data_2J3Q
# 
_entry.id   2J3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2J3Q         
PDBE  EBI-29792    
WWPDB D_1290029792 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3- (3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2J3Q 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-08-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Harel, M.'        1 ? 
'Cusack, B.'       2 ? 
'Johnson, J.L.'    3 ? 
'Silman, I.'       4 ? 
'Sussman, J.L.'    5 ? 
'Rosenberry, T.L.' 6 ? 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of thioflavin T bound to the peripheral site of Torpedo californica acetylcholinesterase reveals how thioflavin T acts as a sensitive fluorescent reporter of ligand binding to the acylation site.
;
_citation.journal_abbrev            'J. Am. Chem. Soc.' 
_citation.journal_volume            130 
_citation.page_first                7856 
_citation.page_last                 7861 
_citation.year                      2008 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           1520-5126 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18512913 
_citation.pdbx_database_id_DOI      10.1021/ja7109822 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'        1 ? 
primary 'Sonoda, L.K.'     2 ? 
primary 'Silman, I.'       3 ? 
primary 'Sussman, J.L.'    4 ? 
primary 'Rosenberry, T.L.' 5 ? 
# 
_cell.entry_id           2J3Q 
_cell.length_a           139.440 
_cell.length_b           139.440 
_cell.length_c           71.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2J3Q 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                    61325.090 1  3.1.1.7 ? 'RESIDUES 22-564' 
? 
2 non-polymer syn '2-[4-(DIMETHYLAMINO)PHENYL]-6-HYDROXY-3-METHYL-1,3-BENZOTHIAZOL-3-IUM' 285.384   1  ?       ? ?                 
? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                221.208   3  ?       ? ?                 
? 
4 non-polymer syn 'MAGNESIUM ION'                                                         24.305    2  ?       ? ?                 
? 
5 water       nat water                                                                   18.015    85 ?       ? ?                 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ACHE, TORPEDO ACETYLCHOLINESTERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2J3Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                 ? 'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking'          y ARGININE                                                                ? 'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                              ? 'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                         ? 'C4 H7 N O4'       
133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                ? 'C3 H7 N O2 S'     
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                               ? 'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                         ? 'C5 H9 N O4'       
147.129 
GLY 'peptide linking'            y GLYCINE                                                                 ? 'C2 H5 N O2'       
75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                               ? 'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer                  . WATER                                                                   ? 'H2 O'             
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                              ? 'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                 ? 'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking'          y LYSINE                                                                  ? 'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking'          y METHIONINE                                                              ? 'C5 H11 N O2 S'    
149.211 
MG  non-polymer                  . 'MAGNESIUM ION'                                                         ? 'Mg 2'             
24.305  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                ? 'C8 H15 N O6'      
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                           ? 'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking'          y PROLINE                                                                 ? 'C5 H9 N O2'       
115.130 
SER 'L-peptide linking'          y SERINE                                                                  ? 'C3 H7 N O3'       
105.093 
TFL non-polymer                  . '2-[4-(DIMETHYLAMINO)PHENYL]-6-HYDROXY-3-METHYL-1,3-BENZOTHIAZOL-3-IUM' ? 'C16 H17 N2 O S 1' 
285.384 
THR 'L-peptide linking'          y THREONINE                                                               ? 'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                              ? 'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                ? 'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking'          y VALINE                                                                  ? 'C5 H11 N O2'      
117.146 
# 
_exptl.entry_id          2J3Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.08 
_exptl_crystal.density_percent_sol   60 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MULTIWIRE 
_diffrn_detector.pdbx_collection_date   2005-02-23 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2J3Q 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   242941 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.90 
_reflns.B_iso_Wilson_estimate        64.3 
_reflns.pdbx_redundancy              12.3 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   92.5 
_reflns_shell.Rmerge_I_obs           0.61 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.93 
_reflns_shell.pdbx_redundancy        12.0 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2J3Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19966 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3057165 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.813 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  1982 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.1 
_refine.aniso_B[1][1]                            2.61 
_refine.aniso_B[2][2]                            2.61 
_refine.aniso_B[3][3]                            -5.21 
_refine.aniso_B[1][2]                            10.70 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.301444 
_refine.solvent_model_param_bsol                 12.7011 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1U65' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMIM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2J3Q 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.45 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.4 
_refine_analyze.Luzzati_sigma_a_free            0.55 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4250 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             85 
_refine_hist.number_atoms_total               4399 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        27.813 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.84  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.24  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.15  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.70  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.69  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.8 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             2835 
_refine_ls_shell.R_factor_R_work                  0.282 
_refine_ls_shell.percent_reflns_obs               95.6 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             315 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 3 ION.PARAM          ION.TOP          
'X-RAY DIFFRACTION' 4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 5 THT_SKETCHER.PAR   THT_SKETCHER.TOP 
# 
_struct.entry_id                  2J3Q 
_struct.title                     'Torpedo acetylcholinesterase complexed with fluorophore thioflavin T' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2J3Q 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;SERINE ESTERASE, ALTERNATIVE SPLICING, LIPOPROTEIN, GLYCOPROTEIN, TORPEDO ACHE, NEUROTRANSMITTER DEGRADATION, ANTICANCER PRODRUG CPT- 11, SYNAPSE, MEMBRANE, HYDROLASE, GPI-ANCHOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  6  ASN A 167 ? ASP A 182 ? ASN A 167 ASP A 182 1 ? 16 
HELX_P HELX_P7  7  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P8  8  SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P9  9  VAL A 238 ? ASN A 251 ? VAL A 238 ASN A 251 1 ? 14 
HELX_P HELX_P10 10 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P11 11 LYS A 270 ? ASP A 276 ? LYS A 270 ASP A 276 1 ? 7  
HELX_P HELX_P12 12 VAL A 277 ? LEU A 282 ? VAL A 277 LEU A 282 5 ? 6  
HELX_P HELX_P13 13 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P14 14 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 15 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P16 16 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 17 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 18 VAL A 400 ? THR A 412 ? VAL A 400 THR A 412 1 ? 13 
HELX_P HELX_P19 19 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P20 20 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P21 21 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P22 22 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P23 23 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67   A CYS 94   1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254  A CYS 265  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402  A CYS 521  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59   A NAG 1539 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416  A NAG 1540 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale3 covale one ? A ASN 457 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 457  A NAG 1541 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
metalc1 metalc ?   ? A HIS 264 NE2 ? ? ? 1_555 F MG  .   MG ? ? A HIS 264  A MG  1542 1_555 ? ? ? ? ? ? ? 2.607 ? ?               
metalc2 metalc ?   ? A GLU 268 OE1 ? ? ? 1_555 F MG  .   MG ? ? A GLU 268  A MG  1542 1_555 ? ? ? ? ? ? ? 2.205 ? ?               
metalc3 metalc ?   ? A ASP 326 OD1 ? ? ? 1_555 G MG  .   MG ? ? A ASP 326  A MG  1543 1_555 ? ? ? ? ? ? ? 2.435 ? ?               
metalc4 metalc ?   ? A ASP 392 OD2 ? ? ? 1_555 G MG  .   MG ? ? A ASP 392  A MG  1543 1_555 ? ? ? ? ? ? ? 2.297 ? ?               
metalc5 metalc ?   ? G MG  .   MG  ? ? ? 1_555 H HOH .   O  ? ? A MG  1543 A HOH 2065 1_555 ? ? ? ? ? ? ? 2.341 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AB 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          2J3Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2J3Q 
_atom_sites.fract_transf_matrix[1][1]   0.007172 
_atom_sites.fract_transf_matrix[1][2]   0.004140 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008281 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014002 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -36.024 69.856  52.365 1.00 64.15 ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -35.579 71.249  52.675 1.00 64.58 ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -34.876 71.908  51.485 1.00 64.24 ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -33.688 71.677  51.226 1.00 63.61 ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -34.657 71.250  53.904 1.00 65.31 ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -35.386 70.972  55.093 1.00 64.37 ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -35.634 72.738  50.771 1.00 63.41 ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -35.144 73.448  49.599 1.00 61.91 ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -34.280 74.652  49.956 1.00 61.01 ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -33.790 75.343  49.070 1.00 62.53 ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -36.321 73.907  48.740 1.00 61.48 ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -37.328 74.749  49.500 1.00 61.98 ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -38.509 75.148  48.644 1.00 63.61 ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -39.494 75.673  49.201 1.00 63.33 ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -38.453 74.941  47.413 1.00 65.01 ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -34.102 74.918  51.245 1.00 58.66 ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -33.263 76.035  51.653 1.00 57.05 ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -31.833 75.558  51.885 1.00 56.81 ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -30.939 76.350  52.175 1.00 56.10 ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -33.801 76.684  52.925 1.00 56.56 ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -35.120 77.448  52.861 1.00 56.11 ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -35.255 78.271  54.130 1.00 54.95 ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -35.147 78.359  51.648 1.00 56.89 ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -31.624 74.254  51.759 1.00 57.34 ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -30.298 73.683  51.941 1.00 57.79 ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -29.756 73.184  50.608 1.00 57.78 ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -30.371 72.333  49.953 1.00 58.06 ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -30.335 72.525  52.938 1.00 58.65 ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -28.960 71.893  53.184 1.00 59.10 ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -28.017 72.923  53.783 1.00 59.88 ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -29.096 70.718  54.120 1.00 61.00 ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -28.601 73.719  50.217 1.00 56.58 ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -27.963 73.349  48.959 1.00 54.82 ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -26.480 73.064  49.143 1.00 53.63 ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -25.810 73.705  49.953 1.00 52.43 ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -28.122 74.471  47.904 1.00 54.60 ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -27.364 74.112  46.643 1.00 54.65 ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -29.593 74.684  47.590 1.00 53.12 ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -25.976 72.091  48.392 1.00 53.33 ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? -24.568 71.735  48.464 1.00 54.01 ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? -23.880 72.081  47.146 1.00 53.12 ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? -24.230 71.551  46.093 1.00 53.45 ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? -24.399 70.246  48.747 1.00 55.70 ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? -22.964 69.887  49.086 1.00 58.42 ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? -22.507 70.106  50.212 1.00 59.59 ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? -22.237 69.358  48.107 1.00 59.08 ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? -22.895 72.968  47.212 1.00 51.50 ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -22.179 73.396  46.020 1.00 50.35 ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -20.734 72.952  46.085 1.00 50.34 ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -20.215 72.679  47.164 1.00 50.55 ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -22.163 74.909  45.902 1.00 49.33 ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -21.136 75.426  46.757 1.00 48.35 ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -23.511 75.492  46.321 1.00 48.58 ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? -20.084 72.912  44.925 1.00 50.45 ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? -18.682 72.511  44.812 1.00 51.12 ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? -17.759 73.371  45.671 1.00 51.58 ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? -16.542 73.344  45.494 1.00 51.12 ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? -18.212 72.627  43.360 1.00 52.24 ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? -19.102 71.959  42.327 1.00 53.25 ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? -18.527 72.137  40.921 1.00 52.27 ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? -19.426 71.513  39.863 1.00 51.79 ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? -18.853 71.686  38.503 1.00 51.60 ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? -18.334 74.143  46.585 1.00 52.45 ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -17.540 75.012  47.439 1.00 53.66 ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -17.914 74.823  48.902 1.00 53.64 ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -17.121 75.113  49.802 1.00 53.43 ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -17.759 76.468  47.025 1.00 54.96 ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -17.418 76.669  45.661 1.00 56.66 ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? -19.127 74.329  49.123 1.00 53.24 ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? -19.624 74.102  50.467 1.00 53.62 ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? -21.144 74.093  50.471 1.00 54.24 ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? -21.775 74.151  49.411 1.00 54.87 ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? -21.743 74.016  51.654 1.00 53.69 ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? -23.197 74.008  51.753 1.00 52.76 ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? -23.702 75.420  52.026 1.00 51.40 ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? -23.004 76.232  52.633 1.00 50.43 ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? -23.653 73.083  52.882 1.00 53.81 ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? -23.158 71.652  52.785 1.00 53.93 ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? -23.629 70.879  54.006 1.00 55.42 ? 14   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? -23.155 69.439  54.008 1.00 55.23 ? 14   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? -23.526 68.764  55.290 1.00 55.27 ? 14   LYS A NZ  1 
ATOM   82   N  N   . VAL A 1 15  ? -24.917 75.709  51.577 1.00 49.56 ? 15   VAL A N   1 
ATOM   83   C  CA  . VAL A 1 15  ? -25.495 77.024  51.787 1.00 48.37 ? 15   VAL A CA  1 
ATOM   84   C  C   . VAL A 1 15  ? -26.907 76.915  52.334 1.00 48.89 ? 15   VAL A C   1 
ATOM   85   O  O   . VAL A 1 15  ? -27.754 76.205  51.783 1.00 49.07 ? 15   VAL A O   1 
ATOM   86   C  CB  . VAL A 1 15  ? -25.536 77.843  50.480 1.00 47.19 ? 15   VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 15  ? -24.132 78.127  50.001 1.00 46.25 ? 15   VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 15  ? -26.309 77.091  49.418 1.00 47.26 ? 15   VAL A CG2 1 
ATOM   89   N  N   . MET A 1 16  ? -27.149 77.624  53.429 1.00 48.24 ? 16   MET A N   1 
ATOM   90   C  CA  . MET A 1 16  ? -28.455 77.642  54.068 1.00 47.40 ? 16   MET A CA  1 
ATOM   91   C  C   . MET A 1 16  ? -29.152 78.919  53.607 1.00 46.55 ? 16   MET A C   1 
ATOM   92   O  O   . MET A 1 16  ? -28.770 80.022  53.999 1.00 47.02 ? 16   MET A O   1 
ATOM   93   C  CB  . MET A 1 16  ? -28.283 77.645  55.595 1.00 48.83 ? 16   MET A CB  1 
ATOM   94   C  CG  . MET A 1 16  ? -29.571 77.643  56.409 1.00 48.94 ? 16   MET A CG  1 
ATOM   95   S  SD  . MET A 1 16  ? -30.455 76.076  56.331 1.00 51.55 ? 16   MET A SD  1 
ATOM   96   C  CE  . MET A 1 16  ? -31.682 76.439  55.104 1.00 47.88 ? 16   MET A CE  1 
ATOM   97   N  N   . GLY A 1 17  ? -30.162 78.768  52.759 1.00 45.24 ? 17   GLY A N   1 
ATOM   98   C  CA  . GLY A 1 17  ? -30.881 79.926  52.267 1.00 45.06 ? 17   GLY A CA  1 
ATOM   99   C  C   . GLY A 1 17  ? -31.870 80.479  53.275 1.00 45.11 ? 17   GLY A C   1 
ATOM   100  O  O   . GLY A 1 17  ? -31.618 80.449  54.482 1.00 45.12 ? 17   GLY A O   1 
ATOM   101  N  N   . THR A 1 18  ? -32.988 80.996  52.769 1.00 45.04 ? 18   THR A N   1 
ATOM   102  C  CA  . THR A 1 18  ? -34.062 81.562  53.588 1.00 45.23 ? 18   THR A CA  1 
ATOM   103  C  C   . THR A 1 18  ? -35.299 81.784  52.745 1.00 46.27 ? 18   THR A C   1 
ATOM   104  O  O   . THR A 1 18  ? -35.213 82.259  51.622 1.00 46.84 ? 18   THR A O   1 
ATOM   105  C  CB  . THR A 1 18  ? -33.694 82.923  54.213 1.00 43.71 ? 18   THR A CB  1 
ATOM   106  O  OG1 . THR A 1 18  ? -34.896 83.585  54.626 1.00 41.03 ? 18   THR A OG1 1 
ATOM   107  C  CG2 . THR A 1 18  ? -32.967 83.801  53.215 1.00 44.31 ? 18   THR A CG2 1 
ATOM   108  N  N   . ARG A 1 19  ? -36.454 81.437  53.291 1.00 49.12 ? 19   ARG A N   1 
ATOM   109  C  CA  . ARG A 1 19  ? -37.713 81.603  52.574 1.00 51.47 ? 19   ARG A CA  1 
ATOM   110  C  C   . ARG A 1 19  ? -38.204 83.033  52.785 1.00 51.22 ? 19   ARG A C   1 
ATOM   111  O  O   . ARG A 1 19  ? -38.385 83.468  53.921 1.00 51.56 ? 19   ARG A O   1 
ATOM   112  C  CB  . ARG A 1 19  ? -38.744 80.603  53.105 1.00 52.81 ? 19   ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 19  ? -40.077 80.626  52.384 1.00 55.79 ? 19   ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 19  ? -41.083 79.702  53.063 1.00 57.65 ? 19   ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 19  ? -42.382 79.742  52.401 1.00 58.32 ? 19   ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 19  ? -42.589 79.351  51.148 1.00 59.25 ? 19   ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 19  ? -41.579 78.885  50.420 1.00 57.67 ? 19   ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 19  ? -43.803 79.437  50.619 1.00 59.80 ? 19   ARG A NH2 1 
ATOM   119  N  N   . VAL A 1 20  ? -38.411 83.769  51.696 1.00 50.82 ? 20   VAL A N   1 
ATOM   120  C  CA  . VAL A 1 20  ? -38.872 85.149  51.809 1.00 49.30 ? 20   VAL A CA  1 
ATOM   121  C  C   . VAL A 1 20  ? -40.176 85.429  51.064 1.00 48.60 ? 20   VAL A C   1 
ATOM   122  O  O   . VAL A 1 20  ? -40.471 84.816  50.037 1.00 46.26 ? 20   VAL A O   1 
ATOM   123  C  CB  . VAL A 1 20  ? -37.791 86.146  51.319 1.00 48.34 ? 20   VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 20  ? -36.453 85.796  51.953 1.00 47.52 ? 20   VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 20  ? -37.704 86.138  49.807 1.00 45.96 ? 20   VAL A CG2 1 
ATOM   126  N  N   . PRO A 1 21  ? -40.975 86.368  51.588 1.00 49.10 ? 21   PRO A N   1 
ATOM   127  C  CA  . PRO A 1 21  ? -42.256 86.758  51.004 1.00 50.08 ? 21   PRO A CA  1 
ATOM   128  C  C   . PRO A 1 21  ? -42.082 87.555  49.727 1.00 50.71 ? 21   PRO A C   1 
ATOM   129  O  O   . PRO A 1 21  ? -41.180 88.385  49.613 1.00 51.53 ? 21   PRO A O   1 
ATOM   130  C  CB  . PRO A 1 21  ? -42.896 87.585  52.112 1.00 50.27 ? 21   PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 21  ? -41.722 88.267  52.719 1.00 49.05 ? 21   PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 21  ? -40.714 87.138  52.818 1.00 49.36 ? 21   PRO A CD  1 
ATOM   133  N  N   . VAL A 1 22  ? -42.955 87.297  48.767 1.00 51.26 ? 22   VAL A N   1 
ATOM   134  C  CA  . VAL A 1 22  ? -42.905 87.994  47.500 1.00 52.47 ? 22   VAL A CA  1 
ATOM   135  C  C   . VAL A 1 22  ? -44.310 88.092  46.929 1.00 53.15 ? 22   VAL A C   1 
ATOM   136  O  O   . VAL A 1 22  ? -44.808 87.160  46.297 1.00 53.81 ? 22   VAL A O   1 
ATOM   137  C  CB  . VAL A 1 22  ? -41.958 87.267  46.503 1.00 52.57 ? 22   VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 22  ? -42.237 85.773  46.502 1.00 51.88 ? 22   VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 22  ? -42.125 87.846  45.101 1.00 53.35 ? 22   VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 23  ? -44.958 89.223  47.178 1.00 53.55 ? 23   LEU A N   1 
ATOM   141  C  CA  . LEU A 1 23  ? -46.305 89.439  46.678 1.00 54.67 ? 23   LEU A CA  1 
ATOM   142  C  C   . LEU A 1 23  ? -47.219 88.266  47.038 1.00 55.69 ? 23   LEU A C   1 
ATOM   143  O  O   . LEU A 1 23  ? -47.532 87.427  46.191 1.00 55.52 ? 23   LEU A O   1 
ATOM   144  C  CB  . LEU A 1 23  ? -46.263 89.606  45.161 1.00 54.53 ? 23   LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 23  ? -45.236 90.608  44.635 1.00 54.55 ? 23   LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 23  ? -45.234 90.599  43.115 1.00 53.91 ? 23   LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 23  ? -45.567 91.993  45.166 1.00 55.53 ? 23   LEU A CD2 1 
ATOM   148  N  N   . SER A 1 24  ? -47.632 88.202  48.299 1.00 56.28 ? 24   SER A N   1 
ATOM   149  C  CA  . SER A 1 24  ? -48.522 87.142  48.758 1.00 57.13 ? 24   SER A CA  1 
ATOM   150  C  C   . SER A 1 24  ? -48.099 85.752  48.295 1.00 56.80 ? 24   SER A C   1 
ATOM   151  O  O   . SER A 1 24  ? -48.911 84.978  47.785 1.00 56.40 ? 24   SER A O   1 
ATOM   152  C  CB  . SER A 1 24  ? -49.943 87.421  48.275 1.00 59.42 ? 24   SER A CB  1 
ATOM   153  O  OG  . SER A 1 24  ? -49.982 87.483  46.857 1.00 62.05 ? 24   SER A OG  1 
ATOM   154  N  N   . SER A 1 25  ? -46.823 85.442  48.473 1.00 57.00 ? 25   SER A N   1 
ATOM   155  C  CA  . SER A 1 25  ? -46.284 84.144  48.097 1.00 56.42 ? 25   SER A CA  1 
ATOM   156  C  C   . SER A 1 25  ? -44.829 84.142  48.549 1.00 56.88 ? 25   SER A C   1 
ATOM   157  O  O   . SER A 1 25  ? -44.401 85.074  49.230 1.00 56.45 ? 25   SER A O   1 
ATOM   158  C  CB  . SER A 1 25  ? -46.391 83.944  46.587 1.00 55.64 ? 25   SER A CB  1 
ATOM   159  O  OG  . SER A 1 25  ? -46.340 82.569  46.263 1.00 54.50 ? 25   SER A OG  1 
ATOM   160  N  N   . HIS A 1 26  ? -44.065 83.113  48.192 1.00 58.06 ? 26   HIS A N   1 
ATOM   161  C  CA  . HIS A 1 26  ? -42.665 83.053  48.622 1.00 59.10 ? 26   HIS A CA  1 
ATOM   162  C  C   . HIS A 1 26  ? -41.716 82.362  47.638 1.00 57.84 ? 26   HIS A C   1 
ATOM   163  O  O   . HIS A 1 26  ? -42.149 81.685  46.703 1.00 58.15 ? 26   HIS A O   1 
ATOM   164  C  CB  . HIS A 1 26  ? -42.560 82.332  49.978 1.00 62.14 ? 26   HIS A CB  1 
ATOM   165  C  CG  . HIS A 1 26  ? -43.522 82.829  51.017 1.00 65.01 ? 26   HIS A CG  1 
ATOM   166  N  ND1 . HIS A 1 26  ? -44.891 82.732  50.876 1.00 65.59 ? 26   HIS A ND1 1 
ATOM   167  C  CD2 . HIS A 1 26  ? -43.310 83.419  52.218 1.00 66.16 ? 26   HIS A CD2 1 
ATOM   168  C  CE1 . HIS A 1 26  ? -45.480 83.241  51.944 1.00 66.03 ? 26   HIS A CE1 1 
ATOM   169  N  NE2 . HIS A 1 26  ? -44.543 83.665  52.774 1.00 66.37 ? 26   HIS A NE2 1 
ATOM   170  N  N   . ILE A 1 27  ? -40.418 82.554  47.858 1.00 56.20 ? 27   ILE A N   1 
ATOM   171  C  CA  . ILE A 1 27  ? -39.369 81.927  47.047 1.00 55.13 ? 27   ILE A CA  1 
ATOM   172  C  C   . ILE A 1 27  ? -38.091 81.865  47.887 1.00 53.85 ? 27   ILE A C   1 
ATOM   173  O  O   . ILE A 1 27  ? -37.933 82.610  48.857 1.00 53.39 ? 27   ILE A O   1 
ATOM   174  C  CB  . ILE A 1 27  ? -39.039 82.708  45.717 1.00 54.75 ? 27   ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 27  ? -38.148 83.917  46.008 1.00 53.72 ? 27   ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 27  ? -40.315 83.141  45.020 1.00 53.96 ? 27   ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 27  ? -38.799 84.968  46.867 1.00 54.92 ? 27   ILE A CD1 1 
ATOM   178  N  N   . SER A 1 28  ? -37.184 80.970  47.514 1.00 52.21 ? 28   SER A N   1 
ATOM   179  C  CA  . SER A 1 28  ? -35.922 80.825  48.230 1.00 49.96 ? 28   SER A CA  1 
ATOM   180  C  C   . SER A 1 28  ? -35.005 82.006  47.907 1.00 47.52 ? 28   SER A C   1 
ATOM   181  O  O   . SER A 1 28  ? -35.119 82.632  46.854 1.00 47.40 ? 28   SER A O   1 
ATOM   182  C  CB  . SER A 1 28  ? -35.238 79.514  47.829 1.00 51.22 ? 28   SER A CB  1 
ATOM   183  O  OG  . SER A 1 28  ? -36.129 78.416  47.936 1.00 53.08 ? 28   SER A OG  1 
ATOM   184  N  N   . ALA A 1 29  ? -34.094 82.302  48.821 1.00 44.42 ? 29   ALA A N   1 
ATOM   185  C  CA  . ALA A 1 29  ? -33.160 83.397  48.641 1.00 41.77 ? 29   ALA A CA  1 
ATOM   186  C  C   . ALA A 1 29  ? -31.841 83.016  49.282 1.00 40.82 ? 29   ALA A C   1 
ATOM   187  O  O   . ALA A 1 29  ? -31.802 82.634  50.446 1.00 40.18 ? 29   ALA A O   1 
ATOM   188  C  CB  . ALA A 1 29  ? -33.706 84.657  49.291 1.00 38.88 ? 29   ALA A CB  1 
ATOM   189  N  N   . PHE A 1 30  ? -30.759 83.110  48.524 1.00 40.84 ? 30   PHE A N   1 
ATOM   190  C  CA  . PHE A 1 30  ? -29.446 82.780  49.062 1.00 41.75 ? 30   PHE A CA  1 
ATOM   191  C  C   . PHE A 1 30  ? -28.563 84.006  48.933 1.00 40.05 ? 30   PHE A C   1 
ATOM   192  O  O   . PHE A 1 30  ? -27.943 84.225  47.899 1.00 41.36 ? 30   PHE A O   1 
ATOM   193  C  CB  . PHE A 1 30  ? -28.847 81.600  48.297 1.00 43.96 ? 30   PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 30  ? -29.725 80.381  48.292 1.00 47.03 ? 30   PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 30  ? -30.977 80.410  47.674 1.00 47.89 ? 30   PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 30  ? -29.316 79.209  48.920 1.00 48.19 ? 30   PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 30  ? -31.810 79.290  47.682 1.00 48.14 ? 30   PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 30  ? -30.143 78.084  48.933 1.00 49.82 ? 30   PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 30  ? -31.393 78.127  48.312 1.00 48.35 ? 30   PHE A CZ  1 
ATOM   200  N  N   . LEU A 1 31  ? -28.508 84.805  49.991 1.00 37.71 ? 31   LEU A N   1 
ATOM   201  C  CA  . LEU A 1 31  ? -27.725 86.031  49.977 1.00 37.24 ? 31   LEU A CA  1 
ATOM   202  C  C   . LEU A 1 31  ? -26.317 85.868  50.543 1.00 38.25 ? 31   LEU A C   1 
ATOM   203  O  O   . LEU A 1 31  ? -26.121 85.198  51.554 1.00 40.14 ? 31   LEU A O   1 
ATOM   204  C  CB  . LEU A 1 31  ? -28.453 87.109  50.781 1.00 35.46 ? 31   LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 31  ? -29.985 87.110  50.751 1.00 35.27 ? 31   LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 31  ? -30.459 88.206  51.664 1.00 33.60 ? 31   LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 31  ? -30.532 87.307  49.335 1.00 32.74 ? 31   LEU A CD2 1 
ATOM   208  N  N   . GLY A 1 32  ? -25.336 86.483  49.890 1.00 37.67 ? 32   GLY A N   1 
ATOM   209  C  CA  . GLY A 1 32  ? -23.977 86.424  50.390 1.00 38.18 ? 32   GLY A CA  1 
ATOM   210  C  C   . GLY A 1 32  ? -23.165 85.165  50.155 1.00 39.36 ? 32   GLY A C   1 
ATOM   211  O  O   . GLY A 1 32  ? -22.262 84.857  50.939 1.00 38.82 ? 32   GLY A O   1 
ATOM   212  N  N   . ILE A 1 33  ? -23.472 84.428  49.094 1.00 38.76 ? 33   ILE A N   1 
ATOM   213  C  CA  . ILE A 1 33  ? -22.708 83.230  48.792 1.00 38.84 ? 33   ILE A CA  1 
ATOM   214  C  C   . ILE A 1 33  ? -21.356 83.724  48.290 1.00 39.26 ? 33   ILE A C   1 
ATOM   215  O  O   . ILE A 1 33  ? -21.292 84.409  47.272 1.00 39.38 ? 33   ILE A O   1 
ATOM   216  C  CB  . ILE A 1 33  ? -23.353 82.417  47.662 1.00 39.56 ? 33   ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 33  ? -24.837 82.212  47.945 1.00 40.04 ? 33   ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 33  ? -22.642 81.075  47.514 1.00 38.46 ? 33   ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 33  ? -25.111 81.301  49.098 1.00 42.40 ? 33   ILE A CD1 1 
ATOM   220  N  N   . PRO A 1 34  ? -20.260 83.395  48.995 1.00 38.99 ? 34   PRO A N   1 
ATOM   221  C  CA  . PRO A 1 34  ? -18.926 83.833  48.570 1.00 39.34 ? 34   PRO A CA  1 
ATOM   222  C  C   . PRO A 1 34  ? -18.418 83.015  47.374 1.00 39.47 ? 34   PRO A C   1 
ATOM   223  O  O   . PRO A 1 34  ? -18.605 81.799  47.323 1.00 39.97 ? 34   PRO A O   1 
ATOM   224  C  CB  . PRO A 1 34  ? -18.087 83.612  49.818 1.00 38.03 ? 34   PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 34  ? -18.677 82.369  50.361 1.00 38.77 ? 34   PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 34  ? -20.171 82.614  50.239 1.00 38.78 ? 34   PRO A CD  1 
ATOM   227  N  N   . PHE A 1 35  ? -17.781 83.689  46.417 1.00 38.62 ? 35   PHE A N   1 
ATOM   228  C  CA  . PHE A 1 35  ? -17.268 83.022  45.228 1.00 36.60 ? 35   PHE A CA  1 
ATOM   229  C  C   . PHE A 1 35  ? -15.805 83.358  44.996 1.00 36.45 ? 35   PHE A C   1 
ATOM   230  O  O   . PHE A 1 35  ? -15.238 83.005  43.966 1.00 35.83 ? 35   PHE A O   1 
ATOM   231  C  CB  . PHE A 1 35  ? -18.102 83.406  43.995 1.00 35.20 ? 35   PHE A CB  1 
ATOM   232  C  CG  . PHE A 1 35  ? -17.963 84.848  43.578 1.00 34.58 ? 35   PHE A CG  1 
ATOM   233  C  CD1 . PHE A 1 35  ? -16.816 85.297  42.925 1.00 34.74 ? 35   PHE A CD1 1 
ATOM   234  C  CD2 . PHE A 1 35  ? -18.982 85.759  43.833 1.00 34.96 ? 35   PHE A CD2 1 
ATOM   235  C  CE1 . PHE A 1 35  ? -16.683 86.629  42.531 1.00 33.27 ? 35   PHE A CE1 1 
ATOM   236  C  CE2 . PHE A 1 35  ? -18.860 87.096  43.443 1.00 35.41 ? 35   PHE A CE2 1 
ATOM   237  C  CZ  . PHE A 1 35  ? -17.705 87.529  42.791 1.00 33.78 ? 35   PHE A CZ  1 
ATOM   238  N  N   . ALA A 1 36  ? -15.198 84.049  45.954 1.00 36.69 ? 36   ALA A N   1 
ATOM   239  C  CA  . ALA A 1 36  ? -13.787 84.405  45.850 1.00 37.83 ? 36   ALA A CA  1 
ATOM   240  C  C   . ALA A 1 36  ? -13.189 84.659  47.231 1.00 38.40 ? 36   ALA A C   1 
ATOM   241  O  O   . ALA A 1 36  ? -13.905 84.991  48.180 1.00 38.16 ? 36   ALA A O   1 
ATOM   242  C  CB  . ALA A 1 36  ? -13.615 85.636  44.968 1.00 37.14 ? 36   ALA A CB  1 
ATOM   243  N  N   . GLU A 1 37  ? -11.876 84.481  47.339 1.00 39.33 ? 37   GLU A N   1 
ATOM   244  C  CA  . GLU A 1 37  ? -11.176 84.707  48.599 1.00 40.29 ? 37   GLU A CA  1 
ATOM   245  C  C   . GLU A 1 37  ? -11.097 86.210  48.834 1.00 39.44 ? 37   GLU A C   1 
ATOM   246  O  O   . GLU A 1 37  ? -10.833 86.971  47.907 1.00 39.48 ? 37   GLU A O   1 
ATOM   247  C  CB  . GLU A 1 37  ? -9.765  84.110  48.532 1.00 43.05 ? 37   GLU A CB  1 
ATOM   248  C  CG  . GLU A 1 37  ? -9.698  82.600  48.765 1.00 45.87 ? 37   GLU A CG  1 
ATOM   249  C  CD  . GLU A 1 37  ? -9.988  82.209  50.212 1.00 48.40 ? 37   GLU A CD  1 
ATOM   250  O  OE1 . GLU A 1 37  ? -9.221  82.622  51.113 1.00 48.98 ? 37   GLU A OE1 1 
ATOM   251  O  OE2 . GLU A 1 37  ? -10.982 81.485  50.447 1.00 49.38 ? 37   GLU A OE2 1 
ATOM   252  N  N   . PRO A 1 38  ? -11.326 86.658  50.077 1.00 39.06 ? 38   PRO A N   1 
ATOM   253  C  CA  . PRO A 1 38  ? -11.271 88.091  50.383 1.00 39.55 ? 38   PRO A CA  1 
ATOM   254  C  C   . PRO A 1 38  ? -10.055 88.768  49.757 1.00 38.88 ? 38   PRO A C   1 
ATOM   255  O  O   . PRO A 1 38  ? -8.909  88.428  50.060 1.00 39.11 ? 38   PRO A O   1 
ATOM   256  C  CB  . PRO A 1 38  ? -11.244 88.116  51.910 1.00 39.48 ? 38   PRO A CB  1 
ATOM   257  C  CG  . PRO A 1 38  ? -12.095 86.936  52.262 1.00 38.94 ? 38   PRO A CG  1 
ATOM   258  C  CD  . PRO A 1 38  ? -11.582 85.874  51.298 1.00 39.82 ? 38   PRO A CD  1 
ATOM   259  N  N   . PRO A 1 39  ? -10.297 89.734  48.861 1.00 37.59 ? 39   PRO A N   1 
ATOM   260  C  CA  . PRO A 1 39  ? -9.225  90.458  48.187 1.00 37.42 ? 39   PRO A CA  1 
ATOM   261  C  C   . PRO A 1 39  ? -8.620  91.485  49.131 1.00 38.35 ? 39   PRO A C   1 
ATOM   262  O  O   . PRO A 1 39  ? -8.380  92.628  48.746 1.00 40.61 ? 39   PRO A O   1 
ATOM   263  C  CB  . PRO A 1 39  ? -9.951  91.098  47.015 1.00 36.96 ? 39   PRO A CB  1 
ATOM   264  C  CG  . PRO A 1 39  ? -11.262 91.447  47.615 1.00 35.38 ? 39   PRO A CG  1 
ATOM   265  C  CD  . PRO A 1 39  ? -11.615 90.215  48.410 1.00 36.38 ? 39   PRO A CD  1 
ATOM   266  N  N   . VAL A 1 40  ? -8.367  91.069  50.368 1.00 38.54 ? 40   VAL A N   1 
ATOM   267  C  CA  . VAL A 1 40  ? -7.821  91.969  51.375 1.00 38.56 ? 40   VAL A CA  1 
ATOM   268  C  C   . VAL A 1 40  ? -6.337  91.810  51.616 1.00 38.76 ? 40   VAL A C   1 
ATOM   269  O  O   . VAL A 1 40  ? -5.758  90.778  51.305 1.00 38.52 ? 40   VAL A O   1 
ATOM   270  C  CB  . VAL A 1 40  ? -8.531  91.778  52.716 1.00 38.54 ? 40   VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 40  ? -10.032 91.935  52.532 1.00 38.29 ? 40   VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 40  ? -8.197  90.415  53.285 1.00 38.57 ? 40   VAL A CG2 1 
ATOM   273  N  N   . GLY A 1 41  ? -5.735  92.850  52.190 1.00 40.69 ? 41   GLY A N   1 
ATOM   274  C  CA  . GLY A 1 41  ? -4.314  92.832  52.492 1.00 42.09 ? 41   GLY A CA  1 
ATOM   275  C  C   . GLY A 1 41  ? -3.469  92.669  51.254 1.00 43.10 ? 41   GLY A C   1 
ATOM   276  O  O   . GLY A 1 41  ? -3.634  93.397  50.284 1.00 44.72 ? 41   GLY A O   1 
ATOM   277  N  N   . ASN A 1 42  ? -2.561  91.705  51.280 1.00 45.16 ? 42   ASN A N   1 
ATOM   278  C  CA  . ASN A 1 42  ? -1.699  91.458  50.138 1.00 47.35 ? 42   ASN A CA  1 
ATOM   279  C  C   . ASN A 1 42  ? -2.491  91.290  48.844 1.00 46.70 ? 42   ASN A C   1 
ATOM   280  O  O   . ASN A 1 42  ? -2.000  91.634  47.771 1.00 47.63 ? 42   ASN A O   1 
ATOM   281  C  CB  . ASN A 1 42  ? -0.843  90.212  50.391 1.00 51.72 ? 42   ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 42  ? 0.638   90.539  50.501 1.00 56.05 ? 42   ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 42  ? 1.008   91.617  50.977 1.00 59.05 ? 42   ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 42  ? 1.494   89.608  50.073 1.00 56.46 ? 42   ASN A ND2 1 
ATOM   285  N  N   . MET A 1 43  ? -3.717  90.779  48.949 1.00 44.56 ? 43   MET A N   1 
ATOM   286  C  CA  . MET A 1 43  ? -4.569  90.549  47.779 1.00 43.17 ? 43   MET A CA  1 
ATOM   287  C  C   . MET A 1 43  ? -5.037  91.819  47.043 1.00 41.62 ? 43   MET A C   1 
ATOM   288  O  O   . MET A 1 43  ? -5.342  91.765  45.849 1.00 41.00 ? 43   MET A O   1 
ATOM   289  C  CB  . MET A 1 43  ? -5.800  89.730  48.185 1.00 45.50 ? 43   MET A CB  1 
ATOM   290  C  CG  . MET A 1 43  ? -5.498  88.505  49.031 1.00 47.82 ? 43   MET A CG  1 
ATOM   291  S  SD  . MET A 1 43  ? -4.591  87.243  48.135 1.00 54.04 ? 43   MET A SD  1 
ATOM   292  C  CE  . MET A 1 43  ? -5.963  86.206  47.515 1.00 50.03 ? 43   MET A CE  1 
ATOM   293  N  N   . ARG A 1 44  ? -5.092  92.953  47.742 1.00 38.00 ? 44   ARG A N   1 
ATOM   294  C  CA  . ARG A 1 44  ? -5.544  94.207  47.131 1.00 35.09 ? 44   ARG A CA  1 
ATOM   295  C  C   . ARG A 1 44  ? -4.886  94.508  45.781 1.00 33.84 ? 44   ARG A C   1 
ATOM   296  O  O   . ARG A 1 44  ? -3.661  94.571  45.678 1.00 32.18 ? 44   ARG A O   1 
ATOM   297  C  CB  . ARG A 1 44  ? -5.317  95.402  48.083 1.00 34.35 ? 44   ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 44  ? -5.895  96.741  47.563 1.00 29.28 ? 44   ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 44  ? -5.523  97.945  48.426 1.00 25.17 ? 44   ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 44  ? -6.270  97.998  49.679 1.00 24.76 ? 44   ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 44  ? -6.006  98.850  50.669 1.00 24.55 ? 44   ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 44  ? -5.013  99.722  50.544 1.00 23.33 ? 44   ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 44  ? -6.716  98.820  51.793 1.00 21.57 ? 44   ARG A NH2 1 
ATOM   304  N  N   . PHE A 1 45  ? -5.724  94.702  44.763 1.00 32.62 ? 45   PHE A N   1 
ATOM   305  C  CA  . PHE A 1 45  ? -5.294  95.004  43.401 1.00 32.02 ? 45   PHE A CA  1 
ATOM   306  C  C   . PHE A 1 45  ? -4.909  93.772  42.595 1.00 32.51 ? 45   PHE A C   1 
ATOM   307  O  O   . PHE A 1 45  ? -4.784  93.855  41.372 1.00 31.54 ? 45   PHE A O   1 
ATOM   308  C  CB  . PHE A 1 45  ? -4.113  95.983  43.389 1.00 31.53 ? 45   PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 45  ? -4.378  97.265  44.112 1.00 29.57 ? 45   PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 45  ? -5.487  98.032  43.807 1.00 29.38 ? 45   PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 45  ? -3.506  97.709  45.096 1.00 30.48 ? 45   PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 45  ? -5.727  99.228  44.471 1.00 30.14 ? 45   PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 45  ? -3.733  98.903  45.770 1.00 29.92 ? 45   PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 45  ? -4.844  99.665  45.456 1.00 30.18 ? 45   PHE A CZ  1 
ATOM   315  N  N   . ARG A 1 46  ? -4.705  92.644  43.274 1.00 33.29 ? 46   ARG A N   1 
ATOM   316  C  CA  . ARG A 1 46  ? -4.338  91.403  42.592 1.00 35.62 ? 46   ARG A CA  1 
ATOM   317  C  C   . ARG A 1 46  ? -5.567  90.766  41.962 1.00 36.01 ? 46   ARG A C   1 
ATOM   318  O  O   . ARG A 1 46  ? -6.697  91.123  42.296 1.00 37.10 ? 46   ARG A O   1 
ATOM   319  C  CB  . ARG A 1 46  ? -3.722  90.389  43.562 1.00 38.25 ? 46   ARG A CB  1 
ATOM   320  C  CG  . ARG A 1 46  ? -2.254  90.584  43.871 1.00 41.86 ? 46   ARG A CG  1 
ATOM   321  C  CD  . ARG A 1 46  ? -1.532  89.232  43.923 1.00 44.94 ? 46   ARG A CD  1 
ATOM   322  N  NE  . ARG A 1 46  ? -0.264  89.326  44.646 1.00 48.20 ? 46   ARG A NE  1 
ATOM   323  C  CZ  . ARG A 1 46  ? -0.159  89.402  45.972 1.00 50.08 ? 46   ARG A CZ  1 
ATOM   324  N  NH1 . ARG A 1 46  ? 1.034   89.496  46.545 1.00 50.96 ? 46   ARG A NH1 1 
ATOM   325  N  NH2 . ARG A 1 46  ? -1.245  89.364  46.734 1.00 52.45 ? 46   ARG A NH2 1 
ATOM   326  N  N   . ARG A 1 47  ? -5.350  89.823  41.050 1.00 34.93 ? 47   ARG A N   1 
ATOM   327  C  CA  . ARG A 1 47  ? -6.470  89.146  40.420 1.00 34.50 ? 47   ARG A CA  1 
ATOM   328  C  C   . ARG A 1 47  ? -7.217  88.459  41.548 1.00 33.07 ? 47   ARG A C   1 
ATOM   329  O  O   . ARG A 1 47  ? -6.749  88.441  42.681 1.00 32.08 ? 47   ARG A O   1 
ATOM   330  C  CB  . ARG A 1 47  ? -5.974  88.108  39.411 1.00 37.24 ? 47   ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 47  ? -5.131  88.691  38.288 1.00 40.78 ? 47   ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 47  ? -4.782  87.645  37.228 1.00 41.44 ? 47   ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 47  ? -4.099  88.235  36.072 1.00 41.90 ? 47   ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 47  ? -2.931  88.875  36.128 1.00 41.24 ? 47   ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 47  ? -2.302  89.016  37.289 1.00 41.38 ? 47   ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 47  ? -2.390  89.371  35.020 1.00 39.41 ? 47   ARG A NH2 1 
ATOM   337  N  N   . PRO A 1 48  ? -8.398  87.907  41.269 1.00 32.31 ? 48   PRO A N   1 
ATOM   338  C  CA  . PRO A 1 48  ? -9.106  87.244  42.360 1.00 33.43 ? 48   PRO A CA  1 
ATOM   339  C  C   . PRO A 1 48  ? -8.836  85.744  42.347 1.00 35.06 ? 48   PRO A C   1 
ATOM   340  O  O   . PRO A 1 48  ? -8.804  85.129  41.289 1.00 35.51 ? 48   PRO A O   1 
ATOM   341  C  CB  . PRO A 1 48  ? -10.560 87.565  42.051 1.00 31.58 ? 48   PRO A CB  1 
ATOM   342  C  CG  . PRO A 1 48  ? -10.581 87.441  40.561 1.00 31.15 ? 48   PRO A CG  1 
ATOM   343  C  CD  . PRO A 1 48  ? -9.311  88.168  40.142 1.00 32.40 ? 48   PRO A CD  1 
ATOM   344  N  N   . GLU A 1 49  ? -8.634  85.165  43.525 1.00 37.10 ? 49   GLU A N   1 
ATOM   345  C  CA  . GLU A 1 49  ? -8.400  83.729  43.643 1.00 39.09 ? 49   GLU A CA  1 
ATOM   346  C  C   . GLU A 1 49  ? -9.724  83.155  44.154 1.00 39.15 ? 49   GLU A C   1 
ATOM   347  O  O   . GLU A 1 49  ? -10.410 83.791  44.956 1.00 38.90 ? 49   GLU A O   1 
ATOM   348  C  CB  . GLU A 1 49  ? -7.263  83.436  44.627 1.00 41.57 ? 49   GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 49  ? -5.870  83.951  44.219 1.00 46.19 ? 49   GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 49  ? -5.242  83.145  43.090 1.00 50.94 ? 49   GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 49  ? -5.252  81.899  43.178 1.00 54.40 ? 49   GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 49  ? -4.733  83.749  42.118 1.00 52.73 ? 49   GLU A OE2 1 
ATOM   353  N  N   . PRO A 1 50  ? -10.092 81.942  43.724 1.00 40.15 ? 50   PRO A N   1 
ATOM   354  C  CA  . PRO A 1 50  ? -11.330 81.245  44.095 1.00 40.87 ? 50   PRO A CA  1 
ATOM   355  C  C   . PRO A 1 50  ? -11.461 80.985  45.579 1.00 41.90 ? 50   PRO A C   1 
ATOM   356  O  O   . PRO A 1 50  ? -10.470 80.749  46.259 1.00 42.01 ? 50   PRO A O   1 
ATOM   357  C  CB  . PRO A 1 50  ? -11.248 79.930  43.324 1.00 41.45 ? 50   PRO A CB  1 
ATOM   358  C  CG  . PRO A 1 50  ? -10.197 80.203  42.255 1.00 42.62 ? 50   PRO A CG  1 
ATOM   359  C  CD  . PRO A 1 50  ? -9.206  81.031  43.005 1.00 40.99 ? 50   PRO A CD  1 
ATOM   360  N  N   . LYS A 1 51  ? -12.693 80.991  46.070 1.00 43.89 ? 51   LYS A N   1 
ATOM   361  C  CA  . LYS A 1 51  ? -12.953 80.754  47.483 1.00 46.12 ? 51   LYS A CA  1 
ATOM   362  C  C   . LYS A 1 51  ? -12.687 79.302  47.878 1.00 48.49 ? 51   LYS A C   1 
ATOM   363  O  O   . LYS A 1 51  ? -13.391 78.387  47.431 1.00 48.07 ? 51   LYS A O   1 
ATOM   364  C  CB  . LYS A 1 51  ? -14.403 81.123  47.819 1.00 45.09 ? 51   LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 51  ? -14.840 80.868  49.271 1.00 44.95 ? 51   LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 51  ? -13.998 81.649  50.282 1.00 43.53 ? 51   LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 51  ? -14.469 81.411  51.716 1.00 42.61 ? 51   LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 51  ? -13.562 82.030  52.727 1.00 40.83 ? 51   LYS A NZ  1 
ATOM   369  N  N   . LYS A 1 52  ? -11.664 79.099  48.711 1.00 50.85 ? 52   LYS A N   1 
ATOM   370  C  CA  . LYS A 1 52  ? -11.299 77.771  49.199 1.00 52.69 ? 52   LYS A CA  1 
ATOM   371  C  C   . LYS A 1 52  ? -12.541 77.153  49.833 1.00 53.97 ? 52   LYS A C   1 
ATOM   372  O  O   . LYS A 1 52  ? -13.097 77.707  50.781 1.00 53.82 ? 52   LYS A O   1 
ATOM   373  C  CB  . LYS A 1 52  ? -10.202 77.878  50.265 1.00 52.45 ? 52   LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 52  ? -8.949  78.623  49.834 1.00 52.91 ? 52   LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 52  ? -8.044  78.884  51.039 1.00 53.31 ? 52   LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 52  ? -6.789  79.665  50.660 1.00 54.02 ? 52   LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 52  ? -5.887  78.911  49.733 1.00 55.55 ? 52   LYS A NZ  1 
ATOM   378  N  N   . PRO A 1 53  ? -12.988 75.995  49.325 1.00 56.09 ? 53   PRO A N   1 
ATOM   379  C  CA  . PRO A 1 53  ? -14.176 75.317  49.861 1.00 57.78 ? 53   PRO A CA  1 
ATOM   380  C  C   . PRO A 1 53  ? -14.237 75.404  51.381 1.00 59.13 ? 53   PRO A C   1 
ATOM   381  O  O   . PRO A 1 53  ? -13.249 75.134  52.065 1.00 59.61 ? 53   PRO A O   1 
ATOM   382  C  CB  . PRO A 1 53  ? -14.004 73.889  49.365 1.00 57.59 ? 53   PRO A CB  1 
ATOM   383  C  CG  . PRO A 1 53  ? -13.350 74.098  48.029 1.00 58.32 ? 53   PRO A CG  1 
ATOM   384  C  CD  . PRO A 1 53  ? -12.303 75.149  48.332 1.00 56.46 ? 53   PRO A CD  1 
ATOM   385  N  N   . TRP A 1 54  ? -15.397 75.789  51.903 1.00 60.03 ? 54   TRP A N   1 
ATOM   386  C  CA  . TRP A 1 54  ? -15.572 75.929  53.346 1.00 61.42 ? 54   TRP A CA  1 
ATOM   387  C  C   . TRP A 1 54  ? -16.226 74.705  53.973 1.00 62.37 ? 54   TRP A C   1 
ATOM   388  O  O   . TRP A 1 54  ? -17.007 73.997  53.332 1.00 63.04 ? 54   TRP A O   1 
ATOM   389  C  CB  . TRP A 1 54  ? -16.419 77.171  53.656 1.00 61.12 ? 54   TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 54  ? -17.824 77.074  53.136 1.00 60.24 ? 54   TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 54  ? -18.866 76.408  53.708 1.00 59.48 ? 54   TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 54  ? -18.316 77.602  51.898 1.00 59.93 ? 54   TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 54  ? -19.975 76.482  52.903 1.00 59.74 ? 54   TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 54  ? -19.667 77.210  51.785 1.00 59.72 ? 54   TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 54  ? -17.744 78.366  50.872 1.00 60.25 ? 54   TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 54  ? -20.461 77.556  50.685 1.00 59.72 ? 54   TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 54  ? -18.533 78.711  49.774 1.00 60.73 ? 54   TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 54  ? -19.879 78.304  49.692 1.00 60.12 ? 54   TRP A CH2 1 
ATOM   399  N  N   . SER A 1 55  ? -15.904 74.463  55.237 1.00 62.49 ? 55   SER A N   1 
ATOM   400  C  CA  . SER A 1 55  ? -16.475 73.337  55.954 1.00 63.23 ? 55   SER A CA  1 
ATOM   401  C  C   . SER A 1 55  ? -17.712 73.813  56.714 1.00 63.47 ? 55   SER A C   1 
ATOM   402  O  O   . SER A 1 55  ? -17.815 74.985  57.077 1.00 64.08 ? 55   SER A O   1 
ATOM   403  C  CB  . SER A 1 55  ? -15.442 72.768  56.921 1.00 62.81 ? 55   SER A CB  1 
ATOM   404  O  OG  . SER A 1 55  ? -14.908 73.801  57.726 1.00 62.94 ? 55   SER A OG  1 
ATOM   405  N  N   . GLY A 1 56  ? -18.653 72.906  56.947 1.00 63.25 ? 56   GLY A N   1 
ATOM   406  C  CA  . GLY A 1 56  ? -19.859 73.278  57.659 1.00 62.95 ? 56   GLY A CA  1 
ATOM   407  C  C   . GLY A 1 56  ? -20.882 73.823  56.692 1.00 63.05 ? 56   GLY A C   1 
ATOM   408  O  O   . GLY A 1 56  ? -20.788 73.581  55.488 1.00 63.42 ? 56   GLY A O   1 
ATOM   409  N  N   . VAL A 1 57  ? -21.859 74.557  57.211 1.00 63.00 ? 57   VAL A N   1 
ATOM   410  C  CA  . VAL A 1 57  ? -22.900 75.132  56.370 1.00 63.67 ? 57   VAL A CA  1 
ATOM   411  C  C   . VAL A 1 57  ? -22.849 76.653  56.378 1.00 64.34 ? 57   VAL A C   1 
ATOM   412  O  O   . VAL A 1 57  ? -23.024 77.284  57.422 1.00 65.90 ? 57   VAL A O   1 
ATOM   413  C  CB  . VAL A 1 57  ? -24.296 74.703  56.831 1.00 63.25 ? 57   VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 57  ? -25.340 75.217  55.851 1.00 63.23 ? 57   VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 57  ? -24.360 73.194  56.943 1.00 64.12 ? 57   VAL A CG2 1 
ATOM   416  N  N   . TRP A 1 58  ? -22.618 77.236  55.205 1.00 63.71 ? 58   TRP A N   1 
ATOM   417  C  CA  . TRP A 1 58  ? -22.548 78.685  55.066 1.00 61.63 ? 58   TRP A CA  1 
ATOM   418  C  C   . TRP A 1 58  ? -23.947 79.299  55.146 1.00 61.53 ? 58   TRP A C   1 
ATOM   419  O  O   . TRP A 1 58  ? -24.871 78.862  54.453 1.00 60.63 ? 58   TRP A O   1 
ATOM   420  C  CB  . TRP A 1 58  ? -21.887 79.046  53.736 1.00 60.22 ? 58   TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 58  ? -21.566 80.493  53.619 1.00 57.92 ? 58   TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 58  ? -22.439 81.512  53.367 1.00 56.87 ? 58   TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 58  ? -20.288 81.099  53.829 1.00 56.05 ? 58   TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 58  ? -21.782 82.718  53.413 1.00 56.90 ? 58   TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 58  ? -20.460 82.493  53.695 1.00 55.58 ? 58   TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 58  ? -19.013 80.598  54.122 1.00 55.13 ? 58   TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 58  ? -19.406 83.394  53.845 1.00 54.21 ? 58   TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 58  ? -17.966 81.492  54.271 1.00 55.22 ? 58   TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 58  ? -18.169 82.878  54.132 1.00 54.84 ? 58   TRP A CH2 1 
ATOM   430  N  N   . ASN A 1 59  ? -24.091 80.314  55.995 1.00 61.16 ? 59   ASN A N   1 
ATOM   431  C  CA  . ASN A 1 59  ? -25.376 80.977  56.181 1.00 61.48 ? 59   ASN A CA  1 
ATOM   432  C  C   . ASN A 1 59  ? -25.645 82.098  55.183 1.00 60.24 ? 59   ASN A C   1 
ATOM   433  O  O   . ASN A 1 59  ? -25.181 83.223  55.353 1.00 60.62 ? 59   ASN A O   1 
ATOM   434  C  CB  . ASN A 1 59  ? -25.484 81.531  57.604 1.00 63.43 ? 59   ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 59  ? -26.797 82.246  57.843 1.00 65.97 ? 59   ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 59  ? -27.830 81.837  57.304 1.00 67.74 ? 59   ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 59  ? -26.771 83.301  58.657 1.00 68.16 ? 59   ASN A ND2 1 
ATOM   438  N  N   . ALA A 1 60  ? -26.411 81.791  54.146 1.00 58.13 ? 60   ALA A N   1 
ATOM   439  C  CA  . ALA A 1 60  ? -26.735 82.783  53.134 1.00 55.93 ? 60   ALA A CA  1 
ATOM   440  C  C   . ALA A 1 60  ? -28.174 83.241  53.306 1.00 54.63 ? 60   ALA A C   1 
ATOM   441  O  O   . ALA A 1 60  ? -29.034 82.932  52.481 1.00 54.43 ? 60   ALA A O   1 
ATOM   442  C  CB  . ALA A 1 60  ? -26.541 82.189  51.752 1.00 56.29 ? 60   ALA A CB  1 
ATOM   443  N  N   . SER A 1 61  ? -28.434 83.990  54.370 1.00 52.99 ? 61   SER A N   1 
ATOM   444  C  CA  . SER A 1 61  ? -29.787 84.460  54.642 1.00 51.51 ? 61   SER A CA  1 
ATOM   445  C  C   . SER A 1 61  ? -29.912 85.976  54.794 1.00 50.40 ? 61   SER A C   1 
ATOM   446  O  O   . SER A 1 61  ? -30.997 86.493  55.071 1.00 50.11 ? 61   SER A O   1 
ATOM   447  C  CB  . SER A 1 61  ? -30.320 83.775  55.901 1.00 50.91 ? 61   SER A CB  1 
ATOM   448  O  OG  . SER A 1 61  ? -29.445 83.991  56.991 1.00 49.28 ? 61   SER A OG  1 
ATOM   449  N  N   . THR A 1 62  ? -28.806 86.688  54.616 1.00 48.83 ? 62   THR A N   1 
ATOM   450  C  CA  . THR A 1 62  ? -28.822 88.139  54.736 1.00 46.75 ? 62   THR A CA  1 
ATOM   451  C  C   . THR A 1 62  ? -27.740 88.758  53.864 1.00 45.76 ? 62   THR A C   1 
ATOM   452  O  O   . THR A 1 62  ? -26.574 88.359  53.934 1.00 45.32 ? 62   THR A O   1 
ATOM   453  C  CB  . THR A 1 62  ? -28.584 88.585  56.186 1.00 46.91 ? 62   THR A CB  1 
ATOM   454  O  OG1 . THR A 1 62  ? -27.249 88.248  56.577 1.00 46.39 ? 62   THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 62  ? -29.566 87.902  57.123 1.00 46.78 ? 62   THR A CG2 1 
ATOM   456  N  N   . TYR A 1 63  ? -28.133 89.735  53.049 1.00 43.83 ? 63   TYR A N   1 
ATOM   457  C  CA  . TYR A 1 63  ? -27.209 90.428  52.151 1.00 40.24 ? 63   TYR A CA  1 
ATOM   458  C  C   . TYR A 1 63  ? -25.824 90.595  52.752 1.00 37.56 ? 63   TYR A C   1 
ATOM   459  O  O   . TYR A 1 63  ? -25.672 90.674  53.968 1.00 39.16 ? 63   TYR A O   1 
ATOM   460  C  CB  . TYR A 1 63  ? -27.753 91.801  51.796 1.00 39.70 ? 63   TYR A CB  1 
ATOM   461  C  CG  . TYR A 1 63  ? -28.820 91.800  50.734 1.00 39.65 ? 63   TYR A CG  1 
ATOM   462  C  CD1 . TYR A 1 63  ? -28.578 91.252  49.476 1.00 37.72 ? 63   TYR A CD1 1 
ATOM   463  C  CD2 . TYR A 1 63  ? -30.029 92.453  50.947 1.00 40.20 ? 63   TYR A CD2 1 
ATOM   464  C  CE1 . TYR A 1 63  ? -29.506 91.375  48.453 1.00 39.68 ? 63   TYR A CE1 1 
ATOM   465  C  CE2 . TYR A 1 63  ? -30.965 92.580  49.935 1.00 41.22 ? 63   TYR A CE2 1 
ATOM   466  C  CZ  . TYR A 1 63  ? -30.698 92.048  48.688 1.00 41.26 ? 63   TYR A CZ  1 
ATOM   467  O  OH  . TYR A 1 63  ? -31.610 92.241  47.672 1.00 43.08 ? 63   TYR A OH  1 
ATOM   468  N  N   . PRO A 1 64  ? -24.793 90.659  51.900 1.00 34.51 ? 64   PRO A N   1 
ATOM   469  C  CA  . PRO A 1 64  ? -23.412 90.816  52.359 1.00 32.27 ? 64   PRO A CA  1 
ATOM   470  C  C   . PRO A 1 64  ? -22.970 92.265  52.438 1.00 31.65 ? 64   PRO A C   1 
ATOM   471  O  O   . PRO A 1 64  ? -23.759 93.191  52.236 1.00 30.22 ? 64   PRO A O   1 
ATOM   472  C  CB  . PRO A 1 64  ? -22.631 90.065  51.303 1.00 32.87 ? 64   PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 64  ? -23.370 90.469  50.058 1.00 32.49 ? 64   PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 64  ? -24.827 90.342  50.459 1.00 32.93 ? 64   PRO A CD  1 
ATOM   475  N  N   . ASN A 1 65  ? -21.689 92.448  52.732 1.00 31.27 ? 65   ASN A N   1 
ATOM   476  C  CA  . ASN A 1 65  ? -21.104 93.778  52.803 1.00 30.82 ? 65   ASN A CA  1 
ATOM   477  C  C   . ASN A 1 65  ? -20.992 94.292  51.374 1.00 30.15 ? 65   ASN A C   1 
ATOM   478  O  O   . ASN A 1 65  ? -21.040 93.515  50.419 1.00 30.86 ? 65   ASN A O   1 
ATOM   479  C  CB  . ASN A 1 65  ? -19.705 93.712  53.418 1.00 31.57 ? 65   ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 65  ? -19.727 93.376  54.898 1.00 32.88 ? 65   ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 65  ? -18.845 92.676  55.389 1.00 35.56 ? 65   ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 65  ? -20.724 93.888  55.617 1.00 30.50 ? 65   ASN A ND2 1 
ATOM   483  N  N   . ASN A 1 66  ? -20.848 95.601  51.222 1.00 28.82 ? 66   ASN A N   1 
ATOM   484  C  CA  . ASN A 1 66  ? -20.707 96.190  49.898 1.00 27.74 ? 66   ASN A CA  1 
ATOM   485  C  C   . ASN A 1 66  ? -19.216 96.488  49.697 1.00 27.18 ? 66   ASN A C   1 
ATOM   486  O  O   . ASN A 1 66  ? -18.446 96.450  50.649 1.00 27.72 ? 66   ASN A O   1 
ATOM   487  C  CB  . ASN A 1 66  ? -21.554 97.467  49.811 1.00 26.31 ? 66   ASN A CB  1 
ATOM   488  C  CG  . ASN A 1 66  ? -23.056 97.187  49.881 1.00 25.14 ? 66   ASN A CG  1 
ATOM   489  O  OD1 . ASN A 1 66  ? -23.806 97.956  50.476 1.00 26.85 ? 66   ASN A OD1 1 
ATOM   490  N  ND2 . ASN A 1 66  ? -23.496 96.096  49.260 1.00 21.63 ? 66   ASN A ND2 1 
ATOM   491  N  N   . CYS A 1 67  ? -18.789 96.758  48.473 1.00 27.70 ? 67   CYS A N   1 
ATOM   492  C  CA  . CYS A 1 67  ? -17.372 97.048  48.271 1.00 29.22 ? 67   CYS A CA  1 
ATOM   493  C  C   . CYS A 1 67  ? -17.060 98.482  48.658 1.00 29.27 ? 67   CYS A C   1 
ATOM   494  O  O   . CYS A 1 67  ? -17.948 99.333  48.663 1.00 29.25 ? 67   CYS A O   1 
ATOM   495  C  CB  . CYS A 1 67  ? -16.967 96.809  46.818 1.00 28.20 ? 67   CYS A CB  1 
ATOM   496  S  SG  . CYS A 1 67  ? -17.146 95.081  46.294 0.80 27.58 ? 67   CYS A SG  1 
ATOM   497  N  N   . GLN A 1 68  ? -15.800 98.746  48.987 1.00 29.26 ? 68   GLN A N   1 
ATOM   498  C  CA  . GLN A 1 68  ? -15.388 100.089 49.377 1.00 30.61 ? 68   GLN A CA  1 
ATOM   499  C  C   . GLN A 1 68  ? -15.533 101.056 48.216 1.00 30.30 ? 68   GLN A C   1 
ATOM   500  O  O   . GLN A 1 68  ? -15.038 100.798 47.114 1.00 30.47 ? 68   GLN A O   1 
ATOM   501  C  CB  . GLN A 1 68  ? -13.944 100.076 49.873 1.00 32.84 ? 68   GLN A CB  1 
ATOM   502  C  CG  . GLN A 1 68  ? -13.791 99.403  51.228 1.00 34.84 ? 68   GLN A CG  1 
ATOM   503  C  CD  . GLN A 1 68  ? -14.410 100.205 52.355 1.00 34.87 ? 68   GLN A CD  1 
ATOM   504  O  OE1 . GLN A 1 68  ? -14.773 99.648  53.389 1.00 37.31 ? 68   GLN A OE1 1 
ATOM   505  N  NE2 . GLN A 1 68  ? -14.517 101.519 52.172 1.00 33.22 ? 68   GLN A NE2 1 
ATOM   506  N  N   . GLN A 1 69  ? -16.199 102.180 48.471 1.00 29.27 ? 69   GLN A N   1 
ATOM   507  C  CA  . GLN A 1 69  ? -16.435 103.158 47.419 1.00 28.31 ? 69   GLN A CA  1 
ATOM   508  C  C   . GLN A 1 69  ? -16.752 104.569 47.900 1.00 27.09 ? 69   GLN A C   1 
ATOM   509  O  O   . GLN A 1 69  ? -16.995 104.824 49.081 1.00 24.69 ? 69   GLN A O   1 
ATOM   510  C  CB  . GLN A 1 69  ? -17.603 102.679 46.552 1.00 28.33 ? 69   GLN A CB  1 
ATOM   511  C  CG  . GLN A 1 69  ? -18.918 102.598 47.327 1.00 28.39 ? 69   GLN A CG  1 
ATOM   512  C  CD  . GLN A 1 69  ? -19.975 101.751 46.637 1.00 29.29 ? 69   GLN A CD  1 
ATOM   513  O  OE1 . GLN A 1 69  ? -20.609 102.176 45.669 1.00 31.02 ? 69   GLN A OE1 1 
ATOM   514  N  NE2 . GLN A 1 69  ? -20.164 100.537 47.135 1.00 28.74 ? 69   GLN A NE2 1 
ATOM   515  N  N   . TYR A 1 70  ? -16.738 105.479 46.940 1.00 26.45 ? 70   TYR A N   1 
ATOM   516  C  CA  . TYR A 1 70  ? -17.088 106.862 47.178 1.00 26.10 ? 70   TYR A CA  1 
ATOM   517  C  C   . TYR A 1 70  ? -18.585 106.820 47.505 1.00 25.55 ? 70   TYR A C   1 
ATOM   518  O  O   . TYR A 1 70  ? -19.330 106.051 46.911 1.00 24.83 ? 70   TYR A O   1 
ATOM   519  C  CB  . TYR A 1 70  ? -16.862 107.665 45.893 1.00 27.36 ? 70   TYR A CB  1 
ATOM   520  C  CG  . TYR A 1 70  ? -17.415 109.060 45.948 1.00 29.94 ? 70   TYR A CG  1 
ATOM   521  C  CD1 . TYR A 1 70  ? -16.595 110.145 46.258 1.00 30.97 ? 70   TYR A CD1 1 
ATOM   522  C  CD2 . TYR A 1 70  ? -18.773 109.288 45.771 1.00 30.66 ? 70   TYR A CD2 1 
ATOM   523  C  CE1 . TYR A 1 70  ? -17.116 111.417 46.396 1.00 31.20 ? 70   TYR A CE1 1 
ATOM   524  C  CE2 . TYR A 1 70  ? -19.304 110.550 45.911 1.00 33.19 ? 70   TYR A CE2 1 
ATOM   525  C  CZ  . TYR A 1 70  ? -18.470 111.611 46.222 1.00 33.17 ? 70   TYR A CZ  1 
ATOM   526  O  OH  . TYR A 1 70  ? -19.002 112.869 46.350 1.00 35.51 ? 70   TYR A OH  1 
ATOM   527  N  N   . VAL A 1 71  ? -19.034 107.623 48.455 1.00 26.25 ? 71   VAL A N   1 
ATOM   528  C  CA  . VAL A 1 71  ? -20.448 107.642 48.792 1.00 25.43 ? 71   VAL A CA  1 
ATOM   529  C  C   . VAL A 1 71  ? -20.955 109.019 48.444 1.00 26.45 ? 71   VAL A C   1 
ATOM   530  O  O   . VAL A 1 71  ? -20.325 110.011 48.781 1.00 25.62 ? 71   VAL A O   1 
ATOM   531  C  CB  . VAL A 1 71  ? -20.683 107.375 50.275 1.00 25.38 ? 71   VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 71  ? -22.171 107.399 50.571 1.00 25.17 ? 71   VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 71  ? -20.101 106.031 50.650 1.00 25.04 ? 71   VAL A CG2 1 
ATOM   534  N  N   . ASP A 1 72  ? -22.092 109.071 47.759 1.00 29.47 ? 72   ASP A N   1 
ATOM   535  C  CA  . ASP A 1 72  ? -22.683 110.329 47.314 1.00 31.77 ? 72   ASP A CA  1 
ATOM   536  C  C   . ASP A 1 72  ? -23.419 111.082 48.415 1.00 32.71 ? 72   ASP A C   1 
ATOM   537  O  O   . ASP A 1 72  ? -24.472 110.657 48.879 1.00 33.58 ? 72   ASP A O   1 
ATOM   538  C  CB  . ASP A 1 72  ? -23.617 110.055 46.131 1.00 31.92 ? 72   ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 72  ? -24.458 111.252 45.758 1.00 33.17 ? 72   ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 72  ? -23.991 112.384 45.966 1.00 35.00 ? 72   ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 72  ? -25.581 111.067 45.247 1.00 32.26 ? 72   ASP A OD2 1 
ATOM   542  N  N   . GLU A 1 73  ? -22.854 112.210 48.833 1.00 34.58 ? 73   GLU A N   1 
ATOM   543  C  CA  . GLU A 1 73  ? -23.463 113.016 49.884 1.00 36.76 ? 73   GLU A CA  1 
ATOM   544  C  C   . GLU A 1 73  ? -23.788 114.419 49.402 1.00 36.21 ? 73   GLU A C   1 
ATOM   545  O  O   . GLU A 1 73  ? -23.754 115.378 50.166 1.00 36.29 ? 73   GLU A O   1 
ATOM   546  C  CB  . GLU A 1 73  ? -22.537 113.082 51.099 1.00 39.34 ? 73   GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 73  ? -22.385 111.745 51.803 1.00 45.21 ? 73   GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 73  ? -21.799 111.875 53.192 1.00 48.37 ? 73   GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 73  ? -20.684 112.424 53.317 1.00 50.97 ? 73   GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 73  ? -22.455 111.426 54.159 1.00 49.96 ? 73   GLU A OE2 1 
ATOM   551  N  N   . GLN A 1 74  ? -24.126 114.519 48.124 1.00 35.98 ? 74   GLN A N   1 
ATOM   552  C  CA  . GLN A 1 74  ? -24.446 115.792 47.514 1.00 35.06 ? 74   GLN A CA  1 
ATOM   553  C  C   . GLN A 1 74  ? -25.810 116.291 47.957 1.00 33.78 ? 74   GLN A C   1 
ATOM   554  O  O   . GLN A 1 74  ? -26.010 117.487 48.147 1.00 35.59 ? 74   GLN A O   1 
ATOM   555  C  CB  . GLN A 1 74  ? -24.412 115.654 45.999 1.00 36.93 ? 74   GLN A CB  1 
ATOM   556  C  CG  . GLN A 1 74  ? -23.751 116.821 45.301 1.00 43.63 ? 74   GLN A CG  1 
ATOM   557  C  CD  . GLN A 1 74  ? -24.474 118.120 45.560 1.00 46.73 ? 74   GLN A CD  1 
ATOM   558  O  OE1 . GLN A 1 74  ? -25.674 118.225 45.316 1.00 49.05 ? 74   GLN A OE1 1 
ATOM   559  N  NE2 . GLN A 1 74  ? -23.750 119.121 46.058 1.00 49.62 ? 74   GLN A NE2 1 
ATOM   560  N  N   . PHE A 1 75  ? -26.748 115.372 48.133 1.00 30.84 ? 75   PHE A N   1 
ATOM   561  C  CA  . PHE A 1 75  ? -28.090 115.745 48.539 1.00 26.72 ? 75   PHE A CA  1 
ATOM   562  C  C   . PHE A 1 75  ? -28.547 114.916 49.726 1.00 25.25 ? 75   PHE A C   1 
ATOM   563  O  O   . PHE A 1 75  ? -29.424 114.066 49.597 1.00 24.98 ? 75   PHE A O   1 
ATOM   564  C  CB  . PHE A 1 75  ? -29.061 115.538 47.385 1.00 25.74 ? 75   PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 75  ? -28.716 116.311 46.145 1.00 24.71 ? 75   PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 75  ? -28.900 117.677 46.088 1.00 25.83 ? 75   PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 75  ? -28.247 115.657 45.014 1.00 26.10 ? 75   PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 75  ? -28.628 118.384 44.921 1.00 26.06 ? 75   PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 75  ? -27.969 116.350 43.840 1.00 25.62 ? 75   PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 75  ? -28.162 117.716 43.792 1.00 26.45 ? 75   PHE A CZ  1 
ATOM   571  N  N   . PRO A 1 76  ? -27.962 115.156 50.904 1.00 24.14 ? 76   PRO A N   1 
ATOM   572  C  CA  . PRO A 1 76  ? -28.321 114.425 52.126 1.00 25.40 ? 76   PRO A CA  1 
ATOM   573  C  C   . PRO A 1 76  ? -29.823 114.255 52.400 1.00 26.23 ? 76   PRO A C   1 
ATOM   574  O  O   . PRO A 1 76  ? -30.609 115.187 52.242 1.00 26.46 ? 76   PRO A O   1 
ATOM   575  C  CB  . PRO A 1 76  ? -27.618 115.223 53.236 1.00 22.18 ? 76   PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 76  ? -27.364 116.555 52.623 1.00 22.37 ? 76   PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 76  ? -26.993 116.218 51.205 1.00 23.34 ? 76   PRO A CD  1 
ATOM   578  N  N   . GLY A 1 77  ? -30.202 113.048 52.814 1.00 27.46 ? 77   GLY A N   1 
ATOM   579  C  CA  . GLY A 1 77  ? -31.589 112.764 53.121 1.00 28.81 ? 77   GLY A CA  1 
ATOM   580  C  C   . GLY A 1 77  ? -32.491 112.839 51.913 1.00 30.67 ? 77   GLY A C   1 
ATOM   581  O  O   . GLY A 1 77  ? -33.702 112.980 52.046 1.00 33.48 ? 77   GLY A O   1 
ATOM   582  N  N   . PHE A 1 78  ? -31.906 112.758 50.727 1.00 31.21 ? 78   PHE A N   1 
ATOM   583  C  CA  . PHE A 1 78  ? -32.685 112.804 49.496 1.00 31.98 ? 78   PHE A CA  1 
ATOM   584  C  C   . PHE A 1 78  ? -32.641 111.415 48.861 1.00 32.95 ? 78   PHE A C   1 
ATOM   585  O  O   . PHE A 1 78  ? -31.670 111.062 48.196 1.00 33.22 ? 78   PHE A O   1 
ATOM   586  C  CB  . PHE A 1 78  ? -32.086 113.840 48.547 1.00 31.87 ? 78   PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 78  ? -32.866 114.022 47.285 1.00 30.41 ? 78   PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 78  ? -34.151 114.533 47.320 1.00 29.34 ? 78   PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 78  ? -32.322 113.667 46.062 1.00 30.53 ? 78   PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 78  ? -34.883 114.686 46.154 1.00 29.69 ? 78   PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 78  ? -33.050 113.817 44.892 1.00 30.17 ? 78   PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 78  ? -34.332 114.327 44.941 1.00 29.63 ? 78   PHE A CZ  1 
ATOM   593  N  N   . SER A 1 79  ? -33.690 110.628 49.076 1.00 33.42 ? 79   SER A N   1 
ATOM   594  C  CA  . SER A 1 79  ? -33.747 109.272 48.542 1.00 33.71 ? 79   SER A CA  1 
ATOM   595  C  C   . SER A 1 79  ? -33.311 109.215 47.086 1.00 33.83 ? 79   SER A C   1 
ATOM   596  O  O   . SER A 1 79  ? -32.640 108.269 46.669 1.00 33.87 ? 79   SER A O   1 
ATOM   597  C  CB  . SER A 1 79  ? -35.165 108.707 48.654 1.00 32.47 ? 79   SER A CB  1 
ATOM   598  O  OG  . SER A 1 79  ? -35.979 109.185 47.600 1.00 32.78 ? 79   SER A OG  1 
ATOM   599  N  N   . GLY A 1 80  ? -33.695 110.232 46.321 1.00 33.61 ? 80   GLY A N   1 
ATOM   600  C  CA  . GLY A 1 80  ? -33.349 110.278 44.912 1.00 33.76 ? 80   GLY A CA  1 
ATOM   601  C  C   . GLY A 1 80  ? -31.921 109.878 44.604 1.00 34.09 ? 80   GLY A C   1 
ATOM   602  O  O   . GLY A 1 80  ? -31.677 109.083 43.699 1.00 33.69 ? 80   GLY A O   1 
ATOM   603  N  N   . SER A 1 81  ? -30.980 110.427 45.366 1.00 33.99 ? 81   SER A N   1 
ATOM   604  C  CA  . SER A 1 81  ? -29.568 110.144 45.175 1.00 34.13 ? 81   SER A CA  1 
ATOM   605  C  C   . SER A 1 81  ? -29.066 109.047 46.109 1.00 35.00 ? 81   SER A C   1 
ATOM   606  O  O   . SER A 1 81  ? -28.190 108.258 45.742 1.00 35.80 ? 81   SER A O   1 
ATOM   607  C  CB  . SER A 1 81  ? -28.750 111.413 45.411 1.00 34.11 ? 81   SER A CB  1 
ATOM   608  O  OG  . SER A 1 81  ? -28.761 111.777 46.782 1.00 34.40 ? 81   SER A OG  1 
ATOM   609  N  N   . GLU A 1 82  ? -29.624 108.996 47.314 1.00 35.88 ? 82   GLU A N   1 
ATOM   610  C  CA  . GLU A 1 82  ? -29.205 108.009 48.304 1.00 36.94 ? 82   GLU A CA  1 
ATOM   611  C  C   . GLU A 1 82  ? -29.640 106.574 48.009 1.00 35.97 ? 82   GLU A C   1 
ATOM   612  O  O   . GLU A 1 82  ? -29.149 105.637 48.635 1.00 36.43 ? 82   GLU A O   1 
ATOM   613  C  CB  . GLU A 1 82  ? -29.660 108.448 49.713 1.00 38.66 ? 82   GLU A CB  1 
ATOM   614  C  CG  . GLU A 1 82  ? -29.041 109.797 50.144 1.00 41.30 ? 82   GLU A CG  1 
ATOM   615  C  CD  . GLU A 1 82  ? -29.352 110.203 51.582 1.00 43.32 ? 82   GLU A CD  1 
ATOM   616  O  OE1 . GLU A 1 82  ? -30.540 110.200 51.973 1.00 46.19 ? 82   GLU A OE1 1 
ATOM   617  O  OE2 . GLU A 1 82  ? -28.405 110.546 52.323 1.00 43.20 ? 82   GLU A OE2 1 
ATOM   618  N  N   . MET A 1 83  ? -30.532 106.391 47.040 1.00 34.77 ? 83   MET A N   1 
ATOM   619  C  CA  . MET A 1 83  ? -30.982 105.046 46.692 1.00 33.25 ? 83   MET A CA  1 
ATOM   620  C  C   . MET A 1 83  ? -29.884 104.228 46.002 1.00 33.27 ? 83   MET A C   1 
ATOM   621  O  O   . MET A 1 83  ? -30.024 103.017 45.831 1.00 34.41 ? 83   MET A O   1 
ATOM   622  C  CB  . MET A 1 83  ? -32.201 105.107 45.778 1.00 32.38 ? 83   MET A CB  1 
ATOM   623  C  CG  . MET A 1 83  ? -31.918 105.691 44.412 1.00 33.28 ? 83   MET A CG  1 
ATOM   624  S  SD  . MET A 1 83  ? -33.316 105.521 43.291 1.00 32.79 ? 83   MET A SD  1 
ATOM   625  C  CE  . MET A 1 83  ? -32.959 103.939 42.558 1.00 33.82 ? 83   MET A CE  1 
ATOM   626  N  N   . TRP A 1 84  ? -28.803 104.892 45.592 1.00 31.96 ? 84   TRP A N   1 
ATOM   627  C  CA  . TRP A 1 84  ? -27.696 104.206 44.929 1.00 30.12 ? 84   TRP A CA  1 
ATOM   628  C  C   . TRP A 1 84  ? -26.538 103.971 45.898 1.00 30.41 ? 84   TRP A C   1 
ATOM   629  O  O   . TRP A 1 84  ? -25.675 103.139 45.648 1.00 31.15 ? 84   TRP A O   1 
ATOM   630  C  CB  . TRP A 1 84  ? -27.187 105.011 43.726 1.00 27.82 ? 84   TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 84  ? -28.241 105.365 42.715 1.00 25.60 ? 84   TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 84  ? -28.850 106.581 42.549 1.00 24.46 ? 84   TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 84  ? -28.855 104.479 41.773 1.00 25.04 ? 84   TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 84  ? -29.811 106.505 41.566 1.00 22.64 ? 84   TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 84  ? -29.838 105.225 41.074 1.00 24.22 ? 84   TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 84  ? -28.675 103.126 41.451 1.00 23.15 ? 84   TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 84  ? -30.639 104.658 40.078 1.00 22.18 ? 84   TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 84  ? -29.468 102.564 40.461 1.00 21.91 ? 84   TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 84  ? -30.440 103.331 39.786 1.00 22.77 ? 84   TRP A CH2 1 
ATOM   640  N  N   . ASN A 1 85  ? -26.521 104.703 47.006 1.00 31.35 ? 85   ASN A N   1 
ATOM   641  C  CA  . ASN A 1 85  ? -25.455 104.555 47.994 1.00 31.47 ? 85   ASN A CA  1 
ATOM   642  C  C   . ASN A 1 85  ? -25.434 103.154 48.586 1.00 31.62 ? 85   ASN A C   1 
ATOM   643  O  O   . ASN A 1 85  ? -26.444 102.453 48.573 1.00 32.16 ? 85   ASN A O   1 
ATOM   644  C  CB  . ASN A 1 85  ? -25.629 105.553 49.138 1.00 30.26 ? 85   ASN A CB  1 
ATOM   645  C  CG  . ASN A 1 85  ? -25.409 106.981 48.708 1.00 32.21 ? 85   ASN A CG  1 
ATOM   646  O  OD1 . ASN A 1 85  ? -24.404 107.309 48.082 1.00 32.27 ? 85   ASN A OD1 1 
ATOM   647  N  ND2 . ASN A 1 85  ? -26.344 107.848 49.060 1.00 35.51 ? 85   ASN A ND2 1 
ATOM   648  N  N   . PRO A 1 86  ? -24.275 102.726 49.112 1.00 31.89 ? 86   PRO A N   1 
ATOM   649  C  CA  . PRO A 1 86  ? -24.178 101.394 49.708 1.00 31.85 ? 86   PRO A CA  1 
ATOM   650  C  C   . PRO A 1 86  ? -25.172 101.356 50.857 1.00 32.37 ? 86   PRO A C   1 
ATOM   651  O  O   . PRO A 1 86  ? -25.326 102.357 51.564 1.00 32.15 ? 86   PRO A O   1 
ATOM   652  C  CB  . PRO A 1 86  ? -22.738 101.344 50.207 1.00 31.38 ? 86   PRO A CB  1 
ATOM   653  C  CG  . PRO A 1 86  ? -22.021 102.250 49.266 1.00 31.73 ? 86   PRO A CG  1 
ATOM   654  C  CD  . PRO A 1 86  ? -22.966 103.403 49.125 1.00 32.26 ? 86   PRO A CD  1 
ATOM   655  N  N   . ASN A 1 87  ? -25.857 100.229 51.037 1.00 32.60 ? 87   ASN A N   1 
ATOM   656  C  CA  . ASN A 1 87  ? -26.821 100.106 52.125 1.00 33.53 ? 87   ASN A CA  1 
ATOM   657  C  C   . ASN A 1 87  ? -26.393 98.988  53.076 1.00 34.84 ? 87   ASN A C   1 
ATOM   658  O  O   . ASN A 1 87  ? -27.212 98.358  53.744 1.00 34.73 ? 87   ASN A O   1 
ATOM   659  C  CB  . ASN A 1 87  ? -28.227 99.847  51.578 1.00 31.13 ? 87   ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 87  ? -28.300 98.606  50.726 1.00 31.71 ? 87   ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 87  ? -29.384 98.143  50.369 1.00 30.27 ? 87   ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 87  ? -27.145 98.057  50.388 1.00 32.49 ? 87   ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 88  ? -25.086 98.755  53.116 1.00 37.67 ? 88   ARG A N   1 
ATOM   664  C  CA  . ARG A 1 88  ? -24.477 97.749  53.982 1.00 38.84 ? 88   ARG A CA  1 
ATOM   665  C  C   . ARG A 1 88  ? -23.100 98.267  54.381 1.00 39.18 ? 88   ARG A C   1 
ATOM   666  O  O   . ARG A 1 88  ? -22.649 99.288  53.868 1.00 39.80 ? 88   ARG A O   1 
ATOM   667  C  CB  . ARG A 1 88  ? -24.365 96.404  53.255 1.00 39.76 ? 88   ARG A CB  1 
ATOM   668  C  CG  . ARG A 1 88  ? -25.645 95.575  53.308 1.00 40.91 ? 88   ARG A CG  1 
ATOM   669  C  CD  . ARG A 1 88  ? -26.022 95.287  54.762 1.00 44.77 ? 88   ARG A CD  1 
ATOM   670  N  NE  . ARG A 1 88  ? -27.124 94.337  54.893 1.00 46.91 ? 88   ARG A NE  1 
ATOM   671  C  CZ  . ARG A 1 88  ? -28.349 94.540  54.416 1.00 48.33 ? 88   ARG A CZ  1 
ATOM   672  N  NH1 . ARG A 1 88  ? -28.636 95.663  53.771 1.00 48.18 ? 88   ARG A NH1 1 
ATOM   673  N  NH2 . ARG A 1 88  ? -29.288 93.619  54.583 1.00 48.65 ? 88   ARG A NH2 1 
ATOM   674  N  N   . GLU A 1 89  ? -22.431 97.594  55.306 1.00 40.42 ? 89   GLU A N   1 
ATOM   675  C  CA  . GLU A 1 89  ? -21.117 98.066  55.724 1.00 41.22 ? 89   GLU A CA  1 
ATOM   676  C  C   . GLU A 1 89  ? -20.084 97.899  54.622 1.00 37.75 ? 89   GLU A C   1 
ATOM   677  O  O   . GLU A 1 89  ? -19.858 96.792  54.140 1.00 37.11 ? 89   GLU A O   1 
ATOM   678  C  CB  . GLU A 1 89  ? -20.658 97.322  56.975 1.00 46.02 ? 89   GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 89  ? -21.458 97.664  58.220 1.00 55.18 ? 89   GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 89  ? -20.908 96.988  59.478 1.00 61.23 ? 89   GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 89  ? -19.902 96.242  59.365 1.00 63.69 ? 89   GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 89  ? -21.479 97.204  60.577 1.00 62.98 ? 89   GLU A OE2 1 
ATOM   683  N  N   . MET A 1 90  ? -19.465 98.998  54.209 1.00 34.08 ? 90   MET A N   1 
ATOM   684  C  CA  . MET A 1 90  ? -18.451 98.894  53.172 1.00 32.01 ? 90   MET A CA  1 
ATOM   685  C  C   . MET A 1 90  ? -17.324 98.039  53.722 1.00 30.79 ? 90   MET A C   1 
ATOM   686  O  O   . MET A 1 90  ? -17.091 98.030  54.923 1.00 30.48 ? 90   MET A O   1 
ATOM   687  C  CB  . MET A 1 90  ? -17.930 100.273 52.780 1.00 29.24 ? 90   MET A CB  1 
ATOM   688  C  CG  . MET A 1 90  ? -18.978 101.127 52.146 1.00 28.77 ? 90   MET A CG  1 
ATOM   689  S  SD  . MET A 1 90  ? -18.275 102.331 51.019 1.00 31.06 ? 90   MET A SD  1 
ATOM   690  C  CE  . MET A 1 90  ? -18.039 103.715 52.103 1.00 29.31 ? 90   MET A CE  1 
ATOM   691  N  N   . SER A 1 91  ? -16.637 97.319  52.845 1.00 31.04 ? 91   SER A N   1 
ATOM   692  C  CA  . SER A 1 91  ? -15.544 96.446  53.258 1.00 32.89 ? 91   SER A CA  1 
ATOM   693  C  C   . SER A 1 91  ? -14.779 95.935  52.054 1.00 33.77 ? 91   SER A C   1 
ATOM   694  O  O   . SER A 1 91  ? -15.366 95.741  50.987 1.00 35.47 ? 91   SER A O   1 
ATOM   695  C  CB  . SER A 1 91  ? -16.094 95.244  54.029 1.00 32.65 ? 91   SER A CB  1 
ATOM   696  O  OG  . SER A 1 91  ? -15.110 94.229  54.147 1.00 30.23 ? 91   SER A OG  1 
ATOM   697  N  N   . GLU A 1 92  ? -13.475 95.712  52.219 1.00 34.08 ? 92   GLU A N   1 
ATOM   698  C  CA  . GLU A 1 92  ? -12.664 95.190  51.119 1.00 33.26 ? 92   GLU A CA  1 
ATOM   699  C  C   . GLU A 1 92  ? -13.136 93.774  50.826 1.00 32.88 ? 92   GLU A C   1 
ATOM   700  O  O   . GLU A 1 92  ? -13.017 93.293  49.703 1.00 32.81 ? 92   GLU A O   1 
ATOM   701  C  CB  . GLU A 1 92  ? -11.170 95.179  51.469 1.00 32.62 ? 92   GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 92  ? -10.559 96.559  51.606 1.00 32.42 ? 92   GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 92  ? -9.102  96.603  51.188 1.00 32.00 ? 92   GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 92  ? -8.812  96.476  49.979 1.00 31.72 ? 92   GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 92  ? -8.242  96.765  52.073 1.00 35.32 ? 92   GLU A OE2 1 
ATOM   706  N  N   . ASP A 1 93  ? -13.674 93.119  51.851 1.00 32.93 ? 93   ASP A N   1 
ATOM   707  C  CA  . ASP A 1 93  ? -14.196 91.765  51.724 1.00 33.90 ? 93   ASP A CA  1 
ATOM   708  C  C   . ASP A 1 93  ? -15.625 91.912  51.236 1.00 33.35 ? 93   ASP A C   1 
ATOM   709  O  O   . ASP A 1 93  ? -16.544 91.990  52.046 1.00 33.14 ? 93   ASP A O   1 
ATOM   710  C  CB  . ASP A 1 93  ? -14.212 91.071  53.079 1.00 35.07 ? 93   ASP A CB  1 
ATOM   711  C  CG  . ASP A 1 93  ? -14.743 89.660  52.995 1.00 37.61 ? 93   ASP A CG  1 
ATOM   712  O  OD1 . ASP A 1 93  ? -15.609 89.411  52.130 1.00 36.79 ? 93   ASP A OD1 1 
ATOM   713  O  OD2 . ASP A 1 93  ? -14.301 88.805  53.797 1.00 38.65 ? 93   ASP A OD2 1 
ATOM   714  N  N   . CYS A 1 94  ? -15.811 91.927  49.921 1.00 33.03 ? 94   CYS A N   1 
ATOM   715  C  CA  . CYS A 1 94  ? -17.133 92.123  49.349 1.00 34.64 ? 94   CYS A CA  1 
ATOM   716  C  C   . CYS A 1 94  ? -17.442 91.254  48.135 1.00 36.53 ? 94   CYS A C   1 
ATOM   717  O  O   . CYS A 1 94  ? -18.419 91.512  47.423 1.00 37.73 ? 94   CYS A O   1 
ATOM   718  C  CB  . CYS A 1 94  ? -17.275 93.588  48.943 1.00 33.48 ? 94   CYS A CB  1 
ATOM   719  S  SG  . CYS A 1 94  ? -16.068 94.043  47.661 0.80 29.36 ? 94   CYS A SG  1 
ATOM   720  N  N   . LEU A 1 95  ? -16.623 90.238  47.886 1.00 36.45 ? 95   LEU A N   1 
ATOM   721  C  CA  . LEU A 1 95  ? -16.846 89.377  46.731 1.00 36.34 ? 95   LEU A CA  1 
ATOM   722  C  C   . LEU A 1 95  ? -17.844 88.258  47.018 1.00 36.72 ? 95   LEU A C   1 
ATOM   723  O  O   . LEU A 1 95  ? -17.480 87.095  47.205 1.00 37.00 ? 95   LEU A O   1 
ATOM   724  C  CB  . LEU A 1 95  ? -15.511 88.814  46.253 1.00 36.29 ? 95   LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 95  ? -14.612 89.901  45.662 1.00 34.99 ? 95   LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 95  ? -13.206 89.404  45.480 1.00 35.87 ? 95   LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 95  ? -15.189 90.333  44.338 1.00 36.69 ? 95   LEU A CD2 1 
ATOM   728  N  N   . TYR A 1 96  ? -19.117 88.633  47.044 1.00 36.40 ? 96   TYR A N   1 
ATOM   729  C  CA  . TYR A 1 96  ? -20.197 87.700  47.309 1.00 36.43 ? 96   TYR A CA  1 
ATOM   730  C  C   . TYR A 1 96  ? -21.231 87.852  46.210 1.00 35.93 ? 96   TYR A C   1 
ATOM   731  O  O   . TYR A 1 96  ? -21.139 88.780  45.415 1.00 36.12 ? 96   TYR A O   1 
ATOM   732  C  CB  . TYR A 1 96  ? -20.838 88.015  48.665 1.00 37.64 ? 96   TYR A CB  1 
ATOM   733  C  CG  . TYR A 1 96  ? -19.875 87.938  49.832 1.00 39.64 ? 96   TYR A CG  1 
ATOM   734  C  CD1 . TYR A 1 96  ? -18.932 88.944  50.055 1.00 39.61 ? 96   TYR A CD1 1 
ATOM   735  C  CD2 . TYR A 1 96  ? -19.884 86.838  50.694 1.00 39.41 ? 96   TYR A CD2 1 
ATOM   736  C  CE1 . TYR A 1 96  ? -18.019 88.853  51.106 1.00 40.29 ? 96   TYR A CE1 1 
ATOM   737  C  CE2 . TYR A 1 96  ? -18.979 86.736  51.747 1.00 39.13 ? 96   TYR A CE2 1 
ATOM   738  C  CZ  . TYR A 1 96  ? -18.045 87.743  51.953 1.00 40.62 ? 96   TYR A CZ  1 
ATOM   739  O  OH  . TYR A 1 96  ? -17.138 87.632  52.998 1.00 40.20 ? 96   TYR A OH  1 
ATOM   740  N  N   . LEU A 1 97  ? -22.203 86.942  46.157 1.00 35.90 ? 97   LEU A N   1 
ATOM   741  C  CA  . LEU A 1 97  ? -23.263 87.010  45.153 1.00 35.38 ? 97   LEU A CA  1 
ATOM   742  C  C   . LEU A 1 97  ? -24.599 86.528  45.712 1.00 35.17 ? 97   LEU A C   1 
ATOM   743  O  O   . LEU A 1 97  ? -24.639 85.769  46.676 1.00 35.07 ? 97   LEU A O   1 
ATOM   744  C  CB  . LEU A 1 97  ? -22.875 86.216  43.896 1.00 35.39 ? 97   LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 97  ? -22.665 84.701  43.907 1.00 33.53 ? 97   LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 97  ? -24.003 84.003  44.041 1.00 31.19 ? 97   LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 97  ? -21.975 84.277  42.612 1.00 30.33 ? 97   LEU A CD2 1 
ATOM   748  N  N   . ASN A 1 98  ? -25.690 86.984  45.102 1.00 36.04 ? 98   ASN A N   1 
ATOM   749  C  CA  . ASN A 1 98  ? -27.038 86.631  45.546 1.00 36.44 ? 98   ASN A CA  1 
ATOM   750  C  C   . ASN A 1 98  ? -27.804 85.810  44.517 1.00 36.61 ? 98   ASN A C   1 
ATOM   751  O  O   . ASN A 1 98  ? -27.715 86.056  43.314 1.00 36.69 ? 98   ASN A O   1 
ATOM   752  C  CB  . ASN A 1 98  ? -27.841 87.899  45.840 1.00 38.48 ? 98   ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 98  ? -27.042 88.936  46.607 1.00 39.01 ? 98   ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 98  ? -26.746 88.758  47.789 1.00 39.61 ? 98   ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 98  ? -26.685 90.028  45.932 1.00 37.16 ? 98   ASN A ND2 1 
ATOM   756  N  N   . ILE A 1 99  ? -28.570 84.844  45.014 1.00 37.90 ? 99   ILE A N   1 
ATOM   757  C  CA  . ILE A 1 99  ? -29.388 83.962  44.180 1.00 38.78 ? 99   ILE A CA  1 
ATOM   758  C  C   . ILE A 1 99  ? -30.839 84.031  44.672 1.00 40.29 ? 99   ILE A C   1 
ATOM   759  O  O   . ILE A 1 99  ? -31.100 84.091  45.878 1.00 40.77 ? 99   ILE A O   1 
ATOM   760  C  CB  . ILE A 1 99  ? -28.960 82.475  44.305 1.00 37.32 ? 99   ILE A CB  1 
ATOM   761  C  CG1 . ILE A 1 99  ? -27.441 82.348  44.408 1.00 36.69 ? 99   ILE A CG1 1 
ATOM   762  C  CG2 . ILE A 1 99  ? -29.483 81.693  43.125 1.00 35.75 ? 99   ILE A CG2 1 
ATOM   763  C  CD1 . ILE A 1 99  ? -26.712 82.667  43.149 1.00 38.77 ? 99   ILE A CD1 1 
ATOM   764  N  N   . TRP A 1 100 ? -31.778 84.030  43.740 1.00 40.80 ? 100  TRP A N   1 
ATOM   765  C  CA  . TRP A 1 100 ? -33.189 84.042  44.093 1.00 42.43 ? 100  TRP A CA  1 
ATOM   766  C  C   . TRP A 1 100 ? -33.761 82.861  43.349 1.00 44.40 ? 100  TRP A C   1 
ATOM   767  O  O   . TRP A 1 100 ? -33.673 82.804  42.119 1.00 46.06 ? 100  TRP A O   1 
ATOM   768  C  CB  . TRP A 1 100 ? -33.851 85.330  43.634 1.00 41.71 ? 100  TRP A CB  1 
ATOM   769  C  CG  . TRP A 1 100 ? -33.771 86.404  44.645 1.00 43.00 ? 100  TRP A CG  1 
ATOM   770  C  CD1 . TRP A 1 100 ? -34.671 86.664  45.631 1.00 43.39 ? 100  TRP A CD1 1 
ATOM   771  C  CD2 . TRP A 1 100 ? -32.727 87.372  44.786 1.00 44.74 ? 100  TRP A CD2 1 
ATOM   772  N  NE1 . TRP A 1 100 ? -34.258 87.740  46.380 1.00 44.18 ? 100  TRP A NE1 1 
ATOM   773  C  CE2 . TRP A 1 100 ? -33.066 88.194  45.883 1.00 45.02 ? 100  TRP A CE2 1 
ATOM   774  C  CE3 . TRP A 1 100 ? -31.535 87.627  44.090 1.00 45.53 ? 100  TRP A CE3 1 
ATOM   775  C  CZ2 . TRP A 1 100 ? -32.257 89.256  46.303 1.00 45.92 ? 100  TRP A CZ2 1 
ATOM   776  C  CZ3 . TRP A 1 100 ? -30.727 88.684  44.507 1.00 45.53 ? 100  TRP A CZ3 1 
ATOM   777  C  CH2 . TRP A 1 100 ? -31.093 89.485  45.604 1.00 46.51 ? 100  TRP A CH2 1 
ATOM   778  N  N   . VAL A 1 101 ? -34.322 81.905  44.086 1.00 45.30 ? 101  VAL A N   1 
ATOM   779  C  CA  . VAL A 1 101 ? -34.880 80.705  43.467 1.00 44.93 ? 101  VAL A CA  1 
ATOM   780  C  C   . VAL A 1 101 ? -36.369 80.535  43.758 1.00 45.49 ? 101  VAL A C   1 
ATOM   781  O  O   . VAL A 1 101 ? -36.811 80.686  44.895 1.00 45.94 ? 101  VAL A O   1 
ATOM   782  C  CB  . VAL A 1 101 ? -34.139 79.451  43.950 1.00 44.05 ? 101  VAL A CB  1 
ATOM   783  C  CG1 . VAL A 1 101 ? -34.477 78.273  43.054 1.00 44.02 ? 101  VAL A CG1 1 
ATOM   784  C  CG2 . VAL A 1 101 ? -32.644 79.706  43.964 1.00 42.63 ? 101  VAL A CG2 1 
ATOM   785  N  N   . PRO A 1 102 ? -37.164 80.221  42.724 1.00 45.93 ? 102  PRO A N   1 
ATOM   786  C  CA  . PRO A 1 102 ? -38.609 80.033  42.888 1.00 47.71 ? 102  PRO A CA  1 
ATOM   787  C  C   . PRO A 1 102 ? -38.941 78.829  43.769 1.00 49.46 ? 102  PRO A C   1 
ATOM   788  O  O   . PRO A 1 102 ? -38.065 78.018  44.079 1.00 49.97 ? 102  PRO A O   1 
ATOM   789  C  CB  . PRO A 1 102 ? -39.093 79.835  41.453 1.00 45.50 ? 102  PRO A CB  1 
ATOM   790  C  CG  . PRO A 1 102 ? -38.111 80.602  40.654 1.00 44.30 ? 102  PRO A CG  1 
ATOM   791  C  CD  . PRO A 1 102 ? -36.808 80.208  41.297 1.00 44.98 ? 102  PRO A CD  1 
ATOM   792  N  N   . SER A 1 103 ? -40.204 78.726  44.175 1.00 51.47 ? 103  SER A N   1 
ATOM   793  C  CA  . SER A 1 103 ? -40.653 77.601  44.990 1.00 53.53 ? 103  SER A CA  1 
ATOM   794  C  C   . SER A 1 103 ? -41.998 77.098  44.480 1.00 54.49 ? 103  SER A C   1 
ATOM   795  O  O   . SER A 1 103 ? -42.947 77.871  44.324 1.00 54.58 ? 103  SER A O   1 
ATOM   796  C  CB  . SER A 1 103 ? -40.777 77.986  46.469 1.00 54.89 ? 103  SER A CB  1 
ATOM   797  O  OG  . SER A 1 103 ? -40.991 76.838  47.284 1.00 52.75 ? 103  SER A OG  1 
ATOM   798  N  N   . PRO A 1 104 ? -42.093 75.786  44.218 1.00 55.33 ? 104  PRO A N   1 
ATOM   799  C  CA  . PRO A 1 104 ? -40.983 74.841  44.399 1.00 56.12 ? 104  PRO A CA  1 
ATOM   800  C  C   . PRO A 1 104 ? -39.787 75.120  43.483 1.00 56.20 ? 104  PRO A C   1 
ATOM   801  O  O   . PRO A 1 104 ? -39.923 75.762  42.439 1.00 54.84 ? 104  PRO A O   1 
ATOM   802  C  CB  . PRO A 1 104 ? -41.632 73.489  44.108 1.00 55.93 ? 104  PRO A CB  1 
ATOM   803  C  CG  . PRO A 1 104 ? -43.056 73.711  44.504 1.00 57.02 ? 104  PRO A CG  1 
ATOM   804  C  CD  . PRO A 1 104 ? -43.336 75.067  43.904 1.00 55.81 ? 104  PRO A CD  1 
ATOM   805  N  N   . ARG A 1 105 ? -38.620 74.633  43.894 1.00 56.07 ? 105  ARG A N   1 
ATOM   806  C  CA  . ARG A 1 105 ? -37.395 74.811  43.132 1.00 56.56 ? 105  ARG A CA  1 
ATOM   807  C  C   . ARG A 1 105 ? -37.512 74.082  41.792 1.00 57.19 ? 105  ARG A C   1 
ATOM   808  O  O   . ARG A 1 105 ? -37.645 72.861  41.748 1.00 58.36 ? 105  ARG A O   1 
ATOM   809  C  CB  . ARG A 1 105 ? -36.204 74.257  43.924 1.00 56.17 ? 105  ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 105 ? -34.857 74.523  43.286 1.00 57.20 ? 105  ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 105 ? -33.784 73.621  43.863 1.00 56.15 ? 105  ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 105 ? -33.696 73.717  45.314 1.00 56.34 ? 105  ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 105 ? -32.852 72.998  46.048 1.00 58.07 ? 105  ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 105 ? -32.030 72.138  45.461 1.00 57.78 ? 105  ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 105 ? -32.833 73.131  47.369 1.00 58.99 ? 105  ARG A NH2 1 
ATOM   816  N  N   . PRO A 1 106 ? -37.463 74.823  40.677 1.00 57.52 ? 106  PRO A N   1 
ATOM   817  C  CA  . PRO A 1 106 ? -37.571 74.180  39.369 1.00 56.95 ? 106  PRO A CA  1 
ATOM   818  C  C   . PRO A 1 106 ? -36.243 73.529  39.030 1.00 57.26 ? 106  PRO A C   1 
ATOM   819  O  O   . PRO A 1 106 ? -35.336 73.507  39.860 1.00 57.82 ? 106  PRO A O   1 
ATOM   820  C  CB  . PRO A 1 106 ? -37.908 75.351  38.459 1.00 57.11 ? 106  PRO A CB  1 
ATOM   821  C  CG  . PRO A 1 106 ? -37.056 76.436  39.036 1.00 56.21 ? 106  PRO A CG  1 
ATOM   822  C  CD  . PRO A 1 106 ? -37.242 76.273  40.534 1.00 57.22 ? 106  PRO A CD  1 
ATOM   823  N  N   . LYS A 1 107 ? -36.135 72.974  37.831 1.00 57.71 ? 107  LYS A N   1 
ATOM   824  C  CA  . LYS A 1 107 ? -34.880 72.372  37.408 1.00 58.32 ? 107  LYS A CA  1 
ATOM   825  C  C   . LYS A 1 107 ? -34.565 72.899  36.014 1.00 58.09 ? 107  LYS A C   1 
ATOM   826  O  O   . LYS A 1 107 ? -35.480 73.247  35.259 1.00 58.06 ? 107  LYS A O   1 
ATOM   827  C  CB  . LYS A 1 107 ? -34.963 70.845  37.395 1.00 59.81 ? 107  LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 107 ? -33.612 70.156  37.181 1.00 60.92 ? 107  LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 107 ? -32.605 70.511  38.284 1.00 61.59 ? 107  LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 107 ? -31.874 71.836  38.039 1.00 61.57 ? 107  LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 107 ? -30.897 71.780  36.907 1.00 61.66 ? 107  LYS A NZ  1 
ATOM   832  N  N   . SER A 1 108 ? -33.277 72.962  35.683 1.00 57.18 ? 108  SER A N   1 
ATOM   833  C  CA  . SER A 1 108 ? -32.825 73.478  34.392 1.00 57.13 ? 108  SER A CA  1 
ATOM   834  C  C   . SER A 1 108 ? -33.706 74.607  33.869 1.00 56.78 ? 108  SER A C   1 
ATOM   835  O  O   . SER A 1 108 ? -34.281 74.505  32.779 1.00 57.45 ? 108  SER A O   1 
ATOM   836  C  CB  . SER A 1 108 ? -32.749 72.360  33.349 1.00 57.81 ? 108  SER A CB  1 
ATOM   837  O  OG  . SER A 1 108 ? -31.472 71.746  33.364 1.00 59.53 ? 108  SER A OG  1 
ATOM   838  N  N   . THR A 1 109 ? -33.812 75.674  34.662 1.00 54.96 ? 109  THR A N   1 
ATOM   839  C  CA  . THR A 1 109 ? -34.596 76.847  34.295 1.00 51.79 ? 109  THR A CA  1 
ATOM   840  C  C   . THR A 1 109 ? -33.646 77.999  33.956 1.00 50.99 ? 109  THR A C   1 
ATOM   841  O  O   . THR A 1 109 ? -32.461 77.986  34.325 1.00 48.94 ? 109  THR A O   1 
ATOM   842  C  CB  . THR A 1 109 ? -35.529 77.281  35.431 1.00 50.65 ? 109  THR A CB  1 
ATOM   843  O  OG1 . THR A 1 109 ? -36.307 78.405  35.010 1.00 49.68 ? 109  THR A OG1 1 
ATOM   844  C  CG2 . THR A 1 109 ? -34.730 77.675  36.639 1.00 51.77 ? 109  THR A CG2 1 
ATOM   845  N  N   . THR A 1 110 ? -34.182 78.991  33.251 1.00 49.17 ? 110  THR A N   1 
ATOM   846  C  CA  . THR A 1 110 ? -33.411 80.144  32.816 1.00 46.95 ? 110  THR A CA  1 
ATOM   847  C  C   . THR A 1 110 ? -32.755 80.920  33.950 1.00 45.58 ? 110  THR A C   1 
ATOM   848  O  O   . THR A 1 110 ? -33.385 81.232  34.962 1.00 46.36 ? 110  THR A O   1 
ATOM   849  C  CB  . THR A 1 110 ? -34.292 81.116  32.010 1.00 47.32 ? 110  THR A CB  1 
ATOM   850  O  OG1 . THR A 1 110 ? -34.941 80.404  30.950 1.00 48.17 ? 110  THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 110 ? -33.447 82.233  31.407 1.00 48.10 ? 110  THR A CG2 1 
ATOM   852  N  N   . VAL A 1 111 ? -31.478 81.231  33.764 1.00 42.61 ? 111  VAL A N   1 
ATOM   853  C  CA  . VAL A 1 111 ? -30.726 81.997  34.743 1.00 40.12 ? 111  VAL A CA  1 
ATOM   854  C  C   . VAL A 1 111 ? -30.497 83.410  34.197 1.00 39.54 ? 111  VAL A C   1 
ATOM   855  O  O   . VAL A 1 111 ? -30.365 83.610  32.984 1.00 40.49 ? 111  VAL A O   1 
ATOM   856  C  CB  . VAL A 1 111 ? -29.355 81.343  35.026 1.00 38.58 ? 111  VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 111 ? -28.526 82.225  35.937 1.00 37.19 ? 111  VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 111 ? -29.557 79.991  35.660 1.00 39.17 ? 111  VAL A CG2 1 
ATOM   859  N  N   . MET A 1 112 ? -30.481 84.390  35.093 1.00 36.24 ? 112  MET A N   1 
ATOM   860  C  CA  . MET A 1 112 ? -30.225 85.768  34.706 1.00 32.24 ? 112  MET A CA  1 
ATOM   861  C  C   . MET A 1 112 ? -29.303 86.387  35.745 1.00 30.69 ? 112  MET A C   1 
ATOM   862  O  O   . MET A 1 112 ? -29.672 86.523  36.913 1.00 31.35 ? 112  MET A O   1 
ATOM   863  C  CB  . MET A 1 112 ? -31.530 86.551  34.608 1.00 31.45 ? 112  MET A CB  1 
ATOM   864  C  CG  . MET A 1 112 ? -32.275 86.300  33.307 1.00 29.44 ? 112  MET A CG  1 
ATOM   865  S  SD  . MET A 1 112 ? -33.854 87.165  33.224 1.00 29.14 ? 112  MET A SD  1 
ATOM   866  C  CE  . MET A 1 112 ? -33.345 88.775  32.684 1.00 29.14 ? 112  MET A CE  1 
ATOM   867  N  N   . VAL A 1 113 ? -28.090 86.731  35.323 1.00 27.62 ? 113  VAL A N   1 
ATOM   868  C  CA  . VAL A 1 113 ? -27.117 87.330  36.222 1.00 24.71 ? 113  VAL A CA  1 
ATOM   869  C  C   . VAL A 1 113 ? -27.027 88.834  36.025 1.00 24.57 ? 113  VAL A C   1 
ATOM   870  O  O   . VAL A 1 113 ? -26.717 89.314  34.942 1.00 25.04 ? 113  VAL A O   1 
ATOM   871  C  CB  . VAL A 1 113 ? -25.742 86.728  36.010 1.00 23.75 ? 113  VAL A CB  1 
ATOM   872  C  CG1 . VAL A 1 113 ? -24.773 87.292  37.033 1.00 22.51 ? 113  VAL A CG1 1 
ATOM   873  C  CG2 . VAL A 1 113 ? -25.827 85.215  36.118 1.00 25.14 ? 113  VAL A CG2 1 
ATOM   874  N  N   . TRP A 1 114 ? -27.299 89.579  37.085 1.00 24.82 ? 114  TRP A N   1 
ATOM   875  C  CA  . TRP A 1 114 ? -27.262 91.028  37.027 1.00 25.11 ? 114  TRP A CA  1 
ATOM   876  C  C   . TRP A 1 114 ? -25.916 91.629  37.406 1.00 26.71 ? 114  TRP A C   1 
ATOM   877  O  O   . TRP A 1 114 ? -25.291 91.235  38.389 1.00 27.85 ? 114  TRP A O   1 
ATOM   878  C  CB  . TRP A 1 114 ? -28.345 91.587  37.933 1.00 23.70 ? 114  TRP A CB  1 
ATOM   879  C  CG  . TRP A 1 114 ? -28.266 93.051  38.152 1.00 23.84 ? 114  TRP A CG  1 
ATOM   880  C  CD1 . TRP A 1 114 ? -27.776 93.685  39.251 1.00 22.80 ? 114  TRP A CD1 1 
ATOM   881  C  CD2 . TRP A 1 114 ? -28.731 94.076  37.269 1.00 23.68 ? 114  TRP A CD2 1 
ATOM   882  N  NE1 . TRP A 1 114 ? -27.909 95.043  39.112 1.00 24.31 ? 114  TRP A NE1 1 
ATOM   883  C  CE2 . TRP A 1 114 ? -28.491 95.312  37.903 1.00 23.40 ? 114  TRP A CE2 1 
ATOM   884  C  CE3 . TRP A 1 114 ? -29.322 94.069  36.003 1.00 22.48 ? 114  TRP A CE3 1 
ATOM   885  C  CZ2 . TRP A 1 114 ? -28.829 96.532  37.318 1.00 23.80 ? 114  TRP A CZ2 1 
ATOM   886  C  CZ3 . TRP A 1 114 ? -29.658 95.282  35.420 1.00 24.15 ? 114  TRP A CZ3 1 
ATOM   887  C  CH2 . TRP A 1 114 ? -29.408 96.500  36.079 1.00 24.21 ? 114  TRP A CH2 1 
ATOM   888  N  N   . ILE A 1 115 ? -25.462 92.585  36.608 1.00 27.76 ? 115  ILE A N   1 
ATOM   889  C  CA  . ILE A 1 115 ? -24.207 93.261  36.896 1.00 27.09 ? 115  ILE A CA  1 
ATOM   890  C  C   . ILE A 1 115 ? -24.565 94.732  37.124 1.00 27.62 ? 115  ILE A C   1 
ATOM   891  O  O   . ILE A 1 115 ? -24.979 95.434  36.201 1.00 27.62 ? 115  ILE A O   1 
ATOM   892  C  CB  . ILE A 1 115 ? -23.210 93.119  35.719 1.00 26.46 ? 115  ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 115 ? -23.165 91.661  35.263 1.00 26.45 ? 115  ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 115 ? -21.812 93.535  36.155 1.00 23.56 ? 115  ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 115 ? -22.104 91.368  34.216 1.00 25.44 ? 115  ILE A CD1 1 
ATOM   896  N  N   . TYR A 1 116 ? -24.440 95.188  38.365 1.00 28.10 ? 116  TYR A N   1 
ATOM   897  C  CA  . TYR A 1 116 ? -24.764 96.571  38.674 1.00 28.59 ? 116  TYR A CA  1 
ATOM   898  C  C   . TYR A 1 116 ? -23.778 97.526  38.029 1.00 28.64 ? 116  TYR A C   1 
ATOM   899  O  O   . TYR A 1 116 ? -22.663 97.143  37.697 1.00 29.22 ? 116  TYR A O   1 
ATOM   900  C  CB  . TYR A 1 116 ? -24.789 96.796  40.181 1.00 26.49 ? 116  TYR A CB  1 
ATOM   901  C  CG  . TYR A 1 116 ? -23.493 96.499  40.897 1.00 28.07 ? 116  TYR A CG  1 
ATOM   902  C  CD1 . TYR A 1 116 ? -22.341 97.265  40.672 1.00 26.64 ? 116  TYR A CD1 1 
ATOM   903  C  CD2 . TYR A 1 116 ? -23.431 95.477  41.853 1.00 28.54 ? 116  TYR A CD2 1 
ATOM   904  C  CE1 . TYR A 1 116 ? -21.157 97.018  41.395 1.00 25.73 ? 116  TYR A CE1 1 
ATOM   905  C  CE2 . TYR A 1 116 ? -22.261 95.223  42.574 1.00 26.34 ? 116  TYR A CE2 1 
ATOM   906  C  CZ  . TYR A 1 116 ? -21.131 95.993  42.346 1.00 26.25 ? 116  TYR A CZ  1 
ATOM   907  O  OH  . TYR A 1 116 ? -19.992 95.732  43.085 1.00 25.62 ? 116  TYR A OH  1 
ATOM   908  N  N   . GLY A 1 117 ? -24.209 98.769  37.850 1.00 29.49 ? 117  GLY A N   1 
ATOM   909  C  CA  . GLY A 1 117 ? -23.367 99.783  37.243 1.00 27.96 ? 117  GLY A CA  1 
ATOM   910  C  C   . GLY A 1 117 ? -22.883 100.761 38.294 1.00 26.90 ? 117  GLY A C   1 
ATOM   911  O  O   . GLY A 1 117 ? -22.804 100.418 39.474 1.00 27.12 ? 117  GLY A O   1 
ATOM   912  N  N   . GLY A 1 118 ? -22.572 101.982 37.876 1.00 25.72 ? 118  GLY A N   1 
ATOM   913  C  CA  . GLY A 1 118 ? -22.082 102.968 38.819 1.00 23.95 ? 118  GLY A CA  1 
ATOM   914  C  C   . GLY A 1 118 ? -20.750 103.530 38.367 1.00 23.88 ? 118  GLY A C   1 
ATOM   915  O  O   . GLY A 1 118 ? -19.888 103.857 39.188 1.00 23.77 ? 118  GLY A O   1 
ATOM   916  N  N   . GLY A 1 119 ? -20.577 103.622 37.051 1.00 22.49 ? 119  GLY A N   1 
ATOM   917  C  CA  . GLY A 1 119 ? -19.352 104.171 36.487 1.00 22.22 ? 119  GLY A CA  1 
ATOM   918  C  C   . GLY A 1 119 ? -18.039 103.475 36.825 1.00 21.25 ? 119  GLY A C   1 
ATOM   919  O  O   . GLY A 1 119 ? -16.960 104.047 36.615 1.00 20.79 ? 119  GLY A O   1 
ATOM   920  N  N   . PHE A 1 120 ? -18.125 102.246 37.331 1.00 18.41 ? 120  PHE A N   1 
ATOM   921  C  CA  . PHE A 1 120 ? -16.943 101.473 37.699 1.00 17.19 ? 120  PHE A CA  1 
ATOM   922  C  C   . PHE A 1 120 ? -16.296 102.004 38.963 1.00 16.09 ? 120  PHE A C   1 
ATOM   923  O  O   . PHE A 1 120 ? -15.277 101.485 39.401 1.00 14.64 ? 120  PHE A O   1 
ATOM   924  C  CB  . PHE A 1 120 ? -15.905 101.462 36.564 1.00 18.30 ? 120  PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 120 ? -16.288 100.594 35.385 1.00 19.95 ? 120  PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 120 ? -16.478 99.221  35.543 1.00 18.37 ? 120  PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 120 ? -16.467 101.150 34.120 1.00 19.12 ? 120  PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 120 ? -16.841 98.420  34.462 1.00 17.01 ? 120  PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 120 ? -16.831 100.350 33.031 1.00 18.99 ? 120  PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 120 ? -17.018 98.985  33.208 1.00 17.16 ? 120  PHE A CZ  1 
ATOM   931  N  N   . TYR A 1 121 ? -16.895 103.030 39.561 1.00 16.78 ? 121  TYR A N   1 
ATOM   932  C  CA  . TYR A 1 121 ? -16.347 103.613 40.786 1.00 16.48 ? 121  TYR A CA  1 
ATOM   933  C  C   . TYR A 1 121 ? -17.258 103.371 41.989 1.00 15.72 ? 121  TYR A C   1 
ATOM   934  O  O   . TYR A 1 121 ? -16.846 103.535 43.134 1.00 17.04 ? 121  TYR A O   1 
ATOM   935  C  CB  . TYR A 1 121 ? -16.124 105.121 40.598 1.00 16.69 ? 121  TYR A CB  1 
ATOM   936  C  CG  . TYR A 1 121 ? -17.387 105.955 40.658 1.00 18.80 ? 121  TYR A CG  1 
ATOM   937  C  CD1 . TYR A 1 121 ? -17.981 106.268 41.885 1.00 19.44 ? 121  TYR A CD1 1 
ATOM   938  C  CD2 . TYR A 1 121 ? -17.998 106.418 39.494 1.00 18.21 ? 121  TYR A CD2 1 
ATOM   939  C  CE1 . TYR A 1 121 ? -19.143 107.017 41.953 1.00 19.68 ? 121  TYR A CE1 1 
ATOM   940  C  CE2 . TYR A 1 121 ? -19.163 107.166 39.552 1.00 21.06 ? 121  TYR A CE2 1 
ATOM   941  C  CZ  . TYR A 1 121 ? -19.734 107.465 40.789 1.00 21.36 ? 121  TYR A CZ  1 
ATOM   942  O  OH  . TYR A 1 121 ? -20.892 108.215 40.865 1.00 23.64 ? 121  TYR A OH  1 
ATOM   943  N  N   . SER A 1 122 ? -18.500 102.987 41.721 1.00 15.10 ? 122  SER A N   1 
ATOM   944  C  CA  . SER A 1 122 ? -19.477 102.742 42.777 1.00 14.05 ? 122  SER A CA  1 
ATOM   945  C  C   . SER A 1 122 ? -20.406 101.603 42.380 1.00 14.75 ? 122  SER A C   1 
ATOM   946  O  O   . SER A 1 122 ? -20.471 101.226 41.208 1.00 13.74 ? 122  SER A O   1 
ATOM   947  C  CB  . SER A 1 122 ? -20.308 104.016 43.024 1.00 14.29 ? 122  SER A CB  1 
ATOM   948  O  OG  . SER A 1 122 ? -21.070 104.411 41.878 1.00 9.44  ? 122  SER A OG  1 
ATOM   949  N  N   . GLY A 1 123 ? -21.132 101.066 43.355 1.00 14.84 ? 123  GLY A N   1 
ATOM   950  C  CA  . GLY A 1 123 ? -22.058 99.985  43.065 1.00 17.49 ? 123  GLY A CA  1 
ATOM   951  C  C   . GLY A 1 123 ? -22.396 99.121  44.265 1.00 19.73 ? 123  GLY A C   1 
ATOM   952  O  O   . GLY A 1 123 ? -21.727 99.179  45.294 1.00 18.37 ? 123  GLY A O   1 
ATOM   953  N  N   . SER A 1 124 ? -23.445 98.316  44.129 1.00 22.29 ? 124  SER A N   1 
ATOM   954  C  CA  . SER A 1 124 ? -23.883 97.424  45.197 1.00 25.15 ? 124  SER A CA  1 
ATOM   955  C  C   . SER A 1 124 ? -24.895 96.460  44.623 1.00 27.34 ? 124  SER A C   1 
ATOM   956  O  O   . SER A 1 124 ? -25.793 96.872  43.890 1.00 28.03 ? 124  SER A O   1 
ATOM   957  C  CB  . SER A 1 124 ? -24.550 98.210  46.330 1.00 25.59 ? 124  SER A CB  1 
ATOM   958  O  OG  . SER A 1 124 ? -23.638 99.066  46.994 1.00 27.58 ? 124  SER A OG  1 
ATOM   959  N  N   . SER A 1 125 ? -24.755 95.180  44.952 1.00 28.95 ? 125  SER A N   1 
ATOM   960  C  CA  . SER A 1 125 ? -25.693 94.171  44.468 1.00 30.72 ? 125  SER A CA  1 
ATOM   961  C  C   . SER A 1 125 ? -26.872 94.057  45.428 1.00 31.34 ? 125  SER A C   1 
ATOM   962  O  O   . SER A 1 125 ? -27.746 93.207  45.253 1.00 30.86 ? 125  SER A O   1 
ATOM   963  C  CB  . SER A 1 125 ? -25.011 92.809  44.378 1.00 31.68 ? 125  SER A CB  1 
ATOM   964  O  OG  . SER A 1 125 ? -24.669 92.336  45.670 1.00 32.65 ? 125  SER A OG  1 
ATOM   965  N  N   . THR A 1 126 ? -26.896 94.927  46.432 1.00 31.70 ? 126  THR A N   1 
ATOM   966  C  CA  . THR A 1 126 ? -27.939 94.890  47.444 1.00 32.08 ? 126  THR A CA  1 
ATOM   967  C  C   . THR A 1 126 ? -28.861 96.091  47.505 1.00 33.75 ? 126  THR A C   1 
ATOM   968  O  O   . THR A 1 126 ? -29.518 96.293  48.524 1.00 33.95 ? 126  THR A O   1 
ATOM   969  C  CB  . THR A 1 126 ? -27.325 94.761  48.814 1.00 30.71 ? 126  THR A CB  1 
ATOM   970  O  OG1 . THR A 1 126 ? -26.553 95.933  49.079 1.00 28.37 ? 126  THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 126 ? -26.411 93.558  48.871 1.00 31.67 ? 126  THR A CG2 1 
ATOM   972  N  N   . LEU A 1 127 ? -28.904 96.905  46.451 1.00 34.43 ? 127  LEU A N   1 
ATOM   973  C  CA  . LEU A 1 127 ? -29.793 98.063  46.459 1.00 33.67 ? 127  LEU A CA  1 
ATOM   974  C  C   . LEU A 1 127 ? -31.223 97.553  46.378 1.00 34.54 ? 127  LEU A C   1 
ATOM   975  O  O   . LEU A 1 127 ? -31.481 96.479  45.828 1.00 35.63 ? 127  LEU A O   1 
ATOM   976  C  CB  . LEU A 1 127 ? -29.533 98.973  45.261 1.00 31.92 ? 127  LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 127 ? -28.131 99.522  45.034 1.00 31.60 ? 127  LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 127 ? -28.198 100.510 43.897 1.00 33.23 ? 127  LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 127 ? -27.599 100.201 46.275 1.00 32.18 ? 127  LEU A CD2 1 
ATOM   980  N  N   . ASP A 1 128 ? -32.153 98.324  46.922 1.00 34.38 ? 128  ASP A N   1 
ATOM   981  C  CA  . ASP A 1 128 ? -33.551 97.940  46.893 1.00 34.71 ? 128  ASP A CA  1 
ATOM   982  C  C   . ASP A 1 128 ? -33.992 97.713  45.449 1.00 34.56 ? 128  ASP A C   1 
ATOM   983  O  O   . ASP A 1 128 ? -34.775 96.809  45.159 1.00 35.41 ? 128  ASP A O   1 
ATOM   984  C  CB  . ASP A 1 128 ? -34.405 99.036  47.537 1.00 35.95 ? 128  ASP A CB  1 
ATOM   985  C  CG  . ASP A 1 128 ? -34.120 99.200  49.022 1.00 38.32 ? 128  ASP A CG  1 
ATOM   986  O  OD1 . ASP A 1 128 ? -33.120 98.630  49.507 1.00 41.16 ? 128  ASP A OD1 1 
ATOM   987  O  OD2 . ASP A 1 128 ? -34.889 99.903  49.710 1.00 39.72 ? 128  ASP A OD2 1 
ATOM   988  N  N   . VAL A 1 129 ? -33.464 98.518  44.537 1.00 34.23 ? 129  VAL A N   1 
ATOM   989  C  CA  . VAL A 1 129 ? -33.844 98.407  43.137 1.00 34.71 ? 129  VAL A CA  1 
ATOM   990  C  C   . VAL A 1 129 ? -33.287 97.180  42.396 1.00 36.53 ? 129  VAL A C   1 
ATOM   991  O  O   . VAL A 1 129 ? -33.648 96.946  41.240 1.00 37.91 ? 129  VAL A O   1 
ATOM   992  C  CB  . VAL A 1 129 ? -33.470 99.703  42.370 1.00 33.29 ? 129  VAL A CB  1 
ATOM   993  C  CG1 . VAL A 1 129 ? -31.983 99.735  42.068 1.00 32.34 ? 129  VAL A CG1 1 
ATOM   994  C  CG2 . VAL A 1 129 ? -34.291 99.810  41.119 1.00 32.81 ? 129  VAL A CG2 1 
ATOM   995  N  N   . TYR A 1 130 ? -32.422 96.393  43.044 1.00 36.19 ? 130  TYR A N   1 
ATOM   996  C  CA  . TYR A 1 130 ? -31.875 95.192  42.398 1.00 35.38 ? 130  TYR A CA  1 
ATOM   997  C  C   . TYR A 1 130 ? -32.334 93.913  43.092 1.00 36.15 ? 130  TYR A C   1 
ATOM   998  O  O   . TYR A 1 130 ? -31.697 92.856  42.966 1.00 34.03 ? 130  TYR A O   1 
ATOM   999  C  CB  . TYR A 1 130 ? -30.343 95.201  42.383 1.00 34.33 ? 130  TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 130 ? -29.703 96.411  41.748 1.00 33.15 ? 130  TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 130 ? -30.280 97.045  40.648 1.00 32.64 ? 130  TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 130 ? -28.497 96.909  42.236 1.00 33.35 ? 130  TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 130 ? -29.667 98.148  40.054 1.00 31.62 ? 130  TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 130 ? -27.878 98.006  41.649 1.00 31.54 ? 130  TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 130 ? -28.467 98.617  40.565 1.00 31.13 ? 130  TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 130 ? -27.849 99.700  40.002 1.00 33.02 ? 130  TYR A OH  1 
ATOM   1007 N  N   . ASN A 1 131 ? -33.431 94.009  43.837 1.00 37.14 ? 131  ASN A N   1 
ATOM   1008 C  CA  . ASN A 1 131 ? -33.954 92.846  44.532 1.00 37.63 ? 131  ASN A CA  1 
ATOM   1009 C  C   . ASN A 1 131 ? -34.508 91.894  43.490 1.00 36.94 ? 131  ASN A C   1 
ATOM   1010 O  O   . ASN A 1 131 ? -35.505 92.195  42.841 1.00 35.93 ? 131  ASN A O   1 
ATOM   1011 C  CB  . ASN A 1 131 ? -35.059 93.251  45.495 1.00 39.95 ? 131  ASN A CB  1 
ATOM   1012 C  CG  . ASN A 1 131 ? -35.228 92.256  46.620 1.00 42.93 ? 131  ASN A CG  1 
ATOM   1013 O  OD1 . ASN A 1 131 ? -35.662 91.122  46.408 1.00 43.91 ? 131  ASN A OD1 1 
ATOM   1014 N  ND2 . ASN A 1 131 ? -34.864 92.671  47.829 1.00 44.29 ? 131  ASN A ND2 1 
ATOM   1015 N  N   . GLY A 1 132 ? -33.858 90.745  43.332 1.00 36.73 ? 132  GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 132 ? -34.294 89.782  42.337 1.00 36.65 ? 132  GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 132 ? -35.577 89.020  42.606 1.00 36.13 ? 132  GLY A C   1 
ATOM   1018 O  O   . GLY A 1 132 ? -36.184 88.483  41.680 1.00 33.69 ? 132  GLY A O   1 
ATOM   1019 N  N   . LYS A 1 133 ? -36.006 88.978  43.862 1.00 38.16 ? 133  LYS A N   1 
ATOM   1020 C  CA  . LYS A 1 133 ? -37.211 88.234  44.215 1.00 40.99 ? 133  LYS A CA  1 
ATOM   1021 C  C   . LYS A 1 133 ? -38.399 88.458  43.275 1.00 41.11 ? 133  LYS A C   1 
ATOM   1022 O  O   . LYS A 1 133 ? -39.038 87.497  42.849 1.00 41.25 ? 133  LYS A O   1 
ATOM   1023 C  CB  . LYS A 1 133 ? -37.614 88.517  45.670 1.00 42.01 ? 133  LYS A CB  1 
ATOM   1024 C  CG  . LYS A 1 133 ? -38.208 89.886  45.947 1.00 44.82 ? 133  LYS A CG  1 
ATOM   1025 C  CD  . LYS A 1 133 ? -38.600 90.005  47.424 1.00 45.90 ? 133  LYS A CD  1 
ATOM   1026 C  CE  . LYS A 1 133 ? -39.595 91.134  47.655 1.00 46.28 ? 133  LYS A CE  1 
ATOM   1027 N  NZ  . LYS A 1 133 ? -40.053 91.214  49.069 1.00 46.30 ? 133  LYS A NZ  1 
ATOM   1028 N  N   . TYR A 1 134 ? -38.688 89.707  42.930 1.00 40.90 ? 134  TYR A N   1 
ATOM   1029 C  CA  . TYR A 1 134 ? -39.806 89.988  42.040 1.00 41.59 ? 134  TYR A CA  1 
ATOM   1030 C  C   . TYR A 1 134 ? -39.623 89.313  40.688 1.00 42.53 ? 134  TYR A C   1 
ATOM   1031 O  O   . TYR A 1 134 ? -40.445 88.498  40.271 1.00 42.71 ? 134  TYR A O   1 
ATOM   1032 C  CB  . TYR A 1 134 ? -39.950 91.493  41.843 1.00 43.35 ? 134  TYR A CB  1 
ATOM   1033 C  CG  . TYR A 1 134 ? -40.144 92.236  43.134 1.00 45.63 ? 134  TYR A CG  1 
ATOM   1034 C  CD1 . TYR A 1 134 ? -41.355 92.180  43.813 1.00 46.84 ? 134  TYR A CD1 1 
ATOM   1035 C  CD2 . TYR A 1 134 ? -39.099 92.959  43.706 1.00 47.60 ? 134  TYR A CD2 1 
ATOM   1036 C  CE1 . TYR A 1 134 ? -41.526 92.826  45.038 1.00 49.58 ? 134  TYR A CE1 1 
ATOM   1037 C  CE2 . TYR A 1 134 ? -39.254 93.609  44.934 1.00 49.63 ? 134  TYR A CE2 1 
ATOM   1038 C  CZ  . TYR A 1 134 ? -40.472 93.538  45.596 1.00 50.44 ? 134  TYR A CZ  1 
ATOM   1039 O  OH  . TYR A 1 134 ? -40.637 94.166  46.815 1.00 51.04 ? 134  TYR A OH  1 
ATOM   1040 N  N   . LEU A 1 135 ? -38.540 89.656  40.001 1.00 43.96 ? 135  LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 135 ? -38.262 89.083  38.689 1.00 44.34 ? 135  LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 135 ? -38.299 87.564  38.772 1.00 44.57 ? 135  LEU A C   1 
ATOM   1043 O  O   . LEU A 1 135 ? -39.025 86.910  38.023 1.00 43.68 ? 135  LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 135 ? -36.889 89.550  38.198 1.00 44.76 ? 135  LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 135 ? -36.484 89.292  36.744 1.00 44.47 ? 135  LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 135 ? -37.485 89.955  35.801 1.00 43.78 ? 135  LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 135 ? -35.080 89.847  36.511 1.00 44.11 ? 135  LEU A CD2 1 
ATOM   1048 N  N   . ALA A 1 136 ? -37.521 87.009  39.697 1.00 45.59 ? 136  ALA A N   1 
ATOM   1049 C  CA  . ALA A 1 136 ? -37.467 85.561  39.870 1.00 47.87 ? 136  ALA A CA  1 
ATOM   1050 C  C   . ALA A 1 136 ? -38.875 84.984  39.927 1.00 49.11 ? 136  ALA A C   1 
ATOM   1051 O  O   . ALA A 1 136 ? -39.251 84.138  39.115 1.00 48.50 ? 136  ALA A O   1 
ATOM   1052 C  CB  . ALA A 1 136 ? -36.704 85.209  41.144 1.00 46.17 ? 136  ALA A CB  1 
ATOM   1053 N  N   . TYR A 1 137 ? -39.650 85.474  40.887 1.00 50.93 ? 137  TYR A N   1 
ATOM   1054 C  CA  . TYR A 1 137 ? -41.022 85.032  41.108 1.00 51.89 ? 137  TYR A CA  1 
ATOM   1055 C  C   . TYR A 1 137 ? -41.963 85.144  39.904 1.00 51.52 ? 137  TYR A C   1 
ATOM   1056 O  O   . TYR A 1 137 ? -42.584 84.161  39.495 1.00 51.05 ? 137  TYR A O   1 
ATOM   1057 C  CB  . TYR A 1 137 ? -41.625 85.817  42.275 1.00 53.59 ? 137  TYR A CB  1 
ATOM   1058 C  CG  . TYR A 1 137 ? -43.060 85.456  42.562 1.00 56.56 ? 137  TYR A CG  1 
ATOM   1059 C  CD1 . TYR A 1 137 ? -43.374 84.296  43.266 1.00 57.98 ? 137  TYR A CD1 1 
ATOM   1060 C  CD2 . TYR A 1 137 ? -44.108 86.255  42.106 1.00 57.11 ? 137  TYR A CD2 1 
ATOM   1061 C  CE1 . TYR A 1 137 ? -44.700 83.935  43.510 1.00 58.95 ? 137  TYR A CE1 1 
ATOM   1062 C  CE2 . TYR A 1 137 ? -45.439 85.902  42.344 1.00 59.00 ? 137  TYR A CE2 1 
ATOM   1063 C  CZ  . TYR A 1 137 ? -45.726 84.739  43.049 1.00 58.72 ? 137  TYR A CZ  1 
ATOM   1064 O  OH  . TYR A 1 137 ? -47.031 84.383  43.306 1.00 58.86 ? 137  TYR A OH  1 
ATOM   1065 N  N   . THR A 1 138 ? -42.067 86.348  39.350 1.00 50.93 ? 138  THR A N   1 
ATOM   1066 C  CA  . THR A 1 138 ? -42.965 86.613  38.235 1.00 50.12 ? 138  THR A CA  1 
ATOM   1067 C  C   . THR A 1 138 ? -42.715 85.844  36.952 1.00 49.93 ? 138  THR A C   1 
ATOM   1068 O  O   . THR A 1 138 ? -43.667 85.430  36.286 1.00 49.97 ? 138  THR A O   1 
ATOM   1069 C  CB  . THR A 1 138 ? -42.975 88.101  37.883 1.00 50.68 ? 138  THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 138 ? -43.265 88.865  39.059 1.00 50.73 ? 138  THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 138 ? -44.035 88.384  36.818 1.00 49.94 ? 138  THR A CG2 1 
ATOM   1072 N  N   . GLU A 1 139 ? -41.448 85.661  36.592 1.00 49.00 ? 139  GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 139 ? -41.127 84.954  35.360 1.00 48.22 ? 139  GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 139 ? -40.541 83.563  35.585 1.00 47.26 ? 139  GLU A C   1 
ATOM   1075 O  O   . GLU A 1 139 ? -40.223 82.851  34.636 1.00 46.09 ? 139  GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 139 ? -40.175 85.799  34.510 1.00 49.25 ? 139  GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 139 ? -40.786 87.088  33.960 1.00 49.38 ? 139  GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 139 ? -41.962 86.840  33.027 1.00 51.01 ? 139  GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 139 ? -41.861 85.932  32.168 1.00 50.59 ? 139  GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 139 ? -42.981 87.562  33.147 1.00 50.31 ? 139  GLU A OE2 1 
ATOM   1081 N  N   . GLU A 1 140 ? -40.400 83.181  36.846 1.00 47.61 ? 140  GLU A N   1 
ATOM   1082 C  CA  . GLU A 1 140 ? -39.873 81.865  37.188 1.00 48.92 ? 140  GLU A CA  1 
ATOM   1083 C  C   . GLU A 1 140 ? -38.504 81.584  36.586 1.00 45.79 ? 140  GLU A C   1 
ATOM   1084 O  O   . GLU A 1 140 ? -38.352 80.699  35.743 1.00 45.37 ? 140  GLU A O   1 
ATOM   1085 C  CB  . GLU A 1 140 ? -40.864 80.787  36.751 1.00 53.46 ? 140  GLU A CB  1 
ATOM   1086 C  CG  . GLU A 1 140 ? -42.183 80.838  37.508 1.00 61.22 ? 140  GLU A CG  1 
ATOM   1087 C  CD  . GLU A 1 140 ? -43.206 79.849  36.975 1.00 66.61 ? 140  GLU A CD  1 
ATOM   1088 O  OE1 . GLU A 1 140 ? -42.846 79.045  36.083 1.00 69.90 ? 140  GLU A OE1 1 
ATOM   1089 O  OE2 . GLU A 1 140 ? -44.367 79.876  37.448 1.00 68.90 ? 140  GLU A OE2 1 
ATOM   1090 N  N   . VAL A 1 141 ? -37.513 82.339  37.045 1.00 42.88 ? 141  VAL A N   1 
ATOM   1091 C  CA  . VAL A 1 141 ? -36.140 82.211  36.585 1.00 41.27 ? 141  VAL A CA  1 
ATOM   1092 C  C   . VAL A 1 141 ? -35.217 82.380  37.784 1.00 40.80 ? 141  VAL A C   1 
ATOM   1093 O  O   . VAL A 1 141 ? -35.594 83.010  38.772 1.00 41.30 ? 141  VAL A O   1 
ATOM   1094 C  CB  . VAL A 1 141 ? -35.795 83.312  35.567 1.00 40.75 ? 141  VAL A CB  1 
ATOM   1095 C  CG1 . VAL A 1 141 ? -36.795 83.303  34.434 1.00 41.20 ? 141  VAL A CG1 1 
ATOM   1096 C  CG2 . VAL A 1 141 ? -35.794 84.672  36.253 1.00 40.37 ? 141  VAL A CG2 1 
ATOM   1097 N  N   . VAL A 1 142 ? -34.016 81.816  37.709 1.00 39.68 ? 142  VAL A N   1 
ATOM   1098 C  CA  . VAL A 1 142 ? -33.057 81.958  38.802 1.00 38.93 ? 142  VAL A CA  1 
ATOM   1099 C  C   . VAL A 1 142 ? -32.279 83.250  38.566 1.00 38.06 ? 142  VAL A C   1 
ATOM   1100 O  O   . VAL A 1 142 ? -31.370 83.295  37.733 1.00 39.03 ? 142  VAL A O   1 
ATOM   1101 C  CB  . VAL A 1 142 ? -32.065 80.764  38.859 1.00 39.34 ? 142  VAL A CB  1 
ATOM   1102 C  CG1 . VAL A 1 142 ? -30.916 81.072  39.813 1.00 37.54 ? 142  VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A 1 142 ? -32.791 79.515  39.311 1.00 37.35 ? 142  VAL A CG2 1 
ATOM   1104 N  N   . LEU A 1 143 ? -32.657 84.304  39.284 1.00 35.33 ? 143  LEU A N   1 
ATOM   1105 C  CA  . LEU A 1 143 ? -31.999 85.590  39.144 1.00 33.19 ? 143  LEU A CA  1 
ATOM   1106 C  C   . LEU A 1 143 ? -30.773 85.636  40.056 1.00 33.04 ? 143  LEU A C   1 
ATOM   1107 O  O   . LEU A 1 143 ? -30.858 85.334  41.248 1.00 33.60 ? 143  LEU A O   1 
ATOM   1108 C  CB  . LEU A 1 143 ? -32.977 86.712  39.499 1.00 32.21 ? 143  LEU A CB  1 
ATOM   1109 C  CG  . LEU A 1 143 ? -32.609 88.158  39.139 1.00 31.38 ? 143  LEU A CG  1 
ATOM   1110 C  CD1 . LEU A 1 143 ? -31.399 88.609  39.936 1.00 31.29 ? 143  LEU A CD1 1 
ATOM   1111 C  CD2 . LEU A 1 143 ? -32.329 88.257  37.650 1.00 32.33 ? 143  LEU A CD2 1 
ATOM   1112 N  N   . VAL A 1 144 ? -29.629 86.001  39.488 1.00 31.73 ? 144  VAL A N   1 
ATOM   1113 C  CA  . VAL A 1 144 ? -28.389 86.087  40.254 1.00 31.57 ? 144  VAL A CA  1 
ATOM   1114 C  C   . VAL A 1 144 ? -27.824 87.502  40.194 1.00 31.80 ? 144  VAL A C   1 
ATOM   1115 O  O   . VAL A 1 144 ? -27.772 88.098  39.120 1.00 33.58 ? 144  VAL A O   1 
ATOM   1116 C  CB  . VAL A 1 144 ? -27.303 85.152  39.676 1.00 31.49 ? 144  VAL A CB  1 
ATOM   1117 C  CG1 . VAL A 1 144 ? -26.046 85.227  40.544 1.00 30.41 ? 144  VAL A CG1 1 
ATOM   1118 C  CG2 . VAL A 1 144 ? -27.827 83.732  39.564 1.00 28.55 ? 144  VAL A CG2 1 
ATOM   1119 N  N   . SER A 1 145 ? -27.407 88.055  41.328 1.00 30.65 ? 145  SER A N   1 
ATOM   1120 C  CA  . SER A 1 145 ? -26.809 89.387  41.293 1.00 28.91 ? 145  SER A CA  1 
ATOM   1121 C  C   . SER A 1 145 ? -25.396 89.240  41.843 1.00 29.18 ? 145  SER A C   1 
ATOM   1122 O  O   . SER A 1 145 ? -25.206 88.890  43.008 1.00 30.50 ? 145  SER A O   1 
ATOM   1123 C  CB  . SER A 1 145 ? -27.628 90.402  42.111 1.00 25.91 ? 145  SER A CB  1 
ATOM   1124 O  OG  . SER A 1 145 ? -27.420 90.285  43.503 1.00 23.31 ? 145  SER A OG  1 
ATOM   1125 N  N   . LEU A 1 146 ? -24.403 89.467  40.989 1.00 28.34 ? 146  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 146 ? -23.007 89.343  41.405 1.00 28.65 ? 146  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 146 ? -22.448 90.662  41.957 1.00 28.82 ? 146  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 146 ? -23.184 91.634  42.164 1.00 27.73 ? 146  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 146 ? -22.155 88.853  40.225 1.00 27.64 ? 146  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 146 ? -22.075 89.722  38.963 1.00 29.15 ? 146  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 146 ? -21.267 90.966  39.257 1.00 30.21 ? 146  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 146 ? -21.414 88.959  37.825 1.00 28.84 ? 146  LEU A CD2 1 
ATOM   1133 N  N   . SER A 1 147 ? -21.143 90.691  42.199 1.00 27.95 ? 147  SER A N   1 
ATOM   1134 C  CA  . SER A 1 147 ? -20.497 91.886  42.716 1.00 28.39 ? 147  SER A CA  1 
ATOM   1135 C  C   . SER A 1 147 ? -19.057 91.873  42.259 1.00 29.56 ? 147  SER A C   1 
ATOM   1136 O  O   . SER A 1 147 ? -18.488 90.807  42.032 1.00 31.33 ? 147  SER A O   1 
ATOM   1137 C  CB  . SER A 1 147 ? -20.523 91.900  44.241 1.00 28.72 ? 147  SER A CB  1 
ATOM   1138 O  OG  . SER A 1 147 ? -19.581 90.983  44.780 1.00 27.87 ? 147  SER A OG  1 
ATOM   1139 N  N   . TYR A 1 148 ? -18.465 93.052  42.125 1.00 29.22 ? 148  TYR A N   1 
ATOM   1140 C  CA  . TYR A 1 148 ? -17.074 93.152  41.707 1.00 28.30 ? 148  TYR A CA  1 
ATOM   1141 C  C   . TYR A 1 148 ? -16.454 94.361  42.363 1.00 28.57 ? 148  TYR A C   1 
ATOM   1142 O  O   . TYR A 1 148 ? -17.154 95.289  42.766 1.00 29.34 ? 148  TYR A O   1 
ATOM   1143 C  CB  . TYR A 1 148 ? -16.969 93.301  40.194 1.00 27.28 ? 148  TYR A CB  1 
ATOM   1144 C  CG  . TYR A 1 148 ? -17.809 94.424  39.637 1.00 25.62 ? 148  TYR A CG  1 
ATOM   1145 C  CD1 . TYR A 1 148 ? -19.181 94.262  39.448 1.00 26.06 ? 148  TYR A CD1 1 
ATOM   1146 C  CD2 . TYR A 1 148 ? -17.236 95.650  39.294 1.00 24.49 ? 148  TYR A CD2 1 
ATOM   1147 C  CE1 . TYR A 1 148 ? -19.968 95.292  38.920 1.00 24.02 ? 148  TYR A CE1 1 
ATOM   1148 C  CE2 . TYR A 1 148 ? -18.011 96.684  38.772 1.00 24.06 ? 148  TYR A CE2 1 
ATOM   1149 C  CZ  . TYR A 1 148 ? -19.375 96.494  38.586 1.00 22.90 ? 148  TYR A CZ  1 
ATOM   1150 O  OH  . TYR A 1 148 ? -20.141 97.495  38.056 1.00 19.94 ? 148  TYR A OH  1 
ATOM   1151 N  N   . ARG A 1 149 ? -15.136 94.348  42.474 1.00 28.00 ? 149  ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 149 ? -14.438 95.462  43.078 1.00 27.40 ? 149  ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 149 ? -14.565 96.672  42.168 1.00 27.09 ? 149  ARG A C   1 
ATOM   1154 O  O   . ARG A 1 149 ? -14.554 96.540  40.948 1.00 27.93 ? 149  ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 149 ? -12.967 95.103  43.279 1.00 28.06 ? 149  ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 149 ? -12.722 94.190  44.462 1.00 27.32 ? 149  ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 149 ? -11.287 93.713  44.479 1.00 28.20 ? 149  ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 149 ? -11.090 92.551  43.619 1.00 27.91 ? 149  ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 149 ? -9.898  92.125  43.230 1.00 27.09 ? 149  ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 149 ? -8.819  92.782  43.628 1.00 27.10 ? 149  ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 149 ? -9.785  91.051  42.456 1.00 24.83 ? 149  ARG A NH2 1 
ATOM   1162 N  N   . VAL A 1 150 ? -14.708 97.850  42.767 1.00 27.19 ? 150  VAL A N   1 
ATOM   1163 C  CA  . VAL A 1 150 ? -14.828 99.089  42.005 1.00 25.39 ? 150  VAL A CA  1 
ATOM   1164 C  C   . VAL A 1 150 ? -13.768 100.042 42.516 1.00 25.63 ? 150  VAL A C   1 
ATOM   1165 O  O   . VAL A 1 150 ? -13.132 99.776  43.537 1.00 26.48 ? 150  VAL A O   1 
ATOM   1166 C  CB  . VAL A 1 150 ? -16.211 99.750  42.203 1.00 24.42 ? 150  VAL A CB  1 
ATOM   1167 C  CG1 . VAL A 1 150 ? -17.308 98.837  41.700 1.00 24.41 ? 150  VAL A CG1 1 
ATOM   1168 C  CG2 . VAL A 1 150 ? -16.427 100.066 43.667 1.00 22.57 ? 150  VAL A CG2 1 
ATOM   1169 N  N   . GLY A 1 151 ? -13.588 101.155 41.812 1.00 25.65 ? 151  GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 151 ? -12.599 102.138 42.217 1.00 25.77 ? 151  GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 151 ? -11.179 101.643 42.061 1.00 26.68 ? 151  GLY A C   1 
ATOM   1172 O  O   . GLY A 1 151 ? -10.915 100.695 41.327 1.00 28.03 ? 151  GLY A O   1 
ATOM   1173 N  N   . ALA A 1 152 ? -10.245 102.285 42.745 1.00 27.42 ? 152  ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 152 ? -8.855  101.866 42.652 1.00 28.11 ? 152  ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 152 ? -8.774  100.361 42.931 1.00 28.89 ? 152  ALA A C   1 
ATOM   1176 O  O   . ALA A 1 152 ? -8.059  99.624  42.250 1.00 28.05 ? 152  ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 152 ? -8.010  102.642 43.663 1.00 26.14 ? 152  ALA A CB  1 
ATOM   1178 N  N   . PHE A 1 153 ? -9.542  99.924  43.926 1.00 29.02 ? 153  PHE A N   1 
ATOM   1179 C  CA  . PHE A 1 153 ? -9.588  98.532  44.369 1.00 28.35 ? 153  PHE A CA  1 
ATOM   1180 C  C   . PHE A 1 153 ? -9.893  97.493  43.298 1.00 26.95 ? 153  PHE A C   1 
ATOM   1181 O  O   . PHE A 1 153 ? -9.555  96.318  43.457 1.00 28.40 ? 153  PHE A O   1 
ATOM   1182 C  CB  . PHE A 1 153 ? -10.620 98.407  45.487 1.00 29.59 ? 153  PHE A CB  1 
ATOM   1183 C  CG  . PHE A 1 153 ? -10.424 99.402  46.597 1.00 31.80 ? 153  PHE A CG  1 
ATOM   1184 C  CD1 . PHE A 1 153 ? -9.470  99.189  47.583 1.00 31.36 ? 153  PHE A CD1 1 
ATOM   1185 C  CD2 . PHE A 1 153 ? -11.191 100.561 46.650 1.00 32.47 ? 153  PHE A CD2 1 
ATOM   1186 C  CE1 . PHE A 1 153 ? -9.287  100.118 48.605 1.00 33.43 ? 153  PHE A CE1 1 
ATOM   1187 C  CE2 . PHE A 1 153 ? -11.013 101.492 47.667 1.00 32.96 ? 153  PHE A CE2 1 
ATOM   1188 C  CZ  . PHE A 1 153 ? -10.060 101.272 48.647 1.00 31.90 ? 153  PHE A CZ  1 
ATOM   1189 N  N   . GLY A 1 154 ? -10.532 97.912  42.214 1.00 24.73 ? 154  GLY A N   1 
ATOM   1190 C  CA  . GLY A 1 154 ? -10.871 96.966  41.172 1.00 23.09 ? 154  GLY A CA  1 
ATOM   1191 C  C   . GLY A 1 154 ? -10.347 97.313  39.797 1.00 23.28 ? 154  GLY A C   1 
ATOM   1192 O  O   . GLY A 1 154 ? -10.471 96.517  38.867 1.00 23.33 ? 154  GLY A O   1 
ATOM   1193 N  N   . PHE A 1 155 ? -9.744  98.486  39.645 1.00 23.45 ? 155  PHE A N   1 
ATOM   1194 C  CA  . PHE A 1 155 ? -9.251  98.854  38.330 1.00 24.28 ? 155  PHE A CA  1 
ATOM   1195 C  C   . PHE A 1 155 ? -7.911  99.575  38.257 1.00 25.28 ? 155  PHE A C   1 
ATOM   1196 O  O   . PHE A 1 155 ? -7.449  99.893  37.157 1.00 27.82 ? 155  PHE A O   1 
ATOM   1197 C  CB  . PHE A 1 155 ? -10.337 99.649  37.591 1.00 21.75 ? 155  PHE A CB  1 
ATOM   1198 C  CG  . PHE A 1 155 ? -11.575 98.850  37.334 1.00 18.17 ? 155  PHE A CG  1 
ATOM   1199 C  CD1 . PHE A 1 155 ? -11.541 97.758  36.481 1.00 17.20 ? 155  PHE A CD1 1 
ATOM   1200 C  CD2 . PHE A 1 155 ? -12.751 99.132  38.004 1.00 17.03 ? 155  PHE A CD2 1 
ATOM   1201 C  CE1 . PHE A 1 155 ? -12.659 96.954  36.308 1.00 16.24 ? 155  PHE A CE1 1 
ATOM   1202 C  CE2 . PHE A 1 155 ? -13.875 98.332  37.834 1.00 16.03 ? 155  PHE A CE2 1 
ATOM   1203 C  CZ  . PHE A 1 155 ? -13.827 97.243  36.986 1.00 15.28 ? 155  PHE A CZ  1 
ATOM   1204 N  N   . LEU A 1 156 ? -7.287  99.829  39.405 1.00 25.55 ? 156  LEU A N   1 
ATOM   1205 C  CA  . LEU A 1 156 ? -5.978  100.485 39.423 1.00 27.00 ? 156  LEU A CA  1 
ATOM   1206 C  C   . LEU A 1 156 ? -5.135  99.748  38.384 1.00 29.03 ? 156  LEU A C   1 
ATOM   1207 O  O   . LEU A 1 156 ? -5.040  98.513  38.422 1.00 27.80 ? 156  LEU A O   1 
ATOM   1208 C  CB  . LEU A 1 156 ? -5.340  100.355 40.808 1.00 25.79 ? 156  LEU A CB  1 
ATOM   1209 C  CG  . LEU A 1 156 ? -3.909  100.882 40.926 1.00 28.52 ? 156  LEU A CG  1 
ATOM   1210 C  CD1 . LEU A 1 156 ? -3.906  102.391 40.738 1.00 29.98 ? 156  LEU A CD1 1 
ATOM   1211 C  CD2 . LEU A 1 156 ? -3.324  100.513 42.280 1.00 28.24 ? 156  LEU A CD2 1 
ATOM   1212 N  N   . ALA A 1 157 ? -4.519  100.480 37.458 1.00 31.29 ? 157  ALA A N   1 
ATOM   1213 C  CA  . ALA A 1 157 ? -3.758  99.793  36.421 1.00 34.61 ? 157  ALA A CA  1 
ATOM   1214 C  C   . ALA A 1 157 ? -2.327  100.203 36.108 1.00 36.53 ? 157  ALA A C   1 
ATOM   1215 O  O   . ALA A 1 157 ? -2.093  101.176 35.393 1.00 37.81 ? 157  ALA A O   1 
ATOM   1216 C  CB  . ALA A 1 157 ? -4.559  99.797  35.134 1.00 36.04 ? 157  ALA A CB  1 
ATOM   1217 N  N   . LEU A 1 158 ? -1.376  99.432  36.625 1.00 37.92 ? 158  LEU A N   1 
ATOM   1218 C  CA  . LEU A 1 158 ? 0.039   99.656  36.361 1.00 39.43 ? 158  LEU A CA  1 
ATOM   1219 C  C   . LEU A 1 158 ? 0.455   98.491  35.477 1.00 41.21 ? 158  LEU A C   1 
ATOM   1220 O  O   . LEU A 1 158 ? 1.177   97.595  35.914 1.00 42.65 ? 158  LEU A O   1 
ATOM   1221 C  CB  . LEU A 1 158 ? 0.847   99.640  37.658 1.00 39.04 ? 158  LEU A CB  1 
ATOM   1222 C  CG  . LEU A 1 158 ? 0.742   100.896 38.526 1.00 39.76 ? 158  LEU A CG  1 
ATOM   1223 C  CD1 . LEU A 1 158 ? 1.432   100.650 39.843 1.00 40.37 ? 158  LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A 1 158 ? 1.367   102.086 37.810 1.00 38.43 ? 158  LEU A CD2 1 
ATOM   1225 N  N   . HIS A 1 159 ? -0.034  98.503  34.240 1.00 42.39 ? 159  HIS A N   1 
ATOM   1226 C  CA  . HIS A 1 159 ? 0.251   97.449  33.270 1.00 42.93 ? 159  HIS A CA  1 
ATOM   1227 C  C   . HIS A 1 159 ? 1.736   97.114  33.250 1.00 44.08 ? 159  HIS A C   1 
ATOM   1228 O  O   . HIS A 1 159 ? 2.587   97.994  33.139 1.00 43.59 ? 159  HIS A O   1 
ATOM   1229 C  CB  . HIS A 1 159 ? -0.202  97.890  31.879 1.00 41.24 ? 159  HIS A CB  1 
ATOM   1230 C  CG  . HIS A 1 159 ? -0.047  96.838  30.826 1.00 40.26 ? 159  HIS A CG  1 
ATOM   1231 N  ND1 . HIS A 1 159 ? -0.831  95.705  30.782 1.00 38.82 ? 159  HIS A ND1 1 
ATOM   1232 C  CD2 . HIS A 1 159 ? 0.790   96.757  29.764 1.00 39.22 ? 159  HIS A CD2 1 
ATOM   1233 C  CE1 . HIS A 1 159 ? -0.486  94.975  29.737 1.00 37.86 ? 159  HIS A CE1 1 
ATOM   1234 N  NE2 . HIS A 1 159 ? 0.495   95.591  29.102 1.00 37.91 ? 159  HIS A NE2 1 
ATOM   1235 N  N   . GLY A 1 160 ? 2.036   95.827  33.357 1.00 46.31 ? 160  GLY A N   1 
ATOM   1236 C  CA  . GLY A 1 160 ? 3.420   95.382  33.373 1.00 47.73 ? 160  GLY A CA  1 
ATOM   1237 C  C   . GLY A 1 160 ? 3.647   94.609  34.655 1.00 48.11 ? 160  GLY A C   1 
ATOM   1238 O  O   . GLY A 1 160 ? 4.430   93.664  34.705 1.00 48.38 ? 160  GLY A O   1 
ATOM   1239 N  N   . SER A 1 161 ? 2.943   95.028  35.699 1.00 48.70 ? 161  SER A N   1 
ATOM   1240 C  CA  . SER A 1 161 ? 3.029   94.390  36.997 1.00 48.42 ? 161  SER A CA  1 
ATOM   1241 C  C   . SER A 1 161 ? 2.171   93.142  36.993 1.00 48.53 ? 161  SER A C   1 
ATOM   1242 O  O   . SER A 1 161 ? 1.401   92.907  36.060 1.00 48.25 ? 161  SER A O   1 
ATOM   1243 C  CB  . SER A 1 161 ? 2.520   95.340  38.083 1.00 48.88 ? 161  SER A CB  1 
ATOM   1244 O  OG  . SER A 1 161 ? 2.318   94.650  39.308 1.00 50.06 ? 161  SER A OG  1 
ATOM   1245 N  N   . GLN A 1 162 ? 2.323   92.337  38.037 1.00 49.06 ? 162  GLN A N   1 
ATOM   1246 C  CA  . GLN A 1 162 ? 1.531   91.126  38.193 1.00 49.07 ? 162  GLN A CA  1 
ATOM   1247 C  C   . GLN A 1 162 ? 0.771   91.252  39.502 1.00 48.26 ? 162  GLN A C   1 
ATOM   1248 O  O   . GLN A 1 162 ? -0.048  90.400  39.857 1.00 48.77 ? 162  GLN A O   1 
ATOM   1249 C  CB  . GLN A 1 162 ? 2.426   89.889  38.216 1.00 49.94 ? 162  GLN A CB  1 
ATOM   1250 C  CG  . GLN A 1 162 ? 2.566   89.241  36.858 1.00 52.71 ? 162  GLN A CG  1 
ATOM   1251 C  CD  . GLN A 1 162 ? 1.226   89.137  36.142 1.00 55.14 ? 162  GLN A CD  1 
ATOM   1252 O  OE1 . GLN A 1 162 ? 0.216   88.781  36.752 1.00 56.42 ? 162  GLN A OE1 1 
ATOM   1253 N  NE2 . GLN A 1 162 ? 1.213   89.440  34.842 1.00 54.21 ? 162  GLN A NE2 1 
ATOM   1254 N  N   . GLU A 1 163 ? 1.050   92.345  40.205 1.00 46.60 ? 163  GLU A N   1 
ATOM   1255 C  CA  . GLU A 1 163 ? 0.423   92.631  41.482 1.00 45.14 ? 163  GLU A CA  1 
ATOM   1256 C  C   . GLU A 1 163 ? -0.740  93.601  41.326 1.00 43.05 ? 163  GLU A C   1 
ATOM   1257 O  O   . GLU A 1 163 ? -1.661  93.601  42.139 1.00 44.12 ? 163  GLU A O   1 
ATOM   1258 C  CB  . GLU A 1 163 ? 1.463   93.201  42.454 1.00 47.16 ? 163  GLU A CB  1 
ATOM   1259 C  CG  . GLU A 1 163 ? 2.487   92.176  42.935 1.00 47.15 ? 163  GLU A CG  1 
ATOM   1260 C  CD  . GLU A 1 163 ? 1.853   91.072  43.762 1.00 47.54 ? 163  GLU A CD  1 
ATOM   1261 O  OE1 . GLU A 1 163 ? 1.319   91.379  44.844 1.00 47.69 ? 163  GLU A OE1 1 
ATOM   1262 O  OE2 . GLU A 1 163 ? 1.878   89.899  43.335 1.00 49.03 ? 163  GLU A OE2 1 
ATOM   1263 N  N   . ALA A 1 164 ? -0.691  94.423  40.281 1.00 40.40 ? 164  ALA A N   1 
ATOM   1264 C  CA  . ALA A 1 164 ? -1.746  95.402  39.998 1.00 37.36 ? 164  ALA A CA  1 
ATOM   1265 C  C   . ALA A 1 164 ? -1.904  95.561  38.485 1.00 35.91 ? 164  ALA A C   1 
ATOM   1266 O  O   . ALA A 1 164 ? -1.681  96.647  37.941 1.00 34.29 ? 164  ALA A O   1 
ATOM   1267 C  CB  . ALA A 1 164 ? -1.390  96.738  40.619 1.00 37.03 ? 164  ALA A CB  1 
ATOM   1268 N  N   . PRO A 1 165 ? -2.298  94.475  37.788 1.00 34.20 ? 165  PRO A N   1 
ATOM   1269 C  CA  . PRO A 1 165 ? -2.487  94.461  36.334 1.00 33.76 ? 165  PRO A CA  1 
ATOM   1270 C  C   . PRO A 1 165 ? -3.638  95.298  35.806 1.00 34.03 ? 165  PRO A C   1 
ATOM   1271 O  O   . PRO A 1 165 ? -3.573  95.795  34.682 1.00 34.99 ? 165  PRO A O   1 
ATOM   1272 C  CB  . PRO A 1 165 ? -2.681  92.982  36.027 1.00 32.53 ? 165  PRO A CB  1 
ATOM   1273 C  CG  . PRO A 1 165 ? -3.409  92.501  37.223 1.00 33.24 ? 165  PRO A CG  1 
ATOM   1274 C  CD  . PRO A 1 165 ? -2.641  93.160  38.358 1.00 33.19 ? 165  PRO A CD  1 
ATOM   1275 N  N   . GLY A 1 166 ? -4.682  95.458  36.616 1.00 32.87 ? 166  GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 166 ? -5.839  96.213  36.180 1.00 31.51 ? 166  GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 166 ? -6.895  95.240  35.693 1.00 31.07 ? 166  GLY A C   1 
ATOM   1278 O  O   . GLY A 1 166 ? -6.615  94.053  35.552 1.00 30.71 ? 166  GLY A O   1 
ATOM   1279 N  N   . ASN A 1 167 ? -8.102  95.740  35.439 1.00 31.32 ? 167  ASN A N   1 
ATOM   1280 C  CA  . ASN A 1 167 ? -9.222  94.925  34.974 1.00 30.60 ? 167  ASN A CA  1 
ATOM   1281 C  C   . ASN A 1 167 ? -9.604  93.816  35.947 1.00 30.52 ? 167  ASN A C   1 
ATOM   1282 O  O   . ASN A 1 167 ? -10.469 92.988  35.642 1.00 31.38 ? 167  ASN A O   1 
ATOM   1283 C  CB  . ASN A 1 167 ? -8.915  94.290  33.619 1.00 31.92 ? 167  ASN A CB  1 
ATOM   1284 C  CG  . ASN A 1 167 ? -8.894  95.294  32.497 1.00 32.21 ? 167  ASN A CG  1 
ATOM   1285 O  OD1 . ASN A 1 167 ? -9.790  96.119  32.378 1.00 33.73 ? 167  ASN A OD1 1 
ATOM   1286 N  ND2 . ASN A 1 167 ? -7.876  95.219  31.655 1.00 32.55 ? 167  ASN A ND2 1 
ATOM   1287 N  N   . VAL A 1 168 ? -8.972  93.801  37.117 1.00 29.29 ? 168  VAL A N   1 
ATOM   1288 C  CA  . VAL A 1 168 ? -9.256  92.767  38.105 1.00 26.54 ? 168  VAL A CA  1 
ATOM   1289 C  C   . VAL A 1 168 ? -10.730 92.800  38.467 1.00 25.36 ? 168  VAL A C   1 
ATOM   1290 O  O   . VAL A 1 168 ? -11.298 91.779  38.844 1.00 25.79 ? 168  VAL A O   1 
ATOM   1291 C  CB  . VAL A 1 168 ? -8.389  92.946  39.379 1.00 25.97 ? 168  VAL A CB  1 
ATOM   1292 C  CG1 . VAL A 1 168 ? -6.927  93.166  38.988 1.00 22.99 ? 168  VAL A CG1 1 
ATOM   1293 C  CG2 . VAL A 1 168 ? -8.900  94.102  40.205 1.00 25.30 ? 168  VAL A CG2 1 
ATOM   1294 N  N   . GLY A 1 169 ? -11.343 93.976  38.337 1.00 24.68 ? 169  GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 169 ? -12.757 94.122  38.638 1.00 24.05 ? 169  GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 169 ? -13.564 93.252  37.694 1.00 24.47 ? 169  GLY A C   1 
ATOM   1297 O  O   . GLY A 1 169 ? -14.438 92.487  38.108 1.00 22.12 ? 169  GLY A O   1 
ATOM   1298 N  N   . LEU A 1 170 ? -13.252 93.376  36.409 1.00 25.84 ? 170  LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 170 ? -13.911 92.599  35.374 1.00 27.58 ? 170  LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 170 ? -13.635 91.130  35.616 1.00 29.18 ? 170  LEU A C   1 
ATOM   1301 O  O   . LEU A 1 170 ? -14.405 90.259  35.182 1.00 29.46 ? 170  LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 170 ? -13.366 92.979  34.006 1.00 28.23 ? 170  LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 170 ? -13.886 94.279  33.420 1.00 29.46 ? 170  LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 170 ? -13.018 94.693  32.247 1.00 28.35 ? 170  LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 170 ? -15.339 94.079  33.011 1.00 29.15 ? 170  LEU A CD2 1 
ATOM   1306 N  N   . LEU A 1 171 ? -12.524 90.858  36.298 1.00 28.89 ? 171  LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 171 ? -12.141 89.486  36.602 1.00 29.08 ? 171  LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 171 ? -13.029 88.895  37.685 1.00 30.17 ? 171  LEU A C   1 
ATOM   1309 O  O   . LEU A 1 171 ? -13.394 87.713  37.628 1.00 29.80 ? 171  LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 171 ? -10.670 89.432  36.997 1.00 25.87 ? 171  LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 171 ? -9.822  89.704  35.748 1.00 26.04 ? 171  LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 171 ? -8.346  89.860  36.097 1.00 24.65 ? 171  LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 171 ? -10.042 88.571  34.756 1.00 22.52 ? 171  LEU A CD2 1 
ATOM   1314 N  N   . ASP A 1 172 ? -13.391 89.724  38.662 1.00 30.84 ? 172  ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 172 ? -14.264 89.273  39.731 1.00 31.34 ? 172  ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 172 ? -15.601 88.841  39.118 1.00 32.80 ? 172  ASP A C   1 
ATOM   1317 O  O   . ASP A 1 172 ? -16.138 87.787  39.463 1.00 33.24 ? 172  ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 172 ? -14.478 90.391  40.759 1.00 30.60 ? 172  ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 172 ? -13.195 90.763  41.497 1.00 31.88 ? 172  ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 172 ? -12.239 89.967  41.468 1.00 33.94 ? 172  ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 172 ? -13.136 91.843  42.124 1.00 31.29 ? 172  ASP A OD2 1 
ATOM   1322 N  N   . GLN A 1 173 ? -16.122 89.644  38.191 1.00 33.19 ? 173  GLN A N   1 
ATOM   1323 C  CA  . GLN A 1 173 ? -17.396 89.336  37.550 1.00 32.82 ? 173  GLN A CA  1 
ATOM   1324 C  C   . GLN A 1 173 ? -17.282 88.028  36.795 1.00 33.41 ? 173  GLN A C   1 
ATOM   1325 O  O   . GLN A 1 173 ? -18.268 87.307  36.622 1.00 34.15 ? 173  GLN A O   1 
ATOM   1326 C  CB  . GLN A 1 173 ? -17.800 90.427  36.556 1.00 33.12 ? 173  GLN A CB  1 
ATOM   1327 C  CG  . GLN A 1 173 ? -17.380 91.836  36.907 1.00 32.39 ? 173  GLN A CG  1 
ATOM   1328 C  CD  . GLN A 1 173 ? -18.019 92.865  35.990 1.00 31.91 ? 173  GLN A CD  1 
ATOM   1329 O  OE1 . GLN A 1 173 ? -18.286 92.594  34.820 1.00 31.77 ? 173  GLN A OE1 1 
ATOM   1330 N  NE2 . GLN A 1 173 ? -18.258 94.056  36.517 1.00 32.43 ? 173  GLN A NE2 1 
ATOM   1331 N  N   . ARG A 1 174 ? -16.081 87.731  36.317 1.00 33.85 ? 174  ARG A N   1 
ATOM   1332 C  CA  . ARG A 1 174 ? -15.875 86.497  35.584 1.00 34.42 ? 174  ARG A CA  1 
ATOM   1333 C  C   . ARG A 1 174 ? -15.982 85.356  36.575 1.00 36.33 ? 174  ARG A C   1 
ATOM   1334 O  O   . ARG A 1 174 ? -16.866 84.505  36.465 1.00 38.25 ? 174  ARG A O   1 
ATOM   1335 C  CB  . ARG A 1 174 ? -14.499 86.476  34.922 1.00 33.38 ? 174  ARG A CB  1 
ATOM   1336 C  CG  . ARG A 1 174 ? -14.229 85.206  34.127 1.00 32.29 ? 174  ARG A CG  1 
ATOM   1337 C  CD  . ARG A 1 174 ? -12.875 85.250  33.439 1.00 32.31 ? 174  ARG A CD  1 
ATOM   1338 N  NE  . ARG A 1 174 ? -12.847 86.207  32.341 1.00 32.46 ? 174  ARG A NE  1 
ATOM   1339 C  CZ  . ARG A 1 174 ? -11.779 86.443  31.588 1.00 33.83 ? 174  ARG A CZ  1 
ATOM   1340 N  NH1 . ARG A 1 174 ? -10.648 85.791  31.819 1.00 34.86 ? 174  ARG A NH1 1 
ATOM   1341 N  NH2 . ARG A 1 174 ? -11.840 87.324  30.599 1.00 33.60 ? 174  ARG A NH2 1 
ATOM   1342 N  N   . MET A 1 175 ? -15.089 85.352  37.557 1.00 36.59 ? 175  MET A N   1 
ATOM   1343 C  CA  . MET A 1 175 ? -15.088 84.305  38.561 1.00 36.04 ? 175  MET A CA  1 
ATOM   1344 C  C   . MET A 1 175 ? -16.482 84.041  39.078 1.00 35.41 ? 175  MET A C   1 
ATOM   1345 O  O   . MET A 1 175 ? -16.804 82.915  39.431 1.00 37.14 ? 175  MET A O   1 
ATOM   1346 C  CB  . MET A 1 175 ? -14.190 84.685  39.716 1.00 37.28 ? 175  MET A CB  1 
ATOM   1347 C  CG  . MET A 1 175 ? -13.977 83.566  40.690 1.00 38.24 ? 175  MET A CG  1 
ATOM   1348 S  SD  . MET A 1 175 ? -12.573 83.988  41.714 1.00 44.32 ? 175  MET A SD  1 
ATOM   1349 C  CE  . MET A 1 175 ? -11.215 83.400  40.665 1.00 40.45 ? 175  MET A CE  1 
ATOM   1350 N  N   . ALA A 1 176 ? -17.309 85.079  39.128 1.00 35.08 ? 176  ALA A N   1 
ATOM   1351 C  CA  . ALA A 1 176 ? -18.685 84.929  39.587 1.00 34.22 ? 176  ALA A CA  1 
ATOM   1352 C  C   . ALA A 1 176 ? -19.457 84.193  38.501 1.00 34.34 ? 176  ALA A C   1 
ATOM   1353 O  O   . ALA A 1 176 ? -20.200 83.249  38.780 1.00 34.74 ? 176  ALA A O   1 
ATOM   1354 C  CB  . ALA A 1 176 ? -19.306 86.283  39.840 1.00 33.56 ? 176  ALA A CB  1 
ATOM   1355 N  N   . LEU A 1 177 ? -19.279 84.634  37.260 1.00 33.73 ? 177  LEU A N   1 
ATOM   1356 C  CA  . LEU A 1 177 ? -19.945 83.993  36.132 1.00 35.64 ? 177  LEU A CA  1 
ATOM   1357 C  C   . LEU A 1 177 ? -19.469 82.539  36.036 1.00 36.37 ? 177  LEU A C   1 
ATOM   1358 O  O   . LEU A 1 177 ? -20.201 81.651  35.584 1.00 35.88 ? 177  LEU A O   1 
ATOM   1359 C  CB  . LEU A 1 177 ? -19.629 84.747  34.839 1.00 33.69 ? 177  LEU A CB  1 
ATOM   1360 C  CG  . LEU A 1 177 ? -20.264 86.134  34.742 1.00 32.92 ? 177  LEU A CG  1 
ATOM   1361 C  CD1 . LEU A 1 177 ? -19.659 86.880  33.574 1.00 32.20 ? 177  LEU A CD1 1 
ATOM   1362 C  CD2 . LEU A 1 177 ? -21.777 86.007  34.590 1.00 30.10 ? 177  LEU A CD2 1 
ATOM   1363 N  N   . GLN A 1 178 ? -18.232 82.311  36.465 1.00 36.37 ? 178  GLN A N   1 
ATOM   1364 C  CA  . GLN A 1 178 ? -17.659 80.978  36.461 1.00 36.14 ? 178  GLN A CA  1 
ATOM   1365 C  C   . GLN A 1 178 ? -18.416 80.181  37.509 1.00 36.90 ? 178  GLN A C   1 
ATOM   1366 O  O   . GLN A 1 178 ? -19.025 79.160  37.208 1.00 37.39 ? 178  GLN A O   1 
ATOM   1367 C  CB  . GLN A 1 178 ? -16.175 81.026  36.834 1.00 35.33 ? 178  GLN A CB  1 
ATOM   1368 C  CG  . GLN A 1 178 ? -15.500 79.660  36.835 1.00 33.95 ? 178  GLN A CG  1 
ATOM   1369 C  CD  . GLN A 1 178 ? -15.441 79.032  35.448 1.00 34.44 ? 178  GLN A CD  1 
ATOM   1370 O  OE1 . GLN A 1 178 ? -14.802 79.564  34.537 1.00 35.96 ? 178  GLN A OE1 1 
ATOM   1371 N  NE2 . GLN A 1 178 ? -16.110 77.896  35.282 1.00 34.47 ? 178  GLN A NE2 1 
ATOM   1372 N  N   . TRP A 1 179 ? -18.389 80.671  38.744 1.00 37.16 ? 179  TRP A N   1 
ATOM   1373 C  CA  . TRP A 1 179 ? -19.064 79.999  39.842 1.00 37.58 ? 179  TRP A CA  1 
ATOM   1374 C  C   . TRP A 1 179 ? -20.520 79.667  39.528 1.00 39.41 ? 179  TRP A C   1 
ATOM   1375 O  O   . TRP A 1 179 ? -20.981 78.563  39.811 1.00 41.26 ? 179  TRP A O   1 
ATOM   1376 C  CB  . TRP A 1 179 ? -19.017 80.850  41.100 1.00 34.92 ? 179  TRP A CB  1 
ATOM   1377 C  CG  . TRP A 1 179 ? -19.471 80.097  42.304 1.00 34.64 ? 179  TRP A CG  1 
ATOM   1378 C  CD1 . TRP A 1 179 ? -18.685 79.420  43.195 1.00 35.03 ? 179  TRP A CD1 1 
ATOM   1379 C  CD2 . TRP A 1 179 ? -20.820 79.944  42.762 1.00 33.14 ? 179  TRP A CD2 1 
ATOM   1380 N  NE1 . TRP A 1 179 ? -19.463 78.862  44.184 1.00 34.59 ? 179  TRP A NE1 1 
ATOM   1381 C  CE2 . TRP A 1 179 ? -20.776 79.170  43.941 1.00 33.40 ? 179  TRP A CE2 1 
ATOM   1382 C  CE3 . TRP A 1 179 ? -22.062 80.388  42.291 1.00 32.94 ? 179  TRP A CE3 1 
ATOM   1383 C  CZ2 . TRP A 1 179 ? -21.926 78.833  44.658 1.00 33.12 ? 179  TRP A CZ2 1 
ATOM   1384 C  CZ3 . TRP A 1 179 ? -23.206 80.051  43.005 1.00 33.61 ? 179  TRP A CZ3 1 
ATOM   1385 C  CH2 . TRP A 1 179 ? -23.127 79.281  44.177 1.00 33.63 ? 179  TRP A CH2 1 
ATOM   1386 N  N   . VAL A 1 180 ? -21.254 80.619  38.965 1.00 40.71 ? 180  VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 180 ? -22.652 80.364  38.633 1.00 41.52 ? 180  VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 180 ? -22.672 79.179  37.677 1.00 42.76 ? 180  VAL A C   1 
ATOM   1389 O  O   . VAL A 1 180 ? -23.538 78.308  37.752 1.00 42.63 ? 180  VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 180 ? -23.311 81.597  37.946 1.00 40.54 ? 180  VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 180 ? -24.662 81.209  37.340 1.00 38.21 ? 180  VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 180 ? -23.490 82.722  38.963 1.00 38.24 ? 180  VAL A CG2 1 
ATOM   1393 N  N   . HIS A 1 181 ? -21.686 79.153  36.792 1.00 44.12 ? 181  HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 181 ? -21.562 78.100  35.801 1.00 46.29 ? 181  HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 181 ? -21.533 76.722  36.450 1.00 47.23 ? 181  HIS A C   1 
ATOM   1396 O  O   . HIS A 1 181 ? -22.372 75.865  36.152 1.00 47.54 ? 181  HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 181 ? -20.288 78.327  34.984 1.00 48.05 ? 181  HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 181 ? -20.062 77.308  33.913 1.00 49.77 ? 181  HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 181 ? -21.039 76.953  33.010 1.00 51.11 ? 181  HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 181 ? -18.957 76.604  33.570 1.00 50.65 ? 181  HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 181 ? -20.546 76.075  32.155 1.00 50.86 ? 181  HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 181 ? -19.286 75.846  32.471 1.00 51.98 ? 181  HIS A NE2 1 
ATOM   1403 N  N   . ASP A 1 182 ? -20.569 76.523  37.346 1.00 46.49 ? 182  ASP A N   1 
ATOM   1404 C  CA  . ASP A 1 182 ? -20.400 75.248  38.027 1.00 45.26 ? 182  ASP A CA  1 
ATOM   1405 C  C   . ASP A 1 182 ? -21.227 75.101  39.290 1.00 45.40 ? 182  ASP A C   1 
ATOM   1406 O  O   . ASP A 1 182 ? -20.885 74.298  40.154 1.00 46.18 ? 182  ASP A O   1 
ATOM   1407 C  CB  . ASP A 1 182 ? -18.931 75.027  38.390 1.00 44.67 ? 182  ASP A CB  1 
ATOM   1408 C  CG  . ASP A 1 182 ? -17.994 75.876  37.569 1.00 45.48 ? 182  ASP A CG  1 
ATOM   1409 O  OD1 . ASP A 1 182 ? -18.174 75.939  36.335 1.00 45.90 ? 182  ASP A OD1 1 
ATOM   1410 O  OD2 . ASP A 1 182 ? -17.069 76.476  38.159 1.00 45.80 ? 182  ASP A OD2 1 
ATOM   1411 N  N   . ASN A 1 183 ? -22.311 75.853  39.421 1.00 45.02 ? 183  ASN A N   1 
ATOM   1412 C  CA  . ASN A 1 183 ? -23.098 75.716  40.631 1.00 45.35 ? 183  ASN A CA  1 
ATOM   1413 C  C   . ASN A 1 183 ? -24.572 76.033  40.510 1.00 45.42 ? 183  ASN A C   1 
ATOM   1414 O  O   . ASN A 1 183 ? -25.376 75.491  41.263 1.00 46.41 ? 183  ASN A O   1 
ATOM   1415 C  CB  . ASN A 1 183 ? -22.499 76.574  41.749 1.00 46.80 ? 183  ASN A CB  1 
ATOM   1416 C  CG  . ASN A 1 183 ? -21.261 75.949  42.372 1.00 48.90 ? 183  ASN A CG  1 
ATOM   1417 O  OD1 . ASN A 1 183 ? -21.321 74.855  42.933 1.00 51.04 ? 183  ASN A OD1 1 
ATOM   1418 N  ND2 . ASN A 1 183 ? -20.132 76.643  42.281 1.00 49.92 ? 183  ASN A ND2 1 
ATOM   1419 N  N   . ILE A 1 184 ? -24.941 76.889  39.564 1.00 45.03 ? 184  ILE A N   1 
ATOM   1420 C  CA  . ILE A 1 184 ? -26.341 77.280  39.434 1.00 45.02 ? 184  ILE A CA  1 
ATOM   1421 C  C   . ILE A 1 184 ? -27.325 76.129  39.237 1.00 47.32 ? 184  ILE A C   1 
ATOM   1422 O  O   . ILE A 1 184 ? -28.527 76.298  39.454 1.00 49.53 ? 184  ILE A O   1 
ATOM   1423 C  CB  . ILE A 1 184 ? -26.539 78.326  38.304 1.00 42.52 ? 184  ILE A CB  1 
ATOM   1424 C  CG1 . ILE A 1 184 ? -27.693 79.265  38.671 1.00 40.89 ? 184  ILE A CG1 1 
ATOM   1425 C  CG2 . ILE A 1 184 ? -26.850 77.633  36.983 1.00 40.28 ? 184  ILE A CG2 1 
ATOM   1426 C  CD1 . ILE A 1 184 ? -27.559 79.908  40.041 1.00 36.35 ? 184  ILE A CD1 1 
ATOM   1427 N  N   . GLN A 1 185 ? -26.829 74.961  38.844 1.00 48.51 ? 185  GLN A N   1 
ATOM   1428 C  CA  . GLN A 1 185 ? -27.708 73.810  38.629 1.00 49.33 ? 185  GLN A CA  1 
ATOM   1429 C  C   . GLN A 1 185 ? -28.278 73.292  39.941 1.00 48.41 ? 185  GLN A C   1 
ATOM   1430 O  O   . GLN A 1 185 ? -29.456 72.951  40.020 1.00 47.61 ? 185  GLN A O   1 
ATOM   1431 C  CB  . GLN A 1 185 ? -26.951 72.687  37.919 1.00 51.33 ? 185  GLN A CB  1 
ATOM   1432 C  CG  . GLN A 1 185 ? -25.786 72.122  38.711 1.00 53.87 ? 185  GLN A CG  1 
ATOM   1433 C  CD  . GLN A 1 185 ? -24.729 71.528  37.809 1.00 55.40 ? 185  GLN A CD  1 
ATOM   1434 O  OE1 . GLN A 1 185 ? -24.096 72.242  37.032 1.00 57.66 ? 185  GLN A OE1 1 
ATOM   1435 N  NE2 . GLN A 1 185 ? -24.537 70.216  37.898 1.00 56.29 ? 185  GLN A NE2 1 
ATOM   1436 N  N   . PHE A 1 186 ? -27.438 73.241  40.969 1.00 47.46 ? 186  PHE A N   1 
ATOM   1437 C  CA  . PHE A 1 186 ? -27.864 72.768  42.272 1.00 46.59 ? 186  PHE A CA  1 
ATOM   1438 C  C   . PHE A 1 186 ? -29.037 73.592  42.783 1.00 45.69 ? 186  PHE A C   1 
ATOM   1439 O  O   . PHE A 1 186 ? -29.807 73.118  43.613 1.00 47.06 ? 186  PHE A O   1 
ATOM   1440 C  CB  . PHE A 1 186 ? -26.709 72.844  43.269 1.00 48.09 ? 186  PHE A CB  1 
ATOM   1441 C  CG  . PHE A 1 186 ? -25.463 72.139  42.810 1.00 50.46 ? 186  PHE A CG  1 
ATOM   1442 C  CD1 . PHE A 1 186 ? -25.484 70.782  42.512 1.00 50.73 ? 186  PHE A CD1 1 
ATOM   1443 C  CD2 . PHE A 1 186 ? -24.263 72.838  42.672 1.00 51.12 ? 186  PHE A CD2 1 
ATOM   1444 C  CE1 . PHE A 1 186 ? -24.329 70.129  42.081 1.00 51.17 ? 186  PHE A CE1 1 
ATOM   1445 C  CE2 . PHE A 1 186 ? -23.101 72.195  42.243 1.00 50.86 ? 186  PHE A CE2 1 
ATOM   1446 C  CZ  . PHE A 1 186 ? -23.135 70.839  41.946 1.00 51.32 ? 186  PHE A CZ  1 
ATOM   1447 N  N   . PHE A 1 187 ? -29.176 74.821  42.289 1.00 43.64 ? 187  PHE A N   1 
ATOM   1448 C  CA  . PHE A 1 187 ? -30.277 75.690  42.715 1.00 42.07 ? 187  PHE A CA  1 
ATOM   1449 C  C   . PHE A 1 187 ? -31.440 75.654  41.733 1.00 41.12 ? 187  PHE A C   1 
ATOM   1450 O  O   . PHE A 1 187 ? -32.357 76.475  41.806 1.00 39.08 ? 187  PHE A O   1 
ATOM   1451 C  CB  . PHE A 1 187 ? -29.809 77.141  42.864 1.00 40.92 ? 187  PHE A CB  1 
ATOM   1452 C  CG  . PHE A 1 187 ? -28.694 77.321  43.843 1.00 39.23 ? 187  PHE A CG  1 
ATOM   1453 C  CD1 . PHE A 1 187 ? -27.379 77.083  43.468 1.00 38.51 ? 187  PHE A CD1 1 
ATOM   1454 C  CD2 . PHE A 1 187 ? -28.956 77.730  45.142 1.00 38.86 ? 187  PHE A CD2 1 
ATOM   1455 C  CE1 . PHE A 1 187 ? -26.338 77.254  44.373 1.00 37.87 ? 187  PHE A CE1 1 
ATOM   1456 C  CE2 . PHE A 1 187 ? -27.925 77.902  46.056 1.00 38.89 ? 187  PHE A CE2 1 
ATOM   1457 C  CZ  . PHE A 1 187 ? -26.611 77.665  45.669 1.00 38.07 ? 187  PHE A CZ  1 
ATOM   1458 N  N   . GLY A 1 188 ? -31.392 74.703  40.811 1.00 40.76 ? 188  GLY A N   1 
ATOM   1459 C  CA  . GLY A 1 188 ? -32.449 74.583  39.829 1.00 42.19 ? 188  GLY A CA  1 
ATOM   1460 C  C   . GLY A 1 188 ? -32.160 75.397  38.583 1.00 43.10 ? 188  GLY A C   1 
ATOM   1461 O  O   . GLY A 1 188 ? -33.041 75.593  37.743 1.00 42.92 ? 188  GLY A O   1 
ATOM   1462 N  N   . GLY A 1 189 ? -30.924 75.868  38.454 1.00 43.05 ? 189  GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 189 ? -30.572 76.667  37.298 1.00 43.51 ? 189  GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 189 ? -29.990 75.856  36.161 1.00 44.25 ? 189  GLY A C   1 
ATOM   1465 O  O   . GLY A 1 189 ? -29.509 74.741  36.370 1.00 44.73 ? 189  GLY A O   1 
ATOM   1466 N  N   . ASP A 1 190 ? -30.048 76.414  34.954 1.00 44.40 ? 190  ASP A N   1 
ATOM   1467 C  CA  . ASP A 1 190 ? -29.499 75.761  33.768 1.00 44.36 ? 190  ASP A CA  1 
ATOM   1468 C  C   . ASP A 1 190 ? -28.278 76.556  33.293 1.00 44.07 ? 190  ASP A C   1 
ATOM   1469 O  O   . ASP A 1 190 ? -28.418 77.591  32.641 1.00 44.70 ? 190  ASP A O   1 
ATOM   1470 C  CB  . ASP A 1 190 ? -30.545 75.713  32.651 1.00 44.56 ? 190  ASP A CB  1 
ATOM   1471 C  CG  . ASP A 1 190 ? -29.992 75.115  31.370 1.00 45.51 ? 190  ASP A CG  1 
ATOM   1472 O  OD1 . ASP A 1 190 ? -28.780 74.796  31.355 1.00 42.64 ? 190  ASP A OD1 1 
ATOM   1473 O  OD2 . ASP A 1 190 ? -30.756 74.967  30.387 1.00 45.19 ? 190  ASP A OD2 1 
ATOM   1474 N  N   . PRO A 1 191 ? -27.063 76.075  33.602 1.00 43.19 ? 191  PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 191 ? -25.853 76.789  33.188 1.00 42.64 ? 191  PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 191 ? -25.679 77.015  31.697 1.00 43.08 ? 191  PRO A C   1 
ATOM   1477 O  O   . PRO A 1 191 ? -24.755 77.719  31.291 1.00 43.41 ? 191  PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 191 ? -24.726 75.955  33.797 1.00 42.70 ? 191  PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 191 ? -25.307 74.589  33.877 1.00 41.90 ? 191  PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 191 ? -26.719 74.849  34.340 1.00 43.05 ? 191  PRO A CD  1 
ATOM   1481 N  N   . LYS A 1 192 ? -26.569 76.440  30.888 1.00 43.74 ? 192  LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 192 ? -26.499 76.601  29.437 1.00 44.54 ? 192  LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 192 ? -27.508 77.632  28.931 1.00 44.25 ? 192  LYS A C   1 
ATOM   1484 O  O   . LYS A 1 192 ? -27.682 77.801  27.726 1.00 45.63 ? 192  LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 192 ? -26.743 75.256  28.723 1.00 46.92 ? 192  LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 192 ? -28.167 74.694  28.847 1.00 48.42 ? 192  LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 192 ? -28.390 73.388  28.055 1.00 49.94 ? 192  LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 192 ? -28.760 73.661  26.588 1.00 51.71 ? 192  LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 192 ? -29.235 72.452  25.842 1.00 48.90 ? 192  LYS A NZ  1 
ATOM   1490 N  N   . THR A 1 193 ? -28.175 78.323  29.846 1.00 43.04 ? 193  THR A N   1 
ATOM   1491 C  CA  . THR A 1 193 ? -29.155 79.320  29.442 1.00 42.97 ? 193  THR A CA  1 
ATOM   1492 C  C   . THR A 1 193 ? -29.024 80.559  30.317 1.00 42.41 ? 193  THR A C   1 
ATOM   1493 O  O   . THR A 1 193 ? -30.006 81.171  30.733 1.00 41.88 ? 193  THR A O   1 
ATOM   1494 C  CB  . THR A 1 193 ? -30.577 78.747  29.529 1.00 42.81 ? 193  THR A CB  1 
ATOM   1495 O  OG1 . THR A 1 193 ? -30.580 77.429  28.967 1.00 43.83 ? 193  THR A OG1 1 
ATOM   1496 C  CG2 . THR A 1 193 ? -31.551 79.605  28.732 1.00 42.27 ? 193  THR A CG2 1 
ATOM   1497 N  N   . VAL A 1 194 ? -27.773 80.918  30.571 1.00 41.78 ? 194  VAL A N   1 
ATOM   1498 C  CA  . VAL A 1 194 ? -27.423 82.068  31.387 1.00 40.32 ? 194  VAL A CA  1 
ATOM   1499 C  C   . VAL A 1 194 ? -27.382 83.342  30.552 1.00 38.32 ? 194  VAL A C   1 
ATOM   1500 O  O   . VAL A 1 194 ? -26.748 83.388  29.499 1.00 39.28 ? 194  VAL A O   1 
ATOM   1501 C  CB  . VAL A 1 194 ? -26.052 81.837  32.043 1.00 41.20 ? 194  VAL A CB  1 
ATOM   1502 C  CG1 . VAL A 1 194 ? -25.603 83.071  32.798 1.00 42.76 ? 194  VAL A CG1 1 
ATOM   1503 C  CG2 . VAL A 1 194 ? -26.139 80.649  32.974 1.00 41.19 ? 194  VAL A CG2 1 
ATOM   1504 N  N   . THR A 1 195 ? -28.053 84.379  31.035 1.00 34.94 ? 195  THR A N   1 
ATOM   1505 C  CA  . THR A 1 195 ? -28.101 85.656  30.336 1.00 32.29 ? 195  THR A CA  1 
ATOM   1506 C  C   . THR A 1 195 ? -27.584 86.764  31.252 1.00 32.17 ? 195  THR A C   1 
ATOM   1507 O  O   . THR A 1 195 ? -28.167 87.006  32.302 1.00 34.99 ? 195  THR A O   1 
ATOM   1508 C  CB  . THR A 1 195 ? -29.547 85.964  29.913 1.00 29.81 ? 195  THR A CB  1 
ATOM   1509 O  OG1 . THR A 1 195 ? -29.938 85.044  28.886 1.00 27.07 ? 195  THR A OG1 1 
ATOM   1510 C  CG2 . THR A 1 195 ? -29.681 87.397  29.421 1.00 27.61 ? 195  THR A CG2 1 
ATOM   1511 N  N   . ILE A 1 196 ? -26.490 87.426  30.872 1.00 29.85 ? 196  ILE A N   1 
ATOM   1512 C  CA  . ILE A 1 196 ? -25.942 88.495  31.705 1.00 26.14 ? 196  ILE A CA  1 
ATOM   1513 C  C   . ILE A 1 196 ? -26.532 89.839  31.322 1.00 26.37 ? 196  ILE A C   1 
ATOM   1514 O  O   . ILE A 1 196 ? -26.564 90.196  30.136 1.00 26.98 ? 196  ILE A O   1 
ATOM   1515 C  CB  . ILE A 1 196 ? -24.408 88.593  31.596 1.00 23.53 ? 196  ILE A CB  1 
ATOM   1516 C  CG1 . ILE A 1 196 ? -23.984 88.754  30.140 1.00 23.17 ? 196  ILE A CG1 1 
ATOM   1517 C  CG2 . ILE A 1 196 ? -23.774 87.368  32.192 1.00 24.84 ? 196  ILE A CG2 1 
ATOM   1518 C  CD1 . ILE A 1 196 ? -22.477 88.909  29.968 1.00 23.81 ? 196  ILE A CD1 1 
ATOM   1519 N  N   . PHE A 1 197 ? -27.006 90.579  32.325 1.00 24.99 ? 197  PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 197 ? -27.598 91.894  32.090 1.00 23.58 ? 197  PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 197 ? -27.174 92.929  33.137 1.00 24.15 ? 197  PHE A C   1 
ATOM   1522 O  O   . PHE A 1 197 ? -27.129 92.651  34.341 1.00 24.86 ? 197  PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 197 ? -29.140 91.776  31.968 1.00 20.68 ? 197  PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 197 ? -29.866 91.501  33.258 1.00 17.92 ? 197  PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 197 ? -29.450 90.503  34.126 1.00 18.58 ? 197  PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 197 ? -30.986 92.257  33.603 1.00 20.58 ? 197  PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 197 ? -30.133 90.261  35.330 1.00 19.07 ? 197  PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 197 ? -31.683 92.024  34.806 1.00 20.30 ? 197  PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 197 ? -31.250 91.026  35.668 1.00 19.38 ? 197  PHE A CZ  1 
ATOM   1530 N  N   . GLY A 1 198 ? -26.821 94.118  32.653 1.00 23.91 ? 198  GLY A N   1 
ATOM   1531 C  CA  . GLY A 1 198 ? -26.382 95.192  33.531 1.00 23.12 ? 198  GLY A CA  1 
ATOM   1532 C  C   . GLY A 1 198 ? -26.587 96.558  32.913 1.00 22.84 ? 198  GLY A C   1 
ATOM   1533 O  O   . GLY A 1 198 ? -26.628 96.707  31.690 1.00 23.66 ? 198  GLY A O   1 
ATOM   1534 N  N   . GLU A 1 199 ? -26.706 97.566  33.763 1.00 22.78 ? 199  GLU A N   1 
ATOM   1535 C  CA  . GLU A 1 199 ? -26.945 98.929  33.309 1.00 21.82 ? 199  GLU A CA  1 
ATOM   1536 C  C   . GLU A 1 199 ? -25.712 99.798  33.512 1.00 21.10 ? 199  GLU A C   1 
ATOM   1537 O  O   . GLU A 1 199 ? -24.910 99.549  34.402 1.00 20.65 ? 199  GLU A O   1 
ATOM   1538 C  CB  . GLU A 1 199 ? -28.146 99.491  34.073 1.00 21.22 ? 199  GLU A CB  1 
ATOM   1539 C  CG  . GLU A 1 199 ? -28.587 100.893 33.694 1.00 24.32 ? 199  GLU A CG  1 
ATOM   1540 C  CD  . GLU A 1 199 ? -27.771 101.984 34.376 1.00 26.34 ? 199  GLU A CD  1 
ATOM   1541 O  OE1 . GLU A 1 199 ? -27.140 101.717 35.426 1.00 27.26 ? 199  GLU A OE1 1 
ATOM   1542 O  OE2 . GLU A 1 199 ? -27.774 103.121 33.868 1.00 28.30 ? 199  GLU A OE2 1 
ATOM   1543 N  N   . SER A 1 200 ? -25.562 100.815 32.674 1.00 21.52 ? 200  SER A N   1 
ATOM   1544 C  CA  . SER A 1 200 ? -24.427 101.724 32.763 1.00 23.41 ? 200  SER A CA  1 
ATOM   1545 C  C   . SER A 1 200 ? -23.108 100.940 32.738 1.00 22.78 ? 200  SER A C   1 
ATOM   1546 O  O   . SER A 1 200 ? -22.844 100.198 31.795 1.00 22.20 ? 200  SER A O   1 
ATOM   1547 C  CB  . SER A 1 200 ? -24.537 102.571 34.043 1.00 25.01 ? 200  SER A CB  1 
ATOM   1548 O  OG  . SER A 1 200 ? -23.533 103.576 34.105 1.00 26.96 ? 200  SER A OG  1 
ATOM   1549 N  N   . ALA A 1 201 ? -22.277 101.110 33.761 1.00 22.56 ? 201  ALA A N   1 
ATOM   1550 C  CA  . ALA A 1 201 ? -21.015 100.384 33.818 1.00 22.32 ? 201  ALA A CA  1 
ATOM   1551 C  C   . ALA A 1 201 ? -21.310 98.891  33.693 1.00 21.80 ? 201  ALA A C   1 
ATOM   1552 O  O   . ALA A 1 201 ? -20.498 98.131  33.166 1.00 23.11 ? 201  ALA A O   1 
ATOM   1553 C  CB  . ALA A 1 201 ? -20.295 100.669 35.127 1.00 21.75 ? 201  ALA A CB  1 
ATOM   1554 N  N   . GLY A 1 202 ? -22.476 98.483  34.182 1.00 20.53 ? 202  GLY A N   1 
ATOM   1555 C  CA  . GLY A 1 202 ? -22.876 97.087  34.105 1.00 20.57 ? 202  GLY A CA  1 
ATOM   1556 C  C   . GLY A 1 202 ? -23.099 96.681  32.663 1.00 21.09 ? 202  GLY A C   1 
ATOM   1557 O  O   . GLY A 1 202 ? -22.738 95.573  32.255 1.00 21.31 ? 202  GLY A O   1 
ATOM   1558 N  N   . GLY A 1 203 ? -23.697 97.583  31.889 1.00 21.16 ? 203  GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 203 ? -23.928 97.314  30.480 1.00 21.02 ? 203  GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 203 ? -22.603 97.194  29.741 1.00 20.95 ? 203  GLY A C   1 
ATOM   1561 O  O   . GLY A 1 203 ? -22.386 96.272  28.951 1.00 19.97 ? 203  GLY A O   1 
ATOM   1562 N  N   . ALA A 1 204 ? -21.705 98.138  29.990 1.00 20.86 ? 204  ALA A N   1 
ATOM   1563 C  CA  . ALA A 1 204 ? -20.399 98.088  29.354 1.00 21.05 ? 204  ALA A CA  1 
ATOM   1564 C  C   . ALA A 1 204 ? -19.744 96.774  29.766 1.00 20.25 ? 204  ALA A C   1 
ATOM   1565 O  O   . ALA A 1 204 ? -19.067 96.125  28.966 1.00 19.09 ? 204  ALA A O   1 
ATOM   1566 C  CB  . ALA A 1 204 ? -19.549 99.261  29.799 1.00 19.98 ? 204  ALA A CB  1 
ATOM   1567 N  N   . SER A 1 205 ? -19.961 96.378  31.015 1.00 19.00 ? 205  SER A N   1 
ATOM   1568 C  CA  . SER A 1 205 ? -19.384 95.142  31.503 1.00 19.74 ? 205  SER A CA  1 
ATOM   1569 C  C   . SER A 1 205 ? -19.881 93.971  30.661 1.00 21.82 ? 205  SER A C   1 
ATOM   1570 O  O   . SER A 1 205 ? -19.076 93.203  30.121 1.00 22.70 ? 205  SER A O   1 
ATOM   1571 C  CB  . SER A 1 205 ? -19.731 94.950  32.976 1.00 19.61 ? 205  SER A CB  1 
ATOM   1572 O  OG  . SER A 1 205 ? -19.059 95.921  33.768 1.00 17.75 ? 205  SER A OG  1 
ATOM   1573 N  N   . VAL A 1 206 ? -21.199 93.843  30.530 1.00 21.89 ? 206  VAL A N   1 
ATOM   1574 C  CA  . VAL A 1 206 ? -21.772 92.768  29.726 1.00 21.18 ? 206  VAL A CA  1 
ATOM   1575 C  C   . VAL A 1 206 ? -21.099 92.737  28.357 1.00 22.15 ? 206  VAL A C   1 
ATOM   1576 O  O   . VAL A 1 206 ? -20.617 91.695  27.912 1.00 23.30 ? 206  VAL A O   1 
ATOM   1577 C  CB  . VAL A 1 206 ? -23.276 92.974  29.537 1.00 21.25 ? 206  VAL A CB  1 
ATOM   1578 C  CG1 . VAL A 1 206 ? -23.787 92.134  28.379 1.00 19.84 ? 206  VAL A CG1 1 
ATOM   1579 C  CG2 . VAL A 1 206 ? -23.994 92.614  30.814 1.00 21.93 ? 206  VAL A CG2 1 
ATOM   1580 N  N   . GLY A 1 207 ? -21.065 93.893  27.701 1.00 22.57 ? 207  GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 207 ? -20.452 93.999  26.389 1.00 21.09 ? 207  GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 207 ? -18.965 93.684  26.399 1.00 21.42 ? 207  GLY A C   1 
ATOM   1583 O  O   . GLY A 1 207 ? -18.417 93.252  25.395 1.00 19.14 ? 207  GLY A O   1 
ATOM   1584 N  N   . MET A 1 208 ? -18.291 93.893  27.522 1.00 23.08 ? 208  MET A N   1 
ATOM   1585 C  CA  . MET A 1 208 ? -16.866 93.593  27.560 1.00 25.43 ? 208  MET A CA  1 
ATOM   1586 C  C   . MET A 1 208 ? -16.674 92.102  27.707 1.00 27.11 ? 208  MET A C   1 
ATOM   1587 O  O   . MET A 1 208 ? -15.638 91.562  27.324 1.00 27.93 ? 208  MET A O   1 
ATOM   1588 C  CB  . MET A 1 208 ? -16.179 94.339  28.699 1.00 24.31 ? 208  MET A CB  1 
ATOM   1589 C  CG  . MET A 1 208 ? -16.125 95.832  28.456 1.00 24.81 ? 208  MET A CG  1 
ATOM   1590 S  SD  . MET A 1 208 ? -15.583 96.771  29.873 1.00 26.50 ? 208  MET A SD  1 
ATOM   1591 C  CE  . MET A 1 208 ? -14.918 98.187  29.072 1.00 26.66 ? 208  MET A CE  1 
ATOM   1592 N  N   . HIS A 1 209 ? -17.680 91.434  28.260 1.00 27.96 ? 209  HIS A N   1 
ATOM   1593 C  CA  . HIS A 1 209 ? -17.606 89.992  28.412 1.00 27.63 ? 209  HIS A CA  1 
ATOM   1594 C  C   . HIS A 1 209 ? -17.907 89.354  27.065 1.00 27.38 ? 209  HIS A C   1 
ATOM   1595 O  O   . HIS A 1 209 ? -17.479 88.241  26.798 1.00 28.28 ? 209  HIS A O   1 
ATOM   1596 C  CB  . HIS A 1 209 ? -18.583 89.514  29.483 1.00 26.61 ? 209  HIS A CB  1 
ATOM   1597 C  CG  . HIS A 1 209 ? -18.106 89.777  30.875 1.00 23.63 ? 209  HIS A CG  1 
ATOM   1598 N  ND1 . HIS A 1 209 ? -16.874 89.357  31.324 1.00 22.05 ? 209  HIS A ND1 1 
ATOM   1599 C  CD2 . HIS A 1 209 ? -18.683 90.425  31.913 1.00 23.88 ? 209  HIS A CD2 1 
ATOM   1600 C  CE1 . HIS A 1 209 ? -16.711 89.736  32.579 1.00 21.83 ? 209  HIS A CE1 1 
ATOM   1601 N  NE2 . HIS A 1 209 ? -17.795 90.386  32.960 1.00 22.45 ? 209  HIS A NE2 1 
ATOM   1602 N  N   . ILE A 1 210 ? -18.644 90.078  26.226 1.00 26.96 ? 210  ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 210 ? -18.976 89.625  24.876 1.00 26.46 ? 210  ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 210 ? -17.702 89.713  24.043 1.00 28.02 ? 210  ILE A C   1 
ATOM   1605 O  O   . ILE A 1 210 ? -17.491 88.936  23.124 1.00 29.03 ? 210  ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 210 ? -20.061 90.526  24.236 1.00 24.38 ? 210  ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 210 ? -21.444 90.004  24.601 1.00 25.07 ? 210  ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 210 ? -19.894 90.587  22.741 1.00 21.49 ? 210  ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 210 ? -22.420 91.089  24.946 1.00 26.22 ? 210  ILE A CD1 1 
ATOM   1610 N  N   . LEU A 1 211 ? -16.845 90.667  24.376 1.00 30.06 ? 211  LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 211 ? -15.601 90.829  23.650 1.00 31.39 ? 211  LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 211 ? -14.522 89.904  24.181 1.00 33.09 ? 211  LEU A C   1 
ATOM   1613 O  O   . LEU A 1 211 ? -13.903 89.162  23.422 1.00 34.37 ? 211  LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 211 ? -15.116 92.272  23.737 1.00 29.65 ? 211  LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 211 ? -15.938 93.283  22.943 1.00 29.62 ? 211  LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 211 ? -15.444 94.696  23.225 1.00 30.54 ? 211  LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 211 ? -15.833 92.967  21.478 1.00 29.17 ? 211  LEU A CD2 1 
ATOM   1618 N  N   . SER A 1 212 ? -14.302 89.937  25.489 1.00 34.73 ? 212  SER A N   1 
ATOM   1619 C  CA  . SER A 1 212 ? -13.257 89.113  26.093 1.00 34.70 ? 212  SER A CA  1 
ATOM   1620 C  C   . SER A 1 212 ? -13.436 87.612  25.883 1.00 34.02 ? 212  SER A C   1 
ATOM   1621 O  O   . SER A 1 212 ? -14.438 87.026  26.297 1.00 32.78 ? 212  SER A O   1 
ATOM   1622 C  CB  . SER A 1 212 ? -13.140 89.406  27.588 1.00 34.49 ? 212  SER A CB  1 
ATOM   1623 O  OG  . SER A 1 212 ? -11.948 88.852  28.116 1.00 35.44 ? 212  SER A OG  1 
ATOM   1624 N  N   . PRO A 1 213 ? -12.447 86.977  25.227 1.00 34.15 ? 213  PRO A N   1 
ATOM   1625 C  CA  . PRO A 1 213 ? -12.402 85.543  24.917 1.00 33.14 ? 213  PRO A CA  1 
ATOM   1626 C  C   . PRO A 1 213 ? -12.450 84.702  26.182 1.00 31.85 ? 213  PRO A C   1 
ATOM   1627 O  O   . PRO A 1 213 ? -13.021 83.619  26.200 1.00 32.29 ? 213  PRO A O   1 
ATOM   1628 C  CB  . PRO A 1 213 ? -11.073 85.394  24.192 1.00 32.63 ? 213  PRO A CB  1 
ATOM   1629 C  CG  . PRO A 1 213 ? -10.917 86.718  23.511 1.00 33.69 ? 213  PRO A CG  1 
ATOM   1630 C  CD  . PRO A 1 213 ? -11.309 87.675  24.599 1.00 33.77 ? 213  PRO A CD  1 
ATOM   1631 N  N   . GLY A 1 214 ? -11.847 85.214  27.244 1.00 31.42 ? 214  GLY A N   1 
ATOM   1632 C  CA  . GLY A 1 214 ? -11.834 84.485  28.496 1.00 31.77 ? 214  GLY A CA  1 
ATOM   1633 C  C   . GLY A 1 214 ? -13.138 84.527  29.269 1.00 30.80 ? 214  GLY A C   1 
ATOM   1634 O  O   . GLY A 1 214 ? -13.198 84.111  30.432 1.00 29.72 ? 214  GLY A O   1 
ATOM   1635 N  N   . SER A 1 215 ? -14.187 85.024  28.627 1.00 30.73 ? 215  SER A N   1 
ATOM   1636 C  CA  . SER A 1 215 ? -15.487 85.117  29.274 1.00 31.23 ? 215  SER A CA  1 
ATOM   1637 C  C   . SER A 1 215 ? -16.573 84.558  28.375 1.00 31.66 ? 215  SER A C   1 
ATOM   1638 O  O   . SER A 1 215 ? -17.575 84.030  28.854 1.00 32.68 ? 215  SER A O   1 
ATOM   1639 C  CB  . SER A 1 215 ? -15.819 86.581  29.604 1.00 30.13 ? 215  SER A CB  1 
ATOM   1640 O  OG  . SER A 1 215 ? -14.898 87.133  30.530 1.00 27.96 ? 215  SER A OG  1 
ATOM   1641 N  N   . ARG A 1 216 ? -16.361 84.679  27.072 1.00 31.32 ? 216  ARG A N   1 
ATOM   1642 C  CA  . ARG A 1 216 ? -17.327 84.236  26.077 1.00 33.04 ? 216  ARG A CA  1 
ATOM   1643 C  C   . ARG A 1 216 ? -18.088 82.946  26.376 1.00 33.85 ? 216  ARG A C   1 
ATOM   1644 O  O   . ARG A 1 216 ? -19.316 82.882  26.225 1.00 32.53 ? 216  ARG A O   1 
ATOM   1645 C  CB  . ARG A 1 216 ? -16.633 84.101  24.728 1.00 33.82 ? 216  ARG A CB  1 
ATOM   1646 C  CG  . ARG A 1 216 ? -16.031 85.387  24.223 1.00 34.61 ? 216  ARG A CG  1 
ATOM   1647 C  CD  . ARG A 1 216 ? -15.354 85.168  22.892 1.00 34.35 ? 216  ARG A CD  1 
ATOM   1648 N  NE  . ARG A 1 216 ? -14.820 86.408  22.348 1.00 35.77 ? 216  ARG A NE  1 
ATOM   1649 C  CZ  . ARG A 1 216 ? -14.053 86.472  21.268 1.00 35.62 ? 216  ARG A CZ  1 
ATOM   1650 N  NH1 . ARG A 1 216 ? -13.731 85.364  20.624 1.00 37.80 ? 216  ARG A NH1 1 
ATOM   1651 N  NH2 . ARG A 1 216 ? -13.612 87.641  20.828 1.00 36.29 ? 216  ARG A NH2 1 
ATOM   1652 N  N   . ASP A 1 217 ? -17.363 81.924  26.811 1.00 34.62 ? 217  ASP A N   1 
ATOM   1653 C  CA  . ASP A 1 217 ? -17.977 80.631  27.080 1.00 35.12 ? 217  ASP A CA  1 
ATOM   1654 C  C   . ASP A 1 217 ? -18.708 80.516  28.411 1.00 33.33 ? 217  ASP A C   1 
ATOM   1655 O  O   . ASP A 1 217 ? -19.108 79.425  28.799 1.00 34.36 ? 217  ASP A O   1 
ATOM   1656 C  CB  . ASP A 1 217 ? -16.913 79.532  26.965 1.00 37.19 ? 217  ASP A CB  1 
ATOM   1657 C  CG  . ASP A 1 217 ? -16.198 79.554  25.617 1.00 41.00 ? 217  ASP A CG  1 
ATOM   1658 O  OD1 . ASP A 1 217 ? -16.889 79.530  24.572 1.00 40.82 ? 217  ASP A OD1 1 
ATOM   1659 O  OD2 . ASP A 1 217 ? -14.949 79.598  25.598 1.00 42.87 ? 217  ASP A OD2 1 
ATOM   1660 N  N   . LEU A 1 218 ? -18.924 81.633  29.091 1.00 30.83 ? 218  LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 218 ? -19.586 81.584  30.382 1.00 29.59 ? 218  LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 218 ? -21.040 82.062  30.442 1.00 29.32 ? 218  LEU A C   1 
ATOM   1663 O  O   . LEU A 1 218 ? -21.606 82.172  31.527 1.00 28.88 ? 218  LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 218 ? -18.742 82.344  31.399 1.00 31.36 ? 218  LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 218 ? -17.315 81.811  31.572 1.00 33.24 ? 218  LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 218 ? -16.486 82.779  32.412 1.00 34.24 ? 218  LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 218 ? -17.362 80.444  32.226 1.00 34.15 ? 218  LEU A CD2 1 
ATOM   1668 N  N   . PHE A 1 219 ? -21.643 82.355  29.291 1.00 29.26 ? 219  PHE A N   1 
ATOM   1669 C  CA  . PHE A 1 219 ? -23.050 82.773  29.245 1.00 30.16 ? 219  PHE A CA  1 
ATOM   1670 C  C   . PHE A 1 219 ? -23.601 82.597  27.828 1.00 32.45 ? 219  PHE A C   1 
ATOM   1671 O  O   . PHE A 1 219 ? -22.834 82.527  26.863 1.00 33.48 ? 219  PHE A O   1 
ATOM   1672 C  CB  . PHE A 1 219 ? -23.224 84.227  29.704 1.00 29.08 ? 219  PHE A CB  1 
ATOM   1673 C  CG  . PHE A 1 219 ? -22.583 85.234  28.798 1.00 27.09 ? 219  PHE A CG  1 
ATOM   1674 C  CD1 . PHE A 1 219 ? -21.209 85.449  28.837 1.00 26.67 ? 219  PHE A CD1 1 
ATOM   1675 C  CD2 . PHE A 1 219 ? -23.352 85.944  27.879 1.00 26.08 ? 219  PHE A CD2 1 
ATOM   1676 C  CE1 . PHE A 1 219 ? -20.609 86.353  27.973 1.00 27.91 ? 219  PHE A CE1 1 
ATOM   1677 C  CE2 . PHE A 1 219 ? -22.767 86.848  27.009 1.00 25.84 ? 219  PHE A CE2 1 
ATOM   1678 C  CZ  . PHE A 1 219 ? -21.392 87.056  27.052 1.00 27.61 ? 219  PHE A CZ  1 
ATOM   1679 N  N   . ARG A 1 220 ? -24.927 82.538  27.706 1.00 33.98 ? 220  ARG A N   1 
ATOM   1680 C  CA  . ARG A 1 220 ? -25.589 82.323  26.414 1.00 35.71 ? 220  ARG A CA  1 
ATOM   1681 C  C   . ARG A 1 220 ? -25.862 83.578  25.585 1.00 37.07 ? 220  ARG A C   1 
ATOM   1682 O  O   . ARG A 1 220 ? -25.219 83.809  24.557 1.00 38.60 ? 220  ARG A O   1 
ATOM   1683 C  CB  . ARG A 1 220 ? -26.901 81.573  26.640 1.00 36.12 ? 220  ARG A CB  1 
ATOM   1684 C  CG  . ARG A 1 220 ? -27.728 81.371  25.392 1.00 38.90 ? 220  ARG A CG  1 
ATOM   1685 C  CD  . ARG A 1 220 ? -27.469 80.024  24.739 1.00 42.89 ? 220  ARG A CD  1 
ATOM   1686 N  NE  . ARG A 1 220 ? -28.301 79.879  23.548 1.00 46.77 ? 220  ARG A NE  1 
ATOM   1687 C  CZ  . ARG A 1 220 ? -28.100 80.543  22.412 1.00 47.71 ? 220  ARG A CZ  1 
ATOM   1688 N  NH1 . ARG A 1 220 ? -27.082 81.392  22.309 1.00 47.51 ? 220  ARG A NH1 1 
ATOM   1689 N  NH2 . ARG A 1 220 ? -28.927 80.375  21.384 1.00 47.87 ? 220  ARG A NH2 1 
ATOM   1690 N  N   . ARG A 1 221 ? -26.848 84.361  26.009 1.00 36.95 ? 221  ARG A N   1 
ATOM   1691 C  CA  . ARG A 1 221 ? -27.197 85.598  25.323 1.00 35.94 ? 221  ARG A CA  1 
ATOM   1692 C  C   . ARG A 1 221 ? -26.934 86.740  26.302 1.00 34.33 ? 221  ARG A C   1 
ATOM   1693 O  O   . ARG A 1 221 ? -26.438 86.486  27.405 1.00 35.08 ? 221  ARG A O   1 
ATOM   1694 C  CB  . ARG A 1 221 ? -28.655 85.556  24.859 1.00 37.30 ? 221  ARG A CB  1 
ATOM   1695 C  CG  . ARG A 1 221 ? -29.601 84.823  25.794 1.00 40.69 ? 221  ARG A CG  1 
ATOM   1696 C  CD  . ARG A 1 221 ? -30.976 84.662  25.154 1.00 43.84 ? 221  ARG A CD  1 
ATOM   1697 N  NE  . ARG A 1 221 ? -30.967 83.690  24.059 1.00 46.51 ? 221  ARG A NE  1 
ATOM   1698 C  CZ  . ARG A 1 221 ? -30.945 82.371  24.229 1.00 46.38 ? 221  ARG A CZ  1 
ATOM   1699 N  NH1 . ARG A 1 221 ? -30.937 81.852  25.451 1.00 45.73 ? 221  ARG A NH1 1 
ATOM   1700 N  NH2 . ARG A 1 221 ? -30.914 81.569  23.175 1.00 46.68 ? 221  ARG A NH2 1 
ATOM   1701 N  N   . ALA A 1 222 ? -27.249 87.983  25.928 1.00 31.22 ? 222  ALA A N   1 
ATOM   1702 C  CA  . ALA A 1 222 ? -26.956 89.111  26.818 1.00 28.10 ? 222  ALA A CA  1 
ATOM   1703 C  C   . ALA A 1 222 ? -27.777 90.372  26.601 1.00 26.99 ? 222  ALA A C   1 
ATOM   1704 O  O   . ALA A 1 222 ? -28.216 90.656  25.483 1.00 27.94 ? 222  ALA A O   1 
ATOM   1705 C  CB  . ALA A 1 222 ? -25.485 89.455  26.711 1.00 27.55 ? 222  ALA A CB  1 
ATOM   1706 N  N   . ILE A 1 223 ? -27.953 91.142  27.675 1.00 24.82 ? 223  ILE A N   1 
ATOM   1707 C  CA  . ILE A 1 223 ? -28.716 92.391  27.625 1.00 23.46 ? 223  ILE A CA  1 
ATOM   1708 C  C   . ILE A 1 223 ? -27.890 93.589  28.114 1.00 21.48 ? 223  ILE A C   1 
ATOM   1709 O  O   . ILE A 1 223 ? -27.235 93.508  29.148 1.00 21.27 ? 223  ILE A O   1 
ATOM   1710 C  CB  . ILE A 1 223 ? -29.998 92.284  28.484 1.00 24.00 ? 223  ILE A CB  1 
ATOM   1711 C  CG1 . ILE A 1 223 ? -30.851 91.112  28.005 1.00 25.80 ? 223  ILE A CG1 1 
ATOM   1712 C  CG2 . ILE A 1 223 ? -30.817 93.559  28.378 1.00 24.69 ? 223  ILE A CG2 1 
ATOM   1713 C  CD1 . ILE A 1 223 ? -32.133 90.923  28.813 1.00 27.73 ? 223  ILE A CD1 1 
ATOM   1714 N  N   . LEU A 1 224 ? -27.921 94.692  27.361 1.00 20.98 ? 224  LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 224 ? -27.181 95.914  27.719 1.00 21.27 ? 224  LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 224 ? -28.089 97.142  27.894 1.00 20.83 ? 224  LEU A C   1 
ATOM   1717 O  O   . LEU A 1 224 ? -28.760 97.559  26.948 1.00 20.93 ? 224  LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 224 ? -26.127 96.237  26.655 1.00 20.54 ? 224  LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 224 ? -24.912 95.327  26.496 1.00 19.85 ? 224  LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 224 ? -25.317 94.010  25.824 1.00 19.07 ? 224  LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 224 ? -23.876 96.045  25.658 1.00 16.88 ? 224  LEU A CD2 1 
ATOM   1722 N  N   . GLN A 1 225 ? -28.077 97.737  29.088 1.00 20.38 ? 225  GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 225 ? -28.918 98.904  29.378 1.00 21.89 ? 225  GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 225 ? -28.145 100.196 29.657 1.00 20.96 ? 225  GLN A C   1 
ATOM   1725 O  O   . GLN A 1 225 ? -27.480 100.297 30.686 1.00 21.31 ? 225  GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 225 ? -29.796 98.609  30.593 1.00 23.94 ? 225  GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 225 ? -30.438 97.239  30.582 1.00 26.44 ? 225  GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 225 ? -31.070 96.902  31.911 1.00 26.25 ? 225  GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 225 ? -31.524 95.781  32.135 1.00 25.91 ? 225  GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 225 ? -31.101 97.877  32.806 1.00 27.23 ? 225  GLN A NE2 1 
ATOM   1731 N  N   . SER A 1 226 ? -28.263 101.186 28.770 1.00 19.99 ? 226  SER A N   1 
ATOM   1732 C  CA  . SER A 1 226 ? -27.581 102.476 28.940 1.00 21.30 ? 226  SER A CA  1 
ATOM   1733 C  C   . SER A 1 226 ? -26.094 102.299 29.202 1.00 22.82 ? 226  SER A C   1 
ATOM   1734 O  O   . SER A 1 226 ? -25.578 102.776 30.208 1.00 24.36 ? 226  SER A O   1 
ATOM   1735 C  CB  . SER A 1 226 ? -28.169 103.265 30.120 1.00 20.02 ? 226  SER A CB  1 
ATOM   1736 O  OG  . SER A 1 226 ? -29.475 103.730 29.863 1.00 21.35 ? 226  SER A OG  1 
ATOM   1737 N  N   . GLY A 1 227 ? -25.401 101.620 28.304 1.00 23.56 ? 227  GLY A N   1 
ATOM   1738 C  CA  . GLY A 1 227 ? -23.983 101.409 28.504 1.00 23.69 ? 227  GLY A CA  1 
ATOM   1739 C  C   . GLY A 1 227 ? -23.453 100.461 27.455 1.00 24.52 ? 227  GLY A C   1 
ATOM   1740 O  O   . GLY A 1 227 ? -24.021 99.393  27.229 1.00 25.57 ? 227  GLY A O   1 
ATOM   1741 N  N   . SER A 1 228 ? -22.365 100.864 26.809 1.00 24.17 ? 228  SER A N   1 
ATOM   1742 C  CA  . SER A 1 228 ? -21.740 100.075 25.767 1.00 23.13 ? 228  SER A CA  1 
ATOM   1743 C  C   . SER A 1 228 ? -20.261 99.896  26.096 1.00 22.44 ? 228  SER A C   1 
ATOM   1744 O  O   . SER A 1 228 ? -19.663 100.733 26.763 1.00 23.78 ? 228  SER A O   1 
ATOM   1745 C  CB  . SER A 1 228 ? -21.911 100.795 24.447 1.00 24.16 ? 228  SER A CB  1 
ATOM   1746 O  OG  . SER A 1 228 ? -21.619 99.921  23.383 1.00 32.64 ? 228  SER A OG  1 
ATOM   1747 N  N   . PRO A 1 229 ? -19.644 98.800  25.634 1.00 22.10 ? 229  PRO A N   1 
ATOM   1748 C  CA  . PRO A 1 229 ? -18.223 98.595  25.940 1.00 22.12 ? 229  PRO A CA  1 
ATOM   1749 C  C   . PRO A 1 229 ? -17.278 99.625  25.334 1.00 21.98 ? 229  PRO A C   1 
ATOM   1750 O  O   . PRO A 1 229 ? -16.179 99.831  25.833 1.00 22.96 ? 229  PRO A O   1 
ATOM   1751 C  CB  . PRO A 1 229 ? -17.956 97.181  25.425 1.00 20.28 ? 229  PRO A CB  1 
ATOM   1752 C  CG  . PRO A 1 229 ? -18.871 97.085  24.267 1.00 22.64 ? 229  PRO A CG  1 
ATOM   1753 C  CD  . PRO A 1 229 ? -20.157 97.710  24.790 1.00 22.15 ? 229  PRO A CD  1 
ATOM   1754 N  N   . ASN A 1 230 ? -17.695 100.275 24.261 1.00 21.30 ? 230  ASN A N   1 
ATOM   1755 C  CA  . ASN A 1 230 ? -16.832 101.267 23.639 1.00 21.16 ? 230  ASN A CA  1 
ATOM   1756 C  C   . ASN A 1 230 ? -17.144 102.662 24.128 1.00 21.19 ? 230  ASN A C   1 
ATOM   1757 O  O   . ASN A 1 230 ? -16.801 103.631 23.468 1.00 21.98 ? 230  ASN A O   1 
ATOM   1758 C  CB  . ASN A 1 230 ? -16.967 101.214 22.109 1.00 20.74 ? 230  ASN A CB  1 
ATOM   1759 C  CG  . ASN A 1 230 ? -18.403 101.393 21.639 1.00 20.10 ? 230  ASN A CG  1 
ATOM   1760 O  OD1 . ASN A 1 230 ? -19.325 100.854 22.238 1.00 18.69 ? 230  ASN A OD1 1 
ATOM   1761 N  ND2 . ASN A 1 230 ? -18.593 102.138 20.554 1.00 21.16 ? 230  ASN A ND2 1 
ATOM   1762 N  N   . CYS A 1 231 ? -17.801 102.776 25.277 1.00 22.15 ? 231  CYS A N   1 
ATOM   1763 C  CA  . CYS A 1 231 ? -18.138 104.100 25.801 1.00 22.52 ? 231  CYS A CA  1 
ATOM   1764 C  C   . CYS A 1 231 ? -16.887 104.902 26.142 1.00 22.19 ? 231  CYS A C   1 
ATOM   1765 O  O   . CYS A 1 231 ? -15.920 104.370 26.678 1.00 21.05 ? 231  CYS A O   1 
ATOM   1766 C  CB  . CYS A 1 231 ? -19.038 103.986 27.034 1.00 23.92 ? 231  CYS A CB  1 
ATOM   1767 S  SG  . CYS A 1 231 ? -20.756 103.614 26.660 1.00 20.79 ? 231  CYS A SG  1 
ATOM   1768 N  N   . PRO A 1 232 ? -16.905 106.207 25.847 1.00 23.19 ? 232  PRO A N   1 
ATOM   1769 C  CA  . PRO A 1 232 ? -15.785 107.125 26.096 1.00 23.36 ? 232  PRO A CA  1 
ATOM   1770 C  C   . PRO A 1 232 ? -15.182 106.962 27.478 1.00 22.91 ? 232  PRO A C   1 
ATOM   1771 O  O   . PRO A 1 232 ? -13.963 107.027 27.651 1.00 24.23 ? 232  PRO A O   1 
ATOM   1772 C  CB  . PRO A 1 232 ? -16.423 108.501 25.924 1.00 21.98 ? 232  PRO A CB  1 
ATOM   1773 C  CG  . PRO A 1 232 ? -17.494 108.248 24.939 1.00 23.06 ? 232  PRO A CG  1 
ATOM   1774 C  CD  . PRO A 1 232 ? -18.103 106.959 25.444 1.00 22.44 ? 232  PRO A CD  1 
ATOM   1775 N  N   . TRP A 1 233 ? -16.064 106.733 28.443 1.00 21.63 ? 233  TRP A N   1 
ATOM   1776 C  CA  . TRP A 1 233 ? -15.720 106.589 29.849 1.00 20.95 ? 233  TRP A CA  1 
ATOM   1777 C  C   . TRP A 1 233 ? -15.514 105.155 30.334 1.00 20.72 ? 233  TRP A C   1 
ATOM   1778 O  O   . TRP A 1 233 ? -15.177 104.941 31.490 1.00 19.79 ? 233  TRP A O   1 
ATOM   1779 C  CB  . TRP A 1 233 ? -16.841 107.202 30.675 1.00 20.68 ? 233  TRP A CB  1 
ATOM   1780 C  CG  . TRP A 1 233 ? -18.165 106.633 30.291 1.00 19.01 ? 233  TRP A CG  1 
ATOM   1781 C  CD1 . TRP A 1 233 ? -19.006 107.086 29.310 1.00 21.09 ? 233  TRP A CD1 1 
ATOM   1782 C  CD2 . TRP A 1 233 ? -18.770 105.458 30.823 1.00 19.04 ? 233  TRP A CD2 1 
ATOM   1783 N  NE1 . TRP A 1 233 ? -20.101 106.260 29.201 1.00 20.57 ? 233  TRP A NE1 1 
ATOM   1784 C  CE2 . TRP A 1 233 ? -19.981 105.252 30.121 1.00 19.77 ? 233  TRP A CE2 1 
ATOM   1785 C  CE3 . TRP A 1 233 ? -18.408 104.552 31.826 1.00 18.68 ? 233  TRP A CE3 1 
ATOM   1786 C  CZ2 . TRP A 1 233 ? -20.829 104.182 30.393 1.00 19.89 ? 233  TRP A CZ2 1 
ATOM   1787 C  CZ3 . TRP A 1 233 ? -19.255 103.482 32.097 1.00 17.91 ? 233  TRP A CZ3 1 
ATOM   1788 C  CH2 . TRP A 1 233 ? -20.451 103.309 31.383 1.00 20.15 ? 233  TRP A CH2 1 
ATOM   1789 N  N   . ALA A 1 234 ? -15.736 104.171 29.477 1.00 21.00 ? 234  ALA A N   1 
ATOM   1790 C  CA  . ALA A 1 234 ? -15.595 102.789 29.911 1.00 21.67 ? 234  ALA A CA  1 
ATOM   1791 C  C   . ALA A 1 234 ? -14.167 102.241 29.972 1.00 22.62 ? 234  ALA A C   1 
ATOM   1792 O  O   . ALA A 1 234 ? -13.946 101.164 30.514 1.00 22.14 ? 234  ALA A O   1 
ATOM   1793 C  CB  . ALA A 1 234 ? -16.450 101.896 29.041 1.00 20.13 ? 234  ALA A CB  1 
ATOM   1794 N  N   . SER A 1 235 ? -13.189 102.957 29.433 1.00 22.91 ? 235  SER A N   1 
ATOM   1795 C  CA  . SER A 1 235 ? -11.832 102.431 29.490 1.00 24.71 ? 235  SER A CA  1 
ATOM   1796 C  C   . SER A 1 235 ? -10.748 103.432 29.135 1.00 24.41 ? 235  SER A C   1 
ATOM   1797 O  O   . SER A 1 235 ? -11.027 104.493 28.581 1.00 25.99 ? 235  SER A O   1 
ATOM   1798 C  CB  . SER A 1 235 ? -11.711 101.216 28.570 1.00 25.30 ? 235  SER A CB  1 
ATOM   1799 O  OG  . SER A 1 235 ? -11.913 101.592 27.218 1.00 28.10 ? 235  SER A OG  1 
ATOM   1800 N  N   . VAL A 1 236 ? -9.509  103.082 29.465 1.00 23.16 ? 236  VAL A N   1 
ATOM   1801 C  CA  . VAL A 1 236 ? -8.362  103.931 29.169 1.00 22.70 ? 236  VAL A CA  1 
ATOM   1802 C  C   . VAL A 1 236 ? -7.234  103.071 28.630 1.00 23.06 ? 236  VAL A C   1 
ATOM   1803 O  O   . VAL A 1 236 ? -7.252  101.845 28.747 1.00 22.99 ? 236  VAL A O   1 
ATOM   1804 C  CB  . VAL A 1 236 ? -7.825  104.629 30.415 1.00 22.09 ? 236  VAL A CB  1 
ATOM   1805 C  CG1 . VAL A 1 236 ? -8.940  105.379 31.122 1.00 22.60 ? 236  VAL A CG1 1 
ATOM   1806 C  CG2 . VAL A 1 236 ? -7.180  103.600 31.329 1.00 20.47 ? 236  VAL A CG2 1 
ATOM   1807 N  N   . SER A 1 237 ? -6.247  103.725 28.042 1.00 23.28 ? 237  SER A N   1 
ATOM   1808 C  CA  . SER A 1 237 ? -5.105  103.023 27.502 1.00 23.73 ? 237  SER A CA  1 
ATOM   1809 C  C   . SER A 1 237 ? -4.215  102.645 28.673 1.00 26.20 ? 237  SER A C   1 
ATOM   1810 O  O   . SER A 1 237 ? -4.322  103.211 29.768 1.00 25.16 ? 237  SER A O   1 
ATOM   1811 C  CB  . SER A 1 237 ? -4.324  103.938 26.583 1.00 23.29 ? 237  SER A CB  1 
ATOM   1812 O  OG  . SER A 1 237 ? -3.707  104.962 27.351 1.00 23.09 ? 237  SER A OG  1 
ATOM   1813 N  N   . VAL A 1 238 ? -3.329  101.687 28.435 1.00 27.74 ? 238  VAL A N   1 
ATOM   1814 C  CA  . VAL A 1 238 ? -2.400  101.251 29.462 1.00 29.03 ? 238  VAL A CA  1 
ATOM   1815 C  C   . VAL A 1 238 ? -1.585  102.461 29.912 1.00 29.02 ? 238  VAL A C   1 
ATOM   1816 O  O   . VAL A 1 238 ? -1.220  102.594 31.084 1.00 29.37 ? 238  VAL A O   1 
ATOM   1817 C  CB  . VAL A 1 238 ? -1.453  100.165 28.905 1.00 29.97 ? 238  VAL A CB  1 
ATOM   1818 C  CG1 . VAL A 1 238 ? -0.159  100.143 29.697 1.00 30.80 ? 238  VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A 1 238 ? -2.135  98.803  28.970 1.00 29.35 ? 238  VAL A CG2 1 
ATOM   1820 N  N   . ALA A 1 239 ? -1.303  103.347 28.970 1.00 27.80 ? 239  ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 239 ? -0.533  104.530 29.286 1.00 27.32 ? 239  ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 239 ? -1.313  105.418 30.245 1.00 27.42 ? 239  ALA A C   1 
ATOM   1823 O  O   . ALA A 1 239 ? -0.824  105.758 31.321 1.00 28.71 ? 239  ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 239 ? -0.196  105.288 28.006 1.00 27.07 ? 239  ALA A CB  1 
ATOM   1825 N  N   . GLU A 1 240 ? -2.531  105.786 29.860 1.00 26.52 ? 240  GLU A N   1 
ATOM   1826 C  CA  . GLU A 1 240 ? -3.349  106.647 30.698 1.00 26.64 ? 240  GLU A CA  1 
ATOM   1827 C  C   . GLU A 1 240 ? -3.604  106.026 32.065 1.00 27.24 ? 240  GLU A C   1 
ATOM   1828 O  O   . GLU A 1 240 ? -3.644  106.738 33.072 1.00 28.15 ? 240  GLU A O   1 
ATOM   1829 C  CB  . GLU A 1 240 ? -4.682  106.950 30.007 1.00 25.89 ? 240  GLU A CB  1 
ATOM   1830 C  CG  . GLU A 1 240 ? -5.631  107.797 30.841 1.00 25.22 ? 240  GLU A CG  1 
ATOM   1831 C  CD  . GLU A 1 240 ? -4.994  109.079 31.329 1.00 26.59 ? 240  GLU A CD  1 
ATOM   1832 O  OE1 . GLU A 1 240 ? -3.926  109.451 30.793 1.00 28.34 ? 240  GLU A OE1 1 
ATOM   1833 O  OE2 . GLU A 1 240 ? -5.564  109.725 32.236 1.00 24.90 ? 240  GLU A OE2 1 
ATOM   1834 N  N   . GLY A 1 241 ? -3.772  104.702 32.092 1.00 25.56 ? 241  GLY A N   1 
ATOM   1835 C  CA  . GLY A 1 241 ? -4.029  104.002 33.337 1.00 24.69 ? 241  GLY A CA  1 
ATOM   1836 C  C   . GLY A 1 241 ? -2.840  104.019 34.273 1.00 26.20 ? 241  GLY A C   1 
ATOM   1837 O  O   . GLY A 1 241 ? -2.980  104.095 35.500 1.00 24.53 ? 241  GLY A O   1 
ATOM   1838 N  N   . ARG A 1 242 ? -1.655  103.930 33.688 1.00 28.33 ? 242  ARG A N   1 
ATOM   1839 C  CA  . ARG A 1 242 ? -0.436  103.955 34.467 1.00 30.18 ? 242  ARG A CA  1 
ATOM   1840 C  C   . ARG A 1 242 ? -0.251  105.363 35.012 1.00 30.89 ? 242  ARG A C   1 
ATOM   1841 O  O   . ARG A 1 242 ? 0.140   105.544 36.165 1.00 31.00 ? 242  ARG A O   1 
ATOM   1842 C  CB  . ARG A 1 242 ? 0.748   103.556 33.594 1.00 31.96 ? 242  ARG A CB  1 
ATOM   1843 C  CG  . ARG A 1 242 ? 2.107   103.872 34.199 1.00 33.64 ? 242  ARG A CG  1 
ATOM   1844 C  CD  . ARG A 1 242 ? 3.227   103.245 33.375 1.00 35.60 ? 242  ARG A CD  1 
ATOM   1845 N  NE  . ARG A 1 242 ? 3.355   101.820 33.650 1.00 33.75 ? 242  ARG A NE  1 
ATOM   1846 C  CZ  . ARG A 1 242 ? 3.627   101.335 34.854 1.00 33.18 ? 242  ARG A CZ  1 
ATOM   1847 N  NH1 . ARG A 1 242 ? 3.798   102.168 35.874 1.00 32.43 ? 242  ARG A NH1 1 
ATOM   1848 N  NH2 . ARG A 1 242 ? 3.723   100.027 35.039 1.00 31.81 ? 242  ARG A NH2 1 
ATOM   1849 N  N   . ARG A 1 243 ? -0.544  106.359 34.182 1.00 31.97 ? 243  ARG A N   1 
ATOM   1850 C  CA  . ARG A 1 243 ? -0.417  107.747 34.608 1.00 34.39 ? 243  ARG A CA  1 
ATOM   1851 C  C   . ARG A 1 243 ? -1.278  107.964 35.845 1.00 34.30 ? 243  ARG A C   1 
ATOM   1852 O  O   . ARG A 1 243 ? -0.782  108.395 36.889 1.00 35.47 ? 243  ARG A O   1 
ATOM   1853 C  CB  . ARG A 1 243 ? -0.876  108.713 33.508 1.00 36.67 ? 243  ARG A CB  1 
ATOM   1854 C  CG  . ARG A 1 243 ? -0.609  110.186 33.840 1.00 37.79 ? 243  ARG A CG  1 
ATOM   1855 C  CD  . ARG A 1 243 ? -1.274  111.134 32.840 1.00 40.93 ? 243  ARG A CD  1 
ATOM   1856 N  NE  . ARG A 1 243 ? -2.741  111.111 32.914 1.00 43.02 ? 243  ARG A NE  1 
ATOM   1857 C  CZ  . ARG A 1 243 ? -3.461  111.521 33.961 1.00 42.89 ? 243  ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A 1 243 ? -2.862  111.998 35.047 1.00 41.00 ? 243  ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A 1 243 ? -4.787  111.448 33.925 1.00 42.52 ? 243  ARG A NH2 1 
ATOM   1860 N  N   . ARG A 1 244 ? -2.568  107.659 35.726 1.00 32.66 ? 244  ARG A N   1 
ATOM   1861 C  CA  . ARG A 1 244 ? -3.476  107.839 36.842 1.00 32.03 ? 244  ARG A CA  1 
ATOM   1862 C  C   . ARG A 1 244 ? -3.021  107.018 38.039 1.00 33.77 ? 244  ARG A C   1 
ATOM   1863 O  O   . ARG A 1 244 ? -3.170  107.450 39.189 1.00 35.91 ? 244  ARG A O   1 
ATOM   1864 C  CB  . ARG A 1 244 ? -4.892  107.444 36.444 1.00 30.70 ? 244  ARG A CB  1 
ATOM   1865 C  CG  . ARG A 1 244 ? -5.455  108.285 35.331 1.00 28.33 ? 244  ARG A CG  1 
ATOM   1866 C  CD  . ARG A 1 244 ? -6.909  107.949 35.036 1.00 25.56 ? 244  ARG A CD  1 
ATOM   1867 N  NE  . ARG A 1 244 ? -7.330  108.572 33.784 1.00 23.75 ? 244  ARG A NE  1 
ATOM   1868 C  CZ  . ARG A 1 244 ? -8.555  108.503 33.279 1.00 21.99 ? 244  ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A 1 244 ? -9.502  107.832 33.923 1.00 18.88 ? 244  ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A 1 244 ? -8.823  109.106 32.124 1.00 21.02 ? 244  ARG A NH2 1 
ATOM   1871 N  N   . ALA A 1 245 ? -2.462  105.839 37.776 1.00 32.99 ? 245  ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 245 ? -1.982  104.976 38.852 1.00 31.20 ? 245  ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 245 ? -0.906  105.707 39.648 1.00 30.16 ? 245  ALA A C   1 
ATOM   1874 O  O   . ALA A 1 245 ? -0.983  105.813 40.871 1.00 28.40 ? 245  ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 245 ? -1.427  103.685 38.273 1.00 31.79 ? 245  ALA A CB  1 
ATOM   1876 N  N   . VAL A 1 246 ? 0.100   106.210 38.943 1.00 30.15 ? 246  VAL A N   1 
ATOM   1877 C  CA  . VAL A 1 246 ? 1.180   106.944 39.582 1.00 30.46 ? 246  VAL A CA  1 
ATOM   1878 C  C   . VAL A 1 246 ? 0.600   108.160 40.284 1.00 32.55 ? 246  VAL A C   1 
ATOM   1879 O  O   . VAL A 1 246 ? 0.945   108.458 41.432 1.00 33.66 ? 246  VAL A O   1 
ATOM   1880 C  CB  . VAL A 1 246 ? 2.206   107.434 38.550 1.00 29.19 ? 246  VAL A CB  1 
ATOM   1881 C  CG1 . VAL A 1 246 ? 3.138   108.436 39.191 1.00 27.23 ? 246  VAL A CG1 1 
ATOM   1882 C  CG2 . VAL A 1 246 ? 2.992   106.256 38.003 1.00 28.25 ? 246  VAL A CG2 1 
ATOM   1883 N  N   . GLU A 1 247 ? -0.291  108.855 39.579 1.00 32.78 ? 247  GLU A N   1 
ATOM   1884 C  CA  . GLU A 1 247 ? -0.940  110.051 40.099 1.00 32.63 ? 247  GLU A CA  1 
ATOM   1885 C  C   . GLU A 1 247 ? -1.569  109.860 41.478 1.00 31.89 ? 247  GLU A C   1 
ATOM   1886 O  O   . GLU A 1 247 ? -1.473  110.736 42.329 1.00 30.45 ? 247  GLU A O   1 
ATOM   1887 C  CB  . GLU A 1 247 ? -2.003  110.522 39.112 1.00 34.54 ? 247  GLU A CB  1 
ATOM   1888 C  CG  . GLU A 1 247 ? -2.535  111.905 39.412 1.00 36.18 ? 247  GLU A CG  1 
ATOM   1889 C  CD  . GLU A 1 247 ? -1.422  112.896 39.643 1.00 36.37 ? 247  GLU A CD  1 
ATOM   1890 O  OE1 . GLU A 1 247 ? -0.450  112.895 38.857 1.00 35.62 ? 247  GLU A OE1 1 
ATOM   1891 O  OE2 . GLU A 1 247 ? -1.522  113.676 40.609 1.00 38.27 ? 247  GLU A OE2 1 
ATOM   1892 N  N   . LEU A 1 248 ? -2.227  108.720 41.683 1.00 32.67 ? 248  LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 248 ? -2.865  108.408 42.961 1.00 31.91 ? 248  LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 248 ? -1.787  108.353 44.030 1.00 33.06 ? 248  LEU A C   1 
ATOM   1895 O  O   . LEU A 1 248 ? -1.938  108.915 45.113 1.00 34.14 ? 248  LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 248 ? -3.569  107.052 42.889 1.00 30.58 ? 248  LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 248 ? -4.393  106.641 44.115 1.00 30.19 ? 248  LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 248 ? -5.640  107.519 44.195 1.00 28.40 ? 248  LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 248 ? -4.783  105.171 44.026 1.00 28.02 ? 248  LEU A CD2 1 
ATOM   1900 N  N   . GLY A 1 249 ? -0.699  107.658 43.716 1.00 34.22 ? 249  GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 249 ? 0.405   107.545 44.647 1.00 34.60 ? 249  GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 249 ? 0.937   108.919 45.002 1.00 35.17 ? 249  GLY A C   1 
ATOM   1903 O  O   . GLY A 1 249 ? 1.080   109.252 46.180 1.00 35.14 ? 249  GLY A O   1 
ATOM   1904 N  N   . ARG A 1 250 ? 1.225   109.726 43.986 1.00 35.60 ? 250  ARG A N   1 
ATOM   1905 C  CA  . ARG A 1 250 ? 1.735   111.069 44.219 1.00 36.39 ? 250  ARG A CA  1 
ATOM   1906 C  C   . ARG A 1 250 ? 0.805   111.827 45.157 1.00 37.07 ? 250  ARG A C   1 
ATOM   1907 O  O   . ARG A 1 250 ? 1.254   112.642 45.955 1.00 37.52 ? 250  ARG A O   1 
ATOM   1908 C  CB  . ARG A 1 250 ? 1.877   111.828 42.897 1.00 35.96 ? 250  ARG A CB  1 
ATOM   1909 C  CG  . ARG A 1 250 ? 2.339   113.277 43.064 1.00 37.54 ? 250  ARG A CG  1 
ATOM   1910 C  CD  . ARG A 1 250 ? 2.593   113.994 41.728 1.00 39.37 ? 250  ARG A CD  1 
ATOM   1911 N  NE  . ARG A 1 250 ? 3.675   113.397 40.940 1.00 41.46 ? 250  ARG A NE  1 
ATOM   1912 C  CZ  . ARG A 1 250 ? 3.537   112.357 40.116 1.00 42.78 ? 250  ARG A CZ  1 
ATOM   1913 N  NH1 . ARG A 1 250 ? 2.354   111.775 39.948 1.00 43.03 ? 250  ARG A NH1 1 
ATOM   1914 N  NH2 . ARG A 1 250 ? 4.588   111.895 39.451 1.00 43.02 ? 250  ARG A NH2 1 
ATOM   1915 N  N   . ASN A 1 251 ? -0.492  111.542 45.060 1.00 39.14 ? 251  ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 251 ? -1.508  112.187 45.896 1.00 41.41 ? 251  ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 251 ? -1.526  111.631 47.311 1.00 42.85 ? 251  ASN A C   1 
ATOM   1918 O  O   . ASN A 1 251 ? -2.261  112.115 48.159 1.00 44.57 ? 251  ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 251 ? -2.906  112.001 45.291 1.00 40.84 ? 251  ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 251 ? -3.297  113.121 44.345 1.00 40.39 ? 251  ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 251 ? -3.992  114.060 44.728 1.00 39.93 ? 251  ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 251 ? -2.846  113.027 43.102 1.00 41.91 ? 251  ASN A ND2 1 
ATOM   1923 N  N   . LEU A 1 252 ? -0.732  110.604 47.564 1.00 44.48 ? 252  LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 252 ? -0.702  110.010 48.888 1.00 45.92 ? 252  LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 252 ? 0.732   109.941 49.385 1.00 47.32 ? 252  LEU A C   1 
ATOM   1926 O  O   . LEU A 1 252 ? 1.047   109.195 50.310 1.00 48.34 ? 252  LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 252 ? -1.321  108.614 48.842 1.00 45.25 ? 252  LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 252 ? -2.726  108.574 48.240 1.00 45.17 ? 252  LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 252 ? -3.235  107.144 48.227 1.00 45.15 ? 252  LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 252 ? -3.660  109.466 49.046 1.00 45.18 ? 252  LEU A CD2 1 
ATOM   1931 N  N   . ASN A 1 253 ? 1.592   110.739 48.764 1.00 48.49 ? 253  ASN A N   1 
ATOM   1932 C  CA  . ASN A 1 253 ? 3.002   110.788 49.121 1.00 49.67 ? 253  ASN A CA  1 
ATOM   1933 C  C   . ASN A 1 253 ? 3.586   109.380 49.129 1.00 49.05 ? 253  ASN A C   1 
ATOM   1934 O  O   . ASN A 1 253 ? 3.992   108.868 50.169 1.00 50.46 ? 253  ASN A O   1 
ATOM   1935 C  CB  . ASN A 1 253 ? 3.176   111.443 50.494 1.00 51.71 ? 253  ASN A CB  1 
ATOM   1936 C  CG  . ASN A 1 253 ? 4.639   111.622 50.875 1.00 55.19 ? 253  ASN A CG  1 
ATOM   1937 O  OD1 . ASN A 1 253 ? 5.381   112.359 50.214 1.00 56.59 ? 253  ASN A OD1 1 
ATOM   1938 N  ND2 . ASN A 1 253 ? 5.062   110.946 51.943 1.00 55.72 ? 253  ASN A ND2 1 
ATOM   1939 N  N   . CYS A 1 254 ? 3.617   108.758 47.958 1.00 47.78 ? 254  CYS A N   1 
ATOM   1940 C  CA  . CYS A 1 254 ? 4.143   107.410 47.809 1.00 46.04 ? 254  CYS A CA  1 
ATOM   1941 C  C   . CYS A 1 254 ? 5.485   107.423 47.112 1.00 46.42 ? 254  CYS A C   1 
ATOM   1942 O  O   . CYS A 1 254 ? 5.833   108.397 46.448 1.00 47.14 ? 254  CYS A O   1 
ATOM   1943 C  CB  . CYS A 1 254 ? 3.214   106.571 46.949 1.00 44.03 ? 254  CYS A CB  1 
ATOM   1944 S  SG  . CYS A 1 254 ? 1.701   105.957 47.723 1.00 44.74 ? 254  CYS A SG  1 
ATOM   1945 N  N   . ASN A 1 255 ? 6.235   106.337 47.258 1.00 47.08 ? 255  ASN A N   1 
ATOM   1946 C  CA  . ASN A 1 255 ? 7.508   106.219 46.567 1.00 47.40 ? 255  ASN A CA  1 
ATOM   1947 C  C   . ASN A 1 255 ? 7.059   105.906 45.151 1.00 46.77 ? 255  ASN A C   1 
ATOM   1948 O  O   . ASN A 1 255 ? 6.361   104.910 44.934 1.00 46.60 ? 255  ASN A O   1 
ATOM   1949 C  CB  . ASN A 1 255 ? 8.338   105.054 47.114 1.00 49.19 ? 255  ASN A CB  1 
ATOM   1950 C  CG  . ASN A 1 255 ? 8.920   105.342 48.486 1.00 50.83 ? 255  ASN A CG  1 
ATOM   1951 O  OD1 . ASN A 1 255 ? 9.356   106.464 48.769 1.00 50.44 ? 255  ASN A OD1 1 
ATOM   1952 N  ND2 . ASN A 1 255 ? 8.952   104.322 49.340 1.00 51.06 ? 255  ASN A ND2 1 
ATOM   1953 N  N   . LEU A 1 256 ? 7.446   106.750 44.195 1.00 45.23 ? 256  LEU A N   1 
ATOM   1954 C  CA  . LEU A 1 256 ? 7.029   106.562 42.807 1.00 44.13 ? 256  LEU A CA  1 
ATOM   1955 C  C   . LEU A 1 256 ? 8.062   105.918 41.901 1.00 43.59 ? 256  LEU A C   1 
ATOM   1956 O  O   . LEU A 1 256 ? 7.774   105.606 40.747 1.00 42.98 ? 256  LEU A O   1 
ATOM   1957 C  CB  . LEU A 1 256 ? 6.612   107.904 42.215 1.00 43.07 ? 256  LEU A CB  1 
ATOM   1958 C  CG  . LEU A 1 256 ? 5.563   108.647 43.031 1.00 41.71 ? 256  LEU A CG  1 
ATOM   1959 C  CD1 . LEU A 1 256 ? 5.213   109.950 42.336 1.00 42.54 ? 256  LEU A CD1 1 
ATOM   1960 C  CD2 . LEU A 1 256 ? 4.337   107.769 43.193 1.00 41.31 ? 256  LEU A CD2 1 
ATOM   1961 N  N   . ASN A 1 257 ? 9.264   105.725 42.427 1.00 44.86 ? 257  ASN A N   1 
ATOM   1962 C  CA  . ASN A 1 257 ? 10.364  105.117 41.679 1.00 45.94 ? 257  ASN A CA  1 
ATOM   1963 C  C   . ASN A 1 257 ? 10.043  103.810 40.916 1.00 44.69 ? 257  ASN A C   1 
ATOM   1964 O  O   . ASN A 1 257 ? 10.345  103.694 39.729 1.00 45.19 ? 257  ASN A O   1 
ATOM   1965 C  CB  . ASN A 1 257 ? 11.566  104.898 42.619 1.00 47.24 ? 257  ASN A CB  1 
ATOM   1966 C  CG  . ASN A 1 257 ? 11.158  104.389 44.008 1.00 48.99 ? 257  ASN A CG  1 
ATOM   1967 O  OD1 . ASN A 1 257 ? 12.008  104.110 44.851 1.00 49.69 ? 257  ASN A OD1 1 
ATOM   1968 N  ND2 . ASN A 1 257 ? 9.858   104.272 44.245 1.00 50.99 ? 257  ASN A ND2 1 
ATOM   1969 N  N   . SER A 1 258 ? 9.426   102.838 41.578 1.00 42.95 ? 258  SER A N   1 
ATOM   1970 C  CA  . SER A 1 258 ? 9.121   101.570 40.920 1.00 41.56 ? 258  SER A CA  1 
ATOM   1971 C  C   . SER A 1 258 ? 7.714   101.106 41.217 1.00 40.69 ? 258  SER A C   1 
ATOM   1972 O  O   . SER A 1 258 ? 7.137   101.483 42.239 1.00 41.12 ? 258  SER A O   1 
ATOM   1973 C  CB  . SER A 1 258 ? 10.091  100.490 41.390 1.00 41.57 ? 258  SER A CB  1 
ATOM   1974 O  OG  . SER A 1 258 ? 9.895   100.204 42.767 1.00 38.96 ? 258  SER A OG  1 
ATOM   1975 N  N   . ASP A 1 259 ? 7.168   100.270 40.339 1.00 38.97 ? 259  ASP A N   1 
ATOM   1976 C  CA  . ASP A 1 259 ? 5.814   99.767  40.538 1.00 39.33 ? 259  ASP A CA  1 
ATOM   1977 C  C   . ASP A 1 259 ? 5.670   99.064  41.870 1.00 39.33 ? 259  ASP A C   1 
ATOM   1978 O  O   . ASP A 1 259 ? 4.665   99.219  42.558 1.00 38.96 ? 259  ASP A O   1 
ATOM   1979 C  CB  . ASP A 1 259 ? 5.421   98.777  39.448 1.00 38.53 ? 259  ASP A CB  1 
ATOM   1980 C  CG  . ASP A 1 259 ? 5.144   99.441  38.144 1.00 38.77 ? 259  ASP A CG  1 
ATOM   1981 O  OD1 . ASP A 1 259 ? 4.996   100.680 38.130 1.00 39.66 ? 259  ASP A OD1 1 
ATOM   1982 O  OD2 . ASP A 1 259 ? 5.060   98.720  37.135 1.00 40.69 ? 259  ASP A OD2 1 
ATOM   1983 N  N   . GLU A 1 260 ? 6.685   98.286  42.220 1.00 40.00 ? 260  GLU A N   1 
ATOM   1984 C  CA  . GLU A 1 260 ? 6.669   97.520  43.453 1.00 39.90 ? 260  GLU A CA  1 
ATOM   1985 C  C   . GLU A 1 260 ? 6.615   98.404  44.685 1.00 39.09 ? 260  GLU A C   1 
ATOM   1986 O  O   . GLU A 1 260 ? 6.039   98.018  45.701 1.00 38.69 ? 260  GLU A O   1 
ATOM   1987 C  CB  . GLU A 1 260 ? 7.886   96.604  43.504 1.00 41.29 ? 260  GLU A CB  1 
ATOM   1988 C  CG  . GLU A 1 260 ? 8.004   95.624  42.319 1.00 44.50 ? 260  GLU A CG  1 
ATOM   1989 C  CD  . GLU A 1 260 ? 8.381   96.294  40.998 1.00 45.40 ? 260  GLU A CD  1 
ATOM   1990 O  OE1 . GLU A 1 260 ? 9.033   97.361  41.024 1.00 46.26 ? 260  GLU A OE1 1 
ATOM   1991 O  OE2 . GLU A 1 260 ? 8.045   95.742  39.926 1.00 47.48 ? 260  GLU A OE2 1 
ATOM   1992 N  N   . GLU A 1 261 ? 7.216   99.587  44.597 1.00 38.69 ? 261  GLU A N   1 
ATOM   1993 C  CA  . GLU A 1 261 ? 7.204   100.525 45.715 1.00 38.99 ? 261  GLU A CA  1 
ATOM   1994 C  C   . GLU A 1 261 ? 5.822   101.148 45.804 1.00 39.24 ? 261  GLU A C   1 
ATOM   1995 O  O   . GLU A 1 261 ? 5.235   101.214 46.882 1.00 40.58 ? 261  GLU A O   1 
ATOM   1996 C  CB  . GLU A 1 261 ? 8.245   101.627 45.514 1.00 39.56 ? 261  GLU A CB  1 
ATOM   1997 C  CG  . GLU A 1 261 ? 9.659   101.221 45.888 1.00 41.27 ? 261  GLU A CG  1 
ATOM   1998 C  CD  . GLU A 1 261 ? 9.905   101.247 47.387 1.00 42.13 ? 261  GLU A CD  1 
ATOM   1999 O  OE1 . GLU A 1 261 ? 8.926   101.327 48.163 1.00 41.27 ? 261  GLU A OE1 1 
ATOM   2000 O  OE2 . GLU A 1 261 ? 11.085  101.181 47.788 1.00 42.76 ? 261  GLU A OE2 1 
ATOM   2001 N  N   . LEU A 1 262 ? 5.313   101.595 44.655 1.00 38.17 ? 262  LEU A N   1 
ATOM   2002 C  CA  . LEU A 1 262 ? 3.997   102.217 44.558 1.00 35.62 ? 262  LEU A CA  1 
ATOM   2003 C  C   . LEU A 1 262 ? 2.896   101.306 45.087 1.00 34.52 ? 262  LEU A C   1 
ATOM   2004 O  O   . LEU A 1 262 ? 2.013   101.755 45.814 1.00 33.27 ? 262  LEU A O   1 
ATOM   2005 C  CB  . LEU A 1 262 ? 3.697   102.592 43.101 1.00 36.27 ? 262  LEU A CB  1 
ATOM   2006 C  CG  . LEU A 1 262 ? 2.375   103.323 42.819 1.00 37.02 ? 262  LEU A CG  1 
ATOM   2007 C  CD1 . LEU A 1 262 ? 2.301   104.585 43.659 1.00 36.66 ? 262  LEU A CD1 1 
ATOM   2008 C  CD2 . LEU A 1 262 ? 2.259   103.664 41.338 1.00 34.30 ? 262  LEU A CD2 1 
ATOM   2009 N  N   . ILE A 1 263 ? 2.957   100.029 44.720 1.00 34.40 ? 263  ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 263 ? 1.971   99.046  45.154 1.00 34.17 ? 263  ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 263 ? 1.994   98.850  46.676 1.00 35.35 ? 263  ILE A C   1 
ATOM   2012 O  O   . ILE A 1 263 ? 0.948   98.692  47.305 1.00 35.69 ? 263  ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 263 ? 2.216   97.666  44.492 1.00 33.91 ? 263  ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 263 ? 2.480   97.824  42.990 1.00 31.56 ? 263  ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 263 ? 1.008   96.754  44.727 1.00 33.69 ? 263  ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 263 ? 1.309   98.260  42.192 1.00 30.67 ? 263  ILE A CD1 1 
ATOM   2017 N  N   . HIS A 1 264 ? 3.180   98.844  47.274 1.00 36.87 ? 264  HIS A N   1 
ATOM   2018 C  CA  . HIS A 1 264 ? 3.268   98.666  48.725 1.00 38.67 ? 264  HIS A CA  1 
ATOM   2019 C  C   . HIS A 1 264 ? 2.557   99.825  49.409 1.00 38.83 ? 264  HIS A C   1 
ATOM   2020 O  O   . HIS A 1 264 ? 1.723   99.635  50.299 1.00 39.38 ? 264  HIS A O   1 
ATOM   2021 C  CB  . HIS A 1 264 ? 4.732   98.635  49.198 1.00 39.60 ? 264  HIS A CB  1 
ATOM   2022 C  CG  . HIS A 1 264 ? 4.885   98.640  50.692 1.00 41.33 ? 264  HIS A CG  1 
ATOM   2023 N  ND1 . HIS A 1 264 ? 4.514   97.574  51.482 1.00 43.26 ? 264  HIS A ND1 1 
ATOM   2024 C  CD2 . HIS A 1 264 ? 5.326   99.600  51.542 1.00 42.14 ? 264  HIS A CD2 1 
ATOM   2025 C  CE1 . HIS A 1 264 ? 4.719   97.875  52.752 1.00 43.08 ? 264  HIS A CE1 1 
ATOM   2026 N  NE2 . HIS A 1 264 ? 5.211   99.100  52.817 1.00 39.94 ? 264  HIS A NE2 1 
ATOM   2027 N  N   . CYS A 1 265 ? 2.905   101.029 48.976 1.00 38.24 ? 265  CYS A N   1 
ATOM   2028 C  CA  . CYS A 1 265 ? 2.342   102.244 49.521 1.00 38.07 ? 265  CYS A CA  1 
ATOM   2029 C  C   . CYS A 1 265 ? 0.834   102.253 49.455 1.00 37.83 ? 265  CYS A C   1 
ATOM   2030 O  O   . CYS A 1 265 ? 0.169   102.449 50.462 1.00 38.33 ? 265  CYS A O   1 
ATOM   2031 C  CB  . CYS A 1 265 ? 2.888   103.425 48.759 1.00 39.66 ? 265  CYS A CB  1 
ATOM   2032 S  SG  . CYS A 1 265 ? 2.372   105.037 49.394 1.00 42.95 ? 265  CYS A SG  1 
ATOM   2033 N  N   . LEU A 1 266 ? 0.292   102.037 48.265 1.00 38.22 ? 266  LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 266 ? -1.151  102.025 48.100 1.00 37.43 ? 266  LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 266 ? -1.802  100.881 48.868 1.00 38.39 ? 266  LEU A C   1 
ATOM   2036 O  O   . LEU A 1 266 ? -2.999  100.912 49.113 1.00 41.16 ? 266  LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 266 ? -1.521  101.950 46.614 1.00 34.05 ? 266  LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 266 ? -0.881  103.042 45.752 1.00 31.20 ? 266  LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 266 ? -1.388  102.930 44.345 1.00 30.69 ? 266  LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 266 ? -1.196  104.415 46.315 1.00 31.13 ? 266  LEU A CD2 1 
ATOM   2041 N  N   . ARG A 1 267 ? -1.034  99.871  49.260 1.00 38.88 ? 267  ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 267 ? -1.629  98.772  50.019 1.00 40.11 ? 267  ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 267 ? -1.624  99.029  51.528 1.00 39.80 ? 267  ARG A C   1 
ATOM   2044 O  O   . ARG A 1 267 ? -2.396  98.417  52.270 1.00 38.20 ? 267  ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 267 ? -0.921  97.451  49.707 1.00 41.02 ? 267  ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 267 ? -1.262  96.887  48.338 1.00 43.42 ? 267  ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 267 ? -0.582  95.555  48.091 1.00 45.26 ? 267  ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 267 ? -0.921  94.998  46.784 1.00 48.03 ? 267  ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 267 ? -0.577  93.779  46.377 1.00 48.21 ? 267  ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 267 ? 0.120   92.989  47.179 1.00 48.96 ? 267  ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 267 ? -0.937  93.346  45.174 1.00 47.37 ? 267  ARG A NH2 1 
ATOM   2052 N  N   . GLU A 1 268 ? -0.758  99.939  51.977 1.00 40.42 ? 268  GLU A N   1 
ATOM   2053 C  CA  . GLU A 1 268 ? -0.664  100.272 53.398 1.00 40.34 ? 268  GLU A CA  1 
ATOM   2054 C  C   . GLU A 1 268 ? -1.644  101.387 53.755 1.00 40.41 ? 268  GLU A C   1 
ATOM   2055 O  O   . GLU A 1 268 ? -1.875  101.665 54.929 1.00 41.12 ? 268  GLU A O   1 
ATOM   2056 C  CB  . GLU A 1 268 ? 0.767   100.705 53.778 1.00 40.59 ? 268  GLU A CB  1 
ATOM   2057 C  CG  . GLU A 1 268 ? 1.857   99.622  53.597 1.00 42.15 ? 268  GLU A CG  1 
ATOM   2058 C  CD  . GLU A 1 268 ? 3.203   99.992  54.242 1.00 41.75 ? 268  GLU A CD  1 
ATOM   2059 O  OE1 . GLU A 1 268 ? 3.617   101.166 54.154 1.00 40.51 ? 268  GLU A OE1 1 
ATOM   2060 O  OE2 . GLU A 1 268 ? 3.854   99.100  54.825 1.00 37.41 ? 268  GLU A OE2 1 
ATOM   2061 N  N   . LYS A 1 269 ? -2.221  102.024 52.739 1.00 40.18 ? 269  LYS A N   1 
ATOM   2062 C  CA  . LYS A 1 269 ? -3.179  103.105 52.953 1.00 39.51 ? 269  LYS A CA  1 
ATOM   2063 C  C   . LYS A 1 269 ? -4.570  102.537 53.198 1.00 39.68 ? 269  LYS A C   1 
ATOM   2064 O  O   . LYS A 1 269 ? -4.949  101.523 52.609 1.00 39.57 ? 269  LYS A O   1 
ATOM   2065 C  CB  . LYS A 1 269 ? -3.239  104.017 51.733 1.00 39.58 ? 269  LYS A CB  1 
ATOM   2066 C  CG  . LYS A 1 269 ? -1.928  104.647 51.340 1.00 40.56 ? 269  LYS A CG  1 
ATOM   2067 C  CD  . LYS A 1 269 ? -1.503  105.742 52.303 1.00 41.40 ? 269  LYS A CD  1 
ATOM   2068 C  CE  . LYS A 1 269 ? -0.184  106.361 51.853 1.00 41.03 ? 269  LYS A CE  1 
ATOM   2069 N  NZ  . LYS A 1 269 ? 0.275   107.435 52.772 1.00 43.48 ? 269  LYS A NZ  1 
ATOM   2070 N  N   . LYS A 1 270 ? -5.328  103.200 54.064 1.00 39.58 ? 270  LYS A N   1 
ATOM   2071 C  CA  . LYS A 1 270 ? -6.681  102.767 54.383 1.00 39.38 ? 270  LYS A CA  1 
ATOM   2072 C  C   . LYS A 1 270 ? -7.607  103.057 53.212 1.00 38.97 ? 270  LYS A C   1 
ATOM   2073 O  O   . LYS A 1 270 ? -7.431  104.051 52.513 1.00 38.61 ? 270  LYS A O   1 
ATOM   2074 C  CB  . LYS A 1 270 ? -7.193  103.491 55.626 1.00 40.66 ? 270  LYS A CB  1 
ATOM   2075 C  CG  . LYS A 1 270 ? -6.587  103.024 56.930 1.00 40.98 ? 270  LYS A CG  1 
ATOM   2076 C  CD  . LYS A 1 270 ? -7.411  103.529 58.091 1.00 42.67 ? 270  LYS A CD  1 
ATOM   2077 C  CE  . LYS A 1 270 ? -7.052  102.807 59.371 1.00 44.26 ? 270  LYS A CE  1 
ATOM   2078 N  NZ  . LYS A 1 270 ? -7.924  103.253 60.501 1.00 47.33 ? 270  LYS A NZ  1 
ATOM   2079 N  N   . PRO A 1 271 ? -8.615  102.196 52.995 1.00 39.28 ? 271  PRO A N   1 
ATOM   2080 C  CA  . PRO A 1 271 ? -9.585  102.340 51.907 1.00 39.02 ? 271  PRO A CA  1 
ATOM   2081 C  C   . PRO A 1 271 ? -10.035 103.771 51.707 1.00 38.78 ? 271  PRO A C   1 
ATOM   2082 O  O   . PRO A 1 271 ? -10.041 104.285 50.589 1.00 39.78 ? 271  PRO A O   1 
ATOM   2083 C  CB  . PRO A 1 271 ? -10.730 101.441 52.350 1.00 38.96 ? 271  PRO A CB  1 
ATOM   2084 C  CG  . PRO A 1 271 ? -10.005 100.321 53.010 1.00 40.12 ? 271  PRO A CG  1 
ATOM   2085 C  CD  . PRO A 1 271 ? -8.980  101.060 53.860 1.00 40.12 ? 271  PRO A CD  1 
ATOM   2086 N  N   . GLN A 1 272 ? -10.402 104.421 52.800 1.00 37.75 ? 272  GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 272 ? -10.868 105.786 52.716 1.00 36.97 ? 272  GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 272 ? -9.781  106.745 52.238 1.00 36.96 ? 272  GLN A C   1 
ATOM   2089 O  O   . GLN A 1 272 ? -10.078 107.708 51.539 1.00 37.54 ? 272  GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 272 ? -11.415 106.226 54.073 1.00 38.48 ? 272  GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 272 ? -12.513 107.256 53.971 1.00 40.03 ? 272  GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 272 ? -13.525 106.891 52.899 1.00 41.81 ? 272  GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 272 ? -14.134 105.816 52.938 1.00 40.72 ? 272  GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 272 ? -13.701 107.784 51.926 1.00 41.74 ? 272  GLN A NE2 1 
ATOM   2095 N  N   . GLU A 1 273 ? -8.526  106.486 52.598 1.00 36.94 ? 273  GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 273 ? -7.421  107.358 52.183 1.00 36.24 ? 273  GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 273 ? -7.253  107.360 50.664 1.00 35.13 ? 273  GLU A C   1 
ATOM   2098 O  O   . GLU A 1 273 ? -6.775  108.340 50.078 1.00 36.05 ? 273  GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 273 ? -6.103  106.909 52.818 1.00 38.05 ? 273  GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 273 ? -6.090  106.871 54.332 1.00 39.61 ? 273  GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 273 ? -4.722  106.504 54.880 1.00 41.21 ? 273  GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 273 ? -3.771  107.299 54.701 1.00 41.02 ? 273  GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 273 ? -4.599  105.415 55.480 1.00 41.90 ? 273  GLU A OE2 1 
ATOM   2104 N  N   . LEU A 1 274 ? -7.621  106.244 50.039 1.00 32.18 ? 274  LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 274 ? -7.534  106.095 48.592 1.00 29.46 ? 274  LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 274 ? -8.754  106.740 47.947 1.00 29.27 ? 274  LEU A C   1 
ATOM   2107 O  O   . LEU A 1 274 ? -8.650  107.430 46.931 1.00 28.60 ? 274  LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 274 ? -7.484  104.617 48.229 1.00 27.74 ? 274  LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 274 ? -6.097  104.008 48.060 1.00 27.07 ? 274  LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 274 ? -5.172  104.541 49.118 1.00 26.95 ? 274  LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 274 ? -6.204  102.494 48.135 1.00 26.48 ? 274  LEU A CD2 1 
ATOM   2112 N  N   . ILE A 1 275 ? -9.911  106.507 48.556 1.00 27.85 ? 275  ILE A N   1 
ATOM   2113 C  CA  . ILE A 1 275 ? -11.163 107.059 48.072 1.00 26.90 ? 275  ILE A CA  1 
ATOM   2114 C  C   . ILE A 1 275 ? -11.190 108.580 48.131 1.00 27.38 ? 275  ILE A C   1 
ATOM   2115 O  O   . ILE A 1 275 ? -11.677 109.221 47.206 1.00 29.02 ? 275  ILE A O   1 
ATOM   2116 C  CB  . ILE A 1 275 ? -12.362 106.505 48.884 1.00 25.68 ? 275  ILE A CB  1 
ATOM   2117 C  CG1 . ILE A 1 275 ? -12.697 105.096 48.394 1.00 26.02 ? 275  ILE A CG1 1 
ATOM   2118 C  CG2 . ILE A 1 275 ? -13.557 107.433 48.770 1.00 23.55 ? 275  ILE A CG2 1 
ATOM   2119 C  CD1 . ILE A 1 275 ? -13.788 104.404 49.160 1.00 23.99 ? 275  ILE A CD1 1 
ATOM   2120 N  N   . ASP A 1 276 ? -10.666 109.167 49.200 1.00 26.98 ? 276  ASP A N   1 
ATOM   2121 C  CA  . ASP A 1 276 ? -10.712 110.613 49.306 1.00 28.31 ? 276  ASP A CA  1 
ATOM   2122 C  C   . ASP A 1 276 ? -10.003 111.354 48.187 1.00 28.96 ? 276  ASP A C   1 
ATOM   2123 O  O   . ASP A 1 276 ? -10.392 112.473 47.862 1.00 30.92 ? 276  ASP A O   1 
ATOM   2124 C  CB  . ASP A 1 276 ? -10.191 111.081 50.662 1.00 29.59 ? 276  ASP A CB  1 
ATOM   2125 C  CG  . ASP A 1 276 ? -11.060 110.598 51.823 1.00 32.96 ? 276  ASP A CG  1 
ATOM   2126 O  OD1 . ASP A 1 276 ? -12.284 110.402 51.632 1.00 32.15 ? 276  ASP A OD1 1 
ATOM   2127 O  OD2 . ASP A 1 276 ? -10.518 110.427 52.938 1.00 34.84 ? 276  ASP A OD2 1 
ATOM   2128 N  N   . VAL A 1 277 ? -8.981  110.754 47.580 1.00 28.81 ? 277  VAL A N   1 
ATOM   2129 C  CA  . VAL A 1 277 ? -8.288  111.444 46.484 1.00 29.30 ? 277  VAL A CA  1 
ATOM   2130 C  C   . VAL A 1 277 ? -8.549  110.803 45.129 1.00 28.14 ? 277  VAL A C   1 
ATOM   2131 O  O   . VAL A 1 277 ? -7.937  111.179 44.138 1.00 28.30 ? 277  VAL A O   1 
ATOM   2132 C  CB  . VAL A 1 277 ? -6.744  111.493 46.680 1.00 29.98 ? 277  VAL A CB  1 
ATOM   2133 C  CG1 . VAL A 1 277 ? -6.405  111.993 48.070 1.00 30.88 ? 277  VAL A CG1 1 
ATOM   2134 C  CG2 . VAL A 1 277 ? -6.135  110.121 46.418 1.00 30.62 ? 277  VAL A CG2 1 
ATOM   2135 N  N   . GLU A 1 278 ? -9.457  109.837 45.087 1.00 27.27 ? 278  GLU A N   1 
ATOM   2136 C  CA  . GLU A 1 278 ? -9.763  109.147 43.843 1.00 26.69 ? 278  GLU A CA  1 
ATOM   2137 C  C   . GLU A 1 278 ? -9.930  110.095 42.666 1.00 27.65 ? 278  GLU A C   1 
ATOM   2138 O  O   . GLU A 1 278 ? -9.288  109.931 41.621 1.00 27.71 ? 278  GLU A O   1 
ATOM   2139 C  CB  . GLU A 1 278 ? -11.044 108.317 43.983 1.00 26.16 ? 278  GLU A CB  1 
ATOM   2140 C  CG  . GLU A 1 278 ? -11.256 107.336 42.829 1.00 25.09 ? 278  GLU A CG  1 
ATOM   2141 C  CD  . GLU A 1 278 ? -12.634 106.698 42.836 1.00 24.95 ? 278  GLU A CD  1 
ATOM   2142 O  OE1 . GLU A 1 278 ? -13.073 106.229 43.910 1.00 21.66 ? 278  GLU A OE1 1 
ATOM   2143 O  OE2 . GLU A 1 278 ? -13.271 106.657 41.758 1.00 26.02 ? 278  GLU A OE2 1 
ATOM   2144 N  N   . TRP A 1 279 ? -10.786 111.096 42.841 1.00 27.22 ? 279  TRP A N   1 
ATOM   2145 C  CA  . TRP A 1 279 ? -11.065 112.030 41.764 1.00 26.81 ? 279  TRP A CA  1 
ATOM   2146 C  C   . TRP A 1 279 ? -9.922  112.923 41.289 1.00 26.85 ? 279  TRP A C   1 
ATOM   2147 O  O   . TRP A 1 279 ? -9.977  113.444 40.179 1.00 26.18 ? 279  TRP A O   1 
ATOM   2148 C  CB  . TRP A 1 279 ? -12.274 112.892 42.135 1.00 25.66 ? 279  TRP A CB  1 
ATOM   2149 C  CG  . TRP A 1 279 ? -13.481 112.086 42.507 1.00 24.81 ? 279  TRP A CG  1 
ATOM   2150 C  CD1 . TRP A 1 279 ? -13.855 111.693 43.761 1.00 24.74 ? 279  TRP A CD1 1 
ATOM   2151 C  CD2 . TRP A 1 279 ? -14.439 111.518 41.609 1.00 23.27 ? 279  TRP A CD2 1 
ATOM   2152 N  NE1 . TRP A 1 279 ? -14.986 110.918 43.698 1.00 23.88 ? 279  TRP A NE1 1 
ATOM   2153 C  CE2 . TRP A 1 279 ? -15.365 110.795 42.388 1.00 22.37 ? 279  TRP A CE2 1 
ATOM   2154 C  CE3 . TRP A 1 279 ? -14.604 111.550 40.221 1.00 23.08 ? 279  TRP A CE3 1 
ATOM   2155 C  CZ2 . TRP A 1 279 ? -16.434 110.104 41.825 1.00 21.32 ? 279  TRP A CZ2 1 
ATOM   2156 C  CZ3 . TRP A 1 279 ? -15.672 110.862 39.661 1.00 22.00 ? 279  TRP A CZ3 1 
ATOM   2157 C  CH2 . TRP A 1 279 ? -16.573 110.150 40.465 1.00 21.39 ? 279  TRP A CH2 1 
ATOM   2158 N  N   . ASN A 1 280 ? -8.880  113.083 42.099 1.00 27.70 ? 280  ASN A N   1 
ATOM   2159 C  CA  . ASN A 1 280 ? -7.772  113.965 41.725 1.00 28.41 ? 280  ASN A CA  1 
ATOM   2160 C  C   . ASN A 1 280 ? -6.892  113.503 40.571 1.00 27.88 ? 280  ASN A C   1 
ATOM   2161 O  O   . ASN A 1 280 ? -6.049  114.265 40.100 1.00 28.67 ? 280  ASN A O   1 
ATOM   2162 C  CB  . ASN A 1 280 ? -6.889  114.255 42.942 1.00 30.65 ? 280  ASN A CB  1 
ATOM   2163 C  CG  . ASN A 1 280 ? -7.700  114.597 44.179 1.00 33.99 ? 280  ASN A CG  1 
ATOM   2164 O  OD1 . ASN A 1 280 ? -8.829  115.080 44.078 1.00 34.43 ? 280  ASN A OD1 1 
ATOM   2165 N  ND2 . ASN A 1 280 ? -7.127  114.354 45.357 1.00 35.40 ? 280  ASN A ND2 1 
ATOM   2166 N  N   . VAL A 1 281 ? -7.091  112.276 40.097 1.00 27.62 ? 281  VAL A N   1 
ATOM   2167 C  CA  . VAL A 1 281 ? -6.267  111.757 39.007 1.00 25.46 ? 281  VAL A CA  1 
ATOM   2168 C  C   . VAL A 1 281 ? -6.836  111.977 37.608 1.00 26.95 ? 281  VAL A C   1 
ATOM   2169 O  O   . VAL A 1 281 ? -6.115  111.821 36.617 1.00 27.93 ? 281  VAL A O   1 
ATOM   2170 C  CB  . VAL A 1 281 ? -5.971  110.260 39.212 1.00 22.54 ? 281  VAL A CB  1 
ATOM   2171 C  CG1 . VAL A 1 281 ? -5.504  110.042 40.631 1.00 21.75 ? 281  VAL A CG1 1 
ATOM   2172 C  CG2 . VAL A 1 281 ? -7.199  109.423 38.930 1.00 20.96 ? 281  VAL A CG2 1 
ATOM   2173 N  N   . LEU A 1 282 ? -8.119  112.331 37.519 1.00 26.65 ? 282  LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 282 ? -8.743  112.589 36.223 1.00 27.46 ? 282  LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 282 ? -8.009  113.738 35.533 1.00 29.25 ? 282  LEU A C   1 
ATOM   2176 O  O   . LEU A 1 282 ? -7.885  114.833 36.080 1.00 30.77 ? 282  LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 282 ? -10.200 112.998 36.391 1.00 27.66 ? 282  LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 282 ? -11.201 111.999 36.940 1.00 27.40 ? 282  LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 282 ? -12.533 112.703 37.067 1.00 27.18 ? 282  LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 282 ? -11.303 110.798 36.033 1.00 26.96 ? 282  LEU A CD2 1 
ATOM   2181 N  N   . PRO A 1 283 ? -7.539  113.512 34.309 1.00 29.05 ? 283  PRO A N   1 
ATOM   2182 C  CA  . PRO A 1 283 ? -6.814  114.533 33.555 1.00 29.28 ? 283  PRO A CA  1 
ATOM   2183 C  C   . PRO A 1 283 ? -7.500  115.878 33.351 1.00 30.05 ? 283  PRO A C   1 
ATOM   2184 O  O   . PRO A 1 283 ? -6.828  116.903 33.252 1.00 30.07 ? 283  PRO A O   1 
ATOM   2185 C  CB  . PRO A 1 283 ? -6.529  113.836 32.230 1.00 29.15 ? 283  PRO A CB  1 
ATOM   2186 C  CG  . PRO A 1 283 ? -7.693  112.914 32.084 1.00 30.75 ? 283  PRO A CG  1 
ATOM   2187 C  CD  . PRO A 1 283 ? -7.802  112.332 33.470 1.00 30.49 ? 283  PRO A CD  1 
ATOM   2188 N  N   . PHE A 1 284 ? -8.826  115.893 33.295 1.00 30.82 ? 284  PHE A N   1 
ATOM   2189 C  CA  . PHE A 1 284 ? -9.521  117.146 33.047 1.00 30.84 ? 284  PHE A CA  1 
ATOM   2190 C  C   . PHE A 1 284 ? -10.693 117.412 33.970 1.00 31.41 ? 284  PHE A C   1 
ATOM   2191 O  O   . PHE A 1 284 ? -11.246 116.500 34.577 1.00 32.13 ? 284  PHE A O   1 
ATOM   2192 C  CB  . PHE A 1 284 ? -10.055 117.172 31.613 1.00 31.91 ? 284  PHE A CB  1 
ATOM   2193 C  CG  . PHE A 1 284 ? -9.067  116.722 30.565 1.00 33.14 ? 284  PHE A CG  1 
ATOM   2194 C  CD1 . PHE A 1 284 ? -7.896  117.440 30.324 1.00 33.72 ? 284  PHE A CD1 1 
ATOM   2195 C  CD2 . PHE A 1 284 ? -9.346  115.611 29.763 1.00 34.26 ? 284  PHE A CD2 1 
ATOM   2196 C  CE1 . PHE A 1 284 ? -7.014  117.062 29.290 1.00 33.45 ? 284  PHE A CE1 1 
ATOM   2197 C  CE2 . PHE A 1 284 ? -8.472  115.223 28.727 1.00 33.73 ? 284  PHE A CE2 1 
ATOM   2198 C  CZ  . PHE A 1 284 ? -7.307  115.953 28.492 1.00 32.83 ? 284  PHE A CZ  1 
ATOM   2199 N  N   . ASP A 1 285 ? -11.072 118.681 34.062 1.00 32.57 ? 285  ASP A N   1 
ATOM   2200 C  CA  . ASP A 1 285 ? -12.223 119.083 34.859 1.00 33.53 ? 285  ASP A CA  1 
ATOM   2201 C  C   . ASP A 1 285 ? -13.366 118.647 33.963 1.00 31.99 ? 285  ASP A C   1 
ATOM   2202 O  O   . ASP A 1 285 ? -13.454 119.090 32.815 1.00 31.21 ? 285  ASP A O   1 
ATOM   2203 C  CB  . ASP A 1 285 ? -12.223 120.596 35.044 1.00 37.35 ? 285  ASP A CB  1 
ATOM   2204 C  CG  . ASP A 1 285 ? -11.996 121.002 36.487 1.00 43.91 ? 285  ASP A CG  1 
ATOM   2205 O  OD1 . ASP A 1 285 ? -11.238 120.302 37.207 1.00 45.76 ? 285  ASP A OD1 1 
ATOM   2206 O  OD2 . ASP A 1 285 ? -12.573 122.035 36.901 1.00 48.20 ? 285  ASP A OD2 1 
ATOM   2207 N  N   . SER A 1 286 ? -14.237 117.775 34.458 1.00 30.65 ? 286  SER A N   1 
ATOM   2208 C  CA  . SER A 1 286 ? -15.301 117.284 33.590 1.00 28.55 ? 286  SER A CA  1 
ATOM   2209 C  C   . SER A 1 286 ? -16.391 116.459 34.248 1.00 26.34 ? 286  SER A C   1 
ATOM   2210 O  O   . SER A 1 286 ? -16.359 116.188 35.446 1.00 26.48 ? 286  SER A O   1 
ATOM   2211 C  CB  . SER A 1 286 ? -14.676 116.433 32.491 1.00 29.27 ? 286  SER A CB  1 
ATOM   2212 O  OG  . SER A 1 286 ? -14.000 115.329 33.077 1.00 27.51 ? 286  SER A OG  1 
ATOM   2213 N  N   . ILE A 1 287 ? -17.351 116.045 33.427 1.00 23.59 ? 287  ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 287 ? -18.450 115.227 33.901 1.00 20.45 ? 287  ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 287 ? -18.498 113.935 33.099 1.00 18.67 ? 287  ILE A C   1 
ATOM   2216 O  O   . ILE A 1 287 ? -17.951 113.861 31.995 1.00 15.62 ? 287  ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 287 ? -19.783 115.963 33.782 1.00 19.83 ? 287  ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 287 ? -20.042 116.353 32.332 1.00 17.21 ? 287  ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 287 ? -19.773 117.184 34.684 1.00 17.17 ? 287  ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 287 ? -21.430 116.938 32.125 1.00 19.56 ? 287  ILE A CD1 1 
ATOM   2221 N  N   . PHE A 1 288 ? -19.137 112.919 33.678 1.00 17.42 ? 288  PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 288 ? -19.256 111.596 33.059 1.00 16.96 ? 288  PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 288 ? -17.877 111.022 32.711 1.00 15.28 ? 288  PHE A C   1 
ATOM   2224 O  O   . PHE A 1 288 ? -17.645 110.542 31.604 1.00 14.12 ? 288  PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 288 ? -20.120 111.660 31.799 1.00 17.93 ? 288  PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 288 ? -20.980 110.444 31.593 1.00 19.58 ? 288  PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 288 ? -20.470 109.168 31.813 1.00 20.30 ? 288  PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 288 ? -22.300 110.576 31.173 1.00 19.63 ? 288  PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 288 ? -21.260 108.045 31.620 1.00 20.09 ? 288  PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 288 ? -23.102 109.462 30.976 1.00 19.36 ? 288  PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 288 ? -22.585 108.193 31.199 1.00 21.75 ? 288  PHE A CZ  1 
ATOM   2232 N  N   . ARG A 1 289 ? -16.961 111.101 33.669 1.00 14.60 ? 289  ARG A N   1 
ATOM   2233 C  CA  . ARG A 1 289 ? -15.604 110.590 33.515 1.00 14.19 ? 289  ARG A CA  1 
ATOM   2234 C  C   . ARG A 1 289 ? -15.224 110.110 34.898 1.00 16.20 ? 289  ARG A C   1 
ATOM   2235 O  O   . ARG A 1 289 ? -15.475 110.791 35.892 1.00 17.11 ? 289  ARG A O   1 
ATOM   2236 C  CB  . ARG A 1 289 ? -14.642 111.679 33.054 1.00 10.35 ? 289  ARG A CB  1 
ATOM   2237 C  CG  . ARG A 1 289 ? -14.797 112.078 31.613 1.00 9.33  ? 289  ARG A CG  1 
ATOM   2238 C  CD  . ARG A 1 289 ? -14.393 110.953 30.699 1.00 11.70 ? 289  ARG A CD  1 
ATOM   2239 N  NE  . ARG A 1 289 ? -14.360 111.335 29.288 1.00 10.89 ? 289  ARG A NE  1 
ATOM   2240 C  CZ  . ARG A 1 289 ? -15.430 111.427 28.509 1.00 10.70 ? 289  ARG A CZ  1 
ATOM   2241 N  NH1 . ARG A 1 289 ? -16.638 111.169 28.999 1.00 10.77 ? 289  ARG A NH1 1 
ATOM   2242 N  NH2 . ARG A 1 289 ? -15.289 111.745 27.231 1.00 8.46  ? 289  ARG A NH2 1 
ATOM   2243 N  N   . PHE A 1 290 ? -14.623 108.931 34.954 1.00 17.33 ? 290  PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 290 ? -14.257 108.326 36.216 1.00 18.39 ? 290  PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 290 ? -12.808 107.836 36.167 1.00 20.20 ? 290  PHE A C   1 
ATOM   2246 O  O   . PHE A 1 290 ? -12.323 107.370 35.133 1.00 20.59 ? 290  PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 290 ? -15.241 107.200 36.472 1.00 18.50 ? 290  PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 290 ? -16.622 107.507 35.975 1.00 19.65 ? 290  PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 290 ? -17.416 108.450 36.617 1.00 21.63 ? 290  PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 290 ? -17.109 106.907 34.821 1.00 21.55 ? 290  PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 290 ? -18.676 108.793 36.113 1.00 21.00 ? 290  PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 290 ? -18.367 107.246 34.311 1.00 20.54 ? 290  PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 290 ? -19.147 108.191 34.960 1.00 20.42 ? 290  PHE A CZ  1 
ATOM   2254 N  N   . SER A 1 291 ? -12.125 107.948 37.299 1.00 21.46 ? 291  SER A N   1 
ATOM   2255 C  CA  . SER A 1 291 ? -10.716 107.590 37.386 1.00 22.41 ? 291  SER A CA  1 
ATOM   2256 C  C   . SER A 1 291 ? -10.306 106.173 36.995 1.00 22.02 ? 291  SER A C   1 
ATOM   2257 O  O   . SER A 1 291 ? -9.714  105.959 35.937 1.00 20.39 ? 291  SER A O   1 
ATOM   2258 C  CB  . SER A 1 291 ? -10.204 107.907 38.793 1.00 23.33 ? 291  SER A CB  1 
ATOM   2259 O  OG  . SER A 1 291 ? -10.327 109.296 39.066 1.00 23.85 ? 291  SER A OG  1 
ATOM   2260 N  N   . PHE A 1 292 ? -10.613 105.210 37.852 1.00 21.41 ? 292  PHE A N   1 
ATOM   2261 C  CA  . PHE A 1 292 ? -10.234 103.831 37.595 1.00 21.21 ? 292  PHE A CA  1 
ATOM   2262 C  C   . PHE A 1 292 ? -11.312 103.022 36.871 1.00 21.77 ? 292  PHE A C   1 
ATOM   2263 O  O   . PHE A 1 292 ? -12.416 102.806 37.377 1.00 22.09 ? 292  PHE A O   1 
ATOM   2264 C  CB  . PHE A 1 292 ? -9.804  103.206 38.924 1.00 20.19 ? 292  PHE A CB  1 
ATOM   2265 C  CG  . PHE A 1 292 ? -8.786  104.041 39.644 1.00 22.04 ? 292  PHE A CG  1 
ATOM   2266 C  CD1 . PHE A 1 292 ? -7.518  104.233 39.099 1.00 23.15 ? 292  PHE A CD1 1 
ATOM   2267 C  CD2 . PHE A 1 292 ? -9.136  104.768 40.778 1.00 24.37 ? 292  PHE A CD2 1 
ATOM   2268 C  CE1 . PHE A 1 292 ? -6.620  105.146 39.666 1.00 23.37 ? 292  PHE A CE1 1 
ATOM   2269 C  CE2 . PHE A 1 292 ? -8.246  105.683 41.352 1.00 22.46 ? 292  PHE A CE2 1 
ATOM   2270 C  CZ  . PHE A 1 292 ? -6.991  105.872 40.791 1.00 23.32 ? 292  PHE A CZ  1 
ATOM   2271 N  N   . VAL A 1 293 ? -10.976 102.609 35.652 1.00 21.82 ? 293  VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 293 ? -11.884 101.843 34.804 1.00 22.44 ? 293  VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 293 ? -11.083 100.844 33.955 1.00 22.47 ? 293  VAL A C   1 
ATOM   2274 O  O   . VAL A 1 293 ? -9.853  100.883 33.938 1.00 23.29 ? 293  VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 293 ? -12.666 102.778 33.856 1.00 21.27 ? 293  VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 293 ? -13.279 103.930 34.645 1.00 20.14 ? 293  VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 293 ? -11.742 103.286 32.752 1.00 18.93 ? 293  VAL A CG2 1 
ATOM   2278 N  N   . PRO A 1 294 ? -11.774 99.939  33.243 1.00 20.82 ? 294  PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 294 ? -11.114 98.944  32.403 1.00 20.40 ? 294  PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 294 ? -9.959  99.502  31.579 1.00 21.68 ? 294  PRO A C   1 
ATOM   2281 O  O   . PRO A 1 294 ? -10.041 100.604 31.045 1.00 22.66 ? 294  PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 294 ? -12.253 98.447  31.527 1.00 20.75 ? 294  PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 294 ? -13.403 98.459  32.462 1.00 20.04 ? 294  PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 294 ? -13.239 99.794  33.158 1.00 20.96 ? 294  PRO A CD  1 
ATOM   2285 N  N   . VAL A 1 295 ? -8.876  98.739  31.476 1.00 23.69 ? 295  VAL A N   1 
ATOM   2286 C  CA  . VAL A 1 295 ? -7.727  99.176  30.691 1.00 24.88 ? 295  VAL A CA  1 
ATOM   2287 C  C   . VAL A 1 295 ? -7.555  98.253  29.477 1.00 25.13 ? 295  VAL A C   1 
ATOM   2288 O  O   . VAL A 1 295 ? -7.720  97.040  29.588 1.00 25.37 ? 295  VAL A O   1 
ATOM   2289 C  CB  . VAL A 1 295 ? -6.429  99.192  31.557 1.00 25.18 ? 295  VAL A CB  1 
ATOM   2290 C  CG1 . VAL A 1 295 ? -6.022  97.776  31.942 1.00 23.54 ? 295  VAL A CG1 1 
ATOM   2291 C  CG2 . VAL A 1 295 ? -5.308  99.905  30.804 1.00 27.09 ? 295  VAL A CG2 1 
ATOM   2292 N  N   . ILE A 1 296 ? -7.265  98.834  28.314 1.00 25.99 ? 296  ILE A N   1 
ATOM   2293 C  CA  . ILE A 1 296 ? -7.065  98.050  27.090 1.00 27.52 ? 296  ILE A CA  1 
ATOM   2294 C  C   . ILE A 1 296 ? -5.678  97.397  27.198 1.00 28.68 ? 296  ILE A C   1 
ATOM   2295 O  O   . ILE A 1 296 ? -4.705  97.851  26.592 1.00 27.78 ? 296  ILE A O   1 
ATOM   2296 C  CB  . ILE A 1 296 ? -7.133  98.963  25.846 1.00 26.52 ? 296  ILE A CB  1 
ATOM   2297 C  CG1 . ILE A 1 296 ? -8.447  99.759  25.857 1.00 24.43 ? 296  ILE A CG1 1 
ATOM   2298 C  CG2 . ILE A 1 296 ? -7.007  98.129  24.578 1.00 25.11 ? 296  ILE A CG2 1 
ATOM   2299 C  CD1 . ILE A 1 296 ? -9.706  98.909  25.763 1.00 22.34 ? 296  ILE A CD1 1 
ATOM   2300 N  N   . ASP A 1 297 ? -5.629  96.318  27.977 1.00 30.44 ? 297  ASP A N   1 
ATOM   2301 C  CA  . ASP A 1 297 ? -4.408  95.588  28.301 1.00 32.28 ? 297  ASP A CA  1 
ATOM   2302 C  C   . ASP A 1 297 ? -3.704  94.726  27.272 1.00 34.73 ? 297  ASP A C   1 
ATOM   2303 O  O   . ASP A 1 297 ? -2.482  94.610  27.308 1.00 36.60 ? 297  ASP A O   1 
ATOM   2304 C  CB  . ASP A 1 297 ? -4.654  94.722  29.533 1.00 31.14 ? 297  ASP A CB  1 
ATOM   2305 C  CG  . ASP A 1 297 ? -5.724  93.670  29.305 1.00 31.93 ? 297  ASP A CG  1 
ATOM   2306 O  OD1 . ASP A 1 297 ? -6.194  93.518  28.152 1.00 30.46 ? 297  ASP A OD1 1 
ATOM   2307 O  OD2 . ASP A 1 297 ? -6.089  92.989  30.290 1.00 33.01 ? 297  ASP A OD2 1 
ATOM   2308 N  N   . GLY A 1 298 ? -4.445  94.097  26.374 1.00 36.01 ? 298  GLY A N   1 
ATOM   2309 C  CA  . GLY A 1 298 ? -3.781  93.252  25.404 1.00 37.99 ? 298  GLY A CA  1 
ATOM   2310 C  C   . GLY A 1 298 ? -4.029  91.801  25.751 1.00 39.95 ? 298  GLY A C   1 
ATOM   2311 O  O   . GLY A 1 298 ? -3.760  90.906  24.952 1.00 40.99 ? 298  GLY A O   1 
ATOM   2312 N  N   . GLU A 1 299 ? -4.538  91.569  26.956 1.00 41.02 ? 299  GLU A N   1 
ATOM   2313 C  CA  . GLU A 1 299 ? -4.863  90.222  27.400 1.00 41.70 ? 299  GLU A CA  1 
ATOM   2314 C  C   . GLU A 1 299 ? -6.387  90.123  27.445 1.00 40.13 ? 299  GLU A C   1 
ATOM   2315 O  O   . GLU A 1 299 ? -7.001  89.616  26.503 1.00 40.53 ? 299  GLU A O   1 
ATOM   2316 C  CB  . GLU A 1 299 ? -4.264  89.941  28.786 1.00 46.40 ? 299  GLU A CB  1 
ATOM   2317 C  CG  . GLU A 1 299 ? -4.332  88.459  29.225 1.00 51.37 ? 299  GLU A CG  1 
ATOM   2318 C  CD  . GLU A 1 299 ? -3.672  88.194  30.588 1.00 54.58 ? 299  GLU A CD  1 
ATOM   2319 O  OE1 . GLU A 1 299 ? -3.677  87.022  31.036 1.00 55.81 ? 299  GLU A OE1 1 
ATOM   2320 O  OE2 . GLU A 1 299 ? -3.146  89.148  31.211 1.00 55.70 ? 299  GLU A OE2 1 
ATOM   2321 N  N   . PHE A 1 300 ? -6.995  90.623  28.522 1.00 37.63 ? 300  PHE A N   1 
ATOM   2322 C  CA  . PHE A 1 300 ? -8.456  90.585  28.666 1.00 35.85 ? 300  PHE A CA  1 
ATOM   2323 C  C   . PHE A 1 300 ? -9.085  91.091  27.374 1.00 36.10 ? 300  PHE A C   1 
ATOM   2324 O  O   . PHE A 1 300 ? -10.135 90.608  26.935 1.00 36.78 ? 300  PHE A O   1 
ATOM   2325 C  CB  . PHE A 1 300 ? -8.909  91.457  29.845 1.00 33.13 ? 300  PHE A CB  1 
ATOM   2326 C  CG  . PHE A 1 300 ? -10.369 91.321  30.174 1.00 29.15 ? 300  PHE A CG  1 
ATOM   2327 C  CD1 . PHE A 1 300 ? -11.335 91.936  29.391 1.00 27.91 ? 300  PHE A CD1 1 
ATOM   2328 C  CD2 . PHE A 1 300 ? -10.780 90.554  31.259 1.00 27.89 ? 300  PHE A CD2 1 
ATOM   2329 C  CE1 . PHE A 1 300 ? -12.687 91.787  29.685 1.00 26.94 ? 300  PHE A CE1 1 
ATOM   2330 C  CE2 . PHE A 1 300 ? -12.136 90.398  31.558 1.00 25.99 ? 300  PHE A CE2 1 
ATOM   2331 C  CZ  . PHE A 1 300 ? -13.086 91.015  30.772 1.00 24.61 ? 300  PHE A CZ  1 
ATOM   2332 N  N   . PHE A 1 301 ? -8.434  92.080  26.778 1.00 34.43 ? 301  PHE A N   1 
ATOM   2333 C  CA  . PHE A 1 301 ? -8.884  92.635  25.519 1.00 33.19 ? 301  PHE A CA  1 
ATOM   2334 C  C   . PHE A 1 301 ? -7.724  92.378  24.561 1.00 34.06 ? 301  PHE A C   1 
ATOM   2335 O  O   . PHE A 1 301 ? -6.709  93.072  24.603 1.00 33.84 ? 301  PHE A O   1 
ATOM   2336 C  CB  . PHE A 1 301 ? -9.156  94.142  25.651 1.00 31.37 ? 301  PHE A CB  1 
ATOM   2337 C  CG  . PHE A 1 301 ? -10.353 94.479  26.512 1.00 29.10 ? 301  PHE A CG  1 
ATOM   2338 C  CD1 . PHE A 1 301 ? -11.641 94.104  26.125 1.00 26.86 ? 301  PHE A CD1 1 
ATOM   2339 C  CD2 . PHE A 1 301 ? -10.198 95.181  27.705 1.00 27.08 ? 301  PHE A CD2 1 
ATOM   2340 C  CE1 . PHE A 1 301 ? -12.747 94.423  26.909 1.00 21.78 ? 301  PHE A CE1 1 
ATOM   2341 C  CE2 . PHE A 1 301 ? -11.311 95.501  28.494 1.00 23.95 ? 301  PHE A CE2 1 
ATOM   2342 C  CZ  . PHE A 1 301 ? -12.581 95.119  28.090 1.00 21.08 ? 301  PHE A CZ  1 
ATOM   2343 N  N   . PRO A 1 302 ? -7.853  91.349  23.704 1.00 34.66 ? 302  PRO A N   1 
ATOM   2344 C  CA  . PRO A 1 302 ? -6.868  90.926  22.703 1.00 34.00 ? 302  PRO A CA  1 
ATOM   2345 C  C   . PRO A 1 302 ? -6.255  92.081  21.930 1.00 34.22 ? 302  PRO A C   1 
ATOM   2346 O  O   . PRO A 1 302 ? -5.034  92.199  21.834 1.00 34.11 ? 302  PRO A O   1 
ATOM   2347 C  CB  . PRO A 1 302 ? -7.681  90.020  21.789 1.00 33.28 ? 302  PRO A CB  1 
ATOM   2348 C  CG  . PRO A 1 302 ? -8.613  89.369  22.733 1.00 35.64 ? 302  PRO A CG  1 
ATOM   2349 C  CD  . PRO A 1 302 ? -9.062  90.509  23.623 1.00 36.11 ? 302  PRO A CD  1 
ATOM   2350 N  N   . THR A 1 303 ? -7.120  92.923  21.370 1.00 33.80 ? 303  THR A N   1 
ATOM   2351 C  CA  . THR A 1 303 ? -6.700  94.075  20.580 1.00 33.07 ? 303  THR A CA  1 
ATOM   2352 C  C   . THR A 1 303 ? -7.588  95.270  20.924 1.00 31.86 ? 303  THR A C   1 
ATOM   2353 O  O   . THR A 1 303 ? -8.306  95.229  21.912 1.00 31.25 ? 303  THR A O   1 
ATOM   2354 C  CB  . THR A 1 303 ? -6.814  93.756  19.078 1.00 33.76 ? 303  THR A CB  1 
ATOM   2355 O  OG1 . THR A 1 303 ? -8.185  93.503  18.744 1.00 34.81 ? 303  THR A OG1 1 
ATOM   2356 C  CG2 . THR A 1 303 ? -6.008  92.511  18.743 1.00 32.44 ? 303  THR A CG2 1 
ATOM   2357 N  N   . SER A 1 304 ? -7.549  96.327  20.118 1.00 31.99 ? 304  SER A N   1 
ATOM   2358 C  CA  . SER A 1 304 ? -8.377  97.508  20.392 1.00 32.27 ? 304  SER A CA  1 
ATOM   2359 C  C   . SER A 1 304 ? -9.850  97.158  20.280 1.00 32.04 ? 304  SER A C   1 
ATOM   2360 O  O   . SER A 1 304 ? -10.213 96.222  19.581 1.00 34.01 ? 304  SER A O   1 
ATOM   2361 C  CB  . SER A 1 304 ? -8.071  98.620  19.398 1.00 32.56 ? 304  SER A CB  1 
ATOM   2362 O  OG  . SER A 1 304 ? -8.662  98.341  18.141 1.00 33.32 ? 304  SER A OG  1 
ATOM   2363 N  N   . LEU A 1 305 ? -10.710 97.914  20.946 1.00 32.46 ? 305  LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 305 ? -12.139 97.623  20.880 1.00 33.31 ? 305  LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 305 ? -12.741 97.783  19.475 1.00 34.15 ? 305  LEU A C   1 
ATOM   2366 O  O   . LEU A 1 305 ? -13.526 96.946  19.028 1.00 34.37 ? 305  LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 305 ? -12.899 98.506  21.868 1.00 31.88 ? 305  LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 305 ? -12.567 98.280  23.343 1.00 32.36 ? 305  LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 305 ? -13.431 99.197  24.201 1.00 31.85 ? 305  LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 305 ? -12.804 96.818  23.712 1.00 30.24 ? 305  LEU A CD2 1 
ATOM   2371 N  N   . GLU A 1 306 ? -12.372 98.853  18.777 1.00 35.36 ? 306  GLU A N   1 
ATOM   2372 C  CA  . GLU A 1 306 ? -12.906 99.099  17.443 1.00 35.88 ? 306  GLU A CA  1 
ATOM   2373 C  C   . GLU A 1 306 ? -12.469 97.991  16.495 1.00 34.63 ? 306  GLU A C   1 
ATOM   2374 O  O   . GLU A 1 306 ? -13.241 97.563  15.633 1.00 33.99 ? 306  GLU A O   1 
ATOM   2375 C  CB  . GLU A 1 306 ? -12.436 100.470 16.927 1.00 38.79 ? 306  GLU A CB  1 
ATOM   2376 C  CG  . GLU A 1 306 ? -13.237 101.041 15.736 1.00 44.46 ? 306  GLU A CG  1 
ATOM   2377 C  CD  . GLU A 1 306 ? -14.760 101.152 15.995 1.00 48.91 ? 306  GLU A CD  1 
ATOM   2378 O  OE1 . GLU A 1 306 ? -15.181 101.448 17.146 1.00 49.37 ? 306  GLU A OE1 1 
ATOM   2379 O  OE2 . GLU A 1 306 ? -15.540 100.958 15.030 1.00 48.90 ? 306  GLU A OE2 1 
ATOM   2380 N  N   . SER A 1 307 ? -11.239 97.512  16.670 1.00 32.39 ? 307  SER A N   1 
ATOM   2381 C  CA  . SER A 1 307 ? -10.715 96.456  15.817 1.00 31.34 ? 307  SER A CA  1 
ATOM   2382 C  C   . SER A 1 307 ? -11.425 95.139  16.077 1.00 31.17 ? 307  SER A C   1 
ATOM   2383 O  O   . SER A 1 307 ? -11.727 94.394  15.150 1.00 31.11 ? 307  SER A O   1 
ATOM   2384 C  CB  . SER A 1 307 ? -9.216  96.281  16.041 1.00 30.53 ? 307  SER A CB  1 
ATOM   2385 O  OG  . SER A 1 307 ? -8.956  95.816  17.350 1.00 32.51 ? 307  SER A OG  1 
ATOM   2386 N  N   . MET A 1 308 ? -11.685 94.844  17.342 1.00 32.04 ? 308  MET A N   1 
ATOM   2387 C  CA  . MET A 1 308 ? -12.381 93.613  17.683 1.00 33.37 ? 308  MET A CA  1 
ATOM   2388 C  C   . MET A 1 308 ? -13.787 93.629  17.103 1.00 33.65 ? 308  MET A C   1 
ATOM   2389 O  O   . MET A 1 308 ? -14.239 92.634  16.543 1.00 33.75 ? 308  MET A O   1 
ATOM   2390 C  CB  . MET A 1 308 ? -12.441 93.436  19.198 1.00 34.01 ? 308  MET A CB  1 
ATOM   2391 C  CG  . MET A 1 308 ? -11.081 93.210  19.813 1.00 34.54 ? 308  MET A CG  1 
ATOM   2392 S  SD  . MET A 1 308 ? -11.190 92.853  21.549 1.00 36.84 ? 308  MET A SD  1 
ATOM   2393 C  CE  . MET A 1 308 ? -11.714 91.105  21.504 1.00 34.70 ? 308  MET A CE  1 
ATOM   2394 N  N   . LEU A 1 309 ? -14.467 94.769  17.223 1.00 34.60 ? 309  LEU A N   1 
ATOM   2395 C  CA  . LEU A 1 309 ? -15.827 94.919  16.704 1.00 34.76 ? 309  LEU A CA  1 
ATOM   2396 C  C   . LEU A 1 309 ? -15.879 94.909  15.171 1.00 34.61 ? 309  LEU A C   1 
ATOM   2397 O  O   . LEU A 1 309 ? -16.798 94.339  14.582 1.00 33.92 ? 309  LEU A O   1 
ATOM   2398 C  CB  . LEU A 1 309 ? -16.462 96.213  17.234 1.00 33.93 ? 309  LEU A CB  1 
ATOM   2399 C  CG  . LEU A 1 309 ? -16.733 96.323  18.739 1.00 32.78 ? 309  LEU A CG  1 
ATOM   2400 C  CD1 . LEU A 1 309 ? -17.319 97.689  19.048 1.00 33.29 ? 309  LEU A CD1 1 
ATOM   2401 C  CD2 . LEU A 1 309 ? -17.684 95.230  19.183 1.00 30.46 ? 309  LEU A CD2 1 
ATOM   2402 N  N   . ASN A 1 310 ? -14.899 95.538  14.529 1.00 34.46 ? 310  ASN A N   1 
ATOM   2403 C  CA  . ASN A 1 310 ? -14.872 95.576  13.073 1.00 35.56 ? 310  ASN A CA  1 
ATOM   2404 C  C   . ASN A 1 310 ? -14.567 94.222  12.446 1.00 34.66 ? 310  ASN A C   1 
ATOM   2405 O  O   . ASN A 1 310 ? -15.049 93.920  11.351 1.00 35.20 ? 310  ASN A O   1 
ATOM   2406 C  CB  . ASN A 1 310 ? -13.846 96.594  12.569 1.00 37.22 ? 310  ASN A CB  1 
ATOM   2407 C  CG  . ASN A 1 310 ? -14.346 98.020  12.663 1.00 38.97 ? 310  ASN A CG  1 
ATOM   2408 O  OD1 . ASN A 1 310 ? -15.511 98.296  12.381 1.00 38.92 ? 310  ASN A OD1 1 
ATOM   2409 N  ND2 . ASN A 1 310 ? -13.463 98.939  13.044 1.00 39.11 ? 310  ASN A ND2 1 
ATOM   2410 N  N   . SER A 1 311 ? -13.772 93.405  13.132 1.00 32.70 ? 311  SER A N   1 
ATOM   2411 C  CA  . SER A 1 311 ? -13.416 92.105  12.590 1.00 30.94 ? 311  SER A CA  1 
ATOM   2412 C  C   . SER A 1 311 ? -14.360 90.997  13.034 1.00 31.05 ? 311  SER A C   1 
ATOM   2413 O  O   . SER A 1 311 ? -14.313 89.888  12.504 1.00 32.69 ? 311  SER A O   1 
ATOM   2414 C  CB  . SER A 1 311 ? -11.973 91.752  12.955 1.00 28.71 ? 311  SER A CB  1 
ATOM   2415 O  OG  . SER A 1 311 ? -11.850 91.397  14.315 1.00 28.24 ? 311  SER A OG  1 
ATOM   2416 N  N   . GLY A 1 312 ? -15.227 91.293  13.994 1.00 31.78 ? 312  GLY A N   1 
ATOM   2417 C  CA  . GLY A 1 312 ? -16.174 90.295  14.466 1.00 30.35 ? 312  GLY A CA  1 
ATOM   2418 C  C   . GLY A 1 312 ? -15.607 89.412  15.558 1.00 30.90 ? 312  GLY A C   1 
ATOM   2419 O  O   . GLY A 1 312 ? -16.237 88.445  15.984 1.00 32.17 ? 312  GLY A O   1 
ATOM   2420 N  N   . ASN A 1 313 ? -14.407 89.749  16.013 1.00 29.60 ? 313  ASN A N   1 
ATOM   2421 C  CA  . ASN A 1 313 ? -13.732 89.000  17.056 1.00 28.41 ? 313  ASN A CA  1 
ATOM   2422 C  C   . ASN A 1 313 ? -14.474 89.155  18.384 1.00 28.16 ? 313  ASN A C   1 
ATOM   2423 O  O   . ASN A 1 313 ? -14.056 89.915  19.259 1.00 28.24 ? 313  ASN A O   1 
ATOM   2424 C  CB  . ASN A 1 313 ? -12.286 89.501  17.152 1.00 29.69 ? 313  ASN A CB  1 
ATOM   2425 C  CG  . ASN A 1 313 ? -11.512 88.870  18.293 1.00 32.29 ? 313  ASN A CG  1 
ATOM   2426 O  OD1 . ASN A 1 313 ? -11.659 87.674  18.594 1.00 30.69 ? 313  ASN A OD1 1 
ATOM   2427 N  ND2 . ASN A 1 313 ? -10.657 89.670  18.926 1.00 32.17 ? 313  ASN A ND2 1 
ATOM   2428 N  N   . PHE A 1 314 ? -15.580 88.425  18.530 1.00 28.20 ? 314  PHE A N   1 
ATOM   2429 C  CA  . PHE A 1 314 ? -16.396 88.485  19.748 1.00 28.28 ? 314  PHE A CA  1 
ATOM   2430 C  C   . PHE A 1 314 ? -17.568 87.494  19.741 1.00 28.34 ? 314  PHE A C   1 
ATOM   2431 O  O   . PHE A 1 314 ? -18.139 87.216  18.690 1.00 28.87 ? 314  PHE A O   1 
ATOM   2432 C  CB  . PHE A 1 314 ? -16.936 89.909  19.925 1.00 25.59 ? 314  PHE A CB  1 
ATOM   2433 C  CG  . PHE A 1 314 ? -17.741 90.403  18.750 1.00 24.73 ? 314  PHE A CG  1 
ATOM   2434 C  CD1 . PHE A 1 314 ? -19.027 89.920  18.514 1.00 22.90 ? 314  PHE A CD1 1 
ATOM   2435 C  CD2 . PHE A 1 314 ? -17.213 91.361  17.881 1.00 24.15 ? 314  PHE A CD2 1 
ATOM   2436 C  CE1 . PHE A 1 314 ? -19.774 90.382  17.436 1.00 22.54 ? 314  PHE A CE1 1 
ATOM   2437 C  CE2 . PHE A 1 314 ? -17.957 91.833  16.794 1.00 23.63 ? 314  PHE A CE2 1 
ATOM   2438 C  CZ  . PHE A 1 314 ? -19.241 91.341  16.574 1.00 23.15 ? 314  PHE A CZ  1 
ATOM   2439 N  N   . LYS A 1 315 ? -17.930 86.976  20.914 1.00 29.69 ? 315  LYS A N   1 
ATOM   2440 C  CA  . LYS A 1 315 ? -19.046 86.029  21.028 1.00 30.60 ? 315  LYS A CA  1 
ATOM   2441 C  C   . LYS A 1 315 ? -20.237 86.506  20.219 1.00 31.59 ? 315  LYS A C   1 
ATOM   2442 O  O   . LYS A 1 315 ? -20.706 87.636  20.391 1.00 33.14 ? 315  LYS A O   1 
ATOM   2443 C  CB  . LYS A 1 315 ? -19.494 85.856  22.486 1.00 29.67 ? 315  LYS A CB  1 
ATOM   2444 C  CG  . LYS A 1 315 ? -20.673 84.878  22.643 1.00 29.49 ? 315  LYS A CG  1 
ATOM   2445 C  CD  . LYS A 1 315 ? -20.926 84.500  24.105 1.00 30.66 ? 315  LYS A CD  1 
ATOM   2446 C  CE  . LYS A 1 315 ? -21.468 83.066  24.273 1.00 29.61 ? 315  LYS A CE  1 
ATOM   2447 N  NZ  . LYS A 1 315 ? -22.830 82.846  23.706 1.00 29.87 ? 315  LYS A NZ  1 
ATOM   2448 N  N   . LYS A 1 316 ? -20.730 85.630  19.350 1.00 31.49 ? 316  LYS A N   1 
ATOM   2449 C  CA  . LYS A 1 316 ? -21.867 85.940  18.491 1.00 30.21 ? 316  LYS A CA  1 
ATOM   2450 C  C   . LYS A 1 316 ? -23.126 85.216  18.966 1.00 29.99 ? 316  LYS A C   1 
ATOM   2451 O  O   . LYS A 1 316 ? -23.184 83.985  18.972 1.00 31.49 ? 316  LYS A O   1 
ATOM   2452 C  CB  . LYS A 1 316 ? -21.517 85.550  17.057 1.00 29.23 ? 316  LYS A CB  1 
ATOM   2453 C  CG  . LYS A 1 316 ? -20.128 86.034  16.669 1.00 28.84 ? 316  LYS A CG  1 
ATOM   2454 C  CD  . LYS A 1 316 ? -19.884 85.995  15.175 1.00 29.92 ? 316  LYS A CD  1 
ATOM   2455 C  CE  . LYS A 1 316 ? -18.517 86.586  14.833 1.00 30.58 ? 316  LYS A CE  1 
ATOM   2456 N  NZ  . LYS A 1 316 ? -17.423 85.960  15.641 1.00 29.70 ? 316  LYS A NZ  1 
ATOM   2457 N  N   . THR A 1 317 ? -24.128 85.991  19.370 1.00 29.50 ? 317  THR A N   1 
ATOM   2458 C  CA  . THR A 1 317 ? -25.390 85.451  19.872 1.00 28.48 ? 317  THR A CA  1 
ATOM   2459 C  C   . THR A 1 317 ? -26.461 86.528  19.802 1.00 28.12 ? 317  THR A C   1 
ATOM   2460 O  O   . THR A 1 317 ? -26.261 87.554  19.162 1.00 28.61 ? 317  THR A O   1 
ATOM   2461 C  CB  . THR A 1 317 ? -25.251 85.009  21.338 1.00 29.69 ? 317  THR A CB  1 
ATOM   2462 O  OG1 . THR A 1 317 ? -26.512 84.528  21.818 1.00 32.73 ? 317  THR A OG1 1 
ATOM   2463 C  CG2 . THR A 1 317 ? -24.799 86.174  22.204 1.00 26.55 ? 317  THR A CG2 1 
ATOM   2464 N  N   . GLN A 1 318 ? -27.594 86.298  20.462 1.00 27.40 ? 318  GLN A N   1 
ATOM   2465 C  CA  . GLN A 1 318 ? -28.674 87.279  20.470 1.00 27.50 ? 318  GLN A CA  1 
ATOM   2466 C  C   . GLN A 1 318 ? -28.397 88.258  21.604 1.00 27.15 ? 318  GLN A C   1 
ATOM   2467 O  O   . GLN A 1 318 ? -27.894 87.864  22.657 1.00 27.55 ? 318  GLN A O   1 
ATOM   2468 C  CB  . GLN A 1 318 ? -30.036 86.610  20.714 1.00 29.13 ? 318  GLN A CB  1 
ATOM   2469 C  CG  . GLN A 1 318 ? -30.337 85.351  19.888 1.00 29.86 ? 318  GLN A CG  1 
ATOM   2470 C  CD  . GLN A 1 318 ? -29.607 84.114  20.405 1.00 29.16 ? 318  GLN A CD  1 
ATOM   2471 O  OE1 . GLN A 1 318 ? -29.626 83.823  21.599 1.00 27.29 ? 318  GLN A OE1 1 
ATOM   2472 N  NE2 . GLN A 1 318 ? -28.973 83.376  19.502 1.00 29.13 ? 318  GLN A NE2 1 
ATOM   2473 N  N   . ILE A 1 319 ? -28.715 89.533  21.391 1.00 26.63 ? 319  ILE A N   1 
ATOM   2474 C  CA  . ILE A 1 319 ? -28.509 90.558  22.418 1.00 24.63 ? 319  ILE A CA  1 
ATOM   2475 C  C   . ILE A 1 319 ? -29.685 91.515  22.402 1.00 24.69 ? 319  ILE A C   1 
ATOM   2476 O  O   . ILE A 1 319 ? -30.239 91.805  21.345 1.00 25.22 ? 319  ILE A O   1 
ATOM   2477 C  CB  . ILE A 1 319 ? -27.229 91.398  22.178 1.00 22.77 ? 319  ILE A CB  1 
ATOM   2478 C  CG1 . ILE A 1 319 ? -27.401 92.285  20.943 1.00 22.33 ? 319  ILE A CG1 1 
ATOM   2479 C  CG2 . ILE A 1 319 ? -26.033 90.487  21.997 1.00 22.86 ? 319  ILE A CG2 1 
ATOM   2480 C  CD1 . ILE A 1 319 ? -26.396 93.428  20.852 1.00 19.59 ? 319  ILE A CD1 1 
ATOM   2481 N  N   . LEU A 1 320 ? -30.062 92.002  23.578 1.00 25.13 ? 320  LEU A N   1 
ATOM   2482 C  CA  . LEU A 1 320 ? -31.171 92.943  23.708 1.00 25.45 ? 320  LEU A CA  1 
ATOM   2483 C  C   . LEU A 1 320 ? -30.637 94.166  24.455 1.00 26.23 ? 320  LEU A C   1 
ATOM   2484 O  O   . LEU A 1 320 ? -30.211 94.046  25.605 1.00 26.83 ? 320  LEU A O   1 
ATOM   2485 C  CB  . LEU A 1 320 ? -32.307 92.294  24.500 1.00 24.78 ? 320  LEU A CB  1 
ATOM   2486 C  CG  . LEU A 1 320 ? -33.675 92.967  24.482 1.00 24.84 ? 320  LEU A CG  1 
ATOM   2487 C  CD1 . LEU A 1 320 ? -34.718 91.912  24.729 1.00 27.11 ? 320  LEU A CD1 1 
ATOM   2488 C  CD2 . LEU A 1 320 ? -33.769 94.062  25.520 1.00 24.85 ? 320  LEU A CD2 1 
ATOM   2489 N  N   . LEU A 1 321 ? -30.659 95.336  23.815 1.00 25.51 ? 321  LEU A N   1 
ATOM   2490 C  CA  . LEU A 1 321 ? -30.141 96.546  24.458 1.00 25.20 ? 321  LEU A CA  1 
ATOM   2491 C  C   . LEU A 1 321 ? -30.940 97.812  24.148 1.00 25.34 ? 321  LEU A C   1 
ATOM   2492 O  O   . LEU A 1 321 ? -31.768 97.824  23.237 1.00 25.55 ? 321  LEU A O   1 
ATOM   2493 C  CB  . LEU A 1 321 ? -28.681 96.759  24.048 1.00 23.30 ? 321  LEU A CB  1 
ATOM   2494 C  CG  . LEU A 1 321 ? -28.445 97.157  22.591 1.00 20.47 ? 321  LEU A CG  1 
ATOM   2495 C  CD1 . LEU A 1 321 ? -26.963 97.332  22.356 1.00 20.78 ? 321  LEU A CD1 1 
ATOM   2496 C  CD2 . LEU A 1 321 ? -29.011 96.105  21.666 1.00 20.92 ? 321  LEU A CD2 1 
ATOM   2497 N  N   . GLY A 1 322 ? -30.677 98.877  24.905 1.00 25.18 ? 322  GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 322 ? -31.376 100.134 24.675 1.00 25.65 ? 322  GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 322 ? -30.871 101.315 25.485 1.00 24.16 ? 322  GLY A C   1 
ATOM   2500 O  O   . GLY A 1 322 ? -29.917 101.192 26.239 1.00 25.62 ? 322  GLY A O   1 
ATOM   2501 N  N   . VAL A 1 323 ? -31.508 102.469 25.326 1.00 23.94 ? 323  VAL A N   1 
ATOM   2502 C  CA  . VAL A 1 323 ? -31.103 103.660 26.068 1.00 24.54 ? 323  VAL A CA  1 
ATOM   2503 C  C   . VAL A 1 323 ? -32.331 104.355 26.641 1.00 26.28 ? 323  VAL A C   1 
ATOM   2504 O  O   . VAL A 1 323 ? -33.461 103.909 26.428 1.00 27.81 ? 323  VAL A O   1 
ATOM   2505 C  CB  . VAL A 1 323 ? -30.365 104.679 25.177 1.00 22.29 ? 323  VAL A CB  1 
ATOM   2506 C  CG1 . VAL A 1 323 ? -29.133 104.052 24.558 1.00 20.41 ? 323  VAL A CG1 1 
ATOM   2507 C  CG2 . VAL A 1 323 ? -31.305 105.192 24.103 1.00 22.84 ? 323  VAL A CG2 1 
ATOM   2508 N  N   . ASN A 1 324 ? -32.099 105.444 27.371 1.00 25.94 ? 324  ASN A N   1 
ATOM   2509 C  CA  . ASN A 1 324 ? -33.175 106.225 27.967 1.00 24.34 ? 324  ASN A CA  1 
ATOM   2510 C  C   . ASN A 1 324 ? -33.163 107.616 27.355 1.00 24.34 ? 324  ASN A C   1 
ATOM   2511 O  O   . ASN A 1 324 ? -32.108 108.126 26.961 1.00 24.02 ? 324  ASN A O   1 
ATOM   2512 C  CB  . ASN A 1 324 ? -32.992 106.309 29.469 1.00 24.43 ? 324  ASN A CB  1 
ATOM   2513 C  CG  . ASN A 1 324 ? -33.135 104.967 30.137 1.00 27.42 ? 324  ASN A CG  1 
ATOM   2514 O  OD1 . ASN A 1 324 ? -33.194 103.922 29.468 1.00 28.55 ? 324  ASN A OD1 1 
ATOM   2515 N  ND2 . ASN A 1 324 ? -33.185 104.974 31.465 1.00 27.22 ? 324  ASN A ND2 1 
ATOM   2516 N  N   . LYS A 1 325 ? -34.339 108.228 27.287 1.00 22.89 ? 325  LYS A N   1 
ATOM   2517 C  CA  . LYS A 1 325 ? -34.492 109.540 26.681 1.00 21.08 ? 325  LYS A CA  1 
ATOM   2518 C  C   . LYS A 1 325 ? -33.562 110.656 27.142 1.00 21.06 ? 325  LYS A C   1 
ATOM   2519 O  O   . LYS A 1 325 ? -33.189 111.492 26.330 1.00 22.54 ? 325  LYS A O   1 
ATOM   2520 C  CB  . LYS A 1 325 ? -35.941 110.012 26.820 1.00 21.25 ? 325  LYS A CB  1 
ATOM   2521 C  CG  . LYS A 1 325 ? -36.198 111.351 26.152 1.00 21.75 ? 325  LYS A CG  1 
ATOM   2522 C  CD  . LYS A 1 325 ? -37.636 111.773 26.264 1.00 22.23 ? 325  LYS A CD  1 
ATOM   2523 C  CE  . LYS A 1 325 ? -37.776 113.285 26.130 1.00 25.28 ? 325  LYS A CE  1 
ATOM   2524 N  NZ  . LYS A 1 325 ? -37.237 113.986 27.346 1.00 27.23 ? 325  LYS A NZ  1 
ATOM   2525 N  N   . ASP A 1 326 ? -33.178 110.685 28.417 1.00 20.29 ? 326  ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 326 ? -32.317 111.767 28.903 1.00 20.14 ? 326  ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 326 ? -31.094 111.308 29.696 1.00 19.78 ? 326  ASP A C   1 
ATOM   2528 O  O   . ASP A 1 326 ? -30.916 111.674 30.854 1.00 20.95 ? 326  ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 326 ? -33.163 112.723 29.749 1.00 21.14 ? 326  ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 326 ? -34.457 113.130 29.042 1.00 23.53 ? 326  ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 326 ? -34.411 113.965 28.102 1.00 22.44 ? 326  ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 326 ? -35.524 112.597 29.419 1.00 24.25 ? 326  ASP A OD2 1 
ATOM   2533 N  N   . GLU A 1 327 ? -30.233 110.531 29.056 1.00 18.56 ? 327  GLU A N   1 
ATOM   2534 C  CA  . GLU A 1 327 ? -29.045 109.997 29.707 1.00 17.38 ? 327  GLU A CA  1 
ATOM   2535 C  C   . GLU A 1 327 ? -28.118 110.997 30.397 1.00 18.13 ? 327  GLU A C   1 
ATOM   2536 O  O   . GLU A 1 327 ? -27.423 110.639 31.364 1.00 17.33 ? 327  GLU A O   1 
ATOM   2537 C  CB  . GLU A 1 327 ? -28.229 109.188 28.693 1.00 18.98 ? 327  GLU A CB  1 
ATOM   2538 C  CG  . GLU A 1 327 ? -28.960 108.003 28.092 1.00 16.71 ? 327  GLU A CG  1 
ATOM   2539 C  CD  . GLU A 1 327 ? -29.289 106.955 29.126 1.00 18.09 ? 327  GLU A CD  1 
ATOM   2540 O  OE1 . GLU A 1 327 ? -29.076 107.227 30.333 1.00 16.23 ? 327  GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A 1 327 ? -29.765 105.867 28.731 1.00 16.33 ? 327  GLU A OE2 1 
ATOM   2542 N  N   . GLY A 1 328 ? -28.106 112.242 29.919 1.00 18.70 ? 328  GLY A N   1 
ATOM   2543 C  CA  . GLY A 1 328 ? -27.201 113.235 30.482 1.00 20.25 ? 328  GLY A CA  1 
ATOM   2544 C  C   . GLY A 1 328 ? -27.614 114.111 31.656 1.00 21.70 ? 328  GLY A C   1 
ATOM   2545 O  O   . GLY A 1 328 ? -26.747 114.663 32.346 1.00 20.54 ? 328  GLY A O   1 
ATOM   2546 N  N   . SER A 1 329 ? -28.915 114.250 31.893 1.00 21.77 ? 329  SER A N   1 
ATOM   2547 C  CA  . SER A 1 329 ? -29.390 115.097 32.977 1.00 22.82 ? 329  SER A CA  1 
ATOM   2548 C  C   . SER A 1 329 ? -28.753 114.801 34.335 1.00 22.90 ? 329  SER A C   1 
ATOM   2549 O  O   . SER A 1 329 ? -28.364 115.726 35.054 1.00 22.56 ? 329  SER A O   1 
ATOM   2550 C  CB  . SER A 1 329 ? -30.912 115.000 33.092 1.00 23.74 ? 329  SER A CB  1 
ATOM   2551 O  OG  . SER A 1 329 ? -31.291 113.744 33.619 1.00 28.73 ? 329  SER A OG  1 
ATOM   2552 N  N   . PHE A 1 330 ? -28.631 113.526 34.693 1.00 22.95 ? 330  PHE A N   1 
ATOM   2553 C  CA  . PHE A 1 330 ? -28.043 113.181 35.987 1.00 24.25 ? 330  PHE A CA  1 
ATOM   2554 C  C   . PHE A 1 330 ? -26.688 113.834 36.219 1.00 25.71 ? 330  PHE A C   1 
ATOM   2555 O  O   . PHE A 1 330 ? -26.466 114.538 37.209 1.00 26.49 ? 330  PHE A O   1 
ATOM   2556 C  CB  . PHE A 1 330 ? -27.845 111.674 36.118 1.00 26.56 ? 330  PHE A CB  1 
ATOM   2557 C  CG  . PHE A 1 330 ? -28.098 111.153 37.504 1.00 29.88 ? 330  PHE A CG  1 
ATOM   2558 C  CD1 . PHE A 1 330 ? -27.723 111.893 38.613 1.00 31.35 ? 330  PHE A CD1 1 
ATOM   2559 C  CD2 . PHE A 1 330 ? -28.778 109.954 37.703 1.00 31.77 ? 330  PHE A CD2 1 
ATOM   2560 C  CE1 . PHE A 1 330 ? -28.031 111.459 39.896 1.00 32.45 ? 330  PHE A CE1 1 
ATOM   2561 C  CE2 . PHE A 1 330 ? -29.088 109.508 38.988 1.00 32.39 ? 330  PHE A CE2 1 
ATOM   2562 C  CZ  . PHE A 1 330 ? -28.719 110.263 40.084 1.00 32.79 ? 330  PHE A CZ  1 
ATOM   2563 N  N   . PHE A 1 331 ? -25.774 113.574 35.298 1.00 25.59 ? 331  PHE A N   1 
ATOM   2564 C  CA  . PHE A 1 331 ? -24.431 114.082 35.399 1.00 26.38 ? 331  PHE A CA  1 
ATOM   2565 C  C   . PHE A 1 331 ? -24.347 115.582 35.330 1.00 27.43 ? 331  PHE A C   1 
ATOM   2566 O  O   . PHE A 1 331 ? -23.526 116.184 36.016 1.00 29.45 ? 331  PHE A O   1 
ATOM   2567 C  CB  . PHE A 1 331 ? -23.576 113.427 34.329 1.00 27.06 ? 331  PHE A CB  1 
ATOM   2568 C  CG  . PHE A 1 331 ? -23.655 111.938 34.361 1.00 27.06 ? 331  PHE A CG  1 
ATOM   2569 C  CD1 . PHE A 1 331 ? -24.749 111.278 33.817 1.00 25.76 ? 331  PHE A CD1 1 
ATOM   2570 C  CD2 . PHE A 1 331 ? -22.682 111.195 35.022 1.00 28.28 ? 331  PHE A CD2 1 
ATOM   2571 C  CE1 . PHE A 1 331 ? -24.875 109.906 33.934 1.00 26.43 ? 331  PHE A CE1 1 
ATOM   2572 C  CE2 . PHE A 1 331 ? -22.801 109.819 35.145 1.00 27.45 ? 331  PHE A CE2 1 
ATOM   2573 C  CZ  . PHE A 1 331 ? -23.900 109.174 34.600 1.00 26.88 ? 331  PHE A CZ  1 
ATOM   2574 N  N   . LEU A 1 332 ? -25.191 116.199 34.517 1.00 28.02 ? 332  LEU A N   1 
ATOM   2575 C  CA  . LEU A 1 332 ? -25.166 117.653 34.436 1.00 28.49 ? 332  LEU A CA  1 
ATOM   2576 C  C   . LEU A 1 332 ? -25.469 118.197 35.833 1.00 29.98 ? 332  LEU A C   1 
ATOM   2577 O  O   . LEU A 1 332 ? -24.721 119.016 36.363 1.00 31.67 ? 332  LEU A O   1 
ATOM   2578 C  CB  . LEU A 1 332 ? -26.189 118.159 33.404 1.00 25.42 ? 332  LEU A CB  1 
ATOM   2579 C  CG  . LEU A 1 332 ? -25.781 117.998 31.928 1.00 24.27 ? 332  LEU A CG  1 
ATOM   2580 C  CD1 . LEU A 1 332 ? -26.998 118.121 31.026 1.00 21.07 ? 332  LEU A CD1 1 
ATOM   2581 C  CD2 . LEU A 1 332 ? -24.726 119.041 31.561 1.00 22.21 ? 332  LEU A CD2 1 
ATOM   2582 N  N   . LEU A 1 333 ? -26.543 117.709 36.447 1.00 31.04 ? 333  LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 333 ? -26.931 118.153 37.788 1.00 32.06 ? 333  LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 333 ? -25.812 118.121 38.838 1.00 32.60 ? 333  LEU A C   1 
ATOM   2585 O  O   . LEU A 1 333 ? -25.704 119.026 39.668 1.00 32.63 ? 333  LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 333 ? -28.106 117.315 38.299 1.00 30.94 ? 333  LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 333 ? -28.456 117.495 39.774 1.00 29.52 ? 333  LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 333 ? -28.801 118.939 40.068 1.00 28.53 ? 333  LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 333 ? -29.616 116.590 40.110 1.00 30.95 ? 333  LEU A CD2 1 
ATOM   2590 N  N   . TYR A 1 334 ? -24.982 117.084 38.809 1.00 32.45 ? 334  TYR A N   1 
ATOM   2591 C  CA  . TYR A 1 334 ? -23.915 116.975 39.790 1.00 31.26 ? 334  TYR A CA  1 
ATOM   2592 C  C   . TYR A 1 334 ? -22.650 117.774 39.520 1.00 31.37 ? 334  TYR A C   1 
ATOM   2593 O  O   . TYR A 1 334 ? -21.974 118.181 40.462 1.00 33.13 ? 334  TYR A O   1 
ATOM   2594 C  CB  . TYR A 1 334 ? -23.535 115.512 40.005 1.00 30.23 ? 334  TYR A CB  1 
ATOM   2595 C  CG  . TYR A 1 334 ? -24.429 114.775 40.974 1.00 28.13 ? 334  TYR A CG  1 
ATOM   2596 C  CD1 . TYR A 1 334 ? -25.754 114.490 40.653 1.00 28.57 ? 334  TYR A CD1 1 
ATOM   2597 C  CD2 . TYR A 1 334 ? -23.947 114.360 42.216 1.00 27.40 ? 334  TYR A CD2 1 
ATOM   2598 C  CE1 . TYR A 1 334 ? -26.583 113.802 41.552 1.00 29.32 ? 334  TYR A CE1 1 
ATOM   2599 C  CE2 . TYR A 1 334 ? -24.763 113.675 43.120 1.00 28.46 ? 334  TYR A CE2 1 
ATOM   2600 C  CZ  . TYR A 1 334 ? -26.081 113.398 42.781 1.00 28.69 ? 334  TYR A CZ  1 
ATOM   2601 O  OH  . TYR A 1 334 ? -26.892 112.723 43.663 1.00 25.44 ? 334  TYR A OH  1 
ATOM   2602 N  N   . GLY A 1 335 ? -22.323 118.019 38.258 1.00 31.11 ? 335  GLY A N   1 
ATOM   2603 C  CA  . GLY A 1 335 ? -21.101 118.754 37.992 1.00 30.48 ? 335  GLY A CA  1 
ATOM   2604 C  C   . GLY A 1 335 ? -21.111 119.886 36.984 1.00 30.83 ? 335  GLY A C   1 
ATOM   2605 O  O   . GLY A 1 335 ? -20.048 120.410 36.659 1.00 32.57 ? 335  GLY A O   1 
ATOM   2606 N  N   . ALA A 1 336 ? -22.277 120.278 36.482 1.00 30.34 ? 336  ALA A N   1 
ATOM   2607 C  CA  . ALA A 1 336 ? -22.335 121.371 35.508 1.00 30.35 ? 336  ALA A CA  1 
ATOM   2608 C  C   . ALA A 1 336 ? -22.925 122.644 36.108 1.00 29.48 ? 336  ALA A C   1 
ATOM   2609 O  O   . ALA A 1 336 ? -23.863 122.609 36.908 1.00 29.39 ? 336  ALA A O   1 
ATOM   2610 C  CB  . ALA A 1 336 ? -23.142 120.952 34.272 1.00 31.65 ? 336  ALA A CB  1 
ATOM   2611 N  N   . PRO A 1 337 ? -22.381 123.795 35.713 1.00 28.10 ? 337  PRO A N   1 
ATOM   2612 C  CA  . PRO A 1 337 ? -22.854 125.080 36.218 1.00 27.14 ? 337  PRO A CA  1 
ATOM   2613 C  C   . PRO A 1 337 ? -24.227 125.458 35.695 1.00 26.69 ? 337  PRO A C   1 
ATOM   2614 O  O   . PRO A 1 337 ? -24.552 125.208 34.531 1.00 26.54 ? 337  PRO A O   1 
ATOM   2615 C  CB  . PRO A 1 337 ? -21.773 126.046 35.742 1.00 26.51 ? 337  PRO A CB  1 
ATOM   2616 C  CG  . PRO A 1 337 ? -21.396 125.473 34.422 1.00 27.21 ? 337  PRO A CG  1 
ATOM   2617 C  CD  . PRO A 1 337 ? -21.297 123.984 34.733 1.00 28.42 ? 337  PRO A CD  1 
ATOM   2618 N  N   . GLY A 1 338 ? -25.029 126.064 36.561 1.00 26.14 ? 338  GLY A N   1 
ATOM   2619 C  CA  . GLY A 1 338 ? -26.346 126.507 36.150 1.00 25.63 ? 338  GLY A CA  1 
ATOM   2620 C  C   . GLY A 1 338 ? -27.475 125.592 36.550 1.00 25.36 ? 338  GLY A C   1 
ATOM   2621 O  O   . GLY A 1 338 ? -28.609 126.038 36.734 1.00 25.78 ? 338  GLY A O   1 
ATOM   2622 N  N   . PHE A 1 339 ? -27.161 124.311 36.685 1.00 25.38 ? 339  PHE A N   1 
ATOM   2623 C  CA  . PHE A 1 339 ? -28.158 123.317 37.045 1.00 24.22 ? 339  PHE A CA  1 
ATOM   2624 C  C   . PHE A 1 339 ? -28.460 123.331 38.521 1.00 24.31 ? 339  PHE A C   1 
ATOM   2625 O  O   . PHE A 1 339 ? -27.603 123.619 39.339 1.00 25.03 ? 339  PHE A O   1 
ATOM   2626 C  CB  . PHE A 1 339 ? -27.698 121.917 36.602 1.00 22.50 ? 339  PHE A CB  1 
ATOM   2627 C  CG  . PHE A 1 339 ? -27.516 121.798 35.115 1.00 18.81 ? 339  PHE A CG  1 
ATOM   2628 C  CD1 . PHE A 1 339 ? -26.365 122.285 34.503 1.00 14.91 ? 339  PHE A CD1 1 
ATOM   2629 C  CD2 . PHE A 1 339 ? -28.536 121.282 34.316 1.00 16.46 ? 339  PHE A CD2 1 
ATOM   2630 C  CE1 . PHE A 1 339 ? -26.239 122.265 33.124 1.00 13.28 ? 339  PHE A CE1 1 
ATOM   2631 C  CE2 . PHE A 1 339 ? -28.416 121.261 32.933 1.00 12.96 ? 339  PHE A CE2 1 
ATOM   2632 C  CZ  . PHE A 1 339 ? -27.270 121.753 32.337 1.00 11.78 ? 339  PHE A CZ  1 
ATOM   2633 N  N   . SER A 1 340 ? -29.703 123.014 38.841 1.00 26.19 ? 340  SER A N   1 
ATOM   2634 C  CA  . SER A 1 340 ? -30.179 122.988 40.204 1.00 27.85 ? 340  SER A CA  1 
ATOM   2635 C  C   . SER A 1 340 ? -31.277 121.956 40.312 1.00 29.55 ? 340  SER A C   1 
ATOM   2636 O  O   . SER A 1 340 ? -31.979 121.673 39.340 1.00 29.08 ? 340  SER A O   1 
ATOM   2637 C  CB  . SER A 1 340 ? -30.741 124.355 40.584 1.00 28.73 ? 340  SER A CB  1 
ATOM   2638 O  OG  . SER A 1 340 ? -31.613 124.257 41.696 1.00 30.47 ? 340  SER A OG  1 
ATOM   2639 N  N   . LYS A 1 341 ? -31.425 121.406 41.508 1.00 31.37 ? 341  LYS A N   1 
ATOM   2640 C  CA  . LYS A 1 341 ? -32.445 120.412 41.779 1.00 33.34 ? 341  LYS A CA  1 
ATOM   2641 C  C   . LYS A 1 341 ? -33.707 121.134 42.247 1.00 35.93 ? 341  LYS A C   1 
ATOM   2642 O  O   . LYS A 1 341 ? -34.785 120.539 42.283 1.00 35.67 ? 341  LYS A O   1 
ATOM   2643 C  CB  . LYS A 1 341 ? -31.947 119.461 42.868 1.00 32.91 ? 341  LYS A CB  1 
ATOM   2644 C  CG  . LYS A 1 341 ? -32.856 118.288 43.165 1.00 31.92 ? 341  LYS A CG  1 
ATOM   2645 C  CD  . LYS A 1 341 ? -32.181 117.280 44.111 1.00 32.12 ? 341  LYS A CD  1 
ATOM   2646 C  CE  . LYS A 1 341 ? -32.088 117.775 45.556 1.00 30.35 ? 341  LYS A CE  1 
ATOM   2647 N  NZ  . LYS A 1 341 ? -33.420 117.876 46.220 1.00 30.88 ? 341  LYS A NZ  1 
ATOM   2648 N  N   . ASP A 1 342 ? -33.566 122.420 42.584 1.00 37.19 ? 342  ASP A N   1 
ATOM   2649 C  CA  . ASP A 1 342 ? -34.687 123.224 43.080 1.00 40.40 ? 342  ASP A CA  1 
ATOM   2650 C  C   . ASP A 1 342 ? -35.306 124.201 42.078 1.00 40.92 ? 342  ASP A C   1 
ATOM   2651 O  O   . ASP A 1 342 ? -36.038 125.109 42.467 1.00 42.67 ? 342  ASP A O   1 
ATOM   2652 C  CB  . ASP A 1 342 ? -34.266 124.026 44.320 1.00 43.31 ? 342  ASP A CB  1 
ATOM   2653 C  CG  . ASP A 1 342 ? -33.627 123.166 45.397 1.00 45.58 ? 342  ASP A CG  1 
ATOM   2654 O  OD1 . ASP A 1 342 ? -34.170 122.078 45.713 1.00 44.73 ? 342  ASP A OD1 1 
ATOM   2655 O  OD2 . ASP A 1 342 ? -32.580 123.597 45.937 1.00 46.92 ? 342  ASP A OD2 1 
ATOM   2656 N  N   . SER A 1 343 ? -35.005 124.034 40.799 1.00 41.26 ? 343  SER A N   1 
ATOM   2657 C  CA  . SER A 1 343 ? -35.565 124.899 39.769 1.00 40.93 ? 343  SER A CA  1 
ATOM   2658 C  C   . SER A 1 343 ? -35.540 124.146 38.440 1.00 42.14 ? 343  SER A C   1 
ATOM   2659 O  O   . SER A 1 343 ? -35.093 122.996 38.382 1.00 42.60 ? 343  SER A O   1 
ATOM   2660 C  CB  . SER A 1 343 ? -34.758 126.191 39.667 1.00 39.36 ? 343  SER A CB  1 
ATOM   2661 O  OG  . SER A 1 343 ? -33.437 125.932 39.236 1.00 38.57 ? 343  SER A OG  1 
ATOM   2662 N  N   . GLU A 1 344 ? -36.018 124.778 37.374 1.00 42.65 ? 344  GLU A N   1 
ATOM   2663 C  CA  . GLU A 1 344 ? -36.030 124.112 36.081 1.00 43.75 ? 344  GLU A CA  1 
ATOM   2664 C  C   . GLU A 1 344 ? -34.714 124.266 35.303 1.00 42.35 ? 344  GLU A C   1 
ATOM   2665 O  O   . GLU A 1 344 ? -34.621 123.909 34.124 1.00 41.96 ? 344  GLU A O   1 
ATOM   2666 C  CB  . GLU A 1 344 ? -37.235 124.589 35.263 1.00 47.37 ? 344  GLU A CB  1 
ATOM   2667 C  CG  . GLU A 1 344 ? -37.394 126.094 35.136 1.00 52.45 ? 344  GLU A CG  1 
ATOM   2668 C  CD  . GLU A 1 344 ? -38.777 126.473 34.619 1.00 56.80 ? 344  GLU A CD  1 
ATOM   2669 O  OE1 . GLU A 1 344 ? -38.959 127.632 34.181 1.00 58.37 ? 344  GLU A OE1 1 
ATOM   2670 O  OE2 . GLU A 1 344 ? -39.686 125.608 34.665 1.00 57.50 ? 344  GLU A OE2 1 
ATOM   2671 N  N   . SER A 1 345 ? -33.701 124.785 35.992 1.00 40.05 ? 345  SER A N   1 
ATOM   2672 C  CA  . SER A 1 345 ? -32.353 124.966 35.457 1.00 38.35 ? 345  SER A CA  1 
ATOM   2673 C  C   . SER A 1 345 ? -32.226 125.537 34.050 1.00 39.26 ? 345  SER A C   1 
ATOM   2674 O  O   . SER A 1 345 ? -31.617 124.910 33.178 1.00 40.37 ? 345  SER A O   1 
ATOM   2675 C  CB  . SER A 1 345 ? -31.593 123.635 35.504 1.00 36.61 ? 345  SER A CB  1 
ATOM   2676 O  OG  . SER A 1 345 ? -31.835 122.936 36.711 1.00 35.59 ? 345  SER A OG  1 
ATOM   2677 N  N   . LYS A 1 346 ? -32.793 126.715 33.813 1.00 39.26 ? 346  LYS A N   1 
ATOM   2678 C  CA  . LYS A 1 346 ? -32.664 127.337 32.499 1.00 38.37 ? 346  LYS A CA  1 
ATOM   2679 C  C   . LYS A 1 346 ? -31.188 127.719 32.400 1.00 36.99 ? 346  LYS A C   1 
ATOM   2680 O  O   . LYS A 1 346 ? -30.695 128.511 33.200 1.00 36.38 ? 346  LYS A O   1 
ATOM   2681 C  CB  . LYS A 1 346 ? -33.538 128.588 32.403 1.00 39.59 ? 346  LYS A CB  1 
ATOM   2682 C  CG  . LYS A 1 346 ? -35.015 128.353 32.677 1.00 41.36 ? 346  LYS A CG  1 
ATOM   2683 C  CD  . LYS A 1 346 ? -35.827 129.602 32.341 1.00 44.03 ? 346  LYS A CD  1 
ATOM   2684 C  CE  . LYS A 1 346 ? -37.325 129.374 32.518 1.00 45.05 ? 346  LYS A CE  1 
ATOM   2685 N  NZ  . LYS A 1 346 ? -38.143 130.397 31.788 1.00 44.76 ? 346  LYS A NZ  1 
ATOM   2686 N  N   . ILE A 1 347 ? -30.478 127.157 31.430 1.00 36.01 ? 347  ILE A N   1 
ATOM   2687 C  CA  . ILE A 1 347 ? -29.053 127.438 31.306 1.00 34.57 ? 347  ILE A CA  1 
ATOM   2688 C  C   . ILE A 1 347 ? -28.724 128.618 30.406 1.00 35.77 ? 347  ILE A C   1 
ATOM   2689 O  O   . ILE A 1 347 ? -29.188 128.708 29.266 1.00 33.95 ? 347  ILE A O   1 
ATOM   2690 C  CB  . ILE A 1 347 ? -28.285 126.189 30.812 1.00 32.41 ? 347  ILE A CB  1 
ATOM   2691 C  CG1 . ILE A 1 347 ? -28.662 124.982 31.668 1.00 29.34 ? 347  ILE A CG1 1 
ATOM   2692 C  CG2 . ILE A 1 347 ? -26.787 126.420 30.890 1.00 32.09 ? 347  ILE A CG2 1 
ATOM   2693 C  CD1 . ILE A 1 347 ? -28.466 125.192 33.137 1.00 27.28 ? 347  ILE A CD1 1 
ATOM   2694 N  N   . SER A 1 348 ? -27.906 129.517 30.949 1.00 37.82 ? 348  SER A N   1 
ATOM   2695 C  CA  . SER A 1 348 ? -27.467 130.724 30.259 1.00 38.82 ? 348  SER A CA  1 
ATOM   2696 C  C   . SER A 1 348 ? -26.469 130.373 29.174 1.00 40.24 ? 348  SER A C   1 
ATOM   2697 O  O   . SER A 1 348 ? -25.891 129.292 29.188 1.00 40.81 ? 348  SER A O   1 
ATOM   2698 C  CB  . SER A 1 348 ? -26.784 131.666 31.244 1.00 38.75 ? 348  SER A CB  1 
ATOM   2699 O  OG  . SER A 1 348 ? -25.488 131.190 31.562 1.00 36.89 ? 348  SER A OG  1 
ATOM   2700 N  N   . ARG A 1 349 ? -26.249 131.306 28.252 1.00 41.95 ? 349  ARG A N   1 
ATOM   2701 C  CA  . ARG A 1 349 ? -25.308 131.095 27.161 1.00 42.25 ? 349  ARG A CA  1 
ATOM   2702 C  C   . ARG A 1 349 ? -23.900 130.888 27.699 1.00 42.84 ? 349  ARG A C   1 
ATOM   2703 O  O   . ARG A 1 349 ? -23.180 130.006 27.232 1.00 43.03 ? 349  ARG A O   1 
ATOM   2704 C  CB  . ARG A 1 349 ? -25.317 132.288 26.207 1.00 42.89 ? 349  ARG A CB  1 
ATOM   2705 C  CG  . ARG A 1 349 ? -24.701 131.990 24.858 1.00 42.80 ? 349  ARG A CG  1 
ATOM   2706 C  CD  . ARG A 1 349 ? -25.530 130.955 24.123 1.00 45.36 ? 349  ARG A CD  1 
ATOM   2707 N  NE  . ARG A 1 349 ? -24.743 130.266 23.111 1.00 48.95 ? 349  ARG A NE  1 
ATOM   2708 C  CZ  . ARG A 1 349 ? -25.121 129.151 22.496 1.00 50.39 ? 349  ARG A CZ  1 
ATOM   2709 N  NH1 . ARG A 1 349 ? -26.290 128.585 22.785 1.00 49.30 ? 349  ARG A NH1 1 
ATOM   2710 N  NH2 . ARG A 1 349 ? -24.318 128.593 21.598 1.00 51.52 ? 349  ARG A NH2 1 
ATOM   2711 N  N   . GLU A 1 350 ? -23.506 131.687 28.688 1.00 43.60 ? 350  GLU A N   1 
ATOM   2712 C  CA  . GLU A 1 350 ? -22.167 131.549 29.251 1.00 44.53 ? 350  GLU A CA  1 
ATOM   2713 C  C   . GLU A 1 350 ? -21.981 130.200 29.934 1.00 43.40 ? 350  GLU A C   1 
ATOM   2714 O  O   . GLU A 1 350 ? -20.936 129.566 29.791 1.00 43.24 ? 350  GLU A O   1 
ATOM   2715 C  CB  . GLU A 1 350 ? -21.860 132.666 30.247 1.00 46.42 ? 350  GLU A CB  1 
ATOM   2716 C  CG  . GLU A 1 350 ? -20.476 132.511 30.858 1.00 51.34 ? 350  GLU A CG  1 
ATOM   2717 C  CD  . GLU A 1 350 ? -20.157 133.568 31.894 1.00 54.48 ? 350  GLU A CD  1 
ATOM   2718 O  OE1 . GLU A 1 350 ? -20.967 133.746 32.833 1.00 56.45 ? 350  GLU A OE1 1 
ATOM   2719 O  OE2 . GLU A 1 350 ? -19.089 134.212 31.775 1.00 55.66 ? 350  GLU A OE2 1 
ATOM   2720 N  N   . ASP A 1 351 ? -22.990 129.767 30.685 1.00 42.54 ? 351  ASP A N   1 
ATOM   2721 C  CA  . ASP A 1 351 ? -22.925 128.475 31.360 1.00 40.68 ? 351  ASP A CA  1 
ATOM   2722 C  C   . ASP A 1 351 ? -22.854 127.350 30.332 1.00 40.84 ? 351  ASP A C   1 
ATOM   2723 O  O   . ASP A 1 351 ? -22.091 126.403 30.504 1.00 42.10 ? 351  ASP A O   1 
ATOM   2724 C  CB  . ASP A 1 351 ? -24.151 128.251 32.243 1.00 40.48 ? 351  ASP A CB  1 
ATOM   2725 C  CG  . ASP A 1 351 ? -24.015 128.888 33.610 1.00 39.77 ? 351  ASP A CG  1 
ATOM   2726 O  OD1 . ASP A 1 351 ? -22.873 128.974 34.107 1.00 38.32 ? 351  ASP A OD1 1 
ATOM   2727 O  OD2 . ASP A 1 351 ? -25.050 129.276 34.195 1.00 37.56 ? 351  ASP A OD2 1 
ATOM   2728 N  N   . PHE A 1 352 ? -23.656 127.462 29.271 1.00 39.07 ? 352  PHE A N   1 
ATOM   2729 C  CA  . PHE A 1 352 ? -23.700 126.469 28.197 1.00 36.14 ? 352  PHE A CA  1 
ATOM   2730 C  C   . PHE A 1 352 ? -22.300 126.193 27.677 1.00 35.94 ? 352  PHE A C   1 
ATOM   2731 O  O   . PHE A 1 352 ? -21.885 125.038 27.578 1.00 35.97 ? 352  PHE A O   1 
ATOM   2732 C  CB  . PHE A 1 352 ? -24.566 126.973 27.044 1.00 34.62 ? 352  PHE A CB  1 
ATOM   2733 C  CG  . PHE A 1 352 ? -24.789 125.958 25.945 1.00 33.05 ? 352  PHE A CG  1 
ATOM   2734 C  CD1 . PHE A 1 352 ? -25.859 125.070 25.999 1.00 31.93 ? 352  PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A 1 352 ? -23.956 125.924 24.829 1.00 32.18 ? 352  PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A 1 352 ? -26.099 124.168 24.952 1.00 29.30 ? 352  PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A 1 352 ? -24.192 125.023 23.784 1.00 29.67 ? 352  PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A 1 352 ? -25.265 124.149 23.848 1.00 27.54 ? 352  PHE A CZ  1 
ATOM   2739 N  N   . MET A 1 353 ? -21.570 127.250 27.338 1.00 35.38 ? 353  MET A N   1 
ATOM   2740 C  CA  . MET A 1 353 ? -20.216 127.068 26.833 1.00 35.88 ? 353  MET A CA  1 
ATOM   2741 C  C   . MET A 1 353 ? -19.433 126.279 27.877 1.00 34.64 ? 353  MET A C   1 
ATOM   2742 O  O   . MET A 1 353 ? -18.723 125.331 27.549 1.00 35.09 ? 353  MET A O   1 
ATOM   2743 C  CB  . MET A 1 353 ? -19.537 128.417 26.577 1.00 38.46 ? 353  MET A CB  1 
ATOM   2744 C  CG  . MET A 1 353 ? -20.293 129.349 25.637 1.00 41.67 ? 353  MET A CG  1 
ATOM   2745 S  SD  . MET A 1 353 ? -20.671 128.596 24.040 1.00 47.57 ? 353  MET A SD  1 
ATOM   2746 C  CE  . MET A 1 353 ? -19.175 128.998 23.120 1.00 46.58 ? 353  MET A CE  1 
ATOM   2747 N  N   . SER A 1 354 ? -19.571 126.667 29.141 1.00 32.45 ? 354  SER A N   1 
ATOM   2748 C  CA  . SER A 1 354 ? -18.875 125.967 30.213 1.00 31.41 ? 354  SER A CA  1 
ATOM   2749 C  C   . SER A 1 354 ? -19.264 124.498 30.147 1.00 31.84 ? 354  SER A C   1 
ATOM   2750 O  O   . SER A 1 354 ? -18.410 123.621 30.016 1.00 32.75 ? 354  SER A O   1 
ATOM   2751 C  CB  . SER A 1 354 ? -19.281 126.522 31.582 1.00 29.57 ? 354  SER A CB  1 
ATOM   2752 O  OG  . SER A 1 354 ? -18.957 127.890 31.707 1.00 28.52 ? 354  SER A OG  1 
ATOM   2753 N  N   . GLY A 1 355 ? -20.572 124.255 30.238 1.00 31.37 ? 355  GLY A N   1 
ATOM   2754 C  CA  . GLY A 1 355 ? -21.110 122.910 30.208 1.00 27.76 ? 355  GLY A CA  1 
ATOM   2755 C  C   . GLY A 1 355 ? -20.581 122.070 29.071 1.00 25.92 ? 355  GLY A C   1 
ATOM   2756 O  O   . GLY A 1 355 ? -20.292 120.888 29.253 1.00 25.22 ? 355  GLY A O   1 
ATOM   2757 N  N   . VAL A 1 356 ? -20.449 122.672 27.896 1.00 24.33 ? 356  VAL A N   1 
ATOM   2758 C  CA  . VAL A 1 356 ? -19.947 121.933 26.751 1.00 23.20 ? 356  VAL A CA  1 
ATOM   2759 C  C   . VAL A 1 356 ? -18.520 121.466 27.021 1.00 25.04 ? 356  VAL A C   1 
ATOM   2760 O  O   . VAL A 1 356 ? -18.223 120.278 26.895 1.00 28.24 ? 356  VAL A O   1 
ATOM   2761 C  CB  . VAL A 1 356 ? -20.010 122.781 25.455 1.00 18.77 ? 356  VAL A CB  1 
ATOM   2762 C  CG1 . VAL A 1 356 ? -19.352 122.057 24.313 1.00 16.48 ? 356  VAL A CG1 1 
ATOM   2763 C  CG2 . VAL A 1 356 ? -21.446 123.043 25.098 1.00 17.75 ? 356  VAL A CG2 1 
ATOM   2764 N  N   . LYS A 1 357 ? -17.645 122.381 27.424 1.00 24.82 ? 357  LYS A N   1 
ATOM   2765 C  CA  . LYS A 1 357 ? -16.263 122.014 27.698 1.00 24.51 ? 357  LYS A CA  1 
ATOM   2766 C  C   . LYS A 1 357 ? -16.156 120.953 28.796 1.00 24.47 ? 357  LYS A C   1 
ATOM   2767 O  O   . LYS A 1 357 ? -15.195 120.186 28.828 1.00 25.74 ? 357  LYS A O   1 
ATOM   2768 C  CB  . LYS A 1 357 ? -15.443 123.248 28.097 1.00 25.97 ? 357  LYS A CB  1 
ATOM   2769 C  CG  . LYS A 1 357 ? -13.950 122.955 28.281 1.00 29.22 ? 357  LYS A CG  1 
ATOM   2770 C  CD  . LYS A 1 357 ? -13.281 123.924 29.255 1.00 33.29 ? 357  LYS A CD  1 
ATOM   2771 C  CE  . LYS A 1 357 ? -12.455 124.984 28.537 1.00 35.46 ? 357  LYS A CE  1 
ATOM   2772 N  NZ  . LYS A 1 357 ? -11.316 124.376 27.780 1.00 37.83 ? 357  LYS A NZ  1 
ATOM   2773 N  N   . LEU A 1 358 ? -17.125 120.899 29.705 1.00 23.39 ? 358  LEU A N   1 
ATOM   2774 C  CA  . LEU A 1 358 ? -17.058 119.904 30.769 1.00 23.35 ? 358  LEU A CA  1 
ATOM   2775 C  C   . LEU A 1 358 ? -17.536 118.553 30.271 1.00 25.31 ? 358  LEU A C   1 
ATOM   2776 O  O   . LEU A 1 358 ? -17.373 117.544 30.958 1.00 26.86 ? 358  LEU A O   1 
ATOM   2777 C  CB  . LEU A 1 358 ? -17.914 120.310 31.971 1.00 20.82 ? 358  LEU A CB  1 
ATOM   2778 C  CG  . LEU A 1 358 ? -17.466 121.476 32.851 1.00 20.46 ? 358  LEU A CG  1 
ATOM   2779 C  CD1 . LEU A 1 358 ? -18.442 121.656 33.996 1.00 18.95 ? 358  LEU A CD1 1 
ATOM   2780 C  CD2 . LEU A 1 358 ? -16.084 121.203 33.401 1.00 19.72 ? 358  LEU A CD2 1 
ATOM   2781 N  N   . SER A 1 359 ? -18.115 118.532 29.074 1.00 25.26 ? 359  SER A N   1 
ATOM   2782 C  CA  . SER A 1 359 ? -18.650 117.303 28.510 1.00 26.69 ? 359  SER A CA  1 
ATOM   2783 C  C   . SER A 1 359 ? -17.760 116.638 27.463 1.00 29.75 ? 359  SER A C   1 
ATOM   2784 O  O   . SER A 1 359 ? -17.914 115.454 27.160 1.00 30.51 ? 359  SER A O   1 
ATOM   2785 C  CB  . SER A 1 359 ? -20.033 117.587 27.935 1.00 24.36 ? 359  SER A CB  1 
ATOM   2786 O  OG  . SER A 1 359 ? -20.871 118.082 28.960 1.00 19.83 ? 359  SER A OG  1 
ATOM   2787 N  N   . VAL A 1 360 ? -16.830 117.400 26.909 1.00 31.12 ? 360  VAL A N   1 
ATOM   2788 C  CA  . VAL A 1 360 ? -15.906 116.872 25.923 1.00 32.84 ? 360  VAL A CA  1 
ATOM   2789 C  C   . VAL A 1 360 ? -14.546 117.453 26.267 1.00 33.55 ? 360  VAL A C   1 
ATOM   2790 O  O   . VAL A 1 360 ? -13.944 118.166 25.472 1.00 34.68 ? 360  VAL A O   1 
ATOM   2791 C  CB  . VAL A 1 360 ? -16.324 117.283 24.501 1.00 33.35 ? 360  VAL A CB  1 
ATOM   2792 C  CG1 . VAL A 1 360 ? -17.225 116.233 23.905 1.00 34.08 ? 360  VAL A CG1 1 
ATOM   2793 C  CG2 . VAL A 1 360 ? -17.077 118.589 24.547 1.00 35.85 ? 360  VAL A CG2 1 
ATOM   2794 N  N   . PRO A 1 361 ? -14.045 117.142 27.472 1.00 34.99 ? 361  PRO A N   1 
ATOM   2795 C  CA  . PRO A 1 361 ? -12.759 117.596 28.017 1.00 35.84 ? 361  PRO A CA  1 
ATOM   2796 C  C   . PRO A 1 361 ? -11.524 117.318 27.165 1.00 36.71 ? 361  PRO A C   1 
ATOM   2797 O  O   . PRO A 1 361 ? -10.518 118.018 27.268 1.00 37.99 ? 361  PRO A O   1 
ATOM   2798 C  CB  . PRO A 1 361 ? -12.694 116.895 29.372 1.00 35.99 ? 361  PRO A CB  1 
ATOM   2799 C  CG  . PRO A 1 361 ? -13.460 115.629 29.129 1.00 35.79 ? 361  PRO A CG  1 
ATOM   2800 C  CD  . PRO A 1 361 ? -14.653 116.133 28.360 1.00 35.67 ? 361  PRO A CD  1 
ATOM   2801 N  N   . HIS A 1 362 ? -11.599 116.301 26.322 1.00 36.30 ? 362  HIS A N   1 
ATOM   2802 C  CA  . HIS A 1 362 ? -10.476 115.945 25.467 1.00 36.74 ? 362  HIS A CA  1 
ATOM   2803 C  C   . HIS A 1 362 ? -10.520 116.739 24.166 1.00 36.90 ? 362  HIS A C   1 
ATOM   2804 O  O   . HIS A 1 362 ? -9.643  116.591 23.315 1.00 38.30 ? 362  HIS A O   1 
ATOM   2805 C  CB  . HIS A 1 362 ? -10.565 114.474 25.117 1.00 37.33 ? 362  HIS A CB  1 
ATOM   2806 C  CG  . HIS A 1 362 ? -11.840 114.125 24.426 1.00 37.88 ? 362  HIS A CG  1 
ATOM   2807 N  ND1 . HIS A 1 362 ? -13.061 114.169 25.064 1.00 38.90 ? 362  HIS A ND1 1 
ATOM   2808 C  CD2 . HIS A 1 362 ? -12.100 113.824 23.132 1.00 37.64 ? 362  HIS A CD2 1 
ATOM   2809 C  CE1 . HIS A 1 362 ? -14.020 113.913 24.191 1.00 40.16 ? 362  HIS A CE1 1 
ATOM   2810 N  NE2 . HIS A 1 362 ? -13.464 113.701 23.012 1.00 39.53 ? 362  HIS A NE2 1 
ATOM   2811 N  N   . ALA A 1 363 ? -11.545 117.568 24.003 1.00 35.34 ? 363  ALA A N   1 
ATOM   2812 C  CA  . ALA A 1 363 ? -11.699 118.337 22.779 1.00 34.35 ? 363  ALA A CA  1 
ATOM   2813 C  C   . ALA A 1 363 ? -10.926 119.642 22.744 1.00 35.53 ? 363  ALA A C   1 
ATOM   2814 O  O   . ALA A 1 363 ? -10.851 120.357 23.741 1.00 36.82 ? 363  ALA A O   1 
ATOM   2815 C  CB  . ALA A 1 363 ? -13.167 118.612 22.538 1.00 33.17 ? 363  ALA A CB  1 
ATOM   2816 N  N   . ASN A 1 364 ? -10.353 119.949 21.583 1.00 36.23 ? 364  ASN A N   1 
ATOM   2817 C  CA  . ASN A 1 364 ? -9.616  121.191 21.397 1.00 35.27 ? 364  ASN A CA  1 
ATOM   2818 C  C   . ASN A 1 364 ? -10.644 122.299 21.195 1.00 35.61 ? 364  ASN A C   1 
ATOM   2819 O  O   . ASN A 1 364 ? -11.842 122.034 21.105 1.00 35.60 ? 364  ASN A O   1 
ATOM   2820 C  CB  . ASN A 1 364 ? -8.697  121.106 20.174 1.00 35.93 ? 364  ASN A CB  1 
ATOM   2821 C  CG  . ASN A 1 364 ? -9.442  120.722 18.914 1.00 36.87 ? 364  ASN A CG  1 
ATOM   2822 O  OD1 . ASN A 1 364 ? -10.600 121.085 18.739 1.00 37.62 ? 364  ASN A OD1 1 
ATOM   2823 N  ND2 . ASN A 1 364 ? -8.776  119.997 18.021 1.00 36.07 ? 364  ASN A ND2 1 
ATOM   2824 N  N   . ASP A 1 365 ? -10.180 123.537 21.109 1.00 35.94 ? 365  ASP A N   1 
ATOM   2825 C  CA  . ASP A 1 365 ? -11.089 124.650 20.945 1.00 35.84 ? 365  ASP A CA  1 
ATOM   2826 C  C   . ASP A 1 365 ? -11.978 124.507 19.712 1.00 34.40 ? 365  ASP A C   1 
ATOM   2827 O  O   . ASP A 1 365 ? -13.166 124.810 19.755 1.00 33.70 ? 365  ASP A O   1 
ATOM   2828 C  CB  . ASP A 1 365 ? -10.292 125.943 20.888 1.00 41.02 ? 365  ASP A CB  1 
ATOM   2829 C  CG  . ASP A 1 365 ? -10.922 127.046 21.711 1.00 44.94 ? 365  ASP A CG  1 
ATOM   2830 O  OD1 . ASP A 1 365 ? -11.937 127.626 21.256 1.00 47.90 ? 365  ASP A OD1 1 
ATOM   2831 O  OD2 . ASP A 1 365 ? -10.405 127.319 22.820 1.00 46.85 ? 365  ASP A OD2 1 
ATOM   2832 N  N   . LEU A 1 366 ? -11.411 124.038 18.612 1.00 32.25 ? 366  LEU A N   1 
ATOM   2833 C  CA  . LEU A 1 366 ? -12.200 123.868 17.400 1.00 31.89 ? 366  LEU A CA  1 
ATOM   2834 C  C   . LEU A 1 366 ? -13.288 122.823 17.618 1.00 32.93 ? 366  LEU A C   1 
ATOM   2835 O  O   . LEU A 1 366 ? -14.434 123.011 17.212 1.00 32.74 ? 366  LEU A O   1 
ATOM   2836 C  CB  . LEU A 1 366 ? -11.311 123.435 16.231 1.00 29.21 ? 366  LEU A CB  1 
ATOM   2837 C  CG  . LEU A 1 366 ? -12.047 123.239 14.905 1.00 27.00 ? 366  LEU A CG  1 
ATOM   2838 C  CD1 . LEU A 1 366 ? -12.647 124.568 14.445 1.00 25.31 ? 366  LEU A CD1 1 
ATOM   2839 C  CD2 . LEU A 1 366 ? -11.086 122.700 13.862 1.00 26.00 ? 366  LEU A CD2 1 
ATOM   2840 N  N   . GLY A 1 367 ? -12.912 121.717 18.255 1.00 34.31 ? 367  GLY A N   1 
ATOM   2841 C  CA  . GLY A 1 367 ? -13.851 120.643 18.527 1.00 33.98 ? 367  GLY A CA  1 
ATOM   2842 C  C   . GLY A 1 367 ? -15.040 121.145 19.317 1.00 33.74 ? 367  GLY A C   1 
ATOM   2843 O  O   . GLY A 1 367 ? -16.187 120.772 19.037 1.00 33.55 ? 367  GLY A O   1 
ATOM   2844 N  N   . LEU A 1 368 ? -14.766 121.993 20.305 1.00 32.57 ? 368  LEU A N   1 
ATOM   2845 C  CA  . LEU A 1 368 ? -15.823 122.562 21.122 1.00 32.43 ? 368  LEU A CA  1 
ATOM   2846 C  C   . LEU A 1 368 ? -16.752 123.410 20.248 1.00 32.88 ? 368  LEU A C   1 
ATOM   2847 O  O   . LEU A 1 368 ? -17.973 123.390 20.418 1.00 31.84 ? 368  LEU A O   1 
ATOM   2848 C  CB  . LEU A 1 368 ? -15.213 123.395 22.251 1.00 31.97 ? 368  LEU A CB  1 
ATOM   2849 C  CG  . LEU A 1 368 ? -14.439 122.568 23.287 1.00 32.73 ? 368  LEU A CG  1 
ATOM   2850 C  CD1 . LEU A 1 368 ? -13.865 123.470 24.375 1.00 30.91 ? 368  LEU A CD1 1 
ATOM   2851 C  CD2 . LEU A 1 368 ? -15.379 121.530 23.908 1.00 32.80 ? 368  LEU A CD2 1 
ATOM   2852 N  N   . ASP A 1 369 ? -16.175 124.141 19.299 1.00 33.01 ? 369  ASP A N   1 
ATOM   2853 C  CA  . ASP A 1 369 ? -16.980 124.963 18.407 1.00 34.00 ? 369  ASP A CA  1 
ATOM   2854 C  C   . ASP A 1 369 ? -17.874 124.077 17.546 1.00 33.11 ? 369  ASP A C   1 
ATOM   2855 O  O   . ASP A 1 369 ? -19.049 124.384 17.324 1.00 33.51 ? 369  ASP A O   1 
ATOM   2856 C  CB  . ASP A 1 369 ? -16.089 125.828 17.507 1.00 36.01 ? 369  ASP A CB  1 
ATOM   2857 C  CG  . ASP A 1 369 ? -15.271 126.835 18.293 1.00 38.21 ? 369  ASP A CG  1 
ATOM   2858 O  OD1 . ASP A 1 369 ? -15.830 127.456 19.223 1.00 40.30 ? 369  ASP A OD1 1 
ATOM   2859 O  OD2 . ASP A 1 369 ? -14.073 127.014 17.979 1.00 39.96 ? 369  ASP A OD2 1 
ATOM   2860 N  N   . ALA A 1 370 ? -17.311 122.976 17.064 1.00 31.46 ? 370  ALA A N   1 
ATOM   2861 C  CA  . ALA A 1 370 ? -18.061 122.043 16.242 1.00 30.50 ? 370  ALA A CA  1 
ATOM   2862 C  C   . ALA A 1 370 ? -19.240 121.514 17.034 1.00 30.65 ? 370  ALA A C   1 
ATOM   2863 O  O   . ALA A 1 370 ? -20.329 121.334 16.491 1.00 32.07 ? 370  ALA A O   1 
ATOM   2864 C  CB  . ALA A 1 370 ? -17.173 120.892 15.808 1.00 29.04 ? 370  ALA A CB  1 
ATOM   2865 N  N   . VAL A 1 371 ? -19.019 121.271 18.323 1.00 30.29 ? 371  VAL A N   1 
ATOM   2866 C  CA  . VAL A 1 371 ? -20.065 120.751 19.198 1.00 28.98 ? 371  VAL A CA  1 
ATOM   2867 C  C   . VAL A 1 371 ? -21.159 121.779 19.430 1.00 29.41 ? 371  VAL A C   1 
ATOM   2868 O  O   . VAL A 1 371 ? -22.339 121.445 19.407 1.00 31.09 ? 371  VAL A O   1 
ATOM   2869 C  CB  . VAL A 1 371 ? -19.496 120.323 20.563 1.00 27.79 ? 371  VAL A CB  1 
ATOM   2870 C  CG1 . VAL A 1 371 ? -20.608 119.783 21.448 1.00 26.85 ? 371  VAL A CG1 1 
ATOM   2871 C  CG2 . VAL A 1 371 ? -18.424 119.262 20.366 1.00 27.03 ? 371  VAL A CG2 1 
ATOM   2872 N  N   . THR A 1 372 ? -20.765 123.029 19.654 1.00 29.86 ? 372  THR A N   1 
ATOM   2873 C  CA  . THR A 1 372 ? -21.721 124.106 19.888 1.00 28.58 ? 372  THR A CA  1 
ATOM   2874 C  C   . THR A 1 372 ? -22.558 124.387 18.646 1.00 29.14 ? 372  THR A C   1 
ATOM   2875 O  O   . THR A 1 372 ? -23.786 124.486 18.717 1.00 29.50 ? 372  THR A O   1 
ATOM   2876 C  CB  . THR A 1 372 ? -21.007 125.399 20.299 1.00 28.57 ? 372  THR A CB  1 
ATOM   2877 O  OG1 . THR A 1 372 ? -20.434 125.231 21.604 1.00 28.60 ? 372  THR A OG1 1 
ATOM   2878 C  CG2 . THR A 1 372 ? -21.988 126.577 20.313 1.00 29.58 ? 372  THR A CG2 1 
ATOM   2879 N  N   . LEU A 1 373 ? -21.894 124.518 17.505 1.00 28.35 ? 373  LEU A N   1 
ATOM   2880 C  CA  . LEU A 1 373 ? -22.607 124.784 16.265 1.00 27.69 ? 373  LEU A CA  1 
ATOM   2881 C  C   . LEU A 1 373 ? -23.640 123.704 16.030 1.00 27.90 ? 373  LEU A C   1 
ATOM   2882 O  O   . LEU A 1 373 ? -24.779 123.986 15.685 1.00 28.49 ? 373  LEU A O   1 
ATOM   2883 C  CB  . LEU A 1 373 ? -21.636 124.805 15.084 1.00 25.96 ? 373  LEU A CB  1 
ATOM   2884 C  CG  . LEU A 1 373 ? -22.292 124.864 13.707 1.00 24.05 ? 373  LEU A CG  1 
ATOM   2885 C  CD1 . LEU A 1 373 ? -23.055 126.174 13.565 1.00 22.92 ? 373  LEU A CD1 1 
ATOM   2886 C  CD2 . LEU A 1 373 ? -21.229 124.719 12.626 1.00 23.70 ? 373  LEU A CD2 1 
ATOM   2887 N  N   . GLN A 1 374 ? -23.218 122.463 16.236 1.00 28.86 ? 374  GLN A N   1 
ATOM   2888 C  CA  . GLN A 1 374 ? -24.053 121.285 16.031 1.00 28.91 ? 374  GLN A CA  1 
ATOM   2889 C  C   . GLN A 1 374 ? -25.287 121.224 16.926 1.00 27.90 ? 374  GLN A C   1 
ATOM   2890 O  O   . GLN A 1 374 ? -26.342 120.751 16.506 1.00 26.42 ? 374  GLN A O   1 
ATOM   2891 C  CB  . GLN A 1 374 ? -23.205 120.031 16.253 1.00 31.54 ? 374  GLN A CB  1 
ATOM   2892 C  CG  . GLN A 1 374 ? -23.831 118.749 15.762 1.00 34.52 ? 374  GLN A CG  1 
ATOM   2893 C  CD  . GLN A 1 374 ? -23.873 118.659 14.254 1.00 37.05 ? 374  GLN A CD  1 
ATOM   2894 O  OE1 . GLN A 1 374 ? -24.374 117.676 13.701 1.00 40.66 ? 374  GLN A OE1 1 
ATOM   2895 N  NE2 . GLN A 1 374 ? -23.347 119.679 13.575 1.00 38.00 ? 374  GLN A NE2 1 
ATOM   2896 N  N   . TYR A 1 375 ? -25.156 121.711 18.154 1.00 26.91 ? 375  TYR A N   1 
ATOM   2897 C  CA  . TYR A 1 375 ? -26.265 121.673 19.096 1.00 27.03 ? 375  TYR A CA  1 
ATOM   2898 C  C   . TYR A 1 375 ? -26.925 122.996 19.471 1.00 26.59 ? 375  TYR A C   1 
ATOM   2899 O  O   . TYR A 1 375 ? -27.775 123.024 20.354 1.00 26.46 ? 375  TYR A O   1 
ATOM   2900 C  CB  . TYR A 1 375 ? -25.821 120.970 20.376 1.00 26.16 ? 375  TYR A CB  1 
ATOM   2901 C  CG  . TYR A 1 375 ? -25.758 119.469 20.264 1.00 25.39 ? 375  TYR A CG  1 
ATOM   2902 C  CD1 . TYR A 1 375 ? -24.616 118.825 19.798 1.00 25.35 ? 375  TYR A CD1 1 
ATOM   2903 C  CD2 . TYR A 1 375 ? -26.841 118.688 20.651 1.00 23.32 ? 375  TYR A CD2 1 
ATOM   2904 C  CE1 . TYR A 1 375 ? -24.557 117.438 19.733 1.00 23.45 ? 375  TYR A CE1 1 
ATOM   2905 C  CE2 . TYR A 1 375 ? -26.791 117.312 20.589 1.00 22.88 ? 375  TYR A CE2 1 
ATOM   2906 C  CZ  . TYR A 1 375 ? -25.651 116.691 20.133 1.00 23.03 ? 375  TYR A CZ  1 
ATOM   2907 O  OH  . TYR A 1 375 ? -25.610 115.321 20.095 1.00 22.40 ? 375  TYR A OH  1 
ATOM   2908 N  N   . THR A 1 376 ? -26.556 124.079 18.796 1.00 27.91 ? 376  THR A N   1 
ATOM   2909 C  CA  . THR A 1 376 ? -27.110 125.409 19.085 1.00 29.20 ? 376  THR A CA  1 
ATOM   2910 C  C   . THR A 1 376 ? -28.086 125.960 18.046 1.00 30.45 ? 376  THR A C   1 
ATOM   2911 O  O   . THR A 1 376 ? -27.806 125.951 16.845 1.00 30.56 ? 376  THR A O   1 
ATOM   2912 C  CB  . THR A 1 376 ? -25.979 126.447 19.237 1.00 27.46 ? 376  THR A CB  1 
ATOM   2913 O  OG1 . THR A 1 376 ? -25.219 126.143 20.406 1.00 27.53 ? 376  THR A OG1 1 
ATOM   2914 C  CG2 . THR A 1 376 ? -26.536 127.846 19.347 1.00 24.80 ? 376  THR A CG2 1 
ATOM   2915 N  N   . ASP A 1 377 ? -29.225 126.460 18.513 1.00 32.88 ? 377  ASP A N   1 
ATOM   2916 C  CA  . ASP A 1 377 ? -30.215 127.039 17.609 1.00 36.68 ? 377  ASP A CA  1 
ATOM   2917 C  C   . ASP A 1 377 ? -29.967 128.541 17.522 1.00 38.62 ? 377  ASP A C   1 
ATOM   2918 O  O   . ASP A 1 377 ? -30.292 129.292 18.435 1.00 37.67 ? 377  ASP A O   1 
ATOM   2919 C  CB  . ASP A 1 377 ? -31.633 126.769 18.112 1.00 37.56 ? 377  ASP A CB  1 
ATOM   2920 C  CG  . ASP A 1 377 ? -32.683 127.449 17.268 1.00 37.82 ? 377  ASP A CG  1 
ATOM   2921 O  OD1 . ASP A 1 377 ? -32.381 127.756 16.091 1.00 39.24 ? 377  ASP A OD1 1 
ATOM   2922 O  OD2 . ASP A 1 377 ? -33.805 127.665 17.777 1.00 36.37 ? 377  ASP A OD2 1 
ATOM   2923 N  N   . TRP A 1 378 ? -29.390 128.974 16.410 1.00 41.65 ? 378  TRP A N   1 
ATOM   2924 C  CA  . TRP A 1 378 ? -29.066 130.377 16.247 1.00 44.62 ? 378  TRP A CA  1 
ATOM   2925 C  C   . TRP A 1 378 ? -30.256 131.287 15.997 1.00 46.36 ? 378  TRP A C   1 
ATOM   2926 O  O   . TRP A 1 378 ? -30.094 132.489 15.795 1.00 46.17 ? 378  TRP A O   1 
ATOM   2927 C  CB  . TRP A 1 378 ? -28.002 130.528 15.160 1.00 45.23 ? 378  TRP A CB  1 
ATOM   2928 C  CG  . TRP A 1 378 ? -26.678 129.977 15.601 1.00 45.65 ? 378  TRP A CG  1 
ATOM   2929 C  CD1 . TRP A 1 378 ? -26.003 128.920 15.060 1.00 46.40 ? 378  TRP A CD1 1 
ATOM   2930 C  CD2 . TRP A 1 378 ? -25.895 130.427 16.714 1.00 45.99 ? 378  TRP A CD2 1 
ATOM   2931 N  NE1 . TRP A 1 378 ? -24.849 128.681 15.771 1.00 46.57 ? 378  TRP A NE1 1 
ATOM   2932 C  CE2 . TRP A 1 378 ? -24.758 129.592 16.790 1.00 46.00 ? 378  TRP A CE2 1 
ATOM   2933 C  CE3 . TRP A 1 378 ? -26.045 131.455 17.657 1.00 47.46 ? 378  TRP A CE3 1 
ATOM   2934 C  CZ2 . TRP A 1 378 ? -23.772 129.751 17.774 1.00 47.02 ? 378  TRP A CZ2 1 
ATOM   2935 C  CZ3 . TRP A 1 378 ? -25.061 131.614 18.642 1.00 47.91 ? 378  TRP A CZ3 1 
ATOM   2936 C  CH2 . TRP A 1 378 ? -23.940 130.764 18.688 1.00 47.54 ? 378  TRP A CH2 1 
ATOM   2937 N  N   . MET A 1 379 ? -31.452 130.713 16.021 1.00 48.54 ? 379  MET A N   1 
ATOM   2938 C  CA  . MET A 1 379 ? -32.667 131.496 15.849 1.00 50.93 ? 379  MET A CA  1 
ATOM   2939 C  C   . MET A 1 379 ? -33.311 131.657 17.212 1.00 51.49 ? 379  MET A C   1 
ATOM   2940 O  O   . MET A 1 379 ? -34.426 132.174 17.318 1.00 52.57 ? 379  MET A O   1 
ATOM   2941 C  CB  . MET A 1 379 ? -33.665 130.789 14.947 1.00 52.80 ? 379  MET A CB  1 
ATOM   2942 C  CG  . MET A 1 379 ? -33.522 131.078 13.488 1.00 56.85 ? 379  MET A CG  1 
ATOM   2943 S  SD  . MET A 1 379 ? -34.957 130.391 12.660 1.00 64.73 ? 379  MET A SD  1 
ATOM   2944 C  CE  . MET A 1 379 ? -34.607 128.581 12.794 1.00 61.60 ? 379  MET A CE  1 
ATOM   2945 N  N   . ASP A 1 380 ? -32.606 131.215 18.251 1.00 51.44 ? 380  ASP A N   1 
ATOM   2946 C  CA  . ASP A 1 380 ? -33.126 131.273 19.613 1.00 51.75 ? 380  ASP A CA  1 
ATOM   2947 C  C   . ASP A 1 380 ? -32.055 130.750 20.577 1.00 52.66 ? 380  ASP A C   1 
ATOM   2948 O  O   . ASP A 1 380 ? -32.316 129.866 21.389 1.00 53.63 ? 380  ASP A O   1 
ATOM   2949 C  CB  . ASP A 1 380 ? -34.391 130.406 19.672 1.00 50.44 ? 380  ASP A CB  1 
ATOM   2950 C  CG  . ASP A 1 380 ? -35.213 130.637 20.916 1.00 50.48 ? 380  ASP A CG  1 
ATOM   2951 O  OD1 . ASP A 1 380 ? -35.210 131.776 21.436 1.00 50.54 ? 380  ASP A OD1 1 
ATOM   2952 O  OD2 . ASP A 1 380 ? -35.882 129.678 21.360 1.00 49.63 ? 380  ASP A OD2 1 
ATOM   2953 N  N   . ASP A 1 381 ? -30.852 131.316 20.482 1.00 54.23 ? 381  ASP A N   1 
ATOM   2954 C  CA  . ASP A 1 381 ? -29.698 130.904 21.292 1.00 55.03 ? 381  ASP A CA  1 
ATOM   2955 C  C   . ASP A 1 381 ? -29.702 131.288 22.772 1.00 54.68 ? 381  ASP A C   1 
ATOM   2956 O  O   . ASP A 1 381 ? -28.888 130.785 23.552 1.00 53.17 ? 381  ASP A O   1 
ATOM   2957 C  CB  . ASP A 1 381 ? -28.421 131.456 20.667 1.00 57.17 ? 381  ASP A CB  1 
ATOM   2958 C  CG  . ASP A 1 381 ? -28.365 132.973 20.716 1.00 59.24 ? 381  ASP A CG  1 
ATOM   2959 O  OD1 . ASP A 1 381 ? -29.199 133.621 20.042 1.00 58.04 ? 381  ASP A OD1 1 
ATOM   2960 O  OD2 . ASP A 1 381 ? -27.493 133.511 21.437 1.00 61.05 ? 381  ASP A OD2 1 
ATOM   2961 N  N   . ASN A 1 382 ? -30.598 132.189 23.150 1.00 54.63 ? 382  ASN A N   1 
ATOM   2962 C  CA  . ASN A 1 382 ? -30.682 132.636 24.533 1.00 54.28 ? 382  ASN A CA  1 
ATOM   2963 C  C   . ASN A 1 382 ? -31.727 131.852 25.311 1.00 52.38 ? 382  ASN A C   1 
ATOM   2964 O  O   . ASN A 1 382 ? -31.815 131.970 26.533 1.00 51.75 ? 382  ASN A O   1 
ATOM   2965 C  CB  . ASN A 1 382 ? -31.005 134.130 24.577 1.00 57.22 ? 382  ASN A CB  1 
ATOM   2966 C  CG  . ASN A 1 382 ? -29.786 134.992 24.325 1.00 59.48 ? 382  ASN A CG  1 
ATOM   2967 O  OD1 . ASN A 1 382 ? -29.885 136.088 23.761 1.00 60.73 ? 382  ASN A OD1 1 
ATOM   2968 N  ND2 . ASN A 1 382 ? -28.623 134.506 24.754 1.00 60.08 ? 382  ASN A ND2 1 
ATOM   2969 N  N   . ASN A 1 383 ? -32.516 131.056 24.597 1.00 49.53 ? 383  ASN A N   1 
ATOM   2970 C  CA  . ASN A 1 383 ? -33.551 130.241 25.220 1.00 47.60 ? 383  ASN A CA  1 
ATOM   2971 C  C   . ASN A 1 383 ? -32.888 129.368 26.286 1.00 46.89 ? 383  ASN A C   1 
ATOM   2972 O  O   . ASN A 1 383 ? -32.120 128.464 25.960 1.00 48.32 ? 383  ASN A O   1 
ATOM   2973 C  CB  . ASN A 1 383 ? -34.220 129.359 24.165 1.00 46.90 ? 383  ASN A CB  1 
ATOM   2974 C  CG  . ASN A 1 383 ? -35.530 128.783 24.636 1.00 46.23 ? 383  ASN A CG  1 
ATOM   2975 O  OD1 . ASN A 1 383 ? -35.620 128.237 25.731 1.00 46.85 ? 383  ASN A OD1 1 
ATOM   2976 N  ND2 . ASN A 1 383 ? -36.557 128.895 23.805 1.00 46.32 ? 383  ASN A ND2 1 
ATOM   2977 N  N   . GLY A 1 384 ? -33.179 129.640 27.554 1.00 44.88 ? 384  GLY A N   1 
ATOM   2978 C  CA  . GLY A 1 384 ? -32.581 128.869 28.631 1.00 41.62 ? 384  GLY A CA  1 
ATOM   2979 C  C   . GLY A 1 384 ? -32.971 127.405 28.619 1.00 39.81 ? 384  GLY A C   1 
ATOM   2980 O  O   . GLY A 1 384 ? -32.201 126.544 29.049 1.00 38.77 ? 384  GLY A O   1 
ATOM   2981 N  N   . ILE A 1 385 ? -34.170 127.123 28.125 1.00 38.10 ? 385  ILE A N   1 
ATOM   2982 C  CA  . ILE A 1 385 ? -34.672 125.757 28.057 1.00 36.85 ? 385  ILE A CA  1 
ATOM   2983 C  C   . ILE A 1 385 ? -33.957 124.959 26.985 1.00 36.35 ? 385  ILE A C   1 
ATOM   2984 O  O   . ILE A 1 385 ? -33.631 123.793 27.185 1.00 38.56 ? 385  ILE A O   1 
ATOM   2985 C  CB  . ILE A 1 385 ? -36.195 125.724 27.760 1.00 35.68 ? 385  ILE A CB  1 
ATOM   2986 C  CG1 . ILE A 1 385 ? -36.971 126.300 28.949 1.00 34.43 ? 385  ILE A CG1 1 
ATOM   2987 C  CG2 . ILE A 1 385 ? -36.641 124.307 27.460 1.00 33.80 ? 385  ILE A CG2 1 
ATOM   2988 C  CD1 . ILE A 1 385 ? -36.662 125.623 30.261 1.00 33.29 ? 385  ILE A CD1 1 
ATOM   2989 N  N   . LYS A 1 386 ? -33.711 125.582 25.844 1.00 34.68 ? 386  LYS A N   1 
ATOM   2990 C  CA  . LYS A 1 386 ? -33.035 124.883 24.767 1.00 34.68 ? 386  LYS A CA  1 
ATOM   2991 C  C   . LYS A 1 386 ? -31.587 124.533 25.116 1.00 33.85 ? 386  LYS A C   1 
ATOM   2992 O  O   . LYS A 1 386 ? -31.087 123.457 24.760 1.00 32.81 ? 386  LYS A O   1 
ATOM   2993 C  CB  . LYS A 1 386 ? -33.102 125.719 23.492 1.00 36.03 ? 386  LYS A CB  1 
ATOM   2994 C  CG  . LYS A 1 386 ? -34.422 125.562 22.771 1.00 36.87 ? 386  LYS A CG  1 
ATOM   2995 C  CD  . LYS A 1 386 ? -34.541 126.517 21.617 1.00 38.63 ? 386  LYS A CD  1 
ATOM   2996 C  CE  . LYS A 1 386 ? -35.788 126.216 20.826 1.00 40.80 ? 386  LYS A CE  1 
ATOM   2997 N  NZ  . LYS A 1 386 ? -36.000 127.245 19.780 1.00 44.78 ? 386  LYS A NZ  1 
ATOM   2998 N  N   . ASN A 1 387 ? -30.916 125.437 25.819 1.00 32.39 ? 387  ASN A N   1 
ATOM   2999 C  CA  . ASN A 1 387 ? -29.540 125.197 26.215 1.00 30.95 ? 387  ASN A CA  1 
ATOM   3000 C  C   . ASN A 1 387 ? -29.500 124.044 27.207 1.00 30.15 ? 387  ASN A C   1 
ATOM   3001 O  O   . ASN A 1 387 ? -28.634 123.171 27.120 1.00 30.51 ? 387  ASN A O   1 
ATOM   3002 C  CB  . ASN A 1 387 ? -28.943 126.451 26.852 1.00 30.81 ? 387  ASN A CB  1 
ATOM   3003 C  CG  . ASN A 1 387 ? -28.741 127.560 25.861 1.00 29.00 ? 387  ASN A CG  1 
ATOM   3004 O  OD1 . ASN A 1 387 ? -27.963 127.433 24.919 1.00 29.56 ? 387  ASN A OD1 1 
ATOM   3005 N  ND2 . ASN A 1 387 ? -29.442 128.660 26.064 1.00 31.05 ? 387  ASN A ND2 1 
ATOM   3006 N  N   . ARG A 1 388 ? -30.442 124.049 28.148 1.00 28.03 ? 388  ARG A N   1 
ATOM   3007 C  CA  . ARG A 1 388 ? -30.526 122.999 29.154 1.00 26.40 ? 388  ARG A CA  1 
ATOM   3008 C  C   . ARG A 1 388 ? -30.657 121.659 28.452 1.00 25.70 ? 388  ARG A C   1 
ATOM   3009 O  O   . ARG A 1 388 ? -29.833 120.770 28.640 1.00 23.24 ? 388  ARG A O   1 
ATOM   3010 C  CB  . ARG A 1 388 ? -31.739 123.224 30.055 1.00 27.47 ? 388  ARG A CB  1 
ATOM   3011 C  CG  . ARG A 1 388 ? -31.789 122.310 31.266 1.00 28.89 ? 388  ARG A CG  1 
ATOM   3012 C  CD  . ARG A 1 388 ? -33.129 121.619 31.357 1.00 28.06 ? 388  ARG A CD  1 
ATOM   3013 N  NE  . ARG A 1 388 ? -34.182 122.519 31.803 1.00 29.37 ? 388  ARG A NE  1 
ATOM   3014 C  CZ  . ARG A 1 388 ? -35.441 122.444 31.387 1.00 30.33 ? 388  ARG A CZ  1 
ATOM   3015 N  NH1 . ARG A 1 388 ? -35.795 121.511 30.505 1.00 29.08 ? 388  ARG A NH1 1 
ATOM   3016 N  NH2 . ARG A 1 388 ? -36.349 123.286 31.864 1.00 29.10 ? 388  ARG A NH2 1 
ATOM   3017 N  N   . ASP A 1 389 ? -31.693 121.519 27.631 1.00 25.84 ? 389  ASP A N   1 
ATOM   3018 C  CA  . ASP A 1 389 ? -31.907 120.274 26.905 1.00 26.71 ? 389  ASP A CA  1 
ATOM   3019 C  C   . ASP A 1 389 ? -30.737 119.960 26.004 1.00 26.46 ? 389  ASP A C   1 
ATOM   3020 O  O   . ASP A 1 389 ? -30.389 118.794 25.812 1.00 26.71 ? 389  ASP A O   1 
ATOM   3021 C  CB  . ASP A 1 389 ? -33.161 120.347 26.050 1.00 26.68 ? 389  ASP A CB  1 
ATOM   3022 C  CG  . ASP A 1 389 ? -34.408 120.404 26.871 1.00 28.12 ? 389  ASP A CG  1 
ATOM   3023 O  OD1 . ASP A 1 389 ? -34.405 119.856 27.995 1.00 26.46 ? 389  ASP A OD1 1 
ATOM   3024 O  OD2 . ASP A 1 389 ? -35.396 120.987 26.384 1.00 29.58 ? 389  ASP A OD2 1 
ATOM   3025 N  N   . GLY A 1 390 ? -30.154 121.009 25.435 1.00 25.58 ? 390  GLY A N   1 
ATOM   3026 C  CA  . GLY A 1 390 ? -29.026 120.829 24.549 1.00 25.69 ? 390  GLY A CA  1 
ATOM   3027 C  C   . GLY A 1 390 ? -27.940 120.037 25.242 1.00 26.23 ? 390  GLY A C   1 
ATOM   3028 O  O   . GLY A 1 390 ? -27.452 119.050 24.707 1.00 27.59 ? 390  GLY A O   1 
ATOM   3029 N  N   . LEU A 1 391 ? -27.562 120.458 26.443 1.00 24.90 ? 391  LEU A N   1 
ATOM   3030 C  CA  . LEU A 1 391 ? -26.528 119.752 27.175 1.00 24.04 ? 391  LEU A CA  1 
ATOM   3031 C  C   . LEU A 1 391 ? -26.956 118.320 27.469 1.00 24.33 ? 391  LEU A C   1 
ATOM   3032 O  O   . LEU A 1 391 ? -26.160 117.386 27.350 1.00 26.98 ? 391  LEU A O   1 
ATOM   3033 C  CB  . LEU A 1 391 ? -26.199 120.497 28.470 1.00 23.71 ? 391  LEU A CB  1 
ATOM   3034 C  CG  . LEU A 1 391 ? -25.343 121.743 28.237 1.00 22.48 ? 391  LEU A CG  1 
ATOM   3035 C  CD1 . LEU A 1 391 ? -25.308 122.572 29.481 1.00 24.11 ? 391  LEU A CD1 1 
ATOM   3036 C  CD2 . LEU A 1 391 ? -23.940 121.342 27.823 1.00 20.82 ? 391  LEU A CD2 1 
ATOM   3037 N  N   . ASP A 1 392 ? -28.214 118.140 27.843 1.00 22.87 ? 392  ASP A N   1 
ATOM   3038 C  CA  . ASP A 1 392 ? -28.704 116.812 28.132 1.00 20.94 ? 392  ASP A CA  1 
ATOM   3039 C  C   . ASP A 1 392 ? -28.412 115.906 26.942 1.00 20.92 ? 392  ASP A C   1 
ATOM   3040 O  O   . ASP A 1 392 ? -27.891 114.808 27.113 1.00 21.96 ? 392  ASP A O   1 
ATOM   3041 C  CB  . ASP A 1 392 ? -30.204 116.852 28.423 1.00 20.42 ? 392  ASP A CB  1 
ATOM   3042 C  CG  . ASP A 1 392 ? -30.797 115.467 28.657 1.00 23.38 ? 392  ASP A CG  1 
ATOM   3043 O  OD1 . ASP A 1 392 ? -30.107 114.607 29.265 1.00 22.39 ? 392  ASP A OD1 1 
ATOM   3044 O  OD2 . ASP A 1 392 ? -31.961 115.247 28.247 1.00 20.30 ? 392  ASP A OD2 1 
ATOM   3045 N  N   . ASP A 1 393 ? -28.728 116.368 25.736 1.00 20.90 ? 393  ASP A N   1 
ATOM   3046 C  CA  . ASP A 1 393 ? -28.499 115.562 24.537 1.00 20.96 ? 393  ASP A CA  1 
ATOM   3047 C  C   . ASP A 1 393 ? -27.028 115.392 24.262 1.00 21.34 ? 393  ASP A C   1 
ATOM   3048 O  O   . ASP A 1 393 ? -26.595 114.333 23.818 1.00 20.84 ? 393  ASP A O   1 
ATOM   3049 C  CB  . ASP A 1 393 ? -29.158 116.189 23.304 1.00 21.67 ? 393  ASP A CB  1 
ATOM   3050 C  CG  . ASP A 1 393 ? -30.660 116.048 23.314 1.00 23.55 ? 393  ASP A CG  1 
ATOM   3051 O  OD1 . ASP A 1 393 ? -31.137 114.991 23.776 1.00 26.06 ? 393  ASP A OD1 1 
ATOM   3052 O  OD2 . ASP A 1 393 ? -31.361 116.974 22.851 1.00 23.61 ? 393  ASP A OD2 1 
ATOM   3053 N  N   . ILE A 1 394 ? -26.258 116.445 24.514 1.00 22.22 ? 394  ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 394 ? -24.830 116.382 24.276 1.00 21.47 ? 394  ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 394 ? -24.252 115.306 25.167 1.00 21.78 ? 394  ILE A C   1 
ATOM   3056 O  O   . ILE A 1 394 ? -23.736 114.304 24.680 1.00 24.14 ? 394  ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 394 ? -24.151 117.730 24.543 1.00 20.67 ? 394  ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 394 ? -24.524 118.715 23.425 1.00 22.26 ? 394  ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 394 ? -22.647 117.547 24.597 1.00 22.67 ? 394  ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 394 ? -23.920 120.094 23.560 1.00 21.37 ? 394  ILE A CD1 1 
ATOM   3061 N  N   . VAL A 1 395 ? -24.365 115.489 26.473 1.00 20.86 ? 395  VAL A N   1 
ATOM   3062 C  CA  . VAL A 1 395 ? -23.852 114.492 27.395 1.00 19.91 ? 395  VAL A CA  1 
ATOM   3063 C  C   . VAL A 1 395 ? -24.416 113.090 27.100 1.00 18.49 ? 395  VAL A C   1 
ATOM   3064 O  O   . VAL A 1 395 ? -23.702 112.094 27.158 1.00 16.46 ? 395  VAL A O   1 
ATOM   3065 C  CB  . VAL A 1 395 ? -24.195 114.877 28.831 1.00 19.50 ? 395  VAL A CB  1 
ATOM   3066 C  CG1 . VAL A 1 395 ? -23.710 113.796 29.783 1.00 19.31 ? 395  VAL A CG1 1 
ATOM   3067 C  CG2 . VAL A 1 395 ? -23.577 116.229 29.156 1.00 17.54 ? 395  VAL A CG2 1 
ATOM   3068 N  N   . GLY A 1 396 ? -25.694 113.033 26.755 1.00 18.26 ? 396  GLY A N   1 
ATOM   3069 C  CA  . GLY A 1 396 ? -26.334 111.760 26.482 1.00 19.88 ? 396  GLY A CA  1 
ATOM   3070 C  C   . GLY A 1 396 ? -25.844 111.052 25.241 1.00 21.01 ? 396  GLY A C   1 
ATOM   3071 O  O   . GLY A 1 396 ? -25.489 109.874 25.292 1.00 22.08 ? 396  GLY A O   1 
ATOM   3072 N  N   . ASP A 1 397 ? -25.831 111.768 24.123 1.00 20.44 ? 397  ASP A N   1 
ATOM   3073 C  CA  . ASP A 1 397 ? -25.385 111.197 22.873 1.00 21.13 ? 397  ASP A CA  1 
ATOM   3074 C  C   . ASP A 1 397 ? -23.902 110.833 22.920 1.00 22.37 ? 397  ASP A C   1 
ATOM   3075 O  O   . ASP A 1 397 ? -23.524 109.726 22.518 1.00 24.71 ? 397  ASP A O   1 
ATOM   3076 C  CB  . ASP A 1 397 ? -25.622 112.169 21.713 1.00 22.78 ? 397  ASP A CB  1 
ATOM   3077 C  CG  . ASP A 1 397 ? -27.066 112.632 21.611 1.00 24.46 ? 397  ASP A CG  1 
ATOM   3078 O  OD1 . ASP A 1 397 ? -27.958 111.964 22.177 1.00 27.70 ? 397  ASP A OD1 1 
ATOM   3079 O  OD2 . ASP A 1 397 ? -27.308 113.666 20.951 1.00 23.61 ? 397  ASP A OD2 1 
ATOM   3080 N  N   . HIS A 1 398 ? -23.064 111.750 23.406 1.00 20.23 ? 398  HIS A N   1 
ATOM   3081 C  CA  . HIS A 1 398 ? -21.621 111.506 23.468 1.00 18.13 ? 398  HIS A CA  1 
ATOM   3082 C  C   . HIS A 1 398 ? -21.216 110.397 24.424 1.00 18.84 ? 398  HIS A C   1 
ATOM   3083 O  O   . HIS A 1 398 ? -20.309 109.629 24.128 1.00 17.18 ? 398  HIS A O   1 
ATOM   3084 C  CB  . HIS A 1 398 ? -20.861 112.792 23.840 1.00 15.18 ? 398  HIS A CB  1 
ATOM   3085 C  CG  . HIS A 1 398 ? -19.414 112.568 24.187 1.00 14.15 ? 398  HIS A CG  1 
ATOM   3086 N  ND1 . HIS A 1 398 ? -18.516 111.985 23.317 1.00 14.51 ? 398  HIS A ND1 1 
ATOM   3087 C  CD2 . HIS A 1 398 ? -18.715 112.843 25.315 1.00 11.82 ? 398  HIS A CD2 1 
ATOM   3088 C  CE1 . HIS A 1 398 ? -17.329 111.912 23.894 1.00 12.40 ? 398  HIS A CE1 1 
ATOM   3089 N  NE2 . HIS A 1 398 ? -17.423 112.426 25.107 1.00 8.68  ? 398  HIS A NE2 1 
ATOM   3090 N  N   . ASN A 1 399 ? -21.883 110.312 25.570 1.00 21.01 ? 399  ASN A N   1 
ATOM   3091 C  CA  . ASN A 1 399 ? -21.539 109.293 26.558 1.00 22.09 ? 399  ASN A CA  1 
ATOM   3092 C  C   . ASN A 1 399 ? -22.311 107.983 26.518 1.00 20.92 ? 399  ASN A C   1 
ATOM   3093 O  O   . ASN A 1 399 ? -21.792 106.968 26.969 1.00 22.07 ? 399  ASN A O   1 
ATOM   3094 C  CB  . ASN A 1 399 ? -21.634 109.866 27.974 1.00 24.69 ? 399  ASN A CB  1 
ATOM   3095 C  CG  . ASN A 1 399 ? -20.460 110.747 28.323 1.00 26.24 ? 399  ASN A CG  1 
ATOM   3096 O  OD1 . ASN A 1 399 ? -19.303 110.339 28.168 1.00 26.31 ? 399  ASN A OD1 1 
ATOM   3097 N  ND2 . ASN A 1 399 ? -20.744 111.962 28.803 1.00 25.28 ? 399  ASN A ND2 1 
ATOM   3098 N  N   . VAL A 1 400 ? -23.536 107.987 25.999 1.00 20.10 ? 400  VAL A N   1 
ATOM   3099 C  CA  . VAL A 1 400 ? -24.301 106.749 25.963 1.00 18.35 ? 400  VAL A CA  1 
ATOM   3100 C  C   . VAL A 1 400 ? -24.962 106.344 24.663 1.00 19.14 ? 400  VAL A C   1 
ATOM   3101 O  O   . VAL A 1 400 ? -24.570 105.336 24.086 1.00 20.19 ? 400  VAL A O   1 
ATOM   3102 C  CB  . VAL A 1 400 ? -25.372 106.728 27.053 1.00 17.94 ? 400  VAL A CB  1 
ATOM   3103 C  CG1 . VAL A 1 400 ? -26.206 105.489 26.924 1.00 15.83 ? 400  VAL A CG1 1 
ATOM   3104 C  CG2 . VAL A 1 400 ? -24.710 106.761 28.421 1.00 18.85 ? 400  VAL A CG2 1 
ATOM   3105 N  N   . ILE A 1 401 ? -25.953 107.102 24.192 1.00 20.07 ? 401  ILE A N   1 
ATOM   3106 C  CA  . ILE A 1 401 ? -26.654 106.717 22.961 1.00 21.25 ? 401  ILE A CA  1 
ATOM   3107 C  C   . ILE A 1 401 ? -25.740 106.403 21.774 1.00 23.92 ? 401  ILE A C   1 
ATOM   3108 O  O   . ILE A 1 401 ? -25.669 105.257 21.322 1.00 25.63 ? 401  ILE A O   1 
ATOM   3109 C  CB  . ILE A 1 401 ? -27.684 107.778 22.473 1.00 19.70 ? 401  ILE A CB  1 
ATOM   3110 C  CG1 . ILE A 1 401 ? -28.791 107.996 23.500 1.00 17.23 ? 401  ILE A CG1 1 
ATOM   3111 C  CG2 . ILE A 1 401 ? -28.355 107.277 21.194 1.00 19.40 ? 401  ILE A CG2 1 
ATOM   3112 C  CD1 . ILE A 1 401 ? -28.344 108.686 24.719 1.00 19.84 ? 401  ILE A CD1 1 
ATOM   3113 N  N   . CYS A 1 402 ? -25.039 107.406 21.262 1.00 24.37 ? 402  CYS A N   1 
ATOM   3114 C  CA  . CYS A 1 402 ? -24.175 107.173 20.115 1.00 24.96 ? 402  CYS A CA  1 
ATOM   3115 C  C   . CYS A 1 402 ? -23.179 106.022 20.268 1.00 24.09 ? 402  CYS A C   1 
ATOM   3116 O  O   . CYS A 1 402 ? -22.978 105.249 19.334 1.00 24.80 ? 402  CYS A O   1 
ATOM   3117 C  CB  . CYS A 1 402 ? -23.455 108.460 19.736 1.00 25.44 ? 402  CYS A CB  1 
ATOM   3118 S  SG  . CYS A 1 402 ? -24.620 109.712 19.139 1.00 26.35 ? 402  CYS A SG  1 
ATOM   3119 N  N   . PRO A 1 403 ? -22.529 105.898 21.433 1.00 21.94 ? 403  PRO A N   1 
ATOM   3120 C  CA  . PRO A 1 403 ? -21.584 104.784 21.569 1.00 20.72 ? 403  PRO A CA  1 
ATOM   3121 C  C   . PRO A 1 403 ? -22.339 103.474 21.395 1.00 19.68 ? 403  PRO A C   1 
ATOM   3122 O  O   . PRO A 1 403 ? -21.920 102.616 20.613 1.00 17.86 ? 403  PRO A O   1 
ATOM   3123 C  CB  . PRO A 1 403 ? -21.045 104.948 22.984 1.00 21.75 ? 403  PRO A CB  1 
ATOM   3124 C  CG  . PRO A 1 403 ? -21.110 106.440 23.195 1.00 25.23 ? 403  PRO A CG  1 
ATOM   3125 C  CD  . PRO A 1 403 ? -22.456 106.806 22.586 1.00 23.37 ? 403  PRO A CD  1 
ATOM   3126 N  N   . LEU A 1 404 ? -23.458 103.333 22.118 1.00 18.33 ? 404  LEU A N   1 
ATOM   3127 C  CA  . LEU A 1 404 ? -24.275 102.125 22.028 1.00 15.83 ? 404  LEU A CA  1 
ATOM   3128 C  C   . LEU A 1 404 ? -24.724 101.926 20.583 1.00 16.87 ? 404  LEU A C   1 
ATOM   3129 O  O   . LEU A 1 404 ? -24.783 100.793 20.107 1.00 18.77 ? 404  LEU A O   1 
ATOM   3130 C  CB  . LEU A 1 404 ? -25.501 102.194 22.959 1.00 12.99 ? 404  LEU A CB  1 
ATOM   3131 C  CG  . LEU A 1 404 ? -26.529 101.039 22.830 1.00 11.37 ? 404  LEU A CG  1 
ATOM   3132 C  CD1 . LEU A 1 404 ? -27.214 100.705 24.158 1.00 8.64  ? 404  LEU A CD1 1 
ATOM   3133 C  CD2 . LEU A 1 404 ? -27.561 101.419 21.787 1.00 7.91  ? 404  LEU A CD2 1 
ATOM   3134 N  N   . MET A 1 405 ? -25.025 103.012 19.876 1.00 15.70 ? 405  MET A N   1 
ATOM   3135 C  CA  . MET A 1 405 ? -25.445 102.882 18.488 1.00 16.12 ? 405  MET A CA  1 
ATOM   3136 C  C   . MET A 1 405 ? -24.330 102.331 17.635 1.00 17.93 ? 405  MET A C   1 
ATOM   3137 O  O   . MET A 1 405 ? -24.550 101.440 16.820 1.00 18.98 ? 405  MET A O   1 
ATOM   3138 C  CB  . MET A 1 405 ? -25.901 104.223 17.927 1.00 15.11 ? 405  MET A CB  1 
ATOM   3139 C  CG  . MET A 1 405 ? -27.246 104.621 18.450 1.00 16.58 ? 405  MET A CG  1 
ATOM   3140 S  SD  . MET A 1 405 ? -28.306 103.171 18.531 1.00 16.28 ? 405  MET A SD  1 
ATOM   3141 C  CE  . MET A 1 405 ? -28.833 103.074 16.829 1.00 13.90 ? 405  MET A CE  1 
ATOM   3142 N  N   . HIS A 1 406 ? -23.129 102.866 17.818 1.00 20.94 ? 406  HIS A N   1 
ATOM   3143 C  CA  . HIS A 1 406 ? -21.980 102.401 17.062 1.00 23.06 ? 406  HIS A CA  1 
ATOM   3144 C  C   . HIS A 1 406 ? -21.879 100.887 17.291 1.00 23.91 ? 406  HIS A C   1 
ATOM   3145 O  O   . HIS A 1 406 ? -21.764 100.113 16.347 1.00 23.50 ? 406  HIS A O   1 
ATOM   3146 C  CB  . HIS A 1 406 ? -20.716 103.102 17.556 1.00 24.29 ? 406  HIS A CB  1 
ATOM   3147 C  CG  . HIS A 1 406 ? -19.533 102.915 16.661 1.00 28.00 ? 406  HIS A CG  1 
ATOM   3148 N  ND1 . HIS A 1 406 ? -19.502 103.375 15.361 1.00 29.35 ? 406  HIS A ND1 1 
ATOM   3149 C  CD2 . HIS A 1 406 ? -18.336 102.319 16.877 1.00 29.60 ? 406  HIS A CD2 1 
ATOM   3150 C  CE1 . HIS A 1 406 ? -18.338 103.073 14.816 1.00 30.02 ? 406  HIS A CE1 1 
ATOM   3151 N  NE2 . HIS A 1 406 ? -17.611 102.432 15.715 1.00 31.32 ? 406  HIS A NE2 1 
ATOM   3152 N  N   . PHE A 1 407 ? -21.953 100.485 18.556 1.00 23.62 ? 407  PHE A N   1 
ATOM   3153 C  CA  . PHE A 1 407 ? -21.880 99.084  18.935 1.00 25.15 ? 407  PHE A CA  1 
ATOM   3154 C  C   . PHE A 1 407 ? -22.960 98.264  18.239 1.00 26.30 ? 407  PHE A C   1 
ATOM   3155 O  O   . PHE A 1 407 ? -22.665 97.253  17.597 1.00 26.00 ? 407  PHE A O   1 
ATOM   3156 C  CB  . PHE A 1 407 ? -22.036 98.936  20.452 1.00 25.72 ? 407  PHE A CB  1 
ATOM   3157 C  CG  . PHE A 1 407 ? -21.947 97.512  20.938 1.00 28.00 ? 407  PHE A CG  1 
ATOM   3158 C  CD1 . PHE A 1 407 ? -20.723 96.825  20.923 1.00 28.48 ? 407  PHE A CD1 1 
ATOM   3159 C  CD2 . PHE A 1 407 ? -23.086 96.845  21.401 1.00 27.69 ? 407  PHE A CD2 1 
ATOM   3160 C  CE1 . PHE A 1 407 ? -20.635 95.488  21.366 1.00 27.66 ? 407  PHE A CE1 1 
ATOM   3161 C  CE2 . PHE A 1 407 ? -23.008 95.505  21.846 1.00 26.55 ? 407  PHE A CE2 1 
ATOM   3162 C  CZ  . PHE A 1 407 ? -21.781 94.831  21.827 1.00 25.62 ? 407  PHE A CZ  1 
ATOM   3163 N  N   . VAL A 1 408 ? -24.212 98.695  18.369 1.00 27.58 ? 408  VAL A N   1 
ATOM   3164 C  CA  . VAL A 1 408 ? -25.320 97.967  17.754 1.00 28.75 ? 408  VAL A CA  1 
ATOM   3165 C  C   . VAL A 1 408 ? -24.963 97.562  16.333 1.00 29.45 ? 408  VAL A C   1 
ATOM   3166 O  O   . VAL A 1 408 ? -24.907 96.377  16.017 1.00 31.59 ? 408  VAL A O   1 
ATOM   3167 C  CB  . VAL A 1 408 ? -26.615 98.798  17.690 1.00 27.17 ? 408  VAL A CB  1 
ATOM   3168 C  CG1 . VAL A 1 408 ? -27.736 97.926  17.185 1.00 27.85 ? 408  VAL A CG1 1 
ATOM   3169 C  CG2 . VAL A 1 408 ? -26.971 99.335  19.051 1.00 27.51 ? 408  VAL A CG2 1 
ATOM   3170 N  N   . ASN A 1 409 ? -24.719 98.554  15.486 1.00 28.93 ? 409  ASN A N   1 
ATOM   3171 C  CA  . ASN A 1 409 ? -24.364 98.310  14.100 1.00 28.97 ? 409  ASN A CA  1 
ATOM   3172 C  C   . ASN A 1 409 ? -23.182 97.356  13.960 1.00 29.87 ? 409  ASN A C   1 
ATOM   3173 O  O   . ASN A 1 409 ? -23.306 96.301  13.331 1.00 29.84 ? 409  ASN A O   1 
ATOM   3174 C  CB  . ASN A 1 409 ? -24.044 99.633  13.417 1.00 29.34 ? 409  ASN A CB  1 
ATOM   3175 C  CG  . ASN A 1 409 ? -25.243 100.537 13.340 1.00 28.99 ? 409  ASN A CG  1 
ATOM   3176 O  OD1 . ASN A 1 409 ? -26.239 100.197 12.705 1.00 31.12 ? 409  ASN A OD1 1 
ATOM   3177 N  ND2 . ASN A 1 409 ? -25.165 101.692 13.990 1.00 28.52 ? 409  ASN A ND2 1 
ATOM   3178 N  N   . LYS A 1 410 ? -22.041 97.723  14.540 1.00 29.39 ? 410  LYS A N   1 
ATOM   3179 C  CA  . LYS A 1 410 ? -20.859 96.872  14.463 1.00 30.66 ? 410  LYS A CA  1 
ATOM   3180 C  C   . LYS A 1 410 ? -21.177 95.440  14.902 1.00 32.08 ? 410  LYS A C   1 
ATOM   3181 O  O   . LYS A 1 410 ? -20.632 94.484  14.335 1.00 32.23 ? 410  LYS A O   1 
ATOM   3182 C  CB  . LYS A 1 410 ? -19.717 97.436  15.321 1.00 30.46 ? 410  LYS A CB  1 
ATOM   3183 C  CG  . LYS A 1 410 ? -19.092 98.714  14.775 1.00 31.60 ? 410  LYS A CG  1 
ATOM   3184 C  CD  . LYS A 1 410 ? -18.440 98.476  13.419 1.00 33.38 ? 410  LYS A CD  1 
ATOM   3185 C  CE  . LYS A 1 410 ? -18.003 99.778  12.751 1.00 33.88 ? 410  LYS A CE  1 
ATOM   3186 N  NZ  . LYS A 1 410 ? -17.518 99.550  11.352 1.00 33.53 ? 410  LYS A NZ  1 
ATOM   3187 N  N   . TYR A 1 411 ? -22.057 95.288  15.897 1.00 31.50 ? 411  TYR A N   1 
ATOM   3188 C  CA  . TYR A 1 411 ? -22.422 93.958  16.382 1.00 31.55 ? 411  TYR A CA  1 
ATOM   3189 C  C   . TYR A 1 411 ? -23.325 93.235  15.395 1.00 33.27 ? 411  TYR A C   1 
ATOM   3190 O  O   . TYR A 1 411 ? -23.052 92.097  15.008 1.00 34.05 ? 411  TYR A O   1 
ATOM   3191 C  CB  . TYR A 1 411 ? -23.154 94.017  17.724 1.00 29.52 ? 411  TYR A CB  1 
ATOM   3192 C  CG  . TYR A 1 411 ? -23.260 92.650  18.366 1.00 27.54 ? 411  TYR A CG  1 
ATOM   3193 C  CD1 . TYR A 1 411 ? -22.169 92.098  19.023 1.00 28.50 ? 411  TYR A CD1 1 
ATOM   3194 C  CD2 . TYR A 1 411 ? -24.406 91.869  18.241 1.00 27.30 ? 411  TYR A CD2 1 
ATOM   3195 C  CE1 . TYR A 1 411 ? -22.198 90.805  19.538 1.00 26.04 ? 411  TYR A CE1 1 
ATOM   3196 C  CE2 . TYR A 1 411 ? -24.446 90.560  18.759 1.00 26.44 ? 411  TYR A CE2 1 
ATOM   3197 C  CZ  . TYR A 1 411 ? -23.327 90.044  19.406 1.00 24.74 ? 411  TYR A CZ  1 
ATOM   3198 O  OH  . TYR A 1 411 ? -23.309 88.778  19.928 1.00 20.45 ? 411  TYR A OH  1 
ATOM   3199 N  N   . THR A 1 412 ? -24.400 93.909  14.998 1.00 33.78 ? 412  THR A N   1 
ATOM   3200 C  CA  . THR A 1 412 ? -25.387 93.358  14.073 1.00 35.30 ? 412  THR A CA  1 
ATOM   3201 C  C   . THR A 1 412 ? -24.821 92.999  12.700 1.00 36.72 ? 412  THR A C   1 
ATOM   3202 O  O   . THR A 1 412 ? -25.529 93.066  11.701 1.00 39.08 ? 412  THR A O   1 
ATOM   3203 C  CB  . THR A 1 412 ? -26.561 94.346  13.872 1.00 33.64 ? 412  THR A CB  1 
ATOM   3204 O  OG1 . THR A 1 412 ? -27.028 94.797  15.147 1.00 32.46 ? 412  THR A OG1 1 
ATOM   3205 C  CG2 . THR A 1 412 ? -27.712 93.672  13.153 1.00 34.43 ? 412  THR A CG2 1 
ATOM   3206 N  N   . LYS A 1 413 ? -23.548 92.627  12.639 1.00 37.57 ? 413  LYS A N   1 
ATOM   3207 C  CA  . LYS A 1 413 ? -22.934 92.259  11.369 1.00 38.48 ? 413  LYS A CA  1 
ATOM   3208 C  C   . LYS A 1 413 ? -22.338 90.875  11.482 1.00 39.47 ? 413  LYS A C   1 
ATOM   3209 O  O   . LYS A 1 413 ? -21.867 90.306  10.497 1.00 40.96 ? 413  LYS A O   1 
ATOM   3210 C  CB  . LYS A 1 413 ? -21.835 93.253  10.973 1.00 38.33 ? 413  LYS A CB  1 
ATOM   3211 C  CG  . LYS A 1 413 ? -22.338 94.527  10.314 1.00 39.28 ? 413  LYS A CG  1 
ATOM   3212 C  CD  . LYS A 1 413 ? -21.172 95.348  9.773  1.00 41.73 ? 413  LYS A CD  1 
ATOM   3213 C  CE  . LYS A 1 413 ? -21.643 96.634  9.100  1.00 42.71 ? 413  LYS A CE  1 
ATOM   3214 N  NZ  . LYS A 1 413 ? -20.477 97.455  8.659  1.00 44.19 ? 413  LYS A NZ  1 
ATOM   3215 N  N   . PHE A 1 414 ? -22.351 90.340  12.695 1.00 39.35 ? 414  PHE A N   1 
ATOM   3216 C  CA  . PHE A 1 414 ? -21.819 89.013  12.943 1.00 40.02 ? 414  PHE A CA  1 
ATOM   3217 C  C   . PHE A 1 414 ? -22.698 88.276  13.949 1.00 41.10 ? 414  PHE A C   1 
ATOM   3218 O  O   . PHE A 1 414 ? -22.599 87.059  14.098 1.00 42.00 ? 414  PHE A O   1 
ATOM   3219 C  CB  . PHE A 1 414 ? -20.389 89.119  13.472 1.00 40.34 ? 414  PHE A CB  1 
ATOM   3220 C  CG  . PHE A 1 414 ? -19.425 89.750  12.502 1.00 40.75 ? 414  PHE A CG  1 
ATOM   3221 C  CD1 . PHE A 1 414 ? -19.108 89.122  11.307 1.00 40.78 ? 414  PHE A CD1 1 
ATOM   3222 C  CD2 . PHE A 1 414 ? -18.834 90.975  12.784 1.00 42.10 ? 414  PHE A CD2 1 
ATOM   3223 C  CE1 . PHE A 1 414 ? -18.215 89.704  10.407 1.00 40.79 ? 414  PHE A CE1 1 
ATOM   3224 C  CE2 . PHE A 1 414 ? -17.939 91.566  11.888 1.00 41.22 ? 414  PHE A CE2 1 
ATOM   3225 C  CZ  . PHE A 1 414 ? -17.631 90.929  10.700 1.00 40.66 ? 414  PHE A CZ  1 
ATOM   3226 N  N   . GLY A 1 415 ? -23.566 89.025  14.626 1.00 41.94 ? 415  GLY A N   1 
ATOM   3227 C  CA  . GLY A 1 415 ? -24.455 88.460  15.626 1.00 42.27 ? 415  GLY A CA  1 
ATOM   3228 C  C   . GLY A 1 415 ? -25.529 87.555  15.063 1.00 43.13 ? 415  GLY A C   1 
ATOM   3229 O  O   . GLY A 1 415 ? -25.568 87.307  13.860 1.00 43.50 ? 415  GLY A O   1 
ATOM   3230 N  N   . ASN A 1 416 ? -26.407 87.071  15.938 1.00 43.82 ? 416  ASN A N   1 
ATOM   3231 C  CA  . ASN A 1 416 ? -27.488 86.165  15.546 1.00 44.47 ? 416  ASN A CA  1 
ATOM   3232 C  C   . ASN A 1 416 ? -28.850 86.740  15.932 1.00 42.93 ? 416  ASN A C   1 
ATOM   3233 O  O   . ASN A 1 416 ? -29.817 85.998  16.117 1.00 41.80 ? 416  ASN A O   1 
ATOM   3234 C  CB  . ASN A 1 416 ? -27.279 84.802  16.228 1.00 48.65 ? 416  ASN A CB  1 
ATOM   3235 C  CG  . ASN A 1 416 ? -28.274 83.739  15.772 1.00 51.67 ? 416  ASN A CG  1 
ATOM   3236 O  OD1 . ASN A 1 416 ? -29.052 83.226  16.572 1.00 51.22 ? 416  ASN A OD1 1 
ATOM   3237 N  ND2 . ASN A 1 416 ? -28.230 83.396  14.490 1.00 56.78 ? 416  ASN A ND2 1 
ATOM   3238 N  N   . GLY A 1 417 ? -28.919 88.063  16.058 1.00 40.98 ? 417  GLY A N   1 
ATOM   3239 C  CA  . GLY A 1 417 ? -30.171 88.702  16.419 1.00 38.70 ? 417  GLY A CA  1 
ATOM   3240 C  C   . GLY A 1 417 ? -29.987 89.882  17.351 1.00 36.83 ? 417  GLY A C   1 
ATOM   3241 O  O   . GLY A 1 417 ? -29.257 89.791  18.337 1.00 35.51 ? 417  GLY A O   1 
ATOM   3242 N  N   . THR A 1 418 ? -30.673 90.983  17.046 1.00 35.85 ? 418  THR A N   1 
ATOM   3243 C  CA  . THR A 1 418 ? -30.586 92.208  17.837 1.00 32.73 ? 418  THR A CA  1 
ATOM   3244 C  C   . THR A 1 418 ? -31.934 92.854  18.097 1.00 31.25 ? 418  THR A C   1 
ATOM   3245 O  O   . THR A 1 418 ? -32.733 93.019  17.183 1.00 31.85 ? 418  THR A O   1 
ATOM   3246 C  CB  . THR A 1 418 ? -29.736 93.248  17.124 1.00 31.75 ? 418  THR A CB  1 
ATOM   3247 O  OG1 . THR A 1 418 ? -28.441 92.697  16.858 1.00 31.91 ? 418  THR A OG1 1 
ATOM   3248 C  CG2 . THR A 1 418 ? -29.608 94.503  17.979 1.00 31.83 ? 418  THR A CG2 1 
ATOM   3249 N  N   . TYR A 1 419 ? -32.168 93.240  19.344 1.00 29.84 ? 419  TYR A N   1 
ATOM   3250 C  CA  . TYR A 1 419 ? -33.407 93.902  19.733 1.00 28.88 ? 419  TYR A CA  1 
ATOM   3251 C  C   . TYR A 1 419 ? -33.087 95.212  20.470 1.00 27.14 ? 419  TYR A C   1 
ATOM   3252 O  O   . TYR A 1 419 ? -32.583 95.211  21.597 1.00 24.67 ? 419  TYR A O   1 
ATOM   3253 C  CB  . TYR A 1 419 ? -34.225 92.966  20.613 1.00 31.48 ? 419  TYR A CB  1 
ATOM   3254 C  CG  . TYR A 1 419 ? -34.661 91.707  19.898 1.00 32.25 ? 419  TYR A CG  1 
ATOM   3255 C  CD1 . TYR A 1 419 ? -35.772 91.708  19.048 1.00 31.51 ? 419  TYR A CD1 1 
ATOM   3256 C  CD2 . TYR A 1 419 ? -33.953 90.514  20.057 1.00 32.40 ? 419  TYR A CD2 1 
ATOM   3257 C  CE1 . TYR A 1 419 ? -36.166 90.554  18.376 1.00 30.81 ? 419  TYR A CE1 1 
ATOM   3258 C  CE2 . TYR A 1 419 ? -34.340 89.356  19.390 1.00 32.34 ? 419  TYR A CE2 1 
ATOM   3259 C  CZ  . TYR A 1 419 ? -35.444 89.384  18.553 1.00 31.62 ? 419  TYR A CZ  1 
ATOM   3260 O  OH  . TYR A 1 419 ? -35.812 88.240  17.891 1.00 33.53 ? 419  TYR A OH  1 
ATOM   3261 N  N   . LEU A 1 420 ? -33.394 96.327  19.817 1.00 26.32 ? 420  LEU A N   1 
ATOM   3262 C  CA  . LEU A 1 420 ? -33.116 97.655  20.349 1.00 25.88 ? 420  LEU A CA  1 
ATOM   3263 C  C   . LEU A 1 420 ? -34.347 98.336  20.928 1.00 26.53 ? 420  LEU A C   1 
ATOM   3264 O  O   . LEU A 1 420 ? -35.440 98.192  20.392 1.00 28.28 ? 420  LEU A O   1 
ATOM   3265 C  CB  . LEU A 1 420 ? -32.536 98.520  19.233 1.00 24.82 ? 420  LEU A CB  1 
ATOM   3266 C  CG  . LEU A 1 420 ? -31.893 99.845  19.634 1.00 23.78 ? 420  LEU A CG  1 
ATOM   3267 C  CD1 . LEU A 1 420 ? -30.831 99.590  20.703 1.00 21.61 ? 420  LEU A CD1 1 
ATOM   3268 C  CD2 . LEU A 1 420 ? -31.298 100.509 18.398 1.00 20.30 ? 420  LEU A CD2 1 
ATOM   3269 N  N   . TYR A 1 421 ? -34.167 99.100  22.006 1.00 26.82 ? 421  TYR A N   1 
ATOM   3270 C  CA  . TYR A 1 421 ? -35.294 99.785  22.637 1.00 26.64 ? 421  TYR A CA  1 
ATOM   3271 C  C   . TYR A 1 421 ? -35.007 101.230 23.025 1.00 25.89 ? 421  TYR A C   1 
ATOM   3272 O  O   . TYR A 1 421 ? -33.854 101.611 23.197 1.00 25.57 ? 421  TYR A O   1 
ATOM   3273 C  CB  . TYR A 1 421 ? -35.737 99.020  23.889 1.00 28.73 ? 421  TYR A CB  1 
ATOM   3274 C  CG  . TYR A 1 421 ? -34.820 99.158  25.100 1.00 29.53 ? 421  TYR A CG  1 
ATOM   3275 C  CD1 . TYR A 1 421 ? -34.758 100.347 25.833 1.00 30.49 ? 421  TYR A CD1 1 
ATOM   3276 C  CD2 . TYR A 1 421 ? -34.048 98.087  25.532 1.00 30.43 ? 421  TYR A CD2 1 
ATOM   3277 C  CE1 . TYR A 1 421 ? -33.952 100.456 26.968 1.00 30.77 ? 421  TYR A CE1 1 
ATOM   3278 C  CE2 . TYR A 1 421 ? -33.239 98.185  26.663 1.00 31.93 ? 421  TYR A CE2 1 
ATOM   3279 C  CZ  . TYR A 1 421 ? -33.193 99.369  27.378 1.00 31.06 ? 421  TYR A CZ  1 
ATOM   3280 O  OH  . TYR A 1 421 ? -32.384 99.458  28.495 1.00 31.93 ? 421  TYR A OH  1 
ATOM   3281 N  N   . PHE A 1 422 ? -36.063 102.025 23.186 1.00 23.95 ? 422  PHE A N   1 
ATOM   3282 C  CA  . PHE A 1 422 ? -35.901 103.416 23.590 1.00 22.75 ? 422  PHE A CA  1 
ATOM   3283 C  C   . PHE A 1 422 ? -36.787 103.735 24.790 1.00 22.37 ? 422  PHE A C   1 
ATOM   3284 O  O   . PHE A 1 422 ? -37.890 104.242 24.637 1.00 24.15 ? 422  PHE A O   1 
ATOM   3285 C  CB  . PHE A 1 422 ? -36.243 104.364 22.440 1.00 21.23 ? 422  PHE A CB  1 
ATOM   3286 C  CG  . PHE A 1 422 ? -35.901 105.805 22.720 1.00 21.29 ? 422  PHE A CG  1 
ATOM   3287 C  CD1 . PHE A 1 422 ? -34.570 106.229 22.744 1.00 22.66 ? 422  PHE A CD1 1 
ATOM   3288 C  CD2 . PHE A 1 422 ? -36.905 106.741 22.964 1.00 20.12 ? 422  PHE A CD2 1 
ATOM   3289 C  CE1 . PHE A 1 422 ? -34.244 107.568 23.003 1.00 19.65 ? 422  PHE A CE1 1 
ATOM   3290 C  CE2 . PHE A 1 422 ? -36.593 108.075 23.224 1.00 19.59 ? 422  PHE A CE2 1 
ATOM   3291 C  CZ  . PHE A 1 422 ? -35.254 108.489 23.241 1.00 19.51 ? 422  PHE A CZ  1 
ATOM   3292 N  N   . PHE A 1 423 ? -36.303 103.443 25.990 1.00 21.76 ? 423  PHE A N   1 
ATOM   3293 C  CA  . PHE A 1 423 ? -37.079 103.707 27.196 1.00 22.07 ? 423  PHE A CA  1 
ATOM   3294 C  C   . PHE A 1 423 ? -37.355 105.192 27.387 1.00 23.37 ? 423  PHE A C   1 
ATOM   3295 O  O   . PHE A 1 423 ? -36.433 105.963 27.641 1.00 24.48 ? 423  PHE A O   1 
ATOM   3296 C  CB  . PHE A 1 423 ? -36.334 103.198 28.422 1.00 20.43 ? 423  PHE A CB  1 
ATOM   3297 C  CG  . PHE A 1 423 ? -37.160 103.208 29.666 1.00 18.92 ? 423  PHE A CG  1 
ATOM   3298 C  CD1 . PHE A 1 423 ? -38.110 102.216 29.890 1.00 18.99 ? 423  PHE A CD1 1 
ATOM   3299 C  CD2 . PHE A 1 423 ? -37.015 104.219 30.602 1.00 18.19 ? 423  PHE A CD2 1 
ATOM   3300 C  CE1 . PHE A 1 423 ? -38.905 102.234 31.028 1.00 16.73 ? 423  PHE A CE1 1 
ATOM   3301 C  CE2 . PHE A 1 423 ? -37.803 104.247 31.744 1.00 17.35 ? 423  PHE A CE2 1 
ATOM   3302 C  CZ  . PHE A 1 423 ? -38.751 103.251 31.956 1.00 17.91 ? 423  PHE A CZ  1 
ATOM   3303 N  N   . ASN A 1 424 ? -38.614 105.604 27.277 1.00 24.43 ? 424  ASN A N   1 
ATOM   3304 C  CA  . ASN A 1 424 ? -38.924 107.020 27.460 1.00 25.24 ? 424  ASN A CA  1 
ATOM   3305 C  C   . ASN A 1 424 ? -40.108 107.293 28.368 1.00 26.62 ? 424  ASN A C   1 
ATOM   3306 O  O   . ASN A 1 424 ? -40.843 108.248 28.150 1.00 26.35 ? 424  ASN A O   1 
ATOM   3307 C  CB  . ASN A 1 424 ? -39.160 107.715 26.116 1.00 23.98 ? 424  ASN A CB  1 
ATOM   3308 C  CG  . ASN A 1 424 ? -40.320 107.122 25.342 1.00 23.94 ? 424  ASN A CG  1 
ATOM   3309 O  OD1 . ASN A 1 424 ? -41.157 106.415 25.903 1.00 23.21 ? 424  ASN A OD1 1 
ATOM   3310 N  ND2 . ASN A 1 424 ? -40.383 107.423 24.045 1.00 20.42 ? 424  ASN A ND2 1 
ATOM   3311 N  N   . HIS A 1 425 ? -40.288 106.459 29.390 1.00 29.13 ? 425  HIS A N   1 
ATOM   3312 C  CA  . HIS A 1 425 ? -41.384 106.636 30.339 1.00 30.44 ? 425  HIS A CA  1 
ATOM   3313 C  C   . HIS A 1 425 ? -40.900 107.360 31.582 1.00 31.67 ? 425  HIS A C   1 
ATOM   3314 O  O   . HIS A 1 425 ? -39.924 106.952 32.205 1.00 32.12 ? 425  HIS A O   1 
ATOM   3315 C  CB  . HIS A 1 425 ? -41.972 105.293 30.776 1.00 30.77 ? 425  HIS A CB  1 
ATOM   3316 C  CG  . HIS A 1 425 ? -42.955 105.417 31.901 1.00 31.75 ? 425  HIS A CG  1 
ATOM   3317 N  ND1 . HIS A 1 425 ? -44.223 105.931 31.728 1.00 31.05 ? 425  HIS A ND1 1 
ATOM   3318 C  CD2 . HIS A 1 425 ? -42.822 105.189 33.230 1.00 30.72 ? 425  HIS A CD2 1 
ATOM   3319 C  CE1 . HIS A 1 425 ? -44.825 106.020 32.900 1.00 28.67 ? 425  HIS A CE1 1 
ATOM   3320 N  NE2 . HIS A 1 425 ? -43.997 105.577 33.828 1.00 29.62 ? 425  HIS A NE2 1 
ATOM   3321 N  N   . ARG A 1 426 ? -41.604 108.422 31.951 1.00 32.91 ? 426  ARG A N   1 
ATOM   3322 C  CA  . ARG A 1 426 ? -41.250 109.209 33.126 1.00 35.68 ? 426  ARG A CA  1 
ATOM   3323 C  C   . ARG A 1 426 ? -42.053 108.760 34.346 1.00 36.39 ? 426  ARG A C   1 
ATOM   3324 O  O   . ARG A 1 426 ? -43.200 109.162 34.515 1.00 37.11 ? 426  ARG A O   1 
ATOM   3325 C  CB  . ARG A 1 426 ? -41.512 110.692 32.837 1.00 36.98 ? 426  ARG A CB  1 
ATOM   3326 C  CG  . ARG A 1 426 ? -41.629 111.575 34.066 1.00 38.31 ? 426  ARG A CG  1 
ATOM   3327 C  CD  . ARG A 1 426 ? -40.296 111.827 34.722 1.00 38.29 ? 426  ARG A CD  1 
ATOM   3328 N  NE  . ARG A 1 426 ? -40.454 112.629 35.929 1.00 39.08 ? 426  ARG A NE  1 
ATOM   3329 C  CZ  . ARG A 1 426 ? -39.543 113.485 36.376 1.00 40.22 ? 426  ARG A CZ  1 
ATOM   3330 N  NH1 . ARG A 1 426 ? -38.405 113.652 35.710 1.00 40.36 ? 426  ARG A NH1 1 
ATOM   3331 N  NH2 . ARG A 1 426 ? -39.771 114.178 37.483 1.00 41.19 ? 426  ARG A NH2 1 
ATOM   3332 N  N   . ALA A 1 427 ? -41.448 107.940 35.200 1.00 37.40 ? 427  ALA A N   1 
ATOM   3333 C  CA  . ALA A 1 427 ? -42.130 107.438 36.393 1.00 38.12 ? 427  ALA A CA  1 
ATOM   3334 C  C   . ALA A 1 427 ? -43.007 108.478 37.097 1.00 39.38 ? 427  ALA A C   1 
ATOM   3335 O  O   . ALA A 1 427 ? -42.673 109.665 37.166 1.00 40.05 ? 427  ALA A O   1 
ATOM   3336 C  CB  . ALA A 1 427 ? -41.114 106.868 37.370 1.00 38.88 ? 427  ALA A CB  1 
ATOM   3337 N  N   . SER A 1 428 ? -44.130 108.004 37.627 1.00 40.12 ? 428  SER A N   1 
ATOM   3338 C  CA  . SER A 1 428 ? -45.112 108.833 38.319 1.00 39.58 ? 428  SER A CA  1 
ATOM   3339 C  C   . SER A 1 428 ? -44.695 109.273 39.722 1.00 40.27 ? 428  SER A C   1 
ATOM   3340 O  O   . SER A 1 428 ? -45.150 110.305 40.212 1.00 41.57 ? 428  SER A O   1 
ATOM   3341 C  CB  . SER A 1 428 ? -46.430 108.068 38.419 1.00 40.12 ? 428  SER A CB  1 
ATOM   3342 O  OG  . SER A 1 428 ? -46.281 106.927 39.251 1.00 38.49 ? 428  SER A OG  1 
ATOM   3343 N  N   . ASN A 1 429 ? -43.845 108.487 40.374 1.00 39.36 ? 429  ASN A N   1 
ATOM   3344 C  CA  . ASN A 1 429 ? -43.399 108.814 41.722 1.00 38.22 ? 429  ASN A CA  1 
ATOM   3345 C  C   . ASN A 1 429 ? -41.961 109.310 41.754 1.00 37.64 ? 429  ASN A C   1 
ATOM   3346 O  O   . ASN A 1 429 ? -41.364 109.425 42.829 1.00 37.16 ? 429  ASN A O   1 
ATOM   3347 C  CB  . ASN A 1 429 ? -43.519 107.591 42.620 1.00 39.23 ? 429  ASN A CB  1 
ATOM   3348 C  CG  . ASN A 1 429 ? -42.829 106.377 42.033 1.00 40.83 ? 429  ASN A CG  1 
ATOM   3349 O  OD1 . ASN A 1 429 ? -42.152 106.467 41.003 1.00 39.42 ? 429  ASN A OD1 1 
ATOM   3350 N  ND2 . ASN A 1 429 ? -42.995 105.229 42.685 1.00 42.46 ? 429  ASN A ND2 1 
ATOM   3351 N  N   . LEU A 1 430 ? -41.401 109.597 40.584 1.00 36.25 ? 430  LEU A N   1 
ATOM   3352 C  CA  . LEU A 1 430 ? -40.028 110.081 40.513 1.00 36.50 ? 430  LEU A CA  1 
ATOM   3353 C  C   . LEU A 1 430 ? -39.859 111.196 41.536 1.00 36.42 ? 430  LEU A C   1 
ATOM   3354 O  O   . LEU A 1 430 ? -40.732 112.058 41.660 1.00 38.00 ? 430  LEU A O   1 
ATOM   3355 C  CB  . LEU A 1 430 ? -39.729 110.619 39.116 1.00 36.89 ? 430  LEU A CB  1 
ATOM   3356 C  CG  . LEU A 1 430 ? -38.403 110.149 38.535 1.00 37.54 ? 430  LEU A CG  1 
ATOM   3357 C  CD1 . LEU A 1 430 ? -38.410 108.631 38.473 1.00 37.87 ? 430  LEU A CD1 1 
ATOM   3358 C  CD2 . LEU A 1 430 ? -38.202 110.734 37.153 1.00 38.66 ? 430  LEU A CD2 1 
ATOM   3359 N  N   . VAL A 1 431 ? -38.750 111.179 42.273 1.00 34.74 ? 431  VAL A N   1 
ATOM   3360 C  CA  . VAL A 1 431 ? -38.502 112.208 43.280 1.00 33.07 ? 431  VAL A CA  1 
ATOM   3361 C  C   . VAL A 1 431 ? -37.669 113.368 42.745 1.00 32.79 ? 431  VAL A C   1 
ATOM   3362 O  O   . VAL A 1 431 ? -37.558 114.405 43.407 1.00 32.99 ? 431  VAL A O   1 
ATOM   3363 C  CB  . VAL A 1 431 ? -37.774 111.633 44.505 1.00 32.42 ? 431  VAL A CB  1 
ATOM   3364 C  CG1 . VAL A 1 431 ? -38.575 110.502 45.099 1.00 32.82 ? 431  VAL A CG1 1 
ATOM   3365 C  CG2 . VAL A 1 431 ? -36.401 111.150 44.103 1.00 32.84 ? 431  VAL A CG2 1 
ATOM   3366 N  N   . TRP A 1 432 ? -37.074 113.186 41.562 1.00 31.07 ? 432  TRP A N   1 
ATOM   3367 C  CA  . TRP A 1 432 ? -36.247 114.221 40.938 1.00 29.34 ? 432  TRP A CA  1 
ATOM   3368 C  C   . TRP A 1 432 ? -37.117 115.234 40.201 1.00 30.93 ? 432  TRP A C   1 
ATOM   3369 O  O   . TRP A 1 432 ? -38.297 114.975 39.946 1.00 29.80 ? 432  TRP A O   1 
ATOM   3370 C  CB  . TRP A 1 432 ? -35.265 113.616 39.936 1.00 27.31 ? 432  TRP A CB  1 
ATOM   3371 C  CG  . TRP A 1 432 ? -34.208 112.735 40.529 1.00 26.84 ? 432  TRP A CG  1 
ATOM   3372 C  CD1 . TRP A 1 432 ? -34.208 111.373 40.580 1.00 26.57 ? 432  TRP A CD1 1 
ATOM   3373 C  CD2 . TRP A 1 432 ? -33.000 113.157 41.163 1.00 26.83 ? 432  TRP A CD2 1 
ATOM   3374 N  NE1 . TRP A 1 432 ? -33.076 110.920 41.205 1.00 23.56 ? 432  TRP A NE1 1 
ATOM   3375 C  CE2 . TRP A 1 432 ? -32.316 111.994 41.575 1.00 25.42 ? 432  TRP A CE2 1 
ATOM   3376 C  CE3 . TRP A 1 432 ? -32.429 114.407 41.427 1.00 28.69 ? 432  TRP A CE3 1 
ATOM   3377 C  CZ2 . TRP A 1 432 ? -31.089 112.039 42.236 1.00 27.29 ? 432  TRP A CZ2 1 
ATOM   3378 C  CZ3 . TRP A 1 432 ? -31.201 114.452 42.088 1.00 30.45 ? 432  TRP A CZ3 1 
ATOM   3379 C  CH2 . TRP A 1 432 ? -30.547 113.274 42.484 1.00 28.35 ? 432  TRP A CH2 1 
ATOM   3380 N  N   . PRO A 1 433 ? -36.544 116.412 39.872 1.00 31.62 ? 433  PRO A N   1 
ATOM   3381 C  CA  . PRO A 1 433 ? -37.231 117.493 39.161 1.00 31.66 ? 433  PRO A CA  1 
ATOM   3382 C  C   . PRO A 1 433 ? -37.776 116.994 37.832 1.00 33.09 ? 433  PRO A C   1 
ATOM   3383 O  O   . PRO A 1 433 ? -37.531 115.861 37.441 1.00 33.25 ? 433  PRO A O   1 
ATOM   3384 C  CB  . PRO A 1 433 ? -36.137 118.532 38.987 1.00 30.77 ? 433  PRO A CB  1 
ATOM   3385 C  CG  . PRO A 1 433 ? -35.344 118.363 40.222 1.00 32.85 ? 433  PRO A CG  1 
ATOM   3386 C  CD  . PRO A 1 433 ? -35.214 116.861 40.326 1.00 31.98 ? 433  PRO A CD  1 
ATOM   3387 N  N   . GLU A 1 434 ? -38.497 117.852 37.129 1.00 34.74 ? 434  GLU A N   1 
ATOM   3388 C  CA  . GLU A 1 434 ? -39.091 117.455 35.876 1.00 35.16 ? 434  GLU A CA  1 
ATOM   3389 C  C   . GLU A 1 434 ? -38.197 117.647 34.677 1.00 32.13 ? 434  GLU A C   1 
ATOM   3390 O  O   . GLU A 1 434 ? -38.267 116.865 33.729 1.00 29.71 ? 434  GLU A O   1 
ATOM   3391 C  CB  . GLU A 1 434 ? -40.407 118.196 35.664 1.00 41.64 ? 434  GLU A CB  1 
ATOM   3392 C  CG  . GLU A 1 434 ? -41.623 117.285 35.597 1.00 49.67 ? 434  GLU A CG  1 
ATOM   3393 C  CD  . GLU A 1 434 ? -42.483 117.580 34.378 1.00 56.30 ? 434  GLU A CD  1 
ATOM   3394 O  OE1 . GLU A 1 434 ? -41.976 117.430 33.242 1.00 58.07 ? 434  GLU A OE1 1 
ATOM   3395 O  OE2 . GLU A 1 434 ? -43.664 117.964 34.552 1.00 61.38 ? 434  GLU A OE2 1 
ATOM   3396 N  N   . TRP A 1 435 ? -37.358 118.678 34.704 1.00 29.66 ? 435  TRP A N   1 
ATOM   3397 C  CA  . TRP A 1 435 ? -36.467 118.916 33.567 1.00 28.28 ? 435  TRP A CA  1 
ATOM   3398 C  C   . TRP A 1 435 ? -35.514 117.739 33.378 1.00 26.57 ? 435  TRP A C   1 
ATOM   3399 O  O   . TRP A 1 435 ? -35.002 117.497 32.280 1.00 24.85 ? 435  TRP A O   1 
ATOM   3400 C  CB  . TRP A 1 435 ? -35.656 120.206 33.745 1.00 28.86 ? 435  TRP A CB  1 
ATOM   3401 C  CG  . TRP A 1 435 ? -34.717 120.219 34.913 1.00 29.16 ? 435  TRP A CG  1 
ATOM   3402 C  CD1 . TRP A 1 435 ? -34.972 120.706 36.161 1.00 30.57 ? 435  TRP A CD1 1 
ATOM   3403 C  CD2 . TRP A 1 435 ? -33.369 119.732 34.940 1.00 29.15 ? 435  TRP A CD2 1 
ATOM   3404 N  NE1 . TRP A 1 435 ? -33.865 120.555 36.966 1.00 31.04 ? 435  TRP A NE1 1 
ATOM   3405 C  CE2 . TRP A 1 435 ? -32.868 119.958 36.240 1.00 30.04 ? 435  TRP A CE2 1 
ATOM   3406 C  CE3 . TRP A 1 435 ? -32.534 119.126 33.992 1.00 29.06 ? 435  TRP A CE3 1 
ATOM   3407 C  CZ2 . TRP A 1 435 ? -31.566 119.599 36.615 1.00 29.60 ? 435  TRP A CZ2 1 
ATOM   3408 C  CZ3 . TRP A 1 435 ? -31.240 118.771 34.367 1.00 27.90 ? 435  TRP A CZ3 1 
ATOM   3409 C  CH2 . TRP A 1 435 ? -30.772 119.009 35.668 1.00 27.91 ? 435  TRP A CH2 1 
ATOM   3410 N  N   . MET A 1 436 ? -35.288 116.998 34.456 1.00 24.40 ? 436  MET A N   1 
ATOM   3411 C  CA  . MET A 1 436 ? -34.402 115.858 34.394 1.00 21.93 ? 436  MET A CA  1 
ATOM   3412 C  C   . MET A 1 436 ? -34.986 114.729 33.548 1.00 21.43 ? 436  MET A C   1 
ATOM   3413 O  O   . MET A 1 436 ? -34.269 113.801 33.167 1.00 22.36 ? 436  MET A O   1 
ATOM   3414 C  CB  . MET A 1 436 ? -34.067 115.392 35.811 1.00 19.18 ? 436  MET A CB  1 
ATOM   3415 C  CG  . MET A 1 436 ? -33.209 116.400 36.553 1.00 17.00 ? 436  MET A CG  1 
ATOM   3416 S  SD  . MET A 1 436 ? -32.366 115.734 37.998 1.00 19.13 ? 436  MET A SD  1 
ATOM   3417 C  CE  . MET A 1 436 ? -31.189 114.693 37.191 1.00 17.42 ? 436  MET A CE  1 
ATOM   3418 N  N   . GLY A 1 437 ? -36.278 114.826 33.240 1.00 20.38 ? 437  GLY A N   1 
ATOM   3419 C  CA  . GLY A 1 437 ? -36.951 113.824 32.420 1.00 20.24 ? 437  GLY A CA  1 
ATOM   3420 C  C   . GLY A 1 437 ? -36.757 112.358 32.786 1.00 19.69 ? 437  GLY A C   1 
ATOM   3421 O  O   . GLY A 1 437 ? -36.826 111.986 33.958 1.00 19.24 ? 437  GLY A O   1 
ATOM   3422 N  N   . VAL A 1 438 ? -36.539 111.517 31.774 1.00 20.20 ? 438  VAL A N   1 
ATOM   3423 C  CA  . VAL A 1 438 ? -36.313 110.088 31.996 1.00 21.31 ? 438  VAL A CA  1 
ATOM   3424 C  C   . VAL A 1 438 ? -34.820 109.946 32.238 1.00 21.97 ? 438  VAL A C   1 
ATOM   3425 O  O   . VAL A 1 438 ? -34.016 109.869 31.300 1.00 22.14 ? 438  VAL A O   1 
ATOM   3426 C  CB  . VAL A 1 438 ? -36.724 109.241 30.779 1.00 20.83 ? 438  VAL A CB  1 
ATOM   3427 C  CG1 . VAL A 1 438 ? -36.648 107.772 31.145 1.00 19.53 ? 438  VAL A CG1 1 
ATOM   3428 C  CG2 . VAL A 1 438 ? -38.136 109.599 30.341 1.00 17.28 ? 438  VAL A CG2 1 
ATOM   3429 N  N   . ILE A 1 439 ? -34.472 109.913 33.517 1.00 21.98 ? 439  ILE A N   1 
ATOM   3430 C  CA  . ILE A 1 439 ? -33.092 109.869 33.964 1.00 21.94 ? 439  ILE A CA  1 
ATOM   3431 C  C   . ILE A 1 439 ? -32.322 108.575 33.820 1.00 21.68 ? 439  ILE A C   1 
ATOM   3432 O  O   . ILE A 1 439 ? -32.869 107.484 33.933 1.00 21.94 ? 439  ILE A O   1 
ATOM   3433 C  CB  . ILE A 1 439 ? -33.013 110.329 35.437 1.00 21.97 ? 439  ILE A CB  1 
ATOM   3434 C  CG1 . ILE A 1 439 ? -33.755 111.664 35.589 1.00 20.36 ? 439  ILE A CG1 1 
ATOM   3435 C  CG2 . ILE A 1 439 ? -31.558 110.476 35.870 1.00 20.73 ? 439  ILE A CG2 1 
ATOM   3436 C  CD1 . ILE A 1 439 ? -33.763 112.202 36.979 1.00 19.95 ? 439  ILE A CD1 1 
ATOM   3437 N  N   . HIS A 1 440 ? -31.024 108.732 33.588 1.00 22.47 ? 440  HIS A N   1 
ATOM   3438 C  CA  . HIS A 1 440 ? -30.098 107.620 33.441 1.00 23.08 ? 440  HIS A CA  1 
ATOM   3439 C  C   . HIS A 1 440 ? -30.272 106.629 34.588 1.00 23.47 ? 440  HIS A C   1 
ATOM   3440 O  O   . HIS A 1 440 ? -30.348 107.018 35.748 1.00 22.89 ? 440  HIS A O   1 
ATOM   3441 C  CB  . HIS A 1 440 ? -28.660 108.147 33.442 1.00 21.82 ? 440  HIS A CB  1 
ATOM   3442 C  CG  . HIS A 1 440 ? -27.621 107.089 33.243 1.00 21.45 ? 440  HIS A CG  1 
ATOM   3443 N  ND1 . HIS A 1 440 ? -27.308 106.578 32.002 1.00 19.44 ? 440  HIS A ND1 1 
ATOM   3444 C  CD2 . HIS A 1 440 ? -26.808 106.459 34.127 1.00 21.77 ? 440  HIS A CD2 1 
ATOM   3445 C  CE1 . HIS A 1 440 ? -26.345 105.682 32.127 1.00 21.12 ? 440  HIS A CE1 1 
ATOM   3446 N  NE2 . HIS A 1 440 ? -26.023 105.590 33.406 1.00 23.15 ? 440  HIS A NE2 1 
ATOM   3447 N  N   . GLY A 1 441 ? -30.342 105.347 34.250 1.00 25.63 ? 441  GLY A N   1 
ATOM   3448 C  CA  . GLY A 1 441 ? -30.483 104.321 35.263 1.00 27.02 ? 441  GLY A CA  1 
ATOM   3449 C  C   . GLY A 1 441 ? -31.853 104.170 35.895 1.00 28.50 ? 441  GLY A C   1 
ATOM   3450 O  O   . GLY A 1 441 ? -32.037 103.280 36.732 1.00 29.16 ? 441  GLY A O   1 
ATOM   3451 N  N   . TYR A 1 442 ? -32.819 105.004 35.508 1.00 28.84 ? 442  TYR A N   1 
ATOM   3452 C  CA  . TYR A 1 442 ? -34.147 104.902 36.103 1.00 29.96 ? 442  TYR A CA  1 
ATOM   3453 C  C   . TYR A 1 442 ? -35.130 103.979 35.421 1.00 31.80 ? 442  TYR A C   1 
ATOM   3454 O  O   . TYR A 1 442 ? -36.322 103.982 35.732 1.00 32.45 ? 442  TYR A O   1 
ATOM   3455 C  CB  . TYR A 1 442 ? -34.753 106.287 36.295 1.00 29.74 ? 442  TYR A CB  1 
ATOM   3456 C  CG  . TYR A 1 442 ? -34.247 106.894 37.582 1.00 31.04 ? 442  TYR A CG  1 
ATOM   3457 C  CD1 . TYR A 1 442 ? -32.937 107.385 37.676 1.00 30.21 ? 442  TYR A CD1 1 
ATOM   3458 C  CD2 . TYR A 1 442 ? -35.012 106.835 38.745 1.00 27.96 ? 442  TYR A CD2 1 
ATOM   3459 C  CE1 . TYR A 1 442 ? -32.401 107.785 38.898 1.00 28.04 ? 442  TYR A CE1 1 
ATOM   3460 C  CE2 . TYR A 1 442 ? -34.483 107.228 39.968 1.00 29.26 ? 442  TYR A CE2 1 
ATOM   3461 C  CZ  . TYR A 1 442 ? -33.176 107.697 40.036 1.00 29.19 ? 442  TYR A CZ  1 
ATOM   3462 O  OH  . TYR A 1 442 ? -32.636 108.033 41.251 1.00 32.14 ? 442  TYR A OH  1 
ATOM   3463 N  N   . GLU A 1 443 ? -34.612 103.166 34.507 1.00 32.06 ? 443  GLU A N   1 
ATOM   3464 C  CA  . GLU A 1 443 ? -35.423 102.202 33.796 1.00 32.14 ? 443  GLU A CA  1 
ATOM   3465 C  C   . GLU A 1 443 ? -35.220 100.857 34.491 1.00 33.33 ? 443  GLU A C   1 
ATOM   3466 O  O   . GLU A 1 443 ? -35.885 99.876  34.173 1.00 34.46 ? 443  GLU A O   1 
ATOM   3467 C  CB  . GLU A 1 443 ? -34.971 102.108 32.335 1.00 32.47 ? 443  GLU A CB  1 
ATOM   3468 C  CG  . GLU A 1 443 ? -33.750 101.205 32.050 1.00 33.65 ? 443  GLU A CG  1 
ATOM   3469 C  CD  . GLU A 1 443 ? -32.473 101.617 32.787 1.00 35.52 ? 443  GLU A CD  1 
ATOM   3470 O  OE1 . GLU A 1 443 ? -32.197 102.833 32.914 1.00 35.39 ? 443  GLU A OE1 1 
ATOM   3471 O  OE2 . GLU A 1 443 ? -31.730 100.712 33.227 1.00 34.44 ? 443  GLU A OE2 1 
ATOM   3472 N  N   . ILE A 1 444 ? -34.298 100.820 35.449 1.00 33.66 ? 444  ILE A N   1 
ATOM   3473 C  CA  . ILE A 1 444 ? -33.989 99.586  36.157 1.00 32.63 ? 444  ILE A CA  1 
ATOM   3474 C  C   . ILE A 1 444 ? -35.106 99.112  37.054 1.00 34.53 ? 444  ILE A C   1 
ATOM   3475 O  O   . ILE A 1 444 ? -35.407 97.916  37.096 1.00 35.58 ? 444  ILE A O   1 
ATOM   3476 C  CB  . ILE A 1 444 ? -32.722 99.717  37.015 1.00 30.65 ? 444  ILE A CB  1 
ATOM   3477 C  CG1 . ILE A 1 444 ? -31.520 100.040 36.127 1.00 29.03 ? 444  ILE A CG1 1 
ATOM   3478 C  CG2 . ILE A 1 444 ? -32.469 98.412  37.757 1.00 29.97 ? 444  ILE A CG2 1 
ATOM   3479 C  CD1 . ILE A 1 444 ? -30.212 100.074 36.868 1.00 28.05 ? 444  ILE A CD1 1 
ATOM   3480 N  N   . GLU A 1 445 ? -35.725 100.040 37.776 1.00 36.02 ? 445  GLU A N   1 
ATOM   3481 C  CA  . GLU A 1 445 ? -36.808 99.672  38.681 1.00 35.49 ? 445  GLU A CA  1 
ATOM   3482 C  C   . GLU A 1 445 ? -37.918 98.911  37.963 1.00 34.68 ? 445  GLU A C   1 
ATOM   3483 O  O   . GLU A 1 445 ? -38.593 98.080  38.565 1.00 35.13 ? 445  GLU A O   1 
ATOM   3484 C  CB  . GLU A 1 445 ? -37.360 100.915 39.383 1.00 35.48 ? 445  GLU A CB  1 
ATOM   3485 C  CG  . GLU A 1 445 ? -37.780 102.031 38.461 1.00 36.91 ? 445  GLU A CG  1 
ATOM   3486 C  CD  . GLU A 1 445 ? -37.882 103.352 39.191 1.00 36.58 ? 445  GLU A CD  1 
ATOM   3487 O  OE1 . GLU A 1 445 ? -36.831 103.845 39.636 1.00 36.95 ? 445  GLU A OE1 1 
ATOM   3488 O  OE2 . GLU A 1 445 ? -39.000 103.895 39.326 1.00 37.03 ? 445  GLU A OE2 1 
ATOM   3489 N  N   . PHE A 1 446 ? -38.097 99.178  36.674 1.00 33.24 ? 446  PHE A N   1 
ATOM   3490 C  CA  . PHE A 1 446 ? -39.113 98.473  35.911 1.00 32.10 ? 446  PHE A CA  1 
ATOM   3491 C  C   . PHE A 1 446 ? -38.619 97.087  35.487 1.00 32.72 ? 446  PHE A C   1 
ATOM   3492 O  O   . PHE A 1 446 ? -39.383 96.122  35.477 1.00 32.81 ? 446  PHE A O   1 
ATOM   3493 C  CB  . PHE A 1 446 ? -39.509 99.281  34.684 1.00 30.99 ? 446  PHE A CB  1 
ATOM   3494 C  CG  . PHE A 1 446 ? -40.302 100.508 35.005 1.00 32.27 ? 446  PHE A CG  1 
ATOM   3495 C  CD1 . PHE A 1 446 ? -39.677 101.653 35.481 1.00 33.07 ? 446  PHE A CD1 1 
ATOM   3496 C  CD2 . PHE A 1 446 ? -41.683 100.518 34.840 1.00 32.73 ? 446  PHE A CD2 1 
ATOM   3497 C  CE1 . PHE A 1 446 ? -40.414 102.794 35.787 1.00 33.51 ? 446  PHE A CE1 1 
ATOM   3498 C  CE2 . PHE A 1 446 ? -42.432 101.652 35.144 1.00 33.48 ? 446  PHE A CE2 1 
ATOM   3499 C  CZ  . PHE A 1 446 ? -41.797 102.793 35.618 1.00 34.03 ? 446  PHE A CZ  1 
ATOM   3500 N  N   . VAL A 1 447 ? -37.343 96.980  35.134 1.00 31.44 ? 447  VAL A N   1 
ATOM   3501 C  CA  . VAL A 1 447 ? -36.805 95.691  34.736 1.00 29.71 ? 447  VAL A CA  1 
ATOM   3502 C  C   . VAL A 1 447 ? -36.874 94.719  35.911 1.00 31.38 ? 447  VAL A C   1 
ATOM   3503 O  O   . VAL A 1 447 ? -37.009 93.510  35.715 1.00 30.83 ? 447  VAL A O   1 
ATOM   3504 C  CB  . VAL A 1 447 ? -35.336 95.806  34.262 1.00 27.67 ? 447  VAL A CB  1 
ATOM   3505 C  CG1 . VAL A 1 447 ? -34.689 94.429  34.208 1.00 25.32 ? 447  VAL A CG1 1 
ATOM   3506 C  CG2 . VAL A 1 447 ? -35.288 96.447  32.891 1.00 25.37 ? 447  VAL A CG2 1 
ATOM   3507 N  N   . PHE A 1 448 ? -36.793 95.243  37.133 1.00 31.86 ? 448  PHE A N   1 
ATOM   3508 C  CA  . PHE A 1 448 ? -36.837 94.379  38.305 1.00 32.84 ? 448  PHE A CA  1 
ATOM   3509 C  C   . PHE A 1 448 ? -38.220 94.251  38.945 1.00 34.50 ? 448  PHE A C   1 
ATOM   3510 O  O   . PHE A 1 448 ? -38.372 93.674  40.022 1.00 34.48 ? 448  PHE A O   1 
ATOM   3511 C  CB  . PHE A 1 448 ? -35.797 94.832  39.333 1.00 31.37 ? 448  PHE A CB  1 
ATOM   3512 C  CG  . PHE A 1 448 ? -34.398 94.390  39.002 1.00 29.96 ? 448  PHE A CG  1 
ATOM   3513 C  CD1 . PHE A 1 448 ? -33.636 95.077  38.067 1.00 30.70 ? 448  PHE A CD1 1 
ATOM   3514 C  CD2 . PHE A 1 448 ? -33.863 93.250  39.586 1.00 29.70 ? 448  PHE A CD2 1 
ATOM   3515 C  CE1 . PHE A 1 448 ? -32.363 94.630  37.716 1.00 31.65 ? 448  PHE A CE1 1 
ATOM   3516 C  CE2 . PHE A 1 448 ? -32.592 92.794  39.242 1.00 29.12 ? 448  PHE A CE2 1 
ATOM   3517 C  CZ  . PHE A 1 448 ? -31.842 93.482  38.307 1.00 30.57 ? 448  PHE A CZ  1 
ATOM   3518 N  N   . GLY A 1 449 ? -39.225 94.792  38.270 1.00 36.04 ? 449  GLY A N   1 
ATOM   3519 C  CA  . GLY A 1 449 ? -40.588 94.699  38.758 1.00 39.13 ? 449  GLY A CA  1 
ATOM   3520 C  C   . GLY A 1 449 ? -40.974 95.432  40.029 1.00 40.82 ? 449  GLY A C   1 
ATOM   3521 O  O   . GLY A 1 449 ? -41.955 95.066  40.668 1.00 41.20 ? 449  GLY A O   1 
ATOM   3522 N  N   . LEU A 1 450 ? -40.234 96.465  40.408 1.00 42.91 ? 450  LEU A N   1 
ATOM   3523 C  CA  . LEU A 1 450 ? -40.591 97.193  41.617 1.00 44.32 ? 450  LEU A CA  1 
ATOM   3524 C  C   . LEU A 1 450 ? -41.964 97.846  41.507 1.00 45.17 ? 450  LEU A C   1 
ATOM   3525 O  O   . LEU A 1 450 ? -42.592 98.129  42.520 1.00 45.75 ? 450  LEU A O   1 
ATOM   3526 C  CB  . LEU A 1 450 ? -39.536 98.252  41.953 1.00 45.16 ? 450  LEU A CB  1 
ATOM   3527 C  CG  . LEU A 1 450 ? -38.116 97.749  42.242 1.00 44.99 ? 450  LEU A CG  1 
ATOM   3528 C  CD1 . LEU A 1 450 ? -37.298 98.894  42.804 1.00 46.38 ? 450  LEU A CD1 1 
ATOM   3529 C  CD2 . LEU A 1 450 ? -38.139 96.613  43.240 1.00 44.68 ? 450  LEU A CD2 1 
ATOM   3530 N  N   . PRO A 1 451 ? -42.451 98.104  40.280 1.00 46.23 ? 451  PRO A N   1 
ATOM   3531 C  CA  . PRO A 1 451 ? -43.777 98.726  40.217 1.00 47.58 ? 451  PRO A CA  1 
ATOM   3532 C  C   . PRO A 1 451 ? -44.876 97.801  40.731 1.00 48.86 ? 451  PRO A C   1 
ATOM   3533 O  O   . PRO A 1 451 ? -45.894 98.273  41.240 1.00 50.56 ? 451  PRO A O   1 
ATOM   3534 C  CB  . PRO A 1 451 ? -43.940 99.051  38.735 1.00 46.40 ? 451  PRO A CB  1 
ATOM   3535 C  CG  . PRO A 1 451 ? -42.548 99.327  38.312 1.00 47.05 ? 451  PRO A CG  1 
ATOM   3536 C  CD  . PRO A 1 451 ? -41.780 98.204  38.974 1.00 46.53 ? 451  PRO A CD  1 
ATOM   3537 N  N   . LEU A 1 452 ? -44.672 96.490  40.597 1.00 49.14 ? 452  LEU A N   1 
ATOM   3538 C  CA  . LEU A 1 452 ? -45.652 95.506  41.061 1.00 49.48 ? 452  LEU A CA  1 
ATOM   3539 C  C   . LEU A 1 452 ? -45.994 95.686  42.541 1.00 51.55 ? 452  LEU A C   1 
ATOM   3540 O  O   . LEU A 1 452 ? -47.042 95.234  43.005 1.00 52.59 ? 452  LEU A O   1 
ATOM   3541 C  CB  . LEU A 1 452 ? -45.138 94.083  40.828 1.00 46.33 ? 452  LEU A CB  1 
ATOM   3542 C  CG  . LEU A 1 452 ? -45.442 93.451  39.471 1.00 44.57 ? 452  LEU A CG  1 
ATOM   3543 C  CD1 . LEU A 1 452 ? -44.885 94.298  38.340 1.00 44.57 ? 452  LEU A CD1 1 
ATOM   3544 C  CD2 . LEU A 1 452 ? -44.856 92.061  39.442 1.00 43.72 ? 452  LEU A CD2 1 
ATOM   3545 N  N   . VAL A 1 453 ? -45.109 96.346  43.281 1.00 53.24 ? 453  VAL A N   1 
ATOM   3546 C  CA  . VAL A 1 453 ? -45.344 96.592  44.695 1.00 55.46 ? 453  VAL A CA  1 
ATOM   3547 C  C   . VAL A 1 453 ? -46.340 97.731  44.876 1.00 58.16 ? 453  VAL A C   1 
ATOM   3548 O  O   . VAL A 1 453 ? -46.153 98.829  44.351 1.00 58.41 ? 453  VAL A O   1 
ATOM   3549 C  CB  . VAL A 1 453 ? -44.053 96.959  45.408 1.00 54.36 ? 453  VAL A CB  1 
ATOM   3550 C  CG1 . VAL A 1 453 ? -44.358 97.374  46.832 1.00 53.86 ? 453  VAL A CG1 1 
ATOM   3551 C  CG2 . VAL A 1 453 ? -43.104 95.776  45.375 1.00 53.95 ? 453  VAL A CG2 1 
ATOM   3552 N  N   . LYS A 1 454 ? -47.399 97.468  45.633 1.00 61.11 ? 454  LYS A N   1 
ATOM   3553 C  CA  . LYS A 1 454 ? -48.433 98.469  45.860 1.00 63.01 ? 454  LYS A CA  1 
ATOM   3554 C  C   . LYS A 1 454 ? -48.008 99.569  46.835 1.00 62.78 ? 454  LYS A C   1 
ATOM   3555 O  O   . LYS A 1 454 ? -48.461 100.707 46.730 1.00 62.33 ? 454  LYS A O   1 
ATOM   3556 C  CB  . LYS A 1 454 ? -49.717 97.771  46.337 1.00 65.13 ? 454  LYS A CB  1 
ATOM   3557 C  CG  . LYS A 1 454 ? -50.260 96.744  45.324 1.00 67.39 ? 454  LYS A CG  1 
ATOM   3558 C  CD  . LYS A 1 454 ? -51.368 95.854  45.907 1.00 67.75 ? 454  LYS A CD  1 
ATOM   3559 C  CE  . LYS A 1 454 ? -51.777 94.743  44.925 1.00 66.79 ? 454  LYS A CE  1 
ATOM   3560 N  NZ  . LYS A 1 454 ? -52.610 93.689  45.582 1.00 64.32 ? 454  LYS A NZ  1 
ATOM   3561 N  N   . GLU A 1 455 ? -47.125 99.233  47.770 1.00 62.76 ? 455  GLU A N   1 
ATOM   3562 C  CA  . GLU A 1 455 ? -46.651 100.203 48.753 1.00 63.07 ? 455  GLU A CA  1 
ATOM   3563 C  C   . GLU A 1 455 ? -45.690 101.211 48.129 1.00 62.13 ? 455  GLU A C   1 
ATOM   3564 O  O   . GLU A 1 455 ? -45.426 102.267 48.707 1.00 61.66 ? 455  GLU A O   1 
ATOM   3565 C  CB  . GLU A 1 455 ? -45.938 99.500  49.910 1.00 65.24 ? 455  GLU A CB  1 
ATOM   3566 C  CG  . GLU A 1 455 ? -46.776 98.477  50.657 1.00 70.34 ? 455  GLU A CG  1 
ATOM   3567 C  CD  . GLU A 1 455 ? -47.133 97.262  49.809 1.00 73.22 ? 455  GLU A CD  1 
ATOM   3568 O  OE1 . GLU A 1 455 ? -46.544 97.088  48.718 1.00 74.00 ? 455  GLU A OE1 1 
ATOM   3569 O  OE2 . GLU A 1 455 ? -48.000 96.473  50.243 1.00 75.33 ? 455  GLU A OE2 1 
ATOM   3570 N  N   . LEU A 1 456 ? -45.157 100.879 46.956 1.00 60.56 ? 456  LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 456 ? -44.228 101.772 46.276 1.00 58.49 ? 456  LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 456 ? -44.987 102.867 45.546 1.00 57.54 ? 456  LEU A C   1 
ATOM   3573 O  O   . LEU A 1 456 ? -44.398 103.748 44.927 1.00 57.05 ? 456  LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 456 ? -43.352 100.984 45.303 1.00 57.99 ? 456  LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 456 ? -42.355 100.025 45.960 1.00 57.65 ? 456  LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 456 ? -41.527 99.324  44.898 1.00 57.73 ? 456  LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 456 ? -41.448 100.796 46.898 1.00 57.00 ? 456  LEU A CD2 1 
ATOM   3578 N  N   . ASN A 1 457 ? -46.308 102.793 45.629 1.00 57.77 ? 457  ASN A N   1 
ATOM   3579 C  CA  . ASN A 1 457 ? -47.192 103.775 45.016 1.00 58.17 ? 457  ASN A CA  1 
ATOM   3580 C  C   . ASN A 1 457 ? -46.958 104.064 43.523 1.00 56.48 ? 457  ASN A C   1 
ATOM   3581 O  O   . ASN A 1 457 ? -46.647 105.192 43.135 1.00 56.01 ? 457  ASN A O   1 
ATOM   3582 C  CB  . ASN A 1 457 ? -47.144 105.082 45.830 1.00 60.97 ? 457  ASN A CB  1 
ATOM   3583 C  CG  . ASN A 1 457 ? -47.522 104.876 47.301 1.00 64.73 ? 457  ASN A CG  1 
ATOM   3584 O  OD1 . ASN A 1 457 ? -48.401 104.072 47.605 1.00 64.85 ? 457  ASN A OD1 1 
ATOM   3585 N  ND2 . ASN A 1 457 ? -46.879 105.615 48.206 1.00 68.69 ? 457  ASN A ND2 1 
ATOM   3586 N  N   . TYR A 1 458 ? -47.122 103.037 42.692 1.00 54.25 ? 458  TYR A N   1 
ATOM   3587 C  CA  . TYR A 1 458 ? -46.966 103.169 41.243 1.00 52.51 ? 458  TYR A CA  1 
ATOM   3588 C  C   . TYR A 1 458 ? -48.355 103.105 40.613 1.00 52.55 ? 458  TYR A C   1 
ATOM   3589 O  O   . TYR A 1 458 ? -49.234 102.411 41.124 1.00 54.08 ? 458  TYR A O   1 
ATOM   3590 C  CB  . TYR A 1 458 ? -46.111 102.026 40.691 1.00 50.90 ? 458  TYR A CB  1 
ATOM   3591 C  CG  . TYR A 1 458 ? -44.617 102.226 40.833 1.00 50.04 ? 458  TYR A CG  1 
ATOM   3592 C  CD1 . TYR A 1 458 ? -43.920 103.068 39.963 1.00 49.08 ? 458  TYR A CD1 1 
ATOM   3593 C  CD2 . TYR A 1 458 ? -43.897 101.564 41.828 1.00 48.60 ? 458  TYR A CD2 1 
ATOM   3594 C  CE1 . TYR A 1 458 ? -42.549 103.244 40.078 1.00 47.79 ? 458  TYR A CE1 1 
ATOM   3595 C  CE2 . TYR A 1 458 ? -42.523 101.734 41.955 1.00 48.10 ? 458  TYR A CE2 1 
ATOM   3596 C  CZ  . TYR A 1 458 ? -41.856 102.574 41.077 1.00 48.10 ? 458  TYR A CZ  1 
ATOM   3597 O  OH  . TYR A 1 458 ? -40.498 102.746 41.199 1.00 47.39 ? 458  TYR A OH  1 
ATOM   3598 N  N   . THR A 1 459 ? -48.564 103.817 39.512 1.00 51.30 ? 459  THR A N   1 
ATOM   3599 C  CA  . THR A 1 459 ? -49.867 103.797 38.861 1.00 50.59 ? 459  THR A CA  1 
ATOM   3600 C  C   . THR A 1 459 ? -50.125 102.436 38.217 1.00 51.29 ? 459  THR A C   1 
ATOM   3601 O  O   . THR A 1 459 ? -49.192 101.737 37.829 1.00 51.63 ? 459  THR A O   1 
ATOM   3602 C  CB  . THR A 1 459 ? -49.977 104.902 37.785 1.00 49.78 ? 459  THR A CB  1 
ATOM   3603 O  OG1 . THR A 1 459 ? -49.160 104.568 36.656 1.00 50.83 ? 459  THR A OG1 1 
ATOM   3604 C  CG2 . THR A 1 459 ? -49.533 106.235 38.355 1.00 47.25 ? 459  THR A CG2 1 
ATOM   3605 N  N   . ALA A 1 460 ? -51.399 102.068 38.114 1.00 52.78 ? 460  ALA A N   1 
ATOM   3606 C  CA  . ALA A 1 460 ? -51.805 100.790 37.530 1.00 54.20 ? 460  ALA A CA  1 
ATOM   3607 C  C   . ALA A 1 460 ? -51.135 100.512 36.193 1.00 55.21 ? 460  ALA A C   1 
ATOM   3608 O  O   . ALA A 1 460 ? -50.726 99.383  35.913 1.00 54.45 ? 460  ALA A O   1 
ATOM   3609 C  CB  . ALA A 1 460 ? -53.321 100.756 37.358 1.00 53.64 ? 460  ALA A CB  1 
ATOM   3610 N  N   . GLU A 1 461 ? -51.029 101.548 35.370 1.00 56.60 ? 461  GLU A N   1 
ATOM   3611 C  CA  . GLU A 1 461 ? -50.422 101.420 34.052 1.00 58.58 ? 461  GLU A CA  1 
ATOM   3612 C  C   . GLU A 1 461 ? -48.930 101.130 34.115 1.00 57.47 ? 461  GLU A C   1 
ATOM   3613 O  O   . GLU A 1 461 ? -48.379 100.477 33.222 1.00 55.84 ? 461  GLU A O   1 
ATOM   3614 C  CB  . GLU A 1 461 ? -50.659 102.695 33.264 1.00 62.18 ? 461  GLU A CB  1 
ATOM   3615 C  CG  . GLU A 1 461 ? -52.118 103.037 33.129 1.00 67.94 ? 461  GLU A CG  1 
ATOM   3616 C  CD  . GLU A 1 461 ? -52.317 104.469 32.718 1.00 72.21 ? 461  GLU A CD  1 
ATOM   3617 O  OE1 . GLU A 1 461 ? -51.923 105.360 33.509 1.00 74.11 ? 461  GLU A OE1 1 
ATOM   3618 O  OE2 . GLU A 1 461 ? -52.856 104.700 31.609 1.00 74.18 ? 461  GLU A OE2 1 
ATOM   3619 N  N   . GLU A 1 462 ? -48.280 101.626 35.166 1.00 56.04 ? 462  GLU A N   1 
ATOM   3620 C  CA  . GLU A 1 462 ? -46.852 101.404 35.342 1.00 54.70 ? 462  GLU A CA  1 
ATOM   3621 C  C   . GLU A 1 462 ? -46.565 99.953  35.730 1.00 54.65 ? 462  GLU A C   1 
ATOM   3622 O  O   . GLU A 1 462 ? -45.521 99.408  35.369 1.00 55.75 ? 462  GLU A O   1 
ATOM   3623 C  CB  . GLU A 1 462 ? -46.290 102.377 36.378 1.00 52.62 ? 462  GLU A CB  1 
ATOM   3624 C  CG  . GLU A 1 462 ? -46.430 103.827 35.936 1.00 50.19 ? 462  GLU A CG  1 
ATOM   3625 C  CD  . GLU A 1 462 ? -45.779 104.810 36.884 1.00 48.72 ? 462  GLU A CD  1 
ATOM   3626 O  OE1 . GLU A 1 462 ? -46.093 104.783 38.089 1.00 49.08 ? 462  GLU A OE1 1 
ATOM   3627 O  OE2 . GLU A 1 462 ? -44.956 105.621 36.424 1.00 48.47 ? 462  GLU A OE2 1 
ATOM   3628 N  N   . GLU A 1 463 ? -47.484 99.324  36.460 1.00 53.52 ? 463  GLU A N   1 
ATOM   3629 C  CA  . GLU A 1 463 ? -47.302 97.921  36.817 1.00 52.37 ? 463  GLU A CA  1 
ATOM   3630 C  C   . GLU A 1 463 ? -47.466 97.141  35.523 1.00 49.92 ? 463  GLU A C   1 
ATOM   3631 O  O   . GLU A 1 463 ? -46.897 96.073  35.345 1.00 48.64 ? 463  GLU A O   1 
ATOM   3632 C  CB  . GLU A 1 463 ? -48.361 97.454  37.816 1.00 55.46 ? 463  GLU A CB  1 
ATOM   3633 C  CG  . GLU A 1 463 ? -48.476 95.929  37.891 1.00 59.12 ? 463  GLU A CG  1 
ATOM   3634 C  CD  . GLU A 1 463 ? -49.542 95.454  38.861 1.00 61.86 ? 463  GLU A CD  1 
ATOM   3635 O  OE1 . GLU A 1 463 ? -50.664 96.003  38.828 1.00 63.56 ? 463  GLU A OE1 1 
ATOM   3636 O  OE2 . GLU A 1 463 ? -49.262 94.521  39.647 1.00 63.12 ? 463  GLU A OE2 1 
ATOM   3637 N  N   . ALA A 1 464 ? -48.267 97.688  34.621 1.00 48.48 ? 464  ALA A N   1 
ATOM   3638 C  CA  . ALA A 1 464 ? -48.493 97.053  33.339 1.00 47.44 ? 464  ALA A CA  1 
ATOM   3639 C  C   . ALA A 1 464 ? -47.155 96.989  32.621 1.00 46.70 ? 464  ALA A C   1 
ATOM   3640 O  O   . ALA A 1 464 ? -46.672 95.908  32.263 1.00 45.67 ? 464  ALA A O   1 
ATOM   3641 C  CB  . ALA A 1 464 ? -49.483 97.868  32.526 1.00 47.39 ? 464  ALA A CB  1 
ATOM   3642 N  N   . LEU A 1 465 ? -46.564 98.167  32.430 1.00 45.29 ? 465  LEU A N   1 
ATOM   3643 C  CA  . LEU A 1 465 ? -45.284 98.302  31.751 1.00 43.36 ? 465  LEU A CA  1 
ATOM   3644 C  C   . LEU A 1 465 ? -44.222 97.411  32.370 1.00 42.45 ? 465  LEU A C   1 
ATOM   3645 O  O   . LEU A 1 465 ? -43.574 96.634  31.667 1.00 43.12 ? 465  LEU A O   1 
ATOM   3646 C  CB  . LEU A 1 465 ? -44.825 99.763  31.784 1.00 43.02 ? 465  LEU A CB  1 
ATOM   3647 C  CG  . LEU A 1 465 ? -43.449 100.116 31.205 1.00 43.11 ? 465  LEU A CG  1 
ATOM   3648 C  CD1 . LEU A 1 465 ? -43.250 99.483  29.839 1.00 42.40 ? 465  LEU A CD1 1 
ATOM   3649 C  CD2 . LEU A 1 465 ? -43.333 101.621 31.114 1.00 42.74 ? 465  LEU A CD2 1 
ATOM   3650 N  N   . SER A 1 466 ? -44.046 97.520  33.683 1.00 40.16 ? 466  SER A N   1 
ATOM   3651 C  CA  . SER A 1 466 ? -43.054 96.714  34.379 1.00 39.40 ? 466  SER A CA  1 
ATOM   3652 C  C   . SER A 1 466 ? -43.231 95.219  34.078 1.00 39.61 ? 466  SER A C   1 
ATOM   3653 O  O   . SER A 1 466 ? -42.258 94.501  33.816 1.00 39.26 ? 466  SER A O   1 
ATOM   3654 C  CB  . SER A 1 466 ? -43.149 96.961  35.880 1.00 39.12 ? 466  SER A CB  1 
ATOM   3655 O  OG  . SER A 1 466 ? -42.110 96.292  36.569 1.00 40.11 ? 466  SER A OG  1 
ATOM   3656 N  N   . ARG A 1 467 ? -44.477 94.752  34.118 1.00 38.98 ? 467  ARG A N   1 
ATOM   3657 C  CA  . ARG A 1 467 ? -44.771 93.352  33.831 1.00 36.78 ? 467  ARG A CA  1 
ATOM   3658 C  C   . ARG A 1 467 ? -44.438 93.056  32.378 1.00 35.45 ? 467  ARG A C   1 
ATOM   3659 O  O   . ARG A 1 467 ? -43.908 91.993  32.062 1.00 34.98 ? 467  ARG A O   1 
ATOM   3660 C  CB  . ARG A 1 467 ? -46.252 93.038  34.093 1.00 37.21 ? 467  ARG A CB  1 
ATOM   3661 C  CG  . ARG A 1 467 ? -46.607 92.782  35.562 1.00 36.17 ? 467  ARG A CG  1 
ATOM   3662 C  CD  . ARG A 1 467 ? -48.119 92.597  35.765 1.00 33.34 ? 467  ARG A CD  1 
ATOM   3663 N  NE  . ARG A 1 467 ? -48.484 92.496  37.180 1.00 31.09 ? 467  ARG A NE  1 
ATOM   3664 C  CZ  . ARG A 1 467 ? -48.161 91.470  37.964 1.00 31.46 ? 467  ARG A CZ  1 
ATOM   3665 N  NH1 . ARG A 1 467 ? -47.468 90.447  37.475 1.00 31.45 ? 467  ARG A NH1 1 
ATOM   3666 N  NH2 . ARG A 1 467 ? -48.520 91.466  39.242 1.00 29.04 ? 467  ARG A NH2 1 
ATOM   3667 N  N   . ARG A 1 468 ? -44.740 93.996  31.490 1.00 34.54 ? 468  ARG A N   1 
ATOM   3668 C  CA  . ARG A 1 468 ? -44.457 93.782  30.077 1.00 34.60 ? 468  ARG A CA  1 
ATOM   3669 C  C   . ARG A 1 468 ? -42.959 93.674  29.832 1.00 35.11 ? 468  ARG A C   1 
ATOM   3670 O  O   . ARG A 1 468 ? -42.499 92.770  29.121 1.00 34.51 ? 468  ARG A O   1 
ATOM   3671 C  CB  . ARG A 1 468 ? -45.039 94.910  29.221 1.00 33.29 ? 468  ARG A CB  1 
ATOM   3672 C  CG  . ARG A 1 468 ? -45.117 94.539  27.749 1.00 34.66 ? 468  ARG A CG  1 
ATOM   3673 C  CD  . ARG A 1 468 ? -45.931 95.529  26.943 1.00 36.14 ? 468  ARG A CD  1 
ATOM   3674 N  NE  . ARG A 1 468 ? -45.105 96.574  26.347 1.00 38.53 ? 468  ARG A NE  1 
ATOM   3675 C  CZ  . ARG A 1 468 ? -45.323 97.876  26.507 1.00 40.30 ? 468  ARG A CZ  1 
ATOM   3676 N  NH1 . ARG A 1 468 ? -46.346 98.292  27.250 1.00 39.05 ? 468  ARG A NH1 1 
ATOM   3677 N  NH2 . ARG A 1 468 ? -44.519 98.765  25.925 1.00 40.65 ? 468  ARG A NH2 1 
ATOM   3678 N  N   . ILE A 1 469 ? -42.204 94.596  30.430 1.00 35.04 ? 469  ILE A N   1 
ATOM   3679 C  CA  . ILE A 1 469 ? -40.752 94.615  30.280 1.00 34.92 ? 469  ILE A CA  1 
ATOM   3680 C  C   . ILE A 1 469 ? -40.122 93.344  30.843 1.00 33.85 ? 469  ILE A C   1 
ATOM   3681 O  O   . ILE A 1 469 ? -39.292 92.711  30.189 1.00 32.36 ? 469  ILE A O   1 
ATOM   3682 C  CB  . ILE A 1 469 ? -40.119 95.860  30.975 1.00 34.60 ? 469  ILE A CB  1 
ATOM   3683 C  CG1 . ILE A 1 469 ? -40.517 97.132  30.223 1.00 34.30 ? 469  ILE A CG1 1 
ATOM   3684 C  CG2 . ILE A 1 469 ? -38.599 95.735  31.006 1.00 33.88 ? 469  ILE A CG2 1 
ATOM   3685 C  CD1 . ILE A 1 469 ? -39.886 98.400  30.765 1.00 33.47 ? 469  ILE A CD1 1 
ATOM   3686 N  N   . MET A 1 470 ? -40.521 92.969  32.052 1.00 33.39 ? 470  MET A N   1 
ATOM   3687 C  CA  . MET A 1 470 ? -39.980 91.769  32.666 1.00 34.83 ? 470  MET A CA  1 
ATOM   3688 C  C   . MET A 1 470 ? -40.172 90.570  31.747 1.00 35.36 ? 470  MET A C   1 
ATOM   3689 O  O   . MET A 1 470 ? -39.306 89.705  31.645 1.00 35.12 ? 470  MET A O   1 
ATOM   3690 C  CB  . MET A 1 470 ? -40.656 91.503  34.011 1.00 35.21 ? 470  MET A CB  1 
ATOM   3691 C  CG  . MET A 1 470 ? -40.273 92.483  35.100 1.00 36.92 ? 470  MET A CG  1 
ATOM   3692 S  SD  . MET A 1 470 ? -40.656 91.878  36.758 1.00 37.57 ? 470  MET A SD  1 
ATOM   3693 C  CE  . MET A 1 470 ? -42.351 92.387  36.878 1.00 38.41 ? 470  MET A CE  1 
ATOM   3694 N  N   . HIS A 1 471 ? -41.308 90.523  31.065 1.00 36.67 ? 471  HIS A N   1 
ATOM   3695 C  CA  . HIS A 1 471 ? -41.574 89.412  30.171 1.00 37.45 ? 471  HIS A CA  1 
ATOM   3696 C  C   . HIS A 1 471 ? -40.601 89.424  29.007 1.00 37.05 ? 471  HIS A C   1 
ATOM   3697 O  O   . HIS A 1 471 ? -39.908 88.438  28.769 1.00 37.33 ? 471  HIS A O   1 
ATOM   3698 C  CB  . HIS A 1 471 ? -43.008 89.463  29.657 1.00 39.92 ? 471  HIS A CB  1 
ATOM   3699 C  CG  . HIS A 1 471 ? -43.574 88.110  29.373 1.00 40.72 ? 471  HIS A CG  1 
ATOM   3700 N  ND1 . HIS A 1 471 ? -43.633 87.120  30.332 1.00 38.76 ? 471  HIS A ND1 1 
ATOM   3701 C  CD2 . HIS A 1 471 ? -44.052 87.562  28.232 1.00 41.27 ? 471  HIS A CD2 1 
ATOM   3702 C  CE1 . HIS A 1 471 ? -44.120 86.019  29.792 1.00 40.56 ? 471  HIS A CE1 1 
ATOM   3703 N  NE2 . HIS A 1 471 ? -44.383 86.261  28.520 1.00 41.71 ? 471  HIS A NE2 1 
ATOM   3704 N  N   . TYR A 1 472 ? -40.561 90.539  28.279 1.00 37.24 ? 472  TYR A N   1 
ATOM   3705 C  CA  . TYR A 1 472 ? -39.642 90.694  27.154 1.00 35.70 ? 472  TYR A CA  1 
ATOM   3706 C  C   . TYR A 1 472 ? -38.263 90.192  27.589 1.00 34.42 ? 472  TYR A C   1 
ATOM   3707 O  O   . TYR A 1 472 ? -37.680 89.302  26.968 1.00 32.71 ? 472  TYR A O   1 
ATOM   3708 C  CB  . TYR A 1 472 ? -39.516 92.167  26.773 1.00 36.76 ? 472  TYR A CB  1 
ATOM   3709 C  CG  . TYR A 1 472 ? -40.703 92.783  26.064 1.00 37.83 ? 472  TYR A CG  1 
ATOM   3710 C  CD1 . TYR A 1 472 ? -41.173 92.256  24.863 1.00 38.32 ? 472  TYR A CD1 1 
ATOM   3711 C  CD2 . TYR A 1 472 ? -41.286 93.960  26.538 1.00 38.94 ? 472  TYR A CD2 1 
ATOM   3712 C  CE1 . TYR A 1 472 ? -42.187 92.891  24.143 1.00 39.01 ? 472  TYR A CE1 1 
ATOM   3713 C  CE2 . TYR A 1 472 ? -42.303 94.606  25.824 1.00 39.53 ? 472  TYR A CE2 1 
ATOM   3714 C  CZ  . TYR A 1 472 ? -42.745 94.067  24.626 1.00 40.06 ? 472  TYR A CZ  1 
ATOM   3715 O  OH  . TYR A 1 472 ? -43.716 94.712  23.896 1.00 40.36 ? 472  TYR A OH  1 
ATOM   3716 N  N   . TRP A 1 473 ? -37.762 90.781  28.675 1.00 33.37 ? 473  TRP A N   1 
ATOM   3717 C  CA  . TRP A 1 473 ? -36.458 90.443  29.241 1.00 32.80 ? 473  TRP A CA  1 
ATOM   3718 C  C   . TRP A 1 473 ? -36.270 88.943  29.514 1.00 32.66 ? 473  TRP A C   1 
ATOM   3719 O  O   . TRP A 1 473 ? -35.408 88.297  28.920 1.00 33.31 ? 473  TRP A O   1 
ATOM   3720 C  CB  . TRP A 1 473 ? -36.233 91.232  30.536 1.00 31.51 ? 473  TRP A CB  1 
ATOM   3721 C  CG  . TRP A 1 473 ? -35.410 92.494  30.398 1.00 32.09 ? 473  TRP A CG  1 
ATOM   3722 C  CD1 . TRP A 1 473 ? -34.319 92.832  31.144 1.00 32.69 ? 473  TRP A CD1 1 
ATOM   3723 C  CD2 . TRP A 1 473 ? -35.650 93.605  29.521 1.00 32.58 ? 473  TRP A CD2 1 
ATOM   3724 N  NE1 . TRP A 1 473 ? -33.869 94.077  30.796 1.00 33.06 ? 473  TRP A NE1 1 
ATOM   3725 C  CE2 . TRP A 1 473 ? -34.666 94.578  29.802 1.00 31.91 ? 473  TRP A CE2 1 
ATOM   3726 C  CE3 . TRP A 1 473 ? -36.602 93.877  28.528 1.00 34.23 ? 473  TRP A CE3 1 
ATOM   3727 C  CZ2 . TRP A 1 473 ? -34.602 95.804  29.127 1.00 30.74 ? 473  TRP A CZ2 1 
ATOM   3728 C  CZ3 . TRP A 1 473 ? -36.538 95.105  27.853 1.00 33.29 ? 473  TRP A CZ3 1 
ATOM   3729 C  CH2 . TRP A 1 473 ? -35.543 96.048  28.159 1.00 30.92 ? 473  TRP A CH2 1 
ATOM   3730 N  N   . ALA A 1 474 ? -37.066 88.392  30.420 1.00 32.07 ? 474  ALA A N   1 
ATOM   3731 C  CA  . ALA A 1 474 ? -36.961 86.979  30.741 1.00 31.53 ? 474  ALA A CA  1 
ATOM   3732 C  C   . ALA A 1 474 ? -37.208 86.120  29.501 1.00 32.74 ? 474  ALA A C   1 
ATOM   3733 O  O   . ALA A 1 474 ? -36.473 85.158  29.247 1.00 32.60 ? 474  ALA A O   1 
ATOM   3734 C  CB  . ALA A 1 474 ? -37.949 86.623  31.826 1.00 30.98 ? 474  ALA A CB  1 
ATOM   3735 N  N   . THR A 1 475 ? -38.241 86.459  28.730 1.00 32.42 ? 475  THR A N   1 
ATOM   3736 C  CA  . THR A 1 475 ? -38.551 85.699  27.524 1.00 33.11 ? 475  THR A CA  1 
ATOM   3737 C  C   . THR A 1 475 ? -37.306 85.640  26.642 1.00 35.32 ? 475  THR A C   1 
ATOM   3738 O  O   . THR A 1 475 ? -36.947 84.575  26.130 1.00 37.30 ? 475  THR A O   1 
ATOM   3739 C  CB  . THR A 1 475 ? -39.711 86.333  26.721 1.00 32.31 ? 475  THR A CB  1 
ATOM   3740 O  OG1 . THR A 1 475 ? -40.911 86.315  27.507 1.00 29.33 ? 475  THR A OG1 1 
ATOM   3741 C  CG2 . THR A 1 475 ? -39.947 85.556  25.418 1.00 31.13 ? 475  THR A CG2 1 
ATOM   3742 N  N   . PHE A 1 476 ? -36.647 86.785  26.473 1.00 35.50 ? 476  PHE A N   1 
ATOM   3743 C  CA  . PHE A 1 476 ? -35.424 86.855  25.676 1.00 35.14 ? 476  PHE A CA  1 
ATOM   3744 C  C   . PHE A 1 476 ? -34.410 85.839  26.202 1.00 35.92 ? 476  PHE A C   1 
ATOM   3745 O  O   . PHE A 1 476 ? -34.013 84.921  25.485 1.00 35.38 ? 476  PHE A O   1 
ATOM   3746 C  CB  . PHE A 1 476 ? -34.809 88.254  25.753 1.00 33.68 ? 476  PHE A CB  1 
ATOM   3747 C  CG  . PHE A 1 476 ? -33.521 88.389  24.994 1.00 31.73 ? 476  PHE A CG  1 
ATOM   3748 C  CD1 . PHE A 1 476 ? -33.522 88.479  23.600 1.00 32.25 ? 476  PHE A CD1 1 
ATOM   3749 C  CD2 . PHE A 1 476 ? -32.305 88.406  25.664 1.00 30.03 ? 476  PHE A CD2 1 
ATOM   3750 C  CE1 . PHE A 1 476 ? -32.321 88.584  22.883 1.00 30.45 ? 476  PHE A CE1 1 
ATOM   3751 C  CE2 . PHE A 1 476 ? -31.105 88.509  24.960 1.00 29.42 ? 476  PHE A CE2 1 
ATOM   3752 C  CZ  . PHE A 1 476 ? -31.113 88.598  23.566 1.00 29.18 ? 476  PHE A CZ  1 
ATOM   3753 N  N   . ALA A 1 477 ? -34.001 86.008  27.456 1.00 36.57 ? 477  ALA A N   1 
ATOM   3754 C  CA  . ALA A 1 477 ? -33.034 85.102  28.076 1.00 39.14 ? 477  ALA A CA  1 
ATOM   3755 C  C   . ALA A 1 477 ? -33.320 83.647  27.726 1.00 40.71 ? 477  ALA A C   1 
ATOM   3756 O  O   . ALA A 1 477 ? -32.430 82.907  27.298 1.00 41.03 ? 477  ALA A O   1 
ATOM   3757 C  CB  . ALA A 1 477 ? -33.050 85.272  29.590 1.00 37.49 ? 477  ALA A CB  1 
ATOM   3758 N  N   . LYS A 1 478 ? -34.577 83.252  27.898 1.00 42.09 ? 478  LYS A N   1 
ATOM   3759 C  CA  . LYS A 1 478 ? -35.005 81.887  27.640 1.00 41.91 ? 478  LYS A CA  1 
ATOM   3760 C  C   . LYS A 1 478 ? -35.053 81.485  26.167 1.00 40.40 ? 478  LYS A C   1 
ATOM   3761 O  O   . LYS A 1 478 ? -34.648 80.376  25.824 1.00 39.70 ? 478  LYS A O   1 
ATOM   3762 C  CB  . LYS A 1 478 ? -36.373 81.651  28.301 1.00 44.70 ? 478  LYS A CB  1 
ATOM   3763 C  CG  . LYS A 1 478 ? -36.963 80.250  28.101 1.00 48.14 ? 478  LYS A CG  1 
ATOM   3764 C  CD  . LYS A 1 478 ? -38.153 79.996  29.038 1.00 50.16 ? 478  LYS A CD  1 
ATOM   3765 C  CE  . LYS A 1 478 ? -38.956 78.752  28.633 1.00 51.30 ? 478  LYS A CE  1 
ATOM   3766 N  NZ  . LYS A 1 478 ? -40.095 78.460  29.565 1.00 48.85 ? 478  LYS A NZ  1 
ATOM   3767 N  N   . THR A 1 479 ? -35.514 82.378  25.294 1.00 38.97 ? 479  THR A N   1 
ATOM   3768 C  CA  . THR A 1 479 ? -35.627 82.037  23.875 1.00 38.25 ? 479  THR A CA  1 
ATOM   3769 C  C   . THR A 1 479 ? -34.723 82.767  22.873 1.00 38.75 ? 479  THR A C   1 
ATOM   3770 O  O   . THR A 1 479 ? -34.537 82.295  21.753 1.00 39.06 ? 479  THR A O   1 
ATOM   3771 C  CB  . THR A 1 479 ? -37.082 82.218  23.385 1.00 37.24 ? 479  THR A CB  1 
ATOM   3772 O  OG1 . THR A 1 479 ? -37.270 83.559  22.916 1.00 37.31 ? 479  THR A OG1 1 
ATOM   3773 C  CG2 . THR A 1 479 ? -38.058 81.954  24.515 1.00 36.12 ? 479  THR A CG2 1 
ATOM   3774 N  N   . GLY A 1 480 ? -34.168 83.909  23.258 1.00 38.78 ? 480  GLY A N   1 
ATOM   3775 C  CA  . GLY A 1 480 ? -33.335 84.654  22.330 1.00 37.88 ? 480  GLY A CA  1 
ATOM   3776 C  C   . GLY A 1 480 ? -34.208 85.591  21.506 1.00 37.72 ? 480  GLY A C   1 
ATOM   3777 O  O   . GLY A 1 480 ? -33.769 86.143  20.496 1.00 37.86 ? 480  GLY A O   1 
ATOM   3778 N  N   . ASN A 1 481 ? -35.457 85.744  21.945 1.00 37.14 ? 481  ASN A N   1 
ATOM   3779 C  CA  . ASN A 1 481 ? -36.451 86.611  21.308 1.00 36.70 ? 481  ASN A CA  1 
ATOM   3780 C  C   . ASN A 1 481 ? -37.417 87.063  22.407 1.00 37.46 ? 481  ASN A C   1 
ATOM   3781 O  O   . ASN A 1 481 ? -37.912 86.239  23.186 1.00 37.51 ? 481  ASN A O   1 
ATOM   3782 C  CB  . ASN A 1 481 ? -37.231 85.850  20.238 1.00 36.49 ? 481  ASN A CB  1 
ATOM   3783 C  CG  . ASN A 1 481 ? -38.257 86.725  19.522 1.00 36.96 ? 481  ASN A CG  1 
ATOM   3784 O  OD1 . ASN A 1 481 ? -38.998 87.494  20.145 1.00 35.31 ? 481  ASN A OD1 1 
ATOM   3785 N  ND2 . ASN A 1 481 ? -38.311 86.595  18.204 1.00 35.29 ? 481  ASN A ND2 1 
ATOM   3786 N  N   . PRO A 1 482 ? -37.687 88.380  22.493 1.00 37.28 ? 482  PRO A N   1 
ATOM   3787 C  CA  . PRO A 1 482 ? -38.591 88.930  23.505 1.00 37.24 ? 482  PRO A CA  1 
ATOM   3788 C  C   . PRO A 1 482 ? -40.068 88.709  23.208 1.00 37.88 ? 482  PRO A C   1 
ATOM   3789 O  O   . PRO A 1 482 ? -40.886 88.676  24.122 1.00 35.98 ? 482  PRO A O   1 
ATOM   3790 C  CB  . PRO A 1 482 ? -38.219 90.404  23.519 1.00 36.97 ? 482  PRO A CB  1 
ATOM   3791 C  CG  . PRO A 1 482 ? -37.897 90.660  22.100 1.00 36.58 ? 482  PRO A CG  1 
ATOM   3792 C  CD  . PRO A 1 482 ? -37.044 89.468  21.737 1.00 36.82 ? 482  PRO A CD  1 
ATOM   3793 N  N   . ASN A 1 483 ? -40.403 88.556  21.932 1.00 40.07 ? 483  ASN A N   1 
ATOM   3794 C  CA  . ASN A 1 483 ? -41.790 88.345  21.521 1.00 42.80 ? 483  ASN A CA  1 
ATOM   3795 C  C   . ASN A 1 483 ? -42.343 86.979  21.921 1.00 45.33 ? 483  ASN A C   1 
ATOM   3796 O  O   . ASN A 1 483 ? -41.589 86.031  22.157 1.00 45.61 ? 483  ASN A O   1 
ATOM   3797 C  CB  . ASN A 1 483 ? -41.920 88.494  20.006 1.00 40.60 ? 483  ASN A CB  1 
ATOM   3798 C  CG  . ASN A 1 483 ? -41.679 89.902  19.537 1.00 39.57 ? 483  ASN A CG  1 
ATOM   3799 O  OD1 . ASN A 1 483 ? -42.416 90.821  19.895 1.00 37.74 ? 483  ASN A OD1 1 
ATOM   3800 N  ND2 . ASN A 1 483 ? -40.646 90.083  18.725 1.00 38.31 ? 483  ASN A ND2 1 
ATOM   3801 N  N   . GLU A 1 484 ? -43.669 86.888  21.993 1.00 48.16 ? 484  GLU A N   1 
ATOM   3802 C  CA  . GLU A 1 484 ? -44.332 85.634  22.327 1.00 50.91 ? 484  GLU A CA  1 
ATOM   3803 C  C   . GLU A 1 484 ? -44.221 84.698  21.113 1.00 53.32 ? 484  GLU A C   1 
ATOM   3804 O  O   . GLU A 1 484 ? -44.054 85.151  19.976 1.00 52.80 ? 484  GLU A O   1 
ATOM   3805 C  CB  . GLU A 1 484 ? -45.810 85.880  22.673 1.00 51.14 ? 484  GLU A CB  1 
ATOM   3806 C  CG  . GLU A 1 484 ? -46.077 86.623  24.004 1.00 52.95 ? 484  GLU A CG  1 
ATOM   3807 C  CD  . GLU A 1 484 ? -45.610 85.854  25.247 1.00 53.57 ? 484  GLU A CD  1 
ATOM   3808 O  OE1 . GLU A 1 484 ? -45.985 86.244  26.379 1.00 50.53 ? 484  GLU A OE1 1 
ATOM   3809 O  OE2 . GLU A 1 484 ? -44.860 84.865  25.095 1.00 54.70 ? 484  GLU A OE2 1 
ATOM   3810 N  N   . PRO A 1 485 ? -44.311 83.377  21.339 1.00 55.50 ? 485  PRO A N   1 
ATOM   3811 C  CA  . PRO A 1 485 ? -44.213 82.399  20.251 1.00 56.74 ? 485  PRO A CA  1 
ATOM   3812 C  C   . PRO A 1 485 ? -45.247 82.582  19.147 1.00 58.38 ? 485  PRO A C   1 
ATOM   3813 O  O   . PRO A 1 485 ? -44.989 82.261  17.989 1.00 58.97 ? 485  PRO A O   1 
ATOM   3814 C  CB  . PRO A 1 485 ? -44.375 81.066  20.973 1.00 56.10 ? 485  PRO A CB  1 
ATOM   3815 C  CG  . PRO A 1 485 ? -45.282 81.420  22.113 1.00 55.81 ? 485  PRO A CG  1 
ATOM   3816 C  CD  . PRO A 1 485 ? -44.672 82.710  22.603 1.00 55.74 ? 485  PRO A CD  1 
ATOM   3817 N  N   . HIS A 1 486 ? -46.416 83.094  19.507 1.00 60.30 ? 486  HIS A N   1 
ATOM   3818 C  CA  . HIS A 1 486 ? -47.476 83.302  18.534 1.00 62.96 ? 486  HIS A CA  1 
ATOM   3819 C  C   . HIS A 1 486 ? -48.678 84.001  19.143 1.00 63.94 ? 486  HIS A C   1 
ATOM   3820 O  O   . HIS A 1 486 ? -49.782 83.456  19.169 1.00 64.73 ? 486  HIS A O   1 
ATOM   3821 C  CB  . HIS A 1 486 ? -47.919 81.962  17.936 1.00 65.10 ? 486  HIS A CB  1 
ATOM   3822 C  CG  . HIS A 1 486 ? -47.957 80.836  18.927 1.00 67.18 ? 486  HIS A CG  1 
ATOM   3823 N  ND1 . HIS A 1 486 ? -48.490 80.969  20.191 1.00 67.74 ? 486  HIS A ND1 1 
ATOM   3824 C  CD2 . HIS A 1 486 ? -47.539 79.551  18.831 1.00 67.77 ? 486  HIS A CD2 1 
ATOM   3825 C  CE1 . HIS A 1 486 ? -48.400 79.816  20.831 1.00 67.36 ? 486  HIS A CE1 1 
ATOM   3826 N  NE2 . HIS A 1 486 ? -47.827 78.939  20.027 1.00 68.08 ? 486  HIS A NE2 1 
ATOM   3827 N  N   . SER A 1 487 ? -48.461 85.209  19.643 1.00 64.59 ? 487  SER A N   1 
ATOM   3828 C  CA  . SER A 1 487 ? -49.545 85.971  20.233 1.00 64.59 ? 487  SER A CA  1 
ATOM   3829 C  C   . SER A 1 487 ? -49.965 87.037  19.225 1.00 65.68 ? 487  SER A C   1 
ATOM   3830 O  O   . SER A 1 487 ? -49.298 87.241  18.210 1.00 65.15 ? 487  SER A O   1 
ATOM   3831 C  CB  . SER A 1 487 ? -49.087 86.621  21.540 1.00 63.93 ? 487  SER A CB  1 
ATOM   3832 O  OG  . SER A 1 487 ? -50.191 87.078  22.299 1.00 63.22 ? 487  SER A OG  1 
ATOM   3833 N  N   . GLN A 1 488 ? -51.082 87.700  19.498 1.00 67.58 ? 488  GLN A N   1 
ATOM   3834 C  CA  . GLN A 1 488 ? -51.586 88.745  18.617 1.00 69.28 ? 488  GLN A CA  1 
ATOM   3835 C  C   . GLN A 1 488 ? -50.962 90.075  19.005 1.00 69.09 ? 488  GLN A C   1 
ATOM   3836 O  O   . GLN A 1 488 ? -51.086 91.067  18.280 1.00 69.16 ? 488  GLN A O   1 
ATOM   3837 C  CB  . GLN A 1 488 ? -53.108 88.832  18.726 1.00 72.15 ? 488  GLN A CB  1 
ATOM   3838 C  CG  . GLN A 1 488 ? -53.839 87.647  18.107 1.00 76.17 ? 488  GLN A CG  1 
ATOM   3839 C  CD  . GLN A 1 488 ? -55.138 87.323  18.824 1.00 77.83 ? 488  GLN A CD  1 
ATOM   3840 O  OE1 . GLN A 1 488 ? -55.957 88.210  19.083 1.00 79.30 ? 488  GLN A OE1 1 
ATOM   3841 N  NE2 . GLN A 1 488 ? -55.335 86.045  19.147 1.00 78.11 ? 488  GLN A NE2 1 
ATOM   3842 N  N   . GLU A 1 489 ? -50.293 90.084  20.158 1.00 68.16 ? 489  GLU A N   1 
ATOM   3843 C  CA  . GLU A 1 489 ? -49.630 91.282  20.661 1.00 66.28 ? 489  GLU A CA  1 
ATOM   3844 C  C   . GLU A 1 489 ? -48.672 91.758  19.572 1.00 63.95 ? 489  GLU A C   1 
ATOM   3845 O  O   . GLU A 1 489 ? -48.158 90.955  18.789 1.00 63.30 ? 489  GLU A O   1 
ATOM   3846 C  CB  . GLU A 1 489 ? -48.852 90.962  21.950 1.00 67.57 ? 489  GLU A CB  1 
ATOM   3847 C  CG  . GLU A 1 489 ? -49.675 90.241  23.029 1.00 70.72 ? 489  GLU A CG  1 
ATOM   3848 C  CD  . GLU A 1 489 ? -48.867 89.882  24.285 1.00 72.37 ? 489  GLU A CD  1 
ATOM   3849 O  OE1 . GLU A 1 489 ? -47.821 89.209  24.162 1.00 73.77 ? 489  GLU A OE1 1 
ATOM   3850 O  OE2 . GLU A 1 489 ? -49.286 90.265  25.400 1.00 72.33 ? 489  GLU A OE2 1 
ATOM   3851 N  N   . SER A 1 490 ? -48.447 93.064  19.505 1.00 60.91 ? 490  SER A N   1 
ATOM   3852 C  CA  . SER A 1 490 ? -47.542 93.597  18.505 1.00 57.29 ? 490  SER A CA  1 
ATOM   3853 C  C   . SER A 1 490 ? -46.132 93.102  18.796 1.00 55.58 ? 490  SER A C   1 
ATOM   3854 O  O   . SER A 1 490 ? -45.694 93.066  19.950 1.00 55.38 ? 490  SER A O   1 
ATOM   3855 C  CB  . SER A 1 490 ? -47.588 95.119  18.520 1.00 57.21 ? 490  SER A CB  1 
ATOM   3856 O  OG  . SER A 1 490 ? -48.897 95.566  18.224 1.00 57.36 ? 490  SER A OG  1 
ATOM   3857 N  N   . LYS A 1 491 ? -45.429 92.711  17.742 1.00 52.80 ? 491  LYS A N   1 
ATOM   3858 C  CA  . LYS A 1 491 ? -44.071 92.208  17.875 1.00 50.23 ? 491  LYS A CA  1 
ATOM   3859 C  C   . LYS A 1 491 ? -42.997 93.302  17.963 1.00 48.15 ? 491  LYS A C   1 
ATOM   3860 O  O   . LYS A 1 491 ? -43.162 94.416  17.451 1.00 47.34 ? 491  LYS A O   1 
ATOM   3861 C  CB  . LYS A 1 491 ? -43.758 91.277  16.700 1.00 51.06 ? 491  LYS A CB  1 
ATOM   3862 C  CG  . LYS A 1 491 ? -44.443 89.917  16.778 1.00 52.51 ? 491  LYS A CG  1 
ATOM   3863 C  CD  . LYS A 1 491 ? -44.384 89.178  15.443 1.00 53.38 ? 491  LYS A CD  1 
ATOM   3864 C  CE  . LYS A 1 491 ? -42.957 89.026  14.923 1.00 54.45 ? 491  LYS A CE  1 
ATOM   3865 N  NZ  . LYS A 1 491 ? -42.126 88.123  15.755 1.00 52.87 ? 491  LYS A NZ  1 
ATOM   3866 N  N   . TRP A 1 492 ? -41.902 92.969  18.637 1.00 43.97 ? 492  TRP A N   1 
ATOM   3867 C  CA  . TRP A 1 492 ? -40.770 93.871  18.784 1.00 39.72 ? 492  TRP A CA  1 
ATOM   3868 C  C   . TRP A 1 492 ? -39.887 93.477  17.616 1.00 36.78 ? 492  TRP A C   1 
ATOM   3869 O  O   . TRP A 1 492 ? -39.231 92.441  17.648 1.00 35.67 ? 492  TRP A O   1 
ATOM   3870 C  CB  . TRP A 1 492 ? -40.053 93.596  20.107 1.00 40.03 ? 492  TRP A CB  1 
ATOM   3871 C  CG  . TRP A 1 492 ? -38.785 94.376  20.367 1.00 40.22 ? 492  TRP A CG  1 
ATOM   3872 C  CD1 . TRP A 1 492 ? -37.914 94.892  19.442 1.00 40.10 ? 492  TRP A CD1 1 
ATOM   3873 C  CD2 . TRP A 1 492 ? -38.197 94.626  21.646 1.00 40.23 ? 492  TRP A CD2 1 
ATOM   3874 N  NE1 . TRP A 1 492 ? -36.821 95.439  20.068 1.00 38.46 ? 492  TRP A NE1 1 
ATOM   3875 C  CE2 . TRP A 1 492 ? -36.969 95.290  21.422 1.00 40.31 ? 492  TRP A CE2 1 
ATOM   3876 C  CE3 . TRP A 1 492 ? -38.586 94.348  22.965 1.00 39.88 ? 492  TRP A CE3 1 
ATOM   3877 C  CZ2 . TRP A 1 492 ? -36.129 95.681  22.473 1.00 40.06 ? 492  TRP A CZ2 1 
ATOM   3878 C  CZ3 . TRP A 1 492 ? -37.749 94.737  24.009 1.00 38.91 ? 492  TRP A CZ3 1 
ATOM   3879 C  CH2 . TRP A 1 492 ? -36.535 95.395  23.755 1.00 38.82 ? 492  TRP A CH2 1 
ATOM   3880 N  N   . PRO A 1 493 ? -39.864 94.299  16.565 1.00 34.94 ? 493  PRO A N   1 
ATOM   3881 C  CA  . PRO A 1 493 ? -39.058 94.027  15.375 1.00 34.79 ? 493  PRO A CA  1 
ATOM   3882 C  C   . PRO A 1 493 ? -37.636 93.593  15.709 1.00 34.33 ? 493  PRO A C   1 
ATOM   3883 O  O   . PRO A 1 493 ? -37.149 93.825  16.806 1.00 36.33 ? 493  PRO A O   1 
ATOM   3884 C  CB  . PRO A 1 493 ? -39.089 95.358  14.631 1.00 35.51 ? 493  PRO A CB  1 
ATOM   3885 C  CG  . PRO A 1 493 ? -40.404 95.942  15.032 1.00 35.79 ? 493  PRO A CG  1 
ATOM   3886 C  CD  . PRO A 1 493 ? -40.442 95.650  16.505 1.00 34.77 ? 493  PRO A CD  1 
ATOM   3887 N  N   . LEU A 1 494 ? -36.974 92.950  14.762 1.00 33.21 ? 494  LEU A N   1 
ATOM   3888 C  CA  . LEU A 1 494 ? -35.608 92.518  14.978 1.00 32.02 ? 494  LEU A CA  1 
ATOM   3889 C  C   . LEU A 1 494 ? -34.789 93.648  14.383 1.00 32.89 ? 494  LEU A C   1 
ATOM   3890 O  O   . LEU A 1 494 ? -35.134 94.164  13.325 1.00 33.85 ? 494  LEU A O   1 
ATOM   3891 C  CB  . LEU A 1 494 ? -35.366 91.204  14.234 1.00 30.56 ? 494  LEU A CB  1 
ATOM   3892 C  CG  . LEU A 1 494 ? -34.073 90.421  14.452 1.00 30.40 ? 494  LEU A CG  1 
ATOM   3893 C  CD1 . LEU A 1 494 ? -33.793 90.208  15.925 1.00 28.98 ? 494  LEU A CD1 1 
ATOM   3894 C  CD2 . LEU A 1 494 ? -34.208 89.095  13.751 1.00 29.77 ? 494  LEU A CD2 1 
ATOM   3895 N  N   . PHE A 1 495 ? -33.731 94.069  15.065 1.00 34.34 ? 495  PHE A N   1 
ATOM   3896 C  CA  . PHE A 1 495 ? -32.904 95.153  14.538 1.00 35.54 ? 495  PHE A CA  1 
ATOM   3897 C  C   . PHE A 1 495 ? -32.019 94.638  13.409 1.00 36.85 ? 495  PHE A C   1 
ATOM   3898 O  O   . PHE A 1 495 ? -31.336 93.616  13.552 1.00 38.03 ? 495  PHE A O   1 
ATOM   3899 C  CB  . PHE A 1 495 ? -32.040 95.767  15.647 1.00 34.19 ? 495  PHE A CB  1 
ATOM   3900 C  CG  . PHE A 1 495 ? -31.122 96.869  15.173 1.00 34.38 ? 495  PHE A CG  1 
ATOM   3901 C  CD1 . PHE A 1 495 ? -29.835 96.579  14.713 1.00 33.85 ? 495  PHE A CD1 1 
ATOM   3902 C  CD2 . PHE A 1 495 ? -31.539 98.203  15.193 1.00 34.17 ? 495  PHE A CD2 1 
ATOM   3903 C  CE1 . PHE A 1 495 ? -28.978 97.602  14.284 1.00 32.21 ? 495  PHE A CE1 1 
ATOM   3904 C  CE2 . PHE A 1 495 ? -30.690 99.231  14.767 1.00 31.90 ? 495  PHE A CE2 1 
ATOM   3905 C  CZ  . PHE A 1 495 ? -29.408 98.928  14.313 1.00 31.54 ? 495  PHE A CZ  1 
ATOM   3906 N  N   . THR A 1 496 ? -32.041 95.345  12.283 1.00 37.02 ? 496  THR A N   1 
ATOM   3907 C  CA  . THR A 1 496 ? -31.241 94.951  11.137 1.00 37.11 ? 496  THR A CA  1 
ATOM   3908 C  C   . THR A 1 496 ? -30.474 96.110  10.526 1.00 36.89 ? 496  THR A C   1 
ATOM   3909 O  O   . THR A 1 496 ? -30.945 97.243  10.503 1.00 35.08 ? 496  THR A O   1 
ATOM   3910 C  CB  . THR A 1 496 ? -32.118 94.284  10.055 1.00 37.57 ? 496  THR A CB  1 
ATOM   3911 O  OG1 . THR A 1 496 ? -33.107 95.206  9.579  1.00 36.11 ? 496  THR A OG1 1 
ATOM   3912 C  CG2 . THR A 1 496 ? -32.808 93.063  10.637 1.00 37.36 ? 496  THR A CG2 1 
ATOM   3913 N  N   . THR A 1 497 ? -29.280 95.800  10.036 1.00 38.30 ? 497  THR A N   1 
ATOM   3914 C  CA  . THR A 1 497 ? -28.395 96.777  9.417  1.00 40.21 ? 497  THR A CA  1 
ATOM   3915 C  C   . THR A 1 497 ? -29.102 97.638  8.370  1.00 41.91 ? 497  THR A C   1 
ATOM   3916 O  O   . THR A 1 497 ? -28.753 98.804  8.172  1.00 40.60 ? 497  THR A O   1 
ATOM   3917 C  CB  . THR A 1 497 ? -27.218 96.063  8.729  1.00 40.34 ? 497  THR A CB  1 
ATOM   3918 O  OG1 . THR A 1 497 ? -26.524 95.254  9.684  1.00 42.08 ? 497  THR A OG1 1 
ATOM   3919 C  CG2 . THR A 1 497 ? -26.255 97.068  8.130  1.00 41.29 ? 497  THR A CG2 1 
ATOM   3920 N  N   . LYS A 1 498 ? -30.100 97.062  7.707  1.00 43.73 ? 498  LYS A N   1 
ATOM   3921 C  CA  . LYS A 1 498 ? -30.814 97.770  6.651  1.00 45.47 ? 498  LYS A CA  1 
ATOM   3922 C  C   . LYS A 1 498 ? -31.936 98.685  7.108  1.00 46.10 ? 498  LYS A C   1 
ATOM   3923 O  O   . LYS A 1 498 ? -32.010 99.837  6.676  1.00 46.07 ? 498  LYS A O   1 
ATOM   3924 C  CB  . LYS A 1 498 ? -31.362 96.766  5.638  1.00 47.17 ? 498  LYS A CB  1 
ATOM   3925 C  CG  . LYS A 1 498 ? -31.694 97.376  4.292  1.00 49.49 ? 498  LYS A CG  1 
ATOM   3926 C  CD  . LYS A 1 498 ? -31.791 96.300  3.229  1.00 52.91 ? 498  LYS A CD  1 
ATOM   3927 C  CE  . LYS A 1 498 ? -31.629 96.879  1.830  1.00 55.20 ? 498  LYS A CE  1 
ATOM   3928 N  NZ  . LYS A 1 498 ? -31.571 95.803  0.793  1.00 57.21 ? 498  LYS A NZ  1 
ATOM   3929 N  N   . GLU A 1 499 ? -32.805 98.180  7.980  1.00 46.73 ? 499  GLU A N   1 
ATOM   3930 C  CA  . GLU A 1 499 ? -33.937 98.958  8.473  1.00 47.83 ? 499  GLU A CA  1 
ATOM   3931 C  C   . GLU A 1 499 ? -33.707 99.616  9.833  1.00 46.82 ? 499  GLU A C   1 
ATOM   3932 O  O   . GLU A 1 499 ? -34.348 100.615 10.159 1.00 45.77 ? 499  GLU A O   1 
ATOM   3933 C  CB  . GLU A 1 499 ? -35.174 98.066  8.527  1.00 51.09 ? 499  GLU A CB  1 
ATOM   3934 C  CG  . GLU A 1 499 ? -35.585 97.523  7.170  1.00 55.71 ? 499  GLU A CG  1 
ATOM   3935 C  CD  . GLU A 1 499 ? -36.001 96.065  7.238  1.00 59.62 ? 499  GLU A CD  1 
ATOM   3936 O  OE1 . GLU A 1 499 ? -35.119 95.198  7.463  1.00 60.57 ? 499  GLU A OE1 1 
ATOM   3937 O  OE2 . GLU A 1 499 ? -37.211 95.791  7.072  1.00 61.01 ? 499  GLU A OE2 1 
ATOM   3938 N  N   . GLN A 1 500 ? -32.794 99.051  10.619 1.00 46.51 ? 500  GLN A N   1 
ATOM   3939 C  CA  . GLN A 1 500 ? -32.455 99.576  11.943 1.00 45.95 ? 500  GLN A CA  1 
ATOM   3940 C  C   . GLN A 1 500 ? -33.678 99.962  12.752 1.00 45.23 ? 500  GLN A C   1 
ATOM   3941 O  O   . GLN A 1 500 ? -33.804 101.106 13.205 1.00 45.03 ? 500  GLN A O   1 
ATOM   3942 C  CB  . GLN A 1 500 ? -31.560 100.803 11.819 1.00 46.32 ? 500  GLN A CB  1 
ATOM   3943 C  CG  . GLN A 1 500 ? -30.557 100.720 10.706 1.00 48.13 ? 500  GLN A CG  1 
ATOM   3944 C  CD  . GLN A 1 500 ? -29.547 101.825 10.787 1.00 50.28 ? 500  GLN A CD  1 
ATOM   3945 O  OE1 . GLN A 1 500 ? -28.895 102.158 9.797  1.00 52.79 ? 500  GLN A OE1 1 
ATOM   3946 N  NE2 . GLN A 1 500 ? -29.395 102.401 11.980 1.00 51.25 ? 500  GLN A NE2 1 
ATOM   3947 N  N   . LYS A 1 501 ? -34.579 99.008  12.937 1.00 43.01 ? 501  LYS A N   1 
ATOM   3948 C  CA  . LYS A 1 501 ? -35.783 99.272  13.694 1.00 41.31 ? 501  LYS A CA  1 
ATOM   3949 C  C   . LYS A 1 501 ? -35.528 99.133  15.192 1.00 39.94 ? 501  LYS A C   1 
ATOM   3950 O  O   . LYS A 1 501 ? -34.617 98.415  15.614 1.00 39.32 ? 501  LYS A O   1 
ATOM   3951 C  CB  . LYS A 1 501 ? -36.878 98.289  13.287 1.00 41.54 ? 501  LYS A CB  1 
ATOM   3952 C  CG  . LYS A 1 501 ? -37.287 98.320  11.830 1.00 41.48 ? 501  LYS A CG  1 
ATOM   3953 C  CD  . LYS A 1 501 ? -38.356 97.264  11.611 1.00 42.20 ? 501  LYS A CD  1 
ATOM   3954 C  CE  . LYS A 1 501 ? -38.944 97.292  10.217 1.00 43.05 ? 501  LYS A CE  1 
ATOM   3955 N  NZ  . LYS A 1 501 ? -39.975 96.220  10.096 1.00 44.46 ? 501  LYS A NZ  1 
ATOM   3956 N  N   . PHE A 1 502 ? -36.336 99.838  15.983 1.00 37.91 ? 502  PHE A N   1 
ATOM   3957 C  CA  . PHE A 1 502 ? -36.279 99.774  17.443 1.00 35.91 ? 502  PHE A CA  1 
ATOM   3958 C  C   . PHE A 1 502 ? -37.634 100.202 17.959 1.00 36.80 ? 502  PHE A C   1 
ATOM   3959 O  O   . PHE A 1 502 ? -38.407 100.833 17.244 1.00 38.22 ? 502  PHE A O   1 
ATOM   3960 C  CB  . PHE A 1 502 ? -35.209 100.693 18.026 1.00 32.73 ? 502  PHE A CB  1 
ATOM   3961 C  CG  . PHE A 1 502 ? -35.510 102.158 17.886 1.00 29.93 ? 502  PHE A CG  1 
ATOM   3962 C  CD1 . PHE A 1 502 ? -35.277 102.820 16.684 1.00 29.17 ? 502  PHE A CD1 1 
ATOM   3963 C  CD2 . PHE A 1 502 ? -35.992 102.887 18.968 1.00 29.32 ? 502  PHE A CD2 1 
ATOM   3964 C  CE1 . PHE A 1 502 ? -35.513 104.180 16.565 1.00 25.87 ? 502  PHE A CE1 1 
ATOM   3965 C  CE2 . PHE A 1 502 ? -36.232 104.249 18.856 1.00 27.37 ? 502  PHE A CE2 1 
ATOM   3966 C  CZ  . PHE A 1 502 ? -35.990 104.894 17.652 1.00 26.75 ? 502  PHE A CZ  1 
ATOM   3967 N  N   . ILE A 1 503 ? -37.939 99.845  19.194 1.00 38.09 ? 503  ILE A N   1 
ATOM   3968 C  CA  . ILE A 1 503 ? -39.220 100.222 19.769 1.00 39.90 ? 503  ILE A CA  1 
ATOM   3969 C  C   . ILE A 1 503 ? -38.932 101.099 20.974 1.00 43.23 ? 503  ILE A C   1 
ATOM   3970 O  O   . ILE A 1 503 ? -37.789 101.175 21.435 1.00 44.52 ? 503  ILE A O   1 
ATOM   3971 C  CB  . ILE A 1 503 ? -40.032 98.983  20.250 1.00 37.38 ? 503  ILE A CB  1 
ATOM   3972 C  CG1 . ILE A 1 503 ? -39.341 98.338  21.450 1.00 34.96 ? 503  ILE A CG1 1 
ATOM   3973 C  CG2 . ILE A 1 503 ? -40.147 97.964  19.142 1.00 35.23 ? 503  ILE A CG2 1 
ATOM   3974 C  CD1 . ILE A 1 503 ? -40.142 97.265  22.097 1.00 34.26 ? 503  ILE A CD1 1 
ATOM   3975 N  N   . ASP A 1 504 ? -39.960 101.773 21.474 1.00 45.67 ? 504  ASP A N   1 
ATOM   3976 C  CA  . ASP A 1 504 ? -39.800 102.599 22.656 1.00 48.09 ? 504  ASP A CA  1 
ATOM   3977 C  C   . ASP A 1 504 ? -40.556 101.897 23.784 1.00 48.49 ? 504  ASP A C   1 
ATOM   3978 O  O   . ASP A 1 504 ? -41.567 101.234 23.551 1.00 48.28 ? 504  ASP A O   1 
ATOM   3979 C  CB  . ASP A 1 504 ? -40.325 104.028 22.411 1.00 51.17 ? 504  ASP A CB  1 
ATOM   3980 C  CG  . ASP A 1 504 ? -41.762 104.067 21.896 1.00 55.73 ? 504  ASP A CG  1 
ATOM   3981 O  OD1 . ASP A 1 504 ? -42.232 105.173 21.533 1.00 57.30 ? 504  ASP A OD1 1 
ATOM   3982 O  OD2 . ASP A 1 504 ? -42.427 103.007 21.855 1.00 59.40 ? 504  ASP A OD2 1 
ATOM   3983 N  N   . LEU A 1 505 ? -40.038 102.000 25.000 1.00 48.81 ? 505  LEU A N   1 
ATOM   3984 C  CA  . LEU A 1 505 ? -40.684 101.368 26.134 1.00 49.67 ? 505  LEU A CA  1 
ATOM   3985 C  C   . LEU A 1 505 ? -41.338 102.397 27.034 1.00 50.97 ? 505  LEU A C   1 
ATOM   3986 O  O   . LEU A 1 505 ? -40.659 103.185 27.695 1.00 50.68 ? 505  LEU A O   1 
ATOM   3987 C  CB  . LEU A 1 505 ? -39.672 100.552 26.929 1.00 50.27 ? 505  LEU A CB  1 
ATOM   3988 C  CG  . LEU A 1 505 ? -39.246 99.261  26.237 1.00 51.11 ? 505  LEU A CG  1 
ATOM   3989 C  CD1 . LEU A 1 505 ? -38.103 98.605  26.998 1.00 50.74 ? 505  LEU A CD1 1 
ATOM   3990 C  CD2 . LEU A 1 505 ? -40.450 98.337  26.151 1.00 50.51 ? 505  LEU A CD2 1 
ATOM   3991 N  N   . ASN A 1 506 ? -42.666 102.386 27.038 1.00 52.35 ? 506  ASN A N   1 
ATOM   3992 C  CA  . ASN A 1 506 ? -43.457 103.294 27.858 1.00 53.84 ? 506  ASN A CA  1 
ATOM   3993 C  C   . ASN A 1 506 ? -44.827 102.669 28.101 1.00 54.65 ? 506  ASN A C   1 
ATOM   3994 O  O   . ASN A 1 506 ? -45.020 101.474 27.884 1.00 55.23 ? 506  ASN A O   1 
ATOM   3995 C  CB  . ASN A 1 506 ? -43.611 104.649 27.161 1.00 53.95 ? 506  ASN A CB  1 
ATOM   3996 C  CG  . ASN A 1 506 ? -44.239 104.533 25.787 1.00 55.03 ? 506  ASN A CG  1 
ATOM   3997 O  OD1 . ASN A 1 506 ? -45.335 103.988 25.635 1.00 55.83 ? 506  ASN A OD1 1 
ATOM   3998 N  ND2 . ASN A 1 506 ? -43.547 105.052 24.776 1.00 54.91 ? 506  ASN A ND2 1 
ATOM   3999 N  N   . THR A 1 507 ? -45.778 103.478 28.547 1.00 55.27 ? 507  THR A N   1 
ATOM   4000 C  CA  . THR A 1 507 ? -47.120 102.986 28.815 1.00 55.80 ? 507  THR A CA  1 
ATOM   4001 C  C   . THR A 1 507 ? -47.958 102.788 27.553 1.00 56.77 ? 507  THR A C   1 
ATOM   4002 O  O   . THR A 1 507 ? -48.626 101.769 27.400 1.00 57.79 ? 507  THR A O   1 
ATOM   4003 C  CB  . THR A 1 507 ? -47.854 103.934 29.765 1.00 54.95 ? 507  THR A CB  1 
ATOM   4004 O  OG1 . THR A 1 507 ? -47.564 105.288 29.400 1.00 53.09 ? 507  THR A OG1 1 
ATOM   4005 C  CG2 . THR A 1 507 ? -47.414 103.686 31.197 1.00 54.94 ? 507  THR A CG2 1 
ATOM   4006 N  N   . GLU A 1 508 ? -47.914 103.759 26.651 1.00 57.36 ? 508  GLU A N   1 
ATOM   4007 C  CA  . GLU A 1 508 ? -48.672 103.693 25.405 1.00 58.67 ? 508  GLU A CA  1 
ATOM   4008 C  C   . GLU A 1 508 ? -48.423 102.406 24.615 1.00 58.63 ? 508  GLU A C   1 
ATOM   4009 O  O   . GLU A 1 508 ? -47.538 101.620 24.952 1.00 58.67 ? 508  GLU A O   1 
ATOM   4010 C  CB  . GLU A 1 508 ? -48.307 104.879 24.520 1.00 59.94 ? 508  GLU A CB  1 
ATOM   4011 C  CG  . GLU A 1 508 ? -48.509 106.223 25.159 1.00 62.81 ? 508  GLU A CG  1 
ATOM   4012 C  CD  . GLU A 1 508 ? -48.071 107.346 24.241 1.00 65.71 ? 508  GLU A CD  1 
ATOM   4013 O  OE1 . GLU A 1 508 ? -48.151 108.523 24.661 1.00 67.37 ? 508  GLU A OE1 1 
ATOM   4014 O  OE2 . GLU A 1 508 ? -47.647 107.047 23.097 1.00 65.69 ? 508  GLU A OE2 1 
ATOM   4015 N  N   . PRO A 1 509 ? -49.208 102.178 23.545 1.00 58.25 ? 509  PRO A N   1 
ATOM   4016 C  CA  . PRO A 1 509 ? -49.044 100.980 22.719 1.00 57.90 ? 509  PRO A CA  1 
ATOM   4017 C  C   . PRO A 1 509 ? -47.729 101.084 21.942 1.00 57.65 ? 509  PRO A C   1 
ATOM   4018 O  O   . PRO A 1 509 ? -47.343 102.172 21.519 1.00 58.82 ? 509  PRO A O   1 
ATOM   4019 C  CB  . PRO A 1 509 ? -50.283 101.014 21.828 1.00 57.18 ? 509  PRO A CB  1 
ATOM   4020 C  CG  . PRO A 1 509 ? -50.522 102.484 21.659 1.00 56.70 ? 509  PRO A CG  1 
ATOM   4021 C  CD  . PRO A 1 509 ? -50.325 103.005 23.055 1.00 57.65 ? 509  PRO A CD  1 
ATOM   4022 N  N   . MET A 1 510 ? -47.039 99.962  21.767 1.00 56.69 ? 510  MET A N   1 
ATOM   4023 C  CA  . MET A 1 510 ? -45.757 99.958  21.067 1.00 56.58 ? 510  MET A CA  1 
ATOM   4024 C  C   . MET A 1 510 ? -45.738 100.679 19.717 1.00 56.24 ? 510  MET A C   1 
ATOM   4025 O  O   . MET A 1 510 ? -46.705 100.636 18.960 1.00 56.18 ? 510  MET A O   1 
ATOM   4026 C  CB  . MET A 1 510 ? -45.277 98.521  20.856 1.00 56.45 ? 510  MET A CB  1 
ATOM   4027 C  CG  . MET A 1 510 ? -43.951 98.420  20.117 1.00 56.59 ? 510  MET A CG  1 
ATOM   4028 S  SD  . MET A 1 510 ? -43.611 96.759  19.524 1.00 58.94 ? 510  MET A SD  1 
ATOM   4029 C  CE  . MET A 1 510 ? -43.359 95.882  21.083 1.00 58.83 ? 510  MET A CE  1 
ATOM   4030 N  N   . LYS A 1 511 ? -44.623 101.344 19.432 1.00 56.20 ? 511  LYS A N   1 
ATOM   4031 C  CA  . LYS A 1 511 ? -44.423 102.048 18.166 1.00 56.62 ? 511  LYS A CA  1 
ATOM   4032 C  C   . LYS A 1 511 ? -43.049 101.651 17.640 1.00 54.99 ? 511  LYS A C   1 
ATOM   4033 O  O   . LYS A 1 511 ? -42.084 101.581 18.405 1.00 55.23 ? 511  LYS A O   1 
ATOM   4034 C  CB  . LYS A 1 511 ? -44.463 103.572 18.353 1.00 59.03 ? 511  LYS A CB  1 
ATOM   4035 C  CG  . LYS A 1 511 ? -45.853 104.170 18.524 1.00 61.82 ? 511  LYS A CG  1 
ATOM   4036 C  CD  . LYS A 1 511 ? -45.807 105.696 18.479 1.00 63.10 ? 511  LYS A CD  1 
ATOM   4037 C  CE  . LYS A 1 511 ? -47.185 106.308 18.728 1.00 64.18 ? 511  LYS A CE  1 
ATOM   4038 N  NZ  . LYS A 1 511 ? -47.734 105.935 20.070 1.00 63.70 ? 511  LYS A NZ  1 
ATOM   4039 N  N   . VAL A 1 512 ? -42.958 101.382 16.342 1.00 51.89 ? 512  VAL A N   1 
ATOM   4040 C  CA  . VAL A 1 512 ? -41.686 101.004 15.747 1.00 49.14 ? 512  VAL A CA  1 
ATOM   4041 C  C   . VAL A 1 512 ? -41.050 102.220 15.088 1.00 49.44 ? 512  VAL A C   1 
ATOM   4042 O  O   . VAL A 1 512 ? -41.656 102.865 14.238 1.00 50.64 ? 512  VAL A O   1 
ATOM   4043 C  CB  . VAL A 1 512 ? -41.866 99.901  14.690 1.00 46.82 ? 512  VAL A CB  1 
ATOM   4044 C  CG1 . VAL A 1 512 ? -40.523 99.513  14.116 1.00 43.43 ? 512  VAL A CG1 1 
ATOM   4045 C  CG2 . VAL A 1 512 ? -42.537 98.697  15.312 1.00 45.53 ? 512  VAL A CG2 1 
ATOM   4046 N  N   . HIS A 1 513 ? -39.829 102.542 15.491 1.00 48.31 ? 513  HIS A N   1 
ATOM   4047 C  CA  . HIS A 1 513 ? -39.133 103.677 14.915 1.00 47.79 ? 513  HIS A CA  1 
ATOM   4048 C  C   . HIS A 1 513 ? -37.906 103.179 14.186 1.00 47.79 ? 513  HIS A C   1 
ATOM   4049 O  O   . HIS A 1 513 ? -37.536 102.012 14.312 1.00 48.12 ? 513  HIS A O   1 
ATOM   4050 C  CB  . HIS A 1 513 ? -38.721 104.651 16.009 1.00 48.40 ? 513  HIS A CB  1 
ATOM   4051 C  CG  . HIS A 1 513 ? -39.871 105.342 16.663 1.00 49.97 ? 513  HIS A CG  1 
ATOM   4052 N  ND1 . HIS A 1 513 ? -40.607 106.318 16.029 1.00 50.97 ? 513  HIS A ND1 1 
ATOM   4053 C  CD2 . HIS A 1 513 ? -40.433 105.177 17.883 1.00 51.82 ? 513  HIS A CD2 1 
ATOM   4054 C  CE1 . HIS A 1 513 ? -41.575 106.725 16.832 1.00 53.06 ? 513  HIS A CE1 1 
ATOM   4055 N  NE2 . HIS A 1 513 ? -41.492 106.048 17.964 1.00 52.30 ? 513  HIS A NE2 1 
ATOM   4056 N  N   . GLN A 1 514 ? -37.276 104.064 13.421 1.00 47.58 ? 514  GLN A N   1 
ATOM   4057 C  CA  . GLN A 1 514 ? -36.077 103.699 12.679 1.00 46.96 ? 514  GLN A CA  1 
ATOM   4058 C  C   . GLN A 1 514 ? -34.921 104.679 12.852 1.00 45.41 ? 514  GLN A C   1 
ATOM   4059 O  O   . GLN A 1 514 ? -35.127 105.881 12.996 1.00 44.48 ? 514  GLN A O   1 
ATOM   4060 C  CB  . GLN A 1 514 ? -36.397 103.574 11.188 1.00 48.72 ? 514  GLN A CB  1 
ATOM   4061 C  CG  . GLN A 1 514 ? -37.016 102.252 10.783 1.00 51.84 ? 514  GLN A CG  1 
ATOM   4062 C  CD  . GLN A 1 514 ? -37.153 102.111 9.273  1.00 54.19 ? 514  GLN A CD  1 
ATOM   4063 O  OE1 . GLN A 1 514 ? -37.911 102.846 8.632  1.00 55.06 ? 514  GLN A OE1 1 
ATOM   4064 N  NE2 . GLN A 1 514 ? -36.412 101.165 8.695  1.00 54.01 ? 514  GLN A NE2 1 
ATOM   4065 N  N   . ARG A 1 515 ? -33.704 104.141 12.841 1.00 44.62 ? 515  ARG A N   1 
ATOM   4066 C  CA  . ARG A 1 515 ? -32.480 104.934 12.945 1.00 43.02 ? 515  ARG A CA  1 
ATOM   4067 C  C   . ARG A 1 515 ? -32.397 105.881 14.150 1.00 40.66 ? 515  ARG A C   1 
ATOM   4068 O  O   . ARG A 1 515 ? -32.544 107.103 14.017 1.00 38.25 ? 515  ARG A O   1 
ATOM   4069 C  CB  . ARG A 1 515 ? -32.287 105.714 11.640 1.00 45.76 ? 515  ARG A CB  1 
ATOM   4070 C  CG  . ARG A 1 515 ? -32.134 104.824 10.406 1.00 48.04 ? 515  ARG A CG  1 
ATOM   4071 C  CD  . ARG A 1 515 ? -31.899 105.644 9.141  1.00 52.20 ? 515  ARG A CD  1 
ATOM   4072 N  NE  . ARG A 1 515 ? -31.432 104.826 8.019  1.00 57.69 ? 515  ARG A NE  1 
ATOM   4073 C  CZ  . ARG A 1 515 ? -32.210 104.071 7.243  1.00 59.21 ? 515  ARG A CZ  1 
ATOM   4074 N  NH1 . ARG A 1 515 ? -33.520 104.016 7.450  1.00 60.84 ? 515  ARG A NH1 1 
ATOM   4075 N  NH2 . ARG A 1 515 ? -31.675 103.365 6.255  1.00 59.30 ? 515  ARG A NH2 1 
ATOM   4076 N  N   . LEU A 1 516 ? -32.128 105.301 15.317 1.00 37.54 ? 516  LEU A N   1 
ATOM   4077 C  CA  . LEU A 1 516 ? -32.027 106.052 16.563 1.00 34.28 ? 516  LEU A CA  1 
ATOM   4078 C  C   . LEU A 1 516 ? -30.960 107.139 16.504 1.00 33.15 ? 516  LEU A C   1 
ATOM   4079 O  O   . LEU A 1 516 ? -29.795 106.857 16.273 1.00 34.27 ? 516  LEU A O   1 
ATOM   4080 C  CB  . LEU A 1 516 ? -31.740 105.091 17.716 1.00 31.67 ? 516  LEU A CB  1 
ATOM   4081 C  CG  . LEU A 1 516 ? -31.780 105.626 19.149 1.00 31.12 ? 516  LEU A CG  1 
ATOM   4082 C  CD1 . LEU A 1 516 ? -32.899 106.645 19.329 1.00 29.55 ? 516  LEU A CD1 1 
ATOM   4083 C  CD2 . LEU A 1 516 ? -31.966 104.444 20.091 1.00 29.62 ? 516  LEU A CD2 1 
ATOM   4084 N  N   . ARG A 1 517 ? -31.381 108.379 16.721 1.00 31.36 ? 517  ARG A N   1 
ATOM   4085 C  CA  . ARG A 1 517 ? -30.507 109.545 16.698 1.00 30.20 ? 517  ARG A CA  1 
ATOM   4086 C  C   . ARG A 1 517 ? -29.431 109.491 15.629 1.00 30.34 ? 517  ARG A C   1 
ATOM   4087 O  O   . ARG A 1 517 ? -28.348 110.048 15.793 1.00 31.96 ? 517  ARG A O   1 
ATOM   4088 C  CB  . ARG A 1 517 ? -29.859 109.751 18.067 1.00 30.12 ? 517  ARG A CB  1 
ATOM   4089 C  CG  . ARG A 1 517 ? -30.859 110.011 19.180 1.00 29.45 ? 517  ARG A CG  1 
ATOM   4090 C  CD  . ARG A 1 517 ? -30.181 110.564 20.429 1.00 31.50 ? 517  ARG A CD  1 
ATOM   4091 N  NE  . ARG A 1 517 ? -29.788 111.968 20.297 1.00 30.13 ? 517  ARG A NE  1 
ATOM   4092 C  CZ  . ARG A 1 517 ? -30.639 112.953 20.033 1.00 29.38 ? 517  ARG A CZ  1 
ATOM   4093 N  NH1 . ARG A 1 517 ? -31.928 112.685 19.870 1.00 28.13 ? 517  ARG A NH1 1 
ATOM   4094 N  NH2 . ARG A 1 517 ? -30.202 114.200 19.939 1.00 27.38 ? 517  ARG A NH2 1 
ATOM   4095 N  N   . VAL A 1 518 ? -29.740 108.835 14.521 1.00 29.91 ? 518  VAL A N   1 
ATOM   4096 C  CA  . VAL A 1 518 ? -28.787 108.703 13.429 1.00 29.82 ? 518  VAL A CA  1 
ATOM   4097 C  C   . VAL A 1 518 ? -28.027 109.983 13.098 1.00 29.65 ? 518  VAL A C   1 
ATOM   4098 O  O   . VAL A 1 518 ? -26.811 109.949 12.921 1.00 30.15 ? 518  VAL A O   1 
ATOM   4099 C  CB  . VAL A 1 518 ? -29.483 108.196 12.146 1.00 29.49 ? 518  VAL A CB  1 
ATOM   4100 C  CG1 . VAL A 1 518 ? -30.762 108.977 11.905 1.00 32.02 ? 518  VAL A CG1 1 
ATOM   4101 C  CG2 . VAL A 1 518 ? -28.551 108.340 10.955 1.00 27.34 ? 518  VAL A CG2 1 
ATOM   4102 N  N   . GLN A 1 519 ? -28.741 111.104 13.020 1.00 30.38 ? 519  GLN A N   1 
ATOM   4103 C  CA  . GLN A 1 519 ? -28.125 112.387 12.682 1.00 30.36 ? 519  GLN A CA  1 
ATOM   4104 C  C   . GLN A 1 519 ? -27.026 112.810 13.652 1.00 30.35 ? 519  GLN A C   1 
ATOM   4105 O  O   . GLN A 1 519 ? -25.860 112.920 13.268 1.00 28.91 ? 519  GLN A O   1 
ATOM   4106 C  CB  . GLN A 1 519 ? -29.181 113.488 12.618 1.00 31.77 ? 519  GLN A CB  1 
ATOM   4107 C  CG  . GLN A 1 519 ? -28.676 114.764 11.954 1.00 35.45 ? 519  GLN A CG  1 
ATOM   4108 C  CD  . GLN A 1 519 ? -28.536 114.611 10.444 1.00 38.63 ? 519  GLN A CD  1 
ATOM   4109 O  OE1 . GLN A 1 519 ? -27.660 115.222 9.816  1.00 37.78 ? 519  GLN A OE1 1 
ATOM   4110 N  NE2 . GLN A 1 519 ? -29.414 113.799 9.850  1.00 39.87 ? 519  GLN A NE2 1 
ATOM   4111 N  N   . MET A 1 520 ? -27.396 113.052 14.908 1.00 30.83 ? 520  MET A N   1 
ATOM   4112 C  CA  . MET A 1 520 ? -26.415 113.465 15.902 1.00 29.93 ? 520  MET A CA  1 
ATOM   4113 C  C   . MET A 1 520 ? -25.314 112.438 16.064 1.00 29.30 ? 520  MET A C   1 
ATOM   4114 O  O   . MET A 1 520 ? -24.172 112.788 16.351 1.00 31.18 ? 520  MET A O   1 
ATOM   4115 C  CB  . MET A 1 520 ? -27.080 113.717 17.249 1.00 29.85 ? 520  MET A CB  1 
ATOM   4116 C  CG  . MET A 1 520 ? -27.992 114.928 17.262 1.00 33.83 ? 520  MET A CG  1 
ATOM   4117 S  SD  . MET A 1 520 ? -27.134 116.496 16.947 1.00 35.01 ? 520  MET A SD  1 
ATOM   4118 C  CE  . MET A 1 520 ? -27.256 116.649 15.163 1.00 35.11 ? 520  MET A CE  1 
ATOM   4119 N  N   . CYS A 1 521 ? -25.631 111.168 15.863 1.00 27.61 ? 521  CYS A N   1 
ATOM   4120 C  CA  . CYS A 1 521 ? -24.596 110.161 16.019 1.00 27.87 ? 521  CYS A CA  1 
ATOM   4121 C  C   . CYS A 1 521 ? -23.573 110.113 14.885 1.00 27.20 ? 521  CYS A C   1 
ATOM   4122 O  O   . CYS A 1 521 ? -22.473 109.575 15.062 1.00 26.87 ? 521  CYS A O   1 
ATOM   4123 C  CB  . CYS A 1 521 ? -25.215 108.784 16.274 1.00 26.17 ? 521  CYS A CB  1 
ATOM   4124 S  SG  . CYS A 1 521 ? -25.938 108.699 17.944 1.00 27.25 ? 521  CYS A SG  1 
ATOM   4125 N  N   . VAL A 1 522 ? -23.906 110.667 13.722 1.00 25.94 ? 522  VAL A N   1 
ATOM   4126 C  CA  . VAL A 1 522 ? -22.905 110.678 12.663 1.00 25.66 ? 522  VAL A CA  1 
ATOM   4127 C  C   . VAL A 1 522 ? -21.834 111.643 13.146 1.00 25.47 ? 522  VAL A C   1 
ATOM   4128 O  O   . VAL A 1 522 ? -20.638 111.415 12.966 1.00 27.22 ? 522  VAL A O   1 
ATOM   4129 C  CB  . VAL A 1 522 ? -23.450 111.168 11.322 1.00 23.67 ? 522  VAL A CB  1 
ATOM   4130 C  CG1 . VAL A 1 522 ? -22.296 111.385 10.353 1.00 24.56 ? 522  VAL A CG1 1 
ATOM   4131 C  CG2 . VAL A 1 522 ? -24.383 110.138 10.743 1.00 24.71 ? 522  VAL A CG2 1 
ATOM   4132 N  N   . PHE A 1 523 ? -22.282 112.714 13.787 1.00 24.98 ? 523  PHE A N   1 
ATOM   4133 C  CA  . PHE A 1 523 ? -21.381 113.710 14.334 1.00 24.01 ? 523  PHE A CA  1 
ATOM   4134 C  C   . PHE A 1 523 ? -20.403 113.103 15.334 1.00 23.38 ? 523  PHE A C   1 
ATOM   4135 O  O   . PHE A 1 523 ? -19.199 113.321 15.245 1.00 23.61 ? 523  PHE A O   1 
ATOM   4136 C  CB  . PHE A 1 523 ? -22.169 114.800 15.051 1.00 23.48 ? 523  PHE A CB  1 
ATOM   4137 C  CG  . PHE A 1 523 ? -21.300 115.780 15.781 1.00 21.42 ? 523  PHE A CG  1 
ATOM   4138 C  CD1 . PHE A 1 523 ? -20.638 116.786 15.094 1.00 21.21 ? 523  PHE A CD1 1 
ATOM   4139 C  CD2 . PHE A 1 523 ? -21.115 115.674 17.150 1.00 19.83 ? 523  PHE A CD2 1 
ATOM   4140 C  CE1 . PHE A 1 523 ? -19.801 117.674 15.764 1.00 20.73 ? 523  PHE A CE1 1 
ATOM   4141 C  CE2 . PHE A 1 523 ? -20.283 116.555 17.821 1.00 21.26 ? 523  PHE A CE2 1 
ATOM   4142 C  CZ  . PHE A 1 523 ? -19.624 117.559 17.123 1.00 19.34 ? 523  PHE A CZ  1 
ATOM   4143 N  N   . TRP A 1 524 ? -20.920 112.353 16.296 1.00 22.75 ? 524  TRP A N   1 
ATOM   4144 C  CA  . TRP A 1 524 ? -20.052 111.777 17.311 1.00 24.03 ? 524  TRP A CA  1 
ATOM   4145 C  C   . TRP A 1 524 ? -19.199 110.603 16.867 1.00 23.98 ? 524  TRP A C   1 
ATOM   4146 O  O   . TRP A 1 524 ? -18.055 110.473 17.300 1.00 24.49 ? 524  TRP A O   1 
ATOM   4147 C  CB  . TRP A 1 524 ? -20.858 111.360 18.547 1.00 24.42 ? 524  TRP A CB  1 
ATOM   4148 C  CG  . TRP A 1 524 ? -21.482 112.500 19.252 1.00 24.13 ? 524  TRP A CG  1 
ATOM   4149 C  CD1 . TRP A 1 524 ? -22.786 112.882 19.191 1.00 24.08 ? 524  TRP A CD1 1 
ATOM   4150 C  CD2 . TRP A 1 524 ? -20.819 113.460 20.071 1.00 25.74 ? 524  TRP A CD2 1 
ATOM   4151 N  NE1 . TRP A 1 524 ? -22.981 114.027 19.919 1.00 24.61 ? 524  TRP A NE1 1 
ATOM   4152 C  CE2 . TRP A 1 524 ? -21.789 114.408 20.471 1.00 26.82 ? 524  TRP A CE2 1 
ATOM   4153 C  CE3 . TRP A 1 524 ? -19.497 113.618 20.504 1.00 27.33 ? 524  TRP A CE3 1 
ATOM   4154 C  CZ2 . TRP A 1 524 ? -21.479 115.506 21.289 1.00 27.79 ? 524  TRP A CZ2 1 
ATOM   4155 C  CZ3 . TRP A 1 524 ? -19.188 114.711 21.319 1.00 29.35 ? 524  TRP A CZ3 1 
ATOM   4156 C  CH2 . TRP A 1 524 ? -20.180 115.641 21.702 1.00 28.66 ? 524  TRP A CH2 1 
ATOM   4157 N  N   . ASN A 1 525 ? -19.734 109.744 16.014 1.00 23.45 ? 525  ASN A N   1 
ATOM   4158 C  CA  . ASN A 1 525 ? -18.953 108.593 15.607 1.00 24.36 ? 525  ASN A CA  1 
ATOM   4159 C  C   . ASN A 1 525 ? -18.017 108.842 14.452 1.00 25.46 ? 525  ASN A C   1 
ATOM   4160 O  O   . ASN A 1 525 ? -17.006 108.163 14.308 1.00 24.35 ? 525  ASN A O   1 
ATOM   4161 C  CB  . ASN A 1 525 ? -19.868 107.415 15.293 1.00 22.69 ? 525  ASN A CB  1 
ATOM   4162 C  CG  . ASN A 1 525 ? -20.603 106.931 16.508 1.00 21.41 ? 525  ASN A CG  1 
ATOM   4163 O  OD1 . ASN A 1 525 ? -20.052 106.901 17.607 1.00 21.04 ? 525  ASN A OD1 1 
ATOM   4164 N  ND2 . ASN A 1 525 ? -21.852 106.540 16.324 1.00 24.11 ? 525  ASN A ND2 1 
ATOM   4165 N  N   . GLN A 1 526 ? -18.343 109.827 13.631 1.00 28.57 ? 526  GLN A N   1 
ATOM   4166 C  CA  . GLN A 1 526 ? -17.503 110.122 12.495 1.00 29.65 ? 526  GLN A CA  1 
ATOM   4167 C  C   . GLN A 1 526 ? -16.819 111.471 12.525 1.00 29.55 ? 526  GLN A C   1 
ATOM   4168 O  O   . GLN A 1 526 ? -15.654 111.568 12.895 1.00 31.80 ? 526  GLN A O   1 
ATOM   4169 C  CB  . GLN A 1 526 ? -18.317 109.993 11.230 1.00 31.68 ? 526  GLN A CB  1 
ATOM   4170 C  CG  . GLN A 1 526 ? -18.790 108.593 11.008 1.00 36.15 ? 526  GLN A CG  1 
ATOM   4171 C  CD  . GLN A 1 526 ? -19.573 108.470 9.735  1.00 40.18 ? 526  GLN A CD  1 
ATOM   4172 O  OE1 . GLN A 1 526 ? -19.093 108.847 8.659  1.00 41.48 ? 526  GLN A OE1 1 
ATOM   4173 N  NE2 . GLN A 1 526 ? -20.793 107.944 9.839  1.00 41.64 ? 526  GLN A NE2 1 
ATOM   4174 N  N   . PHE A 1 527 ? -17.546 112.513 12.151 1.00 28.43 ? 527  PHE A N   1 
ATOM   4175 C  CA  . PHE A 1 527 ? -16.975 113.852 12.080 1.00 27.24 ? 527  PHE A CA  1 
ATOM   4176 C  C   . PHE A 1 527 ? -16.066 114.309 13.207 1.00 26.52 ? 527  PHE A C   1 
ATOM   4177 O  O   . PHE A 1 527 ? -14.856 114.437 13.018 1.00 25.04 ? 527  PHE A O   1 
ATOM   4178 C  CB  . PHE A 1 527 ? -18.074 114.893 11.906 1.00 26.25 ? 527  PHE A CB  1 
ATOM   4179 C  CG  . PHE A 1 527 ? -17.549 116.266 11.603 1.00 25.40 ? 527  PHE A CG  1 
ATOM   4180 C  CD1 . PHE A 1 527 ? -16.899 116.518 10.403 1.00 21.44 ? 527  PHE A CD1 1 
ATOM   4181 C  CD2 . PHE A 1 527 ? -17.689 117.304 12.524 1.00 24.13 ? 527  PHE A CD2 1 
ATOM   4182 C  CE1 . PHE A 1 527 ? -16.400 117.771 10.124 1.00 20.70 ? 527  PHE A CE1 1 
ATOM   4183 C  CE2 . PHE A 1 527 ? -17.187 118.567 12.247 1.00 22.90 ? 527  PHE A CE2 1 
ATOM   4184 C  CZ  . PHE A 1 527 ? -16.542 118.799 11.043 1.00 21.21 ? 527  PHE A CZ  1 
ATOM   4185 N  N   . LEU A 1 528 ? -16.645 114.572 14.375 1.00 27.08 ? 528  LEU A N   1 
ATOM   4186 C  CA  . LEU A 1 528 ? -15.856 115.064 15.499 1.00 26.79 ? 528  LEU A CA  1 
ATOM   4187 C  C   . LEU A 1 528 ? -14.554 114.315 15.674 1.00 27.48 ? 528  LEU A C   1 
ATOM   4188 O  O   . LEU A 1 528 ? -13.486 114.920 15.649 1.00 27.68 ? 528  LEU A O   1 
ATOM   4189 C  CB  . LEU A 1 528 ? -16.660 115.029 16.800 1.00 25.02 ? 528  LEU A CB  1 
ATOM   4190 C  CG  . LEU A 1 528 ? -15.882 115.490 18.041 1.00 26.17 ? 528  LEU A CG  1 
ATOM   4191 C  CD1 . LEU A 1 528 ? -15.282 116.861 17.785 1.00 26.13 ? 528  LEU A CD1 1 
ATOM   4192 C  CD2 . LEU A 1 528 ? -16.796 115.525 19.264 1.00 23.37 ? 528  LEU A CD2 1 
ATOM   4193 N  N   . PRO A 1 529 ? -14.618 112.984 15.831 1.00 29.51 ? 529  PRO A N   1 
ATOM   4194 C  CA  . PRO A 1 529 ? -13.386 112.212 16.008 1.00 30.25 ? 529  PRO A CA  1 
ATOM   4195 C  C   . PRO A 1 529 ? -12.413 112.531 14.887 1.00 30.86 ? 529  PRO A C   1 
ATOM   4196 O  O   . PRO A 1 529 ? -11.230 112.767 15.129 1.00 32.27 ? 529  PRO A O   1 
ATOM   4197 C  CB  . PRO A 1 529 ? -13.874 110.767 15.963 1.00 29.65 ? 529  PRO A CB  1 
ATOM   4198 C  CG  . PRO A 1 529 ? -15.264 110.866 16.498 1.00 29.53 ? 529  PRO A CG  1 
ATOM   4199 C  CD  . PRO A 1 529 ? -15.783 112.085 15.774 1.00 30.12 ? 529  PRO A CD  1 
ATOM   4200 N  N   . LYS A 1 530 ? -12.934 112.552 13.665 1.00 30.45 ? 530  LYS A N   1 
ATOM   4201 C  CA  . LYS A 1 530 ? -12.137 112.850 12.477 1.00 31.37 ? 530  LYS A CA  1 
ATOM   4202 C  C   . LYS A 1 530 ? -11.489 114.231 12.589 1.00 31.59 ? 530  LYS A C   1 
ATOM   4203 O  O   . LYS A 1 530 ? -10.327 114.416 12.226 1.00 30.93 ? 530  LYS A O   1 
ATOM   4204 C  CB  . LYS A 1 530 ? -13.033 112.777 11.233 1.00 30.96 ? 530  LYS A CB  1 
ATOM   4205 C  CG  . LYS A 1 530 ? -12.343 113.053 9.911  1.00 30.18 ? 530  LYS A CG  1 
ATOM   4206 C  CD  . LYS A 1 530 ? -12.962 112.217 8.797  1.00 31.42 ? 530  LYS A CD  1 
ATOM   4207 C  CE  . LYS A 1 530 ? -14.479 112.401 8.720  1.00 34.96 ? 530  LYS A CE  1 
ATOM   4208 N  NZ  . LYS A 1 530 ? -15.118 111.470 7.739  1.00 34.46 ? 530  LYS A NZ  1 
ATOM   4209 N  N   . LEU A 1 531 ? -12.253 115.193 13.099 1.00 32.01 ? 531  LEU A N   1 
ATOM   4210 C  CA  . LEU A 1 531 ? -11.767 116.553 13.271 1.00 32.42 ? 531  LEU A CA  1 
ATOM   4211 C  C   . LEU A 1 531 ? -10.694 116.583 14.338 1.00 34.83 ? 531  LEU A C   1 
ATOM   4212 O  O   . LEU A 1 531 ? -9.583  117.048 14.099 1.00 34.30 ? 531  LEU A O   1 
ATOM   4213 C  CB  . LEU A 1 531 ? -12.912 117.468 13.688 1.00 30.30 ? 531  LEU A CB  1 
ATOM   4214 C  CG  . LEU A 1 531 ? -12.578 118.914 14.034 1.00 27.86 ? 531  LEU A CG  1 
ATOM   4215 C  CD1 . LEU A 1 531 ? -13.857 119.727 13.977 1.00 29.67 ? 531  LEU A CD1 1 
ATOM   4216 C  CD2 . LEU A 1 531 ? -11.947 119.006 15.401 1.00 24.15 ? 531  LEU A CD2 1 
ATOM   4217 N  N   . LEU A 1 532 ? -11.041 116.091 15.525 1.00 37.45 ? 532  LEU A N   1 
ATOM   4218 C  CA  . LEU A 1 532 ? -10.104 116.062 16.638 1.00 38.95 ? 532  LEU A CA  1 
ATOM   4219 C  C   . LEU A 1 532 ? -8.750  115.495 16.249 1.00 42.20 ? 532  LEU A C   1 
ATOM   4220 O  O   . LEU A 1 532 ? -7.721  116.085 16.560 1.00 42.68 ? 532  LEU A O   1 
ATOM   4221 C  CB  . LEU A 1 532 ? -10.671 115.249 17.794 1.00 35.17 ? 532  LEU A CB  1 
ATOM   4222 C  CG  . LEU A 1 532 ? -11.707 115.931 18.682 1.00 34.79 ? 532  LEU A CG  1 
ATOM   4223 C  CD1 . LEU A 1 532 ? -11.940 115.028 19.874 1.00 34.15 ? 532  LEU A CD1 1 
ATOM   4224 C  CD2 . LEU A 1 532 ? -11.232 117.309 19.152 1.00 32.51 ? 532  LEU A CD2 1 
ATOM   4225 N  N   . ASN A 1 533 ? -8.757  114.352 15.566 1.00 46.55 ? 533  ASN A N   1 
ATOM   4226 C  CA  . ASN A 1 533 ? -7.525  113.689 15.137 1.00 50.84 ? 533  ASN A CA  1 
ATOM   4227 C  C   . ASN A 1 533 ? -6.688  114.488 14.130 1.00 53.60 ? 533  ASN A C   1 
ATOM   4228 O  O   . ASN A 1 533 ? -5.464  114.558 14.255 1.00 54.06 ? 533  ASN A O   1 
ATOM   4229 C  CB  . ASN A 1 533 ? -7.861  112.311 14.558 1.00 52.43 ? 533  ASN A CB  1 
ATOM   4230 C  CG  . ASN A 1 533 ? -6.704  111.696 13.790 1.00 54.66 ? 533  ASN A CG  1 
ATOM   4231 O  OD1 . ASN A 1 533 ? -6.361  112.151 12.694 1.00 56.23 ? 533  ASN A OD1 1 
ATOM   4232 N  ND2 . ASN A 1 533 ? -6.095  110.658 14.360 1.00 54.04 ? 533  ASN A ND2 1 
ATOM   4233 N  N   . ALA A 1 534 ? -7.342  115.087 13.139 1.00 55.72 ? 534  ALA A N   1 
ATOM   4234 C  CA  . ALA A 1 534 ? -6.641  115.868 12.129 1.00 57.53 ? 534  ALA A CA  1 
ATOM   4235 C  C   . ALA A 1 534 ? -6.175  117.221 12.659 1.00 59.73 ? 534  ALA A C   1 
ATOM   4236 O  O   . ALA A 1 534 ? -5.314  117.857 12.057 1.00 60.91 ? 534  ALA A O   1 
ATOM   4237 C  CB  . ALA A 1 534 ? -7.536  116.072 10.923 1.00 56.87 ? 534  ALA A CB  1 
ATOM   4238 N  N   . THR A 1 535 ? -6.733  117.656 13.785 1.00 62.59 ? 535  THR A N   1 
ATOM   4239 C  CA  . THR A 1 535 ? -6.375  118.955 14.367 1.00 64.98 ? 535  THR A CA  1 
ATOM   4240 C  C   . THR A 1 535 ? -5.917  118.888 15.832 1.00 67.05 ? 535  THR A C   1 
ATOM   4241 O  O   . THR A 1 535 ? -6.516  119.519 16.709 1.00 68.15 ? 535  THR A O   1 
ATOM   4242 C  CB  . THR A 1 535 ? -7.570  119.954 14.276 1.00 64.07 ? 535  THR A CB  1 
ATOM   4243 O  OG1 . THR A 1 535 ? -8.655  119.495 15.096 1.00 63.57 ? 535  THR A OG1 1 
ATOM   4244 C  CG2 . THR A 1 535 ? -8.058  120.073 12.840 1.00 63.34 ? 535  THR A CG2 1 
ATOM   4245 N  N   . ALA A 1 536 ? -4.853  118.135 16.096 1.00 68.29 ? 536  ALA A N   1 
ATOM   4246 C  CA  . ALA A 1 536 ? -4.335  118.006 17.458 1.00 68.78 ? 536  ALA A CA  1 
ATOM   4247 C  C   . ALA A 1 536 ? -2.815  118.155 17.497 1.00 69.57 ? 536  ALA A C   1 
ATOM   4248 O  O   . ALA A 1 536 ? -2.310  118.720 18.493 1.00 69.98 ? 536  ALA A O   1 
ATOM   4249 C  CB  . ALA A 1 536 ? -4.749  116.662 18.052 1.00 67.94 ? 536  ALA A CB  1 
ATOM   4250 N  N   . CYS A 1 537 ? -2.147  117.697 16.541 1.00 70.27 ? 537  CYS A N   1 
HETATM 4251 C  C2  . TFL B 2 .   ? -23.673 110.345 39.838 1.00 58.49 ? 1538 TFL A C2  1 
HETATM 4252 C  C3  . TFL B 2 .   ? -22.828 110.885 38.766 1.00 57.69 ? 1538 TFL A C3  1 
HETATM 4253 C  C4  . TFL B 2 .   ? -21.598 111.612 39.071 1.00 57.23 ? 1538 TFL A C4  1 
HETATM 4254 C  C5  . TFL B 2 .   ? -21.193 111.815 40.453 1.00 57.35 ? 1538 TFL A C5  1 
HETATM 4255 C  C6  . TFL B 2 .   ? -22.056 111.287 41.487 1.00 57.41 ? 1538 TFL A C6  1 
HETATM 4256 C  C7  . TFL B 2 .   ? -23.256 110.577 41.192 1.00 58.06 ? 1538 TFL A C7  1 
HETATM 4257 C  C8  . TFL B 2 .   ? -19.879 112.563 40.862 1.00 56.94 ? 1538 TFL A C8  1 
HETATM 4258 N  N1  . TFL B 2 .   ? -19.262 112.874 42.095 1.00 56.39 ? 1538 TFL A N1  1 
HETATM 4259 C  C9  . TFL B 2 .   ? -18.039 113.559 41.996 1.00 55.11 ? 1538 TFL A C9  1 
HETATM 4260 S  S1  . TFL B 2 .   ? -18.900 113.131 39.501 1.00 60.72 ? 1538 TFL A S1  1 
HETATM 4261 C  C10 . TFL B 2 .   ? -17.688 113.771 40.545 1.00 56.81 ? 1538 TFL A C10 1 
HETATM 4262 C  C11 . TFL B 2 .   ? -16.480 114.436 40.154 1.00 56.31 ? 1538 TFL A C11 1 
HETATM 4263 C  C12 . TFL B 2 .   ? -15.580 114.890 41.187 1.00 54.88 ? 1538 TFL A C12 1 
HETATM 4264 C  C13 . TFL B 2 .   ? -15.903 114.689 42.575 1.00 53.38 ? 1538 TFL A C13 1 
HETATM 4265 C  C14 . TFL B 2 .   ? -17.102 114.036 42.965 1.00 53.58 ? 1538 TFL A C14 1 
HETATM 4266 O  O3  . TFL B 2 .   ? -14.283 115.593 40.838 1.00 53.25 ? 1538 TFL A O3  1 
HETATM 4267 N  N2  . TFL B 2 .   ? -24.909 109.578 39.579 1.00 59.13 ? 1538 TFL A N2  1 
HETATM 4268 C  C15 . TFL B 2 .   ? -25.391 109.278 38.209 1.00 59.81 ? 1538 TFL A C15 1 
HETATM 4269 C  C16 . TFL B 2 .   ? -25.723 109.046 40.700 1.00 58.11 ? 1538 TFL A C16 1 
HETATM 4270 C  C17 . TFL B 2 .   ? -19.852 112.527 43.422 1.00 56.73 ? 1538 TFL A C17 1 
HETATM 4271 C  C1  . NAG C 3 .   ? -27.259 83.190  60.025 1.00 69.34 ? 1539 NAG A C1  1 
HETATM 4272 C  C2  . NAG C 3 .   ? -28.347 84.255  60.305 1.00 69.59 ? 1539 NAG A C2  1 
HETATM 4273 C  C3  . NAG C 3 .   ? -28.909 84.086  61.725 1.00 69.19 ? 1539 NAG A C3  1 
HETATM 4274 C  C4  . NAG C 3 .   ? -29.350 82.639  61.955 1.00 68.89 ? 1539 NAG A C4  1 
HETATM 4275 C  C5  . NAG C 3 .   ? -28.194 81.688  61.642 1.00 67.72 ? 1539 NAG A C5  1 
HETATM 4276 C  C6  . NAG C 3 .   ? -28.573 80.230  61.800 1.00 66.16 ? 1539 NAG A C6  1 
HETATM 4277 C  C7  . NAG C 3 .   ? -27.318 86.316  61.129 1.00 72.17 ? 1539 NAG A C7  1 
HETATM 4278 C  C8  . NAG C 3 .   ? -28.300 87.142  61.956 1.00 71.40 ? 1539 NAG A C8  1 
HETATM 4279 N  N2  . NAG C 3 .   ? -27.817 85.602  60.115 1.00 71.56 ? 1539 NAG A N2  1 
HETATM 4280 O  O3  . NAG C 3 .   ? -30.012 84.961  61.919 1.00 67.38 ? 1539 NAG A O3  1 
HETATM 4281 O  O4  . NAG C 3 .   ? -29.753 82.472  63.305 1.00 70.79 ? 1539 NAG A O4  1 
HETATM 4282 O  O5  . NAG C 3 .   ? -27.769 81.868  60.278 1.00 68.53 ? 1539 NAG A O5  1 
HETATM 4283 O  O6  . NAG C 3 .   ? -27.530 79.498  62.421 1.00 63.94 ? 1539 NAG A O6  1 
HETATM 4284 O  O7  . NAG C 3 .   ? -26.111 86.351  61.397 1.00 71.46 ? 1539 NAG A O7  1 
HETATM 4285 C  C1  . NAG D 3 .   ? -29.211 82.479  13.941 1.00 61.27 ? 1540 NAG A C1  1 
HETATM 4286 C  C2  . NAG D 3 .   ? -29.868 83.143  12.721 1.00 62.47 ? 1540 NAG A C2  1 
HETATM 4287 C  C3  . NAG D 3 .   ? -30.730 82.177  11.903 1.00 64.17 ? 1540 NAG A C3  1 
HETATM 4288 C  C4  . NAG D 3 .   ? -30.007 80.854  11.651 1.00 65.60 ? 1540 NAG A C4  1 
HETATM 4289 C  C5  . NAG D 3 .   ? -29.502 80.299  12.980 1.00 66.55 ? 1540 NAG A C5  1 
HETATM 4290 C  C6  . NAG D 3 .   ? -28.789 78.960  12.840 1.00 67.65 ? 1540 NAG A C6  1 
HETATM 4291 C  C7  . NAG D 3 .   ? -30.379 85.486  12.846 1.00 62.28 ? 1540 NAG A C7  1 
HETATM 4292 C  C8  . NAG D 3 .   ? -31.510 86.507  12.835 1.00 62.56 ? 1540 NAG A C8  1 
HETATM 4293 N  N2  . NAG D 3 .   ? -30.696 84.240  13.175 1.00 61.76 ? 1540 NAG A N2  1 
HETATM 4294 O  O3  . NAG D 3 .   ? -31.046 82.782  10.657 1.00 63.89 ? 1540 NAG A O3  1 
HETATM 4295 O  O4  . NAG D 3 .   ? -30.900 79.926  11.049 1.00 66.03 ? 1540 NAG A O4  1 
HETATM 4296 O  O5  . NAG D 3 .   ? -28.580 81.238  13.577 1.00 64.55 ? 1540 NAG A O5  1 
HETATM 4297 O  O6  . NAG D 3 .   ? -27.378 79.117  12.750 1.00 69.77 ? 1540 NAG A O6  1 
HETATM 4298 O  O7  . NAG D 3 .   ? -29.230 85.829  12.553 1.00 62.13 ? 1540 NAG A O7  1 
HETATM 4299 C  C1  . NAG E 3 .   ? -46.321 105.010 49.408 1.00 72.21 ? 1541 NAG A C1  1 
HETATM 4300 C  C2  . NAG E 3 .   ? -47.352 105.047 50.578 1.00 73.40 ? 1541 NAG A C2  1 
HETATM 4301 C  C3  . NAG E 3 .   ? -46.771 104.639 51.953 1.00 74.37 ? 1541 NAG A C3  1 
HETATM 4302 C  C4  . NAG E 3 .   ? -45.287 105.008 52.086 1.00 74.98 ? 1541 NAG A C4  1 
HETATM 4303 C  C5  . NAG E 3 .   ? -44.949 106.124 51.091 1.00 74.60 ? 1541 NAG A C5  1 
HETATM 4304 C  C6  . NAG E 3 .   ? -43.549 106.699 51.250 1.00 74.64 ? 1541 NAG A C6  1 
HETATM 4305 C  C7  . NAG E 3 .   ? -49.256 106.454 51.036 1.00 72.27 ? 1541 NAG A C7  1 
HETATM 4306 C  C8  . NAG E 3 .   ? -49.636 106.063 52.461 1.00 71.32 ? 1541 NAG A C8  1 
HETATM 4307 N  N2  . NAG E 3 .   ? -47.972 106.355 50.695 1.00 73.10 ? 1541 NAG A N2  1 
HETATM 4308 O  O3  . NAG E 3 .   ? -46.953 103.247 52.179 1.00 73.06 ? 1541 NAG A O3  1 
HETATM 4309 O  O4  . NAG E 3 .   ? -45.019 105.440 53.415 1.00 76.28 ? 1541 NAG A O4  1 
HETATM 4310 O  O5  . NAG E 3 .   ? -45.050 105.627 49.737 1.00 73.30 ? 1541 NAG A O5  1 
HETATM 4311 O  O6  . NAG E 3 .   ? -42.897 106.189 52.405 1.00 75.85 ? 1541 NAG A O6  1 
HETATM 4312 O  O7  . NAG E 3 .   ? -50.124 106.849 50.256 1.00 70.91 ? 1541 NAG A O7  1 
HETATM 4313 MG MG  . MG  F 4 .   ? 5.741   101.507 53.668 1.00 15.70 ? 1542 MG  A MG  1 
HETATM 4314 MG MG  . MG  G 4 .   ? -33.695 115.975 26.928 1.00 18.85 ? 1543 MG  A MG  1 
HETATM 4315 O  O   . HOH H 5 .   ? -3.040  95.706  55.483 1.00 44.85 ? 2001 HOH A O   1 
HETATM 4316 O  O   . HOH H 5 .   ? -43.858 91.697  48.115 1.00 23.81 ? 2002 HOH A O   1 
HETATM 4317 O  O   . HOH H 5 .   ? -1.633  85.098  50.000 1.00 17.90 ? 2003 HOH A O   1 
HETATM 4318 O  O   . HOH H 5 .   ? -1.802  80.712  47.182 1.00 27.84 ? 2004 HOH A O   1 
HETATM 4319 O  O   . HOH H 5 .   ? -54.591 86.501  45.798 1.00 31.01 ? 2005 HOH A O   1 
HETATM 4320 O  O   . HOH H 5 .   ? -21.168 115.979 43.901 1.00 29.68 ? 2006 HOH A O   1 
HETATM 4321 O  O   . HOH H 5 .   ? -14.120 80.824  43.129 1.00 31.73 ? 2007 HOH A O   1 
HETATM 4322 O  O   . HOH H 5 .   ? -7.444  87.179  51.703 1.00 57.40 ? 2008 HOH A O   1 
HETATM 4323 O  O   . HOH H 5 .   ? -5.293  88.799  53.192 1.00 31.76 ? 2009 HOH A O   1 
HETATM 4324 O  O   . HOH H 5 .   ? -4.911  95.716  51.736 1.00 29.62 ? 2010 HOH A O   1 
HETATM 4325 O  O   . HOH H 5 .   ? -4.345  83.260  50.045 1.00 52.55 ? 2011 HOH A O   1 
HETATM 4326 O  O   . HOH H 5 .   ? 6.248   90.728  37.640 1.00 34.80 ? 2012 HOH A O   1 
HETATM 4327 O  O   . HOH H 5 .   ? -16.645 106.209 51.446 1.00 35.39 ? 2013 HOH A O   1 
HETATM 4328 O  O   . HOH H 5 .   ? -21.785 113.222 45.396 1.00 23.96 ? 2014 HOH A O   1 
HETATM 4329 O  O   . HOH H 5 .   ? -25.624 105.001 38.077 1.00 28.32 ? 2015 HOH A O   1 
HETATM 4330 O  O   . HOH H 5 .   ? -26.744 112.309 48.547 1.00 20.87 ? 2016 HOH A O   1 
HETATM 4331 O  O   . HOH H 5 .   ? -9.991  104.929 21.559 1.00 19.07 ? 2017 HOH A O   1 
HETATM 4332 O  O   . HOH H 5 .   ? -27.130 97.102  57.989 1.00 28.18 ? 2018 HOH A O   1 
HETATM 4333 O  O   . HOH H 5 .   ? -33.552 71.130  29.699 1.00 50.23 ? 2019 HOH A O   1 
HETATM 4334 O  O   . HOH H 5 .   ? -13.341 102.203 20.252 1.00 24.08 ? 2020 HOH A O   1 
HETATM 4335 O  O   . HOH H 5 .   ? -24.709 92.930  40.339 1.00 22.98 ? 2021 HOH A O   1 
HETATM 4336 O  O   . HOH H 5 .   ? -26.699 99.289  37.532 1.00 13.33 ? 2022 HOH A O   1 
HETATM 4337 O  O   . HOH H 5 .   ? -29.248 92.325  43.513 1.00 26.71 ? 2023 HOH A O   1 
HETATM 4338 O  O   . HOH H 5 .   ? -43.515 125.181 35.688 1.00 40.70 ? 2024 HOH A O   1 
HETATM 4339 O  O   . HOH H 5 .   ? -38.254 126.726 39.802 1.00 37.36 ? 2025 HOH A O   1 
HETATM 4340 O  O   . HOH H 5 .   ? -25.221 99.960  41.310 1.00 14.38 ? 2026 HOH A O   1 
HETATM 4341 O  O   . HOH H 5 .   ? -36.542 91.360  40.729 1.00 12.50 ? 2027 HOH A O   1 
HETATM 4342 O  O   . HOH H 5 .   ? -11.789 111.325 19.305 1.00 24.46 ? 2028 HOH A O   1 
HETATM 4343 O  O   . HOH H 5 .   ? -39.313 120.704 22.482 1.00 34.97 ? 2029 HOH A O   1 
HETATM 4344 O  O   . HOH H 5 .   ? -16.301 107.289 21.873 1.00 26.41 ? 2030 HOH A O   1 
HETATM 4345 O  O   . HOH H 5 .   ? -19.971 100.260 38.117 1.00 8.76  ? 2031 HOH A O   1 
HETATM 4346 O  O   . HOH H 5 .   ? -10.902 104.232 44.682 1.00 9.67  ? 2032 HOH A O   1 
HETATM 4347 O  O   . HOH H 5 .   ? -1.301  100.315 32.927 1.00 37.41 ? 2033 HOH A O   1 
HETATM 4348 O  O   . HOH H 5 .   ? 3.681   90.929  34.867 1.00 20.63 ? 2034 HOH A O   1 
HETATM 4349 O  O   . HOH H 5 .   ? 0.642   87.721  42.391 1.00 39.71 ? 2035 HOH A O   1 
HETATM 4350 O  O   . HOH H 5 .   ? -23.379 104.834 36.326 1.00 22.13 ? 2036 HOH A O   1 
HETATM 4351 O  O   . HOH H 5 .   ? -12.157 79.754  24.462 1.00 25.80 ? 2037 HOH A O   1 
HETATM 4352 O  O   . HOH H 5 .   ? -14.234 102.034 26.108 1.00 22.78 ? 2038 HOH A O   1 
HETATM 4353 O  O   . HOH H 5 .   ? -11.119 105.846 25.377 1.00 22.19 ? 2039 HOH A O   1 
HETATM 4354 O  O   . HOH H 5 .   ? -10.111 102.422 24.681 1.00 19.62 ? 2040 HOH A O   1 
HETATM 4355 O  O   . HOH H 5 .   ? -7.014  106.763 27.370 1.00 3.52  ? 2041 HOH A O   1 
HETATM 4356 O  O   . HOH H 5 .   ? -5.496  102.232 24.517 1.00 23.39 ? 2042 HOH A O   1 
HETATM 4357 O  O   . HOH H 5 .   ? -0.345  109.988 29.659 1.00 30.18 ? 2043 HOH A O   1 
HETATM 4358 O  O   . HOH H 5 .   ? -11.594 109.090 31.616 1.00 9.83  ? 2044 HOH A O   1 
HETATM 4359 O  O   . HOH H 5 .   ? -2.369  117.004 47.617 1.00 35.06 ? 2045 HOH A O   1 
HETATM 4360 O  O   . HOH H 5 .   ? 8.210   93.255  40.563 1.00 33.90 ? 2046 HOH A O   1 
HETATM 4361 O  O   . HOH H 5 .   ? 4.573   96.129  55.428 1.00 38.19 ? 2047 HOH A O   1 
HETATM 4362 O  O   . HOH H 5 .   ? -10.759 103.721 55.662 1.00 27.03 ? 2048 HOH A O   1 
HETATM 4363 O  O   . HOH H 5 .   ? -8.033  111.709 52.698 1.00 30.52 ? 2049 HOH A O   1 
HETATM 4364 O  O   . HOH H 5 .   ? -10.901 114.091 32.449 1.00 17.35 ? 2050 HOH A O   1 
HETATM 4365 O  O   . HOH H 5 .   ? -14.570 117.361 37.431 1.00 47.89 ? 2051 HOH A O   1 
HETATM 4366 O  O   . HOH H 5 .   ? -19.681 113.201 36.507 1.00 28.29 ? 2052 HOH A O   1 
HETATM 4367 O  O   . HOH H 5 .   ? -11.631 112.097 27.721 1.00 25.06 ? 2053 HOH A O   1 
HETATM 4368 O  O   . HOH H 5 .   ? -10.870 100.699 19.739 1.00 24.96 ? 2054 HOH A O   1 
HETATM 4369 O  O   . HOH H 5 .   ? -11.058 99.254  8.799  1.00 21.98 ? 2055 HOH A O   1 
HETATM 4370 O  O   . HOH H 5 .   ? -40.845 126.846 37.248 1.00 46.65 ? 2056 HOH A O   1 
HETATM 4371 O  O   . HOH H 5 .   ? -14.405 112.339 20.696 1.00 20.18 ? 2057 HOH A O   1 
HETATM 4372 O  O   . HOH H 5 .   ? -12.835 130.476 20.767 1.00 35.34 ? 2058 HOH A O   1 
HETATM 4373 O  O   . HOH H 5 .   ? -14.617 130.129 19.077 1.00 28.57 ? 2059 HOH A O   1 
HETATM 4374 O  O   . HOH H 5 .   ? -21.609 127.958 17.051 1.00 26.95 ? 2060 HOH A O   1 
HETATM 4375 O  O   . HOH H 5 .   ? -25.656 123.007 13.738 1.00 25.63 ? 2061 HOH A O   1 
HETATM 4376 O  O   . HOH H 5 .   ? -27.999 133.927 27.719 1.00 22.56 ? 2062 HOH A O   1 
HETATM 4377 O  O   . HOH H 5 .   ? -31.745 121.906 22.518 1.00 20.20 ? 2063 HOH A O   1 
HETATM 4378 O  O   . HOH H 5 .   ? -36.791 122.867 20.400 1.00 38.53 ? 2064 HOH A O   1 
HETATM 4379 O  O   . HOH H 5 .   ? -32.645 114.239 25.760 1.00 34.41 ? 2065 HOH A O   1 
HETATM 4380 O  O   . HOH H 5 .   ? -30.431 111.936 23.645 1.00 19.87 ? 2066 HOH A O   1 
HETATM 4381 O  O   . HOH H 5 .   ? -19.002 109.321 21.686 1.00 18.13 ? 2067 HOH A O   1 
HETATM 4382 O  O   . HOH H 5 .   ? -18.838 95.115  12.934 1.00 38.08 ? 2068 HOH A O   1 
HETATM 4383 O  O   . HOH H 5 .   ? -38.361 121.342 36.450 1.00 32.91 ? 2069 HOH A O   1 
HETATM 4384 O  O   . HOH H 5 .   ? -44.470 106.814 46.880 1.00 21.64 ? 2070 HOH A O   1 
HETATM 4385 O  O   . HOH H 5 .   ? -45.400 87.028  31.912 1.00 9.95  ? 2071 HOH A O   1 
HETATM 4386 O  O   . HOH H 5 .   ? -44.564 84.552  27.324 1.00 17.48 ? 2072 HOH A O   1 
HETATM 4387 O  O   . HOH H 5 .   ? -40.062 84.115  22.044 1.00 32.18 ? 2073 HOH A O   1 
HETATM 4388 O  O   . HOH H 5 .   ? -40.297 87.127  16.828 1.00 31.05 ? 2074 HOH A O   1 
HETATM 4389 O  O   . HOH H 5 .   ? -18.820 106.896 19.814 1.00 22.00 ? 2075 HOH A O   1 
HETATM 4390 O  O   . HOH H 5 .   ? -18.135 113.293 8.587  1.00 14.05 ? 2076 HOH A O   1 
HETATM 4391 O  O   . HOH H 5 .   ? -4.894  108.539 13.366 1.00 42.44 ? 2077 HOH A O   1 
HETATM 4392 O  O   . HOH H 5 .   ? -2.222  118.323 12.105 1.00 32.51 ? 2078 HOH A O   1 
HETATM 4393 O  O   . HOH H 5 .   ? -23.210 106.839 38.564 1.00 32.37 ? 2079 HOH A O   1 
HETATM 4394 O  O   . HOH H 5 .   ? -32.536 86.659  61.523 1.00 23.41 ? 2080 HOH A O   1 
HETATM 4395 O  O   . HOH H 5 .   ? -31.568 86.295  64.265 1.00 35.62 ? 2081 HOH A O   1 
HETATM 4396 O  O   . HOH H 5 .   ? -26.125 88.073  63.315 1.00 33.85 ? 2082 HOH A O   1 
HETATM 4397 O  O   . HOH H 5 .   ? -30.803 77.737  10.318 1.00 36.94 ? 2083 HOH A O   1 
HETATM 4398 O  O   . HOH H 5 .   ? -30.660 79.221  8.120  1.00 31.57 ? 2084 HOH A O   1 
HETATM 4399 O  O   . HOH H 5 .   ? -46.778 106.512 54.895 1.00 27.72 ? 2085 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 1541 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 537 CYS CYS A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 TFL 1  1538 1538 TFL TFL A . 
C 3 NAG 1  1539 1539 NAG NAG A . 
D 3 NAG 1  1540 1540 NAG NAG A . 
E 3 NAG 1  1541 1541 NAG NDG A . 
F 4 MG  1  1542 1542 MG  MG  A . 
G 4 MG  1  1543 1543 MG  MG  A . 
H 5 HOH 1  2001 2001 HOH HOH A . 
H 5 HOH 2  2002 2002 HOH HOH A . 
H 5 HOH 3  2003 2003 HOH HOH A . 
H 5 HOH 4  2004 2004 HOH HOH A . 
H 5 HOH 5  2005 2005 HOH HOH A . 
H 5 HOH 6  2006 2006 HOH HOH A . 
H 5 HOH 7  2007 2007 HOH HOH A . 
H 5 HOH 8  2008 2008 HOH HOH A . 
H 5 HOH 9  2009 2009 HOH HOH A . 
H 5 HOH 10 2010 2010 HOH HOH A . 
H 5 HOH 11 2011 2011 HOH HOH A . 
H 5 HOH 12 2012 2012 HOH HOH A . 
H 5 HOH 13 2013 2013 HOH HOH A . 
H 5 HOH 14 2014 2014 HOH HOH A . 
H 5 HOH 15 2015 2015 HOH HOH A . 
H 5 HOH 16 2016 2016 HOH HOH A . 
H 5 HOH 17 2017 2017 HOH HOH A . 
H 5 HOH 18 2018 2018 HOH HOH A . 
H 5 HOH 19 2019 2019 HOH HOH A . 
H 5 HOH 20 2020 2020 HOH HOH A . 
H 5 HOH 21 2021 2021 HOH HOH A . 
H 5 HOH 22 2022 2022 HOH HOH A . 
H 5 HOH 23 2023 2023 HOH HOH A . 
H 5 HOH 24 2024 2024 HOH HOH A . 
H 5 HOH 25 2025 2025 HOH HOH A . 
H 5 HOH 26 2026 2026 HOH HOH A . 
H 5 HOH 27 2027 2027 HOH HOH A . 
H 5 HOH 28 2028 2028 HOH HOH A . 
H 5 HOH 29 2029 2029 HOH HOH A . 
H 5 HOH 30 2030 2030 HOH HOH A . 
H 5 HOH 31 2031 2031 HOH HOH A . 
H 5 HOH 32 2032 2032 HOH HOH A . 
H 5 HOH 33 2033 2033 HOH HOH A . 
H 5 HOH 34 2034 2034 HOH HOH A . 
H 5 HOH 35 2035 2035 HOH HOH A . 
H 5 HOH 36 2036 2036 HOH HOH A . 
H 5 HOH 37 2037 2037 HOH HOH A . 
H 5 HOH 38 2038 2038 HOH HOH A . 
H 5 HOH 39 2039 2039 HOH HOH A . 
H 5 HOH 40 2040 2040 HOH HOH A . 
H 5 HOH 41 2041 2041 HOH HOH A . 
H 5 HOH 42 2042 2042 HOH HOH A . 
H 5 HOH 43 2043 2043 HOH HOH A . 
H 5 HOH 44 2044 2044 HOH HOH A . 
H 5 HOH 45 2045 2045 HOH HOH A . 
H 5 HOH 46 2046 2046 HOH HOH A . 
H 5 HOH 47 2047 2047 HOH HOH A . 
H 5 HOH 48 2048 2048 HOH HOH A . 
H 5 HOH 49 2049 2049 HOH HOH A . 
H 5 HOH 50 2050 2050 HOH HOH A . 
H 5 HOH 51 2051 2051 HOH HOH A . 
H 5 HOH 52 2052 2052 HOH HOH A . 
H 5 HOH 53 2053 2053 HOH HOH A . 
H 5 HOH 54 2054 2054 HOH HOH A . 
H 5 HOH 55 2055 2055 HOH HOH A . 
H 5 HOH 56 2056 2056 HOH HOH A . 
H 5 HOH 57 2057 2057 HOH HOH A . 
H 5 HOH 58 2058 2058 HOH HOH A . 
H 5 HOH 59 2059 2059 HOH HOH A . 
H 5 HOH 60 2060 2060 HOH HOH A . 
H 5 HOH 61 2061 2061 HOH HOH A . 
H 5 HOH 62 2062 2062 HOH HOH A . 
H 5 HOH 63 2063 2063 HOH HOH A . 
H 5 HOH 64 2064 2064 HOH HOH A . 
H 5 HOH 65 2065 2065 HOH HOH A . 
H 5 HOH 66 2066 2066 HOH HOH A . 
H 5 HOH 67 2067 2067 HOH HOH A . 
H 5 HOH 68 2068 2068 HOH HOH A . 
H 5 HOH 69 2069 2069 HOH HOH A . 
H 5 HOH 70 2070 2070 HOH HOH A . 
H 5 HOH 71 2071 2071 HOH HOH A . 
H 5 HOH 72 2072 2072 HOH HOH A . 
H 5 HOH 73 2073 2073 HOH HOH A . 
H 5 HOH 74 2074 2074 HOH HOH A . 
H 5 HOH 75 2075 2075 HOH HOH A . 
H 5 HOH 76 2076 2076 HOH HOH A . 
H 5 HOH 77 2077 2077 HOH HOH A . 
H 5 HOH 78 2078 2078 HOH HOH A . 
H 5 HOH 79 2079 2079 HOH HOH A . 
H 5 HOH 80 2080 2080 HOH HOH A . 
H 5 HOH 81 2081 2081 HOH HOH A . 
H 5 HOH 82 2082 2082 HOH HOH A . 
H 5 HOH 83 2083 2083 HOH HOH A . 
H 5 HOH 84 2084 2084 HOH HOH A . 
H 5 HOH 85 2085 2085 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 457 A ASN 457 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 264 ? A HIS 264 ? 1_555 MG ? F MG . ? A MG 1542 ? 1_555 OE1 ? A GLU 268 ? A GLU 268  ? 1_555 74.5 ? 
2 OD1 ? A ASP 326 ? A ASP 326 ? 1_555 MG ? G MG . ? A MG 1543 ? 1_555 OD2 ? A ASP 392 ? A ASP 392  ? 1_555 71.6 ? 
3 OD1 ? A ASP 326 ? A ASP 326 ? 1_555 MG ? G MG . ? A MG 1543 ? 1_555 O   ? H HOH .   ? A HOH 2065 ? 1_555 76.1 ? 
4 OD2 ? A ASP 392 ? A ASP 392 ? 1_555 MG ? G MG . ? A MG 1543 ? 1_555 O   ? H HOH .   ? A HOH 2065 ? 1_555 73.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-09-04 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2018-07-25 
5 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' Advisory                    
4  4 'Structure model' 'Atomic model'              
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Database references'       
7  4 'Structure model' 'Derived calculations'      
8  4 'Structure model' 'Non-polymer description'   
9  4 'Structure model' 'Structure summary'         
10 5 'Structure model' 'Data collection'           
11 5 'Structure model' 'Derived calculations'      
12 5 'Structure model' Other                       
13 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                 
2  4 'Structure model' chem_comp                 
3  4 'Structure model' citation                  
4  4 'Structure model' database_PDB_caveat       
5  4 'Structure model' entity                    
6  4 'Structure model' pdbx_entity_nonpoly       
7  4 'Structure model' pdbx_nonpoly_scheme       
8  4 'Structure model' pdbx_validate_chiral      
9  4 'Structure model' struct_asym               
10 4 'Structure model' struct_conn               
11 5 'Structure model' chem_comp                 
12 5 'Structure model' entity                    
13 5 'Structure model' pdbx_chem_comp_identifier 
14 5 'Structure model' pdbx_database_status      
15 5 'Structure model' pdbx_entity_nonpoly       
16 5 'Structure model' pdbx_struct_conn_angle    
17 5 'Structure model' struct_conn               
18 5 'Structure model' struct_site               
19 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_atom_id'                     
6  4 'Structure model' '_atom_site.auth_comp_id'                     
7  4 'Structure model' '_atom_site.label_atom_id'                    
8  4 'Structure model' '_atom_site.label_comp_id'                    
9  4 'Structure model' '_atom_site.label_entity_id'                  
10 4 'Structure model' '_atom_site.type_symbol'                      
11 4 'Structure model' '_chem_comp.formula'                          
12 4 'Structure model' '_chem_comp.formula_weight'                   
13 4 'Structure model' '_chem_comp.id'                               
14 4 'Structure model' '_chem_comp.mon_nstd_flag'                    
15 4 'Structure model' '_chem_comp.name'                             
16 4 'Structure model' '_chem_comp.type'                             
17 4 'Structure model' '_citation.journal_abbrev'                    
18 4 'Structure model' '_citation.journal_id_CSD'                    
19 4 'Structure model' '_citation.journal_id_ISSN'                   
20 4 'Structure model' '_citation.page_last'                         
21 4 'Structure model' '_citation.pdbx_database_id_DOI'              
22 4 'Structure model' '_citation.title'                             
23 4 'Structure model' '_pdbx_nonpoly_scheme.entity_id'              
24 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id'                 
25 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id'             
26 4 'Structure model' '_struct_asym.entity_id'                      
27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 5 'Structure model' '_chem_comp.name'                             
30 5 'Structure model' '_chem_comp.type'                             
31 5 'Structure model' '_entity.pdbx_description'                    
32 5 'Structure model' '_pdbx_database_status.status_code_sf'        
33 5 'Structure model' '_pdbx_entity_nonpoly.name'                   
34 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
35 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
36 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
37 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
38 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
39 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
40 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
41 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
42 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
43 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
44 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
45 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
46 5 'Structure model' '_pdbx_struct_conn_angle.value'               
47 5 'Structure model' '_struct_conn.pdbx_dist_value'                
48 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
49 5 'Structure model' '_struct_conn.pdbx_role'                      
50 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
51 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
52 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
53 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
54 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
55 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
56 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
57 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
58 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
59 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
60 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
61 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
XDS    'data reduction' .   ? 2 
XSCALE 'data scaling'   .   ? 3 
CNS    phasing          .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HIS 
_pdbx_validate_close_contact.auth_seq_id_1    471 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2072 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 11  ? ? -57.22  13.56   
2  1 LEU A 23  ? ? 51.12   75.75   
3  1 SER A 25  ? ? -175.96 -172.90 
4  1 PRO A 39  ? ? -76.75  45.02   
5  1 PHE A 45  ? ? 82.74   -15.12  
6  1 PRO A 53  ? ? -39.29  131.46  
7  1 ALA A 60  ? ? -105.44 70.57   
8  1 TYR A 63  ? ? -35.07  151.80  
9  1 SER A 91  ? ? -170.03 148.06  
10 1 SER A 108 ? ? 34.11   58.45   
11 1 PHE A 155 ? ? -140.60 -0.53   
12 1 LEU A 158 ? ? -109.93 70.09   
13 1 ASN A 183 ? ? -152.13 -26.85  
14 1 PRO A 191 ? ? -58.63  -6.13   
15 1 SER A 200 ? ? 53.88   -123.01 
16 1 SER A 215 ? ? -131.69 -30.35  
17 1 ARG A 220 ? ? -86.71  -73.67  
18 1 SER A 291 ? ? -56.91  -73.93  
19 1 GLU A 299 ? ? -109.15 -81.14  
20 1 ASN A 313 ? ? -67.66  77.81   
21 1 PHE A 314 ? ? -176.08 147.03  
22 1 THR A 317 ? ? -161.01 -166.87 
23 1 ASP A 380 ? ? -177.45 52.71   
24 1 VAL A 400 ? ? -130.96 -66.20  
25 1 THR A 412 ? ? -60.95  29.97   
26 1 PHE A 414 ? ? -141.23 -14.41  
27 1 ALA A 427 ? ? -39.75  143.92  
28 1 PRO A 433 ? ? -56.93  175.69  
29 1 HIS A 486 ? ? -175.30 60.72   
30 1 PRO A 493 ? ? -46.02  160.15  
31 1 GLU A 508 ? ? -53.07  171.49  
32 1 ARG A 515 ? ? 53.91   76.30   
33 1 ARG A 517 ? ? 37.91   30.87   
34 1 GLN A 526 ? ? -114.63 -80.82  
35 1 PHE A 527 ? ? -43.00  -71.77  
36 1 ALA A 536 ? ? -134.28 -35.76  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     1541 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2017 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.84 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 537 ? CA ? A CYS 537 CA 
2 1 Y 1 A CYS 537 ? C  ? A CYS 537 C  
3 1 Y 1 A CYS 537 ? O  ? A CYS 537 O  
4 1 Y 1 A CYS 537 ? CB ? A CYS 537 CB 
5 1 Y 1 A CYS 537 ? SG ? A CYS 537 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ASP 538 ? A ASP 538 
5 1 Y 1 A GLY 539 ? A GLY 539 
6 1 Y 1 A GLU 540 ? A GLU 540 
7 1 Y 1 A LEU 541 ? A LEU 541 
8 1 Y 1 A SER 542 ? A SER 542 
9 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-[4-(DIMETHYLAMINO)PHENYL]-6-HYDROXY-3-METHYL-1,3-BENZOTHIAZOL-3-IUM' TFL 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                NAG 
4 'MAGNESIUM ION'                                                         MG  
5 water                                                                   HOH 
#