 1 7.59   
5 LEU 478 C . ? LEU 478 C ASN 479 C ? ASN 479 C 1 -11.14 
6 GLU 384 D . ? GLU 384 D PRO 385 D ? PRO 385 D 1 5.61   
7 LEU 478 D . ? LEU 478 D ASN 479 D ? ASN 479 D 1 1.08   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 3  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 3  ? 
CA ? 22 ? 
DA ? 20 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? anti-parallel 
AB 5  6  ? anti-parallel 
AB 6  7  ? anti-parallel 
AB 7  8  ? anti-parallel 
AB 8  9  ? anti-parallel 
AB 9  10 ? anti-parallel 
AB 10 11 ? anti-parallel 
AC 1  2  ? anti-parallel 
AC 2  3  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? anti-parallel 
BB 6  7  ? anti-parallel 
BB 7  8  ? anti-parallel 
BB 8  9  ? anti-parallel 
BB 9  10 ? anti-parallel 
BB 10 11 ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
CA 1  2  ? anti-parallel 
CA 2  3  ? anti-parallel 
CA 3  4  ? anti-parallel 
CA 5  6  ? anti-parallel 
CA 7  8  ? anti-parallel 
CA 9  10 ? anti-parallel 
CA 11 12 ? anti-parallel 
CA 13 14 ? anti-parallel 
CA 15 16 ? anti-parallel 
CA 17 18 ? anti-parallel 
CA 19 20 ? anti-parallel 
CA 21 22 ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 3  4  ? anti-parallel 
DA 5  6  ? anti-parallel 
DA 7  8  ? anti-parallel 
DA 9  10 ? anti-parallel 
DA 11 12 ? anti-parallel 
DA 13 14 ? anti-parallel 
DA 15 16 ? anti-parallel 
DA 17 18 ? anti-parallel 
DA 19 20 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ARG A 23  ? THR A 24  ? ARG A 23  THR A 24  
AA 2  ILE B 409 ? ARG B 412 ? ILE B 409 ARG B 412 
AA 3  GLN C 403 ? PRO C 404 ? GLN C 403 PRO C 404 
AB 1  GLY A 59  ? VAL A 68  ? GLY A 59  VAL A 68  
AB 2  GLU A 87  ? SER A 95  ? GLU A 87  SER A 95  
AB 3  GLY A 112 ? THR A 119 ? GLY A 112 THR A 119 
AB 4  GLY A 122 ? ASN A 129 ? GLY A 122 ASN A 129 
AB 5  GLY A 195 ? SER A 196 ? GLY A 195 SER A 196 
AB 6  THR A 210 ? PRO A 219 ? THR A 210 PRO A 219 
AB 7  GLU A 257 ? LEU A 265 ? GLU A 257 LEU A 265 
AB 8  GLN A 292 ? ASN A 302 ? GLN A 292 ASN A 302 
AB 9  GLY A 59  ? VAL A 68  ? GLY A 59  VAL A 68  
AB 10 GLU A 87  ? SER A 95  ? GLU A 87  SER A 95  
AB 11 GLY A 59  ? VAL A 68  ? GLY A 59  VAL A 68  
AC 1  GLN A 403 ? PRO A 404 ? GLN A 403 PRO A 404 
AC 2  ILE D 409 ? ARG D 412 ? ILE D 409 ARG D 412 
AC 3  ARG C 23  ? THR C 24  ? ARG C 23  THR C 24  
BA 1  ARG B 23  ? THR B 24  ? ARG B 23  THR B 24  
BA 2  ILE A 409 ? ARG A 412 ? ILE A 409 ARG A 412 
BA 3  GLN D 403 ? PRO D 404 ? GLN D 403 PRO D 404 
BB 1  GLY B 59  ? VAL B 68  ? GLY B 59  VAL B 68  
BB 2  GLU B 87  ? SER B 95  ? GLU B 87  SER B 95  
BB 3  GLY B 112 ? THR B 119 ? GLY B 112 THR B 119 
BB 4  GLY B 122 ? ASN B 129 ? GLY B 122 ASN B 129 
BB 5  GLY B 195 ? SER B 196 ? GLY B 195 SER B 196 
BB 6  THR B 210 ? PRO B 219 ? THR B 210 PRO B 219 
BB 7  GLU B 257 ? LEU B 265 ? GLU B 257 LEU B 265 
BB 8  GLN B 292 ? ASN B 302 ? GLN B 292 ASN B 302 
BB 9  GLY B 59  ? VAL B 68  ? GLY B 59  VAL B 68  
BB 10 GLU B 87  ? SER B 95  ? GLU B 87  SER B 95  
BB 11 GLY B 59  ? VAL B 68  ? GLY B 59  VAL B 68  
BC 1  GLN B 403 ? PRO B 404 ? GLN B 403 PRO B 404 
BC 2  ILE C 409 ? ARG C 412 ? ILE C 409 ARG C 412 
BC 3  ARG D 23  ? THR D 24  ? ARG D 23  THR D 24  
CA 1  GLY C 59  ? VAL C 68  ? GLY C 59  VAL C 68  
CA 2  GLU C 87  ? SER C 95  ? GLU C 87  SER C 95  
CA 3  GLY C 112 ? THR C 119 ? GLY C 112 THR C 119 
CA 4  GLY C 122 ? ASN C 129 ? GLY C 122 ASN C 129 
CA 5  GLU C 87  ? SER C 95  ? GLU C 87  SER C 95  
CA 6  GLY C 59  ? VAL C 68  ? GLY C 59  VAL C 68  
CA 7  GLY C 112 ? THR C 119 ? GLY C 112 THR C 119 
CA 8  GLU C 87  ? SER C 95  ? GLU C 87  SER C 95  
CA 9  GLY C 122 ? ASN C 129 ? GLY C 122 ASN C 129 
CA 10 GLY C 112 ? THR C 119 ? GLY C 112 THR C 119 
CA 11 GLY C 195 ? SER C 196 ? GLY C 195 SER C 196 
CA 12 GLY C 122 ? ASN C 129 ? GLY C 122 ASN C 129 
CA 13 PHE C 201 ? VAL C 204 ? PHE C 201 VAL C 204 
CA 14 THR C 210 ? PRO C 219 ? THR C 210 PRO C 219 
CA 15 THR C 210 ? PRO C 219 ? THR C 210 PRO C 219 
CA 16 GLY C 195 ? SER C 196 ? GLY C 195 SER C 196 
CA 17 GLU C 257 ? LEU C 265 ? GLU C 257 LEU C 265 
CA 18 THR C 210 ? PRO C 219 ? THR C 210 PRO C 219 
CA 19 GLN C 292 ? ASN C 302 ? GLN C 292 ASN C 302 
CA 20 GLY C 59  ? VAL C 68  ? GLY C 59  VAL C 68  
CA 21 MET C 324 ? PRO C 326 ? MET C 324 PRO C 326 
CA 22 PHE C 201 ? VAL C 204 ? PHE C 201 VAL C 204 
DA 1  GLY D 59  ? VAL D 68  ? GLY D 59  VAL D 68  
DA 2  GLU D 87  ? SER D 95  ? GLU D 87  SER D 95  
DA 3  GLU D 87  ? SER D 95  ? GLU D 87  SER D 95  
DA 4  GLY D 59  ? VAL D 68  ? GLY D 59  VAL D 68  
DA 5  GLY D 112 ? THR D 119 ? GLY D 112 THR D 119 
DA 6  GLU D 87  ? SER D 95  ? GLU D 87  SER D 95  
DA 7  GLY D 122 ? ASN D 129 ? GLY D 122 ASN D 129 
DA 8  GLY D 112 ? THR D 119 ? GLY D 112 THR D 119 
DA 9  GLY D 195 ? SER D 196 ? GLY D 195 SER D 196 
DA 10 GLY D 122 ? ASN D 129 ? GLY D 122 ASN D 129 
DA 11 PHE D 201 ? VAL D 204 ? PHE D 201 VAL D 204 
DA 12 THR D 210 ? PRO D 219 ? THR D 210 PRO D 219 
DA 13 THR D 210 ? PRO D 219 ? THR D 210 PRO D 219 
DA 14 GLY D 195 ? SER D 196 ? GLY D 195 SER D 196 
DA 15 GLU D 257 ? LEU D 265 ? GLU D 257 LEU D 265 
DA 16 THR D 210 ? PRO D 219 ? THR D 210 PRO D 219 
DA 17 PHE D 291 ? ASN D 302 ? PHE D 291 ASN D 302 
DA 18 GLY D 59  ? VAL D 68  ? GLY D 59  VAL D 68  
DA 19 MET D 324 ? PRO D 326 ? MET D 324 PRO D 326 
DA 20 PHE D 201 ? VAL D 204 ? PHE D 201 VAL D 204 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 24  ? N THR A 24  O GLY B 411 ? O GLY B 411 
AA 2  3  N HIS B 410 ? N HIS B 410 O GLN C 403 ? O GLN C 403 
AB 1  2  N PHE A 66  ? N PHE A 66  O VAL A 88  ? O VAL A 88  
AB 2  3  N SER A 95  ? N SER A 95  O GLY A 112 ? O GLY A 112 
AB 3  4  N THR A 119 ? N THR A 119 O GLY A 122 ? O GLY A 122 
AB 4  5  N ASN A 129 ? N ASN A 129 O SER A 196 ? O SER A 196 
AB 5  6  N GLY A 195 ? N GLY A 195 O TRP A 217 ? O TRP A 217 
AB 6  7  N VAL A 218 ? N VAL A 218 O ASP A 259 ? O ASP A 259 
AB 7  8  N VAL A 262 ? N VAL A 262 O GLN A 292 ? O GLN A 292 
AB 8  9  N LYS A 301 ? N LYS A 301 O HIS A 63  ? O HIS A 63  
AB 9  10 N PHE A 66  ? N PHE A 66  O VAL A 88  ? O VAL A 88  
AB 10 11 N PHE A 94  ? N PHE A 94  O PHE A 60  ? O PHE A 60  
AC 1  2  N GLN A 403 ? N GLN A 403 O HIS D 410 ? O HIS D 410 
AC 2  3  O GLY D 411 ? O GLY D 411 N THR C 24  ? N THR C 24  
BA 1  2  N THR B 24  ? N THR B 24  O GLY A 411 ? O GLY A 411 
BA 2  3  N HIS A 410 ? N HIS A 410 O GLN D 403 ? O GLN D 403 
BB 1  2  N PHE B 66  ? N PHE B 66  O VAL B 88  ? O VAL B 88  
BB 2  3  N SER B 95  ? N SER B 95  O GLY B 112 ? O GLY B 112 
BB 3  4  N THR B 119 ? N THR B 119 O GLY B 122 ? O GLY B 122 
BB 4  5  N ASN B 129 ? N ASN B 129 O SER B 196 ? O SER B 196 
BB 5  6  N GLY B 195 ? N GLY B 195 O TRP B 217 ? O TRP B 217 
BB 6  7  N VAL B 218 ? N VAL B 218 O ASP B 259 ? O ASP B 259 
BB 7  8  N VAL B 262 ? N VAL B 262 O GLN B 292 ? O GLN B 292 
BB 8  9  N LYS B 301 ? N LYS B 301 O HIS B 63  ? O HIS B 63  
BB 9  10 N PHE B 66  ? N PHE B 66  O VAL B 88  ? O VAL B 88  
BB 10 11 N PHE B 94  ? N PHE B 94  O PHE B 60  ? O PHE B 60  
BC 1  2  N GLN B 403 ? N GLN B 403 O HIS C 410 ? O HIS C 410 
BC 2  3  N GLY C 411 ? N GLY C 411 O THR D 24  ? O THR D 24  
CA 1  2  N PHE C 66  ? N PHE C 66  O VAL C 88  ? O VAL C 88  
CA 2  3  N SER C 95  ? N SER C 95  O GLY C 112 ? O GLY C 112 
CA 3  4  N THR C 119 ? N THR C 119 O GLY C 122 ? O GLY C 122 
CA 5  6  N PHE C 94  ? N PHE C 94  O PHE C 60  ? O PHE C 60  
CA 7  8  N TYR C 118 ? N TYR C 118 O PRO C 89  ? O PRO C 89  
CA 9  10 N GLY C 128 ? N GLY C 128 O PHE C 113 ? O PHE C 113 
CA 11 12 N SER C 196 ? N SER C 196 O ASN C 129 ? O ASN C 129 
CA 13 14 N TRP C 203 ? N TRP C 203 O VAL C 211 ? O VAL C 211 
CA 15 16 N TRP C 217 ? N TRP C 217 O GLY C 195 ? O GLY C 195 
CA 17 18 N LEU C 265 ? N LEU C 265 O TYR C 212 ? O TYR C 212 
CA 19 20 N LYS C 301 ? N LYS C 301 O HIS C 63  ? O HIS C 63  
CA 21 22 N LEU C 325 ? N LEU C 325 O LYS C 202 ? O LYS C 202 
DA 1  2  N PHE D 66  ? N PHE D 66  O VAL D 88  ? O VAL D 88  
DA 3  4  N PHE D 94  ? N PHE D 94  O PHE D 60  ? O PHE D 60  
DA 5  6  N TYR D 118 ? N TYR D 118 O PRO D 89  ? O PRO D 89  
DA 7  8  N GLY D 128 ? N GLY D 128 O PHE D 113 ? O PHE D 113 
DA 9  10 N SER D 196 ? N SER D 196 O ASN D 129 ? O ASN D 129 
DA 11 12 N TRP D 203 ? N TRP D 203 O VAL D 211 ? O VAL D 211 
DA 13 14 N TRP D 217 ? N TRP D 217 O GLY D 195 ? O GLY D 195 
DA 15 16 N LEU D 265 ? N LEU D 265 O TYR D 212 ? O TYR D 212 
DA 17 18 N LYS D 301 ? N LYS D 301 O HIS D 63  ? O HIS D 63  
DA 19 20 N LEU D 325 ? N LEU D 325 O LYS D 202 ? O LYS D 202 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE HEM A 501' 
AC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE HEM B 501' 
AC3 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE HEM C 501' 
AC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE HEM D 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 26 ARG A 53  ? ARG A 53   . ? 1_555 ? 
2   AC1 26 VAL A 54  ? VAL A 54   . ? 1_555 ? 
3   AC1 26 VAL A 55  ? VAL A 55   . ? 1_555 ? 
4   AC1 26 HIS A 56  ? HIS A 56   . ? 1_555 ? 
5   AC1 26 ARG A 93  ? ARG A 93   . ? 1_555 ? 
6   AC1 26 GLY A 112 ? GLY A 112  . ? 1_555 ? 
7   AC1 26 SER A 114 ? SER A 114  . ? 1_555 ? 
8   AC1 26 GLY A 128 ? GLY A 128  . ? 1_555 ? 
9   AC1 26 ASN A 129 ? ASN A 129  . ? 1_555 ? 
10  AC1 26 PHE A 134 ? PHE A 134  . ? 1_555 ? 
11  AC1 26 PHE A 142 ? PHE A 142  . ? 1_555 ? 
12  AC1 26 VAL A 198 ? VAL A 198  . ? 1_555 ? 
13  AC1 26 HIS A 199 ? HIS A 199  . ? 1_555 ? 
14  AC1 26 PHE A 315 ? PHE A 315  . ? 1_555 ? 
15  AC1 26 LEU A 331 ? LEU A 331  . ? 1_555 ? 
16  AC1 26 GLY A 334 ? GLY A 334  . ? 1_555 ? 
17  AC1 26 ARG A 335 ? ARG A 335  . ? 1_555 ? 
18  AC1 26 SER A 338 ? SER A 338  . ? 1_555 ? 
19  AC1 26 TYR A 339 ? TYR A 339  . ? 1_555 ? 
20  AC1 26 THR A 342 ? THR A 342  . ? 1_555 ? 
21  AC1 26 GLN A 343 ? GLN A 343  . ? 1_555 ? 
22  AC1 26 ARG A 346 ? ARG A 346  . ? 1_555 ? 
23  AC1 26 HOH I .   ? HOH A 2038 . ? 1_555 ? 
24  AC1 26 HOH I .   ? HOH A 2161 . ? 1_555 ? 
25  AC1 26 HOH I .   ? HOH A 2162 . ? 1_555 ? 
26  AC1 26 ASP B 46  ? ASP B 46   . ? 1_555 ? 
27  AC2 27 ASP A 46  ? ASP A 46   . ? 1_555 ? 
28  AC2 27 ARG B 53  ? ARG B 53   . ? 1_555 ? 
29  AC2 27 VAL B 54  ? VAL B 54   . ? 1_555 ? 
30  AC2 27 VAL B 55  ? VAL B 55   . ? 1_555 ? 
31  AC2 27 HIS B 56  ? HIS B 56   . ? 1_555 ? 
32  AC2 27 ARG B 93  ? ARG B 93   . ? 1_555 ? 
33  AC2 27 GLY B 112 ? GLY B 112  . ? 1_555 ? 
34  AC2 27 PHE B 113 ? PHE B 113  . ? 1_555 ? 
35  AC2 27 SER B 114 ? SER B 114  . ? 1_555 ? 
36  AC2 27 GLY B 128 ? GLY B 128  . ? 1_555 ? 
37  AC2 27 ASN B 129 ? ASN B 129  . ? 1_555 ? 
38  AC2 27 PHE B 134 ? PHE B 134  . ? 1_555 ? 
39  AC2 27 PHE B 142 ? PHE B 142  . ? 1_555 ? 
40  AC2 27 VAL B 198 ? VAL B 198  . ? 1_555 ? 
41  AC2 27 HIS B 199 ? HIS B 199  . ? 1_555 ? 
42  AC2 27 PHE B 315 ? PHE B 315  . ? 1_555 ? 
43  AC2 27 LEU B 331 ? LEU B 331  . ? 1_555 ? 
44  AC2 27 GLY B 334 ? GLY B 334  . ? 1_555 ? 
45  AC2 27 ARG B 335 ? ARG B 335  . ? 1_555 ? 
46  AC2 27 SER B 338 ? SER B 338  . ? 1_555 ? 
47  AC2 27 TYR B 339 ? TYR B 339  . ? 1_555 ? 
48  AC2 27 THR B 342 ? THR B 342  . ? 1_555 ? 
49  AC2 27 GLN B 343 ? GLN B 343  . ? 1_555 ? 
50  AC2 27 ARG B 346 ? ARG B 346  . ? 1_555 ? 
51  AC2 27 HOH J .   ? HOH B 2153 . ? 1_555 ? 
52  AC2 27 HOH J .   ? HOH B 2154 . ? 1_555 ? 
53  AC2 27 HOH J .   ? HOH B 2155 . ? 1_555 ? 
54  AC3 26 ARG C 53  ? ARG C 53   . ? 1_555 ? 
55  AC3 26 VAL C 54  ? VAL C 54   . ? 1_555 ? 
56  AC3 26 VAL C 55  ? VAL C 55   . ? 1_555 ? 
57  AC3 26 HIS C 56  ? HIS C 56   . ? 1_555 ? 
58  AC3 26 ARG C 93  ? ARG C 93   . ? 1_555 ? 
59  AC3 26 GLY C 112 ? GLY C 112  . ? 1_555 ? 
60  AC3 26 PHE C 113 ? PHE C 113  . ? 1_555 ? 
61  AC3 26 SER C 114 ? SER C 114  . ? 1_555 ? 
62  AC3 26 GLY C 128 ? GLY C 128  . ? 1_555 ? 
63  AC3 26 ASN C 129 ? ASN C 129  . ? 1_555 ? 
64  AC3 26 PHE C 134 ? PHE C 134  . ? 1_555 ? 
65  AC3 26 PHE C 142 ? PHE C 142  . ? 1_555 ? 
66  AC3 26 VAL C 198 ? VAL C 198  . ? 1_555 ? 
67  AC3 26 HIS C 199 ? HIS C 199  . ? 1_555 ? 
68  AC3 26 PHE C 315 ? PHE C 315  . ? 1_555 ? 
69  AC3 26 LEU C 331 ? LEU C 331  . ? 1_555 ? 
70  AC3 26 ARG C 335 ? ARG C 335  . ? 1_555 ? 
71  AC3 26 SER C 338 ? SER C 338  . ? 1_555 ? 
72  AC3 26 TYR C 339 ? TYR C 339  . ? 1_555 ? 
73  AC3 26 THR C 342 ? THR C 342  . ? 1_555 ? 
74  AC3 26 GLN C 343 ? GLN C 343  . ? 1_555 ? 
75  AC3 26 ARG C 346 ? ARG C 346  . ? 1_555 ? 
76  AC3 26 HOH K .   ? HOH C 2031 . ? 1_555 ? 
77  AC3 26 HOH K .   ? HOH C 2108 . ? 1_555 ? 
78  AC3 26 ILE D 42  ? ILE D 42   . ? 1_555 ? 
79  AC3 26 ASP D 46  ? ASP D 46   . ? 1_555 ? 
80  AC4 26 ASP C 46  ? ASP C 46   . ? 1_555 ? 
81  AC4 26 ARG D 53  ? ARG D 53   . ? 1_555 ? 
82  AC4 26 VAL D 54  ? VAL D 54   . ? 1_555 ? 
83  AC4 26 VAL D 55  ? VAL D 55   . ? 1_555 ? 
84  AC4 26 HIS D 56  ? HIS D 56   . ? 1_555 ? 
85  AC4 26 ARG D 93  ? ARG D 93   . ? 1_555 ? 
86  AC4 26 GLY D 112 ? GLY D 112  . ? 1_555 ? 
87  AC4 26 SER D 114 ? SER D 114  . ? 1_555 ? 
88  AC4 26 GLY D 128 ? GLY D 128  . ? 1_555 ? 
89  AC4 26 ASN D 129 ? ASN D 129  . ? 1_555 ? 
90  AC4 26 PHE D 134 ? PHE D 134  . ? 1_555 ? 
91  AC4 26 PHE D 142 ? PHE D 142  . ? 1_555 ? 
92  AC4 26 VAL D 198 ? VAL D 198  . ? 1_555 ? 
93  AC4 26 HIS D 199 ? HIS D 199  . ? 1_555 ? 
94  AC4 26 PHE D 315 ? PHE D 315  . ? 1_555 ? 
95  AC4 26 LEU D 331 ? LEU D 331  . ? 1_555 ? 
96  AC4 26 GLY D 334 ? GLY D 334  . ? 1_555 ? 
97  AC4 26 ARG D 335 ? ARG D 335  . ? 1_555 ? 
98  AC4 26 SER D 338 ? SER D 338  . ? 1_555 ? 
99  AC4 26 TYR D 339 ? TYR D 339  . ? 1_555 ? 
100 AC4 26 THR D 342 ? THR D 342  . ? 1_555 ? 
101 AC4 26 GLN D 343 ? GLN D 343  . ? 1_555 ? 
102 AC4 26 ARG D 346 ? ARG D 346  . ? 1_555 ? 
103 AC4 26 HOH L .   ? HOH D 2066 . ? 1_555 ? 
104 AC4 26 HOH L .   ? HOH D 2076 . ? 1_555 ? 
105 AC4 26 HOH L .   ? HOH D 2111 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2J2M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2J2M 
_atom_sites.fract_transf_matrix[1][1]   0.010608 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003367 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007579 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009483 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LYS A 1 6   ? 37.122  -33.316 31.089  1.00 20.24 ? 6    LYS A N   1 
ATOM   2     C  CA  . LYS A 1 6   ? 36.759  -32.087 30.325  1.00 20.50 ? 6    LYS A CA  1 
ATOM   3     C  C   . LYS A 1 6   ? 38.022  -31.303 29.960  1.00 19.32 ? 6    LYS A C   1 
ATOM   4     O  O   . LYS A 1 6   ? 38.740  -30.820 30.850  1.00 19.25 ? 6    LYS A O   1 
ATOM   5     C  CB  . LYS A 1 6   ? 35.816  -31.212 31.165  1.00 21.12 ? 6    LYS A CB  1 
ATOM   6     C  CG  . LYS A 1 6   ? 34.708  -30.537 30.361  1.00 24.42 ? 6    LYS A CG  1 
ATOM   7     C  CD  . LYS A 1 6   ? 33.521  -30.185 31.251  1.00 28.15 ? 6    LYS A CD  1 
ATOM   8     C  CE  . LYS A 1 6   ? 32.217  -30.233 30.454  1.00 31.66 ? 6    LYS A CE  1 
ATOM   9     N  NZ  . LYS A 1 6   ? 31.222  -29.219 30.952  1.00 33.88 ? 6    LYS A NZ  1 
ATOM   10    N  N   . LYS A 1 7   ? 38.294  -31.196 28.658  1.00 17.79 ? 7    LYS A N   1 
ATOM   11    C  CA  . LYS A 1 7   ? 39.467  -30.465 28.144  1.00 16.41 ? 7    LYS A CA  1 
ATOM   12    C  C   . LYS A 1 7   ? 39.252  -28.944 28.093  1.00 15.09 ? 7    LYS A C   1 
ATOM   13    O  O   . LYS A 1 7   ? 38.276  -28.465 27.504  1.00 14.07 ? 7    LYS A O   1 
ATOM   14    C  CB  . LYS A 1 7   ? 39.859  -30.944 26.733  1.00 16.70 ? 7    LYS A CB  1 
ATOM   15    C  CG  . LYS A 1 7   ? 40.211  -32.415 26.603  1.00 17.92 ? 7    LYS A CG  1 
ATOM   16    C  CD  . LYS A 1 7   ? 41.215  -32.657 25.456  1.00 20.68 ? 7    LYS A CD  1 
ATOM   17    C  CE  . LYS A 1 7   ? 40.811  -33.785 24.489  1.00 23.14 ? 7    LYS A CE  1 
ATOM   18    N  NZ  . LYS A 1 7   ? 40.256  -35.034 25.118  1.00 24.99 ? 7    LYS A NZ  1 
ATOM   19    N  N   . LEU A 1 8   ? 40.183  -28.210 28.714  1.00 13.64 ? 8    LEU A N   1 
ATOM   20    C  CA  . LEU A 1 8   ? 40.316  -26.769 28.555  1.00 11.87 ? 8    LEU A CA  1 
ATOM   21    C  C   . LEU A 1 8   ? 40.681  -26.433 27.106  1.00 11.62 ? 8    LEU A C   1 
ATOM   22    O  O   . LEU A 1 8   ? 41.601  -27.042 26.538  1.00 11.04 ? 8    LEU A O   1 
ATOM   23    C  CB  . LEU A 1 8   ? 41.393  -26.236 29.494  1.00 11.74 ? 8    LEU A CB  1 
ATOM   24    C  CG  . LEU A 1 8   ? 41.808  -24.764 29.346  1.00 10.64 ? 8    LEU A CG  1 
ATOM   25    C  CD1 . LEU A 1 8   ? 40.686  -23.791 29.744  1.00 8.52  ? 8    LEU A CD1 1 
ATOM   26    C  CD2 . LEU A 1 8   ? 43.030  -24.531 30.186  1.00 8.91  ? 8    LEU A CD2 1 
ATOM   27    N  N   . THR A 1 9   ? 39.958  -25.472 26.514  1.00 10.72 ? 9    THR A N   1 
ATOM   28    C  CA  . THR A 1 9   ? 40.144  -25.102 25.103  1.00 10.31 ? 9    THR A CA  1 
ATOM   29    C  C   . THR A 1 9   ? 40.262  -23.590 24.989  1.00 10.60 ? 9    THR A C   1 
ATOM   30    O  O   . THR A 1 9   ? 39.928  -22.877 25.938  1.00 10.62 ? 9    THR A O   1 
ATOM   31    C  CB  . THR A 1 9   ? 38.957  -25.568 24.183  1.00 9.99  ? 9    THR A CB  1 
ATOM   32    O  OG1 . THR A 1 9   ? 37.748  -24.897 24.570  1.00 10.10 ? 9    THR A OG1 1 
ATOM   33    C  CG2 . THR A 1 9   ? 38.718  -27.063 24.275  1.00 8.27  ? 9    THR A CG2 1 
ATOM   34    N  N   . THR A 1 10  ? 40.749  -23.118 23.835  1.00 10.52 ? 10   THR A N   1 
ATOM   35    C  CA  . THR A 1 10  ? 40.601  -21.718 23.408  1.00 10.46 ? 10   THR A CA  1 
ATOM   36    C  C   . THR A 1 10  ? 39.169  -21.497 22.865  1.00 10.77 ? 10   THR A C   1 
ATOM   37    O  O   . THR A 1 10  ? 38.392  -22.446 22.741  1.00 10.38 ? 10   THR A O   1 
ATOM   38    C  CB  . THR A 1 10  ? 41.601  -21.379 22.298  1.00 10.42 ? 10   THR A CB  1 
ATOM   39    O  OG1 . THR A 1 10  ? 41.259  -22.111 21.121  1.00 9.02  ? 10   THR A OG1 1 
ATOM   40    C  CG2 . THR A 1 10  ? 43.073  -21.743 22.718  1.00 10.79 ? 10   THR A CG2 1 
ATOM   41    N  N   . ASN A 1 11  ? 38.818  -20.256 22.530  1.00 10.59 ? 11   ASN A N   1 
ATOM   42    C  CA  . ASN A 1 11  ? 37.476  -19.979 22.018  1.00 11.02 ? 11   ASN A CA  1 
ATOM   43    C  C   . ASN A 1 11  ? 37.319  -20.608 20.621  1.00 11.57 ? 11   ASN A C   1 
ATOM   44    O  O   . ASN A 1 11  ? 36.226  -20.584 20.042  1.00 10.75 ? 11   ASN A O   1 
ATOM   45    C  CB  . ASN A 1 11  ? 37.200  -18.467 21.959  1.00 10.11 ? 11   ASN A CB  1 
ATOM   46    C  CG  . ASN A 1 11  ? 37.148  -17.814 23.338  1.00 10.62 ? 11   ASN A CG  1 
ATOM   47    O  OD1 . ASN A 1 11  ? 37.323  -16.584 23.463  1.00 11.62 ? 11   ASN A OD1 1 
ATOM   48    N  ND2 . ASN A 1 11  ? 36.893  -18.614 24.379  1.00 8.33  ? 11   ASN A ND2 1 
ATOM   49    N  N   . GLN A 1 12  ? 38.443  -21.148 20.115  1.00 11.40 ? 12   GLN A N   1 
ATOM   50    C  CA  . GLN A 1 12  ? 38.540  -21.771 18.808  1.00 11.28 ? 12   GLN A CA  1 
ATOM   51    C  C   . GLN A 1 12  ? 38.346  -23.281 18.937  1.00 11.52 ? 12   GLN A C   1 
ATOM   52    O  O   . GLN A 1 12  ? 38.376  -23.991 17.935  1.00 11.96 ? 12   GLN A O   1 
ATOM   53    C  CB  . GLN A 1 12  ? 39.907  -21.480 18.141  1.00 11.12 ? 12   GLN A CB  1 
ATOM   54    C  CG  . GLN A 1 12  ? 40.265  -19.995 17.888  1.00 9.94  ? 12   GLN A CG  1 
ATOM   55    C  CD  . GLN A 1 12  ? 39.370  -19.319 16.858  1.00 10.63 ? 12   GLN A CD  1 
ATOM   56    O  OE1 . GLN A 1 12  ? 38.575  -19.970 16.189  1.00 13.53 ? 12   GLN A OE1 1 
ATOM   57    N  NE2 . GLN A 1 12  ? 39.491  -18.008 16.731  1.00 9.07  ? 12   GLN A NE2 1 
ATOM   58    N  N   . GLY A 1 13  ? 38.139  -23.762 20.165  1.00 11.12 ? 13   GLY A N   1 
ATOM   59    C  CA  . GLY A 1 13  ? 38.022  -25.188 20.429  1.00 10.61 ? 13   GLY A CA  1 
ATOM   60    C  C   . GLY A 1 13  ? 39.303  -26.006 20.294  1.00 10.82 ? 13   GLY A C   1 
ATOM   61    O  O   . GLY A 1 13  ? 39.249  -27.239 20.217  1.00 10.93 ? 13   GLY A O   1 
ATOM   62    N  N   . VAL A 1 14  ? 40.451  -25.332 20.246  1.00 10.90 ? 14   VAL A N   1 
ATOM   63    C  CA  . VAL A 1 14  ? 41.748  -25.995 20.246  1.00 10.96 ? 14   VAL A CA  1 
ATOM   64    C  C   . VAL A 1 14  ? 42.102  -26.305 21.690  1.00 11.77 ? 14   VAL A C   1 
ATOM   65    O  O   . VAL A 1 14  ? 42.097  -25.390 22.521  1.00 12.89 ? 14   VAL A O   1 
ATOM   66    C  CB  . VAL A 1 14  ? 42.855  -25.076 19.693  1.00 11.00 ? 14   VAL A CB  1 
ATOM   67    C  CG1 . VAL A 1 14  ? 44.269  -25.677 19.951  1.00 9.83  ? 14   VAL A CG1 1 
ATOM   68    C  CG2 . VAL A 1 14  ? 42.635  -24.778 18.229  1.00 9.99  ? 14   VAL A CG2 1 
ATOM   69    N  N   . PRO A 1 15  ? 42.424  -27.579 22.002  1.00 11.95 ? 15   PRO A N   1 
ATOM   70    C  CA  . PRO A 1 15  ? 42.816  -27.937 23.364  1.00 12.06 ? 15   PRO A CA  1 
ATOM   71    C  C   . PRO A 1 15  ? 44.081  -27.212 23.849  1.00 11.99 ? 15   PRO A C   1 
ATOM   72    O  O   . PRO A 1 15  ? 45.060  -27.142 23.134  1.00 11.98 ? 15   PRO A O   1 
ATOM   73    C  CB  . PRO A 1 15  ? 43.079  -29.445 23.265  1.00 12.05 ? 15   PRO A CB  1 
ATOM   74    C  CG  . PRO A 1 15  ? 42.332  -29.881 22.079  1.00 12.33 ? 15   PRO A CG  1 
ATOM   75    C  CD  . PRO A 1 15  ? 42.429  -28.757 21.117  1.00 11.79 ? 15   PRO A CD  1 
ATOM   76    N  N   . ILE A 1 16  ? 44.034  -26.697 25.070  1.00 12.23 ? 16   ILE A N   1 
ATOM   77    C  CA  . ILE A 1 16  ? 45.170  -26.055 25.705  1.00 11.82 ? 16   ILE A CA  1 
ATOM   78    C  C   . ILE A 1 16  ? 46.057  -27.073 26.430  1.00 11.65 ? 16   ILE A C   1 
ATOM   79    O  O   . ILE A 1 16  ? 45.581  -27.879 27.227  1.00 11.67 ? 16   ILE A O   1 
ATOM   80    C  CB  . ILE A 1 16  ? 44.689  -24.898 26.642  1.00 12.05 ? 16   ILE A CB  1 
ATOM   81    C  CG1 . ILE A 1 16  ? 44.243  -23.712 25.774  1.00 11.50 ? 16   ILE A CG1 1 
ATOM   82    C  CG2 . ILE A 1 16  ? 45.801  -24.453 27.630  1.00 10.16 ? 16   ILE A CG2 1 
ATOM   83    C  CD1 . ILE A 1 16  ? 43.343  -22.699 26.448  1.00 12.08 ? 16   ILE A CD1 1 
ATOM   84    N  N   . GLY A 1 17  ? 47.354  -27.028 26.141  1.00 11.77 ? 17   GLY A N   1 
ATOM   85    C  CA  . GLY A 1 17  ? 48.319  -27.910 26.780  1.00 11.86 ? 17   GLY A CA  1 
ATOM   86    C  C   . GLY A 1 17  ? 48.938  -27.328 28.040  1.00 12.28 ? 17   GLY A C   1 
ATOM   87    O  O   . GLY A 1 17  ? 49.180  -28.049 29.020  1.00 12.20 ? 17   GLY A O   1 
ATOM   88    N  N   . ASP A 1 18  ? 49.202  -26.024 28.016  1.00 12.25 ? 18   ASP A N   1 
ATOM   89    C  CA  . ASP A 1 18  ? 49.848  -25.356 29.133  1.00 12.93 ? 18   ASP A CA  1 
ATOM   90    C  C   . ASP A 1 18  ? 49.107  -24.047 29.400  1.00 12.85 ? 18   ASP A C   1 
ATOM   91    O  O   . ASP A 1 18  ? 49.237  -23.070 28.657  1.00 13.25 ? 18   ASP A O   1 
ATOM   92    C  CB  . ASP A 1 18  ? 51.339  -25.117 28.808  1.00 13.26 ? 18   ASP A CB  1 
ATOM   93    C  CG  . ASP A 1 18  ? 52.113  -24.427 29.941  1.00 15.27 ? 18   ASP A CG  1 
ATOM   94    O  OD1 . ASP A 1 18  ? 53.360  -24.366 29.833  1.00 17.85 ? 18   ASP A OD1 1 
ATOM   95    O  OD2 . ASP A 1 18  ? 51.516  -23.954 30.938  1.00 18.09 ? 18   ASP A OD2 1 
ATOM   96    N  N   . ASN A 1 19  ? 48.316  -24.040 30.462  1.00 12.46 ? 19   ASN A N   1 
ATOM   97    C  CA  . ASN A 1 19  ? 47.562  -22.858 30.861  1.00 11.96 ? 19   ASN A CA  1 
ATOM   98    C  C   . ASN A 1 19  ? 48.283  -22.023 31.932  1.00 11.89 ? 19   ASN A C   1 
ATOM   99    O  O   . ASN A 1 19  ? 47.649  -21.228 32.629  1.00 11.65 ? 19   ASN A O   1 
ATOM   100   C  CB  . ASN A 1 19  ? 46.184  -23.289 31.377  1.00 11.90 ? 19   ASN A CB  1 
ATOM   101   C  CG  . ASN A 1 19  ? 45.245  -22.123 31.567  1.00 11.38 ? 19   ASN A CG  1 
ATOM   102   O  OD1 . ASN A 1 19  ? 45.160  -21.215 30.719  1.00 9.33  ? 19   ASN A OD1 1 
ATOM   103   N  ND2 . ASN A 1 19  ? 44.533  -22.130 32.690  1.00 10.27 ? 19   ASN A ND2 1 
ATOM   104   N  N   . GLN A 1 20  ? 49.603  -22.209 32.060  1.00 11.55 ? 20   GLN A N   1 
ATOM   105   C  CA  . GLN A 1 20  ? 50.385  -21.572 33.143  1.00 10.74 ? 20   GLN A CA  1 
ATOM   106   C  C   . GLN A 1 20  ? 51.528  -20.670 32.647  1.00 10.60 ? 20   GLN A C   1 
ATOM   107   O  O   . GLN A 1 20  ? 51.976  -19.771 33.365  1.00 10.15 ? 20   GLN A O   1 
ATOM   108   C  CB  . GLN A 1 20  ? 50.954  -22.640 34.108  1.00 10.71 ? 20   GLN A CB  1 
ATOM   109   C  CG  . GLN A 1 20  ? 50.056  -23.883 34.388  1.00 9.01  ? 20   GLN A CG  1 
ATOM   110   C  CD  . GLN A 1 20  ? 48.684  -23.543 34.968  1.00 8.51  ? 20   GLN A CD  1 
ATOM   111   O  OE1 . GLN A 1 20  ? 48.514  -22.556 35.689  1.00 9.90  ? 20   GLN A OE1 1 
ATOM   112   N  NE2 . GLN A 1 20  ? 47.705  -24.373 34.673  1.00 10.29 ? 20   GLN A NE2 1 
ATOM   113   N  N   . ASN A 1 21  ? 52.008  -20.918 31.432  1.00 10.18 ? 21   ASN A N   1 
ATOM   114   C  CA  . ASN A 1 21  ? 53.175  -20.206 30.922  1.00 10.06 ? 21   ASN A CA  1 
ATOM   115   C  C   . ASN A 1 21  ? 52.921  -19.527 29.580  1.00 9.90  ? 21   ASN A C   1 
ATOM   116   O  O   . ASN A 1 21  ? 52.398  -20.146 28.646  1.00 9.90  ? 21   ASN A O   1 
ATOM   117   C  CB  . ASN A 1 21  ? 54.384  -21.161 30.812  1.00 10.36 ? 21   ASN A CB  1 
ATOM   118   C  CG  . ASN A 1 21  ? 54.678  -21.906 32.122  1.00 10.26 ? 21   ASN A CG  1 
ATOM   119   O  OD1 . ASN A 1 21  ? 54.942  -21.298 33.148  1.00 9.58  ? 21   ASN A OD1 1 
ATOM   120   N  ND2 . ASN A 1 21  ? 54.618  -23.226 32.077  1.00 11.71 ? 21   ASN A ND2 1 
ATOM   121   N  N   . SER A 1 22  ? 53.300  -18.257 29.473  1.00 9.40  ? 22   SER A N   1 
ATOM   122   C  CA  . SER A 1 22  ? 53.302  -17.589 28.175  1.00 9.10  ? 22   SER A CA  1 
ATOM   123   C  C   . SER A 1 22  ? 54.388  -18.172 27.271  1.00 9.46  ? 22   SER A C   1 
ATOM   124   O  O   . SER A 1 22  ? 55.353  -18.765 27.749  1.00 9.49  ? 22   SER A O   1 
ATOM   125   C  CB  . SER A 1 22  ? 53.517  -16.091 28.347  1.00 8.86  ? 22   SER A CB  1 
ATOM   126   O  OG  . SER A 1 22  ? 52.525  -15.534 29.191  1.00 9.14  ? 22   SER A OG  1 
ATOM   127   N  N   . ARG A 1 23  ? 54.220  -18.017 25.959  1.00 9.90  ? 23   ARG A N   1 
ATOM   128   C  CA  . ARG A 1 23  ? 55.272  -18.374 25.028  1.00 10.00 ? 23   ARG A CA  1 
ATOM   129   C  C   . ARG A 1 23  ? 56.274  -17.224 24.950  1.00 10.09 ? 23   ARG A C   1 
ATOM   130   O  O   . ARG A 1 23  ? 55.919  -16.110 24.586  1.00 9.87  ? 23   ARG A O   1 
ATOM   131   C  CB  . ARG A 1 23  ? 54.716  -18.707 23.645  1.00 9.86  ? 23   ARG A CB  1 
ATOM   132   C  CG  . ARG A 1 23  ? 55.811  -19.185 22.731  1.00 9.81  ? 23   ARG A CG  1 
ATOM   133   C  CD  . ARG A 1 23  ? 55.317  -19.770 21.416  1.00 13.50 ? 23   ARG A CD  1 
ATOM   134   N  NE  . ARG A 1 23  ? 56.399  -20.564 20.832  1.00 14.01 ? 23   ARG A NE  1 
ATOM   135   C  CZ  . ARG A 1 23  ? 56.368  -21.878 20.644  1.00 16.08 ? 23   ARG A CZ  1 
ATOM   136   N  NH1 . ARG A 1 23  ? 57.436  -22.497 20.142  1.00 18.22 ? 23   ARG A NH1 1 
ATOM   137   N  NH2 . ARG A 1 23  ? 55.275  -22.576 20.927  1.00 17.62 ? 23   ARG A NH2 1 
ATOM   138   N  N   . THR A 1 24  ? 57.521  -17.505 25.310  1.00 10.25 ? 24   THR A N   1 
ATOM   139   C  CA  . THR A 1 24  ? 58.544  -16.460 25.407  1.00 10.24 ? 24   THR A CA  1 
ATOM   140   C  C   . THR A 1 24  ? 59.769  -16.756 24.556  1.00 10.46 ? 24   THR A C   1 
ATOM   141   O  O   . THR A 1 24  ? 60.015  -17.911 24.182  1.00 10.80 ? 24   THR A O   1 
ATOM   142   C  CB  . THR A 1 24  ? 58.991  -16.223 26.884  1.00 10.48 ? 24   THR A CB  1 
ATOM   143   O  OG1 . THR A 1 24  ? 59.399  -17.471 27.484  1.00 9.23  ? 24   THR A OG1 1 
ATOM   144   C  CG2 . THR A 1 24  ? 57.854  -15.582 27.673  1.00 8.72  ? 24   THR A CG2 1 
ATOM   145   N  N   . ALA A 1 25  ? 60.535  -15.708 24.248  1.00 10.42 ? 25   ALA A N   1 
ATOM   146   C  CA  . ALA A 1 25  ? 61.706  -15.853 23.400  1.00 10.30 ? 25   ALA A CA  1 
ATOM   147   C  C   . ALA A 1 25  ? 62.880  -16.337 24.255  1.00 10.54 ? 25   ALA A C   1 
ATOM   148   O  O   . ALA A 1 25  ? 63.852  -15.612 24.499  1.00 10.23 ? 25   ALA A O   1 
ATOM   149   C  CB  . ALA A 1 25  ? 62.019  -14.538 22.708  1.00 10.71 ? 25   ALA A CB  1 
ATOM   150   N  N   . GLY A 1 26  ? 62.770  -17.581 24.716  1.00 10.87 ? 26   GLY A N   1 
ATOM   151   C  CA  . GLY A 1 26  ? 63.695  -18.137 25.696  1.00 10.80 ? 26   GLY A CA  1 
ATOM   152   C  C   . GLY A 1 26  ? 63.024  -18.207 27.048  1.00 11.05 ? 26   GLY A C   1 
ATOM   153   O  O   . GLY A 1 26  ? 62.010  -17.536 27.293  1.00 11.61 ? 26   GLY A O   1 
ATOM   154   N  N   . ARG A 1 27  ? 63.586  -19.022 27.931  1.00 10.78 ? 27   ARG A N   1 
ATOM   155   C  CA  . ARG A 1 27  ? 63.038  -19.223 29.265  1.00 10.45 ? 27   ARG A CA  1 
ATOM   156   C  C   . ARG A 1 27  ? 62.905  -17.892 30.015  1.00 10.55 ? 27   ARG A C   1 
ATOM   157   O  O   . ARG A 1 27  ? 61.973  -17.718 30.782  1.00 9.88  ? 27   ARG A O   1 
ATOM   158   C  CB  . ARG A 1 27  ? 63.936  -20.164 30.054  1.00 10.29 ? 27   ARG A CB  1 
ATOM   159   C  CG  . ARG A 1 27  ? 63.264  -20.812 31.249  1.00 10.70 ? 27   ARG A CG  1 
ATOM   160   C  CD  . ARG A 1 27  ? 64.102  -21.964 31.781  1.00 9.91  ? 27   ARG A CD  1 
ATOM   161   N  NE  . ARG A 1 27  ? 64.251  -23.042 30.816  1.00 10.98 ? 27   ARG A NE  1 
ATOM   162   C  CZ  . ARG A 1 27  ? 63.391  -24.050 30.669  1.00 15.58 ? 27   ARG A CZ  1 
ATOM   163   N  NH1 . ARG A 1 27  ? 62.280  -24.120 31.422  1.00 14.79 ? 27   ARG A NH1 1 
ATOM   164   N  NH2 . ARG A 1 27  ? 63.635  -24.991 29.753  1.00 16.27 ? 27   ARG A NH2 1 
ATOM   165   N  N   . ARG A 1 28  ? 63.850  -16.974 29.805  1.00 10.40 ? 28   ARG A N   1 
ATOM   166   C  CA  . ARG A 1 28  ? 63.833  -15.700 30.515  1.00 11.18 ? 28   ARG A CA  1 
ATOM   167   C  C   . ARG A 1 28  ? 63.805  -14.515 29.557  1.00 10.34 ? 28   ARG A C   1 
ATOM   168   O  O   . ARG A 1 28  ? 64.270  -13.421 29.892  1.00 10.86 ? 28   ARG A O   1 
ATOM   169   C  CB  . ARG A 1 28  ? 65.015  -15.587 31.490  1.00 10.55 ? 28   ARG A CB  1 
ATOM   170   C  CG  . ARG A 1 28  ? 65.106  -16.708 32.558  1.00 12.83 ? 28   ARG A CG  1 
ATOM   171   C  CD  . ARG A 1 28  ? 66.073  -16.316 33.722  1.00 13.96 ? 28   ARG A CD  1 
ATOM   172   N  NE  . ARG A 1 28  ? 67.068  -15.386 33.193  1.00 17.98 ? 28   ARG A NE  1 
ATOM   173   C  CZ  . ARG A 1 28  ? 67.219  -14.112 33.548  1.00 15.00 ? 28   ARG A CZ  1 
ATOM   174   N  NH1 . ARG A 1 28  ? 68.145  -13.406 32.921  1.00 13.59 ? 28   ARG A NH1 1 
ATOM   175   N  NH2 . ARG A 1 28  ? 66.504  -13.566 34.533  1.00 13.23 ? 28   ARG A NH2 1 
ATOM   176   N  N   . GLY A 1 29  ? 63.255  -14.740 28.369  1.00 9.44  ? 29   GLY A N   1 
ATOM   177   C  CA  . GLY A 1 29  ? 63.155  -13.705 27.360  1.00 8.73  ? 29   GLY A CA  1 
ATOM   178   C  C   . GLY A 1 29  ? 61.759  -13.140 27.175  1.00 8.61  ? 29   GLY A C   1 
ATOM   179   O  O   . GLY A 1 29  ? 60.778  -13.644 27.735  1.00 9.21  ? 29   GLY A O   1 
ATOM   180   N  N   . PRO A 1 30  ? 61.641  -12.101 26.351  1.00 8.37  ? 30   PRO A N   1 
ATOM   181   C  CA  . PRO A 1 30  ? 60.329  -11.463 26.220  1.00 7.76  ? 30   PRO A CA  1 
ATOM   182   C  C   . PRO A 1 30  ? 59.239  -12.328 25.528  1.00 7.10  ? 30   PRO A C   1 
ATOM   183   O  O   . PRO A 1 30  ? 59.537  -13.288 24.812  1.00 6.89  ? 30   PRO A O   1 
ATOM   184   C  CB  . PRO A 1 30  ? 60.641  -10.186 25.443  1.00 7.20  ? 30   PRO A CB  1 
ATOM   185   C  CG  . PRO A 1 30  ? 61.849  -10.504 24.686  1.00 8.66  ? 30   PRO A CG  1 
ATOM   186   C  CD  . PRO A 1 30  ? 62.661  -11.468 25.497  1.00 8.55  ? 30   PRO A CD  1 
ATOM   187   N  N   . THR A 1 31  ? 57.987  -11.964 25.792  1.00 6.51  ? 31   THR A N   1 
ATOM   188   C  CA  . THR A 1 31  ? 56.811  -12.664 25.333  1.00 5.87  ? 31   THR A CA  1 
ATOM   189   C  C   . THR A 1 31  ? 56.589  -12.463 23.829  1.00 6.31  ? 31   THR A C   1 
ATOM   190   O  O   . THR A 1 31  ? 56.906  -11.396 23.272  1.00 6.30  ? 31   THR A O   1 
ATOM   191   C  CB  . THR A 1 31  ? 55.600  -12.214 26.149  1.00 5.78  ? 31   THR A CB  1 
ATOM   192   O  OG1 . THR A 1 31  ? 55.854  -12.503 27.532  1.00 6.95  ? 31   THR A OG1 1 
ATOM   193   C  CG2 . THR A 1 31  ? 54.290  -12.910 25.715  1.00 3.74  ? 31   THR A CG2 1 
ATOM   194   N  N   . LEU A 1 32  ? 56.065  -13.501 23.182  1.00 5.62  ? 32   LEU A N   1 
ATOM   195   C  CA  . LEU A 1 32  ? 55.872  -13.479 21.738  1.00 6.37  ? 32   LEU A CA  1 
ATOM   196   C  C   . LEU A 1 32  ? 54.482  -12.987 21.329  1.00 6.86  ? 32   LEU A C   1 
ATOM   197   O  O   . LEU A 1 32  ? 53.457  -13.363 21.936  1.00 6.71  ? 32   LEU A O   1 
ATOM   198   C  CB  . LEU A 1 32  ? 56.144  -14.870 21.142  1.00 5.93  ? 32   LEU A CB  1 
ATOM   199   C  CG  . LEU A 1 32  ? 57.580  -15.376 21.268  1.00 5.41  ? 32   LEU A CG  1 
ATOM   200   C  CD1 . LEU A 1 32  ? 57.727  -16.732 20.536  1.00 7.09  ? 32   LEU A CD1 1 
ATOM   201   C  CD2 . LEU A 1 32  ? 58.577  -14.343 20.747  1.00 2.00  ? 32   LEU A CD2 1 
ATOM   202   N  N   . LEU A 1 33  ? 54.458  -12.152 20.297  1.00 7.18  ? 33   LEU A N   1 
ATOM   203   C  CA  . LEU A 1 33  ? 53.198  -11.716 19.704  1.00 8.35  ? 33   LEU A CA  1 
ATOM   204   C  C   . LEU A 1 33  ? 52.385  -12.912 19.209  1.00 8.90  ? 33   LEU A C   1 
ATOM   205   O  O   . LEU A 1 33  ? 51.169  -12.835 19.138  1.00 9.44  ? 33   LEU A O   1 
ATOM   206   C  CB  . LEU A 1 33  ? 53.430  -10.733 18.547  1.00 8.13  ? 33   LEU A CB  1 
ATOM   207   C  CG  . LEU A 1 33  ? 52.186  -10.017 18.000  1.00 8.57  ? 33   LEU A CG  1 
ATOM   208   C  CD1 . LEU A 1 33  ? 51.523  -9.164  19.076  1.00 8.75  ? 33   LEU A CD1 1 
ATOM   209   C  CD2 . LEU A 1 33  ? 52.547  -9.147  16.830  1.00 8.04  ? 33   LEU A CD2 1 
ATOM   210   N  N   . GLU A 1 34  ? 53.060  -14.005 18.862  1.00 8.85  ? 34   GLU A N   1 
ATOM   211   C  CA  . GLU A 1 34  ? 52.373  -15.180 18.319  1.00 9.57  ? 34   GLU A CA  1 
ATOM   212   C  C   . GLU A 1 34  ? 51.674  -16.059 19.364  1.00 8.68  ? 34   GLU A C   1 
ATOM   213   O  O   . GLU A 1 34  ? 51.071  -17.056 19.006  1.00 8.66  ? 34   GLU A O   1 
ATOM   214   C  CB  . GLU A 1 34  ? 53.316  -16.036 17.453  1.00 9.31  ? 34   GLU A CB  1 
ATOM   215   C  CG  . GLU A 1 34  ? 54.385  -16.785 18.211  1.00 9.14  ? 34   GLU A CG  1 
ATOM   216   C  CD  . GLU A 1 34  ? 55.128  -17.760 17.310  1.00 11.58 ? 34   GLU A CD  1 
ATOM   217   O  OE1 . GLU A 1 34  ? 55.035  -18.986 17.571  1.00 14.82 ? 34   GLU A OE1 1 
ATOM   218   O  OE2 . GLU A 1 34  ? 55.782  -17.307 16.330  1.00 13.65 ? 34   GLU A OE2 1 
ATOM   219   N  N   . ASP A 1 35  ? 51.738  -15.693 20.640  1.00 8.49  ? 35   ASP A N   1 
ATOM   220   C  CA  . ASP A 1 35  ? 50.998  -16.436 21.669  1.00 8.22  ? 35   ASP A CA  1 
ATOM   221   C  C   . ASP A 1 35  ? 49.493  -16.198 21.546  1.00 8.01  ? 35   ASP A C   1 
ATOM   222   O  O   . ASP A 1 35  ? 48.927  -15.435 22.318  1.00 8.55  ? 35   ASP A O   1 
ATOM   223   C  CB  . ASP A 1 35  ? 51.485  -16.081 23.069  1.00 7.83  ? 35   ASP A CB  1 
ATOM   224   C  CG  . ASP A 1 35  ? 51.069  -17.117 24.112  1.00 7.55  ? 35   ASP A CG  1 
ATOM   225   O  OD1 . ASP A 1 35  ? 51.758  -17.251 25.142  1.00 5.03  ? 35   ASP A OD1 1 
ATOM   226   O  OD2 . ASP A 1 35  ? 50.060  -17.821 23.902  1.00 8.11  ? 35   ASP A OD2 1 
ATOM   227   N  N   . TYR A 1 36  ? 48.856  -16.845 20.567  1.00 8.55  ? 36   TYR A N   1 
ATOM   228   C  CA  . TYR A 1 36  ? 47.417  -16.677 20.343  1.00 8.93  ? 36   TYR A CA  1 
ATOM   229   C  C   . TYR A 1 36  ? 46.630  -16.989 21.622  1.00 9.15  ? 36   TYR A C   1 
ATOM   230   O  O   . TYR A 1 36  ? 45.691  -16.264 21.981  1.00 9.61  ? 36   TYR A O   1 
ATOM   231   C  CB  . TYR A 1 36  ? 46.889  -17.532 19.166  1.00 9.15  ? 36   TYR A CB  1 
ATOM   232   C  CG  . TYR A 1 36  ? 45.368  -17.429 19.053  1.00 9.78  ? 36   TYR A CG  1 
ATOM   233   C  CD1 . TYR A 1 36  ? 44.782  -16.383 18.325  1.00 8.12  ? 36   TYR A CD1 1 
ATOM   234   C  CD2 . TYR A 1 36  ? 44.519  -18.341 19.717  1.00 7.67  ? 36   TYR A CD2 1 
ATOM   235   C  CE1 . TYR A 1 36  ? 43.391  -16.233 18.244  1.00 8.36  ? 36   TYR A CE1 1 
ATOM   236   C  CE2 . TYR A 1 36  ? 43.110  -18.201 19.642  1.00 8.81  ? 36   TYR A CE2 1 
ATOM   237   C  CZ  . TYR A 1 36  ? 42.563  -17.130 18.906  1.00 9.11  ? 36   TYR A CZ  1 
ATOM   238   O  OH  . TYR A 1 36  ? 41.205  -16.939 18.812  1.00 9.50  ? 36   TYR A OH  1 
ATOM   239   N  N   . GLN A 1 37  ? 47.028  -18.053 22.316  1.00 8.93  ? 37   GLN A N   1 
ATOM   240   C  CA  . GLN A 1 37  ? 46.297  -18.502 23.497  1.00 8.93  ? 37   GLN A CA  1 
ATOM   241   C  C   . GLN A 1 37  ? 46.258  -17.431 24.599  1.00 8.60  ? 37   GLN A C   1 
ATOM   242   O  O   . GLN A 1 37  ? 45.202  -17.167 25.184  1.00 7.98  ? 37   GLN A O   1 
ATOM   243   C  CB  . GLN A 1 37  ? 46.863  -19.830 24.013  1.00 8.69  ? 37   GLN A CB  1 
ATOM   244   C  CG  . GLN A 1 37  ? 46.446  -20.176 25.428  1.00 8.01  ? 37   GLN A CG  1 
ATOM   245   C  CD  . GLN A 1 37  ? 47.202  -21.362 25.975  1.00 9.97  ? 37   GLN A CD  1 
ATOM   246   O  OE1 . GLN A 1 37  ? 47.420  -22.336 25.264  1.00 11.84 ? 37   GLN A OE1 1 
ATOM   247   N  NE2 . GLN A 1 37  ? 47.632  -21.278 27.238  1.00 9.17  ? 37   GLN A NE2 1 
ATOM   248   N  N   . LEU A 1 38  ? 47.411  -16.823 24.868  1.00 8.33  ? 38   LEU A N   1 
ATOM   249   C  CA  . LEU A 1 38  ? 47.504  -15.730 25.838  1.00 7.97  ? 38   LEU A CA  1 
ATOM   250   C  C   . LEU A 1 38  ? 46.670  -14.509 25.410  1.00 8.08  ? 38   LEU A C   1 
ATOM   251   O  O   . LEU A 1 38  ? 45.846  -14.004 26.179  1.00 7.15  ? 38   LEU A O   1 
ATOM   252   C  CB  . LEU A 1 38  ? 48.970  -15.317 26.033  1.00 7.81  ? 38   LEU A CB  1 
ATOM   253   C  CG  . LEU A 1 38  ? 49.169  -14.030 26.851  1.00 7.73  ? 38   LEU A CG  1 
ATOM   254   C  CD1 . LEU A 1 38  ? 49.004  -14.285 28.373  1.00 5.31  ? 38   LEU A CD1 1 
ATOM   255   C  CD2 . LEU A 1 38  ? 50.501  -13.410 26.531  1.00 7.35  ? 38   LEU A CD2 1 
ATOM   256   N  N   . ILE A 1 39  ? 46.894  -14.040 24.181  1.00 8.27  ? 39   ILE A N   1 
ATOM   257   C  CA  . ILE A 1 39  ? 46.243  -12.828 23.700  1.00 8.33  ? 39   ILE A CA  1 
ATOM   258   C  C   . ILE A 1 39  ? 44.721  -13.000 23.633  1.00 9.15  ? 39   ILE A C   1 
ATOM   259   O  O   . ILE A 1 39  ? 43.980  -12.092 24.010  1.00 9.61  ? 39   ILE A O   1 
ATOM   260   C  CB  . ILE A 1 39  ? 46.840  -12.367 22.355  1.00 9.09  ? 39   ILE A CB  1 
ATOM   261   C  CG1 . ILE A 1 39  ? 48.325  -12.002 22.562  1.00 8.71  ? 39   ILE A CG1 1 
ATOM   262   C  CG2 . ILE A 1 39  ? 46.012  -11.196 21.728  1.00 6.27  ? 39   ILE A CG2 1 
ATOM   263   C  CD1 . ILE A 1 39  ? 49.101  -11.939 21.299  1.00 10.39 ? 39   ILE A CD1 1 
ATOM   264   N  N   . GLU A 1 40  ? 44.253  -14.164 23.184  1.00 8.95  ? 40   GLU A N   1 
ATOM   265   C  CA  . GLU A 1 40  ? 42.815  -14.442 23.199  1.00 8.40  ? 40   GLU A CA  1 
ATOM   266   C  C   . GLU A 1 40  ? 42.261  -14.357 24.609  1.00 7.63  ? 40   GLU A C   1 
ATOM   267   O  O   . GLU A 1 40  ? 41.199  -13.795 24.817  1.00 8.41  ? 40   GLU A O   1 
ATOM   268   C  CB  . GLU A 1 40  ? 42.493  -15.813 22.609  1.00 7.93  ? 40   GLU A CB  1 
ATOM   269   C  CG  . GLU A 1 40  ? 40.989  -16.083 22.607  1.00 9.94  ? 40   GLU A CG  1 
ATOM   270   C  CD  . GLU A 1 40  ? 40.639  -17.532 22.389  1.00 9.62  ? 40   GLU A CD  1 
ATOM   271   O  OE1 . GLU A 1 40  ? 40.553  -18.289 23.368  1.00 11.12 ? 40   GLU A OE1 1 
ATOM   272   O  OE2 . GLU A 1 40  ? 40.413  -17.902 21.232  1.00 12.32 ? 40   GLU A OE2 1 
ATOM   273   N  N   . LYS A 1 41  ? 42.987  -14.925 25.560  1.00 6.94  ? 41   LYS A N   1 
ATOM   274   C  CA  . LYS A 1 41  ? 42.587  -14.967 26.970  1.00 7.25  ? 41   LYS A CA  1 
ATOM   275   C  C   . LYS A 1 41  ? 42.610  -13.568 27.602  1.00 6.90  ? 41   LYS A C   1 
ATOM   276   O  O   . LYS A 1 41  ? 41.619  -13.146 28.211  1.00 7.40  ? 41   LYS A O   1 
ATOM   277   C  CB  . LYS A 1 41  ? 43.500  -15.918 27.740  1.00 6.60  ? 41   LYS A CB  1 
ATOM   278   C  CG  . LYS A 1 41  ? 43.003  -16.376 29.088  1.00 8.80  ? 41   LYS A CG  1 
ATOM   279   C  CD  . LYS A 1 41  ? 43.991  -17.402 29.733  1.00 7.72  ? 41   LYS A CD  1 
ATOM   280   C  CE  . LYS A 1 41  ? 43.666  -17.635 31.213  1.00 8.92  ? 41   LYS A CE  1 
ATOM   281   N  NZ  . LYS A 1 41  ? 44.638  -18.584 31.877  1.00 10.64 ? 41   LYS A NZ  1 
ATOM   282   N  N   . ILE A 1 42  ? 43.733  -12.861 27.455  1.00 6.32  ? 42   ILE A N   1 
ATOM   283   C  CA  . ILE A 1 42  ? 43.864  -11.492 27.943  1.00 5.89  ? 42   ILE A CA  1 
ATOM   284   C  C   . ILE A 1 42  ? 42.918  -10.520 27.218  1.00 6.23  ? 42   ILE A C   1 
ATOM   285   O  O   . ILE A 1 42  ? 42.289  -9.666  27.868  1.00 6.35  ? 42   ILE A O   1 
ATOM   286   C  CB  . ILE A 1 42  ? 45.325  -10.960 27.834  1.00 5.89  ? 42   ILE A CB  1 
ATOM   287   C  CG1 . ILE A 1 42  ? 46.287  -11.826 28.656  1.00 4.70  ? 42   ILE A CG1 1 
ATOM   288   C  CG2 . ILE A 1 42  ? 45.395  -9.442  28.202  1.00 4.38  ? 42   ILE A CG2 1 
ATOM   289   C  CD1 . ILE A 1 42  ? 45.970  -11.903 30.159  1.00 4.15  ? 42   ILE A CD1 1 
ATOM   290   N  N   . ALA A 1 43  ? 42.818  -10.636 25.892  1.00 5.72  ? 43   ALA A N   1 
ATOM   291   C  CA  . ALA A 1 43  ? 41.922  -9.753  25.131  1.00 5.51  ? 43   ALA A CA  1 
ATOM   292   C  C   . ALA A 1 43  ? 40.458  -9.894  25.545  1.00 5.98  ? 43   ALA A C   1 
ATOM   293   O  O   . ALA A 1 43  ? 39.742  -8.887  25.608  1.00 6.80  ? 43   ALA A O   1 
ATOM   294   C  CB  . ALA A 1 43  ? 42.089  -9.940  23.653  1.00 4.83  ? 43   ALA A CB  1 
ATOM   295   N  N   . HIS A 1 44  ? 40.001  -11.106 25.874  1.00 5.87  ? 44   HIS A N   1 
ATOM   296   C  CA  . HIS A 1 44  ? 38.608  -11.241 26.328  1.00 5.60  ? 44   HIS A CA  1 
ATOM   297   C  C   . HIS A 1 44  ? 38.427  -10.670 27.742  1.00 5.99  ? 44   HIS A C   1 
ATOM   298   O  O   . HIS A 1 44  ? 37.453  -9.972  28.026  1.00 5.51  ? 44   HIS A O   1 
ATOM   299   C  CB  . HIS A 1 44  ? 38.096  -12.686 26.237  1.00 5.18  ? 44   HIS A CB  1 
ATOM   300   C  CG  . HIS A 1 44  ? 36.608  -12.797 26.395  1.00 4.88  ? 44   HIS A CG  1 
ATOM   301   N  ND1 . HIS A 1 44  ? 36.002  -12.988 27.619  1.00 4.10  ? 44   HIS A ND1 1 
ATOM   302   C  CD2 . HIS A 1 44  ? 35.601  -12.683 25.493  1.00 2.47  ? 44   HIS A CD2 1 
ATOM   303   C  CE1 . HIS A 1 44  ? 34.689  -13.011 27.458  1.00 3.88  ? 44   HIS A CE1 1 
ATOM   304   N  NE2 . HIS A 1 44  ? 34.418  -12.827 26.181  1.00 2.00  ? 44   HIS A NE2 1 
ATOM   305   N  N   . PHE A 1 45  ? 39.379  -10.981 28.622  1.00 6.59  ? 45   PHE A N   1 
ATOM   306   C  CA  . PHE A 1 45  ? 39.437  -10.410 29.974  1.00 6.73  ? 45   PHE A CA  1 
ATOM   307   C  C   . PHE A 1 45  ? 39.309  -8.900  29.927  1.00 7.10  ? 45   PHE A C   1 
ATOM   308   O  O   . PHE A 1 45  ? 38.516  -8.328  30.678  1.00 7.41  ? 45   PHE A O   1 
ATOM   309   C  CB  . PHE A 1 45  ? 40.739  -10.820 30.669  1.00 6.53  ? 45   PHE A CB  1 
ATOM   310   C  CG  . PHE A 1 45  ? 40.940  -10.186 32.019  1.00 6.20  ? 45   PHE A CG  1 
ATOM   311   C  CD1 . PHE A 1 45  ? 40.287  -10.688 33.143  1.00 6.27  ? 45   PHE A CD1 1 
ATOM   312   C  CD2 . PHE A 1 45  ? 41.804  -9.103  32.171  1.00 6.02  ? 45   PHE A CD2 1 
ATOM   313   C  CE1 . PHE A 1 45  ? 40.468  -10.104 34.395  1.00 5.93  ? 45   PHE A CE1 1 
ATOM   314   C  CE2 . PHE A 1 45  ? 42.010  -8.520  33.411  1.00 5.55  ? 45   PHE A CE2 1 
ATOM   315   C  CZ  . PHE A 1 45  ? 41.334  -9.020  34.537  1.00 5.94  ? 45   PHE A CZ  1 
ATOM   316   N  N   . ASP A 1 46  ? 40.080  -8.273  29.022  1.00 7.42  ? 46   ASP A N   1 
ATOM   317   C  CA  . ASP A 1 46  ? 40.090  -6.808  28.795  1.00 6.91  ? 46   ASP A CA  1 
ATOM   318   C  C   . ASP A 1 46  ? 38.730  -6.240  28.405  1.00 6.55  ? 46   ASP A C   1 
ATOM   319   O  O   . ASP A 1 46  ? 38.495  -5.036  28.538  1.00 6.47  ? 46   ASP A O   1 
ATOM   320   C  CB  . ASP A 1 46  ? 41.114  -6.430  27.706  1.00 6.48  ? 46   ASP A CB  1 
ATOM   321   C  CG  . ASP A 1 46  ? 42.576  -6.656  28.149  1.00 6.83  ? 46   ASP A CG  1 
ATOM   322   O  OD1 . ASP A 1 46  ? 43.479  -6.586  27.275  1.00 6.25  ? 46   ASP A OD1 1 
ATOM   323   O  OD2 . ASP A 1 46  ? 42.826  -6.913  29.355  1.00 4.42  ? 46   ASP A OD2 1 
ATOM   324   N  N   . ARG A 1 47  ? 37.843  -7.121  27.949  1.00 6.03  ? 47   ARG A N   1 
ATOM   325   C  CA  . ARG A 1 47  ? 36.555  -6.735  27.369  1.00 5.84  ? 47   ARG A CA  1 
ATOM   326   C  C   . ARG A 1 47  ? 35.337  -7.212  28.177  1.00 6.14  ? 47   ARG A C   1 
ATOM   327   O  O   . ARG A 1 47  ? 34.202  -7.124  27.695  1.00 6.54  ? 47   ARG A O   1 
ATOM   328   C  CB  . ARG A 1 47  ? 36.471  -7.259  25.940  1.00 4.96  ? 47   ARG A CB  1 
ATOM   329   C  CG  . ARG A 1 47  ? 37.150  -6.317  24.960  1.00 6.64  ? 47   ARG A CG  1 
ATOM   330   C  CD  . ARG A 1 47  ? 37.397  -6.892  23.531  1.00 6.22  ? 47   ARG A CD  1 
ATOM   331   N  NE  . ARG A 1 47  ? 38.228  -5.929  22.797  1.00 9.02  ? 47   ARG A NE  1 
ATOM   332   C  CZ  . ARG A 1 47  ? 39.533  -5.734  22.997  1.00 8.76  ? 47   ARG A CZ  1 
ATOM   333   N  NH1 . ARG A 1 47  ? 40.221  -6.484  23.866  1.00 7.74  ? 47   ARG A NH1 1 
ATOM   334   N  NH2 . ARG A 1 47  ? 40.168  -4.807  22.296  1.00 8.30  ? 47   ARG A NH2 1 
ATOM   335   N  N   . GLU A 1 48  ? 35.574  -7.694  29.404  1.00 5.39  ? 48   GLU A N   1 
ATOM   336   C  CA  . GLU A 1 48  ? 34.535  -8.294  30.213  1.00 4.74  ? 48   GLU A CA  1 
ATOM   337   C  C   . GLU A 1 48  ? 33.458  -7.327  30.608  1.00 4.65  ? 48   GLU A C   1 
ATOM   338   O  O   . GLU A 1 48  ? 32.300  -7.724  30.684  1.00 3.39  ? 48   GLU A O   1 
ATOM   339   C  CB  . GLU A 1 48  ? 35.124  -8.894  31.484  1.00 5.62  ? 48   GLU A CB  1 
ATOM   340   C  CG  . GLU A 1 48  ? 35.894  -10.188 31.255  1.00 5.65  ? 48   GLU A CG  1 
ATOM   341   C  CD  . GLU A 1 48  ? 36.325  -10.868 32.533  1.00 7.25  ? 48   GLU A CD  1 
ATOM   342   O  OE1 . GLU A 1 48  ? 35.937  -10.437 33.664  1.00 4.87  ? 48   GLU A OE1 1 
ATOM   343   O  OE2 . GLU A 1 48  ? 37.072  -11.860 32.390  1.00 7.94  ? 48   GLU A OE2 1 
ATOM   344   N  N   . ARG A 1 49  ? 33.856  -6.075  30.892  1.00 4.85  ? 49   ARG A N   1 
ATOM   345   C  CA  . ARG A 1 49  ? 32.947  -5.044  31.409  1.00 4.65  ? 49   ARG A CA  1 
ATOM   346   C  C   . ARG A 1 49  ? 32.094  -4.321  30.366  1.00 4.68  ? 49   ARG A C   1 
ATOM   347   O  O   . ARG A 1 49  ? 32.513  -4.064  29.232  1.00 4.68  ? 49   ARG A O   1 
ATOM   348   C  CB  . ARG A 1 49  ? 33.693  -3.999  32.253  1.00 5.13  ? 49   ARG A CB  1 
ATOM   349   C  CG  . ARG A 1 49  ? 34.496  -4.525  33.449  1.00 5.93  ? 49   ARG A CG  1 
ATOM   350   C  CD  . ARG A 1 49  ? 33.692  -5.209  34.583  1.00 3.97  ? 49   ARG A CD  1 
ATOM   351   N  NE  . ARG A 1 49  ? 34.679  -5.764  35.496  1.00 8.27  ? 49   ARG A NE  1 
ATOM   352   C  CZ  . ARG A 1 49  ? 35.113  -7.029  35.520  1.00 8.63  ? 49   ARG A CZ  1 
ATOM   353   N  NH1 . ARG A 1 49  ? 34.573  -7.975  34.755  1.00 9.56  ? 49   ARG A NH1 1 
ATOM   354   N  NH2 . ARG A 1 49  ? 36.072  -7.356  36.365  1.00 8.28  ? 49   ARG A NH2 1 
ATOM   355   N  N   . VAL A 1 50  ? 30.876  -4.004  30.793  1.00 4.89  ? 50   VAL A N   1 
ATOM   356   C  CA  . VAL A 1 50  ? 29.912  -3.231  30.035  1.00 4.52  ? 50   VAL A CA  1 
ATOM   357   C  C   . VAL A 1 50  ? 29.491  -2.103  30.971  1.00 4.39  ? 50   VAL A C   1 
ATOM   358   O  O   . VAL A 1 50  ? 29.734  -2.197  32.159  1.00 3.18  ? 50   VAL A O   1 
ATOM   359   C  CB  . VAL A 1 50  ? 28.667  -4.110  29.643  1.00 4.83  ? 50   VAL A CB  1 
ATOM   360   C  CG1 . VAL A 1 50  ? 29.066  -5.204  28.645  1.00 5.06  ? 50   VAL A CG1 1 
ATOM   361   C  CG2 . VAL A 1 50  ? 27.951  -4.730  30.907  1.00 4.57  ? 50   VAL A CG2 1 
ATOM   362   N  N   . PRO A 1 51  ? 28.834  -1.042  30.443  1.00 4.93  ? 51   PRO A N   1 
ATOM   363   C  CA  . PRO A 1 51  ? 28.348  0.049   31.304  1.00 4.25  ? 51   PRO A CA  1 
ATOM   364   C  C   . PRO A 1 51  ? 27.369  -0.454  32.374  1.00 4.81  ? 51   PRO A C   1 
ATOM   365   O  O   . PRO A 1 51  ? 26.541  -1.305  32.088  1.00 4.40  ? 51   PRO A O   1 
ATOM   366   C  CB  . PRO A 1 51  ? 27.588  0.950   30.327  1.00 4.15  ? 51   PRO A CB  1 
ATOM   367   C  CG  . PRO A 1 51  ? 28.119  0.597   28.951  1.00 4.10  ? 51   PRO A CG  1 
ATOM   368   C  CD  . PRO A 1 51  ? 28.483  -0.839  29.016  1.00 3.99  ? 51   PRO A CD  1 
ATOM   369   N  N   . GLU A 1 52  ? 27.462  0.080   33.590  1.00 5.01  ? 52   GLU A N   1 
ATOM   370   C  CA  . GLU A 1 52  ? 26.472  -0.172  34.617  1.00 5.39  ? 52   GLU A CA  1 
ATOM   371   C  C   . GLU A 1 52  ? 25.208  0.646   34.270  1.00 4.93  ? 52   GLU A C   1 
ATOM   372   O  O   . GLU A 1 52  ? 25.253  1.514   33.397  1.00 5.14  ? 52   GLU A O   1 
ATOM   373   C  CB  . GLU A 1 52  ? 27.032  0.151   36.025  1.00 5.60  ? 52   GLU A CB  1 
ATOM   374   C  CG  . GLU A 1 52  ? 27.269  1.670   36.328  1.00 6.48  ? 52   GLU A CG  1 
ATOM   375   C  CD  . GLU A 1 52  ? 27.614  1.986   37.810  1.00 7.91  ? 52   GLU A CD  1 
ATOM   376   O  OE1 . GLU A 1 52  ? 28.233  1.135   38.503  1.00 9.97  ? 52   GLU A OE1 1 
ATOM   377   O  OE2 . GLU A 1 52  ? 27.271  3.107   38.285  1.00 11.58 ? 52   GLU A OE2 1 
ATOM   378   N  N   . ARG A 1 53  ? 24.081  0.330   34.908  1.00 3.82  ? 53   ARG A N   1 
ATOM   379   C  CA  . ARG A 1 53  ? 22.850  1.062   34.721  1.00 3.62  ? 53   ARG A CA  1 
ATOM   380   C  C   . ARG A 1 53  ? 23.080  2.524   35.086  1.00 4.27  ? 53   ARG A C   1 
ATOM   381   O  O   . ARG A 1 53  ? 23.769  2.825   36.077  1.00 4.74  ? 53   ARG A O   1 
ATOM   382   C  CB  . ARG A 1 53  ? 21.740  0.456   35.601  1.00 3.86  ? 53   ARG A CB  1 
ATOM   383   C  CG  . ARG A 1 53  ? 21.058  -0.821  35.039  1.00 3.17  ? 53   ARG A CG  1 
ATOM   384   C  CD  . ARG A 1 53  ? 20.505  -1.699  36.183  1.00 3.90  ? 53   ARG A CD  1 
ATOM   385   N  NE  . ARG A 1 53  ? 19.894  -2.977  35.756  1.00 3.18  ? 53   ARG A NE  1 
ATOM   386   C  CZ  . ARG A 1 53  ? 20.585  -4.025  35.357  1.00 3.39  ? 53   ARG A CZ  1 
ATOM   387   N  NH1 . ARG A 1 53  ? 21.924  -3.980  35.308  1.00 6.98  ? 53   ARG A NH1 1 
ATOM   388   N  NH2 . ARG A 1 53  ? 19.953  -5.112  34.985  1.00 5.68  ? 53   ARG A NH2 1 
ATOM   389   N  N   . VAL A 1 54  ? 22.503  3.437   34.313  1.00 4.40  ? 54   VAL A N   1 
ATOM   390   C  CA  . VAL A 1 54  ? 22.661  4.879   34.586  1.00 4.71  ? 54   VAL A CA  1 
ATOM   391   C  C   . VAL A 1 54  ? 22.209  5.193   36.012  1.00 5.05  ? 54   VAL A C   1 
ATOM   392   O  O   . VAL A 1 54  ? 22.888  5.956   36.747  1.00 5.72  ? 54   VAL A O   1 
ATOM   393   C  CB  . VAL A 1 54  ? 21.947  5.781   33.504  1.00 5.02  ? 54   VAL A CB  1 
ATOM   394   C  CG1 . VAL A 1 54  ? 20.510  5.432   33.364  1.00 4.34  ? 54   VAL A CG1 1 
ATOM   395   C  CG2 . VAL A 1 54  ? 22.063  7.260   33.827  1.00 6.40  ? 54   VAL A CG2 1 
ATOM   396   N  N   . VAL A 1 55  ? 21.079  4.588   36.413  1.00 4.33  ? 55   VAL A N   1 
ATOM   397   C  CA  . VAL A 1 55  ? 20.653  4.587   37.825  1.00 3.57  ? 55   VAL A CA  1 
ATOM   398   C  C   . VAL A 1 55  ? 20.273  3.156   38.165  1.00 3.96  ? 55   VAL A C   1 
ATOM   399   O  O   . VAL A 1 55  ? 20.062  2.342   37.273  1.00 3.82  ? 55   VAL A O   1 
ATOM   400   C  CB  . VAL A 1 55  ? 19.475  5.570   38.150  1.00 3.58  ? 55   VAL A CB  1 
ATOM   401   C  CG1 . VAL A 1 55  ? 19.936  7.017   38.095  1.00 2.43  ? 55   VAL A CG1 1 
ATOM   402   C  CG2 . VAL A 1 55  ? 18.237  5.331   37.254  1.00 3.30  ? 55   VAL A CG2 1 
ATOM   403   N  N   . HIS A 1 56  ? 20.198  2.849   39.450  1.00 4.32  ? 56   HIS A N   1 
ATOM   404   C  CA  . HIS A 1 56  ? 19.835  1.515   39.923  1.00 5.24  ? 56   HIS A CA  1 
ATOM   405   C  C   . HIS A 1 56  ? 20.857  0.474   39.542  1.00 5.54  ? 56   HIS A C   1 
ATOM   406   O  O   . HIS A 1 56  ? 20.488  -0.679  39.292  1.00 5.50  ? 56   HIS A O   1 
ATOM   407   C  CB  . HIS A 1 56  ? 18.475  1.065   39.381  1.00 5.02  ? 56   HIS A CB  1 
ATOM   408   C  CG  . HIS A 1 56  ? 17.308  1.813   39.939  1.00 4.14  ? 56   HIS A CG  1 
ATOM   409   N  ND1 . HIS A 1 56  ? 16.520  1.309   40.956  1.00 2.43  ? 56   HIS A ND1 1 
ATOM   410   C  CD2 . HIS A 1 56  ? 16.747  2.990   39.573  1.00 3.59  ? 56   HIS A CD2 1 
ATOM   411   C  CE1 . HIS A 1 56  ? 15.541  2.162   41.212  1.00 4.42  ? 56   HIS A CE1 1 
ATOM   412   N  NE2 . HIS A 1 56  ? 15.644  3.181   40.373  1.00 5.71  ? 56   HIS A NE2 1 
ATOM   413   N  N   . ALA A 1 57  ? 22.122  0.889   39.463  1.00 6.04  ? 57   ALA A N   1 
ATOM   414   C  CA  . ALA A 1 57  ? 23.235  -0.015  39.099  1.00 6.06  ? 57   ALA A CA  1 
ATOM   415   C  C   . ALA A 1 57  ? 23.439  -1.112  40.132  1.00 5.74  ? 57   ALA A C   1 
ATOM   416   O  O   . ALA A 1 57  ? 23.761  -2.256  39.779  1.00 6.36  ? 57   ALA A O   1 
ATOM   417   C  CB  . ALA A 1 57  ? 24.542  0.758   38.870  1.00 5.28  ? 57   ALA A CB  1 
ATOM   418   N  N   . ARG A 1 58  ? 23.272  -0.770  41.404  1.00 5.54  ? 58   ARG A N   1 
ATOM   419   C  CA  . ARG A 1 58  ? 23.409  -1.776  42.482  1.00 4.84  ? 58   ARG A CA  1 
ATOM   420   C  C   . ARG A 1 58  ? 22.105  -2.566  42.644  1.00 4.17  ? 58   ARG A C   1 
ATOM   421   O  O   . ARG A 1 58  ? 21.052  -1.997  42.907  1.00 3.96  ? 58   ARG A O   1 
ATOM   422   C  CB  . ARG A 1 58  ? 23.842  -1.110  43.795  1.00 4.55  ? 58   ARG A CB  1 
ATOM   423   C  CG  . ARG A 1 58  ? 23.691  -1.981  45.030  1.00 6.48  ? 58   ARG A CG  1 
ATOM   424   C  CD  . ARG A 1 58  ? 24.594  -3.242  44.981  1.00 8.85  ? 58   ARG A CD  1 
ATOM   425   N  NE  . ARG A 1 58  ? 25.675  -3.212  45.962  1.00 10.11 ? 58   ARG A NE  1 
ATOM   426   C  CZ  . ARG A 1 58  ? 26.459  -4.248  46.253  1.00 10.26 ? 58   ARG A CZ  1 
ATOM   427   N  NH1 . ARG A 1 58  ? 26.313  -5.397  45.611  1.00 10.17 ? 58   ARG A NH1 1 
ATOM   428   N  NH2 . ARG A 1 58  ? 27.402  -4.126  47.181  1.00 10.45 ? 58   ARG A NH2 1 
ATOM   429   N  N   . GLY A 1 59  ? 22.174  -3.875  42.463  1.00 4.39  ? 59   GLY A N   1 
ATOM   430   C  CA  . GLY A 1 59  ? 20.975  -4.704  42.508  1.00 4.78  ? 59   GLY A CA  1 
ATOM   431   C  C   . GLY A 1 59  ? 21.143  -6.217  42.634  1.00 5.56  ? 59   GLY A C   1 
ATOM   432   O  O   . GLY A 1 59  ? 22.269  -6.751  42.590  1.00 4.64  ? 59   GLY A O   1 
ATOM   433   N  N   . PHE A 1 60  ? 19.991  -6.896  42.756  1.00 5.39  ? 60   PHE A N   1 
ATOM   434   C  CA  . PHE A 1 60  ? 19.908  -8.324  43.008  1.00 5.95  ? 60   PHE A CA  1 
ATOM   435   C  C   . PHE A 1 60  ? 18.718  -8.917  42.271  1.00 5.88  ? 60   PHE A C   1 
ATOM   436   O  O   . PHE A 1 60  ? 17.589  -8.436  42.417  1.00 6.55  ? 60   PHE A O   1 
ATOM   437   C  CB  . PHE A 1 60  ? 19.763  -8.627  44.521  1.00 6.65  ? 60   PHE A CB  1 
ATOM   438   C  CG  . PHE A 1 60  ? 19.423  -10.088 44.815  1.00 7.46  ? 60   PHE A CG  1 
ATOM   439   C  CD1 . PHE A 1 60  ? 20.437  -11.041 44.944  1.00 5.71  ? 60   PHE A CD1 1 
ATOM   440   C  CD2 . PHE A 1 60  ? 18.077  -10.509 44.910  1.00 8.22  ? 60   PHE A CD2 1 
ATOM   441   C  CE1 . PHE A 1 60  ? 20.141  -12.387 45.196  1.00 6.50  ? 60   PHE A CE1 1 
ATOM   442   C  CE2 . PHE A 1 60  ? 17.752  -11.856 45.141  1.00 7.82  ? 60   PHE A CE2 1 
ATOM   443   C  CZ  . PHE A 1 60  ? 18.792  -12.809 45.281  1.00 7.40  ? 60   PHE A CZ  1 
ATOM   444   N  N   . GLY A 1 61  ? 18.967  -9.982  41.517  1.00 5.29  ? 61   GLY A N   1 
ATOM   445   C  CA  . GLY A 1 61  ? 17.931  -10.626 40.725  1.00 5.39  ? 61   GLY A CA  1 
ATOM   446   C  C   . GLY A 1 61  ? 17.717  -12.092 41.025  1.00 5.43  ? 61   GLY A C   1 
ATOM   447   O  O   . GLY A 1 61  ? 18.673  -12.829 41.345  1.00 4.03  ? 61   GLY A O   1 
ATOM   448   N  N   . ALA A 1 62  ? 16.451  -12.510 40.926  1.00 5.66  ? 62   ALA A N   1 
ATOM   449   C  CA  . ALA A 1 62  ? 16.090  -13.931 41.090  1.00 6.63  ? 62   ALA A CA  1 
ATOM   450   C  C   . ALA A 1 62  ? 14.920  -14.346 40.233  1.00 7.18  ? 62   ALA A C   1 
ATOM   451   O  O   . ALA A 1 62  ? 14.123  -13.503 39.799  1.00 8.64  ? 62   ALA A O   1 
ATOM   452   C  CB  . ALA A 1 62  ? 15.822  -14.269 42.547  1.00 5.89  ? 62   ALA A CB  1 
ATOM   453   N  N   . HIS A 1 63  ? 14.846  -15.647 39.972  1.00 7.60  ? 63   HIS A N   1 
ATOM   454   C  CA  . HIS A 1 63  ? 13.754  -16.265 39.231  1.00 7.90  ? 63   HIS A CA  1 
ATOM   455   C  C   . HIS A 1 63  ? 12.652  -16.734 40.159  1.00 8.47  ? 63   HIS A C   1 
ATOM   456   O  O   . HIS A 1 63  ? 12.903  -17.096 41.313  1.00 9.13  ? 63   HIS A O   1 
ATOM   457   C  CB  . HIS A 1 63  ? 14.240  -17.504 38.498  1.00 7.96  ? 63   HIS A CB  1 
ATOM   458   C  CG  . HIS A 1 63  ? 15.217  -17.218 37.416  1.00 7.19  ? 63   HIS A CG  1 
ATOM   459   N  ND1 . HIS A 1 63  ? 14.828  -16.887 36.141  1.00 9.47  ? 63   HIS A ND1 1 
ATOM   460   C  CD2 . HIS A 1 63  ? 16.567  -17.210 37.418  1.00 7.54  ? 63   HIS A CD2 1 
ATOM   461   C  CE1 . HIS A 1 63  ? 15.899  -16.695 35.393  1.00 10.36 ? 63   HIS A CE1 1 
ATOM   462   N  NE2 . HIS A 1 63  ? 16.968  -16.882 36.147  1.00 11.12 ? 63   HIS A NE2 1 
ATOM   463   N  N   . GLY A 1 64  ? 11.433  -16.739 39.633  1.00 8.34  ? 64   GLY A N   1 
ATOM   464   C  CA  . GLY A 1 64  ? 10.308  -17.354 40.304  1.00 8.74  ? 64   GLY A CA  1 
ATOM   465   C  C   . GLY A 1 64  ? 9.095   -17.494 39.400  1.00 9.24  ? 64   GLY A C   1 
ATOM   466   O  O   . GLY A 1 64  ? 9.203   -17.569 38.161  1.00 9.04  ? 64   GLY A O   1 
ATOM   467   N  N   . VAL A 1 65  ? 7.929   -17.490 40.029  1.00 9.56  ? 65   VAL A N   1 
ATOM   468   C  CA  . VAL A 1 65  ? 6.690   -17.760 39.337  1.00 10.21 ? 65   VAL A CA  1 
ATOM   469   C  C   . VAL A 1 65  ? 5.657   -16.758 39.862  1.00 10.14 ? 65   VAL A C   1 
ATOM   470   O  O   . VAL A 1 65  ? 5.697   -16.397 41.035  1.00 9.76  ? 65   VAL A O   1 
ATOM   471   C  CB  . VAL A 1 65  ? 6.275   -19.281 39.526  1.00 9.95  ? 65   VAL A CB  1 
ATOM   472   C  CG1 . VAL A 1 65  ? 6.029   -19.607 40.999  1.00 11.54 ? 65   VAL A CG1 1 
ATOM   473   C  CG2 . VAL A 1 65  ? 5.072   -19.658 38.693  1.00 10.59 ? 65   VAL A CG2 1 
ATOM   474   N  N   . PHE A 1 66  ? 4.776   -16.266 38.988  1.00 10.32 ? 66   PHE A N   1 
ATOM   475   C  CA  . PHE A 1 66  ? 3.627   -15.516 39.456  1.00 10.35 ? 66   PHE A CA  1 
ATOM   476   C  C   . PHE A 1 66  ? 2.360   -16.357 39.303  1.00 11.33 ? 66   PHE A C   1 
ATOM   477   O  O   . PHE A 1 66  ? 2.166   -17.000 38.270  1.00 10.93 ? 66   PHE A O   1 
ATOM   478   C  CB  . PHE A 1 66  ? 3.490   -14.170 38.760  1.00 9.30  ? 66   PHE A CB  1 
ATOM   479   C  CG  . PHE A 1 66  ? 2.277   -13.394 39.211  1.00 10.35 ? 66   PHE A CG  1 
ATOM   480   C  CD1 . PHE A 1 66  ? 2.327   -12.586 40.343  1.00 8.58  ? 66   PHE A CD1 1 
ATOM   481   C  CD2 . PHE A 1 66  ? 1.063   -13.513 38.537  1.00 8.51  ? 66   PHE A CD2 1 
ATOM   482   C  CE1 . PHE A 1 66  ? 1.199   -11.901 40.771  1.00 9.05  ? 66   PHE A CE1 1 
ATOM   483   C  CE2 . PHE A 1 66  ? -0.072  -12.826 38.986  1.00 8.50  ? 66   PHE A CE2 1 
ATOM   484   C  CZ  . PHE A 1 66  ? -0.001  -12.020 40.080  1.00 8.06  ? 66   PHE A CZ  1 
ATOM   485   N  N   . LYS A 1 67  ? 1.512   -16.354 40.334  1.00 12.48 ? 67   LYS A N   1 
ATOM   486   C  CA  . LYS A 1 67  ? 0.297   -17.173 40.334  1.00 14.05 ? 67   LYS A CA  1 
ATOM   487   C  C   . LYS A 1 67  ? -0.954  -16.336 40.542  1.00 14.15 ? 67   LYS A C   1 
ATOM   488   O  O   . LYS A 1 67  ? -1.132  -15.691 41.581  1.00 12.61 ? 67   LYS A O   1 
ATOM   489   C  CB  . LYS A 1 67  ? 0.400   -18.307 41.362  1.00 15.10 ? 67   LYS A CB  1 
ATOM   490   C  CG  . LYS A 1 67  ? -0.918  -19.031 41.681  1.00 18.31 ? 67   LYS A CG  1 
ATOM   491   C  CD  . LYS A 1 67  ? -1.242  -20.090 40.659  1.00 22.82 ? 67   LYS A CD  1 
ATOM   492   C  CE  . LYS A 1 67  ? -1.824  -21.340 41.327  1.00 24.64 ? 67   LYS A CE  1 
ATOM   493   N  NZ  . LYS A 1 67  ? -1.935  -22.422 40.296  1.00 26.61 ? 67   LYS A NZ  1 
ATOM   494   N  N   . VAL A 1 68  ? -1.811  -16.333 39.522  1.00 15.09 ? 68   VAL A N   1 
ATOM   495   C  CA  . VAL A 1 68  ? -3.032  -15.556 39.607  1.00 15.95 ? 68   VAL A CA  1 
ATOM   496   C  C   . VAL A 1 68  ? -4.091  -16.238 40.476  1.00 17.09 ? 68   VAL A C   1 
ATOM   497   O  O   . VAL A 1 68  ? -4.382  -17.440 40.323  1.00 17.45 ? 68   VAL A O   1 
ATOM   498   C  CB  . VAL A 1 68  ? -3.530  -14.906 38.234  1.00 16.67 ? 68   VAL A CB  1 
ATOM   499   C  CG1 . VAL A 1 68  ? -2.644  -15.255 37.028  1.00 13.39 ? 68   VAL A CG1 1 
ATOM   500   C  CG2 . VAL A 1 68  ? -5.067  -15.069 37.994  1.00 15.86 ? 68   VAL A CG2 1 
ATOM   501   N  N   . LYS A 1 69  ? -4.598  -15.461 41.437  1.00 17.37 ? 69   LYS A N   1 
ATOM   502   C  CA  . LYS A 1 69  ? -5.598  -15.931 42.365  1.00 17.93 ? 69   LYS A CA  1 
ATOM   503   C  C   . LYS A 1 69  ? -7.008  -15.504 41.925  1.00 17.36 ? 69   LYS A C   1 
ATOM   504   O  O   . LYS A 1 69  ? -7.919  -16.314 41.931  1.00 17.55 ? 69   LYS A O   1 
ATOM   505   C  CB  . LYS A 1 69  ? -5.267  -15.458 43.790  1.00 18.80 ? 69   LYS A CB  1 
ATOM   506   C  CG  . LYS A 1 69  ? -6.200  -16.022 44.889  1.00 21.18 ? 69   LYS A CG  1 
ATOM   507   C  CD  . LYS A 1 69  ? -5.405  -16.452 46.115  1.00 24.64 ? 69   LYS A CD  1 
ATOM   508   C  CE  . LYS A 1 69  ? -5.960  -15.872 47.420  1.00 25.46 ? 69   LYS A CE  1 
ATOM   509   N  NZ  . LYS A 1 69  ? -4.856  -15.695 48.448  1.00 23.59 ? 69   LYS A NZ  1 
ATOM   510   N  N   . ASN A 1 70  ? -7.159  -14.237 41.536  1.00 16.56 ? 70   ASN A N   1 
ATOM   511   C  CA  . ASN A 1 70  ? -8.420  -13.673 41.082  1.00 15.32 ? 70   ASN A CA  1 
ATOM   512   C  C   . ASN A 1 70  ? -8.324  -13.200 39.649  1.00 14.86 ? 70   ASN A C   1 
ATOM   513   O  O   . ASN A 1 70  ? -7.481  -12.357 39.304  1.00 14.66 ? 70   ASN A O   1 
ATOM   514   C  CB  . ASN A 1 70  ? -8.841  -12.482 41.955  1.00 15.15 ? 70   ASN A CB  1 
ATOM   515   C  CG  . ASN A 1 70  ? -8.984  -12.849 43.431  1.00 16.60 ? 70   ASN A CG  1 
ATOM   516   O  OD1 . ASN A 1 70  ? -8.188  -12.421 44.258  1.00 17.96 ? 70   ASN A OD1 1 
ATOM   517   N  ND2 . ASN A 1 70  ? -10.000 -13.645 43.760  1.00 15.89 ? 70   ASN A ND2 1 
ATOM   518   N  N   . SER A 1 71  ? -9.209  -13.746 38.822  1.00 14.57 ? 71   SER A N   1 
ATOM   519   C  CA  . SER A 1 71  ? -9.480  -13.248 37.478  1.00 14.19 ? 71   SER A CA  1 
ATOM   520   C  C   . SER A 1 71  ? -9.660  -11.736 37.453  1.00 13.86 ? 71   SER A C   1 
ATOM   521   O  O   . SER A 1 71  ? -10.251 -11.157 38.369  1.00 13.41 ? 71   SER A O   1 
ATOM   522   C  CB  . SER A 1 71  ? -10.742 -13.891 36.944  1.00 13.57 ? 71   SER A CB  1 
ATOM   523   O  OG  . SER A 1 71  ? -10.813 -13.640 35.567  1.00 14.52 ? 71   SER A OG  1 
ATOM   524   N  N   . MET A 1 72  ? -9.129  -11.110 36.408  1.00 13.94 ? 72   MET A N   1 
ATOM   525   C  CA  . MET A 1 72  ? -9.125  -9.651  36.265  1.00 14.39 ? 72   MET A CA  1 
ATOM   526   C  C   . MET A 1 72  ? -9.814  -9.269  34.955  1.00 14.88 ? 72   MET A C   1 
ATOM   527   O  O   . MET A 1 72  ? -9.706  -8.123  34.475  1.00 14.58 ? 72   MET A O   1 
ATOM   528   C  CB  . MET A 1 72  ? -7.682  -9.100  36.306  1.00 14.69 ? 72   MET A CB  1 
ATOM   529   C  CG  . MET A 1 72  ? -6.985  -9.157  37.670  1.00 15.90 ? 72   MET A CG  1 
ATOM   530   S  SD  . MET A 1 72  ? -7.732  -7.996  38.857  1.00 19.25 ? 72   MET A SD  1 
ATOM   531   C  CE  . MET A 1 72  ? -8.382  -9.148  40.071  1.00 19.25 ? 72   MET A CE  1 
ATOM   532   N  N   . LYS A 1 73  ? -10.548 -10.233 34.391  1.00 15.23 ? 73   LYS A N   1 
ATOM   533   C  CA  . LYS A 1 73  ? -11.202 -10.053 33.099  1.00 15.91 ? 73   LYS A CA  1 
ATOM   534   C  C   . LYS A 1 73  ? -12.182 -8.867  33.051  1.00 14.26 ? 73   LYS A C   1 
ATOM   535   O  O   . LYS A 1 73  ? -12.383 -8.286  32.000  1.00 14.26 ? 73   LYS A O   1 
ATOM   536   C  CB  . LYS A 1 73  ? -11.884 -11.356 32.643  1.00 16.40 ? 73   LYS A CB  1 
ATOM   537   C  CG  . LYS A 1 73  ? -13.118 -11.756 33.434  1.00 17.98 ? 73   LYS A CG  1 
ATOM   538   C  CD  . LYS A 1 73  ? -13.910 -12.861 32.690  1.00 19.22 ? 73   LYS A CD  1 
ATOM   539   C  CE  . LYS A 1 73  ? -14.428 -13.957 33.670  1.00 24.32 ? 73   LYS A CE  1 
ATOM   540   N  NZ  . LYS A 1 73  ? -14.458 -13.501 35.114  1.00 25.47 ? 73   LYS A NZ  1 
ATOM   541   N  N   . LYS A 1 74  ? -12.795 -8.552  34.185  1.00 13.17 ? 74   LYS A N   1 
ATOM   542   C  CA  . LYS A 1 74  ? -13.600 -7.345  34.386  1.00 12.46 ? 74   LYS A CA  1 
ATOM   543   C  C   . LYS A 1 74  ? -12.855 -6.085  33.913  1.00 11.97 ? 74   LYS A C   1 
ATOM   544   O  O   . LYS A 1 74  ? -13.440 -5.218  33.260  1.00 12.36 ? 74   LYS A O   1 
ATOM   545   C  CB  . LYS A 1 74  ? -13.918 -7.232  35.878  1.00 11.91 ? 74   LYS A CB  1 
ATOM   546   C  CG  . LYS A 1 74  ? -14.878 -6.116  36.321  1.00 12.49 ? 74   LYS A CG  1 
ATOM   547   C  CD  . LYS A 1 74  ? -15.163 -6.260  37.856  1.00 12.34 ? 74   LYS A CD  1 
ATOM   548   C  CE  . LYS A 1 74  ? -15.503 -4.946  38.501  1.00 12.32 ? 74   LYS A CE  1 
ATOM   549   N  NZ  . LYS A 1 74  ? -15.927 -5.034  39.922  1.00 10.34 ? 74   LYS A NZ  1 
ATOM   550   N  N   . TYR A 1 75  ? -11.559 -6.038  34.202  1.00 11.30 ? 75   TYR A N   1 
ATOM   551   C  CA  . TYR A 1 75  ? -10.695 -4.868  33.968  1.00 11.07 ? 75   TYR A CA  1 
ATOM   552   C  C   . TYR A 1 75  ? -9.699  -4.981  32.797  1.00 11.15 ? 75   TYR A C   1 
ATOM   553   O  O   . TYR A 1 75  ? -9.328  -3.975  32.202  1.00 11.46 ? 75   TYR A O   1 
ATOM   554   C  CB  . TYR A 1 75  ? -9.889  -4.565  35.239  1.00 10.03 ? 75   TYR A CB  1 
ATOM   555   C  CG  . TYR A 1 75  ? -10.689 -4.241  36.471  1.00 9.25  ? 75   TYR A CG  1 
ATOM   556   C  CD1 . TYR A 1 75  ? -10.451 -4.911  37.656  1.00 9.41  ? 75   TYR A CD1 1 
ATOM   557   C  CD2 . TYR A 1 75  ? -11.680 -3.244  36.459  1.00 10.27 ? 75   TYR A CD2 1 
ATOM   558   C  CE1 . TYR A 1 75  ? -11.158 -4.597  38.812  1.00 8.76  ? 75   TYR A CE1 1 
ATOM   559   C  CE2 . TYR A 1 75  ? -12.409 -2.936  37.607  1.00 9.07  ? 75   TYR A CE2 1 
ATOM   560   C  CZ  . TYR A 1 75  ? -12.141 -3.615  38.778  1.00 8.61  ? 75   TYR A CZ  1 
ATOM   561   O  OH  . TYR A 1 75  ? -12.831 -3.318  39.931  1.00 7.70  ? 75   TYR A OH  1 
ATOM   562   N  N   . THR A 1 76  ? -9.218  -6.184  32.515  1.00 10.87 ? 76   THR A N   1 
ATOM   563   C  CA  . THR A 1 76  ? -8.252  -6.347  31.464  1.00 11.57 ? 76   THR A CA  1 
ATOM   564   C  C   . THR A 1 76  ? -8.440  -7.654  30.730  1.00 12.11 ? 76   THR A C   1 
ATOM   565   O  O   . THR A 1 76  ? -8.850  -8.662  31.312  1.00 11.54 ? 76   THR A O   1 
ATOM   566   C  CB  . THR A 1 76  ? -6.745  -6.223  31.938  1.00 11.96 ? 76   THR A CB  1 
ATOM   567   O  OG1 . THR A 1 76  ? -5.874  -6.310  30.790  1.00 10.59 ? 76   THR A OG1 1 
ATOM   568   C  CG2 . THR A 1 76  ? -6.360  -7.323  32.933  1.00 9.73  ? 76   THR A CG2 1 
ATOM   569   N  N   . LYS A 1 77  ? -8.103  -7.608  29.450  1.00 12.69 ? 77   LYS A N   1 
ATOM   570   C  CA  . LYS A 1 77  ? -8.132  -8.773  28.591  1.00 14.01 ? 77   LYS A CA  1 
ATOM   571   C  C   . LYS A 1 77  ? -6.722  -9.336  28.458  1.00 14.14 ? 77   LYS A C   1 
ATOM   572   O  O   . LYS A 1 77  ? -6.450  -10.077 27.512  1.00 15.50 ? 77   LYS A O   1 
ATOM   573   C  CB  . LYS A 1 77  ? -8.699  -8.429  27.210  1.00 13.28 ? 77   LYS A CB  1 
ATOM   574   C  CG  . LYS A 1 77  ? -7.987  -7.264  26.547  1.00 15.54 ? 77   LYS A CG  1 
ATOM   575   C  CD  . LYS A 1 77  ? -8.169  -7.263  25.022  1.00 17.60 ? 77   LYS A CD  1 
ATOM   576   C  CE  . LYS A 1 77  ? -7.630  -5.993  24.434  1.00 18.24 ? 77   LYS A CE  1 
ATOM   577   N  NZ  . LYS A 1 77  ? -7.997  -5.944  23.009  1.00 20.08 ? 77   LYS A NZ  1 
ATOM   578   N  N   . ALA A 1 78  ? -5.832  -8.975  29.388  1.00 14.02 ? 78   ALA A N   1 
ATOM   579   C  CA  . ALA A 1 78  ? -4.499  -9.558  29.445  1.00 13.82 ? 78   ALA A CA  1 
ATOM   580   C  C   . ALA A 1 78  ? -4.650  -11.056 29.593  1.00 14.20 ? 78   ALA A C   1 
ATOM   581   O  O   . ALA A 1 78  ? -5.297  -11.516 30.550  1.00 14.44 ? 78   ALA A O   1 
ATOM   582   C  CB  . ALA A 1 78  ? -3.715  -8.996  30.607  1.00 13.43 ? 78   ALA A CB  1 
ATOM   583   N  N   . ALA A 1 79  ? -4.067  -11.800 28.641  1.00 14.03 ? 79   ALA A N   1 
ATOM   584   C  CA  . ALA A 1 79  ? -4.176  -13.273 28.577  1.00 13.96 ? 79   ALA A CA  1 
ATOM   585   C  C   . ALA A 1 79  ? -3.854  -13.986 29.884  1.00 14.03 ? 79   ALA A C   1 
ATOM   586   O  O   . ALA A 1 79  ? -4.629  -14.850 30.329  1.00 14.46 ? 79   ALA A O   1 
ATOM   587   C  CB  . ALA A 1 79  ? -3.310  -13.833 27.464  1.00 13.62 ? 79   ALA A CB  1 
ATOM   588   N  N   . PHE A 1 80  ? -2.736  -13.626 30.518  1.00 13.45 ? 80   PHE A N   1 
ATOM   589   C  CA  . PHE A 1 80  ? -2.333  -14.351 31.718  1.00 13.22 ? 80   PHE A CA  1 
ATOM   590   C  C   . PHE A 1 80  ? -3.262  -14.123 32.919  1.00 12.77 ? 80   PHE A C   1 
ATOM   591   O  O   . PHE A 1 80  ? -3.265  -14.906 33.860  1.00 11.57 ? 80   PHE A O   1 
ATOM   592   C  CB  . PHE A 1 80  ? -0.853  -14.121 32.063  1.00 13.16 ? 80   PHE A CB  1 
ATOM   593   C  CG  . PHE A 1 80  ? -0.575  -12.840 32.821  1.00 13.95 ? 80   PHE A CG  1 
ATOM   594   C  CD1 . PHE A 1 80  ? -0.418  -11.615 32.140  1.00 12.60 ? 80   PHE A CD1 1 
ATOM   595   C  CD2 . PHE A 1 80  ? -0.425  -12.863 34.208  1.00 11.68 ? 80   PHE A CD2 1 
ATOM   596   C  CE1 . PHE A 1 80  ? -0.129  -10.441 32.842  1.00 11.57 ? 80   PHE A CE1 1 
ATOM   597   C  CE2 . PHE A 1 80  ? -0.133  -11.704 34.911  1.00 11.03 ? 80   PHE A CE2 1 
ATOM   598   C  CZ  . PHE A 1 80  ? 0.007   -10.489 34.230  1.00 12.18 ? 80   PHE A CZ  1 
ATOM   599   N  N   . LEU A 1 81  ? -4.070  -13.069 32.858  1.00 12.87 ? 81   LEU A N   1 
ATOM   600   C  CA  . LEU A 1 81  ? -4.898  -12.680 34.002  1.00 13.38 ? 81   LEU A CA  1 
ATOM   601   C  C   . LEU A 1 81  ? -6.359  -13.101 33.894  1.00 13.85 ? 81   LEU A C   1 
ATOM   602   O  O   . LEU A 1 81  ? -7.178  -12.709 34.726  1.00 14.22 ? 81   LEU A O   1 
ATOM   603   C  CB  . LEU A 1 81  ? -4.796  -11.168 34.212  1.00 13.65 ? 81   LEU A CB  1 
ATOM   604   C  CG  . LEU A 1 81  ? -4.132  -10.422 35.383  1.00 14.03 ? 81   LEU A CG  1 
ATOM   605   C  CD1 . LEU A 1 81  ? -3.130  -11.242 36.205  1.00 10.95 ? 81   LEU A CD1 1 
ATOM   606   C  CD2 . LEU A 1 81  ? -3.540  -9.078  34.892  1.00 13.19 ? 81   LEU A CD2 1 
ATOM   607   N  N   . GLN A 1 82  ? -6.685  -13.892 32.871  1.00 14.40 ? 82   GLN A N   1 
ATOM   608   C  CA  . GLN A 1 82  ? -8.068  -14.356 32.643  1.00 15.09 ? 82   GLN A CA  1 
ATOM   609   C  C   . GLN A 1 82  ? -8.589  -15.390 33.666  1.00 16.15 ? 82   GLN A C   1 
ATOM   610   O  O   . GLN A 1 82  ? -9.742  -15.301 34.098  1.00 15.67 ? 82   GLN A O   1 
ATOM   611   C  CB  . GLN A 1 82  ? -8.254  -14.871 31.202  1.00 14.68 ? 82   GLN A CB  1 
ATOM   612   C  CG  . GLN A 1 82  ? -8.060  -13.787 30.129  1.00 13.42 ? 82   GLN A CG  1 
ATOM   613   C  CD  . GLN A 1 82  ? -8.775  -12.492 30.506  1.00 14.28 ? 82   GLN A CD  1 
ATOM   614   O  OE1 . GLN A 1 82  ? -10.002 -12.437 30.510  1.00 15.50 ? 82   GLN A OE1 1 
ATOM   615   N  NE2 . GLN A 1 82  ? -8.009  -11.448 30.824  1.00 11.65 ? 82   GLN A NE2 1 
ATOM   616   N  N   . GLU A 1 83  ? -7.740  -16.343 34.063  1.00 16.71 ? 83   GLU A N   1 
ATOM   617   C  CA  . GLU A 1 83  ? -8.195  -17.506 34.819  1.00 18.34 ? 83   GLU A CA  1 
ATOM   618   C  C   . GLU A 1 83  ? -7.382  -17.689 36.095  1.00 18.43 ? 83   GLU A C   1 
ATOM   619   O  O   . GLU A 1 83  ? -6.154  -17.678 36.059  1.00 17.73 ? 83   GLU A O   1 
ATOM   620   C  CB  . GLU A 1 83  ? -8.095  -18.789 33.959  1.00 18.88 ? 83   GLU A CB  1 
ATOM   621   C  CG  . GLU A 1 83  ? -8.795  -18.724 32.598  1.00 22.77 ? 83   GLU A CG  1 
ATOM   622   C  CD  . GLU A 1 83  ? -10.324 -18.778 32.721  1.00 28.63 ? 83   GLU A CD  1 
ATOM   623   O  OE1 . GLU A 1 83  ? -10.829 -19.708 33.410  1.00 29.34 ? 83   GLU A OE1 1 
ATOM   624   O  OE2 . GLU A 1 83  ? -11.015 -17.890 32.135  1.00 30.46 ? 83   GLU A OE2 1 
ATOM   625   N  N   . GLU A 1 84  ? -8.055  -17.870 37.224  1.00 19.33 ? 84   GLU A N   1 
ATOM   626   C  CA  . GLU A 1 84  ? -7.313  -18.104 38.457  1.00 20.99 ? 84   GLU A CA  1 
ATOM   627   C  C   . GLU A 1 84  ? -6.511  -19.386 38.307  1.00 20.36 ? 84   GLU A C   1 
ATOM   628   O  O   . GLU A 1 84  ? -6.916  -20.291 37.587  1.00 20.52 ? 84   GLU A O   1 
ATOM   629   C  CB  . GLU A 1 84  ? -8.210  -18.116 39.714  1.00 21.53 ? 84   GLU A CB  1 
ATOM   630   C  CG  . GLU A 1 84  ? -9.509  -18.869 39.612  1.00 25.74 ? 84   GLU A CG  1 
ATOM   631   C  CD  . GLU A 1 84  ? -10.555 -18.321 40.583  1.00 30.93 ? 84   GLU A CD  1 
ATOM   632   O  OE1 . GLU A 1 84  ? -10.850 -19.002 41.601  1.00 30.46 ? 84   GLU A OE1 1 
ATOM   633   O  OE2 . GLU A 1 84  ? -11.059 -17.191 40.327  1.00 33.24 ? 84   GLU A OE2 1 
ATOM   634   N  N   . GLY A 1 85  ? -5.350  -19.435 38.942  1.00 19.70 ? 85   GLY A N   1 
ATOM   635   C  CA  . GLY A 1 85  ? -4.537  -20.631 38.895  1.00 18.90 ? 85   GLY A CA  1 
ATOM   636   C  C   . GLY A 1 85  ? -3.459  -20.604 37.837  1.00 18.56 ? 85   GLY A C   1 
ATOM   637   O  O   . GLY A 1 85  ? -2.554  -21.439 37.869  1.00 17.87 ? 85   GLY A O   1 
ATOM   638   N  N   . THR A 1 86  ? -3.525  -19.661 36.894  1.00 18.20 ? 86   THR A N   1 
ATOM   639   C  CA  . THR A 1 86  ? -2.457  -19.626 35.879  1.00 17.92 ? 86   THR A CA  1 
ATOM   640   C  C   . THR A 1 86  ? -1.128  -19.151 36.498  1.00 16.91 ? 86   THR A C   1 
ATOM   641   O  O   . THR A 1 86  ? -1.119  -18.272 37.337  1.00 16.14 ? 86   THR A O   1 
ATOM   642   C  CB  . THR A 1 86  ? -2.784  -18.854 34.560  1.00 17.91 ? 86   THR A CB  1 
ATOM   643   O  OG1 . THR A 1 86  ? -2.001  -17.654 34.489  1.00 21.12 ? 86   THR A OG1 1 
ATOM   644   C  CG2 . THR A 1 86  ? -4.237  -18.538 34.414  1.00 16.95 ? 86   THR A CG2 1 
ATOM   645   N  N   . GLU A 1 87  ? -0.031  -19.787 36.092  1.00 16.34 ? 87   GLU A N   1 
ATOM   646   C  CA  . GLU A 1 87  ? 1.294   -19.478 36.589  1.00 16.32 ? 87   GLU A CA  1 
ATOM   647   C  C   . GLU A 1 87  ? 2.149   -18.945 35.444  1.00 15.26 ? 87   GLU A C   1 
ATOM   648   O  O   . GLU A 1 87  ? 2.152   -19.489 34.343  1.00 14.93 ? 87   GLU A O   1 
ATOM   649   C  CB  . GLU A 1 87  ? 1.970   -20.712 37.198  1.00 16.85 ? 87   GLU A CB  1 
ATOM   650   C  CG  . GLU A 1 87  ? 1.026   -21.648 37.962  1.00 21.00 ? 87   GLU A CG  1 
ATOM   651   C  CD  . GLU A 1 87  ? 1.714   -22.429 39.081  1.00 25.14 ? 87   GLU A CD  1 
ATOM   652   O  OE1 . GLU A 1 87  ? 1.055   -23.326 39.659  1.00 24.82 ? 87   GLU A OE1 1 
ATOM   653   O  OE2 . GLU A 1 87  ? 2.897   -22.134 39.395  1.00 27.76 ? 87   GLU A OE2 1 
ATOM   654   N  N   . VAL A 1 88  ? 2.879   -17.874 35.713  1.00 14.08 ? 88   VAL A N   1 
ATOM   655   C  CA  . VAL A 1 88  ? 3.757   -17.310 34.711  1.00 13.34 ? 88   VAL A CA  1 
ATOM   656   C  C   . VAL A 1 88  ? 5.171   -17.195 35.257  1.00 12.34 ? 88   VAL A C   1 
ATOM   657   O  O   . VAL A 1 88  ? 5.372   -16.720 36.382  1.00 12.35 ? 88   VAL A O   1 
ATOM   658   C  CB  . VAL A 1 88  ? 3.185   -15.974 34.088  1.00 13.46 ? 88   VAL A CB  1 
ATOM   659   C  CG1 . VAL A 1 88  ? 2.239   -15.281 35.032  1.00 15.16 ? 88   VAL A CG1 1 
ATOM   660   C  CG2 . VAL A 1 88  ? 4.281   -15.041 33.639  1.00 13.19 ? 88   VAL A CG2 1 
ATOM   661   N  N   . PRO A 1 89  ? 6.163   -17.648 34.464  1.00 11.30 ? 89   PRO A N   1 
ATOM   662   C  CA  . PRO A 1 89  ? 7.544   -17.489 34.935  1.00 10.68 ? 89   PRO A CA  1 
ATOM   663   C  C   . PRO A 1 89  ? 7.827   -15.983 35.025  1.00 10.32 ? 89   PRO A C   1 
ATOM   664   O  O   . PRO A 1 89  ? 7.350   -15.221 34.174  1.00 9.95  ? 89   PRO A O   1 
ATOM   665   C  CB  . PRO A 1 89  ? 8.396   -18.140 33.830  1.00 11.06 ? 89   PRO A CB  1 
ATOM   666   C  CG  . PRO A 1 89  ? 7.410   -18.866 32.901  1.00 10.71 ? 89   PRO A CG  1 
ATOM   667   C  CD  . PRO A 1 89  ? 6.059   -18.276 33.135  1.00 10.57 ? 89   PRO A CD  1 
ATOM   668   N  N   . VAL A 1 90  ? 8.538   -15.581 36.079  1.00 9.08  ? 90   VAL A N   1 
ATOM   669   C  CA  . VAL A 1 90  ? 9.031   -14.226 36.251  1.00 8.25  ? 90   VAL A CA  1 
ATOM   670   C  C   . VAL A 1 90  ? 10.531  -14.228 36.594  1.00 8.10  ? 90   VAL A C   1 
ATOM   671   O  O   . VAL A 1 90  ? 11.073  -15.190 37.179  1.00 6.69  ? 90   VAL A O   1 
ATOM   672   C  CB  . VAL A 1 90  ? 8.267   -13.421 37.364  1.00 8.04  ? 90   VAL A CB  1 
ATOM   673   C  CG1 . VAL A 1 90  ? 6.783   -13.270 37.038  1.00 8.38  ? 90   VAL A CG1 1 
ATOM   674   C  CG2 . VAL A 1 90  ? 8.453   -14.048 38.742  1.00 7.72  ? 90   VAL A CG2 1 
ATOM   675   N  N   . PHE A 1 91  ? 11.188  -13.138 36.203  1.00 7.74  ? 91   PHE A N   1 
ATOM   676   C  CA  . PHE A 1 91  ? 12.517  -12.812 36.719  1.00 7.73  ? 91   PHE A CA  1 
ATOM   677   C  C   . PHE A 1 91  ? 12.414  -11.434 37.391  1.00 7.08  ? 91   PHE A C   1 
ATOM   678   O  O   . PHE A 1 91  ? 11.816  -10.516 36.849  1.00 6.92  ? 91   PHE A O   1 
ATOM   679   C  CB  . PHE A 1 91  ? 13.582  -12.850 35.606  1.00 6.98  ? 91   PHE A CB  1 
ATOM   680   C  CG  . PHE A 1 91  ? 14.993  -12.593 36.103  1.00 8.43  ? 91   PHE A CG  1 
ATOM   681   C  CD1 . PHE A 1 91  ? 15.697  -13.580 36.796  1.00 7.07  ? 91   PHE A CD1 1 
ATOM   682   C  CD2 . PHE A 1 91  ? 15.610  -11.371 35.890  1.00 7.70  ? 91   PHE A CD2 1 
ATOM   683   C  CE1 . PHE A 1 91  ? 16.972  -13.357 37.251  1.00 5.61  ? 91   PHE A CE1 1 
ATOM   684   C  CE2 . PHE A 1 91  ? 16.919  -11.138 36.350  1.00 8.93  ? 91   PHE A CE2 1 
ATOM   685   C  CZ  . PHE A 1 91  ? 17.594  -12.135 37.039  1.00 5.78  ? 91   PHE A CZ  1 
ATOM   686   N  N   . ALA A 1 92  ? 12.943  -11.323 38.598  1.00 7.34  ? 92   ALA A N   1 
ATOM   687   C  CA  . ALA A 1 92  ? 12.841  -10.083 39.356  1.00 7.28  ? 92   ALA A CA  1 
ATOM   688   C  C   . ALA A 1 92  ? 14.207  -9.496  39.656  1.00 6.76  ? 92   ALA A C   1 
ATOM   689   O  O   . ALA A 1 92  ? 15.190  -10.232 39.756  1.00 7.95  ? 92   ALA A O   1 
ATOM   690   C  CB  . ALA A 1 92  ? 12.061  -10.308 40.646  1.00 6.72  ? 92   ALA A CB  1 
ATOM   691   N  N   . ARG A 1 93  ? 14.265  -8.176  39.773  1.00 5.55  ? 93   ARG A N   1 
ATOM   692   C  CA  . ARG A 1 93  ? 15.494  -7.472  40.142  1.00 5.22  ? 93   ARG A CA  1 
ATOM   693   C  C   . ARG A 1 93  ? 15.131  -6.337  41.090  1.00 4.44  ? 93   ARG A C   1 
ATOM   694   O  O   . ARG A 1 93  ? 14.266  -5.521  40.784  1.00 4.38  ? 93   ARG A O   1 
ATOM   695   C  CB  . ARG A 1 93  ? 16.269  -6.925  38.914  1.00 4.80  ? 93   ARG A CB  1 
ATOM   696   C  CG  . ARG A 1 93  ? 17.586  -6.197  39.284  1.00 6.10  ? 93   ARG A CG  1 
ATOM   697   C  CD  . ARG A 1 93  ? 18.490  -5.876  38.079  1.00 5.84  ? 93   ARG A CD  1 
ATOM   698   N  NE  . ARG A 1 93  ? 19.838  -5.356  38.422  1.00 6.39  ? 93   ARG A NE  1 
ATOM   699   C  CZ  . ARG A 1 93  ? 20.119  -4.093  38.790  1.00 5.85  ? 93   ARG A CZ  1 
ATOM   700   N  NH1 . ARG A 1 93  ? 19.131  -3.194  38.926  1.00 4.01  ? 93   ARG A NH1 1 
ATOM   701   N  NH2 . ARG A 1 93  ? 21.385  -3.727  39.042  1.00 2.00  ? 93   ARG A NH2 1 
ATOM   702   N  N   . PHE A 1 94  ? 15.803  -6.312  42.229  1.00 4.01  ? 94   PHE A N   1 
ATOM   703   C  CA  . PHE A 1 94  ? 15.638  -5.287  43.235  1.00 5.17  ? 94   PHE A CA  1 
ATOM   704   C  C   . PHE A 1 94  ? 16.943  -4.530  43.272  1.00 5.33  ? 94   PHE A C   1 
ATOM   705   O  O   . PHE A 1 94  ? 17.977  -5.072  42.923  1.00 5.59  ? 94   PHE A O   1 
ATOM   706   C  CB  . PHE A 1 94  ? 15.324  -5.934  44.590  1.00 5.14  ? 94   PHE A CB  1 
ATOM   707   C  CG  . PHE A 1 94  ? 14.116  -6.845  44.554  1.00 6.50  ? 94   PHE A CG  1 
ATOM   708   C  CD1 . PHE A 1 94  ? 14.263  -8.223  44.714  1.00 7.22  ? 94   PHE A CD1 1 
ATOM   709   C  CD2 . PHE A 1 94  ? 12.830  -6.326  44.306  1.00 4.17  ? 94   PHE A CD2 1 
ATOM   710   C  CE1 . PHE A 1 94  ? 13.141  -9.063  44.661  1.00 7.88  ? 94   PHE A CE1 1 
ATOM   711   C  CE2 . PHE A 1 94  ? 11.721  -7.151  44.264  1.00 3.48  ? 94   PHE A CE2 1 
ATOM   712   C  CZ  . PHE A 1 94  ? 11.870  -8.518  44.436  1.00 5.34  ? 94   PHE A CZ  1 
ATOM   713   N  N   . SER A 1 95  ? 16.904  -3.274  43.680  1.00 6.48  ? 95   SER A N   1 
ATOM   714   C  CA  . SER A 1 95  ? 18.042  -2.382  43.450  1.00 7.26  ? 95   SER A CA  1 
ATOM   715   C  C   . SER A 1 95  ? 17.989  -1.167  44.344  1.00 7.60  ? 95   SER A C   1 
ATOM   716   O  O   . SER A 1 95  ? 16.938  -0.884  44.917  1.00 9.25  ? 95   SER A O   1 
ATOM   717   C  CB  . SER A 1 95  ? 18.097  -1.952  41.967  1.00 7.36  ? 95   SER A CB  1 
ATOM   718   O  OG  . SER A 1 95  ? 16.909  -1.296  41.572  1.00 7.48  ? 95   SER A OG  1 
ATOM   719   N  N   . THR A 1 96  ? 19.125  -0.488  44.518  1.00 7.34  ? 96   THR A N   1 
ATOM   720   C  CA  . THR A 1 96  ? 19.111  0.880   45.038  1.00 6.96  ? 96   THR A CA  1 
ATOM   721   C  C   . THR A 1 96  ? 19.066  1.789   43.824  1.00 6.91  ? 96   THR A C   1 
ATOM   722   O  O   . THR A 1 96  ? 18.797  1.295   42.748  1.00 7.37  ? 96   THR A O   1 
ATOM   723   C  CB  . THR A 1 96  ? 20.328  1.201   45.921  1.00 7.03  ? 96   THR A CB  1 
ATOM   724   O  OG1 . THR A 1 96  ? 21.534  0.900   45.207  1.00 6.45  ? 96   THR A OG1 1 
ATOM   725   C  CG2 . THR A 1 96  ? 20.261  0.421   47.212  1.00 5.13  ? 96   THR A CG2 1 
ATOM   726   N  N   . VAL A 1 97  ? 19.311  3.092   43.983  1.00 7.00  ? 97   VAL A N   1 
ATOM   727   C  CA  . VAL A 1 97  ? 19.178  4.052   42.873  1.00 6.64  ? 97   VAL A CA  1 
ATOM   728   C  C   . VAL A 1 97  ? 20.471  4.775   42.499  1.00 6.94  ? 97   VAL A C   1 
ATOM   729   O  O   . VAL A 1 97  ? 20.971  4.654   41.379  1.00 7.00  ? 97   VAL A O   1 
ATOM   730   C  CB  . VAL A 1 97  ? 18.061  5.156   43.145  1.00 7.13  ? 97   VAL A CB  1 
ATOM   731   C  CG1 . VAL A 1 97  ? 17.942  6.156   41.943  1.00 5.02  ? 97   VAL A CG1 1 
ATOM   732   C  CG2 . VAL A 1 97  ? 16.706  4.514   43.427  1.00 6.86  ? 97   VAL A CG2 1 
ATOM   733   N  N   . ILE A 1 98  ? 20.979  5.577   43.428  1.00 7.42  ? 98   ILE A N   1 
ATOM   734   C  CA  . ILE A 1 98  ? 21.908  6.625   43.064  1.00 7.71  ? 98   ILE A CA  1 
ATOM   735   C  C   . ILE A 1 98  ? 23.324  6.089   42.843  1.00 8.88  ? 98   ILE A C   1 
ATOM   736   O  O   . ILE A 1 98  ? 23.928  6.367   41.800  1.00 9.91  ? 98   ILE A O   1 
ATOM   737   C  CB  . ILE A 1 98  ? 21.877  7.799   44.062  1.00 7.15  ? 98   ILE A CB  1 
ATOM   738   C  CG1 . ILE A 1 98  ? 20.562  8.576   43.952  1.00 6.72  ? 98   ILE A CG1 1 
ATOM   739   C  CG2 . ILE A 1 98  ? 23.054  8.747   43.805  1.00 7.26  ? 98   ILE A CG2 1 
ATOM   740   C  CD1 . ILE A 1 98  ? 20.198  9.098   42.485  1.00 3.95  ? 98   ILE A CD1 1 
ATOM   741   N  N   . HIS A 1 99  ? 23.836  5.305   43.790  1.00 8.87  ? 99   HIS A N   1 
ATOM   742   C  CA  . HIS A 1 99  ? 25.219  4.883   43.719  1.00 9.72  ? 99   HIS A CA  1 
ATOM   743   C  C   . HIS A 1 99  ? 25.482  3.640   42.834  1.00 10.01 ? 99   HIS A C   1 
ATOM   744   O  O   . HIS A 1 99  ? 24.571  3.029   42.338  1.00 10.30 ? 99   HIS A O   1 
ATOM   745   C  CB  . HIS A 1 99  ? 25.771  4.748   45.122  1.00 9.22  ? 99   HIS A CB  1 
ATOM   746   C  CG  . HIS A 1 99  ? 25.868  6.053   45.852  1.00 9.39  ? 99   HIS A CG  1 
ATOM   747   N  ND1 . HIS A 1 99  ? 24.811  6.598   46.546  1.00 8.39  ? 99   HIS A ND1 1 
ATOM   748   C  CD2 . HIS A 1 99  ? 26.899  6.918   46.000  1.00 7.82  ? 99   HIS A CD2 1 
ATOM   749   C  CE1 . HIS A 1 99  ? 25.187  7.738   47.099  1.00 9.39  ? 99   HIS A CE1 1 
ATOM   750   N  NE2 . HIS A 1 99  ? 26.451  7.952   46.787  1.00 10.28 ? 99   HIS A NE2 1 
ATOM   751   N  N   . GLY A 1 100 ? 26.739  3.290   42.633  1.00 11.00 ? 100  GLY A N   1 
ATOM   752   C  CA  . GLY A 1 100 ? 27.116  2.345   41.587  1.00 12.56 ? 100  GLY A CA  1 
ATOM   753   C  C   . GLY A 1 100 ? 27.190  0.876   41.996  1.00 13.24 ? 100  GLY A C   1 
ATOM   754   O  O   . GLY A 1 100 ? 26.750  0.480   43.074  1.00 12.68 ? 100  GLY A O   1 
ATOM   755   N  N   . THR A 1 101 ? 27.750  0.071   41.100  1.00 14.13 ? 101  THR A N   1 
ATOM   756   C  CA  . THR A 1 101 ? 27.915  -1.360  41.326  1.00 14.46 ? 101  THR A CA  1 
ATOM   757   C  C   . THR A 1 101 ? 28.813  -1.416  42.548  1.00 13.89 ? 101  THR A C   1 
ATOM   758   O  O   . THR A 1 101 ? 29.762  -0.608  42.661  1.00 14.78 ? 101  THR A O   1 
ATOM   759   C  CB  . THR A 1 101 ? 28.576  -2.042  40.049  1.00 14.49 ? 101  THR A CB  1 
ATOM   760   O  OG1 . THR A 1 101 ? 27.858  -3.235  39.691  1.00 17.71 ? 101  THR A OG1 1 
ATOM   761   C  CG2 . THR A 1 101 ? 30.017  -2.407  40.273  1.00 13.36 ? 101  THR A CG2 1 
ATOM   762   N  N   . HIS A 1 102 ? 28.500  -2.306  43.476  1.00 12.48 ? 102  HIS A N   1 
ATOM   763   C  CA  . HIS A 1 102 ? 29.299  -2.510  44.705  1.00 11.76 ? 102  HIS A CA  1 
ATOM   764   C  C   . HIS A 1 102 ? 29.193  -1.401  45.758  1.00 11.15 ? 102  HIS A C   1 
ATOM   765   O  O   . HIS A 1 102 ? 29.940  -1.361  46.733  1.00 12.39 ? 102  HIS A O   1 
ATOM   766   C  CB  . HIS A 1 102 ? 30.759  -2.847  44.386  1.00 12.17 ? 102  HIS A CB  1 
ATOM   767   C  CG  . HIS A 1 102 ? 30.941  -4.135  43.638  1.00 13.82 ? 102  HIS A CG  1 
ATOM   768   N  ND1 . HIS A 1 102 ? 32.171  -4.555  43.188  1.00 14.55 ? 102  HIS A ND1 1 
ATOM   769   C  CD2 . HIS A 1 102 ? 30.055  -5.089  43.253  1.00 15.88 ? 102  HIS A CD2 1 
ATOM   770   C  CE1 . HIS A 1 102 ? 32.043  -5.714  42.560  1.00 15.96 ? 102  HIS A CE1 1 
ATOM   771   N  NE2 . HIS A 1 102 ? 30.767  -6.058  42.582  1.00 17.29 ? 102  HIS A NE2 1 
ATOM   772   N  N   . SER A 1 103 ? 28.254  -0.500  45.553  1.00 10.20 ? 103  SER A N   1 
ATOM   773   C  CA  . SER A 1 103 ? 27.858  0.478   46.523  1.00 9.83  ? 103  SER A CA  1 
ATOM   774   C  C   . SER A 1 103 ? 27.136  -0.212  47.707  1.00 9.53  ? 103  SER A C   1 
ATOM   775   O  O   . SER A 1 103 ? 26.429  -1.215  47.519  1.00 8.74  ? 103  SER A O   1 
ATOM   776   C  CB  . SER A 1 103 ? 26.902  1.455   45.856  1.00 9.15  ? 103  SER A CB  1 
ATOM   777   O  OG  . SER A 1 103 ? 26.870  2.642   46.630  1.00 13.54 ? 103  SER A OG  1 
ATOM   778   N  N   . PRO A 1 104 ? 27.286  0.330   48.933  1.00 9.57  ? 104  PRO A N   1 
ATOM   779   C  CA  . PRO A 1 104 ? 26.627  -0.383  50.025  1.00 9.87  ? 104  PRO A CA  1 
ATOM   780   C  C   . PRO A 1 104 ? 25.110  -0.454  49.828  1.00 10.26 ? 104  PRO A C   1 
ATOM   781   O  O   . PRO A 1 104 ? 24.518  0.437   49.208  1.00 9.79  ? 104  PRO A O   1 
ATOM   782   C  CB  . PRO A 1 104 ? 27.001  0.449   51.250  1.00 9.48  ? 104  PRO A CB  1 
ATOM   783   C  CG  . PRO A 1 104 ? 28.294  1.102   50.842  1.00 9.77  ? 104  PRO A CG  1 
ATOM   784   C  CD  . PRO A 1 104 ? 28.037  1.494   49.432  1.00 9.16  ? 104  PRO A CD  1 
ATOM   785   N  N   . GLU A 1 105 ? 24.503  -1.532  50.320  1.00 10.14 ? 105  GLU A N   1 
ATOM   786   C  CA  . GLU A 1 105 ? 23.049  -1.651  50.284  1.00 10.36 ? 105  GLU A CA  1 
ATOM   787   C  C   . GLU A 1 105 ? 22.367  -1.016  51.518  1.00 10.74 ? 105  GLU A C   1 
ATOM   788   O  O   . GLU A 1 105 ? 21.165  -1.202  51.746  1.00 10.52 ? 105  GLU A O   1 
ATOM   789   C  CB  . GLU A 1 105 ? 22.634  -3.118  50.041  1.00 10.43 ? 105  GLU A CB  1 
ATOM   790   C  CG  . GLU A 1 105 ? 22.997  -3.574  48.607  1.00 9.91  ? 105  GLU A CG  1 
ATOM   791   C  CD  . GLU A 1 105 ? 22.764  -5.061  48.337  1.00 11.03 ? 105  GLU A CD  1 
ATOM   792   O  OE1 . GLU A 1 105 ? 22.940  -5.888  49.259  1.00 9.65  ? 105  GLU A OE1 1 
ATOM   793   O  OE2 . GLU A 1 105 ? 22.412  -5.406  47.176  1.00 11.08 ? 105  GLU A OE2 1 
ATOM   794   N  N   . THR A 1 106 ? 23.137  -0.244  52.288  1.00 10.54 ? 106  THR A N   1 
ATOM   795   C  CA  . THR A 1 106 ? 22.638  0.357   53.518  1.00 11.10 ? 106  THR A CA  1 
ATOM   796   C  C   . THR A 1 106 ? 22.376  1.845   53.353  1.00 10.79 ? 106  THR A C   1 
ATOM   797   O  O   . THR A 1 106 ? 22.098  2.529   54.327  1.00 11.00 ? 106  THR A O   1 
ATOM   798   C  CB  . THR A 1 106 ? 23.649  0.212   54.676  1.00 10.96 ? 106  THR A CB  1 
ATOM   799   O  OG1 . THR A 1 106 ? 24.946  0.568   54.199  1.00 11.08 ? 106  THR A OG1 1 
ATOM   800   C  CG2 . THR A 1 106 ? 23.700  -1.196  55.195  1.00 10.98 ? 106  THR A CG2 1 
ATOM   801   N  N   . LEU A 1 107 ? 22.483  2.352   52.130  1.00 10.58 ? 107  LEU A N   1 
ATOM   802   C  CA  . LEU A 1 107 ? 22.222  3.782   51.882  1.00 9.70  ? 107  LEU A CA  1 
ATOM   803   C  C   . LEU A 1 107 ? 20.741  4.073   51.737  1.00 9.50  ? 107  LEU A C   1 
ATOM   804   O  O   . LEU A 1 107 ? 19.962  3.208   51.283  1.00 9.28  ? 107  LEU A O   1 
ATOM   805   C  CB  . LEU A 1 107 ? 22.979  4.282   50.637  1.00 8.76  ? 107  LEU A CB  1 
ATOM   806   C  CG  . LEU A 1 107 ? 24.477  3.943   50.586  1.00 7.20  ? 107  LEU A CG  1 
ATOM   807   C  CD1 . LEU A 1 107 ? 25.127  4.686   49.487  1.00 4.93  ? 107  LEU A CD1 1 
ATOM   808   C  CD2 . LEU A 1 107 ? 25.182  4.225   51.906  1.00 4.65  ? 107  LEU A CD2 1 
ATOM   809   N  N   . ARG A 1 108 ? 20.382  5.302   52.106  1.00 8.68  ? 108  ARG A N   1 
ATOM   810   C  CA  . ARG A 1 108 ? 19.069  5.857   51.887  1.00 8.58  ? 108  ARG A CA  1 
ATOM   811   C  C   . ARG A 1 108 ? 18.799  6.075   50.390  1.00 8.55  ? 108  ARG A C   1 
ATOM   812   O  O   . ARG A 1 108 ? 19.547  6.779   49.691  1.00 8.69  ? 108  ARG A O   1 
ATOM   813   C  CB  . ARG A 1 108 ? 18.957  7.193   52.640  1.00 8.63  ? 108  ARG A CB  1 
ATOM   814   C  CG  . ARG A 1 108 ? 17.521  7.786   52.652  1.00 9.62  ? 108  ARG A CG  1 
ATOM   815   C  CD  . ARG A 1 108 ? 17.412  8.975   53.586  1.00 9.30  ? 108  ARG A CD  1 
ATOM   816   N  NE  . ARG A 1 108 ? 17.841  8.644   54.955  1.00 12.33 ? 108  ARG A NE  1 
ATOM   817   C  CZ  . ARG A 1 108 ? 17.113  7.963   55.844  1.00 11.61 ? 108  ARG A CZ  1 
ATOM   818   N  NH1 . ARG A 1 108 ? 17.619  7.732   57.049  1.00 12.54 ? 108  ARG A NH1 1 
ATOM   819   N  NH2 . ARG A 1 108 ? 15.893  7.497   55.530  1.00 9.97  ? 108  ARG A NH2 1 
ATOM   820   N  N   . ASP A 1 109 ? 17.721  5.485   49.895  1.00 8.28  ? 109  ASP A N   1 
ATOM   821   C  CA  . ASP A 1 109 ? 17.358  5.566   48.467  1.00 7.33  ? 109  ASP A CA  1 
ATOM   822   C  C   . ASP A 1 109 ? 16.026  4.900   48.332  1.00 6.88  ? 109  ASP A C   1 
ATOM   823   O  O   . ASP A 1 109 ? 15.687  4.021   49.147  1.00 6.46  ? 109  ASP A O   1 
ATOM   824   C  CB  . ASP A 1 109 ? 18.318  4.737   47.604  1.00 7.94  ? 109  ASP A CB  1 
ATOM   825   C  CG  . ASP A 1 109 ? 19.269  5.586   46.766  1.00 8.66  ? 109  ASP A CG  1 
ATOM   826   O  OD1 . ASP A 1 109 ? 20.206  4.990   46.163  1.00 8.23  ? 109  ASP A OD1 1 
ATOM   827   O  OD2 . ASP A 1 109 ? 19.077  6.827   46.684  1.00 8.83  ? 109  ASP A OD2 1 
ATOM   828   N  N   . PRO A 1 110 ? 15.253  5.295   47.303  1.00 6.69  ? 110  PRO A N   1 
ATOM   829   C  CA  . PRO A 1 110 ? 14.120  4.422   46.998  1.00 6.24  ? 110  PRO A CA  1 
ATOM   830   C  C   . PRO A 1 110 ? 14.745  3.073   46.675  1.00 7.29  ? 110  PRO A C   1 
ATOM   831   O  O   . PRO A 1 110 ? 15.954  3.003   46.405  1.00 7.39  ? 110  PRO A O   1 
ATOM   832   C  CB  . PRO A 1 110 ? 13.518  5.042   45.746  1.00 6.97  ? 110  PRO A CB  1 
ATOM   833   C  CG  . PRO A 1 110 ? 14.045  6.507   45.706  1.00 6.12  ? 110  PRO A CG  1 
ATOM   834   C  CD  . PRO A 1 110 ? 15.363  6.468   46.398  1.00 5.60  ? 110  PRO A CD  1 
ATOM   835   N  N   . ARG A 1 111 ? 13.964  1.999   46.744  1.00 7.50  ? 111  ARG A N   1 
ATOM   836   C  CA  . ARG A 1 111 ? 14.446  0.698   46.315  1.00 7.31  ? 111  ARG A CA  1 
ATOM   837   C  C   . ARG A 1 111 ? 13.669  0.250   45.087  1.00 6.97  ? 111  ARG A C   1 
ATOM   838   O  O   . ARG A 1 111 ? 12.440  0.130   45.153  1.00 6.12  ? 111  ARG A O   1 
ATOM   839   C  CB  . ARG A 1 111 ? 14.275  -0.339  47.428  1.00 7.05  ? 111  ARG A CB  1 
ATOM   840   C  CG  . ARG A 1 111 ? 15.565  -0.763  48.131  1.00 8.79  ? 111  ARG A CG  1 
ATOM   841   C  CD  . ARG A 1 111 ? 16.305  0.412   48.695  1.00 7.23  ? 111  ARG A CD  1 
ATOM   842   N  NE  . ARG A 1 111 ? 17.431  0.040   49.534  1.00 6.21  ? 111  ARG A NE  1 
ATOM   843   C  CZ  . ARG A 1 111 ? 18.166  0.935   50.204  1.00 7.74  ? 111  ARG A CZ  1 
ATOM   844   N  NH1 . ARG A 1 111 ? 17.886  2.226   50.083  1.00 6.87  ? 111  ARG A NH1 1 
ATOM   845   N  NH2 . ARG A 1 111 ? 19.184  0.558   50.982  1.00 6.34  ? 111  ARG A NH2 1 
ATOM   846   N  N   . GLY A 1 112 ? 14.391  -0.032  43.999  1.00 6.38  ? 112  GLY A N   1 
ATOM   847   C  CA  . GLY A 1 112 ? 13.788  -0.553  42.775  1.00 5.72  ? 112  GLY A CA  1 
ATOM   848   C  C   . GLY A 1 112 ? 13.173  -1.934  42.968  1.00 6.22  ? 112  GLY A C   1 
ATOM   849   O  O   . GLY A 1 112 ? 13.721  -2.776  43.700  1.00 5.73  ? 112  GLY A O   1 
ATOM   850   N  N   . PHE A 1 113 ? 12.037  -2.147  42.299  1.00 5.81  ? 113  PHE A N   1 
ATOM   851   C  CA  . PHE A 1 113 ? 11.240  -3.373  42.362  1.00 6.21  ? 113  PHE A CA  1 
ATOM   852   C  C   . PHE A 1 113 ? 10.768  -3.742  40.927  1.00 6.12  ? 113  PHE A C   1 
ATOM   853   O  O   . PHE A 1 113 ? 9.741   -3.265  40.441  1.00 5.82  ? 113  PHE A O   1 
ATOM   854   C  CB  . PHE A 1 113 ? 10.044  -3.137  43.317  1.00 6.49  ? 113  PHE A CB  1 
ATOM   855   C  CG  . PHE A 1 113 ? 9.303   -4.396  43.727  1.00 5.91  ? 113  PHE A CG  1 
ATOM   856   C  CD1 . PHE A 1 113 ? 8.823   -5.288  42.782  1.00 4.73  ? 113  PHE A CD1 1 
ATOM   857   C  CD2 . PHE A 1 113 ? 9.058   -4.658  45.082  1.00 6.83  ? 113  PHE A CD2 1 
ATOM   858   C  CE1 . PHE A 1 113 ? 8.130   -6.435  43.174  1.00 4.58  ? 113  PHE A CE1 1 
ATOM   859   C  CE2 . PHE A 1 113 ? 8.370   -5.789  45.489  1.00 6.39  ? 113  PHE A CE2 1 
ATOM   860   C  CZ  . PHE A 1 113 ? 7.905   -6.682  44.524  1.00 6.24  ? 113  PHE A CZ  1 
ATOM   861   N  N   . SER A 1 114 ? 11.546  -4.571  40.246  1.00 5.96  ? 114  SER A N   1 
ATOM   862   C  CA  . SER A 1 114 ? 11.310  -4.863  38.836  1.00 5.54  ? 114  SER A CA  1 
ATOM   863   C  C   . SER A 1 114 ? 10.971  -6.350  38.629  1.00 5.85  ? 114  SER A C   1 
ATOM   864   O  O   . SER A 1 114 ? 11.671  -7.240  39.134  1.00 5.33  ? 114  SER A O   1 
ATOM   865   C  CB  . SER A 1 114 ? 12.541  -4.468  37.977  1.00 5.45  ? 114  SER A CB  1 
ATOM   866   O  OG  . SER A 1 114 ? 12.824  -3.077  38.048  1.00 3.23  ? 114  SER A OG  1 
ATOM   867   N  N   . VAL A 1 115 ? 9.915   -6.602  37.861  1.00 5.97  ? 115  VAL A N   1 
ATOM   868   C  CA  . VAL A 1 115 ? 9.451   -7.965  37.563  1.00 6.32  ? 115  VAL A CA  1 
ATOM   869   C  C   . VAL A 1 115 ? 9.090   -8.126  36.075  1.00 6.46  ? 115  VAL A C   1 
ATOM   870   O  O   . VAL A 1 115 ? 8.191   -7.451  35.563  1.00 6.02  ? 115  VAL A O   1 
ATOM   871   C  CB  . VAL A 1 115 ? 8.266   -8.390  38.468  1.00 5.94  ? 115  VAL A CB  1 
ATOM   872   C  CG1 . VAL A 1 115 ? 7.788   -9.808  38.115  1.00 7.12  ? 115  VAL A CG1 1 
ATOM   873   C  CG2 . VAL A 1 115 ? 8.677   -8.339  39.919  1.00 5.42  ? 115  VAL A CG2 1 
ATOM   874   N  N   . LYS A 1 116 ? 9.828   -9.013  35.403  1.00 6.88  ? 116  LYS A N   1 
ATOM   875   C  CA  . LYS A 1 116 ? 9.582   -9.402  34.007  1.00 7.33  ? 116  LYS A CA  1 
ATOM   876   C  C   . LYS A 1 116 ? 8.721   -10.667 33.989  1.00 7.38  ? 116  LYS A C   1 
ATOM   877   O  O   . LYS A 1 116 ? 9.104   -11.702 34.574  1.00 7.22  ? 116  LYS A O   1 
ATOM   878   C  CB  . LYS A 1 116 ? 10.915  -9.672  33.270  1.00 7.22  ? 116  LYS A CB  1 
ATOM   879   C  CG  . LYS A 1 116 ? 10.784  -10.053 31.773  1.00 7.68  ? 116  LYS A CG  1 
ATOM   880   C  CD  . LYS A 1 116 ? 12.147  -10.220 31.039  1.00 7.58  ? 116  LYS A CD  1 
ATOM   881   C  CE  . LYS A 1 116 ? 12.920  -8.912  30.881  1.00 7.24  ? 116  LYS A CE  1 
ATOM   882   N  NZ  . LYS A 1 116 ? 12.084  -7.821  30.302  1.00 7.25  ? 116  LYS A NZ  1 
ATOM   883   N  N   . PHE A 1 117 ? 7.565   -10.567 33.329  1.00 8.11  ? 117  PHE A N   1 
ATOM   884   C  CA  . PHE A 1 117 ? 6.585   -11.661 33.229  1.00 8.11  ? 117  PHE A CA  1 
ATOM   885   C  C   . PHE A 1 117 ? 6.686   -12.191 31.833  1.00 9.01  ? 117  PHE A C   1 
ATOM   886   O  O   . PHE A 1 117 ? 6.436   -11.460 30.884  1.00 9.58  ? 117  PHE A O   1 
ATOM   887   C  CB  . PHE A 1 117 ? 5.146   -11.167 33.428  1.00 7.16  ? 117  PHE A CB  1 
ATOM   888   C  CG  . PHE A 1 117 ? 4.844   -10.680 34.813  1.00 6.32  ? 117  PHE A CG  1 
ATOM   889   C  CD1 . PHE A 1 117 ? 5.419   -9.503  35.302  1.00 5.29  ? 117  PHE A CD1 1 
ATOM   890   C  CD2 . PHE A 1 117 ? 3.939   -11.375 35.621  1.00 4.99  ? 117  PHE A CD2 1 
ATOM   891   C  CE1 . PHE A 1 117 ? 5.091   -9.035  36.602  1.00 4.26  ? 117  PHE A CE1 1 
ATOM   892   C  CE2 . PHE A 1 117 ? 3.619   -10.933 36.895  1.00 2.11  ? 117  PHE A CE2 1 
ATOM   893   C  CZ  . PHE A 1 117 ? 4.206   -9.762  37.394  1.00 4.27  ? 117  PHE A CZ  1 
ATOM   894   N  N   . TYR A 1 118 ? 7.056   -13.460 31.705  1.00 9.70  ? 118  TYR A N   1 
ATOM   895   C  CA  . TYR A 1 118 ? 7.195   -14.080 30.404  1.00 9.77  ? 118  TYR A CA  1 
ATOM   896   C  C   . TYR A 1 118 ? 5.886   -14.726 30.096  1.00 10.56 ? 118  TYR A C   1 
ATOM   897   O  O   . TYR A 1 118 ? 5.681   -15.885 30.384  1.00 10.66 ? 118  TYR A O   1 
ATOM   898   C  CB  . TYR A 1 118 ? 8.311   -15.107 30.409  1.00 9.54  ? 118  TYR A CB  1 
ATOM   899   C  CG  . TYR A 1 118 ? 9.676   -14.578 30.836  1.00 9.32  ? 118  TYR A CG  1 
ATOM   900   C  CD1 . TYR A 1 118 ? 10.052  -14.568 32.185  1.00 10.64 ? 118  TYR A CD1 1 
ATOM   901   C  CD2 . TYR A 1 118 ? 10.605  -14.123 29.891  1.00 7.14  ? 118  TYR A CD2 1 
ATOM   902   C  CE1 . TYR A 1 118 ? 11.319  -14.110 32.590  1.00 8.99  ? 118  TYR A CE1 1 
ATOM   903   C  CE2 . TYR A 1 118 ? 11.872  -13.700 30.273  1.00 8.14  ? 118  TYR A CE2 1 
ATOM   904   C  CZ  . TYR A 1 118 ? 12.220  -13.680 31.627  1.00 10.28 ? 118  TYR A CZ  1 
ATOM   905   O  OH  . TYR A 1 118 ? 13.478  -13.243 32.022  1.00 12.36 ? 118  TYR A OH  1 
ATOM   906   N  N   . THR A 1 119 ? 4.999   -13.930 29.515  1.00 12.00 ? 119  THR A N   1 
ATOM   907   C  CA  . THR A 1 119 ? 3.600   -14.278 29.235  1.00 13.27 ? 119  THR A CA  1 
ATOM   908   C  C   . THR A 1 119 ? 3.376   -14.977 27.874  1.00 13.21 ? 119  THR A C   1 
ATOM   909   O  O   . THR A 1 119 ? 4.178   -14.831 26.962  1.00 13.04 ? 119  THR A O   1 
ATOM   910   C  CB  . THR A 1 119 ? 2.795   -12.954 29.267  1.00 13.24 ? 119  THR A CB  1 
ATOM   911   O  OG1 . THR A 1 119 ? 2.410   -12.658 30.620  1.00 15.82 ? 119  THR A OG1 1 
ATOM   912   C  CG2 . THR A 1 119 ? 1.596   -12.992 28.382  1.00 11.36 ? 119  THR A CG2 1 
ATOM   913   N  N   . GLU A 1 120 ? 2.266   -15.696 27.736  1.00 13.74 ? 120  GLU A N   1 
ATOM   914   C  CA  . GLU A 1 120 ? 1.894   -16.312 26.440  1.00 14.96 ? 120  GLU A CA  1 
ATOM   915   C  C   . GLU A 1 120 ? 1.658   -15.298 25.278  1.00 13.47 ? 120  GLU A C   1 
ATOM   916   O  O   . GLU A 1 120 ? 1.813   -15.645 24.111  1.00 12.92 ? 120  GLU A O   1 
ATOM   917   C  CB  . GLU A 1 120 ? 0.715   -17.292 26.613  1.00 15.40 ? 120  GLU A CB  1 
ATOM   918   C  CG  . GLU A 1 120 ? 0.755   -18.455 25.598  1.00 21.82 ? 120  GLU A CG  1 
ATOM   919   C  CD  . GLU A 1 120 ? 0.310   -19.812 26.181  1.00 28.43 ? 120  GLU A CD  1 
ATOM   920   O  OE1 . GLU A 1 120 ? -0.921  -20.014 26.364  1.00 32.10 ? 120  GLU A OE1 1 
ATOM   921   O  OE2 . GLU A 1 120 ? 1.186   -20.679 26.441  1.00 29.06 ? 120  GLU A OE2 1 
ATOM   922   N  N   . GLU A 1 121 ? 1.319   -14.052 25.618  1.00 12.34 ? 121  GLU A N   1 
ATOM   923   C  CA  . GLU A 1 121 ? 1.169   -12.953 24.639  1.00 11.90 ? 121  GLU A CA  1 
ATOM   924   C  C   . GLU A 1 121 ? 2.282   -11.900 24.717  1.00 10.56 ? 121  GLU A C   1 
ATOM   925   O  O   . GLU A 1 121 ? 2.035   -10.716 24.448  1.00 10.00 ? 121  GLU A O   1 
ATOM   926   C  CB  . GLU A 1 121 ? -0.216  -12.277 24.771  1.00 11.43 ? 121  GLU A CB  1 
ATOM   927   C  CG  . GLU A 1 121 ? -1.390  -13.189 24.360  1.00 12.82 ? 121  GLU A CG  1 
ATOM   928   C  CD  . GLU A 1 121 ? -2.717  -12.453 24.203  1.00 14.54 ? 121  GLU A CD  1 
ATOM   929   O  OE1 . GLU A 1 121 ? -2.888  -11.303 24.712  1.00 15.61 ? 121  GLU A OE1 1 
ATOM   930   O  OE2 . GLU A 1 121 ? -3.615  -13.056 23.575  1.00 18.37 ? 121  GLU A OE2 1 
ATOM   931   N  N   . GLY A 1 122 ? 3.492   -12.317 25.097  1.00 9.50  ? 122  GLY A N   1 
ATOM   932   C  CA  . GLY A 1 122 ? 4.619   -11.377 25.244  1.00 8.90  ? 122  GLY A CA  1 
ATOM   933   C  C   . GLY A 1 122 ? 5.109   -11.086 26.662  1.00 8.88  ? 122  GLY A C   1 
ATOM   934   O  O   . GLY A 1 122 ? 4.526   -11.544 27.670  1.00 8.01  ? 122  GLY A O   1 
ATOM   935   N  N   . ASN A 1 123 ? 6.208   -10.342 26.742  1.00 8.53  ? 123  ASN A N   1 
ATOM   936   C  CA  . ASN A 1 123 ? 6.722   -9.888  28.042  1.00 8.21  ? 123  ASN A CA  1 
ATOM   937   C  C   . ASN A 1 123 ? 5.995   -8.630  28.531  1.00 8.37  ? 123  ASN A C   1 
ATOM   938   O  O   . ASN A 1 123 ? 5.756   -7.687  27.746  1.00 8.15  ? 123  ASN A O   1 
ATOM   939   C  CB  . ASN A 1 123 ? 8.246   -9.650  28.016  1.00 7.50  ? 123  ASN A CB  1 
ATOM   940   C  CG  . ASN A 1 123 ? 9.057   -10.951 27.835  1.00 7.58  ? 123  ASN A CG  1 
ATOM   941   O  OD1 . ASN A 1 123 ? 8.488   -12.057 27.749  1.00 6.57  ? 123  ASN A OD1 1 
ATOM   942   N  ND2 . ASN A 1 123 ? 10.392  -10.813 27.751  1.00 2.12  ? 123  ASN A ND2 1 
ATOM   943   N  N   . TRP A 1 124 ? 5.653   -8.640  29.824  1.00 7.82  ? 124  TRP A N   1 
ATOM   944   C  CA  . TRP A 1 124 ? 5.223   -7.464  30.536  1.00 7.69  ? 124  TRP A CA  1 
ATOM   945   C  C   . TRP A 1 124 ? 6.230   -7.130  31.611  1.00 8.27  ? 124  TRP A C   1 
ATOM   946   O  O   . TRP A 1 124 ? 6.531   -7.969  32.491  1.00 9.98  ? 124  TRP A O   1 
ATOM   947   C  CB  . TRP A 1 124 ? 3.876   -7.705  31.215  1.00 8.16  ? 124  TRP A CB  1 
ATOM   948   C  CG  . TRP A 1 124 ? 3.491   -6.605  32.204  1.00 8.41  ? 124  TRP A CG  1 
ATOM   949   C  CD1 . TRP A 1 124 ? 3.624   -5.257  32.032  1.00 7.18  ? 124  TRP A CD1 1 
ATOM   950   C  CD2 . TRP A 1 124 ? 2.884   -6.781  33.480  1.00 9.89  ? 124  TRP A CD2 1 
ATOM   951   N  NE1 . TRP A 1 124 ? 3.170   -4.581  33.135  1.00 6.75  ? 124  TRP A NE1 1 
ATOM   952   C  CE2 . TRP A 1 124 ? 2.699   -5.491  34.038  1.00 8.15  ? 124  TRP A CE2 1 
ATOM   953   C  CE3 . TRP A 1 124 ? 2.469   -7.902  34.211  1.00 9.42  ? 124  TRP A CE3 1 
ATOM   954   C  CZ2 . TRP A 1 124 ? 2.138   -5.294  35.292  1.00 7.94  ? 124  TRP A CZ2 1 
ATOM   955   C  CZ3 . TRP A 1 124 ? 1.907   -7.697  35.468  1.00 9.14  ? 124  TRP A CZ3 1 
ATOM   956   C  CH2 . TRP A 1 124 ? 1.748   -6.404  35.990  1.00 8.83  ? 124  TRP A CH2 1 
ATOM   957   N  N   . ASP A 1 125 ? 6.741   -5.908  31.600  1.00 7.16  ? 125  ASP A N   1 
ATOM   958   C  CA  . ASP A 1 125 ? 7.628   -5.521  32.686  1.00 6.52  ? 125  ASP A CA  1 
ATOM   959   C  C   . ASP A 1 125 ? 6.888   -4.668  33.694  1.00 6.09  ? 125  ASP A C   1 
ATOM   960   O  O   . ASP A 1 125 ? 6.320   -3.644  33.310  1.00 6.32  ? 125  ASP A O   1 
ATOM   961   C  CB  . ASP A 1 125 ? 8.844   -4.755  32.158  1.00 6.71  ? 125  ASP A CB  1 
ATOM   962   C  CG  . ASP A 1 125 ? 9.749   -5.608  31.291  1.00 6.04  ? 125  ASP A CG  1 
ATOM   963   O  OD1 . ASP A 1 125 ? 10.392  -5.022  30.399  1.00 5.67  ? 125  ASP A OD1 1 
ATOM   964   O  OD2 . ASP A 1 125 ? 9.836   -6.845  31.499  1.00 4.61  ? 125  ASP A OD2 1 
ATOM   965   N  N   . PHE A 1 126 ? 6.856   -5.116  34.950  1.00 4.68  ? 126  PHE A N   1 
ATOM   966   C  CA  . PHE A 1 126 ? 6.574   -4.233  36.078  1.00 4.84  ? 126  PHE A CA  1 
ATOM   967   C  C   . PHE A 1 126 ? 7.887   -3.583  36.543  1.00 4.59  ? 126  PHE A C   1 
ATOM   968   O  O   . PHE A 1 126 ? 8.848   -4.277  36.858  1.00 4.86  ? 126  PHE A O   1 
ATOM   969   C  CB  . PHE A 1 126 ? 5.878   -4.963  37.256  1.00 4.48  ? 126  PHE A CB  1 
ATOM   970   C  CG  . PHE A 1 126 ? 5.680   -4.086  38.488  1.00 5.72  ? 126  PHE A CG  1 
ATOM   971   C  CD1 . PHE A 1 126 ? 6.710   -3.924  39.432  1.00 5.79  ? 126  PHE A CD1 1 
ATOM   972   C  CD2 . PHE A 1 126 ? 4.484   -3.393  38.687  1.00 5.51  ? 126  PHE A CD2 1 
ATOM   973   C  CE1 . PHE A 1 126 ? 6.534   -3.101  40.580  1.00 7.08  ? 126  PHE A CE1 1 
ATOM   974   C  CE2 . PHE A 1 126 ? 4.286   -2.570  39.826  1.00 6.34  ? 126  PHE A CE2 1 
ATOM   975   C  CZ  . PHE A 1 126 ? 5.315   -2.414  40.771  1.00 5.67  ? 126  PHE A CZ  1 
ATOM   976   N  N   . VAL A 1 127 ? 7.940   -2.255  36.552  1.00 4.29  ? 127  VAL A N   1 
ATOM   977   C  CA  . VAL A 1 127 ? 9.172   -1.552  36.949  1.00 3.80  ? 127  VAL A CA  1 
ATOM   978   C  C   . VAL A 1 127 ? 8.763   -0.435  37.907  1.00 4.40  ? 127  VAL A C   1 
ATOM   979   O  O   . VAL A 1 127 ? 8.361   0.648   37.489  1.00 4.35  ? 127  VAL A O   1 
ATOM   980   C  CB  . VAL A 1 127 ? 9.963   -1.025  35.700  1.00 4.04  ? 127  VAL A CB  1 
ATOM   981   C  CG1 . VAL A 1 127 ? 11.290  -0.356  36.104  1.00 2.00  ? 127  VAL A CG1 1 
ATOM   982   C  CG2 . VAL A 1 127 ? 10.211  -2.168  34.710  1.00 2.56  ? 127  VAL A CG2 1 
ATOM   983   N  N   . GLY A 1 128 ? 8.784   -0.744  39.199  1.00 5.42  ? 128  GLY A N   1 
ATOM   984   C  CA  . GLY A 1 128 ? 8.384   0.201   40.226  1.00 6.15  ? 128  GLY A CA  1 
ATOM   985   C  C   . GLY A 1 128 ? 9.462   0.405   41.290  1.00 7.15  ? 128  GLY A C   1 
ATOM   986   O  O   . GLY A 1 128 ? 10.578  -0.077  41.143  1.00 6.94  ? 128  GLY A O   1 
ATOM   987   N  N   . ASN A 1 129 ? 9.099   1.139   42.349  1.00 7.53  ? 129  ASN A N   1 
ATOM   988   C  CA  . ASN A 1 129 ? 9.921   1.358   43.539  1.00 7.65  ? 129  ASN A CA  1 
ATOM   989   C  C   . ASN A 1 129 ? 9.109   0.927   44.773  1.00 8.29  ? 129  ASN A C   1 
ATOM   990   O  O   . ASN A 1 129 ? 7.890   0.736   44.675  1.00 8.73  ? 129  ASN A O   1 
ATOM   991   C  CB  . ASN A 1 129 ? 10.290  2.841   43.664  1.00 7.18  ? 129  ASN A CB  1 
ATOM   992   C  CG  . ASN A 1 129 ? 11.503  3.236   42.816  1.00 6.20  ? 129  ASN A CG  1 
ATOM   993   O  OD1 . ASN A 1 129 ? 12.328  2.399   42.464  1.00 4.23  ? 129  ASN A OD1 1 
ATOM   994   N  ND2 . ASN A 1 129 ? 11.633  4.536   42.532  1.00 2.44  ? 129  ASN A ND2 1 
ATOM   995   N  N   . ASN A 1 130 ? 9.758   0.772   45.929  1.00 8.32  ? 130  ASN A N   1 
ATOM   996   C  CA  . ASN A 1 130 ? 9.005   0.477   47.148  1.00 8.22  ? 130  ASN A CA  1 
ATOM   997   C  C   . ASN A 1 130 ? 8.075   1.627   47.511  1.00 7.63  ? 130  ASN A C   1 
ATOM   998   O  O   . ASN A 1 130 ? 6.898   1.420   47.817  1.00 7.00  ? 130  ASN A O   1 
ATOM   999   C  CB  . ASN A 1 130 ? 9.904   0.058   48.325  1.00 8.42  ? 130  ASN A CB  1 
ATOM   1000  C  CG  . ASN A 1 130 ? 10.978  1.102   48.680  1.00 9.78  ? 130  ASN A CG  1 
ATOM   1001  O  OD1 . ASN A 1 130 ? 11.442  1.881   47.837  1.00 7.71  ? 130  ASN A OD1 1 
ATOM   1002  N  ND2 . ASN A 1 130 ? 11.384  1.099   49.950  1.00 10.26 ? 130  ASN A ND2 1 
ATOM   1003  N  N   . LEU A 1 131 ? 8.614   2.837   47.405  1.00 7.74  ? 131  LEU A N   1 
ATOM   1004  C  CA  . LEU A 1 131 ? 7.926   4.053   47.792  1.00 7.63  ? 131  LEU A CA  1 
ATOM   1005  C  C   . LEU A 1 131 ? 6.884   4.409   46.732  1.00 7.56  ? 131  LEU A C   1 
ATOM   1006  O  O   . LEU A 1 131 ? 7.158   4.285   45.541  1.00 7.30  ? 131  LEU A O   1 
ATOM   1007  C  CB  . LEU A 1 131 ? 8.937   5.188   47.995  1.00 7.76  ? 131  LEU A CB  1 
ATOM   1008  C  CG  . LEU A 1 131 ? 10.082  4.963   48.991  1.00 7.70  ? 131  LEU A CG  1 
ATOM   1009  C  CD1 . LEU A 1 131 ? 10.905  6.233   49.153  1.00 6.36  ? 131  LEU A CD1 1 
ATOM   1010  C  CD2 . LEU A 1 131 ? 9.577   4.468   50.353  1.00 6.62  ? 131  LEU A CD2 1 
ATOM   1011  N  N   . PRO A 1 132 ? 5.680   4.805   47.178  1.00 7.70  ? 132  PRO A N   1 
ATOM   1012  C  CA  . PRO A 1 132 ? 4.493   4.914   46.341  1.00 8.07  ? 132  PRO A CA  1 
ATOM   1013  C  C   . PRO A 1 132 ? 4.399   6.202   45.502  1.00 7.92  ? 132  PRO A C   1 
ATOM   1014  O  O   . PRO A 1 132 ? 3.522   6.293   44.639  1.00 7.76  ? 132  PRO A O   1 
ATOM   1015  C  CB  . PRO A 1 132 ? 3.349   4.832   47.364  1.00 8.13  ? 132  PRO A CB  1 
ATOM   1016  C  CG  . PRO A 1 132 ? 3.891   5.520   48.566  1.00 7.60  ? 132  PRO A CG  1 
ATOM   1017  C  CD  . PRO A 1 132 ? 5.373   5.153   48.584  1.00 8.45  ? 132  PRO A CD  1 
ATOM   1018  N  N   . VAL A 1 133 ? 5.319   7.148   45.717  1.00 7.46  ? 133  VAL A N   1 
ATOM   1019  C  CA  . VAL A 1 133 ? 5.346   8.392   44.938  1.00 6.72  ? 133  VAL A CA  1 
ATOM   1020  C  C   . VAL A 1 133 ? 6.748   8.686   44.411  1.00 7.18  ? 133  VAL A C   1 
ATOM   1021  O  O   . VAL A 1 133 ? 7.690   7.934   44.727  1.00 6.98  ? 133  VAL A O   1 
ATOM   1022  C  CB  . VAL A 1 133 ? 4.774   9.593   45.750  1.00 6.67  ? 133  VAL A CB  1 
ATOM   1023  C  CG1 . VAL A 1 133 ? 3.350   9.285   46.211  1.00 4.69  ? 133  VAL A CG1 1 
ATOM   1024  C  CG2 . VAL A 1 133 ? 5.647   9.888   46.963  1.00 5.94  ? 133  VAL A CG2 1 
ATOM   1025  N  N   . PHE A 1 134 ? 6.870   9.746   43.588  1.00 7.08  ? 134  PHE A N   1 
ATOM   1026  C  CA  . PHE A 1 134 ? 8.160   10.220  43.091  1.00 6.88  ? 134  PHE A CA  1 
ATOM   1027  C  C   . PHE A 1 134 ? 8.439   11.700  43.382  1.00 7.65  ? 134  PHE A C   1 
ATOM   1028  O  O   . PHE A 1 134 ? 7.521   12.455  43.771  1.00 8.38  ? 134  PHE A O   1 
ATOM   1029  C  CB  . PHE A 1 134 ? 8.335   9.914   41.593  1.00 7.13  ? 134  PHE A CB  1 
ATOM   1030  C  CG  . PHE A 1 134 ? 9.736   9.564   41.218  1.00 5.23  ? 134  PHE A CG  1 
ATOM   1031  C  CD1 . PHE A 1 134 ? 10.463  10.383  40.376  1.00 6.36  ? 134  PHE A CD1 1 
ATOM   1032  C  CD2 . PHE A 1 134 ? 10.355  8.426   41.758  1.00 6.85  ? 134  PHE A CD2 1 
ATOM   1033  C  CE1 . PHE A 1 134 ? 11.797  10.063  40.009  1.00 5.68  ? 134  PHE A CE1 1 
ATOM   1034  C  CE2 . PHE A 1 134 ? 11.682  8.101   41.441  1.00 6.68  ? 134  PHE A CE2 1 
ATOM   1035  C  CZ  . PHE A 1 134 ? 12.403  8.922   40.531  1.00 6.68  ? 134  PHE A CZ  1 
ATOM   1036  N  N   . PHE A 1 135 ? 9.701   12.107  43.209  1.00 6.97  ? 135  PHE A N   1 
ATOM   1037  C  CA  . PHE A 1 135 ? 10.124  13.482  43.504  1.00 7.08  ? 135  PHE A CA  1 
ATOM   1038  C  C   . PHE A 1 135 ? 9.551   14.489  42.505  1.00 7.32  ? 135  PHE A C   1 
ATOM   1039  O  O   . PHE A 1 135 ? 9.365   15.648  42.845  1.00 8.12  ? 135  PHE A O   1 
ATOM   1040  C  CB  . PHE A 1 135 ? 11.655  13.651  43.501  1.00 6.73  ? 135  PHE A CB  1 
ATOM   1041  C  CG  . PHE A 1 135 ? 12.433  12.682  44.414  1.00 6.44  ? 135  PHE A CG  1 
ATOM   1042  C  CD1 . PHE A 1 135 ? 12.806  11.413  43.958  1.00 5.93  ? 135  PHE A CD1 1 
ATOM   1043  C  CD2 . PHE A 1 135 ? 12.859  13.084  45.667  1.00 4.85  ? 135  PHE A CD2 1 
ATOM   1044  C  CE1 . PHE A 1 135 ? 13.548  10.544  44.751  1.00 7.11  ? 135  PHE A CE1 1 
ATOM   1045  C  CE2 . PHE A 1 135 ? 13.620  12.241  46.471  1.00 8.02  ? 135  PHE A CE2 1 
ATOM   1046  C  CZ  . PHE A 1 135 ? 13.967  10.952  46.013  1.00 7.32  ? 135  PHE A CZ  1 
ATOM   1047  N  N   . ILE A 1 136 ? 9.286   14.039  41.283  1.00 7.05  ? 136  ILE A N   1 
ATOM   1048  C  CA  . ILE A 1 136 ? 9.007   14.905  40.125  1.00 7.12  ? 136  ILE A CA  1 
ATOM   1049  C  C   . ILE A 1 136 ? 7.851   14.311  39.300  1.00 7.45  ? 136  ILE A C   1 
ATOM   1050  O  O   . ILE A 1 136 ? 7.482   13.154  39.477  1.00 8.20  ? 136  ILE A O   1 
ATOM   1051  C  CB  . ILE A 1 136 ? 10.288  15.128  39.207  1.00 7.27  ? 136  ILE A CB  1 
ATOM   1052  C  CG1 . ILE A 1 136 ? 10.870  13.803  38.676  1.00 7.03  ? 136  ILE A CG1 1 
ATOM   1053  C  CG2 . ILE A 1 136 ? 11.379  15.884  39.929  1.00 7.59  ? 136  ILE A CG2 1 
ATOM   1054  C  CD1 . ILE A 1 136 ? 11.821  13.990  37.509  1.00 5.29  ? 136  ILE A CD1 1 
ATOM   1055  N  N   . ARG A 1 137 ? 7.274   15.090  38.408  1.00 8.32  ? 137  ARG A N   1 
ATOM   1056  C  CA  . ARG A 1 137 ? 6.092   14.624  37.676  1.00 9.75  ? 137  ARG A CA  1 
ATOM   1057  C  C   . ARG A 1 137 ? 6.203   14.704  36.152  1.00 9.85  ? 137  ARG A C   1 
ATOM   1058  O  O   . ARG A 1 137 ? 5.225   14.454  35.460  1.00 10.53 ? 137  ARG A O   1 
ATOM   1059  C  CB  . ARG A 1 137 ? 4.822   15.338  38.167  1.00 10.00 ? 137  ARG A CB  1 
ATOM   1060  C  CG  . ARG A 1 137 ? 4.724   16.849  37.806  1.00 10.08 ? 137  ARG A CG  1 
ATOM   1061  C  CD  . ARG A 1 137 ? 3.399   17.415  38.359  1.00 10.83 ? 137  ARG A CD  1 
ATOM   1062  N  NE  . ARG A 1 137 ? 3.678   18.709  38.962  1.00 15.82 ? 137  ARG A NE  1 
ATOM   1063  C  CZ  . ARG A 1 137 ? 3.434   19.056  40.221  1.00 14.70 ? 137  ARG A CZ  1 
ATOM   1064  N  NH1 . ARG A 1 137 ? 2.799   18.246  41.074  1.00 13.23 ? 137  ARG A NH1 1 
ATOM   1065  N  NH2 . ARG A 1 137 ? 3.795   20.264  40.604  1.00 16.60 ? 137  ARG A NH2 1 
ATOM   1066  N  N   . ASP A 1 138 ? 7.386   15.064  35.647  1.00 9.90  ? 138  ASP A N   1 
ATOM   1067  C  CA  . ASP A 1 138 ? 7.637   15.158  34.210  1.00 9.44  ? 138  ASP A CA  1 
ATOM   1068  C  C   . ASP A 1 138 ? 9.078   14.674  33.937  1.00 9.31  ? 138  ASP A C   1 
ATOM   1069  O  O   . ASP A 1 138 ? 10.018  15.029  34.666  1.00 8.99  ? 138  ASP A O   1 
ATOM   1070  C  CB  . ASP A 1 138 ? 7.445   16.604  33.728  1.00 8.95  ? 138  ASP A CB  1 
ATOM   1071  C  CG  . ASP A 1 138 ? 7.406   16.721  32.206  1.00 10.97 ? 138  ASP A CG  1 
ATOM   1072  O  OD1 . ASP A 1 138 ? 8.304   16.141  31.517  1.00 8.92  ? 138  ASP A OD1 1 
ATOM   1073  O  OD2 . ASP A 1 138 ? 6.465   17.402  31.689  1.00 11.09 ? 138  ASP A OD2 1 
ATOM   1074  N  N   . ALA A 1 139 ? 9.230   13.867  32.883  1.00 9.04  ? 139  ALA A N   1 
ATOM   1075  C  CA  . ALA A 1 139 ? 10.488  13.233  32.527  1.00 8.50  ? 139  ALA A CA  1 
ATOM   1076  C  C   . ALA A 1 139 ? 11.568  14.265  32.199  1.00 8.67  ? 139  ALA A C   1 
ATOM   1077  O  O   . ALA A 1 139 ? 12.763  13.981  32.339  1.00 8.35  ? 139  ALA A O   1 
ATOM   1078  C  CB  . ALA A 1 139 ? 10.276  12.305  31.360  1.00 8.15  ? 139  ALA A CB  1 
ATOM   1079  N  N   . MET A 1 140 ? 11.133  15.464  31.791  1.00 8.59  ? 140  MET A N   1 
ATOM   1080  C  CA  . MET A 1 140 ? 12.019  16.596  31.461  1.00 8.73  ? 140  MET A CA  1 
ATOM   1081  C  C   . MET A 1 140 ? 12.991  16.915  32.593  1.00 8.33  ? 140  MET A C   1 
ATOM   1082  O  O   . MET A 1 140 ? 14.096  17.409  32.344  1.00 8.36  ? 140  MET A O   1 
ATOM   1083  C  CB  . MET A 1 140 ? 11.195  17.856  31.127  1.00 9.43  ? 140  MET A CB  1 
ATOM   1084  C  CG  . MET A 1 140 ? 12.009  19.053  30.576  1.00 11.02 ? 140  MET A CG  1 
ATOM   1085  S  SD  . MET A 1 140 ? 12.856  18.734  29.003  1.00 15.42 ? 140  MET A SD  1 
ATOM   1086  C  CE  . MET A 1 140 ? 11.489  18.971  27.861  1.00 11.69 ? 140  MET A CE  1 
ATOM   1087  N  N   . LYS A 1 141 ? 12.586  16.620  33.830  1.00 7.66  ? 141  LYS A N   1 
ATOM   1088  C  CA  . LYS A 1 141 ? 13.398  16.978  34.996  1.00 6.79  ? 141  LYS A CA  1 
ATOM   1089  C  C   . LYS A 1 141 ? 14.280  15.871  35.512  1.00 6.46  ? 141  LYS A C   1 
ATOM   1090  O  O   . LYS A 1 141 ? 15.097  16.120  36.378  1.00 6.37  ? 141  LYS A O   1 
ATOM   1091  C  CB  . LYS A 1 141 ? 12.539  17.510  36.137  1.00 6.42  ? 141  LYS A CB  1 
ATOM   1092  C  CG  . LYS A 1 141 ? 11.694  18.751  35.813  1.00 7.76  ? 141  LYS A CG  1 
ATOM   1093  C  CD  . LYS A 1 141 ? 12.534  19.902  35.201  1.00 8.94  ? 141  LYS A CD  1 
ATOM   1094  C  CE  . LYS A 1 141 ? 13.828  20.194  35.969  1.00 9.98  ? 141  LYS A CE  1 
ATOM   1095  N  NZ  . LYS A 1 141 ? 14.622  21.219  35.212  1.00 11.09 ? 141  LYS A NZ  1 
ATOM   1096  N  N   . PHE A 1 142 ? 14.117  14.660  34.981  1.00 6.59  ? 142  PHE A N   1 
ATOM   1097  C  CA  . PHE A 1 142 ? 14.758  13.464  35.559  1.00 7.19  ? 142  PHE A CA  1 
ATOM   1098  C  C   . PHE A 1 142 ? 16.302  13.507  35.536  1.00 6.87  ? 142  PHE A C   1 
ATOM   1099  O  O   . PHE A 1 142 ? 16.944  13.221  36.552  1.00 6.42  ? 142  PHE A O   1 
ATOM   1100  C  CB  . PHE A 1 142 ? 14.223  12.158  34.915  1.00 7.59  ? 142  PHE A CB  1 
ATOM   1101  C  CG  . PHE A 1 142 ? 14.724  10.908  35.594  1.00 9.05  ? 142  PHE A CG  1 
ATOM   1102  C  CD1 . PHE A 1 142 ? 14.217  10.523  36.843  1.00 9.63  ? 142  PHE A CD1 1 
ATOM   1103  C  CD2 . PHE A 1 142 ? 15.717  10.121  35.002  1.00 7.54  ? 142  PHE A CD2 1 
ATOM   1104  C  CE1 . PHE A 1 142 ? 14.693  9.364   37.485  1.00 7.92  ? 142  PHE A CE1 1 
ATOM   1105  C  CE2 . PHE A 1 142 ? 16.176  8.972   35.632  1.00 6.60  ? 142  PHE A CE2 1 
ATOM   1106  C  CZ  . PHE A 1 142 ? 15.672  8.596   36.877  1.00 6.07  ? 142  PHE A CZ  1 
ATOM   1107  N  N   . PRO A 1 143 ? 16.901  13.865  34.376  1.00 6.87  ? 143  PRO A N   1 
ATOM   1108  C  CA  . PRO A 1 143 ? 18.371  14.023  34.378  1.00 7.18  ? 143  PRO A CA  1 
ATOM   1109  C  C   . PRO A 1 143 ? 18.862  15.023  35.418  1.00 7.20  ? 143  PRO A C   1 
ATOM   1110  O  O   . PRO A 1 143 ? 19.807  14.707  36.136  1.00 7.78  ? 143  PRO A O   1 
ATOM   1111  C  CB  . PRO A 1 143 ? 18.677  14.478  32.943  1.00 6.84  ? 143  PRO A CB  1 
ATOM   1112  C  CG  . PRO A 1 143 ? 17.561  13.884  32.152  1.00 6.01  ? 143  PRO A CG  1 
ATOM   1113  C  CD  . PRO A 1 143 ? 16.350  14.085  33.030  1.00 5.80  ? 143  PRO A CD  1 
ATOM   1114  N  N   . ASP A 1 144 ? 18.186  16.169  35.548  1.00 7.16  ? 144  ASP A N   1 
ATOM   1115  C  CA  . ASP A 1 144 ? 18.510  17.159  36.574  1.00 7.80  ? 144  ASP A CA  1 
ATOM   1116  C  C   . ASP A 1 144 ? 18.439  16.601  37.991  1.00 8.14  ? 144  ASP A C   1 
ATOM   1117  O  O   . ASP A 1 144 ? 19.363  16.772  38.793  1.00 8.04  ? 144  ASP A O   1 
ATOM   1118  C  CB  . ASP A 1 144 ? 17.580  18.359  36.453  1.00 7.97  ? 144  ASP A CB  1 
ATOM   1119  C  CG  . ASP A 1 144 ? 17.676  19.035  35.109  1.00 9.26  ? 144  ASP A CG  1 
ATOM   1120  O  OD1 . ASP A 1 144 ? 16.651  19.030  34.383  1.00 11.64 ? 144  ASP A OD1 1 
ATOM   1121  O  OD2 . ASP A 1 144 ? 18.767  19.569  34.771  1.00 11.05 ? 144  ASP A OD2 1 
ATOM   1122  N  N   . MET A 1 145 ? 17.333  15.932  38.301  1.00 8.87  ? 145  MET A N   1 
ATOM   1123  C  CA  . MET A 1 145 ? 17.123  15.386  39.635  1.00 9.37  ? 145  MET A CA  1 
ATOM   1124  C  C   . MET A 1 145 ? 18.260  14.416  39.970  1.00 8.83  ? 145  MET A C   1 
ATOM   1125  O  O   . MET A 1 145 ? 18.899  14.542  41.003  1.00 9.38  ? 145  MET A O   1 
ATOM   1126  C  CB  . MET A 1 145 ? 15.752  14.692  39.717  1.00 9.09  ? 145  MET A CB  1 
ATOM   1127  C  CG  . MET A 1 145 ? 15.392  14.152  41.106  1.00 9.15  ? 145  MET A CG  1 
ATOM   1128  S  SD  . MET A 1 145 ? 14.237  12.757  41.014  1.00 12.18 ? 145  MET A SD  1 
ATOM   1129  C  CE  . MET A 1 145 ? 15.377  11.403  40.738  1.00 10.84 ? 145  MET A CE  1 
ATOM   1130  N  N   . VAL A 1 146 ? 18.494  13.457  39.076  1.00 8.53  ? 146  VAL A N   1 
ATOM   1131  C  CA  . VAL A 1 146 ? 19.551  12.454  39.203  1.00 7.84  ? 146  VAL A CA  1 
ATOM   1132  C  C   . VAL A 1 146 ? 20.926  13.087  39.322  1.00 7.73  ? 146  VAL A C   1 
ATOM   1133  O  O   . VAL A 1 146 ? 21.697  12.715  40.197  1.00 7.88  ? 146  VAL A O   1 
ATOM   1134  C  CB  . VAL A 1 146 ? 19.497  11.469  38.019  1.00 8.16  ? 146  VAL A CB  1 
ATOM   1135  C  CG1 . VAL A 1 146 ? 20.739  10.629  37.933  1.00 6.72  ? 146  VAL A CG1 1 
ATOM   1136  C  CG2 . VAL A 1 146 ? 18.252  10.588  38.141  1.00 8.08  ? 146  VAL A CG2 1 
ATOM   1137  N  N   . HIS A 1 147 ? 21.226  14.061  38.461  1.00 7.75  ? 147  HIS A N   1 
ATOM   1138  C  CA  . HIS A 1 147 ? 22.512  14.786  38.527  1.00 7.25  ? 147  HIS A CA  1 
ATOM   1139  C  C   . HIS A 1 147 ? 22.706  15.454  39.850  1.00 7.15  ? 147  HIS A C   1 
ATOM   1140  O  O   . HIS A 1 147 ? 23.822  15.457  40.372  1.00 8.03  ? 147  HIS A O   1 
ATOM   1141  C  CB  . HIS A 1 147 ? 22.645  15.805  37.398  1.00 6.83  ? 147  HIS A CB  1 
ATOM   1142  C  CG  . HIS A 1 147 ? 22.964  15.180  36.086  1.00 7.83  ? 147  HIS A CG  1 
ATOM   1143  N  ND1 . HIS A 1 147 ? 23.293  15.914  34.964  1.00 10.06 ? 147  HIS A ND1 1 
ATOM   1144  C  CD2 . HIS A 1 147 ? 23.005  13.877  35.713  1.00 9.15  ? 147  HIS A CD2 1 
ATOM   1145  C  CE1 . HIS A 1 147 ? 23.506  15.092  33.951  1.00 10.72 ? 147  HIS A CE1 1 
ATOM   1146  N  NE2 . HIS A 1 147 ? 23.339  13.848  34.380  1.00 11.23 ? 147  HIS A NE2 1 
ATOM   1147  N  N   . SER A 1 148 ? 21.615  15.989  40.413  1.00 6.84  ? 148  SER A N   1 
ATOM   1148  C  CA  . SER A 1 148 ? 21.658  16.624  41.726  1.00 5.98  ? 148  SER A CA  1 
ATOM   1149  C  C   . SER A 1 148 ? 21.886  15.633  42.888  1.00 5.53  ? 148  SER A C   1 
ATOM   1150  O  O   . SER A 1 148 ? 22.473  15.973  43.907  1.00 5.48  ? 148  SER A O   1 
ATOM   1151  C  CB  . SER A 1 148 ? 20.386  17.463  41.955  1.00 5.61  ? 148  SER A CB  1 
ATOM   1152  O  OG  . SER A 1 148 ? 19.361  16.729  42.620  1.00 5.10  ? 148  SER A OG  1 
ATOM   1153  N  N   . LEU A 1 149 ? 21.395  14.418  42.730  1.00 5.63  ? 149  LEU A N   1 
ATOM   1154  C  CA  . LEU A 1 149 ? 21.449  13.418  43.792  1.00 5.82  ? 149  LEU A CA  1 
ATOM   1155  C  C   . LEU A 1 149 ? 22.729  12.620  43.667  1.00 6.55  ? 149  LEU A C   1 
ATOM   1156  O  O   . LEU A 1 149 ? 23.272  12.164  44.669  1.00 7.68  ? 149  LEU A O   1 
ATOM   1157  C  CB  . LEU A 1 149 ? 20.255  12.468  43.675  1.00 6.18  ? 149  LEU A CB  1 
ATOM   1158  C  CG  . LEU A 1 149 ? 18.869  12.853  44.218  1.00 5.15  ? 149  LEU A CG  1 
ATOM   1159  C  CD1 . LEU A 1 149 ? 17.817  12.030  43.527  1.00 4.37  ? 149  LEU A CD1 1 
ATOM   1160  C  CD2 . LEU A 1 149 ? 18.828  12.588  45.718  1.00 5.82  ? 149  LEU A CD2 1 
ATOM   1161  N  N   . LYS A 1 150 ? 23.217  12.463  42.435  1.00 6.24  ? 150  LYS A N   1 
ATOM   1162  C  CA  . LYS A 1 150 ? 24.461  11.739  42.167  1.00 6.31  ? 150  LYS A CA  1 
ATOM   1163  C  C   . LYS A 1 150 ? 25.645  12.391  42.869  1.00 6.64  ? 150  LYS A C   1 
ATOM   1164  O  O   . LYS A 1 150 ? 25.618  13.591  43.159  1.00 5.46  ? 150  LYS A O   1 
ATOM   1165  C  CB  . LYS A 1 150 ? 24.751  11.698  40.663  1.00 6.17  ? 150  LYS A CB  1 
ATOM   1166  C  CG  . LYS A 1 150 ? 23.916  10.675  39.884  1.00 5.99  ? 150  LYS A CG  1 
ATOM   1167  C  CD  . LYS A 1 150 ? 24.481  9.269   40.017  1.00 5.42  ? 150  LYS A CD  1 
ATOM   1168  C  CE  . LYS A 1 150 ? 23.612  8.314   39.260  1.00 8.70  ? 150  LYS A CE  1 
ATOM   1169  N  NZ  . LYS A 1 150 ? 24.215  6.970   39.244  1.00 11.09 ? 150  LYS A NZ  1 
ATOM   1170  N  N   . PRO A 1 151 ? 26.694  11.594  43.158  1.00 6.84  ? 151  PRO A N   1 
ATOM   1171  C  CA  . PRO A 1 151 ? 27.908  12.192  43.660  1.00 6.70  ? 151  PRO A CA  1 
ATOM   1172  C  C   . PRO A 1 151 ? 28.253  13.474  42.923  1.00 7.16  ? 151  PRO A C   1 
ATOM   1173  O  O   . PRO A 1 151 ? 28.107  13.568  41.691  1.00 6.99  ? 151  PRO A O   1 
ATOM   1174  C  CB  . PRO A 1 151 ? 28.935  11.116  43.362  1.00 6.47  ? 151  PRO A CB  1 
ATOM   1175  C  CG  . PRO A 1 151 ? 28.186  9.868   43.651  1.00 6.67  ? 151  PRO A CG  1 
ATOM   1176  C  CD  . PRO A 1 151 ? 26.812  10.125  43.083  1.00 6.33  ? 151  PRO A CD  1 
ATOM   1177  N  N   . ASP A 1 152 ? 28.683  14.463  43.689  1.00 8.07  ? 152  ASP A N   1 
ATOM   1178  C  CA  . ASP A 1 152 ? 29.287  15.683  43.148  1.00 9.07  ? 152  ASP A CA  1 
ATOM   1179  C  C   . ASP A 1 152 ? 30.317  15.318  42.075  1.00 8.83  ? 152  ASP A C   1 
ATOM   1180  O  O   . ASP A 1 152 ? 31.174  14.506  42.338  1.00 9.01  ? 152  ASP A O   1 
ATOM   1181  C  CB  . ASP A 1 152 ? 29.954  16.475  44.279  1.00 8.99  ? 152  ASP A CB  1 
ATOM   1182  C  CG  . ASP A 1 152 ? 30.565  17.766  43.802  1.00 11.32 ? 152  ASP A CG  1 
ATOM   1183  O  OD1 . ASP A 1 152 ? 31.517  17.723  42.981  1.00 14.73 ? 152  ASP A OD1 1 
ATOM   1184  O  OD2 . ASP A 1 152 ? 30.111  18.832  44.256  1.00 12.40 ? 152  ASP A OD2 1 
ATOM   1185  N  N   . PRO A 1 153 ? 30.207  15.906  40.867  1.00 9.14  ? 153  PRO A N   1 
ATOM   1186  C  CA  . PRO A 1 153 ? 31.012  15.555  39.687  1.00 9.38  ? 153  PRO A CA  1 
ATOM   1187  C  C   . PRO A 1 153 ? 32.507  15.882  39.781  1.00 10.21 ? 153  PRO A C   1 
ATOM   1188  O  O   . PRO A 1 153 ? 33.300  15.448  38.919  1.00 9.76  ? 153  PRO A O   1 
ATOM   1189  C  CB  . PRO A 1 153 ? 30.366  16.364  38.554  1.00 8.77  ? 153  PRO A CB  1 
ATOM   1190  C  CG  . PRO A 1 153 ? 29.641  17.439  39.193  1.00 8.48  ? 153  PRO A CG  1 
ATOM   1191  C  CD  . PRO A 1 153 ? 29.207  16.948  40.552  1.00 9.36  ? 153  PRO A CD  1 
ATOM   1192  N  N   . ARG A 1 154 ? 32.870  16.645  40.814  1.00 10.72 ? 154  ARG A N   1 
ATOM   1193  C  CA  . ARG A 1 154 ? 34.259  16.967  41.129  1.00 11.12 ? 154  ARG A CA  1 
ATOM   1194  C  C   . ARG A 1 154 ? 34.771  16.084  42.273  1.00 11.14 ? 154  ARG A C   1 
ATOM   1195  O  O   . ARG A 1 154 ? 35.830  15.454  42.166  1.00 11.19 ? 154  ARG A O   1 
ATOM   1196  C  CB  . ARG A 1 154 ? 34.350  18.447  41.497  1.00 11.55 ? 154  ARG A CB  1 
ATOM   1197  C  CG  . ARG A 1 154 ? 35.735  18.968  41.607  1.00 12.95 ? 154  ARG A CG  1 
ATOM   1198  C  CD  . ARG A 1 154 ? 35.799  20.447  41.265  1.00 14.57 ? 154  ARG A CD  1 
ATOM   1199  N  NE  . ARG A 1 154 ? 36.059  21.212  42.477  1.00 20.62 ? 154  ARG A NE  1 
ATOM   1200  C  CZ  . ARG A 1 154 ? 37.271  21.510  42.951  1.00 21.41 ? 154  ARG A CZ  1 
ATOM   1201  N  NH1 . ARG A 1 154 ? 37.366  22.207  44.079  1.00 22.50 ? 154  ARG A NH1 1 
ATOM   1202  N  NH2 . ARG A 1 154 ? 38.376  21.151  42.300  1.00 18.84 ? 154  ARG A NH2 1 
ATOM   1203  N  N   . THR A 1 155 ? 34.016  16.032  43.370  1.00 11.01 ? 155  THR A N   1 
ATOM   1204  C  CA  . THR A 1 155 ? 34.446  15.261  44.544  1.00 11.12 ? 155  THR A CA  1 
ATOM   1205  C  C   . THR A 1 155 ? 34.136  13.752  44.457  1.00 10.81 ? 155  THR A C   1 
ATOM   1206  O  O   . THR A 1 155 ? 34.765  12.940  45.149  1.00 11.11 ? 155  THR A O   1 
ATOM   1207  C  CB  . THR A 1 155 ? 33.852  15.838  45.846  1.00 11.06 ? 155  THR A CB  1 
ATOM   1208  O  OG1 . THR A 1 155 ? 32.459  15.526  45.913  1.00 12.04 ? 155  THR A OG1 1 
ATOM   1209  C  CG2 . THR A 1 155 ? 34.028  17.372  45.904  1.00 10.61 ? 155  THR A CG2 1 
ATOM   1210  N  N   . ASN A 1 156 ? 33.187  13.375  43.606  1.00 9.81  ? 156  ASN A N   1 
ATOM   1211  C  CA  . ASN A 1 156 ? 32.699  11.982  43.559  1.00 9.64  ? 156  ASN A CA  1 
ATOM   1212  C  C   . ASN A 1 156 ? 32.021  11.520  44.849  1.00 9.15  ? 156  ASN A C   1 
ATOM   1213  O  O   . ASN A 1 156 ? 32.058  10.330  45.184  1.00 9.12  ? 156  ASN A O   1 
ATOM   1214  C  CB  . ASN A 1 156 ? 33.817  10.985  43.184  1.00 9.64  ? 156  ASN A CB  1 
ATOM   1215  C  CG  . ASN A 1 156 ? 33.270  9.727   42.512  1.00 9.43  ? 156  ASN A CG  1 
ATOM   1216  O  OD1 . ASN A 1 156 ? 32.269  9.795   41.795  1.00 10.18 ? 156  ASN A OD1 1 
ATOM   1217  N  ND2 . ASN A 1 156 ? 33.910  8.581   42.751  1.00 5.86  ? 156  ASN A ND2 1 
ATOM   1218  N  N   . ILE A 1 157 ? 31.405  12.458  45.570  1.00 8.53  ? 157  ILE A N   1 
ATOM   1219  C  CA  . ILE A 1 157 ? 30.780  12.154  46.848  1.00 8.37  ? 157  ILE A CA  1 
ATOM   1220  C  C   . ILE A 1 157 ? 29.420  12.831  46.853  1.00 8.49  ? 157  ILE A C   1 
ATOM   1221  O  O   . ILE A 1 157 ? 29.297  13.989  46.420  1.00 8.60  ? 157  ILE A O   1 
ATOM   1222  C  CB  . ILE A 1 157 ? 31.659  12.598  48.076  1.00 8.76  ? 157  ILE A CB  1 
ATOM   1223  C  CG1 . ILE A 1 157 ? 32.960  11.774  48.135  1.00 8.92  ? 157  ILE A CG1 1 
ATOM   1224  C  CG2 . ILE A 1 157 ? 30.871  12.441  49.410  1.00 8.26  ? 157  ILE A CG2 1 
ATOM   1225  C  CD1 . ILE A 1 157 ? 33.773  11.894  49.428  1.00 7.79  ? 157  ILE A CD1 1 
ATOM   1226  N  N   . GLN A 1 158 ? 28.390  12.102  47.284  1.00 7.63  ? 158  GLN A N   1 
ATOM   1227  C  CA  . GLN A 1 158 ? 27.040  12.658  47.309  1.00 7.41  ? 158  GLN A CA  1 
ATOM   1228  C  C   . GLN A 1 158 ? 26.992  13.836  48.267  1.00 6.92  ? 158  GLN A C   1 
ATOM   1229  O  O   . GLN A 1 158 ? 27.511  13.749  49.350  1.00 6.82  ? 158  GLN A O   1 
ATOM   1230  C  CB  . GLN A 1 158 ? 26.008  11.602  47.748  1.00 7.24  ? 158  GLN A CB  1 
ATOM   1231  C  CG  . GLN A 1 158 ? 24.579  12.071  47.578  1.00 5.92  ? 158  GLN A CG  1 
ATOM   1232  C  CD  . GLN A 1 158 ? 23.564  11.006  47.935  1.00 7.33  ? 158  GLN A CD  1 
ATOM   1233  O  OE1 . GLN A 1 158 ? 23.595  10.436  49.027  1.00 9.12  ? 158  GLN A OE1 1 
ATOM   1234  N  NE2 . GLN A 1 158 ? 22.655  10.743  47.026  1.00 4.43  ? 158  GLN A NE2 1 
ATOM   1235  N  N   . ASP A 1 159 ? 26.361  14.930  47.873  1.00 7.24  ? 159  ASP A N   1 
ATOM   1236  C  CA  . ASP A 1 159 ? 26.345  16.115  48.731  1.00 7.63  ? 159  ASP A CA  1 
ATOM   1237  C  C   . ASP A 1 159 ? 24.924  16.650  48.810  1.00 7.51  ? 159  ASP A C   1 
ATOM   1238  O  O   . ASP A 1 159 ? 24.381  17.080  47.807  1.00 7.55  ? 159  ASP A O   1 
ATOM   1239  C  CB  . ASP A 1 159 ? 27.350  17.177  48.236  1.00 7.07  ? 159  ASP A CB  1 
ATOM   1240  C  CG  . ASP A 1 159 ? 27.325  18.473  49.069  1.00 9.48  ? 159  ASP A CG  1 
ATOM   1241  O  OD1 . ASP A 1 159 ? 28.132  19.388  48.751  1.00 10.66 ? 159  ASP A OD1 1 
ATOM   1242  O  OD2 . ASP A 1 159 ? 26.517  18.597  50.034  1.00 8.60  ? 159  ASP A OD2 1 
ATOM   1243  N  N   . PRO A 1 160 ? 24.318  16.600  50.014  1.00 7.90  ? 160  PRO A N   1 
ATOM   1244  C  CA  . PRO A 1 160 ? 22.978  17.097  50.258  1.00 8.05  ? 160  PRO A CA  1 
ATOM   1245  C  C   . PRO A 1 160 ? 22.814  18.562  49.898  1.00 8.48  ? 160  PRO A C   1 
ATOM   1246  O  O   . PRO A 1 160 ? 21.722  18.991  49.537  1.00 8.64  ? 160  PRO A O   1 
ATOM   1247  C  CB  . PRO A 1 160 ? 22.800  16.890  51.776  1.00 8.40  ? 160  PRO A CB  1 
ATOM   1248  C  CG  . PRO A 1 160 ? 23.683  15.716  52.088  1.00 7.76  ? 160  PRO A CG  1 
ATOM   1249  C  CD  . PRO A 1 160 ? 24.910  16.025  51.249  1.00 8.08  ? 160  PRO A CD  1 
ATOM   1250  N  N   . ASP A 1 161 ? 23.881  19.337  50.010  1.00 9.21  ? 161  ASP A N   1 
ATOM   1251  C  CA  . ASP A 1 161 ? 23.820  20.736  49.594  1.00 9.96  ? 161  ASP A CA  1 
ATOM   1252  C  C   . ASP A 1 161 ? 23.368  20.838  48.136  1.00 9.88  ? 161  ASP A C   1 
ATOM   1253  O  O   . ASP A 1 161 ? 22.663  21.786  47.765  1.00 10.07 ? 161  ASP A O   1 
ATOM   1254  C  CB  . ASP A 1 161 ? 25.177  21.410  49.782  1.00 10.25 ? 161  ASP A CB  1 
ATOM   1255  C  CG  . ASP A 1 161 ? 25.130  22.885  49.504  1.00 11.97 ? 161  ASP A CG  1 
ATOM   1256  O  OD1 . ASP A 1 161 ? 24.695  23.649  50.395  1.00 12.73 ? 161  ASP A OD1 1 
ATOM   1257  O  OD2 . ASP A 1 161 ? 25.532  23.280  48.384  1.00 15.41 ? 161  ASP A OD2 1 
ATOM   1258  N  N   . ARG A 1 162 ? 23.761  19.852  47.324  1.00 9.35  ? 162  ARG A N   1 
ATOM   1259  C  CA  . ARG A 1 162 ? 23.428  19.828  45.905  1.00 9.47  ? 162  ARG A CA  1 
ATOM   1260  C  C   . ARG A 1 162 ? 21.975  19.355  45.617  1.00 10.01 ? 162  ARG A C   1 
ATOM   1261  O  O   . ARG A 1 162 ? 21.237  20.014  44.886  1.00 9.82  ? 162  ARG A O   1 
ATOM   1262  C  CB  . ARG A 1 162 ? 24.456  18.991  45.131  1.00 9.70  ? 162  ARG A CB  1 
ATOM   1263  C  CG  . ARG A 1 162 ? 25.930  19.392  45.365  1.00 9.65  ? 162  ARG A CG  1 
ATOM   1264  C  CD  . ARG A 1 162 ? 26.923  18.559  44.535  1.00 8.21  ? 162  ARG A CD  1 
ATOM   1265  N  NE  . ARG A 1 162 ? 26.803  18.869  43.100  1.00 6.79  ? 162  ARG A NE  1 
ATOM   1266  C  CZ  . ARG A 1 162 ? 26.104  18.140  42.224  1.00 5.30  ? 162  ARG A CZ  1 
ATOM   1267  N  NH1 . ARG A 1 162 ? 25.463  17.035  42.615  1.00 2.27  ? 162  ARG A NH1 1 
ATOM   1268  N  NH2 . ARG A 1 162 ? 26.054  18.512  40.950  1.00 5.50  ? 162  ARG A NH2 1 
ATOM   1269  N  N   . TYR A 1 163 ? 21.568  18.227  46.206  1.00 9.81  ? 163  TYR A N   1 
ATOM   1270  C  CA  . TYR A 1 163 ? 20.224  17.712  45.991  1.00 9.60  ? 163  TYR A CA  1 
ATOM   1271  C  C   . TYR A 1 163 ? 19.080  18.463  46.694  1.00 8.94  ? 163  TYR A C   1 
ATOM   1272  O  O   . TYR A 1 163 ? 17.988  18.593  46.133  1.00 8.03  ? 163  TYR A O   1 
ATOM   1273  C  CB  . TYR A 1 163 ? 20.139  16.184  46.184  1.00 10.14 ? 163  TYR A CB  1 
ATOM   1274  C  CG  . TYR A 1 163 ? 20.433  15.573  47.553  1.00 9.82  ? 163  TYR A CG  1 
ATOM   1275  C  CD1 . TYR A 1 163 ? 19.550  15.736  48.618  1.00 12.18 ? 163  TYR A CD1 1 
ATOM   1276  C  CD2 . TYR A 1 163 ? 21.524  14.728  47.740  1.00 9.76  ? 163  TYR A CD2 1 
ATOM   1277  C  CE1 . TYR A 1 163 ? 19.770  15.115  49.855  1.00 11.06 ? 163  TYR A CE1 1 
ATOM   1278  C  CE2 . TYR A 1 163 ? 21.755  14.094  48.983  1.00 9.87  ? 163  TYR A CE2 1 
ATOM   1279  C  CZ  . TYR A 1 163 ? 20.866  14.293  50.026  1.00 10.22 ? 163  TYR A CZ  1 
ATOM   1280  O  OH  . TYR A 1 163 ? 21.067  13.707  51.260  1.00 9.64  ? 163  TYR A OH  1 
ATOM   1281  N  N   . TRP A 1 164 ? 19.331  18.959  47.901  1.00 8.76  ? 164  TRP A N   1 
ATOM   1282  C  CA  . TRP A 1 164 ? 18.384  19.856  48.566  1.00 8.26  ? 164  TRP A CA  1 
ATOM   1283  C  C   . TRP A 1 164 ? 18.153  21.161  47.794  1.00 8.64  ? 164  TRP A C   1 
ATOM   1284  O  O   . TRP A 1 164 ? 17.047  21.698  47.850  1.00 8.15  ? 164  TRP A O   1 
ATOM   1285  C  CB  . TRP A 1 164 ? 18.796  20.132  50.004  1.00 8.23  ? 164  TRP A CB  1 
ATOM   1286  C  CG  . TRP A 1 164 ? 18.361  19.043  50.931  1.00 7.69  ? 164  TRP A CG  1 
ATOM   1287  C  CD1 . TRP A 1 164 ? 19.155  18.105  51.543  1.00 7.27  ? 164  TRP A CD1 1 
ATOM   1288  C  CD2 . TRP A 1 164 ? 17.024  18.760  51.326  1.00 6.94  ? 164  TRP A CD2 1 
ATOM   1289  N  NE1 . TRP A 1 164 ? 18.382  17.255  52.291  1.00 6.72  ? 164  TRP A NE1 1 
ATOM   1290  C  CE2 . TRP A 1 164 ? 17.068  17.635  52.172  1.00 7.69  ? 164  TRP A CE2 1 
ATOM   1291  C  CE3 . TRP A 1 164 ? 15.785  19.358  51.056  1.00 8.12  ? 164  TRP A CE3 1 
ATOM   1292  C  CZ2 . TRP A 1 164 ? 15.919  17.103  52.760  1.00 6.81  ? 164  TRP A CZ2 1 
ATOM   1293  C  CZ3 . TRP A 1 164 ? 14.645  18.820  51.628  1.00 7.01  ? 164  TRP A CZ3 1 
ATOM   1294  C  CH2 . TRP A 1 164 ? 14.722  17.703  52.467  1.00 7.33  ? 164  TRP A CH2 1 
ATOM   1295  N  N   . ASP A 1 165 ? 19.184  21.635  47.067  1.00 8.60  ? 165  ASP A N   1 
ATOM   1296  C  CA  . ASP A 1 165 ? 19.060  22.755  46.125  1.00 9.06  ? 165  ASP A CA  1 
ATOM   1297  C  C   . ASP A 1 165 ? 17.985  22.451  45.073  1.00 9.23  ? 165  ASP A C   1 
ATOM   1298  O  O   . ASP A 1 165 ? 16.972  23.155  44.987  1.00 10.00 ? 165  ASP A O   1 
ATOM   1299  C  CB  . ASP A 1 165 ? 20.406  23.068  45.423  1.00 8.94  ? 165  ASP A CB  1 
ATOM   1300  C  CG  . ASP A 1 165 ? 20.403  24.419  44.660  1.00 10.16 ? 165  ASP A CG  1 
ATOM   1301  O  OD1 . ASP A 1 165 ? 19.564  25.301  44.977  1.00 12.09 ? 165  ASP A OD1 1 
ATOM   1302  O  OD2 . ASP A 1 165 ? 21.256  24.619  43.761  1.00 9.20  ? 165  ASP A OD2 1 
ATOM   1303  N  N   . PHE A 1 166 ? 18.223  21.416  44.264  1.00 8.97  ? 166  PHE A N   1 
ATOM   1304  C  CA  . PHE A 1 166 ? 17.247  20.973  43.269  1.00 8.11  ? 166  PHE A CA  1 
ATOM   1305  C  C   . PHE A 1 166 ? 15.856  20.760  43.863  1.00 8.33  ? 166  PHE A C   1 
ATOM   1306  O  O   . PHE A 1 166 ? 14.869  21.270  43.334  1.00 8.32  ? 166  PHE A O   1 
ATOM   1307  C  CB  . PHE A 1 166 ? 17.694  19.693  42.546  1.00 7.01  ? 166  PHE A CB  1 
ATOM   1308  C  CG  . PHE A 1 166 ? 16.674  19.187  41.585  1.00 4.95  ? 166  PHE A CG  1 
ATOM   1309  C  CD1 . PHE A 1 166 ? 15.671  18.325  42.014  1.00 3.56  ? 166  PHE A CD1 1 
ATOM   1310  C  CD2 . PHE A 1 166 ? 16.641  19.662  40.265  1.00 4.19  ? 166  PHE A CD2 1 
ATOM   1311  C  CE1 . PHE A 1 166 ? 14.662  17.882  41.127  1.00 2.82  ? 166  PHE A CE1 1 
ATOM   1312  C  CE2 . PHE A 1 166 ? 15.646  19.223  39.373  1.00 3.82  ? 166  PHE A CE2 1 
ATOM   1313  C  CZ  . PHE A 1 166 ? 14.651  18.334  39.812  1.00 2.75  ? 166  PHE A CZ  1 
ATOM   1314  N  N   . MET A 1 167 ? 15.790  20.011  44.964  1.00 9.17  ? 167  MET A N   1 
ATOM   1315  C  CA  . MET A 1 167 ? 14.508  19.613  45.574  1.00 9.22  ? 167  MET A CA  1 
ATOM   1316  C  C   . MET A 1 167 ? 13.667  20.778  46.113  1.00 9.36  ? 167  MET A C   1 
ATOM   1317  O  O   . MET A 1 167 ? 12.460  20.835  45.878  1.00 8.84  ? 167  MET A O   1 
ATOM   1318  C  CB  . MET A 1 167 ? 14.740  18.596  46.681  1.00 9.17  ? 167  MET A CB  1 
ATOM   1319  C  CG  . MET A 1 167 ? 15.291  17.265  46.214  1.00 9.39  ? 167  MET A CG  1 
ATOM   1320  S  SD  . MET A 1 167 ? 14.269  16.438  44.981  1.00 8.93  ? 167  MET A SD  1 
ATOM   1321  C  CE  . MET A 1 167 ? 15.244  14.931  44.806  1.00 8.36  ? 167  MET A CE  1 
ATOM   1322  N  N   . THR A 1 168 ? 14.308  21.702  46.828  1.00 9.56  ? 168  THR A N   1 
ATOM   1323  C  CA  . THR A 1 168 ? 13.607  22.889  47.372  1.00 9.16  ? 168  THR A CA  1 
ATOM   1324  C  C   . THR A 1 168 ? 13.030  23.742  46.255  1.00 9.84  ? 168  THR A C   1 
ATOM   1325  O  O   . THR A 1 168 ? 11.931  24.300  46.396  1.00 9.96  ? 168  THR A O   1 
ATOM   1326  C  CB  . THR A 1 168 ? 14.519  23.780  48.273  1.00 8.97  ? 168  THR A CB  1 
ATOM   1327  O  OG1 . THR A 1 168 ? 15.728  24.145  47.577  1.00 7.40  ? 168  THR A OG1 1 
ATOM   1328  C  CG2 . THR A 1 168 ? 14.857  23.068  49.556  1.00 5.92  ? 168  THR A CG2 1 
ATOM   1329  N  N   . LEU A 1 169 ? 13.765  23.811  45.142  1.00 9.98  ? 169  LEU A N   1 
ATOM   1330  C  CA  . LEU A 1 169 ? 13.367  24.623  43.989  1.00 10.50 ? 169  LEU A CA  1 
ATOM   1331  C  C   . LEU A 1 169 ? 12.396  23.893  43.073  1.00 10.93 ? 169  LEU A C   1 
ATOM   1332  O  O   . LEU A 1 169 ? 11.840  24.487  42.154  1.00 11.30 ? 169  LEU A O   1 
ATOM   1333  C  CB  . LEU A 1 169 ? 14.602  25.068  43.203  1.00 10.15 ? 169  LEU A CB  1 
ATOM   1334  C  CG  . LEU A 1 169 ? 15.561  26.073  43.854  1.00 10.80 ? 169  LEU A CG  1 
ATOM   1335  C  CD1 . LEU A 1 169 ? 16.850  26.220  43.010  1.00 10.00 ? 169  LEU A CD1 1 
ATOM   1336  C  CD2 . LEU A 1 169 ? 14.863  27.443  44.077  1.00 9.45  ? 169  LEU A CD2 1 
ATOM   1337  N  N   . ARG A 1 170 ? 12.213  22.595  43.320  1.00 11.41 ? 170  ARG A N   1 
ATOM   1338  C  CA  . ARG A 1 170 ? 11.176  21.779  42.664  1.00 11.15 ? 170  ARG A CA  1 
ATOM   1339  C  C   . ARG A 1 170 ? 10.237  21.251  43.733  1.00 11.10 ? 170  ARG A C   1 
ATOM   1340  O  O   . ARG A 1 170 ? 10.296  20.063  44.086  1.00 11.54 ? 170  ARG A O   1 
ATOM   1341  C  CB  . ARG A 1 170 ? 11.827  20.644  41.874  1.00 11.44 ? 170  ARG A CB  1 
ATOM   1342  C  CG  . ARG A 1 170 ? 12.297  21.105  40.473  1.00 11.82 ? 170  ARG A CG  1 
ATOM   1343  C  CD  . ARG A 1 170 ? 11.094  21.059  39.522  1.00 14.01 ? 170  ARG A CD  1 
ATOM   1344  N  NE  . ARG A 1 170 ? 10.927  22.303  38.802  1.00 16.78 ? 170  ARG A NE  1 
ATOM   1345  C  CZ  . ARG A 1 170 ? 9.875   22.628  38.050  1.00 17.08 ? 170  ARG A CZ  1 
ATOM   1346  N  NH1 . ARG A 1 170 ? 8.845   21.804  37.882  1.00 13.41 ? 170  ARG A NH1 1 
ATOM   1347  N  NH2 . ARG A 1 170 ? 9.861   23.814  37.473  1.00 18.71 ? 170  ARG A NH2 1 
ATOM   1348  N  N   . PRO A 1 171 ? 9.392   22.146  44.294  1.00 10.51 ? 171  PRO A N   1 
ATOM   1349  C  CA  . PRO A 1 171 ? 8.645   21.844  45.530  1.00 9.86  ? 171  PRO A CA  1 
ATOM   1350  C  C   . PRO A 1 171 ? 7.618   20.724  45.433  1.00 9.78  ? 171  PRO A C   1 
ATOM   1351  O  O   . PRO A 1 171 ? 7.163   20.250  46.472  1.00 10.01 ? 171  PRO A O   1 
ATOM   1352  C  CB  . PRO A 1 171 ? 7.973   23.180  45.904  1.00 9.75  ? 171  PRO A CB  1 
ATOM   1353  C  CG  . PRO A 1 171 ? 7.998   24.021  44.673  1.00 9.92  ? 171  PRO A CG  1 
ATOM   1354  C  CD  . PRO A 1 171 ? 9.107   23.497  43.774  1.00 10.12 ? 171  PRO A CD  1 
ATOM   1355  N  N   . GLU A 1 172 ? 7.275   20.269  44.228  1.00 9.81  ? 172  GLU A N   1 
ATOM   1356  C  CA  . GLU A 1 172 ? 6.498   19.005  44.087  1.00 10.34 ? 172  GLU A CA  1 
ATOM   1357  C  C   . GLU A 1 172 ? 7.179   17.782  44.736  1.00 10.13 ? 172  GLU A C   1 
ATOM   1358  O  O   . GLU A 1 172 ? 6.540   16.750  44.973  1.00 10.48 ? 172  GLU A O   1 
ATOM   1359  C  CB  . GLU A 1 172 ? 6.144   18.696  42.614  1.00 10.38 ? 172  GLU A CB  1 
ATOM   1360  C  CG  . GLU A 1 172 ? 7.332   18.295  41.690  1.00 11.21 ? 172  GLU A CG  1 
ATOM   1361  C  CD  . GLU A 1 172 ? 8.011   19.505  41.040  1.00 14.63 ? 172  GLU A CD  1 
ATOM   1362  O  OE1 . GLU A 1 172 ? 8.600   19.343  39.942  1.00 14.85 ? 172  GLU A OE1 1 
ATOM   1363  O  OE2 . GLU A 1 172 ? 7.941   20.622  41.607  1.00 14.46 ? 172  GLU A OE2 1 
ATOM   1364  N  N   . SER A 1 173 ? 8.475   17.904  45.007  1.00 10.15 ? 173  SER A N   1 
ATOM   1365  C  CA  . SER A 1 173 ? 9.259   16.840  45.630  1.00 10.35 ? 173  SER A CA  1 
ATOM   1366  C  C   . SER A 1 173 ? 8.952   16.632  47.117  1.00 10.15 ? 173  SER A C   1 
ATOM   1367  O  O   . SER A 1 173 ? 9.443   15.662  47.728  1.00 11.38 ? 173  SER A O   1 
ATOM   1368  C  CB  . SER A 1 173 ? 10.726  17.173  45.501  1.00 10.02 ? 173  SER A CB  1 
ATOM   1369  O  OG  . SER A 1 173 ? 10.975  18.267  46.353  1.00 11.48 ? 173  SER A OG  1 
ATOM   1370  N  N   . THR A 1 174 ? 8.157   17.525  47.696  1.00 9.28  ? 174  THR A N   1 
ATOM   1371  C  CA  . THR A 1 174 ? 7.874   17.511  49.129  1.00 9.15  ? 174  THR A CA  1 
ATOM   1372  C  C   . THR A 1 174 ? 7.315   16.153  49.588  1.00 9.35  ? 174  THR A C   1 
ATOM   1373  O  O   . THR A 1 174 ? 7.870   15.525  50.468  1.00 9.91  ? 174  THR A O   1 
ATOM   1374  C  CB  . THR A 1 174 ? 6.934   18.698  49.501  1.00 9.13  ? 174  THR A CB  1 
ATOM   1375  O  OG1 . THR A 1 174 ? 7.471   19.907  48.958  1.00 9.85  ? 174  THR A OG1 1 
ATOM   1376  C  CG2 . THR A 1 174 ? 6.798   18.879  50.987  1.00 7.58  ? 174  THR A CG2 1 
ATOM   1377  N  N   . ASN A 1 175 ? 6.225   15.706  48.981  1.00 9.36  ? 175  ASN A N   1 
ATOM   1378  C  CA  . ASN A 1 175 ? 5.635   14.402  49.270  1.00 9.77  ? 175  ASN A CA  1 
ATOM   1379  C  C   . ASN A 1 175 ? 6.618   13.214  49.298  1.00 9.82  ? 175  ASN A C   1 
ATOM   1380  O  O   . ASN A 1 175 ? 6.572   12.409  50.216  1.00 8.90  ? 175  ASN A O   1 
ATOM   1381  C  CB  . ASN A 1 175 ? 4.491   14.120  48.278  1.00 9.99  ? 175  ASN A CB  1 
ATOM   1382  C  CG  . ASN A 1 175 ? 3.457   13.158  48.829  1.00 10.21 ? 175  ASN A CG  1 
ATOM   1383  O  OD1 . ASN A 1 175 ? 3.379   12.945  50.028  1.00 10.27 ? 175  ASN A OD1 1 
ATOM   1384  N  ND2 . ASN A 1 175 ? 2.637   12.598  47.948  1.00 11.74 ? 175  ASN A ND2 1 
ATOM   1385  N  N   . MET A 1 176 ? 7.481   13.100  48.280  1.00 10.03 ? 176  MET A N   1 
ATOM   1386  C  CA  . MET A 1 176 ? 8.510   12.062  48.232  1.00 9.79  ? 176  MET A CA  1 
ATOM   1387  C  C   . MET A 1 176 ? 9.507   12.207  49.395  1.00 10.62 ? 176  MET A C   1 
ATOM   1388  O  O   . MET A 1 176 ? 9.880   11.223  50.085  1.00 11.07 ? 176  MET A O   1 
ATOM   1389  C  CB  . MET A 1 176 ? 9.234   12.119  46.878  1.00 10.14 ? 176  MET A CB  1 
ATOM   1390  C  CG  . MET A 1 176 ? 10.250  10.983  46.608  1.00 8.59  ? 176  MET A CG  1 
ATOM   1391  S  SD  . MET A 1 176 ? 9.650   9.317   46.986  1.00 9.10  ? 176  MET A SD  1 
ATOM   1392  C  CE  . MET A 1 176 ? 10.780  8.421   45.898  1.00 5.65  ? 176  MET A CE  1 
ATOM   1393  N  N   . LEU A 1 177 ? 9.919   13.446  49.637  1.00 10.67 ? 177  LEU A N   1 
ATOM   1394  C  CA  . LEU A 1 177 ? 10.760  13.736  50.781  1.00 10.30 ? 177  LEU A CA  1 
ATOM   1395  C  C   . LEU A 1 177 ? 10.135  13.199  52.063  1.00 11.16 ? 177  LEU A C   1 
ATOM   1396  O  O   . LEU A 1 177 ? 10.848  12.613  52.864  1.00 11.89 ? 177  LEU A O   1 
ATOM   1397  C  CB  . LEU A 1 177 ? 11.062  15.233  50.852  1.00 9.83  ? 177  LEU A CB  1 
ATOM   1398  C  CG  . LEU A 1 177 ? 12.358  15.806  50.216  1.00 9.21  ? 177  LEU A CG  1 
ATOM   1399  C  CD1 . LEU A 1 177 ? 13.049  14.952  49.141  1.00 8.08  ? 177  LEU A CD1 1 
ATOM   1400  C  CD2 . LEU A 1 177 ? 12.103  17.182  49.674  1.00 8.06  ? 177  LEU A CD2 1 
ATOM   1401  N  N   . MET A 1 178 ? 8.813   13.362  52.244  1.00 11.54 ? 178  MET A N   1 
ATOM   1402  C  CA  . MET A 1 178 ? 8.106   12.813  53.415  1.00 11.89 ? 178  MET A CA  1 
ATOM   1403  C  C   . MET A 1 178 ? 8.282   11.311  53.583  1.00 12.18 ? 178  MET A C   1 
ATOM   1404  O  O   . MET A 1 178 ? 8.342   10.837  54.711  1.00 13.02 ? 178  MET A O   1 
ATOM   1405  C  CB  . MET A 1 178 ? 6.608   13.108  53.378  1.00 12.03 ? 178  MET A CB  1 
ATOM   1406  C  CG  . MET A 1 178 ? 6.236   14.550  53.562  1.00 12.50 ? 178  MET A CG  1 
ATOM   1407  S  SD  . MET A 1 178 ? 6.479   15.213  55.237  1.00 14.70 ? 178  MET A SD  1 
ATOM   1408  C  CE  . MET A 1 178 ? 5.743   16.818  54.912  1.00 14.61 ? 178  MET A CE  1 
ATOM   1409  N  N   . HIS A 1 179 ? 8.358   10.570  52.476  1.00 11.63 ? 179  HIS A N   1 
ATOM   1410  C  CA  . HIS A 1 179 ? 8.504   9.103   52.509  1.00 11.65 ? 179  HIS A CA  1 
ATOM   1411  C  C   . HIS A 1 179 ? 9.950   8.619   52.697  1.00 11.85 ? 179  HIS A C   1 
ATOM   1412  O  O   . HIS A 1 179 ? 10.233  7.699   53.463  1.00 11.62 ? 179  HIS A O   1 
ATOM   1413  C  CB  . HIS A 1 179 ? 7.969   8.505   51.205  1.00 11.47 ? 179  HIS A CB  1 
ATOM   1414  C  CG  . HIS A 1 179 ? 6.493   8.680   51.014  1.00 11.47 ? 179  HIS A CG  1 
ATOM   1415  N  ND1 . HIS A 1 179 ? 5.940   9.842   50.524  1.00 9.21  ? 179  HIS A ND1 1 
ATOM   1416  C  CD2 . HIS A 1 179 ? 5.455   7.842   51.260  1.00 10.86 ? 179  HIS A CD2 1 
ATOM   1417  C  CE1 . HIS A 1 179 ? 4.627   9.710   50.457  1.00 8.78  ? 179  HIS A CE1 1 
ATOM   1418  N  NE2 . HIS A 1 179 ? 4.309   8.499   50.878  1.00 11.06 ? 179  HIS A NE2 1 
ATOM   1419  N  N   . ILE A 1 180 ? 10.851  9.268   51.978  1.00 12.27 ? 180  ILE A N   1 
ATOM   1420  C  CA  . ILE A 1 180 ? 12.218  8.832   51.816  1.00 12.76 ? 180  ILE A CA  1 
ATOM   1421  C  C   . ILE A 1 180 ? 13.015  9.070   53.102  1.00 12.96 ? 180  ILE A C   1 
ATOM   1422  O  O   . ILE A 1 180 ? 13.956  8.327   53.421  1.00 12.44 ? 180  ILE A O   1 
ATOM   1423  C  CB  . ILE A 1 180 ? 12.833  9.535   50.531  1.00 12.61 ? 180  ILE A CB  1 
ATOM   1424  C  CG1 . ILE A 1 180 ? 13.499  8.521   49.596  1.00 13.35 ? 180  ILE A CG1 1 
ATOM   1425  C  CG2 . ILE A 1 180 ? 13.705  10.732  50.867  1.00 12.37 ? 180  ILE A CG2 1 
ATOM   1426  C  CD1 . ILE A 1 180 ? 14.964  8.348   49.779  1.00 15.59 ? 180  ILE A CD1 1 
ATOM   1427  N  N   . PHE A 1 181 ? 12.626  10.106  53.851  1.00 13.36 ? 181  PHE A N   1 
ATOM   1428  C  CA  . PHE A 1 181 ? 13.299  10.411  55.113  1.00 13.00 ? 181  PHE A CA  1 
ATOM   1429  C  C   . PHE A 1 181 ? 12.635  9.818   56.349  1.00 13.31 ? 181  PHE A C   1 
ATOM   1430  O  O   . PHE A 1 181 ? 13.069  10.103  57.467  1.00 14.53 ? 181  PHE A O   1 
ATOM   1431  C  CB  . PHE A 1 181 ? 13.553  11.911  55.256  1.00 13.19 ? 181  PHE A CB  1 
ATOM   1432  C  CG  . PHE A 1 181 ? 14.644  12.422  54.354  1.00 12.69 ? 181  PHE A CG  1 
ATOM   1433  C  CD1 . PHE A 1 181 ? 14.328  13.115  53.190  1.00 11.79 ? 181  PHE A CD1 1 
ATOM   1434  C  CD2 . PHE A 1 181 ? 15.986  12.210  54.670  1.00 13.00 ? 181  PHE A CD2 1 
ATOM   1435  C  CE1 . PHE A 1 181 ? 15.324  13.591  52.353  1.00 12.12 ? 181  PHE A CE1 1 
ATOM   1436  C  CE2 . PHE A 1 181 ? 17.009  12.686  53.830  1.00 13.65 ? 181  PHE A CE2 1 
ATOM   1437  C  CZ  . PHE A 1 181 ? 16.676  13.375  52.672  1.00 13.06 ? 181  PHE A CZ  1 
ATOM   1438  N  N   . THR A 1 182 ? 11.605  8.987   56.169  1.00 13.07 ? 182  THR A N   1 
ATOM   1439  C  CA  . THR A 1 182 ? 11.233  8.035   57.215  1.00 13.51 ? 182  THR A CA  1 
ATOM   1440  C  C   . THR A 1 182 ? 12.314  6.940   57.219  1.00 13.75 ? 182  THR A C   1 
ATOM   1441  O  O   . THR A 1 182 ? 13.261  6.986   56.416  1.00 14.25 ? 182  THR A O   1 
ATOM   1442  C  CB  . THR A 1 182 ? 9.784   7.394   57.044  1.00 13.99 ? 182  THR A CB  1 
ATOM   1443  O  OG1 . THR A 1 182 ? 9.714   6.536   55.890  1.00 13.21 ? 182  THR A OG1 1 
ATOM   1444  C  CG2 . THR A 1 182 ? 8.689   8.462   56.986  1.00 12.57 ? 182  THR A CG2 1 
ATOM   1445  N  N   . ASP A 1 183 ? 12.190  5.956   58.099  1.00 13.23 ? 183  ASP A N   1 
ATOM   1446  C  CA  . ASP A 1 183 ? 13.119  4.821   58.062  1.00 12.97 ? 183  ASP A CA  1 
ATOM   1447  C  C   . ASP A 1 183 ? 12.839  3.898   56.852  1.00 13.06 ? 183  ASP A C   1 
ATOM   1448  O  O   . ASP A 1 183 ? 13.680  3.039   56.501  1.00 13.60 ? 183  ASP A O   1 
ATOM   1449  C  CB  . ASP A 1 183 ? 13.143  4.045   59.391  1.00 12.49 ? 183  ASP A CB  1 
ATOM   1450  C  CG  . ASP A 1 183 ? 13.783  4.845   60.548  1.00 12.48 ? 183  ASP A CG  1 
ATOM   1451  O  OD1 . ASP A 1 183 ? 14.431  5.898   60.338  1.00 12.86 ? 183  ASP A OD1 1 
ATOM   1452  O  OD2 . ASP A 1 183 ? 13.638  4.419   61.698  1.00 12.03 ? 183  ASP A OD2 1 
ATOM   1453  N  N   . GLU A 1 184 ? 11.699  4.104   56.183  1.00 12.65 ? 184  GLU A N   1 
ATOM   1454  C  CA  . GLU A 1 184 ? 11.411  3.362   54.938  1.00 12.52 ? 184  GLU A CA  1 
ATOM   1455  C  C   . GLU A 1 184 ? 12.374  3.712   53.802  1.00 11.70 ? 184  GLU A C   1 
ATOM   1456  O  O   . GLU A 1 184 ? 12.409  3.032   52.759  1.00 11.68 ? 184  GLU A O   1 
ATOM   1457  C  CB  . GLU A 1 184 ? 9.960   3.494   54.471  1.00 12.40 ? 184  GLU A CB  1 
ATOM   1458  C  CG  . GLU A 1 184 ? 9.599   2.338   53.537  1.00 14.85 ? 184  GLU A CG  1 
ATOM   1459  C  CD  . GLU A 1 184 ? 8.178   2.383   52.988  1.00 14.57 ? 184  GLU A CD  1 
ATOM   1460  O  OE1 . GLU A 1 184 ? 7.501   3.412   53.190  1.00 13.85 ? 184  GLU A OE1 1 
ATOM   1461  O  OE2 . GLU A 1 184 ? 7.765   1.386   52.340  1.00 13.26 ? 184  GLU A OE2 1 
ATOM   1462  N  N   . GLY A 1 185 ? 13.159  4.763   54.021  1.00 10.69 ? 185  GLY A N   1 
ATOM   1463  C  CA  . GLY A 1 185 ? 14.272  5.089   53.141  1.00 10.54 ? 185  GLY A CA  1 
ATOM   1464  C  C   . GLY A 1 185 ? 15.413  4.079   53.169  1.00 10.16 ? 185  GLY A C   1 
ATOM   1465  O  O   . GLY A 1 185 ? 16.199  4.024   52.236  1.00 10.51 ? 185  GLY A O   1 
ATOM   1466  N  N   . ILE A 1 186 ? 15.522  3.288   54.231  1.00 10.34 ? 186  ILE A N   1 
ATOM   1467  C  CA  . ILE A 1 186 ? 16.494  2.187   54.265  1.00 10.65 ? 186  ILE A CA  1 
ATOM   1468  C  C   . ILE A 1 186 ? 15.822  0.855   54.641  1.00 11.09 ? 186  ILE A C   1 
ATOM   1469  O  O   . ILE A 1 186 ? 15.806  0.485   55.813  1.00 11.72 ? 186  ILE A O   1 
ATOM   1470  C  CB  . ILE A 1 186 ? 17.680  2.453   55.239  1.00 10.45 ? 186  ILE A CB  1 
ATOM   1471  C  CG1 . ILE A 1 186 ? 18.252  3.864   55.047  1.00 9.30  ? 186  ILE A CG1 1 
ATOM   1472  C  CG2 . ILE A 1 186 ? 18.771  1.354   55.076  1.00 10.42 ? 186  ILE A CG2 1 
ATOM   1473  C  CD1 . ILE A 1 186 ? 19.064  4.359   56.213  1.00 6.27  ? 186  ILE A CD1 1 
ATOM   1474  N  N   . PRO A 1 187 ? 15.234  0.144   53.658  1.00 11.33 ? 187  PRO A N   1 
ATOM   1475  C  CA  . PRO A 1 187 ? 14.745  -1.206  53.954  1.00 11.97 ? 187  PRO A CA  1 
ATOM   1476  C  C   . PRO A 1 187 ? 15.832  -2.119  54.530  1.00 12.04 ? 187  PRO A C   1 
ATOM   1477  O  O   . PRO A 1 187 ? 17.009  -1.962  54.194  1.00 12.30 ? 187  PRO A O   1 
ATOM   1478  C  CB  . PRO A 1 187 ? 14.282  -1.720  52.574  1.00 11.88 ? 187  PRO A CB  1 
ATOM   1479  C  CG  . PRO A 1 187 ? 13.885  -0.491  51.849  1.00 12.00 ? 187  PRO A CG  1 
ATOM   1480  C  CD  . PRO A 1 187 ? 14.928  0.538   52.271  1.00 11.25 ? 187  PRO A CD  1 
ATOM   1481  N  N   . ALA A 1 188 ? 15.435  -3.063  55.375  1.00 11.97 ? 188  ALA A N   1 
ATOM   1482  C  CA  . ALA A 1 188 ? 16.372  -4.006  55.992  1.00 12.82 ? 188  ALA A CA  1 
ATOM   1483  C  C   . ALA A 1 188 ? 16.843  -5.056  54.984  1.00 13.35 ? 188  ALA A C   1 
ATOM   1484  O  O   . ALA A 1 188 ? 17.956  -5.608  55.092  1.00 12.93 ? 188  ALA A O   1 
ATOM   1485  C  CB  . ALA A 1 188 ? 15.735  -4.687  57.235  1.00 12.42 ? 188  ALA A CB  1 
ATOM   1486  N  N   . SER A 1 189 ? 15.956  -5.368  54.041  1.00 13.36 ? 189  SER A N   1 
ATOM   1487  C  CA  . SER A 1 189 ? 16.363  -6.031  52.820  1.00 13.67 ? 189  SER A CA  1 
ATOM   1488  C  C   . SER A 1 189 ? 15.294  -5.987  51.730  1.00 13.16 ? 189  SER A C   1 
ATOM   1489  O  O   . SER A 1 189 ? 14.143  -5.549  51.936  1.00 12.59 ? 189  SER A O   1 
ATOM   1490  C  CB  . SER A 1 189 ? 16.824  -7.469  53.074  1.00 13.81 ? 189  SER A CB  1 
ATOM   1491  O  OG  . SER A 1 189 ? 15.790  -8.209  53.659  1.00 16.15 ? 189  SER A OG  1 
ATOM   1492  N  N   . TYR A 1 190 ? 15.726  -6.454  50.564  1.00 12.38 ? 190  TYR A N   1 
ATOM   1493  C  CA  . TYR A 1 190 ? 14.883  -6.605  49.399  1.00 12.16 ? 190  TYR A CA  1 
ATOM   1494  C  C   . TYR A 1 190 ? 13.608  -7.416  49.654  1.00 12.48 ? 190  TYR A C   1 
ATOM   1495  O  O   . TYR A 1 190 ? 12.553  -7.090  49.097  1.00 12.97 ? 190  TYR A O   1 
ATOM   1496  C  CB  . TYR A 1 190 ? 15.715  -7.203  48.264  1.00 11.15 ? 190  TYR A CB  1 
ATOM   1497  C  CG  . TYR A 1 190 ? 16.873  -6.307  47.834  1.00 10.30 ? 190  TYR A CG  1 
ATOM   1498  C  CD1 . TYR A 1 190 ? 16.727  -4.932  47.771  1.00 8.40  ? 190  TYR A CD1 1 
ATOM   1499  C  CD2 . TYR A 1 190 ? 18.111  -6.850  47.477  1.00 11.02 ? 190  TYR A CD2 1 
ATOM   1500  C  CE1 . TYR A 1 190 ? 17.790  -4.108  47.371  1.00 10.09 ? 190  TYR A CE1 1 
ATOM   1501  C  CE2 . TYR A 1 190 ? 19.173  -6.033  47.072  1.00 10.70 ? 190  TYR A CE2 1 
ATOM   1502  C  CZ  . TYR A 1 190 ? 18.998  -4.663  47.017  1.00 9.46  ? 190  TYR A CZ  1 
ATOM   1503  O  OH  . TYR A 1 190 ? 20.024  -3.855  46.618  1.00 7.53  ? 190  TYR A OH  1 
ATOM   1504  N  N   . ARG A 1 191 ? 13.698  -8.442  50.506  1.00 12.45 ? 191  ARG A N   1 
ATOM   1505  C  CA  . ARG A 1 191 ? 12.567  -9.327  50.764  1.00 13.14 ? 191  ARG A CA  1 
ATOM   1506  C  C   . ARG A 1 191 ? 11.631  -8.741  51.825  1.00 13.20 ? 191  ARG A C   1 
ATOM   1507  O  O   . ARG A 1 191 ? 10.494  -9.216  52.019  1.00 12.99 ? 191  ARG A O   1 
ATOM   1508  C  CB  . ARG A 1 191 ? 13.039  -10.741 51.130  1.00 13.41 ? 191  ARG A CB  1 
ATOM   1509  C  CG  . ARG A 1 191 ? 13.774  -10.847 52.444  1.00 16.03 ? 191  ARG A CG  1 
ATOM   1510  C  CD  . ARG A 1 191 ? 14.702  -12.070 52.488  1.00 17.17 ? 191  ARG A CD  1 
ATOM   1511  N  NE  . ARG A 1 191 ? 14.032  -13.175 53.139  1.00 19.61 ? 191  ARG A NE  1 
ATOM   1512  C  CZ  . ARG A 1 191 ? 14.205  -13.532 54.407  1.00 20.15 ? 191  ARG A CZ  1 
ATOM   1513  N  NH1 . ARG A 1 191 ? 15.082  -12.906 55.181  1.00 18.10 ? 191  ARG A NH1 1 
ATOM   1514  N  NH2 . ARG A 1 191 ? 13.516  -14.560 54.884  1.00 20.79 ? 191  ARG A NH2 1 
ATOM   1515  N  N   . LYS A 1 192 ? 12.100  -7.688  52.493  1.00 12.68 ? 192  LYS A N   1 
ATOM   1516  C  CA  . LYS A 1 192 ? 11.303  -7.043  53.530  1.00 12.22 ? 192  LYS A CA  1 
ATOM   1517  C  C   . LYS A 1 192 ? 10.862  -5.634  53.146  1.00 11.40 ? 192  LYS A C   1 
ATOM   1518  O  O   . LYS A 1 192 ? 10.904  -4.715  53.959  1.00 11.62 ? 192  LYS A O   1 
ATOM   1519  C  CB  . LYS A 1 192 ? 12.061  -7.047  54.848  1.00 12.40 ? 192  LYS A CB  1 
ATOM   1520  C  CG  . LYS A 1 192 ? 12.389  -8.450  55.310  1.00 13.96 ? 192  LYS A CG  1 
ATOM   1521  C  CD  . LYS A 1 192 ? 12.891  -8.484  56.740  1.00 17.20 ? 192  LYS A CD  1 
ATOM   1522  C  CE  . LYS A 1 192 ? 13.333  -9.910  57.081  1.00 19.29 ? 192  LYS A CE  1 
ATOM   1523  N  NZ  . LYS A 1 192 ? 13.985  -9.932  58.412  1.00 21.27 ? 192  LYS A NZ  1 
ATOM   1524  N  N   . MET A 1 193 ? 10.425  -5.490  51.904  1.00 10.46 ? 193  MET A N   1 
ATOM   1525  C  CA  . MET A 1 193 ? 9.956   -4.219  51.375  1.00 9.96  ? 193  MET A CA  1 
ATOM   1526  C  C   . MET A 1 193 ? 8.778   -4.432  50.440  1.00 9.70  ? 193  MET A C   1 
ATOM   1527  O  O   . MET A 1 193 ? 8.566   -5.528  49.898  1.00 10.06 ? 193  MET A O   1 
ATOM   1528  C  CB  . MET A 1 193 ? 11.076  -3.509  50.609  1.00 9.69  ? 193  MET A CB  1 
ATOM   1529  C  CG  . MET A 1 193 ? 11.288  -4.024  49.191  1.00 8.60  ? 193  MET A CG  1 
ATOM   1530  S  SD  . MET A 1 193 ? 12.773  -3.309  48.484  1.00 9.48  ? 193  MET A SD  1 
ATOM   1531  C  CE  . MET A 1 193 ? 12.740  -4.035  46.815  1.00 4.24  ? 193  MET A CE  1 
ATOM   1532  N  N   . ARG A 1 194 ? 8.025   -3.362  50.238  1.00 9.16  ? 194  ARG A N   1 
ATOM   1533  C  CA  . ARG A 1 194 ? 6.867   -3.388  49.358  1.00 8.58  ? 194  ARG A CA  1 
ATOM   1534  C  C   . ARG A 1 194 ? 7.263   -2.944  47.951  1.00 8.52  ? 194  ARG A C   1 
ATOM   1535  O  O   . ARG A 1 194 ? 8.440   -2.596  47.699  1.00 7.91  ? 194  ARG A O   1 
ATOM   1536  C  CB  . ARG A 1 194 ? 5.745   -2.497  49.941  1.00 9.04  ? 194  ARG A CB  1 
ATOM   1537  C  CG  . ARG A 1 194 ? 6.217   -1.116  50.436  1.00 9.16  ? 194  ARG A CG  1 
ATOM   1538  C  CD  . ARG A 1 194 ? 5.131   -0.068  50.297  1.00 9.46  ? 194  ARG A CD  1 
ATOM   1539  N  NE  . ARG A 1 194 ? 5.482   1.165   51.015  1.00 8.36  ? 194  ARG A NE  1 
ATOM   1540  C  CZ  . ARG A 1 194 ? 4.683   2.228   51.144  1.00 7.18  ? 194  ARG A CZ  1 
ATOM   1541  N  NH1 . ARG A 1 194 ? 5.104   3.286   51.842  1.00 3.60  ? 194  ARG A NH1 1 
ATOM   1542  N  NH2 . ARG A 1 194 ? 3.463   2.231   50.585  1.00 4.81  ? 194  ARG A NH2 1 
ATOM   1543  N  N   . GLY A 1 195 ? 6.285   -2.972  47.034  1.00 8.26  ? 195  GLY A N   1 
ATOM   1544  C  CA  . GLY A 1 195 ? 6.465   -2.481  45.666  1.00 7.61  ? 195  GLY A CA  1 
ATOM   1545  C  C   . GLY A 1 195 ? 5.295   -1.601  45.271  1.00 8.18  ? 195  GLY A C   1 
ATOM   1546  O  O   . GLY A 1 195 ? 4.186   -1.771  45.799  1.00 8.18  ? 195  GLY A O   1 
ATOM   1547  N  N   . SER A 1 196 ? 5.537   -0.664  44.341  1.00 7.95  ? 196  SER A N   1 
ATOM   1548  C  CA  . SER A 1 196 ? 4.535   0.305   43.922  1.00 7.78  ? 196  SER A CA  1 
ATOM   1549  C  C   . SER A 1 196 ? 4.726   0.655   42.447  1.00 8.77  ? 196  SER A C   1 
ATOM   1550  O  O   . SER A 1 196 ? 5.848   0.944   42.025  1.00 9.44  ? 196  SER A O   1 
ATOM   1551  C  CB  . SER A 1 196 ? 4.664   1.580   44.765  1.00 7.32  ? 196  SER A CB  1 
ATOM   1552  O  OG  . SER A 1 196 ? 4.629   1.280   46.143  1.00 5.07  ? 196  SER A OG  1 
ATOM   1553  N  N   . SER A 1 197 ? 3.656   0.620   41.649  1.00 8.83  ? 197  SER A N   1 
ATOM   1554  C  CA  . SER A 1 197 ? 3.788   1.073   40.250  1.00 8.60  ? 197  SER A CA  1 
ATOM   1555  C  C   . SER A 1 197 ? 4.131   2.554   40.206  1.00 8.15  ? 197  SER A C   1 
ATOM   1556  O  O   . SER A 1 197 ? 4.744   3.037   39.248  1.00 7.47  ? 197  SER A O   1 
ATOM   1557  C  CB  . SER A 1 197 ? 2.523   0.802   39.449  1.00 8.49  ? 197  SER A CB  1 
ATOM   1558  O  OG  . SER A 1 197 ? 1.398   1.370   40.076  1.00 9.43  ? 197  SER A OG  1 
ATOM   1559  N  N   . VAL A 1 198 ? 3.741   3.252   41.277  1.00 7.99  ? 198  VAL A N   1 
ATOM   1560  C  CA  . VAL A 1 198 ? 3.839   4.713   41.388  1.00 7.16  ? 198  VAL A CA  1 
ATOM   1561  C  C   . VAL A 1 198 ? 2.903   5.451   40.405  1.00 7.69  ? 198  VAL A C   1 
ATOM   1562  O  O   . VAL A 1 198 ? 2.093   6.281   40.839  1.00 8.04  ? 198  VAL A O   1 
ATOM   1563  C  CB  . VAL A 1 198 ? 5.328   5.214   41.328  1.00 7.39  ? 198  VAL A CB  1 
ATOM   1564  C  CG1 . VAL A 1 198 ? 5.403   6.761   41.279  1.00 4.88  ? 198  VAL A CG1 1 
ATOM   1565  C  CG2 . VAL A 1 198 ? 6.109   4.642   42.517  1.00 4.54  ? 198  VAL A CG2 1 
ATOM   1566  N  N   . HIS A 1 199 ? 3.039   5.171   39.103  1.00 7.19  ? 199  HIS A N   1 
ATOM   1567  C  CA  . HIS A 1 199 ? 2.134   5.684   38.068  1.00 7.25  ? 199  HIS A CA  1 
ATOM   1568  C  C   . HIS A 1 199 ? 0.827   4.891   37.991  1.00 6.88  ? 199  HIS A C   1 
ATOM   1569  O  O   . HIS A 1 199 ? 0.780   3.716   38.366  1.00 6.79  ? 199  HIS A O   1 
ATOM   1570  C  CB  . HIS A 1 199 ? 2.774   5.603   36.678  1.00 7.40  ? 199  HIS A CB  1 
ATOM   1571  C  CG  . HIS A 1 199 ? 4.216   6.003   36.636  1.00 9.68  ? 199  HIS A CG  1 
ATOM   1572  N  ND1 . HIS A 1 199 ? 4.636   7.311   36.787  1.00 10.63 ? 199  HIS A ND1 1 
ATOM   1573  C  CD2 . HIS A 1 199 ? 5.335   5.268   36.435  1.00 9.89  ? 199  HIS A CD2 1 
ATOM   1574  C  CE1 . HIS A 1 199 ? 5.953   7.363   36.688  1.00 12.16 ? 199  HIS A CE1 1 
ATOM   1575  N  NE2 . HIS A 1 199 ? 6.403   6.134   36.484  1.00 12.69 ? 199  HIS A NE2 1 
ATOM   1576  N  N   . SER A 1 200 ? -0.220  5.546   37.483  1.00 6.47  ? 200  SER A N   1 
ATOM   1577  C  CA  . SER A 1 200 ? -1.381  4.864   36.978  1.00 6.35  ? 200  SER A CA  1 
ATOM   1578  C  C   . SER A 1 200 ? -0.998  4.326   35.606  1.00 6.71  ? 200  SER A C   1 
ATOM   1579  O  O   . SER A 1 200 ? -0.163  4.916   34.895  1.00 5.62  ? 200  SER A O   1 
ATOM   1580  C  CB  . SER A 1 200 ? -2.565  5.812   36.833  1.00 6.56  ? 200  SER A CB  1 
ATOM   1581  O  OG  . SER A 1 200 ? -2.238  6.920   35.983  1.00 7.82  ? 200  SER A OG  1 
ATOM   1582  N  N   . PHE A 1 201 ? -1.595  3.187   35.265  1.00 6.59  ? 201  PHE A N   1 
ATOM   1583  C  CA  . PHE A 1 201 ? -1.593  2.663   33.904  1.00 6.60  ? 201  PHE A CA  1 
ATOM   1584  C  C   . PHE A 1 201 ? -3.034  2.523   33.454  1.00 6.96  ? 201  PHE A C   1 
ATOM   1585  O  O   . PHE A 1 201 ? -3.982  2.876   34.210  1.00 6.87  ? 201  PHE A O   1 
ATOM   1586  C  CB  . PHE A 1 201 ? -0.878  1.306   33.849  1.00 6.79  ? 201  PHE A CB  1 
ATOM   1587  C  CG  . PHE A 1 201 ? 0.603   1.407   34.021  1.00 6.66  ? 201  PHE A CG  1 
ATOM   1588  C  CD1 . PHE A 1 201 ? 1.441   1.379   32.927  1.00 7.79  ? 201  PHE A CD1 1 
ATOM   1589  C  CD2 . PHE A 1 201 ? 1.165   1.588   35.281  1.00 8.12  ? 201  PHE A CD2 1 
ATOM   1590  C  CE1 . PHE A 1 201 ? 2.821   1.502   33.079  1.00 4.64  ? 201  PHE A CE1 1 
ATOM   1591  C  CE2 . PHE A 1 201 ? 2.541   1.714   35.427  1.00 6.33  ? 201  PHE A CE2 1 
ATOM   1592  C  CZ  . PHE A 1 201 ? 3.355   1.670   34.315  1.00 5.39  ? 201  PHE A CZ  1 
ATOM   1593  N  N   . LYS A 1 202 ? -3.210  2.043   32.221  1.00 7.27  ? 202  LYS A N   1 
ATOM   1594  C  CA  . LYS A 1 202 ? -4.541  1.757   31.701  1.00 7.90  ? 202  LYS A CA  1 
ATOM   1595  C  C   . LYS A 1 202 ? -4.688  0.259   31.480  1.00 8.86  ? 202  LYS A C   1 
ATOM   1596  O  O   . LYS A 1 202 ? -3.809  -0.393  30.897  1.00 9.55  ? 202  LYS A O   1 
ATOM   1597  C  CB  . LYS A 1 202 ? -4.786  2.500   30.385  1.00 7.99  ? 202  LYS A CB  1 
ATOM   1598  C  CG  . LYS A 1 202 ? -5.010  4.002   30.542  1.00 8.33  ? 202  LYS A CG  1 
ATOM   1599  C  CD  . LYS A 1 202 ? -4.968  4.719   29.191  1.00 7.34  ? 202  LYS A CD  1 
ATOM   1600  C  CE  . LYS A 1 202 ? -5.638  6.097   29.310  1.00 8.99  ? 202  LYS A CE  1 
ATOM   1601  N  NZ  . LYS A 1 202 ? -5.834  6.835   28.034  1.00 5.87  ? 202  LYS A NZ  1 
ATOM   1602  N  N   . TRP A 1 203 ? -5.799  -0.289  31.958  1.00 9.09  ? 203  TRP A N   1 
ATOM   1603  C  CA  . TRP A 1 203 ? -6.180  -1.644  31.617  1.00 8.89  ? 203  TRP A CA  1 
ATOM   1604  C  C   . TRP A 1 203 ? -7.477  -1.537  30.830  1.00 9.97  ? 203  TRP A C   1 
ATOM   1605  O  O   . TRP A 1 203 ? -8.402  -0.797  31.221  1.00 11.01 ? 203  TRP A O   1 
ATOM   1606  C  CB  . TRP A 1 203 ? -6.383  -2.458  32.878  1.00 7.99  ? 203  TRP A CB  1 
ATOM   1607  C  CG  . TRP A 1 203 ? -5.112  -2.956  33.541  1.00 7.66  ? 203  TRP A CG  1 
ATOM   1608  C  CD1 . TRP A 1 203 ? -3.815  -2.633  33.220  1.00 7.20  ? 203  TRP A CD1 1 
ATOM   1609  C  CD2 . TRP A 1 203 ? -5.035  -3.851  34.661  1.00 7.05  ? 203  TRP A CD2 1 
ATOM   1610  N  NE1 . TRP A 1 203 ? -2.944  -3.282  34.055  1.00 7.26  ? 203  TRP A NE1 1 
ATOM   1611  C  CE2 . TRP A 1 203 ? -3.661  -4.040  34.948  1.00 7.88  ? 203  TRP A CE2 1 
ATOM   1612  C  CE3 . TRP A 1 203 ? -5.994  -4.539  35.427  1.00 2.13  ? 203  TRP A CE3 1 
ATOM   1613  C  CZ2 . TRP A 1 203 ? -3.218  -4.892  35.982  1.00 7.78  ? 203  TRP A CZ2 1 
ATOM   1614  C  CZ3 . TRP A 1 203 ? -5.557  -5.356  36.461  1.00 6.29  ? 203  TRP A CZ3 1 
ATOM   1615  C  CH2 . TRP A 1 203 ? -4.181  -5.525  36.735  1.00 6.62  ? 203  TRP A CH2 1 
ATOM   1616  N  N   . VAL A 1 204 ? -7.518  -2.242  29.703  1.00 10.60 ? 204  VAL A N   1 
ATOM   1617  C  CA  . VAL A 1 204 ? -8.645  -2.257  28.791  1.00 10.64 ? 204  VAL A CA  1 
ATOM   1618  C  C   . VAL A 1 204 ? -9.160  -3.696  28.772  1.00 11.50 ? 204  VAL A C   1 
ATOM   1619  O  O   . VAL A 1 204 ? -8.351  -4.631  28.647  1.00 11.13 ? 204  VAL A O   1 
ATOM   1620  C  CB  . VAL A 1 204 ? -8.183  -1.888  27.368  1.00 10.89 ? 204  VAL A CB  1 
ATOM   1621  C  CG1 . VAL A 1 204 ? -9.363  -1.804  26.409  1.00 9.13  ? 204  VAL A CG1 1 
ATOM   1622  C  CG2 . VAL A 1 204 ? -7.383  -0.571  27.367  1.00 10.43 ? 204  VAL A CG2 1 
ATOM   1623  N  N   . ASN A 1 205 ? -10.481 -3.885  28.914  1.00 12.23 ? 205  ASN A N   1 
ATOM   1624  C  CA  . ASN A 1 205 ? -11.066 -5.238  28.812  1.00 12.86 ? 205  ASN A CA  1 
ATOM   1625  C  C   . ASN A 1 205 ? -11.477 -5.607  27.397  1.00 13.69 ? 205  ASN A C   1 
ATOM   1626  O  O   . ASN A 1 205 ? -11.238 -4.836  26.439  1.00 13.19 ? 205  ASN A O   1 
ATOM   1627  C  CB  . ASN A 1 205 ? -12.198 -5.512  29.841  1.00 12.73 ? 205  ASN A CB  1 
ATOM   1628  C  CG  . ASN A 1 205 ? -13.413 -4.610  29.651  1.00 11.74 ? 205  ASN A CG  1 
ATOM   1629  O  OD1 . ASN A 1 205 ? -13.720 -4.162  28.543  1.00 9.44  ? 205  ASN A OD1 1 
ATOM   1630  N  ND2 . ASN A 1 205 ? -14.093 -4.328  30.745  1.00 11.30 ? 205  ASN A ND2 1 
ATOM   1631  N  N   . ALA A 1 206 ? -12.083 -6.796  27.278  1.00 14.87 ? 206  ALA A N   1 
ATOM   1632  C  CA  . ALA A 1 206 ? -12.395 -7.410  25.989  1.00 15.82 ? 206  ALA A CA  1 
ATOM   1633  C  C   . ALA A 1 206 ? -13.393 -6.584  25.194  1.00 16.91 ? 206  ALA A C   1 
ATOM   1634  O  O   . ALA A 1 206 ? -13.460 -6.690  23.967  1.00 17.65 ? 206  ALA A O   1 
ATOM   1635  C  CB  . ALA A 1 206 ? -12.916 -8.809  26.184  1.00 16.07 ? 206  ALA A CB  1 
ATOM   1636  N  N   . HIS A 1 207 ? -14.158 -5.750  25.891  1.00 17.68 ? 207  HIS A N   1 
ATOM   1637  C  CA  . HIS A 1 207 ? -15.090 -4.854  25.222  1.00 18.62 ? 207  HIS A CA  1 
ATOM   1638  C  C   . HIS A 1 207 ? -14.552 -3.439  24.997  1.00 18.02 ? 207  HIS A C   1 
ATOM   1639  O  O   . HIS A 1 207 ? -15.237 -2.592  24.419  1.00 18.43 ? 207  HIS A O   1 
ATOM   1640  C  CB  . HIS A 1 207 ? -16.460 -4.870  25.907  1.00 19.10 ? 207  HIS A CB  1 
ATOM   1641  C  CG  . HIS A 1 207 ? -17.461 -5.705  25.173  1.00 23.65 ? 207  HIS A CG  1 
ATOM   1642  N  ND1 . HIS A 1 207 ? -17.541 -7.077  25.321  1.00 27.37 ? 207  HIS A ND1 1 
ATOM   1643  C  CD2 . HIS A 1 207 ? -18.390 -5.369  24.240  1.00 27.31 ? 207  HIS A CD2 1 
ATOM   1644  C  CE1 . HIS A 1 207 ? -18.490 -7.548  24.524  1.00 29.77 ? 207  HIS A CE1 1 
ATOM   1645  N  NE2 . HIS A 1 207 ? -19.016 -6.534  23.854  1.00 28.98 ? 207  HIS A NE2 1 
ATOM   1646  N  N   . GLY A 1 208 ? -13.321 -3.186  25.420  1.00 17.26 ? 208  GLY A N   1 
ATOM   1647  C  CA  . GLY A 1 208 ? -12.711 -1.887  25.168  1.00 16.26 ? 208  GLY A CA  1 
ATOM   1648  C  C   . GLY A 1 208 ? -13.031 -0.809  26.190  1.00 15.37 ? 208  GLY A C   1 
ATOM   1649  O  O   . GLY A 1 208 ? -12.814 0.369   25.932  1.00 15.55 ? 208  GLY A O   1 
ATOM   1650  N  N   . ASN A 1 209 ? -13.551 -1.209  27.350  1.00 14.50 ? 209  ASN A N   1 
ATOM   1651  C  CA  . ASN A 1 209 ? -13.638 -0.306  28.488  1.00 13.23 ? 209  ASN A CA  1 
ATOM   1652  C  C   . ASN A 1 209 ? -12.283 -0.152  29.157  1.00 12.49 ? 209  ASN A C   1 
ATOM   1653  O  O   . ASN A 1 209 ? -11.658 -1.148  29.567  1.00 11.91 ? 209  ASN A O   1 
ATOM   1654  C  CB  . ASN A 1 209 ? -14.634 -0.812  29.540  1.00 13.08 ? 209  ASN A CB  1 
ATOM   1655  C  CG  . ASN A 1 209 ? -14.921 0.233   30.603  1.00 13.07 ? 209  ASN A CG  1 
ATOM   1656  O  OD1 . ASN A 1 209 ? -15.260 1.372   30.278  1.00 11.59 ? 209  ASN A OD1 1 
ATOM   1657  N  ND2 . ASN A 1 209 ? -14.764 -0.137  31.872  1.00 11.66 ? 209  ASN A ND2 1 
ATOM   1658  N  N   . THR A 1 210 ? -11.837 1.088   29.305  1.00 11.51 ? 210  THR A N   1 
ATOM   1659  C  CA  . THR A 1 210 ? -10.556 1.307   29.996  1.00 10.64 ? 210  THR A CA  1 
ATOM   1660  C  C   . THR A 1 210 ? -10.716 1.876   31.396  1.00 10.18 ? 210  THR A C   1 
ATOM   1661  O  O   . THR A 1 210 ? -11.530 2.745   31.608  1.00 9.72  ? 210  THR A O   1 
ATOM   1662  C  CB  . THR A 1 210 ? -9.451  2.007   29.099  1.00 10.52 ? 210  THR A CB  1 
ATOM   1663  O  OG1 . THR A 1 210 ? -8.626  2.875   29.880  1.00 8.78  ? 210  THR A OG1 1 
ATOM   1664  C  CG2 . THR A 1 210 ? -10.055 2.773   27.951  1.00 10.72 ? 210  THR A CG2 1 
ATOM   1665  N  N   . VAL A 1 211 ? -9.983  1.315   32.359  1.00 10.26 ? 211  VAL A N   1 
ATOM   1666  C  CA  . VAL A 1 211 ? -9.867  1.920   33.695  1.00 10.63 ? 211  VAL A CA  1 
ATOM   1667  C  C   . VAL A 1 211 ? -8.405  2.308   33.975  1.00 10.78 ? 211  VAL A C   1 
ATOM   1668  O  O   . VAL A 1 211 ? -7.482  1.706   33.408  1.00 11.80 ? 211  VAL A O   1 
ATOM   1669  C  CB  . VAL A 1 211 ? -10.392 0.963   34.831  1.00 10.70 ? 211  VAL A CB  1 
ATOM   1670  C  CG1 . VAL A 1 211 ? -11.914 0.751   34.730  1.00 9.62  ? 211  VAL A CG1 1 
ATOM   1671  C  CG2 . VAL A 1 211 ? -9.664  -0.405  34.789  1.00 10.23 ? 211  VAL A CG2 1 
ATOM   1672  N  N   . TYR A 1 212 ? -8.206  3.303   34.836  1.00 10.97 ? 212  TYR A N   1 
ATOM   1673  C  CA  . TYR A 1 212 ? -6.892  3.601   35.425  1.00 11.01 ? 212  TYR A CA  1 
ATOM   1674  C  C   . TYR A 1 212 ? -6.562  2.690   36.601  1.00 10.68 ? 212  TYR A C   1 
ATOM   1675  O  O   . TYR A 1 212 ? -7.371  2.503   37.512  1.00 9.55  ? 212  TYR A O   1 
ATOM   1676  C  CB  . TYR A 1 212 ? -6.805  5.055   35.913  1.00 11.55 ? 212  TYR A CB  1 
ATOM   1677  C  CG  . TYR A 1 212 ? -6.761  6.080   34.799  1.00 12.29 ? 212  TYR A CG  1 
ATOM   1678  C  CD1 . TYR A 1 212 ? -5.594  6.263   34.038  1.00 10.84 ? 212  TYR A CD1 1 
ATOM   1679  C  CD2 . TYR A 1 212 ? -7.874  6.868   34.516  1.00 10.78 ? 212  TYR A CD2 1 
ATOM   1680  C  CE1 . TYR A 1 212 ? -5.538  7.201   33.028  1.00 11.70 ? 212  TYR A CE1 1 
ATOM   1681  C  CE2 . TYR A 1 212 ? -7.838  7.815   33.492  1.00 13.45 ? 212  TYR A CE2 1 
ATOM   1682  C  CZ  . TYR A 1 212 ? -6.661  7.972   32.751  1.00 13.67 ? 212  TYR A CZ  1 
ATOM   1683  O  OH  . TYR A 1 212 ? -6.612  8.904   31.747  1.00 14.22 ? 212  TYR A OH  1 
ATOM   1684  N  N   . ILE A 1 213 ? -5.341  2.162   36.596  1.00 10.63 ? 213  ILE A N   1 
ATOM   1685  C  CA  . ILE A 1 213 ? -4.942  1.217   37.635  1.00 10.58 ? 213  ILE A CA  1 
ATOM   1686  C  C   . ILE A 1 213 ? -3.585  1.584   38.233  1.00 10.49 ? 213  ILE A C   1 
ATOM   1687  O  O   . ILE A 1 213 ? -2.709  2.099   37.533  1.00 10.25 ? 213  ILE A O   1 
ATOM   1688  C  CB  . ILE A 1 213 ? -4.927  -0.260  37.114  1.00 10.00 ? 213  ILE A CB  1 
ATOM   1689  C  CG1 . ILE A 1 213 ? -3.738  -0.490  36.176  1.00 9.85  ? 213  ILE A CG1 1 
ATOM   1690  C  CG2 . ILE A 1 213 ? -6.248  -0.621  36.414  1.00 9.27  ? 213  ILE A CG2 1 
ATOM   1691  C  CD1 . ILE A 1 213 ? -2.557  -1.129  36.852  1.00 9.46  ? 213  ILE A CD1 1 
ATOM   1692  N  N   . LYS A 1 214 ? -3.451  1.321   39.532  1.00 10.56 ? 214  LYS A N   1 
ATOM   1693  C  CA  . LYS A 1 214 ? -2.182  1.374   40.252  1.00 10.40 ? 214  LYS A CA  1 
ATOM   1694  C  C   . LYS A 1 214 ? -1.909  -0.079  40.703  1.00 10.58 ? 214  LYS A C   1 
ATOM   1695  O  O   . LYS A 1 214 ? -2.858  -0.872  40.941  1.00 9.52  ? 214  LYS A O   1 
ATOM   1696  C  CB  . LYS A 1 214 ? -2.322  2.291   41.471  1.00 10.54 ? 214  LYS A CB  1 
ATOM   1697  C  CG  . LYS A 1 214 ? -1.241  3.361   41.694  1.00 11.12 ? 214  LYS A CG  1 
ATOM   1698  C  CD  . LYS A 1 214 ? -1.374  4.486   40.705  1.00 11.08 ? 214  LYS A CD  1 
ATOM   1699  C  CE  . LYS A 1 214 ? -1.428  5.860   41.350  1.00 12.35 ? 214  LYS A CE  1 
ATOM   1700  N  NZ  . LYS A 1 214 ? -0.238  6.429   42.049  1.00 15.35 ? 214  LYS A NZ  1 
ATOM   1701  N  N   . LEU A 1 215 ? -0.621  -0.422  40.806  1.00 10.28 ? 215  LEU A N   1 
ATOM   1702  C  CA  . LEU A 1 215 ? -0.207  -1.766  41.180  1.00 10.00 ? 215  LEU A CA  1 
ATOM   1703  C  C   . LEU A 1 215 ? 0.554   -1.728  42.479  1.00 10.06 ? 215  LEU A C   1 
ATOM   1704  O  O   . LEU A 1 215 ? 1.317   -0.801  42.721  1.00 10.65 ? 215  LEU A O   1 
ATOM   1705  C  CB  . LEU A 1 215 ? 0.637   -2.388  40.081  1.00 9.55  ? 215  LEU A CB  1 
ATOM   1706  C  CG  . LEU A 1 215 ? 0.080   -3.456  39.128  1.00 11.14 ? 215  LEU A CG  1 
ATOM   1707  C  CD1 . LEU A 1 215 ? -1.394  -3.861  39.323  1.00 9.81  ? 215  LEU A CD1 1 
ATOM   1708  C  CD2 . LEU A 1 215 ? 0.384   -3.104  37.658  1.00 11.13 ? 215  LEU A CD2 1 
ATOM   1709  N  N   . ARG A 1 216 ? 0.382   -2.777  43.274  1.00 9.97  ? 216  ARG A N   1 
ATOM   1710  C  CA  . ARG A 1 216 ? 0.766   -2.799  44.676  1.00 10.27 ? 216  ARG A CA  1 
ATOM   1711  C  C   . ARG A 1 216 ? 1.331   -4.180  45.069  1.00 9.73  ? 216  ARG A C   1 
ATOM   1712  O  O   . ARG A 1 216 ? 0.630   -5.189  44.952  1.00 9.82  ? 216  ARG A O   1 
ATOM   1713  C  CB  . ARG A 1 216 ? -0.494  -2.500  45.517  1.00 11.24 ? 216  ARG A CB  1 
ATOM   1714  C  CG  . ARG A 1 216 ? -0.487  -1.191  46.310  1.00 11.36 ? 216  ARG A CG  1 
ATOM   1715  C  CD  . ARG A 1 216 ? -0.690  0.107   45.525  1.00 9.73  ? 216  ARG A CD  1 
ATOM   1716  N  NE  . ARG A 1 216 ? 0.145   1.055   46.245  1.00 13.60 ? 216  ARG A NE  1 
ATOM   1717  C  CZ  . ARG A 1 216 ? -0.154  2.278   46.659  1.00 11.37 ? 216  ARG A CZ  1 
ATOM   1718  N  NH1 . ARG A 1 216 ? -1.283  2.885   46.352  1.00 12.55 ? 216  ARG A NH1 1 
ATOM   1719  N  NH2 . ARG A 1 216 ? 0.763   2.924   47.340  1.00 11.77 ? 216  ARG A NH2 1 
ATOM   1720  N  N   . TRP A 1 217 ? 2.592   -4.234  45.497  1.00 8.88  ? 217  TRP A N   1 
ATOM   1721  C  CA  . TRP A 1 217 ? 3.156   -5.472  46.069  1.00 9.05  ? 217  TRP A CA  1 
ATOM   1722  C  C   . TRP A 1 217 ? 3.289   -5.395  47.591  1.00 9.32  ? 217  TRP A C   1 
ATOM   1723  O  O   . TRP A 1 217 ? 3.789   -4.400  48.121  1.00 8.89  ? 217  TRP A O   1 
ATOM   1724  C  CB  . TRP A 1 217 ? 4.531   -5.796  45.486  1.00 8.87  ? 217  TRP A CB  1 
ATOM   1725  C  CG  . TRP A 1 217 ? 4.593   -6.029  44.004  1.00 9.03  ? 217  TRP A CG  1 
ATOM   1726  C  CD1 . TRP A 1 217 ? 4.908   -5.101  43.041  1.00 6.97  ? 217  TRP A CD1 1 
ATOM   1727  C  CD2 . TRP A 1 217 ? 4.387   -7.271  43.311  1.00 7.00  ? 217  TRP A CD2 1 
ATOM   1728  N  NE1 . TRP A 1 217 ? 4.908   -5.689  41.811  1.00 5.91  ? 217  TRP A NE1 1 
ATOM   1729  C  CE2 . TRP A 1 217 ? 4.601   -7.019  41.940  1.00 7.40  ? 217  TRP A CE2 1 
ATOM   1730  C  CE3 . TRP A 1 217 ? 4.063   -8.570  43.716  1.00 7.65  ? 217  TRP A CE3 1 
ATOM   1731  C  CZ2 . TRP A 1 217 ? 4.477   -8.019  40.959  1.00 8.03  ? 217  TRP A CZ2 1 
ATOM   1732  C  CZ3 . TRP A 1 217 ? 3.938   -9.579  42.733  1.00 6.97  ? 217  TRP A CZ3 1 
ATOM   1733  C  CH2 . TRP A 1 217 ? 4.153   -9.291  41.378  1.00 7.81  ? 217  TRP A CH2 1 
ATOM   1734  N  N   . VAL A 1 218 ? 2.845   -6.451  48.280  1.00 10.43 ? 218  VAL A N   1 
ATOM   1735  C  CA  . VAL A 1 218 ? 2.800   -6.497  49.746  1.00 11.06 ? 218  VAL A CA  1 
ATOM   1736  C  C   . VAL A 1 218 ? 3.588   -7.728  50.178  1.00 12.07 ? 218  VAL A C   1 
ATOM   1737  O  O   . VAL A 1 218 ? 3.219   -8.830  49.809  1.00 12.36 ? 218  VAL A O   1 
ATOM   1738  C  CB  . VAL A 1 218 ? 1.310   -6.560  50.300  1.00 11.80 ? 218  VAL A CB  1 
ATOM   1739  C  CG1 . VAL A 1 218 ? 1.274   -6.607  51.863  1.00 11.30 ? 218  VAL A CG1 1 
ATOM   1740  C  CG2 . VAL A 1 218 ? 0.420   -5.367  49.771  1.00 10.83 ? 218  VAL A CG2 1 
ATOM   1741  N  N   . PRO A 1 219 ? 4.693   -7.553  50.947  1.00 13.04 ? 219  PRO A N   1 
ATOM   1742  C  CA  . PRO A 1 219 ? 5.553   -8.699  51.228  1.00 13.74 ? 219  PRO A CA  1 
ATOM   1743  C  C   . PRO A 1 219 ? 5.008   -9.594  52.320  1.00 15.11 ? 219  PRO A C   1 
ATOM   1744  O  O   . PRO A 1 219 ? 4.543   -9.094  53.347  1.00 15.80 ? 219  PRO A O   1 
ATOM   1745  C  CB  . PRO A 1 219 ? 6.853   -8.053  51.694  1.00 13.46 ? 219  PRO A CB  1 
ATOM   1746  C  CG  . PRO A 1 219 ? 6.432   -6.774  52.336  1.00 13.32 ? 219  PRO A CG  1 
ATOM   1747  C  CD  . PRO A 1 219 ? 5.207   -6.313  51.572  1.00 13.44 ? 219  PRO A CD  1 
ATOM   1748  N  N   . LYS A 1 220 ? 5.092   -10.905 52.128  1.00 16.17 ? 220  LYS A N   1 
ATOM   1749  C  CA  . LYS A 1 220 ? 4.655   -11.830 53.178  1.00 18.28 ? 220  LYS A CA  1 
ATOM   1750  C  C   . LYS A 1 220 ? 5.531   -11.722 54.454  1.00 18.43 ? 220  LYS A C   1 
ATOM   1751  O  O   . LYS A 1 220 ? 5.036   -11.942 55.559  1.00 18.49 ? 220  LYS A O   1 
ATOM   1752  C  CB  . LYS A 1 220 ? 4.537   -13.272 52.638  1.00 18.77 ? 220  LYS A CB  1 
ATOM   1753  C  CG  . LYS A 1 220 ? 5.140   -14.368 53.538  1.00 22.51 ? 220  LYS A CG  1 
ATOM   1754  C  CD  . LYS A 1 220 ? 4.189   -15.571 53.711  1.00 28.04 ? 220  LYS A CD  1 
ATOM   1755  C  CE  . LYS A 1 220 ? 4.962   -16.887 53.854  1.00 30.03 ? 220  LYS A CE  1 
ATOM   1756  N  NZ  . LYS A 1 220 ? 5.784   -16.935 55.115  1.00 33.04 ? 220  LYS A NZ  1 
ATOM   1757  N  N   . GLU A 1 221 ? 6.811   -11.361 54.279  1.00 18.57 ? 221  GLU A N   1 
ATOM   1758  C  CA  . GLU A 1 221 ? 7.750   -11.119 55.394  1.00 18.34 ? 221  GLU A CA  1 
ATOM   1759  C  C   . GLU A 1 221 ? 7.534   -9.778  56.111  1.00 17.58 ? 221  GLU A C   1 
ATOM   1760  O  O   . GLU A 1 221 ? 8.213   -9.499  57.104  1.00 18.39 ? 221  GLU A O   1 
ATOM   1761  C  CB  . GLU A 1 221 ? 9.218   -11.177 54.925  1.00 18.39 ? 221  GLU A CB  1 
ATOM   1762  C  CG  . GLU A 1 221 ? 9.618   -12.399 54.101  1.00 20.96 ? 221  GLU A CG  1 
ATOM   1763  C  CD  . GLU A 1 221 ? 9.600   -13.708 54.893  1.00 24.18 ? 221  GLU A CD  1 
ATOM   1764  O  OE1 . GLU A 1 221 ? 9.554   -13.661 56.132  1.00 25.45 ? 221  GLU A OE1 1 
ATOM   1765  O  OE2 . GLU A 1 221 ? 9.630   -14.797 54.271  1.00 27.34 ? 221  GLU A OE2 1 
ATOM   1766  N  N   . GLY A 1 222 ? 6.615   -8.949  55.622  1.00 16.13 ? 222  GLY A N   1 
ATOM   1767  C  CA  . GLY A 1 222 ? 6.415   -7.623  56.198  1.00 14.83 ? 222  GLY A CA  1 
ATOM   1768  C  C   . GLY A 1 222 ? 7.449   -6.601  55.730  1.00 14.30 ? 222  GLY A C   1 
ATOM   1769  O  O   . GLY A 1 222 ? 8.537   -6.964  55.265  1.00 13.51 ? 222  GLY A O   1 
ATOM   1770  N  N   . VAL A 1 223 ? 7.083   -5.326  55.831  1.00 13.64 ? 223  VAL A N   1 
ATOM   1771  C  CA  . VAL A 1 223 ? 7.987   -4.194  55.629  1.00 13.75 ? 223  VAL A CA  1 
ATOM   1772  C  C   . VAL A 1 223 ? 8.869   -3.997  56.869  1.00 14.28 ? 223  VAL A C   1 
ATOM   1773  O  O   . VAL A 1 223 ? 8.363   -3.672  57.953  1.00 14.46 ? 223  VAL A O   1 
ATOM   1774  C  CB  . VAL A 1 223 ? 7.188   -2.860  55.389  1.00 14.24 ? 223  VAL A CB  1 
ATOM   1775  C  CG1 . VAL A 1 223 ? 8.146   -1.639  55.330  1.00 13.48 ? 223  VAL A CG1 1 
ATOM   1776  C  CG2 . VAL A 1 223 ? 6.341   -2.955  54.129  1.00 11.53 ? 223  VAL A CG2 1 
ATOM   1777  N  N   . HIS A 1 224 ? 10.176  -4.194  56.721  1.00 13.91 ? 224  HIS A N   1 
ATOM   1778  C  CA  . HIS A 1 224 ? 11.096  -3.958  57.829  1.00 14.34 ? 224  HIS A CA  1 
ATOM   1779  C  C   . HIS A 1 224 ? 12.221  -2.994  57.420  1.00 14.11 ? 224  HIS A C   1 
ATOM   1780  O  O   . HIS A 1 224 ? 12.865  -3.180  56.398  1.00 15.01 ? 224  HIS A O   1 
ATOM   1781  C  CB  . HIS A 1 224 ? 11.649  -5.282  58.365  1.00 14.22 ? 224  HIS A CB  1 
ATOM   1782  C  CG  . HIS A 1 224 ? 10.597  -6.188  58.936  1.00 16.15 ? 224  HIS A CG  1 
ATOM   1783  N  ND1 . HIS A 1 224 ? 10.150  -6.087  60.239  1.00 17.04 ? 224  HIS A ND1 1 
ATOM   1784  C  CD2 . HIS A 1 224 ? 9.904   -7.212  58.378  1.00 16.43 ? 224  HIS A CD2 1 
ATOM   1785  C  CE1 . HIS A 1 224 ? 9.227   -7.009  60.458  1.00 17.75 ? 224  HIS A CE1 1 
ATOM   1786  N  NE2 . HIS A 1 224 ? 9.066   -7.711  59.347  1.00 17.96 ? 224  HIS A NE2 1 
ATOM   1787  N  N   . ASN A 1 225 ? 12.436  -1.959  58.218  1.00 13.84 ? 225  ASN A N   1 
ATOM   1788  C  CA  . ASN A 1 225 ? 13.372  -0.900  57.881  1.00 13.46 ? 225  ASN A CA  1 
ATOM   1789  C  C   . ASN A 1 225 ? 14.524  -0.821  58.874  1.00 13.64 ? 225  ASN A C   1 
ATOM   1790  O  O   . ASN A 1 225 ? 14.477  -1.442  59.943  1.00 13.38 ? 225  ASN A O   1 
ATOM   1791  C  CB  . ASN A 1 225 ? 12.645  0.448   57.856  1.00 12.85 ? 225  ASN A CB  1 
ATOM   1792  C  CG  . ASN A 1 225 ? 11.380  0.427   56.996  1.00 13.65 ? 225  ASN A CG  1 
ATOM   1793  O  OD1 . ASN A 1 225 ? 10.288  0.785   57.469  1.00 13.20 ? 225  ASN A OD1 1 
ATOM   1794  N  ND2 . ASN A 1 225 ? 11.517  0.012   55.732  1.00 10.28 ? 225  ASN A ND2 1 
ATOM   1795  N  N   . LEU A 1 226 ? 15.549  -0.039  58.526  1.00 13.42 ? 226  LEU A N   1 
ATOM   1796  C  CA  . LEU A 1 226 ? 16.650  0.232   59.440  1.00 13.36 ? 226  LEU A CA  1 
ATOM   1797  C  C   . LEU A 1 226 ? 16.638  1.707   59.803  1.00 13.72 ? 226  LEU A C   1 
ATOM   1798  O  O   . LEU A 1 226 ? 16.385  2.550   58.936  1.00 14.34 ? 226  LEU A O   1 
ATOM   1799  C  CB  . LEU A 1 226 ? 17.996  -0.136  58.801  1.00 12.87 ? 226  LEU A CB  1 
ATOM   1800  C  CG  . LEU A 1 226 ? 18.135  -1.577  58.284  1.00 12.96 ? 226  LEU A CG  1 
ATOM   1801  C  CD1 . LEU A 1 226 ? 19.470  -1.805  57.567  1.00 10.83 ? 226  LEU A CD1 1 
ATOM   1802  C  CD2 . LEU A 1 226 ? 17.912  -2.599  59.425  1.00 12.77 ? 226  LEU A CD2 1 
ATOM   1803  N  N   . SER A 1 227 ? 16.899  2.021   61.072  1.00 13.30 ? 227  SER A N   1 
ATOM   1804  C  CA  . SER A 1 227 ? 17.156  3.406   61.483  1.00 13.74 ? 227  SER A CA  1 
ATOM   1805  C  C   . SER A 1 227 ? 18.533  3.796   60.942  1.00 13.39 ? 227  SER A C   1 
ATOM   1806  O  O   . SER A 1 227 ? 19.287  2.918   60.517  1.00 13.83 ? 227  SER A O   1 
ATOM   1807  C  CB  . SER A 1 227 ? 17.183  3.499   63.011  1.00 13.71 ? 227  SER A CB  1 
ATOM   1808  O  OG  . SER A 1 227 ? 18.427  2.993   63.457  1.00 14.78 ? 227  SER A OG  1 
ATOM   1809  N  N   . ALA A 1 228 ? 18.874  5.082   60.962  1.00 12.89 ? 228  ALA A N   1 
ATOM   1810  C  CA  . ALA A 1 228 ? 20.208  5.524   60.516  1.00 13.36 ? 228  ALA A CA  1 
ATOM   1811  C  C   . ALA A 1 228 ? 21.377  4.808   61.227  1.00 13.65 ? 228  ALA A C   1 
ATOM   1812  O  O   . ALA A 1 228 ? 22.346  4.424   60.573  1.00 13.79 ? 228  ALA A O   1 
ATOM   1813  C  CB  . ALA A 1 228 ? 20.361  7.059   60.596  1.00 12.15 ? 228  ALA A CB  1 
ATOM   1814  N  N   . ASP A 1 229 ? 21.276  4.617   62.543  1.00 14.40 ? 229  ASP A N   1 
ATOM   1815  C  CA  . ASP A 1 229 ? 22.342  3.982   63.316  1.00 15.39 ? 229  ASP A CA  1 
ATOM   1816  C  C   . ASP A 1 229 ? 22.448  2.494   63.060  1.00 15.54 ? 229  ASP A C   1 
ATOM   1817  O  O   . ASP A 1 229 ? 23.553  1.946   63.120  1.00 15.50 ? 229  ASP A O   1 
ATOM   1818  C  CB  . ASP A 1 229 ? 22.150  4.199   64.819  1.00 16.23 ? 229  ASP A CB  1 
ATOM   1819  C  CG  . ASP A 1 229 ? 22.291  5.656   65.234  1.00 18.69 ? 229  ASP A CG  1 
ATOM   1820  O  OD1 . ASP A 1 229 ? 21.854  5.961   66.371  1.00 21.89 ? 229  ASP A OD1 1 
ATOM   1821  O  OD2 . ASP A 1 229 ? 22.827  6.484   64.451  1.00 18.57 ? 229  ASP A OD2 1 
ATOM   1822  N  N   . GLU A 1 230 ? 21.305  1.840   62.821  1.00 15.55 ? 230  GLU A N   1 
ATOM   1823  C  CA  . GLU A 1 230 ? 21.273  0.432   62.413  1.00 16.43 ? 230  GLU A CA  1 
ATOM   1824  C  C   . GLU A 1 230 ? 21.950  0.260   61.052  1.00 15.91 ? 230  GLU A C   1 
ATOM   1825  O  O   . GLU A 1 230 ? 22.767  -0.651  60.865  1.00 15.60 ? 230  GLU A O   1 
ATOM   1826  C  CB  . GLU A 1 230 ? 19.839  -0.109  62.379  1.00 16.35 ? 230  GLU A CB  1 
ATOM   1827  C  CG  . GLU A 1 230 ? 19.282  -0.467  63.774  1.00 19.11 ? 230  GLU A CG  1 
ATOM   1828  C  CD  . GLU A 1 230 ? 17.750  -0.660  63.835  1.00 19.97 ? 230  GLU A CD  1 
ATOM   1829  O  OE1 . GLU A 1 230 ? 17.235  -0.935  64.942  1.00 24.04 ? 230  GLU A OE1 1 
ATOM   1830  O  OE2 . GLU A 1 230 ? 17.050  -0.534  62.807  1.00 23.98 ? 230  GLU A OE2 1 
ATOM   1831  N  N   . ALA A 1 231 ? 21.632  1.164   60.126  1.00 15.37 ? 231  ALA A N   1 
ATOM   1832  C  CA  . ALA A 1 231 ? 22.217  1.163   58.787  1.00 15.45 ? 231  ALA A CA  1 
ATOM   1833  C  C   . ALA A 1 231 ? 23.752  1.305   58.822  1.00 15.65 ? 231  ALA A C   1 
ATOM   1834  O  O   . ALA A 1 231 ? 24.457  0.606   58.099  1.00 15.02 ? 231  ALA A O   1 
ATOM   1835  C  CB  . ALA A 1 231 ? 21.584  2.251   57.929  1.00 14.67 ? 231  ALA A CB  1 
ATOM   1836  N  N   . THR A 1 232 ? 24.246  2.198   59.676  1.00 15.89 ? 232  THR A N   1 
ATOM   1837  C  CA  . THR A 1 232 ? 25.671  2.395   59.888  1.00 17.04 ? 232  THR A CA  1 
ATOM   1838  C  C   . THR A 1 232 ? 26.333  1.134   60.453  1.00 17.36 ? 232  THR A C   1 
ATOM   1839  O  O   . THR A 1 232 ? 27.401  0.728   59.996  1.00 17.72 ? 232  THR A O   1 
ATOM   1840  C  CB  . THR A 1 232 ? 25.904  3.592   60.849  1.00 17.35 ? 232  THR A CB  1 
ATOM   1841  O  OG1 . THR A 1 232 ? 25.474  4.798   60.208  1.00 19.21 ? 232  THR A OG1 1 
ATOM   1842  C  CG2 . THR A 1 232 ? 27.375  3.729   61.238  1.00 17.77 ? 232  THR A CG2 1 
ATOM   1843  N  N   . GLU A 1 233 ? 25.694  0.528   61.452  1.00 18.00 ? 233  GLU A N   1 
ATOM   1844  C  CA  . GLU A 1 233 ? 26.191  -0.691  62.073  1.00 18.96 ? 233  GLU A CA  1 
ATOM   1845  C  C   . GLU A 1 233 ? 26.322  -1.760  61.007  1.00 17.62 ? 233  GLU A C   1 
ATOM   1846  O  O   . GLU A 1 233 ? 27.382  -2.366  60.876  1.00 18.30 ? 233  GLU A O   1 
ATOM   1847  C  CB  . GLU A 1 233 ? 25.284  -1.148  63.239  1.00 19.03 ? 233  GLU A CB  1 
ATOM   1848  C  CG  . GLU A 1 233 ? 25.549  -2.580  63.749  1.00 21.79 ? 233  GLU A CG  1 
ATOM   1849  C  CD  . GLU A 1 233 ? 24.938  -2.885  65.151  1.00 23.27 ? 233  GLU A CD  1 
ATOM   1850  O  OE1 . GLU A 1 233 ? 25.414  -3.860  65.803  1.00 24.93 ? 233  GLU A OE1 1 
ATOM   1851  O  OE2 . GLU A 1 233 ? 23.989  -2.170  65.595  1.00 27.74 ? 233  GLU A OE2 1 
ATOM   1852  N  N   . VAL A 1 234 ? 25.267  -1.955  60.222  1.00 16.39 ? 234  VAL A N   1 
ATOM   1853  C  CA  . VAL A 1 234 ? 25.282  -2.968  59.165  1.00 15.30 ? 234  VAL A CA  1 
ATOM   1854  C  C   . VAL A 1 234 ? 26.350  -2.683  58.098  1.00 15.10 ? 234  VAL A C   1 
ATOM   1855  O  O   . VAL A 1 234 ? 27.094  -3.590  57.694  1.00 15.11 ? 234  VAL A O   1 
ATOM   1856  C  CB  . VAL A 1 234 ? 23.880  -3.186  58.513  1.00 15.03 ? 234  VAL A CB  1 
ATOM   1857  C  CG1 . VAL A 1 234 ? 23.989  -4.178  57.361  1.00 14.35 ? 234  VAL A CG1 1 
ATOM   1858  C  CG2 . VAL A 1 234 ? 22.879  -3.691  59.542  1.00 12.83 ? 234  VAL A CG2 1 
ATOM   1859  N  N   . GLN A 1 235 ? 26.434  -1.420  57.676  1.00 14.69 ? 235  GLN A N   1 
ATOM   1860  C  CA  . GLN A 1 235 ? 27.371  -0.994  56.627  1.00 14.02 ? 235  GLN A CA  1 
ATOM   1861  C  C   . GLN A 1 235 ? 28.812  -1.394  56.946  1.00 14.17 ? 235  GLN A C   1 
ATOM   1862  O  O   . GLN A 1 235 ? 29.547  -1.849  56.064  1.00 13.75 ? 235  GLN A O   1 
ATOM   1863  C  CB  . GLN A 1 235 ? 27.270  0.519   56.395  1.00 14.01 ? 235  GLN A CB  1 
ATOM   1864  C  CG  . GLN A 1 235 ? 28.061  1.019   55.191  1.00 13.45 ? 235  GLN A CG  1 
ATOM   1865  C  CD  . GLN A 1 235 ? 27.757  2.468   54.838  1.00 12.59 ? 235  GLN A CD  1 
ATOM   1866  O  OE1 . GLN A 1 235 ? 28.647  3.302   54.832  1.00 14.39 ? 235  GLN A OE1 1 
ATOM   1867  N  NE2 . GLN A 1 235 ? 26.508  2.770   54.567  1.00 8.71  ? 235  GLN A NE2 1 
ATOM   1868  N  N   . GLY A 1 236 ? 29.196  -1.242  58.217  1.00 14.56 ? 236  GLY A N   1 
ATOM   1869  C  CA  . GLY A 1 236 ? 30.557  -1.527  58.661  1.00 15.08 ? 236  GLY A CA  1 
ATOM   1870  C  C   . GLY A 1 236 ? 30.921  -2.994  58.550  1.00 15.75 ? 236  GLY A C   1 
ATOM   1871  O  O   . GLY A 1 236 ? 32.077  -3.340  58.288  1.00 16.12 ? 236  GLY A O   1 
ATOM   1872  N  N   . LYS A 1 237 ? 29.926  -3.855  58.738  1.00 16.37 ? 237  LYS A N   1 
ATOM   1873  C  CA  . LYS A 1 237 ? 30.120  -5.296  58.665  1.00 17.05 ? 237  LYS A CA  1 
ATOM   1874  C  C   . LYS A 1 237 ? 29.881  -5.895  57.276  1.00 16.39 ? 237  LYS A C   1 
ATOM   1875  O  O   . LYS A 1 237 ? 30.577  -6.820  56.883  1.00 16.22 ? 237  LYS A O   1 
ATOM   1876  C  CB  . LYS A 1 237 ? 29.210  -5.992  59.676  1.00 18.47 ? 237  LYS A CB  1 
ATOM   1877  C  CG  . LYS A 1 237 ? 29.890  -6.348  61.000  1.00 20.73 ? 237  LYS A CG  1 
ATOM   1878  C  CD  . LYS A 1 237 ? 29.371  -5.469  62.151  1.00 25.14 ? 237  LYS A CD  1 
ATOM   1879  C  CE  . LYS A 1 237 ? 30.086  -5.810  63.479  1.00 24.39 ? 237  LYS A CE  1 
ATOM   1880  N  NZ  . LYS A 1 237 ? 31.596  -5.847  63.320  1.00 25.86 ? 237  LYS A NZ  1 
ATOM   1881  N  N   . ASP A 1 238 ? 28.900  -5.371  56.540  1.00 15.86 ? 238  ASP A N   1 
ATOM   1882  C  CA  . ASP A 1 238 ? 28.461  -5.970  55.270  1.00 15.21 ? 238  ASP A CA  1 
ATOM   1883  C  C   . ASP A 1 238 ? 27.946  -4.901  54.282  1.00 14.21 ? 238  ASP A C   1 
ATOM   1884  O  O   . ASP A 1 238 ? 26.862  -4.379  54.484  1.00 14.29 ? 238  ASP A O   1 
ATOM   1885  C  CB  . ASP A 1 238 ? 27.342  -6.982  55.585  1.00 15.22 ? 238  ASP A CB  1 
ATOM   1886  C  CG  . ASP A 1 238 ? 26.994  -7.891  54.412  1.00 16.49 ? 238  ASP A CG  1 
ATOM   1887  O  OD1 . ASP A 1 238 ? 27.379  -7.599  53.246  1.00 16.55 ? 238  ASP A OD1 1 
ATOM   1888  O  OD2 . ASP A 1 238 ? 26.305  -8.908  54.669  1.00 15.80 ? 238  ASP A OD2 1 
ATOM   1889  N  N   . PHE A 1 239 ? 28.711  -4.581  53.228  1.00 13.25 ? 239  PHE A N   1 
ATOM   1890  C  CA  . PHE A 1 239 ? 28.244  -3.636  52.173  1.00 12.21 ? 239  PHE A CA  1 
ATOM   1891  C  C   . PHE A 1 239 ? 27.366  -4.312  51.124  1.00 12.17 ? 239  PHE A C   1 
ATOM   1892  O  O   . PHE A 1 239 ? 26.839  -3.642  50.233  1.00 13.30 ? 239  PHE A O   1 
ATOM   1893  C  CB  . PHE A 1 239 ? 29.382  -2.833  51.500  1.00 11.01 ? 239  PHE A CB  1 
ATOM   1894  C  CG  . PHE A 1 239 ? 30.311  -3.662  50.633  1.00 11.20 ? 239  PHE A CG  1 
ATOM   1895  C  CD1 . PHE A 1 239 ? 30.168  -3.680  49.235  1.00 9.70  ? 239  PHE A CD1 1 
ATOM   1896  C  CD2 . PHE A 1 239 ? 31.350  -4.406  51.206  1.00 10.08 ? 239  PHE A CD2 1 
ATOM   1897  C  CE1 . PHE A 1 239 ? 31.012  -4.451  48.423  1.00 8.13  ? 239  PHE A CE1 1 
ATOM   1898  C  CE2 . PHE A 1 239 ? 32.210  -5.183  50.401  1.00 9.88  ? 239  PHE A CE2 1 
ATOM   1899  C  CZ  . PHE A 1 239 ? 32.048  -5.187  48.997  1.00 9.08  ? 239  PHE A CZ  1 
ATOM   1900  N  N   . ASN A 1 240 ? 27.186  -5.625  51.258  1.00 12.03 ? 240  ASN A N   1 
ATOM   1901  C  CA  . ASN A 1 240 ? 26.308  -6.418  50.394  1.00 11.65 ? 240  ASN A CA  1 
ATOM   1902  C  C   . ASN A 1 240 ? 25.146  -7.088  51.140  1.00 11.75 ? 240  ASN A C   1 
ATOM   1903  O  O   . ASN A 1 240 ? 24.765  -8.203  50.769  1.00 12.06 ? 240  ASN A O   1 
ATOM   1904  C  CB  . ASN A 1 240 ? 27.128  -7.539  49.754  1.00 11.22 ? 240  ASN A CB  1 
ATOM   1905  C  CG  . ASN A 1 240 ? 28.406  -7.042  49.119  1.00 11.06 ? 240  ASN A CG  1 
ATOM   1906  O  OD1 . ASN A 1 240 ? 28.372  -6.301  48.124  1.00 8.51  ? 240  ASN A OD1 1 
ATOM   1907  N  ND2 . ASN A 1 240 ? 29.554  -7.466  49.674  1.00 7.43  ? 240  ASN A ND2 1 
ATOM   1908  N  N   . HIS A 1 241 ? 24.581  -6.442  52.170  1.00 11.48 ? 241  HIS A N   1 
ATOM   1909  C  CA  . HIS A 1 241 ? 23.696  -7.165  53.110  1.00 11.53 ? 241  HIS A CA  1 
ATOM   1910  C  C   . HIS A 1 241 ? 22.376  -7.625  52.502  1.00 11.38 ? 241  HIS A C   1 
ATOM   1911  O  O   . HIS A 1 241 ? 21.946  -8.755  52.750  1.00 11.32 ? 241  HIS A O   1 
ATOM   1912  C  CB  . HIS A 1 241 ? 23.455  -6.402  54.426  1.00 11.22 ? 241  HIS A CB  1 
ATOM   1913  C  CG  . HIS A 1 241 ? 22.321  -5.427  54.362  1.00 13.36 ? 241  HIS A CG  1 
ATOM   1914  N  ND1 . HIS A 1 241 ? 22.464  -4.146  53.867  1.00 13.75 ? 241  HIS A ND1 1 
ATOM   1915  C  CD2 . HIS A 1 241 ? 21.021  -5.547  54.728  1.00 13.76 ? 241  HIS A CD2 1 
ATOM   1916  C  CE1 . HIS A 1 241 ? 21.296  -3.526  53.915  1.00 14.66 ? 241  HIS A CE1 1 
ATOM   1917  N  NE2 . HIS A 1 241 ? 20.404  -4.353  54.434  1.00 14.23 ? 241  HIS A NE2 1 
ATOM   1918  N  N   . ALA A 1 242 ? 21.746  -6.769  51.696  1.00 11.20 ? 242  ALA A N   1 
ATOM   1919  C  CA  . ALA A 1 242 ? 20.417  -7.079  51.176  1.00 10.62 ? 242  ALA A CA  1 
ATOM   1920  C  C   . ALA A 1 242 ? 20.506  -8.217  50.176  1.00 10.71 ? 242  ALA A C   1 
ATOM   1921  O  O   . ALA A 1 242 ? 19.710  -9.152  50.232  1.00 10.26 ? 242  ALA A O   1 
ATOM   1922  C  CB  . ALA A 1 242 ? 19.759  -5.852  50.579  1.00 10.52 ? 242  ALA A CB  1 
ATOM   1923  N  N   . SER A 1 243 ? 21.505  -8.142  49.295  1.00 11.16 ? 243  SER A N   1 
ATOM   1924  C  CA  . SER A 1 243 ? 21.800  -9.203  48.310  1.00 11.91 ? 243  SER A CA  1 
ATOM   1925  C  C   . SER A 1 243 ? 22.094  -10.532 49.010  1.00 11.85 ? 243  SER A C   1 
ATOM   1926  O  O   . SER A 1 243 ? 21.474  -11.547 48.701  1.00 11.96 ? 243  SER A O   1 
ATOM   1927  C  CB  . SER A 1 243 ? 23.002  -8.813  47.423  1.00 11.87 ? 243  SER A CB  1 
ATOM   1928  O  OG  . SER A 1 243 ? 22.608  -7.850  46.462  1.00 12.99 ? 243  SER A OG  1 
ATOM   1929  N  N   . ASN A 1 244 ? 23.061  -10.500 49.926  1.00 11.58 ? 244  ASN A N   1 
ATOM   1930  C  CA  . ASN A 1 244 ? 23.395  -11.618 50.791  1.00 12.12 ? 244  ASN A CA  1 
ATOM   1931  C  C   . ASN A 1 244 ? 22.170  -12.291 51.435  1.00 12.47 ? 244  ASN A C   1 
ATOM   1932  O  O   . ASN A 1 244 ? 21.987  -13.501 51.287  1.00 12.44 ? 244  ASN A O   1 
ATOM   1933  C  CB  . ASN A 1 244 ? 24.336  -11.128 51.894  1.00 11.81 ? 244  ASN A CB  1 
ATOM   1934  C  CG  . ASN A 1 244 ? 25.179  -12.242 52.487  1.00 12.80 ? 244  ASN A CG  1 
ATOM   1935  O  OD1 . ASN A 1 244 ? 25.136  -13.394 52.026  1.00 9.92  ? 244  ASN A OD1 1 
ATOM   1936  N  ND2 . ASN A 1 244 ? 25.985  -11.896 53.506  1.00 11.52 ? 244  ASN A ND2 1 
ATOM   1937  N  N   . ASP A 1 245 ? 21.345  -11.493 52.125  1.00 12.72 ? 245  ASP A N   1 
ATOM   1938  C  CA  . ASP A 1 245 ? 20.167  -11.979 52.847  1.00 13.73 ? 245  ASP A CA  1 
ATOM   1939  C  C   . ASP A 1 245 ? 19.119  -12.588 51.906  1.00 13.87 ? 245  ASP A C   1 
ATOM   1940  O  O   . ASP A 1 245 ? 18.556  -13.637 52.207  1.00 13.88 ? 245  ASP A O   1 
ATOM   1941  C  CB  . ASP A 1 245 ? 19.540  -10.850 53.706  1.00 14.00 ? 245  ASP A CB  1 
ATOM   1942  C  CG  . ASP A 1 245 ? 18.158  -11.219 54.257  1.00 14.25 ? 245  ASP A CG  1 
ATOM   1943  O  OD1 . ASP A 1 245 ? 18.076  -11.986 55.226  1.00 14.56 ? 245  ASP A OD1 1 
ATOM   1944  O  OD2 . ASP A 1 245 ? 17.137  -10.744 53.721  1.00 17.28 ? 245  ASP A OD2 1 
ATOM   1945  N  N   . THR A 1 246 ? 18.871  -11.929 50.768  1.00 13.80 ? 246  THR A N   1 
ATOM   1946  C  CA  . THR A 1 246 ? 17.893  -12.428 49.785  1.00 13.58 ? 246  THR A CA  1 
ATOM   1947  C  C   . THR A 1 246 ? 18.404  -13.673 49.059  1.00 13.88 ? 246  THR A C   1 
ATOM   1948  O  O   . THR A 1 246 ? 17.619  -14.601 48.760  1.00 13.63 ? 246  THR A O   1 
ATOM   1949  C  CB  . THR A 1 246 ? 17.463  -11.351 48.730  1.00 13.07 ? 246  THR A CB  1 
ATOM   1950  O  OG1 . THR A 1 246 ? 17.237  -10.096 49.372  1.00 12.47 ? 246  THR A OG1 1 
ATOM   1951  C  CG2 . THR A 1 246 ? 16.178  -11.761 48.042  1.00 12.39 ? 246  THR A CG2 1 
ATOM   1952  N  N   . PHE A 1 247 ? 19.703  -13.688 48.753  1.00 13.32 ? 247  PHE A N   1 
ATOM   1953  C  CA  . PHE A 1 247 ? 20.297  -14.899 48.192  1.00 13.81 ? 247  PHE A CA  1 
ATOM   1954  C  C   . PHE A 1 247 ? 20.218  -16.110 49.139  1.00 14.39 ? 247  PHE A C   1 
ATOM   1955  O  O   . PHE A 1 247 ? 19.846  -17.201 48.701  1.00 15.04 ? 247  PHE A O   1 
ATOM   1956  C  CB  . PHE A 1 247 ? 21.738  -14.690 47.738  1.00 12.95 ? 247  PHE A CB  1 
ATOM   1957  C  CG  . PHE A 1 247 ? 22.277  -15.839 46.938  1.00 12.17 ? 247  PHE A CG  1 
ATOM   1958  C  CD1 . PHE A 1 247 ? 22.748  -16.997 47.570  1.00 11.16 ? 247  PHE A CD1 1 
ATOM   1959  C  CD2 . PHE A 1 247 ? 22.311  -15.777 45.556  1.00 9.15  ? 247  PHE A CD2 1 
ATOM   1960  C  CE1 . PHE A 1 247 ? 23.226  -18.067 46.832  1.00 9.52  ? 247  PHE A CE1 1 
ATOM   1961  C  CE2 . PHE A 1 247 ? 22.806  -16.841 44.817  1.00 9.45  ? 247  PHE A CE2 1 
ATOM   1962  C  CZ  . PHE A 1 247 ? 23.260  -17.990 45.456  1.00 9.32  ? 247  PHE A CZ  1 
ATOM   1963  N  N   . GLN A 1 248 ? 20.564  -15.920 50.411  1.00 14.82 ? 248  GLN A N   1 
ATOM   1964  C  CA  . GLN A 1 248 ? 20.530  -17.004 51.400  1.00 16.01 ? 248  GLN A CA  1 
ATOM   1965  C  C   . GLN A 1 248 ? 19.112  -17.551 51.653  1.00 15.87 ? 248  GLN A C   1 
ATOM   1966  O  O   . GLN A 1 248 ? 18.912  -18.763 51.698  1.00 16.04 ? 248  GLN A O   1 
ATOM   1967  C  CB  . GLN A 1 248 ? 21.182  -16.559 52.726  1.00 16.54 ? 248  GLN A CB  1 
ATOM   1968  C  CG  . GLN A 1 248 ? 22.717  -16.406 52.672  1.00 19.03 ? 248  GLN A CG  1 
ATOM   1969  C  CD  . GLN A 1 248 ? 23.398  -17.580 51.964  1.00 23.26 ? 248  GLN A CD  1 
ATOM   1970  O  OE1 . GLN A 1 248 ? 24.090  -17.394 50.941  1.00 25.00 ? 248  GLN A OE1 1 
ATOM   1971  N  NE2 . GLN A 1 248 ? 23.189  -18.794 52.485  1.00 21.33 ? 248  GLN A NE2 1 
ATOM   1972  N  N   . ALA A 1 249 ? 18.142  -16.652 51.815  1.00 15.82 ? 249  ALA A N   1 
ATOM   1973  C  CA  . ALA A 1 249 ? 16.738  -17.022 51.979  1.00 16.06 ? 249  ALA A CA  1 
ATOM   1974  C  C   . ALA A 1 249 ? 16.224  -17.929 50.866  1.00 16.52 ? 249  ALA A C   1 
ATOM   1975  O  O   . ALA A 1 249 ? 15.507  -18.879 51.133  1.00 16.34 ? 249  ALA A O   1 
ATOM   1976  C  CB  . ALA A 1 249 ? 15.866  -15.777 52.087  1.00 16.02 ? 249  ALA A CB  1 
ATOM   1977  N  N   . ILE A 1 250 ? 16.570  -17.633 49.618  1.00 17.34 ? 250  ILE A N   1 
ATOM   1978  C  CA  . ILE A 1 250 ? 16.128  -18.483 48.499  1.00 18.49 ? 250  ILE A CA  1 
ATOM   1979  C  C   . ILE A 1 250 ? 16.872  -19.825 48.506  1.00 19.39 ? 250  ILE A C   1 
ATOM   1980  O  O   . ILE A 1 250 ? 16.277  -20.883 48.256  1.00 19.41 ? 250  ILE A O   1 
ATOM   1981  C  CB  . ILE A 1 250 ? 16.284  -17.781 47.123  1.00 18.20 ? 250  ILE A CB  1 
ATOM   1982  C  CG1 . ILE A 1 250 ? 15.311  -16.601 47.011  1.00 17.56 ? 250  ILE A CG1 1 
ATOM   1983  C  CG2 . ILE A 1 250 ? 16.017  -18.760 45.991  1.00 18.65 ? 250  ILE A CG2 1 
ATOM   1984  C  CD1 . ILE A 1 250 ? 15.669  -15.575 45.947  1.00 13.23 ? 250  ILE A CD1 1 
ATOM   1985  N  N   . GLU A 1 251 ? 18.168  -19.766 48.814  1.00 20.12 ? 251  GLU A N   1 
ATOM   1986  C  CA  . GLU A 1 251 ? 19.022  -20.944 48.831  1.00 21.04 ? 251  GLU A CA  1 
ATOM   1987  C  C   . GLU A 1 251 ? 18.621  -21.888 49.964  1.00 20.95 ? 251  GLU A C   1 
ATOM   1988  O  O   . GLU A 1 251 ? 18.752  -23.105 49.829  1.00 20.97 ? 251  GLU A O   1 
ATOM   1989  C  CB  . GLU A 1 251 ? 20.509  -20.532 48.946  1.00 21.42 ? 251  GLU A CB  1 
ATOM   1990  C  CG  . GLU A 1 251 ? 21.484  -21.443 48.184  1.00 23.00 ? 251  GLU A CG  1 
ATOM   1991  C  CD  . GLU A 1 251 ? 21.034  -21.785 46.744  1.00 25.01 ? 251  GLU A CD  1 
ATOM   1992  O  OE1 . GLU A 1 251 ? 21.261  -22.950 46.327  1.00 27.25 ? 251  GLU A OE1 1 
ATOM   1993  O  OE2 . GLU A 1 251 ? 20.461  -20.914 46.032  1.00 21.87 ? 251  GLU A OE2 1 
ATOM   1994  N  N   . ASN A 1 252 ? 18.144  -21.310 51.068  1.00 20.98 ? 252  ASN A N   1 
ATOM   1995  C  CA  . ASN A 1 252 ? 17.672  -22.059 52.242  1.00 21.24 ? 252  ASN A CA  1 
ATOM   1996  C  C   . ASN A 1 252 ? 16.211  -22.543 52.134  1.00 21.18 ? 252  ASN A C   1 
ATOM   1997  O  O   . ASN A 1 252 ? 15.718  -23.255 53.017  1.00 20.85 ? 252  ASN A O   1 
ATOM   1998  C  CB  . ASN A 1 252 ? 17.803  -21.197 53.507  1.00 21.36 ? 252  ASN A CB  1 
ATOM   1999  C  CG  . ASN A 1 252 ? 19.250  -20.931 53.907  1.00 22.06 ? 252  ASN A CG  1 
ATOM   2000  O  OD1 . ASN A 1 252 ? 20.184  -21.633 53.487  1.00 22.98 ? 252  ASN A OD1 1 
ATOM   2001  N  ND2 . ASN A 1 252 ? 19.438  -19.916 54.739  1.00 20.71 ? 252  ASN A ND2 1 
ATOM   2002  N  N   . GLY A 1 253 ? 15.516  -22.130 51.072  1.00 20.90 ? 253  GLY A N   1 
ATOM   2003  C  CA  . GLY A 1 253 ? 14.124  -22.522 50.857  1.00 19.96 ? 253  GLY A CA  1 
ATOM   2004  C  C   . GLY A 1 253 ? 13.132  -21.713 51.673  1.00 19.42 ? 253  GLY A C   1 
ATOM   2005  O  O   . GLY A 1 253 ? 12.010  -22.145 51.885  1.00 20.13 ? 253  GLY A O   1 
ATOM   2006  N  N   . ASP A 1 254 ? 13.539  -20.546 52.152  1.00 18.70 ? 254  ASP A N   1 
ATOM   2007  C  CA  . ASP A 1 254 ? 12.605  -19.582 52.742  1.00 17.89 ? 254  ASP A CA  1 
ATOM   2008  C  C   . ASP A 1 254 ? 12.285  -18.587 51.624  1.00 16.94 ? 254  ASP A C   1 
ATOM   2009  O  O   . ASP A 1 254 ? 12.759  -17.459 51.634  1.00 16.64 ? 254  ASP A O   1 
ATOM   2010  C  CB  . ASP A 1 254 ? 13.242  -18.897 53.964  1.00 18.32 ? 254  ASP A CB  1 
ATOM   2011  C  CG  . ASP A 1 254 ? 12.233  -18.066 54.794  1.00 21.34 ? 254  ASP A CG  1 
ATOM   2012  O  OD1 . ASP A 1 254 ? 11.021  -18.388 54.813  1.00 26.26 ? 254  ASP A OD1 1 
ATOM   2013  O  OD2 . ASP A 1 254 ? 12.645  -17.081 55.451  1.00 22.56 ? 254  ASP A OD2 1 
ATOM   2014  N  N   . PHE A 1 255 ? 11.509  -19.037 50.633  1.00 15.61 ? 255  PHE A N   1 
ATOM   2015  C  CA  . PHE A 1 255 ? 11.232  -18.267 49.419  1.00 14.03 ? 255  PHE A CA  1 
ATOM   2016  C  C   . PHE A 1 255 ? 10.520  -16.923 49.645  1.00 14.11 ? 255  PHE A C   1 
ATOM   2017  O  O   . PHE A 1 255 ? 9.415   -16.882 50.185  1.00 14.27 ? 255  PHE A O   1 
ATOM   2018  C  CB  . PHE A 1 255 ? 10.410  -19.113 48.457  1.00 13.83 ? 255  PHE A CB  1 
ATOM   2019  C  CG  . PHE A 1 255 ? 11.099  -20.380 47.997  1.00 13.41 ? 255  PHE A CG  1 
ATOM   2020  C  CD1 . PHE A 1 255 ? 10.346  -21.527 47.727  1.00 11.62 ? 255  PHE A CD1 1 
ATOM   2021  C  CD2 . PHE A 1 255 ? 12.500  -20.427 47.834  1.00 12.81 ? 255  PHE A CD2 1 
ATOM   2022  C  CE1 . PHE A 1 255 ? 10.959  -22.702 47.302  1.00 12.26 ? 255  PHE A CE1 1 
ATOM   2023  C  CE2 . PHE A 1 255 ? 13.141  -21.602 47.405  1.00 13.42 ? 255  PHE A CE2 1 
ATOM   2024  C  CZ  . PHE A 1 255 ? 12.364  -22.746 47.133  1.00 14.02 ? 255  PHE A CZ  1 
ATOM   2025  N  N   . PRO A 1 256 ? 11.146  -15.807 49.224  1.00 14.14 ? 256  PRO A N   1 
ATOM   2026  C  CA  . PRO A 1 256 ? 10.471  -14.510 49.315  1.00 13.67 ? 256  PRO A CA  1 
ATOM   2027  C  C   . PRO A 1 256 ? 9.177   -14.506 48.475  1.00 13.57 ? 256  PRO A C   1 
ATOM   2028  O  O   . PRO A 1 256 ? 9.193   -14.955 47.323  1.00 13.74 ? 256  PRO A O   1 
ATOM   2029  C  CB  . PRO A 1 256 ? 11.502  -13.542 48.711  1.00 13.46 ? 256  PRO A CB  1 
ATOM   2030  C  CG  . PRO A 1 256 ? 12.788  -14.231 48.841  1.00 13.59 ? 256  PRO A CG  1 
ATOM   2031  C  CD  . PRO A 1 256 ? 12.496  -15.670 48.643  1.00 13.70 ? 256  PRO A CD  1 
ATOM   2032  N  N   . GLU A 1 257 ? 8.082   -14.006 49.052  1.00 12.81 ? 257  GLU A N   1 
ATOM   2033  C  CA  . GLU A 1 257 ? 6.803   -13.967 48.388  1.00 13.01 ? 257  GLU A CA  1 
ATOM   2034  C  C   . GLU A 1 257 ? 6.193   -12.604 48.562  1.00 12.52 ? 257  GLU A C   1 
ATOM   2035  O  O   . GLU A 1 257 ? 6.385   -11.984 49.592  1.00 12.60 ? 257  GLU A O   1 
ATOM   2036  C  CB  . GLU A 1 257 ? 5.853   -15.016 48.976  1.00 12.66 ? 257  GLU A CB  1 
ATOM   2037  C  CG  . GLU A 1 257 ? 6.328   -16.462 48.817  1.00 14.62 ? 257  GLU A CG  1 
ATOM   2038  C  CD  . GLU A 1 257 ? 5.193   -17.489 48.898  1.00 15.43 ? 257  GLU A CD  1 
ATOM   2039  O  OE1 . GLU A 1 257 ? 4.207   -17.285 49.638  1.00 15.93 ? 257  GLU A OE1 1 
ATOM   2040  O  OE2 . GLU A 1 257 ? 5.292   -18.515 48.202  1.00 19.93 ? 257  GLU A OE2 1 
ATOM   2041  N  N   . TRP A 1 258 ? 5.453   -12.136 47.558  1.00 12.13 ? 258  TRP A N   1 
ATOM   2042  C  CA  . TRP A 1 258 ? 4.666   -10.918 47.692  1.00 12.21 ? 258  TRP A CA  1 
ATOM   2043  C  C   . TRP A 1 258 ? 3.290   -11.151 47.098  1.00 12.72 ? 258  TRP A C   1 
ATOM   2044  O  O   . TRP A 1 258 ? 3.142   -11.887 46.098  1.00 12.55 ? 258  TRP A O   1 
ATOM   2045  C  CB  . TRP A 1 258 ? 5.276   -9.743  46.905  1.00 12.29 ? 258  TRP A CB  1 
ATOM   2046  C  CG  . TRP A 1 258 ? 6.567   -9.155  47.393  1.00 11.47 ? 258  TRP A CG  1 
ATOM   2047  C  CD1 . TRP A 1 258 ? 6.740   -7.932  47.977  1.00 11.90 ? 258  TRP A CD1 1 
ATOM   2048  C  CD2 . TRP A 1 258 ? 7.876   -9.731  47.274  1.00 11.19 ? 258  TRP A CD2 1 
ATOM   2049  N  NE1 . TRP A 1 258 ? 8.074   -7.715  48.258  1.00 11.11 ? 258  TRP A NE1 1 
ATOM   2050  C  CE2 . TRP A 1 258 ? 8.792   -8.808  47.835  1.00 11.56 ? 258  TRP A CE2 1 
ATOM   2051  C  CE3 . TRP A 1 258 ? 8.363   -10.935 46.753  1.00 10.89 ? 258  TRP A CE3 1 
ATOM   2052  C  CZ2 . TRP A 1 258 ? 10.163  -9.058  47.890  1.00 10.61 ? 258  TRP A CZ2 1 
ATOM   2053  C  CZ3 . TRP A 1 258 ? 9.720   -11.185 46.814  1.00 11.79 ? 258  TRP A CZ3 1 
ATOM   2054  C  CH2 . TRP A 1 258 ? 10.606  -10.250 47.371  1.00 11.56 ? 258  TRP A CH2 1 
ATOM   2055  N  N   . ASP A 1 259 ? 2.287   -10.481 47.670  1.00 12.64 ? 259  ASP A N   1 
ATOM   2056  C  CA  . ASP A 1 259 ? 0.983   -10.391 47.018  1.00 13.31 ? 259  ASP A CA  1 
ATOM   2057  C  C   . ASP A 1 259 ? 0.809   -9.151  46.121  1.00 13.03 ? 259  ASP A C   1 
ATOM   2058  O  O   . ASP A 1 259 ? 1.219   -8.045  46.480  1.00 12.97 ? 259  ASP A O   1 
ATOM   2059  C  CB  . ASP A 1 259 ? -0.123  -10.511 48.059  1.00 13.34 ? 259  ASP A CB  1 
ATOM   2060  C  CG  . ASP A 1 259 ? -0.108  -11.854 48.726  1.00 14.85 ? 259  ASP A CG  1 
ATOM   2061  O  OD1 . ASP A 1 259 ? 0.612   -11.993 49.727  1.00 19.30 ? 259  ASP A OD1 1 
ATOM   2062  O  OD2 . ASP A 1 259 ? -0.763  -12.790 48.232  1.00 17.62 ? 259  ASP A OD2 1 
ATOM   2063  N  N   . LEU A 1 260 ? 0.215   -9.352  44.952  1.00 12.97 ? 260  LEU A N   1 
ATOM   2064  C  CA  . LEU A 1 260 ? -0.100  -8.247  44.013  1.00 12.79 ? 260  LEU A CA  1 
ATOM   2065  C  C   . LEU A 1 260 ? -1.561  -7.779  44.140  1.00 12.78 ? 260  LEU A C   1 
ATOM   2066  O  O   . LEU A 1 260 ? -2.494  -8.573  44.001  1.00 12.56 ? 260  LEU A O   1 
ATOM   2067  C  CB  . LEU A 1 260 ? 0.182   -8.654  42.560  1.00 12.56 ? 260  LEU A CB  1 
ATOM   2068  C  CG  . LEU A 1 260 ? -0.051  -7.631  41.439  1.00 13.58 ? 260  LEU A CG  1 
ATOM   2069  C  CD1 . LEU A 1 260 ? 0.993   -6.496  41.472  1.00 14.90 ? 260  LEU A CD1 1 
ATOM   2070  C  CD2 . LEU A 1 260 ? -0.019  -8.308  40.077  1.00 12.55 ? 260  LEU A CD2 1 
ATOM   2071  N  N   . PHE A 1 261 ? -1.736  -6.488  44.410  1.00 11.84 ? 261  PHE A N   1 
ATOM   2072  C  CA  . PHE A 1 261 ? -3.036  -5.887  44.479  1.00 11.24 ? 261  PHE A CA  1 
ATOM   2073  C  C   . PHE A 1 261 ? -3.133  -4.803  43.396  1.00 11.03 ? 261  PHE A C   1 
ATOM   2074  O  O   . PHE A 1 261 ? -2.113  -4.293  42.884  1.00 9.77  ? 261  PHE A O   1 
ATOM   2075  C  CB  . PHE A 1 261 ? -3.284  -5.247  45.852  1.00 11.73 ? 261  PHE A CB  1 
ATOM   2076  C  CG  . PHE A 1 261 ? -3.343  -6.219  47.010  1.00 12.21 ? 261  PHE A CG  1 
ATOM   2077  C  CD1 . PHE A 1 261 ? -4.567  -6.584  47.560  1.00 12.21 ? 261  PHE A CD1 1 
ATOM   2078  C  CD2 . PHE A 1 261 ? -2.167  -6.725  47.588  1.00 13.19 ? 261  PHE A CD2 1 
ATOM   2079  C  CE1 . PHE A 1 261 ? -4.642  -7.457  48.646  1.00 12.91 ? 261  PHE A CE1 1 
ATOM   2080  C  CE2 . PHE A 1 261 ? -2.217  -7.618  48.675  1.00 11.81 ? 261  PHE A CE2 1 
ATOM   2081  C  CZ  . PHE A 1 261 ? -3.457  -7.983  49.205  1.00 13.27 ? 261  PHE A CZ  1 
ATOM   2082  N  N   . VAL A 1 262 ? -4.379  -4.450  43.071  1.00 10.44 ? 262  VAL A N   1 
ATOM   2083  C  CA  . VAL A 1 262 ? -4.663  -3.499  42.032  1.00 9.79  ? 262  VAL A CA  1 
ATOM   2084  C  C   . VAL A 1 262 ? -5.632  -2.455  42.565  1.00 9.48  ? 262  VAL A C   1 
ATOM   2085  O  O   . VAL A 1 262 ? -6.601  -2.788  43.227  1.00 10.05 ? 262  VAL A O   1 
ATOM   2086  C  CB  . VAL A 1 262 ? -5.189  -4.210  40.729  1.00 9.49  ? 262  VAL A CB  1 
ATOM   2087  C  CG1 . VAL A 1 262 ? -6.561  -4.855  40.938  1.00 9.21  ? 262  VAL A CG1 1 
ATOM   2088  C  CG2 . VAL A 1 262 ? -5.238  -3.243  39.551  1.00 9.41  ? 262  VAL A CG2 1 
ATOM   2089  N  N   . GLN A 1 263 ? -5.342  -1.190  42.291  1.00 9.74  ? 263  GLN A N   1 
ATOM   2090  C  CA  . GLN A 1 263 ? -6.290  -0.096  42.526  1.00 9.49  ? 263  GLN A CA  1 
ATOM   2091  C  C   . GLN A 1 263 ? -6.863  0.399   41.204  1.00 9.72  ? 263  GLN A C   1 
ATOM   2092  O  O   . GLN A 1 263 ? -6.132  0.631   40.235  1.00 9.12  ? 263  GLN A O   1 
ATOM   2093  C  CB  . GLN A 1 263 ? -5.628  1.056   43.284  1.00 9.36  ? 263  GLN A CB  1 
ATOM   2094  C  CG  . GLN A 1 263 ? -5.348  0.747   44.747  1.00 8.67  ? 263  GLN A CG  1 
ATOM   2095  C  CD  . GLN A 1 263 ? -4.493  1.809   45.372  1.00 10.13 ? 263  GLN A CD  1 
ATOM   2096  O  OE1 . GLN A 1 263 ? -3.334  1.969   45.013  1.00 9.24  ? 263  GLN A OE1 1 
ATOM   2097  N  NE2 . GLN A 1 263 ? -5.064  2.564   46.298  1.00 11.22 ? 263  GLN A NE2 1 
ATOM   2098  N  N   . VAL A 1 264 ? -8.185  0.559   41.196  1.00 10.50 ? 264  VAL A N   1 
ATOM   2099  C  CA  . VAL A 1 264 ? -8.947  0.879   39.997  1.00 10.68 ? 264  VAL A CA  1 
ATOM   2100  C  C   . VAL A 1 264 ? -9.740  2.182   40.152  1.00 10.88 ? 264  VAL A C   1 
ATOM   2101  O  O   . VAL A 1 264 ? -10.530 2.367   41.082  1.00 10.18 ? 264  VAL A O   1 
ATOM   2102  C  CB  . VAL A 1 264 ? -9.892  -0.283  39.610  1.00 11.03 ? 264  VAL A CB  1 
ATOM   2103  C  CG1 . VAL A 1 264 ? -10.642 0.042   38.332  1.00 9.64  ? 264  VAL A CG1 1 
ATOM   2104  C  CG2 . VAL A 1 264 ? -9.098  -1.586  39.441  1.00 10.77 ? 264  VAL A CG2 1 
ATOM   2105  N  N   . LEU A 1 265 ? -9.502  3.069   39.200  1.00 11.31 ? 265  LEU A N   1 
ATOM   2106  C  CA  . LEU A 1 265 ? -10.070 4.390   39.171  1.00 12.10 ? 265  LEU A CA  1 
ATOM   2107  C  C   . LEU A 1 265 ? -10.656 4.617   37.793  1.00 12.28 ? 265  LEU A C   1 
ATOM   2108  O  O   . LEU A 1 265 ? -9.930  4.611   36.795  1.00 12.09 ? 265  LEU A O   1 
ATOM   2109  C  CB  . LEU A 1 265 ? -8.983  5.441   39.435  1.00 11.52 ? 265  LEU A CB  1 
ATOM   2110  C  CG  . LEU A 1 265 ? -9.424  6.905   39.264  1.00 12.84 ? 265  LEU A CG  1 
ATOM   2111  C  CD1 . LEU A 1 265 ? -10.459 7.355   40.331  1.00 9.62  ? 265  LEU A CD1 1 
ATOM   2112  C  CD2 . LEU A 1 265 ? -8.207  7.816   39.264  1.00 12.84 ? 265  LEU A CD2 1 
ATOM   2113  N  N   . ASP A 1 266 ? -11.968 4.821   37.745  1.00 12.72 ? 266  ASP A N   1 
ATOM   2114  C  CA  . ASP A 1 266 ? -12.658 5.008   36.482  1.00 13.13 ? 266  ASP A CA  1 
ATOM   2115  C  C   . ASP A 1 266 ? -12.254 6.358   35.874  1.00 13.51 ? 266  ASP A C   1 
ATOM   2116  O  O   . ASP A 1 266 ? -12.178 7.376   36.584  1.00 14.26 ? 266  ASP A O   1 
ATOM   2117  C  CB  . ASP A 1 266 ? -14.147 4.917   36.694  1.00 12.79 ? 266  ASP A CB  1 
ATOM   2118  C  CG  . ASP A 1 266 ? -14.903 4.971   35.420  1.00 16.39 ? 266  ASP A CG  1 
ATOM   2119  O  OD1 . ASP A 1 266 ? -15.355 3.898   34.943  1.00 20.37 ? 266  ASP A OD1 1 
ATOM   2120  O  OD2 . ASP A 1 266 ? -15.028 6.085   34.856  1.00 20.15 ? 266  ASP A OD2 1 
ATOM   2121  N  N   . PRO A 1 267 ? -11.949 6.376   34.567  1.00 13.63 ? 267  PRO A N   1 
ATOM   2122  C  CA  . PRO A 1 267 ? -11.574 7.649   33.931  1.00 13.92 ? 267  PRO A CA  1 
ATOM   2123  C  C   . PRO A 1 267 ? -12.562 8.813   34.146  1.00 13.71 ? 267  PRO A C   1 
ATOM   2124  O  O   . PRO A 1 267 ? -12.132 9.975   34.161  1.00 13.57 ? 267  PRO A O   1 
ATOM   2125  C  CB  . PRO A 1 267 ? -11.459 7.273   32.454  1.00 13.60 ? 267  PRO A CB  1 
ATOM   2126  C  CG  . PRO A 1 267 ? -10.965 5.810   32.528  1.00 14.39 ? 267  PRO A CG  1 
ATOM   2127  C  CD  . PRO A 1 267 ? -11.864 5.248   33.619  1.00 13.47 ? 267  PRO A CD  1 
ATOM   2128  N  N   . ALA A 1 268 ? -13.842 8.503   34.370  1.00 13.56 ? 268  ALA A N   1 
ATOM   2129  C  CA  . ALA A 1 268 ? -14.856 9.555   34.543  1.00 13.65 ? 268  ALA A CA  1 
ATOM   2130  C  C   . ALA A 1 268 ? -14.767 10.219  35.897  1.00 14.29 ? 268  ALA A C   1 
ATOM   2131  O  O   . ALA A 1 268 ? -15.426 11.224  36.111  1.00 15.04 ? 268  ALA A O   1 
ATOM   2132  C  CB  . ALA A 1 268 ? -16.242 9.036   34.307  1.00 12.64 ? 268  ALA A CB  1 
ATOM   2133  N  N   . ASP A 1 269 ? -13.937 9.682   36.793  1.00 14.78 ? 269  ASP A N   1 
ATOM   2134  C  CA  . ASP A 1 269 ? -13.840 10.182  38.155  1.00 15.69 ? 269  ASP A CA  1 
ATOM   2135  C  C   . ASP A 1 269 ? -12.571 11.003  38.452  1.00 16.03 ? 269  ASP A C   1 
ATOM   2136  O  O   . ASP A 1 269 ? -12.336 11.327  39.615  1.00 16.19 ? 269  ASP A O   1 
ATOM   2137  C  CB  . ASP A 1 269 ? -13.880 9.014   39.153  1.00 15.99 ? 269  ASP A CB  1 
ATOM   2138  C  CG  . ASP A 1 269 ? -15.284 8.529   39.471  1.00 17.99 ? 269  ASP A CG  1 
ATOM   2139  O  OD1 . ASP A 1 269 ? -15.398 7.363   39.905  1.00 19.40 ? 269  ASP A OD1 1 
ATOM   2140  O  OD2 . ASP A 1 269 ? -16.274 9.279   39.311  1.00 20.36 ? 269  ASP A OD2 1 
ATOM   2141  N  N   . VAL A 1 270 ? -11.761 11.326  37.440  1.00 16.78 ? 270  VAL A N   1 
ATOM   2142  C  CA  . VAL A 1 270 ? -10.396 11.886  37.667  1.00 17.48 ? 270  VAL A CA  1 
ATOM   2143  C  C   . VAL A 1 270 ? -10.326 13.299  38.268  1.00 18.37 ? 270  VAL A C   1 
ATOM   2144  O  O   . VAL A 1 270 ? -9.364  13.640  38.979  1.00 18.50 ? 270  VAL A O   1 
ATOM   2145  C  CB  . VAL A 1 270 ? -9.493  11.835  36.419  1.00 16.95 ? 270  VAL A CB  1 
ATOM   2146  C  CG1 . VAL A 1 270 ? -9.171  10.401  36.048  1.00 17.36 ? 270  VAL A CG1 1 
ATOM   2147  C  CG2 . VAL A 1 270 ? -10.102 12.603  35.263  1.00 18.02 ? 270  VAL A CG2 1 
ATOM   2148  N  N   . GLU A 1 271 ? -11.356 14.096  38.001  1.00 19.25 ? 271  GLU A N   1 
ATOM   2149  C  CA  . GLU A 1 271 ? -11.492 15.443  38.554  1.00 20.59 ? 271  GLU A CA  1 
ATOM   2150  C  C   . GLU A 1 271 ? -11.998 15.446  40.006  1.00 19.84 ? 271  GLU A C   1 
ATOM   2151  O  O   . GLU A 1 271 ? -12.124 16.509  40.614  1.00 20.27 ? 271  GLU A O   1 
ATOM   2152  C  CB  . GLU A 1 271 ? -12.460 16.270  37.685  1.00 20.44 ? 271  GLU A CB  1 
ATOM   2153  C  CG  . GLU A 1 271 ? -12.119 16.369  36.205  1.00 21.24 ? 271  GLU A CG  1 
ATOM   2154  C  CD  . GLU A 1 271 ? -13.359 16.662  35.350  1.00 24.96 ? 271  GLU A CD  1 
ATOM   2155  O  OE1 . GLU A 1 271 ? -13.838 15.729  34.628  1.00 26.32 ? 271  GLU A OE1 1 
ATOM   2156  O  OE2 . GLU A 1 271 ? -13.871 17.822  35.425  1.00 28.83 ? 271  GLU A OE2 1 
ATOM   2157  N  N   . ASN A 1 272 ? -12.285 14.267  40.553  1.00 19.34 ? 272  ASN A N   1 
ATOM   2158  C  CA  . ASN A 1 272 ? -12.942 14.138  41.864  1.00 19.26 ? 272  ASN A CA  1 
ATOM   2159  C  C   . ASN A 1 272 ? -12.069 14.327  43.134  1.00 19.31 ? 272  ASN A C   1 
ATOM   2160  O  O   . ASN A 1 272 ? -12.566 14.217  44.261  1.00 19.83 ? 272  ASN A O   1 
ATOM   2161  C  CB  . ASN A 1 272 ? -13.667 12.793  41.929  1.00 18.83 ? 272  ASN A CB  1 
ATOM   2162  C  CG  . ASN A 1 272 ? -14.944 12.772  41.104  1.00 21.23 ? 272  ASN A CG  1 
ATOM   2163  O  OD1 . ASN A 1 272 ? -15.413 13.809  40.600  1.00 23.11 ? 272  ASN A OD1 1 
ATOM   2164  N  ND2 . ASN A 1 272 ? -15.535 11.582  40.973  1.00 22.46 ? 272  ASN A ND2 1 
ATOM   2165  N  N   . PHE A 1 273 ? -10.782 14.611  42.966  1.00 18.86 ? 273  PHE A N   1 
ATOM   2166  C  CA  . PHE A 1 273 ? -9.867  14.656  44.093  1.00 18.51 ? 273  PHE A CA  1 
ATOM   2167  C  C   . PHE A 1 273 ? -9.248  16.047  44.170  1.00 18.51 ? 273  PHE A C   1 
ATOM   2168  O  O   . PHE A 1 273 ? -9.464  16.853  43.274  1.00 18.09 ? 273  PHE A O   1 
ATOM   2169  C  CB  . PHE A 1 273 ? -8.771  13.593  43.923  1.00 18.72 ? 273  PHE A CB  1 
ATOM   2170  C  CG  . PHE A 1 273 ? -9.295  12.213  43.641  1.00 18.93 ? 273  PHE A CG  1 
ATOM   2171  C  CD1 . PHE A 1 273 ? -9.502  11.784  42.333  1.00 18.74 ? 273  PHE A CD1 1 
ATOM   2172  C  CD2 . PHE A 1 273 ? -9.586  11.341  44.683  1.00 18.18 ? 273  PHE A CD2 1 
ATOM   2173  C  CE1 . PHE A 1 273 ? -9.984  10.503  42.068  1.00 18.00 ? 273  PHE A CE1 1 
ATOM   2174  C  CE2 . PHE A 1 273 ? -10.056 10.062  44.425  1.00 18.66 ? 273  PHE A CE2 1 
ATOM   2175  C  CZ  . PHE A 1 273 ? -10.260 9.645   43.115  1.00 18.70 ? 273  PHE A CZ  1 
ATOM   2176  N  N   . ASP A 1 274 ? -8.478  16.329  45.230  1.00 18.53 ? 274  ASP A N   1 
ATOM   2177  C  CA  . ASP A 1 274 ? -7.809  17.625  45.351  1.00 18.63 ? 274  ASP A CA  1 
ATOM   2178  C  C   . ASP A 1 274 ? -6.426  17.536  44.712  1.00 18.43 ? 274  ASP A C   1 
ATOM   2179  O  O   . ASP A 1 274 ? -5.579  18.421  44.888  1.00 19.00 ? 274  ASP A O   1 
ATOM   2180  C  CB  . ASP A 1 274 ? -7.737  18.100  46.806  1.00 18.68 ? 274  ASP A CB  1 
ATOM   2181  C  CG  . ASP A 1 274 ? -7.025  17.114  47.724  1.00 21.04 ? 274  ASP A CG  1 
ATOM   2182  O  OD1 . ASP A 1 274 ? -6.253  16.233  47.255  1.00 21.33 ? 274  ASP A OD1 1 
ATOM   2183  O  OD2 . ASP A 1 274 ? -7.249  17.215  48.952  1.00 23.60 ? 274  ASP A OD2 1 
ATOM   2184  N  N   . PHE A 1 275 ? -6.220  16.450  43.966  1.00 17.61 ? 275  PHE A N   1 
ATOM   2185  C  CA  . PHE A 1 275 ? -4.985  16.185  43.263  1.00 16.45 ? 275  PHE A CA  1 
ATOM   2186  C  C   . PHE A 1 275 ? -5.307  15.582  41.885  1.00 16.28 ? 275  PHE A C   1 
ATOM   2187  O  O   . PHE A 1 275 ? -6.361  14.970  41.729  1.00 16.48 ? 275  PHE A O   1 
ATOM   2188  C  CB  . PHE A 1 275 ? -4.099  15.261  44.115  1.00 16.22 ? 275  PHE A CB  1 
ATOM   2189  C  CG  . PHE A 1 275 ? -4.617  13.852  44.255  1.00 15.67 ? 275  PHE A CG  1 
ATOM   2190  C  CD1 . PHE A 1 275 ? -5.484  13.512  45.290  1.00 16.87 ? 275  PHE A CD1 1 
ATOM   2191  C  CD2 . PHE A 1 275 ? -4.201  12.855  43.384  1.00 14.54 ? 275  PHE A CD2 1 
ATOM   2192  C  CE1 . PHE A 1 275 ? -5.960  12.212  45.439  1.00 15.39 ? 275  PHE A CE1 1 
ATOM   2193  C  CE2 . PHE A 1 275 ? -4.668  11.564  43.513  1.00 15.11 ? 275  PHE A CE2 1 
ATOM   2194  C  CZ  . PHE A 1 275 ? -5.556  11.239  44.544  1.00 16.51 ? 275  PHE A CZ  1 
ATOM   2195  N  N   . ASP A 1 276 ? -4.424  15.778  40.901  1.00 15.57 ? 276  ASP A N   1 
ATOM   2196  C  CA  . ASP A 1 276 ? -4.478  15.050  39.629  1.00 15.45 ? 276  ASP A CA  1 
ATOM   2197  C  C   . ASP A 1 276 ? -3.973  13.597  39.791  1.00 16.00 ? 276  ASP A C   1 
ATOM   2198  O  O   . ASP A 1 276 ? -2.785  13.365  40.065  1.00 16.14 ? 276  ASP A O   1 
ATOM   2199  C  CB  . ASP A 1 276 ? -3.670  15.780  38.544  1.00 15.38 ? 276  ASP A CB  1 
ATOM   2200  C  CG  . ASP A 1 276 ? -3.919  15.225  37.126  1.00 13.85 ? 276  ASP A CG  1 
ATOM   2201  O  OD1 . ASP A 1 276 ? -3.953  16.019  36.171  1.00 12.13 ? 276  ASP A OD1 1 
ATOM   2202  O  OD2 . ASP A 1 276 ? -4.074  14.001  36.944  1.00 12.30 ? 276  ASP A OD2 1 
ATOM   2203  N  N   . PRO A 1 277 ? -4.875  12.608  39.628  1.00 15.94 ? 277  PRO A N   1 
ATOM   2204  C  CA  . PRO A 1 277 ? -4.493  11.193  39.812  1.00 16.03 ? 277  PRO A CA  1 
ATOM   2205  C  C   . PRO A 1 277 ? -3.372  10.660  38.886  1.00 15.50 ? 277  PRO A C   1 
ATOM   2206  O  O   . PRO A 1 277 ? -2.810  9.623   39.178  1.00 15.25 ? 277  PRO A O   1 
ATOM   2207  C  CB  . PRO A 1 277 ? -5.805  10.441  39.565  1.00 16.40 ? 277  PRO A CB  1 
ATOM   2208  C  CG  . PRO A 1 277 ? -6.664  11.407  38.778  1.00 16.80 ? 277  PRO A CG  1 
ATOM   2209  C  CD  . PRO A 1 277 ? -6.302  12.758  39.289  1.00 15.69 ? 277  PRO A CD  1 
ATOM   2210  N  N   . LEU A 1 278 ? -3.087  11.377  37.795  1.00 15.23 ? 278  LEU A N   1 
ATOM   2211  C  CA  . LEU A 1 278 ? -1.978  11.150  36.852  1.00 14.50 ? 278  LEU A CA  1 
ATOM   2212  C  C   . LEU A 1 278 ? -0.653  11.830  37.267  1.00 13.75 ? 278  LEU A C   1 
ATOM   2213  O  O   . LEU A 1 278 ? 0.367   11.702  36.568  1.00 13.49 ? 278  LEU A O   1 
ATOM   2214  C  CB  . LEU A 1 278 ? -2.358  11.756  35.491  1.00 14.91 ? 278  LEU A CB  1 
ATOM   2215  C  CG  . LEU A 1 278 ? -2.665  11.054  34.162  1.00 14.79 ? 278  LEU A CG  1 
ATOM   2216  C  CD1 . LEU A 1 278 ? -3.689  9.971   34.289  1.00 15.05 ? 278  LEU A CD1 1 
ATOM   2217  C  CD2 . LEU A 1 278 ? -3.139  12.137  33.174  1.00 15.26 ? 278  LEU A CD2 1 
ATOM   2218  N  N   . ASP A 1 279 ? -0.681  12.591  38.359  1.00 12.34 ? 279  ASP A N   1 
ATOM   2219  C  CA  . ASP A 1 279 ? 0.531   13.211  38.921  1.00 11.17 ? 279  ASP A CA  1 
ATOM   2220  C  C   . ASP A 1 279 ? 1.334   12.158  39.732  1.00 9.86  ? 279  ASP A C   1 
ATOM   2221  O  O   . ASP A 1 279 ? 0.855   11.655  40.736  1.00 9.24  ? 279  ASP A O   1 
ATOM   2222  C  CB  . ASP A 1 279 ? 0.116   14.443  39.772  1.00 10.83 ? 279  ASP A CB  1 
ATOM   2223  C  CG  . ASP A 1 279 ? 1.291   15.136  40.479  1.00 11.46 ? 279  ASP A CG  1 
ATOM   2224  O  OD1 . ASP A 1 279 ? 2.454   14.723  40.303  1.00 11.56 ? 279  ASP A OD1 1 
ATOM   2225  O  OD2 . ASP A 1 279 ? 1.047   16.124  41.216  1.00 11.37 ? 279  ASP A OD2 1 
ATOM   2226  N  N   . ALA A 1 280 ? 2.560   11.862  39.310  1.00 8.92  ? 280  ALA A N   1 
ATOM   2227  C  CA  . ALA A 1 280 ? 3.418   10.874  39.994  1.00 8.54  ? 280  ALA A CA  1 
ATOM   2228  C  C   . ALA A 1 280 ? 3.970   11.274  41.388  1.00 8.57  ? 280  ALA A C   1 
ATOM   2229  O  O   . ALA A 1 280 ? 4.602   10.449  42.103  1.00 7.99  ? 280  ALA A O   1 
ATOM   2230  C  CB  . ALA A 1 280 ? 4.545   10.444  39.084  1.00 8.12  ? 280  ALA A CB  1 
ATOM   2231  N  N   . THR A 1 281 ? 3.753   12.532  41.762  1.00 8.60  ? 281  THR A N   1 
ATOM   2232  C  CA  . THR A 1 281 ? 4.043   12.993  43.129  1.00 9.04  ? 281  THR A CA  1 
ATOM   2233  C  C   . THR A 1 281 ? 2.886   12.685  44.063  1.00 9.48  ? 281  THR A C   1 
ATOM   2234  O  O   . THR A 1 281 ? 2.949   13.028  45.261  1.00 10.98 ? 281  THR A O   1 
ATOM   2235  C  CB  . THR A 1 281 ? 4.351   14.510  43.204  1.00 8.79  ? 281  THR A CB  1 
ATOM   2236  O  OG1 . THR A 1 281 ? 3.289   15.243  42.600  1.00 9.00  ? 281  THR A OG1 1 
ATOM   2237  C  CG2 . THR A 1 281 ? 5.672   14.871  42.487  1.00 7.73  ? 281  THR A CG2 1 
ATOM   2238  N  N   . LYS A 1 282 ? 1.853   12.016  43.534  1.00 8.94  ? 282  LYS A N   1 
ATOM   2239  C  CA  . LYS A 1 282 ? 0.607   11.750  44.282  1.00 8.94  ? 282  LYS A CA  1 
ATOM   2240  C  C   . LYS A 1 282 ? 0.346   10.268  44.528  1.00 8.56  ? 282  LYS A C   1 
ATOM   2241  O  O   . LYS A 1 282 ? 0.552   9.451   43.654  1.00 8.04  ? 282  LYS A O   1 
ATOM   2242  C  CB  . LYS A 1 282 ? -0.611  12.375  43.572  1.00 8.60  ? 282  LYS A CB  1 
ATOM   2243  C  CG  . LYS A 1 282 ? -0.544  13.910  43.434  1.00 9.04  ? 282  LYS A CG  1 
ATOM   2244  C  CD  . LYS A 1 282 ? -0.445  14.610  44.806  1.00 9.58  ? 282  LYS A CD  1 
ATOM   2245  C  CE  . LYS A 1 282 ? -0.420  16.139  44.712  1.00 9.76  ? 282  LYS A CE  1 
ATOM   2246  N  NZ  . LYS A 1 282 ? 0.760   16.689  43.960  1.00 9.59  ? 282  LYS A NZ  1 
ATOM   2247  N  N   . ASP A 1 283 ? -0.108  9.951   45.736  1.00 8.83  ? 283  ASP A N   1 
ATOM   2248  C  CA  . ASP A 1 283 ? -0.483  8.595   46.131  1.00 9.57  ? 283  ASP A CA  1 
ATOM   2249  C  C   . ASP A 1 283 ? -2.005  8.415   46.076  1.00 10.03 ? 283  ASP A C   1 
ATOM   2250  O  O   . ASP A 1 283 ? -2.758  9.409   46.059  1.00 9.37  ? 283  ASP A O   1 
ATOM   2251  C  CB  . ASP A 1 283 ? 0.037   8.270   47.534  1.00 9.23  ? 283  ASP A CB  1 
ATOM   2252  C  CG  . ASP A 1 283 ? 0.035   6.784   47.832  1.00 11.16 ? 283  ASP A CG  1 
ATOM   2253  O  OD1 . ASP A 1 283 ? -0.364  5.982   46.952  1.00 16.06 ? 283  ASP A OD1 1 
ATOM   2254  O  OD2 . ASP A 1 283 ? 0.446   6.388   48.943  1.00 10.31 ? 283  ASP A OD2 1 
ATOM   2255  N  N   . TRP A 1 284 ? -2.431  7.148   45.990  1.00 10.26 ? 284  TRP A N   1 
ATOM   2256  C  CA  . TRP A 1 284 ? -3.842  6.769   46.046  1.00 10.89 ? 284  TRP A CA  1 
ATOM   2257  C  C   . TRP A 1 284 ? -3.952  5.992   47.306  1.00 11.71 ? 284  TRP A C   1 
ATOM   2258  O  O   . TRP A 1 284 ? -3.588  4.809   47.337  1.00 12.44 ? 284  TRP A O   1 
ATOM   2259  C  CB  . TRP A 1 284 ? -4.258  5.831   44.917  1.00 10.12 ? 284  TRP A CB  1 
ATOM   2260  C  CG  . TRP A 1 284 ? -4.273  6.384   43.553  1.00 8.83  ? 284  TRP A CG  1 
ATOM   2261  C  CD1 . TRP A 1 284 ? -3.834  7.615   43.140  1.00 9.31  ? 284  TRP A CD1 1 
ATOM   2262  C  CD2 . TRP A 1 284 ? -4.723  5.704   42.387  1.00 8.89  ? 284  TRP A CD2 1 
ATOM   2263  N  NE1 . TRP A 1 284 ? -3.990  7.740   41.771  1.00 8.19  ? 284  TRP A NE1 1 
ATOM   2264  C  CE2 . TRP A 1 284 ? -4.543  6.584   41.288  1.00 8.65  ? 284  TRP A CE2 1 
ATOM   2265  C  CE3 . TRP A 1 284 ? -5.300  4.444   42.158  1.00 8.80  ? 284  TRP A CE3 1 
ATOM   2266  C  CZ2 . TRP A 1 284 ? -4.889  6.228   39.984  1.00 8.16  ? 284  TRP A CZ2 1 
ATOM   2267  C  CZ3 . TRP A 1 284 ? -5.639  4.091   40.859  1.00 8.51  ? 284  TRP A CZ3 1 
ATOM   2268  C  CH2 . TRP A 1 284 ? -5.427  4.980   39.791  1.00 8.98  ? 284  TRP A CH2 1 
ATOM   2269  N  N   . PHE A 1 285 ? -4.435  6.653   48.345  1.00 12.38 ? 285  PHE A N   1 
ATOM   2270  C  CA  . PHE A 1 285 ? -4.531  6.040   49.658  1.00 13.45 ? 285  PHE A CA  1 
ATOM   2271  C  C   . PHE A 1 285 ? -5.477  4.849   49.601  1.00 14.22 ? 285  PHE A C   1 
ATOM   2272  O  O   . PHE A 1 285 ? -6.492  4.909   48.915  1.00 13.12 ? 285  PHE A O   1 
ATOM   2273  C  CB  . PHE A 1 285 ? -4.990  7.071   50.687  1.00 12.83 ? 285  PHE A CB  1 
ATOM   2274  C  CG  . PHE A 1 285 ? -4.045  8.234   50.852  1.00 13.07 ? 285  PHE A CG  1 
ATOM   2275  C  CD1 . PHE A 1 285 ? -4.509  9.542   50.755  1.00 12.70 ? 285  PHE A CD1 1 
ATOM   2276  C  CD2 . PHE A 1 285 ? -2.689  8.028   51.131  1.00 12.59 ? 285  PHE A CD2 1 
ATOM   2277  C  CE1 . PHE A 1 285 ? -3.635  10.647  50.953  1.00 12.99 ? 285  PHE A CE1 1 
ATOM   2278  C  CE2 . PHE A 1 285 ? -1.815  9.119   51.301  1.00 13.42 ? 285  PHE A CE2 1 
ATOM   2279  C  CZ  . PHE A 1 285 ? -2.295  10.431  51.215  1.00 12.65 ? 285  PHE A CZ  1 
ATOM   2280  N  N   . GLU A 1 286 ? -5.112  3.764   50.290  1.00 15.90 ? 286  GLU A N   1 
ATOM   2281  C  CA  . GLU A 1 286 ? -5.930  2.544   50.299  1.00 17.74 ? 286  GLU A CA  1 
ATOM   2282  C  C   . GLU A 1 286 ? -7.312  2.882   50.837  1.00 18.66 ? 286  GLU A C   1 
ATOM   2283  O  O   . GLU A 1 286 ? -8.315  2.264   50.451  1.00 19.23 ? 286  GLU A O   1 
ATOM   2284  C  CB  . GLU A 1 286 ? -5.281  1.428   51.132  1.00 17.58 ? 286  GLU A CB  1 
ATOM   2285  C  CG  . GLU A 1 286 ? -6.159  0.172   51.222  1.00 18.10 ? 286  GLU A CG  1 
ATOM   2286  C  CD  . GLU A 1 286 ? -5.440  -1.050  51.777  1.00 17.98 ? 286  GLU A CD  1 
ATOM   2287  O  OE1 . GLU A 1 286 ? -4.362  -0.899  52.382  1.00 19.16 ? 286  GLU A OE1 1 
ATOM   2288  O  OE2 . GLU A 1 286 ? -5.969  -2.167  51.616  1.00 17.14 ? 286  GLU A OE2 1 
ATOM   2289  N  N   . ASP A 1 287 ? -7.321  3.885   51.715  1.00 19.80 ? 287  ASP A N   1 
ATOM   2290  C  CA  . ASP A 1 287 ? -8.502  4.509   52.294  1.00 21.14 ? 287  ASP A CA  1 
ATOM   2291  C  C   . ASP A 1 287 ? -9.454  5.050   51.243  1.00 20.32 ? 287  ASP A C   1 
ATOM   2292  O  O   . ASP A 1 287 ? -10.679 4.998   51.413  1.00 20.69 ? 287  ASP A O   1 
ATOM   2293  C  CB  . ASP A 1 287 ? -8.067  5.706   53.162  1.00 21.86 ? 287  ASP A CB  1 
ATOM   2294  C  CG  . ASP A 1 287 ? -8.000  5.365   54.621  1.00 27.22 ? 287  ASP A CG  1 
ATOM   2295  O  OD1 . ASP A 1 287 ? -7.048  5.827   55.296  1.00 32.33 ? 287  ASP A OD1 1 
ATOM   2296  O  OD2 . ASP A 1 287 ? -8.887  4.615   55.110  1.00 31.62 ? 287  ASP A OD2 1 
ATOM   2297  N  N   . VAL A 1 288 ? -8.899  5.637   50.193  1.00 19.13 ? 288  VAL A N   1 
ATOM   2298  C  CA  . VAL A 1 288 ? -9.754  6.269   49.209  1.00 18.60 ? 288  VAL A CA  1 
ATOM   2299  C  C   . VAL A 1 288 ? -10.020 5.332   48.030  1.00 18.23 ? 288  VAL A C   1 
ATOM   2300  O  O   . VAL A 1 288 ? -11.115 5.357   47.472  1.00 18.79 ? 288  VAL A O   1 
ATOM   2301  C  CB  . VAL A 1 288 ? -9.294  7.717   48.808  1.00 18.74 ? 288  VAL A CB  1 
ATOM   2302  C  CG1 . VAL A 1 288 ? -8.536  8.407   49.968  1.00 16.85 ? 288  VAL A CG1 1 
ATOM   2303  C  CG2 . VAL A 1 288 ? -8.486  7.736   47.520  1.00 18.89 ? 288  VAL A CG2 1 
ATOM   2304  N  N   . ILE A 1 289 ? -9.037  4.508   47.674  1.00 17.18 ? 289  ILE A N   1 
ATOM   2305  C  CA  . ILE A 1 289 ? -9.196  3.514   46.618  1.00 17.39 ? 289  ILE A CA  1 
ATOM   2306  C  C   . ILE A 1 289 ? -8.674  2.121   47.049  1.00 17.36 ? 289  ILE A C   1 
ATOM   2307  O  O   . ILE A 1 289 ? -7.460  1.906   47.167  1.00 16.86 ? 289  ILE A O   1 
ATOM   2308  C  CB  . ILE A 1 289 ? -8.560  3.969   45.263  1.00 17.72 ? 289  ILE A CB  1 
ATOM   2309  C  CG1 . ILE A 1 289 ? -9.275  5.212   44.722  1.00 18.27 ? 289  ILE A CG1 1 
ATOM   2310  C  CG2 . ILE A 1 289 ? -8.639  2.841   44.210  1.00 17.02 ? 289  ILE A CG2 1 
ATOM   2311  C  CD1 . ILE A 1 289 ? -8.576  5.857   43.584  1.00 19.20 ? 289  ILE A CD1 1 
ATOM   2312  N  N   . PRO A 1 290 ? -9.602  1.158   47.232  1.00 17.02 ? 290  PRO A N   1 
ATOM   2313  C  CA  . PRO A 1 290 ? -9.267  -0.153  47.809  1.00 16.48 ? 290  PRO A CA  1 
ATOM   2314  C  C   . PRO A 1 290 ? -8.249  -0.942  46.964  1.00 15.89 ? 290  PRO A C   1 
ATOM   2315  O  O   . PRO A 1 290 ? -8.193  -0.779  45.735  1.00 15.84 ? 290  PRO A O   1 
ATOM   2316  C  CB  . PRO A 1 290 ? -10.618 -0.894  47.837  1.00 16.66 ? 290  PRO A CB  1 
ATOM   2317  C  CG  . PRO A 1 290 ? -11.673 0.165   47.646  1.00 17.10 ? 290  PRO A CG  1 
ATOM   2318  C  CD  . PRO A 1 290 ? -11.027 1.266   46.851  1.00 16.69 ? 290  PRO A CD  1 
ATOM   2319  N  N   . PHE A 1 291 ? -7.453  -1.773  47.634  1.00 14.94 ? 291  PHE A N   1 
ATOM   2320  C  CA  . PHE A 1 291 ? -6.587  -2.751  46.974  1.00 14.50 ? 291  PHE A CA  1 
ATOM   2321  C  C   . PHE A 1 291 ? -7.458  -3.968  46.626  1.00 13.76 ? 291  PHE A C   1 
ATOM   2322  O  O   . PHE A 1 291 ? -8.290  -4.393  47.418  1.00 13.61 ? 291  PHE A O   1 
ATOM   2323  C  CB  . PHE A 1 291 ? -5.455  -3.209  47.922  1.00 14.67 ? 291  PHE A CB  1 
ATOM   2324  C  CG  . PHE A 1 291 ? -4.368  -2.164  48.206  1.00 15.63 ? 291  PHE A CG  1 
ATOM   2325  C  CD1 . PHE A 1 291 ? -4.540  -0.801  47.912  1.00 16.57 ? 291  PHE A CD1 1 
ATOM   2326  C  CD2 . PHE A 1 291 ? -3.182  -2.554  48.831  1.00 15.35 ? 291  PHE A CD2 1 
ATOM   2327  C  CE1 . PHE A 1 291 ? -3.527  0.154   48.217  1.00 16.16 ? 291  PHE A CE1 1 
ATOM   2328  C  CE2 . PHE A 1 291 ? -2.177  -1.615  49.143  1.00 16.84 ? 291  PHE A CE2 1 
ATOM   2329  C  CZ  . PHE A 1 291 ? -2.352  -0.253  48.831  1.00 15.26 ? 291  PHE A CZ  1 
ATOM   2330  N  N   . GLN A 1 292 ? -7.296  -4.522  45.437  1.00 13.31 ? 292  GLN A N   1 
ATOM   2331  C  CA  . GLN A 1 292 ? -8.005  -5.755  45.105  1.00 12.63 ? 292  GLN A CA  1 
ATOM   2332  C  C   . GLN A 1 292 ? -6.964  -6.798  44.753  1.00 12.38 ? 292  GLN A C   1 
ATOM   2333  O  O   . GLN A 1 292 ? -6.144  -6.577  43.862  1.00 12.50 ? 292  GLN A O   1 
ATOM   2334  C  CB  . GLN A 1 292 ? -8.989  -5.547  43.952  1.00 12.08 ? 292  GLN A CB  1 
ATOM   2335  C  CG  . GLN A 1 292 ? -9.952  -4.384  44.140  1.00 12.73 ? 292  GLN A CG  1 
ATOM   2336  C  CD  . GLN A 1 292 ? -10.954 -4.298  43.030  1.00 13.49 ? 292  GLN A CD  1 
ATOM   2337  O  OE1 . GLN A 1 292 ? -11.590 -5.296  42.671  1.00 15.86 ? 292  GLN A OE1 1 
ATOM   2338  N  NE2 . GLN A 1 292 ? -11.086 -3.118  42.446  1.00 13.54 ? 292  GLN A NE2 1 
ATOM   2339  N  N   . HIS A 1 293 ? -7.005  -7.925  45.457  1.00 12.55 ? 293  HIS A N   1 
ATOM   2340  C  CA  . HIS A 1 293 ? -6.020  -8.998  45.303  1.00 13.06 ? 293  HIS A CA  1 
ATOM   2341  C  C   . HIS A 1 293 ? -6.005  -9.561  43.897  1.00 12.42 ? 293  HIS A C   1 
ATOM   2342  O  O   . HIS A 1 293 ? -7.060  -9.829  43.335  1.00 13.36 ? 293  HIS A O   1 
ATOM   2343  C  CB  . HIS A 1 293 ? -6.303  -10.121 46.305  1.00 13.66 ? 293  HIS A CB  1 
ATOM   2344  C  CG  . HIS A 1 293 ? -5.162  -11.069 46.486  1.00 15.43 ? 293  HIS A CG  1 
ATOM   2345  N  ND1 . HIS A 1 293 ? -5.251  -12.406 46.173  1.00 17.87 ? 293  HIS A ND1 1 
ATOM   2346  C  CD2 . HIS A 1 293 ? -3.896  -10.871 46.923  1.00 18.25 ? 293  HIS A CD2 1 
ATOM   2347  C  CE1 . HIS A 1 293 ? -4.097  -12.995 46.429  1.00 18.57 ? 293  HIS A CE1 1 
ATOM   2348  N  NE2 . HIS A 1 293 ? -3.257  -12.088 46.887  1.00 17.49 ? 293  HIS A NE2 1 
ATOM   2349  N  N   . VAL A 1 294 ? -4.813  -9.713  43.329  1.00 11.56 ? 294  VAL A N   1 
ATOM   2350  C  CA  . VAL A 1 294 ? -4.635  -10.298 41.987  1.00 11.06 ? 294  VAL A CA  1 
ATOM   2351  C  C   . VAL A 1 294 ? -4.009  -11.707 42.097  1.00 11.18 ? 294  VAL A C   1 
ATOM   2352  O  O   . VAL A 1 294 ? -4.500  -12.689 41.528  1.00 10.80 ? 294  VAL A O   1 
ATOM   2353  C  CB  . VAL A 1 294 ? -3.716  -9.405  41.087  1.00 10.69 ? 294  VAL A CB  1 
ATOM   2354  C  CG1 . VAL A 1 294 ? -3.363  -10.117 39.768  1.00 11.07 ? 294  VAL A CG1 1 
ATOM   2355  C  CG2 . VAL A 1 294 ? -4.334  -8.045  40.820  1.00 9.57  ? 294  VAL A CG2 1 
ATOM   2356  N  N   . GLY A 1 295 ? -2.912  -11.788 42.839  1.00 11.17 ? 295  GLY A N   1 
ATOM   2357  C  CA  . GLY A 1 295 ? -2.148  -13.017 42.921  1.00 11.25 ? 295  GLY A CA  1 
ATOM   2358  C  C   . GLY A 1 295 ? -0.930  -12.831 43.786  1.00 11.00 ? 295  GLY A C   1 
ATOM   2359  O  O   . GLY A 1 295 ? -0.852  -11.878 44.572  1.00 10.65 ? 295  GLY A O   1 
ATOM   2360  N  N   . THR A 1 296 ? -0.001  -13.777 43.653  1.00 11.07 ? 296  THR A N   1 
ATOM   2361  C  CA  . THR A 1 296 ? 1.196   -13.832 44.471  1.00 10.83 ? 296  THR A CA  1 
ATOM   2362  C  C   . THR A 1 296 ? 2.453   -14.316 43.726  1.00 11.17 ? 296  THR A C   1 
ATOM   2363  O  O   . THR A 1 296 ? 2.423   -15.277 42.945  1.00 11.34 ? 296  THR A O   1 
ATOM   2364  C  CB  . THR A 1 296 ? 0.939   -14.537 45.877  1.00 11.30 ? 296  THR A CB  1 
ATOM   2365  O  OG1 . THR A 1 296 ? 1.924   -15.554 46.149  1.00 11.30 ? 296  THR A OG1 1 
ATOM   2366  C  CG2 . THR A 1 296 ? -0.460  -15.092 45.977  1.00 9.89  ? 296  THR A CG2 1 
ATOM   2367  N  N   . MET A 1 297 ? 3.551   -13.598 43.947  1.00 10.37 ? 297  MET A N   1 
ATOM   2368  C  CA  . MET A 1 297 ? 4.819   -13.953 43.356  1.00 9.54  ? 297  MET A CA  1 
ATOM   2369  C  C   . MET A 1 297 ? 5.670   -14.671 44.394  1.00 9.76  ? 297  MET A C   1 
ATOM   2370  O  O   . MET A 1 297 ? 5.767   -14.227 45.553  1.00 9.49  ? 297  MET A O   1 
ATOM   2371  C  CB  . MET A 1 297 ? 5.536   -12.708 42.816  1.00 9.32  ? 297  MET A CB  1 
ATOM   2372  C  CG  . MET A 1 297 ? 7.023   -12.917 42.477  1.00 8.36  ? 297  MET A CG  1 
ATOM   2373  S  SD  . MET A 1 297 ? 7.852   -11.484 41.693  1.00 9.67  ? 297  MET A SD  1 
ATOM   2374  C  CE  . MET A 1 297 ? 7.876   -10.301 43.026  1.00 3.54  ? 297  MET A CE  1 
ATOM   2375  N  N   . THR A 1 298 ? 6.277   -15.779 43.965  1.00 9.35  ? 298  THR A N   1 
ATOM   2376  C  CA  . THR A 1 298 ? 7.233   -16.527 44.765  1.00 9.20  ? 298  THR A CA  1 
ATOM   2377  C  C   . THR A 1 298 ? 8.561   -16.568 44.005  1.00 9.22  ? 298  THR A C   1 
ATOM   2378  O  O   . THR A 1 298 ? 8.591   -17.025 42.874  1.00 9.24  ? 298  THR A O   1 
ATOM   2379  C  CB  . THR A 1 298 ? 6.710   -17.966 45.008  1.00 9.52  ? 298  THR A CB  1 
ATOM   2380  O  OG1 . THR A 1 298 ? 5.452   -17.889 45.692  1.00 10.04 ? 298  THR A OG1 1 
ATOM   2381  C  CG2 . THR A 1 298 ? 7.706   -18.811 45.839  1.00 7.88  ? 298  THR A CG2 1 
ATOM   2382  N  N   . LEU A 1 299 ? 9.631   -16.046 44.602  1.00 9.12  ? 299  LEU A N   1 
ATOM   2383  C  CA  . LEU A 1 299 ? 10.989  -16.201 44.055  1.00 9.31  ? 299  LEU A CA  1 
ATOM   2384  C  C   . LEU A 1 299 ? 11.699  -17.434 44.681  1.00 9.58  ? 299  LEU A C   1 
ATOM   2385  O  O   . LEU A 1 299 ? 12.070  -17.445 45.855  1.00 7.97  ? 299  LEU A O   1 
ATOM   2386  C  CB  . LEU A 1 299 ? 11.808  -14.928 44.286  1.00 9.40  ? 299  LEU A CB  1 
ATOM   2387  C  CG  . LEU A 1 299 ? 11.851  -13.731 43.321  1.00 9.92  ? 299  LEU A CG  1 
ATOM   2388  C  CD1 . LEU A 1 299 ? 10.737  -13.698 42.304  1.00 11.32 ? 299  LEU A CD1 1 
ATOM   2389  C  CD2 . LEU A 1 299 ? 11.923  -12.441 44.085  1.00 5.71  ? 299  LEU A CD2 1 
ATOM   2390  N  N   . ASN A 1 300 ? 11.889  -18.465 43.866  1.00 10.55 ? 300  ASN A N   1 
ATOM   2391  C  CA  . ASN A 1 300 ? 12.314  -19.762 44.369  1.00 11.36 ? 300  ASN A CA  1 
ATOM   2392  C  C   . ASN A 1 300 ? 13.618  -20.319 43.752  1.00 11.93 ? 300  ASN A C   1 
ATOM   2393  O  O   . ASN A 1 300 ? 14.023  -21.440 44.048  1.00 12.83 ? 300  ASN A O   1 
ATOM   2394  C  CB  . ASN A 1 300 ? 11.162  -20.776 44.236  1.00 11.53 ? 300  ASN A CB  1 
ATOM   2395  C  CG  . ASN A 1 300 ? 10.647  -20.936 42.796  1.00 11.24 ? 300  ASN A CG  1 
ATOM   2396  O  OD1 . ASN A 1 300 ? 11.285  -20.549 41.826  1.00 12.41 ? 300  ASN A OD1 1 
ATOM   2397  N  ND2 . ASN A 1 300 ? 9.473   -21.514 42.675  1.00 13.25 ? 300  ASN A ND2 1 
ATOM   2398  N  N   . LYS A 1 301 ? 14.280  -19.533 42.917  1.00 11.59 ? 301  LYS A N   1 
ATOM   2399  C  CA  . LYS A 1 301 ? 15.495  -19.987 42.301  1.00 11.77 ? 301  LYS A CA  1 
ATOM   2400  C  C   . LYS A 1 301 ? 16.465  -18.841 42.114  1.00 11.41 ? 301  LYS A C   1 
ATOM   2401  O  O   . LYS A 1 301 ? 16.170  -17.865 41.437  1.00 11.77 ? 301  LYS A O   1 
ATOM   2402  C  CB  . LYS A 1 301 ? 15.175  -20.628 40.946  1.00 12.57 ? 301  LYS A CB  1 
ATOM   2403  C  CG  . LYS A 1 301 ? 16.363  -21.193 40.252  1.00 13.97 ? 301  LYS A CG  1 
ATOM   2404  C  CD  . LYS A 1 301 ? 15.945  -22.241 39.247  1.00 18.76 ? 301  LYS A CD  1 
ATOM   2405  C  CE  . LYS A 1 301 ? 17.005  -22.371 38.142  1.00 20.52 ? 301  LYS A CE  1 
ATOM   2406  N  NZ  . LYS A 1 301 ? 18.265  -22.887 38.724  1.00 19.61 ? 301  LYS A NZ  1 
ATOM   2407  N  N   . ASN A 1 302 ? 17.648  -18.972 42.688  1.00 10.83 ? 302  ASN A N   1 
ATOM   2408  C  CA  . ASN A 1 302 ? 18.679  -17.995 42.439  1.00 9.88  ? 302  ASN A CA  1 
ATOM   2409  C  C   . ASN A 1 302 ? 19.144  -18.026 40.981  1.00 9.61  ? 302  ASN A C   1 
ATOM   2410  O  O   . ASN A 1 302 ? 18.898  -18.990 40.260  1.00 9.63  ? 302  ASN A O   1 
ATOM   2411  C  CB  . ASN A 1 302 ? 19.841  -18.193 43.417  1.00 9.18  ? 302  ASN A CB  1 
ATOM   2412  C  CG  . ASN A 1 302 ? 19.598  -17.499 44.755  1.00 8.57  ? 302  ASN A CG  1 
ATOM   2413  O  OD1 . ASN A 1 302 ? 19.269  -16.296 44.813  1.00 4.27  ? 302  ASN A OD1 1 
ATOM   2414  N  ND2 . ASN A 1 302 ? 19.786  -18.251 45.849  1.00 7.85  ? 302  ASN A ND2 1 
ATOM   2415  N  N   . VAL A 1 303 ? 19.807  -16.963 40.538  1.00 9.17  ? 303  VAL A N   1 
ATOM   2416  C  CA  . VAL A 1 303 ? 20.465  -17.008 39.228  1.00 8.90  ? 303  VAL A CA  1 
ATOM   2417  C  C   . VAL A 1 303 ? 21.538  -18.111 39.182  1.00 9.39  ? 303  VAL A C   1 
ATOM   2418  O  O   . VAL A 1 303 ? 22.110  -18.486 40.219  1.00 8.95  ? 303  VAL A O   1 
ATOM   2419  C  CB  . VAL A 1 303 ? 21.087  -15.636 38.841  1.00 8.68  ? 303  VAL A CB  1 
ATOM   2420  C  CG1 . VAL A 1 303 ? 19.990  -14.519 38.805  1.00 6.75  ? 303  VAL A CG1 1 
ATOM   2421  C  CG2 . VAL A 1 303 ? 22.245  -15.279 39.766  1.00 7.16  ? 303  VAL A CG2 1 
ATOM   2422  N  N   . ASP A 1 304 ? 21.781  -18.632 37.986  1.00 9.77  ? 304  ASP A N   1 
ATOM   2423  C  CA  . ASP A 1 304 ? 22.979  -19.436 37.702  1.00 10.91 ? 304  ASP A CA  1 
ATOM   2424  C  C   . ASP A 1 304 ? 24.199  -18.546 37.496  1.00 10.89 ? 304  ASP A C   1 
ATOM   2425  O  O   . ASP A 1 304 ? 25.310  -18.911 37.865  1.00 12.11 ? 304  ASP A O   1 
ATOM   2426  C  CB  . ASP A 1 304 ? 22.751  -20.282 36.445  1.00 11.34 ? 304  ASP A CB  1 
ATOM   2427  C  CG  . ASP A 1 304 ? 21.784  -21.439 36.689  1.00 14.25 ? 304  ASP A CG  1 
ATOM   2428  O  OD1 . ASP A 1 304 ? 21.622  -21.873 37.867  1.00 14.65 ? 304  ASP A OD1 1 
ATOM   2429  O  OD2 . ASP A 1 304 ? 21.213  -21.932 35.699  1.00 16.75 ? 304  ASP A OD2 1 
ATOM   2430  N  N   . ASN A 1 305 ? 23.993  -17.372 36.902  1.00 9.98  ? 305  ASN A N   1 
ATOM   2431  C  CA  . ASN A 1 305 ? 25.091  -16.471 36.608  1.00 9.30  ? 305  ASN A CA  1 
ATOM   2432  C  C   . ASN A 1 305 ? 24.612  -15.022 36.667  1.00 9.18  ? 305  ASN A C   1 
ATOM   2433  O  O   . ASN A 1 305 ? 23.638  -14.629 35.982  1.00 9.03  ? 305  ASN A O   1 
ATOM   2434  C  CB  . ASN A 1 305 ? 25.661  -16.792 35.217  1.00 9.50  ? 305  ASN A CB  1 
ATOM   2435  C  CG  . ASN A 1 305 ? 26.783  -15.884 34.827  1.00 9.02  ? 305  ASN A CG  1 
ATOM   2436  O  OD1 . ASN A 1 305 ? 26.603  -14.961 34.032  1.00 10.61 ? 305  ASN A OD1 1 
ATOM   2437  N  ND2 . ASN A 1 305 ? 27.960  -16.129 35.384  1.00 9.68  ? 305  ASN A ND2 1 
ATOM   2438  N  N   . TYR A 1 306 ? 25.297  -14.226 37.478  1.00 8.10  ? 306  TYR A N   1 
ATOM   2439  C  CA  . TYR A 1 306 ? 24.826  -12.871 37.772  1.00 7.58  ? 306  TYR A CA  1 
ATOM   2440  C  C   . TYR A 1 306 ? 24.914  -11.973 36.528  1.00 6.74  ? 306  TYR A C   1 
ATOM   2441  O  O   . TYR A 1 306 ? 23.951  -11.320 36.154  1.00 5.33  ? 306  TYR A O   1 
ATOM   2442  C  CB  . TYR A 1 306 ? 25.605  -12.279 38.963  1.00 6.75  ? 306  TYR A CB  1 
ATOM   2443  C  CG  . TYR A 1 306 ? 25.135  -10.896 39.398  1.00 7.24  ? 306  TYR A CG  1 
ATOM   2444  C  CD1 . TYR A 1 306 ? 24.315  -10.732 40.538  1.00 6.57  ? 306  TYR A CD1 1 
ATOM   2445  C  CD2 . TYR A 1 306 ? 25.522  -9.745  38.686  1.00 6.31  ? 306  TYR A CD2 1 
ATOM   2446  C  CE1 . TYR A 1 306 ? 23.904  -9.477  40.955  1.00 5.08  ? 306  TYR A CE1 1 
ATOM   2447  C  CE2 . TYR A 1 306 ? 25.108  -8.487  39.094  1.00 6.34  ? 306  TYR A CE2 1 
ATOM   2448  C  CZ  . TYR A 1 306 ? 24.310  -8.358  40.230  1.00 6.74  ? 306  TYR A CZ  1 
ATOM   2449  O  OH  . TYR A 1 306 ? 23.896  -7.105  40.604  1.00 5.18  ? 306  TYR A OH  1 
ATOM   2450  N  N   . PHE A 1 307 ? 26.081  -11.973 35.889  1.00 7.26  ? 307  PHE A N   1 
ATOM   2451  C  CA  . PHE A 1 307 ? 26.290  -11.141 34.743  1.00 7.40  ? 307  PHE A CA  1 
ATOM   2452  C  C   . PHE A 1 307 ? 25.250  -11.367 33.646  1.00 8.33  ? 307  PHE A C   1 
ATOM   2453  O  O   . PHE A 1 307 ? 24.659  -10.391 33.150  1.00 8.42  ? 307  PHE A O   1 
ATOM   2454  C  CB  . PHE A 1 307 ? 27.683  -11.290 34.180  1.00 6.89  ? 307  PHE A CB  1 
ATOM   2455  C  CG  . PHE A 1 307 ? 27.936  -10.383 33.028  1.00 7.50  ? 307  PHE A CG  1 
ATOM   2456  C  CD1 . PHE A 1 307 ? 27.917  -10.868 31.724  1.00 7.64  ? 307  PHE A CD1 1 
ATOM   2457  C  CD2 . PHE A 1 307 ? 28.115  -9.012  33.244  1.00 7.33  ? 307  PHE A CD2 1 
ATOM   2458  C  CE1 . PHE A 1 307 ? 28.120  -9.992  30.638  1.00 10.32 ? 307  PHE A CE1 1 
ATOM   2459  C  CE2 . PHE A 1 307 ? 28.321  -8.141  32.195  1.00 8.23  ? 307  PHE A CE2 1 
ATOM   2460  C  CZ  . PHE A 1 307 ? 28.324  -8.623  30.870  1.00 8.08  ? 307  PHE A CZ  1 
ATOM   2461  N  N   . ALA A 1 308 ? 25.044  -12.638 33.280  1.00 8.46  ? 308  ALA A N   1 
ATOM   2462  C  CA  . ALA A 1 308 ? 24.162  -13.019 32.180  1.00 9.38  ? 308  ALA A CA  1 
ATOM   2463  C  C   . ALA A 1 308 ? 22.695  -12.878 32.525  1.00 9.86  ? 308  ALA A C   1 
ATOM   2464  O  O   . ALA A 1 308 ? 21.844  -12.846 31.630  1.00 10.93 ? 308  ALA A O   1 
ATOM   2465  C  CB  . ALA A 1 308 ? 24.443  -14.468 31.695  1.00 8.80  ? 308  ALA A CB  1 
ATOM   2466  N  N   . GLU A 1 309 ? 22.379  -12.809 33.806  1.00 9.64  ? 309  GLU A N   1 
ATOM   2467  C  CA  . GLU A 1 309 ? 20.981  -12.741 34.180  1.00 9.42  ? 309  GLU A CA  1 
ATOM   2468  C  C   . GLU A 1 309 ? 20.684  -11.396 34.806  1.00 9.37  ? 309  GLU A C   1 
ATOM   2469  O  O   . GLU A 1 309 ? 20.042  -10.572 34.176  1.00 9.98  ? 309  GLU A O   1 
ATOM   2470  C  CB  . GLU A 1 309 ? 20.559  -13.935 35.079  1.00 9.92  ? 309  GLU A CB  1 
ATOM   2471  C  CG  . GLU A 1 309 ? 20.680  -15.347 34.409  1.00 8.39  ? 309  GLU A CG  1 
ATOM   2472  C  CD  . GLU A 1 309 ? 20.436  -16.484 35.397  1.00 8.51  ? 309  GLU A CD  1 
ATOM   2473  O  OE1 . GLU A 1 309 ? 19.350  -16.516 36.003  1.00 7.27  ? 309  GLU A OE1 1 
ATOM   2474  O  OE2 . GLU A 1 309 ? 21.326  -17.336 35.583  1.00 6.47  ? 309  GLU A OE2 1 
ATOM   2475  N  N   . THR A 1 310 ? 21.180  -11.150 36.018  1.00 9.08  ? 310  THR A N   1 
ATOM   2476  C  CA  . THR A 1 310 ? 20.900  -9.904  36.723  1.00 8.14  ? 310  THR A CA  1 
ATOM   2477  C  C   . THR A 1 310 ? 21.479  -8.671  35.996  1.00 8.57  ? 310  THR A C   1 
ATOM   2478  O  O   . THR A 1 310 ? 20.790  -7.634  35.854  1.00 7.70  ? 310  THR A O   1 
ATOM   2479  C  CB  . THR A 1 310 ? 21.366  -9.974  38.195  1.00 8.55  ? 310  THR A CB  1 
ATOM   2480  O  OG1 . THR A 1 310 ? 20.913  -11.207 38.776  1.00 9.34  ? 310  THR A OG1 1 
ATOM   2481  C  CG2 . THR A 1 310 ? 20.804  -8.814  39.024  1.00 6.51  ? 310  THR A CG2 1 
ATOM   2482  N  N   . GLU A 1 311 ? 22.714  -8.773  35.510  1.00 8.17  ? 311  GLU A N   1 
ATOM   2483  C  CA  . GLU A 1 311 ? 23.329  -7.582  34.940  1.00 8.72  ? 311  GLU A CA  1 
ATOM   2484  C  C   . GLU A 1 311 ? 22.770  -7.295  33.549  1.00 8.97  ? 311  GLU A C   1 
ATOM   2485  O  O   . GLU A 1 311 ? 22.591  -6.142  33.188  1.00 9.67  ? 311  GLU A O   1 
ATOM   2486  C  CB  . GLU A 1 311 ? 24.870  -7.635  34.945  1.00 8.98  ? 311  GLU A CB  1 
ATOM   2487  C  CG  . GLU A 1 311 ? 25.556  -6.306  34.516  1.00 8.08  ? 311  GLU A CG  1 
ATOM   2488  C  CD  . GLU A 1 311 ? 25.228  -5.161  35.491  1.00 9.85  ? 311  GLU A CD  1 
ATOM   2489  O  OE1 . GLU A 1 311 ? 25.106  -5.467  36.691  1.00 10.02 ? 311  GLU A OE1 1 
ATOM   2490  O  OE2 . GLU A 1 311 ? 25.058  -3.984  35.079  1.00 8.17  ? 311  GLU A OE2 1 
ATOM   2491  N  N   . SER A 1 312 ? 22.445  -8.350  32.808  1.00 9.03  ? 312  SER A N   1 
ATOM   2492  C  CA  . SER A 1 312 ? 22.058  -8.237  31.401  1.00 8.74  ? 312  SER A CA  1 
ATOM   2493  C  C   . SER A 1 312 ? 20.549  -8.045  31.128  1.00 8.87  ? 312  SER A C   1 
ATOM   2494  O  O   . SER A 1 312 ? 20.172  -7.653  30.011  1.00 9.57  ? 312  SER A O   1 
ATOM   2495  C  CB  . SER A 1 312 ? 22.619  -9.417  30.593  1.00 9.02  ? 312  SER A CB  1 
ATOM   2496  O  OG  . SER A 1 312 ? 24.016  -9.265  30.338  1.00 9.15  ? 312  SER A OG  1 
ATOM   2497  N  N   . VAL A 1 313 ? 19.687  -8.327  32.107  1.00 7.78  ? 313  VAL A N   1 
ATOM   2498  C  CA  . VAL A 1 313 ? 18.276  -8.026  31.946  1.00 7.21  ? 313  VAL A CA  1 
ATOM   2499  C  C   . VAL A 1 313 ? 18.024  -6.533  31.719  1.00 7.60  ? 313  VAL A C   1 
ATOM   2500  O  O   . VAL A 1 313 ? 18.694  -5.677  32.303  1.00 7.81  ? 313  VAL A O   1 
ATOM   2501  C  CB  . VAL A 1 313 ? 17.392  -8.560  33.141  1.00 7.96  ? 313  VAL A CB  1 
ATOM   2502  C  CG1 . VAL A 1 313 ? 17.633  -7.780  34.458  1.00 5.87  ? 313  VAL A CG1 1 
ATOM   2503  C  CG2 . VAL A 1 313 ? 15.891  -8.595  32.754  1.00 5.82  ? 313  VAL A CG2 1 
ATOM   2504  N  N   . GLY A 1 314 ? 17.058  -6.237  30.863  1.00 7.28  ? 314  GLY A N   1 
ATOM   2505  C  CA  . GLY A 1 314 ? 16.499  -4.906  30.775  1.00 7.45  ? 314  GLY A CA  1 
ATOM   2506  C  C   . GLY A 1 314 ? 14.996  -4.926  30.949  1.00 7.55  ? 314  GLY A C   1 
ATOM   2507  O  O   . GLY A 1 314 ? 14.320  -5.803  30.409  1.00 8.02  ? 314  GLY A O   1 
ATOM   2508  N  N   . PHE A 1 315 ? 14.469  -3.969  31.715  1.00 7.54  ? 315  PHE A N   1 
ATOM   2509  C  CA  . PHE A 1 315 ? 13.028  -3.811  31.874  1.00 7.01  ? 315  PHE A CA  1 
ATOM   2510  C  C   . PHE A 1 315 ? 12.571  -2.429  31.397  1.00 7.12  ? 315  PHE A C   1 
ATOM   2511  O  O   . PHE A 1 315 ? 13.346  -1.475  31.385  1.00 6.90  ? 315  PHE A O   1 
ATOM   2512  C  CB  . PHE A 1 315 ? 12.593  -3.927  33.329  1.00 7.24  ? 315  PHE A CB  1 
ATOM   2513  C  CG  . PHE A 1 315 ? 13.156  -5.090  34.087  1.00 7.58  ? 315  PHE A CG  1 
ATOM   2514  C  CD1 . PHE A 1 315 ? 12.413  -6.258  34.244  1.00 6.84  ? 315  PHE A CD1 1 
ATOM   2515  C  CD2 . PHE A 1 315 ? 14.375  -4.974  34.756  1.00 6.52  ? 315  PHE A CD2 1 
ATOM   2516  C  CE1 . PHE A 1 315 ? 12.910  -7.312  35.016  1.00 7.84  ? 315  PHE A CE1 1 
ATOM   2517  C  CE2 . PHE A 1 315 ? 14.871  -6.013  35.524  1.00 7.52  ? 315  PHE A CE2 1 
ATOM   2518  C  CZ  . PHE A 1 315 ? 14.143  -7.192  35.652  1.00 7.39  ? 315  PHE A CZ  1 
ATOM   2519  N  N   . ASN A 1 316 ? 11.295  -2.327  31.037  1.00 7.22  ? 316  ASN A N   1 
ATOM   2520  C  CA  . ASN A 1 316 ? 10.692  -1.064  30.597  1.00 7.31  ? 316  ASN A CA  1 
ATOM   2521  C  C   . ASN A 1 316 ? 9.222   -1.079  30.995  1.00 7.14  ? 316  ASN A C   1 
ATOM   2522  O  O   . ASN A 1 316 ? 8.512   -2.008  30.629  1.00 7.10  ? 316  ASN A O   1 
ATOM   2523  C  CB  . ASN A 1 316 ? 10.850  -0.863  29.067  1.00 6.81  ? 316  ASN A CB  1 
ATOM   2524  C  CG  . ASN A 1 316 ? 10.273  0.476   28.575  1.00 6.35  ? 316  ASN A CG  1 
ATOM   2525  O  OD1 . ASN A 1 316 ? 9.537   1.143   29.293  1.00 7.28  ? 316  ASN A OD1 1 
ATOM   2526  N  ND2 . ASN A 1 316 ? 10.604  0.861   27.353  1.00 4.69  ? 316  ASN A ND2 1 
ATOM   2527  N  N   . PRO A 1 317 ? 8.776   -0.080  31.786  1.00 7.64  ? 317  PRO A N   1 
ATOM   2528  C  CA  . PRO A 1 317 ? 7.354   -0.026  32.233  1.00 7.79  ? 317  PRO A CA  1 
ATOM   2529  C  C   . PRO A 1 317 ? 6.353   0.081   31.080  1.00 7.82  ? 317  PRO A C   1 
ATOM   2530  O  O   . PRO A 1 317 ? 5.179   -0.206  31.250  1.00 7.91  ? 317  PRO A O   1 
ATOM   2531  C  CB  . PRO A 1 317 ? 7.281   1.244   33.101  1.00 7.54  ? 317  PRO A CB  1 
ATOM   2532  C  CG  . PRO A 1 317 ? 8.549   2.018   32.806  1.00 6.87  ? 317  PRO A CG  1 
ATOM   2533  C  CD  . PRO A 1 317 ? 9.586   1.018   32.356  1.00 6.93  ? 317  PRO A CD  1 
ATOM   2534  N  N   . GLY A 1 318 ? 6.815   0.509   29.917  1.00 8.07  ? 318  GLY A N   1 
ATOM   2535  C  CA  . GLY A 1 318 ? 5.942   0.580   28.773  1.00 7.92  ? 318  GLY A CA  1 
ATOM   2536  C  C   . GLY A 1 318 ? 6.103   -0.635  27.897  1.00 8.16  ? 318  GLY A C   1 
ATOM   2537  O  O   . GLY A 1 318 ? 5.671   -0.611  26.745  1.00 8.75  ? 318  GLY A O   1 
ATOM   2538  N  N   . VAL A 1 319 ? 6.765   -1.676  28.416  1.00 8.39  ? 319  VAL A N   1 
ATOM   2539  C  CA  . VAL A 1 319 ? 6.728   -3.007  27.808  1.00 8.56  ? 319  VAL A CA  1 
ATOM   2540  C  C   . VAL A 1 319 ? 5.511   -3.744  28.413  1.00 8.79  ? 319  VAL A C   1 
ATOM   2541  O  O   . VAL A 1 319 ? 5.571   -4.337  29.494  1.00 7.96  ? 319  VAL A O   1 
ATOM   2542  C  CB  . VAL A 1 319 ? 8.095   -3.751  27.935  1.00 8.70  ? 319  VAL A CB  1 
ATOM   2543  C  CG1 . VAL A 1 319 ? 7.971   -5.268  27.650  1.00 9.15  ? 319  VAL A CG1 1 
ATOM   2544  C  CG2 . VAL A 1 319 ? 9.090   -3.144  26.972  1.00 7.91  ? 319  VAL A CG2 1 
ATOM   2545  N  N   . LEU A 1 320 ? 4.389   -3.656  27.699  1.00 9.11  ? 320  LEU A N   1 
ATOM   2546  C  CA  . LEU A 1 320 ? 3.096   -4.123  28.219  1.00 9.37  ? 320  LEU A CA  1 
ATOM   2547  C  C   . LEU A 1 320 ? 2.485   -5.150  27.301  1.00 8.97  ? 320  LEU A C   1 
ATOM   2548  O  O   . LEU A 1 320 ? 2.798   -5.160  26.124  1.00 10.14 ? 320  LEU A O   1 
ATOM   2549  C  CB  . LEU A 1 320 ? 2.132   -2.942  28.355  1.00 9.08  ? 320  LEU A CB  1 
ATOM   2550  C  CG  . LEU A 1 320 ? 2.585   -1.785  29.248  1.00 6.71  ? 320  LEU A CG  1 
ATOM   2551  C  CD1 . LEU A 1 320 ? 1.607   -0.668  29.087  1.00 2.93  ? 320  LEU A CD1 1 
ATOM   2552  C  CD2 . LEU A 1 320 ? 2.629   -2.243  30.677  1.00 3.20  ? 320  LEU A CD2 1 
ATOM   2553  N  N   . VAL A 1 321 ? 1.610   -5.997  27.829  1.00 8.26  ? 321  VAL A N   1 
ATOM   2554  C  CA  . VAL A 1 321 ? 0.928   -6.997  27.011  1.00 7.99  ? 321  VAL A CA  1 
ATOM   2555  C  C   . VAL A 1 321 ? -0.453  -6.486  26.581  1.00 8.12  ? 321  VAL A C   1 
ATOM   2556  O  O   . VAL A 1 321 ? -0.944  -5.527  27.153  1.00 7.90  ? 321  VAL A O   1 
ATOM   2557  C  CB  . VAL A 1 321 ? 0.814   -8.376  27.719  1.00 8.22  ? 321  VAL A CB  1 
ATOM   2558  C  CG1 . VAL A 1 321 ? 2.152   -9.145  27.652  1.00 6.37  ? 321  VAL A CG1 1 
ATOM   2559  C  CG2 . VAL A 1 321 ? 0.272   -8.233  29.162  1.00 7.63  ? 321  VAL A CG2 1 
ATOM   2560  N  N   . PRO A 1 322 ? -1.072  -7.099  25.546  1.00 8.47  ? 322  PRO A N   1 
ATOM   2561  C  CA  . PRO A 1 322 ? -2.381  -6.544  25.145  1.00 8.38  ? 322  PRO A CA  1 
ATOM   2562  C  C   . PRO A 1 322 ? -3.331  -6.582  26.336  1.00 9.28  ? 322  PRO A C   1 
ATOM   2563  O  O   . PRO A 1 322 ? -3.317  -7.555  27.111  1.00 9.71  ? 322  PRO A O   1 
ATOM   2564  C  CB  . PRO A 1 322 ? -2.839  -7.488  24.007  1.00 8.84  ? 322  PRO A CB  1 
ATOM   2565  C  CG  . PRO A 1 322 ? -1.526  -8.077  23.430  1.00 7.87  ? 322  PRO A CG  1 
ATOM   2566  C  CD  . PRO A 1 322 ? -0.644  -8.233  24.689  1.00 8.19  ? 322  PRO A CD  1 
ATOM   2567  N  N   . GLY A 1 323 ? -4.119  -5.523  26.514  1.00 9.00  ? 323  GLY A N   1 
ATOM   2568  C  CA  . GLY A 1 323 ? -4.984  -5.396  27.675  1.00 8.25  ? 323  GLY A CA  1 
ATOM   2569  C  C   . GLY A 1 323 ? -4.413  -4.334  28.596  1.00 9.46  ? 323  GLY A C   1 
ATOM   2570  O  O   . GLY A 1 323 ? -5.038  -3.947  29.587  1.00 8.75  ? 323  GLY A O   1 
ATOM   2571  N  N   . MET A 1 324 ? -3.211  -3.856  28.253  1.00 9.99  ? 324  MET A N   1 
ATOM   2572  C  CA  . MET A 1 324 ? -2.475  -2.906  29.076  1.00 10.43 ? 324  MET A CA  1 
ATOM   2573  C  C   . MET A 1 324 ? -1.964  -1.771  28.224  1.00 10.49 ? 324  MET A C   1 
ATOM   2574  O  O   . MET A 1 324 ? -1.446  -2.010  27.135  1.00 10.53 ? 324  MET A O   1 
ATOM   2575  C  CB  . MET A 1 324 ? -1.292  -3.591  29.753  1.00 10.29 ? 324  MET A CB  1 
ATOM   2576  C  CG  . MET A 1 324 ? -1.684  -4.546  30.868  1.00 9.86  ? 324  MET A CG  1 
ATOM   2577  S  SD  . MET A 1 324 ? -0.202  -5.250  31.579  1.00 11.04 ? 324  MET A SD  1 
ATOM   2578  C  CE  . MET A 1 324 ? -0.931  -6.401  32.788  1.00 7.69  ? 324  MET A CE  1 
ATOM   2579  N  N   . LEU A 1 325 ? -2.112  -0.543  28.725  1.00 10.17 ? 325  LEU A N   1 
ATOM   2580  C  CA  . LEU A 1 325 ? -1.621  0.649   28.031  1.00 10.15 ? 325  LEU A CA  1 
ATOM   2581  C  C   . LEU A 1 325 ? -1.017  1.637   29.033  1.00 9.60  ? 325  LEU A C   1 
ATOM   2582  O  O   . LEU A 1 325 ? -1.380  1.615   30.195  1.00 9.40  ? 325  LEU A O   1 
ATOM   2583  C  CB  . LEU A 1 325 ? -2.752  1.319   27.203  1.00 10.44 ? 325  LEU A CB  1 
ATOM   2584  C  CG  . LEU A 1 325 ? -3.219  0.708   25.861  1.00 10.83 ? 325  LEU A CG  1 
ATOM   2585  C  CD1 . LEU A 1 325 ? -4.384  1.485   25.306  1.00 11.19 ? 325  LEU A CD1 1 
ATOM   2586  C  CD2 . LEU A 1 325 ? -2.109  0.736   24.815  1.00 12.27 ? 325  LEU A CD2 1 
ATOM   2587  N  N   . PRO A 1 326 ? -0.079  2.502   28.588  1.00 9.58  ? 326  PRO A N   1 
ATOM   2588  C  CA  . PRO A 1 326 ? 0.419   3.505   29.525  1.00 9.11  ? 326  PRO A CA  1 
ATOM   2589  C  C   . PRO A 1 326 ? -0.600  4.616   29.788  1.00 9.48  ? 326  PRO A C   1 
ATOM   2590  O  O   . PRO A 1 326 ? -1.437  4.907   28.931  1.00 8.80  ? 326  PRO A O   1 
ATOM   2591  C  CB  . PRO A 1 326 ? 1.646   4.063   28.825  1.00 9.04  ? 326  PRO A CB  1 
ATOM   2592  C  CG  . PRO A 1 326 ? 1.361   3.867   27.355  1.00 9.91  ? 326  PRO A CG  1 
ATOM   2593  C  CD  . PRO A 1 326 ? 0.576   2.591   27.266  1.00 8.91  ? 326  PRO A CD  1 
ATOM   2594  N  N   . SER A 1 327 ? -0.536  5.220   30.976  1.00 9.57  ? 327  SER A N   1 
ATOM   2595  C  CA  . SER A 1 327 ? -1.284  6.430   31.207  1.00 9.96  ? 327  SER A CA  1 
ATOM   2596  C  C   . SER A 1 327 ? -0.547  7.660   30.662  1.00 10.17 ? 327  SER A C   1 
ATOM   2597  O  O   . SER A 1 327 ? 0.662   7.612   30.391  1.00 9.61  ? 327  SER A O   1 
ATOM   2598  C  CB  . SER A 1 327 ? -1.579  6.608   32.685  1.00 9.93  ? 327  SER A CB  1 
ATOM   2599  O  OG  . SER A 1 327 ? -0.401  6.946   33.392  1.00 12.36 ? 327  SER A OG  1 
ATOM   2600  N  N   . GLU A 1 328 ? -1.302  8.753   30.534  1.00 10.50 ? 328  GLU A N   1 
ATOM   2601  C  CA  . GLU A 1 328 ? -0.802  10.068  30.142  1.00 10.89 ? 328  GLU A CA  1 
ATOM   2602  C  C   . GLU A 1 328 ? 0.193   10.682  31.164  1.00 10.82 ? 328  GLU A C   1 
ATOM   2603  O  O   . GLU A 1 328 ? 0.891   11.657  30.861  1.00 10.86 ? 328  GLU A O   1 
ATOM   2604  C  CB  . GLU A 1 328 ? -1.984  11.012  29.890  1.00 10.72 ? 328  GLU A CB  1 
ATOM   2605  C  CG  . GLU A 1 328 ? -3.004  10.547  28.817  1.00 12.62 ? 328  GLU A CG  1 
ATOM   2606  C  CD  . GLU A 1 328 ? -4.229  9.769   29.373  1.00 15.16 ? 328  GLU A CD  1 
ATOM   2607  O  OE1 . GLU A 1 328 ? -4.198  9.251   30.513  1.00 13.19 ? 328  GLU A OE1 1 
ATOM   2608  O  OE2 . GLU A 1 328 ? -5.239  9.683   28.645  1.00 16.06 ? 328  GLU A OE2 1 
ATOM   2609  N  N   . ASP A 1 329 ? 0.284   10.098  32.355  1.00 11.07 ? 329  ASP A N   1 
ATOM   2610  C  CA  . ASP A 1 329 ? 1.308   10.489  33.370  1.00 11.48 ? 329  ASP A CA  1 
ATOM   2611  C  C   . ASP A 1 329 ? 2.613   10.974  32.706  1.00 11.18 ? 329  ASP A C   1 
ATOM   2612  O  O   . ASP A 1 329 ? 3.278   10.200  32.004  1.00 11.72 ? 329  ASP A O   1 
ATOM   2613  C  CB  . ASP A 1 329 ? 1.567   9.315   34.334  1.00 10.87 ? 329  ASP A CB  1 
ATOM   2614  C  CG  . ASP A 1 329 ? 2.530   9.672   35.486  1.00 12.00 ? 329  ASP A CG  1 
ATOM   2615  O  OD1 . ASP A 1 329 ? 3.558   10.332  35.223  1.00 11.34 ? 329  ASP A OD1 1 
ATOM   2616  O  OD2 . ASP A 1 329 ? 2.279   9.249   36.651  1.00 9.96  ? 329  ASP A OD2 1 
ATOM   2617  N  N   . LYS A 1 330 ? 2.970   12.244  32.908  1.00 10.75 ? 330  LYS A N   1 
ATOM   2618  C  CA  . LYS A 1 330 ? 4.111   12.830  32.171  1.00 10.43 ? 330  LYS A CA  1 
ATOM   2619  C  C   . LYS A 1 330 ? 5.497   12.348  32.611  1.00 9.82  ? 330  LYS A C   1 
ATOM   2620  O  O   . LYS A 1 330 ? 6.467   12.466  31.862  1.00 10.17 ? 330  LYS A O   1 
ATOM   2621  C  CB  . LYS A 1 330 ? 4.038   14.364  32.135  1.00 11.08 ? 330  LYS A CB  1 
ATOM   2622  C  CG  . LYS A 1 330 ? 2.979   14.871  31.161  1.00 13.09 ? 330  LYS A CG  1 
ATOM   2623  C  CD  . LYS A 1 330 ? 3.027   16.366  30.980  1.00 15.13 ? 330  LYS A CD  1 
ATOM   2624  C  CE  . LYS A 1 330 ? 1.750   17.005  31.547  1.00 16.51 ? 330  LYS A CE  1 
ATOM   2625  N  NZ  . LYS A 1 330 ? 1.539   18.393  31.053  1.00 15.26 ? 330  LYS A NZ  1 
ATOM   2626  N  N   . LEU A 1 331 ? 5.609   11.819  33.816  1.00 8.65  ? 331  LEU A N   1 
ATOM   2627  C  CA  . LEU A 1 331 ? 6.853   11.190  34.199  1.00 8.27  ? 331  LEU A CA  1 
ATOM   2628  C  C   . LEU A 1 331 ? 6.949   9.798   33.500  1.00 8.07  ? 331  LEU A C   1 
ATOM   2629  O  O   . LEU A 1 331 ? 7.955   9.480   32.876  1.00 7.44  ? 331  LEU A O   1 
ATOM   2630  C  CB  . LEU A 1 331 ? 6.935   11.094  35.720  1.00 7.82  ? 331  LEU A CB  1 
ATOM   2631  C  CG  . LEU A 1 331 ? 8.282   10.668  36.320  1.00 7.58  ? 331  LEU A CG  1 
ATOM   2632  C  CD1 . LEU A 1 331 ? 9.322   11.793  36.250  1.00 2.00  ? 331  LEU A CD1 1 
ATOM   2633  C  CD2 . LEU A 1 331 ? 8.068   10.160  37.761  1.00 4.00  ? 331  LEU A CD2 1 
ATOM   2634  N  N   . LEU A 1 332 ? 5.864   9.025   33.541  1.00 7.56  ? 332  LEU A N   1 
ATOM   2635  C  CA  . LEU A 1 332 ? 5.815   7.697   32.922  1.00 7.18  ? 332  LEU A CA  1 
ATOM   2636  C  C   . LEU A 1 332 ? 6.096   7.758   31.423  1.00 7.67  ? 332  LEU A C   1 
ATOM   2637  O  O   . LEU A 1 332 ? 6.820   6.909   30.867  1.00 7.91  ? 332  LEU A O   1 
ATOM   2638  C  CB  . LEU A 1 332 ? 4.440   7.052   33.153  1.00 6.82  ? 332  LEU A CB  1 
ATOM   2639  C  CG  . LEU A 1 332 ? 4.108   5.774   32.390  1.00 6.41  ? 332  LEU A CG  1 
ATOM   2640  C  CD1 . LEU A 1 332 ? 5.108   4.620   32.703  1.00 5.42  ? 332  LEU A CD1 1 
ATOM   2641  C  CD2 . LEU A 1 332 ? 2.658   5.356   32.635  1.00 5.99  ? 332  LEU A CD2 1 
ATOM   2642  N  N   . GLN A 1 333 ? 5.526   8.761   30.772  1.00 7.24  ? 333  GLN A N   1 
ATOM   2643  C  CA  . GLN A 1 333 ? 5.691   8.915   29.336  1.00 8.04  ? 333  GLN A CA  1 
ATOM   2644  C  C   . GLN A 1 333 ? 7.159   8.941   28.815  1.00 8.30  ? 333  GLN A C   1 
ATOM   2645  O  O   . GLN A 1 333 ? 7.458   8.384   27.737  1.00 8.69  ? 333  GLN A O   1 
ATOM   2646  C  CB  . GLN A 1 333 ? 4.882   10.122  28.863  1.00 8.42  ? 333  GLN A CB  1 
ATOM   2647  C  CG  . GLN A 1 333 ? 3.359   9.870   28.899  1.00 8.00  ? 333  GLN A CG  1 
ATOM   2648  C  CD  . GLN A 1 333 ? 2.872   9.267   27.626  1.00 6.52  ? 333  GLN A CD  1 
ATOM   2649  O  OE1 . GLN A 1 333 ? 3.349   9.619   26.563  1.00 7.15  ? 333  GLN A OE1 1 
ATOM   2650  N  NE2 . GLN A 1 333 ? 1.949   8.325   27.721  1.00 7.55  ? 333  GLN A NE2 1 
ATOM   2651  N  N   . GLY A 1 334 ? 8.055   9.577   29.573  1.00 8.28  ? 334  GLY A N   1 
ATOM   2652  C  CA  . GLY A 1 334 ? 9.471   9.633   29.214  1.00 8.77  ? 334  GLY A CA  1 
ATOM   2653  C  C   . GLY A 1 334 ? 10.165  8.300   29.443  1.00 9.12  ? 334  GLY A C   1 
ATOM   2654  O  O   . GLY A 1 334 ? 11.029  7.890   28.667  1.00 9.20  ? 334  GLY A O   1 
ATOM   2655  N  N   . ARG A 1 335 ? 9.776   7.617   30.513  1.00 9.13  ? 335  ARG A N   1 
ATOM   2656  C  CA  . ARG A 1 335 ? 10.272  6.277   30.785  1.00 9.30  ? 335  ARG A CA  1 
ATOM   2657  C  C   . ARG A 1 335 ? 10.008  5.316   29.614  1.00 9.70  ? 335  ARG A C   1 
ATOM   2658  O  O   . ARG A 1 335 ? 10.902  4.529   29.244  1.00 10.76 ? 335  ARG A O   1 
ATOM   2659  C  CB  . ARG A 1 335 ? 9.693   5.728   32.094  1.00 9.49  ? 335  ARG A CB  1 
ATOM   2660  C  CG  . ARG A 1 335 ? 10.134  6.476   33.351  1.00 6.82  ? 335  ARG A CG  1 
ATOM   2661  C  CD  . ARG A 1 335 ? 9.393   5.940   34.576  1.00 9.49  ? 335  ARG A CD  1 
ATOM   2662  N  NE  . ARG A 1 335 ? 9.956   4.686   35.127  1.00 8.88  ? 335  ARG A NE  1 
ATOM   2663  C  CZ  . ARG A 1 335 ? 9.235   3.763   35.768  1.00 6.99  ? 335  ARG A CZ  1 
ATOM   2664  N  NH1 . ARG A 1 335 ? 7.920   3.916   35.908  1.00 3.64  ? 335  ARG A NH1 1 
ATOM   2665  N  NH2 . ARG A 1 335 ? 9.816   2.676   36.250  1.00 3.14  ? 335  ARG A NH2 1 
ATOM   2666  N  N   . LEU A 1 336 ? 8.822   5.395   28.999  1.00 8.91  ? 336  LEU A N   1 
ATOM   2667  C  CA  . LEU A 1 336 ? 8.511   4.516   27.879  1.00 8.16  ? 336  LEU A CA  1 
ATOM   2668  C  C   . LEU A 1 336 ? 9.653   4.456   26.872  1.00 8.08  ? 336  LEU A C   1 
ATOM   2669  O  O   . LEU A 1 336 ? 9.999   3.379   26.403  1.00 8.17  ? 336  LEU A O   1 
ATOM   2670  C  CB  . LEU A 1 336 ? 7.215   4.933   27.191  1.00 8.73  ? 336  LEU A CB  1 
ATOM   2671  C  CG  . LEU A 1 336 ? 6.012   5.189   28.100  1.00 9.06  ? 336  LEU A CG  1 
ATOM   2672  C  CD1 . LEU A 1 336 ? 4.924   5.771   27.253  1.00 7.04  ? 336  LEU A CD1 1 
ATOM   2673  C  CD2 . LEU A 1 336 ? 5.531   3.932   28.886  1.00 7.02  ? 336  LEU A CD2 1 
ATOM   2674  N  N   . PHE A 1 337 ? 10.242  5.617   26.577  1.00 7.91  ? 337  PHE A N   1 
ATOM   2675  C  CA  . PHE A 1 337 ? 11.374  5.754   25.660  1.00 7.37  ? 337  PHE A CA  1 
ATOM   2676  C  C   . PHE A 1 337 ? 12.706  5.362   26.288  1.00 7.33  ? 337  PHE A C   1 
ATOM   2677  O  O   . PHE A 1 337 ? 13.492  4.634   25.685  1.00 7.45  ? 337  PHE A O   1 
ATOM   2678  C  CB  . PHE A 1 337 ? 11.493  7.196   25.109  1.00 6.62  ? 337  PHE A CB  1 
ATOM   2679  C  CG  . PHE A 1 337 ? 12.812  7.473   24.392  1.00 4.58  ? 337  PHE A CG  1 
ATOM   2680  C  CD1 . PHE A 1 337 ? 13.112  6.847   23.187  1.00 2.20  ? 337  PHE A CD1 1 
ATOM   2681  C  CD2 . PHE A 1 337 ? 13.754  8.356   24.947  1.00 3.29  ? 337  PHE A CD2 1 
ATOM   2682  C  CE1 . PHE A 1 337 ? 14.320  7.090   22.551  1.00 4.43  ? 337  PHE A CE1 1 
ATOM   2683  C  CE2 . PHE A 1 337 ? 14.974  8.627   24.318  1.00 2.00  ? 337  PHE A CE2 1 
ATOM   2684  C  CZ  . PHE A 1 337 ? 15.269  7.990   23.126  1.00 4.88  ? 337  PHE A CZ  1 
ATOM   2685  N  N   . SER A 1 338 ? 12.943  5.872   27.488  1.00 7.57  ? 338  SER A N   1 
ATOM   2686  C  CA  . SER A 1 338 ? 14.268  5.900   28.119  1.00 7.49  ? 338  SER A CA  1 
ATOM   2687  C  C   . SER A 1 338 ? 14.887  4.536   28.335  1.00 7.40  ? 338  SER A C   1 
ATOM   2688  O  O   . SER A 1 338 ? 16.056  4.346   28.025  1.00 8.05  ? 338  SER A O   1 
ATOM   2689  C  CB  . SER A 1 338 ? 14.178  6.630   29.462  1.00 7.80  ? 338  SER A CB  1 
ATOM   2690  O  OG  . SER A 1 338 ? 15.447  6.746   30.101  1.00 9.88  ? 338  SER A OG  1 
ATOM   2691  N  N   . TYR A 1 339 ? 14.098  3.596   28.862  1.00 7.49  ? 339  TYR A N   1 
ATOM   2692  C  CA  . TYR A 1 339 ? 14.582  2.275   29.274  1.00 6.95  ? 339  TYR A CA  1 
ATOM   2693  C  C   . TYR A 1 339 ? 15.167  1.466   28.127  1.00 7.18  ? 339  TYR A C   1 
ATOM   2694  O  O   . TYR A 1 339 ? 16.341  1.081   28.177  1.00 7.98  ? 339  TYR A O   1 
ATOM   2695  C  CB  . TYR A 1 339 ? 13.478  1.490   30.016  1.00 6.83  ? 339  TYR A CB  1 
ATOM   2696  C  CG  . TYR A 1 339 ? 13.213  2.005   31.425  1.00 5.74  ? 339  TYR A CG  1 
ATOM   2697  C  CD1 . TYR A 1 339 ? 13.668  1.318   32.545  1.00 3.92  ? 339  TYR A CD1 1 
ATOM   2698  C  CD2 . TYR A 1 339 ? 12.525  3.206   31.618  1.00 4.26  ? 339  TYR A CD2 1 
ATOM   2699  C  CE1 . TYR A 1 339 ? 13.394  1.811   33.846  1.00 6.18  ? 339  TYR A CE1 1 
ATOM   2700  C  CE2 . TYR A 1 339 ? 12.274  3.701   32.844  1.00 4.78  ? 339  TYR A CE2 1 
ATOM   2701  C  CZ  . TYR A 1 339 ? 12.708  3.023   33.977  1.00 7.09  ? 339  TYR A CZ  1 
ATOM   2702  O  OH  . TYR A 1 339 ? 12.431  3.582   35.204  1.00 5.38  ? 339  TYR A OH  1 
ATOM   2703  N  N   . SER A 1 340 ? 14.359  1.239   27.097  1.00 6.70  ? 340  SER A N   1 
ATOM   2704  C  CA  . SER A 1 340 ? 14.763  0.496   25.921  1.00 7.24  ? 340  SER A CA  1 
ATOM   2705  C  C   . SER A 1 340 ? 15.892  1.229   25.195  1.00 7.13  ? 340  SER A C   1 
ATOM   2706  O  O   . SER A 1 340 ? 16.788  0.593   24.615  1.00 6.30  ? 340  SER A O   1 
ATOM   2707  C  CB  . SER A 1 340 ? 13.560  0.321   24.972  1.00 7.42  ? 340  SER A CB  1 
ATOM   2708  O  OG  . SER A 1 340 ? 12.551  -0.467  25.586  1.00 9.49  ? 340  SER A OG  1 
ATOM   2709  N  N   . ASP A 1 341 ? 15.833  2.564   25.240  1.00 7.21  ? 341  ASP A N   1 
ATOM   2710  C  CA  . ASP A 1 341 ? 16.815  3.418   24.569  1.00 7.27  ? 341  ASP A CA  1 
ATOM   2711  C  C   . ASP A 1 341 ? 18.171  3.244   25.192  1.00 7.07  ? 341  ASP A C   1 
ATOM   2712  O  O   . ASP A 1 341 ? 19.146  3.119   24.486  1.00 6.82  ? 341  ASP A O   1 
ATOM   2713  C  CB  . ASP A 1 341 ? 16.450  4.902   24.667  1.00 7.53  ? 341  ASP A CB  1 
ATOM   2714  C  CG  . ASP A 1 341 ? 17.578  5.798   24.174  1.00 8.09  ? 341  ASP A CG  1 
ATOM   2715  O  OD1 . ASP A 1 341 ? 18.040  5.561   23.052  1.00 6.31  ? 341  ASP A OD1 1 
ATOM   2716  O  OD2 . ASP A 1 341 ? 18.035  6.710   24.901  1.00 7.99  ? 341  ASP A OD2 1 
ATOM   2717  N  N   . THR A 1 342 ? 18.224  3.267   26.524  1.00 7.58  ? 342  THR A N   1 
ATOM   2718  C  CA  . THR A 1 342 ? 19.476  3.076   27.255  1.00 7.56  ? 342  THR A CA  1 
ATOM   2719  C  C   . THR A 1 342 ? 19.988  1.641   27.163  1.00 7.71  ? 342  THR A C   1 
ATOM   2720  O  O   . THR A 1 342 ? 21.177  1.416   27.207  1.00 8.24  ? 342  THR A O   1 
ATOM   2721  C  CB  . THR A 1 342 ? 19.330  3.465   28.742  1.00 8.24  ? 342  THR A CB  1 
ATOM   2722  O  OG1 . THR A 1 342 ? 20.637  3.674   29.322  1.00 7.61  ? 342  THR A OG1 1 
ATOM   2723  C  CG2 . THR A 1 342 ? 18.532  2.391   29.535  1.00 6.33  ? 342  THR A CG2 1 
ATOM   2724  N  N   . GLN A 1 343 ? 19.078  0.676   27.040  1.00 7.46  ? 343  GLN A N   1 
ATOM   2725  C  CA  . GLN A 1 343 ? 19.441  -0.727  26.909  1.00 6.64  ? 343  GLN A CA  1 
ATOM   2726  C  C   . GLN A 1 343 ? 20.088  -1.029  25.553  1.00 6.73  ? 343  GLN A C   1 
ATOM   2727  O  O   . GLN A 1 343 ? 20.967  -1.889  25.457  1.00 7.43  ? 343  GLN A O   1 
ATOM   2728  C  CB  . GLN A 1 343 ? 18.235  -1.617  27.175  1.00 6.66  ? 343  GLN A CB  1 
ATOM   2729  C  CG  . GLN A 1 343 ? 17.842  -1.647  28.656  1.00 6.31  ? 343  GLN A CG  1 
ATOM   2730  C  CD  . GLN A 1 343 ? 16.335  -1.814  28.886  1.00 5.65  ? 343  GLN A CD  1 
ATOM   2731  O  OE1 . GLN A 1 343 ? 15.617  -2.291  28.016  1.00 8.47  ? 343  GLN A OE1 1 
ATOM   2732  N  NE2 . GLN A 1 343 ? 15.860  -1.429  30.063  1.00 4.13  ? 343  GLN A NE2 1 
ATOM   2733  N  N   . ARG A 1 344 ? 19.695  -0.314  24.514  1.00 5.97  ? 344  ARG A N   1 
ATOM   2734  C  CA  . ARG A 1 344 ? 20.337  -0.494  23.199  1.00 5.64  ? 344  ARG A CA  1 
ATOM   2735  C  C   . ARG A 1 344 ? 21.819  -0.095  23.257  1.00 5.66  ? 344  ARG A C   1 
ATOM   2736  O  O   . ARG A 1 344 ? 22.648  -0.618  22.506  1.00 4.47  ? 344  ARG A O   1 
ATOM   2737  C  CB  . ARG A 1 344 ? 19.580  0.278   22.096  1.00 4.82  ? 344  ARG A CB  1 
ATOM   2738  C  CG  . ARG A 1 344 ? 18.251  -0.380  21.754  1.00 2.31  ? 344  ARG A CG  1 
ATOM   2739  C  CD  . ARG A 1 344 ? 17.250  0.570   21.085  1.00 2.00  ? 344  ARG A CD  1 
ATOM   2740  N  NE  . ARG A 1 344 ? 15.897  0.016   21.198  1.00 2.00  ? 344  ARG A NE  1 
ATOM   2741  C  CZ  . ARG A 1 344 ? 14.812  0.696   21.562  1.00 2.31  ? 344  ARG A CZ  1 
ATOM   2742  N  NH1 . ARG A 1 344 ? 14.854  2.017   21.789  1.00 2.00  ? 344  ARG A NH1 1 
ATOM   2743  N  NH2 . ARG A 1 344 ? 13.664  0.051   21.665  1.00 3.77  ? 344  ARG A NH2 1 
ATOM   2744  N  N   . HIS A 1 345 ? 22.132  0.820   24.179  1.00 5.67  ? 345  HIS A N   1 
ATOM   2745  C  CA  . HIS A 1 345 ? 23.503  1.262   24.400  1.00 5.83  ? 345  HIS A CA  1 
ATOM   2746  C  C   . HIS A 1 345 ? 24.178  0.347   25.430  1.00 5.62  ? 345  HIS A C   1 
ATOM   2747  O  O   . HIS A 1 345 ? 25.221  -0.238  25.154  1.00 6.10  ? 345  HIS A O   1 
ATOM   2748  C  CB  . HIS A 1 345 ? 23.486  2.732   24.834  1.00 6.21  ? 345  HIS A CB  1 
ATOM   2749  C  CG  . HIS A 1 345 ? 24.551  3.100   25.826  1.00 7.38  ? 345  HIS A CG  1 
ATOM   2750  N  ND1 . HIS A 1 345 ? 25.881  3.237   25.484  1.00 7.58  ? 345  HIS A ND1 1 
ATOM   2751  C  CD2 . HIS A 1 345 ? 24.470  3.397   27.141  1.00 7.89  ? 345  HIS A CD2 1 
ATOM   2752  C  CE1 . HIS A 1 345 ? 26.577  3.576   26.553  1.00 9.58  ? 345  HIS A CE1 1 
ATOM   2753  N  NE2 . HIS A 1 345 ? 25.744  3.683   27.572  1.00 9.86  ? 345  HIS A NE2 1 
ATOM   2754  N  N   . ARG A 1 346 ? 23.549  0.173   26.591  1.00 5.36  ? 346  ARG A N   1 
ATOM   2755  C  CA  . ARG A 1 346 ? 24.127  -0.617  27.684  1.00 5.02  ? 346  ARG A CA  1 
ATOM   2756  C  C   . ARG A 1 346 ? 24.302  -2.127  27.388  1.00 5.10  ? 346  ARG A C   1 
ATOM   2757  O  O   . ARG A 1 346 ? 25.290  -2.736  27.789  1.00 5.00  ? 346  ARG A O   1 
ATOM   2758  C  CB  . ARG A 1 346 ? 23.324  -0.396  28.975  1.00 4.07  ? 346  ARG A CB  1 
ATOM   2759  C  CG  . ARG A 1 346 ? 23.698  -1.362  30.107  1.00 3.45  ? 346  ARG A CG  1 
ATOM   2760  C  CD  . ARG A 1 346 ? 23.018  -1.043  31.452  1.00 4.01  ? 346  ARG A CD  1 
ATOM   2761  N  NE  . ARG A 1 346 ? 21.609  -1.481  31.517  1.00 3.20  ? 346  ARG A NE  1 
ATOM   2762  C  CZ  . ARG A 1 346 ? 21.207  -2.728  31.775  1.00 2.80  ? 346  ARG A CZ  1 
ATOM   2763  N  NH1 . ARG A 1 346 ? 19.919  -3.013  31.848  1.00 2.44  ? 346  ARG A NH1 1 
ATOM   2764  N  NH2 . ARG A 1 346 ? 22.085  -3.702  31.943  1.00 3.65  ? 346  ARG A NH2 1 
ATOM   2765  N  N   . ILE A 1 347 ? 23.341  -2.746  26.724  1.00 5.27  ? 347  ILE A N   1 
ATOM   2766  C  CA  . ILE A 1 347 ? 23.403  -4.193  26.580  1.00 5.84  ? 347  ILE A CA  1 
ATOM   2767  C  C   . ILE A 1 347 ? 23.692  -4.460  25.130  1.00 6.55  ? 347  ILE A C   1 
ATOM   2768  O  O   . ILE A 1 347 ? 24.436  -5.384  24.813  1.00 7.78  ? 347  ILE A O   1 
ATOM   2769  C  CB  . ILE A 1 347 ? 22.072  -4.905  26.997  1.00 5.92  ? 347  ILE A CB  1 
ATOM   2770  C  CG1 . ILE A 1 347 ? 21.575  -4.422  28.362  1.00 5.56  ? 347  ILE A CG1 1 
ATOM   2771  C  CG2 . ILE A 1 347 ? 22.249  -6.423  27.026  1.00 5.46  ? 347  ILE A CG2 1 
ATOM   2772  C  CD1 . ILE A 1 347 ? 20.079  -4.728  28.604  1.00 7.10  ? 347  ILE A CD1 1 
ATOM   2773  N  N   . GLY A 1 348 ? 23.100  -3.654  24.242  1.00 6.74  ? 348  GLY A N   1 
ATOM   2774  C  CA  . GLY A 1 348 ? 23.294  -3.811  22.803  1.00 6.68  ? 348  GLY A CA  1 
ATOM   2775  C  C   . GLY A 1 348 ? 22.015  -3.741  21.967  1.00 6.75  ? 348  GLY A C   1 
ATOM   2776  O  O   . GLY A 1 348 ? 20.912  -3.896  22.494  1.00 7.25  ? 348  GLY A O   1 
ATOM   2777  N  N   . PRO A 1 349 ? 22.160  -3.465  20.655  1.00 5.93  ? 349  PRO A N   1 
ATOM   2778  C  CA  . PRO A 1 349 ? 21.025  -3.392  19.742  1.00 5.83  ? 349  PRO A CA  1 
ATOM   2779  C  C   . PRO A 1 349 ? 20.131  -4.632  19.698  1.00 6.09  ? 349  PRO A C   1 
ATOM   2780  O  O   . PRO A 1 349 ? 18.915  -4.500  19.522  1.00 5.96  ? 349  PRO A O   1 
ATOM   2781  C  CB  . PRO A 1 349 ? 21.698  -3.124  18.391  1.00 5.78  ? 349  PRO A CB  1 
ATOM   2782  C  CG  . PRO A 1 349 ? 22.960  -2.395  18.772  1.00 5.05  ? 349  PRO A CG  1 
ATOM   2783  C  CD  . PRO A 1 349 ? 23.424  -3.124  19.974  1.00 5.11  ? 349  PRO A CD  1 
ATOM   2784  N  N   . ASN A 1 350 ? 20.717  -5.820  19.865  1.00 6.13  ? 350  ASN A N   1 
ATOM   2785  C  CA  . ASN A 1 350 ? 19.945  -7.054  19.872  1.00 5.43  ? 350  ASN A CA  1 
ATOM   2786  C  C   . ASN A 1 350 ? 19.753  -7.583  21.313  1.00 5.77  ? 350  ASN A C   1 
ATOM   2787  O  O   . ASN A 1 350 ? 19.661  -8.800  21.540  1.00 5.38  ? 350  ASN A O   1 
ATOM   2788  C  CB  . ASN A 1 350 ? 20.632  -8.093  18.977  1.00 5.89  ? 350  ASN A CB  1 
ATOM   2789  C  CG  . ASN A 1 350 ? 20.480  -7.787  17.502  1.00 5.36  ? 350  ASN A CG  1 
ATOM   2790  O  OD1 . ASN A 1 350 ? 19.425  -7.367  17.074  1.00 7.32  ? 350  ASN A OD1 1 
ATOM   2791  N  ND2 . ASN A 1 350 ? 21.540  -7.988  16.719  1.00 5.53  ? 350  ASN A ND2 1 
ATOM   2792  N  N   . TYR A 1 351 ? 19.682  -6.666  22.287  1.00 5.14  ? 351  TYR A N   1 
ATOM   2793  C  CA  . TYR A 1 351 ? 19.558  -7.051  23.671  1.00 4.99  ? 351  TYR A CA  1 
ATOM   2794  C  C   . TYR A 1 351 ? 18.366  -7.981  23.913  1.00 5.42  ? 351  TYR A C   1 
ATOM   2795  O  O   . TYR A 1 351 ? 18.431  -8.856  24.771  1.00 4.60  ? 351  TYR A O   1 
ATOM   2796  C  CB  . TYR A 1 351 ? 19.510  -5.818  24.572  1.00 5.23  ? 351  TYR A CB  1 
ATOM   2797  C  CG  . TYR A 1 351 ? 18.178  -5.069  24.673  1.00 4.80  ? 351  TYR A CG  1 
ATOM   2798  C  CD1 . TYR A 1 351 ? 17.249  -5.368  25.698  1.00 3.26  ? 351  TYR A CD1 1 
ATOM   2799  C  CD2 . TYR A 1 351 ? 17.857  -4.068  23.774  1.00 2.52  ? 351  TYR A CD2 1 
ATOM   2800  C  CE1 . TYR A 1 351 ? 16.047  -4.669  25.819  1.00 2.69  ? 351  TYR A CE1 1 
ATOM   2801  C  CE2 . TYR A 1 351 ? 16.651  -3.372  23.875  1.00 2.58  ? 351  TYR A CE2 1 
ATOM   2802  C  CZ  . TYR A 1 351 ? 15.752  -3.663  24.903  1.00 4.93  ? 351  TYR A CZ  1 
ATOM   2803  O  OH  . TYR A 1 351 ? 14.553  -2.941  24.990  1.00 3.85  ? 351  TYR A OH  1 
ATOM   2804  N  N   . GLN A 1 352 ? 17.294  -7.798  23.142  1.00 5.89  ? 352  GLN A N   1 
ATOM   2805  C  CA  . GLN A 1 352 ? 16.098  -8.635  23.265  1.00 6.96  ? 352  GLN A CA  1 
ATOM   2806  C  C   . GLN A 1 352 ? 16.284  -10.092 22.828  1.00 7.23  ? 352  GLN A C   1 
ATOM   2807  O  O   . GLN A 1 352 ? 15.393  -10.914 23.061  1.00 7.64  ? 352  GLN A O   1 
ATOM   2808  C  CB  . GLN A 1 352 ? 14.901  -8.008  22.529  1.00 7.17  ? 352  GLN A CB  1 
ATOM   2809  C  CG  . GLN A 1 352 ? 13.986  -7.163  23.452  1.00 8.62  ? 352  GLN A CG  1 
ATOM   2810  C  CD  . GLN A 1 352 ? 13.565  -7.914  24.704  1.00 9.20  ? 352  GLN A CD  1 
ATOM   2811  O  OE1 . GLN A 1 352 ? 13.990  -7.583  25.809  1.00 9.45  ? 352  GLN A OE1 1 
ATOM   2812  N  NE2 . GLN A 1 352 ? 12.746  -8.937  24.536  1.00 10.72 ? 352  GLN A NE2 1 
ATOM   2813  N  N   . GLN A 1 353 ? 17.428  -10.407 22.207  1.00 7.20  ? 353  GLN A N   1 
ATOM   2814  C  CA  . GLN A 1 353 ? 17.761  -11.785 21.831  1.00 6.75  ? 353  GLN A CA  1 
ATOM   2815  C  C   . GLN A 1 353 ? 18.472  -12.599 22.930  1.00 6.74  ? 353  GLN A C   1 
ATOM   2816  O  O   . GLN A 1 353 ? 18.589  -13.817 22.833  1.00 5.74  ? 353  GLN A O   1 
ATOM   2817  C  CB  . GLN A 1 353 ? 18.618  -11.788 20.574  1.00 6.97  ? 353  GLN A CB  1 
ATOM   2818  C  CG  . GLN A 1 353 ? 18.029  -11.080 19.321  1.00 6.50  ? 353  GLN A CG  1 
ATOM   2819  C  CD  . GLN A 1 353 ? 18.933  -11.261 18.115  1.00 7.65  ? 353  GLN A CD  1 
ATOM   2820  O  OE1 . GLN A 1 353 ? 20.039  -11.860 18.227  1.00 6.25  ? 353  GLN A OE1 1 
ATOM   2821  N  NE2 . GLN A 1 353 ? 18.500  -10.731 16.955  1.00 5.65  ? 353  GLN A NE2 1 
ATOM   2822  N  N   . LEU A 1 354 ? 18.978  -11.923 23.955  1.00 7.13  ? 354  LEU A N   1 
ATOM   2823  C  CA  . LEU A 1 354 ? 19.651  -12.588 25.072  1.00 7.03  ? 354  LEU A CA  1 
ATOM   2824  C  C   . LEU A 1 354 ? 18.703  -13.472 25.877  1.00 6.86  ? 354  LEU A C   1 
ATOM   2825  O  O   . LEU A 1 354 ? 17.593  -13.051 26.172  1.00 7.74  ? 354  LEU A O   1 
ATOM   2826  C  CB  . LEU A 1 354 ? 20.285  -11.545 26.011  1.00 6.86  ? 354  LEU A CB  1 
ATOM   2827  C  CG  . LEU A 1 354 ? 21.545  -10.838 25.468  1.00 6.88  ? 354  LEU A CG  1 
ATOM   2828  C  CD1 . LEU A 1 354 ? 21.979  -9.810  26.459  1.00 3.30  ? 354  LEU A CD1 1 
ATOM   2829  C  CD2 . LEU A 1 354 ? 22.704  -11.816 25.134  1.00 5.48  ? 354  LEU A CD2 1 
ATOM   2830  N  N   . PRO A 1 355 ? 19.137  -14.691 26.241  1.00 6.95  ? 355  PRO A N   1 
ATOM   2831  C  CA  . PRO A 1 355 ? 18.271  -15.608 27.029  1.00 7.70  ? 355  PRO A CA  1 
ATOM   2832  C  C   . PRO A 1 355 ? 17.393  -14.975 28.142  1.00 8.07  ? 355  PRO A C   1 
ATOM   2833  O  O   . PRO A 1 355 ? 16.194  -15.273 28.233  1.00 8.00  ? 355  PRO A O   1 
ATOM   2834  C  CB  . PRO A 1 355 ? 19.275  -16.628 27.596  1.00 7.44  ? 355  PRO A CB  1 
ATOM   2835  C  CG  . PRO A 1 355 ? 20.340  -16.693 26.473  1.00 7.07  ? 355  PRO A CG  1 
ATOM   2836  C  CD  . PRO A 1 355 ? 20.459  -15.292 25.942  1.00 6.26  ? 355  PRO A CD  1 
ATOM   2837  N  N   . ILE A 1 356 ? 17.970  -14.076 28.940  1.00 8.94  ? 356  ILE A N   1 
ATOM   2838  C  CA  . ILE A 1 356 ? 17.248  -13.460 30.055  1.00 8.65  ? 356  ILE A CA  1 
ATOM   2839  C  C   . ILE A 1 356 ? 16.155  -12.489 29.577  1.00 9.54  ? 356  ILE A C   1 
ATOM   2840  O  O   . ILE A 1 356 ? 15.190  -12.238 30.315  1.00 9.29  ? 356  ILE A O   1 
ATOM   2841  C  CB  . ILE A 1 356 ? 18.218  -12.789 31.078  1.00 8.49  ? 356  ILE A CB  1 
ATOM   2842  C  CG1 . ILE A 1 356 ? 17.497  -12.450 32.393  1.00 8.01  ? 356  ILE A CG1 1 
ATOM   2843  C  CG2 . ILE A 1 356 ? 18.916  -11.536 30.490  1.00 6.72  ? 356  ILE A CG2 1 
ATOM   2844  C  CD1 . ILE A 1 356 ? 17.026  -13.674 33.237  1.00 5.56  ? 356  ILE A CD1 1 
ATOM   2845  N  N   . ASN A 1 357 ? 16.291  -11.963 28.353  1.00 9.64  ? 357  ASN A N   1 
ATOM   2846  C  CA  . ASN A 1 357 ? 15.316  -10.997 27.836  1.00 10.86 ? 357  ASN A CA  1 
ATOM   2847  C  C   . ASN A 1 357 ? 14.299  -11.587 26.857  1.00 11.83 ? 357  ASN A C   1 
ATOM   2848  O  O   . ASN A 1 357 ? 13.229  -10.992 26.608  1.00 12.22 ? 357  ASN A O   1 
ATOM   2849  C  CB  . ASN A 1 357 ? 16.015  -9.793  27.213  1.00 9.80  ? 357  ASN A CB  1 
ATOM   2850  C  CG  . ASN A 1 357 ? 16.780  -8.982  28.232  1.00 10.44 ? 357  ASN A CG  1 
ATOM   2851  O  OD1 . ASN A 1 357 ? 16.238  -8.617  29.298  1.00 7.95  ? 357  ASN A OD1 1 
ATOM   2852  N  ND2 . ASN A 1 357 ? 18.056  -8.693  27.925  1.00 6.11  ? 357  ASN A ND2 1 
ATOM   2853  N  N   . CYS A 1 358 ? 14.635  -12.756 26.314  1.00 13.37 ? 358  CYS A N   1 
ATOM   2854  C  CA  . CYS A 1 358 ? 13.819  -13.433 25.306  1.00 12.99 ? 358  CYS A CA  1 
ATOM   2855  C  C   . CYS A 1 358 ? 12.396  -13.722 25.833  1.00 12.90 ? 358  CYS A C   1 
ATOM   2856  O  O   . CYS A 1 358 ? 12.233  -14.238 26.950  1.00 12.40 ? 358  CYS A O   1 
ATOM   2857  C  CB  . CYS A 1 358 ? 14.516  -14.720 24.868  1.00 12.66 ? 358  CYS A CB  1 
ATOM   2858  S  SG  . CYS A 1 358 ? 14.050  -15.275 23.202  1.00 17.36 ? 358  CYS A SG  1 
ATOM   2859  N  N   . PRO A 1 359 ? 11.358  -13.400 25.032  1.00 13.00 ? 359  PRO A N   1 
ATOM   2860  C  CA  . PRO A 1 359 ? 9.979   -13.725 25.434  1.00 12.85 ? 359  PRO A CA  1 
ATOM   2861  C  C   . PRO A 1 359 ? 9.766   -15.242 25.490  1.00 13.48 ? 359  PRO A C   1 
ATOM   2862  O  O   . PRO A 1 359 ? 10.575  -15.993 24.952  1.00 12.61 ? 359  PRO A O   1 
ATOM   2863  C  CB  . PRO A 1 359 ? 9.121   -13.129 24.319  1.00 12.51 ? 359  PRO A CB  1 
ATOM   2864  C  CG  . PRO A 1 359 ? 10.027  -12.247 23.511  1.00 13.29 ? 359  PRO A CG  1 
ATOM   2865  C  CD  . PRO A 1 359 ? 11.423  -12.764 23.701  1.00 12.98 ? 359  PRO A CD  1 
ATOM   2866  N  N   . PHE A 1 360 ? 8.700   -15.682 26.161  1.00 14.40 ? 360  PHE A N   1 
ATOM   2867  C  CA  . PHE A 1 360 ? 8.291   -17.071 26.099  1.00 15.36 ? 360  PHE A CA  1 
ATOM   2868  C  C   . PHE A 1 360 ? 7.558   -17.286 24.778  1.00 15.72 ? 360  PHE A C   1 
ATOM   2869  O  O   . PHE A 1 360 ? 7.650   -18.369 24.176  1.00 15.62 ? 360  PHE A O   1 
ATOM   2870  C  CB  . PHE A 1 360 ? 7.379   -17.424 27.266  1.00 16.19 ? 360  PHE A CB  1 
ATOM   2871  C  CG  . PHE A 1 360 ? 6.584   -18.685 27.057  1.00 18.10 ? 360  PHE A CG  1 
ATOM   2872  C  CD1 . PHE A 1 360 ? 7.089   -19.921 27.481  1.00 19.77 ? 360  PHE A CD1 1 
ATOM   2873  C  CD2 . PHE A 1 360 ? 5.328   -18.639 26.441  1.00 18.66 ? 360  PHE A CD2 1 
ATOM   2874  C  CE1 . PHE A 1 360 ? 6.357   -21.094 27.289  1.00 20.77 ? 360  PHE A CE1 1 
ATOM   2875  C  CE2 . PHE A 1 360 ? 4.586   -19.803 26.232  1.00 21.07 ? 360  PHE A CE2 1 
ATOM   2876  C  CZ  . PHE A 1 360 ? 5.101   -21.039 26.657  1.00 20.77 ? 360  PHE A CZ  1 
ATOM   2877  N  N   . ALA A 1 361 ? 6.813   -16.262 24.358  1.00 15.35 ? 361  ALA A N   1 
ATOM   2878  C  CA  . ALA A 1 361 ? 6.123   -16.249 23.072  1.00 15.74 ? 361  ALA A CA  1 
ATOM   2879  C  C   . ALA A 1 361 ? 7.136   -16.134 21.932  1.00 16.39 ? 361  ALA A C   1 
ATOM   2880  O  O   . ALA A 1 361 ? 8.111   -15.382 22.046  1.00 17.17 ? 361  ALA A O   1 
ATOM   2881  C  CB  . ALA A 1 361 ? 5.173   -15.085 23.026  1.00 15.15 ? 361  ALA A CB  1 
ATOM   2882  N  N   . GLN A 1 362 ? 6.916   -16.863 20.840  1.00 17.21 ? 362  GLN A N   1 
ATOM   2883  C  CA  . GLN A 1 362 ? 7.793   -16.781 19.672  1.00 17.08 ? 362  GLN A CA  1 
ATOM   2884  C  C   . GLN A 1 362 ? 7.795   -15.357 19.099  1.00 16.74 ? 362  GLN A C   1 
ATOM   2885  O  O   . GLN A 1 362 ? 6.775   -14.643 19.135  1.00 16.62 ? 362  GLN A O   1 
ATOM   2886  C  CB  . GLN A 1 362 ? 7.433   -17.854 18.625  1.00 17.90 ? 362  GLN A CB  1 
ATOM   2887  C  CG  . GLN A 1 362 ? 8.338   -17.934 17.310  1.00 20.62 ? 362  GLN A CG  1 
ATOM   2888  C  CD  . GLN A 1 362 ? 9.884   -17.949 17.527  1.00 28.46 ? 362  GLN A CD  1 
ATOM   2889  O  OE1 . GLN A 1 362 ? 10.404  -17.409 18.512  1.00 29.89 ? 362  GLN A OE1 1 
ATOM   2890  N  NE2 . GLN A 1 362 ? 10.615  -18.550 16.568  1.00 29.69 ? 362  GLN A NE2 1 
ATOM   2891  N  N   . VAL A 1 363 ? 8.966   -14.932 18.630  1.00 16.03 ? 363  VAL A N   1 
ATOM   2892  C  CA  . VAL A 1 363 ? 9.148   -13.602 18.030  1.00 15.02 ? 363  VAL A CA  1 
ATOM   2893  C  C   . VAL A 1 363 ? 9.220   -13.822 16.543  1.00 14.23 ? 363  VAL A C   1 
ATOM   2894  O  O   . VAL A 1 363 ? 10.083  -14.557 16.084  1.00 13.97 ? 363  VAL A O   1 
ATOM   2895  C  CB  . VAL A 1 363 ? 10.465  -12.906 18.514  1.00 15.20 ? 363  VAL A CB  1 
ATOM   2896  C  CG1 . VAL A 1 363 ? 10.706  -11.571 17.758  1.00 14.27 ? 363  VAL A CG1 1 
ATOM   2897  C  CG2 . VAL A 1 363 ? 10.430  -12.684 20.023  1.00 14.32 ? 363  VAL A CG2 1 
ATOM   2898  N  N   . ASN A 1 364 ? 8.302   -13.218 15.801  1.00 13.69 ? 364  ASN A N   1 
ATOM   2899  C  CA  . ASN A 1 364 ? 8.257   -13.389 14.346  1.00 13.73 ? 364  ASN A CA  1 
ATOM   2900  C  C   . ASN A 1 364 ? 8.053   -12.063 13.658  1.00 13.38 ? 364  ASN A C   1 
ATOM   2901  O  O   . ASN A 1 364 ? 6.922   -11.557 13.599  1.00 13.25 ? 364  ASN A O   1 
ATOM   2902  C  CB  . ASN A 1 364 ? 7.126   -14.343 13.936  1.00 14.06 ? 364  ASN A CB  1 
ATOM   2903  C  CG  . ASN A 1 364 ? 7.424   -15.781 14.291  1.00 16.05 ? 364  ASN A CG  1 
ATOM   2904  O  OD1 . ASN A 1 364 ? 8.396   -16.361 13.791  1.00 17.89 ? 364  ASN A OD1 1 
ATOM   2905  N  ND2 . ASN A 1 364 ? 6.601   -16.368 15.176  1.00 15.97 ? 364  ASN A ND2 1 
ATOM   2906  N  N   . ASN A 1 365 ? 9.144   -11.491 13.145  1.00 12.96 ? 365  ASN A N   1 
ATOM   2907  C  CA  . ASN A 1 365 ? 9.046   -10.219 12.426  1.00 11.67 ? 365  ASN A CA  1 
ATOM   2908  C  C   . ASN A 1 365 ? 10.097  -9.985  11.351  1.00 11.40 ? 365  ASN A C   1 
ATOM   2909  O  O   . ASN A 1 365 ? 10.900  -10.861 11.031  1.00 10.86 ? 365  ASN A O   1 
ATOM   2910  C  CB  . ASN A 1 365 ? 8.949   -9.036  13.399  1.00 11.68 ? 365  ASN A CB  1 
ATOM   2911  C  CG  . ASN A 1 365 ? 10.144  -8.912  14.320  1.00 11.58 ? 365  ASN A CG  1 
ATOM   2912  O  OD1 . ASN A 1 365 ? 11.289  -9.177  13.931  1.00 12.47 ? 365  ASN A OD1 1 
ATOM   2913  N  ND2 . ASN A 1 365 ? 9.885   -8.472  15.549  1.00 8.98  ? 365  ASN A ND2 1 
ATOM   2914  N  N   . TYR A 1 366 ? 10.084  -8.765  10.826  1.00 11.26 ? 366  TYR A N   1 
ATOM   2915  C  CA  . TYR A 1 366 ? 10.871  -8.372  9.680   1.00 10.40 ? 366  TYR A CA  1 
ATOM   2916  C  C   . TYR A 1 366 ? 12.107  -7.546  10.044  1.00 10.37 ? 366  TYR A C   1 
ATOM   2917  O  O   . TYR A 1 366 ? 12.771  -7.019  9.149   1.00 10.53 ? 366  TYR A O   1 
ATOM   2918  C  CB  . TYR A 1 366 ? 9.954   -7.602  8.735   1.00 10.73 ? 366  TYR A CB  1 
ATOM   2919  C  CG  . TYR A 1 366 ? 8.816   -8.469  8.258   1.00 10.46 ? 366  TYR A CG  1 
ATOM   2920  C  CD1 . TYR A 1 366 ? 7.602   -8.511  8.959   1.00 12.83 ? 366  TYR A CD1 1 
ATOM   2921  C  CD2 . TYR A 1 366 ? 8.964   -9.288  7.147   1.00 9.77  ? 366  TYR A CD2 1 
ATOM   2922  C  CE1 . TYR A 1 366 ? 6.555   -9.329  8.522   1.00 13.39 ? 366  TYR A CE1 1 
ATOM   2923  C  CE2 . TYR A 1 366 ? 7.927   -10.111 6.710   1.00 11.01 ? 366  TYR A CE2 1 
ATOM   2924  C  CZ  . TYR A 1 366 ? 6.737   -10.121 7.390   1.00 10.53 ? 366  TYR A CZ  1 
ATOM   2925  O  OH  . TYR A 1 366 ? 5.740   -10.934 6.978   1.00 8.32  ? 366  TYR A OH  1 
ATOM   2926  N  N   . GLN A 1 367 ? 12.406  -7.434  11.346  1.00 9.20  ? 367  GLN A N   1 
ATOM   2927  C  CA  . GLN A 1 367 ? 13.619  -6.778  11.819  1.00 9.45  ? 367  GLN A CA  1 
ATOM   2928  C  C   . GLN A 1 367 ? 14.836  -7.668  11.536  1.00 9.59  ? 367  GLN A C   1 
ATOM   2929  O  O   . GLN A 1 367 ? 14.748  -8.908  11.607  1.00 9.68  ? 367  GLN A O   1 
ATOM   2930  C  CB  . GLN A 1 367 ? 13.541  -6.471  13.320  1.00 9.15  ? 367  GLN A CB  1 
ATOM   2931  C  CG  . GLN A 1 367 ? 12.479  -5.473  13.706  1.00 9.11  ? 367  GLN A CG  1 
ATOM   2932  C  CD  . GLN A 1 367 ? 12.455  -5.206  15.202  1.00 10.26 ? 367  GLN A CD  1 
ATOM   2933  O  OE1 . GLN A 1 367 ? 13.451  -5.375  15.880  1.00 10.54 ? 367  GLN A OE1 1 
ATOM   2934  N  NE2 . GLN A 1 367 ? 11.306  -4.767  15.717  1.00 12.42 ? 367  GLN A NE2 1 
ATOM   2935  N  N   . ARG A 1 368 ? 15.974  -7.038  11.235  1.00 9.06  ? 368  ARG A N   1 
ATOM   2936  C  CA  . ARG A 1 368 ? 17.144  -7.771  10.772  1.00 8.68  ? 368  ARG A CA  1 
ATOM   2937  C  C   . ARG A 1 368 ? 18.441  -7.153  11.269  1.00 8.64  ? 368  ARG A C   1 
ATOM   2938  O  O   . ARG A 1 368 ? 18.502  -5.957  11.558  1.00 7.69  ? 368  ARG A O   1 
ATOM   2939  C  CB  . ARG A 1 368 ? 17.169  -7.801  9.226   1.00 8.63  ? 368  ARG A CB  1 
ATOM   2940  C  CG  . ARG A 1 368 ? 16.068  -8.698  8.553   1.00 10.25 ? 368  ARG A CG  1 
ATOM   2941  C  CD  . ARG A 1 368 ? 16.188  -10.159 9.003   1.00 9.09  ? 368  ARG A CD  1 
ATOM   2942  N  NE  . ARG A 1 368 ? 15.275  -11.056 8.322   1.00 7.33  ? 368  ARG A NE  1 
ATOM   2943  C  CZ  . ARG A 1 368 ? 14.007  -11.282 8.679   1.00 9.23  ? 368  ARG A CZ  1 
ATOM   2944  N  NH1 . ARG A 1 368 ? 13.461  -10.625 9.713   1.00 9.79  ? 368  ARG A NH1 1 
ATOM   2945  N  NH2 . ARG A 1 368 ? 13.266  -12.150 7.982   1.00 4.92  ? 368  ARG A NH2 1 
ATOM   2946  N  N   . ASP A 1 369 ? 19.489  -7.981  11.315  1.00 8.81  ? 369  ASP A N   1 
ATOM   2947  C  CA  . ASP A 1 369 ? 20.881  -7.519  11.448  1.00 8.93  ? 369  ASP A CA  1 
ATOM   2948  C  C   . ASP A 1 369 ? 21.193  -6.958  12.844  1.00 8.49  ? 369  ASP A C   1 
ATOM   2949  O  O   . ASP A 1 369 ? 20.709  -7.505  13.852  1.00 8.43  ? 369  ASP A O   1 
ATOM   2950  C  CB  . ASP A 1 369 ? 21.246  -6.517  10.327  1.00 9.17  ? 369  ASP A CB  1 
ATOM   2951  C  CG  . ASP A 1 369 ? 21.148  -7.118  8.900   1.00 10.62 ? 369  ASP A CG  1 
ATOM   2952  O  OD1 . ASP A 1 369 ? 21.584  -6.429  7.960   1.00 14.25 ? 369  ASP A OD1 1 
ATOM   2953  O  OD2 . ASP A 1 369 ? 20.671  -8.255  8.683   1.00 9.87  ? 369  ASP A OD2 1 
ATOM   2954  N  N   . GLY A 1 370 ? 21.979  -5.876  12.906  1.00 7.88  ? 370  GLY A N   1 
ATOM   2955  C  CA  . GLY A 1 370 ? 22.460  -5.325  14.186  1.00 7.50  ? 370  GLY A CA  1 
ATOM   2956  C  C   . GLY A 1 370 ? 23.575  -6.171  14.808  1.00 7.81  ? 370  GLY A C   1 
ATOM   2957  O  O   . GLY A 1 370 ? 23.637  -7.396  14.606  1.00 7.70  ? 370  GLY A O   1 
ATOM   2958  N  N   . ALA A 1 371 ? 24.459  -5.526  15.573  1.00 7.50  ? 371  ALA A N   1 
ATOM   2959  C  CA  . ALA A 1 371 ? 25.645  -6.180  16.121  1.00 7.15  ? 371  ALA A CA  1 
ATOM   2960  C  C   . ALA A 1 371 ? 25.292  -7.459  16.878  1.00 7.10  ? 371  ALA A C   1 
ATOM   2961  O  O   . ALA A 1 371 ? 24.297  -7.532  17.600  1.00 6.31  ? 371  ALA A O   1 
ATOM   2962  C  CB  . ALA A 1 371 ? 26.433  -5.228  17.019  1.00 6.98  ? 371  ALA A CB  1 
ATOM   2963  N  N   . MET A 1 372 ? 26.130  -8.469  16.681  1.00 7.69  ? 372  MET A N   1 
ATOM   2964  C  CA  . MET A 1 372 ? 26.024  -9.730  17.376  1.00 8.16  ? 372  MET A CA  1 
ATOM   2965  C  C   . MET A 1 372 ? 24.641  -10.344 17.161  1.00 8.45  ? 372  MET A C   1 
ATOM   2966  O  O   . MET A 1 372 ? 23.886  -10.519 18.115  1.00 8.40  ? 372  MET A O   1 
ATOM   2967  C  CB  . MET A 1 372 ? 26.378  -9.533  18.857  1.00 8.30  ? 372  MET A CB  1 
ATOM   2968  C  CG  . MET A 1 372 ? 27.861  -9.197  19.082  1.00 8.76  ? 372  MET A CG  1 
ATOM   2969  S  SD  . MET A 1 372 ? 28.943  -10.618 18.752  1.00 11.52 ? 372  MET A SD  1 
ATOM   2970  C  CE  . MET A 1 372 ? 28.229  -11.781 19.915  1.00 8.72  ? 372  MET A CE  1 
ATOM   2971  N  N   . PRO A 1 373 ? 24.314  -10.666 15.894  1.00 8.69  ? 373  PRO A N   1 
ATOM   2972  C  CA  . PRO A 1 373 ? 23.005  -11.129 15.461  1.00 9.66  ? 373  PRO A CA  1 
ATOM   2973  C  C   . PRO A 1 373 ? 22.730  -12.614 15.763  1.00 10.52 ? 373  PRO A C   1 
ATOM   2974  O  O   . PRO A 1 373 ? 22.353  -13.374 14.871  1.00 10.88 ? 373  PRO A O   1 
ATOM   2975  C  CB  . PRO A 1 373 ? 23.069  -10.895 13.950  1.00 9.15  ? 373  PRO A CB  1 
ATOM   2976  C  CG  . PRO A 1 373 ? 24.481  -11.158 13.614  1.00 7.11  ? 373  PRO A CG  1 
ATOM   2977  C  CD  . PRO A 1 373 ? 25.250  -10.593 14.750  1.00 9.00  ? 373  PRO A CD  1 
ATOM   2978  N  N   . PHE A 1 374 ? 22.873  -13.009 17.017  1.00 12.46 ? 374  PHE A N   1 
ATOM   2979  C  CA  . PHE A 1 374 ? 22.779  -14.428 17.387  1.00 14.37 ? 374  PHE A CA  1 
ATOM   2980  C  C   . PHE A 1 374 ? 21.503  -15.203 16.981  1.00 14.28 ? 374  PHE A C   1 
ATOM   2981  O  O   . PHE A 1 374 ? 21.599  -16.377 16.629  1.00 13.60 ? 374  PHE A O   1 
ATOM   2982  C  CB  . PHE A 1 374 ? 23.052  -14.612 18.871  1.00 15.67 ? 374  PHE A CB  1 
ATOM   2983  C  CG  . PHE A 1 374 ? 23.739  -15.903 19.185  1.00 19.29 ? 374  PHE A CG  1 
ATOM   2984  C  CD1 . PHE A 1 374 ? 25.093  -15.923 19.459  1.00 22.33 ? 374  PHE A CD1 1 
ATOM   2985  C  CD2 . PHE A 1 374 ? 23.029  -17.119 19.169  1.00 23.64 ? 374  PHE A CD2 1 
ATOM   2986  C  CE1 . PHE A 1 374 ? 25.731  -17.135 19.740  1.00 24.97 ? 374  PHE A CE1 1 
ATOM   2987  C  CE2 . PHE A 1 374 ? 23.653  -18.347 19.442  1.00 23.73 ? 374  PHE A CE2 1 
ATOM   2988  C  CZ  . PHE A 1 374 ? 25.000  -18.363 19.732  1.00 22.79 ? 374  PHE A CZ  1 
ATOM   2989  N  N   . LYS A 1 375 ? 20.335  -14.552 17.054  1.00 14.73 ? 375  LYS A N   1 
ATOM   2990  C  CA  . LYS A 1 375 ? 19.037  -15.150 16.686  1.00 15.01 ? 375  LYS A CA  1 
ATOM   2991  C  C   . LYS A 1 375 ? 18.436  -14.491 15.421  1.00 14.67 ? 375  LYS A C   1 
ATOM   2992  O  O   . LYS A 1 375 ? 17.204  -14.283 15.315  1.00 14.35 ? 375  LYS A O   1 
ATOM   2993  C  CB  . LYS A 1 375 ? 18.031  -15.076 17.865  1.00 15.24 ? 375  LYS A CB  1 
ATOM   2994  C  CG  . LYS A 1 375 ? 18.371  -15.938 19.107  1.00 17.62 ? 375  LYS A CG  1 
ATOM   2995  C  CD  . LYS A 1 375 ? 17.918  -17.398 18.988  1.00 22.58 ? 375  LYS A CD  1 
ATOM   2996  C  CE  . LYS A 1 375 ? 16.628  -17.703 19.776  1.00 24.40 ? 375  LYS A CE  1 
ATOM   2997  N  NZ  . LYS A 1 375 ? 15.370  -17.683 18.956  1.00 25.21 ? 375  LYS A NZ  1 
ATOM   2998  N  N   . GLN A 1 376 ? 19.310  -14.135 14.483  1.00 13.87 ? 376  GLN A N   1 
ATOM   2999  C  CA  . GLN A 1 376 ? 18.892  -13.635 13.170  1.00 13.20 ? 376  GLN A CA  1 
ATOM   3000  C  C   . GLN A 1 376 ? 17.816  -14.537 12.545  1.00 13.18 ? 376  GLN A C   1 
ATOM   3001  O  O   . GLN A 1 376 ? 18.011  -15.747 12.412  1.00 12.84 ? 376  GLN A O   1 
ATOM   3002  C  CB  . GLN A 1 376 ? 20.118  -13.552 12.243  1.00 12.98 ? 376  GLN A CB  1 
ATOM   3003  C  CG  . GLN A 1 376 ? 19.873  -12.935 10.853  1.00 10.79 ? 376  GLN A CG  1 
ATOM   3004  C  CD  . GLN A 1 376 ? 19.969  -11.427 10.878  1.00 7.78  ? 376  GLN A CD  1 
ATOM   3005  O  OE1 . GLN A 1 376 ? 19.388  -10.775 11.749  1.00 4.60  ? 376  GLN A OE1 1 
ATOM   3006  N  NE2 . GLN A 1 376 ? 20.717  -10.860 9.928   1.00 7.71  ? 376  GLN A NE2 1 
ATOM   3007  N  N   . GLN A 1 377 ? 16.679  -13.946 12.188  1.00 13.59 ? 377  GLN A N   1 
ATOM   3008  C  CA  . GLN A 1 377 ? 15.652  -14.643 11.402  1.00 14.39 ? 377  GLN A CA  1 
ATOM   3009  C  C   . GLN A 1 377 ? 16.176  -14.745 9.973   1.00 14.15 ? 377  GLN A C   1 
ATOM   3010  O  O   . GLN A 1 377 ? 16.613  -13.764 9.385   1.00 14.32 ? 377  GLN A O   1 
ATOM   3011  C  CB  . GLN A 1 377 ? 14.309  -13.897 11.470  1.00 14.52 ? 377  GLN A CB  1 
ATOM   3012  C  CG  . GLN A 1 377 ? 13.750  -13.745 12.920  1.00 15.94 ? 377  GLN A CG  1 
ATOM   3013  C  CD  . GLN A 1 377 ? 12.633  -12.705 13.040  1.00 16.39 ? 377  GLN A CD  1 
ATOM   3014  O  OE1 . GLN A 1 377 ? 11.440  -13.043 13.074  1.00 14.49 ? 377  GLN A OE1 1 
ATOM   3015  N  NE2 . GLN A 1 377 ? 13.023  -11.424 13.105  1.00 18.88 ? 377  GLN A NE2 1 
ATOM   3016  N  N   . THR A 1 378 ? 16.166  -15.946 9.421   1.00 14.89 ? 378  THR A N   1 
ATOM   3017  C  CA  . THR A 1 378 ? 16.869  -16.189 8.164   1.00 15.17 ? 378  THR A CA  1 
ATOM   3018  C  C   . THR A 1 378 ? 16.035  -16.078 6.879   1.00 15.01 ? 378  THR A C   1 
ATOM   3019  O  O   . THR A 1 378 ? 16.602  -16.075 5.782   1.00 15.26 ? 378  THR A O   1 
ATOM   3020  C  CB  . THR A 1 378 ? 17.631  -17.523 8.203   1.00 15.37 ? 378  THR A CB  1 
ATOM   3021  O  OG1 . THR A 1 378 ? 16.711  -18.584 8.502   1.00 15.91 ? 378  THR A OG1 1 
ATOM   3022  C  CG2 . THR A 1 378 ? 18.727  -17.469 9.272   1.00 14.99 ? 378  THR A CG2 1 
ATOM   3023  N  N   . SER A 1 379 ? 14.714  -15.998 6.991   1.00 14.99 ? 379  SER A N   1 
ATOM   3024  C  CA  . SER A 1 379 ? 13.895  -15.841 5.785   1.00 15.69 ? 379  SER A CA  1 
ATOM   3025  C  C   . SER A 1 379 ? 14.377  -14.616 5.032   1.00 15.76 ? 379  SER A C   1 
ATOM   3026  O  O   . SER A 1 379 ? 14.614  -13.565 5.640   1.00 15.85 ? 379  SER A O   1 
ATOM   3027  C  CB  . SER A 1 379 ? 12.402  -15.644 6.101   1.00 15.95 ? 379  SER A CB  1 
ATOM   3028  O  OG  . SER A 1 379 ? 11.689  -15.467 4.879   1.00 16.06 ? 379  SER A OG  1 
ATOM   3029  N  N   . SER A 1 380 ? 14.504  -14.748 3.714   1.00 15.78 ? 380  SER A N   1 
ATOM   3030  C  CA  . SER A 1 380 ? 14.946  -13.636 2.871   1.00 16.03 ? 380  SER A CA  1 
ATOM   3031  C  C   . SER A 1 380 ? 13.844  -12.576 2.745   1.00 15.17 ? 380  SER A C   1 
ATOM   3032  O  O   . SER A 1 380 ? 14.104  -11.438 2.408   1.00 15.14 ? 380  SER A O   1 
ATOM   3033  C  CB  . SER A 1 380 ? 15.440  -14.148 1.505   1.00 15.89 ? 380  SER A CB  1 
ATOM   3034  O  OG  . SER A 1 380 ? 14.384  -14.768 0.781   1.00 18.85 ? 380  SER A OG  1 
ATOM   3035  N  N   . VAL A 1 381 ? 12.614  -12.977 3.052   1.00 14.98 ? 381  VAL A N   1 
ATOM   3036  C  CA  . VAL A 1 381 ? 11.468  -12.078 3.105   1.00 14.07 ? 381  VAL A CA  1 
ATOM   3037  C  C   . VAL A 1 381 ? 11.508  -11.237 4.371   1.00 14.07 ? 381  VAL A C   1 
ATOM   3038  O  O   . VAL A 1 381 ? 10.918  -11.596 5.411   1.00 13.52 ? 381  VAL A O   1 
ATOM   3039  C  CB  . VAL A 1 381 ? 10.120  -12.842 3.011   1.00 14.14 ? 381  VAL A CB  1 
ATOM   3040  C  CG1 . VAL A 1 381 ? 8.943   -11.853 2.898   1.00 13.65 ? 381  VAL A CG1 1 
ATOM   3041  C  CG2 . VAL A 1 381 ? 10.135  -13.821 1.821   1.00 12.82 ? 381  VAL A CG2 1 
ATOM   3042  N  N   . ASN A 1 382 ? 12.190  -10.096 4.257   1.00 13.94 ? 382  ASN A N   1 
ATOM   3043  C  CA  . ASN A 1 382 ? 12.377  -9.170  5.377   1.00 13.92 ? 382  ASN A CA  1 
ATOM   3044  C  C   . ASN A 1 382 ? 11.544  -7.869  5.257   1.00 14.14 ? 382  ASN A C   1 
ATOM   3045  O  O   . ASN A 1 382 ? 11.872  -6.839  5.852   1.00 13.95 ? 382  ASN A O   1 
ATOM   3046  C  CB  . ASN A 1 382 ? 13.879  -8.890  5.592   1.00 13.51 ? 382  ASN A CB  1 
ATOM   3047  C  CG  . ASN A 1 382 ? 14.567  -8.263  4.360   1.00 14.46 ? 382  ASN A CG  1 
ATOM   3048  O  OD1 . ASN A 1 382 ? 13.914  -7.835  3.398   1.00 16.90 ? 382  ASN A OD1 1 
ATOM   3049  N  ND2 . ASN A 1 382 ? 15.895  -8.203  4.399   1.00 12.55 ? 382  ASN A ND2 1 
ATOM   3050  N  N   . TYR A 1 383 ? 10.453  -7.929  4.496   1.00 14.25 ? 383  TYR A N   1 
ATOM   3051  C  CA  . TYR A 1 383 ? 9.604   -6.749  4.284   1.00 14.40 ? 383  TYR A CA  1 
ATOM   3052  C  C   . TYR A 1 383 ? 8.149   -7.162  4.358   1.00 13.91 ? 383  TYR A C   1 
ATOM   3053  O  O   . TYR A 1 383 ? 7.813   -8.270  3.938   1.00 14.35 ? 383  TYR A O   1 
ATOM   3054  C  CB  . TYR A 1 383 ? 9.901   -6.095  2.919   1.00 14.81 ? 383  TYR A CB  1 
ATOM   3055  C  CG  . TYR A 1 383 ? 9.657   -7.024  1.764   1.00 14.88 ? 383  TYR A CG  1 
ATOM   3056  C  CD1 . TYR A 1 383 ? 8.426   -7.035  1.106   1.00 15.64 ? 383  TYR A CD1 1 
ATOM   3057  C  CD2 . TYR A 1 383 ? 10.641  -7.914  1.341   1.00 15.63 ? 383  TYR A CD2 1 
ATOM   3058  C  CE1 . TYR A 1 383 ? 8.177   -7.895  0.031   1.00 14.84 ? 383  TYR A CE1 1 
ATOM   3059  C  CE2 . TYR A 1 383 ? 10.396  -8.801  0.267   1.00 16.89 ? 383  TYR A CE2 1 
ATOM   3060  C  CZ  . TYR A 1 383 ? 9.153   -8.776  -0.379  1.00 15.64 ? 383  TYR A CZ  1 
ATOM   3061  O  OH  . TYR A 1 383 ? 8.892   -9.627  -1.432  1.00 15.24 ? 383  TYR A OH  1 
ATOM   3062  N  N   . GLU A 1 384 ? 7.304   -6.277  4.894   1.00 13.22 ? 384  GLU A N   1 
ATOM   3063  C  CA  . GLU A 1 384 ? 5.838   -6.455  4.934   1.00 12.83 ? 384  GLU A CA  1 
ATOM   3064  C  C   . GLU A 1 384 ? 5.142   -5.150  4.522   1.00 13.04 ? 384  GLU A C   1 
ATOM   3065  O  O   . GLU A 1 384 ? 5.590   -4.075  4.895   1.00 13.38 ? 384  GLU A O   1 
ATOM   3066  C  CB  . GLU A 1 384 ? 5.399   -6.830  6.344   1.00 13.18 ? 384  GLU A CB  1 
ATOM   3067  C  CG  . GLU A 1 384 ? 4.069   -7.552  6.454   1.00 12.15 ? 384  GLU A CG  1 
ATOM   3068  C  CD  . GLU A 1 384 ? 2.866   -6.636  6.500   1.00 10.99 ? 384  GLU A CD  1 
ATOM   3069  O  OE1 . GLU A 1 384 ? 1.766   -7.142  6.219   1.00 11.74 ? 384  GLU A OE1 1 
ATOM   3070  O  OE2 . GLU A 1 384 ? 2.995   -5.426  6.811   1.00 12.22 ? 384  GLU A OE2 1 
ATOM   3071  N  N   . PRO A 1 385 ? 4.061   -5.220  3.731   1.00 13.28 ? 385  PRO A N   1 
ATOM   3072  C  CA  . PRO A 1 385 ? 3.421   -6.383  3.105   1.00 13.63 ? 385  PRO A CA  1 
ATOM   3073  C  C   . PRO A 1 385 ? 4.316   -7.093  2.091   1.00 13.53 ? 385  PRO A C   1 
ATOM   3074  O  O   . PRO A 1 385 ? 5.260   -6.510  1.555   1.00 13.35 ? 385  PRO A O   1 
ATOM   3075  C  CB  . PRO A 1 385 ? 2.172   -5.788  2.428   1.00 12.87 ? 385  PRO A CB  1 
ATOM   3076  C  CG  . PRO A 1 385 ? 2.532   -4.388  2.163   1.00 13.60 ? 385  PRO A CG  1 
ATOM   3077  C  CD  . PRO A 1 385 ? 3.359   -3.974  3.374   1.00 13.61 ? 385  PRO A CD  1 
ATOM   3078  N  N   . ASN A 1 386 ? 4.020   -8.370  1.897   1.00 14.38 ? 386  ASN A N   1 
ATOM   3079  C  CA  . ASN A 1 386 ? 4.659   -9.214  0.895   1.00 15.14 ? 386  ASN A CA  1 
ATOM   3080  C  C   . ASN A 1 386 ? 3.592   -10.178 0.340   1.00 15.52 ? 386  ASN A C   1 
ATOM   3081  O  O   . ASN A 1 386 ? 2.440   -10.146 0.814   1.00 14.86 ? 386  ASN A O   1 
ATOM   3082  C  CB  . ASN A 1 386 ? 5.854   -9.963  1.505   1.00 15.03 ? 386  ASN A CB  1 
ATOM   3083  C  CG  . ASN A 1 386 ? 5.501   -10.697 2.768   1.00 14.96 ? 386  ASN A CG  1 
ATOM   3084  O  OD1 . ASN A 1 386 ? 4.762   -11.673 2.744   1.00 16.29 ? 386  ASN A OD1 1 
ATOM   3085  N  ND2 . ASN A 1 386 ? 6.027   -10.236 3.877   1.00 15.15 ? 386  ASN A ND2 1 
ATOM   3086  N  N   . ARG A 1 387 ? 3.976   -11.009 -0.637  1.00 16.22 ? 387  ARG A N   1 
ATOM   3087  C  CA  . ARG A 1 387 ? 3.059   -11.916 -1.346  1.00 17.54 ? 387  ARG A CA  1 
ATOM   3088  C  C   . ARG A 1 387 ? 2.857   -13.282 -0.687  1.00 18.96 ? 387  ARG A C   1 
ATOM   3089  O  O   . ARG A 1 387 ? 1.989   -14.065 -1.094  1.00 19.48 ? 387  ARG A O   1 
ATOM   3090  C  CB  . ARG A 1 387 ? 3.532   -12.143 -2.793  1.00 17.78 ? 387  ARG A CB  1 
ATOM   3091  C  CG  . ARG A 1 387 ? 4.874   -12.855 -2.932  1.00 16.31 ? 387  ARG A CG  1 
ATOM   3092  C  CD  . ARG A 1 387 ? 5.246   -13.081 -4.409  1.00 16.02 ? 387  ARG A CD  1 
ATOM   3093  N  NE  . ARG A 1 387 ? 5.598   -11.854 -5.131  1.00 14.30 ? 387  ARG A NE  1 
ATOM   3094  C  CZ  . ARG A 1 387 ? 6.842   -11.398 -5.338  1.00 13.14 ? 387  ARG A CZ  1 
ATOM   3095  N  NH1 . ARG A 1 387 ? 7.907   -12.051 -4.890  1.00 10.60 ? 387  ARG A NH1 1 
ATOM   3096  N  NH2 . ARG A 1 387 ? 7.029   -10.285 -6.027  1.00 13.22 ? 387  ARG A NH2 1 
ATOM   3097  N  N   . TYR A 1 388 ? 3.666   -13.579 0.316   1.00 20.16 ? 388  TYR A N   1 
ATOM   3098  C  CA  . TYR A 1 388 ? 3.737   -14.927 0.848   1.00 20.59 ? 388  TYR A CA  1 
ATOM   3099  C  C   . TYR A 1 388 ? 2.797   -15.071 2.037   1.00 21.41 ? 388  TYR A C   1 
ATOM   3100  O  O   . TYR A 1 388 ? 2.785   -14.247 2.954   1.00 21.78 ? 388  TYR A O   1 
ATOM   3101  C  CB  . TYR A 1 388 ? 5.184   -15.259 1.206   1.00 20.68 ? 388  TYR A CB  1 
ATOM   3102  C  CG  . TYR A 1 388 ? 6.171   -15.002 0.073   1.00 20.39 ? 388  TYR A CG  1 
ATOM   3103  C  CD1 . TYR A 1 388 ? 6.935   -13.821 0.027   1.00 20.87 ? 388  TYR A CD1 1 
ATOM   3104  C  CD2 . TYR A 1 388 ? 6.350   -15.937 -0.945  1.00 20.97 ? 388  TYR A CD2 1 
ATOM   3105  C  CE1 . TYR A 1 388 ? 7.858   -13.577 -1.011  1.00 18.50 ? 388  TYR A CE1 1 
ATOM   3106  C  CE2 . TYR A 1 388 ? 7.273   -15.710 -1.988  1.00 20.55 ? 388  TYR A CE2 1 
ATOM   3107  C  CZ  . TYR A 1 388 ? 8.011   -14.527 -2.003  1.00 20.45 ? 388  TYR A CZ  1 
ATOM   3108  O  OH  . TYR A 1 388 ? 8.888   -14.313 -3.020  1.00 21.35 ? 388  TYR A OH  1 
ATOM   3109  N  N   . GLN A 1 389 ? 1.983   -16.114 1.999   1.00 22.23 ? 389  GLN A N   1 
ATOM   3110  C  CA  . GLN A 1 389 ? 0.947   -16.319 3.004   1.00 23.15 ? 389  GLN A CA  1 
ATOM   3111  C  C   . GLN A 1 389 ? 1.509   -16.888 4.305   1.00 22.49 ? 389  GLN A C   1 
ATOM   3112  O  O   . GLN A 1 389 ? 0.907   -16.704 5.352   1.00 21.88 ? 389  GLN A O   1 
ATOM   3113  C  CB  . GLN A 1 389 ? -0.170  -17.240 2.469   1.00 23.57 ? 389  GLN A CB  1 
ATOM   3114  C  CG  . GLN A 1 389 ? -1.568  -16.642 2.629   1.00 27.07 ? 389  GLN A CG  1 
ATOM   3115  C  CD  . GLN A 1 389 ? -2.647  -17.697 2.867   1.00 31.62 ? 389  GLN A CD  1 
ATOM   3116  O  OE1 . GLN A 1 389 ? -3.031  -18.448 1.954   1.00 32.63 ? 389  GLN A OE1 1 
ATOM   3117  N  NE2 . GLN A 1 389 ? -3.147  -17.752 4.105   1.00 31.84 ? 389  GLN A NE2 1 
ATOM   3118  N  N   . ASP A 1 390 ? 2.650   -17.573 4.225   1.00 22.38 ? 390  ASP A N   1 
ATOM   3119  C  CA  . ASP A 1 390 ? 3.243   -18.218 5.390   1.00 22.93 ? 390  ASP A CA  1 
ATOM   3120  C  C   . ASP A 1 390 ? 4.255   -17.372 6.166   1.00 21.84 ? 390  ASP A C   1 
ATOM   3121  O  O   . ASP A 1 390 ? 4.818   -17.835 7.163   1.00 21.94 ? 390  ASP A O   1 
ATOM   3122  C  CB  . ASP A 1 390 ? 3.818   -19.601 5.045   1.00 23.47 ? 390  ASP A CB  1 
ATOM   3123  C  CG  . ASP A 1 390 ? 4.982   -19.538 4.055   1.00 28.87 ? 390  ASP A CG  1 
ATOM   3124  O  OD1 . ASP A 1 390 ? 5.005   -18.613 3.188   1.00 33.64 ? 390  ASP A OD1 1 
ATOM   3125  O  OD2 . ASP A 1 390 ? 5.876   -20.438 4.116   1.00 32.32 ? 390  ASP A OD2 1 
ATOM   3126  N  N   . GLU A 1 391 ? 4.465   -16.125 5.754   1.00 20.41 ? 391  GLU A N   1 
ATOM   3127  C  CA  . GLU A 1 391 ? 5.308   -15.221 6.563   1.00 19.00 ? 391  GLU A CA  1 
ATOM   3128  C  C   . GLU A 1 391 ? 4.454   -14.484 7.608   1.00 17.61 ? 391  GLU A C   1 
ATOM   3129  O  O   . GLU A 1 391 ? 3.215   -14.525 7.540   1.00 17.42 ? 391  GLU A O   1 
ATOM   3130  C  CB  . GLU A 1 391 ? 6.133   -14.262 5.687   1.00 18.79 ? 391  GLU A CB  1 
ATOM   3131  C  CG  . GLU A 1 391 ? 7.103   -14.962 4.703   1.00 19.89 ? 391  GLU A CG  1 
ATOM   3132  C  CD  . GLU A 1 391 ? 8.193   -15.839 5.358   1.00 21.16 ? 391  GLU A CD  1 
ATOM   3133  O  OE1 . GLU A 1 391 ? 8.435   -16.940 4.835   1.00 22.34 ? 391  GLU A OE1 1 
ATOM   3134  O  OE2 . GLU A 1 391 ? 8.827   -15.450 6.366   1.00 21.47 ? 391  GLU A OE2 1 
ATOM   3135  N  N   . PRO A 1 392 ? 5.101   -13.861 8.617   1.00 16.58 ? 392  PRO A N   1 
ATOM   3136  C  CA  . PRO A 1 392 ? 4.337   -13.171 9.676   1.00 15.27 ? 392  PRO A CA  1 
ATOM   3137  C  C   . PRO A 1 392 ? 3.355   -12.083 9.189   1.00 14.46 ? 392  PRO A C   1 
ATOM   3138  O  O   . PRO A 1 392 ? 3.722   -11.198 8.401   1.00 14.41 ? 392  PRO A O   1 
ATOM   3139  C  CB  . PRO A 1 392 ? 5.433   -12.552 10.547  1.00 15.38 ? 392  PRO A CB  1 
ATOM   3140  C  CG  . PRO A 1 392 ? 6.661   -13.353 10.280  1.00 14.94 ? 392  PRO A CG  1 
ATOM   3141  C  CD  . PRO A 1 392 ? 6.561   -13.803 8.859   1.00 16.26 ? 392  PRO A CD  1 
ATOM   3142  N  N   . LYS A 1 393 ? 2.119   -12.151 9.672   1.00 13.08 ? 393  LYS A N   1 
ATOM   3143  C  CA  . LYS A 1 393 ? 1.102   -11.158 9.350   1.00 12.53 ? 393  LYS A CA  1 
ATOM   3144  C  C   . LYS A 1 393 ? 0.533   -10.511 10.608  1.00 12.38 ? 393  LYS A C   1 
ATOM   3145  O  O   . LYS A 1 393 ? 0.466   -11.139 11.665  1.00 11.18 ? 393  LYS A O   1 
ATOM   3146  C  CB  . LYS A 1 393 ? -0.053  -11.776 8.519   1.00 12.15 ? 393  LYS A CB  1 
ATOM   3147  C  CG  . LYS A 1 393 ? 0.380   -12.554 7.234   1.00 12.67 ? 393  LYS A CG  1 
ATOM   3148  C  CD  . LYS A 1 393 ? 0.983   -11.636 6.145   1.00 11.84 ? 393  LYS A CD  1 
ATOM   3149  C  CE  . LYS A 1 393 ? 1.965   -12.420 5.299   1.00 12.36 ? 393  LYS A CE  1 
ATOM   3150  N  NZ  . LYS A 1 393 ? 2.145   -11.778 3.955   1.00 12.96 ? 393  LYS A NZ  1 
ATOM   3151  N  N   . GLN A 1 394 ? 0.107   -9.256  10.473  1.00 12.60 ? 394  GLN A N   1 
ATOM   3152  C  CA  . GLN A 1 394 ? -0.619  -8.558  11.534  1.00 13.53 ? 394  GLN A CA  1 
ATOM   3153  C  C   . GLN A 1 394 ? -1.938  -9.266  11.877  1.00 13.34 ? 394  GLN A C   1 
ATOM   3154  O  O   . GLN A 1 394 ? -2.568  -9.834  11.014  1.00 12.86 ? 394  GLN A O   1 
ATOM   3155  C  CB  . GLN A 1 394 ? -0.898  -7.097  11.149  1.00 13.10 ? 394  GLN A CB  1 
ATOM   3156  C  CG  . GLN A 1 394 ? -1.826  -6.902  9.944   1.00 13.89 ? 394  GLN A CG  1 
ATOM   3157  C  CD  . GLN A 1 394 ? -1.956  -5.438  9.545   1.00 15.79 ? 394  GLN A CD  1 
ATOM   3158  O  OE1 . GLN A 1 394 ? -1.015  -4.647  9.701   1.00 16.85 ? 394  GLN A OE1 1 
ATOM   3159  N  NE2 . GLN A 1 394 ? -3.127  -5.066  9.029   1.00 17.01 ? 394  GLN A NE2 1 
ATOM   3160  N  N   . THR A 1 395 ? -2.324  -9.207  13.153  1.00 13.82 ? 395  THR A N   1 
ATOM   3161  C  CA  . THR A 1 395 ? -3.547  -9.783  13.666  1.00 13.71 ? 395  THR A CA  1 
ATOM   3162  C  C   . THR A 1 395 ? -4.392  -8.615  14.189  1.00 14.61 ? 395  THR A C   1 
ATOM   3163  O  O   . THR A 1 395 ? -4.253  -8.217  15.330  1.00 14.85 ? 395  THR A O   1 
ATOM   3164  C  CB  . THR A 1 395 ? -3.223  -10.809 14.763  1.00 13.62 ? 395  THR A CB  1 
ATOM   3165  O  OG1 . THR A 1 395 ? -2.097  -11.574 14.342  1.00 12.23 ? 395  THR A OG1 1 
ATOM   3166  C  CG2 . THR A 1 395 ? -4.407  -11.775 15.042  1.00 11.58 ? 395  THR A CG2 1 
ATOM   3167  N  N   . PRO A 1 396 ? -5.254  -8.037  13.323  1.00 15.89 ? 396  PRO A N   1 
ATOM   3168  C  CA  . PRO A 1 396 ? -6.019  -6.799  13.599  1.00 16.19 ? 396  PRO A CA  1 
ATOM   3169  C  C   . PRO A 1 396 ? -6.695  -6.720  14.961  1.00 17.04 ? 396  PRO A C   1 
ATOM   3170  O  O   . PRO A 1 396 ? -6.788  -5.624  15.531  1.00 17.50 ? 396  PRO A O   1 
ATOM   3171  C  CB  . PRO A 1 396 ? -7.055  -6.780  12.479  1.00 16.16 ? 396  PRO A CB  1 
ATOM   3172  C  CG  . PRO A 1 396 ? -6.341  -7.410  11.341  1.00 16.08 ? 396  PRO A CG  1 
ATOM   3173  C  CD  . PRO A 1 396 ? -5.527  -8.538  11.957  1.00 15.20 ? 396  PRO A CD  1 
ATOM   3174  N  N   . GLU A 1 397 ? -7.137  -7.859  15.497  1.00 17.91 ? 397  GLU A N   1 
ATOM   3175  C  CA  . GLU A 1 397 ? -7.773  -7.898  16.824  1.00 18.88 ? 397  GLU A CA  1 
ATOM   3176  C  C   . GLU A 1 397 ? -6.782  -7.508  17.915  1.00 17.73 ? 397  GLU A C   1 
ATOM   3177  O  O   . GLU A 1 397 ? -7.147  -7.282  19.067  1.00 17.59 ? 397  GLU A O   1 
ATOM   3178  C  CB  . GLU A 1 397 ? -8.388  -9.279  17.102  1.00 18.83 ? 397  GLU A CB  1 
ATOM   3179  C  CG  . GLU A 1 397 ? -7.432  -10.323 17.708  1.00 22.01 ? 397  GLU A CG  1 
ATOM   3180  C  CD  . GLU A 1 397 ? -7.886  -11.760 17.489  1.00 22.80 ? 397  GLU A CD  1 
ATOM   3181  O  OE1 . GLU A 1 397 ? -7.232  -12.696 18.016  1.00 26.80 ? 397  GLU A OE1 1 
ATOM   3182  O  OE2 . GLU A 1 397 ? -8.896  -11.959 16.779  1.00 28.71 ? 397  GLU A OE2 1 
ATOM   3183  N  N   . TYR A 1 398 ? -5.516  -7.414  17.550  1.00 17.39 ? 398  TYR A N   1 
ATOM   3184  C  CA  . TYR A 1 398 ? -4.497  -7.056  18.541  1.00 17.12 ? 398  TYR A CA  1 
ATOM   3185  C  C   . TYR A 1 398 ? -4.112  -5.570  18.545  1.00 16.87 ? 398  TYR A C   1 
ATOM   3186  O  O   . TYR A 1 398 ? -3.321  -5.148  19.380  1.00 17.14 ? 398  TYR A O   1 
ATOM   3187  C  CB  . TYR A 1 398 ? -3.277  -7.960  18.386  1.00 16.53 ? 398  TYR A CB  1 
ATOM   3188  C  CG  . TYR A 1 398 ? -3.449  -9.280  19.093  1.00 16.01 ? 398  TYR A CG  1 
ATOM   3189  C  CD1 . TYR A 1 398 ? -3.778  -10.444 18.383  1.00 14.33 ? 398  TYR A CD1 1 
ATOM   3190  C  CD2 . TYR A 1 398 ? -3.313  -9.364  20.488  1.00 15.02 ? 398  TYR A CD2 1 
ATOM   3191  C  CE1 . TYR A 1 398 ? -3.942  -11.674 19.049  1.00 12.71 ? 398  TYR A CE1 1 
ATOM   3192  C  CE2 . TYR A 1 398 ? -3.477  -10.565 21.158  1.00 14.00 ? 398  TYR A CE2 1 
ATOM   3193  C  CZ  . TYR A 1 398 ? -3.783  -11.718 20.433  1.00 15.52 ? 398  TYR A CZ  1 
ATOM   3194  O  OH  . TYR A 1 398 ? -3.951  -12.893 21.117  1.00 16.06 ? 398  TYR A OH  1 
ATOM   3195  N  N   . THR A 1 399 ? -4.680  -4.790  17.619  1.00 16.29 ? 399  THR A N   1 
ATOM   3196  C  CA  . THR A 1 399 ? -4.453  -3.354  17.554  1.00 16.36 ? 399  THR A CA  1 
ATOM   3197  C  C   . THR A 1 399 ? -4.868  -2.708  18.864  1.00 16.34 ? 399  THR A C   1 
ATOM   3198  O  O   . THR A 1 399 ? -5.900  -3.058  19.437  1.00 15.11 ? 399  THR A O   1 
ATOM   3199  C  CB  . THR A 1 399 ? -5.226  -2.714  16.372  1.00 16.64 ? 399  THR A CB  1 
ATOM   3200  O  OG1 . THR A 1 399 ? -4.913  -3.420  15.172  1.00 18.09 ? 399  THR A OG1 1 
ATOM   3201  C  CG2 . THR A 1 399 ? -4.858  -1.276  16.167  1.00 15.86 ? 399  THR A CG2 1 
ATOM   3202  N  N   . GLU A 1 400 ? -4.025  -1.792  19.336  1.00 17.31 ? 400  GLU A N   1 
ATOM   3203  C  CA  . GLU A 1 400 ? -4.272  -1.024  20.568  1.00 18.42 ? 400  GLU A CA  1 
ATOM   3204  C  C   . GLU A 1 400 ? -5.415  -0.066  20.298  1.00 19.01 ? 400  GLU A C   1 
ATOM   3205  O  O   . GLU A 1 400 ? -5.350  0.725   19.356  1.00 19.26 ? 400  GLU A O   1 
ATOM   3206  C  CB  . GLU A 1 400 ? -3.024  -0.230  20.997  1.00 18.20 ? 400  GLU A CB  1 
ATOM   3207  C  CG  . GLU A 1 400 ? -1.709  -1.035  21.106  1.00 18.26 ? 400  GLU A CG  1 
ATOM   3208  C  CD  . GLU A 1 400 ? -0.817  -0.905  19.860  1.00 19.54 ? 400  GLU A CD  1 
ATOM   3209  O  OE1 . GLU A 1 400 ? -1.323  -1.087  18.727  1.00 17.55 ? 400  GLU A OE1 1 
ATOM   3210  O  OE2 . GLU A 1 400 ? 0.403   -0.639  20.016  1.00 19.67 ? 400  GLU A OE2 1 
ATOM   3211  N  N   . ASP A 1 401 ? -6.470  -0.133  21.107  1.00 20.03 ? 401  ASP A N   1 
ATOM   3212  C  CA  . ASP A 1 401 ? -7.616  0.734   20.854  1.00 20.92 ? 401  ASP A CA  1 
ATOM   3213  C  C   . ASP A 1 401 ? -7.291  2.207   21.018  1.00 19.91 ? 401  ASP A C   1 
ATOM   3214  O  O   . ASP A 1 401 ? -6.318  2.585   21.702  1.00 19.72 ? 401  ASP A O   1 
ATOM   3215  C  CB  . ASP A 1 401 ? -8.850  0.334   21.656  1.00 21.91 ? 401  ASP A CB  1 
ATOM   3216  C  CG  . ASP A 1 401 ? -8.501  -0.225  22.995  1.00 26.30 ? 401  ASP A CG  1 
ATOM   3217  O  OD1 . ASP A 1 401 ? -8.788  -1.440  23.214  1.00 29.78 ? 401  ASP A OD1 1 
ATOM   3218  O  OD2 . ASP A 1 401 ? -7.938  0.549   23.814  1.00 29.75 ? 401  ASP A OD2 1 
ATOM   3219  N  N   . THR A 1 402 ? -8.072  3.022   20.305  1.00 18.71 ? 402  THR A N   1 
ATOM   3220  C  CA  . THR A 1 402 ? -8.026  4.473   20.438  1.00 16.87 ? 402  THR A CA  1 
ATOM   3221  C  C   . THR A 1 402 ? -8.249  4.870   21.908  1.00 16.28 ? 402  THR A C   1 
ATOM   3222  O  O   . THR A 1 402 ? -8.943  4.188   22.647  1.00 15.74 ? 402  THR A O   1 
ATOM   3223  C  CB  . THR A 1 402 ? -9.088  5.157   19.540  1.00 16.49 ? 402  THR A CB  1 
ATOM   3224  O  OG1 . THR A 1 402 ? -10.395 4.787   19.990  1.00 15.32 ? 402  THR A OG1 1 
ATOM   3225  C  CG2 . THR A 1 402 ? -8.944  4.747   18.105  1.00 15.48 ? 402  THR A CG2 1 
ATOM   3226  N  N   . GLN A 1 403 ? -7.644  5.973   22.324  1.00 16.27 ? 403  GLN A N   1 
ATOM   3227  C  CA  . GLN A 1 403 ? -7.895  6.534   23.647  1.00 16.19 ? 403  GLN A CA  1 
ATOM   3228  C  C   . GLN A 1 403 ? -8.338  7.996   23.467  1.00 16.51 ? 403  GLN A C   1 
ATOM   3229  O  O   . GLN A 1 403 ? -8.110  8.557   22.401  1.00 16.43 ? 403  GLN A O   1 
ATOM   3230  C  CB  . GLN A 1 403 ? -6.629  6.427   24.493  1.00 16.24 ? 403  GLN A CB  1 
ATOM   3231  C  CG  . GLN A 1 403 ? -6.366  5.041   25.087  1.00 14.33 ? 403  GLN A CG  1 
ATOM   3232  C  CD  . GLN A 1 403 ? -7.473  4.594   26.026  1.00 15.22 ? 403  GLN A CD  1 
ATOM   3233  O  OE1 . GLN A 1 403 ? -7.825  5.299   27.000  1.00 14.33 ? 403  GLN A OE1 1 
ATOM   3234  N  NE2 . GLN A 1 403 ? -8.059  3.426   25.726  1.00 13.35 ? 403  GLN A NE2 1 
ATOM   3235  N  N   . PRO A 1 404 ? -8.978  8.609   24.484  1.00 16.52 ? 404  PRO A N   1 
ATOM   3236  C  CA  . PRO A 1 404 ? -9.488  9.974   24.284  1.00 16.81 ? 404  PRO A CA  1 
ATOM   3237  C  C   . PRO A 1 404 ? -8.435  11.059  24.346  1.00 17.02 ? 404  PRO A C   1 
ATOM   3238  O  O   . PRO A 1 404 ? -7.421  10.907  25.016  1.00 16.93 ? 404  PRO A O   1 
ATOM   3239  C  CB  . PRO A 1 404 ? -10.473 10.179  25.450  1.00 16.45 ? 404  PRO A CB  1 
ATOM   3240  C  CG  . PRO A 1 404 ? -10.479 8.902   26.245  1.00 16.58 ? 404  PRO A CG  1 
ATOM   3241  C  CD  . PRO A 1 404 ? -9.284  8.101   25.835  1.00 17.04 ? 404  PRO A CD  1 
ATOM   3242  N  N   . LEU A 1 405 ? -8.696  12.152  23.634  1.00 17.88 ? 405  LEU A N   1 
ATOM   3243  C  CA  . LEU A 1 405 ? -7.943  13.401  23.776  1.00 18.35 ? 405  LEU A CA  1 
ATOM   3244  C  C   . LEU A 1 405 ? -8.896  14.461  24.270  1.00 18.94 ? 405  LEU A C   1 
ATOM   3245  O  O   . LEU A 1 405 ? -10.023 14.560  23.758  1.00 19.67 ? 405  LEU A O   1 
ATOM   3246  C  CB  . LEU A 1 405 ? -7.403  13.859  22.437  1.00 18.20 ? 405  LEU A CB  1 
ATOM   3247  C  CG  . LEU A 1 405 ? -6.191  13.179  21.849  1.00 18.31 ? 405  LEU A CG  1 
ATOM   3248  C  CD1 . LEU A 1 405 ? -5.821  13.946  20.597  1.00 17.25 ? 405  LEU A CD1 1 
ATOM   3249  C  CD2 . LEU A 1 405 ? -5.062  13.178  22.882  1.00 15.71 ? 405  LEU A CD2 1 
ATOM   3250  N  N   . HIS A 1 406 ? -8.436  15.271  25.216  1.00 18.88 ? 406  HIS A N   1 
ATOM   3251  C  CA  . HIS A 1 406 ? -9.293  16.228  25.907  1.00 19.62 ? 406  HIS A CA  1 
ATOM   3252  C  C   . HIS A 1 406 ? -8.864  17.703  25.762  1.00 19.50 ? 406  HIS A C   1 
ATOM   3253  O  O   . HIS A 1 406 ? -9.299  18.545  26.528  1.00 20.20 ? 406  HIS A O   1 
ATOM   3254  C  CB  . HIS A 1 406 ? -9.370  15.865  27.397  1.00 19.21 ? 406  HIS A CB  1 
ATOM   3255  C  CG  . HIS A 1 406 ? -9.853  14.469  27.658  1.00 21.69 ? 406  HIS A CG  1 
ATOM   3256  N  ND1 . HIS A 1 406 ? -11.148 14.062  27.388  1.00 22.10 ? 406  HIS A ND1 1 
ATOM   3257  C  CD2 . HIS A 1 406 ? -9.219  13.387  28.181  1.00 20.79 ? 406  HIS A CD2 1 
ATOM   3258  C  CE1 . HIS A 1 406 ? -11.292 12.794  27.741  1.00 21.69 ? 406  HIS A CE1 1 
ATOM   3259  N  NE2 . HIS A 1 406 ? -10.135 12.359  28.215  1.00 22.06 ? 406  HIS A NE2 1 
ATOM   3260  N  N   . ASP A 1 407 ? -8.002  18.014  24.807  1.00 19.39 ? 407  ASP A N   1 
ATOM   3261  C  CA  . ASP A 1 407 ? -7.516  19.381  24.644  1.00 19.07 ? 407  ASP A CA  1 
ATOM   3262  C  C   . ASP A 1 407 ? -7.488  19.765  23.169  1.00 18.80 ? 407  ASP A C   1 
ATOM   3263  O  O   . ASP A 1 407 ? -7.405  18.883  22.283  1.00 18.25 ? 407  ASP A O   1 
ATOM   3264  C  CB  . ASP A 1 407 ? -6.123  19.536  25.273  1.00 19.24 ? 407  ASP A CB  1 
ATOM   3265  C  CG  . ASP A 1 407 ? -5.883  20.927  25.883  1.00 18.97 ? 407  ASP A CG  1 
ATOM   3266  O  OD1 . ASP A 1 407 ? -6.513  21.910  25.416  1.00 21.22 ? 407  ASP A OD1 1 
ATOM   3267  O  OD2 . ASP A 1 407 ? -5.047  21.040  26.822  1.00 15.45 ? 407  ASP A OD2 1 
ATOM   3268  N  N   . ASP A 1 408 ? -7.578  21.078  22.924  1.00 18.42 ? 408  ASP A N   1 
ATOM   3269  C  CA  . ASP A 1 408 ? -7.540  21.645  21.578  1.00 18.31 ? 408  ASP A CA  1 
ATOM   3270  C  C   . ASP A 1 408 ? -6.150  22.129  21.153  1.00 18.06 ? 408  ASP A C   1 
ATOM   3271  O  O   . ASP A 1 408 ? -5.946  22.550  19.996  1.00 18.27 ? 408  ASP A O   1 
ATOM   3272  C  CB  . ASP A 1 408 ? -8.584  22.742  21.412  1.00 18.80 ? 408  ASP A CB  1 
ATOM   3273  C  CG  . ASP A 1 408 ? -8.382  23.914  22.359  1.00 21.81 ? 408  ASP A CG  1 
ATOM   3274  O  OD1 . ASP A 1 408 ? -7.624  23.805  23.355  1.00 24.61 ? 408  ASP A OD1 1 
ATOM   3275  O  OD2 . ASP A 1 408 ? -8.995  24.978  22.103  1.00 25.41 ? 408  ASP A OD2 1 
ATOM   3276  N  N   . ILE A 1 409 ? -5.179  22.047  22.064  1.00 16.78 ? 409  ILE A N   1 
ATOM   3277  C  CA  . ILE A 1 409 ? -3.817  22.460  21.729  1.00 15.44 ? 409  ILE A CA  1 
ATOM   3278  C  C   . ILE A 1 409 ? -2.798  21.416  22.157  1.00 15.24 ? 409  ILE A C   1 
ATOM   3279  O  O   . ILE A 1 409 ? -3.027  20.652  23.091  1.00 14.55 ? 409  ILE A O   1 
ATOM   3280  C  CB  . ILE A 1 409 ? -3.444  23.854  22.353  1.00 15.72 ? 409  ILE A CB  1 
ATOM   3281  C  CG1 . ILE A 1 409 ? -3.745  23.867  23.866  1.00 15.01 ? 409  ILE A CG1 1 
ATOM   3282  C  CG2 . ILE A 1 409 ? -4.109  25.019  21.551  1.00 14.79 ? 409  ILE A CG2 1 
ATOM   3283  C  CD1 . ILE A 1 409 ? -3.347  25.118  24.618  1.00 14.55 ? 409  ILE A CD1 1 
ATOM   3284  N  N   . HIS A 1 410 ? -1.671  21.368  21.451  1.00 14.96 ? 410  HIS A N   1 
ATOM   3285  C  CA  . HIS A 1 410 ? -0.517  20.624  21.969  1.00 14.31 ? 410  HIS A CA  1 
ATOM   3286  C  C   . HIS A 1 410 ? 0.625   21.587  22.195  1.00 13.86 ? 410  HIS A C   1 
ATOM   3287  O  O   . HIS A 1 410 ? 0.747   22.578  21.466  1.00 13.71 ? 410  HIS A O   1 
ATOM   3288  C  CB  . HIS A 1 410 ? -0.140  19.412  21.107  1.00 13.65 ? 410  HIS A CB  1 
ATOM   3289  C  CG  . HIS A 1 410 ? 0.516   19.745  19.802  1.00 13.37 ? 410  HIS A CG  1 
ATOM   3290  N  ND1 . HIS A 1 410 ? 1.814   20.198  19.712  1.00 13.93 ? 410  HIS A ND1 1 
ATOM   3291  C  CD2 . HIS A 1 410 ? 0.075   19.624  18.530  1.00 13.18 ? 410  HIS A CD2 1 
ATOM   3292  C  CE1 . HIS A 1 410 ? 2.135   20.366  18.441  1.00 13.87 ? 410  HIS A CE1 1 
ATOM   3293  N  NE2 . HIS A 1 410 ? 1.097   20.021  17.704  1.00 12.87 ? 410  HIS A NE2 1 
ATOM   3294  N  N   . GLY A 1 411 ? 1.404   21.314  23.245  1.00 13.27 ? 411  GLY A N   1 
ATOM   3295  C  CA  . GLY A 1 411 ? 2.551   22.138  23.632  1.00 13.24 ? 411  GLY A CA  1 
ATOM   3296  C  C   . GLY A 1 411 ? 3.053   21.830  25.038  1.00 13.31 ? 411  GLY A C   1 
ATOM   3297  O  O   . GLY A 1 411 ? 2.627   20.831  25.663  1.00 12.91 ? 411  GLY A O   1 
ATOM   3298  N  N   . ARG A 1 412 ? 3.953   22.690  25.532  1.00 13.10 ? 412  ARG A N   1 
ATOM   3299  C  CA  . ARG A 1 412 ? 4.538   22.558  26.878  1.00 12.84 ? 412  ARG A CA  1 
ATOM   3300  C  C   . ARG A 1 412 ? 3.611   23.209  27.890  1.00 13.47 ? 412  ARG A C   1 
ATOM   3301  O  O   . ARG A 1 412 ? 3.642   24.436  28.089  1.00 13.00 ? 412  ARG A O   1 
ATOM   3302  C  CB  . ARG A 1 412 ? 5.947   23.178  26.953  1.00 12.84 ? 412  ARG A CB  1 
ATOM   3303  C  CG  . ARG A 1 412 ? 6.896   22.642  25.902  1.00 11.92 ? 412  ARG A CG  1 
ATOM   3304  C  CD  . ARG A 1 412 ? 8.363   23.025  26.115  1.00 11.67 ? 412  ARG A CD  1 
ATOM   3305  N  NE  . ARG A 1 412 ? 9.135   22.527  24.995  1.00 10.07 ? 412  ARG A NE  1 
ATOM   3306  C  CZ  . ARG A 1 412 ? 9.565   21.277  24.860  1.00 11.82 ? 412  ARG A CZ  1 
ATOM   3307  N  NH1 . ARG A 1 412 ? 9.349   20.379  25.810  1.00 12.47 ? 412  ARG A NH1 1 
ATOM   3308  N  NH2 . ARG A 1 412 ? 10.228  20.924  23.765  1.00 12.31 ? 412  ARG A NH2 1 
ATOM   3309  N  N   . LEU A 1 413 ? 2.791   22.373  28.531  1.00 13.94 ? 413  LEU A N   1 
ATOM   3310  C  CA  . LEU A 1 413 ? 1.643   22.832  29.312  1.00 14.28 ? 413  LEU A CA  1 
ATOM   3311  C  C   . LEU A 1 413 ? 1.566   22.093  30.634  1.00 15.11 ? 413  LEU A C   1 
ATOM   3312  O  O   . LEU A 1 413 ? 1.105   20.952  30.684  1.00 15.68 ? 413  LEU A O   1 
ATOM   3313  C  CB  . LEU A 1 413 ? 0.337   22.622  28.520  1.00 13.83 ? 413  LEU A CB  1 
ATOM   3314  C  CG  . LEU A 1 413 ? 0.240   23.225  27.096  1.00 14.36 ? 413  LEU A CG  1 
ATOM   3315  C  CD1 . LEU A 1 413 ? -0.725  22.437  26.165  1.00 13.24 ? 413  LEU A CD1 1 
ATOM   3316  C  CD2 . LEU A 1 413 ? -0.113  24.728  27.134  1.00 13.69 ? 413  LEU A CD2 1 
ATOM   3317  N  N   . GLU A 1 414 ? 1.991   22.758  31.704  1.00 16.02 ? 414  GLU A N   1 
ATOM   3318  C  CA  . GLU A 1 414 ? 1.973   22.189  33.044  1.00 17.11 ? 414  GLU A CA  1 
ATOM   3319  C  C   . GLU A 1 414 ? 0.557   21.932  33.542  1.00 17.64 ? 414  GLU A C   1 
ATOM   3320  O  O   . GLU A 1 414 ? -0.338  22.779  33.364  1.00 19.03 ? 414  GLU A O   1 
ATOM   3321  C  CB  . GLU A 1 414 ? 2.680   23.129  34.013  1.00 17.03 ? 414  GLU A CB  1 
ATOM   3322  C  CG  . GLU A 1 414 ? 3.046   22.469  35.337  1.00 18.99 ? 414  GLU A CG  1 
ATOM   3323  C  CD  . GLU A 1 414 ? 3.449   23.466  36.380  1.00 21.55 ? 414  GLU A CD  1 
ATOM   3324  O  OE1 . GLU A 1 414 ? 3.102   24.656  36.222  1.00 23.91 ? 414  GLU A OE1 1 
ATOM   3325  O  OE2 . GLU A 1 414 ? 4.099   23.066  37.364  1.00 22.06 ? 414  GLU A OE2 1 
ATOM   3326  N  N   . ILE A 1 415 ? 0.357   20.788  34.189  1.00 17.76 ? 415  ILE A N   1 
ATOM   3327  C  CA  . ILE A 1 415 ? -0.951  20.444  34.761  1.00 18.05 ? 415  ILE A CA  1 
ATOM   3328  C  C   . ILE A 1 415 ? -1.474  21.529  35.722  1.00 19.44 ? 415  ILE A C   1 
ATOM   3329  O  O   . ILE A 1 415 ? -0.696  22.240  36.336  1.00 18.97 ? 415  ILE A O   1 
ATOM   3330  C  CB  . ILE A 1 415 ? -0.986  18.995  35.405  1.00 17.47 ? 415  ILE A CB  1 
ATOM   3331  C  CG1 . ILE A 1 415 ? -0.034  18.867  36.594  1.00 16.25 ? 415  ILE A CG1 1 
ATOM   3332  C  CG2 . ILE A 1 415 ? -0.669  17.928  34.350  1.00 16.55 ? 415  ILE A CG2 1 
ATOM   3333  C  CD1 . ILE A 1 415 ? -0.255  17.591  37.419  1.00 16.12 ? 415  ILE A CD1 1 
ATOM   3334  N  N   . GLU A 1 416 ? -2.796  21.631  35.838  1.00 21.26 ? 416  GLU A N   1 
ATOM   3335  C  CA  . GLU A 1 416 ? -3.450  22.700  36.613  1.00 22.75 ? 416  GLU A CA  1 
ATOM   3336  C  C   . GLU A 1 416 ? -3.386  22.515  38.131  1.00 22.20 ? 416  GLU A C   1 
ATOM   3337  O  O   . GLU A 1 416 ? -2.955  23.424  38.836  1.00 22.87 ? 416  GLU A O   1 
ATOM   3338  C  CB  . GLU A 1 416 ? -4.914  22.865  36.178  1.00 23.28 ? 416  GLU A CB  1 
ATOM   3339  C  CG  . GLU A 1 416 ? -5.097  23.488  34.801  1.00 27.19 ? 416  GLU A CG  1 
ATOM   3340  C  CD  . GLU A 1 416 ? -5.625  24.911  34.875  1.00 31.77 ? 416  GLU A CD  1 
ATOM   3341  O  OE1 . GLU A 1 416 ? -5.023  25.806  34.243  1.00 32.68 ? 416  GLU A OE1 1 
ATOM   3342  O  OE2 . GLU A 1 416 ? -6.647  25.129  35.575  1.00 34.49 ? 416  GLU A OE2 1 
ATOM   3343  N  N   . LYS A 1 417 ? -3.822  21.370  38.655  1.00 21.73 ? 417  LYS A N   1 
ATOM   3344  C  CA  . LYS A 1 417 ? -3.790  21.233  40.117  1.00 20.72 ? 417  LYS A CA  1 
ATOM   3345  C  C   . LYS A 1 417 ? -2.595  20.452  40.637  1.00 20.43 ? 417  LYS A C   1 
ATOM   3346  O  O   . LYS A 1 417 ? -2.598  19.209  40.734  1.00 20.50 ? 417  LYS A O   1 
ATOM   3347  C  CB  . LYS A 1 417 ? -5.121  20.811  40.766  1.00 20.75 ? 417  LYS A CB  1 
ATOM   3348  C  CG  . LYS A 1 417 ? -5.954  19.797  40.063  1.00 20.22 ? 417  LYS A CG  1 
ATOM   3349  C  CD  . LYS A 1 417 ? -7.128  19.428  40.981  1.00 20.93 ? 417  LYS A CD  1 
ATOM   3350  C  CE  . LYS A 1 417 ? -8.310  18.870  40.179  1.00 21.29 ? 417  LYS A CE  1 
ATOM   3351  N  NZ  . LYS A 1 417 ? -9.439  18.380  41.028  1.00 20.03 ? 417  LYS A NZ  1 
ATOM   3352  N  N   . THR A 1 418 ? -1.572  21.227  40.979  1.00 19.36 ? 418  THR A N   1 
ATOM   3353  C  CA  . THR A 1 418 ? -0.285  20.696  41.384  1.00 18.13 ? 418  THR A CA  1 
ATOM   3354  C  C   . THR A 1 418 ? -0.321  20.196  42.796  1.00 17.34 ? 418  THR A C   1 
ATOM   3355  O  O   . THR A 1 418 ? 0.232   19.156  43.084  1.00 17.32 ? 418  THR A O   1 
ATOM   3356  C  CB  . THR A 1 418 ? 0.802   21.752  41.224  1.00 18.56 ? 418  THR A CB  1 
ATOM   3357  O  OG1 . THR A 1 418 ? 0.377   22.960  41.890  1.00 17.10 ? 418  THR A OG1 1 
ATOM   3358  C  CG2 . THR A 1 418 ? 1.037   22.008  39.712  1.00 16.87 ? 418  THR A CG2 1 
ATOM   3359  N  N   . ASN A 1 419 ? -0.981  20.938  43.675  1.00 16.97 ? 419  ASN A N   1 
ATOM   3360  C  CA  . ASN A 1 419 ? -1.132  20.533  45.070  1.00 16.46 ? 419  ASN A CA  1 
ATOM   3361  C  C   . ASN A 1 419 ? 0.188   19.942  45.602  1.00 15.96 ? 419  ASN A C   1 
ATOM   3362  O  O   . ASN A 1 419 ? 0.256   18.765  46.005  1.00 15.71 ? 419  ASN A O   1 
ATOM   3363  C  CB  . ASN A 1 419 ? -2.304  19.549  45.193  1.00 16.65 ? 419  ASN A CB  1 
ATOM   3364  C  CG  . ASN A 1 419 ? -2.706  19.289  46.622  1.00 18.42 ? 419  ASN A CG  1 
ATOM   3365  O  OD1 . ASN A 1 419 ? -2.098  19.797  47.574  1.00 20.34 ? 419  ASN A OD1 1 
ATOM   3366  N  ND2 . ASN A 1 419 ? -3.742  18.492  46.786  1.00 20.18 ? 419  ASN A ND2 1 
ATOM   3367  N  N   . ASN A 1 420 ? 1.226   20.779  45.577  1.00 14.87 ? 420  ASN A N   1 
ATOM   3368  C  CA  . ASN A 1 420 ? 2.591   20.395  45.953  1.00 14.56 ? 420  ASN A CA  1 
ATOM   3369  C  C   . ASN A 1 420 ? 2.795   20.024  47.428  1.00 14.18 ? 420  ASN A C   1 
ATOM   3370  O  O   . ASN A 1 420 ? 3.751   19.293  47.761  1.00 14.03 ? 420  ASN A O   1 
ATOM   3371  C  CB  . ASN A 1 420 ? 3.584   21.518  45.580  1.00 14.31 ? 420  ASN A CB  1 
ATOM   3372  C  CG  . ASN A 1 420 ? 3.840   21.607  44.078  1.00 13.97 ? 420  ASN A CG  1 
ATOM   3373  O  OD1 . ASN A 1 420 ? 3.669   20.634  43.338  1.00 13.99 ? 420  ASN A OD1 1 
ATOM   3374  N  ND2 . ASN A 1 420 ? 4.267   22.773  43.627  1.00 12.15 ? 420  ASN A ND2 1 
ATOM   3375  N  N   . PHE A 1 421 ? 1.910   20.529  48.293  1.00 13.43 ? 421  PHE A N   1 
ATOM   3376  C  CA  . PHE A 1 421 ? 2.102   20.491  49.753  1.00 12.86 ? 421  PHE A CA  1 
ATOM   3377  C  C   . PHE A 1 421 ? 0.954   19.807  50.505  1.00 12.96 ? 421  PHE A C   1 
ATOM   3378  O  O   . PHE A 1 421 ? 1.132   19.321  51.628  1.00 12.95 ? 421  PHE A O   1 
ATOM   3379  C  CB  . PHE A 1 421 ? 2.292   21.920  50.299  1.00 12.45 ? 421  PHE A CB  1 
ATOM   3380  C  CG  . PHE A 1 421 ? 3.354   22.715  49.577  1.00 11.42 ? 421  PHE A CG  1 
ATOM   3381  C  CD1 . PHE A 1 421 ? 4.707   22.418  49.743  1.00 9.85  ? 421  PHE A CD1 1 
ATOM   3382  C  CD2 . PHE A 1 421 ? 2.999   23.758  48.730  1.00 11.53 ? 421  PHE A CD2 1 
ATOM   3383  C  CE1 . PHE A 1 421 ? 5.687   23.139  49.082  1.00 10.26 ? 421  PHE A CE1 1 
ATOM   3384  C  CE2 . PHE A 1 421 ? 3.979   24.486  48.041  1.00 11.39 ? 421  PHE A CE2 1 
ATOM   3385  C  CZ  . PHE A 1 421 ? 5.323   24.183  48.220  1.00 10.53 ? 421  PHE A CZ  1 
ATOM   3386  N  N   . GLY A 1 422 ? -0.217  19.770  49.874  1.00 13.34 ? 422  GLY A N   1 
ATOM   3387  C  CA  . GLY A 1 422 ? -1.444  19.313  50.516  1.00 13.13 ? 422  GLY A CA  1 
ATOM   3388  C  C   . GLY A 1 422 ? -1.380  17.838  50.816  1.00 13.58 ? 422  GLY A C   1 
ATOM   3389  O  O   . GLY A 1 422 ? -1.613  17.423  51.962  1.00 14.30 ? 422  GLY A O   1 
ATOM   3390  N  N   . GLN A 1 423 ? -1.061  17.028  49.805  1.00 13.18 ? 423  GLN A N   1 
ATOM   3391  C  CA  . GLN A 1 423 ? -1.019  15.586  50.039  1.00 12.68 ? 423  GLN A CA  1 
ATOM   3392  C  C   . GLN A 1 423 ? 0.170   15.168  50.924  1.00 12.63 ? 423  GLN A C   1 
ATOM   3393  O  O   . GLN A 1 423 ? 0.039   14.272  51.784  1.00 12.42 ? 423  GLN A O   1 
ATOM   3394  C  CB  . GLN A 1 423 ? -1.082  14.771  48.747  1.00 11.77 ? 423  GLN A CB  1 
ATOM   3395  C  CG  . GLN A 1 423 ? -1.260  13.298  49.110  1.00 11.73 ? 423  GLN A CG  1 
ATOM   3396  C  CD  . GLN A 1 423 ? -1.439  12.382  47.935  1.00 10.99 ? 423  GLN A CD  1 
ATOM   3397  O  OE1 . GLN A 1 423 ? -0.477  11.759  47.482  1.00 10.52 ? 423  GLN A OE1 1 
ATOM   3398  N  NE2 . GLN A 1 423 ? -2.668  12.270  47.447  1.00 7.14  ? 423  GLN A NE2 1 
ATOM   3399  N  N   . ALA A 1 424 ? 1.311   15.828  50.710  1.00 12.49 ? 424  ALA A N   1 
ATOM   3400  C  CA  . ALA A 1 424 ? 2.483   15.681  51.577  1.00 12.87 ? 424  ALA A CA  1 
ATOM   3401  C  C   . ALA A 1 424 ? 2.111   15.867  53.051  1.00 12.90 ? 424  ALA A C   1 
ATOM   3402  O  O   . ALA A 1 424 ? 2.513   15.067  53.909  1.00 12.49 ? 424  ALA A O   1 
ATOM   3403  C  CB  . ALA A 1 424 ? 3.556   16.669  51.178  1.00 12.98 ? 424  ALA A CB  1 
ATOM   3404  N  N   . GLY A 1 425 ? 1.327   16.910  53.335  1.00 13.29 ? 425  GLY A N   1 
ATOM   3405  C  CA  . GLY A 1 425 ? 0.806   17.135  54.690  1.00 13.63 ? 425  GLY A CA  1 
ATOM   3406  C  C   . GLY A 1 425 ? -0.019  15.973  55.202  1.00 14.04 ? 425  GLY A C   1 
ATOM   3407  O  O   . GLY A 1 425 ? 0.222   15.485  56.301  1.00 14.07 ? 425  GLY A O   1 
ATOM   3408  N  N   . GLU A 1 426 ? -0.993  15.527  54.406  1.00 14.79 ? 426  GLU A N   1 
ATOM   3409  C  CA  . GLU A 1 426 ? -1.808  14.353  54.745  1.00 16.04 ? 426  GLU A CA  1 
ATOM   3410  C  C   . GLU A 1 426 ? -0.943  13.133  55.026  1.00 15.72 ? 426  GLU A C   1 
ATOM   3411  O  O   . GLU A 1 426 ? -1.177  12.428  56.007  1.00 16.22 ? 426  GLU A O   1 
ATOM   3412  C  CB  . GLU A 1 426 ? -2.796  14.014  53.628  1.00 16.32 ? 426  GLU A CB  1 
ATOM   3413  C  CG  . GLU A 1 426 ? -3.840  15.097  53.329  1.00 18.16 ? 426  GLU A CG  1 
ATOM   3414  C  CD  . GLU A 1 426 ? -4.653  14.761  52.098  1.00 19.30 ? 426  GLU A CD  1 
ATOM   3415  O  OE1 . GLU A 1 426 ? -5.563  13.905  52.209  1.00 22.77 ? 426  GLU A OE1 1 
ATOM   3416  O  OE2 . GLU A 1 426 ? -4.372  15.341  51.018  1.00 23.68 ? 426  GLU A OE2 1 
ATOM   3417  N  N   . VAL A 1 427 ? 0.060   12.891  54.174  1.00 15.48 ? 427  VAL A N   1 
ATOM   3418  C  CA  . VAL A 1 427 ? 1.021   11.801  54.406  1.00 14.78 ? 427  VAL A CA  1 
ATOM   3419  C  C   . VAL A 1 427 ? 1.701   11.971  55.760  1.00 15.14 ? 427  VAL A C   1 
ATOM   3420  O  O   . VAL A 1 427 ? 1.777   11.008  56.531  1.00 15.19 ? 427  VAL A O   1 
ATOM   3421  C  CB  . VAL A 1 427 ? 2.079   11.631  53.261  1.00 14.85 ? 427  VAL A CB  1 
ATOM   3422  C  CG1 . VAL A 1 427 ? 3.199   10.653  53.689  1.00 14.27 ? 427  VAL A CG1 1 
ATOM   3423  C  CG2 . VAL A 1 427 ? 1.418   11.161  51.945  1.00 12.79 ? 427  VAL A CG2 1 
ATOM   3424  N  N   . TYR A 1 428 ? 2.169   13.180  56.076  1.00 15.16 ? 428  TYR A N   1 
ATOM   3425  C  CA  . TYR A 1 428 ? 2.767   13.388  57.399  1.00 15.98 ? 428  TYR A CA  1 
ATOM   3426  C  C   . TYR A 1 428 ? 1.796   13.003  58.546  1.00 16.36 ? 428  TYR A C   1 
ATOM   3427  O  O   . TYR A 1 428 ? 2.156   12.233  59.456  1.00 16.26 ? 428  TYR A O   1 
ATOM   3428  C  CB  . TYR A 1 428 ? 3.270   14.825  57.582  1.00 16.04 ? 428  TYR A CB  1 
ATOM   3429  C  CG  . TYR A 1 428 ? 3.872   15.076  58.954  1.00 16.87 ? 428  TYR A CG  1 
ATOM   3430  C  CD1 . TYR A 1 428 ? 3.160   15.763  59.944  1.00 17.63 ? 428  TYR A CD1 1 
ATOM   3431  C  CD2 . TYR A 1 428 ? 5.151   14.602  59.268  1.00 16.50 ? 428  TYR A CD2 1 
ATOM   3432  C  CE1 . TYR A 1 428 ? 3.717   15.981  61.200  1.00 17.22 ? 428  TYR A CE1 1 
ATOM   3433  C  CE2 . TYR A 1 428 ? 5.711   14.811  60.498  1.00 16.43 ? 428  TYR A CE2 1 
ATOM   3434  C  CZ  . TYR A 1 428 ? 4.996   15.497  61.468  1.00 17.22 ? 428  TYR A CZ  1 
ATOM   3435  O  OH  . TYR A 1 428 ? 5.576   15.696  62.700  1.00 16.95 ? 428  TYR A OH  1 
ATOM   3436  N  N   . ARG A 1 429 ? 0.569   13.520  58.478  1.00 16.43 ? 429  ARG A N   1 
ATOM   3437  C  CA  . ARG A 1 429 ? -0.415  13.310  59.544  1.00 17.23 ? 429  ARG A CA  1 
ATOM   3438  C  C   . ARG A 1 429 ? -0.944  11.874  59.626  1.00 17.82 ? 429  ARG A C   1 
ATOM   3439  O  O   . ARG A 1 429 ? -1.397  11.446  60.682  1.00 17.12 ? 429  ARG A O   1 
ATOM   3440  C  CB  . ARG A 1 429 ? -1.556  14.343  59.470  1.00 17.15 ? 429  ARG A CB  1 
ATOM   3441  C  CG  . ARG A 1 429 ? -1.107  15.741  59.921  1.00 17.13 ? 429  ARG A CG  1 
ATOM   3442  C  CD  . ARG A 1 429 ? -2.176  16.808  59.756  1.00 16.19 ? 429  ARG A CD  1 
ATOM   3443  N  NE  . ARG A 1 429 ? -2.641  16.954  58.374  1.00 14.96 ? 429  ARG A NE  1 
ATOM   3444  C  CZ  . ARG A 1 429 ? -2.138  17.813  57.487  1.00 14.21 ? 429  ARG A CZ  1 
ATOM   3445  N  NH1 . ARG A 1 429 ? -2.655  17.865  56.265  1.00 11.75 ? 429  ARG A NH1 1 
ATOM   3446  N  NH2 . ARG A 1 429 ? -1.108  18.605  57.807  1.00 12.10 ? 429  ARG A NH2 1 
ATOM   3447  N  N   . ARG A 1 430 ? -0.847  11.127  58.522  1.00 18.45 ? 430  ARG A N   1 
ATOM   3448  C  CA  . ARG A 1 430 ? -1.164  9.696   58.526  1.00 18.88 ? 430  ARG A CA  1 
ATOM   3449  C  C   . ARG A 1 430 ? -0.127  8.802   59.243  1.00 19.23 ? 430  ARG A C   1 
ATOM   3450  O  O   . ARG A 1 430 ? -0.394  7.629   59.500  1.00 18.88 ? 430  ARG A O   1 
ATOM   3451  C  CB  . ARG A 1 430 ? -1.406  9.213   57.093  1.00 19.02 ? 430  ARG A CB  1 
ATOM   3452  C  CG  . ARG A 1 430 ? -2.816  9.504   56.606  1.00 19.76 ? 430  ARG A CG  1 
ATOM   3453  C  CD  . ARG A 1 430 ? -2.843  9.630   55.104  1.00 22.89 ? 430  ARG A CD  1 
ATOM   3454  N  NE  . ARG A 1 430 ? -4.207  9.749   54.575  1.00 24.41 ? 430  ARG A NE  1 
ATOM   3455  C  CZ  . ARG A 1 430 ? -5.021  8.721   54.323  1.00 22.24 ? 430  ARG A CZ  1 
ATOM   3456  N  NH1 . ARG A 1 430 ? -4.628  7.470   54.552  1.00 19.14 ? 430  ARG A NH1 1 
ATOM   3457  N  NH2 . ARG A 1 430 ? -6.230  8.955   53.830  1.00 20.57 ? 430  ARG A NH2 1 
ATOM   3458  N  N   . MET A 1 431 ? 1.036   9.366   59.572  1.00 19.88 ? 431  MET A N   1 
ATOM   3459  C  CA  . MET A 1 431 ? 2.147   8.620   60.205  1.00 20.73 ? 431  MET A CA  1 
ATOM   3460  C  C   . MET A 1 431 ? 1.927   8.416   61.706  1.00 21.50 ? 431  MET A C   1 
ATOM   3461  O  O   . MET A 1 431 ? 1.332   9.271   62.364  1.00 21.13 ? 431  MET A O   1 
ATOM   3462  C  CB  . MET A 1 431 ? 3.487   9.367   60.028  1.00 20.13 ? 431  MET A CB  1 
ATOM   3463  C  CG  . MET A 1 431 ? 4.046   9.441   58.615  1.00 20.42 ? 431  MET A CG  1 
ATOM   3464  S  SD  . MET A 1 431 ? 5.604   10.380  58.508  1.00 20.60 ? 431  MET A SD  1 
ATOM   3465  C  CE  . MET A 1 431 ? 5.655   10.685  56.742  1.00 18.74 ? 431  MET A CE  1 
ATOM   3466  N  N   . THR A 1 432 ? 2.441   7.307   62.246  1.00 22.41 ? 432  THR A N   1 
ATOM   3467  C  CA  . THR A 1 432 ? 2.512   7.130   63.690  1.00 23.76 ? 432  THR A CA  1 
ATOM   3468  C  C   . THR A 1 432 ? 3.550   8.106   64.264  1.00 24.86 ? 432  THR A C   1 
ATOM   3469  O  O   . THR A 1 432 ? 4.349   8.682   63.520  1.00 24.87 ? 432  THR A O   1 
ATOM   3470  C  CB  . THR A 1 432 ? 2.931   5.700   64.078  1.00 23.98 ? 432  THR A CB  1 
ATOM   3471  O  OG1 . THR A 1 432 ? 4.293   5.476   63.678  1.00 24.88 ? 432  THR A OG1 1 
ATOM   3472  C  CG2 . THR A 1 432 ? 2.021   4.666   63.429  1.00 23.75 ? 432  THR A CG2 1 
ATOM   3473  N  N   . GLU A 1 433 ? 3.542   8.275   65.585  1.00 26.00 ? 433  GLU A N   1 
ATOM   3474  C  CA  . GLU A 1 433 ? 4.491   9.150   66.269  1.00 27.61 ? 433  GLU A CA  1 
ATOM   3475  C  C   . GLU A 1 433 ? 5.947   8.723   66.043  1.00 26.77 ? 433  GLU A C   1 
ATOM   3476  O  O   . GLU A 1 433 ? 6.822   9.566   65.833  1.00 26.82 ? 433  GLU A O   1 
ATOM   3477  C  CB  . GLU A 1 433 ? 4.167   9.229   67.769  1.00 27.67 ? 433  GLU A CB  1 
ATOM   3478  C  CG  . GLU A 1 433 ? 4.719   10.497  68.454  1.00 30.58 ? 433  GLU A CG  1 
ATOM   3479  C  CD  . GLU A 1 433 ? 4.021   10.838  69.774  1.00 31.42 ? 433  GLU A CD  1 
ATOM   3480  O  OE1 . GLU A 1 433 ? 2.963   10.236  70.086  1.00 36.10 ? 433  GLU A OE1 1 
ATOM   3481  O  OE2 . GLU A 1 433 ? 4.535   11.720  70.506  1.00 35.70 ? 433  GLU A OE2 1 
ATOM   3482  N  N   . GLU A 1 434 ? 6.189   7.416   66.080  1.00 26.63 ? 434  GLU A N   1 
ATOM   3483  C  CA  . GLU A 1 434 ? 7.505   6.846   65.805  1.00 26.51 ? 434  GLU A CA  1 
ATOM   3484  C  C   . GLU A 1 434 ? 8.002   7.258   64.411  1.00 25.42 ? 434  GLU A C   1 
ATOM   3485  O  O   . GLU A 1 434 ? 9.141   7.699   64.265  1.00 25.35 ? 434  GLU A O   1 
ATOM   3486  C  CB  . GLU A 1 434 ? 7.481   5.318   65.940  1.00 27.09 ? 434  GLU A CB  1 
ATOM   3487  C  CG  . GLU A 1 434 ? 6.713   4.814   67.175  1.00 30.76 ? 434  GLU A CG  1 
ATOM   3488  C  CD  . GLU A 1 434 ? 5.261   4.394   66.861  1.00 34.13 ? 434  GLU A CD  1 
ATOM   3489  O  OE1 . GLU A 1 434 ? 4.317   5.152   67.216  1.00 33.60 ? 434  GLU A OE1 1 
ATOM   3490  O  OE2 . GLU A 1 434 ? 5.078   3.302   66.264  1.00 34.62 ? 434  GLU A OE2 1 
ATOM   3491  N  N   . GLU A 1 435 ? 7.141   7.124   63.401  1.00 24.11 ? 435  GLU A N   1 
ATOM   3492  C  CA  . GLU A 1 435 ? 7.464   7.551   62.037  1.00 23.17 ? 435  GLU A CA  1 
ATOM   3493  C  C   . GLU A 1 435 ? 7.755   9.061   61.950  1.00 22.25 ? 435  GLU A C   1 
ATOM   3494  O  O   . GLU A 1 435 ? 8.735   9.475   61.312  1.00 21.99 ? 435  GLU A O   1 
ATOM   3495  C  CB  . GLU A 1 435 ? 6.349   7.153   61.062  1.00 22.73 ? 435  GLU A CB  1 
ATOM   3496  C  CG  . GLU A 1 435 ? 6.211   5.644   60.864  1.00 23.64 ? 435  GLU A CG  1 
ATOM   3497  C  CD  . GLU A 1 435 ? 4.983   5.240   60.044  1.00 24.09 ? 435  GLU A CD  1 
ATOM   3498  O  OE1 . GLU A 1 435 ? 3.995   5.999   59.963  1.00 25.26 ? 435  GLU A OE1 1 
ATOM   3499  O  OE2 . GLU A 1 435 ? 5.000   4.136   59.480  1.00 26.21 ? 435  GLU A OE2 1 
ATOM   3500  N  N   . GLN A 1 436 ? 6.923   9.871   62.607  1.00 21.14 ? 436  GLN A N   1 
ATOM   3501  C  CA  . GLN A 1 436 ? 7.096   11.322  62.596  1.00 20.90 ? 436  GLN A CA  1 
ATOM   3502  C  C   . GLN A 1 436 ? 8.388   11.760  63.274  1.00 20.51 ? 436  GLN A C   1 
ATOM   3503  O  O   . GLN A 1 436 ? 8.997   12.749  62.866  1.00 20.48 ? 436  GLN A O   1 
ATOM   3504  C  CB  . GLN A 1 436 ? 5.916   12.020  63.255  1.00 20.45 ? 436  GLN A CB  1 
ATOM   3505  C  CG  . GLN A 1 436 ? 4.636   11.924  62.477  1.00 20.63 ? 436  GLN A CG  1 
ATOM   3506  C  CD  . GLN A 1 436 ? 3.515   12.736  63.104  1.00 20.39 ? 436  GLN A CD  1 
ATOM   3507  O  OE1 . GLN A 1 436 ? 3.530   13.025  64.304  1.00 19.93 ? 436  GLN A OE1 1 
ATOM   3508  N  NE2 . GLN A 1 436 ? 2.539   13.106  62.294  1.00 18.77 ? 436  GLN A NE2 1 
ATOM   3509  N  N   . MET A 1 437 ? 8.798   11.024  64.306  1.00 20.17 ? 437  MET A N   1 
ATOM   3510  C  CA  . MET A 1 437 ? 10.039  11.326  65.012  1.00 20.42 ? 437  MET A CA  1 
ATOM   3511  C  C   . MET A 1 437 ? 11.273  10.859  64.218  1.00 19.10 ? 437  MET A C   1 
ATOM   3512  O  O   . MET A 1 437 ? 12.281  11.569  64.172  1.00 18.78 ? 437  MET A O   1 
ATOM   3513  C  CB  . MET A 1 437 ? 10.018  10.770  66.447  1.00 21.47 ? 437  MET A CB  1 
ATOM   3514  C  CG  . MET A 1 437 ? 11.212  11.207  67.330  1.00 26.46 ? 437  MET A CG  1 
ATOM   3515  S  SD  . MET A 1 437 ? 11.572  13.008  67.339  1.00 37.04 ? 437  MET A SD  1 
ATOM   3516  C  CE  . MET A 1 437 ? 10.785  13.521  68.883  1.00 34.34 ? 437  MET A CE  1 
ATOM   3517  N  N   . ALA A 1 438 ? 11.177  9.689   63.582  1.00 17.47 ? 438  ALA A N   1 
ATOM   3518  C  CA  . ALA A 1 438 ? 12.214  9.211   62.656  1.00 16.39 ? 438  ALA A CA  1 
ATOM   3519  C  C   . ALA A 1 438 ? 12.413  10.200  61.515  1.00 15.39 ? 438  ALA A C   1 
ATOM   3520  O  O   . ALA A 1 438 ? 13.550  10.521  61.163  1.00 15.20 ? 438  ALA A O   1 
ATOM   3521  C  CB  . ALA A 1 438 ? 11.873  7.820   62.102  1.00 15.67 ? 438  ALA A CB  1 
ATOM   3522  N  N   . LEU A 1 439 ? 11.304  10.684  60.952  1.00 14.73 ? 439  LEU A N   1 
ATOM   3523  C  CA  . LEU A 1 439 ? 11.349  11.629  59.831  1.00 14.20 ? 439  LEU A CA  1 
ATOM   3524  C  C   . LEU A 1 439 ? 12.061  12.920  60.218  1.00 14.47 ? 439  LEU A C   1 
ATOM   3525  O  O   . LEU A 1 439 ? 12.884  13.427  59.457  1.00 14.28 ? 439  LEU A O   1 
ATOM   3526  C  CB  . LEU A 1 439 ? 9.948   11.928  59.302  1.00 13.86 ? 439  LEU A CB  1 
ATOM   3527  C  CG  . LEU A 1 439 ? 9.826   13.038  58.244  1.00 14.06 ? 439  LEU A CG  1 
ATOM   3528  C  CD1 . LEU A 1 439 ? 10.371  12.579  56.888  1.00 13.41 ? 439  LEU A CD1 1 
ATOM   3529  C  CD2 . LEU A 1 439 ? 8.399   13.549  58.101  1.00 13.31 ? 439  LEU A CD2 1 
ATOM   3530  N  N   . LEU A 1 440 ? 11.733  13.444  61.401  1.00 14.95 ? 440  LEU A N   1 
ATOM   3531  C  CA  . LEU A 1 440 ? 12.349  14.670  61.910  1.00 15.12 ? 440  LEU A CA  1 
ATOM   3532  C  C   . LEU A 1 440 ? 13.850  14.488  62.122  1.00 15.06 ? 440  LEU A C   1 
ATOM   3533  O  O   . LEU A 1 440 ? 14.632  15.307  61.670  1.00 15.88 ? 440  LEU A O   1 
ATOM   3534  C  CB  . LEU A 1 440 ? 11.641  15.168  63.194  1.00 15.26 ? 440  LEU A CB  1 
ATOM   3535  C  CG  . LEU A 1 440 ? 12.135  16.457  63.882  1.00 14.79 ? 440  LEU A CG  1 
ATOM   3536  C  CD1 . LEU A 1 440 ? 12.107  17.688  62.946  1.00 11.01 ? 440  LEU A CD1 1 
ATOM   3537  C  CD2 . LEU A 1 440 ? 11.345  16.732  65.178  1.00 14.63 ? 440  LEU A CD2 1 
ATOM   3538  N  N   . ASN A 1 441 ? 14.260  13.404  62.767  1.00 15.47 ? 441  ASN A N   1 
ATOM   3539  C  CA  . ASN A 1 441 ? 15.688  13.174  62.999  1.00 16.21 ? 441  ASN A CA  1 
ATOM   3540  C  C   . ASN A 1 441 ? 16.495  12.969  61.705  1.00 15.71 ? 441  ASN A C   1 
ATOM   3541  O  O   . ASN A 1 441 ? 17.617  13.460  61.599  1.00 15.69 ? 441  ASN A O   1 
ATOM   3542  C  CB  . ASN A 1 441 ? 15.934  12.077  64.068  1.00 16.83 ? 441  ASN A CB  1 
ATOM   3543  C  CG  . ASN A 1 441 ? 15.536  12.546  65.499  1.00 21.07 ? 441  ASN A CG  1 
ATOM   3544  O  OD1 . ASN A 1 441 ? 16.396  12.956  66.300  1.00 26.60 ? 441  ASN A OD1 1 
ATOM   3545  N  ND2 . ASN A 1 441 ? 14.228  12.541  65.798  1.00 23.95 ? 441  ASN A ND2 1 
ATOM   3546  N  N   . ASN A 1 442 ? 15.914  12.289  60.714  1.00 15.08 ? 442  ASN A N   1 
ATOM   3547  C  CA  . ASN A 1 442 ? 16.584  12.095  59.414  1.00 14.71 ? 442  ASN A CA  1 
ATOM   3548  C  C   . ASN A 1 442 ? 16.694  13.384  58.582  1.00 13.84 ? 442  ASN A C   1 
ATOM   3549  O  O   . ASN A 1 442 ? 17.744  13.678  58.021  1.00 12.96 ? 442  ASN A O   1 
ATOM   3550  C  CB  . ASN A 1 442 ? 15.892  10.990  58.591  1.00 14.86 ? 442  ASN A CB  1 
ATOM   3551  C  CG  . ASN A 1 442 ? 15.920  9.633   59.274  1.00 15.27 ? 442  ASN A CG  1 
ATOM   3552  O  OD1 . ASN A 1 442 ? 16.862  9.301   59.987  1.00 15.75 ? 442  ASN A OD1 1 
ATOM   3553  N  ND2 . ASN A 1 442 ? 14.875  8.836   59.049  1.00 15.48 ? 442  ASN A ND2 1 
ATOM   3554  N  N   . LEU A 1 443 ? 15.602  14.146  58.523  1.00 13.68 ? 443  LEU A N   1 
ATOM   3555  C  CA  . LEU A 1 443 ? 15.593  15.466  57.872  1.00 13.86 ? 443  LEU A CA  1 
ATOM   3556  C  C   . LEU A 1 443 ? 16.589  16.438  58.494  1.00 13.83 ? 443  LEU A C   1 
ATOM   3557  O  O   . LEU A 1 443 ? 17.333  17.132  57.788  1.00 14.14 ? 443  LEU A O   1 
ATOM   3558  C  CB  . LEU A 1 443 ? 14.197  16.101  57.902  1.00 13.23 ? 443  LEU A CB  1 
ATOM   3559  C  CG  . LEU A 1 443 ? 13.185  15.564  56.899  1.00 13.13 ? 443  LEU A CG  1 
ATOM   3560  C  CD1 . LEU A 1 443 ? 11.822  16.205  57.172  1.00 14.18 ? 443  LEU A CD1 1 
ATOM   3561  C  CD2 . LEU A 1 443 ? 13.651  15.834  55.467  1.00 11.05 ? 443  LEU A CD2 1 
ATOM   3562  N  N   . VAL A 1 444 ? 16.591  16.486  59.814  1.00 13.47 ? 444  VAL A N   1 
ATOM   3563  C  CA  . VAL A 1 444 ? 17.498  17.367  60.515  1.00 14.01 ? 444  VAL A CA  1 
ATOM   3564  C  C   . VAL A 1 444 ? 18.949  16.975  60.196  1.00 14.53 ? 444  VAL A C   1 
ATOM   3565  O  O   . VAL A 1 444 ? 19.712  17.809  59.688  1.00 14.77 ? 444  VAL A O   1 
ATOM   3566  C  CB  . VAL A 1 444 ? 17.157  17.454  62.057  1.00 14.13 ? 444  VAL A CB  1 
ATOM   3567  C  CG1 . VAL A 1 444 ? 18.272  18.122  62.818  1.00 13.54 ? 444  VAL A CG1 1 
ATOM   3568  C  CG2 . VAL A 1 444 ? 15.842  18.220  62.255  1.00 11.99 ? 444  VAL A CG2 1 
ATOM   3569  N  N   . ASN A 1 445 ? 19.306  15.716  60.453  1.00 14.74 ? 445  ASN A N   1 
ATOM   3570  C  CA  . ASN A 1 445 ? 20.626  15.179  60.079  1.00 16.10 ? 445  ASN A CA  1 
ATOM   3571  C  C   . ASN A 1 445 ? 21.066  15.486  58.651  1.00 15.80 ? 445  ASN A C   1 
ATOM   3572  O  O   . ASN A 1 445 ? 22.250  15.696  58.401  1.00 16.04 ? 445  ASN A O   1 
ATOM   3573  C  CB  . ASN A 1 445 ? 20.686  13.662  60.271  1.00 16.60 ? 445  ASN A CB  1 
ATOM   3574  C  CG  . ASN A 1 445 ? 22.012  13.074  59.803  1.00 20.74 ? 445  ASN A CG  1 
ATOM   3575  O  OD1 . ASN A 1 445 ? 22.089  12.419  58.747  1.00 23.60 ? 445  ASN A OD1 1 
ATOM   3576  N  ND2 . ASN A 1 445 ? 23.082  13.333  60.574  1.00 22.82 ? 445  ASN A ND2 1 
ATOM   3577  N  N   . ASP A 1 446 ? 20.111  15.482  57.721  1.00 15.63 ? 446  ASP A N   1 
ATOM   3578  C  CA  . ASP A 1 446 ? 20.395  15.772  56.326  1.00 15.17 ? 446  ASP A CA  1 
ATOM   3579  C  C   . ASP A 1 446 ? 20.503  17.275  56.057  1.00 15.08 ? 446  ASP A C   1 
ATOM   3580  O  O   . ASP A 1 446 ? 21.387  17.730  55.296  1.00 14.76 ? 446  ASP A O   1 
ATOM   3581  C  CB  . ASP A 1 446 ? 19.326  15.150  55.429  1.00 15.27 ? 446  ASP A CB  1 
ATOM   3582  C  CG  . ASP A 1 446 ? 19.923  14.465  54.216  1.00 15.59 ? 446  ASP A CG  1 
ATOM   3583  O  OD1 . ASP A 1 446 ? 19.807  14.989  53.093  1.00 16.09 ? 446  ASP A OD1 1 
ATOM   3584  O  OD2 . ASP A 1 446 ? 20.553  13.414  54.397  1.00 16.02 ? 446  ASP A OD2 1 
ATOM   3585  N  N   . LEU A 1 447 ? 19.614  18.057  56.678  1.00 14.67 ? 447  LEU A N   1 
ATOM   3586  C  CA  . LEU A 1 447 ? 19.642  19.509  56.454  1.00 14.28 ? 447  LEU A CA  1 
ATOM   3587  C  C   . LEU A 1 447 ? 20.801  20.199  57.161  1.00 14.18 ? 447  LEU A C   1 
ATOM   3588  O  O   . LEU A 1 447 ? 21.221  21.273  56.744  1.00 14.59 ? 447  LEU A O   1 
ATOM   3589  C  CB  . LEU A 1 447 ? 18.287  20.166  56.751  1.00 13.71 ? 447  LEU A CB  1 
ATOM   3590  C  CG  . LEU A 1 447 ? 17.184  19.762  55.754  1.00 12.98 ? 447  LEU A CG  1 
ATOM   3591  C  CD1 . LEU A 1 447 ? 15.768  19.845  56.383  1.00 11.27 ? 447  LEU A CD1 1 
ATOM   3592  C  CD2 . LEU A 1 447 ? 17.281  20.558  54.450  1.00 7.85  ? 447  LEU A CD2 1 
ATOM   3593  N  N   . GLN A 1 448 ? 21.333  19.568  58.205  1.00 14.82 ? 448  GLN A N   1 
ATOM   3594  C  CA  . GLN A 1 448 ? 22.539  20.063  58.895  1.00 16.00 ? 448  GLN A CA  1 
ATOM   3595  C  C   . GLN A 1 448 ? 23.749  20.060  57.968  1.00 15.72 ? 448  GLN A C   1 
ATOM   3596  O  O   . GLN A 1 448 ? 24.735  20.753  58.244  1.00 16.19 ? 448  GLN A O   1 
ATOM   3597  C  CB  . GLN A 1 448 ? 22.849  19.241  60.155  1.00 15.29 ? 448  GLN A CB  1 
ATOM   3598  C  CG  . GLN A 1 448 ? 22.189  19.790  61.416  1.00 17.75 ? 448  GLN A CG  1 
ATOM   3599  C  CD  . GLN A 1 448 ? 22.139  18.796  62.577  1.00 18.99 ? 448  GLN A CD  1 
ATOM   3600  O  OE1 . GLN A 1 448 ? 22.641  17.657  62.484  1.00 22.34 ? 448  GLN A OE1 1 
ATOM   3601  N  NE2 . GLN A 1 448 ? 21.522  19.221  63.682  1.00 20.55 ? 448  GLN A NE2 1 
ATOM   3602  N  N   . GLN A 1 449 ? 23.662  19.285  56.877  1.00 15.13 ? 449  GLN A N   1 
ATOM   3603  C  CA  . GLN A 1 449 ? 24.746  19.158  55.899  1.00 14.39 ? 449  GLN A CA  1 
ATOM   3604  C  C   . GLN A 1 449 ? 24.641  20.125  54.713  1.00 13.97 ? 449  GLN A C   1 
ATOM   3605  O  O   . GLN A 1 449 ? 25.564  20.193  53.896  1.00 13.83 ? 449  GLN A O   1 
ATOM   3606  C  CB  . GLN A 1 449 ? 24.818  17.721  55.380  1.00 14.65 ? 449  GLN A CB  1 
ATOM   3607  C  CG  . GLN A 1 449 ? 25.305  16.704  56.385  1.00 15.48 ? 449  GLN A CG  1 
ATOM   3608  C  CD  . GLN A 1 449 ? 25.109  15.277  55.881  1.00 19.47 ? 449  GLN A CD  1 
ATOM   3609  O  OE1 . GLN A 1 449 ? 25.898  14.756  55.061  1.00 18.65 ? 449  GLN A OE1 1 
ATOM   3610  N  NE2 . GLN A 1 449 ? 24.050  14.634  56.367  1.00 18.52 ? 449  GLN A NE2 1 
ATOM   3611  N  N   . VAL A 1 450 ? 23.520  20.843  54.608  1.00 13.32 ? 450  VAL A N   1 
ATOM   3612  C  CA  . VAL A 1 450 ? 23.337  21.897  53.602  1.00 13.12 ? 450  VAL A CA  1 
ATOM   3613  C  C   . VAL A 1 450 ? 24.131  23.144  54.047  1.00 13.63 ? 450  VAL A C   1 
ATOM   3614  O  O   . VAL A 1 450 ? 24.155  23.463  55.236  1.00 13.65 ? 450  VAL A O   1 
ATOM   3615  C  CB  . VAL A 1 450 ? 21.811  22.230  53.331  1.00 13.02 ? 450  VAL A CB  1 
ATOM   3616  C  CG1 . VAL A 1 450 ? 21.650  23.351  52.289  1.00 10.53 ? 450  VAL A CG1 1 
ATOM   3617  C  CG2 . VAL A 1 450 ? 21.033  20.990  52.862  1.00 11.84 ? 450  VAL A CG2 1 
ATOM   3618  N  N   . ARG A 1 451 ? 24.788  23.826  53.105  1.00 13.83 ? 451  ARG A N   1 
ATOM   3619  C  CA  . ARG A 1 451 ? 25.747  24.898  53.440  1.00 14.64 ? 451  ARG A CA  1 
ATOM   3620  C  C   . ARG A 1 451 ? 25.260  26.259  52.938  1.00 15.16 ? 451  ARG A C   1 
ATOM   3621  O  O   . ARG A 1 451 ? 25.974  27.258  53.013  1.00 15.00 ? 451  ARG A O   1 
ATOM   3622  C  CB  . ARG A 1 451 ? 27.156  24.580  52.887  1.00 14.01 ? 451  ARG A CB  1 
ATOM   3623  C  CG  . ARG A 1 451 ? 27.754  23.248  53.410  1.00 15.29 ? 451  ARG A CG  1 
ATOM   3624  C  CD  . ARG A 1 451 ? 29.163  22.920  52.837  1.00 15.62 ? 451  ARG A CD  1 
ATOM   3625  N  NE  . ARG A 1 451 ? 29.191  22.829  51.369  1.00 17.17 ? 451  ARG A NE  1 
ATOM   3626  C  CZ  . ARG A 1 451 ? 28.857  21.744  50.665  1.00 18.40 ? 451  ARG A CZ  1 
ATOM   3627  N  NH1 . ARG A 1 451 ? 28.469  20.634  51.284  1.00 17.41 ? 451  ARG A NH1 1 
ATOM   3628  N  NH2 . ARG A 1 451 ? 28.923  21.762  49.334  1.00 16.18 ? 451  ARG A NH2 1 
ATOM   3629  N  N   . HIS A 1 452 ? 24.040  26.282  52.413  1.00 15.93 ? 452  HIS A N   1 
ATOM   3630  C  CA  . HIS A 1 452 ? 23.451  27.497  51.903  1.00 16.54 ? 452  HIS A CA  1 
ATOM   3631  C  C   . HIS A 1 452 ? 22.168  27.729  52.666  1.00 17.27 ? 452  HIS A C   1 
ATOM   3632  O  O   . HIS A 1 452 ? 21.227  26.935  52.574  1.00 16.62 ? 452  HIS A O   1 
ATOM   3633  C  CB  . HIS A 1 452 ? 23.194  27.382  50.400  1.00 16.57 ? 452  HIS A CB  1 
ATOM   3634  C  CG  . HIS A 1 452 ? 24.434  27.500  49.565  1.00 17.31 ? 452  HIS A CG  1 
ATOM   3635  N  ND1 . HIS A 1 452 ? 25.317  26.453  49.387  1.00 17.81 ? 452  HIS A ND1 1 
ATOM   3636  C  CD2 . HIS A 1 452 ? 24.936  28.541  48.858  1.00 16.17 ? 452  HIS A CD2 1 
ATOM   3637  C  CE1 . HIS A 1 452 ? 26.311  26.847  48.609  1.00 17.35 ? 452  HIS A CE1 1 
ATOM   3638  N  NE2 . HIS A 1 452 ? 26.106  28.111  48.277  1.00 16.62 ? 452  HIS A NE2 1 
ATOM   3639  N  N   . GLU A 1 453 ? 22.144  28.825  53.427  1.00 18.12 ? 453  GLU A N   1 
ATOM   3640  C  CA  . GLU A 1 453 ? 21.013  29.158  54.294  1.00 19.72 ? 453  GLU A CA  1 
ATOM   3641  C  C   . GLU A 1 453 ? 19.655  29.231  53.559  1.00 18.40 ? 453  GLU A C   1 
ATOM   3642  O  O   . GLU A 1 453 ? 18.667  28.654  54.020  1.00 18.47 ? 453  GLU A O   1 
ATOM   3643  C  CB  . GLU A 1 453 ? 21.283  30.459  55.065  1.00 19.41 ? 453  GLU A CB  1 
ATOM   3644  C  CG  . GLU A 1 453 ? 20.363  30.636  56.278  1.00 23.21 ? 453  GLU A CG  1 
ATOM   3645  C  CD  . GLU A 1 453 ? 20.462  32.031  56.943  1.00 24.64 ? 453  GLU A CD  1 
ATOM   3646  O  OE1 . GLU A 1 453 ? 21.387  32.822  56.575  1.00 28.35 ? 453  GLU A OE1 1 
ATOM   3647  O  OE2 . GLU A 1 453 ? 19.598  32.317  57.832  1.00 28.12 ? 453  GLU A OE2 1 
ATOM   3648  N  N   . ASN A 1 454 ? 19.614  29.922  52.425  1.00 17.23 ? 454  ASN A N   1 
ATOM   3649  C  CA  . ASN A 1 454 ? 18.369  30.045  51.661  1.00 16.78 ? 454  ASN A CA  1 
ATOM   3650  C  C   . ASN A 1 454 ? 17.716  28.682  51.323  1.00 16.19 ? 454  ASN A C   1 
ATOM   3651  O  O   . ASN A 1 454 ? 16.487  28.534  51.395  1.00 16.25 ? 454  ASN A O   1 
ATOM   3652  C  CB  . ASN A 1 454 ? 18.591  30.874  50.398  1.00 16.36 ? 454  ASN A CB  1 
ATOM   3653  C  CG  . ASN A 1 454 ? 17.288  31.318  49.759  1.00 18.03 ? 454  ASN A CG  1 
ATOM   3654  O  OD1 . ASN A 1 454 ? 16.847  30.740  48.755  1.00 18.31 ? 454  ASN A OD1 1 
ATOM   3655  N  ND2 . ASN A 1 454 ? 16.653  32.345  50.340  1.00 18.38 ? 454  ASN A ND2 1 
ATOM   3656  N  N   . THR A 1 455 ? 18.543  27.693  50.984  1.00 14.99 ? 455  THR A N   1 
ATOM   3657  C  CA  . THR A 1 455 ? 18.063  26.334  50.722  1.00 14.39 ? 455  THR A CA  1 
ATOM   3658  C  C   . THR A 1 455 ? 17.422  25.707  51.965  1.00 14.38 ? 455  THR A C   1 
ATOM   3659  O  O   . THR A 1 455 ? 16.325  25.149  51.878  1.00 14.58 ? 455  THR A O   1 
ATOM   3660  C  CB  . THR A 1 455 ? 19.192  25.436  50.168  1.00 14.00 ? 455  THR A CB  1 
ATOM   3661  O  OG1 . THR A 1 455 ? 19.651  25.982  48.932  1.00 11.98 ? 455  THR A OG1 1 
ATOM   3662  C  CG2 . THR A 1 455 ? 18.704  23.995  49.943  1.00 14.09 ? 455  THR A CG2 1 
ATOM   3663  N  N   . VAL A 1 456 ? 18.091  25.814  53.117  1.00 14.40 ? 456  VAL A N   1 
ATOM   3664  C  CA  . VAL A 1 456 ? 17.515  25.342  54.392  1.00 14.39 ? 456  VAL A CA  1 
ATOM   3665  C  C   . VAL A 1 456 ? 16.165  26.001  54.702  1.00 14.85 ? 456  VAL A C   1 
ATOM   3666  O  O   . VAL A 1 456 ? 15.186  25.297  54.944  1.00 15.02 ? 456  VAL A O   1 
ATOM   3667  C  CB  . VAL A 1 456 ? 18.484  25.508  55.593  1.00 14.45 ? 456  VAL A CB  1 
ATOM   3668  C  CG1 . VAL A 1 456 ? 17.884  24.884  56.838  1.00 12.82 ? 456  VAL A CG1 1 
ATOM   3669  C  CG2 . VAL A 1 456 ? 19.839  24.866  55.283  1.00 13.54 ? 456  VAL A CG2 1 
ATOM   3670  N  N   . LEU A 1 457 ? 16.128  27.341  54.675  1.00 15.27 ? 457  LEU A N   1 
ATOM   3671  C  CA  . LEU A 1 457 ? 14.903  28.143  54.839  1.00 15.66 ? 457  LEU A CA  1 
ATOM   3672  C  C   . LEU A 1 457 ? 13.788  27.643  53.910  1.00 15.79 ? 457  LEU A C   1 
ATOM   3673  O  O   . LEU A 1 457 ? 12.650  27.405  54.346  1.00 15.95 ? 457  LEU A O   1 
ATOM   3674  C  CB  . LEU A 1 457 ? 15.202  29.613  54.501  1.00 15.77 ? 457  LEU A CB  1 
ATOM   3675  C  CG  . LEU A 1 457 ? 14.421  30.816  55.059  1.00 16.97 ? 457  LEU A CG  1 
ATOM   3676  C  CD1 . LEU A 1 457 ? 14.132  31.849  53.959  1.00 14.55 ? 457  LEU A CD1 1 
ATOM   3677  C  CD2 . LEU A 1 457 ? 13.136  30.465  55.830  1.00 15.66 ? 457  LEU A CD2 1 
ATOM   3678  N  N   . LEU A 1 458 ? 14.124  27.481  52.630  1.00 15.81 ? 458  LEU A N   1 
ATOM   3679  C  CA  . LEU A 1 458 ? 13.162  27.005  51.641  1.00 16.36 ? 458  LEU A CA  1 
ATOM   3680  C  C   . LEU A 1 458 ? 12.700  25.584  51.974  1.00 15.97 ? 458  LEU A C   1 
ATOM   3681  O  O   . LEU A 1 458 ? 11.529  25.269  51.821  1.00 15.99 ? 458  LEU A O   1 
ATOM   3682  C  CB  . LEU A 1 458 ? 13.753  27.039  50.226  1.00 16.92 ? 458  LEU A CB  1 
ATOM   3683  C  CG  . LEU A 1 458 ? 12.969  27.695  49.081  1.00 19.54 ? 458  LEU A CG  1 
ATOM   3684  C  CD1 . LEU A 1 458 ? 13.486  27.207  47.729  1.00 20.15 ? 458  LEU A CD1 1 
ATOM   3685  C  CD2 . LEU A 1 458 ? 11.435  27.517  49.174  1.00 21.96 ? 458  LEU A CD2 1 
ATOM   3686  N  N   . ALA A 1 459 ? 13.610  24.726  52.432  1.00 15.60 ? 459  ALA A N   1 
ATOM   3687  C  CA  . ALA A 1 459 ? 13.206  23.365  52.786  1.00 15.32 ? 459  ALA A CA  1 
ATOM   3688  C  C   . ALA A 1 459 ? 12.184  23.388  53.916  1.00 15.24 ? 459  ALA A C   1 
ATOM   3689  O  O   . ALA A 1 459 ? 11.138  22.770  53.801  1.00 14.55 ? 459  ALA A O   1 
ATOM   3690  C  CB  . ALA A 1 459 ? 14.399  22.501  53.141  1.00 14.70 ? 459  ALA A CB  1 
ATOM   3691  N  N   . ILE A 1 460 ? 12.480  24.144  54.980  1.00 15.75 ? 460  ILE A N   1 
ATOM   3692  C  CA  . ILE A 1 460 ? 11.597  24.242  56.149  1.00 15.86 ? 460  ILE A CA  1 
ATOM   3693  C  C   . ILE A 1 460 ? 10.259  24.843  55.742  1.00 15.80 ? 460  ILE A C   1 
ATOM   3694  O  O   . ILE A 1 460 ? 9.217   24.369  56.172  1.00 15.61 ? 460  ILE A O   1 
ATOM   3695  C  CB  . ILE A 1 460 ? 12.235  25.047  57.336  1.00 16.23 ? 460  ILE A CB  1 
ATOM   3696  C  CG1 . ILE A 1 460 ? 13.547  24.401  57.791  1.00 15.82 ? 460  ILE A CG1 1 
ATOM   3697  C  CG2 . ILE A 1 460 ? 11.285  25.107  58.531  1.00 16.06 ? 460  ILE A CG2 1 
ATOM   3698  C  CD1 . ILE A 1 460 ? 14.457  25.335  58.632  1.00 15.26 ? 460  ILE A CD1 1 
ATOM   3699  N  N   . CYS A 1 461 ? 10.297  25.870  54.897  1.00 16.31 ? 461  CYS A N   1 
ATOM   3700  C  CA  . CYS A 1 461 ? 9.069   26.468  54.363  1.00 17.12 ? 461  CYS A CA  1 
ATOM   3701  C  C   . CYS A 1 461 ? 8.212   25.481  53.573  1.00 16.39 ? 461  CYS A C   1 
ATOM   3702  O  O   . CYS A 1 461 ? 7.000   25.428  53.784  1.00 16.64 ? 461  CYS A O   1 
ATOM   3703  C  CB  . CYS A 1 461 ? 9.358   27.738  53.551  1.00 17.15 ? 461  CYS A CB  1 
ATOM   3704  S  SG  . CYS A 1 461 ? 9.868   29.129  54.625  1.00 22.67 ? 461  CYS A SG  1 
ATOM   3705  N  N   . ASN A 1 462 ? 8.831   24.703  52.684  1.00 15.67 ? 462  ASN A N   1 
ATOM   3706  C  CA  . ASN A 1 462 ? 8.108   23.674  51.932  1.00 15.20 ? 462  ASN A CA  1 
ATOM   3707  C  C   . ASN A 1 462 ? 7.433   22.670  52.878  1.00 15.25 ? 462  ASN A C   1 
ATOM   3708  O  O   . ASN A 1 462 ? 6.248   22.398  52.745  1.00 15.45 ? 462  ASN A O   1 
ATOM   3709  C  CB  . ASN A 1 462 ? 9.025   22.960  50.920  1.00 15.00 ? 462  ASN A CB  1 
ATOM   3710  C  CG  . ASN A 1 462 ? 9.444   23.859  49.760  1.00 13.63 ? 462  ASN A CG  1 
ATOM   3711  O  OD1 . ASN A 1 462 ? 8.883   24.929  49.556  1.00 14.67 ? 462  ASN A OD1 1 
ATOM   3712  N  ND2 . ASN A 1 462 ? 10.435  23.423  49.000  1.00 13.07 ? 462  ASN A ND2 1 
ATOM   3713  N  N   . PHE A 1 463 ? 8.177   22.141  53.840  1.00 14.98 ? 463  PHE A N   1 
ATOM   3714  C  CA  . PHE A 1 463 ? 7.589   21.277  54.857  1.00 15.41 ? 463  PHE A CA  1 
ATOM   3715  C  C   . PHE A 1 463 ? 6.495   21.964  55.712  1.00 15.87 ? 463  PHE A C   1 
ATOM   3716  O  O   . PHE A 1 463 ? 5.460   21.351  56.027  1.00 15.10 ? 463  PHE A O   1 
ATOM   3717  C  CB  . PHE A 1 463 ? 8.685   20.660  55.731  1.00 15.30 ? 463  PHE A CB  1 
ATOM   3718  C  CG  . PHE A 1 463 ? 9.484   19.583  55.028  1.00 15.67 ? 463  PHE A CG  1 
ATOM   3719  C  CD1 . PHE A 1 463 ? 10.845  19.756  54.771  1.00 15.42 ? 463  PHE A CD1 1 
ATOM   3720  C  CD2 . PHE A 1 463 ? 8.860   18.409  54.588  1.00 16.36 ? 463  PHE A CD2 1 
ATOM   3721  C  CE1 . PHE A 1 463 ? 11.590  18.761  54.093  1.00 17.32 ? 463  PHE A CE1 1 
ATOM   3722  C  CE2 . PHE A 1 463 ? 9.586   17.395  53.914  1.00 17.22 ? 463  PHE A CE2 1 
ATOM   3723  C  CZ  . PHE A 1 463 ? 10.954  17.576  53.659  1.00 17.25 ? 463  PHE A CZ  1 
ATOM   3724  N  N   . TYR A 1 464 ? 6.717   23.236  56.064  1.00 16.46 ? 464  TYR A N   1 
ATOM   3725  C  CA  . TYR A 1 464 ? 5.748   24.002  56.862  1.00 16.95 ? 464  TYR A CA  1 
ATOM   3726  C  C   . TYR A 1 464 ? 4.377   24.050  56.174  1.00 16.45 ? 464  TYR A C   1 
ATOM   3727  O  O   . TYR A 1 464 ? 3.372   23.773  56.798  1.00 15.60 ? 464  TYR A O   1 
ATOM   3728  C  CB  . TYR A 1 464 ? 6.250   25.429  57.160  1.00 17.58 ? 464  TYR A CB  1 
ATOM   3729  C  CG  . TYR A 1 464 ? 5.323   26.203  58.090  1.00 18.41 ? 464  TYR A CG  1 
ATOM   3730  C  CD1 . TYR A 1 464 ? 5.531   26.200  59.469  1.00 18.95 ? 464  TYR A CD1 1 
ATOM   3731  C  CD2 . TYR A 1 464 ? 4.222   26.908  57.590  1.00 18.78 ? 464  TYR A CD2 1 
ATOM   3732  C  CE1 . TYR A 1 464 ? 4.696   26.893  60.323  1.00 19.61 ? 464  TYR A CE1 1 
ATOM   3733  C  CE2 . TYR A 1 464 ? 3.372   27.598  58.432  1.00 19.76 ? 464  TYR A CE2 1 
ATOM   3734  C  CZ  . TYR A 1 464 ? 3.617   27.589  59.802  1.00 20.51 ? 464  TYR A CZ  1 
ATOM   3735  O  OH  . TYR A 1 464 ? 2.781   28.274  60.657  1.00 21.35 ? 464  TYR A OH  1 
ATOM   3736  N  N   . ARG A 1 465 ? 4.367   24.380  54.883  1.00 16.90 ? 465  ARG A N   1 
ATOM   3737  C  CA  . ARG A 1 465 ? 3.145   24.431  54.063  1.00 17.51 ? 465  ARG A CA  1 
ATOM   3738  C  C   . ARG A 1 465 ? 2.378   23.115  54.024  1.00 17.35 ? 465  ARG A C   1 
ATOM   3739  O  O   . ARG A 1 465 ? 1.162   23.101  53.834  1.00 16.77 ? 465  ARG A O   1 
ATOM   3740  C  CB  . ARG A 1 465 ? 3.490   24.807  52.637  1.00 17.24 ? 465  ARG A CB  1 
ATOM   3741  C  CG  . ARG A 1 465 ? 3.980   26.203  52.477  1.00 20.63 ? 465  ARG A CG  1 
ATOM   3742  C  CD  . ARG A 1 465 ? 4.299   26.438  51.019  1.00 24.57 ? 465  ARG A CD  1 
ATOM   3743  N  NE  . ARG A 1 465 ? 5.157   27.594  50.837  1.00 27.55 ? 465  ARG A NE  1 
ATOM   3744  C  CZ  . ARG A 1 465 ? 5.160   28.348  49.744  1.00 31.11 ? 465  ARG A CZ  1 
ATOM   3745  N  NH1 . ARG A 1 465 ? 4.335   28.068  48.730  1.00 30.26 ? 465  ARG A NH1 1 
ATOM   3746  N  NH2 . ARG A 1 465 ? 5.980   29.397  49.667  1.00 32.40 ? 465  ARG A NH2 1 
ATOM   3747  N  N   . ALA A 1 466 ? 3.119   22.017  54.158  1.00 17.68 ? 466  ALA A N   1 
ATOM   3748  C  CA  . ALA A 1 466 ? 2.546   20.685  54.193  1.00 17.94 ? 466  ALA A CA  1 
ATOM   3749  C  C   . ALA A 1 466 ? 1.932   20.440  55.563  1.00 18.00 ? 466  ALA A C   1 
ATOM   3750  O  O   . ALA A 1 466 ? 0.780   20.033  55.681  1.00 17.76 ? 466  ALA A O   1 
ATOM   3751  C  CB  . ALA A 1 466 ? 3.614   19.647  53.871  1.00 17.95 ? 466  ALA A CB  1 
ATOM   3752  N  N   . ASP A 1 467 ? 2.719   20.695  56.598  1.00 18.11 ? 467  ASP A N   1 
ATOM   3753  C  CA  . ASP A 1 467 ? 2.240   20.586  57.948  1.00 18.56 ? 467  ASP A CA  1 
ATOM   3754  C  C   . ASP A 1 467 ? 2.977   21.597  58.810  1.00 18.44 ? 467  ASP A C   1 
ATOM   3755  O  O   . ASP A 1 467 ? 4.205   21.555  58.910  1.00 19.38 ? 467  ASP A O   1 
ATOM   3756  C  CB  . ASP A 1 467 ? 2.471   19.182  58.480  1.00 18.79 ? 467  ASP A CB  1 
ATOM   3757  C  CG  . ASP A 1 467 ? 1.918   19.002  59.872  1.00 20.45 ? 467  ASP A CG  1 
ATOM   3758  O  OD1 . ASP A 1 467 ? 2.704   19.111  60.850  1.00 23.30 ? 467  ASP A OD1 1 
ATOM   3759  O  OD2 . ASP A 1 467 ? 0.698   18.771  59.987  1.00 21.67 ? 467  ASP A OD2 1 
ATOM   3760  N  N   . ALA A 1 468 ? 2.217   22.490  59.432  1.00 17.96 ? 468  ALA A N   1 
ATOM   3761  C  CA  . ALA A 1 468 ? 2.758   23.600  60.210  1.00 17.51 ? 468  ALA A CA  1 
ATOM   3762  C  C   . ALA A 1 468 ? 3.600   23.149  61.398  1.00 17.27 ? 468  ALA A C   1 
ATOM   3763  O  O   . ALA A 1 468 ? 4.640   23.743  61.662  1.00 17.58 ? 468  ALA A O   1 
ATOM   3764  C  CB  . ALA A 1 468 ? 1.625   24.543  60.663  1.00 17.15 ? 468  ALA A CB  1 
ATOM   3765  N  N   . SER A 1 469 ? 3.168   22.103  62.104  1.00 17.26 ? 469  SER A N   1 
ATOM   3766  C  CA  . SER A 1 469 ? 3.919   21.624  63.272  1.00 17.61 ? 469  SER A CA  1 
ATOM   3767  C  C   . SER A 1 469 ? 5.244   20.952  62.903  1.00 17.40 ? 469  SER A C   1 
ATOM   3768  O  O   . SER A 1 469 ? 6.241   21.131  63.610  1.00 18.31 ? 469  SER A O   1 
ATOM   3769  C  CB  . SER A 1 469 ? 3.073   20.732  64.188  1.00 17.44 ? 469  SER A CB  1 
ATOM   3770  O  OG  . SER A 1 469 ? 2.884   19.441  63.654  1.00 19.12 ? 469  SER A OG  1 
ATOM   3771  N  N   . LEU A 1 470 ? 5.273   20.204  61.797  1.00 16.87 ? 470  LEU A N   1 
ATOM   3772  C  CA  . LEU A 1 470 ? 6.542   19.663  61.300  1.00 15.77 ? 470  LEU A CA  1 
ATOM   3773  C  C   . LEU A 1 470 ? 7.508   20.797  60.978  1.00 16.00 ? 470  LEU A C   1 
ATOM   3774  O  O   . LEU A 1 470 ? 8.690   20.740  61.343  1.00 15.52 ? 470  LEU A O   1 
ATOM   3775  C  CB  . LEU A 1 470 ? 6.353   18.770  60.057  1.00 15.46 ? 470  LEU A CB  1 
ATOM   3776  C  CG  . LEU A 1 470 ? 7.658   18.346  59.343  1.00 14.48 ? 470  LEU A CG  1 
ATOM   3777  C  CD1 . LEU A 1 470 ? 8.599   17.488  60.249  1.00 11.20 ? 470  LEU A CD1 1 
ATOM   3778  C  CD2 . LEU A 1 470 ? 7.391   17.643  58.014  1.00 14.60 ? 470  LEU A CD2 1 
ATOM   3779  N  N   . GLY A 1 471 ? 7.006   21.808  60.270  1.00 16.18 ? 471  GLY A N   1 
ATOM   3780  C  CA  . GLY A 1 471 ? 7.818   22.959  59.909  1.00 17.25 ? 471  GLY A CA  1 
ATOM   3781  C  C   . GLY A 1 471 ? 8.351   23.694  61.132  1.00 17.76 ? 471  GLY A C   1 
ATOM   3782  O  O   . GLY A 1 471 ? 9.494   24.143  61.128  1.00 17.63 ? 471  GLY A O   1 
ATOM   3783  N  N   . GLU A 1 472 ? 7.526   23.806  62.175  1.00 18.22 ? 472  GLU A N   1 
ATOM   3784  C  CA  . GLU A 1 472 ? 7.956   24.407  63.442  1.00 20.04 ? 472  GLU A CA  1 
ATOM   3785  C  C   . GLU A 1 472 ? 9.068   23.598  64.133  1.00 19.26 ? 472  GLU A C   1 
ATOM   3786  O  O   . GLU A 1 472 ? 10.057  24.166  64.619  1.00 19.57 ? 472  GLU A O   1 
ATOM   3787  C  CB  . GLU A 1 472 ? 6.775   24.575  64.397  1.00 19.83 ? 472  GLU A CB  1 
ATOM   3788  C  CG  . GLU A 1 472 ? 5.782   25.661  64.016  1.00 22.33 ? 472  GLU A CG  1 
ATOM   3789  C  CD  . GLU A 1 472 ? 4.484   25.561  64.829  1.00 24.29 ? 472  GLU A CD  1 
ATOM   3790  O  OE1 . GLU A 1 472 ? 3.610   26.460  64.680  1.00 26.88 ? 472  GLU A OE1 1 
ATOM   3791  O  OE2 . GLU A 1 472 ? 4.343   24.574  65.614  1.00 28.23 ? 472  GLU A OE2 1 
ATOM   3792  N  N   . LYS A 1 473 ? 8.902   22.278  64.182  1.00 18.66 ? 473  LYS A N   1 
ATOM   3793  C  CA  . LYS A 1 473 ? 9.918   21.408  64.776  1.00 18.14 ? 473  LYS A CA  1 
ATOM   3794  C  C   . LYS A 1 473 ? 11.252  21.489  64.044  1.00 17.76 ? 473  LYS A C   1 
ATOM   3795  O  O   . LYS A 1 473 ? 12.292  21.617  64.674  1.00 17.27 ? 473  LYS A O   1 
ATOM   3796  C  CB  . LYS A 1 473 ? 9.422   19.969  64.860  1.00 18.06 ? 473  LYS A CB  1 
ATOM   3797  C  CG  . LYS A 1 473 ? 8.310   19.792  65.868  1.00 18.02 ? 473  LYS A CG  1 
ATOM   3798  C  CD  . LYS A 1 473 ? 7.481   18.560  65.605  1.00 18.22 ? 473  LYS A CD  1 
ATOM   3799  C  CE  . LYS A 1 473 ? 6.666   18.207  66.862  1.00 19.46 ? 473  LYS A CE  1 
ATOM   3800  N  NZ  . LYS A 1 473 ? 5.904   16.916  66.737  1.00 18.51 ? 473  LYS A NZ  1 
ATOM   3801  N  N   . LEU A 1 474 ? 11.204  21.450  62.714  1.00 17.95 ? 474  LEU A N   1 
ATOM   3802  C  CA  . LEU A 1 474 ? 12.399  21.589  61.883  1.00 17.95 ? 474  LEU A CA  1 
ATOM   3803  C  C   . LEU A 1 474 ? 13.079  22.938  62.123  1.00 18.30 ? 474  LEU A C   1 
ATOM   3804  O  O   . LEU A 1 474 ? 14.296  23.014  62.219  1.00 17.91 ? 474  LEU A O   1 
ATOM   3805  C  CB  . LEU A 1 474 ? 12.045  21.423  60.397  1.00 17.57 ? 474  LEU A CB  1 
ATOM   3806  C  CG  . LEU A 1 474 ? 11.813  20.025  59.803  1.00 17.66 ? 474  LEU A CG  1 
ATOM   3807  C  CD1 . LEU A 1 474 ? 11.265  20.151  58.385  1.00 16.93 ? 474  LEU A CD1 1 
ATOM   3808  C  CD2 . LEU A 1 474 ? 13.091  19.206  59.793  1.00 14.92 ? 474  LEU A CD2 1 
ATOM   3809  N  N   . SER A 1 475 ? 12.270  23.989  62.207  1.00 19.16 ? 475  SER A N   1 
ATOM   3810  C  CA  . SER A 1 475 ? 12.723  25.352  62.499  1.00 20.50 ? 475  SER A CA  1 
ATOM   3811  C  C   . SER A 1 475 ? 13.480  25.439  63.827  1.00 20.97 ? 475  SER A C   1 
ATOM   3812  O  O   . SER A 1 475 ? 14.524  26.072  63.904  1.00 20.69 ? 475  SER A O   1 
ATOM   3813  C  CB  . SER A 1 475 ? 11.514  26.295  62.532  1.00 20.50 ? 475  SER A CB  1 
ATOM   3814  O  OG  . SER A 1 475 ? 11.881  27.573  63.012  1.00 21.83 ? 475  SER A OG  1 
ATOM   3815  N  N   . GLU A 1 476 ? 12.939  24.796  64.861  1.00 22.05 ? 476  GLU A N   1 
ATOM   3816  C  CA  . GLU A 1 476 ? 13.548  24.789  66.185  1.00 23.35 ? 476  GLU A CA  1 
ATOM   3817  C  C   . GLU A 1 476 ? 14.851  24.012  66.185  1.00 23.29 ? 476  GLU A C   1 
ATOM   3818  O  O   . GLU A 1 476 ? 15.872  24.508  66.672  1.00 23.26 ? 476  GLU A O   1 
ATOM   3819  C  CB  . GLU A 1 476 ? 12.589  24.220  67.242  1.00 23.93 ? 476  GLU A CB  1 
ATOM   3820  C  CG  . GLU A 1 476 ? 11.500  25.202  67.708  1.00 28.12 ? 476  GLU A CG  1 
ATOM   3821  C  CD  . GLU A 1 476 ? 11.180  25.052  69.204  1.00 32.96 ? 476  GLU A CD  1 
ATOM   3822  O  OE1 . GLU A 1 476 ? 9.978   25.121  69.588  1.00 33.30 ? 476  GLU A OE1 1 
ATOM   3823  O  OE2 . GLU A 1 476 ? 12.147  24.869  69.993  1.00 35.38 ? 476  GLU A OE2 1 
ATOM   3824  N  N   . ALA A 1 477 ? 14.818  22.809  65.613  1.00 23.48 ? 477  ALA A N   1 
ATOM   3825  C  CA  . ALA A 1 477 ? 15.986  21.936  65.586  1.00 23.86 ? 477  ALA A CA  1 
ATOM   3826  C  C   . ALA A 1 477 ? 17.140  22.494  64.744  1.00 24.41 ? 477  ALA A C   1 
ATOM   3827  O  O   . ALA A 1 477 ? 18.272  22.082  64.923  1.00 24.31 ? 477  ALA A O   1 
ATOM   3828  C  CB  . ALA A 1 477 ? 15.598  20.519  65.122  1.00 23.37 ? 477  ALA A CB  1 
ATOM   3829  N  N   . LEU A 1 478 ? 16.861  23.463  63.874  1.00 25.65 ? 478  LEU A N   1 
ATOM   3830  C  CA  . LEU A 1 478 ? 17.827  23.860  62.832  1.00 26.81 ? 478  LEU A CA  1 
ATOM   3831  C  C   . LEU A 1 478 ? 18.837  25.024  62.983  1.00 27.49 ? 478  LEU A C   1 
ATOM   3832  O  O   . LEU A 1 478 ? 19.721  25.109  62.154  1.00 28.74 ? 478  LEU A O   1 
ATOM   3833  C  CB  . LEU A 1 478 ? 17.193  23.837  61.427  1.00 26.49 ? 478  LEU A CB  1 
ATOM   3834  C  CG  . LEU A 1 478 ? 17.621  22.749  60.408  1.00 26.47 ? 478  LEU A CG  1 
ATOM   3835  C  CD1 . LEU A 1 478 ? 18.544  21.635  60.938  1.00 25.29 ? 478  LEU A CD1 1 
ATOM   3836  C  CD2 . LEU A 1 478 ? 16.406  22.160  59.673  1.00 25.26 ? 478  LEU A CD2 1 
ATOM   3837  N  N   . ASN A 1 479 ? 18.744  25.974  63.910  1.00 28.52 ? 479  ASN A N   1 
ATOM   3838  C  CA  . ASN A 1 479 ? 17.573  26.644  64.403  1.00 29.02 ? 479  ASN A CA  1 
ATOM   3839  C  C   . ASN A 1 479 ? 17.452  27.834  63.444  1.00 29.06 ? 479  ASN A C   1 
ATOM   3840  O  O   . ASN A 1 479 ? 18.331  28.700  63.400  1.00 28.42 ? 479  ASN A O   1 
ATOM   3841  C  CB  . ASN A 1 479 ? 17.852  27.195  65.807  1.00 29.55 ? 479  ASN A CB  1 
ATOM   3842  C  CG  . ASN A 1 479 ? 18.692  26.245  66.683  1.00 30.87 ? 479  ASN A CG  1 
ATOM   3843  O  OD1 . ASN A 1 479 ? 19.852  25.935  66.373  1.00 31.17 ? 479  ASN A OD1 1 
ATOM   3844  N  ND2 . ASN A 1 479 ? 18.109  25.812  67.808  1.00 30.83 ? 479  ASN A ND2 1 
ATOM   3845  N  N   . VAL A 1 480 ? 16.394  27.852  62.645  1.00 29.54 ? 480  VAL A N   1 
ATOM   3846  C  CA  . VAL A 1 480 ? 16.188  28.886  61.633  1.00 30.15 ? 480  VAL A CA  1 
ATOM   3847  C  C   . VAL A 1 480 ? 14.766  29.433  61.792  1.00 30.76 ? 480  VAL A C   1 
ATOM   3848  O  O   . VAL A 1 480 ? 13.799  28.676  61.650  1.00 30.77 ? 480  VAL A O   1 
ATOM   3849  C  CB  . VAL A 1 480 ? 16.352  28.303  60.203  1.00 30.14 ? 480  VAL A CB  1 
ATOM   3850  C  CG1 . VAL A 1 480 ? 15.971  29.344  59.141  1.00 30.03 ? 480  VAL A CG1 1 
ATOM   3851  C  CG2 . VAL A 1 480 ? 17.774  27.770  59.971  1.00 29.43 ? 480  VAL A CG2 1 
ATOM   3852  N  N   . ASP A 1 481 ? 14.619  30.724  62.101  1.00 31.24 ? 481  ASP A N   1 
ATOM   3853  C  CA  . ASP A 1 481 ? 13.258  31.246  62.284  1.00 31.87 ? 481  ASP A CA  1 
ATOM   3854  C  C   . ASP A 1 481 ? 12.591  31.582  60.958  1.00 31.16 ? 481  ASP A C   1 
ATOM   3855  O  O   . ASP A 1 481 ? 13.099  32.366  60.159  1.00 30.76 ? 481  ASP A O   1 
ATOM   3856  C  CB  . ASP A 1 481 ? 13.146  32.387  63.322  1.00 32.58 ? 481  ASP A CB  1 
ATOM   3857  C  CG  . ASP A 1 481 ? 13.958  33.611  62.952  1.00 35.55 ? 481  ASP A CG  1 
ATOM   3858  O  OD1 . ASP A 1 481 ? 15.081  33.431  62.421  1.00 38.65 ? 481  ASP A OD1 1 
ATOM   3859  O  OD2 . ASP A 1 481 ? 13.486  34.752  63.205  1.00 36.99 ? 481  ASP A OD2 1 
ATOM   3860  N  N   . ILE A 1 482 ? 11.454  30.935  60.745  1.00 30.62 ? 482  ILE A N   1 
ATOM   3861  C  CA  . ILE A 1 482 ? 10.662  31.068  59.530  1.00 30.42 ? 482  ILE A CA  1 
ATOM   3862  C  C   . ILE A 1 482 ? 9.518   32.052  59.735  1.00 30.11 ? 482  ILE A C   1 
ATOM   3863  O  O   . ILE A 1 482 ? 8.803   32.371  58.787  1.00 29.78 ? 482  ILE A O   1 
ATOM   3864  C  CB  . ILE A 1 482 ? 10.066  29.704  59.107  1.00 30.23 ? 482  ILE A CB  1 
ATOM   3865  C  CG1 . ILE A 1 482 ? 9.382   29.038  60.306  1.00 29.81 ? 482  ILE A CG1 1 
ATOM   3866  C  CG2 . ILE A 1 482 ? 11.150  28.803  58.519  1.00 30.03 ? 482  ILE A CG2 1 
ATOM   3867  C  CD1 . ILE A 1 482 ? 8.470   27.893  59.947  1.00 30.71 ? 482  ILE A CD1 1 
ATOM   3868  N  N   . LYS A 1 483 ? 9.358   32.509  60.979  1.00 30.00 ? 483  LYS A N   1 
ATOM   3869  C  CA  . LYS A 1 483 ? 8.321   33.478  61.377  1.00 30.11 ? 483  LYS A CA  1 
ATOM   3870  C  C   . LYS A 1 483 ? 8.277   34.742  60.517  1.00 29.26 ? 483  LYS A C   1 
ATOM   3871  O  O   . LYS A 1 483 ? 7.192   35.120  60.078  1.00 29.33 ? 483  LYS A O   1 
ATOM   3872  C  CB  . LYS A 1 483 ? 8.476   33.872  62.854  1.00 30.73 ? 483  LYS A CB  1 
ATOM   3873  C  CG  . LYS A 1 483 ? 7.510   33.181  63.803  1.00 33.32 ? 483  LYS A CG  1 
ATOM   3874  C  CD  . LYS A 1 483 ? 7.951   33.348  65.257  1.00 37.25 ? 483  LYS A CD  1 
ATOM   3875  C  CE  . LYS A 1 483 ? 8.751   32.133  65.731  1.00 39.20 ? 483  LYS A CE  1 
ATOM   3876  N  NZ  . LYS A 1 483 ? 8.904   32.150  67.220  1.00 41.12 ? 483  LYS A NZ  1 
ATOM   3877  N  N   . PRO A 1 484 ? 9.447   35.400  60.280  1.00 28.45 ? 484  PRO A N   1 
ATOM   3878  C  CA  . PRO A 1 484 ? 9.494   36.596  59.418  1.00 27.73 ? 484  PRO A CA  1 
ATOM   3879  C  C   . PRO A 1 484 ? 8.905   36.341  58.039  1.00 27.36 ? 484  PRO A C   1 
ATOM   3880  O  O   . PRO A 1 484 ? 8.399   37.260  57.398  1.00 26.94 ? 484  PRO A O   1 
ATOM   3881  C  CB  . PRO A 1 484 ? 10.992  36.868  59.291  1.00 27.84 ? 484  PRO A CB  1 
ATOM   3882  C  CG  . PRO A 1 484 ? 11.577  36.316  60.554  1.00 27.94 ? 484  PRO A CG  1 
ATOM   3883  C  CD  . PRO A 1 484 ? 10.786  35.080  60.820  1.00 27.88 ? 484  PRO A CD  1 
ATOM   3884  N  N   . PHE A 1 485 ? 8.986   35.091  57.595  1.00 27.06 ? 485  PHE A N   1 
ATOM   3885  C  CA  . PHE A 1 485 ? 8.403   34.655  56.332  1.00 26.53 ? 485  PHE A CA  1 
ATOM   3886  C  C   . PHE A 1 485 ? 7.097   33.935  56.680  1.00 26.89 ? 485  PHE A C   1 
ATOM   3887  O  O   . PHE A 1 485 ? 6.326   33.556  55.805  1.00 27.48 ? 485  PHE A O   1 
ATOM   3888  C  CB  . PHE A 1 485 ? 9.371   33.712  55.588  1.00 25.40 ? 485  PHE A CB  1 
ATOM   3889  C  CG  . PHE A 1 485 ? 10.773  34.274  55.422  1.00 23.53 ? 485  PHE A CG  1 
ATOM   3890  C  CD1 . PHE A 1 485 ? 11.739  34.086  56.409  1.00 19.71 ? 485  PHE A CD1 1 
ATOM   3891  C  CD2 . PHE A 1 485 ? 11.124  34.990  54.275  1.00 21.50 ? 485  PHE A CD2 1 
ATOM   3892  C  CE1 . PHE A 1 485 ? 13.027  34.603  56.267  1.00 18.22 ? 485  PHE A CE1 1 
ATOM   3893  C  CE2 . PHE A 1 485 ? 12.411  35.515  54.124  1.00 19.35 ? 485  PHE A CE2 1 
ATOM   3894  C  CZ  . PHE A 1 485 ? 13.366  35.316  55.125  1.00 19.87 ? 485  PHE A CZ  1 
ATOM   3895  N  N   . LYS B 1 6   ? 23.645  33.814  30.924  1.00 22.05 ? 6    LYS B N   1 
ATOM   3896  C  CA  . LYS B 1 6   ? 23.981  32.620  30.088  1.00 22.46 ? 6    LYS B CA  1 
ATOM   3897  C  C   . LYS B 1 6   ? 22.746  31.789  29.731  1.00 20.73 ? 6    LYS B C   1 
ATOM   3898  O  O   . LYS B 1 6   ? 22.052  31.274  30.614  1.00 20.74 ? 6    LYS B O   1 
ATOM   3899  C  CB  . LYS B 1 6   ? 25.012  31.731  30.793  1.00 22.50 ? 6    LYS B CB  1 
ATOM   3900  C  CG  . LYS B 1 6   ? 25.687  30.735  29.855  1.00 23.87 ? 6    LYS B CG  1 
ATOM   3901  C  CD  . LYS B 1 6   ? 26.840  29.980  30.528  1.00 24.81 ? 6    LYS B CD  1 
ATOM   3902  C  CE  . LYS B 1 6   ? 27.869  30.919  31.135  1.00 27.28 ? 6    LYS B CE  1 
ATOM   3903  N  NZ  . LYS B 1 6   ? 29.238  30.436  30.842  1.00 30.10 ? 6    LYS B NZ  1 
ATOM   3904  N  N   . LYS B 1 7   ? 22.501  31.660  28.432  1.00 19.19 ? 7    LYS B N   1 
ATOM   3905  C  CA  . LYS B 1 7   ? 21.358  30.907  27.896  1.00 18.05 ? 7    LYS B CA  1 
ATOM   3906  C  C   . LYS B 1 7   ? 21.569  29.390  27.902  1.00 16.73 ? 7    LYS B C   1 
ATOM   3907  O  O   . LYS B 1 7   ? 22.558  28.878  27.360  1.00 16.15 ? 7    LYS B O   1 
ATOM   3908  C  CB  . LYS B 1 7   ? 21.035  31.350  26.460  1.00 17.86 ? 7    LYS B CB  1 
ATOM   3909  C  CG  . LYS B 1 7   ? 20.400  32.740  26.350  1.00 19.55 ? 7    LYS B CG  1 
ATOM   3910  C  CD  . LYS B 1 7   ? 19.734  32.936  24.994  1.00 21.90 ? 7    LYS B CD  1 
ATOM   3911  C  CE  . LYS B 1 7   ? 19.270  34.364  24.815  1.00 25.13 ? 7    LYS B CE  1 
ATOM   3912  N  NZ  . LYS B 1 7   ? 20.398  35.265  24.399  1.00 27.58 ? 7    LYS B NZ  1 
ATOM   3913  N  N   . LEU B 1 8   ? 20.622  28.693  28.531  1.00 15.46 ? 8    LEU B N   1 
ATOM   3914  C  CA  . LEU B 1 8   ? 20.445  27.252  28.391  1.00 13.93 ? 8    LEU B CA  1 
ATOM   3915  C  C   . LEU B 1 8   ? 20.089  26.906  26.942  1.00 13.88 ? 8    LEU B C   1 
ATOM   3916  O  O   . LEU B 1 8   ? 19.162  27.493  26.362  1.00 13.76 ? 8    LEU B O   1 
ATOM   3917  C  CB  . LEU B 1 8   ? 19.343  26.777  29.339  1.00 13.75 ? 8    LEU B CB  1 
ATOM   3918  C  CG  . LEU B 1 8   ? 18.906  25.312  29.341  1.00 13.42 ? 8    LEU B CG  1 
ATOM   3919  C  CD1 . LEU B 1 8   ? 20.041  24.351  29.743  1.00 11.55 ? 8    LEU B CD1 1 
ATOM   3920  C  CD2 . LEU B 1 8   ? 17.708  25.152  30.259  1.00 12.23 ? 8    LEU B CD2 1 
ATOM   3921  N  N   . THR B 1 9   ? 20.835  25.962  26.365  1.00 13.05 ? 9    THR B N   1 
ATOM   3922  C  CA  . THR B 1 9   ? 20.668  25.547  24.976  1.00 12.31 ? 9    THR B CA  1 
ATOM   3923  C  C   . THR B 1 9   ? 20.613  24.014  24.840  1.00 12.47 ? 9    THR B C   1 
ATOM   3924  O  O   . THR B 1 9   ? 21.056  23.289  25.731  1.00 12.36 ? 9    THR B O   1 
ATOM   3925  C  CB  . THR B 1 9   ? 21.850  26.023  24.104  1.00 12.54 ? 9    THR B CB  1 
ATOM   3926  O  OG1 . THR B 1 9   ? 23.039  25.331  24.509  1.00 12.03 ? 9    THR B OG1 1 
ATOM   3927  C  CG2 . THR B 1 9   ? 22.073  27.516  24.225  1.00 10.92 ? 9    THR B CG2 1 
ATOM   3928  N  N   . THR B 1 10  ? 20.069  23.537  23.720  1.00 11.55 ? 10   THR B N   1 
ATOM   3929  C  CA  . THR B 1 10  ? 20.197  22.152  23.327  1.00 11.54 ? 10   THR B CA  1 
ATOM   3930  C  C   . THR B 1 10  ? 21.643  21.925  22.807  1.00 11.74 ? 10   THR B C   1 
ATOM   3931  O  O   . THR B 1 10  ? 22.429  22.874  22.748  1.00 11.75 ? 10   THR B O   1 
ATOM   3932  C  CB  . THR B 1 10  ? 19.198  21.810  22.220  1.00 11.51 ? 10   THR B CB  1 
ATOM   3933  O  OG1 . THR B 1 10  ? 19.600  22.454  21.014  1.00 11.33 ? 10   THR B OG1 1 
ATOM   3934  C  CG2 . THR B 1 10  ? 17.793  22.294  22.570  1.00 12.41 ? 10   THR B CG2 1 
ATOM   3935  N  N   . ASN B 1 11  ? 21.990  20.689  22.428  1.00 11.08 ? 11   ASN B N   1 
ATOM   3936  C  CA  . ASN B 1 11  ? 23.312  20.400  21.868  1.00 11.16 ? 11   ASN B CA  1 
ATOM   3937  C  C   . ASN B 1 11  ? 23.446  20.975  20.458  1.00 11.77 ? 11   ASN B C   1 
ATOM   3938  O  O   . ASN B 1 11  ? 24.534  20.958  19.865  1.00 11.50 ? 11   ASN B O   1 
ATOM   3939  C  CB  . ASN B 1 11  ? 23.568  18.895  21.808  1.00 10.75 ? 11   ASN B CB  1 
ATOM   3940  C  CG  . ASN B 1 11  ? 23.659  18.249  23.184  1.00 10.55 ? 11   ASN B CG  1 
ATOM   3941  O  OD1 . ASN B 1 11  ? 23.422  17.036  23.318  1.00 11.31 ? 11   ASN B OD1 1 
ATOM   3942  N  ND2 . ASN B 1 11  ? 24.006  19.037  24.208  1.00 5.62  ? 11   ASN B ND2 1 
ATOM   3943  N  N   . GLN B 1 12  ? 22.314  21.445  19.930  1.00 11.66 ? 12   GLN B N   1 
ATOM   3944  C  CA  . GLN B 1 12  ? 22.242  22.129  18.648  1.00 11.47 ? 12   GLN B CA  1 
ATOM   3945  C  C   . GLN B 1 12  ? 22.493  23.646  18.770  1.00 11.32 ? 12   GLN B C   1 
ATOM   3946  O  O   . GLN B 1 12  ? 22.558  24.339  17.771  1.00 11.45 ? 12   GLN B O   1 
ATOM   3947  C  CB  . GLN B 1 12  ? 20.880  21.856  17.978  1.00 11.07 ? 12   GLN B CB  1 
ATOM   3948  C  CG  . GLN B 1 12  ? 20.560  20.382  17.775  1.00 10.13 ? 12   GLN B CG  1 
ATOM   3949  C  CD  . GLN B 1 12  ? 21.485  19.708  16.773  1.00 12.36 ? 12   GLN B CD  1 
ATOM   3950  O  OE1 . GLN B 1 12  ? 22.169  20.385  16.006  1.00 13.80 ? 12   GLN B OE1 1 
ATOM   3951  N  NE2 . GLN B 1 12  ? 21.504  18.370  16.764  1.00 10.06 ? 12   GLN B NE2 1 
ATOM   3952  N  N   . GLY B 1 13  ? 22.639  24.164  19.983  1.00 11.33 ? 13   GLY B N   1 
ATOM   3953  C  CA  . GLY B 1 13  ? 22.868  25.591  20.144  1.00 11.22 ? 13   GLY B CA  1 
ATOM   3954  C  C   . GLY B 1 13  ? 21.600  26.436  20.123  1.00 11.56 ? 13   GLY B C   1 
ATOM   3955  O  O   . GLY B 1 13  ? 21.665  27.683  20.039  1.00 11.23 ? 13   GLY B O   1 
ATOM   3956  N  N   . VAL B 1 14  ? 20.447  25.770  20.217  1.00 11.50 ? 14   VAL B N   1 
ATOM   3957  C  CA  . VAL B 1 14  ? 19.148  26.448  20.208  1.00 11.50 ? 14   VAL B CA  1 
ATOM   3958  C  C   . VAL B 1 14  ? 18.748  26.805  21.636  1.00 11.86 ? 14   VAL B C   1 
ATOM   3959  O  O   . VAL B 1 14  ? 18.718  25.913  22.493  1.00 12.56 ? 14   VAL B O   1 
ATOM   3960  C  CB  . VAL B 1 14  ? 18.059  25.545  19.578  1.00 11.97 ? 14   VAL B CB  1 
ATOM   3961  C  CG1 . VAL B 1 14  ? 16.633  26.142  19.781  1.00 11.47 ? 14   VAL B CG1 1 
ATOM   3962  C  CG2 . VAL B 1 14  ? 18.357  25.299  18.104  1.00 10.40 ? 14   VAL B CG2 1 
ATOM   3963  N  N   . PRO B 1 15  ? 18.443  28.100  21.907  1.00 11.51 ? 15   PRO B N   1 
ATOM   3964  C  CA  . PRO B 1 15  ? 18.004  28.460  23.258  1.00 11.20 ? 15   PRO B CA  1 
ATOM   3965  C  C   . PRO B 1 15  ? 16.739  27.697  23.669  1.00 11.22 ? 15   PRO B C   1 
ATOM   3966  O  O   . PRO B 1 15  ? 15.791  27.616  22.891  1.00 11.45 ? 15   PRO B O   1 
ATOM   3967  C  CB  . PRO B 1 15  ? 17.717  29.970  23.162  1.00 10.88 ? 15   PRO B CB  1 
ATOM   3968  C  CG  . PRO B 1 15  ? 18.428  30.442  21.958  1.00 10.67 ? 15   PRO B CG  1 
ATOM   3969  C  CD  . PRO B 1 15  ? 18.495  29.274  21.011  1.00 11.74 ? 15   PRO B CD  1 
ATOM   3970  N  N   . ILE B 1 16  ? 16.764  27.121  24.870  1.00 11.18 ? 16   ILE B N   1 
ATOM   3971  C  CA  . ILE B 1 16  ? 15.612  26.488  25.507  1.00 10.49 ? 16   ILE B CA  1 
ATOM   3972  C  C   . ILE B 1 16  ? 14.809  27.568  26.256  1.00 10.74 ? 16   ILE B C   1 
ATOM   3973  O  O   . ILE B 1 16  ? 15.371  28.439  26.939  1.00 11.39 ? 16   ILE B O   1 
ATOM   3974  C  CB  . ILE B 1 16  ? 16.079  25.358  26.490  1.00 10.81 ? 16   ILE B CB  1 
ATOM   3975  C  CG1 . ILE B 1 16  ? 16.638  24.163  25.697  1.00 10.24 ? 16   ILE B CG1 1 
ATOM   3976  C  CG2 . ILE B 1 16  ? 14.960  24.951  27.471  1.00 9.57  ? 16   ILE B CG2 1 
ATOM   3977  C  CD1 . ILE B 1 16  ? 17.525  23.201  26.500  1.00 9.73  ? 16   ILE B CD1 1 
ATOM   3978  N  N   . GLY B 1 17  ? 13.493  27.514  26.110  1.00 10.39 ? 17   GLY B N   1 
ATOM   3979  C  CA  . GLY B 1 17  ? 12.607  28.439  26.769  1.00 9.93  ? 17   GLY B CA  1 
ATOM   3980  C  C   . GLY B 1 17  ? 11.921  27.825  27.955  1.00 10.09 ? 17   GLY B C   1 
ATOM   3981  O  O   . GLY B 1 17  ? 11.694  28.508  28.957  1.00 10.37 ? 17   GLY B O   1 
ATOM   3982  N  N   . ASP B 1 18  ? 11.580  26.537  27.847  1.00 10.39 ? 18   ASP B N   1 
ATOM   3983  C  CA  . ASP B 1 18  ? 10.968  25.786  28.962  1.00 10.60 ? 18   ASP B CA  1 
ATOM   3984  C  C   . ASP B 1 18  ? 11.697  24.448  29.214  1.00 10.36 ? 18   ASP B C   1 
ATOM   3985  O  O   . ASP B 1 18  ? 11.549  23.497  28.453  1.00 9.88  ? 18   ASP B O   1 
ATOM   3986  C  CB  . ASP B 1 18  ? 9.472   25.573  28.690  1.00 10.14 ? 18   ASP B CB  1 
ATOM   3987  C  CG  . ASP B 1 18  ? 8.730   24.942  29.863  1.00 13.12 ? 18   ASP B CG  1 
ATOM   3988  O  OD1 . ASP B 1 18  ? 7.485   24.993  29.859  1.00 15.37 ? 18   ASP B OD1 1 
ATOM   3989  O  OD2 . ASP B 1 18  ? 9.357   24.394  30.802  1.00 16.59 ? 18   ASP B OD2 1 
ATOM   3990  N  N   . ASN B 1 19  ? 12.472  24.394  30.295  1.00 11.07 ? 19   ASN B N   1 
ATOM   3991  C  CA  . ASN B 1 19  ? 13.242  23.196  30.696  1.00 11.34 ? 19   ASN B CA  1 
ATOM   3992  C  C   . ASN B 1 19  ? 12.529  22.410  31.778  1.00 11.44 ? 19   ASN B C   1 
ATOM   3993  O  O   . ASN B 1 19  ? 13.155  21.596  32.486  1.00 11.76 ? 19   ASN B O   1 
ATOM   3994  C  CB  . ASN B 1 19  ? 14.634  23.607  31.210  1.00 11.39 ? 19   ASN B CB  1 
ATOM   3995  C  CG  . ASN B 1 19  ? 15.598  22.408  31.395  1.00 11.41 ? 19   ASN B CG  1 
ATOM   3996  O  OD1 . ASN B 1 19  ? 15.717  21.523  30.530  1.00 8.77  ? 19   ASN B OD1 1 
ATOM   3997  N  ND2 . ASN B 1 19  ? 16.301  22.402  32.523  1.00 8.24  ? 19   ASN B ND2 1 
ATOM   3998  N  N   . GLN B 1 20  ? 11.224  22.659  31.911  1.00 11.07 ? 20   GLN B N   1 
ATOM   3999  C  CA  . GLN B 1 20  ? 10.420  22.077  32.988  1.00 10.68 ? 20   GLN B CA  1 
ATOM   4000  C  C   . GLN B 1 20  ? 9.287   21.187  32.476  1.00 10.47 ? 20   GLN B C   1 
ATOM   4001  O  O   . GLN B 1 20  ? 8.863   20.287  33.183  1.00 10.48 ? 20   GLN B O   1 
ATOM   4002  C  CB  . GLN B 1 20  ? 9.817   23.178  33.889  1.00 10.83 ? 20   GLN B CB  1 
ATOM   4003  C  CG  . GLN B 1 20  ? 10.713  24.382  34.225  1.00 11.01 ? 20   GLN B CG  1 
ATOM   4004  C  CD  . GLN B 1 20  ? 12.102  24.000  34.771  1.00 12.24 ? 20   GLN B CD  1 
ATOM   4005  O  OE1 . GLN B 1 20  ? 12.242  23.117  35.630  1.00 11.69 ? 20   GLN B OE1 1 
ATOM   4006  N  NE2 . GLN B 1 20  ? 13.129  24.691  34.281  1.00 12.93 ? 20   GLN B NE2 1 
ATOM   4007  N  N   . ASN B 1 21  ? 8.787   21.453  31.267  1.00 10.43 ? 21   ASN B N   1 
ATOM   4008  C  CA  . ASN B 1 21  ? 7.654   20.706  30.705  1.00 10.53 ? 21   ASN B CA  1 
ATOM   4009  C  C   . ASN B 1 21  ? 7.915   20.021  29.353  1.00 10.69 ? 21   ASN B C   1 
ATOM   4010  O  O   . ASN B 1 21  ? 8.426   20.636  28.402  1.00 9.67  ? 21   ASN B O   1 
ATOM   4011  C  CB  . ASN B 1 21  ? 6.419   21.618  30.590  1.00 10.95 ? 21   ASN B CB  1 
ATOM   4012  C  CG  . ASN B 1 21  ? 6.072   22.313  31.911  1.00 11.04 ? 21   ASN B CG  1 
ATOM   4013  O  OD1 . ASN B 1 21  ? 5.779   21.657  32.911  1.00 12.05 ? 21   ASN B OD1 1 
ATOM   4014  N  ND2 . ASN B 1 21  ? 6.106   23.641  31.911  1.00 9.67  ? 21   ASN B ND2 1 
ATOM   4015  N  N   . SER B 1 22  ? 7.546   18.743  29.274  1.00 10.89 ? 22   SER B N   1 
ATOM   4016  C  CA  . SER B 1 22  ? 7.526   18.019  27.993  1.00 10.99 ? 22   SER B CA  1 
ATOM   4017  C  C   . SER B 1 22  ? 6.429   18.572  27.082  1.00 11.02 ? 22   SER B C   1 
ATOM   4018  O  O   . SER B 1 22  ? 5.422   19.091  27.564  1.00 10.91 ? 22   SER B O   1 
ATOM   4019  C  CB  . SER B 1 22  ? 7.277   16.523  28.224  1.00 10.89 ? 22   SER B CB  1 
ATOM   4020  O  OG  . SER B 1 22  ? 8.303   15.925  29.007  1.00 11.83 ? 22   SER B OG  1 
ATOM   4021  N  N   . ARG B 1 23  ? 6.623   18.462  25.771  1.00 11.21 ? 23   ARG B N   1 
ATOM   4022  C  CA  . ARG B 1 23  ? 5.555   18.782  24.839  1.00 11.63 ? 23   ARG B CA  1 
ATOM   4023  C  C   . ARG B 1 23  ? 4.604   17.576  24.758  1.00 11.73 ? 23   ARG B C   1 
ATOM   4024  O  O   . ARG B 1 23  ? 5.014   16.467  24.433  1.00 11.77 ? 23   ARG B O   1 
ATOM   4025  C  CB  . ARG B 1 23  ? 6.103   19.182  23.464  1.00 11.20 ? 23   ARG B CB  1 
ATOM   4026  C  CG  . ARG B 1 23  ? 5.098   19.944  22.658  1.00 11.16 ? 23   ARG B CG  1 
ATOM   4027  C  CD  . ARG B 1 23  ? 5.545   20.240  21.224  1.00 12.67 ? 23   ARG B CD  1 
ATOM   4028  N  NE  . ARG B 1 23  ? 4.498   20.986  20.522  1.00 12.89 ? 23   ARG B NE  1 
ATOM   4029  C  CZ  . ARG B 1 23  ? 4.492   22.311  20.332  1.00 16.49 ? 23   ARG B CZ  1 
ATOM   4030  N  NH1 . ARG B 1 23  ? 3.465   22.872  19.698  1.00 17.17 ? 23   ARG B NH1 1 
ATOM   4031  N  NH2 . ARG B 1 23  ? 5.501   23.085  20.753  1.00 15.23 ? 23   ARG B NH2 1 
ATOM   4032  N  N   . THR B 1 24  ? 3.340   17.816  25.087  1.00 11.94 ? 24   THR B N   1 
ATOM   4033  C  CA  . THR B 1 24  ? 2.337   16.778  25.202  1.00 12.30 ? 24   THR B CA  1 
ATOM   4034  C  C   . THR B 1 24  ? 1.089   17.101  24.367  1.00 12.63 ? 24   THR B C   1 
ATOM   4035  O  O   . THR B 1 24  ? 0.783   18.279  24.089  1.00 12.95 ? 24   THR B O   1 
ATOM   4036  C  CB  . THR B 1 24  ? 1.913   16.557  26.702  1.00 12.92 ? 24   THR B CB  1 
ATOM   4037  O  OG1 . THR B 1 24  ? 1.569   17.816  27.314  1.00 11.67 ? 24   THR B OG1 1 
ATOM   4038  C  CG2 . THR B 1 24  ? 3.044   15.874  27.504  1.00 11.94 ? 24   THR B CG2 1 
ATOM   4039  N  N   . ALA B 1 25  ? 0.366   16.052  23.971  1.00 12.06 ? 25   ALA B N   1 
ATOM   4040  C  CA  . ALA B 1 25  ? -0.811  16.218  23.159  1.00 11.63 ? 25   ALA B CA  1 
ATOM   4041  C  C   . ALA B 1 25  ? -1.955  16.694  24.060  1.00 11.84 ? 25   ALA B C   1 
ATOM   4042  O  O   . ALA B 1 25  ? -2.894  15.943  24.354  1.00 11.61 ? 25   ALA B O   1 
ATOM   4043  C  CB  . ALA B 1 25  ? -1.156  14.914  22.432  1.00 11.53 ? 25   ALA B CB  1 
ATOM   4044  N  N   . GLY B 1 26  ? -1.854  17.955  24.487  1.00 12.11 ? 26   GLY B N   1 
ATOM   4045  C  CA  . GLY B 1 26  ? -2.765  18.547  25.466  1.00 11.59 ? 26   GLY B CA  1 
ATOM   4046  C  C   . GLY B 1 26  ? -2.130  18.645  26.844  1.00 11.87 ? 26   GLY B C   1 
ATOM   4047  O  O   . GLY B 1 26  ? -1.154  17.957  27.136  1.00 12.37 ? 26   GLY B O   1 
ATOM   4048  N  N   . ARG B 1 27  ? -2.699  19.494  27.696  1.00 11.63 ? 27   ARG B N   1 
ATOM   4049  C  CA  . ARG B 1 27  ? -2.223  19.691  29.037  1.00 11.29 ? 27   ARG B CA  1 
ATOM   4050  C  C   . ARG B 1 27  ? -2.126  18.377  29.844  1.00 11.40 ? 27   ARG B C   1 
ATOM   4051  O  O   . ARG B 1 27  ? -1.184  18.191  30.618  1.00 10.72 ? 27   ARG B O   1 
ATOM   4052  C  CB  . ARG B 1 27  ? -3.118  20.713  29.760  1.00 11.78 ? 27   ARG B CB  1 
ATOM   4053  C  CG  . ARG B 1 27  ? -2.531  21.277  31.049  1.00 10.34 ? 27   ARG B CG  1 
ATOM   4054  C  CD  . ARG B 1 27  ? -3.280  22.487  31.523  1.00 11.63 ? 27   ARG B CD  1 
ATOM   4055  N  NE  . ARG B 1 27  ? -3.314  23.550  30.517  1.00 14.53 ? 27   ARG B NE  1 
ATOM   4056  C  CZ  . ARG B 1 27  ? -2.470  24.578  30.463  1.00 16.24 ? 27   ARG B CZ  1 
ATOM   4057  N  NH1 . ARG B 1 27  ? -1.484  24.691  31.361  1.00 15.94 ? 27   ARG B NH1 1 
ATOM   4058  N  NH2 . ARG B 1 27  ? -2.604  25.487  29.492  1.00 15.74 ? 27   ARG B NH2 1 
ATOM   4059  N  N   . ARG B 1 28  ? -3.096  17.482  29.678  1.00 11.03 ? 28   ARG B N   1 
ATOM   4060  C  CA  . ARG B 1 28  ? -3.076  16.221  30.418  1.00 11.62 ? 28   ARG B CA  1 
ATOM   4061  C  C   . ARG B 1 28  ? -3.000  14.994  29.491  1.00 11.25 ? 28   ARG B C   1 
ATOM   4062  O  O   . ARG B 1 28  ? -3.376  13.878  29.882  1.00 11.57 ? 28   ARG B O   1 
ATOM   4063  C  CB  . ARG B 1 28  ? -4.286  16.127  31.368  1.00 11.15 ? 28   ARG B CB  1 
ATOM   4064  C  CG  . ARG B 1 28  ? -4.348  17.197  32.486  1.00 12.72 ? 28   ARG B CG  1 
ATOM   4065  C  CD  . ARG B 1 28  ? -5.253  16.756  33.680  1.00 13.09 ? 28   ARG B CD  1 
ATOM   4066  N  NE  . ARG B 1 28  ? -6.192  15.756  33.187  1.00 17.07 ? 28   ARG B NE  1 
ATOM   4067  C  CZ  . ARG B 1 28  ? -6.300  14.498  33.600  1.00 14.35 ? 28   ARG B CZ  1 
ATOM   4068  N  NH1 . ARG B 1 28  ? -7.177  13.727  32.986  1.00 12.50 ? 28   ARG B NH1 1 
ATOM   4069  N  NH2 . ARG B 1 28  ? -5.585  14.027  34.627  1.00 14.15 ? 28   ARG B NH2 1 
ATOM   4070  N  N   . GLY B 1 29  ? -2.501  15.212  28.274  1.00 11.00 ? 29   GLY B N   1 
ATOM   4071  C  CA  . GLY B 1 29  ? -2.392  14.167  27.257  1.00 10.28 ? 29   GLY B CA  1 
ATOM   4072  C  C   . GLY B 1 29  ? -0.990  13.629  27.070  1.00 10.15 ? 29   GLY B C   1 
ATOM   4073  O  O   . GLY B 1 29  ? -0.047  14.084  27.705  1.00 10.82 ? 29   GLY B O   1 
ATOM   4074  N  N   . PRO B 1 30  ? -0.829  12.677  26.161  1.00 10.19 ? 30   PRO B N   1 
ATOM   4075  C  CA  . PRO B 1 30  ? 0.464   11.982  26.029  1.00 10.08 ? 30   PRO B CA  1 
ATOM   4076  C  C   . PRO B 1 30  ? 1.592   12.787  25.313  1.00 9.62  ? 30   PRO B C   1 
ATOM   4077  O  O   . PRO B 1 30  ? 1.319   13.714  24.564  1.00 9.25  ? 30   PRO B O   1 
ATOM   4078  C  CB  . PRO B 1 30  ? 0.089   10.708  25.262  1.00 10.17 ? 30   PRO B CB  1 
ATOM   4079  C  CG  . PRO B 1 30  ? -1.093  11.131  24.414  1.00 10.94 ? 30   PRO B CG  1 
ATOM   4080  C  CD  . PRO B 1 30  ? -1.842  12.196  25.198  1.00 10.10 ? 30   PRO B CD  1 
ATOM   4081  N  N   . THR B 1 31  ? 2.840   12.407  25.585  1.00 9.09  ? 31   THR B N   1 
ATOM   4082  C  CA  . THR B 1 31  ? 4.032   13.138  25.189  1.00 8.51  ? 31   THR B CA  1 
ATOM   4083  C  C   . THR B 1 31  ? 4.237   12.946  23.684  1.00 8.79  ? 31   THR B C   1 
ATOM   4084  O  O   . THR B 1 31  ? 3.901   11.891  23.135  1.00 8.59  ? 31   THR B O   1 
ATOM   4085  C  CB  . THR B 1 31  ? 5.299   12.646  26.013  1.00 8.54  ? 31   THR B CB  1 
ATOM   4086  O  OG1 . THR B 1 31  ? 5.164   12.986  27.402  1.00 7.65  ? 31   THR B OG1 1 
ATOM   4087  C  CG2 . THR B 1 31  ? 6.593   13.256  25.508  1.00 7.74  ? 31   THR B CG2 1 
ATOM   4088  N  N   . LEU B 1 32  ? 4.803   13.962  23.033  1.00 8.47  ? 32   LEU B N   1 
ATOM   4089  C  CA  . LEU B 1 32  ? 5.020   13.944  21.591  1.00 8.55  ? 32   LEU B CA  1 
ATOM   4090  C  C   . LEU B 1 32  ? 6.428   13.495  21.188  1.00 8.88  ? 32   LEU B C   1 
ATOM   4091  O  O   . LEU B 1 32  ? 7.442   13.959  21.734  1.00 8.73  ? 32   LEU B O   1 
ATOM   4092  C  CB  . LEU B 1 32  ? 4.731   15.332  20.998  1.00 8.62  ? 32   LEU B CB  1 
ATOM   4093  C  CG  . LEU B 1 32  ? 3.290   15.872  21.121  1.00 7.26  ? 32   LEU B CG  1 
ATOM   4094  C  CD1 . LEU B 1 32  ? 3.109   17.201  20.344  1.00 2.66  ? 32   LEU B CD1 1 
ATOM   4095  C  CD2 . LEU B 1 32  ? 2.267   14.798  20.697  1.00 2.00  ? 32   LEU B CD2 1 
ATOM   4096  N  N   . LEU B 1 33  ? 6.480   12.596  20.213  1.00 8.74  ? 33   LEU B N   1 
ATOM   4097  C  CA  . LEU B 1 33  ? 7.744   12.172  19.640  1.00 9.13  ? 33   LEU B CA  1 
ATOM   4098  C  C   . LEU B 1 33  ? 8.559   13.383  19.127  1.00 9.79  ? 33   LEU B C   1 
ATOM   4099  O  O   . LEU B 1 33  ? 9.788   13.336  19.045  1.00 10.22 ? 33   LEU B O   1 
ATOM   4100  C  CB  . LEU B 1 33  ? 7.474   11.163  18.515  1.00 8.96  ? 33   LEU B CB  1 
ATOM   4101  C  CG  . LEU B 1 33  ? 8.646   10.459  17.859  1.00 8.11  ? 33   LEU B CG  1 
ATOM   4102  C  CD1 . LEU B 1 33  ? 9.434   9.676   18.895  1.00 8.34  ? 33   LEU B CD1 1 
ATOM   4103  C  CD2 . LEU B 1 33  ? 8.141   9.530   16.786  1.00 8.63  ? 33   LEU B CD2 1 
ATOM   4104  N  N   . GLU B 1 34  ? 7.874   14.465  18.773  1.00 9.41  ? 34   GLU B N   1 
ATOM   4105  C  CA  . GLU B 1 34  ? 8.567   15.632  18.248  1.00 9.66  ? 34   GLU B CA  1 
ATOM   4106  C  C   . GLU B 1 34  ? 9.219   16.510  19.298  1.00 9.06  ? 34   GLU B C   1 
ATOM   4107  O  O   . GLU B 1 34  ? 9.785   17.537  18.953  1.00 9.29  ? 34   GLU B O   1 
ATOM   4108  C  CB  . GLU B 1 34  ? 7.660   16.491  17.357  1.00 9.53  ? 34   GLU B CB  1 
ATOM   4109  C  CG  . GLU B 1 34  ? 6.533   17.162  18.068  1.00 9.91  ? 34   GLU B CG  1 
ATOM   4110  C  CD  . GLU B 1 34  ? 5.727   18.028  17.130  1.00 14.28 ? 34   GLU B CD  1 
ATOM   4111  O  OE1 . GLU B 1 34  ? 5.739   19.254  17.341  1.00 16.16 ? 34   GLU B OE1 1 
ATOM   4112  O  OE2 . GLU B 1 34  ? 5.088   17.494  16.188  1.00 15.68 ? 34   GLU B OE2 1 
ATOM   4113  N  N   . ASP B 1 35  ? 9.140   16.138  20.568  1.00 8.73  ? 35   ASP B N   1 
ATOM   4114  C  CA  . ASP B 1 35  ? 9.855   16.916  21.594  1.00 8.10  ? 35   ASP B CA  1 
ATOM   4115  C  C   . ASP B 1 35  ? 11.361  16.650  21.475  1.00 8.32  ? 35   ASP B C   1 
ATOM   4116  O  O   . ASP B 1 35  ? 11.933  15.835  22.225  1.00 8.06  ? 35   ASP B O   1 
ATOM   4117  C  CB  . ASP B 1 35  ? 9.350   16.589  22.985  1.00 7.06  ? 35   ASP B CB  1 
ATOM   4118  C  CG  . ASP B 1 35  ? 9.818   17.585  24.012  1.00 7.93  ? 35   ASP B CG  1 
ATOM   4119  O  OD1 . ASP B 1 35  ? 9.143   17.695  25.064  1.00 4.78  ? 35   ASP B OD1 1 
ATOM   4120  O  OD2 . ASP B 1 35  ? 10.848  18.276  23.763  1.00 8.13  ? 35   ASP B OD2 1 
ATOM   4121  N  N   . TYR B 1 36  ? 11.989  17.329  20.509  1.00 8.61  ? 36   TYR B N   1 
ATOM   4122  C  CA  . TYR B 1 36  ? 13.410  17.120  20.230  1.00 9.04  ? 36   TYR B CA  1 
ATOM   4123  C  C   . TYR B 1 36  ? 14.244  17.414  21.467  1.00 9.48  ? 36   TYR B C   1 
ATOM   4124  O  O   . TYR B 1 36  ? 15.215  16.699  21.738  1.00 10.24 ? 36   TYR B O   1 
ATOM   4125  C  CB  . TYR B 1 36  ? 13.928  17.935  19.027  1.00 8.81  ? 36   TYR B CB  1 
ATOM   4126  C  CG  . TYR B 1 36  ? 15.437  17.796  18.891  1.00 8.44  ? 36   TYR B CG  1 
ATOM   4127  C  CD1 . TYR B 1 36  ? 16.000  16.686  18.232  1.00 7.63  ? 36   TYR B CD1 1 
ATOM   4128  C  CD2 . TYR B 1 36  ? 16.301  18.737  19.469  1.00 6.99  ? 36   TYR B CD2 1 
ATOM   4129  C  CE1 . TYR B 1 36  ? 17.398  16.523  18.133  1.00 7.27  ? 36   TYR B CE1 1 
ATOM   4130  C  CE2 . TYR B 1 36  ? 17.711  18.588  19.385  1.00 7.67  ? 36   TYR B CE2 1 
ATOM   4131  C  CZ  . TYR B 1 36  ? 18.243  17.471  18.721  1.00 8.43  ? 36   TYR B CZ  1 
ATOM   4132  O  OH  . TYR B 1 36  ? 19.609  17.301  18.637  1.00 9.81  ? 36   TYR B OH  1 
ATOM   4133  N  N   . GLN B 1 37  ? 13.847  18.452  22.207  1.00 9.16  ? 37   GLN B N   1 
ATOM   4134  C  CA  . GLN B 1 37  ? 14.575  18.931  23.377  1.00 9.07  ? 37   GLN B CA  1 
ATOM   4135  C  C   . GLN B 1 37  ? 14.613  17.843  24.459  1.00 8.97  ? 37   GLN B C   1 
ATOM   4136  O  O   . GLN B 1 37  ? 15.674  17.572  25.024  1.00 8.80  ? 37   GLN B O   1 
ATOM   4137  C  CB  . GLN B 1 37  ? 13.926  20.222  23.903  1.00 8.89  ? 37   GLN B CB  1 
ATOM   4138  C  CG  . GLN B 1 37  ? 14.424  20.692  25.251  1.00 8.02  ? 37   GLN B CG  1 
ATOM   4139  C  CD  . GLN B 1 37  ? 13.594  21.840  25.822  1.00 10.21 ? 37   GLN B CD  1 
ATOM   4140  O  OE1 . GLN B 1 37  ? 13.373  22.861  25.160  1.00 9.56  ? 37   GLN B OE1 1 
ATOM   4141  N  NE2 . GLN B 1 37  ? 13.144  21.682  27.075  1.00 10.19 ? 37   GLN B NE2 1 
ATOM   4142  N  N   . LEU B 1 38  ? 13.455  17.226  24.733  1.00 8.82  ? 38   LEU B N   1 
ATOM   4143  C  CA  . LEU B 1 38  ? 13.340  16.160  25.731  1.00 8.09  ? 38   LEU B CA  1 
ATOM   4144  C  C   . LEU B 1 38  ? 14.178  14.943  25.340  1.00 8.51  ? 38   LEU B C   1 
ATOM   4145  O  O   . LEU B 1 38  ? 14.931  14.409  26.148  1.00 7.81  ? 38   LEU B O   1 
ATOM   4146  C  CB  . LEU B 1 38  ? 11.871  15.744  25.931  1.00 7.57  ? 38   LEU B CB  1 
ATOM   4147  C  CG  . LEU B 1 38  ? 11.649  14.530  26.854  1.00 7.83  ? 38   LEU B CG  1 
ATOM   4148  C  CD1 . LEU B 1 38  ? 11.877  14.875  28.358  1.00 6.58  ? 38   LEU B CD1 1 
ATOM   4149  C  CD2 . LEU B 1 38  ? 10.312  13.831  26.672  1.00 7.50  ? 38   LEU B CD2 1 
ATOM   4150  N  N   . ILE B 1 39  ? 14.050  14.525  24.082  1.00 9.38  ? 39   ILE B N   1 
ATOM   4151  C  CA  . ILE B 1 39  ? 14.667  13.293  23.610  1.00 9.34  ? 39   ILE B CA  1 
ATOM   4152  C  C   . ILE B 1 39  ? 16.178  13.425  23.537  1.00 10.35 ? 39   ILE B C   1 
ATOM   4153  O  O   . ILE B 1 39  ? 16.898  12.507  23.961  1.00 11.11 ? 39   ILE B O   1 
ATOM   4154  C  CB  . ILE B 1 39  ? 14.068  12.876  22.280  1.00 9.96  ? 39   ILE B CB  1 
ATOM   4155  C  CG1 . ILE B 1 39  ? 12.575  12.513  22.510  1.00 9.96  ? 39   ILE B CG1 1 
ATOM   4156  C  CG2 . ILE B 1 39  ? 14.903  11.743  21.624  1.00 8.23  ? 39   ILE B CG2 1 
ATOM   4157  C  CD1 . ILE B 1 39  ? 11.787  12.298  21.262  1.00 10.76 ? 39   ILE B CD1 1 
ATOM   4158  N  N   . GLU B 1 40  ? 16.675  14.569  23.059  1.00 10.08 ? 40   GLU B N   1 
ATOM   4159  C  CA  . GLU B 1 40  ? 18.123  14.825  23.089  1.00 9.64  ? 40   GLU B CA  1 
ATOM   4160  C  C   . GLU B 1 40  ? 18.655  14.740  24.505  1.00 8.95  ? 40   GLU B C   1 
ATOM   4161  O  O   . GLU B 1 40  ? 19.685  14.143  24.744  1.00 9.61  ? 40   GLU B O   1 
ATOM   4162  C  CB  . GLU B 1 40  ? 18.471  16.189  22.492  1.00 9.77  ? 40   GLU B CB  1 
ATOM   4163  C  CG  . GLU B 1 40  ? 19.974  16.477  22.541  1.00 11.47 ? 40   GLU B CG  1 
ATOM   4164  C  CD  . GLU B 1 40  ? 20.305  17.910  22.205  1.00 11.85 ? 40   GLU B CD  1 
ATOM   4165  O  OE1 . GLU B 1 40  ? 20.414  18.731  23.142  1.00 12.37 ? 40   GLU B OE1 1 
ATOM   4166  O  OE2 . GLU B 1 40  ? 20.433  18.214  21.010  1.00 12.05 ? 40   GLU B OE2 1 
ATOM   4167  N  N   . LYS B 1 41  ? 17.936  15.346  25.433  1.00 8.74  ? 41   LYS B N   1 
ATOM   4168  C  CA  . LYS B 1 41  ? 18.295  15.347  26.847  1.00 9.57  ? 41   LYS B CA  1 
ATOM   4169  C  C   . LYS B 1 41  ? 18.271  13.942  27.487  1.00 9.09  ? 41   LYS B C   1 
ATOM   4170  O  O   . LYS B 1 41  ? 19.274  13.514  28.075  1.00 9.79  ? 41   LYS B O   1 
ATOM   4171  C  CB  . LYS B 1 41  ? 17.370  16.286  27.618  1.00 8.96  ? 41   LYS B CB  1 
ATOM   4172  C  CG  . LYS B 1 41  ? 17.853  16.666  28.990  1.00 11.46 ? 41   LYS B CG  1 
ATOM   4173  C  CD  . LYS B 1 41  ? 16.809  17.546  29.709  1.00 11.32 ? 41   LYS B CD  1 
ATOM   4174  C  CE  . LYS B 1 41  ? 17.296  17.990  31.083  1.00 12.82 ? 41   LYS B CE  1 
ATOM   4175  N  NZ  . LYS B 1 41  ? 16.341  18.974  31.676  1.00 14.45 ? 41   LYS B NZ  1 
ATOM   4176  N  N   . ILE B 1 42  ? 17.134  13.248  27.404  1.00 8.13  ? 42   ILE B N   1 
ATOM   4177  C  CA  . ILE B 1 42  ? 17.017  11.903  27.965  1.00 7.74  ? 42   ILE B CA  1 
ATOM   4178  C  C   . ILE B 1 42  ? 17.962  10.936  27.266  1.00 7.80  ? 42   ILE B C   1 
ATOM   4179  O  O   . ILE B 1 42  ? 18.561  10.069  27.905  1.00 8.24  ? 42   ILE B O   1 
ATOM   4180  C  CB  . ILE B 1 42  ? 15.559  11.339  27.857  1.00 8.05  ? 42   ILE B CB  1 
ATOM   4181  C  CG1 . ILE B 1 42  ? 14.579  12.152  28.722  1.00 6.14  ? 42   ILE B CG1 1 
ATOM   4182  C  CG2 . ILE B 1 42  ? 15.524  9.814   28.170  1.00 6.98  ? 42   ILE B CG2 1 
ATOM   4183  C  CD1 . ILE B 1 42  ? 14.842  12.036  30.224  1.00 4.54  ? 42   ILE B CD1 1 
ATOM   4184  N  N   . ALA B 1 43  ? 18.096  11.092  25.954  1.00 7.43  ? 43   ALA B N   1 
ATOM   4185  C  CA  . ALA B 1 43  ? 18.895  10.161  25.163  1.00 7.22  ? 43   ALA B CA  1 
ATOM   4186  C  C   . ALA B 1 43  ? 20.384  10.300  25.454  1.00 6.72  ? 43   ALA B C   1 
ATOM   4187  O  O   . ALA B 1 43  ? 21.122  9.332   25.304  1.00 7.08  ? 43   ALA B O   1 
ATOM   4188  C  CB  . ALA B 1 43  ? 18.594  10.278  23.653  1.00 6.05  ? 43   ALA B CB  1 
ATOM   4189  N  N   . HIS B 1 44  ? 20.819  11.481  25.892  1.00 6.10  ? 44   HIS B N   1 
ATOM   4190  C  CA  . HIS B 1 44  ? 22.229  11.643  26.262  1.00 5.62  ? 44   HIS B CA  1 
ATOM   4191  C  C   . HIS B 1 44  ? 22.462  11.132  27.679  1.00 5.74  ? 44   HIS B C   1 
ATOM   4192  O  O   . HIS B 1 44  ? 23.498  10.536  27.989  1.00 5.65  ? 44   HIS B O   1 
ATOM   4193  C  CB  . HIS B 1 44  ? 22.698  13.095  26.135  1.00 5.28  ? 44   HIS B CB  1 
ATOM   4194  C  CG  . HIS B 1 44  ? 24.175  13.247  26.318  1.00 4.49  ? 44   HIS B CG  1 
ATOM   4195  N  ND1 . HIS B 1 44  ? 24.769  13.329  27.563  1.00 2.94  ? 44   HIS B ND1 1 
ATOM   4196  C  CD2 . HIS B 1 44  ? 25.184  13.270  25.415  1.00 3.25  ? 44   HIS B CD2 1 
ATOM   4197  C  CE1 . HIS B 1 44  ? 26.078  13.429  27.414  1.00 3.01  ? 44   HIS B CE1 1 
ATOM   4198  N  NE2 . HIS B 1 44  ? 26.356  13.396  26.122  1.00 3.20  ? 44   HIS B NE2 1 
ATOM   4199  N  N   . PHE B 1 45  ? 21.489  11.410  28.542  1.00 5.76  ? 45   PHE B N   1 
ATOM   4200  C  CA  . PHE B 1 45  ? 21.444  10.853  29.887  1.00 5.61  ? 45   PHE B CA  1 
ATOM   4201  C  C   . PHE B 1 45  ? 21.479  9.343   29.855  1.00 5.56  ? 45   PHE B C   1 
ATOM   4202  O  O   . PHE B 1 45  ? 22.110  8.741   30.704  1.00 5.30  ? 45   PHE B O   1 
ATOM   4203  C  CB  . PHE B 1 45  ? 20.178  11.310  30.579  1.00 5.38  ? 45   PHE B CB  1 
ATOM   4204  C  CG  . PHE B 1 45  ? 19.938  10.657  31.892  1.00 5.92  ? 45   PHE B CG  1 
ATOM   4205  C  CD1 . PHE B 1 45  ? 20.614  11.093  33.029  1.00 8.23  ? 45   PHE B CD1 1 
ATOM   4206  C  CD2 . PHE B 1 45  ? 19.014  9.624   32.013  1.00 4.58  ? 45   PHE B CD2 1 
ATOM   4207  C  CE1 . PHE B 1 45  ? 20.391  10.491  34.268  1.00 6.20  ? 45   PHE B CE1 1 
ATOM   4208  C  CE2 . PHE B 1 45  ? 18.782  9.030   33.232  1.00 4.35  ? 45   PHE B CE2 1 
ATOM   4209  C  CZ  . PHE B 1 45  ? 19.472  9.474   34.369  1.00 4.93  ? 45   PHE B CZ  1 
ATOM   4210  N  N   . ASP B 1 46  ? 20.799  8.746   28.860  1.00 6.05  ? 46   ASP B N   1 
ATOM   4211  C  CA  . ASP B 1 46  ? 20.717  7.280   28.710  1.00 5.82  ? 46   ASP B CA  1 
ATOM   4212  C  C   . ASP B 1 46  ? 22.068  6.679   28.357  1.00 5.10  ? 46   ASP B C   1 
ATOM   4213  O  O   . ASP B 1 46  ? 22.250  5.489   28.476  1.00 5.09  ? 46   ASP B O   1 
ATOM   4214  C  CB  . ASP B 1 46  ? 19.689  6.891   27.624  1.00 5.53  ? 46   ASP B CB  1 
ATOM   4215  C  CG  . ASP B 1 46  ? 18.231  7.134   28.048  1.00 6.07  ? 46   ASP B CG  1 
ATOM   4216  O  OD1 . ASP B 1 46  ? 17.320  7.108   27.152  1.00 6.23  ? 46   ASP B OD1 1 
ATOM   4217  O  OD2 . ASP B 1 46  ? 17.984  7.364   29.258  1.00 5.86  ? 46   ASP B OD2 1 
ATOM   4218  N  N   . ARG B 1 47  ? 23.004  7.535   27.942  1.00 5.39  ? 47   ARG B N   1 
ATOM   4219  C  CA  . ARG B 1 47  ? 24.302  7.152   27.361  1.00 5.31  ? 47   ARG B CA  1 
ATOM   4220  C  C   . ARG B 1 47  ? 25.525  7.650   28.157  1.00 5.30  ? 47   ARG B C   1 
ATOM   4221  O  O   . ARG B 1 47  ? 26.680  7.502   27.704  1.00 4.54  ? 47   ARG B O   1 
ATOM   4222  C  CB  . ARG B 1 47  ? 24.363  7.667   25.926  1.00 4.48  ? 47   ARG B CB  1 
ATOM   4223  C  CG  . ARG B 1 47  ? 23.646  6.746   24.962  1.00 6.23  ? 47   ARG B CG  1 
ATOM   4224  C  CD  . ARG B 1 47  ? 23.500  7.293   23.499  1.00 6.81  ? 47   ARG B CD  1 
ATOM   4225  N  NE  . ARG B 1 47  ? 22.632  6.379   22.749  1.00 8.21  ? 47   ARG B NE  1 
ATOM   4226  C  CZ  . ARG B 1 47  ? 21.315  6.275   22.941  1.00 8.39  ? 47   ARG B CZ  1 
ATOM   4227  N  NH1 . ARG B 1 47  ? 20.686  7.067   23.817  1.00 7.89  ? 47   ARG B NH1 1 
ATOM   4228  N  NH2 . ARG B 1 47  ? 20.621  5.389   22.245  1.00 6.88  ? 47   ARG B NH2 1 
ATOM   4229  N  N   . GLU B 1 48  ? 25.261  8.223   29.345  1.00 5.00  ? 48   GLU B N   1 
ATOM   4230  C  CA  . GLU B 1 48  ? 26.300  8.795   30.224  1.00 4.71  ? 48   GLU B CA  1 
ATOM   4231  C  C   . GLU B 1 48  ? 27.373  7.818   30.622  1.00 4.32  ? 48   GLU B C   1 
ATOM   4232  O  O   . GLU B 1 48  ? 28.536  8.192   30.719  1.00 3.21  ? 48   GLU B O   1 
ATOM   4233  C  CB  . GLU B 1 48  ? 25.681  9.367   31.513  1.00 5.22  ? 48   GLU B CB  1 
ATOM   4234  C  CG  . GLU B 1 48  ? 25.027  10.707  31.298  1.00 5.19  ? 48   GLU B CG  1 
ATOM   4235  C  CD  . GLU B 1 48  ? 24.573  11.381  32.553  1.00 6.11  ? 48   GLU B CD  1 
ATOM   4236  O  OE1 . GLU B 1 48  ? 24.922  10.942  33.675  1.00 5.37  ? 48   GLU B OE1 1 
ATOM   4237  O  OE2 . GLU B 1 48  ? 23.853  12.390  32.402  1.00 7.39  ? 48   GLU B OE2 1 
ATOM   4238  N  N   . ARG B 1 49  ? 26.956  6.579   30.878  1.00 4.49  ? 49   ARG B N   1 
ATOM   4239  C  CA  . ARG B 1 49  ? 27.854  5.518   31.378  1.00 5.03  ? 49   ARG B CA  1 
ATOM   4240  C  C   . ARG B 1 49  ? 28.679  4.769   30.333  1.00 5.09  ? 49   ARG B C   1 
ATOM   4241  O  O   . ARG B 1 49  ? 28.251  4.520   29.204  1.00 5.31  ? 49   ARG B O   1 
ATOM   4242  C  CB  . ARG B 1 49  ? 27.098  4.514   32.280  1.00 4.99  ? 49   ARG B CB  1 
ATOM   4243  C  CG  . ARG B 1 49  ? 26.228  5.163   33.332  1.00 3.35  ? 49   ARG B CG  1 
ATOM   4244  C  CD  . ARG B 1 49  ? 26.985  5.659   34.578  1.00 2.00  ? 49   ARG B CD  1 
ATOM   4245  N  NE  . ARG B 1 49  ? 26.001  6.283   35.464  1.00 5.23  ? 49   ARG B NE  1 
ATOM   4246  C  CZ  . ARG B 1 49  ? 25.671  7.583   35.477  1.00 5.36  ? 49   ARG B CZ  1 
ATOM   4247  N  NH1 . ARG B 1 49  ? 26.288  8.464   34.688  1.00 7.54  ? 49   ARG B NH1 1 
ATOM   4248  N  NH2 . ARG B 1 49  ? 24.729  8.011   36.303  1.00 5.42  ? 49   ARG B NH2 1 
ATOM   4249  N  N   . VAL B 1 50  ? 29.892  4.432   30.761  1.00 5.90  ? 50   VAL B N   1 
ATOM   4250  C  CA  . VAL B 1 50  ? 30.875  3.685   29.992  1.00 5.41  ? 50   VAL B CA  1 
ATOM   4251  C  C   . VAL B 1 50  ? 31.320  2.551   30.923  1.00 5.21  ? 50   VAL B C   1 
ATOM   4252  O  O   . VAL B 1 50  ? 31.058  2.622   32.106  1.00 4.83  ? 50   VAL B O   1 
ATOM   4253  C  CB  . VAL B 1 50  ? 32.086  4.616   29.594  1.00 5.67  ? 50   VAL B CB  1 
ATOM   4254  C  CG1 . VAL B 1 50  ? 31.597  5.776   28.767  1.00 4.96  ? 50   VAL B CG1 1 
ATOM   4255  C  CG2 . VAL B 1 50  ? 32.885  5.140   30.866  1.00 5.53  ? 50   VAL B CG2 1 
ATOM   4256  N  N   . PRO B 1 51  ? 31.979  1.495   30.395  1.00 5.44  ? 51   PRO B N   1 
ATOM   4257  C  CA  . PRO B 1 51  ? 32.422  0.387   31.253  1.00 5.11  ? 51   PRO B CA  1 
ATOM   4258  C  C   . PRO B 1 51  ? 33.392  0.852   32.349  1.00 6.32  ? 51   PRO B C   1 
ATOM   4259  O  O   . PRO B 1 51  ? 34.235  1.729   32.088  1.00 5.52  ? 51   PRO B O   1 
ATOM   4260  C  CB  . PRO B 1 51  ? 33.178  -0.512  30.270  1.00 5.32  ? 51   PRO B CB  1 
ATOM   4261  C  CG  . PRO B 1 51  ? 32.561  -0.169  28.899  1.00 4.73  ? 51   PRO B CG  1 
ATOM   4262  C  CD  . PRO B 1 51  ? 32.342  1.284   28.977  1.00 3.86  ? 51   PRO B CD  1 
ATOM   4263  N  N   . GLU B 1 52  ? 33.291  0.277   33.559  1.00 6.05  ? 52   GLU B N   1 
ATOM   4264  C  CA  . GLU B 1 52  ? 34.277  0.581   34.576  1.00 6.33  ? 52   GLU B CA  1 
ATOM   4265  C  C   . GLU B 1 52  ? 35.533  -0.232  34.240  1.00 6.07  ? 52   GLU B C   1 
ATOM   4266  O  O   . GLU B 1 52  ? 35.463  -1.177  33.431  1.00 5.89  ? 52   GLU B O   1 
ATOM   4267  C  CB  . GLU B 1 52  ? 33.753  0.310   36.008  1.00 6.68  ? 52   GLU B CB  1 
ATOM   4268  C  CG  . GLU B 1 52  ? 33.402  -1.181  36.321  1.00 7.43  ? 52   GLU B CG  1 
ATOM   4269  C  CD  . GLU B 1 52  ? 33.128  -1.494  37.812  1.00 8.17  ? 52   GLU B CD  1 
ATOM   4270  O  OE1 . GLU B 1 52  ? 32.499  -0.667  38.520  1.00 9.09  ? 52   GLU B OE1 1 
ATOM   4271  O  OE2 . GLU B 1 52  ? 33.515  -2.611  38.273  1.00 12.05 ? 52   GLU B OE2 1 
ATOM   4272  N  N   . ARG B 1 53  ? 36.672  0.146   34.837  1.00 4.96  ? 53   ARG B N   1 
ATOM   4273  C  CA  . ARG B 1 53  ? 37.919  -0.625  34.724  1.00 4.22  ? 53   ARG B CA  1 
ATOM   4274  C  C   . ARG B 1 53  ? 37.702  -2.090  35.113  1.00 4.07  ? 53   ARG B C   1 
ATOM   4275  O  O   . ARG B 1 53  ? 37.054  -2.384  36.131  1.00 4.04  ? 53   ARG B O   1 
ATOM   4276  C  CB  . ARG B 1 53  ? 39.023  0.007   35.589  1.00 4.15  ? 53   ARG B CB  1 
ATOM   4277  C  CG  . ARG B 1 53  ? 39.667  1.289   35.003  1.00 3.82  ? 53   ARG B CG  1 
ATOM   4278  C  CD  . ARG B 1 53  ? 40.175  2.199   36.138  1.00 2.94  ? 53   ARG B CD  1 
ATOM   4279  N  NE  . ARG B 1 53  ? 40.867  3.412   35.696  1.00 2.00  ? 53   ARG B NE  1 
ATOM   4280  C  CZ  . ARG B 1 53  ? 40.246  4.510   35.286  1.00 3.53  ? 53   ARG B CZ  1 
ATOM   4281  N  NH1 . ARG B 1 53  ? 38.897  4.557   35.215  1.00 4.03  ? 53   ARG B NH1 1 
ATOM   4282  N  NH2 . ARG B 1 53  ? 40.964  5.552   34.901  1.00 4.76  ? 53   ARG B NH2 1 
ATOM   4283  N  N   . VAL B 1 54  ? 38.218  -3.010  34.304  1.00 4.36  ? 54   VAL B N   1 
ATOM   4284  C  CA  . VAL B 1 54  ? 38.111  -4.449  34.634  1.00 4.71  ? 54   VAL B CA  1 
ATOM   4285  C  C   . VAL B 1 54  ? 38.602  -4.733  36.054  1.00 4.58  ? 54   VAL B C   1 
ATOM   4286  O  O   . VAL B 1 54  ? 37.920  -5.439  36.806  1.00 4.85  ? 54   VAL B O   1 
ATOM   4287  C  CB  . VAL B 1 54  ? 38.770  -5.406  33.581  1.00 4.56  ? 54   VAL B CB  1 
ATOM   4288  C  CG1 . VAL B 1 54  ? 40.226  -5.217  33.510  1.00 4.09  ? 54   VAL B CG1 1 
ATOM   4289  C  CG2 . VAL B 1 54  ? 38.450  -6.891  33.900  1.00 5.29  ? 54   VAL B CG2 1 
ATOM   4290  N  N   . VAL B 1 55  ? 39.747  -4.140  36.430  1.00 4.17  ? 55   VAL B N   1 
ATOM   4291  C  CA  . VAL B 1 55  ? 40.180  -4.114  37.838  1.00 3.29  ? 55   VAL B CA  1 
ATOM   4292  C  C   . VAL B 1 55  ? 40.546  -2.678  38.153  1.00 3.61  ? 55   VAL B C   1 
ATOM   4293  O  O   . VAL B 1 55  ? 40.747  -1.886  37.247  1.00 3.52  ? 55   VAL B O   1 
ATOM   4294  C  CB  . VAL B 1 55  ? 41.409  -5.033  38.141  1.00 3.54  ? 55   VAL B CB  1 
ATOM   4295  C  CG1 . VAL B 1 55  ? 41.026  -6.527  38.128  1.00 2.00  ? 55   VAL B CG1 1 
ATOM   4296  C  CG2 . VAL B 1 55  ? 42.617  -4.730  37.211  1.00 2.62  ? 55   VAL B CG2 1 
ATOM   4297  N  N   . HIS B 1 56  ? 40.660  -2.359  39.437  1.00 4.38  ? 56   HIS B N   1 
ATOM   4298  C  CA  . HIS B 1 56  ? 40.994  -1.004  39.929  1.00 4.53  ? 56   HIS B CA  1 
ATOM   4299  C  C   . HIS B 1 56  ? 39.963  0.032   39.531  1.00 4.77  ? 56   HIS B C   1 
ATOM   4300  O  O   . HIS B 1 56  ? 40.318  1.202   39.322  1.00 4.96  ? 56   HIS B O   1 
ATOM   4301  C  CB  . HIS B 1 56  ? 42.359  -0.529  39.438  1.00 3.93  ? 56   HIS B CB  1 
ATOM   4302  C  CG  . HIS B 1 56  ? 43.523  -1.256  40.025  1.00 2.56  ? 56   HIS B CG  1 
ATOM   4303  N  ND1 . HIS B 1 56  ? 44.272  -0.740  41.064  1.00 2.00  ? 56   HIS B ND1 1 
ATOM   4304  C  CD2 . HIS B 1 56  ? 44.128  -2.415  39.666  1.00 3.38  ? 56   HIS B CD2 1 
ATOM   4305  C  CE1 . HIS B 1 56  ? 45.262  -1.568  41.350  1.00 2.00  ? 56   HIS B CE1 1 
ATOM   4306  N  NE2 . HIS B 1 56  ? 45.204  -2.590  40.512  1.00 3.38  ? 56   HIS B NE2 1 
ATOM   4307  N  N   . ALA B 1 57  ? 38.705  -0.395  39.401  1.00 5.21  ? 57   ALA B N   1 
ATOM   4308  C  CA  . ALA B 1 57  ? 37.597  0.520   39.051  1.00 5.77  ? 57   ALA B CA  1 
ATOM   4309  C  C   . ALA B 1 57  ? 37.387  1.615   40.119  1.00 5.51  ? 57   ALA B C   1 
ATOM   4310  O  O   . ALA B 1 57  ? 37.080  2.751   39.795  1.00 6.17  ? 57   ALA B O   1 
ATOM   4311  C  CB  . ALA B 1 57  ? 36.293  -0.257  38.798  1.00 5.30  ? 57   ALA B CB  1 
ATOM   4312  N  N   . ARG B 1 58  ? 37.565  1.272   41.388  1.00 5.73  ? 58   ARG B N   1 
ATOM   4313  C  CA  . ARG B 1 58  ? 37.426  2.259   42.460  1.00 5.40  ? 58   ARG B CA  1 
ATOM   4314  C  C   . ARG B 1 58  ? 38.729  3.076   42.624  1.00 4.88  ? 58   ARG B C   1 
ATOM   4315  O  O   . ARG B 1 58  ? 39.763  2.542   42.959  1.00 4.23  ? 58   ARG B O   1 
ATOM   4316  C  CB  . ARG B 1 58  ? 36.980  1.577   43.756  1.00 4.86  ? 58   ARG B CB  1 
ATOM   4317  C  CG  . ARG B 1 58  ? 37.080  2.448   45.012  1.00 6.77  ? 58   ARG B CG  1 
ATOM   4318  C  CD  . ARG B 1 58  ? 36.217  3.715   44.937  1.00 8.67  ? 58   ARG B CD  1 
ATOM   4319  N  NE  . ARG B 1 58  ? 35.125  3.693   45.912  1.00 10.25 ? 58   ARG B NE  1 
ATOM   4320  C  CZ  . ARG B 1 58  ? 34.406  4.755   46.265  1.00 8.66  ? 58   ARG B CZ  1 
ATOM   4321  N  NH1 . ARG B 1 58  ? 34.619  5.939   45.696  1.00 9.05  ? 58   ARG B NH1 1 
ATOM   4322  N  NH2 . ARG B 1 58  ? 33.453  4.620   47.168  1.00 8.99  ? 58   ARG B NH2 1 
ATOM   4323  N  N   . GLY B 1 59  ? 38.659  4.374   42.356  1.00 5.24  ? 59   GLY B N   1 
ATOM   4324  C  CA  . GLY B 1 59  ? 39.853  5.218   42.371  1.00 6.38  ? 59   GLY B CA  1 
ATOM   4325  C  C   . GLY B 1 59  ? 39.641  6.718   42.581  1.00 6.79  ? 59   GLY B C   1 
ATOM   4326  O  O   . GLY B 1 59  ? 38.500  7.207   42.622  1.00 6.60  ? 59   GLY B O   1 
ATOM   4327  N  N   . PHE B 1 60  ? 40.762  7.435   42.681  1.00 6.92  ? 60   PHE B N   1 
ATOM   4328  C  CA  . PHE B 1 60  ? 40.808  8.866   42.952  1.00 7.27  ? 60   PHE B CA  1 
ATOM   4329  C  C   . PHE B 1 60  ? 41.983  9.471   42.206  1.00 7.56  ? 60   PHE B C   1 
ATOM   4330  O  O   . PHE B 1 60  ? 43.115  8.999   42.346  1.00 8.73  ? 60   PHE B O   1 
ATOM   4331  C  CB  . PHE B 1 60  ? 41.001  9.131   44.461  1.00 7.68  ? 60   PHE B CB  1 
ATOM   4332  C  CG  . PHE B 1 60  ? 41.375  10.564  44.767  1.00 8.07  ? 60   PHE B CG  1 
ATOM   4333  C  CD1 . PHE B 1 60  ? 40.385  11.525  44.951  1.00 4.86  ? 60   PHE B CD1 1 
ATOM   4334  C  CD2 . PHE B 1 60  ? 42.727  10.959  44.811  1.00 6.46  ? 60   PHE B CD2 1 
ATOM   4335  C  CE1 . PHE B 1 60  ? 40.723  12.861  45.195  1.00 5.47  ? 60   PHE B CE1 1 
ATOM   4336  C  CE2 . PHE B 1 60  ? 43.074  12.298  45.023  1.00 7.05  ? 60   PHE B CE2 1 
ATOM   4337  C  CZ  . PHE B 1 60  ? 42.069  13.254  45.220  1.00 5.78  ? 60   PHE B CZ  1 
ATOM   4338  N  N   . GLY B 1 61  ? 41.743  10.537  41.448  1.00 7.75  ? 61   GLY B N   1 
ATOM   4339  C  CA  . GLY B 1 61  ? 42.808  11.186  40.671  1.00 6.96  ? 61   GLY B CA  1 
ATOM   4340  C  C   . GLY B 1 61  ? 43.041  12.633  41.043  1.00 7.03  ? 61   GLY B C   1 
ATOM   4341  O  O   . GLY B 1 61  ? 42.099  13.330  41.467  1.00 6.66  ? 61   GLY B O   1 
ATOM   4342  N  N   . ALA B 1 62  ? 44.295  13.077  40.883  1.00 7.00  ? 62   ALA B N   1 
ATOM   4343  C  CA  . ALA B 1 62  ? 44.669  14.501  41.018  1.00 7.48  ? 62   ALA B CA  1 
ATOM   4344  C  C   . ALA B 1 62  ? 45.871  14.899  40.169  1.00 8.07  ? 62   ALA B C   1 
ATOM   4345  O  O   . ALA B 1 62  ? 46.701  14.055  39.799  1.00 8.81  ? 62   ALA B O   1 
ATOM   4346  C  CB  . ALA B 1 62  ? 44.934  14.853  42.463  1.00 7.18  ? 62   ALA B CB  1 
ATOM   4347  N  N   . HIS B 1 63  ? 45.951  16.196  39.871  1.00 8.28  ? 63   HIS B N   1 
ATOM   4348  C  CA  . HIS B 1 63  ? 47.071  16.796  39.155  1.00 8.43  ? 63   HIS B CA  1 
ATOM   4349  C  C   . HIS B 1 63  ? 48.211  17.269  40.056  1.00 8.88  ? 63   HIS B C   1 
ATOM   4350  O  O   . HIS B 1 63  ? 48.003  17.630  41.229  1.00 9.29  ? 63   HIS B O   1 
ATOM   4351  C  CB  . HIS B 1 63  ? 46.596  18.012  38.394  1.00 8.91  ? 63   HIS B CB  1 
ATOM   4352  C  CG  . HIS B 1 63  ? 45.611  17.705  37.329  1.00 9.16  ? 63   HIS B CG  1 
ATOM   4353  N  ND1 . HIS B 1 63  ? 45.992  17.322  36.064  1.00 11.34 ? 63   HIS B ND1 1 
ATOM   4354  C  CD2 . HIS B 1 63  ? 44.259  17.721  37.332  1.00 10.13 ? 63   HIS B CD2 1 
ATOM   4355  C  CE1 . HIS B 1 63  ? 44.913  17.131  35.324  1.00 11.72 ? 63   HIS B CE1 1 
ATOM   4356  N  NE2 . HIS B 1 63  ? 43.850  17.362  36.072  1.00 11.39 ? 63   HIS B NE2 1 
ATOM   4357  N  N   . GLY B 1 64  ? 49.408  17.308  39.481  1.00 8.51  ? 64   GLY B N   1 
ATOM   4358  C  CA  . GLY B 1 64  ? 50.549  17.850  40.166  1.00 9.14  ? 64   GLY B CA  1 
ATOM   4359  C  C   . GLY B 1 64  ? 51.798  17.871  39.321  1.00 9.83  ? 64   GLY B C   1 
ATOM   4360  O  O   . GLY B 1 64  ? 51.744  17.835  38.082  1.00 10.54 ? 64   GLY B O   1 
ATOM   4361  N  N   . VAL B 1 65  ? 52.936  17.902  40.004  1.00 9.90  ? 65   VAL B N   1 
ATOM   4362  C  CA  . VAL B 1 65  ? 54.215  18.177  39.371  1.00 10.20 ? 65   VAL B CA  1 
ATOM   4363  C  C   . VAL B 1 65  ? 55.243  17.206  39.930  1.00 10.33 ? 65   VAL B C   1 
ATOM   4364  O  O   . VAL B 1 65  ? 55.197  16.842  41.105  1.00 10.40 ? 65   VAL B O   1 
ATOM   4365  C  CB  . VAL B 1 65  ? 54.646  19.710  39.493  1.00 9.63  ? 65   VAL B CB  1 
ATOM   4366  C  CG1 . VAL B 1 65  ? 54.754  20.156  40.934  1.00 10.32 ? 65   VAL B CG1 1 
ATOM   4367  C  CG2 . VAL B 1 65  ? 55.967  19.965  38.789  1.00 10.77 ? 65   VAL B CG2 1 
ATOM   4368  N  N   . PHE B 1 66  ? 56.112  16.722  39.054  1.00 10.63 ? 66   PHE B N   1 
ATOM   4369  C  CA  . PHE B 1 66  ? 57.275  15.982  39.494  1.00 10.62 ? 66   PHE B CA  1 
ATOM   4370  C  C   . PHE B 1 66  ? 58.522  16.852  39.321  1.00 11.14 ? 66   PHE B C   1 
ATOM   4371  O  O   . PHE B 1 66  ? 58.721  17.499  38.268  1.00 10.54 ? 66   PHE B O   1 
ATOM   4372  C  CB  . PHE B 1 66  ? 57.427  14.650  38.752  1.00 9.79  ? 66   PHE B CB  1 
ATOM   4373  C  CG  . PHE B 1 66  ? 58.639  13.869  39.194  1.00 10.04 ? 66   PHE B CG  1 
ATOM   4374  C  CD1 . PHE B 1 66  ? 58.588  13.061  40.326  1.00 7.87  ? 66   PHE B CD1 1 
ATOM   4375  C  CD2 . PHE B 1 66  ? 59.845  14.002  38.529  1.00 7.25  ? 66   PHE B CD2 1 
ATOM   4376  C  CE1 . PHE B 1 66  ? 59.711  12.371  40.755  1.00 8.71  ? 66   PHE B CE1 1 
ATOM   4377  C  CE2 . PHE B 1 66  ? 60.972  13.316  38.956  1.00 7.52  ? 66   PHE B CE2 1 
ATOM   4378  C  CZ  . PHE B 1 66  ? 60.909  12.488  40.056  1.00 7.86  ? 66   PHE B CZ  1 
ATOM   4379  N  N   . LYS B 1 67  ? 59.343  16.878  40.366  1.00 11.79 ? 67   LYS B N   1 
ATOM   4380  C  CA  . LYS B 1 67  ? 60.579  17.657  40.340  1.00 13.16 ? 67   LYS B CA  1 
ATOM   4381  C  C   . LYS B 1 67  ? 61.811  16.765  40.500  1.00 13.07 ? 67   LYS B C   1 
ATOM   4382  O  O   . LYS B 1 67  ? 61.962  16.051  41.497  1.00 12.27 ? 67   LYS B O   1 
ATOM   4383  C  CB  . LYS B 1 67  ? 60.549  18.795  41.366  1.00 13.24 ? 67   LYS B CB  1 
ATOM   4384  C  CG  . LYS B 1 67  ? 61.892  19.539  41.500  1.00 17.08 ? 67   LYS B CG  1 
ATOM   4385  C  CD  . LYS B 1 67  ? 61.699  21.049  41.468  1.00 22.16 ? 67   LYS B CD  1 
ATOM   4386  C  CE  . LYS B 1 67  ? 62.768  21.786  42.273  1.00 23.58 ? 67   LYS B CE  1 
ATOM   4387  N  NZ  . LYS B 1 67  ? 62.188  23.018  42.886  1.00 23.74 ? 67   LYS B NZ  1 
ATOM   4388  N  N   . VAL B 1 68  ? 62.661  16.773  39.480  1.00 13.66 ? 68   VAL B N   1 
ATOM   4389  C  CA  . VAL B 1 68  ? 63.885  15.997  39.554  1.00 14.61 ? 68   VAL B CA  1 
ATOM   4390  C  C   . VAL B 1 68  ? 64.963  16.711  40.401  1.00 15.97 ? 68   VAL B C   1 
ATOM   4391  O  O   . VAL B 1 68  ? 65.333  17.870  40.152  1.00 16.17 ? 68   VAL B O   1 
ATOM   4392  C  CB  . VAL B 1 68  ? 64.351  15.375  38.160  1.00 15.48 ? 68   VAL B CB  1 
ATOM   4393  C  CG1 . VAL B 1 68  ? 63.328  15.570  37.011  1.00 11.08 ? 68   VAL B CG1 1 
ATOM   4394  C  CG2 . VAL B 1 68  ? 65.813  15.749  37.770  1.00 15.50 ? 68   VAL B CG2 1 
ATOM   4395  N  N   . LYS B 1 69  ? 65.389  16.007  41.448  1.00 16.72 ? 69   LYS B N   1 
ATOM   4396  C  CA  . LYS B 1 69  ? 66.361  16.468  42.411  1.00 17.68 ? 69   LYS B CA  1 
ATOM   4397  C  C   . LYS B 1 69  ? 67.781  16.057  41.980  1.00 17.83 ? 69   LYS B C   1 
ATOM   4398  O  O   . LYS B 1 69  ? 68.723  16.828  42.128  1.00 18.58 ? 69   LYS B O   1 
ATOM   4399  C  CB  . LYS B 1 69  ? 66.005  15.886  43.788  1.00 18.52 ? 69   LYS B CB  1 
ATOM   4400  C  CG  . LYS B 1 69  ? 66.997  16.163  44.907  1.00 20.65 ? 69   LYS B CG  1 
ATOM   4401  C  CD  . LYS B 1 69  ? 66.727  17.507  45.584  1.00 24.37 ? 69   LYS B CD  1 
ATOM   4402  C  CE  . LYS B 1 69  ? 68.018  18.282  45.821  1.00 24.29 ? 69   LYS B CE  1 
ATOM   4403  N  NZ  . LYS B 1 69  ? 67.714  19.733  46.001  1.00 24.60 ? 69   LYS B NZ  1 
ATOM   4404  N  N   . ASN B 1 70  ? 67.916  14.853  41.429  1.00 17.23 ? 70   ASN B N   1 
ATOM   4405  C  CA  . ASN B 1 70  ? 69.206  14.294  41.028  1.00 16.56 ? 70   ASN B CA  1 
ATOM   4406  C  C   . ASN B 1 70  ? 69.139  13.758  39.604  1.00 15.99 ? 70   ASN B C   1 
ATOM   4407  O  O   . ASN B 1 70  ? 68.301  12.895  39.288  1.00 15.31 ? 70   ASN B O   1 
ATOM   4408  C  CB  . ASN B 1 70  ? 69.642  13.146  41.966  1.00 16.51 ? 70   ASN B CB  1 
ATOM   4409  C  CG  . ASN B 1 70  ? 69.946  13.611  43.399  1.00 17.81 ? 70   ASN B CG  1 
ATOM   4410  O  OD1 . ASN B 1 70  ? 69.384  13.085  44.359  1.00 17.88 ? 70   ASN B OD1 1 
ATOM   4411  N  ND2 . ASN B 1 70  ? 70.857  14.578  43.541  1.00 17.83 ? 70   ASN B ND2 1 
ATOM   4412  N  N   . SER B 1 71  ? 70.028  14.288  38.761  1.00 15.63 ? 71   SER B N   1 
ATOM   4413  C  CA  . SER B 1 71  ? 70.320  13.760  37.424  1.00 15.25 ? 71   SER B CA  1 
ATOM   4414  C  C   . SER B 1 71  ? 70.498  12.242  37.398  1.00 14.20 ? 71   SER B C   1 
ATOM   4415  O  O   . SER B 1 71  ? 71.108  11.668  38.279  1.00 14.32 ? 71   SER B O   1 
ATOM   4416  C  CB  . SER B 1 71  ? 71.585  14.418  36.876  1.00 15.21 ? 71   SER B CB  1 
ATOM   4417  O  OG  . SER B 1 71  ? 71.735  14.078  35.513  1.00 15.88 ? 71   SER B OG  1 
ATOM   4418  N  N   . MET B 1 72  ? 69.937  11.604  36.385  1.00 13.90 ? 72   MET B N   1 
ATOM   4419  C  CA  . MET B 1 72  ? 69.946  10.149  36.252  1.00 13.40 ? 72   MET B CA  1 
ATOM   4420  C  C   . MET B 1 72  ? 70.655  9.780   34.972  1.00 13.46 ? 72   MET B C   1 
ATOM   4421  O  O   . MET B 1 72  ? 70.558  8.634   34.512  1.00 13.63 ? 72   MET B O   1 
ATOM   4422  C  CB  . MET B 1 72  ? 68.521  9.576   36.238  1.00 13.32 ? 72   MET B CB  1 
ATOM   4423  C  CG  . MET B 1 72  ? 67.806  9.581   37.578  1.00 14.74 ? 72   MET B CG  1 
ATOM   4424  S  SD  . MET B 1 72  ? 68.646  8.551   38.808  1.00 17.22 ? 72   MET B SD  1 
ATOM   4425  C  CE  . MET B 1 72  ? 69.167  9.802   39.996  1.00 17.34 ? 72   MET B CE  1 
ATOM   4426  N  N   . LYS B 1 73  ? 71.407  10.739  34.424  1.00 13.47 ? 73   LYS B N   1 
ATOM   4427  C  CA  . LYS B 1 73  ? 72.071  10.564  33.141  1.00 13.90 ? 73   LYS B CA  1 
ATOM   4428  C  C   . LYS B 1 73  ? 73.021  9.370   33.104  1.00 13.23 ? 73   LYS B C   1 
ATOM   4429  O  O   . LYS B 1 73  ? 73.218  8.762   32.065  1.00 13.54 ? 73   LYS B O   1 
ATOM   4430  C  CB  . LYS B 1 73  ? 72.777  11.851  32.693  1.00 14.56 ? 73   LYS B CB  1 
ATOM   4431  C  CG  . LYS B 1 73  ? 73.956  12.288  33.522  1.00 15.74 ? 73   LYS B CG  1 
ATOM   4432  C  CD  . LYS B 1 73  ? 74.681  13.437  32.809  1.00 19.92 ? 73   LYS B CD  1 
ATOM   4433  C  CE  . LYS B 1 73  ? 75.576  14.196  33.795  1.00 23.21 ? 73   LYS B CE  1 
ATOM   4434  N  NZ  . LYS B 1 73  ? 74.748  14.651  34.956  1.00 23.96 ? 73   LYS B NZ  1 
ATOM   4435  N  N   . LYS B 1 74  ? 73.602  9.057   34.243  1.00 12.94 ? 74   LYS B N   1 
ATOM   4436  C  CA  . LYS B 1 74  ? 74.394  7.838   34.428  1.00 13.13 ? 74   LYS B CA  1 
ATOM   4437  C  C   . LYS B 1 74  ? 73.663  6.579   33.936  1.00 12.61 ? 74   LYS B C   1 
ATOM   4438  O  O   . LYS B 1 74  ? 74.288  5.693   33.353  1.00 13.06 ? 74   LYS B O   1 
ATOM   4439  C  CB  . LYS B 1 74  ? 74.745  7.703   35.912  1.00 12.79 ? 74   LYS B CB  1 
ATOM   4440  C  CG  . LYS B 1 74  ? 75.631  6.531   36.315  1.00 12.97 ? 74   LYS B CG  1 
ATOM   4441  C  CD  . LYS B 1 74  ? 75.585  6.411   37.872  1.00 12.68 ? 74   LYS B CD  1 
ATOM   4442  C  CE  . LYS B 1 74  ? 76.623  5.489   38.369  1.00 13.73 ? 74   LYS B CE  1 
ATOM   4443  N  NZ  . LYS B 1 74  ? 76.653  5.492   39.823  1.00 13.61 ? 74   LYS B NZ  1 
ATOM   4444  N  N   . TYR B 1 75  ? 72.343  6.538   34.129  1.00 12.15 ? 75   TYR B N   1 
ATOM   4445  C  CA  . TYR B 1 75  ? 71.539  5.317   33.909  1.00 11.51 ? 75   TYR B CA  1 
ATOM   4446  C  C   . TYR B 1 75  ? 70.538  5.421   32.775  1.00 11.20 ? 75   TYR B C   1 
ATOM   4447  O  O   . TYR B 1 75  ? 70.204  4.417   32.154  1.00 11.54 ? 75   TYR B O   1 
ATOM   4448  C  CB  . TYR B 1 75  ? 70.743  4.948   35.165  1.00 10.91 ? 75   TYR B CB  1 
ATOM   4449  C  CG  . TYR B 1 75  ? 71.531  4.675   36.409  1.00 9.67  ? 75   TYR B CG  1 
ATOM   4450  C  CD1 . TYR B 1 75  ? 71.297  5.414   37.563  1.00 8.34  ? 75   TYR B CD1 1 
ATOM   4451  C  CD2 . TYR B 1 75  ? 72.490  3.647   36.453  1.00 10.01 ? 75   TYR B CD2 1 
ATOM   4452  C  CE1 . TYR B 1 75  ? 71.996  5.156   38.736  1.00 7.56  ? 75   TYR B CE1 1 
ATOM   4453  C  CE2 . TYR B 1 75  ? 73.200  3.379   37.616  1.00 9.32  ? 75   TYR B CE2 1 
ATOM   4454  C  CZ  . TYR B 1 75  ? 72.949  4.140   38.756  1.00 9.25  ? 75   TYR B CZ  1 
ATOM   4455  O  OH  . TYR B 1 75  ? 73.637  3.884   39.924  1.00 9.48  ? 75   TYR B OH  1 
ATOM   4456  N  N   . THR B 1 76  ? 70.015  6.616   32.544  1.00 10.89 ? 76   THR B N   1 
ATOM   4457  C  CA  . THR B 1 76  ? 69.085  6.811   31.448  1.00 10.75 ? 76   THR B CA  1 
ATOM   4458  C  C   . THR B 1 76  ? 69.278  8.126   30.699  1.00 11.50 ? 76   THR B C   1 
ATOM   4459  O  O   . THR B 1 76  ? 69.647  9.173   31.277  1.00 10.90 ? 76   THR B O   1 
ATOM   4460  C  CB  . THR B 1 76  ? 67.601  6.696   31.883  1.00 11.28 ? 76   THR B CB  1 
ATOM   4461  O  OG1 . THR B 1 76  ? 66.758  6.979   30.748  1.00 9.04  ? 76   THR B OG1 1 
ATOM   4462  C  CG2 . THR B 1 76  ? 67.281  7.690   33.033  1.00 9.05  ? 76   THR B CG2 1 
ATOM   4463  N  N   . LYS B 1 77  ? 68.988  8.059   29.405  1.00 11.44 ? 77   LYS B N   1 
ATOM   4464  C  CA  . LYS B 1 77  ? 69.017  9.235   28.557  1.00 12.30 ? 77   LYS B CA  1 
ATOM   4465  C  C   . LYS B 1 77  ? 67.617  9.864   28.441  1.00 12.23 ? 77   LYS B C   1 
ATOM   4466  O  O   . LYS B 1 77  ? 67.439  10.759  27.624  1.00 13.15 ? 77   LYS B O   1 
ATOM   4467  C  CB  . LYS B 1 77  ? 69.538  8.880   27.168  1.00 11.42 ? 77   LYS B CB  1 
ATOM   4468  C  CG  . LYS B 1 77  ? 68.687  7.806   26.518  1.00 13.47 ? 77   LYS B CG  1 
ATOM   4469  C  CD  . LYS B 1 77  ? 68.972  7.676   25.040  1.00 16.06 ? 77   LYS B CD  1 
ATOM   4470  C  CE  . LYS B 1 77  ? 68.367  6.412   24.492  1.00 17.04 ? 77   LYS B CE  1 
ATOM   4471  N  NZ  . LYS B 1 77  ? 69.173  6.026   23.301  1.00 21.74 ? 77   LYS B NZ  1 
ATOM   4472  N  N   . ALA B 1 78  ? 66.647  9.386   29.234  1.00 11.87 ? 78   ALA B N   1 
ATOM   4473  C  CA  . ALA B 1 78  ? 65.326  10.026  29.347  1.00 11.78 ? 78   ALA B CA  1 
ATOM   4474  C  C   . ALA B 1 78  ? 65.479  11.532  29.546  1.00 11.52 ? 78   ALA B C   1 
ATOM   4475  O  O   . ALA B 1 78  ? 66.133  11.958  30.511  1.00 11.02 ? 78   ALA B O   1 
ATOM   4476  C  CB  . ALA B 1 78  ? 64.500  9.405   30.499  1.00 11.28 ? 78   ALA B CB  1 
ATOM   4477  N  N   . ALA B 1 79  ? 64.901  12.311  28.618  1.00 11.47 ? 79   ALA B N   1 
ATOM   4478  C  CA  . ALA B 1 79  ? 65.090  13.777  28.558  1.00 11.92 ? 79   ALA B CA  1 
ATOM   4479  C  C   . ALA B 1 79  ? 64.764  14.488  29.878  1.00 11.99 ? 79   ALA B C   1 
ATOM   4480  O  O   . ALA B 1 79  ? 65.565  15.302  30.371  1.00 11.71 ? 79   ALA B O   1 
ATOM   4481  C  CB  . ALA B 1 79  ? 64.297  14.400  27.415  1.00 11.05 ? 79   ALA B CB  1 
ATOM   4482  N  N   . PHE B 1 80  ? 63.634  14.139  30.487  1.00 11.76 ? 80   PHE B N   1 
ATOM   4483  C  CA  . PHE B 1 80  ? 63.237  14.835  31.710  1.00 11.69 ? 80   PHE B CA  1 
ATOM   4484  C  C   . PHE B 1 80  ? 64.157  14.592  32.917  1.00 11.61 ? 80   PHE B C   1 
ATOM   4485  O  O   . PHE B 1 80  ? 64.152  15.369  33.849  1.00 10.87 ? 80   PHE B O   1 
ATOM   4486  C  CB  . PHE B 1 80  ? 61.745  14.621  32.037  1.00 11.48 ? 80   PHE B CB  1 
ATOM   4487  C  CG  . PHE B 1 80  ? 61.434  13.364  32.820  1.00 11.19 ? 80   PHE B CG  1 
ATOM   4488  C  CD1 . PHE B 1 80  ? 61.327  12.113  32.175  1.00 9.90  ? 80   PHE B CD1 1 
ATOM   4489  C  CD2 . PHE B 1 80  ? 61.173  13.439  34.188  1.00 8.32  ? 80   PHE B CD2 1 
ATOM   4490  C  CE1 . PHE B 1 80  ? 60.988  10.946  32.902  1.00 9.13  ? 80   PHE B CE1 1 
ATOM   4491  C  CE2 . PHE B 1 80  ? 60.827  12.283  34.918  1.00 9.37  ? 80   PHE B CE2 1 
ATOM   4492  C  CZ  . PHE B 1 80  ? 60.746  11.032  34.279  1.00 8.42  ? 80   PHE B CZ  1 
ATOM   4493  N  N   . LEU B 1 81  ? 64.956  13.529  32.877  1.00 12.01 ? 81   LEU B N   1 
ATOM   4494  C  CA  . LEU B 1 81  ? 65.768  13.123  34.027  1.00 12.38 ? 81   LEU B CA  1 
ATOM   4495  C  C   . LEU B 1 81  ? 67.241  13.593  33.964  1.00 13.23 ? 81   LEU B C   1 
ATOM   4496  O  O   . LEU B 1 81  ? 68.045  13.291  34.850  1.00 12.33 ? 81   LEU B O   1 
ATOM   4497  C  CB  . LEU B 1 81  ? 65.660  11.597  34.200  1.00 12.70 ? 81   LEU B CB  1 
ATOM   4498  C  CG  . LEU B 1 81  ? 64.891  10.794  35.275  1.00 11.89 ? 81   LEU B CG  1 
ATOM   4499  C  CD1 . LEU B 1 81  ? 63.939  11.589  36.168  1.00 10.04 ? 81   LEU B CD1 1 
ATOM   4500  C  CD2 . LEU B 1 81  ? 64.191  9.592   34.656  1.00 11.97 ? 81   LEU B CD2 1 
ATOM   4501  N  N   . GLN B 1 82  ? 67.576  14.350  32.917  1.00 14.85 ? 82   GLN B N   1 
ATOM   4502  C  CA  . GLN B 1 82  ? 68.954  14.863  32.696  1.00 16.35 ? 82   GLN B CA  1 
ATOM   4503  C  C   . GLN B 1 82  ? 69.420  15.941  33.699  1.00 17.42 ? 82   GLN B C   1 
ATOM   4504  O  O   . GLN B 1 82  ? 70.575  15.943  34.118  1.00 17.04 ? 82   GLN B O   1 
ATOM   4505  C  CB  . GLN B 1 82  ? 69.139  15.383  31.257  1.00 15.69 ? 82   GLN B CB  1 
ATOM   4506  C  CG  . GLN B 1 82  ? 68.957  14.331  30.174  1.00 16.53 ? 82   GLN B CG  1 
ATOM   4507  C  CD  . GLN B 1 82  ? 69.636  13.022  30.532  1.00 18.08 ? 82   GLN B CD  1 
ATOM   4508  O  OE1 . GLN B 1 82  ? 70.865  12.951  30.636  1.00 18.38 ? 82   GLN B OE1 1 
ATOM   4509  N  NE2 . GLN B 1 82  ? 68.835  11.976  30.735  1.00 17.02 ? 82   GLN B NE2 1 
ATOM   4510  N  N   . GLU B 1 83  ? 68.517  16.846  34.068  1.00 18.79 ? 83   GLU B N   1 
ATOM   4511  C  CA  . GLU B 1 83  ? 68.904  18.057  34.790  1.00 20.49 ? 83   GLU B CA  1 
ATOM   4512  C  C   . GLU B 1 83  ? 68.118  18.220  36.080  1.00 20.28 ? 83   GLU B C   1 
ATOM   4513  O  O   . GLU B 1 83  ? 66.884  18.226  36.085  1.00 19.71 ? 83   GLU B O   1 
ATOM   4514  C  CB  . GLU B 1 83  ? 68.722  19.305  33.911  1.00 20.72 ? 83   GLU B CB  1 
ATOM   4515  C  CG  . GLU B 1 83  ? 69.411  19.232  32.541  1.00 25.97 ? 83   GLU B CG  1 
ATOM   4516  C  CD  . GLU B 1 83  ? 70.891  19.647  32.584  1.00 31.57 ? 83   GLU B CD  1 
ATOM   4517  O  OE1 . GLU B 1 83  ? 71.182  20.838  32.326  1.00 33.69 ? 83   GLU B OE1 1 
ATOM   4518  O  OE2 . GLU B 1 83  ? 71.764  18.789  32.878  1.00 34.50 ? 83   GLU B OE2 1 
ATOM   4519  N  N   . GLU B 1 84  ? 68.858  18.345  37.173  1.00 20.93 ? 84   GLU B N   1 
ATOM   4520  C  CA  . GLU B 1 84  ? 68.300  18.707  38.464  1.00 21.80 ? 84   GLU B CA  1 
ATOM   4521  C  C   . GLU B 1 84  ? 67.380  19.927  38.268  1.00 20.28 ? 84   GLU B C   1 
ATOM   4522  O  O   . GLU B 1 84  ? 67.715  20.847  37.534  1.00 20.39 ? 84   GLU B O   1 
ATOM   4523  C  CB  . GLU B 1 84  ? 69.451  18.972  39.462  1.00 21.59 ? 84   GLU B CB  1 
ATOM   4524  C  CG  . GLU B 1 84  ? 69.069  19.830  40.693  1.00 24.47 ? 84   GLU B CG  1 
ATOM   4525  C  CD  . GLU B 1 84  ? 69.953  19.572  41.912  1.00 25.16 ? 84   GLU B CD  1 
ATOM   4526  O  OE1 . GLU B 1 84  ? 71.045  18.961  41.749  1.00 29.91 ? 84   GLU B OE1 1 
ATOM   4527  O  OE2 . GLU B 1 84  ? 69.548  19.972  43.034  1.00 26.77 ? 84   GLU B OE2 1 
ATOM   4528  N  N   . GLY B 1 85  ? 66.197  19.894  38.868  1.00 19.42 ? 85   GLY B N   1 
ATOM   4529  C  CA  . GLY B 1 85  ? 65.291  21.042  38.841  1.00 18.04 ? 85   GLY B CA  1 
ATOM   4530  C  C   . GLY B 1 85  ? 64.246  21.086  37.743  1.00 16.82 ? 85   GLY B C   1 
ATOM   4531  O  O   . GLY B 1 85  ? 63.331  21.896  37.799  1.00 16.28 ? 85   GLY B O   1 
ATOM   4532  N  N   . THR B 1 86  ? 64.383  20.247  36.726  1.00 16.43 ? 86   THR B N   1 
ATOM   4533  C  CA  . THR B 1 86  ? 63.338  20.165  35.693  1.00 15.78 ? 86   THR B CA  1 
ATOM   4534  C  C   . THR B 1 86  ? 62.032  19.632  36.304  1.00 15.58 ? 86   THR B C   1 
ATOM   4535  O  O   . THR B 1 86  ? 62.053  18.735  37.150  1.00 13.95 ? 86   THR B O   1 
ATOM   4536  C  CB  . THR B 1 86  ? 63.778  19.415  34.368  1.00 16.02 ? 86   THR B CB  1 
ATOM   4537  O  OG1 . THR B 1 86  ? 62.719  18.575  33.868  1.00 15.56 ? 86   THR B OG1 1 
ATOM   4538  C  CG2 . THR B 1 86  ? 65.015  18.599  34.580  1.00 14.50 ? 86   THR B CG2 1 
ATOM   4539  N  N   . GLU B 1 87  ? 60.928  20.271  35.908  1.00 15.21 ? 87   GLU B N   1 
ATOM   4540  C  CA  . GLU B 1 87  ? 59.606  19.985  36.422  1.00 15.39 ? 87   GLU B CA  1 
ATOM   4541  C  C   . GLU B 1 87  ? 58.728  19.466  35.308  1.00 14.13 ? 87   GLU B C   1 
ATOM   4542  O  O   . GLU B 1 87  ? 58.680  20.056  34.232  1.00 13.96 ? 87   GLU B O   1 
ATOM   4543  C  CB  . GLU B 1 87  ? 58.968  21.245  36.992  1.00 15.15 ? 87   GLU B CB  1 
ATOM   4544  C  CG  . GLU B 1 87  ? 59.669  21.811  38.234  1.00 17.68 ? 87   GLU B CG  1 
ATOM   4545  C  CD  . GLU B 1 87  ? 59.066  23.136  38.680  1.00 19.47 ? 87   GLU B CD  1 
ATOM   4546  O  OE1 . GLU B 1 87  ? 59.483  23.660  39.735  1.00 20.78 ? 87   GLU B OE1 1 
ATOM   4547  O  OE2 . GLU B 1 87  ? 58.163  23.652  37.966  1.00 25.56 ? 87   GLU B OE2 1 
ATOM   4548  N  N   . VAL B 1 88  ? 58.029  18.367  35.579  1.00 12.93 ? 88   VAL B N   1 
ATOM   4549  C  CA  . VAL B 1 88  ? 57.092  17.808  34.615  1.00 12.47 ? 88   VAL B CA  1 
ATOM   4550  C  C   . VAL B 1 88  ? 55.673  17.701  35.200  1.00 12.03 ? 88   VAL B C   1 
ATOM   4551  O  O   . VAL B 1 88  ? 55.493  17.264  36.352  1.00 11.77 ? 88   VAL B O   1 
ATOM   4552  C  CB  . VAL B 1 88  ? 57.614  16.459  33.992  1.00 11.88 ? 88   VAL B CB  1 
ATOM   4553  C  CG1 . VAL B 1 88  ? 58.267  15.610  35.023  1.00 13.28 ? 88   VAL B CG1 1 
ATOM   4554  C  CG2 . VAL B 1 88  ? 56.493  15.686  33.351  1.00 12.31 ? 88   VAL B CG2 1 
ATOM   4555  N  N   . PRO B 1 89  ? 54.658  18.130  34.419  1.00 11.66 ? 89   PRO B N   1 
ATOM   4556  C  CA  . PRO B 1 89  ? 53.270  17.939  34.882  1.00 11.06 ? 89   PRO B CA  1 
ATOM   4557  C  C   . PRO B 1 89  ? 52.952  16.443  35.030  1.00 10.73 ? 89   PRO B C   1 
ATOM   4558  O  O   . PRO B 1 89  ? 53.441  15.619  34.246  1.00 10.33 ? 89   PRO B O   1 
ATOM   4559  C  CB  . PRO B 1 89  ? 52.415  18.575  33.768  1.00 11.40 ? 89   PRO B CB  1 
ATOM   4560  C  CG  . PRO B 1 89  ? 53.378  19.474  32.969  1.00 11.16 ? 89   PRO B CG  1 
ATOM   4561  C  CD  . PRO B 1 89  ? 54.738  18.808  33.110  1.00 11.34 ? 89   PRO B CD  1 
ATOM   4562  N  N   . VAL B 1 90  ? 52.195  16.102  36.074  1.00 10.15 ? 90   VAL B N   1 
ATOM   4563  C  CA  . VAL B 1 90  ? 51.709  14.741  36.257  1.00 9.69  ? 90   VAL B CA  1 
ATOM   4564  C  C   . VAL B 1 90  ? 50.210  14.719  36.568  1.00 9.38  ? 90   VAL B C   1 
ATOM   4565  O  O   . VAL B 1 90  ? 49.657  15.675  37.119  1.00 8.21  ? 90   VAL B O   1 
ATOM   4566  C  CB  . VAL B 1 90  ? 52.481  13.936  37.370  1.00 9.00  ? 90   VAL B CB  1 
ATOM   4567  C  CG1 . VAL B 1 90  ? 53.967  13.913  37.116  1.00 9.11  ? 90   VAL B CG1 1 
ATOM   4568  C  CG2 . VAL B 1 90  ? 52.182  14.476  38.772  1.00 10.60 ? 90   VAL B CG2 1 
ATOM   4569  N  N   . PHE B 1 91  ? 49.573  13.611  36.187  1.00 9.13  ? 91   PHE B N   1 
ATOM   4570  C  CA  . PHE B 1 91  ? 48.245  13.256  36.693  1.00 8.72  ? 91   PHE B CA  1 
ATOM   4571  C  C   . PHE B 1 91  ? 48.375  11.898  37.402  1.00 8.51  ? 91   PHE B C   1 
ATOM   4572  O  O   . PHE B 1 91  ? 48.898  10.943  36.840  1.00 8.78  ? 91   PHE B O   1 
ATOM   4573  C  CB  . PHE B 1 91  ? 47.184  13.238  35.569  1.00 7.78  ? 91   PHE B CB  1 
ATOM   4574  C  CG  . PHE B 1 91  ? 45.762  13.027  36.076  1.00 8.01  ? 91   PHE B CG  1 
ATOM   4575  C  CD1 . PHE B 1 91  ? 45.090  14.038  36.755  1.00 6.75  ? 91   PHE B CD1 1 
ATOM   4576  C  CD2 . PHE B 1 91  ? 45.113  11.812  35.897  1.00 7.55  ? 91   PHE B CD2 1 
ATOM   4577  C  CE1 . PHE B 1 91  ? 43.810  13.847  37.243  1.00 6.20  ? 91   PHE B CE1 1 
ATOM   4578  C  CE2 . PHE B 1 91  ? 43.812  11.618  36.390  1.00 8.81  ? 91   PHE B CE2 1 
ATOM   4579  C  CZ  . PHE B 1 91  ? 43.165  12.643  37.064  1.00 5.84  ? 91   PHE B CZ  1 
ATOM   4580  N  N   . ALA B 1 92  ? 47.946  11.829  38.652  1.00 8.42  ? 92   ALA B N   1 
ATOM   4581  C  CA  . ALA B 1 92  ? 48.042  10.579  39.390  1.00 8.38  ? 92   ALA B CA  1 
ATOM   4582  C  C   . ALA B 1 92  ? 46.649  9.986   39.655  1.00 8.56  ? 92   ALA B C   1 
ATOM   4583  O  O   . ALA B 1 92  ? 45.669  10.733  39.805  1.00 9.23  ? 92   ALA B O   1 
ATOM   4584  C  CB  . ALA B 1 92  ? 48.794  10.781  40.685  1.00 7.31  ? 92   ALA B CB  1 
ATOM   4585  N  N   . ARG B 1 93  ? 46.564  8.657   39.691  1.00 7.10  ? 93   ARG B N   1 
ATOM   4586  C  CA  . ARG B 1 93  ? 45.341  8.001   40.112  1.00 6.59  ? 93   ARG B CA  1 
ATOM   4587  C  C   . ARG B 1 93  ? 45.707  6.874   41.079  1.00 5.92  ? 93   ARG B C   1 
ATOM   4588  O  O   . ARG B 1 93  ? 46.592  6.061   40.781  1.00 6.39  ? 93   ARG B O   1 
ATOM   4589  C  CB  . ARG B 1 93  ? 44.535  7.460   38.910  1.00 6.50  ? 93   ARG B CB  1 
ATOM   4590  C  CG  . ARG B 1 93  ? 43.163  6.814   39.312  1.00 7.51  ? 93   ARG B CG  1 
ATOM   4591  C  CD  . ARG B 1 93  ? 42.347  6.349   38.101  1.00 7.13  ? 93   ARG B CD  1 
ATOM   4592  N  NE  . ARG B 1 93  ? 41.016  5.793   38.416  1.00 7.71  ? 93   ARG B NE  1 
ATOM   4593  C  CZ  . ARG B 1 93  ? 40.777  4.524   38.770  1.00 8.75  ? 93   ARG B CZ  1 
ATOM   4594  N  NH1 . ARG B 1 93  ? 41.806  3.673   38.891  1.00 8.93  ? 93   ARG B NH1 1 
ATOM   4595  N  NH2 . ARG B 1 93  ? 39.519  4.100   39.017  1.00 3.23  ? 93   ARG B NH2 1 
ATOM   4596  N  N   . PHE B 1 94  ? 45.039  6.856   42.226  1.00 4.49  ? 94   PHE B N   1 
ATOM   4597  C  CA  . PHE B 1 94  ? 45.181  5.816   43.215  1.00 4.68  ? 94   PHE B CA  1 
ATOM   4598  C  C   . PHE B 1 94  ? 43.867  5.082   43.276  1.00 4.52  ? 94   PHE B C   1 
ATOM   4599  O  O   . PHE B 1 94  ? 42.820  5.652   42.970  1.00 4.25  ? 94   PHE B O   1 
ATOM   4600  C  CB  . PHE B 1 94  ? 45.513  6.410   44.585  1.00 4.81  ? 94   PHE B CB  1 
ATOM   4601  C  CG  . PHE B 1 94  ? 46.663  7.384   44.559  1.00 6.02  ? 94   PHE B CG  1 
ATOM   4602  C  CD1 . PHE B 1 94  ? 46.435  8.751   44.787  1.00 5.85  ? 94   PHE B CD1 1 
ATOM   4603  C  CD2 . PHE B 1 94  ? 47.960  6.949   44.269  1.00 3.13  ? 94   PHE B CD2 1 
ATOM   4604  C  CE1 . PHE B 1 94  ? 47.471  9.639   44.740  1.00 4.37  ? 94   PHE B CE1 1 
ATOM   4605  C  CE2 . PHE B 1 94  ? 49.011  7.838   44.231  1.00 3.68  ? 94   PHE B CE2 1 
ATOM   4606  C  CZ  . PHE B 1 94  ? 48.774  9.178   44.460  1.00 5.39  ? 94   PHE B CZ  1 
ATOM   4607  N  N   . SER B 1 95  ? 43.911  3.826   43.692  1.00 5.22  ? 95   SER B N   1 
ATOM   4608  C  CA  . SER B 1 95  ? 42.772  2.927   43.503  1.00 6.16  ? 95   SER B CA  1 
ATOM   4609  C  C   . SER B 1 95  ? 42.832  1.689   44.384  1.00 7.00  ? 95   SER B C   1 
ATOM   4610  O  O   . SER B 1 95  ? 43.904  1.324   44.864  1.00 8.21  ? 95   SER B O   1 
ATOM   4611  C  CB  . SER B 1 95  ? 42.763  2.456   42.043  1.00 6.20  ? 95   SER B CB  1 
ATOM   4612  O  OG  . SER B 1 95  ? 43.970  1.798   41.727  1.00 4.20  ? 95   SER B OG  1 
ATOM   4613  N  N   . THR B 1 96  ? 41.698  1.022   44.577  1.00 6.88  ? 96   THR B N   1 
ATOM   4614  C  CA  . THR B 1 96  ? 41.716  -0.329  45.114  1.00 7.38  ? 96   THR B CA  1 
ATOM   4615  C  C   . THR B 1 96  ? 41.802  -1.262  43.894  1.00 7.62  ? 96   THR B C   1 
ATOM   4616  O  O   . THR B 1 96  ? 42.176  -0.798  42.826  1.00 8.15  ? 96   THR B O   1 
ATOM   4617  C  CB  . THR B 1 96  ? 40.493  -0.616  46.000  1.00 7.35  ? 96   THR B CB  1 
ATOM   4618  O  OG1 . THR B 1 96  ? 39.296  -0.432  45.236  1.00 5.98  ? 96   THR B OG1 1 
ATOM   4619  C  CG2 . THR B 1 96  ? 40.484  0.336   47.164  1.00 8.59  ? 96   THR B CG2 1 
ATOM   4620  N  N   . VAL B 1 97  ? 41.464  -2.546  44.034  1.00 7.69  ? 97   VAL B N   1 
ATOM   4621  C  CA  . VAL B 1 97  ? 41.673  -3.499  42.946  1.00 7.85  ? 97   VAL B CA  1 
ATOM   4622  C  C   . VAL B 1 97  ? 40.391  -4.219  42.493  1.00 7.98  ? 97   VAL B C   1 
ATOM   4623  O  O   . VAL B 1 97  ? 39.948  -4.095  41.337  1.00 7.82  ? 97   VAL B O   1 
ATOM   4624  C  CB  . VAL B 1 97  ? 42.787  -4.569  43.309  1.00 7.90  ? 97   VAL B CB  1 
ATOM   4625  C  CG1 . VAL B 1 97  ? 42.913  -5.615  42.205  1.00 7.53  ? 97   VAL B CG1 1 
ATOM   4626  C  CG2 . VAL B 1 97  ? 44.128  -3.906  43.555  1.00 7.81  ? 97   VAL B CG2 1 
ATOM   4627  N  N   . ILE B 1 98  ? 39.808  -4.976  43.416  1.00 7.83  ? 98   ILE B N   1 
ATOM   4628  C  CA  . ILE B 1 98  ? 38.872  -6.031  43.060  1.00 8.01  ? 98   ILE B CA  1 
ATOM   4629  C  C   . ILE B 1 98  ? 37.453  -5.533  42.869  1.00 8.17  ? 98   ILE B C   1 
ATOM   4630  O  O   . ILE B 1 98  ? 36.813  -5.862  41.880  1.00 8.79  ? 98   ILE B O   1 
ATOM   4631  C  CB  . ILE B 1 98  ? 38.957  -7.220  44.062  1.00 7.64  ? 98   ILE B CB  1 
ATOM   4632  C  CG1 . ILE B 1 98  ? 40.300  -7.916  43.907  1.00 8.47  ? 98   ILE B CG1 1 
ATOM   4633  C  CG2 . ILE B 1 98  ? 37.819  -8.243  43.847  1.00 7.44  ? 98   ILE B CG2 1 
ATOM   4634  C  CD1 . ILE B 1 98  ? 40.588  -8.451  42.479  1.00 7.14  ? 98   ILE B CD1 1 
ATOM   4635  N  N   . HIS B 1 99  ? 36.962  -4.728  43.789  1.00 8.17  ? 99   HIS B N   1 
ATOM   4636  C  CA  . HIS B 1 99  ? 35.579  -4.331  43.685  1.00 9.32  ? 99   HIS B CA  1 
ATOM   4637  C  C   . HIS B 1 99  ? 35.334  -3.127  42.745  1.00 9.97  ? 99   HIS B C   1 
ATOM   4638  O  O   . HIS B 1 99  ? 36.268  -2.479  42.292  1.00 9.87  ? 99   HIS B O   1 
ATOM   4639  C  CB  . HIS B 1 99  ? 34.947  -4.188  45.076  1.00 8.26  ? 99   HIS B CB  1 
ATOM   4640  C  CG  . HIS B 1 99  ? 34.792  -5.501  45.793  1.00 8.98  ? 99   HIS B CG  1 
ATOM   4641  N  ND1 . HIS B 1 99  ? 35.821  -6.102  46.492  1.00 9.01  ? 99   HIS B ND1 1 
ATOM   4642  C  CD2 . HIS B 1 99  ? 33.730  -6.331  45.909  1.00 7.82  ? 99   HIS B CD2 1 
ATOM   4643  C  CE1 . HIS B 1 99  ? 35.394  -7.233  47.024  1.00 10.28 ? 99   HIS B CE1 1 
ATOM   4644  N  NE2 . HIS B 1 99  ? 34.125  -7.391  46.693  1.00 11.53 ? 99   HIS B NE2 1 
ATOM   4645  N  N   . GLY B 1 100 ? 34.066  -2.867  42.444  1.00 10.95 ? 100  GLY B N   1 
ATOM   4646  C  CA  . GLY B 1 100 ? 33.678  -1.875  41.452  1.00 11.85 ? 100  GLY B CA  1 
ATOM   4647  C  C   . GLY B 1 100 ? 33.516  -0.448  41.959  1.00 12.50 ? 100  GLY B C   1 
ATOM   4648  O  O   . GLY B 1 100 ? 33.796  -0.122  43.114  1.00 11.96 ? 100  GLY B O   1 
ATOM   4649  N  N   . THR B 1 101 ? 33.068  0.404   41.051  1.00 13.09 ? 101  THR B N   1 
ATOM   4650  C  CA  . THR B 1 101 ? 32.864  1.811   41.315  1.00 13.11 ? 101  THR B CA  1 
ATOM   4651  C  C   . THR B 1 101 ? 32.018  1.883   42.586  1.00 12.80 ? 101  THR B C   1 
ATOM   4652  O  O   . THR B 1 101 ? 31.132  1.037   42.797  1.00 13.66 ? 101  THR B O   1 
ATOM   4653  C  CB  . THR B 1 101 ? 32.167  2.458   40.047  1.00 12.61 ? 101  THR B CB  1 
ATOM   4654  O  OG1 . THR B 1 101 ? 32.953  3.554   39.566  1.00 15.20 ? 101  THR B OG1 1 
ATOM   4655  C  CG2 . THR B 1 101 ? 30.780  2.956   40.331  1.00 12.11 ? 101  THR B CG2 1 
ATOM   4656  N  N   . HIS B 1 102 ? 32.307  2.842   43.453  1.00 12.34 ? 102  HIS B N   1 
ATOM   4657  C  CA  . HIS B 1 102 ? 31.503  3.070   44.681  1.00 12.01 ? 102  HIS B CA  1 
ATOM   4658  C  C   . HIS B 1 102 ? 31.602  1.947   45.726  1.00 11.41 ? 102  HIS B C   1 
ATOM   4659  O  O   . HIS B 1 102 ? 30.871  1.906   46.703  1.00 11.82 ? 102  HIS B O   1 
ATOM   4660  C  CB  . HIS B 1 102 ? 30.035  3.443   44.365  1.00 12.77 ? 102  HIS B CB  1 
ATOM   4661  C  CG  . HIS B 1 102 ? 29.869  4.748   43.627  1.00 13.88 ? 102  HIS B CG  1 
ATOM   4662  N  ND1 . HIS B 1 102 ? 28.694  5.103   43.002  1.00 14.45 ? 102  HIS B ND1 1 
ATOM   4663  C  CD2 . HIS B 1 102 ? 30.724  5.782   43.421  1.00 15.95 ? 102  HIS B CD2 1 
ATOM   4664  C  CE1 . HIS B 1 102 ? 28.826  6.291   42.438  1.00 14.55 ? 102  HIS B CE1 1 
ATOM   4665  N  NE2 . HIS B 1 102 ? 30.047  6.730   42.684  1.00 17.59 ? 102  HIS B NE2 1 
ATOM   4666  N  N   . SER B 1 103 ? 32.557  1.065   45.518  1.00 10.65 ? 103  SER B N   1 
ATOM   4667  C  CA  . SER B 1 103 ? 32.990  0.067   46.474  1.00 10.55 ? 103  SER B CA  1 
ATOM   4668  C  C   . SER B 1 103 ? 33.624  0.738   47.720  1.00 9.64  ? 103  SER B C   1 
ATOM   4669  O  O   . SER B 1 103 ? 34.231  1.800   47.608  1.00 9.17  ? 103  SER B O   1 
ATOM   4670  C  CB  . SER B 1 103 ? 34.055  -0.785  45.798  1.00 9.78  ? 103  SER B CB  1 
ATOM   4671  O  OG  . SER B 1 103 ? 34.077  -2.019  46.464  1.00 15.46 ? 103  SER B OG  1 
ATOM   4672  N  N   . PRO B 1 104 ? 33.481  0.132   48.915  1.00 9.11  ? 104  PRO B N   1 
ATOM   4673  C  CA  . PRO B 1 104 ? 34.148  0.798   50.016  1.00 8.98  ? 104  PRO B CA  1 
ATOM   4674  C  C   . PRO B 1 104 ? 35.669  0.890   49.804  1.00 9.05  ? 104  PRO B C   1 
ATOM   4675  O  O   . PRO B 1 104 ? 36.274  0.053   49.128  1.00 8.53  ? 104  PRO B O   1 
ATOM   4676  C  CB  . PRO B 1 104 ? 33.796  -0.080  51.218  1.00 8.06  ? 104  PRO B CB  1 
ATOM   4677  C  CG  . PRO B 1 104 ? 32.520  -0.713  50.834  1.00 7.98  ? 104  PRO B CG  1 
ATOM   4678  C  CD  . PRO B 1 104 ? 32.727  -1.044  49.393  1.00 9.38  ? 104  PRO B CD  1 
ATOM   4679  N  N   . GLU B 1 105 ? 36.252  1.948   50.354  1.00 9.17  ? 105  GLU B N   1 
ATOM   4680  C  CA  . GLU B 1 105 ? 37.684  2.140   50.308  1.00 9.30  ? 105  GLU B CA  1 
ATOM   4681  C  C   . GLU B 1 105 ? 38.401  1.523   51.515  1.00 9.14  ? 105  GLU B C   1 
ATOM   4682  O  O   . GLU B 1 105 ? 39.598  1.704   51.666  1.00 8.69  ? 105  GLU B O   1 
ATOM   4683  C  CB  . GLU B 1 105 ? 38.006  3.632   50.107  1.00 9.22  ? 105  GLU B CB  1 
ATOM   4684  C  CG  . GLU B 1 105 ? 38.036  3.997   48.619  1.00 9.12  ? 105  GLU B CG  1 
ATOM   4685  C  CD  . GLU B 1 105 ? 38.096  5.495   48.338  1.00 10.08 ? 105  GLU B CD  1 
ATOM   4686  O  OE1 . GLU B 1 105 ? 37.679  6.304   49.183  1.00 10.42 ? 105  GLU B OE1 1 
ATOM   4687  O  OE2 . GLU B 1 105 ? 38.537  5.873   47.237  1.00 11.67 ? 105  GLU B OE2 1 
ATOM   4688  N  N   . THR B 1 106 ? 37.662  0.756   52.325  1.00 9.31  ? 106  THR B N   1 
ATOM   4689  C  CA  . THR B 1 106 ? 38.173  0.155   53.571  1.00 9.81  ? 106  THR B CA  1 
ATOM   4690  C  C   . THR B 1 106 ? 38.487  -1.338  53.439  1.00 9.53  ? 106  THR B C   1 
ATOM   4691  O  O   . THR B 1 106 ? 38.852  -2.007  54.414  1.00 8.88  ? 106  THR B O   1 
ATOM   4692  C  CB  . THR B 1 106 ? 37.148  0.283   54.680  1.00 9.88  ? 106  THR B CB  1 
ATOM   4693  O  OG1 . THR B 1 106 ? 35.860  0.068   54.106  1.00 11.78 ? 106  THR B OG1 1 
ATOM   4694  C  CG2 . THR B 1 106 ? 37.192  1.678   55.317  1.00 9.59  ? 106  THR B CG2 1 
ATOM   4695  N  N   . LEU B 1 107 ? 38.326  -1.847  52.223  1.00 9.28  ? 107  LEU B N   1 
ATOM   4696  C  CA  . LEU B 1 107 ? 38.578  -3.251  51.909  1.00 8.15  ? 107  LEU B CA  1 
ATOM   4697  C  C   . LEU B 1 107 ? 40.059  -3.559  51.745  1.00 7.64  ? 107  LEU B C   1 
ATOM   4698  O  O   . LEU B 1 107 ? 40.844  -2.712  51.324  1.00 7.19  ? 107  LEU B O   1 
ATOM   4699  C  CB  . LEU B 1 107 ? 37.793  -3.645  50.640  1.00 7.65  ? 107  LEU B CB  1 
ATOM   4700  C  CG  . LEU B 1 107 ? 36.258  -3.502  50.705  1.00 6.25  ? 107  LEU B CG  1 
ATOM   4701  C  CD1 . LEU B 1 107 ? 35.645  -4.191  49.540  1.00 5.24  ? 107  LEU B CD1 1 
ATOM   4702  C  CD2 . LEU B 1 107 ? 35.665  -4.060  51.985  1.00 5.12  ? 107  LEU B CD2 1 
ATOM   4703  N  N   . ARG B 1 108 ? 40.406  -4.799  52.072  1.00 7.78  ? 108  ARG B N   1 
ATOM   4704  C  CA  . ARG B 1 108 ? 41.734  -5.360  51.910  1.00 8.02  ? 108  ARG B CA  1 
ATOM   4705  C  C   . ARG B 1 108 ? 42.034  -5.651  50.435  1.00 7.84  ? 108  ARG B C   1 
ATOM   4706  O  O   . ARG B 1 108 ? 41.329  -6.396  49.784  1.00 8.22  ? 108  ARG B O   1 
ATOM   4707  C  CB  . ARG B 1 108 ? 41.869  -6.652  52.748  1.00 7.70  ? 108  ARG B CB  1 
ATOM   4708  C  CG  . ARG B 1 108 ? 43.292  -7.276  52.698  1.00 8.79  ? 108  ARG B CG  1 
ATOM   4709  C  CD  . ARG B 1 108 ? 43.473  -8.473  53.630  1.00 9.00  ? 108  ARG B CD  1 
ATOM   4710  N  NE  . ARG B 1 108 ? 43.067  -8.161  55.006  1.00 12.30 ? 108  ARG B NE  1 
ATOM   4711  C  CZ  . ARG B 1 108 ? 43.747  -7.377  55.850  1.00 12.99 ? 108  ARG B CZ  1 
ATOM   4712  N  NH1 . ARG B 1 108 ? 43.252  -7.156  57.075  1.00 13.47 ? 108  ARG B NH1 1 
ATOM   4713  N  NH2 . ARG B 1 108 ? 44.905  -6.807  55.481  1.00 9.35  ? 108  ARG B NH2 1 
ATOM   4714  N  N   . ASP B 1 109 ? 43.122  -5.098  49.931  1.00 7.94  ? 109  ASP B N   1 
ATOM   4715  C  CA  . ASP B 1 109 ? 43.439  -5.109  48.499  1.00 7.05  ? 109  ASP B CA  1 
ATOM   4716  C  C   . ASP B 1 109 ? 44.775  -4.431  48.372  1.00 6.53  ? 109  ASP B C   1 
ATOM   4717  O  O   . ASP B 1 109 ? 45.145  -3.569  49.209  1.00 5.82  ? 109  ASP B O   1 
ATOM   4718  C  CB  . ASP B 1 109 ? 42.436  -4.235  47.724  1.00 7.78  ? 109  ASP B CB  1 
ATOM   4719  C  CG  . ASP B 1 109 ? 41.537  -5.032  46.771  1.00 8.48  ? 109  ASP B CG  1 
ATOM   4720  O  OD1 . ASP B 1 109 ? 40.624  -4.398  46.205  1.00 8.71  ? 109  ASP B OD1 1 
ATOM   4721  O  OD2 . ASP B 1 109 ? 41.747  -6.257  46.559  1.00 8.18  ? 109  ASP B OD2 1 
ATOM   4722  N  N   . PRO B 1 110 ? 45.530  -4.803  47.335  1.00 6.35  ? 110  PRO B N   1 
ATOM   4723  C  CA  . PRO B 1 110 ? 46.668  -3.930  47.035  1.00 6.20  ? 110  PRO B CA  1 
ATOM   4724  C  C   . PRO B 1 110 ? 46.075  -2.556  46.693  1.00 6.81  ? 110  PRO B C   1 
ATOM   4725  O  O   . PRO B 1 110 ? 44.869  -2.445  46.452  1.00 6.59  ? 110  PRO B O   1 
ATOM   4726  C  CB  . PRO B 1 110 ? 47.302  -4.585  45.805  1.00 6.77  ? 110  PRO B CB  1 
ATOM   4727  C  CG  . PRO B 1 110 ? 46.719  -6.015  45.748  1.00 5.17  ? 110  PRO B CG  1 
ATOM   4728  C  CD  . PRO B 1 110 ? 45.397  -5.947  46.407  1.00 5.87  ? 110  PRO B CD  1 
ATOM   4729  N  N   . ARG B 1 111 ? 46.887  -1.504  46.702  1.00 7.11  ? 111  ARG B N   1 
ATOM   4730  C  CA  . ARG B 1 111 ? 46.389  -0.187  46.291  1.00 6.48  ? 111  ARG B CA  1 
ATOM   4731  C  C   . ARG B 1 111 ? 47.185  0.261   45.091  1.00 6.36  ? 111  ARG B C   1 
ATOM   4732  O  O   . ARG B 1 111 ? 48.412  0.312   45.151  1.00 5.75  ? 111  ARG B O   1 
ATOM   4733  C  CB  . ARG B 1 111 ? 46.525  0.842   47.417  1.00 6.55  ? 111  ARG B CB  1 
ATOM   4734  C  CG  . ARG B 1 111 ? 45.203  1.271   48.074  1.00 7.20  ? 111  ARG B CG  1 
ATOM   4735  C  CD  . ARG B 1 111 ? 44.444  0.087   48.601  1.00 8.67  ? 111  ARG B CD  1 
ATOM   4736  N  NE  . ARG B 1 111 ? 43.392  0.450   49.530  1.00 8.36  ? 111  ARG B NE  1 
ATOM   4737  C  CZ  . ARG B 1 111 ? 42.686  -0.435  50.231  1.00 9.64  ? 111  ARG B CZ  1 
ATOM   4738  N  NH1 . ARG B 1 111 ? 42.924  -1.728  50.092  1.00 8.64  ? 111  ARG B NH1 1 
ATOM   4739  N  NH2 . ARG B 1 111 ? 41.749  -0.030  51.089  1.00 9.82  ? 111  ARG B NH2 1 
ATOM   4740  N  N   . GLY B 1 112 ? 46.478  0.582   44.006  1.00 5.86  ? 112  GLY B N   1 
ATOM   4741  C  CA  . GLY B 1 112 ? 47.111  1.044   42.788  1.00 5.26  ? 112  GLY B CA  1 
ATOM   4742  C  C   . GLY B 1 112 ? 47.694  2.441   42.953  1.00 5.60  ? 112  GLY B C   1 
ATOM   4743  O  O   . GLY B 1 112 ? 47.128  3.285   43.673  1.00 4.78  ? 112  GLY B O   1 
ATOM   4744  N  N   . PHE B 1 113 ? 48.821  2.661   42.273  1.00 4.67  ? 113  PHE B N   1 
ATOM   4745  C  CA  . PHE B 1 113 ? 49.588  3.894   42.343  1.00 5.06  ? 113  PHE B CA  1 
ATOM   4746  C  C   . PHE B 1 113 ? 50.024  4.214   40.916  1.00 4.46  ? 113  PHE B C   1 
ATOM   4747  O  O   . PHE B 1 113 ? 51.019  3.711   40.442  1.00 4.53  ? 113  PHE B O   1 
ATOM   4748  C  CB  . PHE B 1 113 ? 50.809  3.664   43.259  1.00 5.23  ? 113  PHE B CB  1 
ATOM   4749  C  CG  . PHE B 1 113 ? 51.494  4.920   43.744  1.00 4.51  ? 113  PHE B CG  1 
ATOM   4750  C  CD1 . PHE B 1 113 ? 52.011  5.854   42.853  1.00 4.65  ? 113  PHE B CD1 1 
ATOM   4751  C  CD2 . PHE B 1 113 ? 51.668  5.133   45.107  1.00 5.80  ? 113  PHE B CD2 1 
ATOM   4752  C  CE1 . PHE B 1 113 ? 52.681  6.988   43.312  1.00 3.61  ? 113  PHE B CE1 1 
ATOM   4753  C  CE2 . PHE B 1 113 ? 52.320  6.270   45.583  1.00 6.57  ? 113  PHE B CE2 1 
ATOM   4754  C  CZ  . PHE B 1 113 ? 52.834  7.195   44.679  1.00 6.06  ? 113  PHE B CZ  1 
ATOM   4755  N  N   . SER B 1 114 ? 49.251  5.029   40.221  1.00 5.06  ? 114  SER B N   1 
ATOM   4756  C  CA  . SER B 1 114 ? 49.499  5.303   38.805  1.00 5.61  ? 114  SER B CA  1 
ATOM   4757  C  C   . SER B 1 114 ? 49.847  6.770   38.601  1.00 6.29  ? 114  SER B C   1 
ATOM   4758  O  O   . SER B 1 114 ? 49.184  7.654   39.153  1.00 7.28  ? 114  SER B O   1 
ATOM   4759  C  CB  . SER B 1 114 ? 48.282  4.926   37.964  1.00 5.28  ? 114  SER B CB  1 
ATOM   4760  O  OG  . SER B 1 114 ? 47.996  3.542   38.107  1.00 5.40  ? 114  SER B OG  1 
ATOM   4761  N  N   . VAL B 1 115 ? 50.876  7.026   37.803  1.00 7.09  ? 115  VAL B N   1 
ATOM   4762  C  CA  . VAL B 1 115 ? 51.327  8.398   37.521  1.00 7.52  ? 115  VAL B CA  1 
ATOM   4763  C  C   . VAL B 1 115 ? 51.687  8.584   36.042  1.00 7.95  ? 115  VAL B C   1 
ATOM   4764  O  O   . VAL B 1 115 ? 52.573  7.894   35.505  1.00 7.91  ? 115  VAL B O   1 
ATOM   4765  C  CB  . VAL B 1 115 ? 52.527  8.817   38.440  1.00 7.76  ? 115  VAL B CB  1 
ATOM   4766  C  CG1 . VAL B 1 115 ? 52.989  10.238  38.114  1.00 7.50  ? 115  VAL B CG1 1 
ATOM   4767  C  CG2 . VAL B 1 115 ? 52.146  8.703   39.904  1.00 5.28  ? 115  VAL B CG2 1 
ATOM   4768  N  N   . LYS B 1 116 ? 50.980  9.512   35.400  1.00 8.00  ? 116  LYS B N   1 
ATOM   4769  C  CA  . LYS B 1 116 ? 51.238  9.896   34.022  1.00 8.19  ? 116  LYS B CA  1 
ATOM   4770  C  C   . LYS B 1 116 ? 52.143  11.127  34.009  1.00 8.72  ? 116  LYS B C   1 
ATOM   4771  O  O   . LYS B 1 116 ? 51.789  12.161  34.593  1.00 9.01  ? 116  LYS B O   1 
ATOM   4772  C  CB  . LYS B 1 116 ? 49.913  10.231  33.307  1.00 8.27  ? 116  LYS B CB  1 
ATOM   4773  C  CG  . LYS B 1 116 ? 50.073  10.701  31.854  1.00 7.70  ? 116  LYS B CG  1 
ATOM   4774  C  CD  . LYS B 1 116 ? 48.763  10.662  31.041  1.00 7.20  ? 116  LYS B CD  1 
ATOM   4775  C  CE  . LYS B 1 116 ? 48.029  9.337   31.160  1.00 4.50  ? 116  LYS B CE  1 
ATOM   4776  N  NZ  . LYS B 1 116 ? 48.637  8.292   30.340  1.00 3.85  ? 116  LYS B NZ  1 
ATOM   4777  N  N   . PHE B 1 117 ? 53.296  11.008  33.354  1.00 8.97  ? 117  PHE B N   1 
ATOM   4778  C  CA  . PHE B 1 117 ? 54.258  12.124  33.196  1.00 9.14  ? 117  PHE B CA  1 
ATOM   4779  C  C   . PHE B 1 117 ? 54.143  12.666  31.797  1.00 9.31  ? 117  PHE B C   1 
ATOM   4780  O  O   . PHE B 1 117 ? 54.358  11.930  30.846  1.00 9.92  ? 117  PHE B O   1 
ATOM   4781  C  CB  . PHE B 1 117 ? 55.714  11.669  33.394  1.00 7.93  ? 117  PHE B CB  1 
ATOM   4782  C  CG  . PHE B 1 117 ? 56.015  11.199  34.771  1.00 8.73  ? 117  PHE B CG  1 
ATOM   4783  C  CD1 . PHE B 1 117 ? 55.435  10.020  35.268  1.00 8.35  ? 117  PHE B CD1 1 
ATOM   4784  C  CD2 . PHE B 1 117 ? 56.888  11.919  35.587  1.00 7.72  ? 117  PHE B CD2 1 
ATOM   4785  C  CE1 . PHE B 1 117 ? 55.741  9.562   36.557  1.00 8.02  ? 117  PHE B CE1 1 
ATOM   4786  C  CE2 . PHE B 1 117 ? 57.187  11.480  36.864  1.00 6.53  ? 117  PHE B CE2 1 
ATOM   4787  C  CZ  . PHE B 1 117 ? 56.610  10.298  37.353  1.00 8.40  ? 117  PHE B CZ  1 
ATOM   4788  N  N   . TYR B 1 118 ? 53.811  13.942  31.672  1.00 9.37  ? 118  TYR B N   1 
ATOM   4789  C  CA  . TYR B 1 118 ? 53.680  14.556  30.358  1.00 9.63  ? 118  TYR B CA  1 
ATOM   4790  C  C   . TYR B 1 118 ? 54.984  15.213  30.029  1.00 10.89 ? 118  TYR B C   1 
ATOM   4791  O  O   . TYR B 1 118 ? 55.248  16.353  30.412  1.00 11.21 ? 118  TYR B O   1 
ATOM   4792  C  CB  . TYR B 1 118 ? 52.566  15.581  30.348  1.00 8.44  ? 118  TYR B CB  1 
ATOM   4793  C  CG  . TYR B 1 118 ? 51.219  15.055  30.771  1.00 7.66  ? 118  TYR B CG  1 
ATOM   4794  C  CD1 . TYR B 1 118 ? 50.835  15.070  32.111  1.00 7.34  ? 118  TYR B CD1 1 
ATOM   4795  C  CD2 . TYR B 1 118 ? 50.303  14.577  29.823  1.00 5.84  ? 118  TYR B CD2 1 
ATOM   4796  C  CE1 . TYR B 1 118 ? 49.558  14.620  32.504  1.00 6.91  ? 118  TYR B CE1 1 
ATOM   4797  C  CE2 . TYR B 1 118 ? 49.037  14.142  30.200  1.00 6.13  ? 118  TYR B CE2 1 
ATOM   4798  C  CZ  . TYR B 1 118 ? 48.673  14.159  31.542  1.00 7.50  ? 118  TYR B CZ  1 
ATOM   4799  O  OH  . TYR B 1 118 ? 47.424  13.703  31.926  1.00 8.29  ? 118  TYR B OH  1 
ATOM   4800  N  N   . THR B 1 119 ? 55.796  14.469  29.292  1.00 12.84 ? 119  THR B N   1 
ATOM   4801  C  CA  . THR B 1 119 ? 57.220  14.743  29.109  1.00 13.63 ? 119  THR B CA  1 
ATOM   4802  C  C   . THR B 1 119 ? 57.432  15.448  27.782  1.00 13.81 ? 119  THR B C   1 
ATOM   4803  O  O   . THR B 1 119 ? 56.607  15.332  26.888  1.00 13.64 ? 119  THR B O   1 
ATOM   4804  C  CB  . THR B 1 119 ? 57.972  13.381  29.146  1.00 13.80 ? 119  THR B CB  1 
ATOM   4805  O  OG1 . THR B 1 119 ? 58.365  13.081  30.489  1.00 15.90 ? 119  THR B OG1 1 
ATOM   4806  C  CG2 . THR B 1 119 ? 59.152  13.358  28.271  1.00 12.26 ? 119  THR B CG2 1 
ATOM   4807  N  N   . GLU B 1 120 ? 58.541  16.171  27.665  1.00 14.48 ? 120  GLU B N   1 
ATOM   4808  C  CA  . GLU B 1 120 ? 58.963  16.780  26.400  1.00 16.05 ? 120  GLU B CA  1 
ATOM   4809  C  C   . GLU B 1 120 ? 59.253  15.748  25.271  1.00 15.15 ? 120  GLU B C   1 
ATOM   4810  O  O   . GLU B 1 120 ? 59.280  16.108  24.095  1.00 15.23 ? 120  GLU B O   1 
ATOM   4811  C  CB  . GLU B 1 120 ? 60.170  17.712  26.646  1.00 16.82 ? 120  GLU B CB  1 
ATOM   4812  C  CG  . GLU B 1 120 ? 60.337  18.832  25.604  1.00 22.15 ? 120  GLU B CG  1 
ATOM   4813  C  CD  . GLU B 1 120 ? 60.850  20.159  26.212  1.00 28.56 ? 120  GLU B CD  1 
ATOM   4814  O  OE1 . GLU B 1 120 ? 61.975  20.176  26.775  1.00 30.54 ? 120  GLU B OE1 1 
ATOM   4815  O  OE2 . GLU B 1 120 ? 60.129  21.186  26.113  1.00 28.98 ? 120  GLU B OE2 1 
ATOM   4816  N  N   . GLU B 1 121 ? 59.462  14.479  25.627  1.00 14.06 ? 121  GLU B N   1 
ATOM   4817  C  CA  . GLU B 1 121 ? 59.643  13.410  24.630  1.00 13.35 ? 121  GLU B CA  1 
ATOM   4818  C  C   . GLU B 1 121 ? 58.547  12.334  24.685  1.00 12.19 ? 121  GLU B C   1 
ATOM   4819  O  O   . GLU B 1 121 ? 58.805  11.150  24.414  1.00 10.95 ? 121  GLU B O   1 
ATOM   4820  C  CB  . GLU B 1 121 ? 61.039  12.776  24.765  1.00 13.70 ? 121  GLU B CB  1 
ATOM   4821  C  CG  . GLU B 1 121 ? 62.173  13.656  24.199  1.00 13.89 ? 121  GLU B CG  1 
ATOM   4822  C  CD  . GLU B 1 121 ? 63.547  12.998  24.263  1.00 13.69 ? 121  GLU B CD  1 
ATOM   4823  O  OE1 . GLU B 1 121 ? 63.674  11.906  24.847  1.00 13.72 ? 121  GLU B OE1 1 
ATOM   4824  O  OE2 . GLU B 1 121 ? 64.518  13.596  23.748  1.00 15.02 ? 121  GLU B OE2 1 
ATOM   4825  N  N   . GLY B 1 122 ? 57.335  12.757  25.059  1.00 11.04 ? 122  GLY B N   1 
ATOM   4826  C  CA  . GLY B 1 122 ? 56.196  11.856  25.212  1.00 9.83  ? 122  GLY B CA  1 
ATOM   4827  C  C   . GLY B 1 122 ? 55.699  11.594  26.628  1.00 9.86  ? 122  GLY B C   1 
ATOM   4828  O  O   . GLY B 1 122 ? 56.277  12.068  27.634  1.00 8.57  ? 122  GLY B O   1 
ATOM   4829  N  N   . ASN B 1 123 ? 54.604  10.839  26.716  1.00 9.47  ? 123  ASN B N   1 
ATOM   4830  C  CA  . ASN B 1 123 ? 54.101  10.414  28.019  1.00 9.08  ? 123  ASN B CA  1 
ATOM   4831  C  C   . ASN B 1 123 ? 54.822  9.174   28.545  1.00 9.07  ? 123  ASN B C   1 
ATOM   4832  O  O   . ASN B 1 123 ? 55.094  8.226   27.784  1.00 8.92  ? 123  ASN B O   1 
ATOM   4833  C  CB  . ASN B 1 123 ? 52.588  10.204  27.996  1.00 8.81  ? 123  ASN B CB  1 
ATOM   4834  C  CG  . ASN B 1 123 ? 51.810  11.509  27.762  1.00 9.26  ? 123  ASN B CG  1 
ATOM   4835  O  OD1 . ASN B 1 123 ? 52.377  12.622  27.738  1.00 7.84  ? 123  ASN B OD1 1 
ATOM   4836  N  ND2 . ASN B 1 123 ? 50.500  11.372  27.602  1.00 6.20  ? 123  ASN B ND2 1 
ATOM   4837  N  N   . TRP B 1 124 ? 55.165  9.214   29.836  1.00 8.64  ? 124  TRP B N   1 
ATOM   4838  C  CA  . TRP B 1 124 ? 55.578  8.027   30.564  1.00 8.80  ? 124  TRP B CA  1 
ATOM   4839  C  C   . TRP B 1 124 ? 54.554  7.724   31.647  1.00 9.24  ? 124  TRP B C   1 
ATOM   4840  O  O   . TRP B 1 124 ? 54.156  8.610   32.417  1.00 10.15 ? 124  TRP B O   1 
ATOM   4841  C  CB  . TRP B 1 124 ? 56.988  8.189   31.170  1.00 8.61  ? 124  TRP B CB  1 
ATOM   4842  C  CG  . TRP B 1 124 ? 57.390  7.067   32.139  1.00 8.92  ? 124  TRP B CG  1 
ATOM   4843  C  CD1 . TRP B 1 124 ? 57.246  5.711   31.950  1.00 9.31  ? 124  TRP B CD1 1 
ATOM   4844  C  CD2 . TRP B 1 124 ? 57.986  7.219   33.429  1.00 9.13  ? 124  TRP B CD2 1 
ATOM   4845  N  NE1 . TRP B 1 124 ? 57.718  5.020   33.039  1.00 6.99  ? 124  TRP B NE1 1 
ATOM   4846  C  CE2 . TRP B 1 124 ? 58.177  5.925   33.961  1.00 8.33  ? 124  TRP B CE2 1 
ATOM   4847  C  CE3 . TRP B 1 124 ? 58.383  8.322   34.187  1.00 8.74  ? 124  TRP B CE3 1 
ATOM   4848  C  CZ2 . TRP B 1 124 ? 58.740  5.713   35.212  1.00 7.68  ? 124  TRP B CZ2 1 
ATOM   4849  C  CZ3 . TRP B 1 124 ? 58.939  8.104   35.427  1.00 8.87  ? 124  TRP B CZ3 1 
ATOM   4850  C  CH2 . TRP B 1 124 ? 59.104  6.808   35.930  1.00 8.86  ? 124  TRP B CH2 1 
ATOM   4851  N  N   . ASP B 1 125 ? 54.123  6.473   31.715  1.00 8.92  ? 125  ASP B N   1 
ATOM   4852  C  CA  . ASP B 1 125 ? 53.240  6.057   32.788  1.00 8.73  ? 125  ASP B CA  1 
ATOM   4853  C  C   . ASP B 1 125 ? 53.995  5.203   33.784  1.00 8.66  ? 125  ASP B C   1 
ATOM   4854  O  O   . ASP B 1 125 ? 54.524  4.151   33.415  1.00 8.95  ? 125  ASP B O   1 
ATOM   4855  C  CB  . ASP B 1 125 ? 52.083  5.215   32.258  1.00 8.76  ? 125  ASP B CB  1 
ATOM   4856  C  CG  . ASP B 1 125 ? 51.133  5.984   31.375  1.00 9.40  ? 125  ASP B CG  1 
ATOM   4857  O  OD1 . ASP B 1 125 ? 50.525  5.306   30.523  1.00 10.61 ? 125  ASP B OD1 1 
ATOM   4858  O  OD2 . ASP B 1 125 ? 50.978  7.226   31.503  1.00 9.30  ? 125  ASP B OD2 1 
ATOM   4859  N  N   . PHE B 1 126 ? 54.019  5.636   35.044  1.00 7.99  ? 126  PHE B N   1 
ATOM   4860  C  CA  . PHE B 1 126 ? 54.269  4.716   36.159  1.00 7.51  ? 126  PHE B CA  1 
ATOM   4861  C  C   . PHE B 1 126 ? 52.944  4.078   36.580  1.00 7.48  ? 126  PHE B C   1 
ATOM   4862  O  O   . PHE B 1 126 ? 51.974  4.785   36.859  1.00 7.49  ? 126  PHE B O   1 
ATOM   4863  C  CB  . PHE B 1 126 ? 54.921  5.426   37.346  1.00 7.28  ? 126  PHE B CB  1 
ATOM   4864  C  CG  . PHE B 1 126 ? 55.143  4.531   38.535  1.00 8.21  ? 126  PHE B CG  1 
ATOM   4865  C  CD1 . PHE B 1 126 ? 54.132  4.360   39.513  1.00 8.42  ? 126  PHE B CD1 1 
ATOM   4866  C  CD2 . PHE B 1 126 ? 56.345  3.850   38.686  1.00 7.50  ? 126  PHE B CD2 1 
ATOM   4867  C  CE1 . PHE B 1 126 ? 54.338  3.526   40.624  1.00 9.67  ? 126  PHE B CE1 1 
ATOM   4868  C  CE2 . PHE B 1 126 ? 56.565  3.003   39.792  1.00 8.22  ? 126  PHE B CE2 1 
ATOM   4869  C  CZ  . PHE B 1 126 ? 55.571  2.835   40.761  1.00 8.01  ? 126  PHE B CZ  1 
ATOM   4870  N  N   . VAL B 1 127 ? 52.888  2.744   36.577  1.00 6.84  ? 127  VAL B N   1 
ATOM   4871  C  CA  . VAL B 1 127 ? 51.674  2.028   36.978  1.00 6.15  ? 127  VAL B CA  1 
ATOM   4872  C  C   . VAL B 1 127 ? 52.087  0.931   37.963  1.00 6.86  ? 127  VAL B C   1 
ATOM   4873  O  O   . VAL B 1 127 ? 52.440  -0.176  37.553  1.00 6.93  ? 127  VAL B O   1 
ATOM   4874  C  CB  . VAL B 1 127 ? 50.903  1.407   35.751  1.00 6.21  ? 127  VAL B CB  1 
ATOM   4875  C  CG1 . VAL B 1 127 ? 49.550  0.854   36.180  1.00 5.08  ? 127  VAL B CG1 1 
ATOM   4876  C  CG2 . VAL B 1 127 ? 50.715  2.429   34.635  1.00 4.70  ? 127  VAL B CG2 1 
ATOM   4877  N  N   . GLY B 1 128 ? 52.089  1.262   39.255  1.00 6.88  ? 128  GLY B N   1 
ATOM   4878  C  CA  . GLY B 1 128 ? 52.490  0.330   40.284  1.00 7.29  ? 128  GLY B CA  1 
ATOM   4879  C  C   . GLY B 1 128 ? 51.404  0.128   41.338  1.00 8.28  ? 128  GLY B C   1 
ATOM   4880  O  O   . GLY B 1 128 ? 50.269  0.612   41.178  1.00 8.52  ? 128  GLY B O   1 
ATOM   4881  N  N   . ASN B 1 129 ? 51.758  -0.589  42.408  1.00 7.81  ? 129  ASN B N   1 
ATOM   4882  C  CA  . ASN B 1 129 ? 50.878  -0.814  43.548  1.00 8.20  ? 129  ASN B CA  1 
ATOM   4883  C  C   . ASN B 1 129 ? 51.682  -0.379  44.751  1.00 8.14  ? 129  ASN B C   1 
ATOM   4884  O  O   . ASN B 1 129 ? 52.892  -0.232  44.633  1.00 8.17  ? 129  ASN B O   1 
ATOM   4885  C  CB  . ASN B 1 129 ? 50.522  -2.303  43.706  1.00 7.75  ? 129  ASN B CB  1 
ATOM   4886  C  CG  . ASN B 1 129 ? 49.290  -2.731  42.887  1.00 9.31  ? 129  ASN B CG  1 
ATOM   4887  O  OD1 . ASN B 1 129 ? 48.423  -1.927  42.564  1.00 8.63  ? 129  ASN B OD1 1 
ATOM   4888  N  ND2 . ASN B 1 129 ? 49.205  -4.029  42.582  1.00 11.14 ? 129  ASN B ND2 1 
ATOM   4889  N  N   . ASN B 1 130 ? 51.039  -0.198  45.904  1.00 7.65  ? 130  ASN B N   1 
ATOM   4890  C  CA  . ASN B 1 130 ? 51.786  0.033   47.126  1.00 7.49  ? 130  ASN B CA  1 
ATOM   4891  C  C   . ASN B 1 130 ? 52.688  -1.139  47.510  1.00 7.17  ? 130  ASN B C   1 
ATOM   4892  O  O   . ASN B 1 130 ? 53.877  -0.934  47.767  1.00 7.41  ? 130  ASN B O   1 
ATOM   4893  C  CB  . ASN B 1 130 ? 50.881  0.439   48.292  1.00 7.88  ? 130  ASN B CB  1 
ATOM   4894  C  CG  . ASN B 1 130 ? 49.835  -0.592  48.618  1.00 8.15  ? 130  ASN B CG  1 
ATOM   4895  O  OD1 . ASN B 1 130 ? 49.416  -1.382  47.765  1.00 4.66  ? 130  ASN B OD1 1 
ATOM   4896  N  ND2 . ASN B 1 130 ? 49.396  -0.589  49.874  1.00 9.46  ? 130  ASN B ND2 1 
ATOM   4897  N  N   . LEU B 1 131 ? 52.133  -2.350  47.522  1.00 6.59  ? 131  LEU B N   1 
ATOM   4898  C  CA  . LEU B 1 131 ? 52.891  -3.552  47.886  1.00 6.86  ? 131  LEU B CA  1 
ATOM   4899  C  C   . LEU B 1 131 ? 53.948  -3.881  46.815  1.00 6.45  ? 131  LEU B C   1 
ATOM   4900  O  O   . LEU B 1 131 ? 53.689  -3.672  45.632  1.00 6.10  ? 131  LEU B O   1 
ATOM   4901  C  CB  . LEU B 1 131 ? 51.953  -4.743  48.183  1.00 6.53  ? 131  LEU B CB  1 
ATOM   4902  C  CG  . LEU B 1 131 ? 50.749  -4.374  49.061  1.00 7.56  ? 131  LEU B CG  1 
ATOM   4903  C  CD1 . LEU B 1 131 ? 49.723  -5.489  49.149  1.00 6.82  ? 131  LEU B CD1 1 
ATOM   4904  C  CD2 . LEU B 1 131 ? 51.214  -3.957  50.438  1.00 6.78  ? 131  LEU B CD2 1 
ATOM   4905  N  N   . PRO B 1 132 ? 55.139  -4.361  47.242  1.00 6.32  ? 132  PRO B N   1 
ATOM   4906  C  CA  . PRO B 1 132 ? 56.341  -4.463  46.402  1.00 6.69  ? 132  PRO B CA  1 
ATOM   4907  C  C   . PRO B 1 132 ? 56.475  -5.749  45.583  1.00 6.88  ? 132  PRO B C   1 
ATOM   4908  O  O   . PRO B 1 132 ? 57.456  -5.913  44.839  1.00 6.96  ? 132  PRO B O   1 
ATOM   4909  C  CB  . PRO B 1 132 ? 57.492  -4.335  47.420  1.00 6.01  ? 132  PRO B CB  1 
ATOM   4910  C  CG  . PRO B 1 132 ? 56.952  -4.842  48.675  1.00 6.11  ? 132  PRO B CG  1 
ATOM   4911  C  CD  . PRO B 1 132 ? 55.427  -4.822  48.610  1.00 6.79  ? 132  PRO B CD  1 
ATOM   4912  N  N   . VAL B 1 133 ? 55.489  -6.641  45.710  1.00 6.95  ? 133  VAL B N   1 
ATOM   4913  C  CA  . VAL B 1 133 ? 55.488  -7.891  44.980  1.00 6.61  ? 133  VAL B CA  1 
ATOM   4914  C  C   . VAL B 1 133 ? 54.076  -8.184  44.457  1.00 6.90  ? 133  VAL B C   1 
ATOM   4915  O  O   . VAL B 1 133 ? 53.122  -7.488  44.817  1.00 6.40  ? 133  VAL B O   1 
ATOM   4916  C  CB  . VAL B 1 133 ? 56.053  -9.065  45.855  1.00 7.03  ? 133  VAL B CB  1 
ATOM   4917  C  CG1 . VAL B 1 133 ? 57.482  -8.763  46.329  1.00 6.15  ? 133  VAL B CG1 1 
ATOM   4918  C  CG2 . VAL B 1 133 ? 55.163  -9.341  47.075  1.00 7.58  ? 133  VAL B CG2 1 
ATOM   4919  N  N   . PHE B 1 134 ? 53.954  -9.207  43.600  1.00 6.94  ? 134  PHE B N   1 
ATOM   4920  C  CA  . PHE B 1 134 ? 52.653  -9.666  43.138  1.00 6.80  ? 134  PHE B CA  1 
ATOM   4921  C  C   . PHE B 1 134 ? 52.392  -11.146 43.447  1.00 6.93  ? 134  PHE B C   1 
ATOM   4922  O  O   . PHE B 1 134 ? 53.316  -11.886 43.807  1.00 7.27  ? 134  PHE B O   1 
ATOM   4923  C  CB  . PHE B 1 134 ? 52.454  -9.362  41.641  1.00 6.78  ? 134  PHE B CB  1 
ATOM   4924  C  CG  . PHE B 1 134 ? 51.053  -8.993  41.299  1.00 5.01  ? 134  PHE B CG  1 
ATOM   4925  C  CD1 . PHE B 1 134 ? 50.319  -9.755  40.400  1.00 6.30  ? 134  PHE B CD1 1 
ATOM   4926  C  CD2 . PHE B 1 134 ? 50.443  -7.885  41.912  1.00 5.41  ? 134  PHE B CD2 1 
ATOM   4927  C  CE1 . PHE B 1 134 ? 48.972  -9.408  40.067  1.00 6.80  ? 134  PHE B CE1 1 
ATOM   4928  C  CE2 . PHE B 1 134 ? 49.096  -7.528  41.617  1.00 4.69  ? 134  PHE B CE2 1 
ATOM   4929  C  CZ  . PHE B 1 134 ? 48.367  -8.283  40.679  1.00 5.53  ? 134  PHE B CZ  1 
ATOM   4930  N  N   . PHE B 1 135 ? 51.132  -11.555 43.301  1.00 6.81  ? 135  PHE B N   1 
ATOM   4931  C  CA  . PHE B 1 135 ? 50.697  -12.935 43.583  1.00 7.06  ? 135  PHE B CA  1 
ATOM   4932  C  C   . PHE B 1 135 ? 51.216  -13.975 42.572  1.00 6.93  ? 135  PHE B C   1 
ATOM   4933  O  O   . PHE B 1 135 ? 51.265  -15.165 42.875  1.00 6.75  ? 135  PHE B O   1 
ATOM   4934  C  CB  . PHE B 1 135 ? 49.156  -13.056 43.564  1.00 6.81  ? 135  PHE B CB  1 
ATOM   4935  C  CG  . PHE B 1 135 ? 48.400  -12.112 44.507  1.00 6.18  ? 135  PHE B CG  1 
ATOM   4936  C  CD1 . PHE B 1 135 ? 48.009  -10.845 44.081  1.00 7.25  ? 135  PHE B CD1 1 
ATOM   4937  C  CD2 . PHE B 1 135 ? 47.985  -12.541 45.754  1.00 5.34  ? 135  PHE B CD2 1 
ATOM   4938  C  CE1 . PHE B 1 135 ? 47.264  -9.992  44.909  1.00 7.59  ? 135  PHE B CE1 1 
ATOM   4939  C  CE2 . PHE B 1 135 ? 47.239  -11.706 46.593  1.00 6.75  ? 135  PHE B CE2 1 
ATOM   4940  C  CZ  . PHE B 1 135 ? 46.865  -10.436 46.169  1.00 6.07  ? 135  PHE B CZ  1 
ATOM   4941  N  N   . ILE B 1 136 ? 51.551  -13.534 41.361  1.00 7.05  ? 136  ILE B N   1 
ATOM   4942  C  CA  . ILE B 1 136 ? 51.846  -14.441 40.240  1.00 7.49  ? 136  ILE B CA  1 
ATOM   4943  C  C   . ILE B 1 136 ? 52.989  -13.874 39.404  1.00 8.37  ? 136  ILE B C   1 
ATOM   4944  O  O   . ILE B 1 136 ? 53.353  -12.703 39.561  1.00 9.61  ? 136  ILE B O   1 
ATOM   4945  C  CB  . ILE B 1 136 ? 50.595  -14.679 39.330  1.00 8.03  ? 136  ILE B CB  1 
ATOM   4946  C  CG1 . ILE B 1 136 ? 49.949  -13.350 38.883  1.00 7.23  ? 136  ILE B CG1 1 
ATOM   4947  C  CG2 . ILE B 1 136 ? 49.544  -15.590 40.022  1.00 8.08  ? 136  ILE B CG2 1 
ATOM   4948  C  CD1 . ILE B 1 136 ? 48.988  -13.515 37.735  1.00 6.91  ? 136  ILE B CD1 1 
ATOM   4949  N  N   . ARG B 1 137 ? 53.558  -14.669 38.512  1.00 8.49  ? 137  ARG B N   1 
ATOM   4950  C  CA  . ARG B 1 137 ? 54.753  -14.210 37.824  1.00 9.43  ? 137  ARG B CA  1 
ATOM   4951  C  C   . ARG B 1 137 ? 54.698  -14.235 36.295  1.00 9.61  ? 137  ARG B C   1 
ATOM   4952  O  O   . ARG B 1 137 ? 55.720  -14.005 35.636  1.00 10.22 ? 137  ARG B O   1 
ATOM   4953  C  CB  . ARG B 1 137 ? 55.988  -14.939 38.343  1.00 9.33  ? 137  ARG B CB  1 
ATOM   4954  C  CG  . ARG B 1 137 ? 56.108  -16.414 37.944  1.00 10.45 ? 137  ARG B CG  1 
ATOM   4955  C  CD  . ARG B 1 137 ? 57.463  -16.949 38.458  1.00 10.20 ? 137  ARG B CD  1 
ATOM   4956  N  NE  . ARG B 1 137 ? 57.159  -18.210 39.092  1.00 14.11 ? 137  ARG B NE  1 
ATOM   4957  C  CZ  . ARG B 1 137 ? 57.403  -18.541 40.341  1.00 11.60 ? 137  ARG B CZ  1 
ATOM   4958  N  NH1 . ARG B 1 137 ? 58.074  -17.756 41.166  1.00 11.67 ? 137  ARG B NH1 1 
ATOM   4959  N  NH2 . ARG B 1 137 ? 56.998  -19.718 40.730  1.00 16.13 ? 137  ARG B NH2 1 
ATOM   4960  N  N   . ASP B 1 138 ? 53.507  -14.491 35.754  1.00 8.81  ? 138  ASP B N   1 
ATOM   4961  C  CA  . ASP B 1 138 ? 53.303  -14.640 34.318  1.00 8.40  ? 138  ASP B CA  1 
ATOM   4962  C  C   . ASP B 1 138 ? 51.871  -14.147 34.004  1.00 8.50  ? 138  ASP B C   1 
ATOM   4963  O  O   . ASP B 1 138 ? 50.914  -14.466 34.730  1.00 8.49  ? 138  ASP B O   1 
ATOM   4964  C  CB  . ASP B 1 138 ? 53.456  -16.129 33.958  1.00 7.80  ? 138  ASP B CB  1 
ATOM   4965  C  CG  . ASP B 1 138 ? 53.448  -16.388 32.482  1.00 7.91  ? 138  ASP B CG  1 
ATOM   4966  O  OD1 . ASP B 1 138 ? 52.521  -15.912 31.778  1.00 9.31  ? 138  ASP B OD1 1 
ATOM   4967  O  OD2 . ASP B 1 138 ? 54.369  -17.092 32.005  1.00 8.78  ? 138  ASP B OD2 1 
ATOM   4968  N  N   . ALA B 1 139 ? 51.730  -13.368 32.938  1.00 7.35  ? 139  ALA B N   1 
ATOM   4969  C  CA  . ALA B 1 139 ? 50.438  -12.803 32.560  1.00 6.97  ? 139  ALA B CA  1 
ATOM   4970  C  C   . ALA B 1 139 ? 49.356  -13.862 32.273  1.00 6.99  ? 139  ALA B C   1 
ATOM   4971  O  O   . ALA B 1 139 ? 48.151  -13.594 32.426  1.00 6.96  ? 139  ALA B O   1 
ATOM   4972  C  CB  . ALA B 1 139 ? 50.606  -11.868 31.354  1.00 6.19  ? 139  ALA B CB  1 
ATOM   4973  N  N   . MET B 1 140 ? 49.786  -15.059 31.868  1.00 6.75  ? 140  MET B N   1 
ATOM   4974  C  CA  . MET B 1 140 ? 48.868  -16.166 31.553  1.00 6.73  ? 140  MET B CA  1 
ATOM   4975  C  C   . MET B 1 140 ? 47.886  -16.429 32.687  1.00 6.46  ? 140  MET B C   1 
ATOM   4976  O  O   . MET B 1 140 ? 46.772  -16.897 32.443  1.00 6.73  ? 140  MET B O   1 
ATOM   4977  C  CB  . MET B 1 140 ? 49.647  -17.454 31.234  1.00 6.75  ? 140  MET B CB  1 
ATOM   4978  C  CG  . MET B 1 140 ? 48.780  -18.610 30.721  1.00 7.18  ? 140  MET B CG  1 
ATOM   4979  S  SD  . MET B 1 140 ? 47.990  -18.244 29.129  1.00 10.34 ? 140  MET B SD  1 
ATOM   4980  C  CE  . MET B 1 140 ? 49.376  -18.512 28.020  1.00 6.66  ? 140  MET B CE  1 
ATOM   4981  N  N   . LYS B 1 141 ? 48.290  -16.121 33.921  1.00 6.14  ? 141  LYS B N   1 
ATOM   4982  C  CA  . LYS B 1 141 ? 47.478  -16.477 35.089  1.00 6.04  ? 141  LYS B CA  1 
ATOM   4983  C  C   . LYS B 1 141 ? 46.586  -15.365 35.625  1.00 6.09  ? 141  LYS B C   1 
ATOM   4984  O  O   . LYS B 1 141 ? 45.833  -15.602 36.563  1.00 6.33  ? 141  LYS B O   1 
ATOM   4985  C  CB  . LYS B 1 141 ? 48.356  -17.006 36.227  1.00 5.77  ? 141  LYS B CB  1 
ATOM   4986  C  CG  . LYS B 1 141 ? 49.067  -18.331 35.962  1.00 6.10  ? 141  LYS B CG  1 
ATOM   4987  C  CD  . LYS B 1 141 ? 48.171  -19.377 35.269  1.00 6.20  ? 141  LYS B CD  1 
ATOM   4988  C  CE  . LYS B 1 141 ? 47.013  -19.874 36.142  1.00 5.43  ? 141  LYS B CE  1 
ATOM   4989  N  NZ  . LYS B 1 141 ? 46.271  -20.957 35.371  1.00 4.37  ? 141  LYS B NZ  1 
ATOM   4990  N  N   . PHE B 1 142 ? 46.669  -14.165 35.042  1.00 6.30  ? 142  PHE B N   1 
ATOM   4991  C  CA  . PHE B 1 142 ? 46.030  -12.974 35.634  1.00 6.81  ? 142  PHE B CA  1 
ATOM   4992  C  C   . PHE B 1 142 ? 44.493  -13.008 35.655  1.00 6.72  ? 142  PHE B C   1 
ATOM   4993  O  O   . PHE B 1 142 ? 43.871  -12.692 36.695  1.00 6.57  ? 142  PHE B O   1 
ATOM   4994  C  CB  . PHE B 1 142 ? 46.531  -11.680 34.969  1.00 7.11  ? 142  PHE B CB  1 
ATOM   4995  C  CG  . PHE B 1 142 ? 46.067  -10.434 35.664  1.00 8.53  ? 142  PHE B CG  1 
ATOM   4996  C  CD1 . PHE B 1 142 ? 46.610  -10.068 36.906  1.00 9.46  ? 142  PHE B CD1 1 
ATOM   4997  C  CD2 . PHE B 1 142 ? 45.078  -9.624  35.093  1.00 7.35  ? 142  PHE B CD2 1 
ATOM   4998  C  CE1 . PHE B 1 142 ? 46.178  -8.900  37.561  1.00 9.01  ? 142  PHE B CE1 1 
ATOM   4999  C  CE2 . PHE B 1 142 ? 44.638  -8.476  35.743  1.00 7.50  ? 142  PHE B CE2 1 
ATOM   5000  C  CZ  . PHE B 1 142 ? 45.191  -8.094  36.972  1.00 6.21  ? 142  PHE B CZ  1 
ATOM   5001  N  N   . PRO B 1 143 ? 43.877  -13.380 34.512  1.00 6.41  ? 143  PRO B N   1 
ATOM   5002  C  CA  . PRO B 1 143 ? 42.428  -13.506 34.482  1.00 6.35  ? 143  PRO B CA  1 
ATOM   5003  C  C   . PRO B 1 143 ? 41.940  -14.478 35.520  1.00 6.26  ? 143  PRO B C   1 
ATOM   5004  O  O   . PRO B 1 143 ? 40.988  -14.161 36.226  1.00 6.26  ? 143  PRO B O   1 
ATOM   5005  C  CB  . PRO B 1 143 ? 42.146  -14.013 33.060  1.00 6.53  ? 143  PRO B CB  1 
ATOM   5006  C  CG  . PRO B 1 143 ? 43.318  -13.486 32.240  1.00 5.56  ? 143  PRO B CG  1 
ATOM   5007  C  CD  . PRO B 1 143 ? 44.476  -13.647 33.183  1.00 6.55  ? 143  PRO B CD  1 
ATOM   5008  N  N   . ASP B 1 144 ? 42.607  -15.625 35.635  1.00 6.63  ? 144  ASP B N   1 
ATOM   5009  C  CA  . ASP B 1 144 ? 42.286  -16.633 36.635  1.00 7.43  ? 144  ASP B CA  1 
ATOM   5010  C  C   . ASP B 1 144 ? 42.391  -16.060 38.040  1.00 7.82  ? 144  ASP B C   1 
ATOM   5011  O  O   . ASP B 1 144 ? 41.450  -16.154 38.838  1.00 7.72  ? 144  ASP B O   1 
ATOM   5012  C  CB  . ASP B 1 144 ? 43.240  -17.811 36.497  1.00 8.00  ? 144  ASP B CB  1 
ATOM   5013  C  CG  . ASP B 1 144 ? 43.100  -18.526 35.162  1.00 8.39  ? 144  ASP B CG  1 
ATOM   5014  O  OD1 . ASP B 1 144 ? 44.107  -18.617 34.424  1.00 10.89 ? 144  ASP B OD1 1 
ATOM   5015  O  OD2 . ASP B 1 144 ? 42.000  -19.026 34.855  1.00 9.29  ? 144  ASP B OD2 1 
ATOM   5016  N  N   . MET B 1 145 ? 43.532  -15.443 38.346  1.00 8.41  ? 145  MET B N   1 
ATOM   5017  C  CA  . MET B 1 145 ? 43.725  -14.873 39.672  1.00 9.14  ? 145  MET B CA  1 
ATOM   5018  C  C   . MET B 1 145 ? 42.589  -13.898 39.964  1.00 8.84  ? 145  MET B C   1 
ATOM   5019  O  O   . MET B 1 145 ? 41.927  -14.019 40.985  1.00 9.30  ? 145  MET B O   1 
ATOM   5020  C  CB  . MET B 1 145 ? 45.090  -14.186 39.783  1.00 8.93  ? 145  MET B CB  1 
ATOM   5021  C  CG  . MET B 1 145 ? 45.463  -13.672 41.176  1.00 8.25  ? 145  MET B CG  1 
ATOM   5022  S  SD  . MET B 1 145 ? 46.648  -12.303 41.007  1.00 11.69 ? 145  MET B SD  1 
ATOM   5023  C  CE  . MET B 1 145 ? 45.562  -10.893 40.768  1.00 12.34 ? 145  MET B CE  1 
ATOM   5024  N  N   . VAL B 1 146 ? 42.354  -12.961 39.045  1.00 8.72  ? 146  VAL B N   1 
ATOM   5025  C  CA  . VAL B 1 146 ? 41.300  -11.952 39.194  1.00 8.43  ? 146  VAL B CA  1 
ATOM   5026  C  C   . VAL B 1 146 ? 39.900  -12.558 39.319  1.00 8.61  ? 146  VAL B C   1 
ATOM   5027  O  O   . VAL B 1 146 ? 39.093  -12.116 40.138  1.00 8.79  ? 146  VAL B O   1 
ATOM   5028  C  CB  . VAL B 1 146 ? 41.375  -10.927 38.044  1.00 8.95  ? 146  VAL B CB  1 
ATOM   5029  C  CG1 . VAL B 1 146 ? 40.145  -10.013 38.010  1.00 7.65  ? 146  VAL B CG1 1 
ATOM   5030  C  CG2 . VAL B 1 146 ? 42.682  -10.126 38.153  1.00 7.27  ? 146  VAL B CG2 1 
ATOM   5031  N  N   . HIS B 1 147 ? 39.614  -13.584 38.524  1.00 8.53  ? 147  HIS B N   1 
ATOM   5032  C  CA  . HIS B 1 147 ? 38.333  -14.318 38.650  1.00 8.58  ? 147  HIS B CA  1 
ATOM   5033  C  C   . HIS B 1 147 ? 38.107  -14.966 40.002  1.00 8.87  ? 147  HIS B C   1 
ATOM   5034  O  O   . HIS B 1 147 ? 36.980  -15.022 40.483  1.00 9.01  ? 147  HIS B O   1 
ATOM   5035  C  CB  . HIS B 1 147 ? 38.208  -15.370 37.567  1.00 7.80  ? 147  HIS B CB  1 
ATOM   5036  C  CG  . HIS B 1 147 ? 37.851  -14.796 36.246  1.00 7.80  ? 147  HIS B CG  1 
ATOM   5037  N  ND1 . HIS B 1 147 ? 37.446  -15.570 35.181  1.00 10.49 ? 147  HIS B ND1 1 
ATOM   5038  C  CD2 . HIS B 1 147 ? 37.833  -13.514 35.813  1.00 8.60  ? 147  HIS B CD2 1 
ATOM   5039  C  CE1 . HIS B 1 147 ? 37.217  -14.791 34.136  1.00 12.21 ? 147  HIS B CE1 1 
ATOM   5040  N  NE2 . HIS B 1 147 ? 37.450  -13.536 34.492  1.00 11.93 ? 147  HIS B NE2 1 
ATOM   5041  N  N   . SER B 1 148 ? 39.189  -15.464 40.599  1.00 9.16  ? 148  SER B N   1 
ATOM   5042  C  CA  . SER B 1 148 ? 39.113  -16.135 41.871  1.00 8.67  ? 148  SER B CA  1 
ATOM   5043  C  C   . SER B 1 148 ? 38.884  -15.114 43.006  1.00 8.36  ? 148  SER B C   1 
ATOM   5044  O  O   . SER B 1 148 ? 38.182  -15.407 43.983  1.00 8.60  ? 148  SER B O   1 
ATOM   5045  C  CB  . SER B 1 148 ? 40.386  -16.950 42.085  1.00 8.28  ? 148  SER B CB  1 
ATOM   5046  O  OG  . SER B 1 148 ? 41.432  -16.144 42.610  1.00 9.69  ? 148  SER B OG  1 
ATOM   5047  N  N   . LEU B 1 149 ? 39.471  -13.926 42.853  1.00 7.91  ? 149  LEU B N   1 
ATOM   5048  C  CA  . LEU B 1 149 ? 39.348  -12.839 43.840  1.00 7.34  ? 149  LEU B CA  1 
ATOM   5049  C  C   . LEU B 1 149 ? 38.062  -12.043 43.673  1.00 7.63  ? 149  LEU B C   1 
ATOM   5050  O  O   . LEU B 1 149 ? 37.504  -11.560 44.662  1.00 8.31  ? 149  LEU B O   1 
ATOM   5051  C  CB  . LEU B 1 149 ? 40.533  -11.888 43.740  1.00 7.45  ? 149  LEU B CB  1 
ATOM   5052  C  CG  . LEU B 1 149 ? 41.933  -12.325 44.204  1.00 6.37  ? 149  LEU B CG  1 
ATOM   5053  C  CD1 . LEU B 1 149 ? 42.957  -11.424 43.524  1.00 4.92  ? 149  LEU B CD1 1 
ATOM   5054  C  CD2 . LEU B 1 149 ? 42.030  -12.216 45.743  1.00 6.29  ? 149  LEU B CD2 1 
ATOM   5055  N  N   . LYS B 1 150 ? 37.592  -11.892 42.436  1.00 6.82  ? 150  LYS B N   1 
ATOM   5056  C  CA  . LYS B 1 150 ? 36.313  -11.212 42.177  1.00 7.25  ? 150  LYS B CA  1 
ATOM   5057  C  C   . LYS B 1 150 ? 35.112  -11.870 42.887  1.00 6.93  ? 150  LYS B C   1 
ATOM   5058  O  O   . LYS B 1 150 ? 35.157  -13.055 43.212  1.00 6.04  ? 150  LYS B O   1 
ATOM   5059  C  CB  . LYS B 1 150 ? 36.041  -11.136 40.663  1.00 7.28  ? 150  LYS B CB  1 
ATOM   5060  C  CG  . LYS B 1 150 ? 36.921  -10.089 39.908  1.00 7.00  ? 150  LYS B CG  1 
ATOM   5061  C  CD  . LYS B 1 150 ? 36.315  -8.703  39.958  1.00 6.36  ? 150  LYS B CD  1 
ATOM   5062  C  CE  . LYS B 1 150 ? 37.165  -7.698  39.190  1.00 8.76  ? 150  LYS B CE  1 
ATOM   5063  N  NZ  . LYS B 1 150 ? 36.510  -6.344  39.202  1.00 9.58  ? 150  LYS B NZ  1 
ATOM   5064  N  N   . PRO B 1 151 ? 34.053  -11.090 43.165  1.00 6.72  ? 151  PRO B N   1 
ATOM   5065  C  CA  . PRO B 1 151 ? 32.823  -11.694 43.665  1.00 6.61  ? 151  PRO B CA  1 
ATOM   5066  C  C   . PRO B 1 151 ? 32.479  -12.992 42.953  1.00 6.66  ? 151  PRO B C   1 
ATOM   5067  O  O   . PRO B 1 151 ? 32.627  -13.108 41.725  1.00 6.39  ? 151  PRO B O   1 
ATOM   5068  C  CB  . PRO B 1 151 ? 31.785  -10.630 43.358  1.00 5.86  ? 151  PRO B CB  1 
ATOM   5069  C  CG  . PRO B 1 151 ? 32.528  -9.352  43.617  1.00 6.92  ? 151  PRO B CG  1 
ATOM   5070  C  CD  . PRO B 1 151 ? 33.952  -9.618  43.125  1.00 6.47  ? 151  PRO B CD  1 
ATOM   5071  N  N   . ASP B 1 152 ? 32.058  -13.977 43.735  1.00 7.49  ? 152  ASP B N   1 
ATOM   5072  C  CA  . ASP B 1 152 ? 31.504  -15.206 43.193  1.00 8.08  ? 152  ASP B CA  1 
ATOM   5073  C  C   . ASP B 1 152 ? 30.485  -14.792 42.137  1.00 8.11  ? 152  ASP B C   1 
ATOM   5074  O  O   . ASP B 1 152 ? 29.683  -13.915 42.405  1.00 8.45  ? 152  ASP B O   1 
ATOM   5075  C  CB  . ASP B 1 152 ? 30.840  -16.012 44.307  1.00 8.12  ? 152  ASP B CB  1 
ATOM   5076  C  CG  . ASP B 1 152 ? 30.163  -17.264 43.798  1.00 8.98  ? 152  ASP B CG  1 
ATOM   5077  O  OD1 . ASP B 1 152 ? 29.225  -17.167 42.980  1.00 12.25 ? 152  ASP B OD1 1 
ATOM   5078  O  OD2 . ASP B 1 152 ? 30.546  -18.355 44.230  1.00 10.10 ? 152  ASP B OD2 1 
ATOM   5079  N  N   . PRO B 1 153 ? 30.547  -15.395 40.925  1.00 8.47  ? 153  PRO B N   1 
ATOM   5080  C  CA  . PRO B 1 153 ? 29.736  -14.946 39.777  1.00 8.56  ? 153  PRO B CA  1 
ATOM   5081  C  C   . PRO B 1 153 ? 28.256  -15.354 39.839  1.00 9.19  ? 153  PRO B C   1 
ATOM   5082  O  O   . PRO B 1 153 ? 27.488  -15.036 38.921  1.00 9.20  ? 153  PRO B O   1 
ATOM   5083  C  CB  . PRO B 1 153 ? 30.423  -15.614 38.589  1.00 8.17  ? 153  PRO B CB  1 
ATOM   5084  C  CG  . PRO B 1 153 ? 30.957  -16.890 39.155  1.00 7.93  ? 153  PRO B CG  1 
ATOM   5085  C  CD  . PRO B 1 153 ? 31.429  -16.521 40.556  1.00 8.14  ? 153  PRO B CD  1 
ATOM   5086  N  N   . ARG B 1 154 ? 27.880  -16.049 40.910  1.00 9.29  ? 154  ARG B N   1 
ATOM   5087  C  CA  . ARG B 1 154 ? 26.498  -16.367 41.210  1.00 9.75  ? 154  ARG B CA  1 
ATOM   5088  C  C   . ARG B 1 154 ? 25.977  -15.487 42.372  1.00 10.09 ? 154  ARG B C   1 
ATOM   5089  O  O   . ARG B 1 154 ? 24.872  -14.907 42.291  1.00 10.25 ? 154  ARG B O   1 
ATOM   5090  C  CB  . ARG B 1 154 ? 26.399  -17.845 41.557  1.00 10.30 ? 154  ARG B CB  1 
ATOM   5091  C  CG  . ARG B 1 154 ? 25.031  -18.401 41.497  1.00 12.57 ? 154  ARG B CG  1 
ATOM   5092  C  CD  . ARG B 1 154 ? 25.026  -19.896 41.180  1.00 13.72 ? 154  ARG B CD  1 
ATOM   5093  N  NE  . ARG B 1 154 ? 24.855  -20.663 42.401  1.00 19.58 ? 154  ARG B NE  1 
ATOM   5094  C  CZ  . ARG B 1 154 ? 23.685  -21.022 42.940  1.00 19.19 ? 154  ARG B CZ  1 
ATOM   5095  N  NH1 . ARG B 1 154 ? 23.694  -21.703 44.076  1.00 19.04 ? 154  ARG B NH1 1 
ATOM   5096  N  NH2 . ARG B 1 154 ? 22.525  -20.732 42.360  1.00 15.95 ? 154  ARG B NH2 1 
ATOM   5097  N  N   . THR B 1 155 ? 26.761  -15.381 43.453  1.00 9.83  ? 155  THR B N   1 
ATOM   5098  C  CA  . THR B 1 155 ? 26.301  -14.635 44.656  1.00 9.58  ? 155  THR B CA  1 
ATOM   5099  C  C   . THR B 1 155 ? 26.624  -13.157 44.548  1.00 8.75  ? 155  THR B C   1 
ATOM   5100  O  O   . THR B 1 155 ? 26.029  -12.352 45.239  1.00 8.51  ? 155  THR B O   1 
ATOM   5101  C  CB  . THR B 1 155 ? 26.883  -15.184 45.975  1.00 9.15  ? 155  THR B CB  1 
ATOM   5102  O  OG1 . THR B 1 155 ? 28.294  -15.026 45.965  1.00 10.14 ? 155  THR B OG1 1 
ATOM   5103  C  CG2 . THR B 1 155 ? 26.616  -16.718 46.114  1.00 11.65 ? 155  THR B CG2 1 
ATOM   5104  N  N   . ASN B 1 156 ? 27.544  -12.800 43.654  1.00 8.28  ? 156  ASN B N   1 
ATOM   5105  C  CA  . ASN B 1 156 ? 28.057  -11.426 43.588  1.00 8.13  ? 156  ASN B CA  1 
ATOM   5106  C  C   . ASN B 1 156 ? 28.753  -10.987 44.891  1.00 7.89  ? 156  ASN B C   1 
ATOM   5107  O  O   . ASN B 1 156 ? 28.763  -9.788  45.257  1.00 6.71  ? 156  ASN B O   1 
ATOM   5108  C  CB  . ASN B 1 156 ? 26.950  -10.430 43.185  1.00 8.13  ? 156  ASN B CB  1 
ATOM   5109  C  CG  . ASN B 1 156 ? 27.514  -9.208  42.504  1.00 9.75  ? 156  ASN B CG  1 
ATOM   5110  O  OD1 . ASN B 1 156 ? 28.566  -9.297  41.860  1.00 11.60 ? 156  ASN B OD1 1 
ATOM   5111  N  ND2 . ASN B 1 156 ? 26.850  -8.052  42.658  1.00 8.60  ? 156  ASN B ND2 1 
ATOM   5112  N  N   . ILE B 1 157 ? 29.339  -11.969 45.588  1.00 7.99  ? 157  ILE B N   1 
ATOM   5113  C  CA  . ILE B 1 157 ? 30.047  -11.696 46.849  1.00 8.37  ? 157  ILE B CA  1 
ATOM   5114  C  C   . ILE B 1 157 ? 31.390  -12.399 46.844  1.00 8.16  ? 157  ILE B C   1 
ATOM   5115  O  O   . ILE B 1 157 ? 31.498  -13.556 46.422  1.00 8.14  ? 157  ILE B O   1 
ATOM   5116  C  CB  . ILE B 1 157 ? 29.181  -12.028 48.111  1.00 9.04  ? 157  ILE B CB  1 
ATOM   5117  C  CG1 . ILE B 1 157 ? 27.932  -11.101 48.153  1.00 9.48  ? 157  ILE B CG1 1 
ATOM   5118  C  CG2 . ILE B 1 157 ? 29.996  -11.877 49.426  1.00 7.59  ? 157  ILE B CG2 1 
ATOM   5119  C  CD1 . ILE B 1 157 ? 26.926  -11.436 49.260  1.00 8.68  ? 157  ILE B CD1 1 
ATOM   5120  N  N   . GLN B 1 158 ? 32.422  -11.664 47.250  1.00 7.82  ? 158  GLN B N   1 
ATOM   5121  C  CA  . GLN B 1 158 ? 33.775  -12.189 47.294  1.00 7.66  ? 158  GLN B CA  1 
ATOM   5122  C  C   . GLN B 1 158 ? 33.812  -13.335 48.289  1.00 7.63  ? 158  GLN B C   1 
ATOM   5123  O  O   . GLN B 1 158 ? 33.202  -13.262 49.344  1.00 8.18  ? 158  GLN B O   1 
ATOM   5124  C  CB  . GLN B 1 158 ? 34.763  -11.109 47.727  1.00 7.19  ? 158  GLN B CB  1 
ATOM   5125  C  CG  . GLN B 1 158 ? 36.206  -11.533 47.558  1.00 6.63  ? 158  GLN B CG  1 
ATOM   5126  C  CD  . GLN B 1 158 ? 37.189  -10.462 48.016  1.00 7.42  ? 158  GLN B CD  1 
ATOM   5127  O  OE1 . GLN B 1 158 ? 37.124  -9.994  49.147  1.00 8.47  ? 158  GLN B OE1 1 
ATOM   5128  N  NE2 . GLN B 1 158 ? 38.116  -10.109 47.160  1.00 3.94  ? 158  GLN B NE2 1 
ATOM   5129  N  N   . ASP B 1 159 ? 34.521  -14.393 47.959  1.00 7.27  ? 159  ASP B N   1 
ATOM   5130  C  CA  . ASP B 1 159 ? 34.501  -15.558 48.816  1.00 7.88  ? 159  ASP B CA  1 
ATOM   5131  C  C   . ASP B 1 159 ? 35.921  -16.101 48.902  1.00 7.68  ? 159  ASP B C   1 
ATOM   5132  O  O   . ASP B 1 159 ? 36.489  -16.514 47.898  1.00 7.48  ? 159  ASP B O   1 
ATOM   5133  C  CB  . ASP B 1 159 ? 33.503  -16.603 48.276  1.00 7.62  ? 159  ASP B CB  1 
ATOM   5134  C  CG  . ASP B 1 159 ? 33.462  -17.875 49.114  1.00 9.63  ? 159  ASP B CG  1 
ATOM   5135  O  OD1 . ASP B 1 159 ? 32.678  -18.787 48.763  1.00 11.02 ? 159  ASP B OD1 1 
ATOM   5136  O  OD2 . ASP B 1 159 ? 34.211  -17.987 50.113  1.00 12.02 ? 159  ASP B OD2 1 
ATOM   5137  N  N   . PRO B 1 160 ? 36.508  -16.050 50.104  1.00 7.82  ? 160  PRO B N   1 
ATOM   5138  C  CA  . PRO B 1 160 ? 37.856  -16.552 50.363  1.00 8.07  ? 160  PRO B CA  1 
ATOM   5139  C  C   . PRO B 1 160 ? 38.030  -18.030 49.998  1.00 8.14  ? 160  PRO B C   1 
ATOM   5140  O  O   . PRO B 1 160 ? 39.134  -18.468 49.678  1.00 8.25  ? 160  PRO B O   1 
ATOM   5141  C  CB  . PRO B 1 160 ? 38.023  -16.323 51.879  1.00 8.30  ? 160  PRO B CB  1 
ATOM   5142  C  CG  . PRO B 1 160 ? 37.084  -15.182 52.179  1.00 6.95  ? 160  PRO B CG  1 
ATOM   5143  C  CD  . PRO B 1 160 ? 35.894  -15.485 51.322  1.00 7.32  ? 160  PRO B CD  1 
ATOM   5144  N  N   . ASP B 1 161 ? 36.946  -18.788 50.022  1.00 8.33  ? 161  ASP B N   1 
ATOM   5145  C  CA  . ASP B 1 161 ? 37.025  -20.195 49.650  1.00 8.70  ? 161  ASP B CA  1 
ATOM   5146  C  C   . ASP B 1 161 ? 37.463  -20.332 48.191  1.00 8.70  ? 161  ASP B C   1 
ATOM   5147  O  O   . ASP B 1 161 ? 38.099  -21.318 47.819  1.00 9.33  ? 161  ASP B O   1 
ATOM   5148  C  CB  . ASP B 1 161 ? 35.671  -20.864 49.868  1.00 8.82  ? 161  ASP B CB  1 
ATOM   5149  C  CG  . ASP B 1 161 ? 35.715  -22.347 49.623  1.00 9.80  ? 161  ASP B CG  1 
ATOM   5150  O  OD1 . ASP B 1 161 ? 36.083  -23.124 50.537  1.00 10.68 ? 161  ASP B OD1 1 
ATOM   5151  O  OD2 . ASP B 1 161 ? 35.388  -22.745 48.501  1.00 12.50 ? 161  ASP B OD2 1 
ATOM   5152  N  N   . ARG B 1 162 ? 37.117  -19.334 47.369  1.00 8.21  ? 162  ARG B N   1 
ATOM   5153  C  CA  . ARG B 1 162 ? 37.418  -19.345 45.954  1.00 7.37  ? 162  ARG B CA  1 
ATOM   5154  C  C   . ARG B 1 162 ? 38.853  -18.866 45.706  1.00 7.60  ? 162  ARG B C   1 
ATOM   5155  O  O   . ARG B 1 162 ? 39.637  -19.552 45.043  1.00 6.91  ? 162  ARG B O   1 
ATOM   5156  C  CB  . ARG B 1 162 ? 36.403  -18.492 45.183  1.00 8.10  ? 162  ARG B CB  1 
ATOM   5157  C  CG  . ARG B 1 162 ? 34.960  -19.007 45.200  1.00 7.58  ? 162  ARG B CG  1 
ATOM   5158  C  CD  . ARG B 1 162 ? 33.993  -18.049 44.490  1.00 7.02  ? 162  ARG B CD  1 
ATOM   5159  N  NE  . ARG B 1 162 ? 34.034  -18.238 43.037  1.00 8.79  ? 162  ARG B NE  1 
ATOM   5160  C  CZ  . ARG B 1 162 ? 34.732  -17.469 42.187  1.00 9.10  ? 162  ARG B CZ  1 
ATOM   5161  N  NH1 . ARG B 1 162 ? 35.449  -16.435 42.625  1.00 5.18  ? 162  ARG B NH1 1 
ATOM   5162  N  NH2 . ARG B 1 162 ? 34.714  -17.740 40.888  1.00 8.33  ? 162  ARG B NH2 1 
ATOM   5163  N  N   . TYR B 1 163 ? 39.211  -17.711 46.270  1.00 7.61  ? 163  TYR B N   1 
ATOM   5164  C  CA  . TYR B 1 163 ? 40.560  -17.170 46.068  1.00 7.50  ? 163  TYR B CA  1 
ATOM   5165  C  C   . TYR B 1 163 ? 41.691  -17.913 46.799  1.00 7.01  ? 163  TYR B C   1 
ATOM   5166  O  O   . TYR B 1 163 ? 42.812  -17.971 46.301  1.00 6.39  ? 163  TYR B O   1 
ATOM   5167  C  CB  . TYR B 1 163 ? 40.619  -15.636 46.226  1.00 8.09  ? 163  TYR B CB  1 
ATOM   5168  C  CG  . TYR B 1 163 ? 40.373  -15.021 47.600  1.00 7.55  ? 163  TYR B CG  1 
ATOM   5169  C  CD1 . TYR B 1 163 ? 41.335  -15.094 48.610  1.00 9.62  ? 163  TYR B CD1 1 
ATOM   5170  C  CD2 . TYR B 1 163 ? 39.219  -14.287 47.852  1.00 7.52  ? 163  TYR B CD2 1 
ATOM   5171  C  CE1 . TYR B 1 163 ? 41.126  -14.475 49.860  1.00 9.06  ? 163  TYR B CE1 1 
ATOM   5172  C  CE2 . TYR B 1 163 ? 39.002  -13.660 49.085  1.00 5.91  ? 163  TYR B CE2 1 
ATOM   5173  C  CZ  . TYR B 1 163 ? 39.955  -13.754 50.075  1.00 7.19  ? 163  TYR B CZ  1 
ATOM   5174  O  OH  . TYR B 1 163 ? 39.725  -13.169 51.304  1.00 7.95  ? 163  TYR B OH  1 
ATOM   5175  N  N   . TRP B 1 164 ? 41.389  -18.525 47.942  1.00 7.15  ? 164  TRP B N   1 
ATOM   5176  C  CA  . TRP B 1 164 ? 42.359  -19.425 48.588  1.00 7.25  ? 164  TRP B CA  1 
ATOM   5177  C  C   . TRP B 1 164 ? 42.570  -20.706 47.794  1.00 7.76  ? 164  TRP B C   1 
ATOM   5178  O  O   . TRP B 1 164 ? 43.664  -21.263 47.812  1.00 7.33  ? 164  TRP B O   1 
ATOM   5179  C  CB  . TRP B 1 164 ? 42.000  -19.729 50.042  1.00 6.67  ? 164  TRP B CB  1 
ATOM   5180  C  CG  . TRP B 1 164 ? 42.437  -18.615 50.956  1.00 6.35  ? 164  TRP B CG  1 
ATOM   5181  C  CD1 . TRP B 1 164 ? 41.645  -17.656 51.529  1.00 6.23  ? 164  TRP B CD1 1 
ATOM   5182  C  CD2 . TRP B 1 164 ? 43.771  -18.331 51.368  1.00 5.99  ? 164  TRP B CD2 1 
ATOM   5183  N  NE1 . TRP B 1 164 ? 42.412  -16.793 52.280  1.00 6.47  ? 164  TRP B NE1 1 
ATOM   5184  C  CE2 . TRP B 1 164 ? 43.721  -17.184 52.194  1.00 6.41  ? 164  TRP B CE2 1 
ATOM   5185  C  CE3 . TRP B 1 164 ? 45.009  -18.947 51.141  1.00 6.08  ? 164  TRP B CE3 1 
ATOM   5186  C  CZ2 . TRP B 1 164 ? 44.851  -16.650 52.789  1.00 5.88  ? 164  TRP B CZ2 1 
ATOM   5187  C  CZ3 . TRP B 1 164 ? 46.131  -18.404 51.718  1.00 5.32  ? 164  TRP B CZ3 1 
ATOM   5188  C  CH2 . TRP B 1 164 ? 46.045  -17.265 52.534  1.00 6.27  ? 164  TRP B CH2 1 
ATOM   5189  N  N   . ASP B 1 165 ? 41.526  -21.160 47.096  1.00 8.29  ? 165  ASP B N   1 
ATOM   5190  C  CA  . ASP B 1 165 ? 41.659  -22.299 46.193  1.00 9.07  ? 165  ASP B CA  1 
ATOM   5191  C  C   . ASP B 1 165 ? 42.774  -22.010 45.181  1.00 9.14  ? 165  ASP B C   1 
ATOM   5192  O  O   . ASP B 1 165 ? 43.804  -22.690 45.180  1.00 9.55  ? 165  ASP B O   1 
ATOM   5193  C  CB  . ASP B 1 165 ? 40.329  -22.637 45.494  1.00 8.84  ? 165  ASP B CB  1 
ATOM   5194  C  CG  . ASP B 1 165 ? 40.386  -23.965 44.732  1.00 10.37 ? 165  ASP B CG  1 
ATOM   5195  O  OD1 . ASP B 1 165 ? 41.272  -24.795 45.058  1.00 10.39 ? 165  ASP B OD1 1 
ATOM   5196  O  OD2 . ASP B 1 165 ? 39.550  -24.186 43.818  1.00 9.07  ? 165  ASP B OD2 1 
ATOM   5197  N  N   . PHE B 1 166 ? 42.570  -20.986 44.351  1.00 9.08  ? 166  PHE B N   1 
ATOM   5198  C  CA  . PHE B 1 166 ? 43.570  -20.530 43.382  1.00 8.50  ? 166  PHE B CA  1 
ATOM   5199  C  C   . PHE B 1 166 ? 44.946  -20.273 44.011  1.00 8.78  ? 166  PHE B C   1 
ATOM   5200  O  O   . PHE B 1 166 ? 45.962  -20.730 43.482  1.00 8.51  ? 166  PHE B O   1 
ATOM   5201  C  CB  . PHE B 1 166 ? 43.113  -19.254 42.634  1.00 7.39  ? 166  PHE B CB  1 
ATOM   5202  C  CG  . PHE B 1 166 ? 44.171  -18.691 41.711  1.00 6.44  ? 166  PHE B CG  1 
ATOM   5203  C  CD1 . PHE B 1 166 ? 45.141  -17.807 42.187  1.00 5.83  ? 166  PHE B CD1 1 
ATOM   5204  C  CD2 . PHE B 1 166 ? 44.238  -19.092 40.376  1.00 6.05  ? 166  PHE B CD2 1 
ATOM   5205  C  CE1 . PHE B 1 166 ? 46.149  -17.295 41.334  1.00 5.24  ? 166  PHE B CE1 1 
ATOM   5206  C  CE2 . PHE B 1 166 ? 45.239  -18.597 39.516  1.00 5.96  ? 166  PHE B CE2 1 
ATOM   5207  C  CZ  . PHE B 1 166 ? 46.197  -17.694 39.999  1.00 5.20  ? 166  PHE B CZ  1 
ATOM   5208  N  N   . MET B 1 167 ? 44.978  -19.525 45.120  1.00 8.92  ? 167  MET B N   1 
ATOM   5209  C  CA  . MET B 1 167 ? 46.248  -19.085 45.698  1.00 9.08  ? 167  MET B CA  1 
ATOM   5210  C  C   . MET B 1 167 ? 47.093  -20.242 46.213  1.00 9.21  ? 167  MET B C   1 
ATOM   5211  O  O   . MET B 1 167 ? 48.276  -20.334 45.904  1.00 9.34  ? 167  MET B O   1 
ATOM   5212  C  CB  . MET B 1 167 ? 46.019  -18.061 46.812  1.00 9.85  ? 167  MET B CB  1 
ATOM   5213  C  CG  . MET B 1 167 ? 45.534  -16.689 46.332  1.00 9.08  ? 167  MET B CG  1 
ATOM   5214  S  SD  . MET B 1 167 ? 46.537  -15.886 45.051  1.00 8.46  ? 167  MET B SD  1 
ATOM   5215  C  CE  . MET B 1 167 ? 45.472  -14.455 44.819  1.00 9.00  ? 167  MET B CE  1 
ATOM   5216  N  N   . THR B 1 168 ? 46.482  -21.138 46.982  1.00 9.02  ? 168  THR B N   1 
ATOM   5217  C  CA  . THR B 1 168 ? 47.197  -22.313 47.507  1.00 8.44  ? 168  THR B CA  1 
ATOM   5218  C  C   . THR B 1 168 ? 47.774  -23.169 46.369  1.00 8.68  ? 168  THR B C   1 
ATOM   5219  O  O   . THR B 1 168 ? 48.898  -23.666 46.462  1.00 8.58  ? 168  THR B O   1 
ATOM   5220  C  CB  . THR B 1 168 ? 46.284  -23.172 48.412  1.00 8.28  ? 168  THR B CB  1 
ATOM   5221  O  OG1 . THR B 1 168 ? 45.104  -23.566 47.679  1.00 8.13  ? 168  THR B OG1 1 
ATOM   5222  C  CG2 . THR B 1 168 ? 45.887  -22.404 49.647  1.00 4.53  ? 168  THR B CG2 1 
ATOM   5223  N  N   . LEU B 1 169 ? 47.010  -23.304 45.288  1.00 8.94  ? 169  LEU B N   1 
ATOM   5224  C  CA  . LEU B 1 169 ? 47.411  -24.113 44.126  1.00 9.75  ? 169  LEU B CA  1 
ATOM   5225  C  C   . LEU B 1 169 ? 48.397  -23.376 43.222  1.00 10.59 ? 169  LEU B C   1 
ATOM   5226  O  O   . LEU B 1 169 ? 48.967  -23.958 42.300  1.00 11.06 ? 169  LEU B O   1 
ATOM   5227  C  CB  . LEU B 1 169 ? 46.194  -24.538 43.320  1.00 9.07  ? 169  LEU B CB  1 
ATOM   5228  C  CG  . LEU B 1 169 ? 45.177  -25.433 44.032  1.00 10.77 ? 169  LEU B CG  1 
ATOM   5229  C  CD1 . LEU B 1 169 ? 43.920  -25.651 43.154  1.00 10.68 ? 169  LEU B CD1 1 
ATOM   5230  C  CD2 . LEU B 1 169 ? 45.836  -26.778 44.412  1.00 11.10 ? 169  LEU B CD2 1 
ATOM   5231  N  N   . ARG B 1 170 ? 48.599  -22.092 43.497  1.00 10.93 ? 170  ARG B N   1 
ATOM   5232  C  CA  . ARG B 1 170 ? 49.624  -21.326 42.829  1.00 11.45 ? 170  ARG B CA  1 
ATOM   5233  C  C   . ARG B 1 170 ? 50.557  -20.760 43.897  1.00 11.19 ? 170  ARG B C   1 
ATOM   5234  O  O   . ARG B 1 170 ? 50.504  -19.547 44.206  1.00 11.71 ? 170  ARG B O   1 
ATOM   5235  C  CB  . ARG B 1 170 ? 48.980  -20.220 42.019  1.00 11.64 ? 170  ARG B CB  1 
ATOM   5236  C  CG  . ARG B 1 170 ? 49.609  -20.054 40.659  1.00 16.20 ? 170  ARG B CG  1 
ATOM   5237  C  CD  . ARG B 1 170 ? 48.956  -20.867 39.569  1.00 16.36 ? 170  ARG B CD  1 
ATOM   5238  N  NE  . ARG B 1 170 ? 49.689  -22.048 39.108  1.00 19.46 ? 170  ARG B NE  1 
ATOM   5239  C  CZ  . ARG B 1 170 ? 50.871  -22.084 38.482  1.00 19.25 ? 170  ARG B CZ  1 
ATOM   5240  N  NH1 . ARG B 1 170 ? 51.601  -21.001 38.262  1.00 20.63 ? 170  ARG B NH1 1 
ATOM   5241  N  NH2 . ARG B 1 170 ? 51.345  -23.251 38.094  1.00 19.13 ? 170  ARG B NH2 1 
ATOM   5242  N  N   . PRO B 1 171 ? 51.408  -21.635 44.484  1.00 10.56 ? 171  PRO B N   1 
ATOM   5243  C  CA  . PRO B 1 171 ? 52.159  -21.293 45.701  1.00 9.67  ? 171  PRO B CA  1 
ATOM   5244  C  C   . PRO B 1 171 ? 53.185  -20.173 45.548  1.00 9.31  ? 171  PRO B C   1 
ATOM   5245  O  O   . PRO B 1 171 ? 53.670  -19.685 46.561  1.00 9.41  ? 171  PRO B O   1 
ATOM   5246  C  CB  . PRO B 1 171 ? 52.852  -22.607 46.088  1.00 9.15  ? 171  PRO B CB  1 
ATOM   5247  C  CG  . PRO B 1 171 ? 52.967  -23.373 44.816  1.00 10.20 ? 171  PRO B CG  1 
ATOM   5248  C  CD  . PRO B 1 171 ? 51.717  -23.003 44.018  1.00 10.38 ? 171  PRO B CD  1 
ATOM   5249  N  N   . GLU B 1 172 ? 53.488  -19.740 44.323  1.00 9.18  ? 172  GLU B N   1 
ATOM   5250  C  CA  . GLU B 1 172 ? 54.303  -18.524 44.122  1.00 9.49  ? 172  GLU B CA  1 
ATOM   5251  C  C   . GLU B 1 172 ? 53.661  -17.274 44.743  1.00 9.85  ? 172  GLU B C   1 
ATOM   5252  O  O   . GLU B 1 172 ? 54.322  -16.231 44.898  1.00 10.09 ? 172  GLU B O   1 
ATOM   5253  C  CB  . GLU B 1 172 ? 54.629  -18.271 42.635  1.00 9.24  ? 172  GLU B CB  1 
ATOM   5254  C  CG  . GLU B 1 172 ? 53.442  -17.839 41.746  1.00 9.06  ? 172  GLU B CG  1 
ATOM   5255  C  CD  . GLU B 1 172 ? 52.701  -19.037 41.122  1.00 10.16 ? 172  GLU B CD  1 
ATOM   5256  O  OE1 . GLU B 1 172 ? 52.247  -18.898 39.972  1.00 9.90  ? 172  GLU B OE1 1 
ATOM   5257  O  OE2 . GLU B 1 172 ? 52.597  -20.119 41.758  1.00 9.41  ? 172  GLU B OE2 1 
ATOM   5258  N  N   . SER B 1 173 ? 52.372  -17.389 45.067  1.00 9.62  ? 173  SER B N   1 
ATOM   5259  C  CA  . SER B 1 173 ? 51.581  -16.313 45.668  1.00 9.92  ? 173  SER B CA  1 
ATOM   5260  C  C   . SER B 1 173 ? 51.929  -16.050 47.129  1.00 10.03 ? 173  SER B C   1 
ATOM   5261  O  O   . SER B 1 173 ? 51.537  -15.031 47.698  1.00 10.48 ? 173  SER B O   1 
ATOM   5262  C  CB  . SER B 1 173 ? 50.106  -16.681 45.586  1.00 9.72  ? 173  SER B CB  1 
ATOM   5263  O  OG  . SER B 1 173 ? 49.844  -17.788 46.451  1.00 10.58 ? 173  SER B OG  1 
ATOM   5264  N  N   . THR B 1 174 ? 52.661  -16.975 47.736  1.00 10.57 ? 174  THR B N   1 
ATOM   5265  C  CA  . THR B 1 174 ? 52.891  -16.975 49.179  1.00 10.47 ? 174  THR B CA  1 
ATOM   5266  C  C   . THR B 1 174 ? 53.489  -15.649 49.658  1.00 10.87 ? 174  THR B C   1 
ATOM   5267  O  O   . THR B 1 174 ? 52.994  -15.052 50.612  1.00 11.54 ? 174  THR B O   1 
ATOM   5268  C  CB  . THR B 1 174 ? 53.764  -18.214 49.606  1.00 11.00 ? 174  THR B CB  1 
ATOM   5269  O  OG1 . THR B 1 174 ? 53.179  -19.424 49.092  1.00 9.73  ? 174  THR B OG1 1 
ATOM   5270  C  CG2 . THR B 1 174 ? 53.897  -18.334 51.135  1.00 10.25 ? 174  THR B CG2 1 
ATOM   5271  N  N   . ASN B 1 175 ? 54.532  -15.180 48.981  1.00 10.82 ? 175  ASN B N   1 
ATOM   5272  C  CA  . ASN B 1 175 ? 55.170  -13.904 49.308  1.00 11.12 ? 175  ASN B CA  1 
ATOM   5273  C  C   . ASN B 1 175 ? 54.205  -12.699 49.383  1.00 11.13 ? 175  ASN B C   1 
ATOM   5274  O  O   . ASN B 1 175 ? 54.294  -11.907 50.315  1.00 11.14 ? 175  ASN B O   1 
ATOM   5275  C  CB  . ASN B 1 175 ? 56.310  -13.606 48.319  1.00 11.04 ? 175  ASN B CB  1 
ATOM   5276  C  CG  . ASN B 1 175 ? 57.353  -12.660 48.889  1.00 12.08 ? 175  ASN B CG  1 
ATOM   5277  O  OD1 . ASN B 1 175 ? 57.376  -12.391 50.088  1.00 11.03 ? 175  ASN B OD1 1 
ATOM   5278  N  ND2 . ASN B 1 175 ? 58.244  -12.170 48.026  1.00 14.88 ? 175  ASN B ND2 1 
ATOM   5279  N  N   . MET B 1 176 ? 53.314  -12.561 48.395  1.00 11.09 ? 176  MET B N   1 
ATOM   5280  C  CA  . MET B 1 176 ? 52.297  -11.499 48.370  1.00 10.83 ? 176  MET B CA  1 
ATOM   5281  C  C   . MET B 1 176 ? 51.297  -11.627 49.515  1.00 11.28 ? 176  MET B C   1 
ATOM   5282  O  O   . MET B 1 176 ? 50.931  -10.637 50.147  1.00 11.94 ? 176  MET B O   1 
ATOM   5283  C  CB  . MET B 1 176 ? 51.555  -11.511 47.033  1.00 11.03 ? 176  MET B CB  1 
ATOM   5284  C  CG  . MET B 1 176 ? 50.502  -10.414 46.883  1.00 10.42 ? 176  MET B CG  1 
ATOM   5285  S  SD  . MET B 1 176 ? 51.180  -8.765  47.081  1.00 11.96 ? 176  MET B SD  1 
ATOM   5286  C  CE  . MET B 1 176 ? 49.985  -7.844  46.097  1.00 9.19  ? 176  MET B CE  1 
ATOM   5287  N  N   . LEU B 1 177 ? 50.869  -12.855 49.790  1.00 11.41 ? 177  LEU B N   1 
ATOM   5288  C  CA  . LEU B 1 177 ? 49.993  -13.147 50.917  1.00 11.23 ? 177  LEU B CA  1 
ATOM   5289  C  C   . LEU B 1 177 ? 50.597  -12.631 52.216  1.00 11.72 ? 177  LEU B C   1 
ATOM   5290  O  O   . LEU B 1 177 ? 49.878  -12.050 53.030  1.00 11.28 ? 177  LEU B O   1 
ATOM   5291  C  CB  . LEU B 1 177 ? 49.690  -14.654 50.978  1.00 10.80 ? 177  LEU B CB  1 
ATOM   5292  C  CG  . LEU B 1 177 ? 48.432  -15.203 50.251  1.00 11.54 ? 177  LEU B CG  1 
ATOM   5293  C  CD1 . LEU B 1 177 ? 47.824  -14.311 49.177  1.00 13.04 ? 177  LEU B CD1 1 
ATOM   5294  C  CD2 . LEU B 1 177 ? 48.639  -16.599 49.689  1.00 11.87 ? 177  LEU B CD2 1 
ATOM   5295  N  N   . MET B 1 178 ? 51.914  -12.835 52.399  1.00 11.94 ? 178  MET B N   1 
ATOM   5296  C  CA  . MET B 1 178 ? 52.642  -12.293 53.556  1.00 12.29 ? 178  MET B CA  1 
ATOM   5297  C  C   . MET B 1 178 ? 52.502  -10.775 53.696  1.00 12.02 ? 178  MET B C   1 
ATOM   5298  O  O   . MET B 1 178 ? 52.610  -10.244 54.797  1.00 12.16 ? 178  MET B O   1 
ATOM   5299  C  CB  . MET B 1 178 ? 54.145  -12.596 53.473  1.00 12.57 ? 178  MET B CB  1 
ATOM   5300  C  CG  . MET B 1 178 ? 54.513  -14.037 53.605  1.00 14.36 ? 178  MET B CG  1 
ATOM   5301  S  SD  . MET B 1 178 ? 54.385  -14.716 55.286  1.00 15.24 ? 178  MET B SD  1 
ATOM   5302  C  CE  . MET B 1 178 ? 55.232  -16.255 54.903  1.00 14.80 ? 178  MET B CE  1 
ATOM   5303  N  N   . HIS B 1 179 ? 52.296  -10.086 52.581  1.00 11.21 ? 179  HIS B N   1 
ATOM   5304  C  CA  . HIS B 1 179 ? 52.281  -8.619  52.586  1.00 10.98 ? 179  HIS B CA  1 
ATOM   5305  C  C   . HIS B 1 179 ? 50.878  -8.080  52.809  1.00 10.59 ? 179  HIS B C   1 
ATOM   5306  O  O   . HIS B 1 179 ? 50.654  -7.178  53.632  1.00 9.44  ? 179  HIS B O   1 
ATOM   5307  C  CB  . HIS B 1 179 ? 52.805  -8.086  51.249  1.00 10.43 ? 179  HIS B CB  1 
ATOM   5308  C  CG  . HIS B 1 179 ? 54.288  -8.140  51.114  1.00 10.12 ? 179  HIS B CG  1 
ATOM   5309  N  ND1 . HIS B 1 179 ? 54.957  -9.270  50.691  1.00 10.53 ? 179  HIS B ND1 1 
ATOM   5310  C  CD2 . HIS B 1 179 ? 55.235  -7.197  51.332  1.00 8.98  ? 179  HIS B CD2 1 
ATOM   5311  C  CE1 . HIS B 1 179 ? 56.255  -9.016  50.644  1.00 10.13 ? 179  HIS B CE1 1 
ATOM   5312  N  NE2 . HIS B 1 179 ? 56.451  -7.765  51.028  1.00 8.22  ? 179  HIS B NE2 1 
ATOM   5313  N  N   . ILE B 1 180 ? 49.959  -8.684  52.059  1.00 10.44 ? 180  ILE B N   1 
ATOM   5314  C  CA  . ILE B 1 180 ? 48.612  -8.223  51.863  1.00 10.73 ? 180  ILE B CA  1 
ATOM   5315  C  C   . ILE B 1 180 ? 47.836  -8.489  53.145  1.00 10.99 ? 180  ILE B C   1 
ATOM   5316  O  O   . ILE B 1 180 ? 46.901  -7.759  53.468  1.00 10.97 ? 180  ILE B O   1 
ATOM   5317  C  CB  . ILE B 1 180 ? 47.985  -8.939  50.576  1.00 11.20 ? 180  ILE B CB  1 
ATOM   5318  C  CG1 . ILE B 1 180 ? 47.266  -7.944  49.652  1.00 11.87 ? 180  ILE B CG1 1 
ATOM   5319  C  CG2 . ILE B 1 180 ? 47.148  -10.179 50.920  1.00 10.01 ? 180  ILE B CG2 1 
ATOM   5320  C  CD1 . ILE B 1 180 ? 45.880  -7.557  50.076  1.00 13.58 ? 180  ILE B CD1 1 
ATOM   5321  N  N   . PHE B 1 181 ? 48.238  -9.529  53.887  1.00 11.13 ? 181  PHE B N   1 
ATOM   5322  C  CA  . PHE B 1 181 ? 47.554  -9.877  55.131  1.00 11.00 ? 181  PHE B CA  1 
ATOM   5323  C  C   . PHE B 1 181 ? 48.169  -9.270  56.395  1.00 11.68 ? 181  PHE B C   1 
ATOM   5324  O  O   . PHE B 1 181 ? 47.674  -9.523  57.506  1.00 12.33 ? 181  PHE B O   1 
ATOM   5325  C  CB  . PHE B 1 181 ? 47.324  -11.393 55.246  1.00 11.17 ? 181  PHE B CB  1 
ATOM   5326  C  CG  . PHE B 1 181 ? 46.176  -11.885 54.404  1.00 9.60  ? 181  PHE B CG  1 
ATOM   5327  C  CD1 . PHE B 1 181 ? 46.411  -12.611 53.243  1.00 9.54  ? 181  PHE B CD1 1 
ATOM   5328  C  CD2 . PHE B 1 181 ? 44.868  -11.594 54.765  1.00 8.70  ? 181  PHE B CD2 1 
ATOM   5329  C  CE1 . PHE B 1 181 ? 45.358  -13.054 52.444  1.00 9.69  ? 181  PHE B CE1 1 
ATOM   5330  C  CE2 . PHE B 1 181 ? 43.791  -12.020 53.979  1.00 10.54 ? 181  PHE B CE2 1 
ATOM   5331  C  CZ  . PHE B 1 181 ? 44.032  -12.743 52.816  1.00 10.66 ? 181  PHE B CZ  1 
ATOM   5332  N  N   . THR B 1 182 ? 49.207  -8.441  56.239  1.00 11.56 ? 182  THR B N   1 
ATOM   5333  C  CA  . THR B 1 182 ? 49.553  -7.500  57.299  1.00 12.53 ? 182  THR B CA  1 
ATOM   5334  C  C   . THR B 1 182 ? 48.481  -6.409  57.292  1.00 12.95 ? 182  THR B C   1 
ATOM   5335  O  O   . THR B 1 182 ? 47.527  -6.470  56.502  1.00 13.76 ? 182  THR B O   1 
ATOM   5336  C  CB  . THR B 1 182 ? 50.957  -6.852  57.108  1.00 13.22 ? 182  THR B CB  1 
ATOM   5337  O  OG1 . THR B 1 182 ? 50.984  -6.038  55.913  1.00 13.17 ? 182  THR B OG1 1 
ATOM   5338  C  CG2 . THR B 1 182 ? 52.052  -7.917  57.058  1.00 12.19 ? 182  THR B CG2 1 
ATOM   5339  N  N   . ASP B 1 183 ? 48.617  -5.402  58.144  1.00 13.07 ? 183  ASP B N   1 
ATOM   5340  C  CA  . ASP B 1 183 ? 47.666  -4.286  58.103  1.00 13.33 ? 183  ASP B CA  1 
ATOM   5341  C  C   . ASP B 1 183 ? 47.897  -3.407  56.860  1.00 13.27 ? 183  ASP B C   1 
ATOM   5342  O  O   . ASP B 1 183 ? 47.047  -2.558  56.510  1.00 13.46 ? 183  ASP B O   1 
ATOM   5343  C  CB  . ASP B 1 183 ? 47.689  -3.464  59.409  1.00 13.42 ? 183  ASP B CB  1 
ATOM   5344  C  CG  . ASP B 1 183 ? 47.045  -4.199  60.607  1.00 14.55 ? 183  ASP B CG  1 
ATOM   5345  O  OD1 . ASP B 1 183 ? 46.222  -5.135  60.438  1.00 15.53 ? 183  ASP B OD1 1 
ATOM   5346  O  OD2 . ASP B 1 183 ? 47.363  -3.828  61.758  1.00 17.14 ? 183  ASP B OD2 1 
ATOM   5347  N  N   . GLU B 1 184 ? 49.030  -3.615  56.180  1.00 12.84 ? 184  GLU B N   1 
ATOM   5348  C  CA  . GLU B 1 184 ? 49.302  -2.875  54.942  1.00 13.10 ? 184  GLU B CA  1 
ATOM   5349  C  C   . GLU B 1 184 ? 48.352  -3.281  53.815  1.00 12.23 ? 184  GLU B C   1 
ATOM   5350  O  O   . GLU B 1 184 ? 48.307  -2.620  52.765  1.00 11.98 ? 184  GLU B O   1 
ATOM   5351  C  CB  . GLU B 1 184 ? 50.765  -2.949  54.487  1.00 12.82 ? 184  GLU B CB  1 
ATOM   5352  C  CG  . GLU B 1 184 ? 51.161  -1.682  53.699  1.00 14.52 ? 184  GLU B CG  1 
ATOM   5353  C  CD  . GLU B 1 184 ? 52.581  -1.695  53.128  1.00 15.02 ? 184  GLU B CD  1 
ATOM   5354  O  OE1 . GLU B 1 184 ? 53.289  -2.722  53.275  1.00 15.50 ? 184  GLU B OE1 1 
ATOM   5355  O  OE2 . GLU B 1 184 ? 52.982  -0.663  52.520  1.00 17.15 ? 184  GLU B OE2 1 
ATOM   5356  N  N   . GLY B 1 185 ? 47.598  -4.363  54.045  1.00 11.16 ? 185  GLY B N   1 
ATOM   5357  C  CA  . GLY B 1 185 ? 46.462  -4.690  53.204  1.00 10.07 ? 185  GLY B CA  1 
ATOM   5358  C  C   . GLY B 1 185 ? 45.389  -3.602  53.182  1.00 9.76  ? 185  GLY B C   1 
ATOM   5359  O  O   . GLY B 1 185 ? 44.599  -3.545  52.242  1.00 9.29  ? 185  GLY B O   1 
ATOM   5360  N  N   . ILE B 1 186 ? 45.342  -2.757  54.217  1.00 9.67  ? 186  ILE B N   1 
ATOM   5361  C  CA  . ILE B 1 186 ? 44.373  -1.658  54.275  1.00 9.98  ? 186  ILE B CA  1 
ATOM   5362  C  C   . ILE B 1 186 ? 45.012  -0.297  54.626  1.00 10.60 ? 186  ILE B C   1 
ATOM   5363  O  O   . ILE B 1 186 ? 44.968  0.143   55.789  1.00 11.17 ? 186  ILE B O   1 
ATOM   5364  C  CB  . ILE B 1 186 ? 43.197  -1.933  55.261  1.00 10.26 ? 186  ILE B CB  1 
ATOM   5365  C  CG1 . ILE B 1 186 ? 42.670  -3.364  55.116  1.00 9.82  ? 186  ILE B CG1 1 
ATOM   5366  C  CG2 . ILE B 1 186 ? 42.080  -0.872  55.096  1.00 8.21  ? 186  ILE B CG2 1 
ATOM   5367  C  CD1 . ILE B 1 186 ? 41.571  -3.704  56.109  1.00 9.83  ? 186  ILE B CD1 1 
ATOM   5368  N  N   . PRO B 1 187 ? 45.601  0.385   53.630  1.00 10.38 ? 187  PRO B N   1 
ATOM   5369  C  CA  . PRO B 1 187 ? 46.128  1.711   53.940  1.00 10.66 ? 187  PRO B CA  1 
ATOM   5370  C  C   . PRO B 1 187 ? 45.036  2.657   54.501  1.00 10.57 ? 187  PRO B C   1 
ATOM   5371  O  O   . PRO B 1 187 ? 43.868  2.503   54.145  1.00 9.99  ? 187  PRO B O   1 
ATOM   5372  C  CB  . PRO B 1 187 ? 46.641  2.195   52.568  1.00 10.75 ? 187  PRO B CB  1 
ATOM   5373  C  CG  . PRO B 1 187 ? 46.970  0.934   51.840  1.00 9.60  ? 187  PRO B CG  1 
ATOM   5374  C  CD  . PRO B 1 187 ? 45.858  0.012   52.225  1.00 10.30 ? 187  PRO B CD  1 
ATOM   5375  N  N   . ALA B 1 188 ? 45.426  3.598   55.370  1.00 10.22 ? 188  ALA B N   1 
ATOM   5376  C  CA  . ALA B 1 188 ? 44.492  4.567   55.974  1.00 10.80 ? 188  ALA B CA  1 
ATOM   5377  C  C   . ALA B 1 188 ? 44.023  5.599   54.958  1.00 10.98 ? 188  ALA B C   1 
ATOM   5378  O  O   . ALA B 1 188 ? 42.918  6.147   55.076  1.00 10.73 ? 188  ALA B O   1 
ATOM   5379  C  CB  . ALA B 1 188 ? 45.111  5.273   57.205  1.00 10.22 ? 188  ALA B CB  1 
ATOM   5380  N  N   . SER B 1 189 ? 44.875  5.870   53.972  1.00 11.19 ? 189  SER B N   1 
ATOM   5381  C  CA  . SER B 1 189 ? 44.452  6.603   52.787  1.00 11.65 ? 189  SER B CA  1 
ATOM   5382  C  C   . SER B 1 189 ? 45.497  6.545   51.692  1.00 11.59 ? 189  SER B C   1 
ATOM   5383  O  O   . SER B 1 189 ? 46.630  6.071   51.893  1.00 12.33 ? 189  SER B O   1 
ATOM   5384  C  CB  . SER B 1 189 ? 44.076  8.054   53.109  1.00 11.91 ? 189  SER B CB  1 
ATOM   5385  O  OG  . SER B 1 189 ? 45.208  8.824   53.447  1.00 13.44 ? 189  SER B OG  1 
ATOM   5386  N  N   . TYR B 1 190 ? 45.097  7.029   50.527  1.00 11.10 ? 190  TYR B N   1 
ATOM   5387  C  CA  . TYR B 1 190 ? 45.983  7.143   49.379  1.00 11.14 ? 190  TYR B CA  1 
ATOM   5388  C  C   . TYR B 1 190 ? 47.253  7.971   49.638  1.00 11.63 ? 190  TYR B C   1 
ATOM   5389  O  O   . TYR B 1 190 ? 48.313  7.660   49.093  1.00 12.25 ? 190  TYR B O   1 
ATOM   5390  C  CB  . TYR B 1 190 ? 45.198  7.677   48.175  1.00 10.10 ? 190  TYR B CB  1 
ATOM   5391  C  CG  . TYR B 1 190 ? 43.997  6.821   47.775  1.00 8.57  ? 190  TYR B CG  1 
ATOM   5392  C  CD1 . TYR B 1 190 ? 44.095  5.432   47.697  1.00 6.39  ? 190  TYR B CD1 1 
ATOM   5393  C  CD2 . TYR B 1 190 ? 42.759  7.412   47.474  1.00 8.65  ? 190  TYR B CD2 1 
ATOM   5394  C  CE1 . TYR B 1 190 ? 42.998  4.639   47.312  1.00 7.61  ? 190  TYR B CE1 1 
ATOM   5395  C  CE2 . TYR B 1 190 ? 41.663  6.630   47.074  1.00 9.54  ? 190  TYR B CE2 1 
ATOM   5396  C  CZ  . TYR B 1 190 ? 41.792  5.234   47.005  1.00 8.33  ? 190  TYR B CZ  1 
ATOM   5397  O  OH  . TYR B 1 190 ? 40.725  4.451   46.643  1.00 6.93  ? 190  TYR B OH  1 
ATOM   5398  N  N   . ARG B 1 191 ? 47.158  8.997   50.481  1.00 11.89 ? 191  ARG B N   1 
ATOM   5399  C  CA  . ARG B 1 191 ? 48.301  9.880   50.740  1.00 12.97 ? 191  ARG B CA  1 
ATOM   5400  C  C   . ARG B 1 191 ? 49.221  9.296   51.827  1.00 12.46 ? 191  ARG B C   1 
ATOM   5401  O  O   . ARG B 1 191 ? 50.309  9.817   52.072  1.00 12.51 ? 191  ARG B O   1 
ATOM   5402  C  CB  . ARG B 1 191 ? 47.839  11.318  51.072  1.00 12.45 ? 191  ARG B CB  1 
ATOM   5403  C  CG  . ARG B 1 191 ? 46.963  11.417  52.306  1.00 15.38 ? 191  ARG B CG  1 
ATOM   5404  C  CD  . ARG B 1 191 ? 46.124  12.711  52.394  1.00 15.21 ? 191  ARG B CD  1 
ATOM   5405  N  NE  . ARG B 1 191 ? 46.804  13.755  53.155  1.00 19.18 ? 191  ARG B NE  1 
ATOM   5406  C  CZ  . ARG B 1 191 ? 46.509  14.120  54.399  1.00 18.86 ? 191  ARG B CZ  1 
ATOM   5407  N  NH1 . ARG B 1 191 ? 45.518  13.547  55.068  1.00 18.98 ? 191  ARG B NH1 1 
ATOM   5408  N  NH2 . ARG B 1 191 ? 47.209  15.085  54.969  1.00 19.60 ? 191  ARG B NH2 1 
ATOM   5409  N  N   . LYS B 1 192 ? 48.783  8.206   52.461  1.00 11.69 ? 192  LYS B N   1 
ATOM   5410  C  CA  . LYS B 1 192 ? 49.543  7.586   53.550  1.00 10.89 ? 192  LYS B CA  1 
ATOM   5411  C  C   . LYS B 1 192 ? 50.017  6.163   53.200  1.00 10.42 ? 192  LYS B C   1 
ATOM   5412  O  O   . LYS B 1 192 ? 50.000  5.252   54.032  1.00 10.11 ? 192  LYS B O   1 
ATOM   5413  C  CB  . LYS B 1 192 ? 48.740  7.623   54.843  1.00 10.67 ? 192  LYS B CB  1 
ATOM   5414  C  CG  . LYS B 1 192 ? 48.359  9.041   55.285  1.00 11.83 ? 192  LYS B CG  1 
ATOM   5415  C  CD  . LYS B 1 192 ? 47.747  9.029   56.677  1.00 16.73 ? 192  LYS B CD  1 
ATOM   5416  C  CE  . LYS B 1 192 ? 47.823  10.408  57.353  1.00 19.63 ? 192  LYS B CE  1 
ATOM   5417  N  NZ  . LYS B 1 192 ? 46.533  11.158  57.230  1.00 22.07 ? 192  LYS B NZ  1 
ATOM   5418  N  N   . MET B 1 193 ? 50.459  6.008   51.952  1.00 9.63  ? 193  MET B N   1 
ATOM   5419  C  CA  . MET B 1 193 ? 50.917  4.730   51.409  1.00 8.53  ? 193  MET B CA  1 
ATOM   5420  C  C   . MET B 1 193 ? 52.097  4.922   50.488  1.00 7.98  ? 193  MET B C   1 
ATOM   5421  O  O   . MET B 1 193 ? 52.344  6.010   49.960  1.00 8.00  ? 193  MET B O   1 
ATOM   5422  C  CB  . MET B 1 193 ? 49.791  4.032   50.634  1.00 8.50  ? 193  MET B CB  1 
ATOM   5423  C  CG  . MET B 1 193 ? 49.416  4.715   49.318  1.00 7.94  ? 193  MET B CG  1 
ATOM   5424  S  SD  . MET B 1 193 ? 48.098  3.802   48.512  1.00 8.09  ? 193  MET B SD  1 
ATOM   5425  C  CE  . MET B 1 193 ? 48.164  4.438   46.797  1.00 3.93  ? 193  MET B CE  1 
ATOM   5426  N  N   . ARG B 1 194 ? 52.819  3.840   50.281  1.00 7.98  ? 194  ARG B N   1 
ATOM   5427  C  CA  . ARG B 1 194 ? 53.976  3.844   49.400  1.00 7.46  ? 194  ARG B CA  1 
ATOM   5428  C  C   . ARG B 1 194 ? 53.534  3.414   48.005  1.00 7.24  ? 194  ARG B C   1 
ATOM   5429  O  O   . ARG B 1 194 ? 52.339  3.089   47.783  1.00 6.58  ? 194  ARG B O   1 
ATOM   5430  C  CB  . ARG B 1 194 ? 55.088  2.923   49.964  1.00 7.19  ? 194  ARG B CB  1 
ATOM   5431  C  CG  . ARG B 1 194 ? 54.617  1.497   50.274  1.00 8.61  ? 194  ARG B CG  1 
ATOM   5432  C  CD  . ARG B 1 194 ? 55.763  0.543   50.456  1.00 8.10  ? 194  ARG B CD  1 
ATOM   5433  N  NE  . ARG B 1 194 ? 55.373  -0.706  51.123  1.00 7.86  ? 194  ARG B NE  1 
ATOM   5434  C  CZ  . ARG B 1 194 ? 56.160  -1.798  51.175  1.00 8.62  ? 194  ARG B CZ  1 
ATOM   5435  N  NH1 . ARG B 1 194 ? 55.762  -2.898  51.818  1.00 6.50  ? 194  ARG B NH1 1 
ATOM   5436  N  NH2 . ARG B 1 194 ? 57.361  -1.797  50.575  1.00 4.87  ? 194  ARG B NH2 1 
ATOM   5437  N  N   . GLY B 1 195 ? 54.490  3.448   47.067  1.00 7.00  ? 195  GLY B N   1 
ATOM   5438  C  CA  . GLY B 1 195 ? 54.314  2.882   45.725  1.00 6.90  ? 195  GLY B CA  1 
ATOM   5439  C  C   . GLY B 1 195 ? 55.531  2.070   45.306  1.00 7.69  ? 195  GLY B C   1 
ATOM   5440  O  O   . GLY B 1 195 ? 56.675  2.350   45.735  1.00 7.78  ? 195  GLY B O   1 
ATOM   5441  N  N   . SER B 1 196 ? 55.294  1.064   44.463  1.00 6.89  ? 196  SER B N   1 
ATOM   5442  C  CA  . SER B 1 196 ? 56.337  0.141   44.063  1.00 7.03  ? 196  SER B CA  1 
ATOM   5443  C  C   . SER B 1 196 ? 56.141  -0.174  42.589  1.00 7.82  ? 196  SER B C   1 
ATOM   5444  O  O   . SER B 1 196 ? 54.988  -0.410  42.144  1.00 7.74  ? 196  SER B O   1 
ATOM   5445  C  CB  . SER B 1 196 ? 56.231  -1.151  44.886  1.00 6.87  ? 196  SER B CB  1 
ATOM   5446  O  OG  . SER B 1 196 ? 56.090  -0.866  46.266  1.00 6.27  ? 196  SER B OG  1 
ATOM   5447  N  N   . SER B 1 197 ? 57.229  -0.178  41.810  1.00 7.09  ? 197  SER B N   1 
ATOM   5448  C  CA  . SER B 1 197 ? 57.070  -0.595  40.408  1.00 7.03  ? 197  SER B CA  1 
ATOM   5449  C  C   . SER B 1 197 ? 56.750  -2.103  40.318  1.00 7.13  ? 197  SER B C   1 
ATOM   5450  O  O   . SER B 1 197 ? 56.172  -2.573  39.321  1.00 6.45  ? 197  SER B O   1 
ATOM   5451  C  CB  . SER B 1 197 ? 58.281  -0.231  39.575  1.00 6.75  ? 197  SER B CB  1 
ATOM   5452  O  OG  . SER B 1 197 ? 59.431  -0.881  40.061  1.00 7.07  ? 197  SER B OG  1 
ATOM   5453  N  N   . VAL B 1 198 ? 57.068  -2.823  41.401  1.00 6.96  ? 198  VAL B N   1 
ATOM   5454  C  CA  . VAL B 1 198 ? 56.977  -4.294  41.489  1.00 6.75  ? 198  VAL B CA  1 
ATOM   5455  C  C   . VAL B 1 198 ? 57.942  -4.951  40.469  1.00 7.67  ? 198  VAL B C   1 
ATOM   5456  O  O   . VAL B 1 198 ? 58.837  -5.719  40.854  1.00 8.18  ? 198  VAL B O   1 
ATOM   5457  C  CB  . VAL B 1 198 ? 55.488  -4.845  41.383  1.00 6.24  ? 198  VAL B CB  1 
ATOM   5458  C  CG1 . VAL B 1 198 ? 55.463  -6.367  41.418  1.00 4.64  ? 198  VAL B CG1 1 
ATOM   5459  C  CG2 . VAL B 1 198 ? 54.613  -4.278  42.491  1.00 3.96  ? 198  VAL B CG2 1 
ATOM   5460  N  N   . HIS B 1 199 ? 57.755  -4.649  39.187  1.00 7.30  ? 199  HIS B N   1 
ATOM   5461  C  CA  . HIS B 1 199 ? 58.641  -5.134  38.133  1.00 7.89  ? 199  HIS B CA  1 
ATOM   5462  C  C   . HIS B 1 199 ? 59.959  -4.365  38.063  1.00 8.27  ? 199  HIS B C   1 
ATOM   5463  O  O   . HIS B 1 199 ? 60.017  -3.164  38.400  1.00 8.17  ? 199  HIS B O   1 
ATOM   5464  C  CB  . HIS B 1 199 ? 57.989  -4.963  36.764  1.00 7.13  ? 199  HIS B CB  1 
ATOM   5465  C  CG  . HIS B 1 199 ? 56.569  -5.417  36.701  1.00 8.86  ? 199  HIS B CG  1 
ATOM   5466  N  ND1 . HIS B 1 199 ? 56.198  -6.736  36.883  1.00 8.33  ? 199  HIS B ND1 1 
ATOM   5467  C  CD2 . HIS B 1 199 ? 55.429  -4.731  36.451  1.00 7.70  ? 199  HIS B CD2 1 
ATOM   5468  C  CE1 . HIS B 1 199 ? 54.889  -6.840  36.741  1.00 8.74  ? 199  HIS B CE1 1 
ATOM   5469  N  NE2 . HIS B 1 199 ? 54.399  -5.638  36.490  1.00 9.91  ? 199  HIS B NE2 1 
ATOM   5470  N  N   . SER B 1 200 ? 61.000  -5.038  37.565  1.00 7.83  ? 200  SER B N   1 
ATOM   5471  C  CA  . SER B 1 200 ? 62.134  -4.312  37.112  1.00 8.31  ? 200  SER B CA  1 
ATOM   5472  C  C   . SER B 1 200 ? 61.780  -3.831  35.707  1.00 9.10  ? 200  SER B C   1 
ATOM   5473  O  O   . SER B 1 200 ? 60.957  -4.436  35.016  1.00 9.35  ? 200  SER B O   1 
ATOM   5474  C  CB  . SER B 1 200 ? 63.404  -5.157  37.108  1.00 7.50  ? 200  SER B CB  1 
ATOM   5475  O  OG  . SER B 1 200 ? 63.285  -6.223  36.196  1.00 9.45  ? 200  SER B OG  1 
ATOM   5476  N  N   . PHE B 1 201 ? 62.419  -2.740  35.311  1.00 9.09  ? 201  PHE B N   1 
ATOM   5477  C  CA  . PHE B 1 201 ? 62.376  -2.215  33.968  1.00 9.04  ? 201  PHE B CA  1 
ATOM   5478  C  C   . PHE B 1 201 ? 63.819  -2.045  33.537  1.00 9.33  ? 201  PHE B C   1 
ATOM   5479  O  O   . PHE B 1 201 ? 64.756  -2.394  34.283  1.00 10.29 ? 201  PHE B O   1 
ATOM   5480  C  CB  . PHE B 1 201 ? 61.664  -0.856  33.992  1.00 8.89  ? 201  PHE B CB  1 
ATOM   5481  C  CG  . PHE B 1 201 ? 60.158  -0.958  34.148  1.00 9.89  ? 201  PHE B CG  1 
ATOM   5482  C  CD1 . PHE B 1 201 ? 59.314  -0.791  33.048  1.00 11.50 ? 201  PHE B CD1 1 
ATOM   5483  C  CD2 . PHE B 1 201 ? 59.577  -1.243  35.382  1.00 10.05 ? 201  PHE B CD2 1 
ATOM   5484  C  CE1 . PHE B 1 201 ? 57.928  -0.896  33.191  1.00 8.27  ? 201  PHE B CE1 1 
ATOM   5485  C  CE2 . PHE B 1 201 ? 58.184  -1.344  35.510  1.00 7.88  ? 201  PHE B CE2 1 
ATOM   5486  C  CZ  . PHE B 1 201 ? 57.382  -1.172  34.420  1.00 7.37  ? 201  PHE B CZ  1 
ATOM   5487  N  N   . LYS B 1 202 ? 64.025  -1.540  32.332  1.00 9.56  ? 202  LYS B N   1 
ATOM   5488  C  CA  . LYS B 1 202 ? 65.376  -1.301  31.845  1.00 9.73  ? 202  LYS B CA  1 
ATOM   5489  C  C   . LYS B 1 202 ? 65.559  0.181   31.566  1.00 9.97  ? 202  LYS B C   1 
ATOM   5490  O  O   . LYS B 1 202 ? 64.702  0.841   30.966  1.00 10.00 ? 202  LYS B O   1 
ATOM   5491  C  CB  . LYS B 1 202 ? 65.641  -2.092  30.561  1.00 9.96  ? 202  LYS B CB  1 
ATOM   5492  C  CG  . LYS B 1 202 ? 65.673  -3.601  30.707  1.00 9.89  ? 202  LYS B CG  1 
ATOM   5493  C  CD  . LYS B 1 202 ? 65.915  -4.222  29.371  1.00 10.79 ? 202  LYS B CD  1 
ATOM   5494  C  CE  . LYS B 1 202 ? 66.521  -5.629  29.520  1.00 14.20 ? 202  LYS B CE  1 
ATOM   5495  N  NZ  . LYS B 1 202 ? 66.780  -6.292  28.181  1.00 11.94 ? 202  LYS B NZ  1 
ATOM   5496  N  N   . TRP B 1 203 ? 66.691  0.705   32.001  1.00 10.11 ? 203  TRP B N   1 
ATOM   5497  C  CA  . TRP B 1 203 ? 67.053  2.070   31.675  1.00 9.96  ? 203  TRP B CA  1 
ATOM   5498  C  C   . TRP B 1 203 ? 68.315  1.994   30.851  1.00 10.85 ? 203  TRP B C   1 
ATOM   5499  O  O   . TRP B 1 203 ? 69.237  1.244   31.183  1.00 10.64 ? 203  TRP B O   1 
ATOM   5500  C  CB  . TRP B 1 203 ? 67.281  2.872   32.942  1.00 8.64  ? 203  TRP B CB  1 
ATOM   5501  C  CG  . TRP B 1 203 ? 66.023  3.370   33.593  1.00 8.89  ? 203  TRP B CG  1 
ATOM   5502  C  CD1 . TRP B 1 203 ? 64.734  3.043   33.265  1.00 8.44  ? 203  TRP B CD1 1 
ATOM   5503  C  CD2 . TRP B 1 203 ? 65.935  4.270   34.704  1.00 7.79  ? 203  TRP B CD2 1 
ATOM   5504  N  NE1 . TRP B 1 203 ? 63.858  3.704   34.066  1.00 7.96  ? 203  TRP B NE1 1 
ATOM   5505  C  CE2 . TRP B 1 203 ? 64.558  4.462   34.970  1.00 8.70  ? 203  TRP B CE2 1 
ATOM   5506  C  CE3 . TRP B 1 203 ? 66.886  4.958   35.478  1.00 3.62  ? 203  TRP B CE3 1 
ATOM   5507  C  CZ2 . TRP B 1 203 ? 64.095  5.307   36.001  1.00 7.48  ? 203  TRP B CZ2 1 
ATOM   5508  C  CZ3 . TRP B 1 203 ? 66.432  5.788   36.505  1.00 6.61  ? 203  TRP B CZ3 1 
ATOM   5509  C  CH2 . TRP B 1 203 ? 65.041  5.954   36.755  1.00 7.70  ? 203  TRP B CH2 1 
ATOM   5510  N  N   . VAL B 1 204 ? 68.331  2.765   29.770  1.00 11.99 ? 204  VAL B N   1 
ATOM   5511  C  CA  . VAL B 1 204 ? 69.402  2.751   28.800  1.00 13.05 ? 204  VAL B CA  1 
ATOM   5512  C  C   . VAL B 1 204 ? 69.916  4.171   28.745  1.00 14.04 ? 204  VAL B C   1 
ATOM   5513  O  O   . VAL B 1 204 ? 69.109  5.096   28.575  1.00 14.69 ? 204  VAL B O   1 
ATOM   5514  C  CB  . VAL B 1 204 ? 68.867  2.339   27.396  1.00 13.46 ? 204  VAL B CB  1 
ATOM   5515  C  CG1 . VAL B 1 204 ? 69.989  2.325   26.367  1.00 12.93 ? 204  VAL B CG1 1 
ATOM   5516  C  CG2 . VAL B 1 204 ? 68.181  0.964   27.450  1.00 11.99 ? 204  VAL B CG2 1 
ATOM   5517  N  N   . ASN B 1 205 ? 71.236  4.348   28.900  1.00 14.53 ? 205  ASN B N   1 
ATOM   5518  C  CA  . ASN B 1 205 ? 71.854  5.681   28.865  1.00 14.56 ? 205  ASN B CA  1 
ATOM   5519  C  C   . ASN B 1 205 ? 72.300  6.068   27.453  1.00 14.87 ? 205  ASN B C   1 
ATOM   5520  O  O   . ASN B 1 205 ? 72.151  5.272   26.522  1.00 14.61 ? 205  ASN B O   1 
ATOM   5521  C  CB  . ASN B 1 205 ? 73.006  5.810   29.894  1.00 14.55 ? 205  ASN B CB  1 
ATOM   5522  C  CG  . ASN B 1 205 ? 74.254  5.016   29.498  1.00 13.38 ? 205  ASN B CG  1 
ATOM   5523  O  OD1 . ASN B 1 205 ? 74.420  4.590   28.358  1.00 12.67 ? 205  ASN B OD1 1 
ATOM   5524  N  ND2 . ASN B 1 205 ? 75.123  4.804   30.460  1.00 14.33 ? 205  ASN B ND2 1 
ATOM   5525  N  N   . ALA B 1 206 ? 72.861  7.275   27.305  1.00 15.64 ? 206  ALA B N   1 
ATOM   5526  C  CA  . ALA B 1 206 ? 73.292  7.806   25.988  1.00 16.57 ? 206  ALA B CA  1 
ATOM   5527  C  C   . ALA B 1 206 ? 74.277  6.911   25.234  1.00 17.30 ? 206  ALA B C   1 
ATOM   5528  O  O   . ALA B 1 206 ? 74.409  7.011   24.011  1.00 18.16 ? 206  ALA B O   1 
ATOM   5529  C  CB  . ALA B 1 206 ? 73.871  9.222   26.122  1.00 16.01 ? 206  ALA B CB  1 
ATOM   5530  N  N   . HIS B 1 207 ? 74.979  6.044   25.950  1.00 18.19 ? 207  HIS B N   1 
ATOM   5531  C  CA  . HIS B 1 207 ? 75.929  5.161   25.283  1.00 19.02 ? 207  HIS B CA  1 
ATOM   5532  C  C   . HIS B 1 207 ? 75.410  3.767   24.931  1.00 18.33 ? 207  HIS B C   1 
ATOM   5533  O  O   . HIS B 1 207 ? 76.121  2.967   24.293  1.00 18.47 ? 207  HIS B O   1 
ATOM   5534  C  CB  . HIS B 1 207 ? 77.277  5.158   26.002  1.00 19.59 ? 207  HIS B CB  1 
ATOM   5535  C  CG  . HIS B 1 207 ? 78.188  6.224   25.487  1.00 23.49 ? 207  HIS B CG  1 
ATOM   5536  N  ND1 . HIS B 1 207 ? 78.235  7.489   26.033  1.00 26.83 ? 207  HIS B ND1 1 
ATOM   5537  C  CD2 . HIS B 1 207 ? 79.024  6.241   24.417  1.00 27.19 ? 207  HIS B CD2 1 
ATOM   5538  C  CE1 . HIS B 1 207 ? 79.095  8.227   25.350  1.00 29.34 ? 207  HIS B CE1 1 
ATOM   5539  N  NE2 . HIS B 1 207 ? 79.583  7.497   24.359  1.00 29.31 ? 207  HIS B NE2 1 
ATOM   5540  N  N   . GLY B 1 208 ? 74.158  3.502   25.294  1.00 16.71 ? 208  GLY B N   1 
ATOM   5541  C  CA  . GLY B 1 208 ? 73.565  2.202   25.036  1.00 15.16 ? 208  GLY B CA  1 
ATOM   5542  C  C   . GLY B 1 208 ? 73.811  1.180   26.130  1.00 13.84 ? 208  GLY B C   1 
ATOM   5543  O  O   . GLY B 1 208 ? 73.523  0.007   25.953  1.00 14.40 ? 208  GLY B O   1 
ATOM   5544  N  N   . ASN B 1 209 ? 74.347  1.616   27.262  1.00 12.70 ? 209  ASN B N   1 
ATOM   5545  C  CA  . ASN B 1 209 ? 74.428  0.747   28.430  1.00 12.01 ? 209  ASN B CA  1 
ATOM   5546  C  C   . ASN B 1 209 ? 73.076  0.648   29.125  1.00 11.00 ? 209  ASN B C   1 
ATOM   5547  O  O   . ASN B 1 209 ? 72.410  1.666   29.369  1.00 10.58 ? 209  ASN B O   1 
ATOM   5548  C  CB  . ASN B 1 209 ? 75.494  1.218   29.437  1.00 11.91 ? 209  ASN B CB  1 
ATOM   5549  C  CG  . ASN B 1 209 ? 75.877  0.114   30.419  1.00 12.41 ? 209  ASN B CG  1 
ATOM   5550  O  OD1 . ASN B 1 209 ? 76.335  -0.931  29.999  1.00 12.15 ? 209  ASN B OD1 1 
ATOM   5551  N  ND2 . ASN B 1 209 ? 75.660  0.338   31.727  1.00 11.91 ? 209  ASN B ND2 1 
ATOM   5552  N  N   . THR B 1 210 ? 72.673  -0.573  29.442  1.00 9.99  ? 210  THR B N   1 
ATOM   5553  C  CA  . THR B 1 210 ? 71.395  -0.771  30.126  1.00 9.43  ? 210  THR B CA  1 
ATOM   5554  C  C   . THR B 1 210 ? 71.553  -1.340  31.521  1.00 8.65  ? 210  THR B C   1 
ATOM   5555  O  O   . THR B 1 210 ? 72.424  -2.145  31.750  1.00 9.51  ? 210  THR B O   1 
ATOM   5556  C  CB  . THR B 1 210 ? 70.291  -1.492  29.233  1.00 9.41  ? 210  THR B CB  1 
ATOM   5557  O  OG1 . THR B 1 210 ? 69.543  -2.440  30.005  1.00 10.57 ? 210  THR B OG1 1 
ATOM   5558  C  CG2 . THR B 1 210 ? 70.874  -2.171  28.033  1.00 9.17  ? 210  THR B CG2 1 
ATOM   5559  N  N   . VAL B 1 211 ? 70.739  -0.884  32.462  1.00 8.05  ? 211  VAL B N   1 
ATOM   5560  C  CA  . VAL B 1 211 ? 70.681  -1.495  33.786  1.00 7.45  ? 211  VAL B CA  1 
ATOM   5561  C  C   . VAL B 1 211 ? 69.236  -1.846  34.052  1.00 8.15  ? 211  VAL B C   1 
ATOM   5562  O  O   . VAL B 1 211 ? 68.341  -1.222  33.474  1.00 9.10  ? 211  VAL B O   1 
ATOM   5563  C  CB  . VAL B 1 211 ? 71.178  -0.527  34.911  1.00 7.81  ? 211  VAL B CB  1 
ATOM   5564  C  CG1 . VAL B 1 211 ? 72.713  -0.346  34.870  1.00 6.07  ? 211  VAL B CG1 1 
ATOM   5565  C  CG2 . VAL B 1 211 ? 70.438  0.848   34.849  1.00 5.87  ? 211  VAL B CG2 1 
ATOM   5566  N  N   . TYR B 1 212 ? 69.002  -2.828  34.917  1.00 8.62  ? 212  TYR B N   1 
ATOM   5567  C  CA  . TYR B 1 212 ? 67.665  -3.094  35.472  1.00 9.24  ? 212  TYR B CA  1 
ATOM   5568  C  C   . TYR B 1 212 ? 67.355  -2.185  36.651  1.00 9.59  ? 212  TYR B C   1 
ATOM   5569  O  O   . TYR B 1 212 ? 68.151  -2.033  37.571  1.00 9.49  ? 212  TYR B O   1 
ATOM   5570  C  CB  . TYR B 1 212 ? 67.518  -4.539  35.958  1.00 9.04  ? 212  TYR B CB  1 
ATOM   5571  C  CG  . TYR B 1 212 ? 67.488  -5.571  34.864  1.00 8.72  ? 212  TYR B CG  1 
ATOM   5572  C  CD1 . TYR B 1 212 ? 66.332  -5.762  34.082  1.00 7.05  ? 212  TYR B CD1 1 
ATOM   5573  C  CD2 . TYR B 1 212 ? 68.601  -6.372  34.616  1.00 7.49  ? 212  TYR B CD2 1 
ATOM   5574  C  CE1 . TYR B 1 212 ? 66.285  -6.724  33.085  1.00 5.99  ? 212  TYR B CE1 1 
ATOM   5575  C  CE2 . TYR B 1 212 ? 68.576  -7.345  33.598  1.00 8.67  ? 212  TYR B CE2 1 
ATOM   5576  C  CZ  . TYR B 1 212 ? 67.414  -7.516  32.847  1.00 8.40  ? 212  TYR B CZ  1 
ATOM   5577  O  OH  . TYR B 1 212 ? 67.389  -8.473  31.858  1.00 8.95  ? 212  TYR B OH  1 
ATOM   5578  N  N   . ILE B 1 213 ? 66.168  -1.605  36.644  1.00 10.03 ? 213  ILE B N   1 
ATOM   5579  C  CA  . ILE B 1 213 ? 65.830  -0.679  37.709  1.00 10.00 ? 213  ILE B CA  1 
ATOM   5580  C  C   . ILE B 1 213 ? 64.526  -1.096  38.326  1.00 10.06 ? 213  ILE B C   1 
ATOM   5581  O  O   . ILE B 1 213 ? 63.688  -1.694  37.655  1.00 9.45  ? 213  ILE B O   1 
ATOM   5582  C  CB  . ILE B 1 213 ? 65.750  0.814   37.215  1.00 9.94  ? 213  ILE B CB  1 
ATOM   5583  C  CG1 . ILE B 1 213 ? 64.570  1.020   36.254  1.00 8.88  ? 213  ILE B CG1 1 
ATOM   5584  C  CG2 . ILE B 1 213 ? 67.105  1.273   36.592  1.00 9.36  ? 213  ILE B CG2 1 
ATOM   5585  C  CD1 . ILE B 1 213 ? 63.366  1.658   36.872  1.00 7.98  ? 213  ILE B CD1 1 
ATOM   5586  N  N   . LYS B 1 214 ? 64.380  -0.784  39.609  1.00 10.34 ? 214  LYS B N   1 
ATOM   5587  C  CA  . LYS B 1 214 ? 63.086  -0.848  40.266  1.00 10.89 ? 214  LYS B CA  1 
ATOM   5588  C  C   . LYS B 1 214 ? 62.782  0.580   40.750  1.00 11.13 ? 214  LYS B C   1 
ATOM   5589  O  O   . LYS B 1 214 ? 63.726  1.363   41.012  1.00 10.21 ? 214  LYS B O   1 
ATOM   5590  C  CB  . LYS B 1 214 ? 63.107  -1.870  41.413  1.00 10.81 ? 214  LYS B CB  1 
ATOM   5591  C  CG  . LYS B 1 214 ? 61.891  -2.767  41.464  1.00 11.99 ? 214  LYS B CG  1 
ATOM   5592  C  CD  . LYS B 1 214 ? 62.146  -4.217  41.051  1.00 12.35 ? 214  LYS B CD  1 
ATOM   5593  C  CE  . LYS B 1 214 ? 61.939  -5.113  42.258  1.00 16.46 ? 214  LYS B CE  1 
ATOM   5594  N  NZ  . LYS B 1 214 ? 61.105  -6.367  42.079  1.00 13.23 ? 214  LYS B NZ  1 
ATOM   5595  N  N   . LEU B 1 215 ? 61.482  0.915   40.829  1.00 11.07 ? 215  LEU B N   1 
ATOM   5596  C  CA  . LEU B 1 215 ? 61.024  2.260   41.242  1.00 10.97 ? 215  LEU B CA  1 
ATOM   5597  C  C   . LEU B 1 215 ? 60.262  2.232   42.544  1.00 10.46 ? 215  LEU B C   1 
ATOM   5598  O  O   . LEU B 1 215 ? 59.474  1.327   42.792  1.00 10.97 ? 215  LEU B O   1 
ATOM   5599  C  CB  . LEU B 1 215 ? 60.152  2.913   40.172  1.00 11.04 ? 215  LEU B CB  1 
ATOM   5600  C  CG  . LEU B 1 215 ? 60.690  4.007   39.238  1.00 12.67 ? 215  LEU B CG  1 
ATOM   5601  C  CD1 . LEU B 1 215 ? 62.142  4.440   39.505  1.00 11.96 ? 215  LEU B CD1 1 
ATOM   5602  C  CD2 . LEU B 1 215 ? 60.469  3.613   37.770  1.00 11.37 ? 215  LEU B CD2 1 
ATOM   5603  N  N   . ARG B 1 216 ? 60.473  3.271   43.338  1.00 10.01 ? 216  ARG B N   1 
ATOM   5604  C  CA  . ARG B 1 216 ? 60.040  3.328   44.718  1.00 9.80  ? 216  ARG B CA  1 
ATOM   5605  C  C   . ARG B 1 216 ? 59.448  4.708   45.058  1.00 9.12  ? 216  ARG B C   1 
ATOM   5606  O  O   . ARG B 1 216 ? 60.095  5.750   44.844  1.00 8.61  ? 216  ARG B O   1 
ATOM   5607  C  CB  . ARG B 1 216 ? 61.265  3.053   45.610  1.00 10.58 ? 216  ARG B CB  1 
ATOM   5608  C  CG  . ARG B 1 216 ? 61.335  1.695   46.290  1.00 11.19 ? 216  ARG B CG  1 
ATOM   5609  C  CD  . ARG B 1 216 ? 61.452  0.456   45.413  1.00 11.35 ? 216  ARG B CD  1 
ATOM   5610  N  NE  . ARG B 1 216 ? 60.618  -0.479  46.123  1.00 15.59 ? 216  ARG B NE  1 
ATOM   5611  C  CZ  . ARG B 1 216 ? 60.926  -1.679  46.600  1.00 15.23 ? 216  ARG B CZ  1 
ATOM   5612  N  NH1 . ARG B 1 216 ? 62.074  -2.290  46.350  1.00 16.66 ? 216  ARG B NH1 1 
ATOM   5613  N  NH2 . ARG B 1 216 ? 59.998  -2.295  47.301  1.00 15.22 ? 216  ARG B NH2 1 
ATOM   5614  N  N   . TRP B 1 217 ? 58.226  4.717   45.583  1.00 8.13  ? 217  TRP B N   1 
ATOM   5615  C  CA  . TRP B 1 217 ? 57.610  5.958   46.088  1.00 7.84  ? 217  TRP B CA  1 
ATOM   5616  C  C   . TRP B 1 217 ? 57.482  5.922   47.606  1.00 7.53  ? 217  TRP B C   1 
ATOM   5617  O  O   . TRP B 1 217 ? 56.944  4.964   48.134  1.00 7.26  ? 217  TRP B O   1 
ATOM   5618  C  CB  . TRP B 1 217 ? 56.230  6.178   45.474  1.00 7.63  ? 217  TRP B CB  1 
ATOM   5619  C  CG  . TRP B 1 217 ? 56.194  6.453   43.971  1.00 8.20  ? 217  TRP B CG  1 
ATOM   5620  C  CD1 . TRP B 1 217 ? 55.879  5.557   42.982  1.00 6.94  ? 217  TRP B CD1 1 
ATOM   5621  C  CD2 . TRP B 1 217 ? 56.434  7.705   43.311  1.00 7.43  ? 217  TRP B CD2 1 
ATOM   5622  N  NE1 . TRP B 1 217 ? 55.903  6.171   41.765  1.00 5.77  ? 217  TRP B NE1 1 
ATOM   5623  C  CE2 . TRP B 1 217 ? 56.231  7.492   41.934  1.00 7.95  ? 217  TRP B CE2 1 
ATOM   5624  C  CE3 . TRP B 1 217 ? 56.785  8.993   43.753  1.00 7.09  ? 217  TRP B CE3 1 
ATOM   5625  C  CZ2 . TRP B 1 217 ? 56.393  8.512   40.985  1.00 7.81  ? 217  TRP B CZ2 1 
ATOM   5626  C  CZ3 . TRP B 1 217 ? 56.931  10.008  42.812  1.00 6.51  ? 217  TRP B CZ3 1 
ATOM   5627  C  CH2 . TRP B 1 217 ? 56.743  9.756   41.445  1.00 7.88  ? 217  TRP B CH2 1 
ATOM   5628  N  N   . VAL B 1 218 ? 58.000  6.953   48.290  1.00 8.08  ? 218  VAL B N   1 
ATOM   5629  C  CA  . VAL B 1 218 ? 58.030  7.045   49.767  1.00 8.27  ? 218  VAL B CA  1 
ATOM   5630  C  C   . VAL B 1 218 ? 57.216  8.274   50.182  1.00 9.35  ? 218  VAL B C   1 
ATOM   5631  O  O   . VAL B 1 218 ? 57.518  9.388   49.752  1.00 9.10  ? 218  VAL B O   1 
ATOM   5632  C  CB  . VAL B 1 218 ? 59.490  7.162   50.343  1.00 8.56  ? 218  VAL B CB  1 
ATOM   5633  C  CG1 . VAL B 1 218 ? 59.493  7.279   51.904  1.00 8.56  ? 218  VAL B CG1 1 
ATOM   5634  C  CG2 . VAL B 1 218 ? 60.390  5.979   49.885  1.00 8.23  ? 218  VAL B CG2 1 
ATOM   5635  N  N   . PRO B 1 219 ? 56.149  8.075   50.983  1.00 10.29 ? 219  PRO B N   1 
ATOM   5636  C  CA  . PRO B 1 219 ? 55.278  9.212   51.255  1.00 11.37 ? 219  PRO B CA  1 
ATOM   5637  C  C   . PRO B 1 219 ? 55.803  10.106  52.379  1.00 13.05 ? 219  PRO B C   1 
ATOM   5638  O  O   . PRO B 1 219 ? 56.248  9.603   53.425  1.00 13.26 ? 219  PRO B O   1 
ATOM   5639  C  CB  . PRO B 1 219 ? 53.960  8.554   51.642  1.00 10.69 ? 219  PRO B CB  1 
ATOM   5640  C  CG  . PRO B 1 219 ? 54.360  7.240   52.240  1.00 11.58 ? 219  PRO B CG  1 
ATOM   5641  C  CD  . PRO B 1 219 ? 55.673  6.835   51.628  1.00 10.08 ? 219  PRO B CD  1 
ATOM   5642  N  N   . LYS B 1 220 ? 55.757  11.419  52.151  1.00 14.53 ? 220  LYS B N   1 
ATOM   5643  C  CA  . LYS B 1 220 ? 56.136  12.408  53.156  1.00 17.20 ? 220  LYS B CA  1 
ATOM   5644  C  C   . LYS B 1 220 ? 55.281  12.205  54.414  1.00 17.19 ? 220  LYS B C   1 
ATOM   5645  O  O   . LYS B 1 220 ? 55.799  12.243  55.536  1.00 17.39 ? 220  LYS B O   1 
ATOM   5646  C  CB  . LYS B 1 220 ? 55.958  13.820  52.586  1.00 17.02 ? 220  LYS B CB  1 
ATOM   5647  C  CG  . LYS B 1 220 ? 55.929  14.963  53.611  1.00 19.63 ? 220  LYS B CG  1 
ATOM   5648  C  CD  . LYS B 1 220 ? 55.381  16.256  52.976  1.00 20.87 ? 220  LYS B CD  1 
ATOM   5649  C  CE  . LYS B 1 220 ? 56.211  17.473  53.379  1.00 26.94 ? 220  LYS B CE  1 
ATOM   5650  N  NZ  . LYS B 1 220 ? 55.976  17.864  54.800  1.00 30.35 ? 220  LYS B NZ  1 
ATOM   5651  N  N   . GLU B 1 221 ? 53.982  11.976  54.195  1.00 17.27 ? 221  GLU B N   1 
ATOM   5652  C  CA  . GLU B 1 221 ? 53.000  11.643  55.251  1.00 17.66 ? 221  GLU B CA  1 
ATOM   5653  C  C   . GLU B 1 221 ? 53.241  10.320  56.002  1.00 17.09 ? 221  GLU B C   1 
ATOM   5654  O  O   . GLU B 1 221 ? 52.579  10.067  57.014  1.00 17.70 ? 221  GLU B O   1 
ATOM   5655  C  CB  . GLU B 1 221 ? 51.562  11.633  54.694  1.00 17.27 ? 221  GLU B CB  1 
ATOM   5656  C  CG  . GLU B 1 221 ? 51.088  12.980  54.133  1.00 19.91 ? 221  GLU B CG  1 
ATOM   5657  C  CD  . GLU B 1 221 ? 50.966  14.069  55.203  1.00 23.34 ? 221  GLU B CD  1 
ATOM   5658  O  OE1 . GLU B 1 221 ? 50.349  13.810  56.259  1.00 25.38 ? 221  GLU B OE1 1 
ATOM   5659  O  OE2 . GLU B 1 221 ? 51.468  15.194  54.984  1.00 24.49 ? 221  GLU B OE2 1 
ATOM   5660  N  N   . GLY B 1 222 ? 54.159  9.483   55.526  1.00 16.16 ? 222  GLY B N   1 
ATOM   5661  C  CA  . GLY B 1 222 ? 54.396  8.185   56.168  1.00 15.10 ? 222  GLY B CA  1 
ATOM   5662  C  C   . GLY B 1 222 ? 53.394  7.122   55.731  1.00 14.61 ? 222  GLY B C   1 
ATOM   5663  O  O   . GLY B 1 222 ? 52.339  7.438   55.198  1.00 14.71 ? 222  GLY B O   1 
ATOM   5664  N  N   . VAL B 1 223 ? 53.741  5.860   55.947  1.00 14.01 ? 223  VAL B N   1 
ATOM   5665  C  CA  . VAL B 1 223 ? 52.844  4.745   55.724  1.00 13.76 ? 223  VAL B CA  1 
ATOM   5666  C  C   . VAL B 1 223 ? 51.959  4.585   56.962  1.00 14.59 ? 223  VAL B C   1 
ATOM   5667  O  O   . VAL B 1 223 ? 52.477  4.341   58.068  1.00 14.71 ? 223  VAL B O   1 
ATOM   5668  C  CB  . VAL B 1 223 ? 53.626  3.416   55.476  1.00 13.86 ? 223  VAL B CB  1 
ATOM   5669  C  CG1 . VAL B 1 223 ? 52.653  2.239   55.198  1.00 13.02 ? 223  VAL B CG1 1 
ATOM   5670  C  CG2 . VAL B 1 223 ? 54.600  3.573   54.320  1.00 11.56 ? 223  VAL B CG2 1 
ATOM   5671  N  N   . HIS B 1 224 ? 50.640  4.729   56.787  1.00 14.05 ? 224  HIS B N   1 
ATOM   5672  C  CA  . HIS B 1 224 ? 49.710  4.509   57.886  1.00 14.36 ? 224  HIS B CA  1 
ATOM   5673  C  C   . HIS B 1 224 ? 48.576  3.562   57.464  1.00 14.23 ? 224  HIS B C   1 
ATOM   5674  O  O   . HIS B 1 224 ? 47.928  3.762   56.434  1.00 15.23 ? 224  HIS B O   1 
ATOM   5675  C  CB  . HIS B 1 224 ? 49.144  5.836   58.411  1.00 14.37 ? 224  HIS B CB  1 
ATOM   5676  C  CG  . HIS B 1 224 ? 50.192  6.819   58.841  1.00 15.85 ? 224  HIS B CG  1 
ATOM   5677  N  ND1 . HIS B 1 224 ? 50.641  6.911   60.144  1.00 16.23 ? 224  HIS B ND1 1 
ATOM   5678  C  CD2 . HIS B 1 224 ? 50.874  7.757   58.143  1.00 15.70 ? 224  HIS B CD2 1 
ATOM   5679  C  CE1 . HIS B 1 224 ? 51.553  7.862   60.229  1.00 15.99 ? 224  HIS B CE1 1 
ATOM   5680  N  NE2 . HIS B 1 224 ? 51.712  8.392   59.030  1.00 16.95 ? 224  HIS B NE2 1 
ATOM   5681  N  N   . ASN B 1 225 ? 48.340  2.548   58.277  1.00 13.08 ? 225  ASN B N   1 
ATOM   5682  C  CA  . ASN B 1 225 ? 47.407  1.507   57.964  1.00 12.87 ? 225  ASN B CA  1 
ATOM   5683  C  C   . ASN B 1 225 ? 46.275  1.462   58.978  1.00 12.91 ? 225  ASN B C   1 
ATOM   5684  O  O   . ASN B 1 225 ? 46.305  2.172   60.000  1.00 12.89 ? 225  ASN B O   1 
ATOM   5685  C  CB  . ASN B 1 225 ? 48.127  0.141   57.905  1.00 12.15 ? 225  ASN B CB  1 
ATOM   5686  C  CG  . ASN B 1 225 ? 49.393  0.173   57.056  1.00 12.07 ? 225  ASN B CG  1 
ATOM   5687  O  OD1 . ASN B 1 225 ? 50.486  -0.181  57.534  1.00 12.13 ? 225  ASN B OD1 1 
ATOM   5688  N  ND2 . ASN B 1 225 ? 49.264  0.604   55.796  1.00 8.06  ? 225  ASN B ND2 1 
ATOM   5689  N  N   . LEU B 1 226 ? 45.285  0.622   58.671  1.00 12.63 ? 226  LEU B N   1 
ATOM   5690  C  CA  . LEU B 1 226 ? 44.148  0.355   59.533  1.00 12.68 ? 226  LEU B CA  1 
ATOM   5691  C  C   . LEU B 1 226 ? 44.129  -1.131  59.799  1.00 13.07 ? 226  LEU B C   1 
ATOM   5692  O  O   . LEU B 1 226 ? 44.371  -1.927  58.889  1.00 13.25 ? 226  LEU B O   1 
ATOM   5693  C  CB  . LEU B 1 226 ? 42.837  0.744   58.846  1.00 12.19 ? 226  LEU B CB  1 
ATOM   5694  C  CG  . LEU B 1 226 ? 42.690  2.177   58.331  1.00 12.78 ? 226  LEU B CG  1 
ATOM   5695  C  CD1 . LEU B 1 226 ? 41.393  2.352   57.553  1.00 11.15 ? 226  LEU B CD1 1 
ATOM   5696  C  CD2 . LEU B 1 226 ? 42.775  3.200   59.481  1.00 14.40 ? 226  LEU B CD2 1 
ATOM   5697  N  N   . SER B 1 227 ? 43.852  -1.501  61.050  1.00 13.23 ? 227  SER B N   1 
ATOM   5698  C  CA  . SER B 1 227 ? 43.600  -2.887  61.424  1.00 13.13 ? 227  SER B CA  1 
ATOM   5699  C  C   . SER B 1 227 ? 42.208  -3.249  60.930  1.00 13.68 ? 227  SER B C   1 
ATOM   5700  O  O   . SER B 1 227 ? 41.463  -2.360  60.471  1.00 13.98 ? 227  SER B O   1 
ATOM   5701  C  CB  . SER B 1 227 ? 43.645  -3.018  62.937  1.00 12.98 ? 227  SER B CB  1 
ATOM   5702  O  OG  . SER B 1 227 ? 42.421  -2.583  63.471  1.00 12.84 ? 227  SER B OG  1 
ATOM   5703  N  N   . ALA B 1 228 ? 41.833  -4.525  61.035  1.00 13.87 ? 228  ALA B N   1 
ATOM   5704  C  CA  . ALA B 1 228 ? 40.517  -4.964  60.550  1.00 14.52 ? 228  ALA B CA  1 
ATOM   5705  C  C   . ALA B 1 228 ? 39.334  -4.270  61.259  1.00 15.13 ? 228  ALA B C   1 
ATOM   5706  O  O   . ALA B 1 228 ? 38.360  -3.875  60.612  1.00 15.72 ? 228  ALA B O   1 
ATOM   5707  C  CB  . ALA B 1 228 ? 40.388  -6.487  60.617  1.00 14.12 ? 228  ALA B CB  1 
ATOM   5708  N  N   . ASP B 1 229 ? 39.427  -4.115  62.576  1.00 16.07 ? 229  ASP B N   1 
ATOM   5709  C  CA  . ASP B 1 229 ? 38.388  -3.453  63.366  1.00 17.05 ? 229  ASP B CA  1 
ATOM   5710  C  C   . ASP B 1 229 ? 38.319  -1.959  63.081  1.00 17.43 ? 229  ASP B C   1 
ATOM   5711  O  O   . ASP B 1 229 ? 37.223  -1.389  63.040  1.00 17.56 ? 229  ASP B O   1 
ATOM   5712  C  CB  . ASP B 1 229 ? 38.637  -3.645  64.863  1.00 17.69 ? 229  ASP B CB  1 
ATOM   5713  C  CG  . ASP B 1 229 ? 38.498  -5.096  65.310  1.00 20.60 ? 229  ASP B CG  1 
ATOM   5714  O  OD1 . ASP B 1 229 ? 38.998  -5.409  66.409  1.00 24.55 ? 229  ASP B OD1 1 
ATOM   5715  O  OD2 . ASP B 1 229 ? 37.895  -5.922  64.583  1.00 22.89 ? 229  ASP B OD2 1 
ATOM   5716  N  N   . GLU B 1 230 ? 39.484  -1.321  62.910  1.00 17.04 ? 230  GLU B N   1 
ATOM   5717  C  CA  . GLU B 1 230 ? 39.521  0.077   62.506  1.00 17.28 ? 230  GLU B CA  1 
ATOM   5718  C  C   . GLU B 1 230 ? 38.844  0.262   61.148  1.00 16.94 ? 230  GLU B C   1 
ATOM   5719  O  O   . GLU B 1 230 ? 38.057  1.200   60.957  1.00 16.42 ? 230  GLU B O   1 
ATOM   5720  C  CB  . GLU B 1 230 ? 40.950  0.590   62.460  1.00 17.53 ? 230  GLU B CB  1 
ATOM   5721  C  CG  . GLU B 1 230 ? 41.453  1.064   63.804  1.00 19.89 ? 230  GLU B CG  1 
ATOM   5722  C  CD  . GLU B 1 230 ? 42.969  1.079   63.909  1.00 24.30 ? 230  GLU B CD  1 
ATOM   5723  O  OE1 . GLU B 1 230 ? 43.466  1.082   65.057  1.00 29.05 ? 230  GLU B OE1 1 
ATOM   5724  O  OE2 . GLU B 1 230 ? 43.673  1.090   62.877  1.00 24.22 ? 230  GLU B OE2 1 
ATOM   5725  N  N   . ALA B 1 231 ? 39.136  -0.658  60.226  1.00 16.17 ? 231  ALA B N   1 
ATOM   5726  C  CA  . ALA B 1 231 ? 38.577  -0.605  58.880  1.00 15.94 ? 231  ALA B CA  1 
ATOM   5727  C  C   . ALA B 1 231 ? 37.060  -0.775  58.919  1.00 15.55 ? 231  ALA B C   1 
ATOM   5728  O  O   . ALA B 1 231 ? 36.344  -0.095  58.208  1.00 14.61 ? 231  ALA B O   1 
ATOM   5729  C  CB  . ALA B 1 231 ? 39.222  -1.658  57.988  1.00 15.80 ? 231  ALA B CB  1 
ATOM   5730  N  N   . THR B 1 232 ? 36.592  -1.691  59.761  1.00 15.96 ? 232  THR B N   1 
ATOM   5731  C  CA  . THR B 1 232 ? 35.163  -1.890  60.013  1.00 16.50 ? 232  THR B CA  1 
ATOM   5732  C  C   . THR B 1 232 ? 34.471  -0.612  60.544  1.00 16.27 ? 232  THR B C   1 
ATOM   5733  O  O   . THR B 1 232 ? 33.417  -0.205  60.040  1.00 16.13 ? 232  THR B O   1 
ATOM   5734  C  CB  . THR B 1 232 ? 34.972  -3.101  60.978  1.00 16.82 ? 232  THR B CB  1 
ATOM   5735  O  OG1 . THR B 1 232 ? 35.310  -4.300  60.275  1.00 17.68 ? 232  THR B OG1 1 
ATOM   5736  C  CG2 . THR B 1 232 ? 33.533  -3.205  61.517  1.00 16.61 ? 232  THR B CG2 1 
ATOM   5737  N  N   . GLU B 1 233 ? 35.074  0.014   61.550  1.00 16.57 ? 233  GLU B N   1 
ATOM   5738  C  CA  . GLU B 1 233 ? 34.570  1.280   62.080  1.00 17.19 ? 233  GLU B CA  1 
ATOM   5739  C  C   . GLU B 1 233 ? 34.525  2.373   61.017  1.00 16.16 ? 233  GLU B C   1 
ATOM   5740  O  O   . GLU B 1 233 ? 33.519  3.067   60.895  1.00 16.92 ? 233  GLU B O   1 
ATOM   5741  C  CB  . GLU B 1 233 ? 35.352  1.738   63.328  1.00 17.89 ? 233  GLU B CB  1 
ATOM   5742  C  CG  . GLU B 1 233 ? 35.422  3.266   63.507  1.00 22.76 ? 233  GLU B CG  1 
ATOM   5743  C  CD  . GLU B 1 233 ? 35.208  3.732   64.946  1.00 30.55 ? 233  GLU B CD  1 
ATOM   5744  O  OE1 . GLU B 1 233 ? 34.544  4.783   65.138  1.00 34.46 ? 233  GLU B OE1 1 
ATOM   5745  O  OE2 . GLU B 1 233 ? 35.701  3.065   65.886  1.00 32.61 ? 233  GLU B OE2 1 
ATOM   5746  N  N   . VAL B 1 234 ? 35.595  2.539   60.246  1.00 15.08 ? 234  VAL B N   1 
ATOM   5747  C  CA  . VAL B 1 234 ? 35.578  3.559   59.202  1.00 14.13 ? 234  VAL B CA  1 
ATOM   5748  C  C   . VAL B 1 234 ? 34.494  3.249   58.148  1.00 13.80 ? 234  VAL B C   1 
ATOM   5749  O  O   . VAL B 1 234 ? 33.730  4.136   57.760  1.00 13.44 ? 234  VAL B O   1 
ATOM   5750  C  CB  . VAL B 1 234 ? 36.972  3.777   58.547  1.00 14.33 ? 234  VAL B CB  1 
ATOM   5751  C  CG1 . VAL B 1 234 ? 36.873  4.757   57.361  1.00 12.67 ? 234  VAL B CG1 1 
ATOM   5752  C  CG2 . VAL B 1 234 ? 37.976  4.305   59.570  1.00 12.48 ? 234  VAL B CG2 1 
ATOM   5753  N  N   . GLN B 1 235 ? 34.409  1.983   57.733  1.00 13.51 ? 235  GLN B N   1 
ATOM   5754  C  CA  . GLN B 1 235 ? 33.456  1.546   56.695  1.00 13.56 ? 235  GLN B CA  1 
ATOM   5755  C  C   . GLN B 1 235 ? 31.988  1.932   56.970  1.00 13.57 ? 235  GLN B C   1 
ATOM   5756  O  O   . GLN B 1 235 ? 31.260  2.333   56.053  1.00 13.05 ? 235  GLN B O   1 
ATOM   5757  C  CB  . GLN B 1 235 ? 33.576  0.043   56.444  1.00 13.63 ? 235  GLN B CB  1 
ATOM   5758  C  CG  . GLN B 1 235 ? 32.867  -0.403  55.186  1.00 13.75 ? 235  GLN B CG  1 
ATOM   5759  C  CD  . GLN B 1 235 ? 33.077  -1.860  54.876  1.00 14.12 ? 235  GLN B CD  1 
ATOM   5760  O  OE1 . GLN B 1 235 ? 32.136  -2.653  54.886  1.00 17.43 ? 235  GLN B OE1 1 
ATOM   5761  N  NE2 . GLN B 1 235 ? 34.300  -2.221  54.585  1.00 13.76 ? 235  GLN B NE2 1 
ATOM   5762  N  N   . GLY B 1 236 ? 31.571  1.830   58.231  1.00 13.65 ? 236  GLY B N   1 
ATOM   5763  C  CA  . GLY B 1 236 ? 30.200  2.136   58.608  1.00 14.45 ? 236  GLY B CA  1 
ATOM   5764  C  C   . GLY B 1 236 ? 29.831  3.597   58.457  1.00 14.97 ? 236  GLY B C   1 
ATOM   5765  O  O   . GLY B 1 236 ? 28.693  3.910   58.149  1.00 14.90 ? 236  GLY B O   1 
ATOM   5766  N  N   . LYS B 1 237 ? 30.809  4.471   58.677  1.00 15.77 ? 237  LYS B N   1 
ATOM   5767  C  CA  . LYS B 1 237 ? 30.663  5.921   58.615  1.00 16.84 ? 237  LYS B CA  1 
ATOM   5768  C  C   . LYS B 1 237 ? 30.918  6.537   57.219  1.00 16.76 ? 237  LYS B C   1 
ATOM   5769  O  O   . LYS B 1 237 ? 30.238  7.494   56.814  1.00 16.20 ? 237  LYS B O   1 
ATOM   5770  C  CB  . LYS B 1 237 ? 31.655  6.548   59.603  1.00 18.32 ? 237  LYS B CB  1 
ATOM   5771  C  CG  . LYS B 1 237 ? 31.014  7.187   60.849  1.00 21.18 ? 237  LYS B CG  1 
ATOM   5772  C  CD  . LYS B 1 237 ? 30.481  6.152   61.837  1.00 24.91 ? 237  LYS B CD  1 
ATOM   5773  C  CE  . LYS B 1 237 ? 29.727  6.821   63.004  1.00 25.58 ? 237  LYS B CE  1 
ATOM   5774  N  NZ  . LYS B 1 237 ? 28.655  7.757   62.499  1.00 27.76 ? 237  LYS B NZ  1 
ATOM   5775  N  N   . ASP B 1 238 ? 31.906  5.998   56.491  1.00 15.68 ? 238  ASP B N   1 
ATOM   5776  C  CA  . ASP B 1 238 ? 32.329  6.577   55.214  1.00 14.52 ? 238  ASP B CA  1 
ATOM   5777  C  C   . ASP B 1 238 ? 32.858  5.485   54.254  1.00 13.51 ? 238  ASP B C   1 
ATOM   5778  O  O   . ASP B 1 238 ? 33.919  4.904   54.495  1.00 13.36 ? 238  ASP B O   1 
ATOM   5779  C  CB  . ASP B 1 238 ? 33.398  7.667   55.488  1.00 14.02 ? 238  ASP B CB  1 
ATOM   5780  C  CG  . ASP B 1 238 ? 33.757  8.494   54.245  1.00 14.89 ? 238  ASP B CG  1 
ATOM   5781  O  OD1 . ASP B 1 238 ? 33.364  8.119   53.115  1.00 13.79 ? 238  ASP B OD1 1 
ATOM   5782  O  OD2 . ASP B 1 238 ? 34.447  9.538   54.392  1.00 16.83 ? 238  ASP B OD2 1 
ATOM   5783  N  N   . PHE B 1 239 ? 32.127  5.209   53.176  1.00 12.64 ? 239  PHE B N   1 
ATOM   5784  C  CA  . PHE B 1 239 ? 32.588  4.246   52.146  1.00 12.19 ? 239  PHE B CA  1 
ATOM   5785  C  C   . PHE B 1 239 ? 33.444  4.918   51.061  1.00 12.41 ? 239  PHE B C   1 
ATOM   5786  O  O   . PHE B 1 239 ? 33.938  4.244   50.131  1.00 12.88 ? 239  PHE B O   1 
ATOM   5787  C  CB  . PHE B 1 239 ? 31.443  3.426   51.515  1.00 11.61 ? 239  PHE B CB  1 
ATOM   5788  C  CG  . PHE B 1 239 ? 30.492  4.241   50.637  1.00 11.31 ? 239  PHE B CG  1 
ATOM   5789  C  CD1 . PHE B 1 239 ? 30.658  4.280   49.237  1.00 10.31 ? 239  PHE B CD1 1 
ATOM   5790  C  CD2 . PHE B 1 239 ? 29.429  4.950   51.208  1.00 9.46  ? 239  PHE B CD2 1 
ATOM   5791  C  CE1 . PHE B 1 239 ? 29.792  5.028   48.424  1.00 9.59  ? 239  PHE B CE1 1 
ATOM   5792  C  CE2 . PHE B 1 239 ? 28.551  5.707   50.407  1.00 10.52 ? 239  PHE B CE2 1 
ATOM   5793  C  CZ  . PHE B 1 239 ? 28.720  5.734   49.012  1.00 11.18 ? 239  PHE B CZ  1 
ATOM   5794  N  N   . ASN B 1 240 ? 33.642  6.226   51.207  1.00 12.12 ? 240  ASN B N   1 
ATOM   5795  C  CA  . ASN B 1 240 ? 34.531  6.989   50.332  1.00 12.07 ? 240  ASN B CA  1 
ATOM   5796  C  C   . ASN B 1 240 ? 35.685  7.644   51.092  1.00 12.27 ? 240  ASN B C   1 
ATOM   5797  O  O   . ASN B 1 240 ? 36.133  8.717   50.703  1.00 12.78 ? 240  ASN B O   1 
ATOM   5798  C  CB  . ASN B 1 240 ? 33.738  8.100   49.634  1.00 11.57 ? 240  ASN B CB  1 
ATOM   5799  C  CG  . ASN B 1 240 ? 32.423  7.615   49.046  1.00 11.12 ? 240  ASN B CG  1 
ATOM   5800  O  OD1 . ASN B 1 240 ? 32.399  6.978   47.984  1.00 7.04  ? 240  ASN B OD1 1 
ATOM   5801  N  ND2 . ASN B 1 240 ? 31.311  7.947   49.719  1.00 7.06  ? 240  ASN B ND2 1 
ATOM   5802  N  N   . HIS B 1 241 ? 36.189  7.012   52.152  1.00 12.43 ? 241  HIS B N   1 
ATOM   5803  C  CA  . HIS B 1 241 ? 37.044  7.737   53.104  1.00 12.14 ? 241  HIS B CA  1 
ATOM   5804  C  C   . HIS B 1 241 ? 38.350  8.199   52.489  1.00 11.89 ? 241  HIS B C   1 
ATOM   5805  O  O   . HIS B 1 241 ? 38.800  9.315   52.769  1.00 11.69 ? 241  HIS B O   1 
ATOM   5806  C  CB  . HIS B 1 241 ? 37.275  6.947   54.416  1.00 12.36 ? 241  HIS B CB  1 
ATOM   5807  C  CG  . HIS B 1 241 ? 38.420  5.982   54.348  1.00 14.06 ? 241  HIS B CG  1 
ATOM   5808  N  ND1 . HIS B 1 241 ? 38.297  4.717   53.811  1.00 14.35 ? 241  HIS B ND1 1 
ATOM   5809  C  CD2 . HIS B 1 241 ? 39.716  6.103   54.736  1.00 14.09 ? 241  HIS B CD2 1 
ATOM   5810  C  CE1 . HIS B 1 241 ? 39.470  4.105   53.859  1.00 14.28 ? 241  HIS B CE1 1 
ATOM   5811  N  NE2 . HIS B 1 241 ? 40.346  4.922   54.420  1.00 13.80 ? 241  HIS B NE2 1 
ATOM   5812  N  N   . ALA B 1 242 ? 38.952  7.360   51.647  1.00 11.57 ? 242  ALA B N   1 
ATOM   5813  C  CA  . ALA B 1 242 ? 40.285  7.654   51.132  1.00 11.42 ? 242  ALA B CA  1 
ATOM   5814  C  C   . ALA B 1 242 ? 40.243  8.760   50.090  1.00 11.86 ? 242  ALA B C   1 
ATOM   5815  O  O   . ALA B 1 242 ? 41.088  9.660   50.098  1.00 12.07 ? 242  ALA B O   1 
ATOM   5816  C  CB  . ALA B 1 242 ? 40.952  6.394   50.582  1.00 11.56 ? 242  ALA B CB  1 
ATOM   5817  N  N   . SER B 1 243 ? 39.262  8.676   49.190  1.00 11.65 ? 243  SER B N   1 
ATOM   5818  C  CA  . SER B 1 243 ? 38.964  9.739   48.229  1.00 11.55 ? 243  SER B CA  1 
ATOM   5819  C  C   . SER B 1 243 ? 38.644  11.047  48.944  1.00 11.57 ? 243  SER B C   1 
ATOM   5820  O  O   . SER B 1 243 ? 39.141  12.101  48.551  1.00 11.52 ? 243  SER B O   1 
ATOM   5821  C  CB  . SER B 1 243 ? 37.768  9.349   47.340  1.00 10.99 ? 243  SER B CB  1 
ATOM   5822  O  OG  . SER B 1 243 ? 38.177  8.399   46.381  1.00 10.78 ? 243  SER B OG  1 
ATOM   5823  N  N   . ASN B 1 244 ? 37.786  10.960  49.962  1.00 11.41 ? 244  ASN B N   1 
ATOM   5824  C  CA  . ASN B 1 244 ? 37.383  12.095  50.776  1.00 11.97 ? 244  ASN B CA  1 
ATOM   5825  C  C   . ASN B 1 244 ? 38.614  12.783  51.378  1.00 12.05 ? 244  ASN B C   1 
ATOM   5826  O  O   . ASN B 1 244 ? 38.808  13.984  51.199  1.00 12.12 ? 244  ASN B O   1 
ATOM   5827  C  CB  . ASN B 1 244 ? 36.481  11.588  51.900  1.00 12.06 ? 244  ASN B CB  1 
ATOM   5828  C  CG  . ASN B 1 244 ? 35.639  12.684  52.549  1.00 13.65 ? 244  ASN B CG  1 
ATOM   5829  O  OD1 . ASN B 1 244 ? 35.657  13.850  52.136  1.00 11.81 ? 244  ASN B OD1 1 
ATOM   5830  N  ND2 . ASN B 1 244 ? 34.837  12.282  53.545  1.00 14.45 ? 244  ASN B ND2 1 
ATOM   5831  N  N   . ASP B 1 245 ? 39.441  11.995  52.068  1.00 12.18 ? 245  ASP B N   1 
ATOM   5832  C  CA  . ASP B 1 245 ? 40.625  12.481  52.782  1.00 13.00 ? 245  ASP B CA  1 
ATOM   5833  C  C   . ASP B 1 245 ? 41.671  13.111  51.859  1.00 12.73 ? 245  ASP B C   1 
ATOM   5834  O  O   . ASP B 1 245 ? 42.244  14.141  52.187  1.00 12.20 ? 245  ASP B O   1 
ATOM   5835  C  CB  . ASP B 1 245 ? 41.276  11.330  53.574  1.00 13.38 ? 245  ASP B CB  1 
ATOM   5836  C  CG  . ASP B 1 245 ? 42.630  11.720  54.170  1.00 15.52 ? 245  ASP B CG  1 
ATOM   5837  O  OD1 . ASP B 1 245 ? 42.646  12.430  55.198  1.00 17.07 ? 245  ASP B OD1 1 
ATOM   5838  O  OD2 . ASP B 1 245 ? 43.680  11.321  53.613  1.00 17.82 ? 245  ASP B OD2 1 
ATOM   5839  N  N   . THR B 1 246 ? 41.929  12.471  50.718  1.00 12.61 ? 246  THR B N   1 
ATOM   5840  C  CA  . THR B 1 246 ? 42.926  12.973  49.770  1.00 12.65 ? 246  THR B CA  1 
ATOM   5841  C  C   . THR B 1 246 ? 42.429  14.239  49.057  1.00 12.78 ? 246  THR B C   1 
ATOM   5842  O  O   . THR B 1 246 ? 43.221  15.172  48.828  1.00 12.08 ? 246  THR B O   1 
ATOM   5843  C  CB  . THR B 1 246 ? 43.357  11.901  48.730  1.00 12.43 ? 246  THR B CB  1 
ATOM   5844  O  OG1 . THR B 1 246 ? 43.612  10.664  49.395  1.00 12.30 ? 246  THR B OG1 1 
ATOM   5845  C  CG2 . THR B 1 246 ? 44.638  12.324  48.001  1.00 12.50 ? 246  THR B CG2 1 
ATOM   5846  N  N   . PHE B 1 247 ? 41.137  14.272  48.707  1.00 12.56 ? 247  PHE B N   1 
ATOM   5847  C  CA  . PHE B 1 247 ? 40.563  15.469  48.071  1.00 12.73 ? 247  PHE B CA  1 
ATOM   5848  C  C   . PHE B 1 247 ? 40.607  16.654  49.040  1.00 13.64 ? 247  PHE B C   1 
ATOM   5849  O  O   . PHE B 1 247 ? 40.994  17.768  48.642  1.00 14.34 ? 247  PHE B O   1 
ATOM   5850  C  CB  . PHE B 1 247 ? 39.130  15.227  47.582  1.00 11.88 ? 247  PHE B CB  1 
ATOM   5851  C  CG  . PHE B 1 247 ? 38.542  16.372  46.764  1.00 10.79 ? 247  PHE B CG  1 
ATOM   5852  C  CD1 . PHE B 1 247 ? 38.089  17.546  47.377  1.00 9.98  ? 247  PHE B CD1 1 
ATOM   5853  C  CD2 . PHE B 1 247 ? 38.395  16.252  45.393  1.00 7.87  ? 247  PHE B CD2 1 
ATOM   5854  C  CE1 . PHE B 1 247 ? 37.542  18.582  46.628  1.00 9.24  ? 247  PHE B CE1 1 
ATOM   5855  C  CE2 . PHE B 1 247 ? 37.844  17.275  44.643  1.00 10.00 ? 247  PHE B CE2 1 
ATOM   5856  C  CZ  . PHE B 1 247 ? 37.413  18.449  45.262  1.00 9.95  ? 247  PHE B CZ  1 
ATOM   5857  N  N   . GLN B 1 248 ? 40.208  16.431  50.292  1.00 13.79 ? 248  GLN B N   1 
ATOM   5858  C  CA  . GLN B 1 248 ? 40.264  17.500  51.293  1.00 15.00 ? 248  GLN B CA  1 
ATOM   5859  C  C   . GLN B 1 248 ? 41.696  17.994  51.582  1.00 15.02 ? 248  GLN B C   1 
ATOM   5860  O  O   . GLN B 1 248 ? 41.908  19.200  51.678  1.00 15.54 ? 248  GLN B O   1 
ATOM   5861  C  CB  . GLN B 1 248 ? 39.539  17.120  52.604  1.00 15.31 ? 248  GLN B CB  1 
ATOM   5862  C  CG  . GLN B 1 248 ? 38.013  17.048  52.496  1.00 18.25 ? 248  GLN B CG  1 
ATOM   5863  C  CD  . GLN B 1 248 ? 37.394  18.310  51.874  1.00 21.32 ? 248  GLN B CD  1 
ATOM   5864  O  OE1 . GLN B 1 248 ? 36.682  18.241  50.859  1.00 22.80 ? 248  GLN B OE1 1 
ATOM   5865  N  NE2 . GLN B 1 248 ? 37.673  19.463  52.476  1.00 21.36 ? 248  GLN B NE2 1 
ATOM   5866  N  N   . ALA B 1 249 ? 42.663  17.086  51.725  1.00 14.40 ? 249  ALA B N   1 
ATOM   5867  C  CA  . ALA B 1 249 ? 44.054  17.504  51.915  1.00 14.87 ? 249  ALA B CA  1 
ATOM   5868  C  C   . ALA B 1 249 ? 44.515  18.486  50.844  1.00 15.13 ? 249  ALA B C   1 
ATOM   5869  O  O   . ALA B 1 249 ? 45.097  19.521  51.155  1.00 15.33 ? 249  ALA B O   1 
ATOM   5870  C  CB  . ALA B 1 249 ? 44.993  16.308  51.961  1.00 14.50 ? 249  ALA B CB  1 
ATOM   5871  N  N   . ILE B 1 250 ? 44.269  18.148  49.580  1.00 15.09 ? 250  ILE B N   1 
ATOM   5872  C  CA  . ILE B 1 250 ? 44.662  19.005  48.478  1.00 15.01 ? 250  ILE B CA  1 
ATOM   5873  C  C   . ILE B 1 250 ? 43.914  20.337  48.517  1.00 15.87 ? 250  ILE B C   1 
ATOM   5874  O  O   . ILE B 1 250 ? 44.511  21.400  48.300  1.00 15.75 ? 250  ILE B O   1 
ATOM   5875  C  CB  . ILE B 1 250 ? 44.458  18.306  47.118  1.00 14.84 ? 250  ILE B CB  1 
ATOM   5876  C  CG1 . ILE B 1 250 ? 45.569  17.275  46.889  1.00 13.06 ? 250  ILE B CG1 1 
ATOM   5877  C  CG2 . ILE B 1 250 ? 44.412  19.342  45.969  1.00 13.88 ? 250  ILE B CG2 1 
ATOM   5878  C  CD1 . ILE B 1 250 ? 45.220  16.185  45.924  1.00 9.82  ? 250  ILE B CD1 1 
ATOM   5879  N  N   . GLU B 1 251 ? 42.614  20.268  48.813  1.00 16.53 ? 251  GLU B N   1 
ATOM   5880  C  CA  . GLU B 1 251 ? 41.746  21.438  48.817  1.00 17.26 ? 251  GLU B CA  1 
ATOM   5881  C  C   . GLU B 1 251 ? 42.131  22.412  49.937  1.00 17.28 ? 251  GLU B C   1 
ATOM   5882  O  O   . GLU B 1 251 ? 42.020  23.626  49.778  1.00 17.60 ? 251  GLU B O   1 
ATOM   5883  C  CB  . GLU B 1 251 ? 40.269  21.003  48.909  1.00 17.46 ? 251  GLU B CB  1 
ATOM   5884  C  CG  . GLU B 1 251 ? 39.257  21.931  48.209  1.00 19.01 ? 251  GLU B CG  1 
ATOM   5885  C  CD  . GLU B 1 251 ? 39.541  22.206  46.703  1.00 21.08 ? 251  GLU B CD  1 
ATOM   5886  O  OE1 . GLU B 1 251 ? 38.943  23.166  46.170  1.00 22.30 ? 251  GLU B OE1 1 
ATOM   5887  O  OE2 . GLU B 1 251 ? 40.328  21.483  46.045  1.00 18.90 ? 251  GLU B OE2 1 
ATOM   5888  N  N   . ASN B 1 252 ? 42.596  21.863  51.054  1.00 17.75 ? 252  ASN B N   1 
ATOM   5889  C  CA  . ASN B 1 252 ? 43.096  22.643  52.190  1.00 18.41 ? 252  ASN B CA  1 
ATOM   5890  C  C   . ASN B 1 252 ? 44.541  23.137  52.049  1.00 18.33 ? 252  ASN B C   1 
ATOM   5891  O  O   . ASN B 1 252 ? 45.022  23.875  52.896  1.00 18.17 ? 252  ASN B O   1 
ATOM   5892  C  CB  . ASN B 1 252 ? 42.960  21.829  53.482  1.00 18.29 ? 252  ASN B CB  1 
ATOM   5893  C  CG  . ASN B 1 252 ? 41.513  21.506  53.821  1.00 19.47 ? 252  ASN B CG  1 
ATOM   5894  O  OD1 . ASN B 1 252 ? 40.575  22.164  53.351  1.00 21.62 ? 252  ASN B OD1 1 
ATOM   5895  N  ND2 . ASN B 1 252 ? 41.324  20.490  54.650  1.00 21.15 ? 252  ASN B ND2 1 
ATOM   5896  N  N   . GLY B 1 253 ? 45.228  22.719  50.990  1.00 18.35 ? 253  GLY B N   1 
ATOM   5897  C  CA  . GLY B 1 253 ? 46.616  23.123  50.758  1.00 18.52 ? 253  GLY B CA  1 
ATOM   5898  C  C   . GLY B 1 253 ? 47.636  22.247  51.470  1.00 18.59 ? 253  GLY B C   1 
ATOM   5899  O  O   . GLY B 1 253 ? 48.802  22.621  51.598  1.00 19.20 ? 253  GLY B O   1 
ATOM   5900  N  N   . ASP B 1 254 ? 47.199  21.089  51.951  1.00 18.12 ? 254  ASP B N   1 
ATOM   5901  C  CA  . ASP B 1 254 ? 48.119  20.117  52.540  1.00 18.04 ? 254  ASP B CA  1 
ATOM   5902  C  C   . ASP B 1 254 ? 48.444  19.052  51.483  1.00 17.11 ? 254  ASP B C   1 
ATOM   5903  O  O   . ASP B 1 254 ? 47.940  17.928  51.524  1.00 17.30 ? 254  ASP B O   1 
ATOM   5904  C  CB  . ASP B 1 254 ? 47.548  19.484  53.822  1.00 18.00 ? 254  ASP B CB  1 
ATOM   5905  C  CG  . ASP B 1 254 ? 48.584  18.620  54.548  1.00 20.78 ? 254  ASP B CG  1 
ATOM   5906  O  OD1 . ASP B 1 254 ? 49.758  18.625  54.109  1.00 23.48 ? 254  ASP B OD1 1 
ATOM   5907  O  OD2 . ASP B 1 254 ? 48.254  17.941  55.553  1.00 22.96 ? 254  ASP B OD2 1 
ATOM   5908  N  N   . PHE B 1 255 ? 49.298  19.427  50.537  1.00 15.49 ? 255  PHE B N   1 
ATOM   5909  C  CA  . PHE B 1 255 ? 49.527  18.634  49.356  1.00 13.32 ? 255  PHE B CA  1 
ATOM   5910  C  C   . PHE B 1 255 ? 50.242  17.313  49.642  1.00 12.87 ? 255  PHE B C   1 
ATOM   5911  O  O   . PHE B 1 255 ? 51.328  17.312  50.195  1.00 12.35 ? 255  PHE B O   1 
ATOM   5912  C  CB  . PHE B 1 255 ? 50.330  19.453  48.363  1.00 13.30 ? 255  PHE B CB  1 
ATOM   5913  C  CG  . PHE B 1 255 ? 49.673  20.742  47.962  1.00 12.95 ? 255  PHE B CG  1 
ATOM   5914  C  CD1 . PHE B 1 255 ? 50.435  21.891  47.786  1.00 12.27 ? 255  PHE B CD1 1 
ATOM   5915  C  CD2 . PHE B 1 255 ? 48.287  20.812  47.775  1.00 12.56 ? 255  PHE B CD2 1 
ATOM   5916  C  CE1 . PHE B 1 255 ? 49.835  23.096  47.403  1.00 12.99 ? 255  PHE B CE1 1 
ATOM   5917  C  CE2 . PHE B 1 255 ? 47.674  22.000  47.384  1.00 13.96 ? 255  PHE B CE2 1 
ATOM   5918  C  CZ  . PHE B 1 255 ? 48.447  23.151  47.196  1.00 13.96 ? 255  PHE B CZ  1 
ATOM   5919  N  N   . PRO B 1 256 ? 49.628  16.180  49.253  1.00 12.55 ? 256  PRO B N   1 
ATOM   5920  C  CA  . PRO B 1 256 ? 50.347  14.914  49.329  1.00 12.36 ? 256  PRO B CA  1 
ATOM   5921  C  C   . PRO B 1 256 ? 51.670  14.952  48.516  1.00 12.44 ? 256  PRO B C   1 
ATOM   5922  O  O   . PRO B 1 256 ? 51.686  15.393  47.366  1.00 11.93 ? 256  PRO B O   1 
ATOM   5923  C  CB  . PRO B 1 256 ? 49.361  13.894  48.727  1.00 11.86 ? 256  PRO B CB  1 
ATOM   5924  C  CG  . PRO B 1 256 ? 48.118  14.579  48.465  1.00 11.56 ? 256  PRO B CG  1 
ATOM   5925  C  CD  . PRO B 1 256 ? 48.254  16.025  48.728  1.00 12.38 ? 256  PRO B CD  1 
ATOM   5926  N  N   . GLU B 1 257 ? 52.761  14.505  49.131  1.00 12.38 ? 257  GLU B N   1 
ATOM   5927  C  CA  . GLU B 1 257 ? 54.035  14.444  48.452  1.00 13.42 ? 257  GLU B CA  1 
ATOM   5928  C  C   . GLU B 1 257 ? 54.664  13.069  48.550  1.00 12.44 ? 257  GLU B C   1 
ATOM   5929  O  O   . GLU B 1 257 ? 54.556  12.392  49.571  1.00 11.86 ? 257  GLU B O   1 
ATOM   5930  C  CB  . GLU B 1 257 ? 55.002  15.492  49.016  1.00 13.03 ? 257  GLU B CB  1 
ATOM   5931  C  CG  . GLU B 1 257 ? 54.664  16.905  48.582  1.00 15.73 ? 257  GLU B CG  1 
ATOM   5932  C  CD  . GLU B 1 257 ? 55.705  17.951  48.994  1.00 16.60 ? 257  GLU B CD  1 
ATOM   5933  O  OE1 . GLU B 1 257 ? 56.778  17.586  49.525  1.00 20.55 ? 257  GLU B OE1 1 
ATOM   5934  O  OE2 . GLU B 1 257 ? 55.443  19.151  48.778  1.00 21.35 ? 257  GLU B OE2 1 
ATOM   5935  N  N   . TRP B 1 258 ? 55.350  12.669  47.490  1.00 11.92 ? 258  TRP B N   1 
ATOM   5936  C  CA  . TRP B 1 258 ? 56.148  11.470  47.556  1.00 11.89 ? 258  TRP B CA  1 
ATOM   5937  C  C   . TRP B 1 258 ? 57.534  11.733  46.993  1.00 12.21 ? 258  TRP B C   1 
ATOM   5938  O  O   . TRP B 1 258 ? 57.695  12.468  46.012  1.00 11.85 ? 258  TRP B O   1 
ATOM   5939  C  CB  . TRP B 1 258 ? 55.497  10.317  46.773  1.00 11.71 ? 258  TRP B CB  1 
ATOM   5940  C  CG  . TRP B 1 258 ? 54.225  9.715   47.351  1.00 11.63 ? 258  TRP B CG  1 
ATOM   5941  C  CD1 . TRP B 1 258 ? 54.098  8.510   48.011  1.00 11.67 ? 258  TRP B CD1 1 
ATOM   5942  C  CD2 . TRP B 1 258 ? 52.896  10.252  47.251  1.00 11.61 ? 258  TRP B CD2 1 
ATOM   5943  N  NE1 . TRP B 1 258 ? 52.773  8.286   48.353  1.00 11.20 ? 258  TRP B NE1 1 
ATOM   5944  C  CE2 . TRP B 1 258 ? 52.021  9.340   47.898  1.00 11.37 ? 258  TRP B CE2 1 
ATOM   5945  C  CE3 . TRP B 1 258 ? 52.360  11.417  46.683  1.00 10.93 ? 258  TRP B CE3 1 
ATOM   5946  C  CZ2 . TRP B 1 258 ? 50.651  9.563   47.986  1.00 11.25 ? 258  TRP B CZ2 1 
ATOM   5947  C  CZ3 . TRP B 1 258 ? 51.005  11.634  46.772  1.00 11.60 ? 258  TRP B CZ3 1 
ATOM   5948  C  CH2 . TRP B 1 258 ? 50.162  10.715  47.418  1.00 11.57 ? 258  TRP B CH2 1 
ATOM   5949  N  N   . ASP B 1 259 ? 58.539  11.105  47.601  1.00 12.51 ? 259  ASP B N   1 
ATOM   5950  C  CA  . ASP B 1 259 ? 59.846  11.004  46.968  1.00 12.81 ? 259  ASP B CA  1 
ATOM   5951  C  C   . ASP B 1 259 ? 59.967  9.743   46.118  1.00 12.49 ? 259  ASP B C   1 
ATOM   5952  O  O   . ASP B 1 259 ? 59.579  8.645   46.551  1.00 11.56 ? 259  ASP B O   1 
ATOM   5953  C  CB  . ASP B 1 259 ? 60.954  11.079  48.003  1.00 13.28 ? 259  ASP B CB  1 
ATOM   5954  C  CG  . ASP B 1 259 ? 60.932  12.378  48.737  1.00 15.07 ? 259  ASP B CG  1 
ATOM   5955  O  OD1 . ASP B 1 259 ? 60.280  12.430  49.793  1.00 19.06 ? 259  ASP B OD1 1 
ATOM   5956  O  OD2 . ASP B 1 259 ? 61.504  13.364  48.241  1.00 17.15 ? 259  ASP B OD2 1 
ATOM   5957  N  N   . LEU B 1 260 ? 60.479  9.932   44.902  1.00 12.03 ? 260  LEU B N   1 
ATOM   5958  C  CA  . LEU B 1 260 ? 60.814  8.826   43.998  1.00 12.06 ? 260  LEU B CA  1 
ATOM   5959  C  C   . LEU B 1 260 ? 62.259  8.344   44.191  1.00 12.21 ? 260  LEU B C   1 
ATOM   5960  O  O   . LEU B 1 260 ? 63.202  9.134   44.165  1.00 12.66 ? 260  LEU B O   1 
ATOM   5961  C  CB  . LEU B 1 260 ? 60.593  9.232   42.537  1.00 11.79 ? 260  LEU B CB  1 
ATOM   5962  C  CG  . LEU B 1 260 ? 60.851  8.165   41.461  1.00 12.85 ? 260  LEU B CG  1 
ATOM   5963  C  CD1 . LEU B 1 260 ? 59.820  6.986   41.528  1.00 11.74 ? 260  LEU B CD1 1 
ATOM   5964  C  CD2 . LEU B 1 260 ? 60.854  8.809   40.078  1.00 10.81 ? 260  LEU B CD2 1 
ATOM   5965  N  N   . PHE B 1 261 ? 62.414  7.045   44.394  1.00 12.11 ? 261  PHE B N   1 
ATOM   5966  C  CA  . PHE B 1 261 ? 63.714  6.418   44.468  1.00 12.05 ? 261  PHE B CA  1 
ATOM   5967  C  C   . PHE B 1 261 ? 63.818  5.337   43.397  1.00 11.93 ? 261  PHE B C   1 
ATOM   5968  O  O   . PHE B 1 261 ? 62.802  4.797   42.923  1.00 11.40 ? 261  PHE B O   1 
ATOM   5969  C  CB  . PHE B 1 261 ? 63.934  5.785   45.847  1.00 12.29 ? 261  PHE B CB  1 
ATOM   5970  C  CG  . PHE B 1 261 ? 64.119  6.779   46.971  1.00 13.27 ? 261  PHE B CG  1 
ATOM   5971  C  CD1 . PHE B 1 261 ? 65.408  7.106   47.426  1.00 13.78 ? 261  PHE B CD1 1 
ATOM   5972  C  CD2 . PHE B 1 261 ? 63.013  7.354   47.610  1.00 11.98 ? 261  PHE B CD2 1 
ATOM   5973  C  CE1 . PHE B 1 261 ? 65.604  8.000   48.489  1.00 12.74 ? 261  PHE B CE1 1 
ATOM   5974  C  CE2 . PHE B 1 261 ? 63.189  8.261   48.669  1.00 13.21 ? 261  PHE B CE2 1 
ATOM   5975  C  CZ  . PHE B 1 261 ? 64.501  8.589   49.108  1.00 13.24 ? 261  PHE B CZ  1 
ATOM   5976  N  N   . VAL B 1 262 ? 65.064  5.015   43.039  1.00 11.82 ? 262  VAL B N   1 
ATOM   5977  C  CA  . VAL B 1 262 ? 65.370  3.989   42.076  1.00 10.66 ? 262  VAL B CA  1 
ATOM   5978  C  C   . VAL B 1 262 ? 66.428  3.068   42.644  1.00 10.50 ? 262  VAL B C   1 
ATOM   5979  O  O   . VAL B 1 262 ? 67.335  3.507   43.348  1.00 10.74 ? 262  VAL B O   1 
ATOM   5980  C  CB  . VAL B 1 262 ? 65.851  4.603   40.742  1.00 10.89 ? 262  VAL B CB  1 
ATOM   5981  C  CG1 . VAL B 1 262 ? 67.269  5.242   40.874  1.00 10.68 ? 262  VAL B CG1 1 
ATOM   5982  C  CG2 . VAL B 1 262 ? 65.832  3.558   39.621  1.00 10.60 ? 262  VAL B CG2 1 
ATOM   5983  N  N   . GLN B 1 263 ? 66.289  1.787   42.324  1.00 10.83 ? 263  GLN B N   1 
ATOM   5984  C  CA  . GLN B 1 263 ? 67.244  0.728   42.654  1.00 10.55 ? 263  GLN B CA  1 
ATOM   5985  C  C   . GLN B 1 263 ? 67.811  0.224   41.332  1.00 10.83 ? 263  GLN B C   1 
ATOM   5986  O  O   . GLN B 1 263 ? 67.068  0.084   40.351  1.00 10.42 ? 263  GLN B O   1 
ATOM   5987  C  CB  . GLN B 1 263 ? 66.539  -0.419  43.355  1.00 10.30 ? 263  GLN B CB  1 
ATOM   5988  C  CG  . GLN B 1 263 ? 66.138  -0.144  44.801  1.00 10.21 ? 263  GLN B CG  1 
ATOM   5989  C  CD  . GLN B 1 263 ? 65.302  -1.279  45.348  1.00 11.12 ? 263  GLN B CD  1 
ATOM   5990  O  OE1 . GLN B 1 263 ? 64.176  -1.487  44.913  1.00 12.32 ? 263  GLN B OE1 1 
ATOM   5991  N  NE2 . GLN B 1 263 ? 65.856  -2.039  46.268  1.00 10.63 ? 263  GLN B NE2 1 
ATOM   5992  N  N   . VAL B 1 264 ? 69.121  -0.023  41.313  1.00 10.88 ? 264  VAL B N   1 
ATOM   5993  C  CA  . VAL B 1 264 ? 69.850  -0.369  40.093  1.00 11.13 ? 264  VAL B CA  1 
ATOM   5994  C  C   . VAL B 1 264 ? 70.624  -1.683  40.236  1.00 10.91 ? 264  VAL B C   1 
ATOM   5995  O  O   . VAL B 1 264 ? 71.405  -1.874  41.169  1.00 10.47 ? 264  VAL B O   1 
ATOM   5996  C  CB  . VAL B 1 264 ? 70.818  0.751   39.694  1.00 11.51 ? 264  VAL B CB  1 
ATOM   5997  C  CG1 . VAL B 1 264 ? 71.562  0.413   38.399  1.00 10.50 ? 264  VAL B CG1 1 
ATOM   5998  C  CG2 . VAL B 1 264 ? 70.066  2.063   39.561  1.00 12.24 ? 264  VAL B CG2 1 
ATOM   5999  N  N   . LEU B 1 265 ? 70.380  -2.579  39.295  1.00 10.62 ? 265  LEU B N   1 
ATOM   6000  C  CA  . LEU B 1 265 ? 71.006  -3.881  39.266  1.00 11.30 ? 265  LEU B CA  1 
ATOM   6001  C  C   . LEU B 1 265 ? 71.601  -4.093  37.888  1.00 11.64 ? 265  LEU B C   1 
ATOM   6002  O  O   . LEU B 1 265 ? 70.888  -4.001  36.874  1.00 11.27 ? 265  LEU B O   1 
ATOM   6003  C  CB  . LEU B 1 265 ? 69.960  -4.966  39.533  1.00 11.28 ? 265  LEU B CB  1 
ATOM   6004  C  CG  . LEU B 1 265 ? 70.370  -6.437  39.401  1.00 12.20 ? 265  LEU B CG  1 
ATOM   6005  C  CD1 . LEU B 1 265 ? 71.372  -6.825  40.504  1.00 11.22 ? 265  LEU B CD1 1 
ATOM   6006  C  CD2 . LEU B 1 265 ? 69.125  -7.338  39.432  1.00 11.56 ? 265  LEU B CD2 1 
ATOM   6007  N  N   . ASP B 1 266 ? 72.901  -4.369  37.846  1.00 11.69 ? 266  ASP B N   1 
ATOM   6008  C  CA  . ASP B 1 266 ? 73.580  -4.542  36.572  1.00 12.41 ? 266  ASP B CA  1 
ATOM   6009  C  C   . ASP B 1 266 ? 73.112  -5.871  35.982  1.00 12.83 ? 266  ASP B C   1 
ATOM   6010  O  O   . ASP B 1 266 ? 73.009  -6.874  36.711  1.00 13.28 ? 266  ASP B O   1 
ATOM   6011  C  CB  . ASP B 1 266 ? 75.081  -4.544  36.781  1.00 12.17 ? 266  ASP B CB  1 
ATOM   6012  C  CG  . ASP B 1 266 ? 75.843  -4.483  35.496  1.00 14.90 ? 266  ASP B CG  1 
ATOM   6013  O  OD1 . ASP B 1 266 ? 76.421  -3.409  35.202  1.00 19.64 ? 266  ASP B OD1 1 
ATOM   6014  O  OD2 . ASP B 1 266 ? 75.874  -5.491  34.750  1.00 17.25 ? 266  ASP B OD2 1 
ATOM   6015  N  N   . PRO B 1 267 ? 72.807  -5.897  34.677  1.00 13.03 ? 267  PRO B N   1 
ATOM   6016  C  CA  . PRO B 1 267 ? 72.388  -7.178  34.067  1.00 13.82 ? 267  PRO B CA  1 
ATOM   6017  C  C   . PRO B 1 267 ? 73.381  -8.349  34.286  1.00 14.35 ? 267  PRO B C   1 
ATOM   6018  O  O   . PRO B 1 267 ? 72.957  -9.534  34.316  1.00 14.16 ? 267  PRO B O   1 
ATOM   6019  C  CB  . PRO B 1 267 ? 72.269  -6.833  32.580  1.00 13.96 ? 267  PRO B CB  1 
ATOM   6020  C  CG  . PRO B 1 267 ? 71.868  -5.315  32.617  1.00 14.38 ? 267  PRO B CG  1 
ATOM   6021  C  CD  . PRO B 1 267 ? 72.800  -4.790  33.705  1.00 12.68 ? 267  PRO B CD  1 
ATOM   6022  N  N   . ALA B 1 268 ? 74.665  -8.029  34.501  1.00 14.00 ? 268  ALA B N   1 
ATOM   6023  C  CA  . ALA B 1 268 ? 75.651  -9.085  34.758  1.00 13.94 ? 268  ALA B CA  1 
ATOM   6024  C  C   . ALA B 1 268 ? 75.570  -9.723  36.143  1.00 14.35 ? 268  ALA B C   1 
ATOM   6025  O  O   . ALA B 1 268 ? 76.244  -10.729 36.382  1.00 14.73 ? 268  ALA B O   1 
ATOM   6026  C  CB  . ALA B 1 268 ? 77.044  -8.622  34.454  1.00 13.55 ? 268  ALA B CB  1 
ATOM   6027  N  N   . ASP B 1 269 ? 74.727  -9.189  37.034  1.00 14.80 ? 269  ASP B N   1 
ATOM   6028  C  CA  . ASP B 1 269 ? 74.586  -9.736  38.392  1.00 15.35 ? 269  ASP B CA  1 
ATOM   6029  C  C   . ASP B 1 269 ? 73.320  -10.541 38.668  1.00 15.80 ? 269  ASP B C   1 
ATOM   6030  O  O   . ASP B 1 269 ? 73.122  -10.997 39.808  1.00 16.46 ? 269  ASP B O   1 
ATOM   6031  C  CB  . ASP B 1 269 ? 74.684  -8.634  39.450  1.00 15.56 ? 269  ASP B CB  1 
ATOM   6032  C  CG  . ASP B 1 269 ? 76.039  -7.959  39.480  1.00 17.68 ? 269  ASP B CG  1 
ATOM   6033  O  OD1 . ASP B 1 269 ? 76.116  -6.823  39.977  1.00 17.72 ? 269  ASP B OD1 1 
ATOM   6034  O  OD2 . ASP B 1 269 ? 77.033  -8.542  39.000  1.00 21.72 ? 269  ASP B OD2 1 
ATOM   6035  N  N   . VAL B 1 270 ? 72.471  -10.733 37.662  1.00 16.20 ? 270  VAL B N   1 
ATOM   6036  C  CA  . VAL B 1 270 ? 71.137  -11.364 37.870  1.00 16.60 ? 270  VAL B CA  1 
ATOM   6037  C  C   . VAL B 1 270 ? 71.146  -12.820 38.410  1.00 17.54 ? 270  VAL B C   1 
ATOM   6038  O  O   . VAL B 1 270 ? 70.166  -13.281 39.017  1.00 17.40 ? 270  VAL B O   1 
ATOM   6039  C  CB  . VAL B 1 270 ? 70.239  -11.289 36.599  1.00 16.03 ? 270  VAL B CB  1 
ATOM   6040  C  CG1 . VAL B 1 270 ? 70.056  -9.846  36.161  1.00 15.79 ? 270  VAL B CG1 1 
ATOM   6041  C  CG2 . VAL B 1 270 ? 70.805  -12.145 35.475  1.00 15.67 ? 270  VAL B CG2 1 
ATOM   6042  N  N   . GLU B 1 271 ? 72.249  -13.533 38.189  1.00 18.13 ? 271  GLU B N   1 
ATOM   6043  C  CA  . GLU B 1 271 ? 72.364  -14.927 38.616  1.00 19.38 ? 271  GLU B CA  1 
ATOM   6044  C  C   . GLU B 1 271 ? 72.833  -15.030 40.066  1.00 18.59 ? 271  GLU B C   1 
ATOM   6045  O  O   . GLU B 1 271 ? 72.905  -16.126 40.623  1.00 18.95 ? 271  GLU B O   1 
ATOM   6046  C  CB  . GLU B 1 271 ? 73.328  -15.697 37.686  1.00 19.19 ? 271  GLU B CB  1 
ATOM   6047  C  CG  . GLU B 1 271 ? 72.735  -16.028 36.342  1.00 20.10 ? 271  GLU B CG  1 
ATOM   6048  C  CD  . GLU B 1 271 ? 73.759  -16.571 35.346  1.00 23.35 ? 271  GLU B CD  1 
ATOM   6049  O  OE1 . GLU B 1 271 ? 74.859  -15.960 35.176  1.00 25.70 ? 271  GLU B OE1 1 
ATOM   6050  O  OE2 . GLU B 1 271 ? 73.440  -17.608 34.706  1.00 28.00 ? 271  GLU B OE2 1 
ATOM   6051  N  N   . ASN B 1 272 ? 73.125  -13.877 40.665  1.00 18.33 ? 272  ASN B N   1 
ATOM   6052  C  CA  . ASN B 1 272 ? 73.793  -13.769 41.959  1.00 17.78 ? 272  ASN B CA  1 
ATOM   6053  C  C   . ASN B 1 272 ? 72.902  -13.923 43.196  1.00 17.61 ? 272  ASN B C   1 
ATOM   6054  O  O   . ASN B 1 272 ? 73.381  -13.815 44.326  1.00 17.81 ? 272  ASN B O   1 
ATOM   6055  C  CB  . ASN B 1 272 ? 74.516  -12.424 42.032  1.00 17.50 ? 272  ASN B CB  1 
ATOM   6056  C  CG  . ASN B 1 272 ? 75.756  -12.369 41.156  1.00 19.11 ? 272  ASN B CG  1 
ATOM   6057  O  OD1 . ASN B 1 272 ? 76.156  -13.360 40.509  1.00 19.36 ? 272  ASN B OD1 1 
ATOM   6058  N  ND2 . ASN B 1 272 ? 76.397  -11.201 41.147  1.00 19.58 ? 272  ASN B ND2 1 
ATOM   6059  N  N   . PHE B 1 273 ? 71.616  -14.181 42.998  1.00 17.07 ? 273  PHE B N   1 
ATOM   6060  C  CA  . PHE B 1 273 ? 70.674  -14.199 44.116  1.00 16.20 ? 273  PHE B CA  1 
ATOM   6061  C  C   . PHE B 1 273 ? 70.049  -15.583 44.272  1.00 16.31 ? 273  PHE B C   1 
ATOM   6062  O  O   . PHE B 1 273 ? 70.210  -16.437 43.401  1.00 15.81 ? 273  PHE B O   1 
ATOM   6063  C  CB  . PHE B 1 273 ? 69.594  -13.123 43.913  1.00 16.12 ? 273  PHE B CB  1 
ATOM   6064  C  CG  . PHE B 1 273 ? 70.146  -11.728 43.688  1.00 15.23 ? 273  PHE B CG  1 
ATOM   6065  C  CD1 . PHE B 1 273 ? 70.426  -11.273 42.412  1.00 14.10 ? 273  PHE B CD1 1 
ATOM   6066  C  CD2 . PHE B 1 273 ? 70.380  -10.876 44.762  1.00 16.73 ? 273  PHE B CD2 1 
ATOM   6067  C  CE1 . PHE B 1 273 ? 70.935  -9.985  42.197  1.00 15.59 ? 273  PHE B CE1 1 
ATOM   6068  C  CE2 . PHE B 1 273 ? 70.891  -9.570  44.561  1.00 16.90 ? 273  PHE B CE2 1 
ATOM   6069  C  CZ  . PHE B 1 273 ? 71.165  -9.132  43.271  1.00 15.75 ? 273  PHE B CZ  1 
ATOM   6070  N  N   . ASP B 1 274 ? 69.342  -15.813 45.384  1.00 16.72 ? 274  ASP B N   1 
ATOM   6071  C  CA  . ASP B 1 274 ? 68.626  -17.072 45.557  1.00 17.16 ? 274  ASP B CA  1 
ATOM   6072  C  C   . ASP B 1 274 ? 67.235  -16.990 44.907  1.00 17.00 ? 274  ASP B C   1 
ATOM   6073  O  O   . ASP B 1 274 ? 66.412  -17.887 45.061  1.00 17.70 ? 274  ASP B O   1 
ATOM   6074  C  CB  . ASP B 1 274 ? 68.570  -17.502 47.030  1.00 17.13 ? 274  ASP B CB  1 
ATOM   6075  C  CG  . ASP B 1 274 ? 67.819  -16.515 47.902  1.00 19.24 ? 274  ASP B CG  1 
ATOM   6076  O  OD1 . ASP B 1 274 ? 67.243  -15.540 47.363  1.00 19.27 ? 274  ASP B OD1 1 
ATOM   6077  O  OD2 . ASP B 1 274 ? 67.801  -16.712 49.142  1.00 21.31 ? 274  ASP B OD2 1 
ATOM   6078  N  N   . PHE B 1 275 ? 67.003  -15.909 44.167  1.00 16.73 ? 275  PHE B N   1 
ATOM   6079  C  CA  . PHE B 1 275 ? 65.772  -15.694 43.425  1.00 16.54 ? 275  PHE B CA  1 
ATOM   6080  C  C   . PHE B 1 275 ? 66.086  -15.120 42.028  1.00 16.43 ? 275  PHE B C   1 
ATOM   6081  O  O   . PHE B 1 275 ? 67.143  -14.520 41.846  1.00 16.72 ? 275  PHE B O   1 
ATOM   6082  C  CB  . PHE B 1 275 ? 64.855  -14.749 44.209  1.00 16.54 ? 275  PHE B CB  1 
ATOM   6083  C  CG  . PHE B 1 275 ? 65.391  -13.352 44.353  1.00 16.92 ? 275  PHE B CG  1 
ATOM   6084  C  CD1 . PHE B 1 275 ? 66.191  -13.004 45.449  1.00 18.13 ? 275  PHE B CD1 1 
ATOM   6085  C  CD2 . PHE B 1 275 ? 65.088  -12.385 43.415  1.00 15.52 ? 275  PHE B CD2 1 
ATOM   6086  C  CE1 . PHE B 1 275 ? 66.694  -11.710 45.594  1.00 16.92 ? 275  PHE B CE1 1 
ATOM   6087  C  CE2 . PHE B 1 275 ? 65.591  -11.095 43.547  1.00 16.62 ? 275  PHE B CE2 1 
ATOM   6088  C  CZ  . PHE B 1 275 ? 66.393  -10.754 44.641  1.00 15.93 ? 275  PHE B CZ  1 
ATOM   6089  N  N   . ASP B 1 276 ? 65.180  -15.320 41.064  1.00 15.50 ? 276  ASP B N   1 
ATOM   6090  C  CA  . ASP B 1 276 ? 65.215  -14.630 39.779  1.00 15.00 ? 276  ASP B CA  1 
ATOM   6091  C  C   . ASP B 1 276 ? 64.743  -13.170 39.913  1.00 14.96 ? 276  ASP B C   1 
ATOM   6092  O  O   . ASP B 1 276 ? 63.575  -12.904 40.200  1.00 14.54 ? 276  ASP B O   1 
ATOM   6093  C  CB  . ASP B 1 276 ? 64.359  -15.369 38.737  1.00 15.22 ? 276  ASP B CB  1 
ATOM   6094  C  CG  . ASP B 1 276 ? 64.654  -14.925 37.292  1.00 15.04 ? 276  ASP B CG  1 
ATOM   6095  O  OD1 . ASP B 1 276 ? 64.574  -15.772 36.390  1.00 16.52 ? 276  ASP B OD1 1 
ATOM   6096  O  OD2 . ASP B 1 276 ? 64.966  -13.740 37.040  1.00 12.72 ? 276  ASP B OD2 1 
ATOM   6097  N  N   . PRO B 1 277 ? 65.659  -12.211 39.702  1.00 14.80 ? 277  PRO B N   1 
ATOM   6098  C  CA  . PRO B 1 277 ? 65.320  -10.801 39.948  1.00 15.07 ? 277  PRO B CA  1 
ATOM   6099  C  C   . PRO B 1 277 ? 64.157  -10.238 39.113  1.00 14.81 ? 277  PRO B C   1 
ATOM   6100  O  O   . PRO B 1 277 ? 63.635  -9.179  39.447  1.00 14.47 ? 277  PRO B O   1 
ATOM   6101  C  CB  . PRO B 1 277 ? 66.620  -10.051 39.657  1.00 15.58 ? 277  PRO B CB  1 
ATOM   6102  C  CG  . PRO B 1 277 ? 67.585  -11.062 39.129  1.00 15.45 ? 277  PRO B CG  1 
ATOM   6103  C  CD  . PRO B 1 277 ? 67.053  -12.417 39.287  1.00 14.37 ? 277  PRO B CD  1 
ATOM   6104  N  N   . LEU B 1 278 ? 63.779  -10.977 38.064  1.00 14.66 ? 278  LEU B N   1 
ATOM   6105  C  CA  . LEU B 1 278 ? 62.707  -10.676 37.111  1.00 14.05 ? 278  LEU B CA  1 
ATOM   6106  C  C   . LEU B 1 278 ? 61.367  -11.375 37.447  1.00 13.40 ? 278  LEU B C   1 
ATOM   6107  O  O   . LEU B 1 278 ? 60.380  -11.249 36.695  1.00 13.69 ? 278  LEU B O   1 
ATOM   6108  C  CB  . LEU B 1 278 ? 63.140  -11.155 35.728  1.00 13.71 ? 278  LEU B CB  1 
ATOM   6109  C  CG  . LEU B 1 278 ? 63.723  -10.231 34.668  1.00 15.08 ? 278  LEU B CG  1 
ATOM   6110  C  CD1 . LEU B 1 278 ? 64.894  -9.404  35.184  1.00 16.23 ? 278  LEU B CD1 1 
ATOM   6111  C  CD2 . LEU B 1 278 ? 64.136  -11.104 33.477  1.00 15.43 ? 278  LEU B CD2 1 
ATOM   6112  N  N   . ASP B 1 279 ? 61.370  -12.152 38.528  1.00 11.87 ? 279  ASP B N   1 
ATOM   6113  C  CA  . ASP B 1 279 ? 60.188  -12.787 39.092  1.00 10.48 ? 279  ASP B CA  1 
ATOM   6114  C  C   . ASP B 1 279 ? 59.444  -11.717 39.911  1.00 10.13 ? 279  ASP B C   1 
ATOM   6115  O  O   . ASP B 1 279 ? 59.968  -11.222 40.918  1.00 9.13  ? 279  ASP B O   1 
ATOM   6116  C  CB  . ASP B 1 279 ? 60.660  -13.968 39.987  1.00 10.39 ? 279  ASP B CB  1 
ATOM   6117  C  CG  . ASP B 1 279 ? 59.517  -14.696 40.711  1.00 9.14  ? 279  ASP B CG  1 
ATOM   6118  O  OD1 . ASP B 1 279 ? 58.332  -14.297 40.589  1.00 7.29  ? 279  ASP B OD1 1 
ATOM   6119  O  OD2 . ASP B 1 279 ? 59.821  -15.683 41.418  1.00 6.77  ? 279  ASP B OD2 1 
ATOM   6120  N  N   . ALA B 1 280 ? 58.225  -11.376 39.476  1.00 9.89  ? 280  ALA B N   1 
ATOM   6121  C  CA  . ALA B 1 280 ? 57.382  -10.353 40.122  1.00 9.25  ? 280  ALA B CA  1 
ATOM   6122  C  C   . ALA B 1 280 ? 56.863  -10.751 41.522  1.00 8.85  ? 280  ALA B C   1 
ATOM   6123  O  O   . ALA B 1 280 ? 56.226  -9.948  42.224  1.00 7.33  ? 280  ALA B O   1 
ATOM   6124  C  CB  . ALA B 1 280 ? 56.213  -10.005 39.210  1.00 9.43  ? 280  ALA B CB  1 
ATOM   6125  N  N   . THR B 1 281 ? 57.112  -12.001 41.908  1.00 8.81  ? 281  THR B N   1 
ATOM   6126  C  CA  . THR B 1 281 ? 56.827  -12.436 43.287  1.00 9.28  ? 281  THR B CA  1 
ATOM   6127  C  C   . THR B 1 281 ? 58.005  -12.120 44.201  1.00 9.50  ? 281  THR B C   1 
ATOM   6128  O  O   . THR B 1 281 ? 57.947  -12.369 45.408  1.00 10.73 ? 281  THR B O   1 
ATOM   6129  C  CB  . THR B 1 281 ? 56.451  -13.952 43.383  1.00 9.19  ? 281  THR B CB  1 
ATOM   6130  O  OG1 . THR B 1 281 ? 57.541  -14.751 42.937  1.00 7.23  ? 281  THR B OG1 1 
ATOM   6131  C  CG2 . THR B 1 281 ? 55.233  -14.281 42.503  1.00 8.66  ? 281  THR B CG2 1 
ATOM   6132  N  N   . LYS B 1 282 ? 59.065  -11.552 43.627  1.00 9.17  ? 282  LYS B N   1 
ATOM   6133  C  CA  . LYS B 1 282 ? 60.289  -11.219 44.377  1.00 8.89  ? 282  LYS B CA  1 
ATOM   6134  C  C   . LYS B 1 282 ? 60.521  -9.710  44.630  1.00 8.52  ? 282  LYS B C   1 
ATOM   6135  O  O   . LYS B 1 282 ? 60.360  -8.891  43.738  1.00 6.83  ? 282  LYS B O   1 
ATOM   6136  C  CB  . LYS B 1 282 ? 61.519  -11.860 43.708  1.00 8.16  ? 282  LYS B CB  1 
ATOM   6137  C  CG  . LYS B 1 282 ? 61.430  -13.387 43.626  1.00 8.02  ? 282  LYS B CG  1 
ATOM   6138  C  CD  . LYS B 1 282 ? 61.457  -14.081 45.018  1.00 6.69  ? 282  LYS B CD  1 
ATOM   6139  C  CE  . LYS B 1 282 ? 61.295  -15.611 44.874  1.00 8.63  ? 282  LYS B CE  1 
ATOM   6140  N  NZ  . LYS B 1 282 ? 60.036  -16.062 44.141  1.00 7.46  ? 282  LYS B NZ  1 
ATOM   6141  N  N   . ASP B 1 283 ? 60.878  -9.389  45.877  1.00 8.80  ? 283  ASP B N   1 
ATOM   6142  C  CA  . ASP B 1 283 ? 61.261  -8.046  46.292  1.00 9.84  ? 283  ASP B CA  1 
ATOM   6143  C  C   . ASP B 1 283 ? 62.775  -7.920  46.179  1.00 10.53 ? 283  ASP B C   1 
ATOM   6144  O  O   . ASP B 1 283 ? 63.498  -8.942  46.151  1.00 10.30 ? 283  ASP B O   1 
ATOM   6145  C  CB  . ASP B 1 283 ? 60.851  -7.765  47.737  1.00 9.61  ? 283  ASP B CB  1 
ATOM   6146  C  CG  . ASP B 1 283 ? 60.759  -6.267  48.051  1.00 10.76 ? 283  ASP B CG  1 
ATOM   6147  O  OD1 . ASP B 1 283 ? 61.015  -5.411  47.157  1.00 11.77 ? 283  ASP B OD1 1 
ATOM   6148  O  OD2 . ASP B 1 283 ? 60.404  -5.935  49.200  1.00 11.30 ? 283  ASP B OD2 1 
ATOM   6149  N  N   . TRP B 1 284 ? 63.223  -6.672  46.052  1.00 10.25 ? 284  TRP B N   1 
ATOM   6150  C  CA  . TRP B 1 284 ? 64.630  -6.323  46.089  1.00 10.92 ? 284  TRP B CA  1 
ATOM   6151  C  C   . TRP B 1 284 ? 64.786  -5.522  47.358  1.00 11.53 ? 284  TRP B C   1 
ATOM   6152  O  O   . TRP B 1 284 ? 64.466  -4.336  47.389  1.00 11.57 ? 284  TRP B O   1 
ATOM   6153  C  CB  . TRP B 1 284 ? 64.994  -5.404  44.935  1.00 10.47 ? 284  TRP B CB  1 
ATOM   6154  C  CG  . TRP B 1 284 ? 65.004  -5.976  43.575  1.00 10.10 ? 284  TRP B CG  1 
ATOM   6155  C  CD1 . TRP B 1 284 ? 64.574  -7.223  43.171  1.00 9.54  ? 284  TRP B CD1 1 
ATOM   6156  C  CD2 . TRP B 1 284 ? 65.448  -5.304  42.401  1.00 9.88  ? 284  TRP B CD2 1 
ATOM   6157  N  NE1 . TRP B 1 284 ? 64.722  -7.354  41.803  1.00 7.96  ? 284  TRP B NE1 1 
ATOM   6158  C  CE2 . TRP B 1 284 ? 65.269  -6.201  41.306  1.00 9.25  ? 284  TRP B CE2 1 
ATOM   6159  C  CE3 . TRP B 1 284 ? 66.002  -4.033  42.158  1.00 9.63  ? 284  TRP B CE3 1 
ATOM   6160  C  CZ2 . TRP B 1 284 ? 65.609  -5.853  39.992  1.00 8.88  ? 284  TRP B CZ2 1 
ATOM   6161  C  CZ3 . TRP B 1 284 ? 66.335  -3.687  40.852  1.00 9.01  ? 284  TRP B CZ3 1 
ATOM   6162  C  CH2 . TRP B 1 284 ? 66.141  -4.600  39.785  1.00 9.66  ? 284  TRP B CH2 1 
ATOM   6163  N  N   . PHE B 1 285 ? 65.262  -6.164  48.410  1.00 12.37 ? 285  PHE B N   1 
ATOM   6164  C  CA  . PHE B 1 285 ? 65.311  -5.518  49.714  1.00 13.12 ? 285  PHE B CA  1 
ATOM   6165  C  C   . PHE B 1 285 ? 66.219  -4.306  49.670  1.00 13.56 ? 285  PHE B C   1 
ATOM   6166  O  O   . PHE B 1 285 ? 67.225  -4.322  48.959  1.00 12.73 ? 285  PHE B O   1 
ATOM   6167  C  CB  . PHE B 1 285 ? 65.756  -6.509  50.775  1.00 13.01 ? 285  PHE B CB  1 
ATOM   6168  C  CG  . PHE B 1 285 ? 64.829  -7.685  50.935  1.00 13.61 ? 285  PHE B CG  1 
ATOM   6169  C  CD1 . PHE B 1 285 ? 65.317  -8.986  50.868  1.00 14.52 ? 285  PHE B CD1 1 
ATOM   6170  C  CD2 . PHE B 1 285 ? 63.472  -7.495  51.181  1.00 14.15 ? 285  PHE B CD2 1 
ATOM   6171  C  CE1 . PHE B 1 285 ? 64.468  -10.093 51.053  1.00 13.23 ? 285  PHE B CE1 1 
ATOM   6172  C  CE2 . PHE B 1 285 ? 62.618  -8.591  51.353  1.00 14.71 ? 285  PHE B CE2 1 
ATOM   6173  C  CZ  . PHE B 1 285 ? 63.126  -9.893  51.289  1.00 13.73 ? 285  PHE B CZ  1 
ATOM   6174  N  N   . GLU B 1 286 ? 65.834  -3.242  50.387  1.00 14.35 ? 286  GLU B N   1 
ATOM   6175  C  CA  . GLU B 1 286 ? 66.626  -2.004  50.396  1.00 15.29 ? 286  GLU B CA  1 
ATOM   6176  C  C   . GLU B 1 286 ? 68.054  -2.243  50.867  1.00 15.27 ? 286  GLU B C   1 
ATOM   6177  O  O   . GLU B 1 286 ? 68.983  -1.590  50.377  1.00 16.03 ? 286  GLU B O   1 
ATOM   6178  C  CB  . GLU B 1 286 ? 65.979  -0.916  51.243  1.00 15.60 ? 286  GLU B CB  1 
ATOM   6179  C  CG  . GLU B 1 286 ? 66.853  0.341   51.324  1.00 17.27 ? 286  GLU B CG  1 
ATOM   6180  C  CD  . GLU B 1 286 ? 66.119  1.562   51.829  1.00 19.29 ? 286  GLU B CD  1 
ATOM   6181  O  OE1 . GLU B 1 286 ? 65.024  1.436   52.399  1.00 20.79 ? 286  GLU B OE1 1 
ATOM   6182  O  OE2 . GLU B 1 286 ? 66.651  2.666   51.659  1.00 23.20 ? 286  GLU B OE2 1 
ATOM   6183  N  N   . ASP B 1 287 ? 68.219  -3.188  51.789  1.00 15.18 ? 287  ASP B N   1 
ATOM   6184  C  CA  . ASP B 1 287 ? 69.536  -3.555  52.305  1.00 16.38 ? 287  ASP B CA  1 
ATOM   6185  C  C   . ASP B 1 287 ? 70.352  -4.416  51.342  1.00 16.07 ? 287  ASP B C   1 
ATOM   6186  O  O   . ASP B 1 287 ? 71.564  -4.552  51.537  1.00 16.53 ? 287  ASP B O   1 
ATOM   6187  C  CB  . ASP B 1 287 ? 69.440  -4.265  53.666  1.00 16.97 ? 287  ASP B CB  1 
ATOM   6188  C  CG  . ASP B 1 287 ? 68.603  -5.516  53.595  1.00 19.25 ? 287  ASP B CG  1 
ATOM   6189  O  OD1 . ASP B 1 287 ? 67.364  -5.386  53.582  1.00 21.93 ? 287  ASP B OD1 1 
ATOM   6190  O  OD2 . ASP B 1 287 ? 69.173  -6.618  53.511  1.00 22.79 ? 287  ASP B OD2 1 
ATOM   6191  N  N   . VAL B 1 288 ? 69.720  -5.009  50.325  1.00 15.59 ? 288  VAL B N   1 
ATOM   6192  C  CA  . VAL B 1 288 ? 70.500  -5.688  49.298  1.00 14.98 ? 288  VAL B CA  1 
ATOM   6193  C  C   . VAL B 1 288 ? 70.833  -4.762  48.103  1.00 14.84 ? 288  VAL B C   1 
ATOM   6194  O  O   . VAL B 1 288 ? 71.982  -4.720  47.651  1.00 14.81 ? 288  VAL B O   1 
ATOM   6195  C  CB  . VAL B 1 288 ? 69.969  -7.114  48.927  1.00 15.40 ? 288  VAL B CB  1 
ATOM   6196  C  CG1 . VAL B 1 288 ? 69.068  -7.681  50.022  1.00 14.22 ? 288  VAL B CG1 1 
ATOM   6197  C  CG2 . VAL B 1 288 ? 69.286  -7.154  47.564  1.00 16.94 ? 288  VAL B CG2 1 
ATOM   6198  N  N   . ILE B 1 289 ? 69.854  -3.999  47.624  1.00 14.56 ? 289  ILE B N   1 
ATOM   6199  C  CA  . ILE B 1 289 ? 70.090  -3.005  46.575  1.00 14.39 ? 289  ILE B CA  1 
ATOM   6200  C  C   . ILE B 1 289 ? 69.602  -1.636  47.082  1.00 14.87 ? 289  ILE B C   1 
ATOM   6201  O  O   . ILE B 1 289 ? 68.405  -1.451  47.324  1.00 14.24 ? 289  ILE B O   1 
ATOM   6202  C  CB  . ILE B 1 289 ? 69.423  -3.402  45.206  1.00 14.56 ? 289  ILE B CB  1 
ATOM   6203  C  CG1 . ILE B 1 289 ? 70.093  -4.636  44.603  1.00 14.78 ? 289  ILE B CG1 1 
ATOM   6204  C  CG2 . ILE B 1 289 ? 69.512  -2.265  44.187  1.00 13.84 ? 289  ILE B CG2 1 
ATOM   6205  C  CD1 . ILE B 1 289 ? 69.253  -5.325  43.588  1.00 15.26 ? 289  ILE B CD1 1 
ATOM   6206  N  N   . PRO B 1 290 ? 70.539  -0.669  47.242  1.00 15.22 ? 290  PRO B N   1 
ATOM   6207  C  CA  . PRO B 1 290 ? 70.180  0.624   47.863  1.00 15.02 ? 290  PRO B CA  1 
ATOM   6208  C  C   . PRO B 1 290 ? 69.182  1.428   47.021  1.00 15.03 ? 290  PRO B C   1 
ATOM   6209  O  O   . PRO B 1 290 ? 69.172  1.301   45.787  1.00 15.70 ? 290  PRO B O   1 
ATOM   6210  C  CB  . PRO B 1 290 ? 71.526  1.373   47.984  1.00 15.31 ? 290  PRO B CB  1 
ATOM   6211  C  CG  . PRO B 1 290 ? 72.608  0.407   47.576  1.00 15.31 ? 290  PRO B CG  1 
ATOM   6212  C  CD  . PRO B 1 290 ? 71.963  -0.749  46.843  1.00 14.84 ? 290  PRO B CD  1 
ATOM   6213  N  N   . PHE B 1 291 ? 68.342  2.221   47.687  1.00 14.47 ? 291  PHE B N   1 
ATOM   6214  C  CA  . PHE B 1 291 ? 67.435  3.165   47.033  1.00 14.40 ? 291  PHE B CA  1 
ATOM   6215  C  C   . PHE B 1 291 ? 68.239  4.426   46.666  1.00 13.94 ? 291  PHE B C   1 
ATOM   6216  O  O   . PHE B 1 291 ? 68.988  4.929   47.483  1.00 13.62 ? 291  PHE B O   1 
ATOM   6217  C  CB  . PHE B 1 291 ? 66.331  3.607   48.020  1.00 15.08 ? 291  PHE B CB  1 
ATOM   6218  C  CG  . PHE B 1 291 ? 65.241  2.578   48.296  1.00 15.53 ? 291  PHE B CG  1 
ATOM   6219  C  CD1 . PHE B 1 291 ? 65.403  1.215   48.008  1.00 16.37 ? 291  PHE B CD1 1 
ATOM   6220  C  CD2 . PHE B 1 291 ? 64.050  2.992   48.895  1.00 15.30 ? 291  PHE B CD2 1 
ATOM   6221  C  CE1 . PHE B 1 291 ? 64.371  0.287   48.295  1.00 16.32 ? 291  PHE B CE1 1 
ATOM   6222  C  CE2 . PHE B 1 291 ? 63.026  2.084   49.198  1.00 16.09 ? 291  PHE B CE2 1 
ATOM   6223  C  CZ  . PHE B 1 291 ? 63.187  0.723   48.892  1.00 16.01 ? 291  PHE B CZ  1 
ATOM   6224  N  N   . GLN B 1 292 ? 68.084  4.957   45.456  1.00 13.52 ? 292  GLN B N   1 
ATOM   6225  C  CA  . GLN B 1 292 ? 68.745  6.226   45.125  1.00 12.92 ? 292  GLN B CA  1 
ATOM   6226  C  C   . GLN B 1 292 ? 67.746  7.318   44.743  1.00 12.96 ? 292  GLN B C   1 
ATOM   6227  O  O   . GLN B 1 292 ? 66.960  7.167   43.781  1.00 12.55 ? 292  GLN B O   1 
ATOM   6228  C  CB  . GLN B 1 292 ? 69.759  6.047   44.005  1.00 12.65 ? 292  GLN B CB  1 
ATOM   6229  C  CG  . GLN B 1 292 ? 70.767  4.947   44.221  1.00 12.47 ? 292  GLN B CG  1 
ATOM   6230  C  CD  . GLN B 1 292 ? 71.733  4.877   43.076  1.00 12.35 ? 292  GLN B CD  1 
ATOM   6231  O  OE1 . GLN B 1 292 ? 72.387  5.873   42.730  1.00 12.69 ? 292  GLN B OE1 1 
ATOM   6232  N  NE2 . GLN B 1 292 ? 71.806  3.721   42.446  1.00 11.83 ? 292  GLN B NE2 1 
ATOM   6233  N  N   . HIS B 1 293 ? 67.795  8.416   45.491  1.00 13.11 ? 293  HIS B N   1 
ATOM   6234  C  CA  . HIS B 1 293 ? 66.837  9.496   45.340  1.00 13.99 ? 293  HIS B CA  1 
ATOM   6235  C  C   . HIS B 1 293 ? 66.801  10.012  43.926  1.00 13.68 ? 293  HIS B C   1 
ATOM   6236  O  O   . HIS B 1 293 ? 67.847  10.223  43.311  1.00 14.52 ? 293  HIS B O   1 
ATOM   6237  C  CB  . HIS B 1 293 ? 67.132  10.645  46.306  1.00 14.38 ? 293  HIS B CB  1 
ATOM   6238  C  CG  . HIS B 1 293 ? 65.990  11.602  46.465  1.00 16.39 ? 293  HIS B CG  1 
ATOM   6239  N  ND1 . HIS B 1 293 ? 66.089  12.939  46.149  1.00 19.44 ? 293  HIS B ND1 1 
ATOM   6240  C  CD2 . HIS B 1 293 ? 64.716  11.410  46.882  1.00 17.54 ? 293  HIS B CD2 1 
ATOM   6241  C  CE1 . HIS B 1 293 ? 64.933  13.535  46.391  1.00 18.32 ? 293  HIS B CE1 1 
ATOM   6242  N  NE2 . HIS B 1 293 ? 64.085  12.631  46.839  1.00 17.47 ? 293  HIS B NE2 1 
ATOM   6243  N  N   . VAL B 1 294 ? 65.593  10.180  43.400  1.00 13.43 ? 294  VAL B N   1 
ATOM   6244  C  CA  . VAL B 1 294 ? 65.413  10.725  42.055  1.00 13.28 ? 294  VAL B CA  1 
ATOM   6245  C  C   . VAL B 1 294 ? 64.784  12.118  42.113  1.00 13.21 ? 294  VAL B C   1 
ATOM   6246  O  O   . VAL B 1 294 ? 65.313  13.062  41.555  1.00 13.79 ? 294  VAL B O   1 
ATOM   6247  C  CB  . VAL B 1 294 ? 64.587  9.783   41.150  1.00 12.89 ? 294  VAL B CB  1 
ATOM   6248  C  CG1 . VAL B 1 294 ? 64.318  10.441  39.778  1.00 12.52 ? 294  VAL B CG1 1 
ATOM   6249  C  CG2 . VAL B 1 294 ? 65.295  8.442   40.996  1.00 12.45 ? 294  VAL B CG2 1 
ATOM   6250  N  N   . GLY B 1 295 ? 63.653  12.236  42.791  1.00 13.26 ? 295  GLY B N   1 
ATOM   6251  C  CA  . GLY B 1 295 ? 62.971  13.521  42.913  1.00 13.08 ? 295  GLY B CA  1 
ATOM   6252  C  C   . GLY B 1 295 ? 61.755  13.401  43.798  1.00 12.69 ? 295  GLY B C   1 
ATOM   6253  O  O   . GLY B 1 295 ? 61.617  12.428  44.551  1.00 12.14 ? 295  GLY B O   1 
ATOM   6254  N  N   . THR B 1 296 ? 60.889  14.409  43.718  1.00 12.73 ? 296  THR B N   1 
ATOM   6255  C  CA  . THR B 1 296 ? 59.646  14.404  44.477  1.00 12.60 ? 296  THR B CA  1 
ATOM   6256  C  C   . THR B 1 296 ? 58.401  14.761  43.639  1.00 12.27 ? 296  THR B C   1 
ATOM   6257  O  O   . THR B 1 296 ? 58.438  15.605  42.730  1.00 12.19 ? 296  THR B O   1 
ATOM   6258  C  CB  . THR B 1 296 ? 59.738  15.248  45.824  1.00 12.99 ? 296  THR B CB  1 
ATOM   6259  O  OG1 . THR B 1 296 ? 59.048  16.492  45.690  1.00 15.04 ? 296  THR B OG1 1 
ATOM   6260  C  CG2 . THR B 1 296 ? 61.161  15.513  46.235  1.00 11.21 ? 296  THR B CG2 1 
ATOM   6261  N  N   . MET B 1 297 ? 57.302  14.081  43.937  1.00 11.39 ? 297  MET B N   1 
ATOM   6262  C  CA  . MET B 1 297 ? 56.027  14.407  43.338  1.00 10.56 ? 297  MET B CA  1 
ATOM   6263  C  C   . MET B 1 297 ? 55.188  15.166  44.353  1.00 10.63 ? 297  MET B C   1 
ATOM   6264  O  O   . MET B 1 297 ? 55.089  14.760  45.514  1.00 10.64 ? 297  MET B O   1 
ATOM   6265  C  CB  . MET B 1 297 ? 55.295  13.132  42.888  1.00 10.25 ? 297  MET B CB  1 
ATOM   6266  C  CG  . MET B 1 297 ? 53.845  13.365  42.409  1.00 9.85  ? 297  MET B CG  1 
ATOM   6267  S  SD  . MET B 1 297 ? 53.016  11.952  41.613  1.00 10.91 ? 297  MET B SD  1 
ATOM   6268  C  CE  . MET B 1 297 ? 52.864  10.756  42.944  1.00 5.87  ? 297  MET B CE  1 
ATOM   6269  N  N   . THR B 1 298 ? 54.569  16.256  43.906  1.00 10.46 ? 298  THR B N   1 
ATOM   6270  C  CA  . THR B 1 298 ? 53.612  17.002  44.723  1.00 10.09 ? 298  THR B CA  1 
ATOM   6271  C  C   . THR B 1 298 ? 52.268  17.020  43.996  1.00 9.93  ? 298  THR B C   1 
ATOM   6272  O  O   . THR B 1 298 ? 52.216  17.370  42.811  1.00 9.63  ? 298  THR B O   1 
ATOM   6273  C  CB  . THR B 1 298 ? 54.108  18.454  44.969  1.00 10.38 ? 298  THR B CB  1 
ATOM   6274  O  OG1 . THR B 1 298 ? 55.378  18.413  45.653  1.00 12.26 ? 298  THR B OG1 1 
ATOM   6275  C  CG2 . THR B 1 298 ? 53.090  19.261  45.787  1.00 7.66  ? 298  THR B CG2 1 
ATOM   6276  N  N   . LEU B 1 299 ? 51.203  16.619  44.688  1.00 9.12  ? 299  LEU B N   1 
ATOM   6277  C  CA  . LEU B 1 299 ? 49.860  16.693  44.134  1.00 9.03  ? 299  LEU B CA  1 
ATOM   6278  C  C   . LEU B 1 299 ? 49.134  17.920  44.724  1.00 9.90  ? 299  LEU B C   1 
ATOM   6279  O  O   . LEU B 1 299 ? 48.780  17.946  45.912  1.00 8.89  ? 299  LEU B O   1 
ATOM   6280  C  CB  . LEU B 1 299 ? 49.090  15.397  44.387  1.00 9.11  ? 299  LEU B CB  1 
ATOM   6281  C  CG  . LEU B 1 299 ? 48.971  14.257  43.352  1.00 9.43  ? 299  LEU B CG  1 
ATOM   6282  C  CD1 . LEU B 1 299 ? 50.041  14.260  42.276  1.00 11.04 ? 299  LEU B CD1 1 
ATOM   6283  C  CD2 . LEU B 1 299 ? 48.881  12.900  44.017  1.00 7.84  ? 299  LEU B CD2 1 
ATOM   6284  N  N   . ASN B 1 300 ? 48.931  18.931  43.877  1.00 10.27 ? 300  ASN B N   1 
ATOM   6285  C  CA  . ASN B 1 300 ? 48.492  20.228  44.333  1.00 11.54 ? 300  ASN B CA  1 
ATOM   6286  C  C   . ASN B 1 300 ? 47.186  20.752  43.735  1.00 12.47 ? 300  ASN B C   1 
ATOM   6287  O  O   . ASN B 1 300 ? 46.770  21.862  44.047  1.00 14.05 ? 300  ASN B O   1 
ATOM   6288  C  CB  . ASN B 1 300 ? 49.622  21.271  44.157  1.00 11.84 ? 300  ASN B CB  1 
ATOM   6289  C  CG  . ASN B 1 300 ? 50.114  21.407  42.723  1.00 11.14 ? 300  ASN B CG  1 
ATOM   6290  O  OD1 . ASN B 1 300 ? 49.479  20.960  41.766  1.00 13.43 ? 300  ASN B OD1 1 
ATOM   6291  N  ND2 . ASN B 1 300 ? 51.267  22.038  42.572  1.00 10.81 ? 300  ASN B ND2 1 
ATOM   6292  N  N   . LYS B 1 301 ? 46.529  19.962  42.895  1.00 12.46 ? 301  LYS B N   1 
ATOM   6293  C  CA  . LYS B 1 301 ? 45.344  20.439  42.216  1.00 12.39 ? 301  LYS B CA  1 
ATOM   6294  C  C   . LYS B 1 301 ? 44.342  19.313  41.976  1.00 11.70 ? 301  LYS B C   1 
ATOM   6295  O  O   . LYS B 1 301 ? 44.605  18.337  41.269  1.00 12.00 ? 301  LYS B O   1 
ATOM   6296  C  CB  . LYS B 1 301 ? 45.738  21.120  40.893  1.00 13.02 ? 301  LYS B CB  1 
ATOM   6297  C  CG  . LYS B 1 301 ? 44.595  21.827  40.216  1.00 15.26 ? 301  LYS B CG  1 
ATOM   6298  C  CD  . LYS B 1 301 ? 45.055  22.652  39.027  1.00 20.08 ? 301  LYS B CD  1 
ATOM   6299  C  CE  . LYS B 1 301 ? 43.879  22.931  38.087  1.00 23.33 ? 301  LYS B CE  1 
ATOM   6300  N  NZ  . LYS B 1 301 ? 42.784  23.666  38.806  1.00 24.72 ? 301  LYS B NZ  1 
ATOM   6301  N  N   . ASN B 1 302 ? 43.179  19.449  42.578  1.00 10.97 ? 302  ASN B N   1 
ATOM   6302  C  CA  . ASN B 1 302 ? 42.134  18.488  42.347  1.00 9.90  ? 302  ASN B CA  1 
ATOM   6303  C  C   . ASN B 1 302 ? 41.660  18.598  40.904  1.00 10.24 ? 302  ASN B C   1 
ATOM   6304  O  O   . ASN B 1 302 ? 41.928  19.593  40.216  1.00 10.16 ? 302  ASN B O   1 
ATOM   6305  C  CB  . ASN B 1 302 ? 40.982  18.694  43.341  1.00 8.36  ? 302  ASN B CB  1 
ATOM   6306  C  CG  . ASN B 1 302 ? 41.252  18.045  44.687  1.00 6.78  ? 302  ASN B CG  1 
ATOM   6307  O  OD1 . ASN B 1 302 ? 41.618  16.843  44.796  1.00 2.43  ? 302  ASN B OD1 1 
ATOM   6308  N  ND2 . ASN B 1 302 ? 41.063  18.825  45.727  1.00 4.80  ? 302  ASN B ND2 1 
ATOM   6309  N  N   . VAL B 1 303 ? 40.962  17.568  40.455  1.00 9.67  ? 303  VAL B N   1 
ATOM   6310  C  CA  . VAL B 1 303 ? 40.335  17.588  39.154  1.00 9.85  ? 303  VAL B CA  1 
ATOM   6311  C  C   . VAL B 1 303 ? 39.244  18.669  39.106  1.00 10.56 ? 303  VAL B C   1 
ATOM   6312  O  O   . VAL B 1 303 ? 38.669  19.020  40.134  1.00 10.18 ? 303  VAL B O   1 
ATOM   6313  C  CB  . VAL B 1 303 ? 39.743  16.162  38.791  1.00 9.78  ? 303  VAL B CB  1 
ATOM   6314  C  CG1 . VAL B 1 303 ? 40.828  15.076  38.906  1.00 7.71  ? 303  VAL B CG1 1 
ATOM   6315  C  CG2 . VAL B 1 303 ? 38.516  15.807  39.665  1.00 7.20  ? 303  VAL B CG2 1 
ATOM   6316  N  N   . ASP B 1 304 ? 38.967  19.194  37.916  1.00 11.74 ? 304  ASP B N   1 
ATOM   6317  C  CA  . ASP B 1 304 ? 37.734  19.953  37.676  1.00 12.53 ? 304  ASP B CA  1 
ATOM   6318  C  C   . ASP B 1 304 ? 36.559  19.009  37.458  1.00 12.94 ? 304  ASP B C   1 
ATOM   6319  O  O   . ASP B 1 304 ? 35.434  19.311  37.851  1.00 14.06 ? 304  ASP B O   1 
ATOM   6320  C  CB  . ASP B 1 304 ? 37.863  20.796  36.422  1.00 13.39 ? 304  ASP B CB  1 
ATOM   6321  C  CG  . ASP B 1 304 ? 38.941  21.850  36.529  1.00 15.72 ? 304  ASP B CG  1 
ATOM   6322  O  OD1 . ASP B 1 304 ? 39.174  22.391  37.641  1.00 18.69 ? 304  ASP B OD1 1 
ATOM   6323  O  OD2 . ASP B 1 304 ? 39.535  22.144  35.481  1.00 18.48 ? 304  ASP B OD2 1 
ATOM   6324  N  N   . ASN B 1 305 ? 36.811  17.872  36.804  1.00 12.12 ? 305  ASN B N   1 
ATOM   6325  C  CA  . ASN B 1 305 ? 35.753  16.934  36.507  1.00 10.97 ? 305  ASN B CA  1 
ATOM   6326  C  C   . ASN B 1 305 ? 36.253  15.498  36.565  1.00 10.68 ? 305  ASN B C   1 
ATOM   6327  O  O   . ASN B 1 305 ? 37.129  15.107  35.791  1.00 11.01 ? 305  ASN B O   1 
ATOM   6328  C  CB  . ASN B 1 305 ? 35.142  17.247  35.128  1.00 10.75 ? 305  ASN B CB  1 
ATOM   6329  C  CG  . ASN B 1 305 ? 33.980  16.351  34.793  1.00 9.50  ? 305  ASN B CG  1 
ATOM   6330  O  OD1 . ASN B 1 305 ? 34.134  15.359  34.095  1.00 8.46  ? 305  ASN B OD1 1 
ATOM   6331  N  ND2 . ASN B 1 305 ? 32.806  16.685  35.307  1.00 10.57 ? 305  ASN B ND2 1 
ATOM   6332  N  N   . TYR B 1 306 ? 35.672  14.722  37.474  1.00 9.86  ? 306  TYR B N   1 
ATOM   6333  C  CA  . TYR B 1 306 ? 36.044  13.330  37.702  1.00 9.18  ? 306  TYR B CA  1 
ATOM   6334  C  C   . TYR B 1 306 ? 35.908  12.438  36.448  1.00 8.59  ? 306  TYR B C   1 
ATOM   6335  O  O   . TYR B 1 306 ? 36.813  11.672  36.093  1.00 6.18  ? 306  TYR B O   1 
ATOM   6336  C  CB  . TYR B 1 306 ? 35.197  12.763  38.856  1.00 8.95  ? 306  TYR B CB  1 
ATOM   6337  C  CG  . TYR B 1 306 ? 35.648  11.384  39.310  1.00 8.98  ? 306  TYR B CG  1 
ATOM   6338  C  CD1 . TYR B 1 306 ? 36.444  11.228  40.467  1.00 8.49  ? 306  TYR B CD1 1 
ATOM   6339  C  CD2 . TYR B 1 306 ? 35.292  10.238  38.587  1.00 7.67  ? 306  TYR B CD2 1 
ATOM   6340  C  CE1 . TYR B 1 306 ? 36.871  9.970   40.892  1.00 7.81  ? 306  TYR B CE1 1 
ATOM   6341  C  CE2 . TYR B 1 306 ? 35.707  8.973   39.005  1.00 8.98  ? 306  TYR B CE2 1 
ATOM   6342  C  CZ  . TYR B 1 306 ? 36.491  8.851   40.159  1.00 9.29  ? 306  TYR B CZ  1 
ATOM   6343  O  OH  . TYR B 1 306 ? 36.907  7.614   40.554  1.00 8.20  ? 306  TYR B OH  1 
ATOM   6344  N  N   . PHE B 1 307 ? 34.763  12.548  35.782  1.00 9.31  ? 307  PHE B N   1 
ATOM   6345  C  CA  . PHE B 1 307 ? 34.516  11.698  34.640  1.00 9.58  ? 307  PHE B CA  1 
ATOM   6346  C  C   . PHE B 1 307 ? 35.556  11.902  33.540  1.00 10.33 ? 307  PHE B C   1 
ATOM   6347  O  O   . PHE B 1 307 ? 36.117  10.916  33.017  1.00 11.71 ? 307  PHE B O   1 
ATOM   6348  C  CB  . PHE B 1 307 ? 33.124  11.881  34.071  1.00 8.78  ? 307  PHE B CB  1 
ATOM   6349  C  CG  . PHE B 1 307 ? 32.847  10.949  32.946  1.00 9.57  ? 307  PHE B CG  1 
ATOM   6350  C  CD1 . PHE B 1 307 ? 32.903  11.388  31.633  1.00 10.39 ? 307  PHE B CD1 1 
ATOM   6351  C  CD2 . PHE B 1 307 ? 32.606  9.592   33.204  1.00 8.79  ? 307  PHE B CD2 1 
ATOM   6352  C  CE1 . PHE B 1 307 ? 32.670  10.487  30.569  1.00 12.33 ? 307  PHE B CE1 1 
ATOM   6353  C  CE2 . PHE B 1 307 ? 32.372  8.695   32.183  1.00 9.45  ? 307  PHE B CE2 1 
ATOM   6354  C  CZ  . PHE B 1 307 ? 32.412  9.135   30.843  1.00 10.93 ? 307  PHE B CZ  1 
ATOM   6355  N  N   . ALA B 1 308 ? 35.809  13.162  33.185  1.00 9.63  ? 308  ALA B N   1 
ATOM   6356  C  CA  . ALA B 1 308 ? 36.693  13.466  32.070  1.00 9.72  ? 308  ALA B CA  1 
ATOM   6357  C  C   . ALA B 1 308 ? 38.165  13.312  32.444  1.00 9.82  ? 308  ALA B C   1 
ATOM   6358  O  O   . ALA B 1 308 ? 39.036  13.229  31.569  1.00 10.01 ? 308  ALA B O   1 
ATOM   6359  C  CB  . ALA B 1 308 ? 36.420  14.878  31.508  1.00 9.05  ? 308  ALA B CB  1 
ATOM   6360  N  N   . GLU B 1 309 ? 38.456  13.270  33.733  1.00 9.47  ? 309  GLU B N   1 
ATOM   6361  C  CA  . GLU B 1 309 ? 39.838  13.230  34.136  1.00 9.59  ? 309  GLU B CA  1 
ATOM   6362  C  C   . GLU B 1 309 ? 40.158  11.868  34.729  1.00 9.85  ? 309  GLU B C   1 
ATOM   6363  O  O   . GLU B 1 309 ? 40.718  11.007  34.039  1.00 10.43 ? 309  GLU B O   1 
ATOM   6364  C  CB  . GLU B 1 309 ? 40.181  14.423  35.052  1.00 10.01 ? 309  GLU B CB  1 
ATOM   6365  C  CG  . GLU B 1 309 ? 40.115  15.821  34.337  1.00 7.62  ? 309  GLU B CG  1 
ATOM   6366  C  CD  . GLU B 1 309 ? 40.333  16.984  35.294  1.00 9.50  ? 309  GLU B CD  1 
ATOM   6367  O  OE1 . GLU B 1 309 ? 41.378  16.997  35.971  1.00 9.69  ? 309  GLU B OE1 1 
ATOM   6368  O  OE2 . GLU B 1 309 ? 39.458  17.877  35.410  1.00 9.80  ? 309  GLU B OE2 1 
ATOM   6369  N  N   . THR B 1 310 ? 39.753  11.644  35.976  1.00 10.13 ? 310  THR B N   1 
ATOM   6370  C  CA  . THR B 1 310 ? 40.003  10.386  36.680  1.00 9.36  ? 310  THR B CA  1 
ATOM   6371  C  C   . THR B 1 310 ? 39.401  9.156   35.988  1.00 9.23  ? 310  THR B C   1 
ATOM   6372  O  O   . THR B 1 310 ? 40.054  8.111   35.913  1.00 9.13  ? 310  THR B O   1 
ATOM   6373  C  CB  . THR B 1 310 ? 39.491  10.464  38.115  1.00 9.66  ? 310  THR B CB  1 
ATOM   6374  O  OG1 . THR B 1 310 ? 39.850  11.738  38.665  1.00 9.75  ? 310  THR B OG1 1 
ATOM   6375  C  CG2 . THR B 1 310 ? 40.079  9.333   38.984  1.00 9.60  ? 310  THR B CG2 1 
ATOM   6376  N  N   . GLU B 1 311 ? 38.171  9.261   35.487  1.00 9.01  ? 311  GLU B N   1 
ATOM   6377  C  CA  . GLU B 1 311 ? 37.540  8.079   34.912  1.00 9.15  ? 311  GLU B CA  1 
ATOM   6378  C  C   . GLU B 1 311 ? 38.141  7.729   33.540  1.00 8.90  ? 311  GLU B C   1 
ATOM   6379  O  O   . GLU B 1 311 ? 38.389  6.565   33.260  1.00 9.35  ? 311  GLU B O   1 
ATOM   6380  C  CB  . GLU B 1 311 ? 35.998  8.187   34.873  1.00 9.63  ? 311  GLU B CB  1 
ATOM   6381  C  CG  . GLU B 1 311 ? 35.216  6.852   34.544  1.00 8.89  ? 311  GLU B CG  1 
ATOM   6382  C  CD  . GLU B 1 311 ? 35.576  5.681   35.504  1.00 10.33 ? 311  GLU B CD  1 
ATOM   6383  O  OE1 . GLU B 1 311 ? 35.781  5.900   36.710  1.00 10.48 ? 311  GLU B OE1 1 
ATOM   6384  O  OE2 . GLU B 1 311 ? 35.689  4.535   35.054  1.00 10.21 ? 311  GLU B OE2 1 
ATOM   6385  N  N   . SER B 1 312 ? 38.418  8.753   32.735  1.00 8.43  ? 312  SER B N   1 
ATOM   6386  C  CA  . SER B 1 312 ? 38.812  8.616   31.330  1.00 7.26  ? 312  SER B CA  1 
ATOM   6387  C  C   . SER B 1 312 ? 40.325  8.530   31.087  1.00 7.51  ? 312  SER B C   1 
ATOM   6388  O  O   . SER B 1 312 ? 40.769  8.278   29.947  1.00 8.02  ? 312  SER B O   1 
ATOM   6389  C  CB  . SER B 1 312 ? 38.213  9.766   30.494  1.00 6.70  ? 312  SER B CB  1 
ATOM   6390  O  OG  . SER B 1 312 ? 36.807  9.668   30.416  1.00 4.53  ? 312  SER B OG  1 
ATOM   6391  N  N   . VAL B 1 313 ? 41.128  8.776   32.115  1.00 6.71  ? 313  VAL B N   1 
ATOM   6392  C  CA  . VAL B 1 313 ? 42.559  8.555   31.953  1.00 6.07  ? 313  VAL B CA  1 
ATOM   6393  C  C   . VAL B 1 313 ? 42.822  7.059   31.707  1.00 6.88  ? 313  VAL B C   1 
ATOM   6394  O  O   . VAL B 1 313 ? 42.142  6.191   32.277  1.00 6.59  ? 313  VAL B O   1 
ATOM   6395  C  CB  . VAL B 1 313 ? 43.409  9.145   33.156  1.00 6.23  ? 313  VAL B CB  1 
ATOM   6396  C  CG1 . VAL B 1 313 ? 43.140  8.432   34.488  1.00 4.20  ? 313  VAL B CG1 1 
ATOM   6397  C  CG2 . VAL B 1 313 ? 44.895  9.185   32.830  1.00 4.18  ? 313  VAL B CG2 1 
ATOM   6398  N  N   . GLY B 1 314 ? 43.778  6.774   30.823  1.00 7.07  ? 314  GLY B N   1 
ATOM   6399  C  CA  . GLY B 1 314 ? 44.346  5.439   30.711  1.00 7.61  ? 314  GLY B CA  1 
ATOM   6400  C  C   . GLY B 1 314 ? 45.853  5.456   30.921  1.00 7.82  ? 314  GLY B C   1 
ATOM   6401  O  O   . GLY B 1 314 ? 46.552  6.316   30.368  1.00 8.15  ? 314  GLY B O   1 
ATOM   6402  N  N   . PHE B 1 315 ? 46.354  4.511   31.725  1.00 7.72  ? 315  PHE B N   1 
ATOM   6403  C  CA  . PHE B 1 315 ? 47.794  4.325   31.905  1.00 7.44  ? 315  PHE B CA  1 
ATOM   6404  C  C   . PHE B 1 315 ? 48.255  2.959   31.404  1.00 7.64  ? 315  PHE B C   1 
ATOM   6405  O  O   . PHE B 1 315 ? 47.479  2.001   31.411  1.00 7.91  ? 315  PHE B O   1 
ATOM   6406  C  CB  . PHE B 1 315 ? 48.208  4.408   33.368  1.00 7.07  ? 315  PHE B CB  1 
ATOM   6407  C  CG  . PHE B 1 315 ? 47.663  5.584   34.133  1.00 6.43  ? 315  PHE B CG  1 
ATOM   6408  C  CD1 . PHE B 1 315 ? 48.461  6.714   34.368  1.00 4.70  ? 315  PHE B CD1 1 
ATOM   6409  C  CD2 . PHE B 1 315 ? 46.408  5.518   34.732  1.00 4.21  ? 315  PHE B CD2 1 
ATOM   6410  C  CE1 . PHE B 1 315 ? 47.988  7.778   35.150  1.00 2.55  ? 315  PHE B CE1 1 
ATOM   6411  C  CE2 . PHE B 1 315 ? 45.944  6.581   35.511  1.00 4.65  ? 315  PHE B CE2 1 
ATOM   6412  C  CZ  . PHE B 1 315 ? 46.735  7.710   35.712  1.00 2.48  ? 315  PHE B CZ  1 
ATOM   6413  N  N   . ASN B 1 316 ? 49.526  2.868   31.006  1.00 7.73  ? 316  ASN B N   1 
ATOM   6414  C  CA  . ASN B 1 316 ? 50.140  1.584   30.621  1.00 8.23  ? 316  ASN B CA  1 
ATOM   6415  C  C   . ASN B 1 316 ? 51.600  1.581   31.039  1.00 7.46  ? 316  ASN B C   1 
ATOM   6416  O  O   . ASN B 1 316 ? 52.314  2.500   30.663  1.00 8.33  ? 316  ASN B O   1 
ATOM   6417  C  CB  . ASN B 1 316 ? 50.033  1.351   29.092  1.00 8.47  ? 316  ASN B CB  1 
ATOM   6418  C  CG  . ASN B 1 316 ? 50.548  -0.032  28.655  1.00 9.20  ? 316  ASN B CG  1 
ATOM   6419  O  OD1 . ASN B 1 316 ? 51.189  -0.752  29.432  1.00 9.00  ? 316  ASN B OD1 1 
ATOM   6420  N  ND2 . ASN B 1 316 ? 50.268  -0.400  27.400  1.00 9.82  ? 316  ASN B ND2 1 
ATOM   6421  N  N   . PRO B 1 317 ? 52.044  0.579   31.828  1.00 6.76  ? 317  PRO B N   1 
ATOM   6422  C  CA  . PRO B 1 317 ? 53.454  0.588   32.261  1.00 6.80  ? 317  PRO B CA  1 
ATOM   6423  C  C   . PRO B 1 317 ? 54.467  0.481   31.103  1.00 6.44  ? 317  PRO B C   1 
ATOM   6424  O  O   . PRO B 1 317 ? 55.629  0.855   31.267  1.00 6.01  ? 317  PRO B O   1 
ATOM   6425  C  CB  . PRO B 1 317 ? 53.560  -0.628  33.204  1.00 6.53  ? 317  PRO B CB  1 
ATOM   6426  C  CG  . PRO B 1 317 ? 52.443  -1.503  32.829  1.00 6.84  ? 317  PRO B CG  1 
ATOM   6427  C  CD  . PRO B 1 317 ? 51.316  -0.567  32.398  1.00 6.73  ? 317  PRO B CD  1 
ATOM   6428  N  N   . GLY B 1 318 ? 54.001  0.001   29.951  1.00 6.15  ? 318  GLY B N   1 
ATOM   6429  C  CA  . GLY B 1 318 ? 54.815  -0.118  28.772  1.00 5.65  ? 318  GLY B CA  1 
ATOM   6430  C  C   . GLY B 1 318 ? 54.737  1.126   27.921  1.00 6.27  ? 318  GLY B C   1 
ATOM   6431  O  O   . GLY B 1 318 ? 55.257  1.140   26.791  1.00 6.25  ? 318  GLY B O   1 
ATOM   6432  N  N   . VAL B 1 319 ? 54.058  2.156   28.429  1.00 6.53  ? 319  VAL B N   1 
ATOM   6433  C  CA  . VAL B 1 319 ? 54.104  3.488   27.811  1.00 7.66  ? 319  VAL B CA  1 
ATOM   6434  C  C   . VAL B 1 319 ? 55.323  4.209   28.429  1.00 8.57  ? 319  VAL B C   1 
ATOM   6435  O  O   . VAL B 1 319 ? 55.257  4.772   29.530  1.00 8.29  ? 319  VAL B O   1 
ATOM   6436  C  CB  . VAL B 1 319 ? 52.746  4.254   27.950  1.00 7.43  ? 319  VAL B CB  1 
ATOM   6437  C  CG1 . VAL B 1 319 ? 52.893  5.784   27.810  1.00 6.87  ? 319  VAL B CG1 1 
ATOM   6438  C  CG2 . VAL B 1 319 ? 51.763  3.722   26.933  1.00 7.07  ? 319  VAL B CG2 1 
ATOM   6439  N  N   . LEU B 1 320 ? 56.450  4.128   27.719  1.00 9.44  ? 320  LEU B N   1 
ATOM   6440  C  CA  . LEU B 1 320 ? 57.752  4.565   28.257  1.00 9.67  ? 320  LEU B CA  1 
ATOM   6441  C  C   . LEU B 1 320 ? 58.366  5.608   27.355  1.00 9.35  ? 320  LEU B C   1 
ATOM   6442  O  O   . LEU B 1 320 ? 58.018  5.678   26.192  1.00 10.15 ? 320  LEU B O   1 
ATOM   6443  C  CB  . LEU B 1 320 ? 58.697  3.366   28.355  1.00 10.01 ? 320  LEU B CB  1 
ATOM   6444  C  CG  . LEU B 1 320 ? 58.261  2.216   29.274  1.00 9.37  ? 320  LEU B CG  1 
ATOM   6445  C  CD1 . LEU B 1 320 ? 59.111  0.974   29.016  1.00 8.11  ? 320  LEU B CD1 1 
ATOM   6446  C  CD2 . LEU B 1 320 ? 58.377  2.668   30.704  1.00 8.81  ? 320  LEU B CD2 1 
ATOM   6447  N  N   . VAL B 1 321 ? 59.254  6.436   27.890  1.00 9.05  ? 321  VAL B N   1 
ATOM   6448  C  CA  . VAL B 1 321 ? 59.960  7.420   27.073  1.00 8.78  ? 321  VAL B CA  1 
ATOM   6449  C  C   . VAL B 1 321 ? 61.332  6.889   26.635  1.00 8.68  ? 321  VAL B C   1 
ATOM   6450  O  O   . VAL B 1 321 ? 61.841  5.945   27.224  1.00 8.05  ? 321  VAL B O   1 
ATOM   6451  C  CB  . VAL B 1 321 ? 60.107  8.813   27.782  1.00 9.20  ? 321  VAL B CB  1 
ATOM   6452  C  CG1 . VAL B 1 321 ? 58.773  9.581   27.776  1.00 7.72  ? 321  VAL B CG1 1 
ATOM   6453  C  CG2 . VAL B 1 321 ? 60.693  8.669   29.181  1.00 7.86  ? 321  VAL B CG2 1 
ATOM   6454  N  N   . PRO B 1 322 ? 61.931  7.493   25.587  1.00 8.82  ? 322  PRO B N   1 
ATOM   6455  C  CA  . PRO B 1 322 ? 63.287  7.045   25.236  1.00 8.49  ? 322  PRO B CA  1 
ATOM   6456  C  C   . PRO B 1 322 ? 64.211  7.105   26.447  1.00 8.50  ? 322  PRO B C   1 
ATOM   6457  O  O   . PRO B 1 322 ? 64.154  8.046   27.221  1.00 9.04  ? 322  PRO B O   1 
ATOM   6458  C  CB  . PRO B 1 322 ? 63.711  8.043   24.139  1.00 8.68  ? 322  PRO B CB  1 
ATOM   6459  C  CG  . PRO B 1 322 ? 62.410  8.460   23.473  1.00 7.71  ? 322  PRO B CG  1 
ATOM   6460  C  CD  . PRO B 1 322 ? 61.440  8.551   24.671  1.00 8.29  ? 322  PRO B CD  1 
ATOM   6461  N  N   . GLY B 1 323 ? 65.041  6.085   26.619  1.00 9.06  ? 323  GLY B N   1 
ATOM   6462  C  CA  . GLY B 1 323 ? 65.853  5.930   27.819  1.00 8.11  ? 323  GLY B CA  1 
ATOM   6463  C  C   . GLY B 1 323 ? 65.307  4.822   28.699  1.00 8.80  ? 323  GLY B C   1 
ATOM   6464  O  O   . GLY B 1 323 ? 65.965  4.414   29.647  1.00 8.82  ? 323  GLY B O   1 
ATOM   6465  N  N   . MET B 1 324 ? 64.114  4.324   28.349  1.00 9.00  ? 324  MET B N   1 
ATOM   6466  C  CA  . MET B 1 324 ? 63.360  3.340   29.131  1.00 9.82  ? 324  MET B CA  1 
ATOM   6467  C  C   . MET B 1 324 ? 62.802  2.210   28.265  1.00 9.00  ? 324  MET B C   1 
ATOM   6468  O  O   . MET B 1 324 ? 62.287  2.436   27.172  1.00 8.91  ? 324  MET B O   1 
ATOM   6469  C  CB  . MET B 1 324 ? 62.188  4.003   29.864  1.00 9.56  ? 324  MET B CB  1 
ATOM   6470  C  CG  . MET B 1 324 ? 62.564  5.075   30.854  1.00 9.78  ? 324  MET B CG  1 
ATOM   6471  S  SD  . MET B 1 324 ? 61.070  5.757   31.617  1.00 12.81 ? 324  MET B SD  1 
ATOM   6472  C  CE  . MET B 1 324 ? 61.791  6.863   32.849  1.00 9.29  ? 324  MET B CE  1 
ATOM   6473  N  N   . LEU B 1 325 ? 62.894  0.993   28.786  1.00 8.83  ? 325  LEU B N   1 
ATOM   6474  C  CA  . LEU B 1 325 ? 62.407  -0.199  28.107  1.00 8.90  ? 325  LEU B CA  1 
ATOM   6475  C  C   . LEU B 1 325 ? 61.850  -1.171  29.125  1.00 7.98  ? 325  LEU B C   1 
ATOM   6476  O  O   . LEU B 1 325 ? 62.268  -1.148  30.277  1.00 7.75  ? 325  LEU B O   1 
ATOM   6477  C  CB  . LEU B 1 325 ? 63.533  -0.885  27.306  1.00 9.18  ? 325  LEU B CB  1 
ATOM   6478  C  CG  . LEU B 1 325 ? 64.002  -0.343  25.958  1.00 11.01 ? 325  LEU B CG  1 
ATOM   6479  C  CD1 . LEU B 1 325 ? 65.214  -1.185  25.522  1.00 13.44 ? 325  LEU B CD1 1 
ATOM   6480  C  CD2 . LEU B 1 325 ? 62.913  -0.423  24.901  1.00 10.37 ? 325  LEU B CD2 1 
ATOM   6481  N  N   . PRO B 1 326 ? 60.922  -2.049  28.696  1.00 7.90  ? 326  PRO B N   1 
ATOM   6482  C  CA  . PRO B 1 326 ? 60.382  -3.046  29.630  1.00 7.68  ? 326  PRO B CA  1 
ATOM   6483  C  C   . PRO B 1 326 ? 61.408  -4.167  29.875  1.00 7.92  ? 326  PRO B C   1 
ATOM   6484  O  O   . PRO B 1 326 ? 62.256  -4.427  29.015  1.00 7.26  ? 326  PRO B O   1 
ATOM   6485  C  CB  . PRO B 1 326 ? 59.152  -3.591  28.893  1.00 7.77  ? 326  PRO B CB  1 
ATOM   6486  C  CG  . PRO B 1 326 ? 59.442  -3.376  27.435  1.00 7.44  ? 326  PRO B CG  1 
ATOM   6487  C  CD  . PRO B 1 326 ? 60.350  -2.175  27.337  1.00 7.12  ? 326  PRO B CD  1 
ATOM   6488  N  N   . SER B 1 327 ? 61.335  -4.797  31.048  1.00 7.85  ? 327  SER B N   1 
ATOM   6489  C  CA  . SER B 1 327 ? 62.143  -5.972  31.333  1.00 8.43  ? 327  SER B CA  1 
ATOM   6490  C  C   . SER B 1 327 ? 61.425  -7.166  30.755  1.00 8.71  ? 327  SER B C   1 
ATOM   6491  O  O   . SER B 1 327 ? 60.233  -7.093  30.474  1.00 8.51  ? 327  SER B O   1 
ATOM   6492  C  CB  . SER B 1 327 ? 62.329  -6.182  32.846  1.00 8.19  ? 327  SER B CB  1 
ATOM   6493  O  OG  . SER B 1 327 ? 61.160  -6.746  33.430  1.00 7.41  ? 327  SER B OG  1 
ATOM   6494  N  N   . GLU B 1 328 ? 62.147  -8.273  30.621  1.00 9.55  ? 328  GLU B N   1 
ATOM   6495  C  CA  . GLU B 1 328 ? 61.549  -9.518  30.179  1.00 10.40 ? 328  GLU B CA  1 
ATOM   6496  C  C   . GLU B 1 328 ? 60.648  -10.233 31.230  1.00 9.82  ? 328  GLU B C   1 
ATOM   6497  O  O   . GLU B 1 328 ? 60.107  -11.284 30.940  1.00 9.83  ? 328  GLU B O   1 
ATOM   6498  C  CB  . GLU B 1 328 ? 62.576  -10.432 29.492  1.00 10.43 ? 328  GLU B CB  1 
ATOM   6499  C  CG  . GLU B 1 328 ? 63.926  -10.590 30.143  1.00 14.43 ? 328  GLU B CG  1 
ATOM   6500  C  CD  . GLU B 1 328 ? 64.834  -9.357  30.102  1.00 14.87 ? 328  GLU B CD  1 
ATOM   6501  O  OE1 . GLU B 1 328 ? 64.681  -8.522  30.998  1.00 16.55 ? 328  GLU B OE1 1 
ATOM   6502  O  OE2 . GLU B 1 328 ? 65.736  -9.257  29.241  1.00 14.76 ? 328  GLU B OE2 1 
ATOM   6503  N  N   . ASP B 1 329 ? 60.433  -9.617  32.400  1.00 9.67  ? 329  ASP B N   1 
ATOM   6504  C  CA  . ASP B 1 329 ? 59.402  -10.036 33.391  1.00 9.86  ? 329  ASP B CA  1 
ATOM   6505  C  C   . ASP B 1 329 ? 58.108  -10.488 32.715  1.00 10.03 ? 329  ASP B C   1 
ATOM   6506  O  O   . ASP B 1 329 ? 57.436  -9.693  32.045  1.00 10.06 ? 329  ASP B O   1 
ATOM   6507  C  CB  . ASP B 1 329 ? 59.120  -8.869  34.358  1.00 10.18 ? 329  ASP B CB  1 
ATOM   6508  C  CG  . ASP B 1 329 ? 58.221  -9.254  35.552  1.00 10.73 ? 329  ASP B CG  1 
ATOM   6509  O  OD1 . ASP B 1 329 ? 57.179  -9.904  35.371  1.00 8.85  ? 329  ASP B OD1 1 
ATOM   6510  O  OD2 . ASP B 1 329 ? 58.543  -8.842  36.688  1.00 11.87 ? 329  ASP B OD2 1 
ATOM   6511  N  N   . LYS B 1 330 ? 57.758  -11.764 32.879  1.00 10.09 ? 330  LYS B N   1 
ATOM   6512  C  CA  . LYS B 1 330 ? 56.616  -12.361 32.156  1.00 9.51  ? 330  LYS B CA  1 
ATOM   6513  C  C   . LYS B 1 330 ? 55.275  -11.815 32.638  1.00 9.13  ? 330  LYS B C   1 
ATOM   6514  O  O   . LYS B 1 330 ? 54.280  -11.853 31.893  1.00 9.06  ? 330  LYS B O   1 
ATOM   6515  C  CB  . LYS B 1 330 ? 56.646  -13.901 32.213  1.00 9.84  ? 330  LYS B CB  1 
ATOM   6516  C  CG  . LYS B 1 330 ? 57.978  -14.499 31.703  1.00 11.14 ? 330  LYS B CG  1 
ATOM   6517  C  CD  . LYS B 1 330 ? 57.853  -15.986 31.382  1.00 12.81 ? 330  LYS B CD  1 
ATOM   6518  C  CE  . LYS B 1 330 ? 59.232  -16.673 31.288  1.00 11.82 ? 330  LYS B CE  1 
ATOM   6519  N  NZ  . LYS B 1 330 ? 59.158  -18.116 31.623  1.00 9.70  ? 330  LYS B NZ  1 
ATOM   6520  N  N   . LEU B 1 331 ? 55.228  -11.306 33.869  1.00 7.56  ? 331  LEU B N   1 
ATOM   6521  C  CA  . LEU B 1 331 ? 54.017  -10.631 34.297  1.00 6.96  ? 331  LEU B CA  1 
ATOM   6522  C  C   . LEU B 1 331 ? 53.888  -9.274  33.574  1.00 7.18  ? 331  LEU B C   1 
ATOM   6523  O  O   . LEU B 1 331 ? 52.852  -8.980  32.988  1.00 7.09  ? 331  LEU B O   1 
ATOM   6524  C  CB  . LEU B 1 331 ? 53.972  -10.474 35.822  1.00 6.78  ? 331  LEU B CB  1 
ATOM   6525  C  CG  . LEU B 1 331 ? 52.591  -10.142 36.411  1.00 6.42  ? 331  LEU B CG  1 
ATOM   6526  C  CD1 . LEU B 1 331 ? 51.600  -11.308 36.238  1.00 2.00  ? 331  LEU B CD1 1 
ATOM   6527  C  CD2 . LEU B 1 331 ? 52.699  -9.701  37.868  1.00 5.26  ? 331  LEU B CD2 1 
ATOM   6528  N  N   . LEU B 1 332 ? 54.957  -8.480  33.600  1.00 7.14  ? 332  LEU B N   1 
ATOM   6529  C  CA  . LEU B 1 332 ? 55.009  -7.169  32.965  1.00 7.19  ? 332  LEU B CA  1 
ATOM   6530  C  C   . LEU B 1 332 ? 54.695  -7.252  31.470  1.00 7.85  ? 332  LEU B C   1 
ATOM   6531  O  O   . LEU B 1 332 ? 53.973  -6.380  30.919  1.00 8.92  ? 332  LEU B O   1 
ATOM   6532  C  CB  . LEU B 1 332 ? 56.389  -6.519  33.200  1.00 7.55  ? 332  LEU B CB  1 
ATOM   6533  C  CG  . LEU B 1 332 ? 56.753  -5.233  32.435  1.00 7.19  ? 332  LEU B CG  1 
ATOM   6534  C  CD1 . LEU B 1 332 ? 55.789  -4.084  32.792  1.00 7.38  ? 332  LEU B CD1 1 
ATOM   6535  C  CD2 . LEU B 1 332 ? 58.182  -4.805  32.659  1.00 6.53  ? 332  LEU B CD2 1 
ATOM   6536  N  N   . GLN B 1 333 ? 55.189  -8.313  30.830  1.00 7.29  ? 333  GLN B N   1 
ATOM   6537  C  CA  . GLN B 1 333 ? 55.037  -8.520  29.392  1.00 7.28  ? 333  GLN B CA  1 
ATOM   6538  C  C   . GLN B 1 333 ? 53.596  -8.515  28.861  1.00 7.93  ? 333  GLN B C   1 
ATOM   6539  O  O   . GLN B 1 333 ? 53.317  -7.903  27.804  1.00 8.37  ? 333  GLN B O   1 
ATOM   6540  C  CB  . GLN B 1 333 ? 55.782  -9.779  28.953  1.00 7.36  ? 333  GLN B CB  1 
ATOM   6541  C  CG  . GLN B 1 333 ? 57.333  -9.584  28.968  1.00 8.78  ? 333  GLN B CG  1 
ATOM   6542  C  CD  . GLN B 1 333 ? 57.853  -8.867  27.757  1.00 7.07  ? 333  GLN B CD  1 
ATOM   6543  O  OE1 . GLN B 1 333 ? 57.418  -9.131  26.650  1.00 7.41  ? 333  GLN B OE1 1 
ATOM   6544  N  NE2 . GLN B 1 333 ? 58.771  -7.936  27.960  1.00 10.08 ? 333  GLN B NE2 1 
ATOM   6545  N  N   . GLY B 1 334 ? 52.698  -9.212  29.561  1.00 7.56  ? 334  GLY B N   1 
ATOM   6546  C  CA  . GLY B 1 334 ? 51.287  -9.220  29.218  1.00 7.62  ? 334  GLY B CA  1 
ATOM   6547  C  C   . GLY B 1 334 ? 50.655  -7.866  29.480  1.00 8.29  ? 334  GLY B C   1 
ATOM   6548  O  O   . GLY B 1 334 ? 49.786  -7.428  28.726  1.00 8.71  ? 334  GLY B O   1 
ATOM   6549  N  N   . ARG B 1 335 ? 51.113  -7.173  30.525  1.00 8.44  ? 335  ARG B N   1 
ATOM   6550  C  CA  . ARG B 1 335 ? 50.606  -5.820  30.817  1.00 8.21  ? 335  ARG B CA  1 
ATOM   6551  C  C   . ARG B 1 335 ? 50.905  -4.819  29.691  1.00 8.44  ? 335  ARG B C   1 
ATOM   6552  O  O   . ARG B 1 335 ? 50.087  -3.923  29.417  1.00 8.86  ? 335  ARG B O   1 
ATOM   6553  C  CB  . ARG B 1 335 ? 51.160  -5.278  32.131  1.00 8.75  ? 335  ARG B CB  1 
ATOM   6554  C  CG  . ARG B 1 335 ? 50.850  -6.100  33.374  1.00 6.88  ? 335  ARG B CG  1 
ATOM   6555  C  CD  . ARG B 1 335 ? 51.567  -5.493  34.572  1.00 7.88  ? 335  ARG B CD  1 
ATOM   6556  N  NE  . ARG B 1 335 ? 50.900  -4.280  35.054  1.00 9.56  ? 335  ARG B NE  1 
ATOM   6557  C  CZ  . ARG B 1 335 ? 51.492  -3.301  35.748  1.00 8.59  ? 335  ARG B CZ  1 
ATOM   6558  N  NH1 . ARG B 1 335 ? 52.788  -3.353  36.016  1.00 7.29  ? 335  ARG B NH1 1 
ATOM   6559  N  NH2 . ARG B 1 335 ? 50.786  -2.256  36.154  1.00 4.23  ? 335  ARG B NH2 1 
ATOM   6560  N  N   . LEU B 1 336 ? 52.057  -4.955  29.035  1.00 7.98  ? 336  LEU B N   1 
ATOM   6561  C  CA  . LEU B 1 336 ? 52.370  -4.080  27.903  1.00 7.31  ? 336  LEU B CA  1 
ATOM   6562  C  C   . LEU B 1 336 ? 51.213  -4.054  26.889  1.00 7.61  ? 336  LEU B C   1 
ATOM   6563  O  O   . LEU B 1 336 ? 50.821  -2.981  26.409  1.00 7.81  ? 336  LEU B O   1 
ATOM   6564  C  CB  . LEU B 1 336 ? 53.667  -4.526  27.221  1.00 7.48  ? 336  LEU B CB  1 
ATOM   6565  C  CG  . LEU B 1 336 ? 54.873  -4.837  28.117  1.00 7.66  ? 336  LEU B CG  1 
ATOM   6566  C  CD1 . LEU B 1 336 ? 55.968  -5.349  27.258  1.00 2.55  ? 336  LEU B CD1 1 
ATOM   6567  C  CD2 . LEU B 1 336 ? 55.342  -3.642  28.975  1.00 5.90  ? 336  LEU B CD2 1 
ATOM   6568  N  N   . PHE B 1 337 ? 50.665  -5.231  26.582  1.00 7.54  ? 337  PHE B N   1 
ATOM   6569  C  CA  . PHE B 1 337 ? 49.539  -5.367  25.663  1.00 7.20  ? 337  PHE B CA  1 
ATOM   6570  C  C   . PHE B 1 337 ? 48.230  -4.899  26.276  1.00 7.11  ? 337  PHE B C   1 
ATOM   6571  O  O   . PHE B 1 337 ? 47.502  -4.105  25.678  1.00 7.40  ? 337  PHE B O   1 
ATOM   6572  C  CB  . PHE B 1 337 ? 49.368  -6.839  25.194  1.00 7.03  ? 337  PHE B CB  1 
ATOM   6573  C  CG  . PHE B 1 337 ? 48.031  -7.119  24.546  1.00 6.66  ? 337  PHE B CG  1 
ATOM   6574  C  CD1 . PHE B 1 337 ? 47.646  -6.461  23.367  1.00 6.49  ? 337  PHE B CD1 1 
ATOM   6575  C  CD2 . PHE B 1 337 ? 47.142  -8.016  25.117  1.00 7.91  ? 337  PHE B CD2 1 
ATOM   6576  C  CE1 . PHE B 1 337 ? 46.397  -6.709  22.766  1.00 6.79  ? 337  PHE B CE1 1 
ATOM   6577  C  CE2 . PHE B 1 337 ? 45.871  -8.271  24.519  1.00 6.71  ? 337  PHE B CE2 1 
ATOM   6578  C  CZ  . PHE B 1 337 ? 45.508  -7.609  23.344  1.00 6.05  ? 337  PHE B CZ  1 
ATOM   6579  N  N   . SER B 1 338 ? 47.938  -5.421  27.462  1.00 7.17  ? 338  SER B N   1 
ATOM   6580  C  CA  . SER B 1 338 ? 46.603  -5.377  28.073  1.00 7.38  ? 338  SER B CA  1 
ATOM   6581  C  C   . SER B 1 338 ? 45.980  -3.993  28.338  1.00 6.83  ? 338  SER B C   1 
ATOM   6582  O  O   . SER B 1 338 ? 44.814  -3.759  28.012  1.00 7.18  ? 338  SER B O   1 
ATOM   6583  C  CB  . SER B 1 338 ? 46.658  -6.172  29.378  1.00 7.90  ? 338  SER B CB  1 
ATOM   6584  O  OG  . SER B 1 338 ? 45.388  -6.225  30.022  1.00 10.35 ? 338  SER B OG  1 
ATOM   6585  N  N   . TYR B 1 339 ? 46.746  -3.090  28.940  1.00 6.46  ? 339  TYR B N   1 
ATOM   6586  C  CA  . TYR B 1 339 ? 46.254  -1.753  29.324  1.00 6.36  ? 339  TYR B CA  1 
ATOM   6587  C  C   . TYR B 1 339 ? 45.676  -0.953  28.160  1.00 6.55  ? 339  TYR B C   1 
ATOM   6588  O  O   . TYR B 1 339 ? 44.529  -0.537  28.209  1.00 7.34  ? 339  TYR B O   1 
ATOM   6589  C  CB  . TYR B 1 339 ? 47.350  -0.961  30.081  1.00 5.90  ? 339  TYR B CB  1 
ATOM   6590  C  CG  . TYR B 1 339 ? 47.624  -1.508  31.478  1.00 4.95  ? 339  TYR B CG  1 
ATOM   6591  C  CD1 . TYR B 1 339 ? 47.188  -0.833  32.611  1.00 3.78  ? 339  TYR B CD1 1 
ATOM   6592  C  CD2 . TYR B 1 339 ? 48.312  -2.720  31.652  1.00 3.80  ? 339  TYR B CD2 1 
ATOM   6593  C  CE1 . TYR B 1 339 ? 47.460  -1.344  33.904  1.00 5.71  ? 339  TYR B CE1 1 
ATOM   6594  C  CE2 . TYR B 1 339 ? 48.560  -3.241  32.895  1.00 4.16  ? 339  TYR B CE2 1 
ATOM   6595  C  CZ  . TYR B 1 339 ? 48.139  -2.558  34.034  1.00 6.15  ? 339  TYR B CZ  1 
ATOM   6596  O  OH  . TYR B 1 339 ? 48.418  -3.088  35.284  1.00 4.26  ? 339  TYR B OH  1 
ATOM   6597  N  N   . SER B 1 340 ? 46.463  -0.788  27.100  1.00 6.91  ? 340  SER B N   1 
ATOM   6598  C  CA  . SER B 1 340 ? 46.055  -0.077  25.907  1.00 6.85  ? 340  SER B CA  1 
ATOM   6599  C  C   . SER B 1 340 ? 44.956  -0.861  25.183  1.00 6.63  ? 340  SER B C   1 
ATOM   6600  O  O   . SER B 1 340 ? 44.103  -0.272  24.496  1.00 5.44  ? 340  SER B O   1 
ATOM   6601  C  CB  . SER B 1 340 ? 47.254  0.071   24.970  1.00 7.39  ? 340  SER B CB  1 
ATOM   6602  O  OG  . SER B 1 340 ? 48.298  0.793   25.604  1.00 9.94  ? 340  SER B OG  1 
ATOM   6603  N  N   . ASP B 1 341 ? 44.986  -2.186  25.325  1.00 6.28  ? 341  ASP B N   1 
ATOM   6604  C  CA  . ASP B 1 341 ? 43.981  -3.029  24.681  1.00 6.47  ? 341  ASP B CA  1 
ATOM   6605  C  C   . ASP B 1 341 ? 42.607  -2.771  25.289  1.00 6.07  ? 341  ASP B C   1 
ATOM   6606  O  O   . ASP B 1 341 ? 41.661  -2.482  24.590  1.00 4.86  ? 341  ASP B O   1 
ATOM   6607  C  CB  . ASP B 1 341 ? 44.316  -4.518  24.806  1.00 7.11  ? 341  ASP B CB  1 
ATOM   6608  C  CG  . ASP B 1 341 ? 43.238  -5.397  24.189  1.00 8.21  ? 341  ASP B CG  1 
ATOM   6609  O  OD1 . ASP B 1 341 ? 42.839  -5.135  23.030  1.00 8.41  ? 341  ASP B OD1 1 
ATOM   6610  O  OD2 . ASP B 1 341 ? 42.765  -6.327  24.859  1.00 9.30  ? 341  ASP B OD2 1 
ATOM   6611  N  N   . THR B 1 342 ? 42.530  -2.851  26.610  1.00 6.25  ? 342  THR B N   1 
ATOM   6612  C  CA  . THR B 1 342 ? 41.282  -2.617  27.323  1.00 6.26  ? 342  THR B CA  1 
ATOM   6613  C  C   . THR B 1 342 ? 40.764  -1.177  27.164  1.00 6.62  ? 342  THR B C   1 
ATOM   6614  O  O   . THR B 1 342 ? 39.561  -0.963  27.038  1.00 7.66  ? 342  THR B O   1 
ATOM   6615  C  CB  . THR B 1 342 ? 41.449  -3.021  28.820  1.00 6.59  ? 342  THR B CB  1 
ATOM   6616  O  OG1 . THR B 1 342 ? 40.169  -3.250  29.429  1.00 5.17  ? 342  THR B OG1 1 
ATOM   6617  C  CG2 . THR B 1 342 ? 42.284  -1.993  29.605  1.00 4.88  ? 342  THR B CG2 1 
ATOM   6618  N  N   . GLN B 1 343 ? 41.668  -0.201  27.167  1.00 6.47  ? 343  GLN B N   1 
ATOM   6619  C  CA  . GLN B 1 343 ? 41.318  1.210   26.984  1.00 6.49  ? 343  GLN B CA  1 
ATOM   6620  C  C   . GLN B 1 343 ? 40.692  1.507   25.595  1.00 7.21  ? 343  GLN B C   1 
ATOM   6621  O  O   . GLN B 1 343 ? 39.755  2.299   25.489  1.00 7.83  ? 343  GLN B O   1 
ATOM   6622  C  CB  . GLN B 1 343 ? 42.551  2.073   27.213  1.00 6.45  ? 343  GLN B CB  1 
ATOM   6623  C  CG  . GLN B 1 343 ? 42.960  2.150   28.678  1.00 5.28  ? 343  GLN B CG  1 
ATOM   6624  C  CD  . GLN B 1 343 ? 44.467  2.286   28.897  1.00 4.09  ? 343  GLN B CD  1 
ATOM   6625  O  OE1 . GLN B 1 343 ? 45.183  2.804   28.054  1.00 7.50  ? 343  GLN B OE1 1 
ATOM   6626  N  NE2 . GLN B 1 343 ? 44.940  1.838   30.047  1.00 2.55  ? 343  GLN B NE2 1 
ATOM   6627  N  N   . ARG B 1 344 ? 41.184  0.857   24.545  1.00 6.95  ? 344  ARG B N   1 
ATOM   6628  C  CA  . ARG B 1 344 ? 40.530  0.935   23.239  1.00 7.12  ? 344  ARG B CA  1 
ATOM   6629  C  C   . ARG B 1 344 ? 39.036  0.576   23.327  1.00 7.50  ? 344  ARG B C   1 
ATOM   6630  O  O   . ARG B 1 344 ? 38.201  1.165   22.622  1.00 7.15  ? 344  ARG B O   1 
ATOM   6631  C  CB  . ARG B 1 344 ? 41.254  0.043   22.216  1.00 6.61  ? 344  ARG B CB  1 
ATOM   6632  C  CG  . ARG B 1 344 ? 42.511  0.692   21.726  1.00 4.70  ? 344  ARG B CG  1 
ATOM   6633  C  CD  . ARG B 1 344 ? 43.471  -0.266  21.106  1.00 4.67  ? 344  ARG B CD  1 
ATOM   6634  N  NE  . ARG B 1 344 ? 44.804  0.338   21.134  1.00 4.75  ? 344  ARG B NE  1 
ATOM   6635  C  CZ  . ARG B 1 344 ? 45.904  -0.301  21.504  1.00 5.76  ? 344  ARG B CZ  1 
ATOM   6636  N  NH1 . ARG B 1 344 ? 45.866  -1.606  21.808  1.00 3.63  ? 344  ARG B NH1 1 
ATOM   6637  N  NH2 . ARG B 1 344 ? 47.049  0.357   21.535  1.00 7.85  ? 344  ARG B NH2 1 
ATOM   6638  N  N   . HIS B 1 345 ? 38.715  -0.369  24.214  1.00 7.00  ? 345  HIS B N   1 
ATOM   6639  C  CA  . HIS B 1 345 ? 37.333  -0.804  24.434  1.00 6.98  ? 345  HIS B CA  1 
ATOM   6640  C  C   . HIS B 1 345 ? 36.625  0.086   25.455  1.00 5.94  ? 345  HIS B C   1 
ATOM   6641  O  O   . HIS B 1 345 ? 35.570  0.619   25.183  1.00 5.50  ? 345  HIS B O   1 
ATOM   6642  C  CB  . HIS B 1 345 ? 37.331  -2.290  24.852  1.00 7.71  ? 345  HIS B CB  1 
ATOM   6643  C  CG  . HIS B 1 345 ? 36.244  -2.670  25.806  1.00 7.97  ? 345  HIS B CG  1 
ATOM   6644  N  ND1 . HIS B 1 345 ? 34.958  -2.946  25.401  1.00 8.33  ? 345  HIS B ND1 1 
ATOM   6645  C  CD2 . HIS B 1 345 ? 36.268  -2.859  27.144  1.00 8.91  ? 345  HIS B CD2 1 
ATOM   6646  C  CE1 . HIS B 1 345 ? 34.231  -3.276  26.451  1.00 10.80 ? 345  HIS B CE1 1 
ATOM   6647  N  NE2 . HIS B 1 345 ? 35.003  -3.230  27.523  1.00 11.06 ? 345  HIS B NE2 1 
ATOM   6648  N  N   . ARG B 1 346 ? 37.250  0.285   26.605  1.00 5.50  ? 346  ARG B N   1 
ATOM   6649  C  CA  . ARG B 1 346 ? 36.664  1.050   27.708  1.00 4.98  ? 346  ARG B CA  1 
ATOM   6650  C  C   . ARG B 1 346 ? 36.512  2.573   27.435  1.00 5.34  ? 346  ARG B C   1 
ATOM   6651  O  O   . ARG B 1 346 ? 35.530  3.206   27.849  1.00 4.36  ? 346  ARG B O   1 
ATOM   6652  C  CB  . ARG B 1 346 ? 37.495  0.801   28.982  1.00 4.57  ? 346  ARG B CB  1 
ATOM   6653  C  CG  . ARG B 1 346 ? 37.108  1.667   30.205  1.00 3.87  ? 346  ARG B CG  1 
ATOM   6654  C  CD  . ARG B 1 346 ? 37.906  1.290   31.451  1.00 3.51  ? 346  ARG B CD  1 
ATOM   6655  N  NE  . ARG B 1 346 ? 39.274  1.839   31.470  1.00 2.94  ? 346  ARG B NE  1 
ATOM   6656  C  CZ  . ARG B 1 346 ? 39.593  3.108   31.754  1.00 4.01  ? 346  ARG B CZ  1 
ATOM   6657  N  NH1 . ARG B 1 346 ? 40.863  3.463   31.780  1.00 2.03  ? 346  ARG B NH1 1 
ATOM   6658  N  NH2 . ARG B 1 346 ? 38.656  4.030   32.013  1.00 3.71  ? 346  ARG B NH2 1 
ATOM   6659  N  N   . ILE B 1 347 ? 37.506  3.169   26.789  1.00 5.57  ? 347  ILE B N   1 
ATOM   6660  C  CA  . ILE B 1 347 ? 37.467  4.602   26.580  1.00 5.62  ? 347  ILE B CA  1 
ATOM   6661  C  C   . ILE B 1 347 ? 37.121  4.877   25.128  1.00 6.13  ? 347  ILE B C   1 
ATOM   6662  O  O   . ILE B 1 347 ? 36.250  5.701   24.841  1.00 6.45  ? 347  ILE B O   1 
ATOM   6663  C  CB  . ILE B 1 347 ? 38.793  5.295   26.991  1.00 5.82  ? 347  ILE B CB  1 
ATOM   6664  C  CG1 . ILE B 1 347 ? 39.256  4.842   28.383  1.00 5.59  ? 347  ILE B CG1 1 
ATOM   6665  C  CG2 . ILE B 1 347 ? 38.614  6.820   26.983  1.00 5.40  ? 347  ILE B CG2 1 
ATOM   6666  C  CD1 . ILE B 1 347 ? 40.793  5.050   28.643  1.00 5.63  ? 347  ILE B CD1 1 
ATOM   6667  N  N   . GLY B 1 348 ? 37.807  4.192   24.206  1.00 6.59  ? 348  GLY B N   1 
ATOM   6668  C  CA  . GLY B 1 348 ? 37.540  4.349   22.788  1.00 6.60  ? 348  GLY B CA  1 
ATOM   6669  C  C   . GLY B 1 348 ? 38.789  4.245   21.956  1.00 7.26  ? 348  GLY B C   1 
ATOM   6670  O  O   . GLY B 1 348 ? 39.878  4.490   22.467  1.00 8.82  ? 348  GLY B O   1 
ATOM   6671  N  N   . PRO B 1 349 ? 38.653  3.855   20.672  1.00 6.71  ? 349  PRO B N   1 
ATOM   6672  C  CA  . PRO B 1 349 ? 39.799  3.768   19.780  1.00 6.64  ? 349  PRO B CA  1 
ATOM   6673  C  C   . PRO B 1 349 ? 40.680  5.018   19.750  1.00 7.35  ? 349  PRO B C   1 
ATOM   6674  O  O   . PRO B 1 349 ? 41.907  4.907   19.568  1.00 7.48  ? 349  PRO B O   1 
ATOM   6675  C  CB  . PRO B 1 349 ? 39.140  3.526   18.427  1.00 5.99  ? 349  PRO B CB  1 
ATOM   6676  C  CG  . PRO B 1 349 ? 37.929  2.740   18.786  1.00 5.08  ? 349  PRO B CG  1 
ATOM   6677  C  CD  . PRO B 1 349 ? 37.416  3.409   19.992  1.00 6.15  ? 349  PRO B CD  1 
ATOM   6678  N  N   . ASN B 1 350 ? 40.066  6.190   19.916  1.00 7.39  ? 350  ASN B N   1 
ATOM   6679  C  CA  . ASN B 1 350 ? 40.807  7.449   19.893  1.00 7.45  ? 350  ASN B CA  1 
ATOM   6680  C  C   . ASN B 1 350 ? 41.034  8.003   21.325  1.00 7.88  ? 350  ASN B C   1 
ATOM   6681  O  O   . ASN B 1 350 ? 41.112  9.219   21.533  1.00 7.50  ? 350  ASN B O   1 
ATOM   6682  C  CB  . ASN B 1 350 ? 40.089  8.457   18.997  1.00 7.35  ? 350  ASN B CB  1 
ATOM   6683  C  CG  . ASN B 1 350 ? 40.335  8.216   17.538  1.00 7.56  ? 350  ASN B CG  1 
ATOM   6684  O  OD1 . ASN B 1 350 ? 41.466  7.979   17.112  1.00 10.64 ? 350  ASN B OD1 1 
ATOM   6685  N  ND2 . ASN B 1 350 ? 39.276  8.285   16.747  1.00 8.52  ? 350  ASN B ND2 1 
ATOM   6686  N  N   . TYR B 1 351 ? 41.163  7.092   22.300  1.00 7.91  ? 351  TYR B N   1 
ATOM   6687  C  CA  . TYR B 1 351 ? 41.302  7.476   23.702  1.00 7.88  ? 351  TYR B CA  1 
ATOM   6688  C  C   . TYR B 1 351 ? 42.493  8.402   23.946  1.00 7.96  ? 351  TYR B C   1 
ATOM   6689  O  O   . TYR B 1 351 ? 42.415  9.302   24.773  1.00 7.71  ? 351  TYR B O   1 
ATOM   6690  C  CB  . TYR B 1 351 ? 41.344  6.244   24.616  1.00 7.27  ? 351  TYR B CB  1 
ATOM   6691  C  CG  . TYR B 1 351 ? 42.671  5.510   24.687  1.00 7.36  ? 351  TYR B CG  1 
ATOM   6692  C  CD1 . TYR B 1 351 ? 43.602  5.784   25.724  1.00 4.92  ? 351  TYR B CD1 1 
ATOM   6693  C  CD2 . TYR B 1 351 ? 43.000  4.523   23.738  1.00 5.87  ? 351  TYR B CD2 1 
ATOM   6694  C  CE1 . TYR B 1 351 ? 44.807  5.083   25.811  1.00 4.11  ? 351  TYR B CE1 1 
ATOM   6695  C  CE2 . TYR B 1 351 ? 44.216  3.819   23.815  1.00 3.71  ? 351  TYR B CE2 1 
ATOM   6696  C  CZ  . TYR B 1 351 ? 45.113  4.107   24.851  1.00 5.44  ? 351  TYR B CZ  1 
ATOM   6697  O  OH  . TYR B 1 351 ? 46.318  3.423   24.917  1.00 6.26  ? 351  TYR B OH  1 
ATOM   6698  N  N   . GLN B 1 352 ? 43.583  8.188   23.212  1.00 8.41  ? 352  GLN B N   1 
ATOM   6699  C  CA  . GLN B 1 352 ? 44.759  9.072   23.285  1.00 8.75  ? 352  GLN B CA  1 
ATOM   6700  C  C   . GLN B 1 352 ? 44.526  10.529  22.856  1.00 9.42  ? 352  GLN B C   1 
ATOM   6701  O  O   . GLN B 1 352 ? 45.410  11.372  23.048  1.00 9.78  ? 352  GLN B O   1 
ATOM   6702  C  CB  . GLN B 1 352 ? 45.938  8.469   22.508  1.00 8.58  ? 352  GLN B CB  1 
ATOM   6703  C  CG  . GLN B 1 352 ? 46.887  7.605   23.378  1.00 8.26  ? 352  GLN B CG  1 
ATOM   6704  C  CD  . GLN B 1 352 ? 47.352  8.341   24.640  1.00 8.76  ? 352  GLN B CD  1 
ATOM   6705  O  OE1 . GLN B 1 352 ? 46.847  8.095   25.735  1.00 7.46  ? 352  GLN B OE1 1 
ATOM   6706  N  NE2 . GLN B 1 352 ? 48.290  9.274   24.479  1.00 9.26  ? 352  GLN B NE2 1 
ATOM   6707  N  N   . GLN B 1 353 ? 43.347  10.822  22.288  1.00 9.67  ? 353  GLN B N   1 
ATOM   6708  C  CA  . GLN B 1 353 ? 43.004  12.175  21.829  1.00 9.35  ? 353  GLN B CA  1 
ATOM   6709  C  C   . GLN B 1 353 ? 42.333  13.007  22.925  1.00 8.81  ? 353  GLN B C   1 
ATOM   6710  O  O   . GLN B 1 353 ? 42.245  14.221  22.814  1.00 7.95  ? 353  GLN B O   1 
ATOM   6711  C  CB  . GLN B 1 353 ? 42.110  12.131  20.579  1.00 9.70  ? 353  GLN B CB  1 
ATOM   6712  C  CG  . GLN B 1 353 ? 42.777  11.600  19.269  1.00 9.72  ? 353  GLN B CG  1 
ATOM   6713  C  CD  . GLN B 1 353 ? 41.880  11.754  18.037  1.00 9.93  ? 353  GLN B CD  1 
ATOM   6714  O  OE1 . GLN B 1 353 ? 40.758  12.269  18.130  1.00 11.11 ? 353  GLN B OE1 1 
ATOM   6715  N  NE2 . GLN B 1 353 ? 42.369  11.309  16.885  1.00 7.70  ? 353  GLN B NE2 1 
ATOM   6716  N  N   . LEU B 1 354 ? 41.858  12.352  23.985  1.00 8.67  ? 354  LEU B N   1 
ATOM   6717  C  CA  . LEU B 1 354 ? 41.211  13.064  25.102  1.00 7.99  ? 354  LEU B CA  1 
ATOM   6718  C  C   . LEU B 1 354 ? 42.214  13.881  25.900  1.00 7.60  ? 354  LEU B C   1 
ATOM   6719  O  O   . LEU B 1 354 ? 43.334  13.416  26.110  1.00 7.98  ? 354  LEU B O   1 
ATOM   6720  C  CB  . LEU B 1 354 ? 40.499  12.085  26.039  1.00 7.93  ? 354  LEU B CB  1 
ATOM   6721  C  CG  . LEU B 1 354 ? 39.301  11.339  25.454  1.00 6.95  ? 354  LEU B CG  1 
ATOM   6722  C  CD1 . LEU B 1 354 ? 38.878  10.340  26.481  1.00 3.64  ? 354  LEU B CD1 1 
ATOM   6723  C  CD2 . LEU B 1 354 ? 38.143  12.293  25.068  1.00 6.72  ? 354  LEU B CD2 1 
ATOM   6724  N  N   . PRO B 1 355 ? 41.829  15.107  26.309  1.00 7.33  ? 355  PRO B N   1 
ATOM   6725  C  CA  . PRO B 1 355 ? 42.679  16.044  27.089  1.00 7.59  ? 355  PRO B CA  1 
ATOM   6726  C  C   . PRO B 1 355 ? 43.549  15.433  28.215  1.00 7.92  ? 355  PRO B C   1 
ATOM   6727  O  O   . PRO B 1 355 ? 44.726  15.770  28.342  1.00 7.83  ? 355  PRO B O   1 
ATOM   6728  C  CB  . PRO B 1 355 ? 41.663  17.042  27.649  1.00 6.82  ? 355  PRO B CB  1 
ATOM   6729  C  CG  . PRO B 1 355 ? 40.606  17.084  26.545  1.00 7.81  ? 355  PRO B CG  1 
ATOM   6730  C  CD  . PRO B 1 355 ? 40.520  15.709  25.966  1.00 6.72  ? 355  PRO B CD  1 
ATOM   6731  N  N   . ILE B 1 356 ? 42.964  14.541  29.010  1.00 8.60  ? 356  ILE B N   1 
ATOM   6732  C  CA  . ILE B 1 356 ? 43.666  13.875  30.087  1.00 8.59  ? 356  ILE B CA  1 
ATOM   6733  C  C   . ILE B 1 356 ? 44.720  12.877  29.574  1.00 9.74  ? 356  ILE B C   1 
ATOM   6734  O  O   . ILE B 1 356 ? 45.744  12.652  30.251  1.00 10.45 ? 356  ILE B O   1 
ATOM   6735  C  CB  . ILE B 1 356 ? 42.666  13.197  31.057  1.00 8.64  ? 356  ILE B CB  1 
ATOM   6736  C  CG1 . ILE B 1 356 ? 43.338  12.907  32.417  1.00 7.73  ? 356  ILE B CG1 1 
ATOM   6737  C  CG2 . ILE B 1 356 ? 41.980  11.985  30.404  1.00 7.04  ? 356  ILE B CG2 1 
ATOM   6738  C  CD1 . ILE B 1 356 ? 43.690  14.199  33.238  1.00 5.94  ? 356  ILE B CD1 1 
ATOM   6739  N  N   . ASN B 1 357 ? 44.510  12.310  28.382  1.00 9.34  ? 357  ASN B N   1 
ATOM   6740  C  CA  . ASN B 1 357 ? 45.497  11.376  27.830  1.00 9.83  ? 357  ASN B CA  1 
ATOM   6741  C  C   . ASN B 1 357 ? 46.509  11.974  26.852  1.00 10.61 ? 357  ASN B C   1 
ATOM   6742  O  O   . ASN B 1 357 ? 47.551  11.376  26.553  1.00 10.09 ? 357  ASN B O   1 
ATOM   6743  C  CB  . ASN B 1 357 ? 44.795  10.189  27.213  1.00 8.22  ? 357  ASN B CB  1 
ATOM   6744  C  CG  . ASN B 1 357 ? 44.067  9.374   28.237  1.00 8.15  ? 357  ASN B CG  1 
ATOM   6745  O  OD1 . ASN B 1 357 ? 44.628  9.065   29.313  1.00 6.31  ? 357  ASN B OD1 1 
ATOM   6746  N  ND2 . ASN B 1 357 ? 42.801  9.000   27.927  1.00 3.52  ? 357  ASN B ND2 1 
ATOM   6747  N  N   . CYS B 1 358 ? 46.175  13.151  26.346  1.00 12.54 ? 358  CYS B N   1 
ATOM   6748  C  CA  . CYS B 1 358 ? 46.948  13.812  25.320  1.00 12.62 ? 358  CYS B CA  1 
ATOM   6749  C  C   . CYS B 1 358 ? 48.367  14.141  25.802  1.00 12.30 ? 358  CYS B C   1 
ATOM   6750  O  O   . CYS B 1 358 ? 48.539  14.680  26.897  1.00 11.84 ? 358  CYS B O   1 
ATOM   6751  C  CB  . CYS B 1 358 ? 46.220  15.086  24.899  1.00 12.88 ? 358  CYS B CB  1 
ATOM   6752  S  SG  . CYS B 1 358 ? 46.731  15.696  23.290  1.00 17.08 ? 358  CYS B SG  1 
ATOM   6753  N  N   . PRO B 1 359 ? 49.390  13.820  24.981  1.00 12.23 ? 359  PRO B N   1 
ATOM   6754  C  CA  . PRO B 1 359 ? 50.788  14.169  25.318  1.00 12.29 ? 359  PRO B CA  1 
ATOM   6755  C  C   . PRO B 1 359 ? 51.019  15.680  25.464  1.00 12.58 ? 359  PRO B C   1 
ATOM   6756  O  O   . PRO B 1 359 ? 50.267  16.453  24.903  1.00 11.49 ? 359  PRO B O   1 
ATOM   6757  C  CB  . PRO B 1 359 ? 51.585  13.652  24.114  1.00 11.47 ? 359  PRO B CB  1 
ATOM   6758  C  CG  . PRO B 1 359 ? 50.699  12.682  23.452  1.00 11.90 ? 359  PRO B CG  1 
ATOM   6759  C  CD  . PRO B 1 359 ? 49.292  13.106  23.695  1.00 11.28 ? 359  PRO B CD  1 
ATOM   6760  N  N   . PHE B 1 360 ? 52.057  16.082  26.208  1.00 13.77 ? 360  PHE B N   1 
ATOM   6761  C  CA  . PHE B 1 360 ? 52.555  17.456  26.120  1.00 15.17 ? 360  PHE B CA  1 
ATOM   6762  C  C   . PHE B 1 360 ? 53.215  17.681  24.750  1.00 15.43 ? 360  PHE B C   1 
ATOM   6763  O  O   . PHE B 1 360 ? 52.927  18.675  24.067  1.00 15.13 ? 360  PHE B O   1 
ATOM   6764  C  CB  . PHE B 1 360 ? 53.564  17.780  27.216  1.00 15.87 ? 360  PHE B CB  1 
ATOM   6765  C  CG  . PHE B 1 360 ? 54.242  19.126  27.027  1.00 18.16 ? 360  PHE B CG  1 
ATOM   6766  C  CD1 . PHE B 1 360 ? 53.619  20.307  27.462  1.00 19.31 ? 360  PHE B CD1 1 
ATOM   6767  C  CD2 . PHE B 1 360 ? 55.499  19.212  26.402  1.00 18.49 ? 360  PHE B CD2 1 
ATOM   6768  C  CE1 . PHE B 1 360 ? 54.245  21.568  27.275  1.00 20.49 ? 360  PHE B CE1 1 
ATOM   6769  C  CE2 . PHE B 1 360 ? 56.131  20.451  26.203  1.00 20.25 ? 360  PHE B CE2 1 
ATOM   6770  C  CZ  . PHE B 1 360 ? 55.506  21.637  26.645  1.00 19.73 ? 360  PHE B CZ  1 
ATOM   6771  N  N   . ALA B 1 361 ? 54.092  16.746  24.375  1.00 15.16 ? 361  ALA B N   1 
ATOM   6772  C  CA  . ALA B 1 361 ? 54.782  16.753  23.097  1.00 15.65 ? 361  ALA B CA  1 
ATOM   6773  C  C   . ALA B 1 361 ? 53.763  16.634  21.971  1.00 16.31 ? 361  ALA B C   1 
ATOM   6774  O  O   . ALA B 1 361 ? 52.713  16.021  22.146  1.00 17.07 ? 361  ALA B O   1 
ATOM   6775  C  CB  . ALA B 1 361 ? 55.765  15.600  23.043  1.00 15.06 ? 361  ALA B CB  1 
ATOM   6776  N  N   . GLN B 1 362 ? 54.062  17.212  20.815  1.00 17.17 ? 362  GLN B N   1 
ATOM   6777  C  CA  . GLN B 1 362 ? 53.114  17.169  19.718  1.00 17.00 ? 362  GLN B CA  1 
ATOM   6778  C  C   . GLN B 1 362 ? 53.055  15.768  19.128  1.00 16.18 ? 362  GLN B C   1 
ATOM   6779  O  O   . GLN B 1 362 ? 54.040  15.029  19.150  1.00 16.68 ? 362  GLN B O   1 
ATOM   6780  C  CB  . GLN B 1 362 ? 53.399  18.269  18.677  1.00 17.56 ? 362  GLN B CB  1 
ATOM   6781  C  CG  . GLN B 1 362 ? 52.590  18.209  17.338  1.00 20.06 ? 362  GLN B CG  1 
ATOM   6782  C  CD  . GLN B 1 362 ? 51.029  18.260  17.423  1.00 27.23 ? 362  GLN B CD  1 
ATOM   6783  O  OE1 . GLN B 1 362 ? 50.391  17.671  18.318  1.00 27.49 ? 362  GLN B OE1 1 
ATOM   6784  N  NE2 . GLN B 1 362 ? 50.416  18.926  16.419  1.00 29.53 ? 362  GLN B NE2 1 
ATOM   6785  N  N   . VAL B 1 363 ? 51.867  15.392  18.665  1.00 14.87 ? 363  VAL B N   1 
ATOM   6786  C  CA  . VAL B 1 363 ? 51.641  14.115  18.005  1.00 13.50 ? 363  VAL B CA  1 
ATOM   6787  C  C   . VAL B 1 363 ? 51.546  14.330  16.504  1.00 12.70 ? 363  VAL B C   1 
ATOM   6788  O  O   . VAL B 1 363 ? 50.674  15.057  16.044  1.00 12.31 ? 363  VAL B O   1 
ATOM   6789  C  CB  . VAL B 1 363 ? 50.362  13.407  18.542  1.00 13.45 ? 363  VAL B CB  1 
ATOM   6790  C  CG1 . VAL B 1 363 ? 49.992  12.161  17.674  1.00 12.54 ? 363  VAL B CG1 1 
ATOM   6791  C  CG2 . VAL B 1 363 ? 50.561  13.022  20.008  1.00 12.41 ? 363  VAL B CG2 1 
ATOM   6792  N  N   . ASN B 1 364 ? 52.447  13.687  15.763  1.00 11.96 ? 364  ASN B N   1 
ATOM   6793  C  CA  . ASN B 1 364 ? 52.536  13.824  14.309  1.00 11.81 ? 364  ASN B CA  1 
ATOM   6794  C  C   . ASN B 1 364 ? 52.791  12.474  13.679  1.00 11.31 ? 364  ASN B C   1 
ATOM   6795  O  O   . ASN B 1 364 ? 53.907  11.953  13.747  1.00 11.50 ? 364  ASN B O   1 
ATOM   6796  C  CB  . ASN B 1 364 ? 53.688  14.755  13.911  1.00 11.83 ? 364  ASN B CB  1 
ATOM   6797  C  CG  . ASN B 1 364 ? 53.441  16.205  14.298  1.00 13.67 ? 364  ASN B CG  1 
ATOM   6798  O  OD1 . ASN B 1 364 ? 52.544  16.875  13.757  1.00 15.81 ? 364  ASN B OD1 1 
ATOM   6799  N  ND2 . ASN B 1 364 ? 54.256  16.708  15.213  1.00 11.73 ? 364  ASN B ND2 1 
ATOM   6800  N  N   . ASN B 1 365 ? 51.769  11.899  13.063  1.00 10.44 ? 365  ASN B N   1 
ATOM   6801  C  CA  . ASN B 1 365 ? 51.948  10.628  12.394  1.00 9.75  ? 365  ASN B CA  1 
ATOM   6802  C  C   . ASN B 1 365 ? 50.905  10.377  11.348  1.00 9.50  ? 365  ASN B C   1 
ATOM   6803  O  O   . ASN B 1 365 ? 50.114  11.262  11.015  1.00 9.80  ? 365  ASN B O   1 
ATOM   6804  C  CB  . ASN B 1 365 ? 51.991  9.457   13.388  1.00 9.82  ? 365  ASN B CB  1 
ATOM   6805  C  CG  . ASN B 1 365 ? 50.709  9.306   14.195  1.00 9.41  ? 365  ASN B CG  1 
ATOM   6806  O  OD1 . ASN B 1 365 ? 49.600  9.644   13.725  1.00 8.95  ? 365  ASN B OD1 1 
ATOM   6807  N  ND2 . ASN B 1 365 ? 50.854  8.797   15.425  1.00 4.25  ? 365  ASN B ND2 1 
ATOM   6808  N  N   . TYR B 1 366 ? 50.882  9.140   10.872  1.00 9.48  ? 366  TYR B N   1 
ATOM   6809  C  CA  . TYR B 1 366 ? 50.061  8.753   9.732   1.00 9.33  ? 366  TYR B CA  1 
ATOM   6810  C  C   . TYR B 1 366 ? 48.793  7.967   10.051  1.00 9.13  ? 366  TYR B C   1 
ATOM   6811  O  O   . TYR B 1 366 ? 48.092  7.559   9.127   1.00 8.86  ? 366  TYR B O   1 
ATOM   6812  C  CB  . TYR B 1 366 ? 50.936  8.010   8.730   1.00 9.68  ? 366  TYR B CB  1 
ATOM   6813  C  CG  . TYR B 1 366 ? 52.047  8.887   8.245   1.00 9.80  ? 366  TYR B CG  1 
ATOM   6814  C  CD1 . TYR B 1 366 ? 53.302  8.862   8.857   1.00 11.65 ? 366  TYR B CD1 1 
ATOM   6815  C  CD2 . TYR B 1 366 ? 51.830  9.790   7.215   1.00 9.41  ? 366  TYR B CD2 1 
ATOM   6816  C  CE1 . TYR B 1 366 ? 54.318  9.700   8.405   1.00 12.40 ? 366  TYR B CE1 1 
ATOM   6817  C  CE2 . TYR B 1 366 ? 52.829  10.617  6.766   1.00 10.09 ? 366  TYR B CE2 1 
ATOM   6818  C  CZ  . TYR B 1 366 ? 54.065  10.559  7.347   1.00 9.79  ? 366  TYR B CZ  1 
ATOM   6819  O  OH  . TYR B 1 366 ? 55.031  11.393  6.901   1.00 10.04 ? 366  TYR B OH  1 
ATOM   6820  N  N   . GLN B 1 367 ? 48.498  7.773   11.346  1.00 8.64  ? 367  GLN B N   1 
ATOM   6821  C  CA  . GLN B 1 367 ? 47.238  7.155   11.782  1.00 8.93  ? 367  GLN B CA  1 
ATOM   6822  C  C   . GLN B 1 367 ? 46.020  8.065   11.481  1.00 9.17  ? 367  GLN B C   1 
ATOM   6823  O  O   . GLN B 1 367 ? 46.129  9.295   11.558  1.00 9.34  ? 367  GLN B O   1 
ATOM   6824  C  CB  . GLN B 1 367 ? 47.282  6.836   13.281  1.00 9.16  ? 367  GLN B CB  1 
ATOM   6825  C  CG  . GLN B 1 367 ? 48.382  5.848   13.711  1.00 9.45  ? 367  GLN B CG  1 
ATOM   6826  C  CD  . GLN B 1 367 ? 48.376  5.584   15.207  1.00 9.16  ? 367  GLN B CD  1 
ATOM   6827  O  OE1 . GLN B 1 367 ? 47.337  5.623   15.863  1.00 11.36 ? 367  GLN B OE1 1 
ATOM   6828  N  NE2 . GLN B 1 367 ? 49.526  5.301   15.744  1.00 8.15  ? 367  GLN B NE2 1 
ATOM   6829  N  N   . ARG B 1 368 ? 44.871  7.457   11.162  1.00 8.49  ? 368  ARG B N   1 
ATOM   6830  C  CA  . ARG B 1 368 ? 43.677  8.184   10.755  1.00 8.44  ? 368  ARG B CA  1 
ATOM   6831  C  C   . ARG B 1 368 ? 42.374  7.553   11.239  1.00 8.56  ? 368  ARG B C   1 
ATOM   6832  O  O   . ARG B 1 368 ? 42.314  6.370   11.561  1.00 8.87  ? 368  ARG B O   1 
ATOM   6833  C  CB  . ARG B 1 368 ? 43.614  8.304   9.226   1.00 8.56  ? 368  ARG B CB  1 
ATOM   6834  C  CG  . ARG B 1 368 ? 44.726  9.179   8.580   1.00 9.85  ? 368  ARG B CG  1 
ATOM   6835  C  CD  . ARG B 1 368 ? 44.642  10.663  9.008   1.00 9.32  ? 368  ARG B CD  1 
ATOM   6836  N  NE  . ARG B 1 368 ? 45.649  11.479  8.334   1.00 8.97  ? 368  ARG B NE  1 
ATOM   6837  C  CZ  . ARG B 1 368 ? 46.923  11.602  8.720   1.00 8.39  ? 368  ARG B CZ  1 
ATOM   6838  N  NH1 . ARG B 1 368 ? 47.383  10.961  9.802   1.00 6.92  ? 368  ARG B NH1 1 
ATOM   6839  N  NH2 . ARG B 1 368 ? 47.742  12.389  8.027   1.00 6.00  ? 368  ARG B NH2 1 
ATOM   6840  N  N   . ASP B 1 369 ? 41.325  8.367   11.271  1.00 8.71  ? 369  ASP B N   1 
ATOM   6841  C  CA  . ASP B 1 369 ? 39.952  7.893   11.401  1.00 9.02  ? 369  ASP B CA  1 
ATOM   6842  C  C   . ASP B 1 369 ? 39.682  7.294   12.798  1.00 9.36  ? 369  ASP B C   1 
ATOM   6843  O  O   . ASP B 1 369 ? 40.205  7.793   13.811  1.00 9.56  ? 369  ASP B O   1 
ATOM   6844  C  CB  . ASP B 1 369 ? 39.603  6.923   10.247  1.00 8.87  ? 369  ASP B CB  1 
ATOM   6845  C  CG  . ASP B 1 369 ? 39.719  7.573   8.831   1.00 9.94  ? 369  ASP B CG  1 
ATOM   6846  O  OD1 . ASP B 1 369 ? 39.306  6.922   7.849   1.00 12.16 ? 369  ASP B OD1 1 
ATOM   6847  O  OD2 . ASP B 1 369 ? 40.201  8.717   8.672   1.00 10.61 ? 369  ASP B OD2 1 
ATOM   6848  N  N   . GLY B 1 370 ? 38.868  6.244   12.864  1.00 9.06  ? 370  GLY B N   1 
ATOM   6849  C  CA  . GLY B 1 370 ? 38.422  5.719   14.151  1.00 9.16  ? 370  GLY B CA  1 
ATOM   6850  C  C   . GLY B 1 370 ? 37.308  6.602   14.727  1.00 9.47  ? 370  GLY B C   1 
ATOM   6851  O  O   . GLY B 1 370 ? 37.246  7.813   14.442  1.00 9.03  ? 370  GLY B O   1 
ATOM   6852  N  N   . ALA B 1 371 ? 36.442  5.988   15.538  1.00 8.93  ? 371  ALA B N   1 
ATOM   6853  C  CA  . ALA B 1 371 ? 35.270  6.639   16.084  1.00 9.34  ? 371  ALA B CA  1 
ATOM   6854  C  C   . ALA B 1 371 ? 35.633  7.911   16.867  1.00 9.68  ? 371  ALA B C   1 
ATOM   6855  O  O   . ALA B 1 371 ? 36.605  7.942   17.625  1.00 9.71  ? 371  ALA B O   1 
ATOM   6856  C  CB  . ALA B 1 371 ? 34.494  5.667   16.969  1.00 9.00  ? 371  ALA B CB  1 
ATOM   6857  N  N   . MET B 1 372 ? 34.839  8.953   16.651  1.00 9.67  ? 372  MET B N   1 
ATOM   6858  C  CA  . MET B 1 372 ? 34.976  10.223  17.334  1.00 10.27 ? 372  MET B CA  1 
ATOM   6859  C  C   . MET B 1 372 ? 36.356  10.830  17.086  1.00 10.77 ? 372  MET B C   1 
ATOM   6860  O  O   . MET B 1 372 ? 37.141  11.025  18.027  1.00 10.11 ? 372  MET B O   1 
ATOM   6861  C  CB  . MET B 1 372 ? 34.647  10.077  18.825  1.00 10.18 ? 372  MET B CB  1 
ATOM   6862  C  CG  . MET B 1 372 ? 33.199  9.616   19.092  1.00 10.76 ? 372  MET B CG  1 
ATOM   6863  S  SD  . MET B 1 372 ? 31.966  10.872  18.704  1.00 12.21 ? 372  MET B SD  1 
ATOM   6864  C  CE  . MET B 1 372 ? 32.559  12.246  19.684  1.00 9.91  ? 372  MET B CE  1 
ATOM   6865  N  N   . PRO B 1 373 ? 36.645  11.149  15.805  1.00 11.30 ? 373  PRO B N   1 
ATOM   6866  C  CA  . PRO B 1 373 ? 37.961  11.603  15.387  1.00 11.66 ? 373  PRO B CA  1 
ATOM   6867  C  C   . PRO B 1 373 ? 38.171  13.092  15.654  1.00 12.40 ? 373  PRO B C   1 
ATOM   6868  O  O   . PRO B 1 373 ? 38.460  13.841  14.734  1.00 13.11 ? 373  PRO B O   1 
ATOM   6869  C  CB  . PRO B 1 373 ? 37.934  11.338  13.890  1.00 11.49 ? 373  PRO B CB  1 
ATOM   6870  C  CG  . PRO B 1 373 ? 36.508  11.474  13.507  1.00 10.25 ? 373  PRO B CG  1 
ATOM   6871  C  CD  . PRO B 1 373 ? 35.685  11.148  14.681  1.00 11.02 ? 373  PRO B CD  1 
ATOM   6872  N  N   . PHE B 1 374 ? 38.052  13.509  16.909  1.00 13.57 ? 374  PHE B N   1 
ATOM   6873  C  CA  . PHE B 1 374 ? 38.173  14.922  17.291  1.00 14.82 ? 374  PHE B CA  1 
ATOM   6874  C  C   . PHE B 1 374 ? 39.429  15.633  16.834  1.00 14.93 ? 374  PHE B C   1 
ATOM   6875  O  O   . PHE B 1 374 ? 39.375  16.809  16.461  1.00 14.67 ? 374  PHE B O   1 
ATOM   6876  C  CB  . PHE B 1 374 ? 38.138  15.048  18.798  1.00 15.69 ? 374  PHE B CB  1 
ATOM   6877  C  CG  . PHE B 1 374 ? 36.791  15.261  19.342  1.00 18.28 ? 374  PHE B CG  1 
ATOM   6878  C  CD1 . PHE B 1 374 ? 36.091  14.195  19.935  1.00 21.26 ? 374  PHE B CD1 1 
ATOM   6879  C  CD2 . PHE B 1 374 ? 36.205  16.525  19.283  1.00 19.19 ? 374  PHE B CD2 1 
ATOM   6880  C  CE1 . PHE B 1 374 ? 34.821  14.393  20.459  1.00 21.38 ? 374  PHE B CE1 1 
ATOM   6881  C  CE2 . PHE B 1 374 ? 34.943  16.728  19.805  1.00 20.99 ? 374  PHE B CE2 1 
ATOM   6882  C  CZ  . PHE B 1 374 ? 34.240  15.663  20.389  1.00 20.16 ? 374  PHE B CZ  1 
ATOM   6883  N  N   . LYS B 1 375 ? 40.555  14.925  16.935  1.00 15.07 ? 375  LYS B N   1 
ATOM   6884  C  CA  . LYS B 1 375 ? 41.871  15.467  16.644  1.00 15.39 ? 375  LYS B CA  1 
ATOM   6885  C  C   . LYS B 1 375 ? 42.425  14.889  15.364  1.00 14.82 ? 375  LYS B C   1 
ATOM   6886  O  O   . LYS B 1 375 ? 43.640  14.799  15.198  1.00 14.62 ? 375  LYS B O   1 
ATOM   6887  C  CB  . LYS B 1 375 ? 42.841  15.199  17.802  1.00 15.33 ? 375  LYS B CB  1 
ATOM   6888  C  CG  . LYS B 1 375 ? 42.438  15.880  19.125  1.00 19.23 ? 375  LYS B CG  1 
ATOM   6889  C  CD  . LYS B 1 375 ? 42.985  17.281  19.252  1.00 23.69 ? 375  LYS B CD  1 
ATOM   6890  C  CE  . LYS B 1 375 ? 44.408  17.266  19.818  1.00 27.77 ? 375  LYS B CE  1 
ATOM   6891  N  NZ  . LYS B 1 375 ? 45.286  18.382  19.242  1.00 29.18 ? 375  LYS B NZ  1 
ATOM   6892  N  N   . GLN B 1 376 ? 41.531  14.493  14.461  1.00 14.56 ? 376  GLN B N   1 
ATOM   6893  C  CA  . GLN B 1 376 ? 41.926  14.008  13.133  1.00 14.24 ? 376  GLN B CA  1 
ATOM   6894  C  C   . GLN B 1 376 ? 43.044  14.874  12.547  1.00 14.46 ? 376  GLN B C   1 
ATOM   6895  O  O   . GLN B 1 376 ? 42.901  16.100  12.465  1.00 14.25 ? 376  GLN B O   1 
ATOM   6896  C  CB  . GLN B 1 376 ? 40.708  14.001  12.183  1.00 13.80 ? 376  GLN B CB  1 
ATOM   6897  C  CG  . GLN B 1 376 ? 40.964  13.405  10.761  1.00 12.84 ? 376  GLN B CG  1 
ATOM   6898  C  CD  . GLN B 1 376 ? 40.900  11.884  10.729  1.00 10.06 ? 376  GLN B CD  1 
ATOM   6899  O  OE1 . GLN B 1 376 ? 41.448  11.224  11.611  1.00 7.94  ? 376  GLN B OE1 1 
ATOM   6900  N  NE2 . GLN B 1 376 ? 40.216  11.322  9.717   1.00 8.24  ? 376  GLN B NE2 1 
ATOM   6901  N  N   . GLN B 1 377 ? 44.149  14.243  12.152  1.00 14.45 ? 377  GLN B N   1 
ATOM   6902  C  CA  . GLN B 1 377 ? 45.185  14.942  11.391  1.00 15.05 ? 377  GLN B CA  1 
ATOM   6903  C  C   . GLN B 1 377 ? 44.704  15.091  9.956   1.00 15.30 ? 377  GLN B C   1 
ATOM   6904  O  O   . GLN B 1 377 ? 44.400  14.093  9.310   1.00 15.91 ? 377  GLN B O   1 
ATOM   6905  C  CB  . GLN B 1 377 ? 46.518  14.174  11.436  1.00 14.96 ? 377  GLN B CB  1 
ATOM   6906  C  CG  . GLN B 1 377 ? 47.177  14.144  12.823  1.00 15.63 ? 377  GLN B CG  1 
ATOM   6907  C  CD  . GLN B 1 377 ? 48.209  13.049  12.973  1.00 15.98 ? 377  GLN B CD  1 
ATOM   6908  O  OE1 . GLN B 1 377 ? 49.416  13.317  12.960  1.00 15.15 ? 377  GLN B OE1 1 
ATOM   6909  N  NE2 . GLN B 1 377 ? 47.747  11.803  13.115  1.00 14.84 ? 377  GLN B NE2 1 
ATOM   6910  N  N   . THR B 1 378 ? 44.645  16.322  9.448   1.00 15.67 ? 378  THR B N   1 
ATOM   6911  C  CA  . THR B 1 378 ? 44.029  16.575  8.133   1.00 16.41 ? 378  THR B CA  1 
ATOM   6912  C  C   . THR B 1 378 ? 44.889  16.372  6.879   1.00 16.51 ? 378  THR B C   1 
ATOM   6913  O  O   . THR B 1 378 ? 44.339  16.278  5.780   1.00 17.40 ? 378  THR B O   1 
ATOM   6914  C  CB  . THR B 1 378 ? 43.340  17.949  8.056   1.00 16.16 ? 378  THR B CB  1 
ATOM   6915  O  OG1 . THR B 1 378 ? 44.299  18.981  8.301   1.00 17.38 ? 378  THR B OG1 1 
ATOM   6916  C  CG2 . THR B 1 378 ? 42.235  18.036  9.088   1.00 17.21 ? 378  THR B CG2 1 
ATOM   6917  N  N   . SER B 1 379 ? 46.207  16.319  7.008   1.00 16.36 ? 379  SER B N   1 
ATOM   6918  C  CA  . SER B 1 379 ? 47.044  16.111  5.827   1.00 17.09 ? 379  SER B CA  1 
ATOM   6919  C  C   . SER B 1 379 ? 46.614  14.862  5.051   1.00 17.44 ? 379  SER B C   1 
ATOM   6920  O  O   . SER B 1 379 ? 46.397  13.806  5.650   1.00 17.43 ? 379  SER B O   1 
ATOM   6921  C  CB  . SER B 1 379 ? 48.527  15.980  6.189   1.00 16.89 ? 379  SER B CB  1 
ATOM   6922  O  OG  . SER B 1 379 ? 49.258  15.625  5.029   1.00 16.81 ? 379  SER B OG  1 
ATOM   6923  N  N   . SER B 1 380 ? 46.510  14.985  3.725   1.00 17.54 ? 380  SER B N   1 
ATOM   6924  C  CA  . SER B 1 380 ? 46.072  13.872  2.889   1.00 17.94 ? 380  SER B CA  1 
ATOM   6925  C  C   . SER B 1 380 ? 47.194  12.846  2.673   1.00 17.84 ? 380  SER B C   1 
ATOM   6926  O  O   . SER B 1 380 ? 46.946  11.716  2.221   1.00 18.19 ? 380  SER B O   1 
ATOM   6927  C  CB  . SER B 1 380 ? 45.506  14.377  1.558   1.00 18.06 ? 380  SER B CB  1 
ATOM   6928  O  OG  . SER B 1 380 ? 46.548  14.869  0.733   1.00 20.23 ? 380  SER B OG  1 
ATOM   6929  N  N   . VAL B 1 381 ? 48.420  13.240  3.010   1.00 17.44 ? 381  VAL B N   1 
ATOM   6930  C  CA  . VAL B 1 381 ? 49.541  12.313  3.038   1.00 16.82 ? 381  VAL B CA  1 
ATOM   6931  C  C   . VAL B 1 381 ? 49.450  11.473  4.311   1.00 17.18 ? 381  VAL B C   1 
ATOM   6932  O  O   . VAL B 1 381 ? 50.011  11.843  5.361   1.00 16.85 ? 381  VAL B O   1 
ATOM   6933  C  CB  . VAL B 1 381 ? 50.914  13.043  2.969   1.00 17.13 ? 381  VAL B CB  1 
ATOM   6934  C  CG1 . VAL B 1 381 ? 52.059  12.026  2.920   1.00 15.07 ? 381  VAL B CG1 1 
ATOM   6935  C  CG2 . VAL B 1 381 ? 50.970  14.018  1.763   1.00 15.86 ? 381  VAL B CG2 1 
ATOM   6936  N  N   . ASN B 1 382 ? 48.743  10.344  4.213   1.00 16.82 ? 382  ASN B N   1 
ATOM   6937  C  CA  . ASN B 1 382 ? 48.532  9.455   5.371   1.00 16.83 ? 382  ASN B CA  1 
ATOM   6938  C  C   . ASN B 1 382 ? 49.334  8.133   5.322   1.00 16.74 ? 382  ASN B C   1 
ATOM   6939  O  O   . ASN B 1 382 ? 49.006  7.183   6.020   1.00 17.27 ? 382  ASN B O   1 
ATOM   6940  C  CB  . ASN B 1 382 ? 47.033  9.181   5.554   1.00 16.27 ? 382  ASN B CB  1 
ATOM   6941  C  CG  . ASN B 1 382 ? 46.385  8.582   4.301   1.00 16.51 ? 382  ASN B CG  1 
ATOM   6942  O  OD1 . ASN B 1 382 ? 47.078  8.110   3.378   1.00 17.17 ? 382  ASN B OD1 1 
ATOM   6943  N  ND2 . ASN B 1 382 ? 45.061  8.608   4.256   1.00 13.31 ? 382  ASN B ND2 1 
ATOM   6944  N  N   . TYR B 1 383 ? 50.387  8.098   4.509   1.00 16.44 ? 383  TYR B N   1 
ATOM   6945  C  CA  . TYR B 1 383 ? 51.236  6.909   4.313   1.00 15.83 ? 383  TYR B CA  1 
ATOM   6946  C  C   . TYR B 1 383 ? 52.685  7.371   4.383   1.00 15.82 ? 383  TYR B C   1 
ATOM   6947  O  O   . TYR B 1 383 ? 52.987  8.531   4.031   1.00 15.97 ? 383  TYR B O   1 
ATOM   6948  C  CB  . TYR B 1 383 ? 50.976  6.268   2.935   1.00 15.55 ? 383  TYR B CB  1 
ATOM   6949  C  CG  . TYR B 1 383 ? 51.254  7.208   1.799   1.00 15.13 ? 383  TYR B CG  1 
ATOM   6950  C  CD1 . TYR B 1 383 ? 52.491  7.180   1.132   1.00 16.64 ? 383  TYR B CD1 1 
ATOM   6951  C  CD2 . TYR B 1 383 ? 50.312  8.168   1.411   1.00 13.68 ? 383  TYR B CD2 1 
ATOM   6952  C  CE1 . TYR B 1 383 ? 52.767  8.071   0.082   1.00 15.45 ? 383  TYR B CE1 1 
ATOM   6953  C  CE2 . TYR B 1 383 ? 50.580  9.072   0.367   1.00 14.40 ? 383  TYR B CE2 1 
ATOM   6954  C  CZ  . TYR B 1 383 ? 51.815  9.007   -0.288  1.00 15.28 ? 383  TYR B CZ  1 
ATOM   6955  O  OH  . TYR B 1 383 ? 52.112  9.874   -1.308  1.00 16.56 ? 383  TYR B OH  1 
ATOM   6956  N  N   . GLU B 1 384 ? 53.568  6.473   4.826   1.00 15.29 ? 384  GLU B N   1 
ATOM   6957  C  CA  . GLU B 1 384 ? 55.009  6.728   4.921   1.00 15.26 ? 384  GLU B CA  1 
ATOM   6958  C  C   . GLU B 1 384 ? 55.723  5.431   4.541   1.00 15.64 ? 384  GLU B C   1 
ATOM   6959  O  O   . GLU B 1 384 ? 55.294  4.369   4.973   1.00 15.39 ? 384  GLU B O   1 
ATOM   6960  C  CB  . GLU B 1 384 ? 55.368  7.093   6.359   1.00 15.19 ? 384  GLU B CB  1 
ATOM   6961  C  CG  . GLU B 1 384 ? 56.713  7.809   6.541   1.00 15.32 ? 384  GLU B CG  1 
ATOM   6962  C  CD  . GLU B 1 384 ? 57.950  6.900   6.550   1.00 13.06 ? 384  GLU B CD  1 
ATOM   6963  O  OE1 . GLU B 1 384 ? 59.041  7.421   6.238   1.00 12.82 ? 384  GLU B OE1 1 
ATOM   6964  O  OE2 . GLU B 1 384 ? 57.847  5.696   6.865   1.00 11.80 ? 384  GLU B OE2 1 
ATOM   6965  N  N   . PRO B 1 385 ? 56.814  5.493   3.751   1.00 16.16 ? 385  PRO B N   1 
ATOM   6966  C  CA  . PRO B 1 385 ? 57.526  6.634   3.160   1.00 16.57 ? 385  PRO B CA  1 
ATOM   6967  C  C   . PRO B 1 385 ? 56.699  7.398   2.139   1.00 16.87 ? 385  PRO B C   1 
ATOM   6968  O  O   . PRO B 1 385 ? 55.774  6.857   1.545   1.00 17.01 ? 385  PRO B O   1 
ATOM   6969  C  CB  . PRO B 1 385 ? 58.728  5.985   2.475   1.00 16.11 ? 385  PRO B CB  1 
ATOM   6970  C  CG  . PRO B 1 385 ? 58.273  4.618   2.146   1.00 16.36 ? 385  PRO B CG  1 
ATOM   6971  C  CD  . PRO B 1 385 ? 57.450  4.221   3.359   1.00 16.57 ? 385  PRO B CD  1 
ATOM   6972  N  N   . ASN B 1 386 ? 57.013  8.675   1.990   1.00 17.87 ? 386  ASN B N   1 
ATOM   6973  C  CA  . ASN B 1 386 ? 56.373  9.522   0.991   1.00 18.55 ? 386  ASN B CA  1 
ATOM   6974  C  C   . ASN B 1 386 ? 57.392  10.545  0.441   1.00 19.12 ? 386  ASN B C   1 
ATOM   6975  O  O   . ASN B 1 386 ? 58.549  10.575  0.909   1.00 19.11 ? 386  ASN B O   1 
ATOM   6976  C  CB  . ASN B 1 386 ? 55.094  10.162  1.565   1.00 18.35 ? 386  ASN B CB  1 
ATOM   6977  C  CG  . ASN B 1 386 ? 55.358  11.014  2.775   1.00 18.19 ? 386  ASN B CG  1 
ATOM   6978  O  OD1 . ASN B 1 386 ? 55.974  12.063  2.668   1.00 19.02 ? 386  ASN B OD1 1 
ATOM   6979  N  ND2 . ASN B 1 386 ? 54.886  10.572  3.941   1.00 17.92 ? 386  ASN B ND2 1 
ATOM   6980  N  N   . ARG B 1 387 ? 56.973  11.365  -0.528  1.00 19.66 ? 387  ARG B N   1 
ATOM   6981  C  CA  . ARG B 1 387 ? 57.891  12.235  -1.294  1.00 20.66 ? 387  ARG B CA  1 
ATOM   6982  C  C   . ARG B 1 387 ? 58.141  13.603  -0.660  1.00 21.65 ? 387  ARG B C   1 
ATOM   6983  O  O   . ARG B 1 387 ? 59.004  14.358  -1.125  1.00 22.29 ? 387  ARG B O   1 
ATOM   6984  C  CB  . ARG B 1 387 ? 57.386  12.431  -2.739  1.00 20.27 ? 387  ARG B CB  1 
ATOM   6985  C  CG  . ARG B 1 387 ? 56.055  13.162  -2.815  1.00 20.04 ? 387  ARG B CG  1 
ATOM   6986  C  CD  . ARG B 1 387 ? 55.612  13.471  -4.231  1.00 20.20 ? 387  ARG B CD  1 
ATOM   6987  N  NE  . ARG B 1 387 ? 55.463  12.281  -5.072  1.00 18.70 ? 387  ARG B NE  1 
ATOM   6988  C  CZ  . ARG B 1 387 ? 54.309  11.670  -5.332  1.00 17.73 ? 387  ARG B CZ  1 
ATOM   6989  N  NH1 . ARG B 1 387 ? 53.178  12.117  -4.815  1.00 17.94 ? 387  ARG B NH1 1 
ATOM   6990  N  NH2 . ARG B 1 387 ? 54.286  10.608  -6.122  1.00 17.72 ? 387  ARG B NH2 1 
ATOM   6991  N  N   . TYR B 1 388 ? 57.394  13.923  0.393   1.00 22.53 ? 388  TYR B N   1 
ATOM   6992  C  CA  . TYR B 1 388 ? 57.355  15.289  0.926   1.00 22.69 ? 388  TYR B CA  1 
ATOM   6993  C  C   . TYR B 1 388 ? 58.263  15.438  2.113   1.00 23.21 ? 388  TYR B C   1 
ATOM   6994  O  O   . TYR B 1 388 ? 58.176  14.679  3.071   1.00 23.30 ? 388  TYR B O   1 
ATOM   6995  C  CB  . TYR B 1 388 ? 55.930  15.661  1.308   1.00 22.43 ? 388  TYR B CB  1 
ATOM   6996  C  CG  . TYR B 1 388 ? 54.920  15.315  0.236   1.00 23.06 ? 388  TYR B CG  1 
ATOM   6997  C  CD1 . TYR B 1 388 ? 54.288  14.066  0.226   1.00 22.79 ? 388  TYR B CD1 1 
ATOM   6998  C  CD2 . TYR B 1 388 ? 54.615  16.223  -0.791  1.00 23.76 ? 388  TYR B CD2 1 
ATOM   6999  C  CE1 . TYR B 1 388 ? 53.364  13.725  -0.758  1.00 22.10 ? 388  TYR B CE1 1 
ATOM   7000  C  CE2 . TYR B 1 388 ? 53.679  15.885  -1.796  1.00 24.32 ? 388  TYR B CE2 1 
ATOM   7001  C  CZ  . TYR B 1 388 ? 53.060  14.629  -1.755  1.00 23.44 ? 388  TYR B CZ  1 
ATOM   7002  O  OH  . TYR B 1 388 ? 52.147  14.268  -2.712  1.00 23.20 ? 388  TYR B OH  1 
ATOM   7003  N  N   . GLN B 1 389 ? 59.141  16.428  2.045   1.00 24.00 ? 389  GLN B N   1 
ATOM   7004  C  CA  . GLN B 1 389 ? 60.114  16.657  3.097   1.00 24.67 ? 389  GLN B CA  1 
ATOM   7005  C  C   . GLN B 1 389 ? 59.522  17.311  4.356   1.00 23.76 ? 389  GLN B C   1 
ATOM   7006  O  O   . GLN B 1 389 ? 60.128  17.271  5.409   1.00 23.35 ? 389  GLN B O   1 
ATOM   7007  C  CB  . GLN B 1 389 ? 61.318  17.443  2.554   1.00 24.91 ? 389  GLN B CB  1 
ATOM   7008  C  CG  . GLN B 1 389 ? 62.523  16.555  2.165   1.00 26.93 ? 389  GLN B CG  1 
ATOM   7009  C  CD  . GLN B 1 389 ? 63.875  17.305  2.199   1.00 27.58 ? 389  GLN B CD  1 
ATOM   7010  O  OE1 . GLN B 1 389 ? 63.928  18.530  2.410   1.00 30.94 ? 389  GLN B OE1 1 
ATOM   7011  N  NE2 . GLN B 1 389 ? 64.969  16.565  1.981   1.00 27.82 ? 389  GLN B NE2 1 
ATOM   7012  N  N   . ASP B 1 390 ? 58.332  17.896  4.239   1.00 23.69 ? 390  ASP B N   1 
ATOM   7013  C  CA  . ASP B 1 390 ? 57.682  18.580  5.349   1.00 23.01 ? 390  ASP B CA  1 
ATOM   7014  C  C   . ASP B 1 390 ? 56.781  17.645  6.171   1.00 22.33 ? 390  ASP B C   1 
ATOM   7015  O  O   . ASP B 1 390 ? 56.343  18.001  7.273   1.00 22.27 ? 390  ASP B O   1 
ATOM   7016  C  CB  . ASP B 1 390 ? 56.893  19.788  4.840   1.00 23.42 ? 390  ASP B CB  1 
ATOM   7017  C  CG  . ASP B 1 390 ? 57.794  20.866  4.161   1.00 26.19 ? 390  ASP B CG  1 
ATOM   7018  O  OD1 . ASP B 1 390 ? 59.058  20.786  4.217   1.00 26.89 ? 390  ASP B OD1 1 
ATOM   7019  O  OD2 . ASP B 1 390 ? 57.222  21.806  3.552   1.00 27.21 ? 390  ASP B OD2 1 
ATOM   7020  N  N   . GLU B 1 391 ? 56.515  16.443  5.661   1.00 21.02 ? 391  GLU B N   1 
ATOM   7021  C  CA  . GLU B 1 391 ? 55.642  15.512  6.394   1.00 19.59 ? 391  GLU B CA  1 
ATOM   7022  C  C   . GLU B 1 391 ? 56.425  14.783  7.500   1.00 18.52 ? 391  GLU B C   1 
ATOM   7023  O  O   . GLU B 1 391 ? 57.662  14.776  7.457   1.00 18.29 ? 391  GLU B O   1 
ATOM   7024  C  CB  . GLU B 1 391 ? 54.924  14.556  5.439   1.00 19.51 ? 391  GLU B CB  1 
ATOM   7025  C  CG  . GLU B 1 391 ? 53.968  15.252  4.453   1.00 19.97 ? 391  GLU B CG  1 
ATOM   7026  C  CD  . GLU B 1 391 ? 52.830  16.072  5.106   1.00 21.03 ? 391  GLU B CD  1 
ATOM   7027  O  OE1 . GLU B 1 391 ? 52.247  16.897  4.390   1.00 23.46 ? 391  GLU B OE1 1 
ATOM   7028  O  OE2 . GLU B 1 391 ? 52.484  15.906  6.297   1.00 22.38 ? 391  GLU B OE2 1 
ATOM   7029  N  N   . PRO B 1 392 ? 55.723  14.215  8.514   1.00 17.18 ? 392  PRO B N   1 
ATOM   7030  C  CA  . PRO B 1 392 ? 56.455  13.610  9.638   1.00 15.91 ? 392  PRO B CA  1 
ATOM   7031  C  C   . PRO B 1 392 ? 57.480  12.580  9.185   1.00 15.22 ? 392  PRO B C   1 
ATOM   7032  O  O   . PRO B 1 392 ? 57.163  11.693  8.384   1.00 15.00 ? 392  PRO B O   1 
ATOM   7033  C  CB  . PRO B 1 392 ? 55.357  12.938  10.469  1.00 15.70 ? 392  PRO B CB  1 
ATOM   7034  C  CG  . PRO B 1 392 ? 54.095  13.655  10.119  1.00 16.44 ? 392  PRO B CG  1 
ATOM   7035  C  CD  . PRO B 1 392 ? 54.257  14.133  8.695   1.00 17.17 ? 392  PRO B CD  1 
ATOM   7036  N  N   . LYS B 1 393 ? 58.702  12.702  9.691   1.00 14.16 ? 393  LYS B N   1 
ATOM   7037  C  CA  . LYS B 1 393 ? 59.752  11.727  9.389   1.00 13.56 ? 393  LYS B CA  1 
ATOM   7038  C  C   . LYS B 1 393 ? 60.302  11.032  10.656  1.00 13.20 ? 393  LYS B C   1 
ATOM   7039  O  O   . LYS B 1 393 ? 60.299  11.604  11.769  1.00 12.27 ? 393  LYS B O   1 
ATOM   7040  C  CB  . LYS B 1 393 ? 60.898  12.386  8.595   1.00 13.17 ? 393  LYS B CB  1 
ATOM   7041  C  CG  . LYS B 1 393 ? 60.493  13.032  7.271   1.00 13.23 ? 393  LYS B CG  1 
ATOM   7042  C  CD  . LYS B 1 393 ? 60.004  12.037  6.223   1.00 12.16 ? 393  LYS B CD  1 
ATOM   7043  C  CE  . LYS B 1 393 ? 59.095  12.726  5.217   1.00 11.82 ? 393  LYS B CE  1 
ATOM   7044  N  NZ  . LYS B 1 393 ? 58.843  11.906  3.974   1.00 11.34 ? 393  LYS B NZ  1 
ATOM   7045  N  N   . GLN B 1 394 ? 60.788  9.807   10.473  1.00 12.77 ? 394  GLN B N   1 
ATOM   7046  C  CA  . GLN B 1 394 ? 61.452  9.076   11.569  1.00 12.95 ? 394  GLN B CA  1 
ATOM   7047  C  C   . GLN B 1 394 ? 62.794  9.716   11.937  1.00 12.54 ? 394  GLN B C   1 
ATOM   7048  O  O   . GLN B 1 394 ? 63.436  10.326  11.100  1.00 11.54 ? 394  GLN B O   1 
ATOM   7049  C  CB  . GLN B 1 394 ? 61.638  7.597   11.225  1.00 12.66 ? 394  GLN B CB  1 
ATOM   7050  C  CG  . GLN B 1 394 ? 62.704  7.340   10.174  1.00 14.08 ? 394  GLN B CG  1 
ATOM   7051  C  CD  . GLN B 1 394 ? 62.718  5.915   9.716   1.00 17.23 ? 394  GLN B CD  1 
ATOM   7052  O  OE1 . GLN B 1 394 ? 61.681  5.252   9.701   1.00 17.77 ? 394  GLN B OE1 1 
ATOM   7053  N  NE2 . GLN B 1 394 ? 63.900  5.418   9.344   1.00 17.75 ? 394  GLN B NE2 1 
ATOM   7054  N  N   . THR B 1 395 ? 63.203  9.554   13.197  1.00 13.07 ? 395  THR B N   1 
ATOM   7055  C  CA  . THR B 1 395 ? 64.404  10.179  13.726  1.00 13.04 ? 395  THR B CA  1 
ATOM   7056  C  C   . THR B 1 395 ? 65.291  9.069   14.295  1.00 14.20 ? 395  THR B C   1 
ATOM   7057  O  O   . THR B 1 395 ? 65.239  8.792   15.488  1.00 14.80 ? 395  THR B O   1 
ATOM   7058  C  CB  . THR B 1 395 ? 64.051  11.249  14.793  1.00 13.11 ? 395  THR B CB  1 
ATOM   7059  O  OG1 . THR B 1 395 ? 62.856  11.939  14.416  1.00 10.77 ? 395  THR B OG1 1 
ATOM   7060  C  CG2 . THR B 1 395 ? 65.178  12.280  14.967  1.00 11.39 ? 395  THR B CG2 1 
ATOM   7061  N  N   . PRO B 1 396 ? 66.101  8.413   13.430  1.00 15.40 ? 396  PRO B N   1 
ATOM   7062  C  CA  . PRO B 1 396 ? 66.829  7.144   13.740  1.00 16.15 ? 396  PRO B CA  1 
ATOM   7063  C  C   . PRO B 1 396 ? 67.589  7.081   15.079  1.00 17.24 ? 396  PRO B C   1 
ATOM   7064  O  O   . PRO B 1 396 ? 67.786  5.976   15.616  1.00 17.42 ? 396  PRO B O   1 
ATOM   7065  C  CB  . PRO B 1 396 ? 67.805  7.001   12.565  1.00 16.43 ? 396  PRO B CB  1 
ATOM   7066  C  CG  . PRO B 1 396 ? 67.111  7.703   11.430  1.00 15.75 ? 396  PRO B CG  1 
ATOM   7067  C  CD  . PRO B 1 396 ? 66.357  8.865   12.042  1.00 14.55 ? 396  PRO B CD  1 
ATOM   7068  N  N   . GLU B 1 397 ? 67.999  8.236   15.609  1.00 17.45 ? 397  GLU B N   1 
ATOM   7069  C  CA  . GLU B 1 397 ? 68.625  8.298   16.927  1.00 18.53 ? 397  GLU B CA  1 
ATOM   7070  C  C   . GLU B 1 397 ? 67.660  7.800   18.016  1.00 18.36 ? 397  GLU B C   1 
ATOM   7071  O  O   . GLU B 1 397 ? 68.080  7.325   19.081  1.00 18.10 ? 397  GLU B O   1 
ATOM   7072  C  CB  . GLU B 1 397 ? 69.187  9.710   17.229  1.00 18.35 ? 397  GLU B CB  1 
ATOM   7073  C  CG  . GLU B 1 397 ? 68.155  10.793  17.609  1.00 20.62 ? 397  GLU B CG  1 
ATOM   7074  C  CD  . GLU B 1 397 ? 68.517  12.224  17.133  1.00 21.39 ? 397  GLU B CD  1 
ATOM   7075  O  OE1 . GLU B 1 397 ? 68.095  13.196  17.804  1.00 23.82 ? 397  GLU B OE1 1 
ATOM   7076  O  OE2 . GLU B 1 397 ? 69.200  12.391  16.086  1.00 24.90 ? 397  GLU B OE2 1 
ATOM   7077  N  N   . TYR B 1 398 ? 66.365  7.858   17.734  1.00 18.29 ? 398  TYR B N   1 
ATOM   7078  C  CA  . TYR B 1 398 ? 65.359  7.434   18.728  1.00 18.33 ? 398  TYR B CA  1 
ATOM   7079  C  C   . TYR B 1 398 ? 65.022  5.936   18.671  1.00 18.27 ? 398  TYR B C   1 
ATOM   7080  O  O   . TYR B 1 398 ? 64.207  5.457   19.449  1.00 18.97 ? 398  TYR B O   1 
ATOM   7081  C  CB  . TYR B 1 398 ? 64.088  8.293   18.599  1.00 17.82 ? 398  TYR B CB  1 
ATOM   7082  C  CG  . TYR B 1 398 ? 64.280  9.666   19.175  1.00 17.11 ? 398  TYR B CG  1 
ATOM   7083  C  CD1 . TYR B 1 398 ? 64.561  10.758  18.344  1.00 15.82 ? 398  TYR B CD1 1 
ATOM   7084  C  CD2 . TYR B 1 398 ? 64.223  9.876   20.567  1.00 16.52 ? 398  TYR B CD2 1 
ATOM   7085  C  CE1 . TYR B 1 398 ? 64.777  12.036  18.882  1.00 14.70 ? 398  TYR B CE1 1 
ATOM   7086  C  CE2 . TYR B 1 398 ? 64.426  11.148  21.117  1.00 15.81 ? 398  TYR B CE2 1 
ATOM   7087  C  CZ  . TYR B 1 398 ? 64.689  12.226  20.255  1.00 16.34 ? 398  TYR B CZ  1 
ATOM   7088  O  OH  . TYR B 1 398 ? 64.895  13.475  20.771  1.00 15.57 ? 398  TYR B OH  1 
ATOM   7089  N  N   . THR B 1 399 ? 65.644  5.207   17.748  1.00 18.26 ? 399  THR B N   1 
ATOM   7090  C  CA  . THR B 1 399 ? 65.382  3.792   17.586  1.00 18.04 ? 399  THR B CA  1 
ATOM   7091  C  C   . THR B 1 399 ? 65.755  3.071   18.870  1.00 18.30 ? 399  THR B C   1 
ATOM   7092  O  O   . THR B 1 399 ? 66.826  3.310   19.435  1.00 17.87 ? 399  THR B O   1 
ATOM   7093  C  CB  . THR B 1 399 ? 66.150  3.222   16.369  1.00 18.28 ? 399  THR B CB  1 
ATOM   7094  O  OG1 . THR B 1 399 ? 65.682  3.876   15.195  1.00 18.23 ? 399  THR B OG1 1 
ATOM   7095  C  CG2 . THR B 1 399 ? 65.943  1.691   16.198  1.00 17.58 ? 399  THR B CG2 1 
ATOM   7096  N  N   . GLU B 1 400 ? 64.850  2.222   19.340  1.00 18.62 ? 400  GLU B N   1 
ATOM   7097  C  CA  . GLU B 1 400 ? 65.105  1.455   20.549  1.00 19.73 ? 400  GLU B CA  1 
ATOM   7098  C  C   . GLU B 1 400 ? 66.241  0.481   20.292  1.00 20.33 ? 400  GLU B C   1 
ATOM   7099  O  O   . GLU B 1 400 ? 66.186  -0.351  19.368  1.00 19.59 ? 400  GLU B O   1 
ATOM   7100  C  CB  . GLU B 1 400 ? 63.864  0.685   21.018  1.00 19.67 ? 400  GLU B CB  1 
ATOM   7101  C  CG  . GLU B 1 400 ? 62.584  1.508   21.098  1.00 19.28 ? 400  GLU B CG  1 
ATOM   7102  C  CD  . GLU B 1 400 ? 61.686  1.278   19.906  1.00 19.74 ? 400  GLU B CD  1 
ATOM   7103  O  OE1 . GLU B 1 400 ? 62.118  1.566   18.766  1.00 18.18 ? 400  GLU B OE1 1 
ATOM   7104  O  OE2 . GLU B 1 400 ? 60.545  0.807   20.116  1.00 20.84 ? 400  GLU B OE2 1 
ATOM   7105  N  N   . ASP B 1 401 ? 67.266  0.595   21.130  1.00 20.89 ? 401  ASP B N   1 
ATOM   7106  C  CA  . ASP B 1 401 ? 68.466  -0.222  21.015  1.00 21.99 ? 401  ASP B CA  1 
ATOM   7107  C  C   . ASP B 1 401 ? 68.157  -1.710  21.142  1.00 21.26 ? 401  ASP B C   1 
ATOM   7108  O  O   . ASP B 1 401 ? 67.183  -2.119  21.783  1.00 20.90 ? 401  ASP B O   1 
ATOM   7109  C  CB  . ASP B 1 401 ? 69.449  0.205   22.086  1.00 23.17 ? 401  ASP B CB  1 
ATOM   7110  C  CG  . ASP B 1 401 ? 68.763  0.427   23.396  1.00 27.19 ? 401  ASP B CG  1 
ATOM   7111  O  OD1 . ASP B 1 401 ? 68.345  1.597   23.658  1.00 30.89 ? 401  ASP B OD1 1 
ATOM   7112  O  OD2 . ASP B 1 401 ? 68.565  -0.590  24.118  1.00 30.92 ? 401  ASP B OD2 1 
ATOM   7113  N  N   . THR B 1 402 ? 68.987  -2.514  20.485  1.00 20.38 ? 402  THR B N   1 
ATOM   7114  C  CA  . THR B 1 402 ? 68.882  -3.953  20.558  1.00 18.78 ? 402  THR B CA  1 
ATOM   7115  C  C   . THR B 1 402 ? 69.146  -4.394  21.999  1.00 18.42 ? 402  THR B C   1 
ATOM   7116  O  O   . THR B 1 402 ? 69.851  -3.721  22.744  1.00 17.67 ? 402  THR B O   1 
ATOM   7117  C  CB  . THR B 1 402 ? 69.909  -4.611  19.635  1.00 18.87 ? 402  THR B CB  1 
ATOM   7118  O  OG1 . THR B 1 402 ? 71.227  -4.273  20.097  1.00 19.52 ? 402  THR B OG1 1 
ATOM   7119  C  CG2 . THR B 1 402 ? 69.742  -4.129  18.204  1.00 16.66 ? 402  THR B CG2 1 
ATOM   7120  N  N   . GLN B 1 403 ? 68.569  -5.524  22.395  1.00 18.10 ? 403  GLN B N   1 
ATOM   7121  C  CA  . GLN B 1 403 ? 68.833  -6.084  23.719  1.00 17.49 ? 403  GLN B CA  1 
ATOM   7122  C  C   . GLN B 1 403 ? 69.272  -7.538  23.550  1.00 17.54 ? 403  GLN B C   1 
ATOM   7123  O  O   . GLN B 1 403 ? 69.117  -8.092  22.472  1.00 17.53 ? 403  GLN B O   1 
ATOM   7124  C  CB  . GLN B 1 403 ? 67.578  -5.989  24.586  1.00 17.27 ? 403  GLN B CB  1 
ATOM   7125  C  CG  . GLN B 1 403 ? 67.280  -4.593  25.111  1.00 15.41 ? 403  GLN B CG  1 
ATOM   7126  C  CD  . GLN B 1 403 ? 68.337  -4.090  26.089  1.00 14.91 ? 403  GLN B CD  1 
ATOM   7127  O  OE1 . GLN B 1 403 ? 68.754  -4.801  27.038  1.00 10.54 ? 403  GLN B OE1 1 
ATOM   7128  N  NE2 . GLN B 1 403 ? 68.780  -2.843  25.865  1.00 14.37 ? 403  GLN B NE2 1 
ATOM   7129  N  N   . PRO B 1 404 ? 69.836  -8.157  24.600  1.00 17.82 ? 404  PRO B N   1 
ATOM   7130  C  CA  . PRO B 1 404 ? 70.276  -9.554  24.448  1.00 17.76 ? 404  PRO B CA  1 
ATOM   7131  C  C   . PRO B 1 404 ? 69.185  -10.622 24.463  1.00 17.90 ? 404  PRO B C   1 
ATOM   7132  O  O   . PRO B 1 404 ? 68.156  -10.477 25.107  1.00 17.41 ? 404  PRO B O   1 
ATOM   7133  C  CB  . PRO B 1 404 ? 71.236  -9.763  25.630  1.00 17.47 ? 404  PRO B CB  1 
ATOM   7134  C  CG  . PRO B 1 404 ? 71.432  -8.373  26.266  1.00 17.87 ? 404  PRO B CG  1 
ATOM   7135  C  CD  . PRO B 1 404 ? 70.183  -7.619  25.929  1.00 17.93 ? 404  PRO B CD  1 
ATOM   7136  N  N   . LEU B 1 405 ? 69.430  -11.684 23.712  1.00 18.76 ? 405  LEU B N   1 
ATOM   7137  C  CA  . LEU B 1 405 ? 68.698  -12.928 23.849  1.00 19.93 ? 405  LEU B CA  1 
ATOM   7138  C  C   . LEU B 1 405 ? 69.658  -13.917 24.487  1.00 20.67 ? 405  LEU B C   1 
ATOM   7139  O  O   . LEU B 1 405 ? 70.858  -13.807 24.285  1.00 21.53 ? 405  LEU B O   1 
ATOM   7140  C  CB  . LEU B 1 405 ? 68.233  -13.437 22.487  1.00 19.72 ? 405  LEU B CB  1 
ATOM   7141  C  CG  . LEU B 1 405 ? 66.932  -12.883 21.923  1.00 19.66 ? 405  LEU B CG  1 
ATOM   7142  C  CD1 . LEU B 1 405 ? 66.517  -13.786 20.802  1.00 19.54 ? 405  LEU B CD1 1 
ATOM   7143  C  CD2 . LEU B 1 405 ? 65.813  -12.823 22.988  1.00 19.64 ? 405  LEU B CD2 1 
ATOM   7144  N  N   . HIS B 1 406 ? 69.147  -14.870 25.260  1.00 21.10 ? 406  HIS B N   1 
ATOM   7145  C  CA  . HIS B 1 406 ? 70.025  -15.744 26.043  1.00 21.55 ? 406  HIS B CA  1 
ATOM   7146  C  C   . HIS B 1 406 ? 69.666  -17.230 25.939  1.00 21.44 ? 406  HIS B C   1 
ATOM   7147  O  O   . HIS B 1 406 ? 70.174  -18.053 26.710  1.00 22.47 ? 406  HIS B O   1 
ATOM   7148  C  CB  . HIS B 1 406 ? 70.024  -15.330 27.527  1.00 21.06 ? 406  HIS B CB  1 
ATOM   7149  C  CG  . HIS B 1 406 ? 70.665  -14.001 27.795  1.00 23.17 ? 406  HIS B CG  1 
ATOM   7150  N  ND1 . HIS B 1 406 ? 72.022  -13.779 27.647  1.00 24.19 ? 406  HIS B ND1 1 
ATOM   7151  C  CD2 . HIS B 1 406 ? 70.140  -12.828 28.236  1.00 23.70 ? 406  HIS B CD2 1 
ATOM   7152  C  CE1 . HIS B 1 406 ? 72.302  -12.526 27.974  1.00 23.26 ? 406  HIS B CE1 1 
ATOM   7153  N  NE2 . HIS B 1 406 ? 71.177  -11.927 28.327  1.00 22.73 ? 406  HIS B NE2 1 
ATOM   7154  N  N   . ASP B 1 407 ? 68.787  -17.584 25.017  1.00 20.58 ? 407  ASP B N   1 
ATOM   7155  C  CA  . ASP B 1 407 ? 68.367  -18.970 24.901  1.00 19.91 ? 407  ASP B CA  1 
ATOM   7156  C  C   . ASP B 1 407 ? 68.430  -19.350 23.430  1.00 19.57 ? 407  ASP B C   1 
ATOM   7157  O  O   . ASP B 1 407 ? 68.535  -18.466 22.560  1.00 19.45 ? 407  ASP B O   1 
ATOM   7158  C  CB  . ASP B 1 407 ? 66.950  -19.144 25.474  1.00 20.01 ? 407  ASP B CB  1 
ATOM   7159  C  CG  . ASP B 1 407 ? 66.718  -20.522 26.113  1.00 19.39 ? 407  ASP B CG  1 
ATOM   7160  O  OD1 . ASP B 1 407 ? 67.496  -21.468 25.839  1.00 19.45 ? 407  ASP B OD1 1 
ATOM   7161  O  OD2 . ASP B 1 407 ? 65.741  -20.665 26.886  1.00 16.19 ? 407  ASP B OD2 1 
ATOM   7162  N  N   . ASP B 1 408 ? 68.387  -20.650 23.149  1.00 19.00 ? 408  ASP B N   1 
ATOM   7163  C  CA  . ASP B 1 408 ? 68.391  -21.115 21.761  1.00 18.79 ? 408  ASP B CA  1 
ATOM   7164  C  C   . ASP B 1 408 ? 67.034  -21.695 21.349  1.00 18.26 ? 408  ASP B C   1 
ATOM   7165  O  O   . ASP B 1 408 ? 66.875  -22.274 20.259  1.00 18.20 ? 408  ASP B O   1 
ATOM   7166  C  CB  . ASP B 1 408 ? 69.521  -22.111 21.536  1.00 18.85 ? 408  ASP B CB  1 
ATOM   7167  C  CG  . ASP B 1 408 ? 69.321  -23.388 22.283  1.00 20.34 ? 408  ASP B CG  1 
ATOM   7168  O  OD1 . ASP B 1 408 ? 68.352  -23.496 23.068  1.00 22.27 ? 408  ASP B OD1 1 
ATOM   7169  O  OD2 . ASP B 1 408 ? 70.135  -24.306 22.085  1.00 23.66 ? 408  ASP B OD2 1 
ATOM   7170  N  N   . ILE B 1 409 ? 66.046  -21.535 22.227  1.00 17.48 ? 409  ILE B N   1 
ATOM   7171  C  CA  . ILE B 1 409 ? 64.680  -21.950 21.919  1.00 16.24 ? 409  ILE B CA  1 
ATOM   7172  C  C   . ILE B 1 409 ? 63.685  -20.902 22.379  1.00 15.99 ? 409  ILE B C   1 
ATOM   7173  O  O   . ILE B 1 409 ? 63.951  -20.144 23.313  1.00 15.51 ? 409  ILE B O   1 
ATOM   7174  C  CB  . ILE B 1 409 ? 64.315  -23.341 22.530  1.00 16.34 ? 409  ILE B CB  1 
ATOM   7175  C  CG1 . ILE B 1 409 ? 64.584  -23.375 24.048  1.00 16.60 ? 409  ILE B CG1 1 
ATOM   7176  C  CG2 . ILE B 1 409 ? 65.042  -24.476 21.773  1.00 16.21 ? 409  ILE B CG2 1 
ATOM   7177  C  CD1 . ILE B 1 409 ? 64.084  -24.616 24.771  1.00 15.46 ? 409  ILE B CD1 1 
ATOM   7178  N  N   . HIS B 1 410 ? 62.550  -20.843 21.684  1.00 15.67 ? 410  HIS B N   1 
ATOM   7179  C  CA  . HIS B 1 410 ? 61.375  -20.165 22.213  1.00 14.51 ? 410  HIS B CA  1 
ATOM   7180  C  C   . HIS B 1 410 ? 60.236  -21.171 22.401  1.00 14.24 ? 410  HIS B C   1 
ATOM   7181  O  O   . HIS B 1 410 ? 60.142  -22.151 21.650  1.00 14.03 ? 410  HIS B O   1 
ATOM   7182  C  CB  . HIS B 1 410 ? 60.975  -18.970 21.339  1.00 14.24 ? 410  HIS B CB  1 
ATOM   7183  C  CG  . HIS B 1 410 ? 60.425  -19.336 19.993  1.00 13.33 ? 410  HIS B CG  1 
ATOM   7184  N  ND1 . HIS B 1 410 ? 59.146  -19.817 19.815  1.00 12.62 ? 410  HIS B ND1 1 
ATOM   7185  C  CD2 . HIS B 1 410 ? 60.961  -19.235 18.753  1.00 12.30 ? 410  HIS B CD2 1 
ATOM   7186  C  CE1 . HIS B 1 410 ? 58.928  -20.024 18.528  1.00 11.42 ? 410  HIS B CE1 1 
ATOM   7187  N  NE2 . HIS B 1 410 ? 60.015  -19.678 17.863  1.00 11.86 ? 410  HIS B NE2 1 
ATOM   7188  N  N   . GLY B 1 411 ? 59.401  -20.924 23.416  1.00 13.43 ? 411  GLY B N   1 
ATOM   7189  C  CA  . GLY B 1 411 ? 58.263  -21.770 23.746  1.00 12.81 ? 411  GLY B CA  1 
ATOM   7190  C  C   . GLY B 1 411 ? 57.770  -21.450 25.142  1.00 13.20 ? 411  GLY B C   1 
ATOM   7191  O  O   . GLY B 1 411 ? 58.172  -20.417 25.729  1.00 12.74 ? 411  GLY B O   1 
ATOM   7192  N  N   . ARG B 1 412 ? 56.908  -22.321 25.680  1.00 12.75 ? 412  ARG B N   1 
ATOM   7193  C  CA  . ARG B 1 412 ? 56.345  -22.140 27.037  1.00 12.80 ? 412  ARG B CA  1 
ATOM   7194  C  C   . ARG B 1 412 ? 57.275  -22.759 28.082  1.00 13.68 ? 412  ARG B C   1 
ATOM   7195  O  O   . ARG B 1 412 ? 57.290  -23.978 28.277  1.00 13.35 ? 412  ARG B O   1 
ATOM   7196  C  CB  . ARG B 1 412 ? 54.920  -22.717 27.145  1.00 12.70 ? 412  ARG B CB  1 
ATOM   7197  C  CG  . ARG B 1 412 ? 53.954  -22.152 26.113  1.00 11.85 ? 412  ARG B CG  1 
ATOM   7198  C  CD  . ARG B 1 412 ? 52.485  -22.499 26.358  1.00 11.77 ? 412  ARG B CD  1 
ATOM   7199  N  NE  . ARG B 1 412 ? 51.698  -22.067 25.206  1.00 10.99 ? 412  ARG B NE  1 
ATOM   7200  C  CZ  . ARG B 1 412 ? 51.246  -20.824 24.999  1.00 12.70 ? 412  ARG B CZ  1 
ATOM   7201  N  NH1 . ARG B 1 412 ? 51.441  -19.855 25.913  1.00 10.22 ? 412  ARG B NH1 1 
ATOM   7202  N  NH2 . ARG B 1 412 ? 50.573  -20.552 23.875  1.00 9.57  ? 412  ARG B NH2 1 
ATOM   7203  N  N   . LEU B 1 413 ? 58.035  -21.904 28.770  1.00 14.64 ? 413  LEU B N   1 
ATOM   7204  C  CA  . LEU B 1 413 ? 59.236  -22.335 29.490  1.00 15.26 ? 413  LEU B CA  1 
ATOM   7205  C  C   . LEU B 1 413 ? 59.359  -21.636 30.842  1.00 16.15 ? 413  LEU B C   1 
ATOM   7206  O  O   . LEU B 1 413 ? 59.855  -20.502 30.915  1.00 16.08 ? 413  LEU B O   1 
ATOM   7207  C  CB  . LEU B 1 413 ? 60.483  -22.033 28.640  1.00 14.76 ? 413  LEU B CB  1 
ATOM   7208  C  CG  . LEU B 1 413 ? 60.608  -22.725 27.271  1.00 15.46 ? 413  LEU B CG  1 
ATOM   7209  C  CD1 . LEU B 1 413 ? 61.573  -21.988 26.339  1.00 14.09 ? 413  LEU B CD1 1 
ATOM   7210  C  CD2 . LEU B 1 413 ? 60.980  -24.206 27.404  1.00 15.03 ? 413  LEU B CD2 1 
ATOM   7211  N  N   . GLU B 1 414 ? 58.926  -22.323 31.905  1.00 16.73 ? 414  GLU B N   1 
ATOM   7212  C  CA  . GLU B 1 414 ? 58.901  -21.760 33.249  1.00 17.85 ? 414  GLU B CA  1 
ATOM   7213  C  C   . GLU B 1 414 ? 60.301  -21.446 33.740  1.00 17.55 ? 414  GLU B C   1 
ATOM   7214  O  O   . GLU B 1 414 ? 61.205  -22.259 33.598  1.00 17.55 ? 414  GLU B O   1 
ATOM   7215  C  CB  . GLU B 1 414 ? 58.218  -22.722 34.225  1.00 17.59 ? 414  GLU B CB  1 
ATOM   7216  C  CG  . GLU B 1 414 ? 58.006  -22.146 35.624  1.00 19.13 ? 414  GLU B CG  1 
ATOM   7217  C  CD  . GLU B 1 414 ? 57.412  -23.154 36.588  1.00 20.74 ? 414  GLU B CD  1 
ATOM   7218  O  OE1 . GLU B 1 414 ? 57.808  -24.345 36.570  1.00 25.32 ? 414  GLU B OE1 1 
ATOM   7219  O  OE2 . GLU B 1 414 ? 56.537  -22.759 37.373  1.00 23.68 ? 414  GLU B OE2 1 
ATOM   7220  N  N   . ILE B 1 415 ? 60.475  -20.265 34.320  1.00 18.06 ? 415  ILE B N   1 
ATOM   7221  C  CA  . ILE B 1 415 ? 61.763  -19.895 34.938  1.00 18.64 ? 415  ILE B CA  1 
ATOM   7222  C  C   . ILE B 1 415 ? 62.224  -20.957 35.948  1.00 19.68 ? 415  ILE B C   1 
ATOM   7223  O  O   . ILE B 1 415 ? 61.406  -21.613 36.597  1.00 19.46 ? 415  ILE B O   1 
ATOM   7224  C  CB  . ILE B 1 415 ? 61.757  -18.455 35.580  1.00 18.00 ? 415  ILE B CB  1 
ATOM   7225  C  CG1 . ILE B 1 415 ? 60.766  -18.345 36.740  1.00 16.97 ? 415  ILE B CG1 1 
ATOM   7226  C  CG2 . ILE B 1 415 ? 61.465  -17.398 34.536  1.00 17.84 ? 415  ILE B CG2 1 
ATOM   7227  C  CD1 . ILE B 1 415 ? 61.109  -17.219 37.715  1.00 18.04 ? 415  ILE B CD1 1 
ATOM   7228  N  N   . GLU B 1 416 ? 63.532  -21.107 36.094  1.00 21.15 ? 416  GLU B N   1 
ATOM   7229  C  CA  . GLU B 1 416 ? 64.074  -22.216 36.886  1.00 22.66 ? 416  GLU B CA  1 
ATOM   7230  C  C   . GLU B 1 416 ? 64.167  -22.008 38.398  1.00 22.22 ? 416  GLU B C   1 
ATOM   7231  O  O   . GLU B 1 416 ? 63.771  -22.901 39.153  1.00 23.29 ? 416  GLU B O   1 
ATOM   7232  C  CB  . GLU B 1 416 ? 65.396  -22.724 36.306  1.00 23.20 ? 416  GLU B CB  1 
ATOM   7233  C  CG  . GLU B 1 416 ? 65.210  -23.309 34.929  1.00 27.03 ? 416  GLU B CG  1 
ATOM   7234  C  CD  . GLU B 1 416 ? 66.237  -24.354 34.590  1.00 32.77 ? 416  GLU B CD  1 
ATOM   7235  O  OE1 . GLU B 1 416 ? 65.826  -25.448 34.142  1.00 34.75 ? 416  GLU B OE1 1 
ATOM   7236  O  OE2 . GLU B 1 416 ? 67.448  -24.083 34.771  1.00 35.57 ? 416  GLU B OE2 1 
ATOM   7237  N  N   . LYS B 1 417 ? 64.664  -20.867 38.867  1.00 21.39 ? 417  LYS B N   1 
ATOM   7238  C  CA  . LYS B 1 417 ? 64.671  -20.678 40.326  1.00 20.65 ? 417  LYS B CA  1 
ATOM   7239  C  C   . LYS B 1 417 ? 63.428  -19.937 40.834  1.00 19.88 ? 417  LYS B C   1 
ATOM   7240  O  O   . LYS B 1 417 ? 63.378  -18.709 40.919  1.00 20.40 ? 417  LYS B O   1 
ATOM   7241  C  CB  . LYS B 1 417 ? 65.998  -20.149 40.893  1.00 20.31 ? 417  LYS B CB  1 
ATOM   7242  C  CG  . LYS B 1 417 ? 66.559  -18.925 40.250  1.00 21.65 ? 417  LYS B CG  1 
ATOM   7243  C  CD  . LYS B 1 417 ? 67.651  -18.281 41.142  1.00 21.79 ? 417  LYS B CD  1 
ATOM   7244  C  CE  . LYS B 1 417 ? 69.030  -18.886 40.887  1.00 22.02 ? 417  LYS B CE  1 
ATOM   7245  N  NZ  . LYS B 1 417 ? 70.166  -17.898 40.988  1.00 21.27 ? 417  LYS B NZ  1 
ATOM   7246  N  N   . THR B 1 418 ? 62.409  -20.725 41.147  1.00 18.65 ? 418  THR B N   1 
ATOM   7247  C  CA  . THR B 1 418 ? 61.116  -20.210 41.531  1.00 17.33 ? 418  THR B CA  1 
ATOM   7248  C  C   . THR B 1 418 ? 61.149  -19.681 42.949  1.00 16.91 ? 418  THR B C   1 
ATOM   7249  O  O   . THR B 1 418 ? 60.544  -18.655 43.231  1.00 16.64 ? 418  THR B O   1 
ATOM   7250  C  CB  . THR B 1 418 ? 60.030  -21.276 41.369  1.00 17.39 ? 418  THR B CB  1 
ATOM   7251  O  OG1 . THR B 1 418 ? 60.469  -22.488 41.990  1.00 16.31 ? 418  THR B OG1 1 
ATOM   7252  C  CG2 . THR B 1 418 ? 59.765  -21.530 39.884  1.00 16.15 ? 418  THR B CG2 1 
ATOM   7253  N  N   . ASN B 1 419 ? 61.876  -20.370 43.829  1.00 16.52 ? 419  ASN B N   1 
ATOM   7254  C  CA  . ASN B 1 419 ? 62.010  -19.972 45.236  1.00 16.02 ? 419  ASN B CA  1 
ATOM   7255  C  C   . ASN B 1 419 ? 60.677  -19.391 45.782  1.00 15.63 ? 419  ASN B C   1 
ATOM   7256  O  O   . ASN B 1 419 ? 60.617  -18.225 46.218  1.00 15.67 ? 419  ASN B O   1 
ATOM   7257  C  CB  . ASN B 1 419 ? 63.206  -19.006 45.384  1.00 16.18 ? 419  ASN B CB  1 
ATOM   7258  C  CG  . ASN B 1 419 ? 63.599  -18.746 46.839  1.00 18.34 ? 419  ASN B CG  1 
ATOM   7259  O  OD1 . ASN B 1 419 ? 63.249  -19.510 47.747  1.00 19.71 ? 419  ASN B OD1 1 
ATOM   7260  N  ND2 . ASN B 1 419 ? 64.332  -17.648 47.064  1.00 18.04 ? 419  ASN B ND2 1 
ATOM   7261  N  N   . ASN B 1 420 ? 59.623  -20.218 45.747  1.00 14.36 ? 420  ASN B N   1 
ATOM   7262  C  CA  . ASN B 1 420 ? 58.258  -19.801 46.093  1.00 14.14 ? 420  ASN B CA  1 
ATOM   7263  C  C   . ASN B 1 420 ? 58.015  -19.452 47.573  1.00 13.77 ? 420  ASN B C   1 
ATOM   7264  O  O   . ASN B 1 420 ? 57.042  -18.736 47.897  1.00 12.67 ? 420  ASN B O   1 
ATOM   7265  C  CB  . ASN B 1 420 ? 57.216  -20.854 45.651  1.00 13.88 ? 420  ASN B CB  1 
ATOM   7266  C  CG  . ASN B 1 420 ? 57.076  -20.962 44.137  1.00 14.30 ? 420  ASN B CG  1 
ATOM   7267  O  OD1 . ASN B 1 420 ? 57.321  -20.009 43.391  1.00 13.81 ? 420  ASN B OD1 1 
ATOM   7268  N  ND2 . ASN B 1 420 ? 56.680  -22.138 43.678  1.00 12.89 ? 420  ASN B ND2 1 
ATOM   7269  N  N   . PHE B 1 421 ? 58.892  -19.977 48.441  1.00 13.60 ? 421  PHE B N   1 
ATOM   7270  C  CA  . PHE B 1 421 ? 58.717  -19.966 49.899  1.00 13.31 ? 421  PHE B CA  1 
ATOM   7271  C  C   . PHE B 1 421 ? 59.837  -19.265 50.656  1.00 14.03 ? 421  PHE B C   1 
ATOM   7272  O  O   . PHE B 1 421 ? 59.620  -18.730 51.763  1.00 14.41 ? 421  PHE B O   1 
ATOM   7273  C  CB  . PHE B 1 421 ? 58.583  -21.402 50.411  1.00 13.23 ? 421  PHE B CB  1 
ATOM   7274  C  CG  . PHE B 1 421 ? 57.500  -22.184 49.726  1.00 11.86 ? 421  PHE B CG  1 
ATOM   7275  C  CD1 . PHE B 1 421 ? 56.156  -21.830 49.892  1.00 11.99 ? 421  PHE B CD1 1 
ATOM   7276  C  CD2 . PHE B 1 421 ? 57.820  -23.256 48.901  1.00 12.73 ? 421  PHE B CD2 1 
ATOM   7277  C  CE1 . PHE B 1 421 ? 55.131  -22.538 49.247  1.00 12.90 ? 421  PHE B CE1 1 
ATOM   7278  C  CE2 . PHE B 1 421 ? 56.810  -23.981 48.235  1.00 13.53 ? 421  PHE B CE2 1 
ATOM   7279  C  CZ  . PHE B 1 421 ? 55.459  -23.624 48.417  1.00 13.09 ? 421  PHE B CZ  1 
ATOM   7280  N  N   . GLY B 1 422 ? 61.023  -19.251 50.052  1.00 14.23 ? 422  GLY B N   1 
ATOM   7281  C  CA  . GLY B 1 422 ? 62.235  -18.772 50.707  1.00 14.62 ? 422  GLY B CA  1 
ATOM   7282  C  C   . GLY B 1 422 ? 62.144  -17.302 51.003  1.00 15.42 ? 422  GLY B C   1 
ATOM   7283  O  O   . GLY B 1 422 ? 62.194  -16.901 52.174  1.00 16.20 ? 422  GLY B O   1 
ATOM   7284  N  N   . GLN B 1 423 ? 61.978  -16.488 49.956  1.00 15.46 ? 423  GLN B N   1 
ATOM   7285  C  CA  . GLN B 1 423 ? 61.844  -15.044 50.171  1.00 15.32 ? 423  GLN B CA  1 
ATOM   7286  C  C   . GLN B 1 423 ? 60.640  -14.666 51.047  1.00 14.75 ? 423  GLN B C   1 
ATOM   7287  O  O   . GLN B 1 423 ? 60.747  -13.779 51.903  1.00 14.75 ? 423  GLN B O   1 
ATOM   7288  C  CB  . GLN B 1 423 ? 61.862  -14.230 48.877  1.00 14.75 ? 423  GLN B CB  1 
ATOM   7289  C  CG  . GLN B 1 423 ? 62.131  -12.763 49.228  1.00 15.19 ? 423  GLN B CG  1 
ATOM   7290  C  CD  . GLN B 1 423 ? 62.174  -11.814 48.039  1.00 14.98 ? 423  GLN B CD  1 
ATOM   7291  O  OE1 . GLN B 1 423 ? 61.167  -11.168 47.718  1.00 14.51 ? 423  GLN B OE1 1 
ATOM   7292  N  NE2 . GLN B 1 423 ? 63.346  -11.692 47.413  1.00 10.40 ? 423  GLN B NE2 1 
ATOM   7293  N  N   . ALA B 1 424 ? 59.513  -15.348 50.835  1.00 14.34 ? 424  ALA B N   1 
ATOM   7294  C  CA  . ALA B 1 424 ? 58.342  -15.216 51.713  1.00 13.94 ? 424  ALA B CA  1 
ATOM   7295  C  C   . ALA B 1 424 ? 58.740  -15.396 53.178  1.00 13.89 ? 424  ALA B C   1 
ATOM   7296  O  O   . ALA B 1 424 ? 58.279  -14.655 54.050  1.00 13.02 ? 424  ALA B O   1 
ATOM   7297  C  CB  . ALA B 1 424 ? 57.275  -16.211 51.326  1.00 13.64 ? 424  ALA B CB  1 
ATOM   7298  N  N   . GLY B 1 425 ? 59.625  -16.370 53.431  1.00 14.57 ? 425  GLY B N   1 
ATOM   7299  C  CA  . GLY B 1 425 ? 60.143  -16.625 54.779  1.00 14.54 ? 425  GLY B CA  1 
ATOM   7300  C  C   . GLY B 1 425 ? 60.872  -15.422 55.326  1.00 15.08 ? 425  GLY B C   1 
ATOM   7301  O  O   . GLY B 1 425 ? 60.549  -14.947 56.416  1.00 15.79 ? 425  GLY B O   1 
ATOM   7302  N  N   . GLU B 1 426 ? 61.832  -14.906 54.554  1.00 15.36 ? 426  GLU B N   1 
ATOM   7303  C  CA  . GLU B 1 426 ? 62.607  -13.706 54.927  1.00 16.15 ? 426  GLU B CA  1 
ATOM   7304  C  C   . GLU B 1 426 ? 61.728  -12.482 55.176  1.00 15.85 ? 426  GLU B C   1 
ATOM   7305  O  O   . GLU B 1 426 ? 61.994  -11.696 56.088  1.00 16.39 ? 426  GLU B O   1 
ATOM   7306  C  CB  . GLU B 1 426 ? 63.640  -13.365 53.852  1.00 15.93 ? 426  GLU B CB  1 
ATOM   7307  C  CG  . GLU B 1 426 ? 64.567  -14.528 53.472  1.00 17.99 ? 426  GLU B CG  1 
ATOM   7308  C  CD  . GLU B 1 426 ? 65.350  -14.248 52.206  1.00 18.79 ? 426  GLU B CD  1 
ATOM   7309  O  OE1 . GLU B 1 426 ? 66.293  -13.431 52.269  1.00 22.07 ? 426  GLU B OE1 1 
ATOM   7310  O  OE2 . GLU B 1 426 ? 65.029  -14.848 51.148  1.00 22.85 ? 426  GLU B OE2 1 
ATOM   7311  N  N   . VAL B 1 427 ? 60.686  -12.318 54.361  1.00 15.69 ? 427  VAL B N   1 
ATOM   7312  C  CA  . VAL B 1 427 ? 59.749  -11.208 54.526  1.00 14.69 ? 427  VAL B CA  1 
ATOM   7313  C  C   . VAL B 1 427 ? 59.099  -11.336 55.884  1.00 14.50 ? 427  VAL B C   1 
ATOM   7314  O  O   . VAL B 1 427 ? 59.042  -10.365 56.636  1.00 15.00 ? 427  VAL B O   1 
ATOM   7315  C  CB  . VAL B 1 427 ? 58.685  -11.168 53.394  1.00 14.82 ? 427  VAL B CB  1 
ATOM   7316  C  CG1 . VAL B 1 427 ? 57.538  -10.216 53.744  1.00 13.98 ? 427  VAL B CG1 1 
ATOM   7317  C  CG2 . VAL B 1 427 ? 59.329  -10.795 52.059  1.00 14.11 ? 427  VAL B CG2 1 
ATOM   7318  N  N   . TYR B 1 428 ? 58.640  -12.538 56.224  1.00 14.56 ? 428  TYR B N   1 
ATOM   7319  C  CA  . TYR B 1 428 ? 58.041  -12.756 57.542  1.00 14.68 ? 428  TYR B CA  1 
ATOM   7320  C  C   . TYR B 1 428 ? 59.024  -12.448 58.674  1.00 14.97 ? 428  TYR B C   1 
ATOM   7321  O  O   . TYR B 1 428 ? 58.676  -11.765 59.650  1.00 14.76 ? 428  TYR B O   1 
ATOM   7322  C  CB  . TYR B 1 428 ? 57.521  -14.184 57.694  1.00 14.70 ? 428  TYR B CB  1 
ATOM   7323  C  CG  . TYR B 1 428 ? 56.885  -14.437 59.054  1.00 14.47 ? 428  TYR B CG  1 
ATOM   7324  C  CD1 . TYR B 1 428 ? 57.505  -15.264 60.007  1.00 14.50 ? 428  TYR B CD1 1 
ATOM   7325  C  CD2 . TYR B 1 428 ? 55.678  -13.832 59.390  1.00 12.33 ? 428  TYR B CD2 1 
ATOM   7326  C  CE1 . TYR B 1 428 ? 56.909  -15.492 61.259  1.00 14.73 ? 428  TYR B CE1 1 
ATOM   7327  C  CE2 . TYR B 1 428 ? 55.073  -14.058 60.610  1.00 12.76 ? 428  TYR B CE2 1 
ATOM   7328  C  CZ  . TYR B 1 428 ? 55.694  -14.874 61.548  1.00 14.05 ? 428  TYR B CZ  1 
ATOM   7329  O  OH  . TYR B 1 428 ? 55.081  -15.057 62.764  1.00 14.70 ? 428  TYR B OH  1 
ATOM   7330  N  N   . ARG B 1 429 ? 60.245  -12.962 58.529  1.00 15.18 ? 429  ARG B N   1 
ATOM   7331  C  CA  . ARG B 1 429 ? 61.301  -12.770 59.522  1.00 15.84 ? 429  ARG B CA  1 
ATOM   7332  C  C   . ARG B 1 429 ? 61.805  -11.335 59.611  1.00 16.43 ? 429  ARG B C   1 
ATOM   7333  O  O   . ARG B 1 429 ? 62.319  -10.953 60.643  1.00 16.04 ? 429  ARG B O   1 
ATOM   7334  C  CB  . ARG B 1 429 ? 62.448  -13.779 59.301  1.00 16.18 ? 429  ARG B CB  1 
ATOM   7335  C  CG  . ARG B 1 429 ? 62.080  -15.198 59.799  1.00 15.29 ? 429  ARG B CG  1 
ATOM   7336  C  CD  . ARG B 1 429 ? 63.209  -16.196 59.632  1.00 15.33 ? 429  ARG B CD  1 
ATOM   7337  N  NE  . ARG B 1 429 ? 63.605  -16.414 58.234  1.00 14.92 ? 429  ARG B NE  1 
ATOM   7338  C  CZ  . ARG B 1 429 ? 63.013  -17.257 57.384  1.00 12.84 ? 429  ARG B CZ  1 
ATOM   7339  N  NH1 . ARG B 1 429 ? 63.493  -17.372 56.154  1.00 10.76 ? 429  ARG B NH1 1 
ATOM   7340  N  NH2 . ARG B 1 429 ? 61.954  -17.990 57.758  1.00 12.01 ? 429  ARG B NH2 1 
ATOM   7341  N  N   . ARG B 1 430 ? 61.609  -10.535 58.551  1.00 17.43 ? 430  ARG B N   1 
ATOM   7342  C  CA  . ARG B 1 430 ? 61.907  -9.085  58.573  1.00 18.07 ? 430  ARG B CA  1 
ATOM   7343  C  C   . ARG B 1 430 ? 60.858  -8.236  59.288  1.00 18.59 ? 430  ARG B C   1 
ATOM   7344  O  O   . ARG B 1 430 ? 61.112  -7.079  59.617  1.00 18.83 ? 430  ARG B O   1 
ATOM   7345  C  CB  . ARG B 1 430 ? 62.128  -8.543  57.155  1.00 18.40 ? 430  ARG B CB  1 
ATOM   7346  C  CG  . ARG B 1 430 ? 63.538  -8.788  56.637  1.00 19.06 ? 430  ARG B CG  1 
ATOM   7347  C  CD  . ARG B 1 430 ? 63.556  -8.887  55.147  1.00 21.49 ? 430  ARG B CD  1 
ATOM   7348  N  NE  . ARG B 1 430 ? 64.914  -9.094  54.641  1.00 23.31 ? 430  ARG B NE  1 
ATOM   7349  C  CZ  . ARG B 1 430 ? 65.765  -8.111  54.336  1.00 23.37 ? 430  ARG B CZ  1 
ATOM   7350  N  NH1 . ARG B 1 430 ? 65.410  -6.833  54.478  1.00 19.46 ? 430  ARG B NH1 1 
ATOM   7351  N  NH2 . ARG B 1 430 ? 66.974  -8.413  53.882  1.00 22.79 ? 430  ARG B NH2 1 
ATOM   7352  N  N   . MET B 1 431 ? 59.689  -8.812  59.539  1.00 19.17 ? 431  MET B N   1 
ATOM   7353  C  CA  . MET B 1 431 ? 58.583  -8.090  60.181  1.00 19.56 ? 431  MET B CA  1 
ATOM   7354  C  C   . MET B 1 431 ? 58.839  -7.834  61.659  1.00 20.62 ? 431  MET B C   1 
ATOM   7355  O  O   . MET B 1 431 ? 59.490  -8.637  62.326  1.00 20.60 ? 431  MET B O   1 
ATOM   7356  C  CB  . MET B 1 431 ? 57.284  -8.896  60.070  1.00 19.14 ? 431  MET B CB  1 
ATOM   7357  C  CG  . MET B 1 431 ? 56.680  -8.929  58.700  1.00 19.02 ? 431  MET B CG  1 
ATOM   7358  S  SD  . MET B 1 431 ? 55.132  -9.835  58.679  1.00 17.86 ? 431  MET B SD  1 
ATOM   7359  C  CE  . MET B 1 431 ? 55.093  -10.208 56.925  1.00 16.67 ? 431  MET B CE  1 
ATOM   7360  N  N   . THR B 1 432 ? 58.296  -6.733  62.175  1.00 21.51 ? 432  THR B N   1 
ATOM   7361  C  CA  . THR B 1 432 ? 58.207  -6.553  63.618  1.00 22.55 ? 432  THR B CA  1 
ATOM   7362  C  C   . THR B 1 432 ? 57.238  -7.601  64.204  1.00 23.52 ? 432  THR B C   1 
ATOM   7363  O  O   . THR B 1 432 ? 56.490  -8.256  63.480  1.00 23.47 ? 432  THR B O   1 
ATOM   7364  C  CB  . THR B 1 432 ? 57.705  -5.161  63.990  1.00 22.23 ? 432  THR B CB  1 
ATOM   7365  O  OG1 . THR B 1 432 ? 56.326  -5.047  63.621  1.00 22.79 ? 432  THR B OG1 1 
ATOM   7366  C  CG2 . THR B 1 432 ? 58.512  -4.079  63.279  1.00 22.20 ? 432  THR B CG2 1 
ATOM   7367  N  N   . GLU B 1 433 ? 57.263  -7.747  65.521  1.00 24.82 ? 433  GLU B N   1 
ATOM   7368  C  CA  . GLU B 1 433 ? 56.373  -8.657  66.226  1.00 26.45 ? 433  GLU B CA  1 
ATOM   7369  C  C   . GLU B 1 433 ? 54.889  -8.246  66.106  1.00 25.78 ? 433  GLU B C   1 
ATOM   7370  O  O   . GLU B 1 433 ? 54.012  -9.100  65.987  1.00 25.65 ? 433  GLU B O   1 
ATOM   7371  C  CB  . GLU B 1 433 ? 56.862  -8.824  67.677  1.00 26.26 ? 433  GLU B CB  1 
ATOM   7372  C  CG  . GLU B 1 433 ? 55.826  -8.697  68.774  1.00 28.51 ? 433  GLU B CG  1 
ATOM   7373  C  CD  . GLU B 1 433 ? 56.387  -9.120  70.127  1.00 30.01 ? 433  GLU B CD  1 
ATOM   7374  O  OE1 . GLU B 1 433 ? 56.935  -10.257 70.210  1.00 31.38 ? 433  GLU B OE1 1 
ATOM   7375  O  OE2 . GLU B 1 433 ? 56.279  -8.313  71.096  1.00 33.39 ? 433  GLU B OE2 1 
ATOM   7376  N  N   . GLU B 1 434 ? 54.631  -6.942  66.107  1.00 25.69 ? 434  GLU B N   1 
ATOM   7377  C  CA  . GLU B 1 434 ? 53.286  -6.410  65.907  1.00 25.82 ? 434  GLU B CA  1 
ATOM   7378  C  C   . GLU B 1 434 ? 52.796  -6.732  64.487  1.00 24.92 ? 434  GLU B C   1 
ATOM   7379  O  O   . GLU B 1 434 ? 51.677  -7.220  64.324  1.00 24.62 ? 434  GLU B O   1 
ATOM   7380  C  CB  . GLU B 1 434 ? 53.237  -4.897  66.182  1.00 26.60 ? 434  GLU B CB  1 
ATOM   7381  C  CG  . GLU B 1 434 ? 53.908  -4.454  67.516  1.00 30.20 ? 434  GLU B CG  1 
ATOM   7382  C  CD  . GLU B 1 434 ? 55.430  -4.243  67.387  1.00 33.85 ? 434  GLU B CD  1 
ATOM   7383  O  OE1 . GLU B 1 434 ? 56.198  -5.073  67.930  1.00 34.42 ? 434  GLU B OE1 1 
ATOM   7384  O  OE2 . GLU B 1 434 ? 55.854  -3.263  66.721  1.00 35.54 ? 434  GLU B OE2 1 
ATOM   7385  N  N   . GLU B 1 435 ? 53.635  -6.486  63.472  1.00 23.70 ? 435  GLU B N   1 
ATOM   7386  C  CA  . GLU B 1 435 ? 53.324  -6.900  62.093  1.00 22.89 ? 435  GLU B CA  1 
ATOM   7387  C  C   . GLU B 1 435 ? 53.029  -8.391  62.021  1.00 22.11 ? 435  GLU B C   1 
ATOM   7388  O  O   . GLU B 1 435 ? 52.044  -8.797  61.397  1.00 21.66 ? 435  GLU B O   1 
ATOM   7389  C  CB  . GLU B 1 435 ? 54.442  -6.537  61.105  1.00 22.78 ? 435  GLU B CB  1 
ATOM   7390  C  CG  . GLU B 1 435 ? 54.607  -5.032  60.886  1.00 23.31 ? 435  GLU B CG  1 
ATOM   7391  C  CD  . GLU B 1 435 ? 55.845  -4.651  60.082  1.00 23.38 ? 435  GLU B CD  1 
ATOM   7392  O  OE1 . GLU B 1 435 ? 56.895  -5.323  60.143  1.00 23.27 ? 435  GLU B OE1 1 
ATOM   7393  O  OE2 . GLU B 1 435 ? 55.761  -3.636  59.378  1.00 26.79 ? 435  GLU B OE2 1 
ATOM   7394  N  N   . GLN B 1 436 ? 53.859  -9.198  62.691  1.00 21.55 ? 436  GLN B N   1 
ATOM   7395  C  CA  . GLN B 1 436 ? 53.654  -10.651 62.732  1.00 21.33 ? 436  GLN B CA  1 
ATOM   7396  C  C   . GLN B 1 436 ? 52.354  -11.099 63.411  1.00 21.21 ? 436  GLN B C   1 
ATOM   7397  O  O   . GLN B 1 436 ? 51.742  -12.062 62.967  1.00 21.10 ? 436  GLN B O   1 
ATOM   7398  C  CB  . GLN B 1 436 ? 54.853  -11.359 63.346  1.00 21.24 ? 436  GLN B CB  1 
ATOM   7399  C  CG  . GLN B 1 436 ? 56.082  -11.362 62.476  1.00 20.91 ? 436  GLN B CG  1 
ATOM   7400  C  CD  . GLN B 1 436 ? 57.271  -12.019 63.158  1.00 22.28 ? 436  GLN B CD  1 
ATOM   7401  O  OE1 . GLN B 1 436 ? 57.279  -12.211 64.373  1.00 23.72 ? 436  GLN B OE1 1 
ATOM   7402  N  NE2 . GLN B 1 436 ? 58.280  -12.366 62.377  1.00 21.37 ? 436  GLN B NE2 1 
ATOM   7403  N  N   . MET B 1 437 ? 51.943  -10.410 64.475  1.00 21.41 ? 437  MET B N   1 
ATOM   7404  C  CA  . MET B 1 437 ? 50.672  -10.697 65.150  1.00 22.87 ? 437  MET B CA  1 
ATOM   7405  C  C   . MET B 1 437 ? 49.478  -10.320 64.255  1.00 20.95 ? 437  MET B C   1 
ATOM   7406  O  O   . MET B 1 437 ? 48.558  -11.125 64.064  1.00 20.73 ? 437  MET B O   1 
ATOM   7407  C  CB  . MET B 1 437 ? 50.571  -9.979  66.516  1.00 23.03 ? 437  MET B CB  1 
ATOM   7408  C  CG  . MET B 1 437 ? 51.603  -10.419 67.594  1.00 25.70 ? 437  MET B CG  1 
ATOM   7409  S  SD  . MET B 1 437 ? 51.552  -9.403  69.130  1.00 29.63 ? 437  MET B SD  1 
ATOM   7410  C  CE  . MET B 1 437 ? 49.962  -9.935  69.818  1.00 31.43 ? 437  MET B CE  1 
ATOM   7411  N  N   . ALA B 1 438 ? 49.506  -9.105  63.707  1.00 19.76 ? 438  ALA B N   1 
ATOM   7412  C  CA  . ALA B 1 438 ? 48.509  -8.652  62.718  1.00 18.78 ? 438  ALA B CA  1 
ATOM   7413  C  C   . ALA B 1 438 ? 48.373  -9.633  61.553  1.00 18.04 ? 438  ALA B C   1 
ATOM   7414  O  O   . ALA B 1 438 ? 47.256  -10.016 61.191  1.00 18.20 ? 438  ALA B O   1 
ATOM   7415  C  CB  . ALA B 1 438 ? 48.856  -7.251  62.194  1.00 18.22 ? 438  ALA B CB  1 
ATOM   7416  N  N   . LEU B 1 439 ? 49.505  -10.052 60.979  1.00 17.03 ? 439  LEU B N   1 
ATOM   7417  C  CA  . LEU B 1 439 ? 49.484  -11.023 59.878  1.00 16.07 ? 439  LEU B CA  1 
ATOM   7418  C  C   . LEU B 1 439 ? 48.723  -12.287 60.269  1.00 15.74 ? 439  LEU B C   1 
ATOM   7419  O  O   . LEU B 1 439 ? 47.899  -12.774 59.510  1.00 15.25 ? 439  LEU B O   1 
ATOM   7420  C  CB  . LEU B 1 439 ? 50.899  -11.375 59.404  1.00 15.76 ? 439  LEU B CB  1 
ATOM   7421  C  CG  . LEU B 1 439 ? 51.002  -12.519 58.378  1.00 16.46 ? 439  LEU B CG  1 
ATOM   7422  C  CD1 . LEU B 1 439 ? 50.334  -12.159 57.014  1.00 15.42 ? 439  LEU B CD1 1 
ATOM   7423  C  CD2 . LEU B 1 439 ? 52.441  -13.005 58.162  1.00 14.88 ? 439  LEU B CD2 1 
ATOM   7424  N  N   . LEU B 1 440 ? 49.007  -12.795 61.466  1.00 15.63 ? 440  LEU B N   1 
ATOM   7425  C  CA  . LEU B 1 440 ? 48.407  -14.026 61.961  1.00 15.50 ? 440  LEU B CA  1 
ATOM   7426  C  C   . LEU B 1 440 ? 46.921  -13.827 62.182  1.00 15.24 ? 440  LEU B C   1 
ATOM   7427  O  O   . LEU B 1 440 ? 46.114  -14.638 61.737  1.00 15.42 ? 440  LEU B O   1 
ATOM   7428  C  CB  . LEU B 1 440 ? 49.112  -14.499 63.247  1.00 15.43 ? 440  LEU B CB  1 
ATOM   7429  C  CG  . LEU B 1 440 ? 48.586  -15.756 63.948  1.00 16.01 ? 440  LEU B CG  1 
ATOM   7430  C  CD1 . LEU B 1 440 ? 48.686  -17.018 63.056  1.00 13.59 ? 440  LEU B CD1 1 
ATOM   7431  C  CD2 . LEU B 1 440 ? 49.293  -15.957 65.285  1.00 15.72 ? 440  LEU B CD2 1 
ATOM   7432  N  N   . ASN B 1 441 ? 46.555  -12.730 62.835  1.00 15.52 ? 441  ASN B N   1 
ATOM   7433  C  CA  . ASN B 1 441 ? 45.146  -12.434 63.055  1.00 16.13 ? 441  ASN B CA  1 
ATOM   7434  C  C   . ASN B 1 441 ? 44.379  -12.374 61.733  1.00 15.60 ? 441  ASN B C   1 
ATOM   7435  O  O   . ASN B 1 441 ? 43.298  -12.950 61.629  1.00 15.70 ? 441  ASN B O   1 
ATOM   7436  C  CB  . ASN B 1 441 ? 44.948  -11.124 63.836  1.00 16.77 ? 441  ASN B CB  1 
ATOM   7437  C  CG  . ASN B 1 441 ? 45.333  -11.227 65.329  1.00 20.30 ? 441  ASN B CG  1 
ATOM   7438  O  OD1 . ASN B 1 441 ? 45.158  -10.255 66.072  1.00 24.12 ? 441  ASN B OD1 1 
ATOM   7439  N  ND2 . ASN B 1 441 ? 45.858  -12.383 65.767  1.00 22.71 ? 441  ASN B ND2 1 
ATOM   7440  N  N   . ASN B 1 442 ? 44.943  -11.689 60.736  1.00 14.50 ? 442  ASN B N   1 
ATOM   7441  C  CA  . ASN B 1 442 ? 44.267  -11.480 59.456  1.00 14.05 ? 442  ASN B CA  1 
ATOM   7442  C  C   . ASN B 1 442 ? 44.128  -12.768 58.641  1.00 13.71 ? 442  ASN B C   1 
ATOM   7443  O  O   . ASN B 1 442 ? 43.045  -13.062 58.133  1.00 13.52 ? 442  ASN B O   1 
ATOM   7444  C  CB  . ASN B 1 442 ? 44.956  -10.370 58.632  1.00 14.22 ? 442  ASN B CB  1 
ATOM   7445  C  CG  . ASN B 1 442 ? 44.861  -8.987  59.290  1.00 13.50 ? 442  ASN B CG  1 
ATOM   7446  O  OD1 . ASN B 1 442 ? 43.917  -8.691  60.016  1.00 13.36 ? 442  ASN B OD1 1 
ATOM   7447  N  ND2 . ASN B 1 442 ? 45.850  -8.142  59.031  1.00 13.64 ? 442  ASN B ND2 1 
ATOM   7448  N  N   . LEU B 1 443 ? 45.215  -13.535 58.547  1.00 13.26 ? 443  LEU B N   1 
ATOM   7449  C  CA  . LEU B 1 443 ? 45.200  -14.850 57.903  1.00 13.34 ? 443  LEU B CA  1 
ATOM   7450  C  C   . LEU B 1 443 ? 44.186  -15.795 58.544  1.00 13.49 ? 443  LEU B C   1 
ATOM   7451  O  O   . LEU B 1 443 ? 43.481  -16.521 57.840  1.00 13.09 ? 443  LEU B O   1 
ATOM   7452  C  CB  . LEU B 1 443 ? 46.585  -15.514 57.957  1.00 13.04 ? 443  LEU B CB  1 
ATOM   7453  C  CG  . LEU B 1 443 ? 47.715  -14.978 57.074  1.00 13.24 ? 443  LEU B CG  1 
ATOM   7454  C  CD1 . LEU B 1 443 ? 49.034  -15.608 57.494  1.00 12.90 ? 443  LEU B CD1 1 
ATOM   7455  C  CD2 . LEU B 1 443 ? 47.428  -15.246 55.598  1.00 12.52 ? 443  LEU B CD2 1 
ATOM   7456  N  N   . VAL B 1 444 ? 44.142  -15.806 59.876  1.00 13.58 ? 444  VAL B N   1 
ATOM   7457  C  CA  . VAL B 1 444 ? 43.257  -16.715 60.591  1.00 13.99 ? 444  VAL B CA  1 
ATOM   7458  C  C   . VAL B 1 444 ? 41.816  -16.301 60.326  1.00 14.24 ? 444  VAL B C   1 
ATOM   7459  O  O   . VAL B 1 444 ? 41.004  -17.131 59.908  1.00 14.40 ? 444  VAL B O   1 
ATOM   7460  C  CB  . VAL B 1 444 ? 43.584  -16.818 62.137  1.00 14.22 ? 444  VAL B CB  1 
ATOM   7461  C  CG1 . VAL B 1 444 ? 42.443  -17.502 62.889  1.00 13.22 ? 444  VAL B CG1 1 
ATOM   7462  C  CG2 . VAL B 1 444 ? 44.916  -17.554 62.377  1.00 11.78 ? 444  VAL B CG2 1 
ATOM   7463  N  N   . ASN B 1 445 ? 41.512  -15.020 60.516  1.00 14.42 ? 445  ASN B N   1 
ATOM   7464  C  CA  . ASN B 1 445 ? 40.190  -14.499 60.141  1.00 15.56 ? 445  ASN B CA  1 
ATOM   7465  C  C   . ASN B 1 445 ? 39.774  -14.883 58.703  1.00 15.00 ? 445  ASN B C   1 
ATOM   7466  O  O   . ASN B 1 445 ? 38.618  -15.217 58.456  1.00 15.33 ? 445  ASN B O   1 
ATOM   7467  C  CB  . ASN B 1 445 ? 40.112  -12.983 60.318  1.00 15.64 ? 445  ASN B CB  1 
ATOM   7468  C  CG  . ASN B 1 445 ? 38.741  -12.413 59.900  1.00 19.72 ? 445  ASN B CG  1 
ATOM   7469  O  OD1 . ASN B 1 445 ? 38.563  -11.906 58.776  1.00 22.19 ? 445  ASN B OD1 1 
ATOM   7470  N  ND2 . ASN B 1 445 ? 37.765  -12.511 60.800  1.00 21.47 ? 445  ASN B ND2 1 
ATOM   7471  N  N   . ASP B 1 446 ? 40.726  -14.835 57.773  1.00 14.47 ? 446  ASP B N   1 
ATOM   7472  C  CA  . ASP B 1 446 ? 40.464  -15.186 56.382  1.00 14.34 ? 446  ASP B CA  1 
ATOM   7473  C  C   . ASP B 1 446 ? 40.309  -16.686 56.141  1.00 13.92 ? 446  ASP B C   1 
ATOM   7474  O  O   . ASP B 1 446 ? 39.403  -17.114 55.407  1.00 13.62 ? 446  ASP B O   1 
ATOM   7475  C  CB  . ASP B 1 446 ? 41.543  -14.611 55.455  1.00 14.43 ? 446  ASP B CB  1 
ATOM   7476  C  CG  . ASP B 1 446 ? 40.944  -13.853 54.295  1.00 14.49 ? 446  ASP B CG  1 
ATOM   7477  O  OD1 . ASP B 1 446 ? 41.110  -14.264 53.136  1.00 15.43 ? 446  ASP B OD1 1 
ATOM   7478  O  OD2 . ASP B 1 446 ? 40.259  -12.859 54.553  1.00 14.94 ? 446  ASP B OD2 1 
ATOM   7479  N  N   . LEU B 1 447 ? 41.181  -17.484 56.759  1.00 13.52 ? 447  LEU B N   1 
ATOM   7480  C  CA  . LEU B 1 447 ? 41.158  -18.931 56.537  1.00 13.43 ? 447  LEU B CA  1 
ATOM   7481  C  C   . LEU B 1 447 ? 40.026  -19.662 57.282  1.00 13.64 ? 447  LEU B C   1 
ATOM   7482  O  O   . LEU B 1 447 ? 39.676  -20.770 56.917  1.00 14.07 ? 447  LEU B O   1 
ATOM   7483  C  CB  . LEU B 1 447 ? 42.535  -19.556 56.790  1.00 13.00 ? 447  LEU B CB  1 
ATOM   7484  C  CG  . LEU B 1 447 ? 43.611  -19.198 55.759  1.00 12.54 ? 447  LEU B CG  1 
ATOM   7485  C  CD1 . LEU B 1 447 ? 45.046  -19.356 56.335  1.00 11.54 ? 447  LEU B CD1 1 
ATOM   7486  C  CD2 . LEU B 1 447 ? 43.425  -20.000 54.462  1.00 8.48  ? 447  LEU B CD2 1 
ATOM   7487  N  N   . GLN B 1 448 ? 39.437  -19.027 58.294  1.00 14.08 ? 448  GLN B N   1 
ATOM   7488  C  CA  . GLN B 1 448 ? 38.253  -19.561 58.964  1.00 14.33 ? 448  GLN B CA  1 
ATOM   7489  C  C   . GLN B 1 448 ? 37.032  -19.513 58.046  1.00 14.58 ? 448  GLN B C   1 
ATOM   7490  O  O   . GLN B 1 448 ? 36.011  -20.156 58.328  1.00 14.59 ? 448  GLN B O   1 
ATOM   7491  C  CB  . GLN B 1 448 ? 37.952  -18.779 60.251  1.00 14.44 ? 448  GLN B CB  1 
ATOM   7492  C  CG  . GLN B 1 448 ? 38.810  -19.174 61.468  1.00 14.18 ? 448  GLN B CG  1 
ATOM   7493  C  CD  . GLN B 1 448 ? 38.621  -18.230 62.661  1.00 16.10 ? 448  GLN B CD  1 
ATOM   7494  O  OE1 . GLN B 1 448 ? 38.063  -17.114 62.527  1.00 17.01 ? 448  GLN B OE1 1 
ATOM   7495  N  NE2 . GLN B 1 448 ? 39.100  -18.663 63.836  1.00 15.99 ? 448  GLN B NE2 1 
ATOM   7496  N  N   . GLN B 1 449 ? 37.129  -18.731 56.967  1.00 14.14 ? 449  GLN B N   1 
ATOM   7497  C  CA  . GLN B 1 449 ? 36.034  -18.591 55.999  1.00 13.97 ? 449  GLN B CA  1 
ATOM   7498  C  C   . GLN B 1 449 ? 36.208  -19.529 54.790  1.00 12.90 ? 449  GLN B C   1 
ATOM   7499  O  O   . GLN B 1 449 ? 35.342  -19.593 53.932  1.00 12.08 ? 449  GLN B O   1 
ATOM   7500  C  CB  . GLN B 1 449 ? 35.905  -17.138 55.533  1.00 13.42 ? 449  GLN B CB  1 
ATOM   7501  C  CG  . GLN B 1 449 ? 35.631  -16.121 56.638  1.00 15.40 ? 449  GLN B CG  1 
ATOM   7502  C  CD  . GLN B 1 449 ? 35.849  -14.672 56.169  1.00 17.29 ? 449  GLN B CD  1 
ATOM   7503  O  OE1 . GLN B 1 449 ? 35.201  -14.202 55.213  1.00 22.43 ? 449  GLN B OE1 1 
ATOM   7504  N  NE2 . GLN B 1 449 ? 36.761  -13.959 56.839  1.00 18.73 ? 449  GLN B NE2 1 
ATOM   7505  N  N   . VAL B 1 450 ? 37.327  -20.253 54.727  1.00 12.29 ? 450  VAL B N   1 
ATOM   7506  C  CA  . VAL B 1 450 ? 37.504  -21.282 53.708  1.00 11.83 ? 450  VAL B CA  1 
ATOM   7507  C  C   . VAL B 1 450 ? 36.696  -22.537 54.141  1.00 12.48 ? 450  VAL B C   1 
ATOM   7508  O  O   . VAL B 1 450 ? 36.638  -22.854 55.328  1.00 12.51 ? 450  VAL B O   1 
ATOM   7509  C  CB  . VAL B 1 450 ? 39.021  -21.550 53.396  1.00 11.54 ? 450  VAL B CB  1 
ATOM   7510  C  CG1 . VAL B 1 450 ? 39.209  -22.690 52.365  1.00 8.78  ? 450  VAL B CG1 1 
ATOM   7511  C  CG2 . VAL B 1 450 ? 39.684  -20.286 52.868  1.00 10.39 ? 450  VAL B CG2 1 
ATOM   7512  N  N   . ARG B 1 451 ? 36.043  -23.212 53.196  1.00 12.75 ? 451  ARG B N   1 
ATOM   7513  C  CA  . ARG B 1 451 ? 35.061  -24.264 53.546  1.00 13.71 ? 451  ARG B CA  1 
ATOM   7514  C  C   . ARG B 1 451 ? 35.526  -25.654 53.084  1.00 14.32 ? 451  ARG B C   1 
ATOM   7515  O  O   . ARG B 1 451 ? 34.796  -26.634 53.181  1.00 14.35 ? 451  ARG B O   1 
ATOM   7516  C  CB  . ARG B 1 451 ? 33.648  -23.923 52.993  1.00 13.06 ? 451  ARG B CB  1 
ATOM   7517  C  CG  . ARG B 1 451 ? 32.999  -22.641 53.592  1.00 12.78 ? 451  ARG B CG  1 
ATOM   7518  C  CD  . ARG B 1 451 ? 31.596  -22.315 52.986  1.00 14.39 ? 451  ARG B CD  1 
ATOM   7519  N  NE  . ARG B 1 451 ? 31.574  -22.244 51.510  1.00 13.29 ? 451  ARG B NE  1 
ATOM   7520  C  CZ  . ARG B 1 451 ? 32.006  -21.204 50.784  1.00 13.21 ? 451  ARG B CZ  1 
ATOM   7521  N  NH1 . ARG B 1 451 ? 32.505  -20.124 51.383  1.00 13.03 ? 451  ARG B NH1 1 
ATOM   7522  N  NH2 . ARG B 1 451 ? 31.931  -21.235 49.451  1.00 9.55  ? 451  ARG B NH2 1 
ATOM   7523  N  N   . HIS B 1 452 ? 36.753  -25.720 52.581  1.00 14.95 ? 452  HIS B N   1 
ATOM   7524  C  CA  . HIS B 1 452 ? 37.315  -26.947 52.081  1.00 15.75 ? 452  HIS B CA  1 
ATOM   7525  C  C   . HIS B 1 452 ? 38.574  -27.234 52.888  1.00 16.74 ? 452  HIS B C   1 
ATOM   7526  O  O   . HIS B 1 452 ? 39.488  -26.399 52.933  1.00 17.14 ? 452  HIS B O   1 
ATOM   7527  C  CB  . HIS B 1 452 ? 37.598  -26.806 50.584  1.00 15.70 ? 452  HIS B CB  1 
ATOM   7528  C  CG  . HIS B 1 452 ? 36.361  -26.866 49.736  1.00 16.25 ? 452  HIS B CG  1 
ATOM   7529  N  ND1 . HIS B 1 452 ? 35.537  -25.774 49.536  1.00 15.68 ? 452  HIS B ND1 1 
ATOM   7530  C  CD2 . HIS B 1 452 ? 35.789  -27.897 49.065  1.00 16.52 ? 452  HIS B CD2 1 
ATOM   7531  C  CE1 . HIS B 1 452 ? 34.521  -26.127 48.766  1.00 16.79 ? 452  HIS B CE1 1 
ATOM   7532  N  NE2 . HIS B 1 452 ? 34.648  -27.411 48.467  1.00 17.02 ? 452  HIS B NE2 1 
ATOM   7533  N  N   . GLU B 1 453 ? 38.608  -28.387 53.561  1.00 17.60 ? 453  GLU B N   1 
ATOM   7534  C  CA  . GLU B 1 453 ? 39.735  -28.724 54.451  1.00 18.27 ? 453  GLU B CA  1 
ATOM   7535  C  C   . GLU B 1 453 ? 41.096  -28.756 53.708  1.00 16.84 ? 453  GLU B C   1 
ATOM   7536  O  O   . GLU B 1 453 ? 42.101  -28.252 54.220  1.00 16.40 ? 453  GLU B O   1 
ATOM   7537  C  CB  . GLU B 1 453 ? 39.474  -30.025 55.262  1.00 17.80 ? 453  GLU B CB  1 
ATOM   7538  C  CG  . GLU B 1 453 ? 40.744  -30.610 55.969  1.00 20.02 ? 453  GLU B CG  1 
ATOM   7539  C  CD  . GLU B 1 453 ? 40.488  -31.359 57.319  1.00 22.82 ? 453  GLU B CD  1 
ATOM   7540  O  OE1 . GLU B 1 453 ? 39.322  -31.371 57.823  1.00 27.45 ? 453  GLU B OE1 1 
ATOM   7541  O  OE2 . GLU B 1 453 ? 41.481  -31.913 57.890  1.00 25.10 ? 453  GLU B OE2 1 
ATOM   7542  N  N   . ASN B 1 454 ? 41.114  -29.324 52.506  1.00 15.75 ? 454  ASN B N   1 
ATOM   7543  C  CA  . ASN B 1 454 ? 42.362  -29.460 51.750  1.00 15.53 ? 454  ASN B CA  1 
ATOM   7544  C  C   . ASN B 1 454 ? 43.059  -28.116 51.418  1.00 14.94 ? 454  ASN B C   1 
ATOM   7545  O  O   . ASN B 1 454 ? 44.298  -28.009 51.430  1.00 15.06 ? 454  ASN B O   1 
ATOM   7546  C  CB  . ASN B 1 454 ? 42.140  -30.275 50.483  1.00 15.09 ? 454  ASN B CB  1 
ATOM   7547  C  CG  . ASN B 1 454 ? 43.444  -30.795 49.902  1.00 17.01 ? 454  ASN B CG  1 
ATOM   7548  O  OD1 . ASN B 1 454 ? 43.976  -30.244 48.929  1.00 17.21 ? 454  ASN B OD1 1 
ATOM   7549  N  ND2 . ASN B 1 454 ? 43.977  -31.858 50.507  1.00 18.33 ? 454  ASN B ND2 1 
ATOM   7550  N  N   . THR B 1 455 ? 42.253  -27.100 51.146  1.00 13.72 ? 455  THR B N   1 
ATOM   7551  C  CA  . THR B 1 455 ? 42.751  -25.767 50.879  1.00 13.26 ? 455  THR B CA  1 
ATOM   7552  C  C   . THR B 1 455 ? 43.375  -25.160 52.144  1.00 13.28 ? 455  THR B C   1 
ATOM   7553  O  O   . THR B 1 455 ? 44.471  -24.603 52.088  1.00 13.00 ? 455  THR B O   1 
ATOM   7554  C  CB  . THR B 1 455 ? 41.615  -24.853 50.306  1.00 13.17 ? 455  THR B CB  1 
ATOM   7555  O  OG1 . THR B 1 455 ? 41.100  -25.435 49.098  1.00 11.77 ? 455  THR B OG1 1 
ATOM   7556  C  CG2 . THR B 1 455 ? 42.132  -23.454 50.012  1.00 12.36 ? 455  THR B CG2 1 
ATOM   7557  N  N   . VAL B 1 456 ? 42.686  -25.260 53.279  1.00 13.37 ? 456  VAL B N   1 
ATOM   7558  C  CA  . VAL B 1 456 ? 43.249  -24.760 54.544  1.00 14.08 ? 456  VAL B CA  1 
ATOM   7559  C  C   . VAL B 1 456 ? 44.597  -25.441 54.868  1.00 14.47 ? 456  VAL B C   1 
ATOM   7560  O  O   . VAL B 1 456 ? 45.574  -24.773 55.165  1.00 14.10 ? 456  VAL B O   1 
ATOM   7561  C  CB  . VAL B 1 456 ? 42.263  -24.891 55.710  1.00 14.11 ? 456  VAL B CB  1 
ATOM   7562  C  CG1 . VAL B 1 456 ? 42.843  -24.275 56.966  1.00 12.49 ? 456  VAL B CG1 1 
ATOM   7563  C  CG2 . VAL B 1 456 ? 40.924  -24.230 55.336  1.00 13.65 ? 456  VAL B CG2 1 
ATOM   7564  N  N   . LEU B 1 457 ? 44.642  -26.764 54.742  1.00 15.21 ? 457  LEU B N   1 
ATOM   7565  C  CA  . LEU B 1 457 ? 45.873  -27.534 54.894  1.00 15.42 ? 457  LEU B CA  1 
ATOM   7566  C  C   . LEU B 1 457 ? 46.967  -27.052 53.942  1.00 15.36 ? 457  LEU B C   1 
ATOM   7567  O  O   . LEU B 1 457 ? 48.120  -26.904 54.344  1.00 15.76 ? 457  LEU B O   1 
ATOM   7568  C  CB  . LEU B 1 457 ? 45.587  -29.007 54.604  1.00 15.48 ? 457  LEU B CB  1 
ATOM   7569  C  CG  . LEU B 1 457 ? 46.309  -30.181 55.282  1.00 16.65 ? 457  LEU B CG  1 
ATOM   7570  C  CD1 . LEU B 1 457 ? 46.667  -31.217 54.207  1.00 15.66 ? 457  LEU B CD1 1 
ATOM   7571  C  CD2 . LEU B 1 457 ? 47.542  -29.802 56.152  1.00 15.92 ? 457  LEU B CD2 1 
ATOM   7572  N  N   . LEU B 1 458 ? 46.617  -26.835 52.674  1.00 15.30 ? 458  LEU B N   1 
ATOM   7573  C  CA  . LEU B 1 458 ? 47.604  -26.372 51.685  1.00 15.09 ? 458  LEU B CA  1 
ATOM   7574  C  C   . LEU B 1 458 ? 48.159  -24.995 52.066  1.00 14.27 ? 458  LEU B C   1 
ATOM   7575  O  O   . LEU B 1 458 ? 49.370  -24.768 51.991  1.00 13.87 ? 458  LEU B O   1 
ATOM   7576  C  CB  . LEU B 1 458 ? 47.003  -26.310 50.280  1.00 15.44 ? 458  LEU B CB  1 
ATOM   7577  C  CG  . LEU B 1 458 ? 47.739  -27.003 49.125  1.00 18.58 ? 458  LEU B CG  1 
ATOM   7578  C  CD1 . LEU B 1 458 ? 47.268  -26.476 47.776  1.00 19.07 ? 458  LEU B CD1 1 
ATOM   7579  C  CD2 . LEU B 1 458 ? 49.271  -26.931 49.232  1.00 20.76 ? 458  LEU B CD2 1 
ATOM   7580  N  N   . ALA B 1 459 ? 47.261  -24.088 52.459  1.00 13.18 ? 459  ALA B N   1 
ATOM   7581  C  CA  . ALA B 1 459 ? 47.631  -22.741 52.867  1.00 12.18 ? 459  ALA B CA  1 
ATOM   7582  C  C   . ALA B 1 459 ? 48.610  -22.816 54.022  1.00 11.66 ? 459  ALA B C   1 
ATOM   7583  O  O   . ALA B 1 459 ? 49.683  -22.224 53.951  1.00 11.05 ? 459  ALA B O   1 
ATOM   7584  C  CB  . ALA B 1 459 ? 46.397  -21.913 53.240  1.00 11.12 ? 459  ALA B CB  1 
ATOM   7585  N  N   . ILE B 1 460 ? 48.248  -23.582 55.056  1.00 11.67 ? 460  ILE B N   1 
ATOM   7586  C  CA  . ILE B 1 460 ? 49.096  -23.772 56.244  1.00 11.99 ? 460  ILE B CA  1 
ATOM   7587  C  C   . ILE B 1 460 ? 50.475  -24.364 55.877  1.00 12.19 ? 460  ILE B C   1 
ATOM   7588  O  O   . ILE B 1 460 ? 51.498  -23.839 56.307  1.00 11.76 ? 460  ILE B O   1 
ATOM   7589  C  CB  . ILE B 1 460 ? 48.380  -24.586 57.370  1.00 12.30 ? 460  ILE B CB  1 
ATOM   7590  C  CG1 . ILE B 1 460 ? 47.158  -23.824 57.880  1.00 11.98 ? 460  ILE B CG1 1 
ATOM   7591  C  CG2 . ILE B 1 460 ? 49.331  -24.853 58.571  1.00 13.25 ? 460  ILE B CG2 1 
ATOM   7592  C  CD1 . ILE B 1 460 ? 46.237  -24.642 58.778  1.00 11.27 ? 460  ILE B CD1 1 
ATOM   7593  N  N   . CYS B 1 461 ? 50.490  -25.417 55.061  1.00 12.56 ? 461  CYS B N   1 
ATOM   7594  C  CA  . CYS B 1 461 ? 51.737  -25.966 54.518  1.00 14.02 ? 461  CYS B CA  1 
ATOM   7595  C  C   . CYS B 1 461 ? 52.560  -24.950 53.705  1.00 13.88 ? 461  CYS B C   1 
ATOM   7596  O  O   . CYS B 1 461 ? 53.790  -24.911 53.803  1.00 14.08 ? 461  CYS B O   1 
ATOM   7597  C  CB  . CYS B 1 461 ? 51.469  -27.238 53.702  1.00 14.32 ? 461  CYS B CB  1 
ATOM   7598  S  SG  . CYS B 1 461 ? 50.811  -28.626 54.718  1.00 17.85 ? 461  CYS B SG  1 
ATOM   7599  N  N   . ASN B 1 462 ? 51.889  -24.122 52.914  1.00 14.00 ? 462  ASN B N   1 
ATOM   7600  C  CA  . ASN B 1 462 ? 52.589  -23.105 52.148  1.00 13.79 ? 462  ASN B CA  1 
ATOM   7601  C  C   . ASN B 1 462 ? 53.276  -22.103 53.094  1.00 13.84 ? 462  ASN B C   1 
ATOM   7602  O  O   . ASN B 1 462 ? 54.447  -21.771 52.912  1.00 13.64 ? 462  ASN B O   1 
ATOM   7603  C  CB  . ASN B 1 462 ? 51.651  -22.425 51.142  1.00 13.38 ? 462  ASN B CB  1 
ATOM   7604  C  CG  . ASN B 1 462 ? 51.345  -23.306 49.926  1.00 13.42 ? 462  ASN B CG  1 
ATOM   7605  O  OD1 . ASN B 1 462 ? 52.082  -24.251 49.616  1.00 13.60 ? 462  ASN B OD1 1 
ATOM   7606  N  ND2 . ASN B 1 462 ? 50.271  -22.979 49.217  1.00 11.67 ? 462  ASN B ND2 1 
ATOM   7607  N  N   . PHE B 1 463 ? 52.574  -21.667 54.130  1.00 13.98 ? 463  PHE B N   1 
ATOM   7608  C  CA  . PHE B 1 463 ? 53.187  -20.754 55.088  1.00 14.93 ? 463  PHE B CA  1 
ATOM   7609  C  C   . PHE B 1 463 ? 54.312  -21.410 55.920  1.00 15.57 ? 463  PHE B C   1 
ATOM   7610  O  O   . PHE B 1 463 ? 55.392  -20.819 56.097  1.00 15.00 ? 463  PHE B O   1 
ATOM   7611  C  CB  . PHE B 1 463 ? 52.126  -20.061 55.946  1.00 14.89 ? 463  PHE B CB  1 
ATOM   7612  C  CG  . PHE B 1 463 ? 51.310  -19.046 55.174  1.00 15.41 ? 463  PHE B CG  1 
ATOM   7613  C  CD1 . PHE B 1 463 ? 49.966  -19.270 54.903  1.00 15.01 ? 463  PHE B CD1 1 
ATOM   7614  C  CD2 . PHE B 1 463 ? 51.904  -17.878 54.683  1.00 15.91 ? 463  PHE B CD2 1 
ATOM   7615  C  CE1 . PHE B 1 463 ? 49.213  -18.334 54.173  1.00 15.72 ? 463  PHE B CE1 1 
ATOM   7616  C  CE2 . PHE B 1 463 ? 51.160  -16.941 53.952  1.00 17.14 ? 463  PHE B CE2 1 
ATOM   7617  C  CZ  . PHE B 1 463 ? 49.817  -17.177 53.685  1.00 15.62 ? 463  PHE B CZ  1 
ATOM   7618  N  N   . TYR B 1 464 ? 54.065  -22.644 56.372  1.00 16.19 ? 464  TYR B N   1 
ATOM   7619  C  CA  . TYR B 1 464 ? 55.071  -23.452 57.070  1.00 16.68 ? 464  TYR B CA  1 
ATOM   7620  C  C   . TYR B 1 464 ? 56.398  -23.529 56.309  1.00 16.23 ? 464  TYR B C   1 
ATOM   7621  O  O   . TYR B 1 464 ? 57.449  -23.341 56.884  1.00 15.65 ? 464  TYR B O   1 
ATOM   7622  C  CB  . TYR B 1 464 ? 54.544  -24.877 57.355  1.00 17.14 ? 464  TYR B CB  1 
ATOM   7623  C  CG  . TYR B 1 464 ? 55.500  -25.681 58.224  1.00 18.09 ? 464  TYR B CG  1 
ATOM   7624  C  CD1 . TYR B 1 464 ? 55.313  -25.766 59.602  1.00 18.77 ? 464  TYR B CD1 1 
ATOM   7625  C  CD2 . TYR B 1 464 ? 56.607  -26.328 57.666  1.00 18.42 ? 464  TYR B CD2 1 
ATOM   7626  C  CE1 . TYR B 1 464 ? 56.191  -26.479 60.398  1.00 19.60 ? 464  TYR B CE1 1 
ATOM   7627  C  CE2 . TYR B 1 464 ? 57.495  -27.039 58.451  1.00 18.66 ? 464  TYR B CE2 1 
ATOM   7628  C  CZ  . TYR B 1 464 ? 57.281  -27.105 59.816  1.00 18.61 ? 464  TYR B CZ  1 
ATOM   7629  O  OH  . TYR B 1 464 ? 58.152  -27.795 60.599  1.00 18.79 ? 464  TYR B OH  1 
ATOM   7630  N  N   . ARG B 1 465 ? 56.332  -23.804 55.010  1.00 16.85 ? 465  ARG B N   1 
ATOM   7631  C  CA  . ARG B 1 465 ? 57.529  -23.891 54.163  1.00 17.38 ? 465  ARG B CA  1 
ATOM   7632  C  C   . ARG B 1 465 ? 58.356  -22.608 54.136  1.00 16.98 ? 465  ARG B C   1 
ATOM   7633  O  O   . ARG B 1 465 ? 59.579  -22.656 53.954  1.00 16.56 ? 465  ARG B O   1 
ATOM   7634  C  CB  . ARG B 1 465 ? 57.147  -24.258 52.738  1.00 17.24 ? 465  ARG B CB  1 
ATOM   7635  C  CG  . ARG B 1 465 ? 56.642  -25.664 52.590  1.00 20.62 ? 465  ARG B CG  1 
ATOM   7636  C  CD  . ARG B 1 465 ? 56.470  -25.956 51.129  1.00 24.92 ? 465  ARG B CD  1 
ATOM   7637  N  NE  . ARG B 1 465 ? 55.652  -27.129 50.879  1.00 29.49 ? 465  ARG B NE  1 
ATOM   7638  C  CZ  . ARG B 1 465 ? 55.795  -27.913 49.817  1.00 32.69 ? 465  ARG B CZ  1 
ATOM   7639  N  NH1 . ARG B 1 465 ? 56.738  -27.648 48.915  1.00 32.18 ? 465  ARG B NH1 1 
ATOM   7640  N  NH2 . ARG B 1 465 ? 55.000  -28.970 49.659  1.00 34.72 ? 465  ARG B NH2 1 
ATOM   7641  N  N   . ALA B 1 466 ? 57.668  -21.476 54.289  1.00 16.89 ? 466  ALA B N   1 
ATOM   7642  C  CA  . ALA B 1 466 ? 58.305  -20.174 54.366  1.00 17.08 ? 466  ALA B CA  1 
ATOM   7643  C  C   . ALA B 1 466 ? 58.919  -19.946 55.745  1.00 17.10 ? 466  ALA B C   1 
ATOM   7644  O  O   . ALA B 1 466 ? 60.085  -19.551 55.872  1.00 16.93 ? 466  ALA B O   1 
ATOM   7645  C  CB  . ALA B 1 466 ? 57.294  -19.068 54.032  1.00 17.02 ? 466  ALA B CB  1 
ATOM   7646  N  N   . ASP B 1 467 ? 58.112  -20.177 56.771  1.00 16.83 ? 467  ASP B N   1 
ATOM   7647  C  CA  . ASP B 1 467 ? 58.558  -20.053 58.140  1.00 16.96 ? 467  ASP B CA  1 
ATOM   7648  C  C   . ASP B 1 467 ? 57.819  -21.039 59.040  1.00 16.98 ? 467  ASP B C   1 
ATOM   7649  O  O   . ASP B 1 467 ? 56.582  -20.992 59.164  1.00 17.75 ? 467  ASP B O   1 
ATOM   7650  C  CB  . ASP B 1 467 ? 58.376  -18.623 58.635  1.00 16.64 ? 467  ASP B CB  1 
ATOM   7651  C  CG  . ASP B 1 467 ? 58.941  -18.422 60.027  1.00 16.48 ? 467  ASP B CG  1 
ATOM   7652  O  OD1 . ASP B 1 467 ? 58.217  -18.717 61.003  1.00 15.92 ? 467  ASP B OD1 1 
ATOM   7653  O  OD2 . ASP B 1 467 ? 60.104  -17.963 60.140  1.00 16.30 ? 467  ASP B OD2 1 
ATOM   7654  N  N   . ALA B 1 468 ? 58.588  -21.922 59.669  1.00 16.88 ? 468  ALA B N   1 
ATOM   7655  C  CA  . ALA B 1 468 ? 58.043  -22.976 60.519  1.00 16.86 ? 468  ALA B CA  1 
ATOM   7656  C  C   . ALA B 1 468 ? 57.154  -22.442 61.657  1.00 16.79 ? 468  ALA B C   1 
ATOM   7657  O  O   . ALA B 1 468 ? 56.010  -22.873 61.787  1.00 17.34 ? 468  ALA B O   1 
ATOM   7658  C  CB  . ALA B 1 468 ? 59.163  -23.864 61.044  1.00 16.72 ? 468  ALA B CB  1 
ATOM   7659  N  N   . SER B 1 469 ? 57.639  -21.484 62.442  1.00 16.72 ? 469  SER B N   1 
ATOM   7660  C  CA  . SER B 1 469 ? 56.807  -20.921 63.528  1.00 17.36 ? 469  SER B CA  1 
ATOM   7661  C  C   . SER B 1 469 ? 55.494  -20.260 63.081  1.00 17.33 ? 469  SER B C   1 
ATOM   7662  O  O   . SER B 1 469 ? 54.510  -20.332 63.815  1.00 17.97 ? 469  SER B O   1 
ATOM   7663  C  CB  . SER B 1 469 ? 57.591  -19.960 64.435  1.00 17.36 ? 469  SER B CB  1 
ATOM   7664  O  OG  . SER B 1 469 ? 58.142  -18.894 63.694  1.00 18.30 ? 469  SER B OG  1 
ATOM   7665  N  N   . LEU B 1 470 ? 55.470  -19.615 61.907  1.00 16.77 ? 470  LEU B N   1 
ATOM   7666  C  CA  . LEU B 1 470 ? 54.204  -19.150 61.323  1.00 16.38 ? 470  LEU B CA  1 
ATOM   7667  C  C   . LEU B 1 470 ? 53.294  -20.329 60.991  1.00 16.72 ? 470  LEU B C   1 
ATOM   7668  O  O   . LEU B 1 470 ? 52.105  -20.311 61.286  1.00 16.20 ? 470  LEU B O   1 
ATOM   7669  C  CB  . LEU B 1 470 ? 54.425  -18.307 60.059  1.00 16.08 ? 470  LEU B CB  1 
ATOM   7670  C  CG  . LEU B 1 470 ? 53.176  -17.794 59.317  1.00 15.58 ? 470  LEU B CG  1 
ATOM   7671  C  CD1 . LEU B 1 470 ? 52.337  -16.882 60.207  1.00 16.25 ? 470  LEU B CD1 1 
ATOM   7672  C  CD2 . LEU B 1 470 ? 53.565  -17.050 58.057  1.00 15.88 ? 470  LEU B CD2 1 
ATOM   7673  N  N   . GLY B 1 471 ? 53.865  -21.347 60.356  1.00 17.83 ? 471  GLY B N   1 
ATOM   7674  C  CA  . GLY B 1 471 ? 53.118  -22.567 60.051  1.00 19.10 ? 471  GLY B CA  1 
ATOM   7675  C  C   . GLY B 1 471 ? 52.499  -23.204 61.286  1.00 19.25 ? 471  GLY B C   1 
ATOM   7676  O  O   . GLY B 1 471 ? 51.352  -23.644 61.238  1.00 18.89 ? 471  GLY B O   1 
ATOM   7677  N  N   . GLU B 1 472 ? 53.259  -23.244 62.384  1.00 19.52 ? 472  GLU B N   1 
ATOM   7678  C  CA  . GLU B 1 472 ? 52.771  -23.814 63.638  1.00 20.99 ? 472  GLU B CA  1 
ATOM   7679  C  C   . GLU B 1 472 ? 51.672  -22.942 64.257  1.00 20.42 ? 472  GLU B C   1 
ATOM   7680  O  O   . GLU B 1 472 ? 50.624  -23.447 64.677  1.00 20.78 ? 472  GLU B O   1 
ATOM   7681  C  CB  . GLU B 1 472 ? 53.913  -24.002 64.648  1.00 20.66 ? 472  GLU B CB  1 
ATOM   7682  C  CG  . GLU B 1 472 ? 54.989  -25.022 64.261  1.00 22.90 ? 472  GLU B CG  1 
ATOM   7683  C  CD  . GLU B 1 472 ? 56.260  -24.890 65.125  1.00 24.44 ? 472  GLU B CD  1 
ATOM   7684  O  OE1 . GLU B 1 472 ? 57.274  -25.588 64.831  1.00 27.29 ? 472  GLU B OE1 1 
ATOM   7685  O  OE2 . GLU B 1 472 ? 56.244  -24.074 66.092  1.00 27.38 ? 472  GLU B OE2 1 
ATOM   7686  N  N   . LYS B 1 473 ? 51.917  -21.637 64.314  1.00 20.01 ? 473  LYS B N   1 
ATOM   7687  C  CA  . LYS B 1 473 ? 50.955  -20.699 64.876  1.00 20.09 ? 473  LYS B CA  1 
ATOM   7688  C  C   . LYS B 1 473 ? 49.604  -20.768 64.149  1.00 20.19 ? 473  LYS B C   1 
ATOM   7689  O  O   . LYS B 1 473 ? 48.555  -20.870 64.783  1.00 19.46 ? 473  LYS B O   1 
ATOM   7690  C  CB  . LYS B 1 473 ? 51.540  -19.288 64.883  1.00 20.38 ? 473  LYS B CB  1 
ATOM   7691  C  CG  . LYS B 1 473 ? 52.603  -19.102 65.958  1.00 20.29 ? 473  LYS B CG  1 
ATOM   7692  C  CD  . LYS B 1 473 ? 53.372  -17.821 65.756  1.00 21.48 ? 473  LYS B CD  1 
ATOM   7693  C  CE  . LYS B 1 473 ? 54.285  -17.520 66.958  1.00 21.85 ? 473  LYS B CE  1 
ATOM   7694  N  NZ  . LYS B 1 473 ? 54.763  -16.107 66.929  1.00 20.56 ? 473  LYS B NZ  1 
ATOM   7695  N  N   . LEU B 1 474 ? 49.648  -20.762 62.816  1.00 20.38 ? 474  LEU B N   1 
ATOM   7696  C  CA  . LEU B 1 474 ? 48.460  -20.986 61.999  1.00 20.21 ? 474  LEU B CA  1 
ATOM   7697  C  C   . LEU B 1 474 ? 47.781  -22.338 62.307  1.00 20.74 ? 474  LEU B C   1 
ATOM   7698  O  O   . LEU B 1 474 ? 46.563  -22.412 62.484  1.00 19.76 ? 474  LEU B O   1 
ATOM   7699  C  CB  . LEU B 1 474 ? 48.829  -20.891 60.523  1.00 19.85 ? 474  LEU B CB  1 
ATOM   7700  C  CG  . LEU B 1 474 ? 49.022  -19.495 59.915  1.00 19.79 ? 474  LEU B CG  1 
ATOM   7701  C  CD1 . LEU B 1 474 ? 49.572  -19.644 58.524  1.00 19.46 ? 474  LEU B CD1 1 
ATOM   7702  C  CD2 . LEU B 1 474 ? 47.719  -18.696 59.868  1.00 17.83 ? 474  LEU B CD2 1 
ATOM   7703  N  N   . SER B 1 475 ? 48.583  -23.398 62.369  1.00 21.52 ? 475  SER B N   1 
ATOM   7704  C  CA  . SER B 1 475 ? 48.085  -24.746 62.637  1.00 22.88 ? 475  SER B CA  1 
ATOM   7705  C  C   . SER B 1 475 ? 47.332  -24.827 63.964  1.00 23.93 ? 475  SER B C   1 
ATOM   7706  O  O   . SER B 1 475 ? 46.250  -25.397 64.023  1.00 23.92 ? 475  SER B O   1 
ATOM   7707  C  CB  . SER B 1 475 ? 49.238  -25.736 62.635  1.00 22.73 ? 475  SER B CB  1 
ATOM   7708  O  OG  . SER B 1 475 ? 48.821  -26.972 63.155  1.00 22.95 ? 475  SER B OG  1 
ATOM   7709  N  N   . GLU B 1 476 ? 47.910  -24.235 65.008  1.00 25.57 ? 476  GLU B N   1 
ATOM   7710  C  CA  . GLU B 1 476 ? 47.329  -24.210 66.350  1.00 27.41 ? 476  GLU B CA  1 
ATOM   7711  C  C   . GLU B 1 476 ? 46.013  -23.437 66.356  1.00 27.48 ? 476  GLU B C   1 
ATOM   7712  O  O   . GLU B 1 476 ? 44.986  -23.925 66.873  1.00 27.43 ? 476  GLU B O   1 
ATOM   7713  C  CB  . GLU B 1 476 ? 48.313  -23.590 67.364  1.00 27.15 ? 476  GLU B CB  1 
ATOM   7714  C  CG  . GLU B 1 476 ? 49.525  -24.471 67.743  1.00 29.36 ? 476  GLU B CG  1 
ATOM   7715  C  CD  . GLU B 1 476 ? 50.723  -23.667 68.324  1.00 30.99 ? 476  GLU B CD  1 
ATOM   7716  O  OE1 . GLU B 1 476 ? 51.892  -24.125 68.170  1.00 34.34 ? 476  GLU B OE1 1 
ATOM   7717  O  OE2 . GLU B 1 476 ? 50.506  -22.584 68.934  1.00 34.01 ? 476  GLU B OE2 1 
ATOM   7718  N  N   . ALA B 1 477 ? 46.049  -22.241 65.764  1.00 27.68 ? 477  ALA B N   1 
ATOM   7719  C  CA  . ALA B 1 477 ? 44.897  -21.337 65.732  1.00 28.12 ? 477  ALA B CA  1 
ATOM   7720  C  C   . ALA B 1 477 ? 43.741  -21.846 64.863  1.00 28.63 ? 477  ALA B C   1 
ATOM   7721  O  O   . ALA B 1 477 ? 42.591  -21.450 65.069  1.00 28.30 ? 477  ALA B O   1 
ATOM   7722  C  CB  . ALA B 1 477 ? 45.328  -19.937 65.291  1.00 27.83 ? 477  ALA B CB  1 
ATOM   7723  N  N   . LEU B 1 478 ? 44.039  -22.752 63.930  1.00 29.63 ? 478  LEU B N   1 
ATOM   7724  C  CA  . LEU B 1 478 ? 43.049  -23.156 62.925  1.00 30.75 ? 478  LEU B CA  1 
ATOM   7725  C  C   . LEU B 1 478 ? 41.890  -24.149 63.175  1.00 31.79 ? 478  LEU B C   1 
ATOM   7726  O  O   . LEU B 1 478 ? 40.841  -23.897 62.588  1.00 33.33 ? 478  LEU B O   1 
ATOM   7727  C  CB  . LEU B 1 478 ? 43.645  -23.323 61.516  1.00 30.44 ? 478  LEU B CB  1 
ATOM   7728  C  CG  . LEU B 1 478 ? 43.405  -22.201 60.476  1.00 29.57 ? 478  LEU B CG  1 
ATOM   7729  C  CD1 . LEU B 1 478 ? 42.105  -21.379 60.702  1.00 28.30 ? 478  LEU B CD1 1 
ATOM   7730  C  CD2 . LEU B 1 478 ? 44.605  -21.290 60.349  1.00 27.77 ? 478  LEU B CD2 1 
ATOM   7731  N  N   . ASN B 1 479 ? 41.958  -25.251 63.937  1.00 32.48 ? 479  ASN B N   1 
ATOM   7732  C  CA  . ASN B 1 479 ? 43.092  -25.980 64.495  1.00 32.98 ? 479  ASN B CA  1 
ATOM   7733  C  C   . ASN B 1 479 ? 43.301  -27.175 63.559  1.00 32.90 ? 479  ASN B C   1 
ATOM   7734  O  O   . ASN B 1 479 ? 42.461  -28.085 63.509  1.00 32.24 ? 479  ASN B O   1 
ATOM   7735  C  CB  . ASN B 1 479 ? 42.700  -26.611 65.847  1.00 33.47 ? 479  ASN B CB  1 
ATOM   7736  C  CG  . ASN B 1 479 ? 42.166  -25.609 66.875  1.00 35.20 ? 479  ASN B CG  1 
ATOM   7737  O  OD1 . ASN B 1 479 ? 41.068  -25.051 66.729  1.00 36.05 ? 479  ASN B OD1 1 
ATOM   7738  N  ND2 . ASN B 1 479 ? 42.925  -25.428 67.962  1.00 37.23 ? 479  ASN B ND2 1 
ATOM   7739  N  N   . VAL B 1 480 ? 44.402  -27.190 62.818  1.00 32.89 ? 480  VAL B N   1 
ATOM   7740  C  CA  . VAL B 1 480 ? 44.592  -28.184 61.767  1.00 32.65 ? 480  VAL B CA  1 
ATOM   7741  C  C   . VAL B 1 480 ? 45.948  -28.843 61.963  1.00 32.91 ? 480  VAL B C   1 
ATOM   7742  O  O   . VAL B 1 480 ? 46.959  -28.149 62.095  1.00 33.26 ? 480  VAL B O   1 
ATOM   7743  C  CB  . VAL B 1 480 ? 44.506  -27.528 60.364  1.00 32.68 ? 480  VAL B CB  1 
ATOM   7744  C  CG1 . VAL B 1 480 ? 44.901  -28.515 59.257  1.00 32.20 ? 480  VAL B CG1 1 
ATOM   7745  C  CG2 . VAL B 1 480 ? 43.103  -26.945 60.112  1.00 31.99 ? 480  VAL B CG2 1 
ATOM   7746  N  N   . ASP B 1 481 ? 45.975  -30.173 61.992  1.00 32.82 ? 481  ASP B N   1 
ATOM   7747  C  CA  . ASP B 1 481 ? 47.227  -30.892 62.218  1.00 32.83 ? 481  ASP B CA  1 
ATOM   7748  C  C   . ASP B 1 481 ? 48.026  -31.053 60.936  1.00 32.30 ? 481  ASP B C   1 
ATOM   7749  O  O   . ASP B 1 481 ? 47.592  -31.712 59.990  1.00 32.11 ? 481  ASP B O   1 
ATOM   7750  C  CB  . ASP B 1 481 ? 46.985  -32.245 62.887  1.00 33.29 ? 481  ASP B CB  1 
ATOM   7751  C  CG  . ASP B 1 481 ? 48.255  -32.850 63.471  1.00 35.06 ? 481  ASP B CG  1 
ATOM   7752  O  OD1 . ASP B 1 481 ? 48.241  -34.069 63.749  1.00 37.89 ? 481  ASP B OD1 1 
ATOM   7753  O  OD2 . ASP B 1 481 ? 49.272  -32.128 63.648  1.00 37.06 ? 481  ASP B OD2 1 
ATOM   7754  N  N   . ILE B 1 482 ? 49.199  -30.435 60.926  1.00 31.86 ? 482  ILE B N   1 
ATOM   7755  C  CA  . ILE B 1 482 ? 50.106  -30.473 59.780  1.00 31.77 ? 482  ILE B CA  1 
ATOM   7756  C  C   . ILE B 1 482 ? 51.245  -31.467 59.961  1.00 31.60 ? 482  ILE B C   1 
ATOM   7757  O  O   . ILE B 1 482 ? 51.999  -31.708 59.022  1.00 31.26 ? 482  ILE B O   1 
ATOM   7758  C  CB  . ILE B 1 482 ? 50.735  -29.085 59.502  1.00 31.57 ? 482  ILE B CB  1 
ATOM   7759  C  CG1 . ILE B 1 482 ? 51.214  -28.452 60.815  1.00 31.34 ? 482  ILE B CG1 1 
ATOM   7760  C  CG2 . ILE B 1 482 ? 49.735  -28.202 58.792  1.00 31.64 ? 482  ILE B CG2 1 
ATOM   7761  C  CD1 . ILE B 1 482 ? 52.333  -27.455 60.657  1.00 32.18 ? 482  ILE B CD1 1 
ATOM   7762  N  N   . LYS B 1 483 ? 51.372  -32.016 61.169  1.00 31.80 ? 483  LYS B N   1 
ATOM   7763  C  CA  . LYS B 1 483 ? 52.455  -32.948 61.494  1.00 32.47 ? 483  LYS B CA  1 
ATOM   7764  C  C   . LYS B 1 483 ? 52.498  -34.143 60.532  1.00 31.78 ? 483  LYS B C   1 
ATOM   7765  O  O   . LYS B 1 483 ? 53.549  -34.390 59.949  1.00 31.64 ? 483  LYS B O   1 
ATOM   7766  C  CB  . LYS B 1 483 ? 52.393  -33.410 62.962  1.00 32.83 ? 483  LYS B CB  1 
ATOM   7767  C  CG  . LYS B 1 483 ? 52.890  -32.380 63.990  1.00 34.37 ? 483  LYS B CG  1 
ATOM   7768  C  CD  . LYS B 1 483 ? 52.422  -32.738 65.412  1.00 34.53 ? 483  LYS B CD  1 
ATOM   7769  C  CE  . LYS B 1 483 ? 52.862  -31.676 66.429  1.00 37.54 ? 483  LYS B CE  1 
ATOM   7770  N  NZ  . LYS B 1 483 ? 52.892  -32.184 67.862  1.00 38.48 ? 483  LYS B NZ  1 
ATOM   7771  N  N   . PRO B 1 484 ? 51.352  -34.853 60.327  1.00 31.43 ? 484  PRO B N   1 
ATOM   7772  C  CA  . PRO B 1 484 ? 51.325  -36.009 59.412  1.00 31.13 ? 484  PRO B CA  1 
ATOM   7773  C  C   . PRO B 1 484 ? 51.942  -35.708 58.046  1.00 31.30 ? 484  PRO B C   1 
ATOM   7774  O  O   . PRO B 1 484 ? 52.353  -36.624 57.333  1.00 31.26 ? 484  PRO B O   1 
ATOM   7775  C  CB  . PRO B 1 484 ? 49.832  -36.293 59.252  1.00 30.95 ? 484  PRO B CB  1 
ATOM   7776  C  CG  . PRO B 1 484 ? 49.214  -35.822 60.523  1.00 31.00 ? 484  PRO B CG  1 
ATOM   7777  C  CD  . PRO B 1 484 ? 50.025  -34.624 60.944  1.00 31.27 ? 484  PRO B CD  1 
ATOM   7778  N  N   . PHE B 1 485 ? 51.986  -34.425 57.693  1.00 31.20 ? 485  PHE B N   1 
ATOM   7779  C  CA  . PHE B 1 485 ? 52.654  -33.953 56.487  1.00 30.97 ? 485  PHE B CA  1 
ATOM   7780  C  C   . PHE B 1 485 ? 53.873  -33.138 56.935  1.00 31.08 ? 485  PHE B C   1 
ATOM   7781  O  O   . PHE B 1 485 ? 54.905  -33.111 56.269  1.00 31.27 ? 485  PHE B O   1 
ATOM   7782  C  CB  . PHE B 1 485 ? 51.692  -33.076 55.663  1.00 30.75 ? 485  PHE B CB  1 
ATOM   7783  C  CG  . PHE B 1 485 ? 50.291  -33.641 55.549  1.00 29.50 ? 485  PHE B CG  1 
ATOM   7784  C  CD1 . PHE B 1 485 ? 49.334  -33.367 56.522  1.00 26.94 ? 485  PHE B CD1 1 
ATOM   7785  C  CD2 . PHE B 1 485 ? 49.935  -34.452 54.468  1.00 29.07 ? 485  PHE B CD2 1 
ATOM   7786  C  CE1 . PHE B 1 485 ? 48.051  -33.890 56.430  1.00 26.44 ? 485  PHE B CE1 1 
ATOM   7787  C  CE2 . PHE B 1 485 ? 48.646  -34.987 54.367  1.00 27.26 ? 485  PHE B CE2 1 
ATOM   7788  C  CZ  . PHE B 1 485 ? 47.706  -34.702 55.353  1.00 27.85 ? 485  PHE B CZ  1 
ATOM   7789  N  N   . LYS C 1 6   ? 1.450   -17.748 11.042  1.00 20.04 ? 6    LYS C N   1 
ATOM   7790  C  CA  . LYS C 1 6   ? 2.463   -17.003 11.841  1.00 20.13 ? 6    LYS C CA  1 
ATOM   7791  C  C   . LYS C 1 6   ? 2.025   -15.581 12.177  1.00 18.83 ? 6    LYS C C   1 
ATOM   7792  O  O   . LYS C 1 6   ? 1.795   -14.768 11.277  1.00 18.35 ? 6    LYS C O   1 
ATOM   7793  C  CB  . LYS C 1 6   ? 3.803   -16.958 11.106  1.00 20.73 ? 6    LYS C CB  1 
ATOM   7794  C  CG  . LYS C 1 6   ? 4.667   -18.199 11.268  1.00 23.61 ? 6    LYS C CG  1 
ATOM   7795  C  CD  . LYS C 1 6   ? 5.847   -18.118 10.295  1.00 27.78 ? 6    LYS C CD  1 
ATOM   7796  C  CE  . LYS C 1 6   ? 6.994   -19.035 10.692  1.00 31.80 ? 6    LYS C CE  1 
ATOM   7797  N  NZ  . LYS C 1 6   ? 7.881   -19.272 9.522   1.00 34.86 ? 6    LYS C NZ  1 
ATOM   7798  N  N   . LYS C 1 7   ? 1.927   -15.287 13.472  1.00 17.50 ? 7    LYS C N   1 
ATOM   7799  C  CA  . LYS C 1 7   ? 1.615   -13.938 13.947  1.00 17.11 ? 7    LYS C CA  1 
ATOM   7800  C  C   . LYS C 1 7   ? 2.855   -13.043 13.926  1.00 16.23 ? 7    LYS C C   1 
ATOM   7801  O  O   . LYS C 1 7   ? 3.931   -13.458 14.371  1.00 17.06 ? 7    LYS C O   1 
ATOM   7802  C  CB  . LYS C 1 7   ? 0.986   -13.962 15.349  1.00 17.24 ? 7    LYS C CB  1 
ATOM   7803  C  CG  . LYS C 1 7   ? -0.489  -14.353 15.345  1.00 19.13 ? 7    LYS C CG  1 
ATOM   7804  C  CD  . LYS C 1 7   ? -1.212  -13.928 16.624  1.00 21.99 ? 7    LYS C CD  1 
ATOM   7805  C  CE  . LYS C 1 7   ? -1.330  -15.090 17.618  1.00 25.77 ? 7    LYS C CE  1 
ATOM   7806  N  NZ  . LYS C 1 7   ? -2.219  -16.214 17.119  1.00 24.83 ? 7    LYS C NZ  1 
ATOM   7807  N  N   . LEU C 1 8   ? 2.702   -11.842 13.362  1.00 14.26 ? 8    LEU C N   1 
ATOM   7808  C  CA  . LEU C 1 8   ? 3.700   -10.792 13.414  1.00 12.53 ? 8    LEU C CA  1 
ATOM   7809  C  C   . LEU C 1 8   ? 3.802   -10.270 14.848  1.00 12.27 ? 8    LEU C C   1 
ATOM   7810  O  O   . LEU C 1 8   ? 2.781   -9.997  15.457  1.00 12.51 ? 8    LEU C O   1 
ATOM   7811  C  CB  . LEU C 1 8   ? 3.325   -9.663  12.436  1.00 12.28 ? 8    LEU C CB  1 
ATOM   7812  C  CG  . LEU C 1 8   ? 4.163   -8.372  12.393  1.00 11.97 ? 8    LEU C CG  1 
ATOM   7813  C  CD1 . LEU C 1 8   ? 5.641   -8.629  12.055  1.00 7.49  ? 8    LEU C CD1 1 
ATOM   7814  C  CD2 . LEU C 1 8   ? 3.537   -7.310  11.467  1.00 10.59 ? 8    LEU C CD2 1 
ATOM   7815  N  N   . THR C 1 9   ? 5.021   -10.135 15.379  1.00 11.63 ? 9    THR C N   1 
ATOM   7816  C  CA  . THR C 1 9   ? 5.237   -9.710  16.783  1.00 11.32 ? 9    THR C CA  1 
ATOM   7817  C  C   . THR C 1 9   ? 6.345   -8.656  16.962  1.00 10.97 ? 9    THR C C   1 
ATOM   7818  O  O   . THR C 1 9   ? 7.301   -8.609  16.186  1.00 10.83 ? 9    THR C O   1 
ATOM   7819  C  CB  . THR C 1 9   ? 5.600   -10.910 17.747  1.00 11.41 ? 9    THR C CB  1 
ATOM   7820  O  OG1 . THR C 1 9   ? 6.962   -11.318 17.547  1.00 11.67 ? 9    THR C OG1 1 
ATOM   7821  C  CG2 . THR C 1 9   ? 4.687   -12.095 17.568  1.00 9.42  ? 9    THR C CG2 1 
ATOM   7822  N  N   . THR C 1 10  ? 6.214   -7.819  17.990  1.00 10.56 ? 10   THR C N   1 
ATOM   7823  C  CA  . THR C 1 10  ? 7.365   -7.043  18.512  1.00 10.55 ? 10   THR C CA  1 
ATOM   7824  C  C   . THR C 1 10  ? 8.480   -8.003  19.016  1.00 10.74 ? 10   THR C C   1 
ATOM   7825  O  O   . THR C 1 10  ? 8.241   -9.216  19.225  1.00 10.72 ? 10   THR C O   1 
ATOM   7826  C  CB  . THR C 1 10  ? 6.935   -6.140  19.684  1.00 10.08 ? 10   THR C CB  1 
ATOM   7827  O  OG1 . THR C 1 10  ? 6.521   -6.961  20.791  1.00 11.16 ? 10   THR C OG1 1 
ATOM   7828  C  CG2 . THR C 1 10  ? 5.765   -5.228  19.296  1.00 8.72  ? 10   THR C CG2 1 
ATOM   7829  N  N   . ASN C 1 11  ? 9.676   -7.464  19.251  1.00 10.52 ? 11   ASN C N   1 
ATOM   7830  C  CA  . ASN C 1 11  ? 10.764  -8.238  19.880  1.00 10.30 ? 11   ASN C CA  1 
ATOM   7831  C  C   . ASN C 1 11  ? 10.404  -8.753  21.276  1.00 10.47 ? 11   ASN C C   1 
ATOM   7832  O  O   . ASN C 1 11  ? 11.168  -9.511  21.881  1.00 10.61 ? 11   ASN C O   1 
ATOM   7833  C  CB  . ASN C 1 11  ? 12.055  -7.418  19.964  1.00 10.08 ? 11   ASN C CB  1 
ATOM   7834  C  CG  . ASN C 1 11  ? 12.588  -6.972  18.586  1.00 11.93 ? 11   ASN C CG  1 
ATOM   7835  O  OD1 . ASN C 1 11  ? 13.435  -6.072  18.511  1.00 15.29 ? 11   ASN C OD1 1 
ATOM   7836  N  ND2 . ASN C 1 11  ? 12.109  -7.591  17.514  1.00 8.66  ? 11   ASN C ND2 1 
ATOM   7837  N  N   . GLN C 1 12  ? 9.248   -8.317  21.786  1.00 10.41 ? 12   GLN C N   1 
ATOM   7838  C  CA  . GLN C 1 12  ? 8.754   -8.689  23.119  1.00 10.04 ? 12   GLN C CA  1 
ATOM   7839  C  C   . GLN C 1 12  ? 7.770   -9.854  23.039  1.00 9.71  ? 12   GLN C C   1 
ATOM   7840  O  O   . GLN C 1 12  ? 7.289   -10.320 24.062  1.00 10.65 ? 12   GLN C O   1 
ATOM   7841  C  CB  . GLN C 1 12  ? 8.052   -7.513  23.817  1.00 9.79  ? 12   GLN C CB  1 
ATOM   7842  C  CG  . GLN C 1 12  ? 8.880   -6.244  24.015  1.00 8.95  ? 12   GLN C CG  1 
ATOM   7843  C  CD  . GLN C 1 12  ? 9.924   -6.416  25.078  1.00 9.39  ? 12   GLN C CD  1 
ATOM   7844  O  OE1 . GLN C 1 12  ? 9.811   -7.309  25.909  1.00 9.83  ? 12   GLN C OE1 1 
ATOM   7845  N  NE2 . GLN C 1 12  ? 10.969  -5.574  25.052  1.00 9.16  ? 12   GLN C NE2 1 
ATOM   7846  N  N   . GLY C 1 13  ? 7.480   -10.333 21.840  1.00 8.99  ? 13   GLY C N   1 
ATOM   7847  C  CA  . GLY C 1 13  ? 6.526   -11.427 21.681  1.00 8.14  ? 13   GLY C CA  1 
ATOM   7848  C  C   . GLY C 1 13  ? 5.078   -10.979 21.746  1.00 7.41  ? 13   GLY C C   1 
ATOM   7849  O  O   . GLY C 1 13  ? 4.198   -11.793 21.895  1.00 7.13  ? 13   GLY C O   1 
ATOM   7850  N  N   . VAL C 1 14  ? 4.830   -9.676  21.644  1.00 7.88  ? 14   VAL C N   1 
ATOM   7851  C  CA  . VAL C 1 14  ? 3.451   -9.161  21.589  1.00 7.48  ? 14   VAL C CA  1 
ATOM   7852  C  C   . VAL C 1 14  ? 3.005   -9.139  20.130  1.00 7.87  ? 14   VAL C C   1 
ATOM   7853  O  O   . VAL C 1 14  ? 3.699   -8.555  19.288  1.00 8.46  ? 14   VAL C O   1 
ATOM   7854  C  CB  . VAL C 1 14  ? 3.297   -7.755  22.261  1.00 7.27  ? 14   VAL C CB  1 
ATOM   7855  C  CG1 . VAL C 1 14  ? 1.912   -7.117  21.973  1.00 5.16  ? 14   VAL C CG1 1 
ATOM   7856  C  CG2 . VAL C 1 14  ? 3.507   -7.866  23.736  1.00 6.58  ? 14   VAL C CG2 1 
ATOM   7857  N  N   . PRO C 1 15  ? 1.869   -9.807  19.824  1.00 7.71  ? 15   PRO C N   1 
ATOM   7858  C  CA  . PRO C 1 15  ? 1.325   -9.840  18.495  1.00 7.82  ? 15   PRO C CA  1 
ATOM   7859  C  C   . PRO C 1 15  ? 0.958   -8.419  18.065  1.00 9.03  ? 15   PRO C C   1 
ATOM   7860  O  O   . PRO C 1 15  ? 0.296   -7.706  18.838  1.00 9.66  ? 15   PRO C O   1 
ATOM   7861  C  CB  . PRO C 1 15  ? 0.054   -10.650 18.659  1.00 8.01  ? 15   PRO C CB  1 
ATOM   7862  C  CG  . PRO C 1 15  ? 0.233   -11.431 19.876  1.00 8.17  ? 15   PRO C CG  1 
ATOM   7863  C  CD  . PRO C 1 15  ? 1.050   -10.585 20.770  1.00 7.75  ? 15   PRO C CD  1 
ATOM   7864  N  N   . ILE C 1 16  ? 1.394   -8.027  16.860  1.00 8.84  ? 16   ILE C N   1 
ATOM   7865  C  CA  . ILE C 1 16  ? 1.098   -6.729  16.263  1.00 9.07  ? 16   ILE C CA  1 
ATOM   7866  C  C   . ILE C 1 16  ? -0.280  -6.690  15.545  1.00 9.66  ? 16   ILE C C   1 
ATOM   7867  O  O   . ILE C 1 16  ? -0.543  -7.502  14.628  1.00 9.20  ? 16   ILE C O   1 
ATOM   7868  C  CB  . ILE C 1 16  ? 2.243   -6.319  15.283  1.00 9.33  ? 16   ILE C CB  1 
ATOM   7869  C  CG1 . ILE C 1 16  ? 3.563   -6.059  16.070  1.00 10.97 ? 16   ILE C CG1 1 
ATOM   7870  C  CG2 . ILE C 1 16  ? 1.854   -5.119  14.454  1.00 6.93  ? 16   ILE C CG2 1 
ATOM   7871  C  CD1 . ILE C 1 16  ? 4.842   -5.897  15.176  1.00 7.81  ? 16   ILE C CD1 1 
ATOM   7872  N  N   . GLY C 1 17  ? -1.145  -5.760  15.970  1.00 9.38  ? 17   GLY C N   1 
ATOM   7873  C  CA  . GLY C 1 17  ? -2.426  -5.515  15.307  1.00 9.93  ? 17   GLY C CA  1 
ATOM   7874  C  C   . GLY C 1 17  ? -2.326  -4.730  13.997  1.00 11.08 ? 17   GLY C C   1 
ATOM   7875  O  O   . GLY C 1 17  ? -2.978  -5.066  13.012  1.00 12.22 ? 17   GLY C O   1 
ATOM   7876  N  N   . ASP C 1 18  ? -1.529  -3.671  13.971  1.00 11.36 ? 18   ASP C N   1 
ATOM   7877  C  CA  . ASP C 1 18  ? -1.483  -2.775  12.824  1.00 11.94 ? 18   ASP C CA  1 
ATOM   7878  C  C   . ASP C 1 18  ? -0.044  -2.376  12.527  1.00 11.54 ? 18   ASP C C   1 
ATOM   7879  O  O   . ASP C 1 18  ? 0.525   -1.533  13.215  1.00 12.13 ? 18   ASP C O   1 
ATOM   7880  C  CB  . ASP C 1 18  ? -2.363  -1.546  13.086  1.00 11.99 ? 18   ASP C CB  1 
ATOM   7881  C  CG  . ASP C 1 18  ? -2.307  -0.511  11.965  1.00 14.24 ? 18   ASP C CG  1 
ATOM   7882  O  OD1 . ASP C 1 18  ? -3.113  0.467   12.016  1.00 14.42 ? 18   ASP C OD1 1 
ATOM   7883  O  OD2 . ASP C 1 18  ? -1.470  -0.658  11.039  1.00 16.72 ? 18   ASP C OD2 1 
ATOM   7884  N  N   . ASN C 1 19  ? 0.530   -3.004  11.508  1.00 11.03 ? 19   ASN C N   1 
ATOM   7885  C  CA  . ASN C 1 19  ? 1.894   -2.756  11.066  1.00 10.21 ? 19   ASN C CA  1 
ATOM   7886  C  C   . ASN C 1 19  ? 2.015   -1.654  10.042  1.00 9.87  ? 19   ASN C C   1 
ATOM   7887  O  O   . ASN C 1 19  ? 3.052   -1.539  9.384   1.00 10.63 ? 19   ASN C O   1 
ATOM   7888  C  CB  . ASN C 1 19  ? 2.479   -4.026  10.436  1.00 9.86  ? 19   ASN C CB  1 
ATOM   7889  C  CG  . ASN C 1 19  ? 4.007   -3.946  10.249  1.00 10.73 ? 19   ASN C CG  1 
ATOM   7890  O  OD1 . ASN C 1 19  ? 4.743   -3.422  11.110  1.00 9.63  ? 19   ASN C OD1 1 
ATOM   7891  N  ND2 . ASN C 1 19  ? 4.483   -4.469  9.129   1.00 9.02  ? 19   ASN C ND2 1 
ATOM   7892  N  N   . GLN C 1 20  ? 0.975   -0.855  9.859   1.00 10.02 ? 20   GLN C N   1 
ATOM   7893  C  CA  . GLN C 1 20  ? 1.009   0.153   8.788   1.00 10.32 ? 20   GLN C CA  1 
ATOM   7894  C  C   . GLN C 1 20  ? 0.800   1.586   9.293   1.00 10.23 ? 20   GLN C C   1 
ATOM   7895  O  O   . GLN C 1 20  ? 1.083   2.541   8.567   1.00 9.50  ? 20   GLN C O   1 
ATOM   7896  C  CB  . GLN C 1 20  ? -0.005  -0.165  7.664   1.00 10.57 ? 20   GLN C CB  1 
ATOM   7897  C  CG  . GLN C 1 20  ? -0.513  -1.626  7.589   1.00 11.14 ? 20   GLN C CG  1 
ATOM   7898  C  CD  . GLN C 1 20  ? 0.512   -2.593  7.053   1.00 12.79 ? 20   GLN C CD  1 
ATOM   7899  O  OE1 . GLN C 1 20  ? 1.392   -2.223  6.268   1.00 15.21 ? 20   GLN C OE1 1 
ATOM   7900  N  NE2 . GLN C 1 20  ? 0.396   -3.851  7.454   1.00 12.54 ? 20   GLN C NE2 1 
ATOM   7901  N  N   . ASN C 1 21  ? 0.300   1.745   10.522  1.00 10.15 ? 21   ASN C N   1 
ATOM   7902  C  CA  . ASN C 1 21  ? 0.016   3.097   11.007  1.00 10.65 ? 21   ASN C CA  1 
ATOM   7903  C  C   . ASN C 1 21  ? 0.658   3.411   12.337  1.00 11.14 ? 21   ASN C C   1 
ATOM   7904  O  O   . ASN C 1 21  ? 0.574   2.608   13.269  1.00 11.71 ? 21   ASN C O   1 
ATOM   7905  C  CB  . ASN C 1 21  ? -1.506  3.388   11.077  1.00 10.41 ? 21   ASN C CB  1 
ATOM   7906  C  CG  . ASN C 1 21  ? -2.227  3.061   9.773   1.00 10.22 ? 21   ASN C CG  1 
ATOM   7907  O  OD1 . ASN C 1 21  ? -1.970  3.664   8.735   1.00 10.27 ? 21   ASN C OD1 1 
ATOM   7908  N  ND2 . ASN C 1 21  ? -3.097  2.064   9.820   1.00 8.79  ? 21   ASN C ND2 1 
ATOM   7909  N  N   . SER C 1 22  ? 1.279   4.592   12.410  1.00 10.89 ? 22   SER C N   1 
ATOM   7910  C  CA  . SER C 1 22  ? 1.821   5.131   13.649  1.00 10.64 ? 22   SER C CA  1 
ATOM   7911  C  C   . SER C 1 22  ? 0.664   5.533   14.556  1.00 11.17 ? 22   SER C C   1 
ATOM   7912  O  O   . SER C 1 22  ? -0.448  5.828   14.083  1.00 11.07 ? 22   SER C O   1 
ATOM   7913  C  CB  . SER C 1 22  ? 2.698   6.359   13.363  1.00 10.34 ? 22   SER C CB  1 
ATOM   7914  O  OG  . SER C 1 22  ? 3.868   6.030   12.645  1.00 9.79  ? 22   SER C OG  1 
ATOM   7915  N  N   . ARG C 1 23  ? 0.914   5.522   15.859  1.00 11.35 ? 23   ARG C N   1 
ATOM   7916  C  CA  . ARG C 1 23  ? -0.060  6.048   16.791  1.00 11.67 ? 23   ARG C CA  1 
ATOM   7917  C  C   . ARG C 1 23  ? 0.179   7.567   16.891  1.00 12.26 ? 23   ARG C C   1 
ATOM   7918  O  O   . ARG C 1 23  ? 1.298   8.023   17.220  1.00 12.33 ? 23   ARG C O   1 
ATOM   7919  C  CB  . ARG C 1 23  ? 0.028   5.369   18.160  1.00 11.45 ? 23   ARG C CB  1 
ATOM   7920  C  CG  . ARG C 1 23  ? -1.210  5.648   19.022  1.00 10.13 ? 23   ARG C CG  1 
ATOM   7921  C  CD  . ARG C 1 23  ? -1.051  5.191   20.473  1.00 11.51 ? 23   ARG C CD  1 
ATOM   7922  N  NE  . ARG C 1 23  ? -2.288  5.432   21.208  1.00 13.39 ? 23   ARG C NE  1 
ATOM   7923  C  CZ  . ARG C 1 23  ? -3.284  4.552   21.320  1.00 16.35 ? 23   ARG C CZ  1 
ATOM   7924  N  NH1 . ARG C 1 23  ? -4.395  4.885   21.971  1.00 19.32 ? 23   ARG C NH1 1 
ATOM   7925  N  NH2 . ARG C 1 23  ? -3.192  3.347   20.772  1.00 16.17 ? 23   ARG C NH2 1 
ATOM   7926  N  N   . THR C 1 24  ? -0.874  8.328   16.590  1.00 11.92 ? 24   THR C N   1 
ATOM   7927  C  CA  . THR C 1 24  ? -0.782  9.771   16.458  1.00 12.06 ? 24   THR C CA  1 
ATOM   7928  C  C   . THR C 1 24  ? -1.825  10.420  17.339  1.00 12.49 ? 24   THR C C   1 
ATOM   7929  O  O   . THR C 1 24  ? -2.827  9.767   17.693  1.00 12.82 ? 24   THR C O   1 
ATOM   7930  C  CB  . THR C 1 24  ? -1.028  10.204  15.000  1.00 12.29 ? 24   THR C CB  1 
ATOM   7931  O  OG1 . THR C 1 24  ? -2.227  9.576   14.512  1.00 12.17 ? 24   THR C OG1 1 
ATOM   7932  C  CG2 . THR C 1 24  ? 0.160   9.821   14.111  1.00 11.01 ? 24   THR C CG2 1 
ATOM   7933  N  N   . ALA C 1 25  ? -1.598  11.690  17.696  1.00 12.18 ? 25   ALA C N   1 
ATOM   7934  C  CA  . ALA C 1 25  ? -2.558  12.440  18.492  1.00 12.15 ? 25   ALA C CA  1 
ATOM   7935  C  C   . ALA C 1 25  ? -3.638  12.980  17.561  1.00 12.59 ? 25   ALA C C   1 
ATOM   7936  O  O   . ALA C 1 25  ? -3.711  14.171  17.266  1.00 12.01 ? 25   ALA C O   1 
ATOM   7937  C  CB  . ALA C 1 25  ? -1.871  13.563  19.256  1.00 12.70 ? 25   ALA C CB  1 
ATOM   7938  N  N   . GLY C 1 26  ? -4.476  12.066  17.089  1.00 12.95 ? 26   GLY C N   1 
ATOM   7939  C  CA  . GLY C 1 26  ? -5.456  12.395  16.081  1.00 13.41 ? 26   GLY C CA  1 
ATOM   7940  C  C   . GLY C 1 26  ? -5.095  11.809  14.743  1.00 13.92 ? 26   GLY C C   1 
ATOM   7941  O  O   . GLY C 1 26  ? -3.968  11.344  14.523  1.00 13.62 ? 26   GLY C O   1 
ATOM   7942  N  N   . ARG C 1 27  ? -6.074  11.837  13.844  1.00 14.70 ? 27   ARG C N   1 
ATOM   7943  C  CA  . ARG C 1 27  ? -5.971  11.148  12.574  1.00 14.80 ? 27   ARG C CA  1 
ATOM   7944  C  C   . ARG C 1 27  ? -4.994  11.875  11.701  1.00 14.64 ? 27   ARG C C   1 
ATOM   7945  O  O   . ARG C 1 27  ? -4.352  11.262  10.848  1.00 15.06 ? 27   ARG C O   1 
ATOM   7946  C  CB  . ARG C 1 27  ? -7.345  11.029  11.901  1.00 15.04 ? 27   ARG C CB  1 
ATOM   7947  C  CG  . ARG C 1 27  ? -7.345  10.212  10.582  1.00 14.64 ? 27   ARG C CG  1 
ATOM   7948  C  CD  . ARG C 1 27  ? -8.769  9.949   10.091  1.00 15.30 ? 27   ARG C CD  1 
ATOM   7949  N  NE  . ARG C 1 27  ? -9.585  9.197   11.060  1.00 14.00 ? 27   ARG C NE  1 
ATOM   7950  C  CZ  . ARG C 1 27  ? -9.709  7.871   11.108  1.00 13.31 ? 27   ARG C CZ  1 
ATOM   7951  N  NH1 . ARG C 1 27  ? -9.073  7.061   10.256  1.00 11.69 ? 27   ARG C NH1 1 
ATOM   7952  N  NH2 . ARG C 1 27  ? -10.501 7.350   12.023  1.00 15.45 ? 27   ARG C NH2 1 
ATOM   7953  N  N   . ARG C 1 28  ? -4.876  13.182  11.922  1.00 14.74 ? 28   ARG C N   1 
ATOM   7954  C  CA  . ARG C 1 28  ? -3.897  14.007  11.186  1.00 14.64 ? 28   ARG C CA  1 
ATOM   7955  C  C   . ARG C 1 28  ? -2.983  14.741  12.168  1.00 14.89 ? 28   ARG C C   1 
ATOM   7956  O  O   . ARG C 1 28  ? -2.448  15.820  11.859  1.00 15.24 ? 28   ARG C O   1 
ATOM   7957  C  CB  . ARG C 1 28  ? -4.599  15.021  10.276  1.00 14.43 ? 28   ARG C CB  1 
ATOM   7958  C  CG  . ARG C 1 28  ? -5.652  14.442  9.293   1.00 14.46 ? 28   ARG C CG  1 
ATOM   7959  C  CD  . ARG C 1 28  ? -5.894  15.390  8.107   1.00 14.37 ? 28   ARG C CD  1 
ATOM   7960  N  NE  . ARG C 1 28  ? -5.708  16.748  8.570   1.00 15.51 ? 28   ARG C NE  1 
ATOM   7961  C  CZ  . ARG C 1 28  ? -4.848  17.635  8.090   1.00 13.83 ? 28   ARG C CZ  1 
ATOM   7962  N  NH1 . ARG C 1 28  ? -4.795  18.816  8.678   1.00 14.70 ? 28   ARG C NH1 1 
ATOM   7963  N  NH2 . ARG C 1 28  ? -4.079  17.377  7.041   1.00 13.50 ? 28   ARG C NH2 1 
ATOM   7964  N  N   . GLY C 1 29  ? -2.817  14.139  13.351  1.00 13.94 ? 29   GLY C N   1 
ATOM   7965  C  CA  . GLY C 1 29  ? -2.025  14.705  14.438  1.00 12.54 ? 29   GLY C CA  1 
ATOM   7966  C  C   . GLY C 1 29  ? -0.627  14.097  14.536  1.00 11.45 ? 29   GLY C C   1 
ATOM   7967  O  O   . GLY C 1 29  ? -0.322  13.124  13.836  1.00 10.98 ? 29   GLY C O   1 
ATOM   7968  N  N   . PRO C 1 30  ? 0.218   14.684  15.405  1.00 10.42 ? 30   PRO C N   1 
ATOM   7969  C  CA  . PRO C 1 30  ? 1.618   14.324  15.687  1.00 9.72  ? 30   PRO C CA  1 
ATOM   7970  C  C   . PRO C 1 30  ? 1.760   12.944  16.358  1.00 9.31  ? 30   PRO C C   1 
ATOM   7971  O  O   . PRO C 1 30  ? 0.902   12.546  17.162  1.00 9.22  ? 30   PRO C O   1 
ATOM   7972  C  CB  . PRO C 1 30  ? 2.067   15.428  16.663  1.00 8.52  ? 30   PRO C CB  1 
ATOM   7973  C  CG  . PRO C 1 30  ? 0.832   15.847  17.337  1.00 9.32  ? 30   PRO C CG  1 
ATOM   7974  C  CD  . PRO C 1 30  ? -0.222  15.818  16.248  1.00 9.93  ? 30   PRO C CD  1 
ATOM   7975  N  N   . THR C 1 31  ? 2.834   12.237  16.017  1.00 8.68  ? 31   THR C N   1 
ATOM   7976  C  CA  . THR C 1 31  ? 3.126   10.907  16.563  1.00 8.30  ? 31   THR C CA  1 
ATOM   7977  C  C   . THR C 1 31  ? 3.483   10.872  18.068  1.00 8.33  ? 31   THR C C   1 
ATOM   7978  O  O   . THR C 1 31  ? 4.193   11.741  18.593  1.00 7.22  ? 31   THR C O   1 
ATOM   7979  C  CB  . THR C 1 31  ? 4.227   10.198  15.703  1.00 8.46  ? 31   THR C CB  1 
ATOM   7980  O  OG1 . THR C 1 31  ? 3.784   10.152  14.338  1.00 8.48  ? 31   THR C OG1 1 
ATOM   7981  C  CG2 . THR C 1 31  ? 4.483   8.768   16.172  1.00 6.34  ? 31   THR C CG2 1 
ATOM   7982  N  N   . LEU C 1 32  ? 2.978   9.837   18.736  1.00 8.58  ? 32   LEU C N   1 
ATOM   7983  C  CA  . LEU C 1 32  ? 3.124   9.652   20.183  1.00 8.85  ? 32   LEU C CA  1 
ATOM   7984  C  C   . LEU C 1 32  ? 4.395   8.900   20.591  1.00 9.37  ? 32   LEU C C   1 
ATOM   7985  O  O   . LEU C 1 32  ? 4.712   7.856   20.037  1.00 9.24  ? 32   LEU C O   1 
ATOM   7986  C  CB  . LEU C 1 32  ? 1.899   8.911   20.742  1.00 8.73  ? 32   LEU C CB  1 
ATOM   7987  C  CG  . LEU C 1 32  ? 0.552   9.634   20.695  1.00 7.68  ? 32   LEU C CG  1 
ATOM   7988  C  CD1 . LEU C 1 32  ? -0.446  8.790   21.452  1.00 2.18  ? 32   LEU C CD1 1 
ATOM   7989  C  CD2 . LEU C 1 32  ? 0.685   11.070  21.326  1.00 6.95  ? 32   LEU C CD2 1 
ATOM   7990  N  N   . LEU C 1 33  ? 5.098   9.435   21.586  1.00 9.30  ? 33   LEU C N   1 
ATOM   7991  C  CA  . LEU C 1 33  ? 6.297   8.790   22.118  1.00 9.49  ? 33   LEU C CA  1 
ATOM   7992  C  C   . LEU C 1 33  ? 5.992   7.397   22.726  1.00 10.12 ? 33   LEU C C   1 
ATOM   7993  O  O   . LEU C 1 33  ? 6.862   6.522   22.791  1.00 10.48 ? 33   LEU C O   1 
ATOM   7994  C  CB  . LEU C 1 33  ? 6.983   9.725   23.129  1.00 9.02  ? 33   LEU C CB  1 
ATOM   7995  C  CG  . LEU C 1 33  ? 8.287   9.291   23.769  1.00 7.58  ? 33   LEU C CG  1 
ATOM   7996  C  CD1 . LEU C 1 33  ? 9.446   9.266   22.796  1.00 3.22  ? 33   LEU C CD1 1 
ATOM   7997  C  CD2 . LEU C 1 33  ? 8.565   10.184  24.993  1.00 8.23  ? 33   LEU C CD2 1 
ATOM   7998  N  N   . GLU C 1 34  ? 4.747   7.191   23.139  1.00 10.31 ? 34   GLU C N   1 
ATOM   7999  C  CA  . GLU C 1 34  ? 4.305   5.888   23.617  1.00 10.48 ? 34   GLU C CA  1 
ATOM   8000  C  C   . GLU C 1 34  ? 4.080   4.838   22.512  1.00 10.15 ? 34   GLU C C   1 
ATOM   8001  O  O   . GLU C 1 34  ? 3.755   3.691   22.804  1.00 10.19 ? 34   GLU C O   1 
ATOM   8002  C  CB  . GLU C 1 34  ? 3.059   6.027   24.490  1.00 10.34 ? 34   GLU C CB  1 
ATOM   8003  C  CG  . GLU C 1 34  ? 1.794   6.484   23.768  1.00 10.93 ? 34   GLU C CG  1 
ATOM   8004  C  CD  . GLU C 1 34  ? 0.589   6.448   24.675  1.00 12.05 ? 34   GLU C CD  1 
ATOM   8005  O  OE1 . GLU C 1 34  ? -0.369  5.726   24.323  1.00 14.41 ? 34   GLU C OE1 1 
ATOM   8006  O  OE2 . GLU C 1 34  ? 0.609   7.109   25.753  1.00 13.95 ? 34   GLU C OE2 1 
ATOM   8007  N  N   . ASP C 1 35  ? 4.259   5.206   21.247  1.00 9.89  ? 35   ASP C N   1 
ATOM   8008  C  CA  . ASP C 1 35  ? 4.244   4.180   20.186  1.00 9.37  ? 35   ASP C CA  1 
ATOM   8009  C  C   . ASP C 1 35  ? 5.483   3.248   20.281  1.00 8.78  ? 35   ASP C C   1 
ATOM   8010  O  O   . ASP C 1 35  ? 6.472   3.437   19.566  1.00 8.62  ? 35   ASP C O   1 
ATOM   8011  C  CB  . ASP C 1 35  ? 4.081   4.810   18.798  1.00 8.28  ? 35   ASP C CB  1 
ATOM   8012  C  CG  . ASP C 1 35  ? 3.640   3.782   17.732  1.00 10.46 ? 35   ASP C CG  1 
ATOM   8013  O  OD1 . ASP C 1 35  ? 3.155   4.199   16.644  1.00 8.08  ? 35   ASP C OD1 1 
ATOM   8014  O  OD2 . ASP C 1 35  ? 3.787   2.551   17.978  1.00 10.25 ? 35   ASP C OD2 1 
ATOM   8015  N  N   . TYR C 1 36  ? 5.412   2.264   21.185  1.00 8.76  ? 36   TYR C N   1 
ATOM   8016  C  CA  . TYR C 1 36  ? 6.533   1.369   21.500  1.00 9.07  ? 36   TYR C CA  1 
ATOM   8017  C  C   . TYR C 1 36  ? 6.899   0.516   20.309  1.00 10.23 ? 36   TYR C C   1 
ATOM   8018  O  O   . TYR C 1 36  ? 8.075   0.289   20.036  1.00 10.96 ? 36   TYR C O   1 
ATOM   8019  C  CB  . TYR C 1 36  ? 6.225   0.422   22.697  1.00 9.42  ? 36   TYR C CB  1 
ATOM   8020  C  CG  . TYR C 1 36  ? 7.316   -0.651  22.836  1.00 9.19  ? 36   TYR C CG  1 
ATOM   8021  C  CD1 . TYR C 1 36  ? 8.494   -0.381  23.542  1.00 10.05 ? 36   TYR C CD1 1 
ATOM   8022  C  CD2 . TYR C 1 36  ? 7.198   -1.889  22.199  1.00 7.05  ? 36   TYR C CD2 1 
ATOM   8023  C  CE1 . TYR C 1 36  ? 9.513   -1.323  23.638  1.00 9.45  ? 36   TYR C CE1 1 
ATOM   8024  C  CE2 . TYR C 1 36  ? 8.204   -2.827  22.270  1.00 7.63  ? 36   TYR C CE2 1 
ATOM   8025  C  CZ  . TYR C 1 36  ? 9.361   -2.539  22.996  1.00 9.47  ? 36   TYR C CZ  1 
ATOM   8026  O  OH  . TYR C 1 36  ? 10.381  -3.453  23.066  1.00 9.18  ? 36   TYR C OH  1 
ATOM   8027  N  N   . GLN C 1 37  ? 5.873   -0.010  19.638  1.00 10.96 ? 37   GLN C N   1 
ATOM   8028  C  CA  . GLN C 1 37  ? 6.036   -0.797  18.425  1.00 10.99 ? 37   GLN C CA  1 
ATOM   8029  C  C   . GLN C 1 37  ? 6.814   -0.033  17.346  1.00 10.91 ? 37   GLN C C   1 
ATOM   8030  O  O   . GLN C 1 37  ? 7.747   -0.590  16.721  1.00 10.42 ? 37   GLN C O   1 
ATOM   8031  C  CB  . GLN C 1 37  ? 4.648   -1.159  17.901  1.00 11.68 ? 37   GLN C CB  1 
ATOM   8032  C  CG  . GLN C 1 37  ? 4.601   -1.895  16.556  1.00 10.53 ? 37   GLN C CG  1 
ATOM   8033  C  CD  . GLN C 1 37  ? 3.168   -1.990  16.073  1.00 12.30 ? 37   GLN C CD  1 
ATOM   8034  O  OE1 . GLN C 1 37  ? 2.268   -2.376  16.839  1.00 9.26  ? 37   GLN C OE1 1 
ATOM   8035  N  NE2 . GLN C 1 37  ? 2.933   -1.605  14.812  1.00 11.53 ? 37   GLN C NE2 1 
ATOM   8036  N  N   . LEU C 1 38  ? 6.419   1.225   17.126  1.00 10.37 ? 38   LEU C N   1 
ATOM   8037  C  CA  . LEU C 1 38  ? 7.098   2.087   16.143  1.00 10.65 ? 38   LEU C CA  1 
ATOM   8038  C  C   . LEU C 1 38  ? 8.547   2.339   16.531  1.00 9.96  ? 38   LEU C C   1 
ATOM   8039  O  O   . LEU C 1 38  ? 9.458   2.204   15.709  1.00 9.84  ? 38   LEU C O   1 
ATOM   8040  C  CB  . LEU C 1 38  ? 6.377   3.438   15.980  1.00 10.30 ? 38   LEU C CB  1 
ATOM   8041  C  CG  . LEU C 1 38  ? 7.152   4.493   15.164  1.00 11.69 ? 38   LEU C CG  1 
ATOM   8042  C  CD1 . LEU C 1 38  ? 7.081   4.221   13.633  1.00 9.44  ? 38   LEU C CD1 1 
ATOM   8043  C  CD2 . LEU C 1 38  ? 6.691   5.926   15.506  1.00 11.78 ? 38   LEU C CD2 1 
ATOM   8044  N  N   . ILE C 1 39  ? 8.748   2.711   17.793  1.00 9.74  ? 39   ILE C N   1 
ATOM   8045  C  CA  . ILE C 1 39  ? 10.079  3.067   18.274  1.00 9.22  ? 39   ILE C CA  1 
ATOM   8046  C  C   . ILE C 1 39  ? 11.009  1.857   18.337  1.00 9.85  ? 39   ILE C C   1 
ATOM   8047  O  O   . ILE C 1 39  ? 12.161  1.962   17.922  1.00 10.34 ? 39   ILE C O   1 
ATOM   8048  C  CB  . ILE C 1 39  ? 10.020  3.861   19.591  1.00 8.92  ? 39   ILE C CB  1 
ATOM   8049  C  CG1 . ILE C 1 39  ? 9.424   5.251   19.296  1.00 7.72  ? 39   ILE C CG1 1 
ATOM   8050  C  CG2 . ILE C 1 39  ? 11.422  3.989   20.207  1.00 7.37  ? 39   ILE C CG2 1 
ATOM   8051  C  CD1 . ILE C 1 39  ? 9.124   6.093   20.507  1.00 9.26  ? 39   ILE C CD1 1 
ATOM   8052  N  N   . GLU C 1 40  ? 10.512  0.704   18.794  1.00 9.95  ? 40   GLU C N   1 
ATOM   8053  C  CA  . GLU C 1 40  ? 11.323  -0.519  18.743  1.00 10.79 ? 40   GLU C CA  1 
ATOM   8054  C  C   . GLU C 1 40  ? 11.801  -0.835  17.314  1.00 10.50 ? 40   GLU C C   1 
ATOM   8055  O  O   . GLU C 1 40  ? 12.999  -1.046  17.077  1.00 10.82 ? 40   GLU C O   1 
ATOM   8056  C  CB  . GLU C 1 40  ? 10.569  -1.715  19.323  1.00 10.52 ? 40   GLU C CB  1 
ATOM   8057  C  CG  . GLU C 1 40  ? 11.394  -2.995  19.383  1.00 10.52 ? 40   GLU C CG  1 
ATOM   8058  C  CD  . GLU C 1 40  ? 10.515  -4.226  19.550  1.00 12.46 ? 40   GLU C CD  1 
ATOM   8059  O  OE1 . GLU C 1 40  ? 9.915   -4.688  18.533  1.00 14.47 ? 40   GLU C OE1 1 
ATOM   8060  O  OE2 . GLU C 1 40  ? 10.396  -4.712  20.698  1.00 10.47 ? 40   GLU C OE2 1 
ATOM   8061  N  N   . LYS C 1 41  ? 10.847  -0.832  16.384  1.00 10.19 ? 41   LYS C N   1 
ATOM   8062  C  CA  . LYS C 1 41  ? 11.067  -1.155  14.976  1.00 9.94  ? 41   LYS C CA  1 
ATOM   8063  C  C   . LYS C 1 41  ? 12.086  -0.202  14.294  1.00 9.03  ? 41   LYS C C   1 
ATOM   8064  O  O   . LYS C 1 41  ? 13.057  -0.641  13.671  1.00 7.88  ? 41   LYS C O   1 
ATOM   8065  C  CB  . LYS C 1 41  ? 9.703   -1.193  14.252  1.00 9.69  ? 41   LYS C CB  1 
ATOM   8066  C  CG  . LYS C 1 41  ? 9.762   -1.619  12.774  1.00 11.50 ? 41   LYS C CG  1 
ATOM   8067  C  CD  . LYS C 1 41  ? 8.369   -1.731  12.127  1.00 11.23 ? 41   LYS C CD  1 
ATOM   8068  C  CE  . LYS C 1 41  ? 8.484   -2.053  10.640  1.00 10.67 ? 41   LYS C CE  1 
ATOM   8069  N  NZ  . LYS C 1 41  ? 7.152   -2.232  9.991   1.00 11.21 ? 41   LYS C NZ  1 
ATOM   8070  N  N   . ILE C 1 42  ? 11.852  1.096   14.434  1.00 8.57  ? 42   ILE C N   1 
ATOM   8071  C  CA  . ILE C 1 42  ? 12.734  2.117   13.878  1.00 8.21  ? 42   ILE C CA  1 
ATOM   8072  C  C   . ILE C 1 42  ? 14.118  2.100   14.576  1.00 7.71  ? 42   ILE C C   1 
ATOM   8073  O  O   . ILE C 1 42  ? 15.167  2.165   13.922  1.00 6.95  ? 42   ILE C O   1 
ATOM   8074  C  CB  . ILE C 1 42  ? 12.066  3.537   14.040  1.00 8.51  ? 42   ILE C CB  1 
ATOM   8075  C  CG1 . ILE C 1 42  ? 10.762  3.671   13.213  1.00 8.92  ? 42   ILE C CG1 1 
ATOM   8076  C  CG2 . ILE C 1 42  ? 13.084  4.689   13.836  1.00 8.30  ? 42   ILE C CG2 1 
ATOM   8077  C  CD1 . ILE C 1 42  ? 10.879  3.689   11.689  1.00 8.46  ? 42   ILE C CD1 1 
ATOM   8078  N  N   . ALA C 1 43  ? 14.119  2.043   15.909  1.00 6.96  ? 43   ALA C N   1 
ATOM   8079  C  CA  . ALA C 1 43  ? 15.398  1.999   16.642  1.00 6.69  ? 43   ALA C CA  1 
ATOM   8080  C  C   . ALA C 1 43  ? 16.273  0.797   16.246  1.00 5.97  ? 43   ALA C C   1 
ATOM   8081  O  O   . ALA C 1 43  ? 17.495  0.937   16.147  1.00 4.68  ? 43   ALA C O   1 
ATOM   8082  C  CB  . ALA C 1 43  ? 15.188  2.070   18.187  1.00 5.63  ? 43   ALA C CB  1 
ATOM   8083  N  N   . HIS C 1 44  ? 15.654  -0.372  16.024  1.00 6.18  ? 44   HIS C N   1 
ATOM   8084  C  CA  . HIS C 1 44  ? 16.435  -1.528  15.567  1.00 6.62  ? 44   HIS C CA  1 
ATOM   8085  C  C   . HIS C 1 44  ? 16.957  -1.311  14.155  1.00 6.74  ? 44   HIS C C   1 
ATOM   8086  O  O   . HIS C 1 44  ? 18.161  -1.532  13.876  1.00 6.86  ? 44   HIS C O   1 
ATOM   8087  C  CB  . HIS C 1 44  ? 15.662  -2.841  15.587  1.00 7.05  ? 44   HIS C CB  1 
ATOM   8088  C  CG  . HIS C 1 44  ? 16.557  -4.016  15.395  1.00 7.20  ? 44   HIS C CG  1 
ATOM   8089  N  ND1 . HIS C 1 44  ? 16.916  -4.475  14.145  1.00 5.98  ? 44   HIS C ND1 1 
ATOM   8090  C  CD2 . HIS C 1 44  ? 17.274  -4.743  16.288  1.00 7.20  ? 44   HIS C CD2 1 
ATOM   8091  C  CE1 . HIS C 1 44  ? 17.784  -5.464  14.279  1.00 4.80  ? 44   HIS C CE1 1 
ATOM   8092  N  NE2 . HIS C 1 44  ? 18.024  -5.641  15.565  1.00 6.57  ? 44   HIS C NE2 1 
ATOM   8093  N  N   . PHE C 1 45  ? 16.046  -0.885  13.278  1.00 6.54  ? 45   PHE C N   1 
ATOM   8094  C  CA  . PHE C 1 45  ? 16.406  -0.433  11.944  1.00 6.96  ? 45   PHE C CA  1 
ATOM   8095  C  C   . PHE C 1 45  ? 17.583  0.535   12.012  1.00 6.60  ? 45   PHE C C   1 
ATOM   8096  O  O   . PHE C 1 45  ? 18.523  0.433   11.204  1.00 6.87  ? 45   PHE C O   1 
ATOM   8097  C  CB  . PHE C 1 45  ? 15.217  0.211   11.211  1.00 7.06  ? 45   PHE C CB  1 
ATOM   8098  C  CG  . PHE C 1 45  ? 15.599  0.865   9.906   1.00 9.80  ? 45   PHE C CG  1 
ATOM   8099  C  CD1 . PHE C 1 45  ? 15.809  0.083   8.743   1.00 12.05 ? 45   PHE C CD1 1 
ATOM   8100  C  CD2 . PHE C 1 45  ? 15.808  2.242   9.836   1.00 9.83  ? 45   PHE C CD2 1 
ATOM   8101  C  CE1 . PHE C 1 45  ? 16.192  0.667   7.542   1.00 8.85  ? 45   PHE C CE1 1 
ATOM   8102  C  CE2 . PHE C 1 45  ? 16.168  2.838   8.644   1.00 10.09 ? 45   PHE C CE2 1 
ATOM   8103  C  CZ  . PHE C 1 45  ? 16.358  2.050   7.489   1.00 10.16 ? 45   PHE C CZ  1 
ATOM   8104  N  N   . ASP C 1 46  ? 17.531  1.455   12.973  1.00 5.93  ? 46   ASP C N   1 
ATOM   8105  C  CA  . ASP C 1 46  ? 18.596  2.462   13.177  1.00 6.65  ? 46   ASP C CA  1 
ATOM   8106  C  C   . ASP C 1 46  ? 20.000  1.873   13.520  1.00 6.53  ? 46   ASP C C   1 
ATOM   8107  O  O   . ASP C 1 46  ? 21.022  2.574   13.441  1.00 6.75  ? 46   ASP C O   1 
ATOM   8108  C  CB  . ASP C 1 46  ? 18.163  3.491   14.248  1.00 5.98  ? 46   ASP C CB  1 
ATOM   8109  C  CG  . ASP C 1 46  ? 17.123  4.513   13.718  1.00 6.69  ? 46   ASP C CG  1 
ATOM   8110  O  OD1 . ASP C 1 46  ? 16.541  5.282   14.545  1.00 2.64  ? 46   ASP C OD1 1 
ATOM   8111  O  OD2 . ASP C 1 46  ? 16.898  4.545   12.479  1.00 4.19  ? 46   ASP C OD2 1 
ATOM   8112  N  N   . ARG C 1 47  ? 20.028  0.597   13.882  1.00 6.13  ? 47   ARG C N   1 
ATOM   8113  C  CA  . ARG C 1 47  ? 21.200  -0.040  14.433  1.00 6.80  ? 47   ARG C CA  1 
ATOM   8114  C  C   . ARG C 1 47  ? 21.607  -1.254  13.598  1.00 7.60  ? 47   ARG C C   1 
ATOM   8115  O  O   . ARG C 1 47  ? 22.441  -2.056  14.010  1.00 8.01  ? 47   ARG C O   1 
ATOM   8116  C  CB  . ARG C 1 47  ? 20.923  -0.428  15.903  1.00 7.20  ? 47   ARG C CB  1 
ATOM   8117  C  CG  . ARG C 1 47  ? 21.169  0.745   16.867  1.00 6.40  ? 47   ARG C CG  1 
ATOM   8118  C  CD  . ARG C 1 47  ? 20.547  0.614   18.258  1.00 6.87  ? 47   ARG C CD  1 
ATOM   8119  N  NE  . ARG C 1 47  ? 20.713  1.914   18.928  1.00 8.39  ? 47   ARG C NE  1 
ATOM   8120  C  CZ  . ARG C 1 47  ? 19.786  2.872   18.959  1.00 6.77  ? 47   ARG C CZ  1 
ATOM   8121  N  NH1 . ARG C 1 47  ? 18.602  2.651   18.429  1.00 4.17  ? 47   ARG C NH1 1 
ATOM   8122  N  NH2 . ARG C 1 47  ? 20.037  4.042   19.540  1.00 5.77  ? 47   ARG C NH2 1 
ATOM   8123  N  N   . GLU C 1 48  ? 21.047  -1.375  12.399  1.00 8.16  ? 48   GLU C N   1 
ATOM   8124  C  CA  . GLU C 1 48  ? 21.301  -2.566  11.594  1.00 8.55  ? 48   GLU C CA  1 
ATOM   8125  C  C   . GLU C 1 48  ? 22.768  -2.750  11.248  1.00 8.25  ? 48   GLU C C   1 
ATOM   8126  O  O   . GLU C 1 48  ? 23.243  -3.892  11.218  1.00 7.58  ? 48   GLU C O   1 
ATOM   8127  C  CB  . GLU C 1 48  ? 20.455  -2.579  10.323  1.00 8.58  ? 48   GLU C CB  1 
ATOM   8128  C  CG  . GLU C 1 48  ? 19.017  -2.989  10.538  1.00 9.16  ? 48   GLU C CG  1 
ATOM   8129  C  CD  . GLU C 1 48  ? 18.244  -3.044  9.243   1.00 11.59 ? 48   GLU C CD  1 
ATOM   8130  O  OE1 . GLU C 1 48  ? 18.892  -3.051  8.163   1.00 13.77 ? 48   GLU C OE1 1 
ATOM   8131  O  OE2 . GLU C 1 48  ? 16.998  -3.092  9.304   1.00 11.72 ? 48   GLU C OE2 1 
ATOM   8132  N  N   . ARG C 1 49  ? 23.458  -1.628  11.008  1.00 7.90  ? 49   ARG C N   1 
ATOM   8133  C  CA  . ARG C 1 49  ? 24.817  -1.626  10.434  1.00 7.78  ? 49   ARG C CA  1 
ATOM   8134  C  C   . ARG C 1 49  ? 25.955  -1.744  11.435  1.00 8.24  ? 49   ARG C C   1 
ATOM   8135  O  O   . ARG C 1 49  ? 25.873  -1.254  12.567  1.00 7.97  ? 49   ARG C O   1 
ATOM   8136  C  CB  . ARG C 1 49  ? 25.066  -0.385  9.542   1.00 7.72  ? 49   ARG C CB  1 
ATOM   8137  C  CG  . ARG C 1 49  ? 24.071  -0.187  8.400   1.00 5.90  ? 49   ARG C CG  1 
ATOM   8138  C  CD  . ARG C 1 49  ? 24.199  -1.218  7.216   1.00 7.45  ? 49   ARG C CD  1 
ATOM   8139  N  NE  . ARG C 1 49  ? 23.136  -0.852  6.287   1.00 5.99  ? 49   ARG C NE  1 
ATOM   8140  C  CZ  . ARG C 1 49  ? 21.932  -1.393  6.265   1.00 5.20  ? 49   ARG C CZ  1 
ATOM   8141  N  NH1 . ARG C 1 49  ? 21.632  -2.438  7.034   1.00 7.91  ? 49   ARG C NH1 1 
ATOM   8142  N  NH2 . ARG C 1 49  ? 21.033  -0.904  5.440   1.00 3.44  ? 49   ARG C NH2 1 
ATOM   8143  N  N   . VAL C 1 50  ? 27.024  -2.403  10.980  1.00 8.30  ? 50   VAL C N   1 
ATOM   8144  C  CA  . VAL C 1 50  ? 28.245  -2.567  11.751  1.00 8.34  ? 50   VAL C CA  1 
ATOM   8145  C  C   . VAL C 1 50  ? 29.416  -2.101  10.877  1.00 8.04  ? 50   VAL C C   1 
ATOM   8146  O  O   . VAL C 1 50  ? 29.245  -1.935  9.690   1.00 7.17  ? 50   VAL C O   1 
ATOM   8147  C  CB  . VAL C 1 50  ? 28.419  -4.047  12.201  1.00 8.57  ? 50   VAL C CB  1 
ATOM   8148  C  CG1 . VAL C 1 50  ? 27.238  -4.485  13.073  1.00 8.30  ? 50   VAL C CG1 1 
ATOM   8149  C  CG2 . VAL C 1 50  ? 28.594  -4.975  10.964  1.00 8.33  ? 50   VAL C CG2 1 
ATOM   8150  N  N   . PRO C 1 51  ? 30.613  -1.894  11.457  1.00 8.85  ? 51   PRO C N   1 
ATOM   8151  C  CA  . PRO C 1 51  ? 31.699  -1.414  10.590  1.00 9.16  ? 51   PRO C CA  1 
ATOM   8152  C  C   . PRO C 1 51  ? 32.057  -2.475  9.565   1.00 9.73  ? 51   PRO C C   1 
ATOM   8153  O  O   . PRO C 1 51  ? 31.928  -3.686  9.853   1.00 9.92  ? 51   PRO C O   1 
ATOM   8154  C  CB  . PRO C 1 51  ? 32.866  -1.224  11.559  1.00 9.25  ? 51   PRO C CB  1 
ATOM   8155  C  CG  . PRO C 1 51  ? 32.226  -1.116  12.928  1.00 8.40  ? 51   PRO C CG  1 
ATOM   8156  C  CD  . PRO C 1 51  ? 31.076  -2.068  12.845  1.00 8.44  ? 51   PRO C CD  1 
ATOM   8157  N  N   . GLU C 1 52  ? 32.467  -2.039  8.373   1.00 9.27  ? 52   GLU C N   1 
ATOM   8158  C  CA  . GLU C 1 52  ? 32.907  -2.994  7.363   1.00 9.54  ? 52   GLU C CA  1 
ATOM   8159  C  C   . GLU C 1 52  ? 34.363  -3.370  7.680   1.00 9.09  ? 52   GLU C C   1 
ATOM   8160  O  O   . GLU C 1 52  ? 35.036  -2.716  8.481   1.00 8.54  ? 52   GLU C O   1 
ATOM   8161  C  CB  . GLU C 1 52  ? 32.737  -2.446  5.929   1.00 9.16  ? 52   GLU C CB  1 
ATOM   8162  C  CG  . GLU C 1 52  ? 33.724  -1.315  5.573   1.00 9.79  ? 52   GLU C CG  1 
ATOM   8163  C  CD  . GLU C 1 52  ? 33.588  -0.752  4.149   1.00 10.39 ? 52   GLU C CD  1 
ATOM   8164  O  OE1 . GLU C 1 52  ? 32.553  -0.935  3.493   1.00 10.29 ? 52   GLU C OE1 1 
ATOM   8165  O  OE2 . GLU C 1 52  ? 34.539  -0.083  3.690   1.00 14.55 ? 52   GLU C OE2 1 
ATOM   8166  N  N   . ARG C 1 53  ? 34.826  -4.449  7.081   1.00 9.33  ? 53   ARG C N   1 
ATOM   8167  C  CA  . ARG C 1 53  ? 36.217  -4.844  7.225   1.00 9.75  ? 53   ARG C CA  1 
ATOM   8168  C  C   . ARG C 1 53  ? 37.141  -3.706  6.771   1.00 10.61 ? 53   ARG C C   1 
ATOM   8169  O  O   . ARG C 1 53  ? 36.896  -3.069  5.737   1.00 10.66 ? 53   ARG C O   1 
ATOM   8170  C  CB  . ARG C 1 53  ? 36.468  -6.129  6.436   1.00 9.31  ? 53   ARG C CB  1 
ATOM   8171  C  CG  . ARG C 1 53  ? 35.741  -7.365  6.994   1.00 6.80  ? 53   ARG C CG  1 
ATOM   8172  C  CD  . ARG C 1 53  ? 35.769  -8.480  5.944   1.00 8.23  ? 53   ARG C CD  1 
ATOM   8173  N  NE  . ARG C 1 53  ? 35.263  -9.769  6.428   1.00 6.42  ? 53   ARG C NE  1 
ATOM   8174  C  CZ  . ARG C 1 53  ? 33.978  -10.039 6.665   1.00 5.63  ? 53   ARG C CZ  1 
ATOM   8175  N  NH1 . ARG C 1 53  ? 33.039  -9.114  6.513   1.00 2.00  ? 53   ARG C NH1 1 
ATOM   8176  N  NH2 . ARG C 1 53  ? 33.641  -11.251 7.079   1.00 6.72  ? 53   ARG C NH2 1 
ATOM   8177  N  N   . VAL C 1 54  ? 38.189  -3.429  7.552   1.00 11.18 ? 54   VAL C N   1 
ATOM   8178  C  CA  . VAL C 1 54  ? 39.037  -2.268  7.258   1.00 11.47 ? 54   VAL C CA  1 
ATOM   8179  C  C   . VAL C 1 54  ? 39.659  -2.451  5.865   1.00 11.88 ? 54   VAL C C   1 
ATOM   8180  O  O   . VAL C 1 54  ? 39.875  -1.474  5.143   1.00 11.78 ? 54   VAL C O   1 
ATOM   8181  C  CB  . VAL C 1 54  ? 40.069  -1.943  8.405   1.00 11.41 ? 54   VAL C CB  1 
ATOM   8182  C  CG1 . VAL C 1 54  ? 40.924  -3.137  8.732   1.00 12.17 ? 54   VAL C CG1 1 
ATOM   8183  C  CG2 . VAL C 1 54  ? 40.960  -0.719  8.052   1.00 11.69 ? 54   VAL C CG2 1 
ATOM   8184  N  N   . VAL C 1 55  ? 39.893  -3.725  5.509   1.00 11.89 ? 55   VAL C N   1 
ATOM   8185  C  CA  . VAL C 1 55  ? 40.241  -4.169  4.162   1.00 11.67 ? 55   VAL C CA  1 
ATOM   8186  C  C   . VAL C 1 55  ? 39.430  -5.435  3.831   1.00 12.33 ? 55   VAL C C   1 
ATOM   8187  O  O   . VAL C 1 55  ? 38.995  -6.160  4.749   1.00 12.53 ? 55   VAL C O   1 
ATOM   8188  C  CB  . VAL C 1 55  ? 41.766  -4.435  3.964   1.00 11.70 ? 55   VAL C CB  1 
ATOM   8189  C  CG1 . VAL C 1 55  ? 42.534  -3.118  3.829   1.00 11.53 ? 55   VAL C CG1 1 
ATOM   8190  C  CG2 . VAL C 1 55  ? 42.360  -5.308  5.089   1.00 11.81 ? 55   VAL C CG2 1 
ATOM   8191  N  N   . HIS C 1 56  ? 39.226  -5.672  2.527   1.00 12.20 ? 56   HIS C N   1 
ATOM   8192  C  CA  . HIS C 1 56  ? 38.462  -6.796  1.982   1.00 12.61 ? 56   HIS C CA  1 
ATOM   8193  C  C   . HIS C 1 56  ? 36.987  -6.703  2.335   1.00 13.34 ? 56   HIS C C   1 
ATOM   8194  O  O   . HIS C 1 56  ? 36.303  -7.732  2.483   1.00 13.68 ? 56   HIS C O   1 
ATOM   8195  C  CB  . HIS C 1 56  ? 39.001  -8.159  2.444   1.00 12.40 ? 56   HIS C CB  1 
ATOM   8196  C  CG  . HIS C 1 56  ? 40.394  -8.467  1.989   1.00 12.64 ? 56   HIS C CG  1 
ATOM   8197  N  ND1 . HIS C 1 56  ? 40.666  -9.395  1.003   1.00 11.93 ? 56   HIS C ND1 1 
ATOM   8198  C  CD2 . HIS C 1 56  ? 41.599  -8.009  2.421   1.00 11.77 ? 56   HIS C CD2 1 
ATOM   8199  C  CE1 . HIS C 1 56  ? 41.979  -9.487  0.843   1.00 12.09 ? 56   HIS C CE1 1 
ATOM   8200  N  NE2 . HIS C 1 56  ? 42.566  -8.661  1.695   1.00 10.72 ? 56   HIS C NE2 1 
ATOM   8201  N  N   . ALA C 1 57  ? 36.485  -5.474  2.448   1.00 13.65 ? 57   ALA C N   1 
ATOM   8202  C  CA  . ALA C 1 57  ? 35.097  -5.267  2.825   1.00 13.61 ? 57   ALA C CA  1 
ATOM   8203  C  C   . ALA C 1 57  ? 34.207  -5.977  1.830   1.00 13.89 ? 57   ALA C C   1 
ATOM   8204  O  O   . ALA C 1 57  ? 33.158  -6.531  2.201   1.00 14.52 ? 57   ALA C O   1 
ATOM   8205  C  CB  . ALA C 1 57  ? 34.769  -3.806  2.885   1.00 13.11 ? 57   ALA C CB  1 
ATOM   8206  N  N   . ARG C 1 58  ? 34.629  -5.974  0.568   1.00 13.78 ? 58   ARG C N   1 
ATOM   8207  C  CA  . ARG C 1 58  ? 33.781  -6.484  -0.502  1.00 13.74 ? 58   ARG C CA  1 
ATOM   8208  C  C   . ARG C 1 58  ? 34.092  -7.950  -0.692  1.00 13.90 ? 58   ARG C C   1 
ATOM   8209  O  O   . ARG C 1 58  ? 35.266  -8.344  -0.804  1.00 13.90 ? 58   ARG C O   1 
ATOM   8210  C  CB  . ARG C 1 58  ? 33.949  -5.680  -1.799  1.00 13.84 ? 58   ARG C CB  1 
ATOM   8211  C  CG  . ARG C 1 58  ? 33.089  -6.158  -2.985  1.00 14.25 ? 58   ARG C CG  1 
ATOM   8212  C  CD  . ARG C 1 58  ? 31.605  -5.959  -2.734  1.00 12.97 ? 58   ARG C CD  1 
ATOM   8213  N  NE  . ARG C 1 58  ? 30.927  -5.273  -3.830  1.00 14.81 ? 58   ARG C NE  1 
ATOM   8214  C  CZ  . ARG C 1 58  ? 29.889  -5.762  -4.514  1.00 15.88 ? 58   ARG C CZ  1 
ATOM   8215  N  NH1 . ARG C 1 58  ? 29.368  -6.948  -4.211  1.00 12.53 ? 58   ARG C NH1 1 
ATOM   8216  N  NH2 . ARG C 1 58  ? 29.352  -5.042  -5.494  1.00 16.02 ? 58   ARG C NH2 1 
ATOM   8217  N  N   . GLY C 1 59  ? 33.037  -8.756  -0.699  1.00 13.92 ? 59   GLY C N   1 
ATOM   8218  C  CA  . GLY C 1 59  ? 33.196  -10.198 -0.654  1.00 14.23 ? 59   GLY C CA  1 
ATOM   8219  C  C   . GLY C 1 59  ? 31.936  -11.034 -0.817  1.00 14.17 ? 59   GLY C C   1 
ATOM   8220  O  O   . GLY C 1 59  ? 30.814  -10.516 -0.885  1.00 13.31 ? 59   GLY C O   1 
ATOM   8221  N  N   . PHE C 1 60  ? 32.165  -12.346 -0.883  1.00 13.97 ? 60   PHE C N   1 
ATOM   8222  C  CA  . PHE C 1 60  ? 31.134  -13.331 -1.102  1.00 14.20 ? 60   PHE C CA  1 
ATOM   8223  C  C   . PHE C 1 60  ? 31.480  -14.573 -0.277  1.00 14.05 ? 60   PHE C C   1 
ATOM   8224  O  O   . PHE C 1 60  ? 32.628  -15.000 -0.282  1.00 14.40 ? 60   PHE C O   1 
ATOM   8225  C  CB  . PHE C 1 60  ? 31.054  -13.696 -2.599  1.00 14.19 ? 60   PHE C CB  1 
ATOM   8226  C  CG  . PHE C 1 60  ? 30.331  -14.981 -2.852  1.00 15.45 ? 60   PHE C CG  1 
ATOM   8227  C  CD1 . PHE C 1 60  ? 28.938  -15.011 -2.912  1.00 15.69 ? 60   PHE C CD1 1 
ATOM   8228  C  CD2 . PHE C 1 60  ? 31.028  -16.174 -2.963  1.00 17.23 ? 60   PHE C CD2 1 
ATOM   8229  C  CE1 . PHE C 1 60  ? 28.253  -16.210 -3.103  1.00 15.45 ? 60   PHE C CE1 1 
ATOM   8230  C  CE2 . PHE C 1 60  ? 30.346  -17.387 -3.151  1.00 17.55 ? 60   PHE C CE2 1 
ATOM   8231  C  CZ  . PHE C 1 60  ? 28.963  -17.400 -3.218  1.00 15.44 ? 60   PHE C CZ  1 
ATOM   8232  N  N   . GLY C 1 61  ? 30.492  -15.175 0.392   1.00 13.96 ? 61   GLY C N   1 
ATOM   8233  C  CA  . GLY C 1 61  ? 30.718  -16.412 1.145   1.00 13.49 ? 61   GLY C CA  1 
ATOM   8234  C  C   . GLY C 1 61  ? 29.863  -17.614 0.761   1.00 13.54 ? 61   GLY C C   1 
ATOM   8235  O  O   . GLY C 1 61  ? 28.805  -17.467 0.188   1.00 12.98 ? 61   GLY C O   1 
ATOM   8236  N  N   . ALA C 1 62  ? 30.335  -18.817 1.078   1.00 13.89 ? 62   ALA C N   1 
ATOM   8237  C  CA  . ALA C 1 62  ? 29.503  -20.010 0.984   1.00 14.19 ? 62   ALA C CA  1 
ATOM   8238  C  C   . ALA C 1 62  ? 30.080  -21.213 1.745   1.00 14.50 ? 62   ALA C C   1 
ATOM   8239  O  O   . ALA C 1 62  ? 31.292  -21.303 1.992   1.00 14.24 ? 62   ALA C O   1 
ATOM   8240  C  CB  . ALA C 1 62  ? 29.266  -20.370 -0.467  1.00 14.55 ? 62   ALA C CB  1 
ATOM   8241  N  N   . HIS C 1 63  ? 29.184  -22.136 2.097   1.00 14.88 ? 63   HIS C N   1 
ATOM   8242  C  CA  . HIS C 1 63  ? 29.517  -23.351 2.838   1.00 14.78 ? 63   HIS C CA  1 
ATOM   8243  C  C   . HIS C 1 63  ? 29.945  -24.454 1.883   1.00 15.08 ? 63   HIS C C   1 
ATOM   8244  O  O   . HIS C 1 63  ? 29.582  -24.459 0.692   1.00 15.08 ? 63   HIS C O   1 
ATOM   8245  C  CB  . HIS C 1 63  ? 28.302  -23.817 3.651   1.00 14.46 ? 63   HIS C CB  1 
ATOM   8246  C  CG  . HIS C 1 63  ? 27.842  -22.830 4.682   1.00 17.00 ? 63   HIS C CG  1 
ATOM   8247  N  ND1 . HIS C 1 63  ? 28.201  -22.923 6.015   1.00 18.30 ? 63   HIS C ND1 1 
ATOM   8248  C  CD2 . HIS C 1 63  ? 27.053  -21.730 4.579   1.00 17.20 ? 63   HIS C CD2 1 
ATOM   8249  C  CE1 . HIS C 1 63  ? 27.656  -21.918 6.684   1.00 19.14 ? 63   HIS C CE1 1 
ATOM   8250  N  NE2 . HIS C 1 63  ? 26.958  -21.178 5.837   1.00 17.30 ? 63   HIS C NE2 1 
ATOM   8251  N  N   . GLY C 1 64  ? 30.691  -25.416 2.407   1.00 15.20 ? 64   GLY C N   1 
ATOM   8252  C  CA  . GLY C 1 64  ? 31.108  -26.538 1.606   1.00 15.33 ? 64   GLY C CA  1 
ATOM   8253  C  C   . GLY C 1 64  ? 31.796  -27.585 2.434   1.00 15.64 ? 64   GLY C C   1 
ATOM   8254  O  O   . GLY C 1 64  ? 31.586  -27.662 3.635   1.00 15.54 ? 64   GLY C O   1 
ATOM   8255  N  N   . VAL C 1 65  ? 32.630  -28.383 1.784   1.00 16.11 ? 65   VAL C N   1 
ATOM   8256  C  CA  . VAL C 1 65  ? 33.284  -29.497 2.448   1.00 17.27 ? 65   VAL C CA  1 
ATOM   8257  C  C   . VAL C 1 65  ? 34.740  -29.567 1.992   1.00 17.44 ? 65   VAL C C   1 
ATOM   8258  O  O   . VAL C 1 65  ? 35.057  -29.202 0.873   1.00 17.62 ? 65   VAL C O   1 
ATOM   8259  C  CB  . VAL C 1 65  ? 32.487  -30.854 2.222   1.00 17.50 ? 65   VAL C CB  1 
ATOM   8260  C  CG1 . VAL C 1 65  ? 32.507  -31.291 0.739   1.00 17.33 ? 65   VAL C CG1 1 
ATOM   8261  C  CG2 . VAL C 1 65  ? 32.996  -31.983 3.124   1.00 17.45 ? 65   VAL C CG2 1 
ATOM   8262  N  N   . PHE C 1 66  ? 35.632  -29.974 2.886   1.00 18.25 ? 66   PHE C N   1 
ATOM   8263  C  CA  . PHE C 1 66  ? 36.979  -30.332 2.484   1.00 18.94 ? 66   PHE C CA  1 
ATOM   8264  C  C   . PHE C 1 66  ? 37.191  -31.824 2.653   1.00 19.68 ? 66   PHE C C   1 
ATOM   8265  O  O   . PHE C 1 66  ? 36.949  -32.383 3.717   1.00 19.76 ? 66   PHE C O   1 
ATOM   8266  C  CB  . PHE C 1 66  ? 38.055  -29.538 3.239   1.00 18.52 ? 66   PHE C CB  1 
ATOM   8267  C  CG  . PHE C 1 66  ? 39.457  -29.819 2.753   1.00 18.60 ? 66   PHE C CG  1 
ATOM   8268  C  CD1 . PHE C 1 66  ? 39.958  -29.172 1.626   1.00 17.66 ? 66   PHE C CD1 1 
ATOM   8269  C  CD2 . PHE C 1 66  ? 40.261  -30.761 3.402   1.00 18.32 ? 66   PHE C CD2 1 
ATOM   8270  C  CE1 . PHE C 1 66  ? 41.252  -29.441 1.158   1.00 18.45 ? 66   PHE C CE1 1 
ATOM   8271  C  CE2 . PHE C 1 66  ? 41.556  -31.035 2.951   1.00 17.53 ? 66   PHE C CE2 1 
ATOM   8272  C  CZ  . PHE C 1 66  ? 42.054  -30.371 1.820   1.00 17.97 ? 66   PHE C CZ  1 
ATOM   8273  N  N   . LYS C 1 67  ? 37.639  -32.464 1.585   1.00 21.30 ? 67   LYS C N   1 
ATOM   8274  C  CA  . LYS C 1 67  ? 37.881  -33.902 1.589   1.00 22.95 ? 67   LYS C CA  1 
ATOM   8275  C  C   . LYS C 1 67  ? 39.384  -34.126 1.510   1.00 23.33 ? 67   LYS C C   1 
ATOM   8276  O  O   . LYS C 1 67  ? 40.010  -33.768 0.506   1.00 23.44 ? 67   LYS C O   1 
ATOM   8277  C  CB  . LYS C 1 67  ? 37.164  -34.561 0.398   1.00 23.21 ? 67   LYS C CB  1 
ATOM   8278  C  CG  . LYS C 1 67  ? 37.415  -36.075 0.185   1.00 25.72 ? 67   LYS C CG  1 
ATOM   8279  C  CD  . LYS C 1 67  ? 36.614  -36.933 1.152   1.00 29.45 ? 67   LYS C CD  1 
ATOM   8280  C  CE  . LYS C 1 67  ? 36.137  -38.256 0.527   1.00 32.25 ? 67   LYS C CE  1 
ATOM   8281  N  NZ  . LYS C 1 67  ? 35.194  -38.973 1.470   1.00 33.29 ? 67   LYS C NZ  1 
ATOM   8282  N  N   . VAL C 1 68  ? 39.976  -34.700 2.555   1.00 23.81 ? 68   VAL C N   1 
ATOM   8283  C  CA  . VAL C 1 68  ? 41.393  -35.014 2.447   1.00 24.86 ? 68   VAL C CA  1 
ATOM   8284  C  C   . VAL C 1 68  ? 41.603  -36.285 1.619   1.00 25.59 ? 68   VAL C C   1 
ATOM   8285  O  O   . VAL C 1 68  ? 40.987  -37.330 1.875   1.00 25.44 ? 68   VAL C O   1 
ATOM   8286  C  CB  . VAL C 1 68  ? 42.174  -35.011 3.802   1.00 25.10 ? 68   VAL C CB  1 
ATOM   8287  C  CG1 . VAL C 1 68  ? 41.417  -34.215 4.883   1.00 24.69 ? 68   VAL C CG1 1 
ATOM   8288  C  CG2 . VAL C 1 68  ? 42.549  -36.412 4.255   1.00 23.88 ? 68   VAL C CG2 1 
ATOM   8289  N  N   . LYS C 1 69  ? 42.449  -36.152 0.603   1.00 26.38 ? 69   LYS C N   1 
ATOM   8290  C  CA  . LYS C 1 69  ? 42.757  -37.247 -0.302  1.00 27.77 ? 69   LYS C CA  1 
ATOM   8291  C  C   . LYS C 1 69  ? 44.020  -38.007 0.121   1.00 27.55 ? 69   LYS C C   1 
ATOM   8292  O  O   . LYS C 1 69  ? 44.070  -39.222 0.022   1.00 27.72 ? 69   LYS C O   1 
ATOM   8293  C  CB  . LYS C 1 69  ? 42.876  -36.731 -1.737  1.00 28.50 ? 69   LYS C CB  1 
ATOM   8294  C  CG  . LYS C 1 69  ? 43.047  -37.826 -2.789  1.00 31.66 ? 69   LYS C CG  1 
ATOM   8295  C  CD  . LYS C 1 69  ? 41.694  -38.365 -3.310  1.00 35.99 ? 69   LYS C CD  1 
ATOM   8296  C  CE  . LYS C 1 69  ? 41.862  -39.719 -4.032  1.00 36.92 ? 69   LYS C CE  1 
ATOM   8297  N  NZ  . LYS C 1 69  ? 43.068  -39.722 -4.922  1.00 39.00 ? 69   LYS C NZ  1 
ATOM   8298  N  N   . ASN C 1 70  ? 45.023  -37.284 0.610   1.00 27.59 ? 70   ASN C N   1 
ATOM   8299  C  CA  . ASN C 1 70  ? 46.303  -37.879 0.971   1.00 27.29 ? 70   ASN C CA  1 
ATOM   8300  C  C   . ASN C 1 70  ? 46.633  -37.594 2.427   1.00 27.26 ? 70   ASN C C   1 
ATOM   8301  O  O   . ASN C 1 70  ? 46.493  -36.449 2.872   1.00 27.53 ? 70   ASN C O   1 
ATOM   8302  C  CB  . ASN C 1 70  ? 47.414  -37.322 0.079   1.00 27.16 ? 70   ASN C CB  1 
ATOM   8303  C  CG  . ASN C 1 70  ? 47.045  -37.328 -1.401  1.00 28.18 ? 70   ASN C CG  1 
ATOM   8304  O  OD1 . ASN C 1 70  ? 46.335  -36.439 -1.890  1.00 30.09 ? 70   ASN C OD1 1 
ATOM   8305  N  ND2 . ASN C 1 70  ? 47.544  -38.318 -2.124  1.00 26.37 ? 70   ASN C ND2 1 
ATOM   8306  N  N   . SER C 1 71  ? 47.065  -38.623 3.163   1.00 26.74 ? 71   SER C N   1 
ATOM   8307  C  CA  . SER C 1 71  ? 47.437  -38.471 4.572   1.00 26.43 ? 71   SER C CA  1 
ATOM   8308  C  C   . SER C 1 71  ? 48.681  -37.619 4.737   1.00 26.63 ? 71   SER C C   1 
ATOM   8309  O  O   . SER C 1 71  ? 49.652  -37.786 3.990   1.00 27.12 ? 71   SER C O   1 
ATOM   8310  C  CB  . SER C 1 71  ? 47.676  -39.822 5.233   1.00 26.00 ? 71   SER C CB  1 
ATOM   8311  O  OG  . SER C 1 71  ? 48.135  -39.632 6.558   1.00 24.99 ? 71   SER C OG  1 
ATOM   8312  N  N   . MET C 1 72  ? 48.657  -36.721 5.724   1.00 26.60 ? 72   MET C N   1 
ATOM   8313  C  CA  . MET C 1 72  ? 49.772  -35.786 5.942   1.00 26.40 ? 72   MET C CA  1 
ATOM   8314  C  C   . MET C 1 72  ? 50.608  -36.105 7.191   1.00 26.19 ? 72   MET C C   1 
ATOM   8315  O  O   . MET C 1 72  ? 51.443  -35.297 7.618   1.00 26.13 ? 72   MET C O   1 
ATOM   8316  C  CB  . MET C 1 72  ? 49.271  -34.337 5.939   1.00 26.65 ? 72   MET C CB  1 
ATOM   8317  C  CG  . MET C 1 72  ? 48.776  -33.883 4.583   1.00 27.58 ? 72   MET C CG  1 
ATOM   8318  S  SD  . MET C 1 72  ? 50.124  -33.696 3.392   1.00 31.95 ? 72   MET C SD  1 
ATOM   8319  C  CE  . MET C 1 72  ? 49.442  -34.536 1.967   1.00 28.31 ? 72   MET C CE  1 
ATOM   8320  N  N   . LYS C 1 73  ? 50.382  -37.298 7.745   1.00 25.80 ? 73   LYS C N   1 
ATOM   8321  C  CA  . LYS C 1 73  ? 51.136  -37.835 8.881   1.00 25.84 ? 73   LYS C CA  1 
ATOM   8322  C  C   . LYS C 1 73  ? 52.635  -37.496 8.867   1.00 25.25 ? 73   LYS C C   1 
ATOM   8323  O  O   . LYS C 1 73  ? 53.200  -37.127 9.901   1.00 25.38 ? 73   LYS C O   1 
ATOM   8324  C  CB  . LYS C 1 73  ? 50.959  -39.356 8.948   1.00 25.84 ? 73   LYS C CB  1 
ATOM   8325  C  CG  . LYS C 1 73  ? 51.141  -39.916 10.351  1.00 26.55 ? 73   LYS C CG  1 
ATOM   8326  C  CD  . LYS C 1 73  ? 50.748  -41.392 10.463  1.00 27.18 ? 73   LYS C CD  1 
ATOM   8327  C  CE  . LYS C 1 73  ? 51.984  -42.277 10.658  1.00 29.43 ? 73   LYS C CE  1 
ATOM   8328  N  NZ  . LYS C 1 73  ? 51.826  -43.162 11.872  1.00 29.57 ? 73   LYS C NZ  1 
ATOM   8329  N  N   . LYS C 1 74  ? 53.257  -37.618 7.694   1.00 24.62 ? 74   LYS C N   1 
ATOM   8330  C  CA  . LYS C 1 74  ? 54.685  -37.341 7.494   1.00 24.29 ? 74   LYS C CA  1 
ATOM   8331  C  C   . LYS C 1 74  ? 55.091  -35.993 8.066   1.00 22.76 ? 74   LYS C C   1 
ATOM   8332  O  O   . LYS C 1 74  ? 56.126  -35.877 8.702   1.00 22.64 ? 74   LYS C O   1 
ATOM   8333  C  CB  . LYS C 1 74  ? 55.042  -37.375 5.994   1.00 24.10 ? 74   LYS C CB  1 
ATOM   8334  C  CG  . LYS C 1 74  ? 55.513  -38.723 5.463   1.00 26.26 ? 74   LYS C CG  1 
ATOM   8335  C  CD  . LYS C 1 74  ? 55.208  -38.935 3.942   1.00 26.37 ? 74   LYS C CD  1 
ATOM   8336  C  CE  . LYS C 1 74  ? 56.165  -38.141 3.012   1.00 30.41 ? 74   LYS C CE  1 
ATOM   8337  N  NZ  . LYS C 1 74  ? 55.848  -38.205 1.517   1.00 29.35 ? 74   LYS C NZ  1 
ATOM   8338  N  N   . TYR C 1 75  ? 54.252  -34.986 7.833   1.00 21.67 ? 75   TYR C N   1 
ATOM   8339  C  CA  . TYR C 1 75  ? 54.616  -33.584 8.038   1.00 20.49 ? 75   TYR C CA  1 
ATOM   8340  C  C   . TYR C 1 75  ? 53.963  -32.911 9.238   1.00 19.55 ? 75   TYR C C   1 
ATOM   8341  O  O   . TYR C 1 75  ? 54.519  -31.966 9.796   1.00 19.04 ? 75   TYR C O   1 
ATOM   8342  C  CB  . TYR C 1 75  ? 54.308  -32.783 6.774   1.00 20.49 ? 75   TYR C CB  1 
ATOM   8343  C  CG  . TYR C 1 75  ? 55.029  -33.284 5.540   1.00 21.07 ? 75   TYR C CG  1 
ATOM   8344  C  CD1 . TYR C 1 75  ? 54.328  -33.575 4.361   1.00 21.70 ? 75   TYR C CD1 1 
ATOM   8345  C  CD2 . TYR C 1 75  ? 56.420  -33.474 5.549   1.00 20.73 ? 75   TYR C CD2 1 
ATOM   8346  C  CE1 . TYR C 1 75  ? 55.003  -34.028 3.214   1.00 21.47 ? 75   TYR C CE1 1 
ATOM   8347  C  CE2 . TYR C 1 75  ? 57.096  -33.924 4.420   1.00 20.06 ? 75   TYR C CE2 1 
ATOM   8348  C  CZ  . TYR C 1 75  ? 56.394  -34.199 3.265   1.00 21.26 ? 75   TYR C CZ  1 
ATOM   8349  O  OH  . TYR C 1 75  ? 57.087  -34.642 2.162   1.00 21.68 ? 75   TYR C OH  1 
ATOM   8350  N  N   . THR C 1 76  ? 52.795  -33.405 9.632   1.00 18.38 ? 76   THR C N   1 
ATOM   8351  C  CA  . THR C 1 76  ? 52.003  -32.764 10.669  1.00 17.71 ? 76   THR C CA  1 
ATOM   8352  C  C   . THR C 1 76  ? 51.165  -33.753 11.485  1.00 17.76 ? 76   THR C C   1 
ATOM   8353  O  O   . THR C 1 76  ? 50.710  -34.791 10.985  1.00 17.85 ? 76   THR C O   1 
ATOM   8354  C  CB  . THR C 1 76  ? 51.098  -31.633 10.073  1.00 17.44 ? 76   THR C CB  1 
ATOM   8355  O  OG1 . THR C 1 76  ? 50.345  -31.035 11.119  1.00 17.30 ? 76   THR C OG1 1 
ATOM   8356  C  CG2 . THR C 1 76  ? 50.116  -32.173 9.035   1.00 17.42 ? 76   THR C CG2 1 
ATOM   8357  N  N   . LYS C 1 77  ? 50.949  -33.427 12.747  1.00 17.48 ? 77   LYS C N   1 
ATOM   8358  C  CA  . LYS C 1 77  ? 50.096  -34.253 13.570  1.00 17.28 ? 77   LYS C CA  1 
ATOM   8359  C  C   . LYS C 1 77  ? 48.633  -33.786 13.545  1.00 16.71 ? 77   LYS C C   1 
ATOM   8360  O  O   . LYS C 1 77  ? 47.797  -34.364 14.235  1.00 16.73 ? 77   LYS C O   1 
ATOM   8361  C  CB  . LYS C 1 77  ? 50.639  -34.362 14.999  1.00 17.32 ? 77   LYS C CB  1 
ATOM   8362  C  CG  . LYS C 1 77  ? 50.768  -33.042 15.719  1.00 18.57 ? 77   LYS C CG  1 
ATOM   8363  C  CD  . LYS C 1 77  ? 51.429  -33.237 17.070  1.00 21.23 ? 77   LYS C CD  1 
ATOM   8364  C  CE  . LYS C 1 77  ? 51.866  -31.906 17.652  1.00 22.77 ? 77   LYS C CE  1 
ATOM   8365  N  NZ  . LYS C 1 77  ? 52.597  -32.115 18.932  1.00 24.95 ? 77   LYS C NZ  1 
ATOM   8366  N  N   . ALA C 1 78  ? 48.329  -32.782 12.724  1.00 16.12 ? 78   ALA C N   1 
ATOM   8367  C  CA  . ALA C 1 78  ? 46.981  -32.229 12.640  1.00 16.40 ? 78   ALA C CA  1 
ATOM   8368  C  C   . ALA C 1 78  ? 45.934  -33.334 12.419  1.00 16.66 ? 78   ALA C C   1 
ATOM   8369  O  O   . ALA C 1 78  ? 45.995  -34.047 11.413  1.00 16.76 ? 78   ALA C O   1 
ATOM   8370  C  CB  . ALA C 1 78  ? 46.906  -31.173 11.527  1.00 16.21 ? 78   ALA C CB  1 
ATOM   8371  N  N   . ALA C 1 79  ? 44.984  -33.462 13.351  1.00 16.60 ? 79   ALA C N   1 
ATOM   8372  C  CA  . ALA C 1 79  ? 44.048  -34.612 13.382  1.00 16.81 ? 79   ALA C CA  1 
ATOM   8373  C  C   . ALA C 1 79  ? 43.284  -34.872 12.077  1.00 16.72 ? 79   ALA C C   1 
ATOM   8374  O  O   . ALA C 1 79  ? 43.223  -36.007 11.626  1.00 16.45 ? 79   ALA C O   1 
ATOM   8375  C  CB  . ALA C 1 79  ? 43.068  -34.508 14.569  1.00 16.26 ? 79   ALA C CB  1 
ATOM   8376  N  N   . PHE C 1 80  ? 42.730  -33.820 11.474  1.00 17.23 ? 80   PHE C N   1 
ATOM   8377  C  CA  . PHE C 1 80  ? 41.883  -33.950 10.281  1.00 17.51 ? 80   PHE C CA  1 
ATOM   8378  C  C   . PHE C 1 80  ? 42.657  -34.415 9.043   1.00 17.95 ? 80   PHE C C   1 
ATOM   8379  O  O   . PHE C 1 80  ? 42.065  -34.909 8.076   1.00 17.40 ? 80   PHE C O   1 
ATOM   8380  C  CB  . PHE C 1 80  ? 41.100  -32.645 10.002  1.00 17.56 ? 80   PHE C CB  1 
ATOM   8381  C  CG  . PHE C 1 80  ? 41.871  -31.577 9.242   1.00 16.04 ? 80   PHE C CG  1 
ATOM   8382  C  CD1 . PHE C 1 80  ? 42.670  -30.654 9.916   1.00 15.76 ? 80   PHE C CD1 1 
ATOM   8383  C  CD2 . PHE C 1 80  ? 41.736  -31.455 7.851   1.00 16.17 ? 80   PHE C CD2 1 
ATOM   8384  C  CE1 . PHE C 1 80  ? 43.376  -29.630 9.209   1.00 14.71 ? 80   PHE C CE1 1 
ATOM   8385  C  CE2 . PHE C 1 80  ? 42.426  -30.447 7.135   1.00 15.49 ? 80   PHE C CE2 1 
ATOM   8386  C  CZ  . PHE C 1 80  ? 43.250  -29.532 7.826   1.00 15.51 ? 80   PHE C CZ  1 
ATOM   8387  N  N   . LEU C 1 81  ? 43.974  -34.240 9.110   1.00 18.48 ? 81   LEU C N   1 
ATOM   8388  C  CA  . LEU C 1 81  ? 44.908  -34.544 8.033   1.00 19.49 ? 81   LEU C CA  1 
ATOM   8389  C  C   . LEU C 1 81  ? 45.556  -35.938 8.175   1.00 20.53 ? 81   LEU C C   1 
ATOM   8390  O  O   . LEU C 1 81  ? 46.394  -36.332 7.351   1.00 21.46 ? 81   LEU C O   1 
ATOM   8391  C  CB  . LEU C 1 81  ? 45.986  -33.446 7.991   1.00 19.33 ? 81   LEU C CB  1 
ATOM   8392  C  CG  . LEU C 1 81  ? 46.129  -32.359 6.898   1.00 18.77 ? 81   LEU C CG  1 
ATOM   8393  C  CD1 . LEU C 1 81  ? 44.959  -32.233 5.943   1.00 18.42 ? 81   LEU C CD1 1 
ATOM   8394  C  CD2 . LEU C 1 81  ? 46.490  -31.009 7.504   1.00 18.37 ? 81   LEU C CD2 1 
ATOM   8395  N  N   . GLN C 1 82  ? 45.154  -36.693 9.193   1.00 21.14 ? 82   GLN C N   1 
ATOM   8396  C  CA  . GLN C 1 82  ? 45.761  -37.997 9.469   1.00 22.26 ? 82   GLN C CA  1 
ATOM   8397  C  C   . GLN C 1 82  ? 45.302  -39.162 8.541   1.00 23.51 ? 82   GLN C C   1 
ATOM   8398  O  O   . GLN C 1 82  ? 46.093  -40.064 8.209   1.00 23.43 ? 82   GLN C O   1 
ATOM   8399  C  CB  . GLN C 1 82  ? 45.595  -38.359 10.951  1.00 21.63 ? 82   GLN C CB  1 
ATOM   8400  C  CG  . GLN C 1 82  ? 46.315  -37.408 11.910  1.00 21.07 ? 82   GLN C CG  1 
ATOM   8401  C  CD  . GLN C 1 82  ? 47.765  -37.127 11.504  1.00 21.37 ? 82   GLN C CD  1 
ATOM   8402  O  OE1 . GLN C 1 82  ? 48.627  -37.991 11.640  1.00 23.30 ? 82   GLN C OE1 1 
ATOM   8403  N  NE2 . GLN C 1 82  ? 48.032  -35.919 11.001  1.00 18.82 ? 82   GLN C NE2 1 
ATOM   8404  N  N   . GLU C 1 83  ? 44.038  -39.119 8.121   1.00 24.55 ? 83   GLU C N   1 
ATOM   8405  C  CA  . GLU C 1 83  ? 43.416  -40.214 7.385   1.00 25.56 ? 83   GLU C CA  1 
ATOM   8406  C  C   . GLU C 1 83  ? 42.778  -39.725 6.104   1.00 25.67 ? 83   GLU C C   1 
ATOM   8407  O  O   . GLU C 1 83  ? 42.015  -38.765 6.117   1.00 25.33 ? 83   GLU C O   1 
ATOM   8408  C  CB  . GLU C 1 83  ? 42.362  -40.922 8.251   1.00 25.82 ? 83   GLU C CB  1 
ATOM   8409  C  CG  . GLU C 1 83  ? 42.937  -41.786 9.382   1.00 29.50 ? 83   GLU C CG  1 
ATOM   8410  C  CD  . GLU C 1 83  ? 44.107  -42.693 8.932   1.00 36.13 ? 83   GLU C CD  1 
ATOM   8411  O  OE1 . GLU C 1 83  ? 44.151  -43.142 7.743   1.00 37.38 ? 83   GLU C OE1 1 
ATOM   8412  O  OE2 . GLU C 1 83  ? 45.001  -42.949 9.777   1.00 38.70 ? 83   GLU C OE2 1 
ATOM   8413  N  N   . GLU C 1 84  ? 43.111  -40.388 4.997   1.00 26.30 ? 84   GLU C N   1 
ATOM   8414  C  CA  . GLU C 1 84  ? 42.451  -40.174 3.714   1.00 26.89 ? 84   GLU C CA  1 
ATOM   8415  C  C   . GLU C 1 84  ? 40.953  -40.390 3.866   1.00 26.23 ? 84   GLU C C   1 
ATOM   8416  O  O   . GLU C 1 84  ? 40.513  -41.295 4.581   1.00 25.88 ? 84   GLU C O   1 
ATOM   8417  C  CB  . GLU C 1 84  ? 42.962  -41.160 2.668   1.00 26.91 ? 84   GLU C CB  1 
ATOM   8418  C  CG  . GLU C 1 84  ? 44.463  -41.143 2.386   1.00 28.77 ? 84   GLU C CG  1 
ATOM   8419  C  CD  . GLU C 1 84  ? 44.808  -42.023 1.182   1.00 29.75 ? 84   GLU C CD  1 
ATOM   8420  O  OE1 . GLU C 1 84  ? 44.203  -43.128 1.075   1.00 32.29 ? 84   GLU C OE1 1 
ATOM   8421  O  OE2 . GLU C 1 84  ? 45.652  -41.605 0.342   1.00 31.27 ? 84   GLU C OE2 1 
ATOM   8422  N  N   . GLY C 1 85  ? 40.172  -39.550 3.195   1.00 25.89 ? 85   GLY C N   1 
ATOM   8423  C  CA  . GLY C 1 85  ? 38.728  -39.681 3.225   1.00 25.55 ? 85   GLY C CA  1 
ATOM   8424  C  C   . GLY C 1 85  ? 38.019  -38.829 4.262   1.00 25.60 ? 85   GLY C C   1 
ATOM   8425  O  O   . GLY C 1 85  ? 36.821  -38.569 4.103   1.00 25.57 ? 85   GLY C O   1 
ATOM   8426  N  N   . THR C 1 86  ? 38.724  -38.388 5.314   1.00 25.15 ? 86   THR C N   1 
ATOM   8427  C  CA  . THR C 1 86  ? 38.075  -37.513 6.316   1.00 25.31 ? 86   THR C CA  1 
ATOM   8428  C  C   . THR C 1 86  ? 37.535  -36.208 5.687   1.00 24.40 ? 86   THR C C   1 
ATOM   8429  O  O   . THR C 1 86  ? 38.175  -35.601 4.825   1.00 23.97 ? 86   THR C O   1 
ATOM   8430  C  CB  . THR C 1 86  ? 38.923  -37.214 7.621   1.00 25.31 ? 86   THR C CB  1 
ATOM   8431  O  OG1 . THR C 1 86  ? 39.562  -35.937 7.529   1.00 27.70 ? 86   THR C OG1 1 
ATOM   8432  C  CG2 . THR C 1 86  ? 39.951  -38.259 7.895   1.00 25.47 ? 86   THR C CG2 1 
ATOM   8433  N  N   . GLU C 1 87  ? 36.338  -35.824 6.119   1.00 23.57 ? 87   GLU C N   1 
ATOM   8434  C  CA  . GLU C 1 87  ? 35.635  -34.661 5.593   1.00 23.36 ? 87   GLU C CA  1 
ATOM   8435  C  C   . GLU C 1 87  ? 35.446  -33.629 6.691   1.00 21.74 ? 87   GLU C C   1 
ATOM   8436  O  O   . GLU C 1 87  ? 35.043  -33.947 7.814   1.00 21.56 ? 87   GLU C O   1 
ATOM   8437  C  CB  . GLU C 1 87  ? 34.274  -35.066 5.023   1.00 23.19 ? 87   GLU C CB  1 
ATOM   8438  C  CG  . GLU C 1 87  ? 34.370  -36.098 3.903   1.00 25.73 ? 87   GLU C CG  1 
ATOM   8439  C  CD  . GLU C 1 87  ? 33.013  -36.498 3.318   1.00 26.71 ? 87   GLU C CD  1 
ATOM   8440  O  OE1 . GLU C 1 87  ? 32.907  -37.638 2.779   1.00 28.63 ? 87   GLU C OE1 1 
ATOM   8441  O  OE2 . GLU C 1 87  ? 32.065  -35.672 3.399   1.00 29.74 ? 87   GLU C OE2 1 
ATOM   8442  N  N   . VAL C 1 88  ? 35.746  -32.384 6.362   1.00 20.28 ? 88   VAL C N   1 
ATOM   8443  C  CA  . VAL C 1 88  ? 35.582  -31.293 7.306   1.00 18.68 ? 88   VAL C CA  1 
ATOM   8444  C  C   . VAL C 1 88  ? 34.670  -30.231 6.678   1.00 17.46 ? 88   VAL C C   1 
ATOM   8445  O  O   . VAL C 1 88  ? 34.892  -29.835 5.525   1.00 16.72 ? 88   VAL C O   1 
ATOM   8446  C  CB  . VAL C 1 88  ? 36.981  -30.755 7.779   1.00 19.20 ? 88   VAL C CB  1 
ATOM   8447  C  CG1 . VAL C 1 88  ? 37.996  -30.859 6.680   1.00 19.45 ? 88   VAL C CG1 1 
ATOM   8448  C  CG2 . VAL C 1 88  ? 36.922  -29.323 8.355   1.00 18.48 ? 88   VAL C CG2 1 
ATOM   8449  N  N   . PRO C 1 89  ? 33.627  -29.784 7.428   1.00 16.37 ? 89   PRO C N   1 
ATOM   8450  C  CA  . PRO C 1 89  ? 32.814  -28.675 6.923   1.00 15.21 ? 89   PRO C CA  1 
ATOM   8451  C  C   . PRO C 1 89  ? 33.683  -27.419 6.841   1.00 14.82 ? 89   PRO C C   1 
ATOM   8452  O  O   . PRO C 1 89  ? 34.599  -27.222 7.683   1.00 13.86 ? 89   PRO C O   1 
ATOM   8453  C  CB  . PRO C 1 89  ? 31.698  -28.514 7.967   1.00 14.97 ? 89   PRO C CB  1 
ATOM   8454  C  CG  . PRO C 1 89  ? 32.166  -29.229 9.195   1.00 15.29 ? 89   PRO C CG  1 
ATOM   8455  C  CD  . PRO C 1 89  ? 33.183  -30.252 8.760   1.00 16.46 ? 89   PRO C CD  1 
ATOM   8456  N  N   . VAL C 1 90  ? 33.437  -26.607 5.809   1.00 13.71 ? 90   VAL C N   1 
ATOM   8457  C  CA  . VAL C 1 90  ? 34.168  -25.358 5.659   1.00 13.12 ? 90   VAL C CA  1 
ATOM   8458  C  C   . VAL C 1 90  ? 33.238  -24.178 5.369   1.00 13.20 ? 90   VAL C C   1 
ATOM   8459  O  O   . VAL C 1 90  ? 32.059  -24.349 5.035   1.00 12.56 ? 90   VAL C O   1 
ATOM   8460  C  CB  . VAL C 1 90  ? 35.282  -25.442 4.574   1.00 13.29 ? 90   VAL C CB  1 
ATOM   8461  C  CG1 . VAL C 1 90  ? 36.397  -26.416 4.994   1.00 12.59 ? 90   VAL C CG1 1 
ATOM   8462  C  CG2 . VAL C 1 90  ? 34.690  -25.798 3.203   1.00 12.12 ? 90   VAL C CG2 1 
ATOM   8463  N  N   . PHE C 1 91  ? 33.775  -22.975 5.544   1.00 12.83 ? 91   PHE C N   1 
ATOM   8464  C  CA  . PHE C 1 91  ? 33.082  -21.779 5.113   1.00 12.79 ? 91   PHE C CA  1 
ATOM   8465  C  C   . PHE C 1 91  ? 34.134  -20.862 4.503   1.00 12.46 ? 91   PHE C C   1 
ATOM   8466  O  O   . PHE C 1 91  ? 35.178  -20.591 5.108   1.00 12.72 ? 91   PHE C O   1 
ATOM   8467  C  CB  . PHE C 1 91  ? 32.281  -21.097 6.248   1.00 12.24 ? 91   PHE C CB  1 
ATOM   8468  C  CG  . PHE C 1 91  ? 31.496  -19.897 5.779   1.00 12.53 ? 91   PHE C CG  1 
ATOM   8469  C  CD1 . PHE C 1 91  ? 30.287  -20.062 5.092   1.00 10.43 ? 91   PHE C CD1 1 
ATOM   8470  C  CD2 . PHE C 1 91  ? 31.982  -18.606 5.984   1.00 12.39 ? 91   PHE C CD2 1 
ATOM   8471  C  CE1 . PHE C 1 91  ? 29.579  -18.970 4.631   1.00 11.01 ? 91   PHE C CE1 1 
ATOM   8472  C  CE2 . PHE C 1 91  ? 31.266  -17.491 5.518   1.00 12.33 ? 91   PHE C CE2 1 
ATOM   8473  C  CZ  . PHE C 1 91  ? 30.065  -17.676 4.837   1.00 11.44 ? 91   PHE C CZ  1 
ATOM   8474  N  N   . ALA C 1 92  ? 33.867  -20.420 3.284   1.00 11.80 ? 92   ALA C N   1 
ATOM   8475  C  CA  . ALA C 1 92  ? 34.855  -19.692 2.526   1.00 11.17 ? 92   ALA C CA  1 
ATOM   8476  C  C   . ALA C 1 92  ? 34.334  -18.303 2.277   1.00 10.89 ? 92   ALA C C   1 
ATOM   8477  O  O   . ALA C 1 92  ? 33.131  -18.106 2.123   1.00 10.64 ? 92   ALA C O   1 
ATOM   8478  C  CB  . ALA C 1 92  ? 35.139  -20.399 1.205   1.00 10.95 ? 92   ALA C CB  1 
ATOM   8479  N  N   . ARG C 1 93  ? 35.241  -17.338 2.256   1.00 10.60 ? 93   ARG C N   1 
ATOM   8480  C  CA  . ARG C 1 93  ? 34.897  -16.009 1.791   1.00 10.75 ? 93   ARG C CA  1 
ATOM   8481  C  C   . ARG C 1 93  ? 35.992  -15.545 0.857   1.00 10.85 ? 93   ARG C C   1 
ATOM   8482  O  O   . ARG C 1 93  ? 37.184  -15.688 1.145   1.00 10.10 ? 93   ARG C O   1 
ATOM   8483  C  CB  . ARG C 1 93  ? 34.673  -15.038 2.961   1.00 11.11 ? 93   ARG C CB  1 
ATOM   8484  C  CG  . ARG C 1 93  ? 34.158  -13.632 2.579   1.00 10.34 ? 93   ARG C CG  1 
ATOM   8485  C  CD  . ARG C 1 93  ? 34.056  -12.728 3.829   1.00 10.37 ? 93   ARG C CD  1 
ATOM   8486  N  NE  . ARG C 1 93  ? 33.620  -11.361 3.525   1.00 9.09  ? 93   ARG C NE  1 
ATOM   8487  C  CZ  . ARG C 1 93  ? 34.430  -10.353 3.205   1.00 7.98  ? 93   ARG C CZ  1 
ATOM   8488  N  NH1 . ARG C 1 93  ? 35.747  -10.568 3.143   1.00 5.04  ? 93   ARG C NH1 1 
ATOM   8489  N  NH2 . ARG C 1 93  ? 33.920  -9.131  2.947   1.00 5.23  ? 93   ARG C NH2 1 
ATOM   8490  N  N   . PHE C 1 94  ? 35.560  -15.024 -0.284  1.00 11.62 ? 94   PHE C N   1 
ATOM   8491  C  CA  . PHE C 1 94  ? 36.455  -14.468 -1.289  1.00 12.75 ? 94   PHE C CA  1 
ATOM   8492  C  C   . PHE C 1 94  ? 36.161  -12.980 -1.345  1.00 13.28 ? 94   PHE C C   1 
ATOM   8493  O  O   . PHE C 1 94  ? 35.044  -12.577 -1.018  1.00 13.77 ? 94   PHE C O   1 
ATOM   8494  C  CB  . PHE C 1 94  ? 36.223  -15.118 -2.650  1.00 12.35 ? 94   PHE C CB  1 
ATOM   8495  C  CG  . PHE C 1 94  ? 36.254  -16.614 -2.614  1.00 12.99 ? 94   PHE C CG  1 
ATOM   8496  C  CD1 . PHE C 1 94  ? 35.067  -17.344 -2.569  1.00 14.42 ? 94   PHE C CD1 1 
ATOM   8497  C  CD2 . PHE C 1 94  ? 37.458  -17.296 -2.608  1.00 12.69 ? 94   PHE C CD2 1 
ATOM   8498  C  CE1 . PHE C 1 94  ? 35.082  -18.735 -2.532  1.00 14.72 ? 94   PHE C CE1 1 
ATOM   8499  C  CE2 . PHE C 1 94  ? 37.493  -18.689 -2.581  1.00 15.02 ? 94   PHE C CE2 1 
ATOM   8500  C  CZ  . PHE C 1 94  ? 36.293  -19.415 -2.539  1.00 14.50 ? 94   PHE C CZ  1 
ATOM   8501  N  N   . SER C 1 95  ? 37.152  -12.188 -1.767  1.00 13.61 ? 95   SER C N   1 
ATOM   8502  C  CA  . SER C 1 95  ? 37.123  -10.741 -1.616  1.00 14.07 ? 95   SER C CA  1 
ATOM   8503  C  C   . SER C 1 95  ? 38.068  -9.960  -2.542  1.00 14.48 ? 95   SER C C   1 
ATOM   8504  O  O   . SER C 1 95  ? 39.103  -10.477 -3.013  1.00 14.29 ? 95   SER C O   1 
ATOM   8505  C  CB  . SER C 1 95  ? 37.447  -10.369 -0.152  1.00 14.21 ? 95   SER C CB  1 
ATOM   8506  O  OG  . SER C 1 95  ? 38.669  -10.945 0.321   1.00 13.48 ? 95   SER C OG  1 
ATOM   8507  N  N   . THR C 1 96  ? 37.700  -8.702  -2.778  1.00 14.04 ? 96   THR C N   1 
ATOM   8508  C  CA  . THR C 1 96  ? 38.638  -7.705  -3.252  1.00 13.98 ? 96   THR C CA  1 
ATOM   8509  C  C   . THR C 1 96  ? 39.347  -7.114  -2.005  1.00 14.84 ? 96   THR C C   1 
ATOM   8510  O  O   . THR C 1 96  ? 39.250  -7.693  -0.904  1.00 15.74 ? 96   THR C O   1 
ATOM   8511  C  CB  . THR C 1 96  ? 37.942  -6.660  -4.145  1.00 13.55 ? 96   THR C CB  1 
ATOM   8512  O  OG1 . THR C 1 96  ? 37.087  -5.816  -3.372  1.00 12.23 ? 96   THR C OG1 1 
ATOM   8513  C  CG2 . THR C 1 96  ? 37.096  -7.361  -5.207  1.00 13.94 ? 96   THR C CG2 1 
ATOM   8514  N  N   . VAL C 1 97  ? 40.075  -6.004  -2.148  1.00 14.78 ? 97   VAL C N   1 
ATOM   8515  C  CA  . VAL C 1 97  ? 40.889  -5.528  -1.033  1.00 14.63 ? 97   VAL C CA  1 
ATOM   8516  C  C   . VAL C 1 97  ? 40.596  -4.096  -0.579  1.00 14.60 ? 97   VAL C C   1 
ATOM   8517  O  O   . VAL C 1 97  ? 40.299  -3.871  0.597   1.00 13.88 ? 97   VAL C O   1 
ATOM   8518  C  CB  . VAL C 1 97  ? 42.418  -5.707  -1.295  1.00 15.25 ? 97   VAL C CB  1 
ATOM   8519  C  CG1 . VAL C 1 97  ? 43.265  -5.204  -0.084  1.00 14.37 ? 97   VAL C CG1 1 
ATOM   8520  C  CG2 . VAL C 1 97  ? 42.750  -7.169  -1.625  1.00 15.33 ? 97   VAL C CG2 1 
ATOM   8521  N  N   . ILE C 1 98  ? 40.679  -3.141  -1.502  1.00 14.32 ? 98   ILE C N   1 
ATOM   8522  C  CA  . ILE C 1 98  ? 40.795  -1.729  -1.131  1.00 14.48 ? 98   ILE C CA  1 
ATOM   8523  C  C   . ILE C 1 98  ? 39.441  -1.037  -0.891  1.00 15.21 ? 98   ILE C C   1 
ATOM   8524  O  O   . ILE C 1 98  ? 39.222  -0.426  0.161   1.00 15.28 ? 98   ILE C O   1 
ATOM   8525  C  CB  . ILE C 1 98  ? 41.662  -0.964  -2.171  1.00 14.00 ? 98   ILE C CB  1 
ATOM   8526  C  CG1 . ILE C 1 98  ? 43.132  -1.425  -2.114  1.00 14.14 ? 98   ILE C CG1 1 
ATOM   8527  C  CG2 . ILE C 1 98  ? 41.513  0.542   -2.040  1.00 13.86 ? 98   ILE C CG2 1 
ATOM   8528  C  CD1 . ILE C 1 98  ? 43.838  -1.319  -0.764  1.00 13.14 ? 98   ILE C CD1 1 
ATOM   8529  N  N   . HIS C 1 99  ? 38.536  -1.142  -1.863  1.00 15.50 ? 99   HIS C N   1 
ATOM   8530  C  CA  . HIS C 1 99  ? 37.260  -0.436  -1.785  1.00 16.08 ? 99   HIS C CA  1 
ATOM   8531  C  C   . HIS C 1 99  ? 36.213  -1.141  -0.896  1.00 16.20 ? 99   HIS C C   1 
ATOM   8532  O  O   . HIS C 1 99  ? 36.371  -2.294  -0.493  1.00 15.71 ? 99   HIS C O   1 
ATOM   8533  C  CB  . HIS C 1 99  ? 36.730  -0.120  -3.197  1.00 15.40 ? 99   HIS C CB  1 
ATOM   8534  C  CG  . HIS C 1 99  ? 37.669  0.722   -4.008  1.00 15.95 ? 99   HIS C CG  1 
ATOM   8535  N  ND1 . HIS C 1 99  ? 38.753  0.195   -4.682  1.00 15.17 ? 99   HIS C ND1 1 
ATOM   8536  C  CD2 . HIS C 1 99  ? 37.703  2.056   -4.232  1.00 14.81 ? 99   HIS C CD2 1 
ATOM   8537  C  CE1 . HIS C 1 99  ? 39.404  1.164   -5.294  1.00 14.60 ? 99   HIS C CE1 1 
ATOM   8538  N  NE2 . HIS C 1 99  ? 38.785  2.301   -5.043  1.00 15.96 ? 99   HIS C NE2 1 
ATOM   8539  N  N   . GLY C 1 100 ? 35.155  -0.413  -0.570  1.00 17.08 ? 100  GLY C N   1 
ATOM   8540  C  CA  . GLY C 1 100 ? 34.244  -0.843  0.471   1.00 17.96 ? 100  GLY C CA  1 
ATOM   8541  C  C   . GLY C 1 100 ? 33.197  -1.833  0.015   1.00 18.75 ? 100  GLY C C   1 
ATOM   8542  O  O   . GLY C 1 100 ? 33.327  -2.500  -1.021  1.00 19.31 ? 100  GLY C O   1 
ATOM   8543  N  N   . THR C 1 101 ? 32.157  -1.923  0.823   1.00 19.25 ? 101  THR C N   1 
ATOM   8544  C  CA  . THR C 1 101 ? 30.978  -2.710  0.547   1.00 19.99 ? 101  THR C CA  1 
ATOM   8545  C  C   . THR C 1 101 ? 30.277  -2.155  -0.740  1.00 20.49 ? 101  THR C C   1 
ATOM   8546  O  O   . THR C 1 101 ? 30.169  -0.929  -0.924  1.00 20.97 ? 101  THR C O   1 
ATOM   8547  C  CB  . THR C 1 101 ? 30.085  -2.670  1.830   1.00 20.16 ? 101  THR C CB  1 
ATOM   8548  O  OG1 . THR C 1 101 ? 29.143  -3.755  1.833   1.00 22.19 ? 101  THR C OG1 1 
ATOM   8549  C  CG2 . THR C 1 101 ? 29.366  -1.343  1.965   1.00 17.95 ? 101  THR C CG2 1 
ATOM   8550  N  N   . HIS C 1 102 ? 29.857  -3.042  -1.647  1.00 20.13 ? 102  HIS C N   1 
ATOM   8551  C  CA  . HIS C 1 102 ? 29.170  -2.643  -2.904  1.00 20.02 ? 102  HIS C CA  1 
ATOM   8552  C  C   . HIS C 1 102 ? 30.060  -1.975  -3.963  1.00 19.65 ? 102  HIS C C   1 
ATOM   8553  O  O   . HIS C 1 102 ? 29.593  -1.479  -4.971  1.00 19.26 ? 102  HIS C O   1 
ATOM   8554  C  CB  . HIS C 1 102 ? 27.922  -1.811  -2.602  1.00 20.33 ? 102  HIS C CB  1 
ATOM   8555  C  CG  . HIS C 1 102 ? 26.905  -2.546  -1.790  1.00 21.25 ? 102  HIS C CG  1 
ATOM   8556  N  ND1 . HIS C 1 102 ? 25.851  -1.915  -1.174  1.00 21.74 ? 102  HIS C ND1 1 
ATOM   8557  C  CD2 . HIS C 1 102 ? 26.793  -3.863  -1.479  1.00 21.86 ? 102  HIS C CD2 1 
ATOM   8558  C  CE1 . HIS C 1 102 ? 25.124  -2.811  -0.527  1.00 22.48 ? 102  HIS C CE1 1 
ATOM   8559  N  NE2 . HIS C 1 102 ? 25.675  -4.000  -0.699  1.00 22.62 ? 102  HIS C NE2 1 
ATOM   8560  N  N   . SER C 1 103 ? 31.347  -1.934  -3.659  1.00 19.77 ? 103  SER C N   1 
ATOM   8561  C  CA  . SER C 1 103 ? 32.449  -1.744  -4.586  1.00 19.36 ? 103  SER C CA  1 
ATOM   8562  C  C   . SER C 1 103 ? 32.308  -2.656  -5.823  1.00 19.11 ? 103  SER C C   1 
ATOM   8563  O  O   . SER C 1 103 ? 31.982  -3.829  -5.684  1.00 18.93 ? 103  SER C O   1 
ATOM   8564  C  CB  . SER C 1 103 ? 33.704  -2.181  -3.839  1.00 18.91 ? 103  SER C CB  1 
ATOM   8565  O  OG  . SER C 1 103 ? 34.767  -1.339  -4.130  1.00 21.17 ? 103  SER C OG  1 
ATOM   8566  N  N   . PRO C 1 104 ? 32.519  -2.119  -7.037  1.00 18.96 ? 104  PRO C N   1 
ATOM   8567  C  CA  . PRO C 1 104 ? 32.650  -3.003  -8.197  1.00 18.71 ? 104  PRO C CA  1 
ATOM   8568  C  C   . PRO C 1 104 ? 33.629  -4.148  -7.986  1.00 18.75 ? 104  PRO C C   1 
ATOM   8569  O  O   . PRO C 1 104 ? 34.729  -3.931  -7.458  1.00 18.64 ? 104  PRO C O   1 
ATOM   8570  C  CB  . PRO C 1 104 ? 33.187  -2.063  -9.284  1.00 18.60 ? 104  PRO C CB  1 
ATOM   8571  C  CG  . PRO C 1 104 ? 32.596  -0.740  -8.946  1.00 18.87 ? 104  PRO C CG  1 
ATOM   8572  C  CD  . PRO C 1 104 ? 32.557  -0.692  -7.427  1.00 18.97 ? 104  PRO C CD  1 
ATOM   8573  N  N   . GLU C 1 105 ? 33.237  -5.350  -8.424  1.00 18.73 ? 105  GLU C N   1 
ATOM   8574  C  CA  . GLU C 1 105 ? 34.118  -6.537  -8.394  1.00 18.86 ? 105  GLU C CA  1 
ATOM   8575  C  C   . GLU C 1 105 ? 35.060  -6.708  -9.629  1.00 18.77 ? 105  GLU C C   1 
ATOM   8576  O  O   . GLU C 1 105 ? 35.761  -7.724  -9.795  1.00 17.82 ? 105  GLU C O   1 
ATOM   8577  C  CB  . GLU C 1 105 ? 33.275  -7.789  -8.122  1.00 19.16 ? 105  GLU C CB  1 
ATOM   8578  C  CG  . GLU C 1 105 ? 32.458  -7.642  -6.824  1.00 19.65 ? 105  GLU C CG  1 
ATOM   8579  C  CD  . GLU C 1 105 ? 31.743  -8.908  -6.402  1.00 19.44 ? 105  GLU C CD  1 
ATOM   8580  O  OE1 . GLU C 1 105 ? 30.914  -9.432  -7.178  1.00 18.10 ? 105  GLU C OE1 1 
ATOM   8581  O  OE2 . GLU C 1 105 ? 31.999  -9.356  -5.262  1.00 21.60 ? 105  GLU C OE2 1 
ATOM   8582  N  N   . THR C 1 106 ? 35.097  -5.669  -10.455 1.00 18.67 ? 106  THR C N   1 
ATOM   8583  C  CA  . THR C 1 106 ? 35.889  -5.631  -11.681 1.00 18.74 ? 106  THR C CA  1 
ATOM   8584  C  C   . THR C 1 106 ? 37.160  -4.807  -11.492 1.00 18.81 ? 106  THR C C   1 
ATOM   8585  O  O   . THR C 1 106 ? 37.945  -4.639  -12.441 1.00 18.42 ? 106  THR C O   1 
ATOM   8586  C  CB  . THR C 1 106 ? 35.056  -4.974  -12.790 1.00 19.18 ? 106  THR C CB  1 
ATOM   8587  O  OG1 . THR C 1 106 ? 34.300  -3.901  -12.209 1.00 19.34 ? 106  THR C OG1 1 
ATOM   8588  C  CG2 . THR C 1 106 ? 34.075  -5.980  -13.402 1.00 17.82 ? 106  THR C CG2 1 
ATOM   8589  N  N   . LEU C 1 107 ? 37.363  -4.293  -10.271 1.00 18.54 ? 107  LEU C N   1 
ATOM   8590  C  CA  . LEU C 1 107 ? 38.560  -3.489  -9.956  1.00 18.57 ? 107  LEU C CA  1 
ATOM   8591  C  C   . LEU C 1 107 ? 39.846  -4.329  -9.853  1.00 18.78 ? 107  LEU C C   1 
ATOM   8592  O  O   . LEU C 1 107 ? 39.798  -5.526  -9.524  1.00 19.14 ? 107  LEU C O   1 
ATOM   8593  C  CB  . LEU C 1 107 ? 38.349  -2.684  -8.665  1.00 18.46 ? 107  LEU C CB  1 
ATOM   8594  C  CG  . LEU C 1 107 ? 37.121  -1.771  -8.630  1.00 17.38 ? 107  LEU C CG  1 
ATOM   8595  C  CD1 . LEU C 1 107 ? 37.042  -1.015  -7.322  1.00 15.51 ? 107  LEU C CD1 1 
ATOM   8596  C  CD2 . LEU C 1 107 ? 37.089  -0.804  -9.840  1.00 16.50 ? 107  LEU C CD2 1 
ATOM   8597  N  N   . ARG C 1 108 ? 40.986  -3.703  -10.136 1.00 18.38 ? 108  ARG C N   1 
ATOM   8598  C  CA  . ARG C 1 108 ? 42.275  -4.364  -9.998  1.00 18.18 ? 108  ARG C CA  1 
ATOM   8599  C  C   . ARG C 1 108 ? 42.658  -4.422  -8.514  1.00 18.39 ? 108  ARG C C   1 
ATOM   8600  O  O   . ARG C 1 108 ? 42.773  -3.392  -7.838  1.00 18.09 ? 108  ARG C O   1 
ATOM   8601  C  CB  . ARG C 1 108 ? 43.353  -3.620  -10.796 1.00 18.19 ? 108  ARG C CB  1 
ATOM   8602  C  CG  . ARG C 1 108 ? 44.771  -4.231  -10.710 1.00 17.94 ? 108  ARG C CG  1 
ATOM   8603  C  CD  . ARG C 1 108 ? 45.742  -3.588  -11.712 1.00 18.34 ? 108  ARG C CD  1 
ATOM   8604  N  NE  . ARG C 1 108 ? 45.156  -3.506  -13.059 1.00 20.34 ? 108  ARG C NE  1 
ATOM   8605  C  CZ  . ARG C 1 108 ? 45.116  -4.514  -13.937 1.00 19.20 ? 108  ARG C CZ  1 
ATOM   8606  N  NH1 . ARG C 1 108 ? 44.543  -4.337  -15.125 1.00 20.07 ? 108  ARG C NH1 1 
ATOM   8607  N  NH2 . ARG C 1 108 ? 45.637  -5.698  -13.631 1.00 17.66 ? 108  ARG C NH2 1 
ATOM   8608  N  N   . ASP C 1 109 ? 42.870  -5.638  -8.025  1.00 18.17 ? 109  ASP C N   1 
ATOM   8609  C  CA  . ASP C 1 109 ? 43.202  -5.888  -6.626  1.00 17.51 ? 109  ASP C CA  1 
ATOM   8610  C  C   . ASP C 1 109 ? 43.662  -7.338  -6.506  1.00 16.87 ? 109  ASP C C   1 
ATOM   8611  O  O   . ASP C 1 109 ? 43.302  -8.176  -7.335  1.00 16.91 ? 109  ASP C O   1 
ATOM   8612  C  CB  . ASP C 1 109 ? 41.959  -5.682  -5.737  1.00 17.28 ? 109  ASP C CB  1 
ATOM   8613  C  CG  . ASP C 1 109 ? 42.016  -4.393  -4.907  1.00 17.95 ? 109  ASP C CG  1 
ATOM   8614  O  OD1 . ASP C 1 109 ? 40.970  -4.041  -4.313  1.00 19.01 ? 109  ASP C OD1 1 
ATOM   8615  O  OD2 . ASP C 1 109 ? 43.083  -3.731  -4.826  1.00 18.07 ? 109  ASP C OD2 1 
ATOM   8616  N  N   . PRO C 1 110 ? 44.452  -7.649  -5.468  1.00 16.43 ? 110  PRO C N   1 
ATOM   8617  C  CA  . PRO C 1 110 ? 44.530  -9.064  -5.158  1.00 16.11 ? 110  PRO C CA  1 
ATOM   8618  C  C   . PRO C 1 110 ? 43.115  -9.521  -4.795  1.00 16.09 ? 110  PRO C C   1 
ATOM   8619  O  O   . PRO C 1 110 ? 42.238  -8.671  -4.570  1.00 15.93 ? 110  PRO C O   1 
ATOM   8620  C  CB  . PRO C 1 110 ? 45.437  -9.109  -3.920  1.00 16.15 ? 110  PRO C CB  1 
ATOM   8621  C  CG  . PRO C 1 110 ? 46.160  -7.829  -3.906  1.00 15.35 ? 110  PRO C CG  1 
ATOM   8622  C  CD  . PRO C 1 110 ? 45.258  -6.824  -4.550  1.00 16.33 ? 110  PRO C CD  1 
ATOM   8623  N  N   . ARG C 1 111 ? 42.884  -10.834 -4.772  1.00 15.55 ? 111  ARG C N   1 
ATOM   8624  C  CA  . ARG C 1 111 ? 41.612  -11.381 -4.318  1.00 14.46 ? 111  ARG C CA  1 
ATOM   8625  C  C   . ARG C 1 111 ? 41.837  -12.282 -3.126  1.00 13.96 ? 111  ARG C C   1 
ATOM   8626  O  O   . ARG C 1 111 ? 42.692  -13.165 -3.150  1.00 13.48 ? 111  ARG C O   1 
ATOM   8627  C  CB  . ARG C 1 111 ? 40.890  -12.147 -5.429  1.00 14.43 ? 111  ARG C CB  1 
ATOM   8628  C  CG  . ARG C 1 111 ? 40.580  -11.329 -6.676  1.00 15.09 ? 111  ARG C CG  1 
ATOM   8629  C  CD  . ARG C 1 111 ? 39.651  -10.195 -6.373  1.00 15.86 ? 111  ARG C CD  1 
ATOM   8630  N  NE  . ARG C 1 111 ? 38.856  -9.724  -7.507  1.00 16.65 ? 111  ARG C NE  1 
ATOM   8631  C  CZ  . ARG C 1 111 ? 39.096  -8.598  -8.180  1.00 17.61 ? 111  ARG C CZ  1 
ATOM   8632  N  NH1 . ARG C 1 111 ? 40.154  -7.833  -7.885  1.00 15.53 ? 111  ARG C NH1 1 
ATOM   8633  N  NH2 . ARG C 1 111 ? 38.276  -8.243  -9.162  1.00 16.07 ? 111  ARG C NH2 1 
ATOM   8634  N  N   . GLY C 1 112 ? 41.068  -12.031 -2.071  1.00 13.53 ? 112  GLY C N   1 
ATOM   8635  C  CA  . GLY C 1 112 ? 41.181  -12.783 -0.848  1.00 12.06 ? 112  GLY C CA  1 
ATOM   8636  C  C   . GLY C 1 112 ? 40.652  -14.181 -1.019  1.00 11.88 ? 112  GLY C C   1 
ATOM   8637  O  O   . GLY C 1 112 ? 39.744  -14.436 -1.810  1.00 11.72 ? 112  GLY C O   1 
ATOM   8638  N  N   . PHE C 1 113 ? 41.233  -15.094 -0.268  1.00 11.18 ? 113  PHE C N   1 
ATOM   8639  C  CA  . PHE C 1 113 ? 40.848  -16.464 -0.363  1.00 11.87 ? 113  PHE C CA  1 
ATOM   8640  C  C   . PHE C 1 113 ? 40.904  -17.002 1.058   1.00 12.07 ? 113  PHE C C   1 
ATOM   8641  O  O   . PHE C 1 113 ? 41.977  -17.375 1.540   1.00 12.58 ? 113  PHE C O   1 
ATOM   8642  C  CB  . PHE C 1 113 ? 41.833  -17.194 -1.299  1.00 12.15 ? 113  PHE C CB  1 
ATOM   8643  C  CG  . PHE C 1 113 ? 41.344  -18.507 -1.805  1.00 11.10 ? 113  PHE C CG  1 
ATOM   8644  C  CD1 . PHE C 1 113 ? 41.054  -19.547 -0.932  1.00 12.51 ? 113  PHE C CD1 1 
ATOM   8645  C  CD2 . PHE C 1 113 ? 41.216  -18.718 -3.162  1.00 11.87 ? 113  PHE C CD2 1 
ATOM   8646  C  CE1 . PHE C 1 113 ? 40.621  -20.773 -1.406  1.00 14.07 ? 113  PHE C CE1 1 
ATOM   8647  C  CE2 . PHE C 1 113 ? 40.782  -19.944 -3.665  1.00 11.61 ? 113  PHE C CE2 1 
ATOM   8648  C  CZ  . PHE C 1 113 ? 40.483  -20.972 -2.791  1.00 14.20 ? 113  PHE C CZ  1 
ATOM   8649  N  N   . SER C 1 114 ? 39.752  -17.032 1.721   1.00 11.66 ? 114  SER C N   1 
ATOM   8650  C  CA  . SER C 1 114 ? 39.684  -17.409 3.136   1.00 11.86 ? 114  SER C CA  1 
ATOM   8651  C  C   . SER C 1 114 ? 38.780  -18.609 3.398   1.00 11.37 ? 114  SER C C   1 
ATOM   8652  O  O   . SER C 1 114 ? 37.633  -18.664 2.913   1.00 10.50 ? 114  SER C O   1 
ATOM   8653  C  CB  . SER C 1 114 ? 39.234  -16.214 3.999   1.00 12.04 ? 114  SER C CB  1 
ATOM   8654  O  OG  . SER C 1 114 ? 40.172  -15.146 3.890   1.00 14.50 ? 114  SER C OG  1 
ATOM   8655  N  N   . VAL C 1 115 ? 39.308  -19.555 4.180   1.00 10.84 ? 115  VAL C N   1 
ATOM   8656  C  CA  . VAL C 1 115 ? 38.627  -20.800 4.473   1.00 10.41 ? 115  VAL C CA  1 
ATOM   8657  C  C   . VAL C 1 115 ? 38.726  -21.161 5.938   1.00 10.84 ? 115  VAL C C   1 
ATOM   8658  O  O   . VAL C 1 115 ? 39.823  -21.329 6.484   1.00 10.92 ? 115  VAL C O   1 
ATOM   8659  C  CB  . VAL C 1 115 ? 39.182  -21.975 3.617   1.00 10.58 ? 115  VAL C CB  1 
ATOM   8660  C  CG1 . VAL C 1 115 ? 38.307  -23.207 3.784   1.00 9.68  ? 115  VAL C CG1 1 
ATOM   8661  C  CG2 . VAL C 1 115 ? 39.230  -21.577 2.138   1.00 9.88  ? 115  VAL C CG2 1 
ATOM   8662  N  N   . LYS C 1 116 ? 37.573  -21.313 6.575   1.00 11.05 ? 116  LYS C N   1 
ATOM   8663  C  CA  . LYS C 1 116 ? 37.527  -21.721 7.975   1.00 11.18 ? 116  LYS C CA  1 
ATOM   8664  C  C   . LYS C 1 116 ? 37.231  -23.210 7.978   1.00 11.66 ? 116  LYS C C   1 
ATOM   8665  O  O   . LYS C 1 116 ? 36.217  -23.631 7.425   1.00 12.28 ? 116  LYS C O   1 
ATOM   8666  C  CB  . LYS C 1 116 ? 36.422  -20.955 8.702   1.00 10.91 ? 116  LYS C CB  1 
ATOM   8667  C  CG  . LYS C 1 116 ? 36.301  -21.235 10.195  1.00 10.83 ? 116  LYS C CG  1 
ATOM   8668  C  CD  . LYS C 1 116 ? 35.209  -20.343 10.835  1.00 11.09 ? 116  LYS C CD  1 
ATOM   8669  C  CE  . LYS C 1 116 ? 35.691  -18.889 11.072  1.00 7.71  ? 116  LYS C CE  1 
ATOM   8670  N  NZ  . LYS C 1 116 ? 37.002  -18.871 11.748  1.00 6.57  ? 116  LYS C NZ  1 
ATOM   8671  N  N   . PHE C 1 117 ? 38.113  -24.001 8.581   1.00 11.80 ? 117  PHE C N   1 
ATOM   8672  C  CA  . PHE C 1 117 ? 37.918  -25.445 8.681   1.00 11.79 ? 117  PHE C CA  1 
ATOM   8673  C  C   . PHE C 1 117 ? 37.435  -25.754 10.069  1.00 12.05 ? 117  PHE C C   1 
ATOM   8674  O  O   . PHE C 1 117 ? 38.167  -25.511 11.031  1.00 11.87 ? 117  PHE C O   1 
ATOM   8675  C  CB  . PHE C 1 117 ? 39.243  -26.179 8.489   1.00 11.92 ? 117  PHE C CB  1 
ATOM   8676  C  CG  . PHE C 1 117 ? 39.832  -26.035 7.121   1.00 12.24 ? 117  PHE C CG  1 
ATOM   8677  C  CD1 . PHE C 1 117 ? 40.442  -24.850 6.730   1.00 11.83 ? 117  PHE C CD1 1 
ATOM   8678  C  CD2 . PHE C 1 117 ? 39.798  -27.105 6.224   1.00 12.95 ? 117  PHE C CD2 1 
ATOM   8679  C  CE1 . PHE C 1 117 ? 40.995  -24.724 5.453   1.00 12.99 ? 117  PHE C CE1 1 
ATOM   8680  C  CE2 . PHE C 1 117 ? 40.347  -26.988 4.947   1.00 11.26 ? 117  PHE C CE2 1 
ATOM   8681  C  CZ  . PHE C 1 117 ? 40.938  -25.796 4.565   1.00 12.39 ? 117  PHE C CZ  1 
ATOM   8682  N  N   . TYR C 1 118 ? 36.219  -26.297 10.185  1.00 12.46 ? 118  TYR C N   1 
ATOM   8683  C  CA  . TYR C 1 118 ? 35.669  -26.677 11.505  1.00 12.63 ? 118  TYR C CA  1 
ATOM   8684  C  C   . TYR C 1 118 ? 36.094  -28.084 11.890  1.00 13.02 ? 118  TYR C C   1 
ATOM   8685  O  O   . TYR C 1 118 ? 35.426  -29.085 11.577  1.00 13.45 ? 118  TYR C O   1 
ATOM   8686  C  CB  . TYR C 1 118 ? 34.147  -26.528 11.576  1.00 12.14 ? 118  TYR C CB  1 
ATOM   8687  C  CG  . TYR C 1 118 ? 33.614  -25.197 11.117  1.00 12.96 ? 118  TYR C CG  1 
ATOM   8688  C  CD1 . TYR C 1 118 ? 33.429  -24.923 9.751   1.00 14.06 ? 118  TYR C CD1 1 
ATOM   8689  C  CD2 . TYR C 1 118 ? 33.259  -24.219 12.041  1.00 12.96 ? 118  TYR C CD2 1 
ATOM   8690  C  CE1 . TYR C 1 118 ? 32.924  -23.691 9.328   1.00 13.78 ? 118  TYR C CE1 1 
ATOM   8691  C  CE2 . TYR C 1 118 ? 32.733  -23.006 11.638  1.00 12.36 ? 118  TYR C CE2 1 
ATOM   8692  C  CZ  . TYR C 1 118 ? 32.578  -22.745 10.286  1.00 13.09 ? 118  TYR C CZ  1 
ATOM   8693  O  OH  . TYR C 1 118 ? 32.082  -21.534 9.897   1.00 13.78 ? 118  TYR C OH  1 
ATOM   8694  N  N   . THR C 1 119 ? 37.204  -28.136 12.611  1.00 13.82 ? 119  THR C N   1 
ATOM   8695  C  CA  . THR C 1 119 ? 37.949  -29.366 12.885  1.00 14.43 ? 119  THR C CA  1 
ATOM   8696  C  C   . THR C 1 119 ? 37.614  -30.007 14.246  1.00 14.99 ? 119  THR C C   1 
ATOM   8697  O  O   . THR C 1 119 ? 37.248  -29.317 15.209  1.00 14.97 ? 119  THR C O   1 
ATOM   8698  C  CB  . THR C 1 119 ? 39.447  -29.007 12.784  1.00 14.23 ? 119  THR C CB  1 
ATOM   8699  O  OG1 . THR C 1 119 ? 39.851  -28.984 11.403  1.00 16.17 ? 119  THR C OG1 1 
ATOM   8700  C  CG2 . THR C 1 119 ? 40.318  -29.905 13.581  1.00 13.20 ? 119  THR C CG2 1 
ATOM   8701  N  N   . GLU C 1 120 ? 37.753  -31.330 14.303  1.00 15.79 ? 120  GLU C N   1 
ATOM   8702  C  CA  . GLU C 1 120 ? 37.681  -32.129 15.532  1.00 16.84 ? 120  GLU C CA  1 
ATOM   8703  C  C   . GLU C 1 120 ? 38.570  -31.597 16.671  1.00 16.57 ? 120  GLU C C   1 
ATOM   8704  O  O   . GLU C 1 120 ? 38.305  -31.859 17.851  1.00 16.60 ? 120  GLU C O   1 
ATOM   8705  C  CB  . GLU C 1 120 ? 38.085  -33.588 15.244  1.00 17.58 ? 120  GLU C CB  1 
ATOM   8706  C  CG  . GLU C 1 120 ? 37.586  -34.150 13.886  1.00 21.53 ? 120  GLU C CG  1 
ATOM   8707  C  CD  . GLU C 1 120 ? 38.613  -34.027 12.728  1.00 25.24 ? 120  GLU C CD  1 
ATOM   8708  O  OE1 . GLU C 1 120 ? 39.565  -34.869 12.669  1.00 25.59 ? 120  GLU C OE1 1 
ATOM   8709  O  OE2 . GLU C 1 120 ? 38.434  -33.117 11.862  1.00 22.99 ? 120  GLU C OE2 1 
ATOM   8710  N  N   . GLU C 1 121 ? 39.637  -30.882 16.325  1.00 16.00 ? 121  GLU C N   1 
ATOM   8711  C  CA  . GLU C 1 121 ? 40.513  -30.281 17.337  1.00 15.94 ? 121  GLU C CA  1 
ATOM   8712  C  C   . GLU C 1 121 ? 40.551  -28.751 17.249  1.00 15.17 ? 121  GLU C C   1 
ATOM   8713  O  O   . GLU C 1 121 ? 41.553  -28.122 17.575  1.00 15.22 ? 121  GLU C O   1 
ATOM   8714  C  CB  . GLU C 1 121 ? 41.918  -30.878 17.240  1.00 15.55 ? 121  GLU C CB  1 
ATOM   8715  C  CG  . GLU C 1 121 ? 41.962  -32.364 17.626  1.00 17.28 ? 121  GLU C CG  1 
ATOM   8716  C  CD  . GLU C 1 121 ? 43.385  -32.938 17.709  1.00 17.15 ? 121  GLU C CD  1 
ATOM   8717  O  OE1 . GLU C 1 121 ? 44.317  -32.374 17.070  1.00 18.29 ? 121  GLU C OE1 1 
ATOM   8718  O  OE2 . GLU C 1 121 ? 43.553  -33.963 18.408  1.00 16.73 ? 121  GLU C OE2 1 
ATOM   8719  N  N   . GLY C 1 122 ? 39.462  -28.158 16.780  1.00 14.61 ? 122  GLY C N   1 
ATOM   8720  C  CA  . GLY C 1 122 ? 39.343  -26.715 16.771  1.00 14.38 ? 122  GLY C CA  1 
ATOM   8721  C  C   . GLY C 1 122 ? 39.267  -26.096 15.401  1.00 13.90 ? 122  GLY C C   1 
ATOM   8722  O  O   . GLY C 1 122 ? 39.425  -26.770 14.401  1.00 14.51 ? 122  GLY C O   1 
ATOM   8723  N  N   . ASN C 1 123 ? 38.999  -24.800 15.342  1.00 13.51 ? 123  ASN C N   1 
ATOM   8724  C  CA  . ASN C 1 123 ? 38.949  -24.136 14.044  1.00 12.98 ? 123  ASN C CA  1 
ATOM   8725  C  C   . ASN C 1 123 ? 40.335  -23.824 13.499  1.00 12.40 ? 123  ASN C C   1 
ATOM   8726  O  O   . ASN C 1 123 ? 41.248  -23.473 14.262  1.00 11.74 ? 123  ASN C O   1 
ATOM   8727  C  CB  . ASN C 1 123 ? 38.053  -22.886 14.077  1.00 12.49 ? 123  ASN C CB  1 
ATOM   8728  C  CG  . ASN C 1 123 ? 36.586  -23.233 14.222  1.00 12.52 ? 123  ASN C CG  1 
ATOM   8729  O  OD1 . ASN C 1 123 ? 36.214  -24.407 14.187  1.00 12.90 ? 123  ASN C OD1 1 
ATOM   8730  N  ND2 . ASN C 1 123 ? 35.740  -22.213 14.387  1.00 9.82  ? 123  ASN C ND2 1 
ATOM   8731  N  N   . TRP C 1 124 ? 40.475  -23.975 12.184  1.00 11.98 ? 124  TRP C N   1 
ATOM   8732  C  CA  . TRP C 1 124 ? 41.668  -23.541 11.465  1.00 12.22 ? 124  TRP C CA  1 
ATOM   8733  C  C   . TRP C 1 124 ? 41.252  -22.629 10.317  1.00 11.58 ? 124  TRP C C   1 
ATOM   8734  O  O   . TRP C 1 124 ? 40.418  -22.994 9.492   1.00 11.00 ? 124  TRP C O   1 
ATOM   8735  C  CB  . TRP C 1 124 ? 42.500  -24.721 10.937  1.00 12.46 ? 124  TRP C CB  1 
ATOM   8736  C  CG  . TRP C 1 124 ? 43.609  -24.269 9.980   1.00 14.64 ? 124  TRP C CG  1 
ATOM   8737  C  CD1 . TRP C 1 124 ? 44.497  -23.231 10.172  1.00 15.44 ? 124  TRP C CD1 1 
ATOM   8738  C  CD2 . TRP C 1 124 ? 43.925  -24.819 8.697   1.00 15.07 ? 124  TRP C CD2 1 
ATOM   8739  N  NE1 . TRP C 1 124 ? 45.330  -23.110 9.093   1.00 14.93 ? 124  TRP C NE1 1 
ATOM   8740  C  CE2 . TRP C 1 124 ? 45.009  -24.074 8.175   1.00 15.99 ? 124  TRP C CE2 1 
ATOM   8741  C  CE3 . TRP C 1 124 ? 43.395  -25.866 7.930   1.00 14.66 ? 124  TRP C CE3 1 
ATOM   8742  C  CZ2 . TRP C 1 124 ? 45.576  -24.350 6.918   1.00 15.60 ? 124  TRP C CZ2 1 
ATOM   8743  C  CZ3 . TRP C 1 124 ? 43.959  -26.133 6.693   1.00 14.78 ? 124  TRP C CZ3 1 
ATOM   8744  C  CH2 . TRP C 1 124 ? 45.034  -25.378 6.197   1.00 14.21 ? 124  TRP C CH2 1 
ATOM   8745  N  N   . ASP C 1 125 ? 41.823  -21.430 10.298  1.00 11.46 ? 125  ASP C N   1 
ATOM   8746  C  CA  . ASP C 1 125 ? 41.567  -20.461 9.231   1.00 11.14 ? 125  ASP C CA  1 
ATOM   8747  C  C   . ASP C 1 125 ? 42.753  -20.428 8.270   1.00 11.08 ? 125  ASP C C   1 
ATOM   8748  O  O   . ASP C 1 125 ? 43.903  -20.192 8.674   1.00 10.43 ? 125  ASP C O   1 
ATOM   8749  C  CB  . ASP C 1 125 ? 41.332  -19.062 9.787   1.00 10.97 ? 125  ASP C CB  1 
ATOM   8750  C  CG  . ASP C 1 125 ? 40.035  -18.946 10.566  1.00 12.08 ? 125  ASP C CG  1 
ATOM   8751  O  OD1 . ASP C 1 125 ? 39.939  -18.062 11.464  1.00 10.77 ? 125  ASP C OD1 1 
ATOM   8752  O  OD2 . ASP C 1 125 ? 39.109  -19.724 10.270  1.00 10.68 ? 125  ASP C OD2 1 
ATOM   8753  N  N   . PHE C 1 126 ? 42.461  -20.722 7.009   1.00 10.95 ? 126  PHE C N   1 
ATOM   8754  C  CA  . PHE C 1 126 ? 43.359  -20.417 5.929   1.00 11.15 ? 126  PHE C CA  1 
ATOM   8755  C  C   . PHE C 1 126 ? 42.937  -19.038 5.490   1.00 11.44 ? 126  PHE C C   1 
ATOM   8756  O  O   . PHE C 1 126 ? 41.766  -18.820 5.186   1.00 11.87 ? 126  PHE C O   1 
ATOM   8757  C  CB  . PHE C 1 126 ? 43.172  -21.399 4.771   1.00 10.82 ? 126  PHE C CB  1 
ATOM   8758  C  CG  . PHE C 1 126 ? 43.922  -21.009 3.534   1.00 10.59 ? 126  PHE C CG  1 
ATOM   8759  C  CD1 . PHE C 1 126 ? 43.310  -20.223 2.550   1.00 8.14  ? 126  PHE C CD1 1 
ATOM   8760  C  CD2 . PHE C 1 126 ? 45.257  -21.404 3.363   1.00 9.91  ? 126  PHE C CD2 1 
ATOM   8761  C  CE1 . PHE C 1 126 ? 44.003  -19.841 1.429   1.00 9.17  ? 126  PHE C CE1 1 
ATOM   8762  C  CE2 . PHE C 1 126 ? 45.966  -21.042 2.236   1.00 9.03  ? 126  PHE C CE2 1 
ATOM   8763  C  CZ  . PHE C 1 126 ? 45.351  -20.252 1.263   1.00 10.42 ? 126  PHE C CZ  1 
ATOM   8764  N  N   . VAL C 1 127 ? 43.882  -18.106 5.453   1.00 11.76 ? 127  VAL C N   1 
ATOM   8765  C  CA  . VAL C 1 127 ? 43.599  -16.751 5.005   1.00 11.97 ? 127  VAL C CA  1 
ATOM   8766  C  C   . VAL C 1 127 ? 44.682  -16.328 4.018   1.00 13.04 ? 127  VAL C C   1 
ATOM   8767  O  O   . VAL C 1 127 ? 45.755  -15.863 4.419   1.00 13.53 ? 127  VAL C O   1 
ATOM   8768  C  CB  . VAL C 1 127 ? 43.476  -15.757 6.218   1.00 12.11 ? 127  VAL C CB  1 
ATOM   8769  C  CG1 . VAL C 1 127 ? 42.911  -14.406 5.786   1.00 10.74 ? 127  VAL C CG1 1 
ATOM   8770  C  CG2 . VAL C 1 127 ? 42.600  -16.370 7.332   1.00 9.66  ? 127  VAL C CG2 1 
ATOM   8771  N  N   . GLY C 1 128 ? 44.398  -16.519 2.728   1.00 13.49 ? 128  GLY C N   1 
ATOM   8772  C  CA  . GLY C 1 128 ? 45.324  -16.169 1.656   1.00 14.43 ? 128  GLY C CA  1 
ATOM   8773  C  C   . GLY C 1 128 ? 44.713  -15.278 0.582   1.00 15.28 ? 128  GLY C C   1 
ATOM   8774  O  O   . GLY C 1 128 ? 43.551  -14.853 0.697   1.00 15.24 ? 128  GLY C O   1 
ATOM   8775  N  N   . ASN C 1 129 ? 45.516  -14.965 -0.440  1.00 15.47 ? 129  ASN C N   1 
ATOM   8776  C  CA  . ASN C 1 129 ? 45.073  -14.229 -1.633  1.00 15.89 ? 129  ASN C CA  1 
ATOM   8777  C  C   . ASN C 1 129 ? 45.283  -15.133 -2.850  1.00 16.31 ? 129  ASN C C   1 
ATOM   8778  O  O   . ASN C 1 129 ? 45.929  -16.184 -2.743  1.00 16.11 ? 129  ASN C O   1 
ATOM   8779  C  CB  . ASN C 1 129 ? 45.877  -12.931 -1.838  1.00 15.51 ? 129  ASN C CB  1 
ATOM   8780  C  CG  . ASN C 1 129 ? 45.471  -11.796 -0.896  1.00 17.00 ? 129  ASN C CG  1 
ATOM   8781  O  OD1 . ASN C 1 129 ? 44.342  -11.723 -0.415  1.00 19.24 ? 129  ASN C OD1 1 
ATOM   8782  N  ND2 . ASN C 1 129 ? 46.407  -10.887 -0.648  1.00 17.84 ? 129  ASN C ND2 1 
ATOM   8783  N  N   . ASN C 1 130 ? 44.774  -14.729 -4.010  1.00 16.66 ? 130  ASN C N   1 
ATOM   8784  C  CA  . ASN C 1 130 ? 45.058  -15.471 -5.236  1.00 17.51 ? 130  ASN C CA  1 
ATOM   8785  C  C   . ASN C 1 130 ? 46.551  -15.418 -5.575  1.00 18.12 ? 130  ASN C C   1 
ATOM   8786  O  O   . ASN C 1 130 ? 47.203  -16.457 -5.801  1.00 18.14 ? 130  ASN C O   1 
ATOM   8787  C  CB  . ASN C 1 130 ? 44.187  -14.982 -6.404  1.00 17.39 ? 130  ASN C CB  1 
ATOM   8788  C  CG  . ASN C 1 130 ? 44.337  -13.496 -6.679  1.00 18.62 ? 130  ASN C CG  1 
ATOM   8789  O  OD1 . ASN C 1 130 ? 44.711  -12.699 -5.796  1.00 18.29 ? 130  ASN C OD1 1 
ATOM   8790  N  ND2 . ASN C 1 130 ? 44.027  -13.104 -7.914  1.00 18.15 ? 130  ASN C ND2 1 
ATOM   8791  N  N   . LEU C 1 131 ? 47.092  -14.202 -5.523  1.00 18.36 ? 131  LEU C N   1 
ATOM   8792  C  CA  . LEU C 1 131 ? 48.467  -13.925 -5.894  1.00 18.18 ? 131  LEU C CA  1 
ATOM   8793  C  C   . LEU C 1 131 ? 49.446  -14.510 -4.879  1.00 18.31 ? 131  LEU C C   1 
ATOM   8794  O  O   . LEU C 1 131 ? 49.180  -14.466 -3.684  1.00 18.91 ? 131  LEU C O   1 
ATOM   8795  C  CB  . LEU C 1 131 ? 48.647  -12.419 -6.059  1.00 18.03 ? 131  LEU C CB  1 
ATOM   8796  C  CG  . LEU C 1 131 ? 47.707  -11.759 -7.079  1.00 17.69 ? 131  LEU C CG  1 
ATOM   8797  C  CD1 . LEU C 1 131 ? 48.078  -10.303 -7.241  1.00 18.20 ? 131  LEU C CD1 1 
ATOM   8798  C  CD2 . LEU C 1 131 ? 47.757  -12.466 -8.436  1.00 19.48 ? 131  LEU C CD2 1 
ATOM   8799  N  N   . PRO C 1 132 ? 50.561  -15.101 -5.359  1.00 18.23 ? 132  PRO C N   1 
ATOM   8800  C  CA  . PRO C 1 132 ? 51.515  -15.848 -4.495  1.00 17.83 ? 132  PRO C CA  1 
ATOM   8801  C  C   . PRO C 1 132 ? 52.515  -15.043 -3.651  1.00 16.96 ? 132  PRO C C   1 
ATOM   8802  O  O   . PRO C 1 132 ? 53.243  -15.624 -2.849  1.00 16.65 ? 132  PRO C O   1 
ATOM   8803  C  CB  . PRO C 1 132 ? 52.263  -16.743 -5.492  1.00 17.61 ? 132  PRO C CB  1 
ATOM   8804  C  CG  . PRO C 1 132 ? 52.229  -15.954 -6.795  1.00 17.79 ? 132  PRO C CG  1 
ATOM   8805  C  CD  . PRO C 1 132 ? 50.944  -15.157 -6.791  1.00 18.19 ? 132  PRO C CD  1 
ATOM   8806  N  N   . VAL C 1 133 ? 52.540  -13.729 -3.818  1.00 16.60 ? 133  VAL C N   1 
ATOM   8807  C  CA  . VAL C 1 133 ? 53.469  -12.867 -3.071  1.00 15.94 ? 133  VAL C CA  1 
ATOM   8808  C  C   . VAL C 1 133 ? 52.739  -11.619 -2.568  1.00 15.76 ? 133  VAL C C   1 
ATOM   8809  O  O   . VAL C 1 133 ? 51.558  -11.425 -2.893  1.00 15.50 ? 133  VAL C O   1 
ATOM   8810  C  CB  . VAL C 1 133 ? 54.713  -12.430 -3.938  1.00 15.95 ? 133  VAL C CB  1 
ATOM   8811  C  CG1 . VAL C 1 133 ? 55.550  -13.629 -4.375  1.00 14.67 ? 133  VAL C CG1 1 
ATOM   8812  C  CG2 . VAL C 1 133 ? 54.286  -11.568 -5.136  1.00 15.32 ? 133  VAL C CG2 1 
ATOM   8813  N  N   . PHE C 1 134 ? 53.441  -10.774 -1.800  1.00 15.18 ? 134  PHE C N   1 
ATOM   8814  C  CA  . PHE C 1 134 ? 52.865  -9.508  -1.305  1.00 15.11 ? 134  PHE C CA  1 
ATOM   8815  C  C   . PHE C 1 134 ? 53.803  -8.284  -1.446  1.00 15.14 ? 134  PHE C C   1 
ATOM   8816  O  O   . PHE C 1 134 ? 55.014  -8.439  -1.608  1.00 15.50 ? 134  PHE C O   1 
ATOM   8817  C  CB  . PHE C 1 134 ? 52.415  -9.673  0.143   1.00 14.88 ? 134  PHE C CB  1 
ATOM   8818  C  CG  . PHE C 1 134 ? 51.258  -8.790  0.522   1.00 14.38 ? 134  PHE C CG  1 
ATOM   8819  C  CD1 . PHE C 1 134 ? 51.452  -7.680  1.337   1.00 13.53 ? 134  PHE C CD1 1 
ATOM   8820  C  CD2 . PHE C 1 134 ? 49.969  -9.087  0.090   1.00 13.60 ? 134  PHE C CD2 1 
ATOM   8821  C  CE1 . PHE C 1 134 ? 50.391  -6.884  1.708   1.00 14.54 ? 134  PHE C CE1 1 
ATOM   8822  C  CE2 . PHE C 1 134 ? 48.888  -8.292  0.452   1.00 12.49 ? 134  PHE C CE2 1 
ATOM   8823  C  CZ  . PHE C 1 134 ? 49.090  -7.191  1.261   1.00 14.55 ? 134  PHE C CZ  1 
ATOM   8824  N  N   . PHE C 1 135 ? 53.235  -7.081  -1.373  1.00 14.80 ? 135  PHE C N   1 
ATOM   8825  C  CA  . PHE C 1 135 ? 53.964  -5.832  -1.640  1.00 14.47 ? 135  PHE C CA  1 
ATOM   8826  C  C   . PHE C 1 135 ? 55.080  -5.553  -0.628  1.00 14.31 ? 135  PHE C C   1 
ATOM   8827  O  O   . PHE C 1 135 ? 56.079  -4.893  -0.951  1.00 13.87 ? 135  PHE C O   1 
ATOM   8828  C  CB  . PHE C 1 135 ? 53.022  -4.619  -1.604  1.00 14.55 ? 135  PHE C CB  1 
ATOM   8829  C  CG  . PHE C 1 135 ? 51.829  -4.694  -2.541  1.00 14.63 ? 135  PHE C CG  1 
ATOM   8830  C  CD1 . PHE C 1 135 ? 50.611  -5.207  -2.097  1.00 15.00 ? 135  PHE C CD1 1 
ATOM   8831  C  CD2 . PHE C 1 135 ? 51.902  -4.172  -3.830  1.00 13.77 ? 135  PHE C CD2 1 
ATOM   8832  C  CE1 . PHE C 1 135 ? 49.482  -5.227  -2.932  1.00 16.53 ? 135  PHE C CE1 1 
ATOM   8833  C  CE2 . PHE C 1 135 ? 50.780  -4.192  -4.688  1.00 15.95 ? 135  PHE C CE2 1 
ATOM   8834  C  CZ  . PHE C 1 135 ? 49.561  -4.717  -4.234  1.00 14.91 ? 135  PHE C CZ  1 
ATOM   8835  N  N   . ILE C 1 136 ? 54.893  -6.026  0.609   1.00 13.99 ? 136  ILE C N   1 
ATOM   8836  C  CA  . ILE C 1 136 ? 55.813  -5.686  1.709   1.00 13.15 ? 136  ILE C CA  1 
ATOM   8837  C  C   . ILE C 1 136 ? 56.196  -6.922  2.507   1.00 13.36 ? 136  ILE C C   1 
ATOM   8838  O  O   . ILE C 1 136 ? 55.623  -7.992  2.285   1.00 12.54 ? 136  ILE C O   1 
ATOM   8839  C  CB  . ILE C 1 136 ? 55.196  -4.605  2.641   1.00 13.63 ? 136  ILE C CB  1 
ATOM   8840  C  CG1 . ILE C 1 136 ? 53.788  -5.053  3.108   1.00 12.37 ? 136  ILE C CG1 1 
ATOM   8841  C  CG2 . ILE C 1 136 ? 55.210  -3.232  1.935   1.00 11.18 ? 136  ILE C CG2 1 
ATOM   8842  C  CD1 . ILE C 1 136 ? 53.200  -4.245  4.237   1.00 12.17 ? 136  ILE C CD1 1 
ATOM   8843  N  N   . ARG C 1 137 ? 57.164  -6.790  3.423   1.00 13.61 ? 137  ARG C N   1 
ATOM   8844  C  CA  . ARG C 1 137 ? 57.581  -7.960  4.213   1.00 14.02 ? 137  ARG C CA  1 
ATOM   8845  C  C   . ARG C 1 137 ? 57.536  -7.796  5.726   1.00 13.89 ? 137  ARG C C   1 
ATOM   8846  O  O   . ARG C 1 137 ? 57.981  -8.679  6.472   1.00 14.23 ? 137  ARG C O   1 
ATOM   8847  C  CB  . ARG C 1 137 ? 58.945  -8.468  3.780   1.00 14.42 ? 137  ARG C CB  1 
ATOM   8848  C  CG  . ARG C 1 137 ? 60.123  -7.523  4.052   1.00 15.60 ? 137  ARG C CG  1 
ATOM   8849  C  CD  . ARG C 1 137 ? 61.278  -7.938  3.141   1.00 17.96 ? 137  ARG C CD  1 
ATOM   8850  N  NE  . ARG C 1 137 ? 62.028  -6.772  2.692   1.00 21.58 ? 137  ARG C NE  1 
ATOM   8851  C  CZ  . ARG C 1 137 ? 62.671  -6.670  1.544   1.00 20.70 ? 137  ARG C CZ  1 
ATOM   8852  N  NH1 . ARG C 1 137 ? 62.671  -7.670  0.656   1.00 21.09 ? 137  ARG C NH1 1 
ATOM   8853  N  NH2 . ARG C 1 137 ? 63.305  -5.542  1.286   1.00 23.81 ? 137  ARG C NH2 1 
ATOM   8854  N  N   . ASP C 1 138 ? 57.000  -6.672  6.179   1.00 13.08 ? 138  ASP C N   1 
ATOM   8855  C  CA  . ASP C 1 138 ? 56.892  -6.432  7.597   1.00 12.36 ? 138  ASP C CA  1 
ATOM   8856  C  C   . ASP C 1 138 ? 55.572  -5.727  7.888   1.00 12.09 ? 138  ASP C C   1 
ATOM   8857  O  O   . ASP C 1 138 ? 55.269  -4.693  7.283   1.00 11.81 ? 138  ASP C O   1 
ATOM   8858  C  CB  . ASP C 1 138 ? 58.075  -5.580  8.067   1.00 12.29 ? 138  ASP C CB  1 
ATOM   8859  C  CG  . ASP C 1 138 ? 58.201  -5.522  9.592   1.00 12.70 ? 138  ASP C CG  1 
ATOM   8860  O  OD1 . ASP C 1 138 ? 57.176  -5.418  10.308  1.00 12.64 ? 138  ASP C OD1 1 
ATOM   8861  O  OD2 . ASP C 1 138 ? 59.341  -5.565  10.086  1.00 14.19 ? 138  ASP C OD2 1 
ATOM   8862  N  N   . ALA C 1 139 ? 54.813  -6.281  8.834   1.00 11.62 ? 139  ALA C N   1 
ATOM   8863  C  CA  . ALA C 1 139 ? 53.540  -5.696  9.289   1.00 11.39 ? 139  ALA C CA  1 
ATOM   8864  C  C   . ALA C 1 139 ? 53.600  -4.196  9.628   1.00 11.13 ? 139  ALA C C   1 
ATOM   8865  O  O   . ALA C 1 139 ? 52.613  -3.477  9.455   1.00 10.67 ? 139  ALA C O   1 
ATOM   8866  C  CB  . ALA C 1 139 ? 52.991  -6.485  10.471  1.00 11.33 ? 139  ALA C CB  1 
ATOM   8867  N  N   . MET C 1 140 ? 54.757  -3.738  10.105  1.00 11.16 ? 140  MET C N   1 
ATOM   8868  C  CA  . MET C 1 140 ? 54.995  -2.325  10.393  1.00 11.63 ? 140  MET C CA  1 
ATOM   8869  C  C   . MET C 1 140 ? 54.529  -1.414  9.233   1.00 12.02 ? 140  MET C C   1 
ATOM   8870  O  O   . MET C 1 140 ? 54.034  -0.321  9.460   1.00 12.26 ? 140  MET C O   1 
ATOM   8871  C  CB  . MET C 1 140 ? 56.480  -2.106  10.728  1.00 10.96 ? 140  MET C CB  1 
ATOM   8872  C  CG  . MET C 1 140 ? 56.822  -0.703  11.232  1.00 11.91 ? 140  MET C CG  1 
ATOM   8873  S  SD  . MET C 1 140 ? 55.998  -0.173  12.770  1.00 14.15 ? 140  MET C SD  1 
ATOM   8874  C  CE  . MET C 1 140 ? 56.868  -1.220  13.962  1.00 11.22 ? 140  MET C CE  1 
ATOM   8875  N  N   . LYS C 1 141 ? 54.635  -1.909  7.999   1.00 12.38 ? 141  LYS C N   1 
ATOM   8876  C  CA  . LYS C 1 141 ? 54.331  -1.111  6.814   1.00 12.53 ? 141  LYS C CA  1 
ATOM   8877  C  C   . LYS C 1 141 ? 52.904  -1.223  6.286   1.00 12.65 ? 141  LYS C C   1 
ATOM   8878  O  O   . LYS C 1 141 ? 52.524  -0.459  5.386   1.00 13.02 ? 141  LYS C O   1 
ATOM   8879  C  CB  . LYS C 1 141 ? 55.326  -1.418  5.669   1.00 12.53 ? 141  LYS C CB  1 
ATOM   8880  C  CG  . LYS C 1 141 ? 56.790  -1.072  5.958   1.00 10.69 ? 141  LYS C CG  1 
ATOM   8881  C  CD  . LYS C 1 141 ? 56.940  0.261   6.698   1.00 12.53 ? 141  LYS C CD  1 
ATOM   8882  C  CE  . LYS C 1 141 ? 56.300  1.453   5.964   1.00 11.64 ? 141  LYS C CE  1 
ATOM   8883  N  NZ  . LYS C 1 141 ? 56.662  2.745   6.664   1.00 11.79 ? 141  LYS C NZ  1 
ATOM   8884  N  N   . PHE C 1 142 ? 52.128  -2.165  6.824   1.00 12.26 ? 142  PHE C N   1 
ATOM   8885  C  CA  . PHE C 1 142 ? 50.770  -2.436  6.317   1.00 11.96 ? 142  PHE C CA  1 
ATOM   8886  C  C   . PHE C 1 142 ? 49.779  -1.261  6.349   1.00 12.04 ? 142  PHE C C   1 
ATOM   8887  O  O   . PHE C 1 142 ? 49.065  -1.057  5.369   1.00 12.36 ? 142  PHE C O   1 
ATOM   8888  C  CB  . PHE C 1 142 ? 50.147  -3.660  7.001   1.00 11.45 ? 142  PHE C CB  1 
ATOM   8889  C  CG  . PHE C 1 142 ? 48.909  -4.159  6.318   1.00 11.16 ? 142  PHE C CG  1 
ATOM   8890  C  CD1 . PHE C 1 142 ? 49.000  -4.942  5.148   1.00 9.89  ? 142  PHE C CD1 1 
ATOM   8891  C  CD2 . PHE C 1 142 ? 47.646  -3.858  6.829   1.00 9.33  ? 142  PHE C CD2 1 
ATOM   8892  C  CE1 . PHE C 1 142 ? 47.845  -5.414  4.500   1.00 7.87  ? 142  PHE C CE1 1 
ATOM   8893  C  CE2 . PHE C 1 142 ? 46.488  -4.338  6.184   1.00 9.71  ? 142  PHE C CE2 1 
ATOM   8894  C  CZ  . PHE C 1 142 ? 46.601  -5.110  5.011   1.00 8.96  ? 142  PHE C CZ  1 
ATOM   8895  N  N   . PRO C 1 143 ? 49.685  -0.524  7.478   1.00 12.17 ? 143  PRO C N   1 
ATOM   8896  C  CA  . PRO C 1 143 ? 48.784  0.645   7.468   1.00 12.37 ? 143  PRO C CA  1 
ATOM   8897  C  C   . PRO C 1 143 ? 49.182  1.712   6.427   1.00 12.34 ? 143  PRO C C   1 
ATOM   8898  O  O   . PRO C 1 143 ? 48.317  2.261   5.738   1.00 12.43 ? 143  PRO C O   1 
ATOM   8899  C  CB  . PRO C 1 143 ? 48.886  1.187   8.902   1.00 12.35 ? 143  PRO C CB  1 
ATOM   8900  C  CG  . PRO C 1 143 ? 49.373  0.008   9.733   1.00 11.98 ? 143  PRO C CG  1 
ATOM   8901  C  CD  . PRO C 1 143 ? 50.303  -0.722  8.807   1.00 12.35 ? 143  PRO C CD  1 
ATOM   8902  N  N   . ASP C 1 144 ? 50.479  1.978   6.308   1.00 12.13 ? 144  ASP C N   1 
ATOM   8903  C  CA  . ASP C 1 144 ? 51.016  2.864   5.280   1.00 11.79 ? 144  ASP C CA  1 
ATOM   8904  C  C   . ASP C 1 144 ? 50.654  2.400   3.870   1.00 12.07 ? 144  ASP C C   1 
ATOM   8905  O  O   . ASP C 1 144 ? 50.121  3.170   3.073   1.00 12.08 ? 144  ASP C O   1 
ATOM   8906  C  CB  . ASP C 1 144 ? 52.524  2.959   5.441   1.00 11.63 ? 144  ASP C CB  1 
ATOM   8907  C  CG  . ASP C 1 144 ? 52.921  3.537   6.773   1.00 11.45 ? 144  ASP C CG  1 
ATOM   8908  O  OD1 . ASP C 1 144 ? 53.657  2.849   7.522   1.00 10.52 ? 144  ASP C OD1 1 
ATOM   8909  O  OD2 . ASP C 1 144 ? 52.480  4.673   7.082   1.00 11.99 ? 144  ASP C OD2 1 
ATOM   8910  N  N   . MET C 1 145 ? 50.919  1.132   3.574   1.00 12.57 ? 145  MET C N   1 
ATOM   8911  C  CA  . MET C 1 145 ? 50.601  0.564   2.264   1.00 13.43 ? 145  MET C CA  1 
ATOM   8912  C  C   . MET C 1 145 ? 49.101  0.662   1.938   1.00 13.19 ? 145  MET C C   1 
ATOM   8913  O  O   . MET C 1 145 ? 48.723  1.058   0.828   1.00 13.57 ? 145  MET C O   1 
ATOM   8914  C  CB  . MET C 1 145 ? 51.054  -0.901  2.185   1.00 13.26 ? 145  MET C CB  1 
ATOM   8915  C  CG  . MET C 1 145 ? 50.867  -1.536  0.817   1.00 12.74 ? 145  MET C CG  1 
ATOM   8916  S  SD  . MET C 1 145 ? 50.645  -3.318  0.965   1.00 14.72 ? 145  MET C SD  1 
ATOM   8917  C  CE  . MET C 1 145 ? 48.855  -3.467  1.228   1.00 11.64 ? 145  MET C CE  1 
ATOM   8918  N  N   . VAL C 1 146 ? 48.262  0.288   2.902   1.00 12.76 ? 146  VAL C N   1 
ATOM   8919  C  CA  . VAL C 1 146 ? 46.814  0.375   2.746   1.00 12.07 ? 146  VAL C CA  1 
ATOM   8920  C  C   . VAL C 1 146 ? 46.409  1.842   2.534   1.00 12.25 ? 146  VAL C C   1 
ATOM   8921  O  O   . VAL C 1 146 ? 45.679  2.145   1.590   1.00 11.90 ? 146  VAL C O   1 
ATOM   8922  C  CB  . VAL C 1 146 ? 46.098  -0.230  3.958   1.00 12.24 ? 146  VAL C CB  1 
ATOM   8923  C  CG1 . VAL C 1 146 ? 44.602  0.044   3.909   1.00 11.22 ? 146  VAL C CG1 1 
ATOM   8924  C  CG2 . VAL C 1 146 ? 46.389  -1.730  4.047   1.00 13.18 ? 146  VAL C CG2 1 
ATOM   8925  N  N   . HIS C 1 147 ? 46.901  2.749   3.381   1.00 11.49 ? 147  HIS C N   1 
ATOM   8926  C  CA  . HIS C 1 147 ? 46.552  4.170   3.236   1.00 12.02 ? 147  HIS C CA  1 
ATOM   8927  C  C   . HIS C 1 147 ? 46.947  4.740   1.850   1.00 12.13 ? 147  HIS C C   1 
ATOM   8928  O  O   . HIS C 1 147 ? 46.298  5.658   1.345   1.00 12.55 ? 147  HIS C O   1 
ATOM   8929  C  CB  . HIS C 1 147 ? 47.172  5.027   4.347   1.00 11.32 ? 147  HIS C CB  1 
ATOM   8930  C  CG  . HIS C 1 147 ? 46.513  4.868   5.683   1.00 12.75 ? 147  HIS C CG  1 
ATOM   8931  N  ND1 . HIS C 1 147 ? 47.019  5.437   6.837   1.00 11.29 ? 147  HIS C ND1 1 
ATOM   8932  C  CD2 . HIS C 1 147 ? 45.402  4.184   6.057   1.00 10.73 ? 147  HIS C CD2 1 
ATOM   8933  C  CE1 . HIS C 1 147 ? 46.230  5.136   7.855   1.00 11.20 ? 147  HIS C CE1 1 
ATOM   8934  N  NE2 . HIS C 1 147 ? 45.248  4.373   7.409   1.00 9.98  ? 147  HIS C NE2 1 
ATOM   8935  N  N   . SER C 1 148 ? 48.009  4.211   1.247   1.00 11.88 ? 148  SER C N   1 
ATOM   8936  C  CA  . SER C 1 148 ? 48.446  4.734   -0.037  1.00 12.37 ? 148  SER C CA  1 
ATOM   8937  C  C   . SER C 1 148 ? 47.525  4.258   -1.159  1.00 12.14 ? 148  SER C C   1 
ATOM   8938  O  O   . SER C 1 148 ? 47.238  5.016   -2.075  1.00 12.19 ? 148  SER C O   1 
ATOM   8939  C  CB  . SER C 1 148 ? 49.928  4.412   -0.320  1.00 12.42 ? 148  SER C CB  1 
ATOM   8940  O  OG  . SER C 1 148 ? 50.115  3.135   -0.915  1.00 12.95 ? 148  SER C OG  1 
ATOM   8941  N  N   . LEU C 1 149 ? 47.060  3.010   -1.051  1.00 12.16 ? 149  LEU C N   1 
ATOM   8942  C  CA  . LEU C 1 149 ? 46.155  2.391   -2.025  1.00 11.86 ? 149  LEU C CA  1 
ATOM   8943  C  C   . LEU C 1 149 ? 44.699  2.822   -1.843  1.00 12.31 ? 149  LEU C C   1 
ATOM   8944  O  O   . LEU C 1 149 ? 43.933  2.871   -2.809  1.00 11.55 ? 149  LEU C O   1 
ATOM   8945  C  CB  . LEU C 1 149 ? 46.248  0.874   -1.931  1.00 11.62 ? 149  LEU C CB  1 
ATOM   8946  C  CG  . LEU C 1 149 ? 47.540  0.176   -2.363  1.00 11.86 ? 149  LEU C CG  1 
ATOM   8947  C  CD1 . LEU C 1 149 ? 47.737  -1.132  -1.598  1.00 10.88 ? 149  LEU C CD1 1 
ATOM   8948  C  CD2 . LEU C 1 149 ? 47.563  -0.066  -3.869  1.00 11.47 ? 149  LEU C CD2 1 
ATOM   8949  N  N   . LYS C 1 150 ? 44.332  3.132   -0.597  1.00 12.84 ? 150  LYS C N   1 
ATOM   8950  C  CA  . LYS C 1 150 ? 42.989  3.586   -0.256  1.00 13.46 ? 150  LYS C CA  1 
ATOM   8951  C  C   . LYS C 1 150 ? 42.667  4.909   -0.942  1.00 13.59 ? 150  LYS C C   1 
ATOM   8952  O  O   . LYS C 1 150 ? 43.563  5.708   -1.190  1.00 13.15 ? 150  LYS C O   1 
ATOM   8953  C  CB  . LYS C 1 150 ? 42.816  3.758   1.268   1.00 13.28 ? 150  LYS C CB  1 
ATOM   8954  C  CG  . LYS C 1 150 ? 42.559  2.481   2.042   1.00 13.39 ? 150  LYS C CG  1 
ATOM   8955  C  CD  . LYS C 1 150 ? 41.148  1.945   1.860   1.00 12.52 ? 150  LYS C CD  1 
ATOM   8956  C  CE  . LYS C 1 150 ? 40.954  0.651   2.651   1.00 13.17 ? 150  LYS C CE  1 
ATOM   8957  N  NZ  . LYS C 1 150 ? 39.480  0.300   2.680   1.00 15.65 ? 150  LYS C NZ  1 
ATOM   8958  N  N   . PRO C 1 151 ? 41.378  5.136   -1.248  1.00 14.03 ? 151  PRO C N   1 
ATOM   8959  C  CA  . PRO C 1 151 ? 40.959  6.420   -1.765  1.00 14.43 ? 151  PRO C CA  1 
ATOM   8960  C  C   . PRO C 1 151 ? 41.672  7.558   -1.051  1.00 14.65 ? 151  PRO C C   1 
ATOM   8961  O  O   . PRO C 1 151 ? 41.788  7.537   0.178   1.00 15.20 ? 151  PRO C O   1 
ATOM   8962  C  CB  . PRO C 1 151 ? 39.459  6.436   -1.430  1.00 13.73 ? 151  PRO C CB  1 
ATOM   8963  C  CG  . PRO C 1 151 ? 39.062  5.039   -1.658  1.00 14.51 ? 151  PRO C CG  1 
ATOM   8964  C  CD  . PRO C 1 151 ? 40.242  4.194   -1.170  1.00 13.78 ? 151  PRO C CD  1 
ATOM   8965  N  N   . ASP C 1 152 ? 42.162  8.522   -1.819  1.00 14.56 ? 152  ASP C N   1 
ATOM   8966  C  CA  . ASP C 1 152 ? 42.675  9.773   -1.273  1.00 15.09 ? 152  ASP C CA  1 
ATOM   8967  C  C   . ASP C 1 152 ? 41.695  10.306  -0.212  1.00 15.00 ? 152  ASP C C   1 
ATOM   8968  O  O   . ASP C 1 152 ? 40.503  10.406  -0.471  1.00 14.86 ? 152  ASP C O   1 
ATOM   8969  C  CB  . ASP C 1 152 ? 42.895  10.769  -2.430  1.00 14.99 ? 152  ASP C CB  1 
ATOM   8970  C  CG  . ASP C 1 152 ? 43.132  12.193  -1.962  1.00 16.07 ? 152  ASP C CG  1 
ATOM   8971  O  OD1 . ASP C 1 152 ? 42.246  12.799  -1.329  1.00 15.88 ? 152  ASP C OD1 1 
ATOM   8972  O  OD2 . ASP C 1 152 ? 44.207  12.734  -2.271  1.00 19.17 ? 152  ASP C OD2 1 
ATOM   8973  N  N   . PRO C 1 153 ? 42.195  10.630  0.995   1.00 15.50 ? 153  PRO C N   1 
ATOM   8974  C  CA  . PRO C 1 153 ? 41.311  10.972  2.133   1.00 15.67 ? 153  PRO C CA  1 
ATOM   8975  C  C   . PRO C 1 153 ? 40.570  12.312  2.025   1.00 15.50 ? 153  PRO C C   1 
ATOM   8976  O  O   . PRO C 1 153 ? 39.727  12.621  2.867   1.00 15.14 ? 153  PRO C O   1 
ATOM   8977  C  CB  . PRO C 1 153 ? 42.273  10.996  3.327   1.00 15.74 ? 153  PRO C CB  1 
ATOM   8978  C  CG  . PRO C 1 153 ? 43.592  11.329  2.726   1.00 15.56 ? 153  PRO C CG  1 
ATOM   8979  C  CD  . PRO C 1 153 ? 43.619  10.674  1.377   1.00 15.34 ? 153  PRO C CD  1 
ATOM   8980  N  N   . ARG C 1 154 ? 40.904  13.099  1.010   1.00 16.00 ? 154  ARG C N   1 
ATOM   8981  C  CA  . ARG C 1 154 ? 40.153  14.301  0.671   1.00 16.36 ? 154  ARG C CA  1 
ATOM   8982  C  C   . ARG C 1 154 ? 39.141  14.056  -0.470  1.00 16.07 ? 154  ARG C C   1 
ATOM   8983  O  O   . ARG C 1 154 ? 37.971  14.422  -0.351  1.00 16.20 ? 154  ARG C O   1 
ATOM   8984  C  CB  . ARG C 1 154 ? 41.122  15.445  0.331   1.00 17.03 ? 154  ARG C CB  1 
ATOM   8985  C  CG  . ARG C 1 154 ? 40.484  16.818  0.386   1.00 19.29 ? 154  ARG C CG  1 
ATOM   8986  C  CD  . ARG C 1 154 ? 41.513  17.922  0.521   1.00 21.70 ? 154  ARG C CD  1 
ATOM   8987  N  NE  . ARG C 1 154 ? 41.906  18.410  -0.792  1.00 25.85 ? 154  ARG C NE  1 
ATOM   8988  C  CZ  . ARG C 1 154 ? 41.524  19.572  -1.317  1.00 26.53 ? 154  ARG C CZ  1 
ATOM   8989  N  NH1 . ARG C 1 154 ? 41.953  19.905  -2.529  1.00 26.65 ? 154  ARG C NH1 1 
ATOM   8990  N  NH2 . ARG C 1 154 ? 40.736  20.403  -0.635  1.00 24.45 ? 154  ARG C NH2 1 
ATOM   8991  N  N   . THR C 1 155 ? 39.588  13.432  -1.560  1.00 15.79 ? 155  THR C N   1 
ATOM   8992  C  CA  . THR C 1 155 ? 38.750  13.241  -2.753  1.00 16.06 ? 155  THR C CA  1 
ATOM   8993  C  C   . THR C 1 155 ? 37.824  12.027  -2.652  1.00 15.77 ? 155  THR C C   1 
ATOM   8994  O  O   . THR C 1 155 ? 36.751  12.008  -3.260  1.00 15.95 ? 155  THR C O   1 
ATOM   8995  C  CB  . THR C 1 155 ? 39.589  13.068  -4.051  1.00 15.98 ? 155  THR C CB  1 
ATOM   8996  O  OG1 . THR C 1 155 ? 40.434  11.916  -3.921  1.00 17.29 ? 155  THR C OG1 1 
ATOM   8997  C  CG2 . THR C 1 155 ? 40.450  14.295  -4.349  1.00 16.40 ? 155  THR C CG2 1 
ATOM   8998  N  N   . ASN C 1 156 ? 38.252  11.021  -1.897  1.00 15.64 ? 156  ASN C N   1 
ATOM   8999  C  CA  . ASN C 1 156 ? 37.557  9.735   -1.791  1.00 15.83 ? 156  ASN C CA  1 
ATOM   9000  C  C   . ASN C 1 156 ? 37.642  8.900   -3.066  1.00 16.14 ? 156  ASN C C   1 
ATOM   9001  O  O   . ASN C 1 156 ? 36.769  8.065   -3.334  1.00 16.06 ? 156  ASN C O   1 
ATOM   9002  C  CB  . ASN C 1 156 ? 36.100  9.894   -1.324  1.00 15.69 ? 156  ASN C CB  1 
ATOM   9003  C  CG  . ASN C 1 156 ? 35.613  8.694   -0.527  1.00 16.11 ? 156  ASN C CG  1 
ATOM   9004  O  OD1 . ASN C 1 156 ? 36.353  8.135   0.303   1.00 18.86 ? 156  ASN C OD1 1 
ATOM   9005  N  ND2 . ASN C 1 156 ? 34.374  8.291   -0.764  1.00 12.11 ? 156  ASN C ND2 1 
ATOM   9006  N  N   . ILE C 1 157 ? 38.722  9.108   -3.827  1.00 16.54 ? 157  ILE C N   1 
ATOM   9007  C  CA  . ILE C 1 157 ? 38.994  8.346   -5.051  1.00 16.65 ? 157  ILE C CA  1 
ATOM   9008  C  C   . ILE C 1 157 ? 40.438  7.872   -5.041  1.00 16.49 ? 157  ILE C C   1 
ATOM   9009  O  O   . ILE C 1 157 ? 41.350  8.655   -4.734  1.00 16.27 ? 157  ILE C O   1 
ATOM   9010  C  CB  . ILE C 1 157 ? 38.725  9.209   -6.319  1.00 17.06 ? 157  ILE C CB  1 
ATOM   9011  C  CG1 . ILE C 1 157 ? 37.254  9.667   -6.332  1.00 17.06 ? 157  ILE C CG1 1 
ATOM   9012  C  CG2 . ILE C 1 157 ? 39.146  8.462   -7.632  1.00 15.38 ? 157  ILE C CG2 1 
ATOM   9013  C  CD1 . ILE C 1 157 ? 36.906  10.613  -7.476  1.00 17.73 ? 157  ILE C CD1 1 
ATOM   9014  N  N   . GLN C 1 158 ? 40.642  6.591   -5.365  1.00 16.12 ? 158  GLN C N   1 
ATOM   9015  C  CA  . GLN C 1 158 ? 41.991  6.009   -5.399  1.00 15.87 ? 158  GLN C CA  1 
ATOM   9016  C  C   . GLN C 1 158 ? 42.851  6.728   -6.424  1.00 15.82 ? 158  GLN C C   1 
ATOM   9017  O  O   . GLN C 1 158 ? 42.407  6.994   -7.548  1.00 15.62 ? 158  GLN C O   1 
ATOM   9018  C  CB  . GLN C 1 158 ? 41.939  4.513   -5.697  1.00 16.06 ? 158  GLN C CB  1 
ATOM   9019  C  CG  . GLN C 1 158 ? 43.292  3.805   -5.735  1.00 14.86 ? 158  GLN C CG  1 
ATOM   9020  C  CD  . GLN C 1 158 ? 43.146  2.337   -6.081  1.00 15.67 ? 158  GLN C CD  1 
ATOM   9021  O  OE1 . GLN C 1 158 ? 42.637  1.993   -7.149  1.00 16.64 ? 158  GLN C OE1 1 
ATOM   9022  N  NE2 . GLN C 1 158 ? 43.573  1.460   -5.173  1.00 14.51 ? 158  GLN C NE2 1 
ATOM   9023  N  N   . ASP C 1 159 ? 44.080  7.042   -6.025  1.00 15.81 ? 159  ASP C N   1 
ATOM   9024  C  CA  . ASP C 1 159 ? 44.970  7.851   -6.840  1.00 16.02 ? 159  ASP C CA  1 
ATOM   9025  C  C   . ASP C 1 159 ? 46.341  7.205   -6.976  1.00 16.40 ? 159  ASP C C   1 
ATOM   9026  O  O   . ASP C 1 159 ? 47.110  7.140   -5.991  1.00 16.54 ? 159  ASP C O   1 
ATOM   9027  C  CB  . ASP C 1 159 ? 45.068  9.268   -6.278  1.00 15.94 ? 159  ASP C CB  1 
ATOM   9028  C  CG  . ASP C 1 159 ? 46.005  10.185  -7.088  1.00 16.43 ? 159  ASP C CG  1 
ATOM   9029  O  OD1 . ASP C 1 159 ? 46.181  11.335  -6.652  1.00 16.73 ? 159  ASP C OD1 1 
ATOM   9030  O  OD2 . ASP C 1 159 ? 46.573  9.782   -8.126  1.00 16.39 ? 159  ASP C OD2 1 
ATOM   9031  N  N   . PRO C 1 160 ? 46.661  6.739   -8.205  1.00 16.31 ? 160  PRO C N   1 
ATOM   9032  C  CA  . PRO C 1 160 ? 47.949  6.121   -8.530  1.00 16.41 ? 160  PRO C CA  1 
ATOM   9033  C  C   . PRO C 1 160 ? 49.145  6.974   -8.088  1.00 16.81 ? 160  PRO C C   1 
ATOM   9034  O  O   . PRO C 1 160 ? 50.170  6.436   -7.652  1.00 16.90 ? 160  PRO C O   1 
ATOM   9035  C  CB  . PRO C 1 160 ? 47.880  5.969   -10.051 1.00 16.79 ? 160  PRO C CB  1 
ATOM   9036  C  CG  . PRO C 1 160 ? 46.403  5.802   -10.331 1.00 15.96 ? 160  PRO C CG  1 
ATOM   9037  C  CD  . PRO C 1 160 ? 45.752  6.757   -9.369  1.00 16.23 ? 160  PRO C CD  1 
ATOM   9038  N  N   . ASP C 1 161 ? 49.003  8.296   -8.163  1.00 17.26 ? 161  ASP C N   1 
ATOM   9039  C  CA  . ASP C 1 161 ? 50.068  9.204   -7.716  1.00 17.50 ? 161  ASP C CA  1 
ATOM   9040  C  C   . ASP C 1 161 ? 50.493  8.959   -6.252  1.00 16.87 ? 161  ASP C C   1 
ATOM   9041  O  O   . ASP C 1 161 ? 51.654  9.157   -5.889  1.00 16.68 ? 161  ASP C O   1 
ATOM   9042  C  CB  . ASP C 1 161 ? 49.645  10.653  -7.895  1.00 17.45 ? 161  ASP C CB  1 
ATOM   9043  C  CG  . ASP C 1 161 ? 50.783  11.603  -7.675  1.00 20.43 ? 161  ASP C CG  1 
ATOM   9044  O  OD1 . ASP C 1 161 ? 51.692  11.661  -8.537  1.00 21.66 ? 161  ASP C OD1 1 
ATOM   9045  O  OD2 . ASP C 1 161 ? 50.796  12.277  -6.621  1.00 24.88 ? 161  ASP C OD2 1 
ATOM   9046  N  N   . ARG C 1 162 ? 49.535  8.515   -5.436  1.00 16.42 ? 162  ARG C N   1 
ATOM   9047  C  CA  . ARG C 1 162 ? 49.747  8.276   -4.005  1.00 15.36 ? 162  ARG C CA  1 
ATOM   9048  C  C   . ARG C 1 162 ? 50.366  6.903   -3.762  1.00 14.97 ? 162  ARG C C   1 
ATOM   9049  O  O   . ARG C 1 162 ? 51.401  6.797   -3.131  1.00 14.55 ? 162  ARG C O   1 
ATOM   9050  C  CB  . ARG C 1 162 ? 48.430  8.428   -3.235  1.00 15.41 ? 162  ARG C CB  1 
ATOM   9051  C  CG  . ARG C 1 162 ? 47.831  9.833   -3.248  1.00 14.43 ? 162  ARG C CG  1 
ATOM   9052  C  CD  . ARG C 1 162 ? 46.466  9.875   -2.530  1.00 14.94 ? 162  ARG C CD  1 
ATOM   9053  N  NE  . ARG C 1 162 ? 46.613  9.963   -1.071  1.00 14.15 ? 162  ARG C NE  1 
ATOM   9054  C  CZ  . ARG C 1 162 ? 46.496  8.945   -0.211  1.00 13.30 ? 162  ARG C CZ  1 
ATOM   9055  N  NH1 . ARG C 1 162 ? 46.182  7.724   -0.627  1.00 9.96  ? 162  ARG C NH1 1 
ATOM   9056  N  NH2 . ARG C 1 162 ? 46.681  9.163   1.087   1.00 12.61 ? 162  ARG C NH2 1 
ATOM   9057  N  N   . TYR C 1 163 ? 49.747  5.849   -4.282  1.00 15.24 ? 163  TYR C N   1 
ATOM   9058  C  CA  . TYR C 1 163 ? 50.290  4.503   -4.059  1.00 15.63 ? 163  TYR C CA  1 
ATOM   9059  C  C   . TYR C 1 163 ? 51.563  4.142   -4.843  1.00 15.19 ? 163  TYR C C   1 
ATOM   9060  O  O   . TYR C 1 163 ? 52.336  3.324   -4.385  1.00 14.56 ? 163  TYR C O   1 
ATOM   9061  C  CB  . TYR C 1 163 ? 49.208  3.407   -4.148  1.00 15.93 ? 163  TYR C CB  1 
ATOM   9062  C  CG  . TYR C 1 163 ? 48.613  3.142   -5.510  1.00 16.82 ? 163  TYR C CG  1 
ATOM   9063  C  CD1 . TYR C 1 163 ? 49.343  2.469   -6.497  1.00 17.52 ? 163  TYR C CD1 1 
ATOM   9064  C  CD2 . TYR C 1 163 ? 47.301  3.517   -5.803  1.00 17.64 ? 163  TYR C CD2 1 
ATOM   9065  C  CE1 . TYR C 1 163 ? 48.787  2.202   -7.752  1.00 17.57 ? 163  TYR C CE1 1 
ATOM   9066  C  CE2 . TYR C 1 163 ? 46.732  3.241   -7.060  1.00 16.67 ? 163  TYR C CE2 1 
ATOM   9067  C  CZ  . TYR C 1 163 ? 47.481  2.591   -8.030  1.00 16.75 ? 163  TYR C CZ  1 
ATOM   9068  O  OH  . TYR C 1 163 ? 46.933  2.312   -9.279  1.00 14.87 ? 163  TYR C OH  1 
ATOM   9069  N  N   . TRP C 1 164 ? 51.792  4.760   -6.003  1.00 15.31 ? 164  TRP C N   1 
ATOM   9070  C  CA  . TRP C 1 164 ? 53.094  4.611   -6.661  1.00 15.32 ? 164  TRP C CA  1 
ATOM   9071  C  C   . TRP C 1 164 ? 54.210  5.268   -5.852  1.00 15.53 ? 164  TRP C C   1 
ATOM   9072  O  O   . TRP C 1 164 ? 55.368  4.795   -5.831  1.00 15.73 ? 164  TRP C O   1 
ATOM   9073  C  CB  . TRP C 1 164 ? 53.064  5.128   -8.101  1.00 15.37 ? 164  TRP C CB  1 
ATOM   9074  C  CG  . TRP C 1 164 ? 52.570  4.070   -9.041  1.00 15.33 ? 164  TRP C CG  1 
ATOM   9075  C  CD1 . TRP C 1 164 ? 51.350  4.004   -9.626  1.00 15.24 ? 164  TRP C CD1 1 
ATOM   9076  C  CD2 . TRP C 1 164 ? 53.285  2.901   -9.458  1.00 15.29 ? 164  TRP C CD2 1 
ATOM   9077  N  NE1 . TRP C 1 164 ? 51.248  2.873   -10.388 1.00 15.56 ? 164  TRP C NE1 1 
ATOM   9078  C  CE2 . TRP C 1 164 ? 52.423  2.173   -10.310 1.00 15.31 ? 164  TRP C CE2 1 
ATOM   9079  C  CE3 . TRP C 1 164 ? 54.575  2.400   -9.198  1.00 14.70 ? 164  TRP C CE3 1 
ATOM   9080  C  CZ2 . TRP C 1 164 ? 52.801  0.968   -10.921 1.00 14.98 ? 164  TRP C CZ2 1 
ATOM   9081  C  CZ3 . TRP C 1 164 ? 54.954  1.196   -9.795  1.00 16.25 ? 164  TRP C CZ3 1 
ATOM   9082  C  CH2 . TRP C 1 164 ? 54.058  0.489   -10.647 1.00 15.87 ? 164  TRP C CH2 1 
ATOM   9083  N  N   . ASP C 1 165 ? 53.853  6.351   -5.175  1.00 15.25 ? 165  ASP C N   1 
ATOM   9084  C  CA  . ASP C 1 165 ? 54.772  7.026   -4.273  1.00 15.49 ? 165  ASP C CA  1 
ATOM   9085  C  C   . ASP C 1 165 ? 55.272  6.023   -3.208  1.00 15.28 ? 165  ASP C C   1 
ATOM   9086  O  O   . ASP C 1 165 ? 56.474  5.800   -3.072  1.00 15.08 ? 165  ASP C O   1 
ATOM   9087  C  CB  . ASP C 1 165 ? 54.098  8.272   -3.663  1.00 14.86 ? 165  ASP C CB  1 
ATOM   9088  C  CG  . ASP C 1 165 ? 55.050  9.123   -2.860  1.00 15.64 ? 165  ASP C CG  1 
ATOM   9089  O  OD1 . ASP C 1 165 ? 56.267  9.043   -3.112  1.00 18.00 ? 165  ASP C OD1 1 
ATOM   9090  O  OD2 . ASP C 1 165 ? 54.598  9.878   -1.965  1.00 14.82 ? 165  ASP C OD2 1 
ATOM   9091  N  N   . PHE C 1 166 ? 54.340  5.390   -2.493  1.00 15.41 ? 166  PHE C N   1 
ATOM   9092  C  CA  . PHE C 1 166 ? 54.695  4.424   -1.454  1.00 14.98 ? 166  PHE C CA  1 
ATOM   9093  C  C   . PHE C 1 166 ? 55.469  3.242   -2.045  1.00 15.70 ? 166  PHE C C   1 
ATOM   9094  O  O   . PHE C 1 166 ? 56.496  2.830   -1.491  1.00 15.90 ? 166  PHE C O   1 
ATOM   9095  C  CB  . PHE C 1 166 ? 53.444  3.915   -0.693  1.00 14.31 ? 166  PHE C CB  1 
ATOM   9096  C  CG  . PHE C 1 166 ? 53.735  2.757   0.248   1.00 12.61 ? 166  PHE C CG  1 
ATOM   9097  C  CD1 . PHE C 1 166 ? 53.786  1.445   -0.227  1.00 10.88 ? 166  PHE C CD1 1 
ATOM   9098  C  CD2 . PHE C 1 166 ? 53.997  2.988   1.594   1.00 11.40 ? 166  PHE C CD2 1 
ATOM   9099  C  CE1 . PHE C 1 166 ? 54.086  0.378   0.626   1.00 10.31 ? 166  PHE C CE1 1 
ATOM   9100  C  CE2 . PHE C 1 166 ? 54.292  1.928   2.464   1.00 12.56 ? 166  PHE C CE2 1 
ATOM   9101  C  CZ  . PHE C 1 166 ? 54.333  0.620   1.980   1.00 11.50 ? 166  PHE C CZ  1 
ATOM   9102  N  N   . MET C 1 167 ? 54.954  2.689   -3.146  1.00 16.06 ? 167  MET C N   1 
ATOM   9103  C  CA  . MET C 1 167 ? 55.501  1.465   -3.723  1.00 16.90 ? 167  MET C CA  1 
ATOM   9104  C  C   . MET C 1 167 ? 56.906  1.644   -4.330  1.00 16.91 ? 167  MET C C   1 
ATOM   9105  O  O   . MET C 1 167 ? 57.767  0.763   -4.194  1.00 16.37 ? 167  MET C O   1 
ATOM   9106  C  CB  . MET C 1 167 ? 54.544  0.884   -4.765  1.00 17.49 ? 167  MET C CB  1 
ATOM   9107  C  CG  . MET C 1 167 ? 53.159  0.526   -4.246  1.00 18.02 ? 167  MET C CG  1 
ATOM   9108  S  SD  . MET C 1 167 ? 53.106  -0.933  -3.194  1.00 22.41 ? 167  MET C SD  1 
ATOM   9109  C  CE  . MET C 1 167 ? 51.320  -1.074  -2.970  1.00 20.00 ? 167  MET C CE  1 
ATOM   9110  N  N   . THR C 1 168 ? 57.130  2.777   -4.994  1.00 16.96 ? 168  THR C N   1 
ATOM   9111  C  CA  . THR C 1 168 ? 58.475  3.103   -5.496  1.00 16.94 ? 168  THR C CA  1 
ATOM   9112  C  C   . THR C 1 168 ? 59.443  3.340   -4.342  1.00 17.70 ? 168  THR C C   1 
ATOM   9113  O  O   . THR C 1 168 ? 60.620  3.002   -4.430  1.00 18.00 ? 168  THR C O   1 
ATOM   9114  C  CB  . THR C 1 168 ? 58.493  4.357   -6.418  1.00 16.85 ? 168  THR C CB  1 
ATOM   9115  O  OG1 . THR C 1 168 ? 57.963  5.494   -5.715  1.00 15.19 ? 168  THR C OG1 1 
ATOM   9116  C  CG2 . THR C 1 168 ? 57.688  4.119   -7.706  1.00 15.00 ? 168  THR C CG2 1 
ATOM   9117  N  N   . LEU C 1 169 ? 58.953  3.923   -3.253  1.00 18.38 ? 169  LEU C N   1 
ATOM   9118  C  CA  . LEU C 1 169 ? 59.833  4.252   -2.146  1.00 18.99 ? 169  LEU C CA  1 
ATOM   9119  C  C   . LEU C 1 169 ? 60.044  3.055   -1.249  1.00 19.60 ? 169  LEU C C   1 
ATOM   9120  O  O   . LEU C 1 169 ? 60.918  3.069   -0.356  1.00 19.79 ? 169  LEU C O   1 
ATOM   9121  C  CB  . LEU C 1 169 ? 59.316  5.459   -1.371  1.00 19.00 ? 169  LEU C CB  1 
ATOM   9122  C  CG  . LEU C 1 169 ? 59.462  6.814   -2.076  1.00 19.27 ? 169  LEU C CG  1 
ATOM   9123  C  CD1 . LEU C 1 169 ? 59.228  7.908   -1.073  1.00 20.18 ? 169  LEU C CD1 1 
ATOM   9124  C  CD2 . LEU C 1 169 ? 60.835  7.004   -2.724  1.00 18.23 ? 169  LEU C CD2 1 
ATOM   9125  N  N   . ARG C 1 170 ? 59.254  2.010   -1.505  1.00 19.87 ? 170  ARG C N   1 
ATOM   9126  C  CA  . ARG C 1 170 ? 59.431  0.717   -0.852  1.00 20.31 ? 170  ARG C CA  1 
ATOM   9127  C  C   . ARG C 1 170 ? 59.684  -0.381  -1.904  1.00 20.75 ? 170  ARG C C   1 
ATOM   9128  O  O   . ARG C 1 170 ? 58.785  -1.199  -2.213  1.00 20.90 ? 170  ARG C O   1 
ATOM   9129  C  CB  . ARG C 1 170 ? 58.219  0.406   0.002   1.00 20.32 ? 170  ARG C CB  1 
ATOM   9130  C  CG  . ARG C 1 170 ? 58.581  -0.210  1.320   1.00 21.18 ? 170  ARG C CG  1 
ATOM   9131  C  CD  . ARG C 1 170 ? 58.613  0.796   2.432   1.00 18.16 ? 170  ARG C CD  1 
ATOM   9132  N  NE  . ARG C 1 170 ? 59.938  1.084   2.965   1.00 18.00 ? 170  ARG C NE  1 
ATOM   9133  C  CZ  . ARG C 1 170 ? 60.775  0.221   3.555   1.00 15.29 ? 170  ARG C CZ  1 
ATOM   9134  N  NH1 . ARG C 1 170 ? 60.530  -1.079  3.648   1.00 12.21 ? 170  ARG C NH1 1 
ATOM   9135  N  NH2 . ARG C 1 170 ? 61.924  0.679   3.999   1.00 14.84 ? 170  ARG C NH2 1 
ATOM   9136  N  N   . PRO C 1 171 ? 60.912  -0.393  -2.473  1.00 20.59 ? 171  PRO C N   1 
ATOM   9137  C  CA  . PRO C 1 171 ? 61.230  -1.203  -3.660  1.00 20.29 ? 171  PRO C CA  1 
ATOM   9138  C  C   . PRO C 1 171 ? 60.926  -2.694  -3.564  1.00 19.57 ? 171  PRO C C   1 
ATOM   9139  O  O   . PRO C 1 171 ? 60.802  -3.331  -4.609  1.00 19.79 ? 171  PRO C O   1 
ATOM   9140  C  CB  . PRO C 1 171 ? 62.732  -0.965  -3.883  1.00 20.17 ? 171  PRO C CB  1 
ATOM   9141  C  CG  . PRO C 1 171 ? 63.230  -0.354  -2.620  1.00 21.16 ? 171  PRO C CG  1 
ATOM   9142  C  CD  . PRO C 1 171 ? 62.074  0.393   -2.025  1.00 20.47 ? 171  PRO C CD  1 
ATOM   9143  N  N   . GLU C 1 172 ? 60.779  -3.234  -2.351  1.00 18.57 ? 172  GLU C N   1 
ATOM   9144  C  CA  . GLU C 1 172 ? 60.426  -4.652  -2.154  1.00 17.91 ? 172  GLU C CA  1 
ATOM   9145  C  C   . GLU C 1 172 ? 59.092  -5.057  -2.806  1.00 17.73 ? 172  GLU C C   1 
ATOM   9146  O  O   . GLU C 1 172 ? 58.828  -6.247  -3.024  1.00 17.47 ? 172  GLU C O   1 
ATOM   9147  C  CB  . GLU C 1 172 ? 60.436  -5.024  -0.663  1.00 18.31 ? 172  GLU C CB  1 
ATOM   9148  C  CG  . GLU C 1 172 ? 59.344  -4.386  0.200   1.00 18.07 ? 172  GLU C CG  1 
ATOM   9149  C  CD  . GLU C 1 172 ? 59.798  -3.115  0.905   1.00 19.21 ? 172  GLU C CD  1 
ATOM   9150  O  OE1 . GLU C 1 172 ? 59.332  -2.851  2.052   1.00 18.31 ? 172  GLU C OE1 1 
ATOM   9151  O  OE2 . GLU C 1 172 ? 60.605  -2.362  0.318   1.00 19.74 ? 172  GLU C OE2 1 
ATOM   9152  N  N   . SER C 1 173 ? 58.279  -4.049  -3.127  1.00 17.55 ? 173  SER C N   1 
ATOM   9153  C  CA  . SER C 1 173 ? 56.989  -4.201  -3.799  1.00 17.41 ? 173  SER C CA  1 
ATOM   9154  C  C   . SER C 1 173 ? 57.073  -4.626  -5.263  1.00 17.83 ? 173  SER C C   1 
ATOM   9155  O  O   . SER C 1 173 ? 56.055  -5.015  -5.854  1.00 17.83 ? 173  SER C O   1 
ATOM   9156  C  CB  . SER C 1 173 ? 56.206  -2.888  -3.712  1.00 17.47 ? 173  SER C CB  1 
ATOM   9157  O  OG  . SER C 1 173 ? 56.978  -1.787  -4.179  1.00 17.18 ? 173  SER C OG  1 
ATOM   9158  N  N   . THR C 1 174 ? 58.277  -4.542  -5.840  1.00 17.88 ? 174  THR C N   1 
ATOM   9159  C  CA  . THR C 1 174 ? 58.483  -4.763  -7.274  1.00 17.81 ? 174  THR C CA  1 
ATOM   9160  C  C   . THR C 1 174 ? 57.891  -6.103  -7.732  1.00 17.77 ? 174  THR C C   1 
ATOM   9161  O  O   . THR C 1 174 ? 57.147  -6.153  -8.708  1.00 17.38 ? 174  THR C O   1 
ATOM   9162  C  CB  . THR C 1 174 ? 59.992  -4.600  -7.695  1.00 17.72 ? 174  THR C CB  1 
ATOM   9163  O  OG1 . THR C 1 174 ? 60.502  -3.357  -7.193  1.00 18.40 ? 174  THR C OG1 1 
ATOM   9164  C  CG2 . THR C 1 174 ? 60.144  -4.596  -9.217  1.00 16.62 ? 174  THR C CG2 1 
ATOM   9165  N  N   . ASN C 1 175 ? 58.191  -7.173  -7.003  1.00 18.12 ? 175  ASN C N   1 
ATOM   9166  C  CA  . ASN C 1 175 ? 57.693  -8.490  -7.375  1.00 18.93 ? 175  ASN C CA  1 
ATOM   9167  C  C   . ASN C 1 175 ? 56.165  -8.565  -7.441  1.00 19.33 ? 175  ASN C C   1 
ATOM   9168  O  O   . ASN C 1 175 ? 55.599  -9.096  -8.409  1.00 19.43 ? 175  ASN C O   1 
ATOM   9169  C  CB  . ASN C 1 175 ? 58.261  -9.578  -6.463  1.00 18.91 ? 175  ASN C CB  1 
ATOM   9170  C  CG  . ASN C 1 175 ? 58.205  -10.934 -7.101  1.00 19.65 ? 175  ASN C CG  1 
ATOM   9171  O  OD1 . ASN C 1 175 ? 57.948  -11.041 -8.299  1.00 21.27 ? 175  ASN C OD1 1 
ATOM   9172  N  ND2 . ASN C 1 175 ? 58.453  -11.985 -6.318  1.00 20.15 ? 175  ASN C ND2 1 
ATOM   9173  N  N   . MET C 1 176 ? 55.506  -8.009  -6.425  1.00 19.66 ? 176  MET C N   1 
ATOM   9174  C  CA  . MET C 1 176 ? 54.057  -7.988  -6.376  1.00 19.93 ? 176  MET C CA  1 
ATOM   9175  C  C   . MET C 1 176 ? 53.486  -7.154  -7.509  1.00 19.86 ? 176  MET C C   1 
ATOM   9176  O  O   . MET C 1 176 ? 52.486  -7.532  -8.113  1.00 19.26 ? 176  MET C O   1 
ATOM   9177  C  CB  . MET C 1 176 ? 53.561  -7.492  -5.012  1.00 20.60 ? 176  MET C CB  1 
ATOM   9178  C  CG  . MET C 1 176 ? 52.042  -7.434  -4.874  1.00 20.96 ? 176  MET C CG  1 
ATOM   9179  S  SD  . MET C 1 176 ? 51.232  -9.044  -4.989  1.00 23.48 ? 176  MET C SD  1 
ATOM   9180  C  CE  . MET C 1 176 ? 49.719  -8.713  -4.072  1.00 20.64 ? 176  MET C CE  1 
ATOM   9181  N  N   . LEU C 1 177 ? 54.136  -6.032  -7.807  1.00 20.70 ? 177  LEU C N   1 
ATOM   9182  C  CA  . LEU C 1 177 ? 53.764  -5.198  -8.960  1.00 21.17 ? 177  LEU C CA  1 
ATOM   9183  C  C   . LEU C 1 177 ? 53.786  -5.985  -10.286 1.00 21.87 ? 177  LEU C C   1 
ATOM   9184  O  O   . LEU C 1 177 ? 52.894  -5.806  -11.116 1.00 22.11 ? 177  LEU C O   1 
ATOM   9185  C  CB  . LEU C 1 177 ? 54.631  -3.934  -9.019  1.00 21.04 ? 177  LEU C CB  1 
ATOM   9186  C  CG  . LEU C 1 177 ? 54.178  -2.595  -8.385  1.00 20.92 ? 177  LEU C CG  1 
ATOM   9187  C  CD1 . LEU C 1 177 ? 52.804  -2.578  -7.682  1.00 18.85 ? 177  LEU C CD1 1 
ATOM   9188  C  CD2 . LEU C 1 177 ? 55.268  -2.051  -7.460  1.00 19.99 ? 177  LEU C CD2 1 
ATOM   9189  N  N   . MET C 1 178 ? 54.762  -6.886  -10.458 1.00 22.30 ? 178  MET C N   1 
ATOM   9190  C  CA  . MET C 1 178 ? 54.791  -7.787  -11.629 1.00 22.63 ? 178  MET C CA  1 
ATOM   9191  C  C   . MET C 1 178 ? 53.515  -8.610  -11.796 1.00 22.66 ? 178  MET C C   1 
ATOM   9192  O  O   . MET C 1 178 ? 52.996  -8.744  -12.911 1.00 22.66 ? 178  MET C O   1 
ATOM   9193  C  CB  . MET C 1 178 ? 55.980  -8.749  -11.578 1.00 22.43 ? 178  MET C CB  1 
ATOM   9194  C  CG  . MET C 1 178 ? 57.327  -8.086  -11.691 1.00 23.31 ? 178  MET C CG  1 
ATOM   9195  S  SD  . MET C 1 178 ? 57.707  -7.416  -13.325 1.00 25.11 ? 178  MET C SD  1 
ATOM   9196  C  CE  . MET C 1 178 ? 59.383  -6.857  -13.010 1.00 22.84 ? 178  MET C CE  1 
ATOM   9197  N  N   . HIS C 1 179 ? 53.026  -9.164  -10.684 1.00 22.74 ? 179  HIS C N   1 
ATOM   9198  C  CA  . HIS C 1 179 ? 51.845  -10.038 -10.693 1.00 22.15 ? 179  HIS C CA  1 
ATOM   9199  C  C   . HIS C 1 179 ? 50.566  -9.237  -10.846 1.00 22.24 ? 179  HIS C C   1 
ATOM   9200  O  O   . HIS C 1 179 ? 49.717  -9.556  -11.683 1.00 22.52 ? 179  HIS C O   1 
ATOM   9201  C  CB  . HIS C 1 179 ? 51.759  -10.859 -9.404  1.00 21.44 ? 179  HIS C CB  1 
ATOM   9202  C  CG  . HIS C 1 179 ? 52.913  -11.786 -9.185  1.00 20.30 ? 179  HIS C CG  1 
ATOM   9203  N  ND1 . HIS C 1 179 ? 54.164  -11.345 -8.807  1.00 19.61 ? 179  HIS C ND1 1 
ATOM   9204  C  CD2 . HIS C 1 179 ? 52.992  -13.138 -9.244  1.00 18.37 ? 179  HIS C CD2 1 
ATOM   9205  C  CE1 . HIS C 1 179 ? 54.967  -12.385 -8.652  1.00 18.23 ? 179  HIS C CE1 1 
ATOM   9206  N  NE2 . HIS C 1 179 ? 54.282  -13.484 -8.920  1.00 18.73 ? 179  HIS C NE2 1 
ATOM   9207  N  N   . ILE C 1 180 ? 50.449  -8.190  -10.038 1.00 22.35 ? 180  ILE C N   1 
ATOM   9208  C  CA  . ILE C 1 180 ? 49.215  -7.433  -9.885  1.00 22.76 ? 180  ILE C CA  1 
ATOM   9209  C  C   . ILE C 1 180 ? 48.830  -6.707  -11.180 1.00 22.72 ? 180  ILE C C   1 
ATOM   9210  O  O   . ILE C 1 180 ? 47.645  -6.499  -11.456 1.00 22.80 ? 180  ILE C O   1 
ATOM   9211  C  CB  . ILE C 1 180 ? 49.319  -6.463  -8.648  1.00 22.83 ? 180  ILE C CB  1 
ATOM   9212  C  CG1 . ILE C 1 180 ? 48.232  -6.749  -7.591  1.00 24.65 ? 180  ILE C CG1 1 
ATOM   9213  C  CG2 . ILE C 1 180 ? 49.362  -5.002  -9.051  1.00 23.40 ? 180  ILE C CG2 1 
ATOM   9214  C  CD1 . ILE C 1 180 ? 46.784  -6.577  -8.047  1.00 24.22 ? 180  ILE C CD1 1 
ATOM   9215  N  N   . PHE C 1 181 ? 49.830  -6.347  -11.983 1.00 22.89 ? 181  PHE C N   1 
ATOM   9216  C  CA  . PHE C 1 181 ? 49.578  -5.636  -13.239 1.00 23.24 ? 181  PHE C CA  1 
ATOM   9217  C  C   . PHE C 1 181 ? 49.589  -6.517  -14.478 1.00 23.39 ? 181  PHE C C   1 
ATOM   9218  O  O   . PHE C 1 181 ? 49.529  -6.007  -15.592 1.00 23.95 ? 181  PHE C O   1 
ATOM   9219  C  CB  . PHE C 1 181 ? 50.487  -4.405  -13.402 1.00 22.95 ? 181  PHE C CB  1 
ATOM   9220  C  CG  . PHE C 1 181 ? 50.045  -3.224  -12.576 1.00 23.26 ? 181  PHE C CG  1 
ATOM   9221  C  CD1 . PHE C 1 181 ? 50.691  -2.913  -11.378 1.00 23.18 ? 181  PHE C CD1 1 
ATOM   9222  C  CD2 . PHE C 1 181 ? 48.965  -2.438  -12.981 1.00 22.27 ? 181  PHE C CD2 1 
ATOM   9223  C  CE1 . PHE C 1 181 ? 50.275  -1.813  -10.596 1.00 23.06 ? 181  PHE C CE1 1 
ATOM   9224  C  CE2 . PHE C 1 181 ? 48.541  -1.349  -12.210 1.00 23.21 ? 181  PHE C CE2 1 
ATOM   9225  C  CZ  . PHE C 1 181 ? 49.200  -1.036  -11.011 1.00 22.31 ? 181  PHE C CZ  1 
ATOM   9226  N  N   . THR C 1 182 ? 49.648  -7.833  -14.298 1.00 23.52 ? 182  THR C N   1 
ATOM   9227  C  CA  . THR C 1 182 ? 49.209  -8.716  -15.369 1.00 23.52 ? 182  THR C CA  1 
ATOM   9228  C  C   . THR C 1 182 ? 47.691  -8.675  -15.340 1.00 24.02 ? 182  THR C C   1 
ATOM   9229  O  O   . THR C 1 182 ? 47.090  -7.943  -14.539 1.00 24.26 ? 182  THR C O   1 
ATOM   9230  C  CB  . THR C 1 182 ? 49.673  -10.188 -15.213 1.00 23.75 ? 182  THR C CB  1 
ATOM   9231  O  OG1 . THR C 1 182 ? 49.038  -10.800 -14.078 1.00 24.36 ? 182  THR C OG1 1 
ATOM   9232  C  CG2 . THR C 1 182 ? 51.176  -10.297 -15.095 1.00 22.85 ? 182  THR C CG2 1 
ATOM   9233  N  N   . ASP C 1 183 ? 47.054  -9.452  -16.205 1.00 24.20 ? 183  ASP C N   1 
ATOM   9234  C  CA  . ASP C 1 183 ? 45.607  -9.531  -16.168 1.00 24.32 ? 183  ASP C CA  1 
ATOM   9235  C  C   . ASP C 1 183 ? 45.105  -10.345 -14.958 1.00 23.80 ? 183  ASP C C   1 
ATOM   9236  O  O   . ASP C 1 183 ? 43.901  -10.354 -14.672 1.00 23.84 ? 183  ASP C O   1 
ATOM   9237  C  CB  . ASP C 1 183 ? 45.061  -10.073 -17.499 1.00 24.68 ? 183  ASP C CB  1 
ATOM   9238  C  CG  . ASP C 1 183 ? 45.077  -9.029  -18.617 1.00 25.44 ? 183  ASP C CG  1 
ATOM   9239  O  OD1 . ASP C 1 183 ? 45.438  -7.844  -18.376 1.00 25.32 ? 183  ASP C OD1 1 
ATOM   9240  O  OD2 . ASP C 1 183 ? 44.723  -9.406  -19.752 1.00 26.18 ? 183  ASP C OD2 1 
ATOM   9241  N  N   . GLU C 1 184 ? 46.015  -11.003 -14.238 1.00 23.09 ? 184  GLU C N   1 
ATOM   9242  C  CA  . GLU C 1 184 ? 45.623  -11.717 -13.017 1.00 22.98 ? 184  GLU C CA  1 
ATOM   9243  C  C   . GLU C 1 184 ? 45.221  -10.758 -11.889 1.00 22.77 ? 184  GLU C C   1 
ATOM   9244  O  O   . GLU C 1 184 ? 44.654  -11.189 -10.884 1.00 22.98 ? 184  GLU C O   1 
ATOM   9245  C  CB  . GLU C 1 184 ? 46.676  -12.736 -12.544 1.00 22.98 ? 184  GLU C CB  1 
ATOM   9246  C  CG  . GLU C 1 184 ? 46.078  -13.848 -11.671 1.00 22.20 ? 184  GLU C CG  1 
ATOM   9247  C  CD  . GLU C 1 184 ? 47.095  -14.894 -11.204 1.00 23.05 ? 184  GLU C CD  1 
ATOM   9248  O  OE1 . GLU C 1 184 ? 48.317  -14.728 -11.485 1.00 21.06 ? 184  GLU C OE1 1 
ATOM   9249  O  OE2 . GLU C 1 184 ? 46.659  -15.879 -10.536 1.00 22.01 ? 184  GLU C OE2 1 
ATOM   9250  N  N   . GLY C 1 185 ? 45.494  -9.464  -12.089 1.00 22.48 ? 185  GLY C N   1 
ATOM   9251  C  CA  . GLY C 1 185 ? 44.973  -8.373  -11.246 1.00 21.91 ? 185  GLY C CA  1 
ATOM   9252  C  C   . GLY C 1 185 ? 43.458  -8.220  -11.285 1.00 21.61 ? 185  GLY C C   1 
ATOM   9253  O  O   . GLY C 1 185 ? 42.858  -7.673  -10.361 1.00 22.01 ? 185  GLY C O   1 
ATOM   9254  N  N   . ILE C 1 186 ? 42.826  -8.692  -12.357 1.00 21.13 ? 186  ILE C N   1 
ATOM   9255  C  CA  . ILE C 1 186 ? 41.364  -8.740  -12.409 1.00 20.46 ? 186  ILE C CA  1 
ATOM   9256  C  C   . ILE C 1 186 ? 40.863  -10.154 -12.761 1.00 20.46 ? 186  ILE C C   1 
ATOM   9257  O  O   . ILE C 1 186 ? 40.601  -10.444 -13.928 1.00 20.97 ? 186  ILE C O   1 
ATOM   9258  C  CB  . ILE C 1 186 ? 40.764  -7.706  -13.404 1.00 20.39 ? 186  ILE C CB  1 
ATOM   9259  C  CG1 . ILE C 1 186 ? 41.467  -6.343  -13.253 1.00 19.93 ? 186  ILE C CG1 1 
ATOM   9260  C  CG2 . ILE C 1 186 ? 39.228  -7.625  -13.214 1.00 20.21 ? 186  ILE C CG2 1 
ATOM   9261  C  CD1 . ILE C 1 186 ? 41.213  -5.338  -14.340 1.00 19.15 ? 186  ILE C CD1 1 
ATOM   9262  N  N   . PRO C 1 187 ? 40.728  -11.036 -11.753 1.00 19.90 ? 187  PRO C N   1 
ATOM   9263  C  CA  . PRO C 1 187 ? 40.119  -12.338 -12.009 1.00 19.62 ? 187  PRO C CA  1 
ATOM   9264  C  C   . PRO C 1 187 ? 38.710  -12.220 -12.590 1.00 19.46 ? 187  PRO C C   1 
ATOM   9265  O  O   . PRO C 1 187 ? 37.963  -11.292 -12.235 1.00 19.02 ? 187  PRO C O   1 
ATOM   9266  C  CB  . PRO C 1 187 ? 40.081  -12.981 -10.620 1.00 19.21 ? 187  PRO C CB  1 
ATOM   9267  C  CG  . PRO C 1 187 ? 41.204  -12.345 -9.905  1.00 19.62 ? 187  PRO C CG  1 
ATOM   9268  C  CD  . PRO C 1 187 ? 41.163  -10.918 -10.352 1.00 19.58 ? 187  PRO C CD  1 
ATOM   9269  N  N   . ALA C 1 188 ? 38.362  -13.162 -13.472 1.00 19.06 ? 188  ALA C N   1 
ATOM   9270  C  CA  . ALA C 1 188 ? 37.042  -13.174 -14.121 1.00 18.82 ? 188  ALA C CA  1 
ATOM   9271  C  C   . ALA C 1 188 ? 35.937  -13.450 -13.106 1.00 18.43 ? 188  ALA C C   1 
ATOM   9272  O  O   . ALA C 1 188 ? 34.871  -12.873 -13.183 1.00 17.97 ? 188  ALA C O   1 
ATOM   9273  C  CB  . ALA C 1 188 ? 37.001  -14.192 -15.268 1.00 18.06 ? 188  ALA C CB  1 
ATOM   9274  N  N   . SER C 1 189 ? 36.228  -14.337 -12.156 1.00 18.79 ? 189  SER C N   1 
ATOM   9275  C  CA  . SER C 1 189 ? 35.328  -14.674 -11.064 1.00 18.89 ? 189  SER C CA  1 
ATOM   9276  C  C   . SER C 1 189 ? 36.085  -15.357 -9.907  1.00 19.00 ? 189  SER C C   1 
ATOM   9277  O  O   . SER C 1 189 ? 37.204  -15.868 -10.072 1.00 18.74 ? 189  SER C O   1 
ATOM   9278  C  CB  . SER C 1 189 ? 34.193  -15.576 -11.560 1.00 18.85 ? 189  SER C CB  1 
ATOM   9279  O  OG  . SER C 1 189 ? 33.406  -16.094 -10.482 1.00 20.00 ? 189  SER C OG  1 
ATOM   9280  N  N   . TYR C 1 190 ? 35.443  -15.352 -8.740  1.00 19.00 ? 190  TYR C N   1 
ATOM   9281  C  CA  . TYR C 1 190 ? 35.931  -16.014 -7.536  1.00 19.15 ? 190  TYR C CA  1 
ATOM   9282  C  C   . TYR C 1 190 ? 36.179  -17.507 -7.770  1.00 19.60 ? 190  TYR C C   1 
ATOM   9283  O  O   . TYR C 1 190 ? 37.106  -18.094 -7.189  1.00 19.65 ? 190  TYR C O   1 
ATOM   9284  C  CB  . TYR C 1 190 ? 34.927  -15.813 -6.386  1.00 18.63 ? 190  TYR C CB  1 
ATOM   9285  C  CG  . TYR C 1 190 ? 34.745  -14.373 -5.935  1.00 17.75 ? 190  TYR C CG  1 
ATOM   9286  C  CD1 . TYR C 1 190 ? 35.845  -13.511 -5.771  1.00 17.40 ? 190  TYR C CD1 1 
ATOM   9287  C  CD2 . TYR C 1 190 ? 33.477  -13.878 -5.624  1.00 17.77 ? 190  TYR C CD2 1 
ATOM   9288  C  CE1 . TYR C 1 190 ? 35.678  -12.182 -5.316  1.00 17.39 ? 190  TYR C CE1 1 
ATOM   9289  C  CE2 . TYR C 1 190 ? 33.301  -12.563 -5.162  1.00 16.82 ? 190  TYR C CE2 1 
ATOM   9290  C  CZ  . TYR C 1 190 ? 34.402  -11.720 -5.017  1.00 17.42 ? 190  TYR C CZ  1 
ATOM   9291  O  OH  . TYR C 1 190 ? 34.214  -10.418 -4.596  1.00 16.94 ? 190  TYR C OH  1 
ATOM   9292  N  N   . ARG C 1 191 ? 35.358  -18.118 -8.628  1.00 19.80 ? 191  ARG C N   1 
ATOM   9293  C  CA  . ARG C 1 191 ? 35.528  -19.546 -8.945  1.00 20.15 ? 191  ARG C CA  1 
ATOM   9294  C  C   . ARG C 1 191 ? 36.652  -19.795 -9.941  1.00 19.43 ? 191  ARG C C   1 
ATOM   9295  O  O   . ARG C 1 191 ? 37.015  -20.940 -10.186 1.00 19.30 ? 191  ARG C O   1 
ATOM   9296  C  CB  . ARG C 1 191 ? 34.229  -20.174 -9.487  1.00 20.14 ? 191  ARG C CB  1 
ATOM   9297  C  CG  . ARG C 1 191 ? 32.957  -19.457 -9.128  1.00 20.99 ? 191  ARG C CG  1 
ATOM   9298  C  CD  . ARG C 1 191 ? 32.037  -19.371 -10.347 1.00 23.93 ? 191  ARG C CD  1 
ATOM   9299  N  NE  . ARG C 1 191 ? 31.975  -20.638 -11.069 1.00 24.50 ? 191  ARG C NE  1 
ATOM   9300  C  CZ  . ARG C 1 191 ? 31.511  -20.811 -12.307 1.00 23.95 ? 191  ARG C CZ  1 
ATOM   9301  N  NH1 . ARG C 1 191 ? 31.029  -19.796 -13.020 1.00 21.51 ? 191  ARG C NH1 1 
ATOM   9302  N  NH2 . ARG C 1 191 ? 31.525  -22.034 -12.824 1.00 23.47 ? 191  ARG C NH2 1 
ATOM   9303  N  N   . LYS C 1 192 ? 37.197  -18.726 -10.516 1.00 19.37 ? 192  LYS C N   1 
ATOM   9304  C  CA  . LYS C 1 192 ? 38.199  -18.858 -11.601 1.00 19.59 ? 192  LYS C CA  1 
ATOM   9305  C  C   . LYS C 1 192 ? 39.543  -18.275 -11.198 1.00 18.99 ? 192  LYS C C   1 
ATOM   9306  O  O   . LYS C 1 192 ? 40.202  -17.582 -11.967 1.00 19.32 ? 192  LYS C O   1 
ATOM   9307  C  CB  . LYS C 1 192 ? 37.690  -18.241 -12.916 1.00 19.66 ? 192  LYS C CB  1 
ATOM   9308  C  CG  . LYS C 1 192 ? 36.244  -18.615 -13.215 1.00 20.20 ? 192  LYS C CG  1 
ATOM   9309  C  CD  . LYS C 1 192 ? 35.963  -18.718 -14.673 1.00 23.26 ? 192  LYS C CD  1 
ATOM   9310  C  CE  . LYS C 1 192 ? 34.626  -19.405 -14.896 1.00 25.23 ? 192  LYS C CE  1 
ATOM   9311  N  NZ  . LYS C 1 192 ? 34.004  -18.918 -16.157 1.00 29.15 ? 192  LYS C NZ  1 
ATOM   9312  N  N   . MET C 1 193 ? 39.924  -18.557 -9.962  1.00 18.45 ? 193  MET C N   1 
ATOM   9313  C  CA  . MET C 1 193 ? 41.138  -18.023 -9.387  1.00 17.32 ? 193  MET C CA  1 
ATOM   9314  C  C   . MET C 1 193 ? 41.782  -19.075 -8.485  1.00 17.25 ? 193  MET C C   1 
ATOM   9315  O  O   . MET C 1 193 ? 41.114  -19.997 -7.993  1.00 16.70 ? 193  MET C O   1 
ATOM   9316  C  CB  . MET C 1 193 ? 40.853  -16.711 -8.641  1.00 17.22 ? 193  MET C CB  1 
ATOM   9317  C  CG  . MET C 1 193 ? 40.351  -16.851 -7.196  1.00 17.29 ? 193  MET C CG  1 
ATOM   9318  S  SD  . MET C 1 193 ? 39.772  -15.280 -6.476  1.00 15.59 ? 193  MET C SD  1 
ATOM   9319  C  CE  . MET C 1 193 ? 39.395  -15.844 -4.824  1.00 15.62 ? 193  MET C CE  1 
ATOM   9320  N  N   . ARG C 1 194 ? 43.091  -18.939 -8.311  1.00 16.99 ? 194  ARG C N   1 
ATOM   9321  C  CA  . ARG C 1 194 ? 43.863  -19.810 -7.445  1.00 16.94 ? 194  ARG C CA  1 
ATOM   9322  C  C   . ARG C 1 194 ? 43.859  -19.265 -6.017  1.00 16.74 ? 194  ARG C C   1 
ATOM   9323  O  O   . ARG C 1 194 ? 43.325  -18.188 -5.757  1.00 16.65 ? 194  ARG C O   1 
ATOM   9324  C  CB  . ARG C 1 194 ? 45.297  -19.919 -7.973  1.00 17.07 ? 194  ARG C CB  1 
ATOM   9325  C  CG  . ARG C 1 194 ? 45.916  -18.594 -8.427  1.00 17.45 ? 194  ARG C CG  1 
ATOM   9326  C  CD  . ARG C 1 194 ? 47.425  -18.672 -8.406  1.00 17.09 ? 194  ARG C CD  1 
ATOM   9327  N  NE  . ARG C 1 194 ? 48.031  -17.575 -9.153  1.00 16.46 ? 194  ARG C NE  1 
ATOM   9328  C  CZ  . ARG C 1 194 ? 49.341  -17.356 -9.235  1.00 17.06 ? 194  ARG C CZ  1 
ATOM   9329  N  NH1 . ARG C 1 194 ? 49.781  -16.337 -9.963  1.00 18.07 ? 194  ARG C NH1 1 
ATOM   9330  N  NH2 . ARG C 1 194 ? 50.212  -18.132 -8.580  1.00 13.85 ? 194  ARG C NH2 1 
ATOM   9331  N  N   . GLY C 1 195 ? 44.456  -20.009 -5.094  1.00 16.81 ? 195  GLY C N   1 
ATOM   9332  C  CA  . GLY C 1 195 ? 44.683  -19.500 -3.740  1.00 16.39 ? 195  GLY C CA  1 
ATOM   9333  C  C   . GLY C 1 195 ? 46.124  -19.732 -3.328  1.00 16.29 ? 195  GLY C C   1 
ATOM   9334  O  O   . GLY C 1 195 ? 46.740  -20.724 -3.737  1.00 15.76 ? 195  GLY C O   1 
ATOM   9335  N  N   . SER C 1 196 ? 46.659  -18.810 -2.528  1.00 15.70 ? 196  SER C N   1 
ATOM   9336  C  CA  . SER C 1 196 ? 48.043  -18.887 -2.062  1.00 15.64 ? 196  SER C CA  1 
ATOM   9337  C  C   . SER C 1 196 ? 48.100  -18.506 -0.580  1.00 15.43 ? 196  SER C C   1 
ATOM   9338  O  O   . SER C 1 196 ? 47.429  -17.560 -0.145  1.00 15.18 ? 196  SER C O   1 
ATOM   9339  C  CB  . SER C 1 196 ? 48.978  -17.964 -2.874  1.00 15.42 ? 196  SER C CB  1 
ATOM   9340  O  OG  . SER C 1 196 ? 48.674  -17.964 -4.257  1.00 15.54 ? 196  SER C OG  1 
ATOM   9341  N  N   . SER C 1 197 ? 48.903  -19.241 0.187   1.00 14.62 ? 197  SER C N   1 
ATOM   9342  C  CA  . SER C 1 197 ? 49.108  -18.911 1.585   1.00 14.64 ? 197  SER C CA  1 
ATOM   9343  C  C   . SER C 1 197 ? 49.997  -17.659 1.693   1.00 14.86 ? 197  SER C C   1 
ATOM   9344  O  O   . SER C 1 197 ? 49.981  -16.954 2.703   1.00 14.65 ? 197  SER C O   1 
ATOM   9345  C  CB  . SER C 1 197 ? 49.731  -20.091 2.322   1.00 14.07 ? 197  SER C CB  1 
ATOM   9346  O  OG  . SER C 1 197 ? 51.069  -20.270 1.903   1.00 14.82 ? 197  SER C OG  1 
ATOM   9347  N  N   . VAL C 1 198 ? 50.763  -17.405 0.627   1.00 14.91 ? 198  VAL C N   1 
ATOM   9348  C  CA  . VAL C 1 198 ? 51.761  -16.326 0.546   1.00 14.18 ? 198  VAL C CA  1 
ATOM   9349  C  C   . VAL C 1 198 ? 52.918  -16.576 1.520   1.00 14.36 ? 198  VAL C C   1 
ATOM   9350  O  O   . VAL C 1 198 ? 54.050  -16.780 1.093   1.00 14.46 ? 198  VAL C O   1 
ATOM   9351  C  CB  . VAL C 1 198 ? 51.126  -14.920 0.679   1.00 14.27 ? 198  VAL C CB  1 
ATOM   9352  C  CG1 . VAL C 1 198 ? 52.195  -13.826 0.599   1.00 13.67 ? 198  VAL C CG1 1 
ATOM   9353  C  CG2 . VAL C 1 198 ? 50.057  -14.721 -0.395  1.00 13.17 ? 198  VAL C CG2 1 
ATOM   9354  N  N   . HIS C 1 199 ? 52.637  -16.608 2.819   1.00 14.06 ? 199  HIS C N   1 
ATOM   9355  C  CA  . HIS C 1 199 ? 53.668  -16.971 3.810   1.00 13.98 ? 199  HIS C CA  1 
ATOM   9356  C  C   . HIS C 1 199 ? 53.857  -18.482 3.863   1.00 14.02 ? 199  HIS C C   1 
ATOM   9357  O  O   . HIS C 1 199 ? 52.965  -19.256 3.486   1.00 13.63 ? 199  HIS C O   1 
ATOM   9358  C  CB  . HIS C 1 199 ? 53.295  -16.501 5.234   1.00 13.61 ? 199  HIS C CB  1 
ATOM   9359  C  CG  . HIS C 1 199 ? 52.529  -15.219 5.273   1.00 13.41 ? 199  HIS C CG  1 
ATOM   9360  N  ND1 . HIS C 1 199 ? 53.140  -13.985 5.209   1.00 14.12 ? 199  HIS C ND1 1 
ATOM   9361  C  CD2 . HIS C 1 199 ? 51.200  -14.977 5.353   1.00 13.47 ? 199  HIS C CD2 1 
ATOM   9362  C  CE1 . HIS C 1 199 ? 52.224  -13.036 5.259   1.00 13.09 ? 199  HIS C CE1 1 
ATOM   9363  N  NE2 . HIS C 1 199 ? 51.038  -13.611 5.331   1.00 14.54 ? 199  HIS C NE2 1 
ATOM   9364  N  N   . SER C 1 200 ? 55.024  -18.894 4.349   1.00 14.21 ? 200  SER C N   1 
ATOM   9365  C  CA  . SER C 1 200 ? 55.202  -20.245 4.827   1.00 14.45 ? 200  SER C CA  1 
ATOM   9366  C  C   . SER C 1 200 ? 54.717  -20.308 6.275   1.00 14.41 ? 200  SER C C   1 
ATOM   9367  O  O   . SER C 1 200 ? 54.625  -19.275 6.964   1.00 14.27 ? 200  SER C O   1 
ATOM   9368  C  CB  . SER C 1 200 ? 56.663  -20.645 4.746   1.00 14.34 ? 200  SER C CB  1 
ATOM   9369  O  OG  . SER C 1 200 ? 57.454  -19.653 5.368   1.00 17.35 ? 200  SER C OG  1 
ATOM   9370  N  N   . PHE C 1 201 ? 54.404  -21.524 6.710   1.00 13.69 ? 201  PHE C N   1 
ATOM   9371  C  CA  . PHE C 1 201 ? 53.941  -21.828 8.049   1.00 13.20 ? 201  PHE C CA  1 
ATOM   9372  C  C   . PHE C 1 201 ? 54.755  -23.034 8.482   1.00 13.86 ? 201  PHE C C   1 
ATOM   9373  O  O   . PHE C 1 201 ? 55.465  -23.634 7.670   1.00 13.82 ? 201  PHE C O   1 
ATOM   9374  C  CB  . PHE C 1 201 ? 52.457  -22.223 8.017   1.00 12.34 ? 201  PHE C CB  1 
ATOM   9375  C  CG  . PHE C 1 201 ? 51.524  -21.061 7.865   1.00 11.27 ? 201  PHE C CG  1 
ATOM   9376  C  CD1 . PHE C 1 201 ? 50.863  -20.544 8.970   1.00 9.45  ? 201  PHE C CD1 1 
ATOM   9377  C  CD2 . PHE C 1 201 ? 51.321  -20.468 6.619   1.00 9.09  ? 201  PHE C CD2 1 
ATOM   9378  C  CE1 . PHE C 1 201 ? 50.008  -19.468 8.834   1.00 9.90  ? 201  PHE C CE1 1 
ATOM   9379  C  CE2 . PHE C 1 201 ? 50.482  -19.381 6.476   1.00 9.54  ? 201  PHE C CE2 1 
ATOM   9380  C  CZ  . PHE C 1 201 ? 49.821  -18.881 7.580   1.00 10.54 ? 201  PHE C CZ  1 
ATOM   9381  N  N   . LYS C 1 202 ? 54.653  -23.411 9.749   1.00 14.28 ? 202  LYS C N   1 
ATOM   9382  C  CA  . LYS C 1 202 ? 55.359  -24.594 10.203  1.00 14.63 ? 202  LYS C CA  1 
ATOM   9383  C  C   . LYS C 1 202 ? 54.364  -25.688 10.474  1.00 15.38 ? 202  LYS C C   1 
ATOM   9384  O  O   . LYS C 1 202 ? 53.332  -25.460 11.121  1.00 15.38 ? 202  LYS C O   1 
ATOM   9385  C  CB  . LYS C 1 202 ? 56.166  -24.309 11.462  1.00 14.25 ? 202  LYS C CB  1 
ATOM   9386  C  CG  . LYS C 1 202 ? 57.230  -23.271 11.272  1.00 14.33 ? 202  LYS C CG  1 
ATOM   9387  C  CD  . LYS C 1 202 ? 57.961  -23.025 12.572  1.00 14.54 ? 202  LYS C CD  1 
ATOM   9388  C  CE  . LYS C 1 202 ? 59.333  -22.433 12.302  1.00 12.54 ? 202  LYS C CE  1 
ATOM   9389  N  NZ  . LYS C 1 202 ? 59.963  -22.034 13.566  1.00 10.99 ? 202  LYS C NZ  1 
ATOM   9390  N  N   . TRP C 1 203 ? 54.678  -26.879 9.976   1.00 15.82 ? 203  TRP C N   1 
ATOM   9391  C  CA  . TRP C 1 203 ? 53.942  -28.069 10.357  1.00 16.36 ? 203  TRP C CA  1 
ATOM   9392  C  C   . TRP C 1 203 ? 54.831  -28.960 11.208  1.00 16.56 ? 203  TRP C C   1 
ATOM   9393  O  O   . TRP C 1 203 ? 56.021  -29.112 10.919  1.00 17.03 ? 203  TRP C O   1 
ATOM   9394  C  CB  . TRP C 1 203 ? 53.458  -28.803 9.112   1.00 16.48 ? 203  TRP C CB  1 
ATOM   9395  C  CG  . TRP C 1 203 ? 52.264  -28.187 8.476   1.00 16.38 ? 203  TRP C CG  1 
ATOM   9396  C  CD1 . TRP C 1 203 ? 51.700  -26.972 8.773   1.00 17.26 ? 203  TRP C CD1 1 
ATOM   9397  C  CD2 . TRP C 1 203 ? 51.494  -28.734 7.405   1.00 17.18 ? 203  TRP C CD2 1 
ATOM   9398  N  NE1 . TRP C 1 203 ? 50.610  -26.742 7.961   1.00 16.40 ? 203  TRP C NE1 1 
ATOM   9399  C  CE2 . TRP C 1 203 ? 50.462  -27.808 7.112   1.00 17.68 ? 203  TRP C CE2 1 
ATOM   9400  C  CE3 . TRP C 1 203 ? 51.563  -29.927 6.671   1.00 16.85 ? 203  TRP C CE3 1 
ATOM   9401  C  CZ2 . TRP C 1 203 ? 49.502  -28.040 6.106   1.00 18.40 ? 203  TRP C CZ2 1 
ATOM   9402  C  CZ3 . TRP C 1 203 ? 50.612  -30.158 5.676   1.00 17.34 ? 203  TRP C CZ3 1 
ATOM   9403  C  CH2 . TRP C 1 203 ? 49.594  -29.212 5.399   1.00 17.20 ? 203  TRP C CH2 1 
ATOM   9404  N  N   . VAL C 1 204 ? 54.249  -29.545 12.248  1.00 16.65 ? 204  VAL C N   1 
ATOM   9405  C  CA  . VAL C 1 204 ? 54.994  -30.336 13.237  1.00 17.49 ? 204  VAL C CA  1 
ATOM   9406  C  C   . VAL C 1 204 ? 54.344  -31.708 13.368  1.00 17.79 ? 204  VAL C C   1 
ATOM   9407  O  O   . VAL C 1 204 ? 53.135  -31.802 13.576  1.00 18.08 ? 204  VAL C O   1 
ATOM   9408  C  CB  . VAL C 1 204 ? 54.991  -29.656 14.636  1.00 17.21 ? 204  VAL C CB  1 
ATOM   9409  C  CG1 . VAL C 1 204 ? 55.906  -30.391 15.597  1.00 17.59 ? 204  VAL C CG1 1 
ATOM   9410  C  CG2 . VAL C 1 204 ? 55.389  -28.190 14.532  1.00 17.77 ? 204  VAL C CG2 1 
ATOM   9411  N  N   . ASN C 1 205 ? 55.137  -32.764 13.245  1.00 18.44 ? 205  ASN C N   1 
ATOM   9412  C  CA  . ASN C 1 205 ? 54.589  -34.122 13.214  1.00 19.27 ? 205  ASN C CA  1 
ATOM   9413  C  C   . ASN C 1 205 ? 54.653  -34.740 14.600  1.00 19.93 ? 205  ASN C C   1 
ATOM   9414  O  O   . ASN C 1 205 ? 55.271  -34.170 15.500  1.00 20.29 ? 205  ASN C O   1 
ATOM   9415  C  CB  . ASN C 1 205 ? 55.253  -35.002 12.118  1.00 19.16 ? 205  ASN C CB  1 
ATOM   9416  C  CG  . ASN C 1 205 ? 56.765  -35.257 12.352  1.00 18.38 ? 205  ASN C CG  1 
ATOM   9417  O  OD1 . ASN C 1 205 ? 57.243  -35.286 13.481  1.00 18.15 ? 205  ASN C OD1 1 
ATOM   9418  N  ND2 . ASN C 1 205 ? 57.500  -35.469 11.266  1.00 16.36 ? 205  ASN C ND2 1 
ATOM   9419  N  N   . ALA C 1 206 ? 53.995  -35.880 14.778  1.00 20.95 ? 206  ALA C N   1 
ATOM   9420  C  CA  . ALA C 1 206 ? 53.925  -36.547 16.085  1.00 22.24 ? 206  ALA C CA  1 
ATOM   9421  C  C   . ALA C 1 206 ? 55.308  -36.753 16.682  1.00 22.90 ? 206  ALA C C   1 
ATOM   9422  O  O   . ALA C 1 206 ? 55.474  -36.659 17.890  1.00 23.02 ? 206  ALA C O   1 
ATOM   9423  C  CB  . ALA C 1 206 ? 53.181  -37.894 15.974  1.00 22.22 ? 206  ALA C CB  1 
ATOM   9424  N  N   . HIS C 1 207 ? 56.289  -37.008 15.812  1.00 24.13 ? 207  HIS C N   1 
ATOM   9425  C  CA  . HIS C 1 207 ? 57.686  -37.220 16.190  1.00 25.09 ? 207  HIS C CA  1 
ATOM   9426  C  C   . HIS C 1 207 ? 58.389  -35.948 16.668  1.00 24.99 ? 207  HIS C C   1 
ATOM   9427  O  O   . HIS C 1 207 ? 59.412  -36.030 17.350  1.00 25.49 ? 207  HIS C O   1 
ATOM   9428  C  CB  . HIS C 1 207 ? 58.460  -37.835 15.012  1.00 25.95 ? 207  HIS C CB  1 
ATOM   9429  C  CG  . HIS C 1 207 ? 59.819  -38.347 15.382  1.00 29.29 ? 207  HIS C CG  1 
ATOM   9430  N  ND1 . HIS C 1 207 ? 60.005  -39.466 16.170  1.00 32.93 ? 207  HIS C ND1 1 
ATOM   9431  C  CD2 . HIS C 1 207 ? 61.059  -37.891 15.078  1.00 31.50 ? 207  HIS C CD2 1 
ATOM   9432  C  CE1 . HIS C 1 207 ? 61.301  -39.674 16.338  1.00 33.44 ? 207  HIS C CE1 1 
ATOM   9433  N  NE2 . HIS C 1 207 ? 61.962  -38.733 15.685  1.00 32.68 ? 207  HIS C NE2 1 
ATOM   9434  N  N   . GLY C 1 208 ? 57.863  -34.773 16.312  1.00 24.59 ? 208  GLY C N   1 
ATOM   9435  C  CA  . GLY C 1 208 ? 58.461  -33.507 16.754  1.00 23.69 ? 208  GLY C CA  1 
ATOM   9436  C  C   . GLY C 1 208 ? 59.347  -32.785 15.746  1.00 23.29 ? 208  GLY C C   1 
ATOM   9437  O  O   . GLY C 1 208 ? 59.968  -31.767 16.083  1.00 23.27 ? 208  GLY C O   1 
ATOM   9438  N  N   . ASN C 1 209 ? 59.400  -33.297 14.513  1.00 22.24 ? 209  ASN C N   1 
ATOM   9439  C  CA  . ASN C 1 209 ? 60.085  -32.613 13.424  1.00 21.43 ? 209  ASN C CA  1 
ATOM   9440  C  C   . ASN C 1 209 ? 59.181  -31.560 12.799  1.00 20.38 ? 209  ASN C C   1 
ATOM   9441  O  O   . ASN C 1 209 ? 57.973  -31.775 12.601  1.00 20.19 ? 209  ASN C O   1 
ATOM   9442  C  CB  . ASN C 1 209 ? 60.551  -33.599 12.333  1.00 22.13 ? 209  ASN C CB  1 
ATOM   9443  C  CG  . ASN C 1 209 ? 61.311  -34.794 12.890  1.00 24.13 ? 209  ASN C CG  1 
ATOM   9444  O  OD1 . ASN C 1 209 ? 60.949  -35.939 12.635  1.00 28.96 ? 209  ASN C OD1 1 
ATOM   9445  N  ND2 . ASN C 1 209 ? 62.356  -34.535 13.654  1.00 25.71 ? 209  ASN C ND2 1 
ATOM   9446  N  N   . THR C 1 210 ? 59.770  -30.424 12.464  1.00 19.01 ? 210  THR C N   1 
ATOM   9447  C  CA  . THR C 1 210 ? 59.002  -29.347 11.870  1.00 18.42 ? 210  THR C CA  1 
ATOM   9448  C  C   . THR C 1 210 ? 59.530  -29.009 10.489  1.00 18.40 ? 210  THR C C   1 
ATOM   9449  O  O   . THR C 1 210 ? 60.742  -29.037 10.252  1.00 18.67 ? 210  THR C O   1 
ATOM   9450  C  CB  . THR C 1 210 ? 58.813  -28.068 12.807  1.00 18.06 ? 210  THR C CB  1 
ATOM   9451  O  OG1 . THR C 1 210 ? 59.034  -26.866 12.058  1.00 18.02 ? 210  THR C OG1 1 
ATOM   9452  C  CG2 . THR C 1 210 ? 59.715  -28.079 13.997  1.00 17.02 ? 210  THR C CG2 1 
ATOM   9453  N  N   . VAL C 1 211 ? 58.604  -28.724 9.577   1.00 17.63 ? 211  VAL C N   1 
ATOM   9454  C  CA  . VAL C 1 211 ? 58.962  -28.297 8.244   1.00 17.12 ? 211  VAL C CA  1 
ATOM   9455  C  C   . VAL C 1 211 ? 58.265  -26.980 7.921   1.00 17.28 ? 211  VAL C C   1 
ATOM   9456  O  O   . VAL C 1 211 ? 57.197  -26.685 8.461   1.00 17.47 ? 211  VAL C O   1 
ATOM   9457  C  CB  . VAL C 1 211 ? 58.659  -29.386 7.173   1.00 17.21 ? 211  VAL C CB  1 
ATOM   9458  C  CG1 . VAL C 1 211 ? 59.637  -30.566 7.312   1.00 16.72 ? 211  VAL C CG1 1 
ATOM   9459  C  CG2 . VAL C 1 211 ? 57.190  -29.866 7.234   1.00 17.12 ? 211  VAL C CG2 1 
ATOM   9460  N  N   . TYR C 1 212 ? 58.893  -26.171 7.071   1.00 17.42 ? 212  TYR C N   1 
ATOM   9461  C  CA  . TYR C 1 212 ? 58.229  -25.011 6.504   1.00 17.17 ? 212  TYR C CA  1 
ATOM   9462  C  C   . TYR C 1 212 ? 57.331  -25.458 5.389   1.00 17.06 ? 212  TYR C C   1 
ATOM   9463  O  O   . TYR C 1 212 ? 57.710  -26.308 4.576   1.00 17.51 ? 212  TYR C O   1 
ATOM   9464  C  CB  . TYR C 1 212 ? 59.232  -23.980 5.999   1.00 17.12 ? 212  TYR C CB  1 
ATOM   9465  C  CG  . TYR C 1 212 ? 59.898  -23.214 7.119   1.00 18.23 ? 212  TYR C CG  1 
ATOM   9466  C  CD1 . TYR C 1 212 ? 59.172  -22.302 7.903   1.00 17.21 ? 212  TYR C CD1 1 
ATOM   9467  C  CD2 . TYR C 1 212 ? 61.262  -23.397 7.406   1.00 18.13 ? 212  TYR C CD2 1 
ATOM   9468  C  CE1 . TYR C 1 212 ? 59.787  -21.597 8.930   1.00 16.79 ? 212  TYR C CE1 1 
ATOM   9469  C  CE2 . TYR C 1 212 ? 61.887  -22.693 8.441   1.00 15.93 ? 212  TYR C CE2 1 
ATOM   9470  C  CZ  . TYR C 1 212 ? 61.144  -21.799 9.190   1.00 17.29 ? 212  TYR C CZ  1 
ATOM   9471  O  OH  . TYR C 1 212 ? 61.759  -21.107 10.211  1.00 18.41 ? 212  TYR C OH  1 
ATOM   9472  N  N   . ILE C 1 213 ? 56.131  -24.890 5.349   1.00 16.81 ? 213  ILE C N   1 
ATOM   9473  C  CA  . ILE C 1 213 ? 55.171  -25.240 4.318   1.00 16.43 ? 213  ILE C CA  1 
ATOM   9474  C  C   . ILE C 1 213 ? 54.540  -24.009 3.705   1.00 16.64 ? 213  ILE C C   1 
ATOM   9475  O  O   . ILE C 1 213 ? 54.402  -22.984 4.361   1.00 16.83 ? 213  ILE C O   1 
ATOM   9476  C  CB  . ILE C 1 213 ? 54.051  -26.215 4.850   1.00 16.40 ? 213  ILE C CB  1 
ATOM   9477  C  CG1 . ILE C 1 213 ? 53.105  -25.502 5.840   1.00 16.00 ? 213  ILE C CG1 1 
ATOM   9478  C  CG2 . ILE C 1 213 ? 54.662  -27.477 5.474   1.00 15.22 ? 213  ILE C CG2 1 
ATOM   9479  C  CD1 . ILE C 1 213 ? 51.923  -24.789 5.169   1.00 13.35 ? 213  ILE C CD1 1 
ATOM   9480  N  N   . LYS C 1 214 ? 54.146  -24.138 2.442   1.00 16.92 ? 214  LYS C N   1 
ATOM   9481  C  CA  . LYS C 1 214 ? 53.346  -23.139 1.749   1.00 16.98 ? 214  LYS C CA  1 
ATOM   9482  C  C   . LYS C 1 214 ? 52.114  -23.882 1.246   1.00 17.36 ? 214  LYS C C   1 
ATOM   9483  O  O   . LYS C 1 214 ? 52.194  -25.078 0.945   1.00 17.62 ? 214  LYS C O   1 
ATOM   9484  C  CB  . LYS C 1 214 ? 54.123  -22.569 0.576   1.00 16.79 ? 214  LYS C CB  1 
ATOM   9485  C  CG  . LYS C 1 214 ? 54.122  -21.084 0.458   1.00 16.34 ? 214  LYS C CG  1 
ATOM   9486  C  CD  . LYS C 1 214 ? 55.410  -20.438 0.933   1.00 16.77 ? 214  LYS C CD  1 
ATOM   9487  C  CE  . LYS C 1 214 ? 55.860  -19.413 -0.119  1.00 17.03 ? 214  LYS C CE  1 
ATOM   9488  N  NZ  . LYS C 1 214 ? 56.284  -18.070 0.341   1.00 13.66 ? 214  LYS C NZ  1 
ATOM   9489  N  N   . LEU C 1 215 ? 50.973  -23.198 1.195   1.00 17.55 ? 215  LEU C N   1 
ATOM   9490  C  CA  . LEU C 1 215 ? 49.723  -23.834 0.779   1.00 17.97 ? 215  LEU C CA  1 
ATOM   9491  C  C   . LEU C 1 215 ? 49.242  -23.274 -0.525  1.00 17.98 ? 215  LEU C C   1 
ATOM   9492  O  O   . LEU C 1 215 ? 49.477  -22.115 -0.837  1.00 17.76 ? 215  LEU C O   1 
ATOM   9493  C  CB  . LEU C 1 215 ? 48.623  -23.685 1.835   1.00 18.05 ? 215  LEU C CB  1 
ATOM   9494  C  CG  . LEU C 1 215 ? 48.199  -24.878 2.715   1.00 17.65 ? 215  LEU C CG  1 
ATOM   9495  C  CD1 . LEU C 1 215 ? 49.082  -26.126 2.579   1.00 15.04 ? 215  LEU C CD1 1 
ATOM   9496  C  CD2 . LEU C 1 215 ? 48.052  -24.452 4.172   1.00 15.31 ? 215  LEU C CD2 1 
ATOM   9497  N  N   . ARG C 1 216 ? 48.514  -24.106 -1.258  1.00 18.77 ? 216  ARG C N   1 
ATOM   9498  C  CA  . ARG C 1 216 ? 48.174  -23.823 -2.636  1.00 18.84 ? 216  ARG C CA  1 
ATOM   9499  C  C   . ARG C 1 216 ? 46.787  -24.303 -3.029  1.00 19.06 ? 216  ARG C C   1 
ATOM   9500  O  O   . ARG C 1 216 ? 46.474  -25.467 -2.865  1.00 18.87 ? 216  ARG C O   1 
ATOM   9501  C  CB  . ARG C 1 216 ? 49.223  -24.502 -3.507  1.00 18.99 ? 216  ARG C CB  1 
ATOM   9502  C  CG  . ARG C 1 216 ? 50.036  -23.561 -4.318  1.00 18.24 ? 216  ARG C CG  1 
ATOM   9503  C  CD  . ARG C 1 216 ? 51.160  -22.829 -3.622  1.00 15.88 ? 216  ARG C CD  1 
ATOM   9504  N  NE  . ARG C 1 216 ? 51.436  -21.713 -4.509  1.00 16.72 ? 216  ARG C NE  1 
ATOM   9505  C  CZ  . ARG C 1 216 ? 52.604  -21.137 -4.745  1.00 17.08 ? 216  ARG C CZ  1 
ATOM   9506  N  NH1 . ARG C 1 216 ? 53.732  -21.517 -4.141  1.00 16.46 ? 216  ARG C NH1 1 
ATOM   9507  N  NH2 . ARG C 1 216 ? 52.618  -20.141 -5.610  1.00 17.35 ? 216  ARG C NH2 1 
ATOM   9508  N  N   . TRP C 1 217 ? 45.962  -23.398 -3.556  1.00 19.95 ? 217  TRP C N   1 
ATOM   9509  C  CA  . TRP C 1 217 ? 44.627  -23.754 -4.069  1.00 20.53 ? 217  TRP C CA  1 
ATOM   9510  C  C   . TRP C 1 217 ? 44.592  -23.660 -5.592  1.00 21.11 ? 217  TRP C C   1 
ATOM   9511  O  O   . TRP C 1 217 ? 45.018  -22.648 -6.176  1.00 20.76 ? 217  TRP C O   1 
ATOM   9512  C  CB  . TRP C 1 217 ? 43.515  -22.866 -3.473  1.00 20.56 ? 217  TRP C CB  1 
ATOM   9513  C  CG  . TRP C 1 217 ? 43.262  -23.061 -1.989  1.00 21.04 ? 217  TRP C CG  1 
ATOM   9514  C  CD1 . TRP C 1 217 ? 43.661  -22.231 -0.975  1.00 21.33 ? 217  TRP C CD1 1 
ATOM   9515  C  CD2 . TRP C 1 217 ? 42.553  -24.138 -1.364  1.00 19.86 ? 217  TRP C CD2 1 
ATOM   9516  N  NE1 . TRP C 1 217 ? 43.247  -22.727 0.237   1.00 20.86 ? 217  TRP C NE1 1 
ATOM   9517  C  CE2 . TRP C 1 217 ? 42.569  -23.898 0.029   1.00 19.75 ? 217  TRP C CE2 1 
ATOM   9518  C  CE3 . TRP C 1 217 ? 41.924  -25.292 -1.841  1.00 20.38 ? 217  TRP C CE3 1 
ATOM   9519  C  CZ2 . TRP C 1 217 ? 41.973  -24.759 0.944   1.00 19.73 ? 217  TRP C CZ2 1 
ATOM   9520  C  CZ3 . TRP C 1 217 ? 41.327  -26.155 -0.926  1.00 20.85 ? 217  TRP C CZ3 1 
ATOM   9521  C  CH2 . TRP C 1 217 ? 41.355  -25.878 0.453   1.00 20.92 ? 217  TRP C CH2 1 
ATOM   9522  N  N   . VAL C 1 218 ? 44.082  -24.721 -6.220  1.00 21.51 ? 218  VAL C N   1 
ATOM   9523  C  CA  . VAL C 1 218 ? 44.049  -24.839 -7.681  1.00 22.37 ? 218  VAL C CA  1 
ATOM   9524  C  C   . VAL C 1 218 ? 42.597  -25.023 -8.165  1.00 22.74 ? 218  VAL C C   1 
ATOM   9525  O  O   . VAL C 1 218 ? 41.927  -25.997 -7.789  1.00 22.99 ? 218  VAL C O   1 
ATOM   9526  C  CB  . VAL C 1 218 ? 44.973  -26.001 -8.188  1.00 22.52 ? 218  VAL C CB  1 
ATOM   9527  C  CG1 . VAL C 1 218 ? 44.892  -26.165 -9.725  1.00 23.24 ? 218  VAL C CG1 1 
ATOM   9528  C  CG2 . VAL C 1 218 ? 46.431  -25.772 -7.771  1.00 21.67 ? 218  VAL C CG2 1 
ATOM   9529  N  N   . PRO C 1 219 ? 42.108  -24.088 -8.998  1.00 22.95 ? 219  PRO C N   1 
ATOM   9530  C  CA  . PRO C 1 219 ? 40.704  -24.108 -9.402  1.00 23.97 ? 219  PRO C CA  1 
ATOM   9531  C  C   . PRO C 1 219 ? 40.375  -25.192 -10.447 1.00 25.15 ? 219  PRO C C   1 
ATOM   9532  O  O   . PRO C 1 219 ? 41.031  -25.272 -11.497 1.00 25.27 ? 219  PRO C O   1 
ATOM   9533  C  CB  . PRO C 1 219 ? 40.480  -22.705 -9.974  1.00 23.56 ? 219  PRO C CB  1 
ATOM   9534  C  CG  . PRO C 1 219 ? 41.823  -22.240 -10.406 1.00 22.88 ? 219  PRO C CG  1 
ATOM   9535  C  CD  . PRO C 1 219 ? 42.856  -22.974 -9.610  1.00 22.89 ? 219  PRO C CD  1 
ATOM   9536  N  N   . LYS C 1 220 ? 39.367  -26.019 -10.159 1.00 26.38 ? 220  LYS C N   1 
ATOM   9537  C  CA  . LYS C 1 220 ? 38.903  -27.014 -11.138 1.00 28.10 ? 220  LYS C CA  1 
ATOM   9538  C  C   . LYS C 1 220 ? 38.482  -26.313 -12.428 1.00 28.16 ? 220  LYS C C   1 
ATOM   9539  O  O   . LYS C 1 220 ? 38.763  -26.820 -13.516 1.00 28.45 ? 220  LYS C O   1 
ATOM   9540  C  CB  . LYS C 1 220 ? 37.763  -27.898 -10.602 1.00 27.82 ? 220  LYS C CB  1 
ATOM   9541  C  CG  . LYS C 1 220 ? 37.438  -29.091 -11.518 1.00 29.05 ? 220  LYS C CG  1 
ATOM   9542  C  CD  . LYS C 1 220 ? 36.477  -30.092 -10.858 1.00 30.17 ? 220  LYS C CD  1 
ATOM   9543  C  CE  . LYS C 1 220 ? 36.964  -31.564 -11.022 1.00 33.33 ? 220  LYS C CE  1 
ATOM   9544  N  NZ  . LYS C 1 220 ? 36.285  -32.319 -12.124 1.00 32.98 ? 220  LYS C NZ  1 
ATOM   9545  N  N   . GLU C 1 221 ? 37.855  -25.136 -12.286 1.00 28.22 ? 221  GLU C N   1 
ATOM   9546  C  CA  . GLU C 1 221 ? 37.402  -24.305 -13.418 1.00 28.11 ? 221  GLU C CA  1 
ATOM   9547  C  C   . GLU C 1 221 ? 38.532  -23.496 -14.066 1.00 27.63 ? 221  GLU C C   1 
ATOM   9548  O  O   . GLU C 1 221 ? 38.269  -22.639 -14.921 1.00 27.23 ? 221  GLU C O   1 
ATOM   9549  C  CB  . GLU C 1 221 ? 36.289  -23.328 -12.982 1.00 28.34 ? 221  GLU C CB  1 
ATOM   9550  C  CG  . GLU C 1 221 ? 35.344  -23.821 -11.871 1.00 29.92 ? 221  GLU C CG  1 
ATOM   9551  C  CD  . GLU C 1 221 ? 34.096  -24.542 -12.381 1.00 31.61 ? 221  GLU C CD  1 
ATOM   9552  O  OE1 . GLU C 1 221 ? 34.151  -25.182 -13.456 1.00 30.08 ? 221  GLU C OE1 1 
ATOM   9553  O  OE2 . GLU C 1 221 ? 33.053  -24.471 -11.682 1.00 34.15 ? 221  GLU C OE2 1 
ATOM   9554  N  N   . GLY C 1 222 ? 39.777  -23.751 -13.641 1.00 27.23 ? 222  GLY C N   1 
ATOM   9555  C  CA  . GLY C 1 222 ? 40.963  -23.039 -14.153 1.00 26.50 ? 222  GLY C CA  1 
ATOM   9556  C  C   . GLY C 1 222 ? 41.010  -21.554 -13.791 1.00 26.42 ? 222  GLY C C   1 
ATOM   9557  O  O   . GLY C 1 222 ? 40.025  -20.982 -13.314 1.00 26.18 ? 222  GLY C O   1 
ATOM   9558  N  N   . VAL C 1 223 ? 42.165  -20.932 -14.020 1.00 25.94 ? 223  VAL C N   1 
ATOM   9559  C  CA  . VAL C 1 223 ? 42.369  -19.518 -13.742 1.00 25.58 ? 223  VAL C CA  1 
ATOM   9560  C  C   . VAL C 1 223 ? 41.926  -18.715 -14.970 1.00 25.89 ? 223  VAL C C   1 
ATOM   9561  O  O   . VAL C 1 223 ? 42.435  -18.933 -16.065 1.00 25.90 ? 223  VAL C O   1 
ATOM   9562  C  CB  . VAL C 1 223 ? 43.876  -19.232 -13.400 1.00 25.63 ? 223  VAL C CB  1 
ATOM   9563  C  CG1 . VAL C 1 223 ? 44.160  -17.737 -13.287 1.00 24.89 ? 223  VAL C CG1 1 
ATOM   9564  C  CG2 . VAL C 1 223 ? 44.300  -19.964 -12.122 1.00 24.72 ? 223  VAL C CG2 1 
ATOM   9565  N  N   . HIS C 1 224 ? 40.975  -17.801 -14.790 1.00 25.74 ? 224  HIS C N   1 
ATOM   9566  C  CA  . HIS C 1 224 ? 40.510  -16.945 -15.885 1.00 25.79 ? 224  HIS C CA  1 
ATOM   9567  C  C   . HIS C 1 224 ? 40.504  -15.476 -15.468 1.00 25.46 ? 224  HIS C C   1 
ATOM   9568  O  O   . HIS C 1 224 ? 40.087  -15.134 -14.361 1.00 24.86 ? 224  HIS C O   1 
ATOM   9569  C  CB  . HIS C 1 224 ? 39.138  -17.400 -16.422 1.00 25.89 ? 224  HIS C CB  1 
ATOM   9570  C  CG  . HIS C 1 224 ? 39.144  -18.795 -16.976 1.00 27.75 ? 224  HIS C CG  1 
ATOM   9571  N  ND1 . HIS C 1 224 ? 39.310  -19.067 -18.321 1.00 28.88 ? 224  HIS C ND1 1 
ATOM   9572  C  CD2 . HIS C 1 224 ? 39.048  -19.999 -16.360 1.00 29.15 ? 224  HIS C CD2 1 
ATOM   9573  C  CE1 . HIS C 1 224 ? 39.300  -20.375 -18.509 1.00 28.42 ? 224  HIS C CE1 1 
ATOM   9574  N  NE2 . HIS C 1 224 ? 39.145  -20.964 -17.336 1.00 29.92 ? 224  HIS C NE2 1 
ATOM   9575  N  N   . ASN C 1 225 ? 40.985  -14.618 -16.371 1.00 25.48 ? 225  ASN C N   1 
ATOM   9576  C  CA  . ASN C 1 225 ? 41.235  -13.211 -16.067 1.00 25.53 ? 225  ASN C CA  1 
ATOM   9577  C  C   . ASN C 1 225 ? 40.546  -12.265 -17.035 1.00 25.98 ? 225  ASN C C   1 
ATOM   9578  O  O   . ASN C 1 225 ? 40.050  -12.686 -18.078 1.00 26.47 ? 225  ASN C O   1 
ATOM   9579  C  CB  . ASN C 1 225 ? 42.736  -12.941 -16.023 1.00 25.08 ? 225  ASN C CB  1 
ATOM   9580  C  CG  . ASN C 1 225 ? 43.443  -13.779 -14.968 1.00 25.11 ? 225  ASN C CG  1 
ATOM   9581  O  OD1 . ASN C 1 225 ? 44.533  -14.308 -15.202 1.00 24.20 ? 225  ASN C OD1 1 
ATOM   9582  N  ND2 . ASN C 1 225 ? 42.810  -13.922 -13.806 1.00 23.34 ? 225  ASN C ND2 1 
ATOM   9583  N  N   . LEU C 1 226 ? 40.489  -10.990 -16.674 1.00 26.12 ? 226  LEU C N   1 
ATOM   9584  C  CA  . LEU C 1 226 ? 39.879  -9.986  -17.540 1.00 26.55 ? 226  LEU C CA  1 
ATOM   9585  C  C   . LEU C 1 226 ? 40.867  -8.872  -17.855 1.00 27.13 ? 226  LEU C C   1 
ATOM   9586  O  O   . LEU C 1 226 ? 41.445  -8.273  -16.943 1.00 27.58 ? 226  LEU C O   1 
ATOM   9587  C  CB  . LEU C 1 226 ? 38.620  -9.389  -16.895 1.00 25.73 ? 226  LEU C CB  1 
ATOM   9588  C  CG  . LEU C 1 226 ? 37.549  -10.340 -16.372 1.00 24.72 ? 226  LEU C CG  1 
ATOM   9589  C  CD1 . LEU C 1 226 ? 36.467  -9.528  -15.696 1.00 24.92 ? 226  LEU C CD1 1 
ATOM   9590  C  CD2 . LEU C 1 226 ? 36.974  -11.221 -17.486 1.00 23.81 ? 226  LEU C CD2 1 
ATOM   9591  N  N   . SER C 1 227 ? 41.050  -8.599  -19.142 1.00 27.46 ? 227  SER C N   1 
ATOM   9592  C  CA  . SER C 1 227 ? 41.799  -7.435  -19.584 1.00 28.14 ? 227  SER C CA  1 
ATOM   9593  C  C   . SER C 1 227 ? 41.110  -6.218  -18.992 1.00 28.27 ? 227  SER C C   1 
ATOM   9594  O  O   . SER C 1 227 ? 39.989  -6.331  -18.471 1.00 28.94 ? 227  SER C O   1 
ATOM   9595  C  CB  . SER C 1 227 ? 41.784  -7.334  -21.117 1.00 28.14 ? 227  SER C CB  1 
ATOM   9596  O  OG  . SER C 1 227 ? 40.462  -7.089  -21.594 1.00 28.03 ? 227  SER C OG  1 
ATOM   9597  N  N   . ALA C 1 228 ? 41.765  -5.061  -19.084 1.00 28.33 ? 228  ALA C N   1 
ATOM   9598  C  CA  . ALA C 1 228 ? 41.187  -3.803  -18.625 1.00 28.29 ? 228  ALA C CA  1 
ATOM   9599  C  C   . ALA C 1 228 ? 39.837  -3.550  -19.314 1.00 28.44 ? 228  ALA C C   1 
ATOM   9600  O  O   . ALA C 1 228 ? 38.803  -3.460  -18.661 1.00 28.26 ? 228  ALA C O   1 
ATOM   9601  C  CB  . ALA C 1 228 ? 42.168  -2.637  -18.863 1.00 27.95 ? 228  ALA C CB  1 
ATOM   9602  N  N   . ASP C 1 229 ? 39.854  -3.485  -20.640 1.00 28.69 ? 229  ASP C N   1 
ATOM   9603  C  CA  . ASP C 1 229 ? 38.649  -3.213  -21.421 1.00 28.88 ? 229  ASP C CA  1 
ATOM   9604  C  C   . ASP C 1 229 ? 37.509  -4.189  -21.122 1.00 28.11 ? 229  ASP C C   1 
ATOM   9605  O  O   . ASP C 1 229 ? 36.361  -3.773  -20.989 1.00 28.07 ? 229  ASP C O   1 
ATOM   9606  C  CB  . ASP C 1 229 ? 38.993  -3.169  -22.920 1.00 29.33 ? 229  ASP C CB  1 
ATOM   9607  C  CG  . ASP C 1 229 ? 40.066  -2.123  -23.239 1.00 31.81 ? 229  ASP C CG  1 
ATOM   9608  O  OD1 . ASP C 1 229 ? 41.061  -2.462  -23.913 1.00 35.47 ? 229  ASP C OD1 1 
ATOM   9609  O  OD2 . ASP C 1 229 ? 39.939  -0.962  -22.793 1.00 33.65 ? 229  ASP C OD2 1 
ATOM   9610  N  N   . GLU C 1 230 ? 37.830  -5.473  -21.014 1.00 27.69 ? 230  GLU C N   1 
ATOM   9611  C  CA  . GLU C 1 230 ? 36.846  -6.474  -20.622 1.00 28.04 ? 230  GLU C CA  1 
ATOM   9612  C  C   . GLU C 1 230 ? 36.253  -6.170  -19.246 1.00 27.15 ? 230  GLU C C   1 
ATOM   9613  O  O   . GLU C 1 230 ? 35.045  -6.297  -19.059 1.00 27.22 ? 230  GLU C O   1 
ATOM   9614  C  CB  . GLU C 1 230 ? 37.454  -7.875  -20.611 1.00 28.16 ? 230  GLU C CB  1 
ATOM   9615  C  CG  . GLU C 1 230 ? 37.429  -8.602  -21.961 1.00 30.41 ? 230  GLU C CG  1 
ATOM   9616  C  CD  . GLU C 1 230 ? 38.143  -9.953  -21.908 1.00 30.22 ? 230  GLU C CD  1 
ATOM   9617  O  OE1 . GLU C 1 230 ? 37.654  -10.920 -22.534 1.00 33.98 ? 230  GLU C OE1 1 
ATOM   9618  O  OE2 . GLU C 1 230 ? 39.181  -10.056 -21.220 1.00 32.14 ? 230  GLU C OE2 1 
ATOM   9619  N  N   . ALA C 1 231 ? 37.097  -5.773  -18.287 1.00 26.36 ? 231  ALA C N   1 
ATOM   9620  C  CA  . ALA C 1 231 ? 36.611  -5.424  -16.949 1.00 25.53 ? 231  ALA C CA  1 
ATOM   9621  C  C   . ALA C 1 231 ? 35.716  -4.170  -16.995 1.00 25.11 ? 231  ALA C C   1 
ATOM   9622  O  O   . ALA C 1 231 ? 34.728  -4.088  -16.260 1.00 24.88 ? 231  ALA C O   1 
ATOM   9623  C  CB  . ALA C 1 231 ? 37.763  -5.252  -15.973 1.00 24.92 ? 231  ALA C CB  1 
ATOM   9624  N  N   . THR C 1 232 ? 36.061  -3.218  -17.868 1.00 24.46 ? 232  THR C N   1 
ATOM   9625  C  CA  . THR C 1 232 ? 35.269  -2.009  -18.102 1.00 24.46 ? 232  THR C CA  1 
ATOM   9626  C  C   . THR C 1 232 ? 33.906  -2.348  -18.692 1.00 24.58 ? 232  THR C C   1 
ATOM   9627  O  O   . THR C 1 232 ? 32.911  -1.711  -18.358 1.00 24.58 ? 232  THR C O   1 
ATOM   9628  C  CB  . THR C 1 232 ? 36.026  -1.014  -19.036 1.00 24.80 ? 232  THR C CB  1 
ATOM   9629  O  OG1 . THR C 1 232 ? 37.168  -0.479  -18.341 1.00 25.99 ? 232  THR C OG1 1 
ATOM   9630  C  CG2 . THR C 1 232 ? 35.137  0.138   -19.477 1.00 24.19 ? 232  THR C CG2 1 
ATOM   9631  N  N   . GLU C 1 233 ? 33.849  -3.352  -19.565 1.00 24.72 ? 233  GLU C N   1 
ATOM   9632  C  CA  . GLU C 1 233 ? 32.574  -3.733  -20.149 1.00 25.11 ? 233  GLU C CA  1 
ATOM   9633  C  C   . GLU C 1 233 ? 31.673  -4.331  -19.083 1.00 24.03 ? 233  GLU C C   1 
ATOM   9634  O  O   . GLU C 1 233 ? 30.522  -3.917  -18.936 1.00 23.60 ? 233  GLU C O   1 
ATOM   9635  C  CB  . GLU C 1 233 ? 32.724  -4.680  -21.362 1.00 25.69 ? 233  GLU C CB  1 
ATOM   9636  C  CG  . GLU C 1 233 ? 32.702  -3.960  -22.714 1.00 29.84 ? 233  GLU C CG  1 
ATOM   9637  C  CD  . GLU C 1 233 ? 31.943  -4.735  -23.796 1.00 35.33 ? 233  GLU C CD  1 
ATOM   9638  O  OE1 . GLU C 1 233 ? 30.743  -4.422  -24.032 1.00 37.11 ? 233  GLU C OE1 1 
ATOM   9639  O  OE2 . GLU C 1 233 ? 32.539  -5.659  -24.404 1.00 36.25 ? 233  GLU C OE2 1 
ATOM   9640  N  N   . VAL C 1 234 ? 32.209  -5.291  -18.341 1.00 23.18 ? 234  VAL C N   1 
ATOM   9641  C  CA  . VAL C 1 234 ? 31.444  -5.984  -17.311 1.00 22.83 ? 234  VAL C CA  1 
ATOM   9642  C  C   . VAL C 1 234 ? 30.932  -4.991  -16.275 1.00 22.40 ? 234  VAL C C   1 
ATOM   9643  O  O   . VAL C 1 234 ? 29.762  -5.025  -15.884 1.00 21.75 ? 234  VAL C O   1 
ATOM   9644  C  CB  . VAL C 1 234 ? 32.264  -7.134  -16.654 1.00 22.96 ? 234  VAL C CB  1 
ATOM   9645  C  CG1 . VAL C 1 234 ? 31.601  -7.614  -15.354 1.00 22.92 ? 234  VAL C CG1 1 
ATOM   9646  C  CG2 . VAL C 1 234 ? 32.434  -8.338  -17.646 1.00 22.54 ? 234  VAL C CG2 1 
ATOM   9647  N  N   . GLN C 1 235 ? 31.810  -4.068  -15.890 1.00 22.50 ? 235  GLN C N   1 
ATOM   9648  C  CA  . GLN C 1 235 ? 31.541  -3.124  -14.807 1.00 22.46 ? 235  GLN C CA  1 
ATOM   9649  C  C   . GLN C 1 235 ? 30.316  -2.237  -15.057 1.00 23.06 ? 235  GLN C C   1 
ATOM   9650  O  O   . GLN C 1 235 ? 29.557  -1.976  -14.131 1.00 23.42 ? 235  GLN C O   1 
ATOM   9651  C  CB  . GLN C 1 235 ? 32.786  -2.284  -14.508 1.00 21.80 ? 235  GLN C CB  1 
ATOM   9652  C  CG  . GLN C 1 235 ? 32.601  -1.382  -13.328 1.00 19.67 ? 235  GLN C CG  1 
ATOM   9653  C  CD  . GLN C 1 235 ? 33.858  -0.699  -12.916 1.00 17.14 ? 235  GLN C CD  1 
ATOM   9654  O  OE1 . GLN C 1 235 ? 33.969  0.529   -13.022 1.00 19.03 ? 235  GLN C OE1 1 
ATOM   9655  N  NE2 . GLN C 1 235 ? 34.813  -1.469  -12.424 1.00 14.25 ? 235  GLN C NE2 1 
ATOM   9656  N  N   . GLY C 1 236 ? 30.131  -1.798  -16.303 1.00 23.98 ? 236  GLY C N   1 
ATOM   9657  C  CA  . GLY C 1 236 ? 28.980  -0.977  -16.698 1.00 24.71 ? 236  GLY C CA  1 
ATOM   9658  C  C   . GLY C 1 236 ? 27.628  -1.667  -16.543 1.00 25.64 ? 236  GLY C C   1 
ATOM   9659  O  O   . GLY C 1 236 ? 26.604  -1.003  -16.306 1.00 25.78 ? 236  GLY C O   1 
ATOM   9660  N  N   . LYS C 1 237 ? 27.606  -2.993  -16.658 1.00 26.12 ? 237  LYS C N   1 
ATOM   9661  C  CA  . LYS C 1 237 ? 26.338  -3.723  -16.564 1.00 27.17 ? 237  LYS C CA  1 
ATOM   9662  C  C   . LYS C 1 237 ? 26.107  -4.503  -15.270 1.00 27.07 ? 237  LYS C C   1 
ATOM   9663  O  O   . LYS C 1 237 ? 24.966  -4.829  -14.947 1.00 27.39 ? 237  LYS C O   1 
ATOM   9664  C  CB  . LYS C 1 237 ? 26.120  -4.615  -17.794 1.00 27.99 ? 237  LYS C CB  1 
ATOM   9665  C  CG  . LYS C 1 237 ? 25.220  -3.945  -18.841 1.00 29.34 ? 237  LYS C CG  1 
ATOM   9666  C  CD  . LYS C 1 237 ? 25.779  -4.116  -20.253 1.00 32.69 ? 237  LYS C CD  1 
ATOM   9667  C  CE  . LYS C 1 237 ? 25.456  -2.899  -21.159 1.00 33.96 ? 237  LYS C CE  1 
ATOM   9668  N  NZ  . LYS C 1 237 ? 24.058  -2.362  -20.968 1.00 33.22 ? 237  LYS C NZ  1 
ATOM   9669  N  N   . ASP C 1 238 ? 27.185  -4.794  -14.539 1.00 26.79 ? 238  ASP C N   1 
ATOM   9670  C  CA  . ASP C 1 238 ? 27.115  -5.528  -13.273 1.00 25.70 ? 238  ASP C CA  1 
ATOM   9671  C  C   . ASP C 1 238 ? 28.337  -5.248  -12.370 1.00 25.07 ? 238  ASP C C   1 
ATOM   9672  O  O   . ASP C 1 238 ? 29.455  -5.683  -12.674 1.00 24.67 ? 238  ASP C O   1 
ATOM   9673  C  CB  . ASP C 1 238 ? 26.988  -7.032  -13.542 1.00 25.76 ? 238  ASP C CB  1 
ATOM   9674  C  CG  . ASP C 1 238 ? 26.526  -7.814  -12.315 1.00 25.32 ? 238  ASP C CG  1 
ATOM   9675  O  OD1 . ASP C 1 238 ? 26.363  -7.214  -11.218 1.00 25.17 ? 238  ASP C OD1 1 
ATOM   9676  O  OD2 . ASP C 1 238 ? 26.311  -9.028  -12.459 1.00 22.24 ? 238  ASP C OD2 1 
ATOM   9677  N  N   . PHE C 1 239 ? 28.101  -4.530  -11.265 1.00 24.10 ? 239  PHE C N   1 
ATOM   9678  C  CA  . PHE C 1 239 ? 29.136  -4.251  -10.250 1.00 23.08 ? 239  PHE C CA  1 
ATOM   9679  C  C   . PHE C 1 239 ? 29.285  -5.339  -9.175  1.00 22.39 ? 239  PHE C C   1 
ATOM   9680  O  O   . PHE C 1 239 ? 30.253  -5.323  -8.389  1.00 22.77 ? 239  PHE C O   1 
ATOM   9681  C  CB  . PHE C 1 239 ? 28.971  -2.853  -9.624  1.00 22.64 ? 239  PHE C CB  1 
ATOM   9682  C  CG  . PHE C 1 239 ? 27.703  -2.661  -8.829  1.00 22.83 ? 239  PHE C CG  1 
ATOM   9683  C  CD1 . PHE C 1 239 ? 27.710  -2.781  -7.445  1.00 22.56 ? 239  PHE C CD1 1 
ATOM   9684  C  CD2 . PHE C 1 239 ? 26.517  -2.308  -9.455  1.00 22.55 ? 239  PHE C CD2 1 
ATOM   9685  C  CE1 . PHE C 1 239 ? 26.549  -2.585  -6.701  1.00 22.14 ? 239  PHE C CE1 1 
ATOM   9686  C  CE2 . PHE C 1 239 ? 25.353  -2.103  -8.716  1.00 22.35 ? 239  PHE C CE2 1 
ATOM   9687  C  CZ  . PHE C 1 239 ? 25.372  -2.246  -7.338  1.00 22.23 ? 239  PHE C CZ  1 
ATOM   9688  N  N   . ASN C 1 240 ? 28.349  -6.290  -9.171  1.00 21.22 ? 240  ASN C N   1 
ATOM   9689  C  CA  . ASN C 1 240 ? 28.422  -7.470  -8.300  1.00 20.43 ? 240  ASN C CA  1 
ATOM   9690  C  C   . ASN C 1 240 ? 28.635  -8.725  -9.093  1.00 20.17 ? 240  ASN C C   1 
ATOM   9691  O  O   . ASN C 1 240 ? 28.021  -9.725  -8.766  1.00 20.18 ? 240  ASN C O   1 
ATOM   9692  C  CB  . ASN C 1 240 ? 27.096  -7.699  -7.579  1.00 20.08 ? 240  ASN C CB  1 
ATOM   9693  C  CG  . ASN C 1 240 ? 26.432  -6.431  -7.162  1.00 19.55 ? 240  ASN C CG  1 
ATOM   9694  O  OD1 . ASN C 1 240 ? 26.841  -5.784  -6.190  1.00 20.63 ? 240  ASN C OD1 1 
ATOM   9695  N  ND2 . ASN C 1 240 ? 25.383  -6.068  -7.873  1.00 17.64 ? 240  ASN C ND2 1 
ATOM   9696  N  N   . HIS C 1 241 ? 29.475  -8.683  -10.130 1.00 19.96 ? 241  HIS C N   1 
ATOM   9697  C  CA  . HIS C 1 241 ? 29.517  -9.755  -11.131 1.00 19.75 ? 241  HIS C CA  1 
ATOM   9698  C  C   . HIS C 1 241 ? 30.069  -11.081 -10.584 1.00 20.34 ? 241  HIS C C   1 
ATOM   9699  O  O   . HIS C 1 241 ? 29.585  -12.177 -10.947 1.00 20.26 ? 241  HIS C O   1 
ATOM   9700  C  CB  . HIS C 1 241 ? 30.297  -9.315  -12.384 1.00 19.01 ? 241  HIS C CB  1 
ATOM   9701  C  CG  . HIS C 1 241 ? 31.765  -9.632  -12.339 1.00 17.64 ? 241  HIS C CG  1 
ATOM   9702  N  ND1 . HIS C 1 241 ? 32.713  -8.726  -11.907 1.00 16.70 ? 241  HIS C ND1 1 
ATOM   9703  C  CD2 . HIS C 1 241 ? 32.446  -10.758 -12.666 1.00 16.22 ? 241  HIS C CD2 1 
ATOM   9704  C  CE1 . HIS C 1 241 ? 33.912  -9.283  -11.963 1.00 17.40 ? 241  HIS C CE1 1 
ATOM   9705  N  NE2 . HIS C 1 241 ? 33.777  -10.514 -12.426 1.00 16.98 ? 241  HIS C NE2 1 
ATOM   9706  N  N   . ALA C 1 242 ? 31.087  -10.977 -9.725  1.00 20.32 ? 242  ALA C N   1 
ATOM   9707  C  CA  . ALA C 1 242 ? 31.783  -12.161 -9.239  1.00 20.48 ? 242  ALA C CA  1 
ATOM   9708  C  C   . ALA C 1 242 ? 30.949  -12.854 -8.157  1.00 20.79 ? 242  ALA C C   1 
ATOM   9709  O  O   . ALA C 1 242 ? 30.850  -14.093 -8.150  1.00 20.60 ? 242  ALA C O   1 
ATOM   9710  C  CB  . ALA C 1 242 ? 33.206  -11.814 -8.746  1.00 20.26 ? 242  ALA C CB  1 
ATOM   9711  N  N   . SER C 1 243 ? 30.341  -12.058 -7.268  1.00 20.50 ? 243  SER C N   1 
ATOM   9712  C  CA  . SER C 1 243 ? 29.367  -12.581 -6.303  1.00 20.98 ? 243  SER C CA  1 
ATOM   9713  C  C   . SER C 1 243 ? 28.175  -13.223 -7.018  1.00 20.91 ? 243  SER C C   1 
ATOM   9714  O  O   . SER C 1 243 ? 27.686  -14.262 -6.583  1.00 20.35 ? 243  SER C O   1 
ATOM   9715  C  CB  . SER C 1 243 ? 28.862  -11.485 -5.343  1.00 21.11 ? 243  SER C CB  1 
ATOM   9716  O  OG  . SER C 1 243 ? 29.915  -10.971 -4.522  1.00 22.88 ? 243  SER C OG  1 
ATOM   9717  N  N   . ASN C 1 244 ? 27.709  -12.587 -8.097  1.00 20.84 ? 244  ASN C N   1 
ATOM   9718  C  CA  . ASN C 1 244 ? 26.544  -13.045 -8.833  1.00 21.54 ? 244  ASN C CA  1 
ATOM   9719  C  C   . ASN C 1 244 ? 26.827  -14.378 -9.493  1.00 21.98 ? 244  ASN C C   1 
ATOM   9720  O  O   . ASN C 1 244 ? 26.051  -15.318 -9.370  1.00 22.42 ? 244  ASN C O   1 
ATOM   9721  C  CB  . ASN C 1 244 ? 26.168  -12.021 -9.891  1.00 21.99 ? 244  ASN C CB  1 
ATOM   9722  C  CG  . ASN C 1 244 ? 24.728  -12.160 -10.380 1.00 23.47 ? 244  ASN C CG  1 
ATOM   9723  O  OD1 . ASN C 1 244 ? 24.000  -13.083 -10.003 1.00 23.39 ? 244  ASN C OD1 1 
ATOM   9724  N  ND2 . ASN C 1 244 ? 24.308  -11.212 -11.217 1.00 24.70 ? 244  ASN C ND2 1 
ATOM   9725  N  N   . ASP C 1 245 ? 27.964  -14.457 -10.178 1.00 22.41 ? 245  ASP C N   1 
ATOM   9726  C  CA  . ASP C 1 245 ? 28.401  -15.678 -10.847 1.00 22.35 ? 245  ASP C CA  1 
ATOM   9727  C  C   . ASP C 1 245 ? 28.571  -16.837 -9.869  1.00 22.23 ? 245  ASP C C   1 
ATOM   9728  O  O   . ASP C 1 245 ? 28.107  -17.941 -10.126 1.00 22.39 ? 245  ASP C O   1 
ATOM   9729  C  CB  . ASP C 1 245 ? 29.722  -15.424 -11.580 1.00 22.50 ? 245  ASP C CB  1 
ATOM   9730  C  CG  . ASP C 1 245 ? 30.281  -16.677 -12.218 1.00 23.77 ? 245  ASP C CG  1 
ATOM   9731  O  OD1 . ASP C 1 245 ? 29.659  -17.175 -13.176 1.00 25.59 ? 245  ASP C OD1 1 
ATOM   9732  O  OD2 . ASP C 1 245 ? 31.337  -17.172 -11.767 1.00 24.43 ? 245  ASP C OD2 1 
ATOM   9733  N  N   . THR C 1 246 ? 29.255  -16.586 -8.753  1.00 22.16 ? 246  THR C N   1 
ATOM   9734  C  CA  . THR C 1 246 ? 29.553  -17.641 -7.788  1.00 21.46 ? 246  THR C CA  1 
ATOM   9735  C  C   . THR C 1 246 ? 28.289  -18.091 -7.061  1.00 20.42 ? 246  THR C C   1 
ATOM   9736  O  O   . THR C 1 246 ? 28.136  -19.284 -6.797  1.00 20.15 ? 246  THR C O   1 
ATOM   9737  C  CB  . THR C 1 246 ? 30.663  -17.237 -6.787  1.00 21.71 ? 246  THR C CB  1 
ATOM   9738  O  OG1 . THR C 1 246 ? 31.703  -16.531 -7.479  1.00 23.47 ? 246  THR C OG1 1 
ATOM   9739  C  CG2 . THR C 1 246 ? 31.270  -18.466 -6.126  1.00 20.79 ? 246  THR C CG2 1 
ATOM   9740  N  N   . PHE C 1 247 ? 27.388  -17.156 -6.763  1.00 19.49 ? 247  PHE C N   1 
ATOM   9741  C  CA  . PHE C 1 247 ? 26.086  -17.520 -6.170  1.00 19.42 ? 247  PHE C CA  1 
ATOM   9742  C  C   . PHE C 1 247 ? 25.328  -18.487 -7.101  1.00 19.75 ? 247  PHE C C   1 
ATOM   9743  O  O   . PHE C 1 247 ? 24.893  -19.572 -6.682  1.00 18.46 ? 247  PHE C O   1 
ATOM   9744  C  CB  . PHE C 1 247 ? 25.203  -16.293 -5.829  1.00 18.33 ? 247  PHE C CB  1 
ATOM   9745  C  CG  . PHE C 1 247 ? 23.964  -16.649 -5.019  1.00 18.23 ? 247  PHE C CG  1 
ATOM   9746  C  CD1 . PHE C 1 247 ? 22.796  -17.118 -5.648  1.00 16.29 ? 247  PHE C CD1 1 
ATOM   9747  C  CD2 . PHE C 1 247 ? 23.971  -16.562 -3.620  1.00 17.85 ? 247  PHE C CD2 1 
ATOM   9748  C  CE1 . PHE C 1 247 ? 21.648  -17.508 -4.891  1.00 14.39 ? 247  PHE C CE1 1 
ATOM   9749  C  CE2 . PHE C 1 247 ? 22.823  -16.930 -2.864  1.00 17.32 ? 247  PHE C CE2 1 
ATOM   9750  C  CZ  . PHE C 1 247 ? 21.663  -17.413 -3.517  1.00 16.15 ? 247  PHE C CZ  1 
ATOM   9751  N  N   . GLN C 1 248 ? 25.194  -18.058 -8.357  1.00 20.85 ? 248  GLN C N   1 
ATOM   9752  C  CA  . GLN C 1 248 ? 24.414  -18.748 -9.372  1.00 22.22 ? 248  GLN C CA  1 
ATOM   9753  C  C   . GLN C 1 248 ? 24.996  -20.123 -9.686  1.00 22.39 ? 248  GLN C C   1 
ATOM   9754  O  O   . GLN C 1 248 ? 24.253  -21.100 -9.834  1.00 22.56 ? 248  GLN C O   1 
ATOM   9755  C  CB  . GLN C 1 248 ? 24.286  -17.895 -10.650 1.00 22.33 ? 248  GLN C CB  1 
ATOM   9756  C  CG  . GLN C 1 248 ? 23.221  -16.776 -10.589 1.00 24.42 ? 248  GLN C CG  1 
ATOM   9757  C  CD  . GLN C 1 248 ? 21.862  -17.249 -10.047 1.00 27.80 ? 248  GLN C CD  1 
ATOM   9758  O  OE1 . GLN C 1 248 ? 21.227  -16.568 -9.234  1.00 28.51 ? 248  GLN C OE1 1 
ATOM   9759  N  NE2 . GLN C 1 248 ? 21.420  -18.423 -10.492 1.00 30.36 ? 248  GLN C NE2 1 
ATOM   9760  N  N   . ALA C 1 249 ? 26.318  -20.194 -9.750  1.00 22.25 ? 249  ALA C N   1 
ATOM   9761  C  CA  . ALA C 1 249 ? 27.002  -21.448 -9.978  1.00 22.82 ? 249  ALA C CA  1 
ATOM   9762  C  C   . ALA C 1 249 ? 26.586  -22.507 -8.957  1.00 23.40 ? 249  ALA C C   1 
ATOM   9763  O  O   . ALA C 1 249 ? 26.227  -23.625 -9.324  1.00 23.34 ? 249  ALA C O   1 
ATOM   9764  C  CB  . ALA C 1 249 ? 28.513  -21.239 -9.961  1.00 22.35 ? 249  ALA C CB  1 
ATOM   9765  N  N   . ILE C 1 250 ? 26.624  -22.145 -7.680  1.00 24.39 ? 250  ILE C N   1 
ATOM   9766  C  CA  . ILE C 1 250 ? 26.302  -23.076 -6.592  1.00 25.39 ? 250  ILE C CA  1 
ATOM   9767  C  C   . ILE C 1 250 ? 24.839  -23.525 -6.676  1.00 25.81 ? 250  ILE C C   1 
ATOM   9768  O  O   . ILE C 1 250 ? 24.537  -24.721 -6.631  1.00 25.64 ? 250  ILE C O   1 
ATOM   9769  C  CB  . ILE C 1 250 ? 26.646  -22.445 -5.202  1.00 25.69 ? 250  ILE C CB  1 
ATOM   9770  C  CG1 . ILE C 1 250 ? 28.171  -22.253 -5.071  1.00 25.90 ? 250  ILE C CG1 1 
ATOM   9771  C  CG2 . ILE C 1 250 ? 26.074  -23.276 -4.049  1.00 25.63 ? 250  ILE C CG2 1 
ATOM   9772  C  CD1 . ILE C 1 250 ? 28.631  -21.709 -3.725  1.00 25.24 ? 250  ILE C CD1 1 
ATOM   9773  N  N   . GLU C 1 251 ? 23.955  -22.541 -6.822  1.00 26.59 ? 251  GLU C N   1 
ATOM   9774  C  CA  . GLU C 1 251 ? 22.510  -22.732 -6.940  1.00 27.44 ? 251  GLU C CA  1 
ATOM   9775  C  C   . GLU C 1 251 ? 22.120  -23.585 -8.161  1.00 27.62 ? 251  GLU C C   1 
ATOM   9776  O  O   . GLU C 1 251 ? 21.133  -24.327 -8.122  1.00 27.61 ? 251  GLU C O   1 
ATOM   9777  C  CB  . GLU C 1 251 ? 21.814  -21.357 -6.974  1.00 27.55 ? 251  GLU C CB  1 
ATOM   9778  C  CG  . GLU C 1 251 ? 20.412  -21.331 -6.364  1.00 28.75 ? 251  GLU C CG  1 
ATOM   9779  C  CD  . GLU C 1 251 ? 20.400  -21.482 -4.842  1.00 30.30 ? 251  GLU C CD  1 
ATOM   9780  O  OE1 . GLU C 1 251 ? 19.301  -21.674 -4.273  1.00 31.15 ? 251  GLU C OE1 1 
ATOM   9781  O  OE2 . GLU C 1 251 ? 21.473  -21.399 -4.204  1.00 29.78 ? 251  GLU C OE2 1 
ATOM   9782  N  N   . ASN C 1 252 ? 22.903  -23.486 -9.236  1.00 27.65 ? 252  ASN C N   1 
ATOM   9783  C  CA  . ASN C 1 252 ? 22.705  -24.339 -10.413 1.00 27.82 ? 252  ASN C CA  1 
ATOM   9784  C  C   . ASN C 1 252 ? 23.326  -25.728 -10.286 1.00 27.49 ? 252  ASN C C   1 
ATOM   9785  O  O   . ASN C 1 252 ? 23.209  -26.538 -11.195 1.00 27.41 ? 252  ASN C O   1 
ATOM   9786  C  CB  . ASN C 1 252 ? 23.207  -23.641 -11.680 1.00 27.47 ? 252  ASN C CB  1 
ATOM   9787  C  CG  . ASN C 1 252 ? 22.347  -22.458 -12.050 1.00 28.65 ? 252  ASN C CG  1 
ATOM   9788  O  OD1 . ASN C 1 252 ? 21.191  -22.365 -11.617 1.00 28.51 ? 252  ASN C OD1 1 
ATOM   9789  N  ND2 . ASN C 1 252 ? 22.900  -21.533 -12.846 1.00 29.35 ? 252  ASN C ND2 1 
ATOM   9790  N  N   . GLY C 1 253 ? 23.984  -25.987 -9.156  1.00 27.38 ? 253  GLY C N   1 
ATOM   9791  C  CA  . GLY C 1 253 ? 24.625  -27.274 -8.885  1.00 26.73 ? 253  GLY C CA  1 
ATOM   9792  C  C   . GLY C 1 253 ? 25.988  -27.410 -9.530  1.00 26.46 ? 253  GLY C C   1 
ATOM   9793  O  O   . GLY C 1 253 ? 26.550  -28.502 -9.592  1.00 26.33 ? 253  GLY C O   1 
ATOM   9794  N  N   . ASP C 1 254 ? 26.527  -26.298 -10.011 1.00 26.37 ? 254  ASP C N   1 
ATOM   9795  C  CA  . ASP C 1 254 ? 27.860  -26.300 -10.604 1.00 26.74 ? 254  ASP C CA  1 
ATOM   9796  C  C   . ASP C 1 254 ? 28.911  -25.931 -9.532  1.00 25.89 ? 254  ASP C C   1 
ATOM   9797  O  O   . ASP C 1 254 ? 29.510  -24.850 -9.576  1.00 26.38 ? 254  ASP C O   1 
ATOM   9798  C  CB  . ASP C 1 254 ? 27.891  -25.363 -11.826 1.00 26.93 ? 254  ASP C CB  1 
ATOM   9799  C  CG  . ASP C 1 254 ? 29.183  -25.471 -12.629 1.00 29.67 ? 254  ASP C CG  1 
ATOM   9800  O  OD1 . ASP C 1 254 ? 29.933  -26.472 -12.486 1.00 32.32 ? 254  ASP C OD1 1 
ATOM   9801  O  OD2 . ASP C 1 254 ? 29.466  -24.535 -13.408 1.00 32.94 ? 254  ASP C OD2 1 
ATOM   9802  N  N   . PHE C 1 255 ? 29.126  -26.841 -8.578  1.00 24.79 ? 255  PHE C N   1 
ATOM   9803  C  CA  . PHE C 1 255 ? 29.898  -26.530 -7.362  1.00 23.83 ? 255  PHE C CA  1 
ATOM   9804  C  C   . PHE C 1 255 ? 31.373  -26.221 -7.652  1.00 23.36 ? 255  PHE C C   1 
ATOM   9805  O  O   . PHE C 1 255 ? 32.094  -27.063 -8.191  1.00 23.35 ? 255  PHE C O   1 
ATOM   9806  C  CB  . PHE C 1 255 ? 29.794  -27.637 -6.285  1.00 23.46 ? 255  PHE C CB  1 
ATOM   9807  C  CG  . PHE C 1 255 ? 28.374  -28.083 -5.965  1.00 23.47 ? 255  PHE C CG  1 
ATOM   9808  C  CD1 . PHE C 1 255 ? 28.093  -29.428 -5.763  1.00 22.80 ? 255  PHE C CD1 1 
ATOM   9809  C  CD2 . PHE C 1 255 ? 27.329  -27.170 -5.869  1.00 22.39 ? 255  PHE C CD2 1 
ATOM   9810  C  CE1 . PHE C 1 255 ? 26.794  -29.857 -5.471  1.00 22.44 ? 255  PHE C CE1 1 
ATOM   9811  C  CE2 . PHE C 1 255 ? 26.032  -27.594 -5.585  1.00 22.47 ? 255  PHE C CE2 1 
ATOM   9812  C  CZ  . PHE C 1 255 ? 25.766  -28.942 -5.393  1.00 21.95 ? 255  PHE C CZ  1 
ATOM   9813  N  N   . PRO C 1 256 ? 31.823  -25.004 -7.293  1.00 22.73 ? 256  PRO C N   1 
ATOM   9814  C  CA  . PRO C 1 256 ? 33.241  -24.649 -7.387  1.00 22.24 ? 256  PRO C CA  1 
ATOM   9815  C  C   . PRO C 1 256 ? 34.074  -25.589 -6.536  1.00 21.93 ? 256  PRO C C   1 
ATOM   9816  O  O   . PRO C 1 256 ? 33.685  -25.917 -5.417  1.00 21.75 ? 256  PRO C O   1 
ATOM   9817  C  CB  . PRO C 1 256 ? 33.286  -23.240 -6.806  1.00 22.13 ? 256  PRO C CB  1 
ATOM   9818  C  CG  . PRO C 1 256 ? 31.893  -22.717 -6.937  1.00 21.72 ? 256  PRO C CG  1 
ATOM   9819  C  CD  . PRO C 1 256 ? 31.005  -23.887 -6.788  1.00 22.41 ? 256  PRO C CD  1 
ATOM   9820  N  N   . GLU C 1 257 ? 35.183  -26.060 -7.095  1.00 21.79 ? 257  GLU C N   1 
ATOM   9821  C  CA  . GLU C 1 257 ? 36.114  -26.929 -6.384  1.00 21.72 ? 257  GLU C CA  1 
ATOM   9822  C  C   . GLU C 1 257 ? 37.515  -26.386 -6.586  1.00 20.81 ? 257  GLU C C   1 
ATOM   9823  O  O   . GLU C 1 257 ? 37.790  -25.726 -7.588  1.00 20.22 ? 257  GLU C O   1 
ATOM   9824  C  CB  . GLU C 1 257 ? 36.053  -28.385 -6.878  1.00 21.69 ? 257  GLU C CB  1 
ATOM   9825  C  CG  . GLU C 1 257 ? 34.651  -28.947 -7.101  1.00 23.25 ? 257  GLU C CG  1 
ATOM   9826  C  CD  . GLU C 1 257 ? 34.611  -30.483 -7.205  1.00 23.52 ? 257  GLU C CD  1 
ATOM   9827  O  OE1 . GLU C 1 257 ? 35.555  -31.096 -7.744  1.00 25.92 ? 257  GLU C OE1 1 
ATOM   9828  O  OE2 . GLU C 1 257 ? 33.619  -31.076 -6.745  1.00 25.47 ? 257  GLU C OE2 1 
ATOM   9829  N  N   . TRP C 1 258 ? 38.377  -26.635 -5.603  1.00 20.33 ? 258  TRP C N   1 
ATOM   9830  C  CA  . TRP C 1 258 ? 39.807  -26.366 -5.707  1.00 20.15 ? 258  TRP C CA  1 
ATOM   9831  C  C   . TRP C 1 258 ? 40.505  -27.550 -5.080  1.00 20.44 ? 258  TRP C C   1 
ATOM   9832  O  O   . TRP C 1 258 ? 39.975  -28.150 -4.123  1.00 20.66 ? 258  TRP C O   1 
ATOM   9833  C  CB  . TRP C 1 258 ? 40.224  -25.107 -4.938  1.00 19.52 ? 258  TRP C CB  1 
ATOM   9834  C  CG  . TRP C 1 258 ? 39.762  -23.800 -5.488  1.00 18.69 ? 258  TRP C CG  1 
ATOM   9835  C  CD1 . TRP C 1 258 ? 40.511  -22.895 -6.185  1.00 18.13 ? 258  TRP C CD1 1 
ATOM   9836  C  CD2 . TRP C 1 258 ? 38.450  -23.222 -5.354  1.00 17.41 ? 258  TRP C CD2 1 
ATOM   9837  N  NE1 . TRP C 1 258 ? 39.743  -21.793 -6.506  1.00 17.73 ? 258  TRP C NE1 1 
ATOM   9838  C  CE2 . TRP C 1 258 ? 38.477  -21.968 -6.011  1.00 16.93 ? 258  TRP C CE2 1 
ATOM   9839  C  CE3 . TRP C 1 258 ? 37.261  -23.640 -4.735  1.00 16.62 ? 258  TRP C CE3 1 
ATOM   9840  C  CZ2 . TRP C 1 258 ? 37.361  -21.125 -6.072  1.00 19.10 ? 258  TRP C CZ2 1 
ATOM   9841  C  CZ3 . TRP C 1 258 ? 36.148  -22.812 -4.794  1.00 18.53 ? 258  TRP C CZ3 1 
ATOM   9842  C  CH2 . TRP C 1 258 ? 36.203  -21.562 -5.459  1.00 19.68 ? 258  TRP C CH2 1 
ATOM   9843  N  N   . ASP C 1 259 ? 41.676  -27.897 -5.614  1.00 20.48 ? 259  ASP C N   1 
ATOM   9844  C  CA  . ASP C 1 259 ? 42.530  -28.875 -4.963  1.00 20.87 ? 259  ASP C CA  1 
ATOM   9845  C  C   . ASP C 1 259 ? 43.575  -28.131 -4.152  1.00 20.76 ? 259  ASP C C   1 
ATOM   9846  O  O   . ASP C 1 259 ? 44.123  -27.116 -4.601  1.00 20.74 ? 259  ASP C O   1 
ATOM   9847  C  CB  . ASP C 1 259 ? 43.207  -29.810 -5.965  1.00 21.11 ? 259  ASP C CB  1 
ATOM   9848  C  CG  . ASP C 1 259 ? 42.282  -30.900 -6.471  1.00 23.20 ? 259  ASP C CG  1 
ATOM   9849  O  OD1 . ASP C 1 259 ? 42.054  -30.931 -7.690  1.00 26.22 ? 259  ASP C OD1 1 
ATOM   9850  O  OD2 . ASP C 1 259 ? 41.773  -31.727 -5.678  1.00 26.22 ? 259  ASP C OD2 1 
ATOM   9851  N  N   . LEU C 1 260 ? 43.837  -28.641 -2.953  1.00 20.39 ? 260  LEU C N   1 
ATOM   9852  C  CA  . LEU C 1 260 ? 44.842  -28.076 -2.080  1.00 19.77 ? 260  LEU C CA  1 
ATOM   9853  C  C   . LEU C 1 260 ? 46.134  -28.867 -2.184  1.00 19.81 ? 260  LEU C C   1 
ATOM   9854  O  O   . LEU C 1 260 ? 46.123  -30.097 -2.167  1.00 19.62 ? 260  LEU C O   1 
ATOM   9855  C  CB  . LEU C 1 260 ? 44.338  -28.064 -0.636  1.00 19.87 ? 260  LEU C CB  1 
ATOM   9856  C  CG  . LEU C 1 260 ? 45.255  -27.595 0.500   1.00 19.37 ? 260  LEU C CG  1 
ATOM   9857  C  CD1 . LEU C 1 260 ? 45.445  -26.084 0.460   1.00 19.65 ? 260  LEU C CD1 1 
ATOM   9858  C  CD2 . LEU C 1 260 ? 44.664  -28.022 1.840   1.00 19.15 ? 260  LEU C CD2 1 
ATOM   9859  N  N   . PHE C 1 261 ? 47.240  -28.129 -2.252  1.00 19.95 ? 261  PHE C N   1 
ATOM   9860  C  CA  . PHE C 1 261 ? 48.583  -28.662 -2.332  1.00 19.84 ? 261  PHE C CA  1 
ATOM   9861  C  C   . PHE C 1 261 ? 49.464  -27.974 -1.300  1.00 20.22 ? 261  PHE C C   1 
ATOM   9862  O  O   . PHE C 1 261 ? 49.301  -26.789 -1.005  1.00 20.22 ? 261  PHE C O   1 
ATOM   9863  C  CB  . PHE C 1 261 ? 49.182  -28.365 -3.715  1.00 20.44 ? 261  PHE C CB  1 
ATOM   9864  C  CG  . PHE C 1 261 ? 48.525  -29.100 -4.859  1.00 19.93 ? 261  PHE C CG  1 
ATOM   9865  C  CD1 . PHE C 1 261 ? 49.050  -30.308 -5.313  1.00 20.36 ? 261  PHE C CD1 1 
ATOM   9866  C  CD2 . PHE C 1 261 ? 47.417  -28.563 -5.501  1.00 19.73 ? 261  PHE C CD2 1 
ATOM   9867  C  CE1 . PHE C 1 261 ? 48.466  -30.991 -6.387  1.00 21.82 ? 261  PHE C CE1 1 
ATOM   9868  C  CE2 . PHE C 1 261 ? 46.814  -29.232 -6.570  1.00 21.53 ? 261  PHE C CE2 1 
ATOM   9869  C  CZ  . PHE C 1 261 ? 47.343  -30.452 -7.018  1.00 21.15 ? 261  PHE C CZ  1 
ATOM   9870  N  N   . VAL C 1 262 ? 50.425  -28.722 -0.778  1.00 20.73 ? 262  VAL C N   1 
ATOM   9871  C  CA  . VAL C 1 262 ? 51.433  -28.195 0.121   1.00 20.80 ? 262  VAL C CA  1 
ATOM   9872  C  C   . VAL C 1 262 ? 52.839  -28.276 -0.497  1.00 21.18 ? 262  VAL C C   1 
ATOM   9873  O  O   . VAL C 1 262 ? 53.181  -29.235 -1.205  1.00 21.08 ? 262  VAL C O   1 
ATOM   9874  C  CB  . VAL C 1 262 ? 51.396  -28.916 1.501   1.00 20.95 ? 262  VAL C CB  1 
ATOM   9875  C  CG1 . VAL C 1 262 ? 51.717  -30.422 1.374   1.00 20.16 ? 262  VAL C CG1 1 
ATOM   9876  C  CG2 . VAL C 1 262 ? 52.320  -28.231 2.499   1.00 20.36 ? 262  VAL C CG2 1 
ATOM   9877  N  N   . GLN C 1 263 ? 53.632  -27.240 -0.241  1.00 21.22 ? 263  GLN C N   1 
ATOM   9878  C  CA  . GLN C 1 263 ? 55.039  -27.241 -0.581  1.00 21.23 ? 263  GLN C CA  1 
ATOM   9879  C  C   . GLN C 1 263 ? 55.850  -27.380 0.696   1.00 21.36 ? 263  GLN C C   1 
ATOM   9880  O  O   . GLN C 1 263 ? 55.562  -26.701 1.681   1.00 21.77 ? 263  GLN C O   1 
ATOM   9881  C  CB  . GLN C 1 263 ? 55.390  -25.957 -1.300  1.00 21.05 ? 263  GLN C CB  1 
ATOM   9882  C  CG  . GLN C 1 263 ? 54.957  -25.941 -2.729  1.00 20.33 ? 263  GLN C CG  1 
ATOM   9883  C  CD  . GLN C 1 263 ? 55.233  -24.607 -3.348  1.00 21.78 ? 263  GLN C CD  1 
ATOM   9884  O  OE1 . GLN C 1 263 ? 54.634  -23.602 -2.949  1.00 23.45 ? 263  GLN C OE1 1 
ATOM   9885  N  NE2 . GLN C 1 263 ? 56.160  -24.567 -4.313  1.00 19.25 ? 263  GLN C NE2 1 
ATOM   9886  N  N   . VAL C 1 264 ? 56.848  -28.263 0.681   1.00 21.30 ? 264  VAL C N   1 
ATOM   9887  C  CA  . VAL C 1 264 ? 57.604  -28.609 1.890   1.00 21.23 ? 264  VAL C CA  1 
ATOM   9888  C  C   . VAL C 1 264 ? 59.088  -28.258 1.788   1.00 21.52 ? 264  VAL C C   1 
ATOM   9889  O  O   . VAL C 1 264 ? 59.776  -28.604 0.815   1.00 21.81 ? 264  VAL C O   1 
ATOM   9890  C  CB  . VAL C 1 264 ? 57.412  -30.095 2.294   1.00 21.14 ? 264  VAL C CB  1 
ATOM   9891  C  CG1 . VAL C 1 264 ? 58.206  -30.429 3.553   1.00 20.76 ? 264  VAL C CG1 1 
ATOM   9892  C  CG2 . VAL C 1 264 ? 55.930  -30.395 2.524   1.00 20.78 ? 264  VAL C CG2 1 
ATOM   9893  N  N   . LEU C 1 265 ? 59.557  -27.549 2.812   1.00 21.75 ? 265  LEU C N   1 
ATOM   9894  C  CA  . LEU C 1 265 ? 60.936  -27.104 2.913   1.00 21.52 ? 265  LEU C CA  1 
ATOM   9895  C  C   . LEU C 1 265 ? 61.498  -27.434 4.287   1.00 21.89 ? 265  LEU C C   1 
ATOM   9896  O  O   . LEU C 1 265 ? 60.918  -27.074 5.326   1.00 21.50 ? 265  LEU C O   1 
ATOM   9897  C  CB  . LEU C 1 265 ? 61.044  -25.596 2.637   1.00 21.32 ? 265  LEU C CB  1 
ATOM   9898  C  CG  . LEU C 1 265 ? 62.420  -24.934 2.830   1.00 20.90 ? 265  LEU C CG  1 
ATOM   9899  C  CD1 . LEU C 1 265 ? 63.488  -25.471 1.843   1.00 19.00 ? 265  LEU C CD1 1 
ATOM   9900  C  CD2 . LEU C 1 265 ? 62.303  -23.416 2.719   1.00 21.26 ? 265  LEU C CD2 1 
ATOM   9901  N  N   . ASP C 1 266 ? 62.628  -28.130 4.288   1.00 22.30 ? 266  ASP C N   1 
ATOM   9902  C  CA  . ASP C 1 266 ? 63.298  -28.452 5.529   1.00 22.94 ? 266  ASP C CA  1 
ATOM   9903  C  C   . ASP C 1 266 ? 63.896  -27.179 6.084   1.00 22.98 ? 266  ASP C C   1 
ATOM   9904  O  O   . ASP C 1 266 ? 64.488  -26.426 5.330   1.00 22.90 ? 266  ASP C O   1 
ATOM   9905  C  CB  . ASP C 1 266 ? 64.395  -29.492 5.314   1.00 23.14 ? 266  ASP C CB  1 
ATOM   9906  C  CG  . ASP C 1 266 ? 64.734  -30.237 6.590   1.00 24.41 ? 266  ASP C CG  1 
ATOM   9907  O  OD1 . ASP C 1 266 ? 64.324  -31.403 6.703   1.00 27.07 ? 266  ASP C OD1 1 
ATOM   9908  O  OD2 . ASP C 1 266 ? 65.361  -29.652 7.502   1.00 26.09 ? 266  ASP C OD2 1 
ATOM   9909  N  N   . PRO C 1 267 ? 63.729  -26.921 7.400   1.00 23.51 ? 267  PRO C N   1 
ATOM   9910  C  CA  . PRO C 1 267 ? 64.371  -25.741 8.016   1.00 23.75 ? 267  PRO C CA  1 
ATOM   9911  C  C   . PRO C 1 267 ? 65.896  -25.726 7.812   1.00 24.12 ? 267  PRO C C   1 
ATOM   9912  O  O   . PRO C 1 267 ? 66.505  -24.659 7.838   1.00 24.28 ? 267  PRO C O   1 
ATOM   9913  C  CB  . PRO C 1 267 ? 64.048  -25.898 9.509   1.00 23.35 ? 267  PRO C CB  1 
ATOM   9914  C  CG  . PRO C 1 267 ? 62.821  -26.736 9.547   1.00 23.53 ? 267  PRO C CG  1 
ATOM   9915  C  CD  . PRO C 1 267 ? 62.941  -27.689 8.383   1.00 23.20 ? 267  PRO C CD  1 
ATOM   9916  N  N   . ALA C 1 268 ? 66.504  -26.891 7.594   1.00 24.59 ? 268  ALA C N   1 
ATOM   9917  C  CA  . ALA C 1 268 ? 67.958  -26.949 7.380   1.00 25.38 ? 268  ALA C CA  1 
ATOM   9918  C  C   . ALA C 1 268 ? 68.374  -26.369 6.024   1.00 25.66 ? 268  ALA C C   1 
ATOM   9919  O  O   . ALA C 1 268 ? 69.510  -25.945 5.849   1.00 25.85 ? 268  ALA C O   1 
ATOM   9920  C  CB  . ALA C 1 268 ? 68.488  -28.377 7.558   1.00 24.95 ? 268  ALA C CB  1 
ATOM   9921  N  N   . ASP C 1 269 ? 67.436  -26.322 5.085   1.00 26.38 ? 269  ASP C N   1 
ATOM   9922  C  CA  . ASP C 1 269 ? 67.717  -25.894 3.718   1.00 27.15 ? 269  ASP C CA  1 
ATOM   9923  C  C   . ASP C 1 269 ? 67.316  -24.445 3.386   1.00 27.66 ? 269  ASP C C   1 
ATOM   9924  O  O   . ASP C 1 269 ? 67.261  -24.090 2.203   1.00 27.67 ? 269  ASP C O   1 
ATOM   9925  C  CB  . ASP C 1 269 ? 67.055  -26.860 2.723   1.00 27.43 ? 269  ASP C CB  1 
ATOM   9926  C  CG  . ASP C 1 269 ? 67.514  -28.309 2.905   1.00 28.34 ? 269  ASP C CG  1 
ATOM   9927  O  OD1 . ASP C 1 269 ? 66.711  -29.220 2.631   1.00 28.57 ? 269  ASP C OD1 1 
ATOM   9928  O  OD2 . ASP C 1 269 ? 68.669  -28.548 3.328   1.00 29.28 ? 269  ASP C OD2 1 
ATOM   9929  N  N   . VAL C 1 270 ? 67.068  -23.614 4.409   1.00 28.13 ? 270  VAL C N   1 
ATOM   9930  C  CA  . VAL C 1 270 ? 66.556  -22.242 4.205   1.00 28.44 ? 270  VAL C CA  1 
ATOM   9931  C  C   . VAL C 1 270 ? 67.558  -21.253 3.596   1.00 29.16 ? 270  VAL C C   1 
ATOM   9932  O  O   . VAL C 1 270 ? 67.152  -20.296 2.938   1.00 29.35 ? 270  VAL C O   1 
ATOM   9933  C  CB  . VAL C 1 270 ? 65.910  -21.602 5.491   1.00 28.30 ? 270  VAL C CB  1 
ATOM   9934  C  CG1 . VAL C 1 270 ? 64.805  -22.492 6.057   1.00 28.68 ? 270  VAL C CG1 1 
ATOM   9935  C  CG2 . VAL C 1 270 ? 66.958  -21.283 6.568   1.00 27.88 ? 270  VAL C CG2 1 
ATOM   9936  N  N   . GLU C 1 271 ? 68.852  -21.464 3.815   1.00 29.68 ? 271  GLU C N   1 
ATOM   9937  C  CA  . GLU C 1 271 ? 69.847  -20.511 3.314   1.00 30.56 ? 271  GLU C CA  1 
ATOM   9938  C  C   . GLU C 1 271 ? 70.436  -20.904 1.950   1.00 30.58 ? 271  GLU C C   1 
ATOM   9939  O  O   . GLU C 1 271 ? 71.431  -20.333 1.509   1.00 30.52 ? 271  GLU C O   1 
ATOM   9940  C  CB  . GLU C 1 271 ? 70.933  -20.239 4.371   1.00 31.05 ? 271  GLU C CB  1 
ATOM   9941  C  CG  . GLU C 1 271 ? 70.413  -19.461 5.602   1.00 32.91 ? 271  GLU C CG  1 
ATOM   9942  C  CD  . GLU C 1 271 ? 70.236  -17.947 5.356   1.00 36.65 ? 271  GLU C CD  1 
ATOM   9943  O  OE1 . GLU C 1 271 ? 71.255  -17.223 5.451   1.00 38.58 ? 271  GLU C OE1 1 
ATOM   9944  O  OE2 . GLU C 1 271 ? 69.089  -17.473 5.100   1.00 36.21 ? 271  GLU C OE2 1 
ATOM   9945  N  N   . ASN C 1 272 ? 69.775  -21.858 1.288   1.00 30.72 ? 272  ASN C N   1 
ATOM   9946  C  CA  . ASN C 1 272 ? 70.195  -22.431 0.003   1.00 30.59 ? 272  ASN C CA  1 
ATOM   9947  C  C   . ASN C 1 272 ? 69.559  -21.751 -1.220  1.00 30.11 ? 272  ASN C C   1 
ATOM   9948  O  O   . ASN C 1 272 ? 69.478  -22.357 -2.309  1.00 30.11 ? 272  ASN C O   1 
ATOM   9949  C  CB  . ASN C 1 272 ? 69.811  -23.918 -0.038  1.00 30.83 ? 272  ASN C CB  1 
ATOM   9950  C  CG  . ASN C 1 272 ? 70.810  -24.813 0.673   1.00 32.58 ? 272  ASN C CG  1 
ATOM   9951  O  OD1 . ASN C 1 272 ? 72.040  -24.629 0.570   1.00 34.45 ? 272  ASN C OD1 1 
ATOM   9952  N  ND2 . ASN C 1 272 ? 70.291  -25.822 1.366   1.00 31.77 ? 272  ASN C ND2 1 
ATOM   9953  N  N   . PHE C 1 273 ? 69.098  -20.513 -1.042  1.00 28.98 ? 273  PHE C N   1 
ATOM   9954  C  CA  . PHE C 1 273 ? 68.372  -19.790 -2.090  1.00 28.00 ? 273  PHE C CA  1 
ATOM   9955  C  C   . PHE C 1 273 ? 68.940  -18.383 -2.244  1.00 27.24 ? 273  PHE C C   1 
ATOM   9956  O  O   . PHE C 1 273 ? 69.647  -17.896 -1.367  1.00 27.00 ? 273  PHE C O   1 
ATOM   9957  C  CB  . PHE C 1 273 ? 66.877  -19.700 -1.736  1.00 28.22 ? 273  PHE C CB  1 
ATOM   9958  C  CG  . PHE C 1 273 ? 66.192  -21.040 -1.566  1.00 27.72 ? 273  PHE C CG  1 
ATOM   9959  C  CD1 . PHE C 1 273 ? 66.020  -21.593 -0.301  1.00 26.96 ? 273  PHE C CD1 1 
ATOM   9960  C  CD2 . PHE C 1 273 ? 65.693  -21.734 -2.675  1.00 28.35 ? 273  PHE C CD2 1 
ATOM   9961  C  CE1 . PHE C 1 273 ? 65.378  -22.841 -0.132  1.00 28.24 ? 273  PHE C CE1 1 
ATOM   9962  C  CE2 . PHE C 1 273 ? 65.050  -22.984 -2.519  1.00 28.23 ? 273  PHE C CE2 1 
ATOM   9963  C  CZ  . PHE C 1 273 ? 64.893  -23.536 -1.243  1.00 28.31 ? 273  PHE C CZ  1 
ATOM   9964  N  N   . ASP C 1 274 ? 68.624  -17.714 -3.343  1.00 26.69 ? 274  ASP C N   1 
ATOM   9965  C  CA  . ASP C 1 274 ? 69.054  -16.324 -3.513  1.00 26.68 ? 274  ASP C CA  1 
ATOM   9966  C  C   . ASP C 1 274 ? 68.041  -15.335 -2.902  1.00 26.59 ? 274  ASP C C   1 
ATOM   9967  O  O   . ASP C 1 274 ? 68.061  -14.122 -3.191  1.00 26.48 ? 274  ASP C O   1 
ATOM   9968  C  CB  . ASP C 1 274 ? 69.316  -16.011 -4.993  1.00 26.93 ? 274  ASP C CB  1 
ATOM   9969  C  CG  . ASP C 1 274 ? 68.077  -16.175 -5.866  1.00 27.05 ? 274  ASP C CG  1 
ATOM   9970  O  OD1 . ASP C 1 274 ? 67.030  -16.668 -5.393  1.00 27.67 ? 274  ASP C OD1 1 
ATOM   9971  O  OD2 . ASP C 1 274 ? 68.150  -15.794 -7.041  1.00 27.47 ? 274  ASP C OD2 1 
ATOM   9972  N  N   . PHE C 1 275 ? 67.161  -15.876 -2.059  1.00 26.17 ? 275  PHE C N   1 
ATOM   9973  C  CA  . PHE C 1 275 ? 66.114  -15.116 -1.391  1.00 25.66 ? 275  PHE C CA  1 
ATOM   9974  C  C   . PHE C 1 275 ? 65.846  -15.753 -0.027  1.00 25.11 ? 275  PHE C C   1 
ATOM   9975  O  O   . PHE C 1 275 ? 66.180  -16.930 0.189   1.00 25.16 ? 275  PHE C O   1 
ATOM   9976  C  CB  . PHE C 1 275 ? 64.833  -15.080 -2.248  1.00 25.92 ? 275  PHE C CB  1 
ATOM   9977  C  CG  . PHE C 1 275 ? 64.146  -16.414 -2.381  1.00 26.18 ? 275  PHE C CG  1 
ATOM   9978  C  CD1 . PHE C 1 275 ? 64.459  -17.275 -3.426  1.00 27.33 ? 275  PHE C CD1 1 
ATOM   9979  C  CD2 . PHE C 1 275 ? 63.182  -16.810 -1.460  1.00 27.49 ? 275  PHE C CD2 1 
ATOM   9980  C  CE1 . PHE C 1 275 ? 63.830  -18.518 -3.548  1.00 27.87 ? 275  PHE C CE1 1 
ATOM   9981  C  CE2 . PHE C 1 275 ? 62.533  -18.054 -1.574  1.00 27.11 ? 275  PHE C CE2 1 
ATOM   9982  C  CZ  . PHE C 1 275 ? 62.861  -18.906 -2.615  1.00 27.54 ? 275  PHE C CZ  1 
ATOM   9983  N  N   . ASP C 1 276 ? 65.257  -14.977 0.884   1.00 24.02 ? 276  ASP C N   1 
ATOM   9984  C  CA  . ASP C 1 276 ? 64.824  -15.499 2.187   1.00 23.27 ? 276  ASP C CA  1 
ATOM   9985  C  C   . ASP C 1 276 ? 63.440  -16.151 2.044   1.00 22.28 ? 276  ASP C C   1 
ATOM   9986  O  O   . ASP C 1 276 ? 62.485  -15.477 1.672   1.00 22.28 ? 276  ASP C O   1 
ATOM   9987  C  CB  . ASP C 1 276 ? 64.786  -14.386 3.250   1.00 23.01 ? 276  ASP C CB  1 
ATOM   9988  C  CG  . ASP C 1 276 ? 64.664  -14.933 4.657   1.00 23.51 ? 276  ASP C CG  1 
ATOM   9989  O  OD1 . ASP C 1 276 ? 65.330  -14.369 5.539   1.00 24.20 ? 276  ASP C OD1 1 
ATOM   9990  O  OD2 . ASP C 1 276 ? 63.928  -15.932 4.894   1.00 21.59 ? 276  ASP C OD2 1 
ATOM   9991  N  N   . PRO C 1 277 ? 63.332  -17.463 2.326   1.00 21.47 ? 277  PRO C N   1 
ATOM   9992  C  CA  . PRO C 1 277 ? 62.058  -18.188 2.149   1.00 20.84 ? 277  PRO C CA  1 
ATOM   9993  C  C   . PRO C 1 277 ? 60.939  -17.682 3.057   1.00 20.31 ? 277  PRO C C   1 
ATOM   9994  O  O   . PRO C 1 277 ? 59.772  -17.956 2.804   1.00 19.68 ? 277  PRO C O   1 
ATOM   9995  C  CB  . PRO C 1 277 ? 62.408  -19.632 2.516   1.00 21.26 ? 277  PRO C CB  1 
ATOM   9996  C  CG  . PRO C 1 277 ? 63.928  -19.698 2.483   1.00 21.70 ? 277  PRO C CG  1 
ATOM   9997  C  CD  . PRO C 1 277 ? 64.412  -18.335 2.824   1.00 21.25 ? 277  PRO C CD  1 
ATOM   9998  N  N   . LEU C 1 278 ? 61.311  -16.943 4.101   1.00 19.96 ? 278  LEU C N   1 
ATOM   9999  C  CA  . LEU C 1 278 ? 60.362  -16.328 5.020   1.00 19.59 ? 278  LEU C CA  1 
ATOM   10000 C  C   . LEU C 1 278 ? 60.016  -14.889 4.632   1.00 18.84 ? 278  LEU C C   1 
ATOM   10001 O  O   . LEU C 1 278 ? 59.308  -14.202 5.372   1.00 18.94 ? 278  LEU C O   1 
ATOM   10002 C  CB  . LEU C 1 278 ? 60.887  -16.405 6.464   1.00 19.79 ? 278  LEU C CB  1 
ATOM   10003 C  CG  . LEU C 1 278 ? 60.531  -17.686 7.257   1.00 20.70 ? 278  LEU C CG  1 
ATOM   10004 C  CD1 . LEU C 1 278 ? 60.642  -18.998 6.436   1.00 21.63 ? 278  LEU C CD1 1 
ATOM   10005 C  CD2 . LEU C 1 278 ? 61.347  -17.801 8.529   1.00 20.78 ? 278  LEU C CD2 1 
ATOM   10006 N  N   . ASP C 1 279 ? 60.512  -14.453 3.474   1.00 17.86 ? 279  ASP C N   1 
ATOM   10007 C  CA  . ASP C 1 279 ? 60.253  -13.116 2.923   1.00 17.27 ? 279  ASP C CA  1 
ATOM   10008 C  C   . ASP C 1 279 ? 58.934  -13.147 2.134   1.00 16.89 ? 279  ASP C C   1 
ATOM   10009 O  O   . ASP C 1 279 ? 58.826  -13.867 1.137   1.00 16.71 ? 279  ASP C O   1 
ATOM   10010 C  CB  . ASP C 1 279 ? 61.428  -12.722 2.010   1.00 16.84 ? 279  ASP C CB  1 
ATOM   10011 C  CG  . ASP C 1 279 ? 61.288  -11.327 1.387   1.00 16.59 ? 279  ASP C CG  1 
ATOM   10012 O  OD1 . ASP C 1 279 ? 60.249  -10.649 1.553   1.00 15.43 ? 279  ASP C OD1 1 
ATOM   10013 O  OD2 . ASP C 1 279 ? 62.250  -10.894 0.716   1.00 16.34 ? 279  ASP C OD2 1 
ATOM   10014 N  N   . ALA C 1 280 ? 57.942  -12.360 2.564   1.00 16.52 ? 280  ALA C N   1 
ATOM   10015 C  CA  . ALA C 1 280 ? 56.589  -12.433 1.972   1.00 16.62 ? 280  ALA C CA  1 
ATOM   10016 C  C   . ALA C 1 280 ? 56.492  -11.872 0.538   1.00 16.36 ? 280  ALA C C   1 
ATOM   10017 O  O   . ALA C 1 280 ? 55.475  -12.032 -0.137  1.00 15.63 ? 280  ALA C O   1 
ATOM   10018 C  CB  . ALA C 1 280 ? 55.559  -11.781 2.880   1.00 16.45 ? 280  ALA C CB  1 
ATOM   10019 N  N   . THR C 1 281 ? 57.569  -11.226 0.087   1.00 16.55 ? 281  THR C N   1 
ATOM   10020 C  CA  . THR C 1 281 ? 57.667  -10.711 -1.273  1.00 16.16 ? 281  THR C CA  1 
ATOM   10021 C  C   . THR C 1 281 ? 58.275  -11.775 -2.220  1.00 17.04 ? 281  THR C C   1 
ATOM   10022 O  O   . THR C 1 281 ? 58.594  -11.466 -3.379  1.00 17.49 ? 281  THR C O   1 
ATOM   10023 C  CB  . THR C 1 281 ? 58.481  -9.367  -1.328  1.00 16.51 ? 281  THR C CB  1 
ATOM   10024 O  OG1 . THR C 1 281 ? 59.841  -9.578  -0.906  1.00 13.81 ? 281  THR C OG1 1 
ATOM   10025 C  CG2 . THR C 1 281 ? 57.833  -8.269  -0.430  1.00 15.49 ? 281  THR C CG2 1 
ATOM   10026 N  N   . LYS C 1 282 ? 58.417  -13.017 -1.745  1.00 16.72 ? 282  LYS C N   1 
ATOM   10027 C  CA  . LYS C 1 282 ? 59.057  -14.083 -2.533  1.00 17.28 ? 282  LYS C CA  1 
ATOM   10028 C  C   . LYS C 1 282 ? 58.171  -15.334 -2.729  1.00 17.53 ? 282  LYS C C   1 
ATOM   10029 O  O   . LYS C 1 282 ? 57.550  -15.835 -1.787  1.00 17.95 ? 282  LYS C O   1 
ATOM   10030 C  CB  . LYS C 1 282 ? 60.400  -14.504 -1.903  1.00 17.11 ? 282  LYS C CB  1 
ATOM   10031 C  CG  . LYS C 1 282 ? 61.423  -13.377 -1.689  1.00 17.39 ? 282  LYS C CG  1 
ATOM   10032 C  CD  . LYS C 1 282 ? 61.981  -12.831 -3.024  1.00 18.07 ? 282  LYS C CD  1 
ATOM   10033 C  CE  . LYS C 1 282 ? 63.080  -11.788 -2.784  1.00 16.73 ? 282  LYS C CE  1 
ATOM   10034 N  NZ  . LYS C 1 282 ? 62.522  -10.430 -2.470  1.00 13.16 ? 282  LYS C NZ  1 
ATOM   10035 N  N   . ASP C 1 283 ? 58.146  -15.843 -3.954  1.00 17.63 ? 283  ASP C N   1 
ATOM   10036 C  CA  . ASP C 1 283 ? 57.386  -17.041 -4.295  1.00 18.15 ? 283  ASP C CA  1 
ATOM   10037 C  C   . ASP C 1 283 ? 58.282  -18.272 -4.121  1.00 18.47 ? 283  ASP C C   1 
ATOM   10038 O  O   . ASP C 1 283 ? 59.513  -18.150 -4.125  1.00 18.47 ? 283  ASP C O   1 
ATOM   10039 C  CB  . ASP C 1 283 ? 56.851  -16.931 -5.736  1.00 17.82 ? 283  ASP C CB  1 
ATOM   10040 C  CG  . ASP C 1 283 ? 55.706  -17.894 -6.027  1.00 18.32 ? 283  ASP C CG  1 
ATOM   10041 O  OD1 . ASP C 1 283 ? 55.456  -18.835 -5.241  1.00 19.71 ? 283  ASP C OD1 1 
ATOM   10042 O  OD2 . ASP C 1 283 ? 55.045  -17.728 -7.070  1.00 19.29 ? 283  ASP C OD2 1 
ATOM   10043 N  N   . TRP C 1 284 ? 57.658  -19.428 -3.901  1.00 18.81 ? 284  TRP C N   1 
ATOM   10044 C  CA  . TRP C 1 284 ? 58.327  -20.729 -3.944  1.00 19.85 ? 284  TRP C CA  1 
ATOM   10045 C  C   . TRP C 1 284 ? 57.862  -21.386 -5.231  1.00 20.70 ? 284  TRP C C   1 
ATOM   10046 O  O   . TRP C 1 284 ? 56.765  -21.969 -5.281  1.00 20.14 ? 284  TRP C O   1 
ATOM   10047 C  CB  . TRP C 1 284 ? 57.892  -21.632 -2.770  1.00 19.97 ? 284  TRP C CB  1 
ATOM   10048 C  CG  . TRP C 1 284 ? 58.392  -21.271 -1.393  1.00 19.15 ? 284  TRP C CG  1 
ATOM   10049 C  CD1 . TRP C 1 284 ? 59.030  -20.115 -1.009  1.00 19.58 ? 284  TRP C CD1 1 
ATOM   10050 C  CD2 . TRP C 1 284 ? 58.249  -22.061 -0.207  1.00 19.48 ? 284  TRP C CD2 1 
ATOM   10051 N  NE1 . TRP C 1 284 ? 59.311  -20.153 0.347   1.00 19.03 ? 284  TRP C NE1 1 
ATOM   10052 C  CE2 . TRP C 1 284 ? 58.847  -21.335 0.860   1.00 19.62 ? 284  TRP C CE2 1 
ATOM   10053 C  CE3 . TRP C 1 284 ? 57.691  -23.321 0.059   1.00 18.36 ? 284  TRP C CE3 1 
ATOM   10054 C  CZ2 . TRP C 1 284 ? 58.895  -21.828 2.165   1.00 19.03 ? 284  TRP C CZ2 1 
ATOM   10055 C  CZ3 . TRP C 1 284 ? 57.741  -23.808 1.347   1.00 19.15 ? 284  TRP C CZ3 1 
ATOM   10056 C  CH2 . TRP C 1 284 ? 58.336  -23.059 2.392   1.00 19.36 ? 284  TRP C CH2 1 
ATOM   10057 N  N   . PHE C 1 285 ? 58.682  -21.267 -6.272  1.00 22.11 ? 285  PHE C N   1 
ATOM   10058 C  CA  . PHE C 1 285 ? 58.355  -21.810 -7.594  1.00 22.91 ? 285  PHE C CA  1 
ATOM   10059 C  C   . PHE C 1 285 ? 58.132  -23.312 -7.543  1.00 23.54 ? 285  PHE C C   1 
ATOM   10060 O  O   . PHE C 1 285 ? 58.868  -24.043 -6.865  1.00 22.73 ? 285  PHE C O   1 
ATOM   10061 C  CB  . PHE C 1 285 ? 59.444  -21.464 -8.622  1.00 22.83 ? 285  PHE C CB  1 
ATOM   10062 C  CG  . PHE C 1 285 ? 59.626  -19.978 -8.861  1.00 23.08 ? 285  PHE C CG  1 
ATOM   10063 C  CD1 . PHE C 1 285 ? 60.905  -19.416 -8.858  1.00 23.80 ? 285  PHE C CD1 1 
ATOM   10064 C  CD2 . PHE C 1 285 ? 58.526  -19.146 -9.104  1.00 21.09 ? 285  PHE C CD2 1 
ATOM   10065 C  CE1 . PHE C 1 285 ? 61.079  -18.043 -9.083  1.00 23.46 ? 285  PHE C CE1 1 
ATOM   10066 C  CE2 . PHE C 1 285 ? 58.691  -17.788 -9.334  1.00 20.04 ? 285  PHE C CE2 1 
ATOM   10067 C  CZ  . PHE C 1 285 ? 59.961  -17.232 -9.323  1.00 22.18 ? 285  PHE C CZ  1 
ATOM   10068 N  N   . GLU C 1 286 ? 57.102  -23.755 -8.264  1.00 24.91 ? 286  GLU C N   1 
ATOM   10069 C  CA  . GLU C 1 286 ? 56.727  -25.162 -8.300  1.00 26.61 ? 286  GLU C CA  1 
ATOM   10070 C  C   . GLU C 1 286 ? 57.896  -26.045 -8.741  1.00 27.38 ? 286  GLU C C   1 
ATOM   10071 O  O   . GLU C 1 286 ? 58.093  -27.149 -8.208  1.00 27.83 ? 286  GLU C O   1 
ATOM   10072 C  CB  . GLU C 1 286 ? 55.516  -25.383 -9.210  1.00 26.64 ? 286  GLU C CB  1 
ATOM   10073 C  CG  . GLU C 1 286 ? 55.004  -26.824 -9.167  1.00 28.03 ? 286  GLU C CG  1 
ATOM   10074 C  CD  . GLU C 1 286 ? 53.578  -26.988 -9.676  1.00 30.10 ? 286  GLU C CD  1 
ATOM   10075 O  OE1 . GLU C 1 286 ? 53.087  -26.110 -10.428 1.00 28.82 ? 286  GLU C OE1 1 
ATOM   10076 O  OE2 . GLU C 1 286 ? 52.955  -28.019 -9.319  1.00 31.15 ? 286  GLU C OE2 1 
ATOM   10077 N  N   . ASP C 1 287 ? 58.670  -25.541 -9.703  1.00 28.10 ? 287  ASP C N   1 
ATOM   10078 C  CA  . ASP C 1 287 ? 59.854  -26.248 -10.202 1.00 28.74 ? 287  ASP C CA  1 
ATOM   10079 C  C   . ASP C 1 287 ? 61.005  -26.318 -9.186  1.00 28.73 ? 287  ASP C C   1 
ATOM   10080 O  O   . ASP C 1 287 ? 61.901  -27.162 -9.323  1.00 29.18 ? 287  ASP C O   1 
ATOM   10081 C  CB  . ASP C 1 287 ? 60.328  -25.667 -11.548 1.00 28.77 ? 287  ASP C CB  1 
ATOM   10082 C  CG  . ASP C 1 287 ? 60.516  -24.158 -11.511 1.00 29.63 ? 287  ASP C CG  1 
ATOM   10083 O  OD1 . ASP C 1 287 ? 61.665  -23.718 -11.393 1.00 30.47 ? 287  ASP C OD1 1 
ATOM   10084 O  OD2 . ASP C 1 287 ? 59.525  -23.406 -11.599 1.00 30.18 ? 287  ASP C OD2 1 
ATOM   10085 N  N   . VAL C 1 288 ? 60.990  -25.456 -8.165  1.00 28.33 ? 288  VAL C N   1 
ATOM   10086 C  CA  . VAL C 1 288 ? 62.010  -25.552 -7.109  1.00 27.61 ? 288  VAL C CA  1 
ATOM   10087 C  C   . VAL C 1 288 ? 61.516  -26.383 -5.908  1.00 26.93 ? 288  VAL C C   1 
ATOM   10088 O  O   . VAL C 1 288 ? 62.239  -27.253 -5.414  1.00 26.64 ? 288  VAL C O   1 
ATOM   10089 C  CB  . VAL C 1 288 ? 62.655  -24.159 -6.719  1.00 27.91 ? 288  VAL C CB  1 
ATOM   10090 C  CG1 . VAL C 1 288 ? 62.789  -23.252 -7.955  1.00 27.92 ? 288  VAL C CG1 1 
ATOM   10091 C  CG2 . VAL C 1 288 ? 61.882  -23.443 -5.626  1.00 29.15 ? 288  VAL C CG2 1 
ATOM   10092 N  N   . ILE C 1 289 ? 60.283  -26.132 -5.465  1.00 25.94 ? 289  ILE C N   1 
ATOM   10093 C  CA  . ILE C 1 289 ? 59.641  -26.949 -4.428  1.00 25.06 ? 289  ILE C CA  1 
ATOM   10094 C  C   . ILE C 1 289 ? 58.297  -27.474 -4.966  1.00 24.57 ? 289  ILE C C   1 
ATOM   10095 O  O   . ILE C 1 289 ? 57.394  -26.682 -5.240  1.00 24.38 ? 289  ILE C O   1 
ATOM   10096 C  CB  . ILE C 1 289 ? 59.449  -26.168 -3.073  1.00 25.02 ? 289  ILE C CB  1 
ATOM   10097 C  CG1 . ILE C 1 289 ? 60.772  -25.536 -2.612  1.00 25.26 ? 289  ILE C CG1 1 
ATOM   10098 C  CG2 . ILE C 1 289 ? 58.915  -27.096 -2.000  1.00 23.92 ? 289  ILE C CG2 1 
ATOM   10099 C  CD1 . ILE C 1 289 ? 60.643  -24.496 -1.535  1.00 24.69 ? 289  ILE C CD1 1 
ATOM   10100 N  N   . PRO C 1 290 ? 58.175  -28.807 -5.137  1.00 24.06 ? 290  PRO C N   1 
ATOM   10101 C  CA  . PRO C 1 290 ? 56.986  -29.410 -5.754  1.00 23.83 ? 290  PRO C CA  1 
ATOM   10102 C  C   . PRO C 1 290 ? 55.690  -29.257 -4.937  1.00 23.42 ? 290  PRO C C   1 
ATOM   10103 O  O   . PRO C 1 290 ? 55.727  -29.252 -3.696  1.00 23.29 ? 290  PRO C O   1 
ATOM   10104 C  CB  . PRO C 1 290 ? 57.368  -30.900 -5.880  1.00 23.79 ? 290  PRO C CB  1 
ATOM   10105 C  CG  . PRO C 1 290 ? 58.439  -31.110 -4.851  1.00 24.11 ? 290  PRO C CG  1 
ATOM   10106 C  CD  . PRO C 1 290 ? 59.183  -29.822 -4.769  1.00 24.10 ? 290  PRO C CD  1 
ATOM   10107 N  N   . PHE C 1 291 ? 54.571  -29.124 -5.650  1.00 22.62 ? 291  PHE C N   1 
ATOM   10108 C  CA  . PHE C 1 291 ? 53.236  -29.188 -5.067  1.00 22.58 ? 291  PHE C CA  1 
ATOM   10109 C  C   . PHE C 1 291 ? 52.878  -30.648 -4.732  1.00 22.82 ? 291  PHE C C   1 
ATOM   10110 O  O   . PHE C 1 291 ? 52.927  -31.507 -5.614  1.00 23.01 ? 291  PHE C O   1 
ATOM   10111 C  CB  . PHE C 1 291 ? 52.202  -28.655 -6.055  1.00 22.03 ? 291  PHE C CB  1 
ATOM   10112 C  CG  . PHE C 1 291 ? 52.231  -27.152 -6.272  1.00 21.92 ? 291  PHE C CG  1 
ATOM   10113 C  CD1 . PHE C 1 291 ? 53.355  -26.379 -5.955  1.00 21.68 ? 291  PHE C CD1 1 
ATOM   10114 C  CD2 . PHE C 1 291 ? 51.128  -26.517 -6.856  1.00 20.79 ? 291  PHE C CD2 1 
ATOM   10115 C  CE1 . PHE C 1 291 ? 53.364  -24.996 -6.191  1.00 20.41 ? 291  PHE C CE1 1 
ATOM   10116 C  CE2 . PHE C 1 291 ? 51.129  -25.143 -7.101  1.00 20.17 ? 291  PHE C CE2 1 
ATOM   10117 C  CZ  . PHE C 1 291 ? 52.245  -24.379 -6.771  1.00 20.39 ? 291  PHE C CZ  1 
ATOM   10118 N  N   . GLN C 1 292 ? 52.534  -30.929 -3.469  1.00 22.82 ? 292  GLN C N   1 
ATOM   10119 C  CA  . GLN C 1 292 ? 52.033  -32.258 -3.065  1.00 22.52 ? 292  GLN C CA  1 
ATOM   10120 C  C   . GLN C 1 292 ? 50.546  -32.216 -2.713  1.00 22.34 ? 292  GLN C C   1 
ATOM   10121 O  O   . GLN C 1 292 ? 50.125  -31.450 -1.841  1.00 21.88 ? 292  GLN C O   1 
ATOM   10122 C  CB  . GLN C 1 292 ? 52.814  -32.818 -1.876  1.00 22.20 ? 292  GLN C CB  1 
ATOM   10123 C  CG  . GLN C 1 292 ? 54.334  -32.773 -2.014  1.00 23.00 ? 292  GLN C CG  1 
ATOM   10124 C  CD  . GLN C 1 292 ? 55.033  -33.491 -0.872  1.00 23.63 ? 292  GLN C CD  1 
ATOM   10125 O  OE1 . GLN C 1 292 ? 54.637  -34.593 -0.482  1.00 25.66 ? 292  GLN C OE1 1 
ATOM   10126 N  NE2 . GLN C 1 292 ? 56.076  -32.870 -0.323  1.00 24.76 ? 292  GLN C NE2 1 
ATOM   10127 N  N   . HIS C 1 293 ? 49.759  -33.062 -3.378  1.00 22.23 ? 293  HIS C N   1 
ATOM   10128 C  CA  . HIS C 1 293 ? 48.305  -33.069 -3.210  1.00 21.85 ? 293  HIS C CA  1 
ATOM   10129 C  C   . HIS C 1 293 ? 47.868  -33.433 -1.789  1.00 21.48 ? 293  HIS C C   1 
ATOM   10130 O  O   . HIS C 1 293 ? 48.400  -34.372 -1.176  1.00 21.20 ? 293  HIS C O   1 
ATOM   10131 C  CB  . HIS C 1 293 ? 47.638  -33.986 -4.236  1.00 21.84 ? 293  HIS C CB  1 
ATOM   10132 C  CG  . HIS C 1 293 ? 46.156  -33.808 -4.330  1.00 22.63 ? 293  HIS C CG  1 
ATOM   10133 N  ND1 . HIS C 1 293 ? 45.260  -34.749 -3.866  1.00 24.43 ? 293  HIS C ND1 1 
ATOM   10134 C  CD2 . HIS C 1 293 ? 45.410  -32.798 -4.836  1.00 23.56 ? 293  HIS C CD2 1 
ATOM   10135 C  CE1 . HIS C 1 293 ? 44.027  -34.329 -4.088  1.00 23.74 ? 293  HIS C CE1 1 
ATOM   10136 N  NE2 . HIS C 1 293 ? 44.089  -33.149 -4.678  1.00 23.48 ? 293  HIS C NE2 1 
ATOM   10137 N  N   . VAL C 1 294 ? 46.900  -32.673 -1.282  1.00 20.76 ? 294  VAL C N   1 
ATOM   10138 C  CA  . VAL C 1 294 ? 46.382  -32.853 0.077   1.00 20.35 ? 294  VAL C CA  1 
ATOM   10139 C  C   . VAL C 1 294 ? 44.916  -33.310 0.034   1.00 19.94 ? 294  VAL C C   1 
ATOM   10140 O  O   . VAL C 1 294 ? 44.531  -34.257 0.713   1.00 20.02 ? 294  VAL C O   1 
ATOM   10141 C  CB  . VAL C 1 294 ? 46.510  -31.534 0.917   1.00 20.49 ? 294  VAL C CB  1 
ATOM   10142 C  CG1 . VAL C 1 294 ? 45.862  -31.686 2.296   1.00 20.05 ? 294  VAL C CG1 1 
ATOM   10143 C  CG2 . VAL C 1 294 ? 47.959  -31.127 1.057   1.00 19.51 ? 294  VAL C CG2 1 
ATOM   10144 N  N   . GLY C 1 295 ? 44.113  -32.629 -0.774  1.00 19.21 ? 295  GLY C N   1 
ATOM   10145 C  CA  . GLY C 1 295 ? 42.704  -32.921 -0.868  1.00 18.80 ? 295  GLY C CA  1 
ATOM   10146 C  C   . GLY C 1 295 ? 41.991  -31.840 -1.652  1.00 18.87 ? 295  GLY C C   1 
ATOM   10147 O  O   . GLY C 1 295 ? 42.623  -31.050 -2.354  1.00 18.56 ? 295  GLY C O   1 
ATOM   10148 N  N   . THR C 1 296 ? 40.667  -31.808 -1.537  1.00 18.66 ? 296  THR C N   1 
ATOM   10149 C  CA  . THR C 1 296 ? 39.862  -30.948 -2.402  1.00 19.28 ? 296  THR C CA  1 
ATOM   10150 C  C   . THR C 1 296 ? 38.680  -30.315 -1.668  1.00 19.06 ? 296  THR C C   1 
ATOM   10151 O  O   . THR C 1 296 ? 37.986  -30.974 -0.879  1.00 18.85 ? 296  THR C O   1 
ATOM   10152 C  CB  . THR C 1 296 ? 39.409  -31.675 -3.723  1.00 19.80 ? 296  THR C CB  1 
ATOM   10153 O  OG1 . THR C 1 296 ? 38.036  -31.363 -4.011  1.00 20.52 ? 296  THR C OG1 1 
ATOM   10154 C  CG2 . THR C 1 296 ? 39.559  -33.200 -3.610  1.00 19.66 ? 296  THR C CG2 1 
ATOM   10155 N  N   . MET C 1 297 ? 38.488  -29.024 -1.915  1.00 18.50 ? 297  MET C N   1 
ATOM   10156 C  CA  . MET C 1 297 ? 37.375  -28.293 -1.336  1.00 18.24 ? 297  MET C CA  1 
ATOM   10157 C  C   . MET C 1 297 ? 36.278  -28.143 -2.376  1.00 17.66 ? 297  MET C C   1 
ATOM   10158 O  O   . MET C 1 297 ? 36.547  -27.778 -3.519  1.00 17.37 ? 297  MET C O   1 
ATOM   10159 C  CB  . MET C 1 297 ? 37.829  -26.914 -0.829  1.00 18.08 ? 297  MET C CB  1 
ATOM   10160 C  CG  . MET C 1 297 ? 36.683  -25.932 -0.497  1.00 18.55 ? 297  MET C CG  1 
ATOM   10161 S  SD  . MET C 1 297 ? 37.248  -24.385 0.252   1.00 19.38 ? 297  MET C SD  1 
ATOM   10162 C  CE  . MET C 1 297 ? 37.929  -23.487 -1.154  1.00 14.67 ? 297  MET C CE  1 
ATOM   10163 N  N   . THR C 1 298 ? 35.044  -28.406 -1.961  1.00 17.32 ? 298  THR C N   1 
ATOM   10164 C  CA  . THR C 1 298 ? 33.873  -28.237 -2.820  1.00 17.65 ? 298  THR C CA  1 
ATOM   10165 C  C   . THR C 1 298 ? 32.859  -27.308 -2.149  1.00 17.59 ? 298  THR C C   1 
ATOM   10166 O  O   . THR C 1 298 ? 32.447  -27.551 -1.010  1.00 17.63 ? 298  THR C O   1 
ATOM   10167 C  CB  . THR C 1 298 ? 33.189  -29.606 -3.093  1.00 17.96 ? 298  THR C CB  1 
ATOM   10168 O  OG1 . THR C 1 298 ? 34.168  -30.549 -3.569  1.00 18.03 ? 298  THR C OG1 1 
ATOM   10169 C  CG2 . THR C 1 298 ? 32.028  -29.456 -4.108  1.00 17.18 ? 298  THR C CG2 1 
ATOM   10170 N  N   . LEU C 1 299 ? 32.457  -26.255 -2.846  1.00 17.23 ? 299  LEU C N   1 
ATOM   10171 C  CA  . LEU C 1 299 ? 31.509  -25.309 -2.275  1.00 17.69 ? 299  LEU C CA  1 
ATOM   10172 C  C   . LEU C 1 299 ? 30.094  -25.568 -2.793  1.00 18.04 ? 299  LEU C C   1 
ATOM   10173 O  O   . LEU C 1 299 ? 29.750  -25.223 -3.934  1.00 18.16 ? 299  LEU C O   1 
ATOM   10174 C  CB  . LEU C 1 299 ? 31.956  -23.863 -2.527  1.00 17.75 ? 299  LEU C CB  1 
ATOM   10175 C  CG  . LEU C 1 299 ? 32.839  -23.115 -1.514  1.00 17.96 ? 299  LEU C CG  1 
ATOM   10176 C  CD1 . LEU C 1 299 ? 33.653  -23.992 -0.588  1.00 17.26 ? 299  LEU C CD1 1 
ATOM   10177 C  CD2 . LEU C 1 299 ? 33.722  -22.142 -2.235  1.00 18.39 ? 299  LEU C CD2 1 
ATOM   10178 N  N   . ASN C 1 300 ? 29.272  -26.132 -1.913  1.00 18.29 ? 300  ASN C N   1 
ATOM   10179 C  CA  . ASN C 1 300 ? 28.026  -26.743 -2.296  1.00 19.07 ? 300  ASN C CA  1 
ATOM   10180 C  C   . ASN C 1 300 ? 26.784  -26.182 -1.618  1.00 19.51 ? 300  ASN C C   1 
ATOM   10181 O  O   . ASN C 1 300 ? 25.724  -26.824 -1.660  1.00 19.72 ? 300  ASN C O   1 
ATOM   10182 C  CB  . ASN C 1 300 ? 28.111  -28.254 -2.045  1.00 19.31 ? 300  ASN C CB  1 
ATOM   10183 C  CG  . ASN C 1 300 ? 28.302  -28.598 -0.580  1.00 19.94 ? 300  ASN C CG  1 
ATOM   10184 O  OD1 . ASN C 1 300 ? 28.393  -27.724 0.284   1.00 21.03 ? 300  ASN C OD1 1 
ATOM   10185 N  ND2 . ASN C 1 300 ? 28.369  -29.889 -0.294  1.00 21.80 ? 300  ASN C ND2 1 
ATOM   10186 N  N   . LYS C 1 301 ? 26.913  -25.021 -0.969  1.00 19.48 ? 301  LYS C N   1 
ATOM   10187 C  CA  . LYS C 1 301 ? 25.745  -24.348 -0.383  1.00 19.74 ? 301  LYS C CA  1 
ATOM   10188 C  C   . LYS C 1 301 ? 25.934  -22.844 -0.119  1.00 19.33 ? 301  LYS C C   1 
ATOM   10189 O  O   . LYS C 1 301 ? 26.887  -22.399 0.555   1.00 19.06 ? 301  LYS C O   1 
ATOM   10190 C  CB  . LYS C 1 301 ? 25.264  -25.045 0.890   1.00 19.83 ? 301  LYS C CB  1 
ATOM   10191 C  CG  . LYS C 1 301 ? 23.856  -24.638 1.324   1.00 20.84 ? 301  LYS C CG  1 
ATOM   10192 C  CD  . LYS C 1 301 ? 23.549  -25.194 2.738   1.00 22.24 ? 301  LYS C CD  1 
ATOM   10193 C  CE  . LYS C 1 301 ? 22.150  -24.781 3.240   1.00 24.29 ? 301  LYS C CE  1 
ATOM   10194 N  NZ  . LYS C 1 301 ? 21.048  -25.364 2.406   1.00 25.80 ? 301  LYS C NZ  1 
ATOM   10195 N  N   . ASN C 1 302 ? 24.998  -22.073 -0.662  1.00 18.21 ? 302  ASN C N   1 
ATOM   10196 C  CA  . ASN C 1 302 ? 24.948  -20.652 -0.412  1.00 17.39 ? 302  ASN C CA  1 
ATOM   10197 C  C   . ASN C 1 302 ? 24.472  -20.393 1.015   1.00 16.44 ? 302  ASN C C   1 
ATOM   10198 O  O   . ASN C 1 302 ? 23.751  -21.195 1.591   1.00 16.05 ? 302  ASN C O   1 
ATOM   10199 C  CB  . ASN C 1 302 ? 24.032  -19.951 -1.436  1.00 16.97 ? 302  ASN C CB  1 
ATOM   10200 C  CG  . ASN C 1 302 ? 24.679  -19.821 -2.802  1.00 17.89 ? 302  ASN C CG  1 
ATOM   10201 O  OD1 . ASN C 1 302 ? 25.721  -19.158 -2.952  1.00 17.78 ? 302  ASN C OD1 1 
ATOM   10202 N  ND2 . ASN C 1 302 ? 24.079  -20.468 -3.811  1.00 16.37 ? 302  ASN C ND2 1 
ATOM   10203 N  N   . VAL C 1 303 ? 24.898  -19.263 1.562   1.00 15.70 ? 303  VAL C N   1 
ATOM   10204 C  CA  . VAL C 1 303 ? 24.505  -18.815 2.888   1.00 14.71 ? 303  VAL C CA  1 
ATOM   10205 C  C   . VAL C 1 303 ? 22.993  -18.704 2.914   1.00 14.64 ? 303  VAL C C   1 
ATOM   10206 O  O   . VAL C 1 303 ? 22.378  -18.448 1.873   1.00 15.08 ? 303  VAL C O   1 
ATOM   10207 C  CB  . VAL C 1 303 ? 25.187  -17.455 3.233   1.00 14.81 ? 303  VAL C CB  1 
ATOM   10208 C  CG1 . VAL C 1 303 ? 26.707  -17.611 3.291   1.00 13.15 ? 303  VAL C CG1 1 
ATOM   10209 C  CG2 . VAL C 1 303 ? 24.826  -16.365 2.206   1.00 14.93 ? 303  VAL C CG2 1 
ATOM   10210 N  N   . ASP C 1 304 ? 22.400  -18.955 4.082   1.00 14.08 ? 304  ASP C N   1 
ATOM   10211 C  CA  . ASP C 1 304 ? 20.984  -18.657 4.341   1.00 14.01 ? 304  ASP C CA  1 
ATOM   10212 C  C   . ASP C 1 304 ? 20.816  -17.151 4.468   1.00 12.78 ? 304  ASP C C   1 
ATOM   10213 O  O   . ASP C 1 304 ? 19.829  -16.597 4.037   1.00 12.79 ? 304  ASP C O   1 
ATOM   10214 C  CB  . ASP C 1 304 ? 20.495  -19.318 5.643   1.00 14.44 ? 304  ASP C CB  1 
ATOM   10215 C  CG  . ASP C 1 304 ? 20.431  -20.840 5.546   1.00 17.09 ? 304  ASP C CG  1 
ATOM   10216 O  OD1 . ASP C 1 304 ? 20.151  -21.359 4.436   1.00 19.74 ? 304  ASP C OD1 1 
ATOM   10217 O  OD2 . ASP C 1 304 ? 20.645  -21.524 6.580   1.00 18.51 ? 304  ASP C OD2 1 
ATOM   10218 N  N   . ASN C 1 305 ? 21.800  -16.502 5.076   1.00 11.60 ? 305  ASN C N   1 
ATOM   10219 C  CA  . ASN C 1 305 ? 21.743  -15.081 5.323   1.00 10.80 ? 305  ASN C CA  1 
ATOM   10220 C  C   . ASN C 1 305 ? 23.154  -14.494 5.280   1.00 10.52 ? 305  ASN C C   1 
ATOM   10221 O  O   . ASN C 1 305 ? 24.051  -14.925 5.973   1.00 10.53 ? 305  ASN C O   1 
ATOM   10222 C  CB  . ASN C 1 305 ? 21.029  -14.811 6.646   1.00 10.22 ? 305  ASN C CB  1 
ATOM   10223 C  CG  . ASN C 1 305 ? 20.966  -13.348 6.984   1.00 9.34  ? 305  ASN C CG  1 
ATOM   10224 O  OD1 . ASN C 1 305 ? 21.821  -12.838 7.726   1.00 10.06 ? 305  ASN C OD1 1 
ATOM   10225 N  ND2 . ASN C 1 305 ? 19.958  -12.657 6.457   1.00 4.99  ? 305  ASN C ND2 1 
ATOM   10226 N  N   . TYR C 1 306 ? 23.330  -13.527 4.407   1.00 10.87 ? 306  TYR C N   1 
ATOM   10227 C  CA  . TYR C 1 306 ? 24.609  -12.944 4.113   1.00 10.49 ? 306  TYR C CA  1 
ATOM   10228 C  C   . TYR C 1 306 ? 25.152  -12.239 5.344   1.00 10.26 ? 306  TYR C C   1 
ATOM   10229 O  O   . TYR C 1 306 ? 26.287  -12.482 5.713   1.00 10.54 ? 306  TYR C O   1 
ATOM   10230 C  CB  . TYR C 1 306 ? 24.449  -11.968 2.927   1.00 10.98 ? 306  TYR C CB  1 
ATOM   10231 C  CG  . TYR C 1 306 ? 25.740  -11.305 2.492   1.00 12.13 ? 306  TYR C CG  1 
ATOM   10232 C  CD1 . TYR C 1 306 ? 26.467  -11.809 1.395   1.00 13.39 ? 306  TYR C CD1 1 
ATOM   10233 C  CD2 . TYR C 1 306 ? 26.238  -10.171 3.167   1.00 12.33 ? 306  TYR C CD2 1 
ATOM   10234 C  CE1 . TYR C 1 306 ? 27.661  -11.213 0.970   1.00 12.38 ? 306  TYR C CE1 1 
ATOM   10235 C  CE2 . TYR C 1 306 ? 27.455  -9.569  2.761   1.00 13.33 ? 306  TYR C CE2 1 
ATOM   10236 C  CZ  . TYR C 1 306 ? 28.149  -10.097 1.664   1.00 12.17 ? 306  TYR C CZ  1 
ATOM   10237 O  OH  . TYR C 1 306 ? 29.322  -9.520  1.259   1.00 10.03 ? 306  TYR C OH  1 
ATOM   10238 N  N   . PHE C 1 307 ? 24.346  -11.381 5.983   1.00 10.34 ? 307  PHE C N   1 
ATOM   10239 C  CA  . PHE C 1 307 ? 24.802  -10.629 7.162   1.00 10.41 ? 307  PHE C CA  1 
ATOM   10240 C  C   . PHE C 1 307 ? 25.327  -11.486 8.280   1.00 10.25 ? 307  PHE C C   1 
ATOM   10241 O  O   . PHE C 1 307 ? 26.389  -11.208 8.794   1.00 10.75 ? 307  PHE C O   1 
ATOM   10242 C  CB  . PHE C 1 307 ? 23.727  -9.705  7.747   1.00 10.45 ? 307  PHE C CB  1 
ATOM   10243 C  CG  . PHE C 1 307 ? 24.225  -8.854  8.887   1.00 9.84  ? 307  PHE C CG  1 
ATOM   10244 C  CD1 . PHE C 1 307 ? 23.972  -9.213  10.213  1.00 10.29 ? 307  PHE C CD1 1 
ATOM   10245 C  CD2 . PHE C 1 307 ? 24.967  -7.703  8.639   1.00 9.79  ? 307  PHE C CD2 1 
ATOM   10246 C  CE1 . PHE C 1 307 ? 24.451  -8.443  11.266  1.00 8.68  ? 307  PHE C CE1 1 
ATOM   10247 C  CE2 . PHE C 1 307 ? 25.448  -6.914  9.692   1.00 8.89  ? 307  PHE C CE2 1 
ATOM   10248 C  CZ  . PHE C 1 307 ? 25.183  -7.282  11.000  1.00 9.49  ? 307  PHE C CZ  1 
ATOM   10249 N  N   . ALA C 1 308 ? 24.574  -12.500 8.682   1.00 10.24 ? 308  ALA C N   1 
ATOM   10250 C  CA  . ALA C 1 308 ? 24.955  -13.284 9.864   1.00 10.58 ? 308  ALA C CA  1 
ATOM   10251 C  C   . ALA C 1 308 ? 26.032  -14.287 9.483   1.00 10.94 ? 308  ALA C C   1 
ATOM   10252 O  O   . ALA C 1 308 ? 26.698  -14.836 10.354  1.00 11.16 ? 308  ALA C O   1 
ATOM   10253 C  CB  . ALA C 1 308 ? 23.758  -13.993 10.469  1.00 9.65  ? 308  ALA C CB  1 
ATOM   10254 N  N   . GLU C 1 309 ? 26.231  -14.498 8.182   1.00 10.92 ? 309  GLU C N   1 
ATOM   10255 C  CA  . GLU C 1 309 ? 27.237  -15.474 7.732   1.00 11.51 ? 309  GLU C CA  1 
ATOM   10256 C  C   . GLU C 1 309 ? 28.486  -14.792 7.122   1.00 10.96 ? 309  GLU C C   1 
ATOM   10257 O  O   . GLU C 1 309 ? 29.544  -14.733 7.765   1.00 10.79 ? 309  GLU C O   1 
ATOM   10258 C  CB  . GLU C 1 309 ? 26.593  -16.561 6.831   1.00 11.53 ? 309  GLU C CB  1 
ATOM   10259 C  CG  . GLU C 1 309 ? 25.458  -17.313 7.563   1.00 11.90 ? 309  GLU C CG  1 
ATOM   10260 C  CD  . GLU C 1 309 ? 24.649  -18.284 6.698   1.00 12.95 ? 309  GLU C CD  1 
ATOM   10261 O  OE1 . GLU C 1 309 ? 25.245  -19.217 6.122   1.00 16.62 ? 309  GLU C OE1 1 
ATOM   10262 O  OE2 . GLU C 1 309 ? 23.401  -18.154 6.632   1.00 13.79 ? 309  GLU C OE2 1 
ATOM   10263 N  N   . THR C 1 310 ? 28.336  -14.232 5.925   1.00 10.67 ? 310  THR C N   1 
ATOM   10264 C  CA  . THR C 1 310 ? 29.444  -13.635 5.196   1.00 10.18 ? 310  THR C CA  1 
ATOM   10265 C  C   . THR C 1 310 ? 29.977  -12.329 5.809   1.00 10.31 ? 310  THR C C   1 
ATOM   10266 O  O   . THR C 1 310 ? 31.205  -12.118 5.869   1.00 10.30 ? 310  THR C O   1 
ATOM   10267 C  CB  . THR C 1 310 ? 29.080  -13.454 3.715   1.00 10.59 ? 310  THR C CB  1 
ATOM   10268 O  OG1 . THR C 1 310 ? 28.678  -14.726 3.196   1.00 9.77  ? 310  THR C OG1 1 
ATOM   10269 C  CG2 . THR C 1 310 ? 30.271  -12.881 2.889   1.00 8.13  ? 310  THR C CG2 1 
ATOM   10270 N  N   . GLU C 1 311 ? 29.077  -11.475 6.275   1.00 9.52  ? 311  GLU C N   1 
ATOM   10271 C  CA  . GLU C 1 311 ? 29.501  -10.259 6.982   1.00 9.87  ? 311  GLU C CA  1 
ATOM   10272 C  C   . GLU C 1 311 ? 30.084  -10.546 8.398   1.00 8.99  ? 311  GLU C C   1 
ATOM   10273 O  O   . GLU C 1 311 ? 31.097  -9.980  8.781   1.00 9.09  ? 311  GLU C O   1 
ATOM   10274 C  CB  . GLU C 1 311 ? 28.349  -9.225  7.035   1.00 10.06 ? 311  GLU C CB  1 
ATOM   10275 C  CG  . GLU C 1 311 ? 28.788  -7.782  7.421   1.00 11.67 ? 311  GLU C CG  1 
ATOM   10276 C  CD  . GLU C 1 311 ? 29.848  -7.171  6.480   1.00 12.08 ? 311  GLU C CD  1 
ATOM   10277 O  OE1 . GLU C 1 311 ? 29.918  -7.590  5.311   1.00 13.27 ? 311  GLU C OE1 1 
ATOM   10278 O  OE2 . GLU C 1 311 ? 30.604  -6.262  6.908   1.00 11.04 ? 311  GLU C OE2 1 
ATOM   10279 N  N   . SER C 1 312 ? 29.466  -11.457 9.135   1.00 8.16  ? 312  SER C N   1 
ATOM   10280 C  CA  . SER C 1 312 ? 29.809  -11.662 10.518  1.00 7.55  ? 312  SER C CA  1 
ATOM   10281 C  C   . SER C 1 312 ? 30.958  -12.644 10.776  1.00 7.61  ? 312  SER C C   1 
ATOM   10282 O  O   . SER C 1 312 ? 31.404  -12.780 11.907  1.00 7.67  ? 312  SER C O   1 
ATOM   10283 C  CB  . SER C 1 312 ? 28.562  -12.030 11.333  1.00 7.70  ? 312  SER C CB  1 
ATOM   10284 O  OG  . SER C 1 312 ? 27.620  -10.967 11.337  1.00 7.63  ? 312  SER C OG  1 
ATOM   10285 N  N   . VAL C 1 313 ? 31.446  -13.326 9.747   1.00 7.42  ? 313  VAL C N   1 
ATOM   10286 C  CA  . VAL C 1 313 ? 32.565  -14.241 9.939   1.00 6.48  ? 313  VAL C CA  1 
ATOM   10287 C  C   . VAL C 1 313 ? 33.893  -13.505 10.137  1.00 7.05  ? 313  VAL C C   1 
ATOM   10288 O  O   . VAL C 1 313 ? 34.182  -12.540 9.435   1.00 6.18  ? 313  VAL C O   1 
ATOM   10289 C  CB  . VAL C 1 313 ? 32.695  -15.271 8.772   1.00 6.68  ? 313  VAL C CB  1 
ATOM   10290 C  CG1 . VAL C 1 313 ? 33.182  -14.616 7.456   1.00 4.94  ? 313  VAL C CG1 1 
ATOM   10291 C  CG2 . VAL C 1 313 ? 33.584  -16.468 9.180   1.00 3.62  ? 313  VAL C CG2 1 
ATOM   10292 N  N   . GLY C 1 314 ? 34.697  -13.996 11.082  1.00 7.37  ? 314  GLY C N   1 
ATOM   10293 C  CA  . GLY C 1 314 ? 36.072  -13.534 11.254  1.00 8.16  ? 314  GLY C CA  1 
ATOM   10294 C  C   . GLY C 1 314 ? 37.031  -14.657 10.919  1.00 8.43  ? 314  GLY C C   1 
ATOM   10295 O  O   . GLY C 1 314 ? 36.764  -15.790 11.265  1.00 9.15  ? 314  GLY C O   1 
ATOM   10296 N  N   . PHE C 1 315 ? 38.128  -14.339 10.231  1.00 8.44  ? 315  PHE C N   1 
ATOM   10297 C  CA  . PHE C 1 315 ? 39.228  -15.282 9.985   1.00 8.54  ? 315  PHE C CA  1 
ATOM   10298 C  C   . PHE C 1 315 ? 40.537  -14.742 10.564  1.00 8.91  ? 315  PHE C C   1 
ATOM   10299 O  O   . PHE C 1 315 ? 40.719  -13.537 10.644  1.00 9.16  ? 315  PHE C O   1 
ATOM   10300 C  CB  . PHE C 1 315 ? 39.464  -15.506 8.494   1.00 7.28  ? 315  PHE C CB  1 
ATOM   10301 C  CG  . PHE C 1 315 ? 38.276  -15.979 7.735   1.00 7.35  ? 315  PHE C CG  1 
ATOM   10302 C  CD1 . PHE C 1 315 ? 37.953  -17.329 7.693   1.00 6.10  ? 315  PHE C CD1 1 
ATOM   10303 C  CD2 . PHE C 1 315 ? 37.502  -15.070 6.992   1.00 8.85  ? 315  PHE C CD2 1 
ATOM   10304 C  CE1 . PHE C 1 315 ? 36.857  -17.769 6.948   1.00 8.09  ? 315  PHE C CE1 1 
ATOM   10305 C  CE2 . PHE C 1 315 ? 36.400  -15.491 6.235   1.00 7.57  ? 315  PHE C CE2 1 
ATOM   10306 C  CZ  . PHE C 1 315 ? 36.078  -16.849 6.211   1.00 8.15  ? 315  PHE C CZ  1 
ATOM   10307 N  N   . ASN C 1 316 ? 41.452  -15.637 10.935  1.00 8.91  ? 316  ASN C N   1 
ATOM   10308 C  CA  . ASN C 1 316 ? 42.799  -15.248 11.344  1.00 9.33  ? 316  ASN C CA  1 
ATOM   10309 C  C   . ASN C 1 316 ? 43.816  -16.317 10.914  1.00 9.60  ? 316  ASN C C   1 
ATOM   10310 O  O   . ASN C 1 316 ? 43.712  -17.477 11.332  1.00 9.86  ? 316  ASN C O   1 
ATOM   10311 C  CB  . ASN C 1 316 ? 42.842  -15.014 12.867  1.00 9.24  ? 316  ASN C CB  1 
ATOM   10312 C  CG  . ASN C 1 316 ? 44.194  -14.491 13.362  1.00 9.46  ? 316  ASN C CG  1 
ATOM   10313 O  OD1 . ASN C 1 316 ? 45.174  -14.472 12.632  1.00 7.93  ? 316  ASN C OD1 1 
ATOM   10314 N  ND2 . ASN C 1 316 ? 44.239  -14.068 14.631  1.00 10.62 ? 316  ASN C ND2 1 
ATOM   10315 N  N   . PRO C 1 317 ? 44.797  -15.942 10.061  1.00 10.03 ? 317  PRO C N   1 
ATOM   10316 C  CA  . PRO C 1 317 ? 45.854  -16.902 9.652   1.00 10.19 ? 317  PRO C CA  1 
ATOM   10317 C  C   . PRO C 1 317 ? 46.539  -17.554 10.858  1.00 10.38 ? 317  PRO C C   1 
ATOM   10318 O  O   . PRO C 1 317 ? 47.114  -18.644 10.740  1.00 10.55 ? 317  PRO C O   1 
ATOM   10319 C  CB  . PRO C 1 317 ? 46.864  -16.023 8.890   1.00 10.05 ? 317  PRO C CB  1 
ATOM   10320 C  CG  . PRO C 1 317 ? 46.453  -14.594 9.212   1.00 9.98  ? 317  PRO C CG  1 
ATOM   10321 C  CD  . PRO C 1 317 ? 44.985  -14.626 9.422   1.00 9.06  ? 317  PRO C CD  1 
ATOM   10322 N  N   . GLY C 1 318 ? 46.465  -16.884 12.008  1.00 10.55 ? 318  GLY C N   1 
ATOM   10323 C  CA  . GLY C 1 318 ? 47.052  -17.389 13.240  1.00 10.51 ? 318  GLY C CA  1 
ATOM   10324 C  C   . GLY C 1 318 ? 46.125  -18.298 14.016  1.00 10.70 ? 318  GLY C C   1 
ATOM   10325 O  O   . GLY C 1 318 ? 46.484  -18.787 15.093  1.00 10.80 ? 318  GLY C O   1 
ATOM   10326 N  N   . VAL C 1 319 ? 44.928  -18.529 13.473  1.00 10.93 ? 319  VAL C N   1 
ATOM   10327 C  CA  . VAL C 1 319 ? 44.001  -19.497 14.065  1.00 11.07 ? 319  VAL C CA  1 
ATOM   10328 C  C   . VAL C 1 319 ? 44.334  -20.852 13.456  1.00 11.19 ? 319  VAL C C   1 
ATOM   10329 O  O   . VAL C 1 319 ? 43.983  -21.139 12.313  1.00 11.93 ? 319  VAL C O   1 
ATOM   10330 C  CB  . VAL C 1 319 ? 42.502  -19.025 13.948  1.00 10.97 ? 319  VAL C CB  1 
ATOM   10331 C  CG1 . VAL C 1 319 ? 41.494  -20.185 14.123  1.00 9.14  ? 319  VAL C CG1 1 
ATOM   10332 C  CG2 . VAL C 1 319 ? 42.253  -17.930 14.964  1.00 9.15  ? 319  VAL C CG2 1 
ATOM   10333 N  N   . LEU C 1 320 ? 45.068  -21.647 14.228  1.00 11.31 ? 320  LEU C N   1 
ATOM   10334 C  CA  . LEU C 1 320 ? 45.695  -22.884 13.761  1.00 11.80 ? 320  LEU C CA  1 
ATOM   10335 C  C   . LEU C 1 320 ? 45.313  -24.042 14.667  1.00 11.86 ? 320  LEU C C   1 
ATOM   10336 O  O   . LEU C 1 320 ? 45.087  -23.845 15.852  1.00 12.54 ? 320  LEU C O   1 
ATOM   10337 C  CB  . LEU C 1 320 ? 47.233  -22.736 13.758  1.00 11.75 ? 320  LEU C CB  1 
ATOM   10338 C  CG  . LEU C 1 320 ? 47.836  -21.680 12.812  1.00 11.95 ? 320  LEU C CG  1 
ATOM   10339 C  CD1 . LEU C 1 320 ? 49.262  -21.382 13.176  1.00 10.53 ? 320  LEU C CD1 1 
ATOM   10340 C  CD2 . LEU C 1 320 ? 47.757  -22.132 11.357  1.00 11.58 ? 320  LEU C CD2 1 
ATOM   10341 N  N   . VAL C 1 321 ? 45.257  -25.247 14.113  1.00 11.80 ? 321  VAL C N   1 
ATOM   10342 C  CA  . VAL C 1 321 ? 45.001  -26.458 14.907  1.00 11.44 ? 321  VAL C CA  1 
ATOM   10343 C  C   . VAL C 1 321 ? 46.338  -27.069 15.332  1.00 11.76 ? 321  VAL C C   1 
ATOM   10344 O  O   . VAL C 1 321 ? 47.371  -26.731 14.749  1.00 11.85 ? 321  VAL C O   1 
ATOM   10345 C  CB  . VAL C 1 321 ? 44.120  -27.474 14.147  1.00 11.20 ? 321  VAL C CB  1 
ATOM   10346 C  CG1 . VAL C 1 321 ? 42.680  -26.944 14.035  1.00 10.35 ? 321  VAL C CG1 1 
ATOM   10347 C  CG2 . VAL C 1 321 ? 44.701  -27.773 12.757  1.00 9.83  ? 321  VAL C CG2 1 
ATOM   10348 N  N   . PRO C 1 322 ? 46.335  -27.928 16.375  1.00 12.09 ? 322  PRO C N   1 
ATOM   10349 C  CA  . PRO C 1 322 ? 47.587  -28.602 16.786  1.00 12.18 ? 322  PRO C CA  1 
ATOM   10350 C  C   . PRO C 1 322 ? 48.226  -29.325 15.613  1.00 12.21 ? 322  PRO C C   1 
ATOM   10351 O  O   . PRO C 1 322 ? 47.536  -29.993 14.833  1.00 12.14 ? 322  PRO C O   1 
ATOM   10352 C  CB  . PRO C 1 322 ? 47.122  -29.607 17.852  1.00 12.19 ? 322  PRO C CB  1 
ATOM   10353 C  CG  . PRO C 1 322 ? 45.880  -28.992 18.410  1.00 12.59 ? 322  PRO C CG  1 
ATOM   10354 C  CD  . PRO C 1 322 ? 45.201  -28.309 17.239  1.00 12.15 ? 322  PRO C CD  1 
ATOM   10355 N  N   . GLY C 1 323 ? 49.537  -29.177 15.482  1.00 12.40 ? 323  GLY C N   1 
ATOM   10356 C  CA  . GLY C 1 323 ? 50.241  -29.674 14.307  1.00 11.95 ? 323  GLY C CA  1 
ATOM   10357 C  C   . GLY C 1 323 ? 50.663  -28.532 13.418  1.00 12.06 ? 323  GLY C C   1 
ATOM   10358 O  O   . GLY C 1 323 ? 51.441  -28.741 12.483  1.00 11.67 ? 323  GLY C O   1 
ATOM   10359 N  N   . MET C 1 324 ? 50.150  -27.327 13.703  1.00 11.87 ? 324  MET C N   1 
ATOM   10360 C  CA  . MET C 1 324 ? 50.479  -26.144 12.898  1.00 12.24 ? 324  MET C CA  1 
ATOM   10361 C  C   . MET C 1 324 ? 50.938  -24.987 13.752  1.00 12.23 ? 324  MET C C   1 
ATOM   10362 O  O   . MET C 1 324 ? 50.402  -24.751 14.827  1.00 12.33 ? 324  MET C O   1 
ATOM   10363 C  CB  . MET C 1 324 ? 49.309  -25.678 12.040  1.00 11.99 ? 324  MET C CB  1 
ATOM   10364 C  CG  . MET C 1 324 ? 48.589  -26.744 11.268  1.00 12.19 ? 324  MET C CG  1 
ATOM   10365 S  SD  . MET C 1 324 ? 47.089  -26.097 10.508  1.00 13.46 ? 324  MET C SD  1 
ATOM   10366 C  CE  . MET C 1 324 ? 46.644  -27.506 9.476   1.00 11.56 ? 324  MET C CE  1 
ATOM   10367 N  N   . LEU C 1 325 ? 51.934  -24.266 13.247  1.00 12.17 ? 325  LEU C N   1 
ATOM   10368 C  CA  . LEU C 1 325 ? 52.476  -23.084 13.900  1.00 11.96 ? 325  LEU C CA  1 
ATOM   10369 C  C   . LEU C 1 325 ? 52.786  -22.013 12.846  1.00 11.66 ? 325  LEU C C   1 
ATOM   10370 O  O   . LEU C 1 325 ? 53.016  -22.337 11.678  1.00 11.82 ? 325  LEU C O   1 
ATOM   10371 C  CB  . LEU C 1 325 ? 53.749  -23.435 14.694  1.00 11.78 ? 325  LEU C CB  1 
ATOM   10372 C  CG  . LEU C 1 325 ? 53.670  -24.236 16.008  1.00 12.41 ? 325  LEU C CG  1 
ATOM   10373 C  CD1 . LEU C 1 325 ? 55.071  -24.323 16.596  1.00 11.99 ? 325  LEU C CD1 1 
ATOM   10374 C  CD2 . LEU C 1 325 ? 52.716  -23.616 17.053  1.00 10.49 ? 325  LEU C CD2 1 
ATOM   10375 N  N   . PRO C 1 326 ? 52.790  -20.729 13.248  1.00 11.08 ? 326  PRO C N   1 
ATOM   10376 C  CA  . PRO C 1 326 ? 53.172  -19.712 12.266  1.00 10.48 ? 326  PRO C CA  1 
ATOM   10377 C  C   . PRO C 1 326 ? 54.687  -19.733 12.001  1.00 10.92 ? 326  PRO C C   1 
ATOM   10378 O  O   . PRO C 1 326 ? 55.459  -20.121 12.869  1.00 10.50 ? 326  PRO C O   1 
ATOM   10379 C  CB  . PRO C 1 326 ? 52.753  -18.404 12.943  1.00 10.99 ? 326  PRO C CB  1 
ATOM   10380 C  CG  . PRO C 1 326 ? 52.751  -18.722 14.460  1.00 9.86  ? 326  PRO C CG  1 
ATOM   10381 C  CD  . PRO C 1 326 ? 52.436  -20.169 14.574  1.00 10.19 ? 326  PRO C CD  1 
ATOM   10382 N  N   . SER C 1 327 ? 55.119  -19.341 10.808  1.00 11.18 ? 327  SER C N   1 
ATOM   10383 C  CA  . SER C 1 327 ? 56.533  -19.119 10.617  1.00 12.20 ? 327  SER C CA  1 
ATOM   10384 C  C   . SER C 1 327 ? 56.949  -17.790 11.256  1.00 12.81 ? 327  SER C C   1 
ATOM   10385 O  O   . SER C 1 327 ? 56.110  -17.024 11.761  1.00 13.19 ? 327  SER C O   1 
ATOM   10386 C  CB  . SER C 1 327 ? 56.900  -19.142 9.146   1.00 11.99 ? 327  SER C CB  1 
ATOM   10387 O  OG  . SER C 1 327 ? 56.449  -17.960 8.518   1.00 12.39 ? 327  SER C OG  1 
ATOM   10388 N  N   . GLU C 1 328 ? 58.244  -17.511 11.236  1.00 13.33 ? 328  GLU C N   1 
ATOM   10389 C  CA  . GLU C 1 328 ? 58.707  -16.220 11.733  1.00 14.52 ? 328  GLU C CA  1 
ATOM   10390 C  C   . GLU C 1 328 ? 58.606  -15.075 10.682  1.00 14.47 ? 328  GLU C C   1 
ATOM   10391 O  O   . GLU C 1 328 ? 59.091  -13.969 10.895  1.00 15.37 ? 328  GLU C O   1 
ATOM   10392 C  CB  . GLU C 1 328 ? 60.038  -16.326 12.529  1.00 14.33 ? 328  GLU C CB  1 
ATOM   10393 C  CG  . GLU C 1 328 ? 61.121  -17.285 12.014  1.00 16.42 ? 328  GLU C CG  1 
ATOM   10394 C  CD  . GLU C 1 328 ? 60.872  -18.787 12.242  1.00 16.07 ? 328  GLU C CD  1 
ATOM   10395 O  OE1 . GLU C 1 328 ? 60.119  -19.390 11.451  1.00 18.04 ? 328  GLU C OE1 1 
ATOM   10396 O  OE2 . GLU C 1 328 ? 61.473  -19.382 13.163  1.00 13.84 ? 328  GLU C OE2 1 
ATOM   10397 N  N   . ASP C 1 329 ? 57.889  -15.333 9.585   1.00 14.60 ? 329  ASP C N   1 
ATOM   10398 C  CA  . ASP C 1 329 ? 57.638  -14.322 8.542   1.00 14.39 ? 329  ASP C CA  1 
ATOM   10399 C  C   . ASP C 1 329 ? 57.066  -13.030 9.177   1.00 14.42 ? 329  ASP C C   1 
ATOM   10400 O  O   . ASP C 1 329 ? 55.995  -13.051 9.806   1.00 15.01 ? 329  ASP C O   1 
ATOM   10401 C  CB  . ASP C 1 329 ? 56.712  -14.925 7.477   1.00 13.65 ? 329  ASP C CB  1 
ATOM   10402 C  CG  . ASP C 1 329 ? 56.241  -13.917 6.437   1.00 15.14 ? 329  ASP C CG  1 
ATOM   10403 O  OD1 . ASP C 1 329 ? 56.189  -12.685 6.712   1.00 15.57 ? 329  ASP C OD1 1 
ATOM   10404 O  OD2 . ASP C 1 329 ? 55.884  -14.375 5.327   1.00 13.09 ? 329  ASP C OD2 1 
ATOM   10405 N  N   . LYS C 1 330 ? 57.793  -11.922 9.021   1.00 13.79 ? 330  LYS C N   1 
ATOM   10406 C  CA  . LYS C 1 330 ? 57.513  -10.671 9.731   1.00 13.04 ? 330  LYS C CA  1 
ATOM   10407 C  C   . LYS C 1 330 ? 56.221  -10.001 9.324   1.00 12.87 ? 330  LYS C C   1 
ATOM   10408 O  O   . LYS C 1 330 ? 55.701  -9.150  10.040  1.00 13.40 ? 330  LYS C O   1 
ATOM   10409 C  CB  . LYS C 1 330 ? 58.667  -9.681  9.589   1.00 13.24 ? 330  LYS C CB  1 
ATOM   10410 C  CG  . LYS C 1 330 ? 59.998  -10.216 10.101  1.00 13.92 ? 330  LYS C CG  1 
ATOM   10411 C  CD  . LYS C 1 330 ? 61.014  -9.116  10.349  1.00 15.10 ? 330  LYS C CD  1 
ATOM   10412 C  CE  . LYS C 1 330 ? 62.327  -9.750  10.815  1.00 15.60 ? 330  LYS C CE  1 
ATOM   10413 N  NZ  . LYS C 1 330 ? 63.509  -8.864  10.602  1.00 14.75 ? 330  LYS C NZ  1 
ATOM   10414 N  N   . LEU C 1 331 ? 55.686  -10.384 8.178   1.00 12.67 ? 331  LEU C N   1 
ATOM   10415 C  CA  . LEU C 1 331 ? 54.404  -9.845  7.744   1.00 11.83 ? 331  LEU C CA  1 
ATOM   10416 C  C   . LEU C 1 331 ? 53.269  -10.673 8.393   1.00 11.67 ? 331  LEU C C   1 
ATOM   10417 O  O   . LEU C 1 331 ? 52.263  -10.119 8.891   1.00 11.53 ? 331  LEU C O   1 
ATOM   10418 C  CB  . LEU C 1 331 ? 54.331  -9.854  6.213   1.00 11.47 ? 331  LEU C CB  1 
ATOM   10419 C  CG  . LEU C 1 331 ? 53.171  -9.118  5.549   1.00 11.45 ? 331  LEU C CG  1 
ATOM   10420 C  CD1 . LEU C 1 331 ? 53.346  -7.598  5.670   1.00 8.80  ? 331  LEU C CD1 1 
ATOM   10421 C  CD2 . LEU C 1 331 ? 53.018  -9.560  4.084   1.00 10.68 ? 331  LEU C CD2 1 
ATOM   10422 N  N   . LEU C 1 332 ? 53.460  -11.991 8.399   1.00 10.99 ? 332  LEU C N   1 
ATOM   10423 C  CA  . LEU C 1 332 ? 52.513  -12.916 8.985   1.00 11.11 ? 332  LEU C CA  1 
ATOM   10424 C  C   . LEU C 1 332 ? 52.322  -12.618 10.474  1.00 11.56 ? 332  LEU C C   1 
ATOM   10425 O  O   . LEU C 1 332 ? 51.195  -12.647 10.998  1.00 11.93 ? 332  LEU C O   1 
ATOM   10426 C  CB  . LEU C 1 332 ? 53.011  -14.360 8.810   1.00 10.79 ? 332  LEU C CB  1 
ATOM   10427 C  CG  . LEU C 1 332 ? 52.283  -15.482 9.580   1.00 10.13 ? 332  LEU C CG  1 
ATOM   10428 C  CD1 . LEU C 1 332 ? 50.748  -15.554 9.309   1.00 4.81  ? 332  LEU C CD1 1 
ATOM   10429 C  CD2 . LEU C 1 332 ? 52.960  -16.848 9.287   1.00 10.43 ? 332  LEU C CD2 1 
ATOM   10430 N  N   . GLN C 1 333 ? 53.437  -12.341 11.146  1.00 11.45 ? 333  GLN C N   1 
ATOM   10431 C  CA  . GLN C 1 333 ? 53.458  -12.157 12.587  1.00 11.49 ? 333  GLN C CA  1 
ATOM   10432 C  C   . GLN C 1 333 ? 52.536  -11.030 13.109  1.00 11.19 ? 333  GLN C C   1 
ATOM   10433 O  O   . GLN C 1 333 ? 51.921  -11.165 14.171  1.00 11.21 ? 333  GLN C O   1 
ATOM   10434 C  CB  . GLN C 1 333 ? 54.906  -12.018 13.061  1.00 11.52 ? 333  GLN C CB  1 
ATOM   10435 C  CG  . GLN C 1 333 ? 55.685  -13.334 13.015  1.00 11.24 ? 333  GLN C CG  1 
ATOM   10436 C  CD  . GLN C 1 333 ? 55.679  -14.106 14.332  1.00 12.10 ? 333  GLN C CD  1 
ATOM   10437 O  OE1 . GLN C 1 333 ? 55.687  -13.524 15.424  1.00 11.76 ? 333  GLN C OE1 1 
ATOM   10438 N  NE2 . GLN C 1 333 ? 55.682  -15.429 14.231  1.00 12.65 ? 333  GLN C NE2 1 
ATOM   10439 N  N   . GLY C 1 334 ? 52.431  -9.938  12.363  1.00 10.69 ? 334  GLY C N   1 
ATOM   10440 C  CA  . GLY C 1 334 ? 51.476  -8.881  12.701  1.00 10.66 ? 334  GLY C CA  1 
ATOM   10441 C  C   . GLY C 1 334 ? 50.029  -9.281  12.428  1.00 10.29 ? 334  GLY C C   1 
ATOM   10442 O  O   . GLY C 1 334 ? 49.105  -8.862  13.150  1.00 10.45 ? 334  GLY C O   1 
ATOM   10443 N  N   . ARG C 1 335 ? 49.833  -10.083 11.381  1.00 9.80  ? 335  ARG C N   1 
ATOM   10444 C  CA  . ARG C 1 335 ? 48.524  -10.647 11.058  1.00 9.32  ? 335  ARG C CA  1 
ATOM   10445 C  C   . ARG C 1 335 ? 47.979  -11.515 12.194  1.00 9.40  ? 335  ARG C C   1 
ATOM   10446 O  O   . ARG C 1 335 ? 46.770  -11.502 12.439  1.00 10.00 ? 335  ARG C O   1 
ATOM   10447 C  CB  . ARG C 1 335 ? 48.579  -11.464 9.778   1.00 9.43  ? 335  ARG C CB  1 
ATOM   10448 C  CG  . ARG C 1 335 ? 49.024  -10.691 8.534   1.00 10.28 ? 335  ARG C CG  1 
ATOM   10449 C  CD  . ARG C 1 335 ? 49.085  -11.591 7.302   1.00 9.02  ? 335  ARG C CD  1 
ATOM   10450 N  NE  . ARG C 1 335 ? 47.750  -11.855 6.782   1.00 10.57 ? 335  ARG C NE  1 
ATOM   10451 C  CZ  . ARG C 1 335 ? 47.376  -12.997 6.210   1.00 12.15 ? 335  ARG C CZ  1 
ATOM   10452 N  NH1 . ARG C 1 335 ? 48.236  -14.012 6.078   1.00 10.55 ? 335  ARG C NH1 1 
ATOM   10453 N  NH2 . ARG C 1 335 ? 46.129  -13.127 5.775   1.00 10.04 ? 335  ARG C NH2 1 
ATOM   10454 N  N   . LEU C 1 336 ? 48.855  -12.252 12.890  1.00 8.58  ? 336  LEU C N   1 
ATOM   10455 C  CA  . LEU C 1 336 ? 48.437  -13.066 14.044  1.00 8.57  ? 336  LEU C CA  1 
ATOM   10456 C  C   . LEU C 1 336 ? 47.670  -12.232 15.067  1.00 9.04  ? 336  LEU C C   1 
ATOM   10457 O  O   . LEU C 1 336 ? 46.702  -12.712 15.652  1.00 8.46  ? 336  LEU C O   1 
ATOM   10458 C  CB  . LEU C 1 336 ? 49.628  -13.742 14.737  1.00 7.58  ? 336  LEU C CB  1 
ATOM   10459 C  CG  . LEU C 1 336 ? 50.588  -14.513 13.825  1.00 7.83  ? 336  LEU C CG  1 
ATOM   10460 C  CD1 . LEU C 1 336 ? 51.778  -15.084 14.582  1.00 5.56  ? 336  LEU C CD1 1 
ATOM   10461 C  CD2 . LEU C 1 336 ? 49.879  -15.575 13.009  1.00 4.30  ? 336  LEU C CD2 1 
ATOM   10462 N  N   . PHE C 1 337 ? 48.126  -10.995 15.271  1.00 9.19  ? 337  PHE C N   1 
ATOM   10463 C  CA  . PHE C 1 337 ? 47.490  -10.071 16.188  1.00 10.15 ? 337  PHE C CA  1 
ATOM   10464 C  C   . PHE C 1 337 ? 46.289  -9.395  15.550  1.00 10.46 ? 337  PHE C C   1 
ATOM   10465 O  O   . PHE C 1 337 ? 45.188  -9.450  16.079  1.00 10.47 ? 337  PHE C O   1 
ATOM   10466 C  CB  . PHE C 1 337 ? 48.495  -9.006  16.668  1.00 10.26 ? 337  PHE C CB  1 
ATOM   10467 C  CG  . PHE C 1 337 ? 47.858  -7.875  17.406  1.00 9.88  ? 337  PHE C CG  1 
ATOM   10468 C  CD1 . PHE C 1 337 ? 47.264  -8.088  18.651  1.00 10.89 ? 337  PHE C CD1 1 
ATOM   10469 C  CD2 . PHE C 1 337 ? 47.868  -6.594  16.874  1.00 9.09  ? 337  PHE C CD2 1 
ATOM   10470 C  CE1 . PHE C 1 337 ? 46.653  -7.036  19.337  1.00 13.09 ? 337  PHE C CE1 1 
ATOM   10471 C  CE2 . PHE C 1 337 ? 47.268  -5.526  17.550  1.00 10.27 ? 337  PHE C CE2 1 
ATOM   10472 C  CZ  . PHE C 1 337 ? 46.666  -5.737  18.790  1.00 10.86 ? 337  PHE C CZ  1 
ATOM   10473 N  N   . SER C 1 338 ? 46.534  -8.775  14.401  1.00 10.95 ? 338  SER C N   1 
ATOM   10474 C  CA  . SER C 1 338 ? 45.593  -7.897  13.732  1.00 11.28 ? 338  SER C CA  1 
ATOM   10475 C  C   . SER C 1 338 ? 44.172  -8.417  13.589  1.00 11.35 ? 338  SER C C   1 
ATOM   10476 O  O   . SER C 1 338 ? 43.213  -7.692  13.848  1.00 12.13 ? 338  SER C O   1 
ATOM   10477 C  CB  . SER C 1 338 ? 46.120  -7.556  12.328  1.00 11.35 ? 338  SER C CB  1 
ATOM   10478 O  OG  . SER C 1 338 ? 45.311  -6.548  11.748  1.00 11.80 ? 338  SER C OG  1 
ATOM   10479 N  N   . TYR C 1 339 ? 44.034  -9.659  13.149  1.00 11.31 ? 339  TYR C N   1 
ATOM   10480 C  CA  . TYR C 1 339 ? 42.752  -10.129 12.643  1.00 11.32 ? 339  TYR C CA  1 
ATOM   10481 C  C   . TYR C 1 339 ? 41.753  -10.237 13.779  1.00 10.81 ? 339  TYR C C   1 
ATOM   10482 O  O   . TYR C 1 339 ? 40.671  -9.664  13.719  1.00 10.18 ? 339  TYR C O   1 
ATOM   10483 C  CB  . TYR C 1 339 ? 42.905  -11.465 11.881  1.00 11.76 ? 339  TYR C CB  1 
ATOM   10484 C  CG  . TYR C 1 339 ? 43.462  -11.298 10.470  1.00 13.21 ? 339  TYR C CG  1 
ATOM   10485 C  CD1 . TYR C 1 339 ? 42.634  -11.437 9.336   1.00 12.21 ? 339  TYR C CD1 1 
ATOM   10486 C  CD2 . TYR C 1 339 ? 44.822  -10.962 10.267  1.00 12.74 ? 339  TYR C CD2 1 
ATOM   10487 C  CE1 . TYR C 1 339 ? 43.158  -11.270 8.043   1.00 13.58 ? 339  TYR C CE1 1 
ATOM   10488 C  CE2 . TYR C 1 339 ? 45.341  -10.782 8.994   1.00 11.35 ? 339  TYR C CE2 1 
ATOM   10489 C  CZ  . TYR C 1 339 ? 44.516  -10.941 7.886   1.00 13.34 ? 339  TYR C CZ  1 
ATOM   10490 O  OH  . TYR C 1 339 ? 45.057  -10.766 6.630   1.00 13.27 ? 339  TYR C OH  1 
ATOM   10491 N  N   . SER C 1 340 ? 42.140  -10.974 14.814  1.00 10.60 ? 340  SER C N   1 
ATOM   10492 C  CA  . SER C 1 340 ? 41.299  -11.182 15.969  1.00 10.15 ? 340  SER C CA  1 
ATOM   10493 C  C   . SER C 1 340 ? 41.106  -9.871  16.735  1.00 9.69  ? 340  SER C C   1 
ATOM   10494 O  O   . SER C 1 340 ? 40.099  -9.678  17.391  1.00 8.96  ? 340  SER C O   1 
ATOM   10495 C  CB  . SER C 1 340 ? 41.900  -12.272 16.854  1.00 10.46 ? 340  SER C CB  1 
ATOM   10496 O  OG  . SER C 1 340 ? 42.036  -13.492 16.129  1.00 10.45 ? 340  SER C OG  1 
ATOM   10497 N  N   . ASP C 1 341 ? 42.078  -8.968  16.645  1.00 9.61  ? 341  ASP C N   1 
ATOM   10498 C  CA  . ASP C 1 341 ? 41.954  -7.677  17.313  1.00 9.10  ? 341  ASP C CA  1 
ATOM   10499 C  C   . ASP C 1 341 ? 40.846  -6.834  16.634  1.00 8.99  ? 341  ASP C C   1 
ATOM   10500 O  O   . ASP C 1 341 ? 40.026  -6.211  17.321  1.00 8.85  ? 341  ASP C O   1 
ATOM   10501 C  CB  . ASP C 1 341 ? 43.301  -6.944  17.341  1.00 8.90  ? 341  ASP C CB  1 
ATOM   10502 C  CG  . ASP C 1 341 ? 43.173  -5.517  17.844  1.00 8.78  ? 341  ASP C CG  1 
ATOM   10503 O  OD1 . ASP C 1 341 ? 42.808  -5.319  19.025  1.00 6.31  ? 341  ASP C OD1 1 
ATOM   10504 O  OD2 . ASP C 1 341 ? 43.432  -4.589  17.049  1.00 8.83  ? 341  ASP C OD2 1 
ATOM   10505 N  N   . THR C 1 342 ? 40.807  -6.846  15.299  1.00 8.31  ? 342  THR C N   1 
ATOM   10506 C  CA  . THR C 1 342 ? 39.831  -6.043  14.559  1.00 7.94  ? 342  THR C CA  1 
ATOM   10507 C  C   . THR C 1 342 ? 38.420  -6.615  14.659  1.00 7.89  ? 342  THR C C   1 
ATOM   10508 O  O   . THR C 1 342 ? 37.420  -5.867  14.694  1.00 7.55  ? 342  THR C O   1 
ATOM   10509 C  CB  . THR C 1 342 ? 40.242  -5.795  13.086  1.00 7.64  ? 342  THR C CB  1 
ATOM   10510 O  OG1 . THR C 1 342 ? 39.544  -4.648  12.600  1.00 8.10  ? 342  THR C OG1 1 
ATOM   10511 C  CG2 . THR C 1 342 ? 39.890  -6.983  12.176  1.00 8.56  ? 342  THR C CG2 1 
ATOM   10512 N  N   . GLN C 1 343 ? 38.350  -7.937  14.759  1.00 7.92  ? 343  GLN C N   1 
ATOM   10513 C  CA  . GLN C 1 343 ? 37.070  -8.659  14.917  1.00 8.15  ? 343  GLN C CA  1 
ATOM   10514 C  C   . GLN C 1 343 ? 36.360  -8.340  16.235  1.00 8.32  ? 343  GLN C C   1 
ATOM   10515 O  O   . GLN C 1 343 ? 35.139  -8.159  16.264  1.00 8.43  ? 343  GLN C O   1 
ATOM   10516 C  CB  . GLN C 1 343 ? 37.284  -10.171 14.722  1.00 7.75  ? 343  GLN C CB  1 
ATOM   10517 C  CG  . GLN C 1 343 ? 37.489  -10.524 13.263  1.00 8.32  ? 343  GLN C CG  1 
ATOM   10518 C  CD  . GLN C 1 343 ? 38.504  -11.638 13.033  1.00 8.61  ? 343  GLN C CD  1 
ATOM   10519 O  OE1 . GLN C 1 343 ? 38.746  -12.458 13.907  1.00 11.32 ? 343  GLN C OE1 1 
ATOM   10520 N  NE2 . GLN C 1 343 ? 39.084  -11.674 11.843  1.00 4.30  ? 343  GLN C NE2 1 
ATOM   10521 N  N   . ARG C 1 344 ? 37.137  -8.273  17.313  1.00 9.13  ? 344  ARG C N   1 
ATOM   10522 C  CA  . ARG C 1 344 ? 36.682  -7.807  18.643  1.00 9.67  ? 344  ARG C CA  1 
ATOM   10523 C  C   . ARG C 1 344 ? 36.049  -6.413  18.538  1.00 9.84  ? 344  ARG C C   1 
ATOM   10524 O  O   . ARG C 1 344 ? 35.006  -6.132  19.134  1.00 10.02 ? 344  ARG C O   1 
ATOM   10525 C  CB  . ARG C 1 344 ? 37.874  -7.778  19.619  1.00 9.66  ? 344  ARG C CB  1 
ATOM   10526 C  CG  . ARG C 1 344 ? 38.280  -9.128  20.080  1.00 8.59  ? 344  ARG C CG  1 
ATOM   10527 C  CD  . ARG C 1 344 ? 39.606  -9.143  20.812  1.00 10.08 ? 344  ARG C CD  1 
ATOM   10528 N  NE  . ARG C 1 344 ? 40.120  -10.516 20.836  1.00 6.92  ? 344  ARG C NE  1 
ATOM   10529 C  CZ  . ARG C 1 344 ? 41.341  -10.897 20.489  1.00 7.41  ? 344  ARG C CZ  1 
ATOM   10530 N  NH1 . ARG C 1 344 ? 42.281  -10.004 20.144  1.00 5.98  ? 344  ARG C NH1 1 
ATOM   10531 N  NH2 . ARG C 1 344 ? 41.631  -12.192 20.535  1.00 7.83  ? 344  ARG C NH2 1 
ATOM   10532 N  N   . HIS C 1 345 ? 36.677  -5.543  17.758  1.00 10.15 ? 345  HIS C N   1 
ATOM   10533 C  CA  . HIS C 1 345 ? 36.061  -4.254  17.428  1.00 9.99  ? 345  HIS C CA  1 
ATOM   10534 C  C   . HIS C 1 345 ? 34.869  -4.347  16.440  1.00 10.06 ? 345  HIS C C   1 
ATOM   10535 O  O   . HIS C 1 345 ? 33.772  -3.836  16.721  1.00 10.33 ? 345  HIS C O   1 
ATOM   10536 C  CB  . HIS C 1 345 ? 37.120  -3.278  16.885  1.00 9.73  ? 345  HIS C CB  1 
ATOM   10537 C  CG  . HIS C 1 345 ? 36.543  -2.184  16.043  1.00 8.80  ? 345  HIS C CG  1 
ATOM   10538 N  ND1 . HIS C 1 345 ? 35.797  -1.153  16.570  1.00 9.43  ? 345  HIS C ND1 1 
ATOM   10539 C  CD2 . HIS C 1 345 ? 36.574  -1.981  14.707  1.00 8.63  ? 345  HIS C CD2 1 
ATOM   10540 C  CE1 . HIS C 1 345 ? 35.410  -0.349  15.599  1.00 9.62  ? 345  HIS C CE1 1 
ATOM   10541 N  NE2 . HIS C 1 345 ? 35.868  -0.832  14.456  1.00 10.62 ? 345  HIS C NE2 1 
ATOM   10542 N  N   . ARG C 1 346 ? 35.103  -4.958  15.274  1.00 9.35  ? 346  ARG C N   1 
ATOM   10543 C  CA  . ARG C 1 346 ? 34.132  -4.950  14.157  1.00 8.73  ? 346  ARG C CA  1 
ATOM   10544 C  C   . ARG C 1 346 ? 32.866  -5.763  14.460  1.00 9.25  ? 346  ARG C C   1 
ATOM   10545 O  O   . ARG C 1 346 ? 31.736  -5.332  14.157  1.00 9.44  ? 346  ARG C O   1 
ATOM   10546 C  CB  . ARG C 1 346 ? 34.808  -5.464  12.862  1.00 8.51  ? 346  ARG C CB  1 
ATOM   10547 C  CG  . ARG C 1 346 ? 33.880  -5.797  11.686  1.00 8.99  ? 346  ARG C CG  1 
ATOM   10548 C  CD  . ARG C 1 346 ? 34.635  -6.194  10.397  1.00 8.05  ? 346  ARG C CD  1 
ATOM   10549 N  NE  . ARG C 1 346 ? 35.162  -7.570  10.405  1.00 5.88  ? 346  ARG C NE  1 
ATOM   10550 C  CZ  . ARG C 1 346 ? 34.443  -8.665  10.144  1.00 6.25  ? 346  ARG C CZ  1 
ATOM   10551 N  NH1 . ARG C 1 346 ? 35.022  -9.860  10.161  1.00 4.10  ? 346  ARG C NH1 1 
ATOM   10552 N  NH2 . ARG C 1 346 ? 33.145  -8.576  9.865   1.00 5.23  ? 346  ARG C NH2 1 
ATOM   10553 N  N   . ILE C 1 347 ? 33.073  -6.956  15.016  1.00 9.00  ? 347  ILE C N   1 
ATOM   10554 C  CA  . ILE C 1 347 ? 31.997  -7.890  15.296  1.00 8.43  ? 347  ILE C CA  1 
ATOM   10555 C  C   . ILE C 1 347 ? 31.564  -7.817  16.750  1.00 8.11  ? 347  ILE C C   1 
ATOM   10556 O  O   . ILE C 1 347 ? 30.376  -7.947  17.034  1.00 8.59  ? 347  ILE C O   1 
ATOM   10557 C  CB  . ILE C 1 347 ? 32.388  -9.377  14.980  1.00 8.38  ? 347  ILE C CB  1 
ATOM   10558 C  CG1 . ILE C 1 347 ? 33.140  -9.487  13.646  1.00 7.98  ? 347  ILE C CG1 1 
ATOM   10559 C  CG2 . ILE C 1 347 ? 31.112  -10.269 15.015  1.00 8.17  ? 347  ILE C CG2 1 
ATOM   10560 C  CD1 . ILE C 1 347 ? 33.713  -10.855 13.347  1.00 8.86  ? 347  ILE C CD1 1 
ATOM   10561 N  N   . GLY C 1 348 ? 32.519  -7.645  17.665  1.00 7.63  ? 348  GLY C N   1 
ATOM   10562 C  CA  . GLY C 1 348 ? 32.221  -7.613  19.112  1.00 6.79  ? 348  GLY C CA  1 
ATOM   10563 C  C   . GLY C 1 348 ? 33.104  -8.537  19.966  1.00 6.49  ? 348  GLY C C   1 
ATOM   10564 O  O   . GLY C 1 348 ? 33.670  -9.509  19.464  1.00 6.59  ? 348  GLY C O   1 
ATOM   10565 N  N   . PRO C 1 349 ? 33.250  -8.223  21.261  1.00 5.71  ? 349  PRO C N   1 
ATOM   10566 C  CA  . PRO C 1 349 ? 34.089  -9.039  22.134  1.00 5.20  ? 349  PRO C CA  1 
ATOM   10567 C  C   . PRO C 1 349 ? 33.783  -10.546 22.087  1.00 5.40  ? 349  PRO C C   1 
ATOM   10568 O  O   . PRO C 1 349 ? 34.711  -11.378 22.200  1.00 4.81  ? 349  PRO C O   1 
ATOM   10569 C  CB  . PRO C 1 349 ? 33.804  -8.465  23.517  1.00 5.47  ? 349  PRO C CB  1 
ATOM   10570 C  CG  . PRO C 1 349 ? 33.433  -7.012  23.247  1.00 5.72  ? 349  PRO C CG  1 
ATOM   10571 C  CD  . PRO C 1 349 ? 32.693  -7.035  21.952  1.00 5.49  ? 349  PRO C CD  1 
ATOM   10572 N  N   . ASN C 1 350 ? 32.513  -10.889 21.890  1.00 4.68  ? 350  ASN C N   1 
ATOM   10573 C  CA  . ASN C 1 350 ? 32.086  -12.274 21.952  1.00 4.40  ? 350  ASN C CA  1 
ATOM   10574 C  C   . ASN C 1 350 ? 31.809  -12.884 20.579  1.00 5.10  ? 350  ASN C C   1 
ATOM   10575 O  O   . ASN C 1 350 ? 31.061  -13.872 20.458  1.00 5.07  ? 350  ASN C O   1 
ATOM   10576 C  CB  . ASN C 1 350 ? 30.901  -12.434 22.923  1.00 4.77  ? 350  ASN C CB  1 
ATOM   10577 C  CG  . ASN C 1 350 ? 31.342  -12.483 24.404  1.00 2.98  ? 350  ASN C CG  1 
ATOM   10578 O  OD1 . ASN C 1 350 ? 32.330  -13.100 24.739  1.00 3.16  ? 350  ASN C OD1 1 
ATOM   10579 N  ND2 . ASN C 1 350 ? 30.586  -11.845 25.276  1.00 2.22  ? 350  ASN C ND2 1 
ATOM   10580 N  N   . TYR C 1 351 ? 32.471  -12.320 19.558  1.00 5.20  ? 351  TYR C N   1 
ATOM   10581 C  CA  . TYR C 1 351 ? 32.342  -12.760 18.161  1.00 5.66  ? 351  TYR C CA  1 
ATOM   10582 C  C   . TYR C 1 351 ? 32.512  -14.294 17.923  1.00 6.35  ? 351  TYR C C   1 
ATOM   10583 O  O   . TYR C 1 351 ? 31.873  -14.858 17.013  1.00 5.03  ? 351  TYR C O   1 
ATOM   10584 C  CB  . TYR C 1 351 ? 33.257  -11.928 17.236  1.00 5.14  ? 351  TYR C CB  1 
ATOM   10585 C  CG  . TYR C 1 351 ? 34.734  -12.319 17.246  1.00 5.01  ? 351  TYR C CG  1 
ATOM   10586 C  CD1 . TYR C 1 351 ? 35.255  -13.148 16.245  1.00 5.69  ? 351  TYR C CD1 1 
ATOM   10587 C  CD2 . TYR C 1 351 ? 35.605  -11.869 18.245  1.00 2.59  ? 351  TYR C CD2 1 
ATOM   10588 C  CE1 . TYR C 1 351 ? 36.594  -13.539 16.250  1.00 5.05  ? 351  TYR C CE1 1 
ATOM   10589 C  CE2 . TYR C 1 351 ? 36.953  -12.247 18.247  1.00 3.93  ? 351  TYR C CE2 1 
ATOM   10590 C  CZ  . TYR C 1 351 ? 37.431  -13.085 17.244  1.00 4.59  ? 351  TYR C CZ  1 
ATOM   10591 O  OH  . TYR C 1 351 ? 38.742  -13.479 17.204  1.00 4.84  ? 351  TYR C OH  1 
ATOM   10592 N  N   . GLN C 1 352 ? 33.355  -14.947 18.737  1.00 7.17  ? 352  GLN C N   1 
ATOM   10593 C  CA  . GLN C 1 352 ? 33.576  -16.404 18.610  1.00 8.38  ? 352  GLN C CA  1 
ATOM   10594 C  C   . GLN C 1 352 ? 32.353  -17.246 19.036  1.00 9.33  ? 352  GLN C C   1 
ATOM   10595 O  O   . GLN C 1 352 ? 32.285  -18.464 18.760  1.00 9.36  ? 352  GLN C O   1 
ATOM   10596 C  CB  . GLN C 1 352 ? 34.833  -16.847 19.367  1.00 8.04  ? 352  GLN C CB  1 
ATOM   10597 C  CG  . GLN C 1 352 ? 36.113  -16.926 18.497  1.00 8.68  ? 352  GLN C CG  1 
ATOM   10598 C  CD  . GLN C 1 352 ? 35.928  -17.798 17.248  1.00 11.11 ? 352  GLN C CD  1 
ATOM   10599 O  OE1 . GLN C 1 352 ? 35.821  -17.279 16.134  1.00 12.41 ? 352  GLN C OE1 1 
ATOM   10600 N  NE2 . GLN C 1 352 ? 35.856  -19.123 17.434  1.00 10.09 ? 352  GLN C NE2 1 
ATOM   10601 N  N   . GLN C 1 353 ? 31.400  -16.581 19.704  1.00 10.00 ? 353  GLN C N   1 
ATOM   10602 C  CA  . GLN C 1 353 ? 30.152  -17.203 20.127  1.00 9.89  ? 353  GLN C CA  1 
ATOM   10603 C  C   . GLN C 1 353 ? 29.120  -17.298 19.013  1.00 10.28 ? 353  GLN C C   1 
ATOM   10604 O  O   . GLN C 1 353 ? 28.226  -18.133 19.090  1.00 11.21 ? 353  GLN C O   1 
ATOM   10605 C  CB  . GLN C 1 353 ? 29.562  -16.471 21.331  1.00 9.37  ? 353  GLN C CB  1 
ATOM   10606 C  CG  . GLN C 1 353 ? 30.346  -16.674 22.605  1.00 10.05 ? 353  GLN C CG  1 
ATOM   10607 C  CD  . GLN C 1 353 ? 29.647  -16.148 23.868  1.00 10.31 ? 353  GLN C CD  1 
ATOM   10608 O  OE1 . GLN C 1 353 ? 28.588  -15.523 23.812  1.00 9.43  ? 353  GLN C OE1 1 
ATOM   10609 N  NE2 . GLN C 1 353 ? 30.251  -16.422 25.019  1.00 10.33 ? 353  GLN C NE2 1 
ATOM   10610 N  N   . LEU C 1 354 ? 29.228  -16.465 17.976  1.00 10.60 ? 354  LEU C N   1 
ATOM   10611 C  CA  . LEU C 1 354 ? 28.223  -16.455 16.900  1.00 10.30 ? 354  LEU C CA  1 
ATOM   10612 C  C   . LEU C 1 354 ? 28.285  -17.740 16.110  1.00 10.13 ? 354  LEU C C   1 
ATOM   10613 O  O   . LEU C 1 354 ? 29.373  -18.250 15.904  1.00 10.22 ? 354  LEU C O   1 
ATOM   10614 C  CB  . LEU C 1 354 ? 28.452  -15.282 15.939  1.00 10.37 ? 354  LEU C CB  1 
ATOM   10615 C  CG  . LEU C 1 354 ? 28.179  -13.841 16.370  1.00 10.41 ? 354  LEU C CG  1 
ATOM   10616 C  CD1 . LEU C 1 354 ? 28.536  -12.927 15.201  1.00 7.57  ? 354  LEU C CD1 1 
ATOM   10617 C  CD2 . LEU C 1 354 ? 26.727  -13.649 16.771  1.00 10.50 ? 354  LEU C CD2 1 
ATOM   10618 N  N   . PRO C 1 355 ? 27.125  -18.254 15.638  1.00 10.28 ? 355  PRO C N   1 
ATOM   10619 C  CA  . PRO C 1 355 ? 27.086  -19.532 14.899  1.00 10.42 ? 355  PRO C CA  1 
ATOM   10620 C  C   . PRO C 1 355 ? 28.111  -19.685 13.757  1.00 10.60 ? 355  PRO C C   1 
ATOM   10621 O  O   . PRO C 1 355 ? 28.707  -20.758 13.614  1.00 10.35 ? 355  PRO C O   1 
ATOM   10622 C  CB  . PRO C 1 355 ? 25.635  -19.597 14.364  1.00 10.16 ? 355  PRO C CB  1 
ATOM   10623 C  CG  . PRO C 1 355 ? 24.844  -18.776 15.323  1.00 8.91  ? 355  PRO C CG  1 
ATOM   10624 C  CD  . PRO C 1 355 ? 25.767  -17.681 15.802  1.00 10.25 ? 355  PRO C CD  1 
ATOM   10625 N  N   . ILE C 1 356 ? 28.319  -18.642 12.957  1.00 10.54 ? 356  ILE C N   1 
ATOM   10626 C  CA  . ILE C 1 356 ? 29.239  -18.756 11.818  1.00 10.20 ? 356  ILE C CA  1 
ATOM   10627 C  C   . ILE C 1 356 ? 30.704  -18.938 12.275  1.00 10.76 ? 356  ILE C C   1 
ATOM   10628 O  O   . ILE C 1 356 ? 31.541  -19.516 11.546  1.00 9.95  ? 356  ILE C O   1 
ATOM   10629 C  CB  . ILE C 1 356 ? 29.132  -17.531 10.876  1.00 10.05 ? 356  ILE C CB  1 
ATOM   10630 C  CG1 . ILE C 1 356 ? 29.712  -17.826 9.461   1.00 9.75  ? 356  ILE C CG1 1 
ATOM   10631 C  CG2 . ILE C 1 356 ? 29.870  -16.356 11.467  1.00 7.86  ? 356  ILE C CG2 1 
ATOM   10632 C  CD1 . ILE C 1 356 ? 29.273  -19.113 8.812   1.00 5.97  ? 356  ILE C CD1 1 
ATOM   10633 N  N   . ASN C 1 357 ? 31.008  -18.435 13.477  1.00 11.44 ? 357  ASN C N   1 
ATOM   10634 C  CA  . ASN C 1 357 ? 32.369  -18.499 14.014  1.00 11.96 ? 357  ASN C CA  1 
ATOM   10635 C  C   . ASN C 1 357 ? 32.572  -19.635 14.992  1.00 12.75 ? 357  ASN C C   1 
ATOM   10636 O  O   . ASN C 1 357 ? 33.709  -20.012 15.296  1.00 11.91 ? 357  ASN C O   1 
ATOM   10637 C  CB  . ASN C 1 357 ? 32.743  -17.185 14.679  1.00 11.55 ? 357  ASN C CB  1 
ATOM   10638 C  CG  . ASN C 1 357 ? 32.846  -16.049 13.686  1.00 11.30 ? 357  ASN C CG  1 
ATOM   10639 O  OD1 . ASN C 1 357 ? 33.449  -16.192 12.616  1.00 10.39 ? 357  ASN C OD1 1 
ATOM   10640 N  ND2 . ASN C 1 357 ? 32.245  -14.910 14.031  1.00 10.03 ? 357  ASN C ND2 1 
ATOM   10641 N  N   . CYS C 1 358 ? 31.462  -20.171 15.484  1.00 14.46 ? 358  CYS C N   1 
ATOM   10642 C  CA  . CYS C 1 358 ? 31.513  -21.166 16.548  1.00 15.53 ? 358  CYS C CA  1 
ATOM   10643 C  C   . CYS C 1 358 ? 32.223  -22.445 16.063  1.00 15.42 ? 358  CYS C C   1 
ATOM   10644 O  O   . CYS C 1 358 ? 31.939  -22.925 14.961  1.00 15.58 ? 358  CYS C O   1 
ATOM   10645 C  CB  . CYS C 1 358 ? 30.103  -21.489 17.045  1.00 15.25 ? 358  CYS C CB  1 
ATOM   10646 S  SG  . CYS C 1 358 ? 30.140  -22.438 18.569  1.00 18.87 ? 358  CYS C SG  1 
ATOM   10647 N  N   . PRO C 1 359 ? 33.169  -22.974 16.863  1.00 15.28 ? 359  PRO C N   1 
ATOM   10648 C  CA  . PRO C 1 359 ? 33.807  -24.248 16.519  1.00 15.44 ? 359  PRO C CA  1 
ATOM   10649 C  C   . PRO C 1 359 ? 32.843  -25.435 16.468  1.00 15.74 ? 359  PRO C C   1 
ATOM   10650 O  O   . PRO C 1 359 ? 31.748  -25.383 17.034  1.00 15.59 ? 359  PRO C O   1 
ATOM   10651 C  CB  . PRO C 1 359 ? 34.814  -24.443 17.651  1.00 15.52 ? 359  PRO C CB  1 
ATOM   10652 C  CG  . PRO C 1 359 ? 35.042  -23.048 18.203  1.00 14.75 ? 359  PRO C CG  1 
ATOM   10653 C  CD  . PRO C 1 359 ? 33.721  -22.408 18.107  1.00 14.90 ? 359  PRO C CD  1 
ATOM   10654 N  N   . PHE C 1 360 ? 33.244  -26.486 15.756  1.00 16.50 ? 360  PHE C N   1 
ATOM   10655 C  CA  . PHE C 1 360 ? 32.613  -27.793 15.897  1.00 16.45 ? 360  PHE C CA  1 
ATOM   10656 C  C   . PHE C 1 360 ? 33.048  -28.397 17.243  1.00 15.98 ? 360  PHE C C   1 
ATOM   10657 O  O   . PHE C 1 360 ? 32.206  -28.882 17.995  1.00 15.85 ? 360  PHE C O   1 
ATOM   10658 C  CB  . PHE C 1 360 ? 32.960  -28.733 14.731  1.00 17.11 ? 360  PHE C CB  1 
ATOM   10659 C  CG  . PHE C 1 360 ? 32.618  -30.190 14.997  1.00 19.00 ? 360  PHE C CG  1 
ATOM   10660 C  CD1 . PHE C 1 360 ? 31.323  -30.678 14.765  1.00 22.26 ? 360  PHE C CD1 1 
ATOM   10661 C  CD2 . PHE C 1 360 ? 33.571  -31.065 15.500  1.00 18.70 ? 360  PHE C CD2 1 
ATOM   10662 C  CE1 . PHE C 1 360 ? 30.987  -32.025 15.022  1.00 21.00 ? 360  PHE C CE1 1 
ATOM   10663 C  CE2 . PHE C 1 360 ? 33.248  -32.394 15.753  1.00 21.19 ? 360  PHE C CE2 1 
ATOM   10664 C  CZ  . PHE C 1 360 ? 31.943  -32.877 15.506  1.00 20.06 ? 360  PHE C CZ  1 
ATOM   10665 N  N   . ALA C 1 361 ? 34.353  -28.393 17.533  1.00 15.60 ? 361  ALA C N   1 
ATOM   10666 C  CA  . ALA C 1 361 ? 34.839  -28.841 18.850  1.00 15.43 ? 361  ALA C CA  1 
ATOM   10667 C  C   . ALA C 1 361 ? 34.204  -28.003 19.976  1.00 15.65 ? 361  ALA C C   1 
ATOM   10668 O  O   . ALA C 1 361 ? 34.010  -26.799 19.844  1.00 15.49 ? 361  ALA C O   1 
ATOM   10669 C  CB  . ALA C 1 361 ? 36.343  -28.782 18.927  1.00 14.85 ? 361  ALA C CB  1 
ATOM   10670 N  N   . GLN C 1 362 ? 33.849  -28.657 21.068  1.00 15.83 ? 362  GLN C N   1 
ATOM   10671 C  CA  . GLN C 1 362 ? 33.238  -27.961 22.184  1.00 16.91 ? 362  GLN C CA  1 
ATOM   10672 C  C   . GLN C 1 362 ? 34.249  -26.964 22.821  1.00 15.75 ? 362  GLN C C   1 
ATOM   10673 O  O   . GLN C 1 362 ? 35.463  -27.206 22.829  1.00 15.39 ? 362  GLN C O   1 
ATOM   10674 C  CB  . GLN C 1 362 ? 32.649  -28.989 23.173  1.00 17.65 ? 362  GLN C CB  1 
ATOM   10675 C  CG  . GLN C 1 362 ? 32.217  -28.463 24.556  1.00 23.17 ? 362  GLN C CG  1 
ATOM   10676 C  CD  . GLN C 1 362 ? 31.134  -27.368 24.525  1.00 28.41 ? 362  GLN C CD  1 
ATOM   10677 O  OE1 . GLN C 1 362 ? 31.056  -26.556 23.582  1.00 28.75 ? 362  GLN C OE1 1 
ATOM   10678 N  NE2 . GLN C 1 362 ? 30.302  -27.334 25.585  1.00 29.47 ? 362  GLN C NE2 1 
ATOM   10679 N  N   . VAL C 1 363 ? 33.737  -25.817 23.264  1.00 14.52 ? 363  VAL C N   1 
ATOM   10680 C  CA  . VAL C 1 363 ? 34.543  -24.794 23.936  1.00 13.30 ? 363  VAL C CA  1 
ATOM   10681 C  C   . VAL C 1 363 ? 34.348  -24.929 25.438  1.00 12.88 ? 363  VAL C C   1 
ATOM   10682 O  O   . VAL C 1 363 ? 33.234  -24.853 25.911  1.00 13.61 ? 363  VAL C O   1 
ATOM   10683 C  CB  . VAL C 1 363 ? 34.144  -23.348 23.482  1.00 13.34 ? 363  VAL C CB  1 
ATOM   10684 C  CG1 . VAL C 1 363 ? 34.811  -22.248 24.382  1.00 11.61 ? 363  VAL C CG1 1 
ATOM   10685 C  CG2 . VAL C 1 363 ? 34.442  -23.141 21.990  1.00 11.42 ? 363  VAL C CG2 1 
ATOM   10686 N  N   . ASN C 1 364 ? 35.424  -25.129 26.182  1.00 12.07 ? 364  ASN C N   1 
ATOM   10687 C  CA  . ASN C 1 364 ? 35.342  -25.215 27.640  1.00 11.70 ? 364  ASN C CA  1 
ATOM   10688 C  C   . ASN C 1 364 ? 36.512  -24.481 28.288  1.00 11.05 ? 364  ASN C C   1 
ATOM   10689 O  O   . ASN C 1 364 ? 37.647  -24.979 28.271  1.00 10.59 ? 364  ASN C O   1 
ATOM   10690 C  CB  . ASN C 1 364 ? 35.350  -26.677 28.100  1.00 12.01 ? 364  ASN C CB  1 
ATOM   10691 C  CG  . ASN C 1 364 ? 34.117  -27.451 27.643  1.00 13.23 ? 364  ASN C CG  1 
ATOM   10692 O  OD1 . ASN C 1 364 ? 33.000  -27.231 28.135  1.00 15.22 ? 364  ASN C OD1 1 
ATOM   10693 N  ND2 . ASN C 1 364 ? 34.317  -28.363 26.697  1.00 14.10 ? 364  ASN C ND2 1 
ATOM   10694 N  N   . ASN C 1 365 ? 36.247  -23.305 28.851  1.00 9.67  ? 365  ASN C N   1 
ATOM   10695 C  CA  . ASN C 1 365 ? 37.320  -22.537 29.479  1.00 8.84  ? 365  ASN C CA  1 
ATOM   10696 C  C   . ASN C 1 365 ? 36.867  -21.608 30.605  1.00 8.10  ? 365  ASN C C   1 
ATOM   10697 O  O   . ASN C 1 365 ? 35.756  -21.707 31.072  1.00 7.59  ? 365  ASN C O   1 
ATOM   10698 C  CB  . ASN C 1 365 ? 38.222  -21.826 28.433  1.00 8.46  ? 365  ASN C CB  1 
ATOM   10699 C  CG  . ASN C 1 365 ? 37.479  -20.797 27.593  1.00 8.06  ? 365  ASN C CG  1 
ATOM   10700 O  OD1 . ASN C 1 365 ? 36.460  -20.210 28.023  1.00 11.46 ? 365  ASN C OD1 1 
ATOM   10701 N  ND2 . ASN C 1 365 ? 37.975  -20.576 26.384  1.00 2.26  ? 365  ASN C ND2 1 
ATOM   10702 N  N   . TYR C 1 366 ? 37.749  -20.722 31.049  1.00 8.36  ? 366  TYR C N   1 
ATOM   10703 C  CA  . TYR C 1 366 ? 37.483  -19.899 32.226  1.00 8.12  ? 366  TYR C CA  1 
ATOM   10704 C  C   . TYR C 1 366 ? 37.212  -18.440 31.865  1.00 8.27  ? 366  TYR C C   1 
ATOM   10705 O  O   . TYR C 1 366 ? 37.072  -17.579 32.739  1.00 8.43  ? 366  TYR C O   1 
ATOM   10706 C  CB  . TYR C 1 366 ? 38.601  -20.091 33.256  1.00 7.74  ? 366  TYR C CB  1 
ATOM   10707 C  CG  . TYR C 1 366 ? 38.649  -21.532 33.737  1.00 8.79  ? 366  TYR C CG  1 
ATOM   10708 C  CD1 . TYR C 1 366 ? 39.399  -22.509 33.064  1.00 7.23  ? 366  TYR C CD1 1 
ATOM   10709 C  CD2 . TYR C 1 366 ? 37.904  -21.928 34.846  1.00 9.36  ? 366  TYR C CD2 1 
ATOM   10710 C  CE1 . TYR C 1 366 ? 39.414  -23.831 33.512  1.00 6.41  ? 366  TYR C CE1 1 
ATOM   10711 C  CE2 . TYR C 1 366 ? 37.920  -23.217 35.289  1.00 9.13  ? 366  TYR C CE2 1 
ATOM   10712 C  CZ  . TYR C 1 366 ? 38.664  -24.170 34.625  1.00 7.74  ? 366  TYR C CZ  1 
ATOM   10713 O  OH  . TYR C 1 366 ? 38.622  -25.455 35.111  1.00 6.53  ? 366  TYR C OH  1 
ATOM   10714 N  N   . GLN C 1 367 ? 37.068  -18.183 30.566  1.00 8.52  ? 367  GLN C N   1 
ATOM   10715 C  CA  . GLN C 1 367 ? 36.736  -16.846 30.080  1.00 9.16  ? 367  GLN C CA  1 
ATOM   10716 C  C   . GLN C 1 367 ? 35.281  -16.562 30.394  1.00 8.66  ? 367  GLN C C   1 
ATOM   10717 O  O   . GLN C 1 367 ? 34.470  -17.493 30.418  1.00 8.11  ? 367  GLN C O   1 
ATOM   10718 C  CB  . GLN C 1 367 ? 37.006  -16.726 28.580  1.00 9.01  ? 367  GLN C CB  1 
ATOM   10719 C  CG  . GLN C 1 367 ? 38.451  -17.015 28.165  1.00 9.04  ? 367  GLN C CG  1 
ATOM   10720 C  CD  . GLN C 1 367 ? 38.663  -16.775 26.684  1.00 11.09 ? 367  GLN C CD  1 
ATOM   10721 O  OE1 . GLN C 1 367 ? 37.954  -15.978 26.061  1.00 12.45 ? 367  GLN C OE1 1 
ATOM   10722 N  NE2 . GLN C 1 367 ? 39.651  -17.453 26.108  1.00 14.39 ? 367  GLN C NE2 1 
ATOM   10723 N  N   . ARG C 1 368 ? 34.956  -15.289 30.633  1.00 8.67  ? 368  ARG C N   1 
ATOM   10724 C  CA  . ARG C 1 368 ? 33.584  -14.897 30.953  1.00 8.75  ? 368  ARG C CA  1 
ATOM   10725 C  C   . ARG C 1 368 ? 33.179  -13.483 30.599  1.00 8.93  ? 368  ARG C C   1 
ATOM   10726 O  O   . ARG C 1 368 ? 34.009  -12.609 30.454  1.00 9.92  ? 368  ARG C O   1 
ATOM   10727 C  CB  . ARG C 1 368 ? 33.268  -15.133 32.435  1.00 8.59  ? 368  ARG C CB  1 
ATOM   10728 C  CG  . ARG C 1 368 ? 32.423  -16.415 32.687  1.00 10.57 ? 368  ARG C CG  1 
ATOM   10729 C  CD  . ARG C 1 368 ? 33.240  -17.292 33.501  1.00 9.96  ? 368  ARG C CD  1 
ATOM   10730 N  NE  . ARG C 1 368 ? 32.716  -18.614 33.863  1.00 10.91 ? 368  ARG C NE  1 
ATOM   10731 C  CZ  . ARG C 1 368 ? 33.108  -19.754 33.302  1.00 7.47  ? 368  ARG C CZ  1 
ATOM   10732 N  NH1 . ARG C 1 368 ? 33.904  -19.733 32.233  1.00 6.74  ? 368  ARG C NH1 1 
ATOM   10733 N  NH2 . ARG C 1 368 ? 32.665  -20.907 33.782  1.00 6.91  ? 368  ARG C NH2 1 
ATOM   10734 N  N   . ASP C 1 369 ? 31.867  -13.275 30.497  1.00 9.00  ? 369  ASP C N   1 
ATOM   10735 C  CA  . ASP C 1 369 ? 31.261  -11.960 30.385  1.00 8.36  ? 369  ASP C CA  1 
ATOM   10736 C  C   . ASP C 1 369 ? 31.549  -11.345 29.001  1.00 8.27  ? 369  ASP C C   1 
ATOM   10737 O  O   . ASP C 1 369 ? 31.649  -12.059 28.005  1.00 8.05  ? 369  ASP C O   1 
ATOM   10738 C  CB  . ASP C 1 369 ? 31.702  -11.025 31.536  1.00 8.36  ? 369  ASP C CB  1 
ATOM   10739 C  CG  . ASP C 1 369 ? 31.203  -11.471 32.939  1.00 8.56  ? 369  ASP C CG  1 
ATOM   10740 O  OD1 . ASP C 1 369 ? 31.492  -10.747 33.925  1.00 8.59  ? 369  ASP C OD1 1 
ATOM   10741 O  OD2 . ASP C 1 369 ? 30.551  -12.521 33.092  1.00 8.30  ? 369  ASP C OD2 1 
ATOM   10742 N  N   . GLY C 1 370 ? 31.694  -10.025 28.942  1.00 7.48  ? 370  GLY C N   1 
ATOM   10743 C  CA  . GLY C 1 370 ? 31.756  -9.347  27.670  1.00 6.88  ? 370  GLY C CA  1 
ATOM   10744 C  C   . GLY C 1 370 ? 30.359  -9.106  27.126  1.00 6.87  ? 370  GLY C C   1 
ATOM   10745 O  O   . GLY C 1 370 ? 29.410  -9.842  27.430  1.00 5.85  ? 370  GLY C O   1 
ATOM   10746 N  N   . ALA C 1 371 ? 30.253  -8.059  26.316  1.00 7.30  ? 371  ALA C N   1 
ATOM   10747 C  CA  . ALA C 1 371 ? 29.032  -7.686  25.605  1.00 7.75  ? 371  ALA C CA  1 
ATOM   10748 C  C   . ALA C 1 371 ? 28.351  -8.871  24.974  1.00 8.03  ? 371  ALA C C   1 
ATOM   10749 O  O   . ALA C 1 371 ? 29.012  -9.748  24.379  1.00 8.89  ? 371  ALA C O   1 
ATOM   10750 C  CB  . ALA C 1 371 ? 29.340  -6.649  24.534  1.00 7.52  ? 371  ALA C CB  1 
ATOM   10751 N  N   . MET C 1 372 ? 27.027  -8.881  25.123  1.00 8.13  ? 372  MET C N   1 
ATOM   10752 C  CA  . MET C 1 372 ? 26.131  -9.850  24.501  1.00 8.58  ? 372  MET C CA  1 
ATOM   10753 C  C   . MET C 1 372 ? 26.534  -11.297 24.779  1.00 8.11  ? 372  MET C C   1 
ATOM   10754 O  O   . MET C 1 372 ? 26.802  -12.039 23.850  1.00 8.21  ? 372  MET C O   1 
ATOM   10755 C  CB  . MET C 1 372 ? 26.034  -9.583  22.995  1.00 8.26  ? 372  MET C CB  1 
ATOM   10756 C  CG  . MET C 1 372 ? 25.328  -8.279  22.654  1.00 9.74  ? 372  MET C CG  1 
ATOM   10757 S  SD  . MET C 1 372 ? 23.588  -8.245  23.157  1.00 11.74 ? 372  MET C SD  1 
ATOM   10758 C  CE  . MET C 1 372 ? 22.914  -9.555  22.130  1.00 11.74 ? 372  MET C CE  1 
ATOM   10759 N  N   . PRO C 1 373 ? 26.561  -11.701 26.061  1.00 8.00  ? 373  PRO C N   1 
ATOM   10760 C  CA  . PRO C 1 373 ? 27.187  -12.975 26.455  1.00 8.17  ? 373  PRO C CA  1 
ATOM   10761 C  C   . PRO C 1 373 ? 26.216  -14.131 26.179  1.00 8.69  ? 373  PRO C C   1 
ATOM   10762 O  O   . PRO C 1 373 ? 25.721  -14.790 27.086  1.00 8.32  ? 373  PRO C O   1 
ATOM   10763 C  CB  . PRO C 1 373 ? 27.418  -12.792 27.972  1.00 7.24  ? 373  PRO C CB  1 
ATOM   10764 C  CG  . PRO C 1 373 ? 26.289  -11.951 28.407  1.00 6.61  ? 373  PRO C CG  1 
ATOM   10765 C  CD  . PRO C 1 373 ? 25.962  -11.013 27.224  1.00 7.97  ? 373  PRO C CD  1 
ATOM   10766 N  N   . PHE C 1 374 ? 25.951  -14.370 24.910  1.00 10.28 ? 374  PHE C N   1 
ATOM   10767 C  CA  . PHE C 1 374 ? 24.886  -15.279 24.534  1.00 11.32 ? 374  PHE C CA  1 
ATOM   10768 C  C   . PHE C 1 374 ? 25.162  -16.722 24.960  1.00 10.70 ? 374  PHE C C   1 
ATOM   10769 O  O   . PHE C 1 374 ? 24.249  -17.456 25.332  1.00 9.64  ? 374  PHE C O   1 
ATOM   10770 C  CB  . PHE C 1 374 ? 24.661  -15.184 23.035  1.00 12.40 ? 374  PHE C CB  1 
ATOM   10771 C  CG  . PHE C 1 374 ? 23.327  -15.657 22.619  1.00 15.35 ? 374  PHE C CG  1 
ATOM   10772 C  CD1 . PHE C 1 374 ? 22.274  -14.760 22.494  1.00 17.33 ? 374  PHE C CD1 1 
ATOM   10773 C  CD2 . PHE C 1 374 ? 23.097  -17.013 22.383  1.00 19.37 ? 374  PHE C CD2 1 
ATOM   10774 C  CE1 . PHE C 1 374 ? 21.010  -15.207 22.121  1.00 19.61 ? 374  PHE C CE1 1 
ATOM   10775 C  CE2 . PHE C 1 374 ? 21.817  -17.475 21.996  1.00 20.84 ? 374  PHE C CE2 1 
ATOM   10776 C  CZ  . PHE C 1 374 ? 20.778  -16.573 21.874  1.00 19.36 ? 374  PHE C CZ  1 
ATOM   10777 N  N   . LYS C 1 375 ? 26.434  -17.106 24.904  1.00 10.59 ? 375  LYS C N   1 
ATOM   10778 C  CA  . LYS C 1 375 ? 26.850  -18.464 25.240  1.00 10.56 ? 375  LYS C CA  1 
ATOM   10779 C  C   . LYS C 1 375 ? 27.628  -18.534 26.549  1.00 10.36 ? 375  LYS C C   1 
ATOM   10780 O  O   . LYS C 1 375 ? 28.493  -19.366 26.683  1.00 10.72 ? 375  LYS C O   1 
ATOM   10781 C  CB  . LYS C 1 375 ? 27.645  -19.076 24.081  1.00 10.08 ? 375  LYS C CB  1 
ATOM   10782 C  CG  . LYS C 1 375 ? 26.810  -19.159 22.790  1.00 11.73 ? 375  LYS C CG  1 
ATOM   10783 C  CD  . LYS C 1 375 ? 27.020  -20.471 22.038  1.00 15.84 ? 375  LYS C CD  1 
ATOM   10784 C  CE  . LYS C 1 375 ? 28.208  -20.389 21.060  1.00 16.63 ? 375  LYS C CE  1 
ATOM   10785 N  NZ  . LYS C 1 375 ? 28.550  -21.694 20.375  1.00 14.31 ? 375  LYS C NZ  1 
ATOM   10786 N  N   . GLN C 1 376 ? 27.298  -17.670 27.513  1.00 10.36 ? 376  GLN C N   1 
ATOM   10787 C  CA  . GLN C 1 376 ? 27.972  -17.641 28.815  1.00 10.20 ? 376  GLN C CA  1 
ATOM   10788 C  C   . GLN C 1 376 ? 28.077  -19.018 29.475  1.00 10.59 ? 376  GLN C C   1 
ATOM   10789 O  O   . GLN C 1 376 ? 27.064  -19.727 29.627  1.00 10.03 ? 376  GLN C O   1 
ATOM   10790 C  CB  . GLN C 1 376 ? 27.230  -16.689 29.768  1.00 10.09 ? 376  GLN C CB  1 
ATOM   10791 C  CG  . GLN C 1 376 ? 27.892  -16.466 31.141  1.00 8.23  ? 376  GLN C CG  1 
ATOM   10792 C  CD  . GLN C 1 376 ? 28.986  -15.378 31.127  1.00 10.05 ? 376  GLN C CD  1 
ATOM   10793 O  OE1 . GLN C 1 376 ? 29.870  -15.375 30.267  1.00 9.57  ? 376  GLN C OE1 1 
ATOM   10794 N  NE2 . GLN C 1 376 ? 28.937  -14.470 32.101  1.00 7.97  ? 376  GLN C NE2 1 
ATOM   10795 N  N   . GLN C 1 377 ? 29.297  -19.396 29.872  1.00 10.84 ? 377  GLN C N   1 
ATOM   10796 C  CA  . GLN C 1 377 ? 29.470  -20.643 30.605  1.00 10.89 ? 377  GLN C CA  1 
ATOM   10797 C  C   . GLN C 1 377 ? 29.039  -20.419 32.047  1.00 11.70 ? 377  GLN C C   1 
ATOM   10798 O  O   . GLN C 1 377 ? 29.493  -19.467 32.704  1.00 11.80 ? 377  GLN C O   1 
ATOM   10799 C  CB  . GLN C 1 377 ? 30.898  -21.169 30.478  1.00 10.98 ? 377  GLN C CB  1 
ATOM   10800 C  CG  . GLN C 1 377 ? 31.306  -21.412 29.020  1.00 9.35  ? 377  GLN C CG  1 
ATOM   10801 C  CD  . GLN C 1 377 ? 32.807  -21.573 28.871  1.00 9.44  ? 377  GLN C CD  1 
ATOM   10802 O  OE1 . GLN C 1 377 ? 33.336  -22.672 29.005  1.00 7.94  ? 377  GLN C OE1 1 
ATOM   10803 N  NE2 . GLN C 1 377 ? 33.509  -20.463 28.601  1.00 9.25  ? 377  GLN C NE2 1 
ATOM   10804 N  N   . THR C 1 378 ? 28.131  -21.273 32.527  1.00 11.93 ? 378  THR C N   1 
ATOM   10805 C  CA  . THR C 1 378 ? 27.433  -20.987 33.762  1.00 13.19 ? 378  THR C CA  1 
ATOM   10806 C  C   . THR C 1 378 ? 28.155  -21.390 35.037  1.00 13.03 ? 378  THR C C   1 
ATOM   10807 O  O   . THR C 1 378 ? 27.908  -20.796 36.083  1.00 13.43 ? 378  THR C O   1 
ATOM   10808 C  CB  . THR C 1 378 ? 25.986  -21.527 33.746  1.00 13.99 ? 378  THR C CB  1 
ATOM   10809 O  OG1 . THR C 1 378 ? 26.008  -22.908 33.361  1.00 15.86 ? 378  THR C OG1 1 
ATOM   10810 C  CG2 . THR C 1 378 ? 25.126  -20.700 32.723  1.00 13.42 ? 378  THR C CG2 1 
ATOM   10811 N  N   . SER C 1 379 ? 29.064  -22.358 34.957  1.00 12.48 ? 379  SER C N   1 
ATOM   10812 C  CA  . SER C 1 379 ? 29.772  -22.837 36.153  1.00 12.06 ? 379  SER C CA  1 
ATOM   10813 C  C   . SER C 1 379 ? 30.452  -21.673 36.914  1.00 12.24 ? 379  SER C C   1 
ATOM   10814 O  O   . SER C 1 379 ? 31.163  -20.864 36.314  1.00 12.41 ? 379  SER C O   1 
ATOM   10815 C  CB  . SER C 1 379 ? 30.796  -23.898 35.767  1.00 11.23 ? 379  SER C CB  1 
ATOM   10816 O  OG  . SER C 1 379 ? 31.715  -24.082 36.808  1.00 11.77 ? 379  SER C OG  1 
ATOM   10817 N  N   . SER C 1 380 ? 30.234  -21.591 38.222  1.00 11.51 ? 380  SER C N   1 
ATOM   10818 C  CA  . SER C 1 380 ? 30.826  -20.531 39.007  1.00 12.08 ? 380  SER C CA  1 
ATOM   10819 C  C   . SER C 1 380 ? 32.369  -20.659 39.189  1.00 11.78 ? 380  SER C C   1 
ATOM   10820 O  O   . SER C 1 380 ? 33.033  -19.718 39.635  1.00 11.20 ? 380  SER C O   1 
ATOM   10821 C  CB  . SER C 1 380 ? 30.100  -20.424 40.350  1.00 12.19 ? 380  SER C CB  1 
ATOM   10822 O  OG  . SER C 1 380 ? 30.454  -21.512 41.188  1.00 14.61 ? 380  SER C OG  1 
ATOM   10823 N  N   . VAL C 1 381 ? 32.919  -21.826 38.842  1.00 11.49 ? 381  VAL C N   1 
ATOM   10824 C  CA  . VAL C 1 381 ? 34.370  -22.039 38.818  1.00 10.82 ? 381  VAL C CA  1 
ATOM   10825 C  C   . VAL C 1 381 ? 34.964  -21.383 37.552  1.00 10.86 ? 381  VAL C C   1 
ATOM   10826 O  O   . VAL C 1 381 ? 35.068  -21.996 36.469  1.00 10.23 ? 381  VAL C O   1 
ATOM   10827 C  CB  . VAL C 1 381 ? 34.744  -23.562 38.915  1.00 11.03 ? 381  VAL C CB  1 
ATOM   10828 C  CG1 . VAL C 1 381 ? 36.215  -23.743 39.220  1.00 8.63  ? 381  VAL C CG1 1 
ATOM   10829 C  CG2 . VAL C 1 381 ? 33.862  -24.282 39.988  1.00 11.44 ? 381  VAL C CG2 1 
ATOM   10830 N  N   . ASN C 1 382 ? 35.349  -20.119 37.706  1.00 10.42 ? 382  ASN C N   1 
ATOM   10831 C  CA  . ASN C 1 382 ? 35.847  -19.338 36.586  1.00 10.18 ? 382  ASN C CA  1 
ATOM   10832 C  C   . ASN C 1 382 ? 37.351  -19.051 36.678  1.00 9.64  ? 382  ASN C C   1 
ATOM   10833 O  O   . ASN C 1 382 ? 37.854  -18.149 36.016  1.00 9.64  ? 382  ASN C O   1 
ATOM   10834 C  CB  . ASN C 1 382 ? 35.031  -18.043 36.453  1.00 9.95  ? 382  ASN C CB  1 
ATOM   10835 C  CG  . ASN C 1 382 ? 35.055  -17.207 37.728  1.00 10.44 ? 382  ASN C CG  1 
ATOM   10836 O  OD1 . ASN C 1 382 ? 35.822  -17.489 38.657  1.00 10.05 ? 382  ASN C OD1 1 
ATOM   10837 N  ND2 . ASN C 1 382 ? 34.192  -16.201 37.794  1.00 7.20  ? 382  ASN C ND2 1 
ATOM   10838 N  N   . TYR C 1 383 ? 38.063  -19.848 37.478  1.00 9.64  ? 383  TYR C N   1 
ATOM   10839 C  CA  . TYR C 1 383 ? 39.511  -19.688 37.695  1.00 9.23  ? 383  TYR C CA  1 
ATOM   10840 C  C   . TYR C 1 383 ? 40.206  -21.041 37.590  1.00 9.35  ? 383  TYR C C   1 
ATOM   10841 O  O   . TYR C 1 383 ? 39.626  -22.075 37.943  1.00 9.66  ? 383  TYR C O   1 
ATOM   10842 C  CB  . TYR C 1 383 ? 39.789  -19.047 39.071  1.00 8.73  ? 383  TYR C CB  1 
ATOM   10843 C  CG  . TYR C 1 383 ? 39.265  -19.862 40.229  1.00 8.89  ? 383  TYR C CG  1 
ATOM   10844 C  CD1 . TYR C 1 383 ? 40.059  -20.858 40.828  1.00 9.94  ? 383  TYR C CD1 1 
ATOM   10845 C  CD2 . TYR C 1 383 ? 37.985  -19.659 40.729  1.00 8.43  ? 383  TYR C CD2 1 
ATOM   10846 C  CE1 . TYR C 1 383 ? 39.586  -21.627 41.877  1.00 7.48  ? 383  TYR C CE1 1 
ATOM   10847 C  CE2 . TYR C 1 383 ? 37.505  -20.432 41.792  1.00 8.29  ? 383  TYR C CE2 1 
ATOM   10848 C  CZ  . TYR C 1 383 ? 38.312  -21.418 42.349  1.00 7.47  ? 383  TYR C CZ  1 
ATOM   10849 O  OH  . TYR C 1 383 ? 37.842  -22.198 43.380  1.00 7.16  ? 383  TYR C OH  1 
ATOM   10850 N  N   . GLU C 1 384 ? 41.443  -21.040 37.103  1.00 9.55  ? 384  GLU C N   1 
ATOM   10851 C  CA  . GLU C 1 384 ? 42.245  -22.270 37.012  1.00 9.89  ? 384  GLU C CA  1 
ATOM   10852 C  C   . GLU C 1 384 ? 43.665  -21.893 37.358  1.00 10.02 ? 384  GLU C C   1 
ATOM   10853 O  O   . GLU C 1 384 ? 44.164  -20.931 36.804  1.00 10.55 ? 384  GLU C O   1 
ATOM   10854 C  CB  . GLU C 1 384 ? 42.201  -22.878 35.607  1.00 9.56  ? 384  GLU C CB  1 
ATOM   10855 C  CG  . GLU C 1 384 ? 42.611  -24.351 35.536  1.00 10.41 ? 384  GLU C CG  1 
ATOM   10856 C  CD  . GLU C 1 384 ? 44.130  -24.599 35.423  1.00 12.40 ? 384  GLU C CD  1 
ATOM   10857 O  OE1 . GLU C 1 384 ? 44.578  -25.719 35.788  1.00 13.82 ? 384  GLU C OE1 1 
ATOM   10858 O  OE2 . GLU C 1 384 ? 44.886  -23.700 34.976  1.00 11.16 ? 384  GLU C OE2 1 
ATOM   10859 N  N   . PRO C 1 385 ? 44.339  -22.663 38.234  1.00 10.15 ? 385  PRO C N   1 
ATOM   10860 C  CA  . PRO C 1 385 ? 43.917  -23.943 38.804  1.00 10.66 ? 385  PRO C CA  1 
ATOM   10861 C  C   . PRO C 1 385 ? 42.779  -23.845 39.832  1.00 10.53 ? 385  PRO C C   1 
ATOM   10862 O  O   . PRO C 1 385 ? 42.593  -22.803 40.441  1.00 10.35 ? 385  PRO C O   1 
ATOM   10863 C  CB  . PRO C 1 385 ? 45.209  -24.478 39.442  1.00 10.71 ? 385  PRO C CB  1 
ATOM   10864 C  CG  . PRO C 1 385 ? 45.951  -23.263 39.801  1.00 10.24 ? 385  PRO C CG  1 
ATOM   10865 C  CD  . PRO C 1 385 ? 45.673  -22.272 38.720  1.00 9.74  ? 385  PRO C CD  1 
ATOM   10866 N  N   . ASN C 1 386 ? 42.015  -24.928 39.953  1.00 11.00 ? 386  ASN C N   1 
ATOM   10867 C  CA  . ASN C 1 386 ? 40.960  -25.091 40.956  1.00 11.79 ? 386  ASN C CA  1 
ATOM   10868 C  C   . ASN C 1 386 ? 40.928  -26.537 41.493  1.00 11.83 ? 386  ASN C C   1 
ATOM   10869 O  O   . ASN C 1 386 ? 41.575  -27.439 40.947  1.00 11.63 ? 386  ASN C O   1 
ATOM   10870 C  CB  . ASN C 1 386 ? 39.589  -24.698 40.376  1.00 12.14 ? 386  ASN C CB  1 
ATOM   10871 C  CG  . ASN C 1 386 ? 39.224  -25.513 39.144  1.00 13.83 ? 386  ASN C CG  1 
ATOM   10872 O  OD1 . ASN C 1 386 ? 38.867  -26.691 39.251  1.00 17.00 ? 386  ASN C OD1 1 
ATOM   10873 N  ND2 . ASN C 1 386 ? 39.329  -24.898 37.966  1.00 13.34 ? 386  ASN C ND2 1 
ATOM   10874 N  N   . ARG C 1 387 ? 40.156  -26.749 42.552  1.00 12.26 ? 387  ARG C N   1 
ATOM   10875 C  CA  . ARG C 1 387 ? 40.075  -28.042 43.234  1.00 12.67 ? 387  ARG C CA  1 
ATOM   10876 C  C   . ARG C 1 387 ? 39.125  -29.081 42.584  1.00 13.09 ? 387  ARG C C   1 
ATOM   10877 O  O   . ARG C 1 387 ? 38.968  -30.177 43.111  1.00 12.57 ? 387  ARG C O   1 
ATOM   10878 C  CB  . ARG C 1 387 ? 39.645  -27.814 44.694  1.00 12.75 ? 387  ARG C CB  1 
ATOM   10879 C  CG  . ARG C 1 387 ? 38.256  -27.166 44.789  1.00 11.77 ? 387  ARG C CG  1 
ATOM   10880 C  CD  . ARG C 1 387 ? 37.669  -27.176 46.190  1.00 11.60 ? 387  ARG C CD  1 
ATOM   10881 N  NE  . ARG C 1 387 ? 38.310  -26.227 47.104  1.00 10.18 ? 387  ARG C NE  1 
ATOM   10882 C  CZ  . ARG C 1 387 ? 37.927  -24.969 47.313  1.00 10.30 ? 387  ARG C CZ  1 
ATOM   10883 N  NH1 . ARG C 1 387 ? 36.886  -24.443 46.664  1.00 10.07 ? 387  ARG C NH1 1 
ATOM   10884 N  NH2 . ARG C 1 387 ? 38.591  -24.228 48.189  1.00 9.12  ? 387  ARG C NH2 1 
ATOM   10885 N  N   . TYR C 1 388 ? 38.488  -28.740 41.467  1.00 14.26 ? 388  TYR C N   1 
ATOM   10886 C  CA  . TYR C 1 388 ? 37.372  -29.571 40.946  1.00 15.54 ? 388  TYR C CA  1 
ATOM   10887 C  C   . TYR C 1 388 ? 37.774  -30.414 39.755  1.00 16.43 ? 388  TYR C C   1 
ATOM   10888 O  O   . TYR C 1 388 ? 38.006  -29.891 38.674  1.00 17.16 ? 388  TYR C O   1 
ATOM   10889 C  CB  . TYR C 1 388 ? 36.148  -28.708 40.598  1.00 14.90 ? 388  TYR C CB  1 
ATOM   10890 C  CG  . TYR C 1 388 ? 35.736  -27.763 41.721  1.00 14.96 ? 388  TYR C CG  1 
ATOM   10891 C  CD1 . TYR C 1 388 ? 36.241  -26.456 41.773  1.00 12.19 ? 388  TYR C CD1 1 
ATOM   10892 C  CD2 . TYR C 1 388 ? 34.871  -28.182 42.744  1.00 14.73 ? 388  TYR C CD2 1 
ATOM   10893 C  CE1 . TYR C 1 388 ? 35.901  -25.595 42.791  1.00 11.31 ? 388  TYR C CE1 1 
ATOM   10894 C  CE2 . TYR C 1 388 ? 34.512  -27.306 43.785  1.00 13.79 ? 388  TYR C CE2 1 
ATOM   10895 C  CZ  . TYR C 1 388 ? 35.038  -26.016 43.780  1.00 13.18 ? 388  TYR C CZ  1 
ATOM   10896 O  OH  . TYR C 1 388 ? 34.725  -25.137 44.764  1.00 14.07 ? 388  TYR C OH  1 
ATOM   10897 N  N   . GLN C 1 389 ? 37.866  -31.722 39.960  1.00 17.84 ? 389  GLN C N   1 
ATOM   10898 C  CA  . GLN C 1 389 ? 38.317  -32.645 38.911  1.00 19.21 ? 389  GLN C CA  1 
ATOM   10899 C  C   . GLN C 1 389 ? 37.499  -32.573 37.620  1.00 19.00 ? 389  GLN C C   1 
ATOM   10900 O  O   . GLN C 1 389 ? 38.007  -32.895 36.549  1.00 18.44 ? 389  GLN C O   1 
ATOM   10901 C  CB  . GLN C 1 389 ? 38.292  -34.077 39.424  1.00 19.97 ? 389  GLN C CB  1 
ATOM   10902 C  CG  . GLN C 1 389 ? 39.666  -34.658 39.783  1.00 24.65 ? 389  GLN C CG  1 
ATOM   10903 C  CD  . GLN C 1 389 ? 39.769  -36.113 39.321  1.00 31.02 ? 389  GLN C CD  1 
ATOM   10904 O  OE1 . GLN C 1 389 ? 38.820  -36.912 39.518  1.00 32.87 ? 389  GLN C OE1 1 
ATOM   10905 N  NE2 . GLN C 1 389 ? 40.902  -36.462 38.670  1.00 30.46 ? 389  GLN C NE2 1 
ATOM   10906 N  N   . ASP C 1 390 ? 36.244  -32.150 37.749  1.00 18.91 ? 390  ASP C N   1 
ATOM   10907 C  CA  . ASP C 1 390 ? 35.266  -32.168 36.669  1.00 19.56 ? 390  ASP C CA  1 
ATOM   10908 C  C   . ASP C 1 390 ? 35.251  -30.883 35.812  1.00 18.49 ? 390  ASP C C   1 
ATOM   10909 O  O   . ASP C 1 390 ? 34.580  -30.831 34.772  1.00 18.17 ? 390  ASP C O   1 
ATOM   10910 C  CB  . ASP C 1 390 ? 33.863  -32.417 37.256  1.00 20.50 ? 390  ASP C CB  1 
ATOM   10911 C  CG  . ASP C 1 390 ? 33.648  -33.883 37.728  1.00 24.21 ? 390  ASP C CG  1 
ATOM   10912 O  OD1 . ASP C 1 390 ? 34.556  -34.747 37.588  1.00 25.99 ? 390  ASP C OD1 1 
ATOM   10913 O  OD2 . ASP C 1 390 ? 32.537  -34.167 38.245  1.00 28.61 ? 390  ASP C OD2 1 
ATOM   10914 N  N   . GLU C 1 391 ? 35.975  -29.851 36.238  1.00 16.99 ? 391  GLU C N   1 
ATOM   10915 C  CA  . GLU C 1 391 ? 36.034  -28.615 35.453  1.00 15.92 ? 391  GLU C CA  1 
ATOM   10916 C  C   . GLU C 1 391 ? 37.117  -28.734 34.386  1.00 14.48 ? 391  GLU C C   1 
ATOM   10917 O  O   . GLU C 1 391 ? 37.944  -29.614 34.478  1.00 14.26 ? 391  GLU C O   1 
ATOM   10918 C  CB  . GLU C 1 391 ? 36.234  -27.391 36.354  1.00 15.80 ? 391  GLU C CB  1 
ATOM   10919 C  CG  . GLU C 1 391 ? 35.062  -27.125 37.285  1.00 17.44 ? 391  GLU C CG  1 
ATOM   10920 C  CD  . GLU C 1 391 ? 33.761  -26.933 36.539  1.00 18.67 ? 391  GLU C CD  1 
ATOM   10921 O  OE1 . GLU C 1 391 ? 32.730  -27.371 37.060  1.00 20.19 ? 391  GLU C OE1 1 
ATOM   10922 O  OE2 . GLU C 1 391 ? 33.759  -26.350 35.432  1.00 20.24 ? 391  GLU C OE2 1 
ATOM   10923 N  N   . PRO C 1 392 ? 37.104  -27.857 33.363  1.00 14.18 ? 392  PRO C N   1 
ATOM   10924 C  CA  . PRO C 1 392 ? 38.104  -27.997 32.287  1.00 13.53 ? 392  PRO C CA  1 
ATOM   10925 C  C   . PRO C 1 392 ? 39.535  -28.034 32.809  1.00 13.15 ? 392  PRO C C   1 
ATOM   10926 O  O   . PRO C 1 392 ? 39.884  -27.268 33.722  1.00 13.09 ? 392  PRO C O   1 
ATOM   10927 C  CB  . PRO C 1 392 ? 37.880  -26.753 31.428  1.00 13.32 ? 392  PRO C CB  1 
ATOM   10928 C  CG  . PRO C 1 392 ? 36.451  -26.351 31.705  1.00 13.63 ? 392  PRO C CG  1 
ATOM   10929 C  CD  . PRO C 1 392 ? 36.198  -26.709 33.127  1.00 13.70 ? 392  PRO C CD  1 
ATOM   10930 N  N   . LYS C 1 393 ? 40.341  -28.940 32.252  1.00 12.34 ? 393  LYS C N   1 
ATOM   10931 C  CA  . LYS C 1 393 ? 41.752  -29.069 32.634  1.00 11.70 ? 393  LYS C CA  1 
ATOM   10932 C  C   . LYS C